4HATA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 61
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hatA00
1D2MA 2F1RA 2W6IA 5DH9A 1HA3A 1ZNXA 2QPTA 2GKSA 3SJAA 3TW8B 4D82A 4ESHA 5L8VA 5DIFA 2J0UB 3GQBA 4BFYA 2WMNB 1TMKA 1AZSC 1W48A 2HF8A 1E9AA 4Q4JA 4ZDIA 1OLOA 3ICEA 2ZJZA 3W5JA 2OZEA 3AVVA 4RY2A 5TARA 1BMFD 1Z6YA 1XEXB 2WJGA 4QHSA 1LTQA 1UKYA 3EASA 3L0PA 1OE0A 2FPLA 4BEJA 2ZETA 2FOLA 4BE7B 1G7CA 2OFXA 4XVUA 4XWOA 4RZUA 1JAHA 2QMHA 3TR0A 5JRZA 4TYWA 5FTJA 3DO6A 4TLCA 2GJ8A 1II9A 4DHEA 2ZPTX 3VR6A 3RYTC 2G83A 1H8ED 2V4ZA 3Q9LA 1YKSA 1P6XA 4BLOA 2BVNA 3KJEA 4LJ5A 3AP3A 4HAYA 4Q47A 1E2KA 3CR8A 4OQFA 2OEPA 4KLZA 2BC9A 2QMUA 1FP7A 3LDAA 5FUYA 3PEVA 4BZQA 3FFAA 4OI0A 4BFTA 1N6NA 4P4SB 1GIAA 4RCZA 1G8FA 4ZO4A 4UXIA 1FX0B 3SNHA 1WDTA 5IK2D 2W00A 3TNFA 2VP9A 1LFDB 2C8VA 1W5SA 1RRPA 1S1MA 1ZW6A 5C18A 3BERA 3FHCB 5GJVC 4TTRA 4DRZA 4QRHA 2CEAA 4GFDA 2FZLA 4Q4HA 2YOHA 1CJTC 3K09A 5FUVA 3GLGB 1BH2A 1FFHA 4CIDA 2J5XA 1T4GA 2RGNC 1WF3A 4M21A 5FBVB 4PR0A 2O8CA 2J0VA 1QG2A 4CT5A 1E2DA 1E2QA 2FPKA 1YZTA 4LHYA 3MWJA 2VHUA 1IN5A 3DDCA 3NC0C 1HURA 2PEZA 4NCHA 3IPYA 4Q03A 1D8TA 3QPVA 5SZJA 1RRFA 5TMPA 2NO0A 4RJLA 1NKSA 4U7DA 3U44B 2DFLA 2E87A 2ZJ2A 3MWYW 2RGNA 4C0AC 1G8YA 1GNQA 3BK7A 4ZI3A 4CGZA 3CWZA 4JLKA 3HYTA 4TMTA 3D8BA 3D7MA 1KDPA 2VHJA 4KCGA 4PC7A 1H8HA 3GEHA 4AWXA 3BH0A 5JS7A 3WHKA 2ZE6A 3HR8A 1GM5A 3R9WA 2IWHA 5KDOA 2PX0A 4NYIQ 1XD2A 4URVR 5JMTA 4E09A 2D74A 4M9QA 4NBSA 1XMIA 1QHSA 3BIFA 4NDZA 1VDZA 4MUBA 2IYQA 4URYR 1YZLA 3RWOA 1TAGA 2O52A 1QZXA 1SVSA 1XMSA 5FFMA 5CK4A 4C0BA 2ZXUA 1F5NA 1OXVA 1P73A 4EPRA 2ECKA 2H92A 2V7QA 5DHAA 1WBDA 4JKYA 1XB2A 1SVWA 3BWDD 5LD2C 2ZJ5A 2VQSA 1KSJA 2IHYA 3O47A 1XD8A 1G4AE 2DR3A 2GJ9A 2WKRA 1E1QA 1T5LA 2Z83A 1D6JA 3EC2A 3LD9A 2W6JD 4HAWA 1CR0A 2ZR7A 3A58B 3JZAA 5SZIA 4HAZA 2WAXA 2ZI3A 4C0JA 5EJEA 1FZQA 3FPAA 2QGZA 3K53A 4ZKDA 4GPTA 3EAQA 1P60A 2ZRCA 3KXLA 1GKUB 3SQXA 2YV5A 1PJRA 3LLUA 3VTKA 4QM6A 1EXMA 4QJ4A 4QJ5A 1XMVA 3GJ4A 2GWHA 4GSYA 5AJXA 1NLZA 2GEUA 2A30A 4I1VA 5HKKA 4JVMA 1CR2A 2OO7A 1E9RA 1NLYA 5BN4A 3K0AA 3GJ8A 2HJGA 3VKWA 2O0JA 1ETUA 4TMXA 1R6BX 5EQTA 5JI2E 4G5GA 1XZPA 3ADCA 5EE3A 5F2EA 1OH5A 4B3BA 3LAWA 1NBMA 3KTAA 1M1YE 4N3NA 2ZRNA 4WIAA 4OK5A 3RS0A 4C2UA 3WRXC 3QBTA 4TSFD 1Q3HA 5CDFA 1KZ7B 2RGBA 3AKCA 4DT1A 2BEKA 1UM8A 4C0KA 4DKXA 1DBSA 2PCLA 1N6PA 2G6BA 3BFKA 4UXHA 4Q9LA 2WVJA 4LX0A 3IPXA 1M2OB 1FTNA 2CK3D 1WXQA 3AB3A 2LKDA 2H16A 2QM7A 4GRAA 4A0GA 2JLZA 4IEIA 3C7KA 4PFSA 3RABA 4ZCLA 2W2XA 3ZS9A 3CRW1 1G41A 2SHKA 4LBWA 1AM4D 4Z51A 2XSZA 1NJGA 4OK6A 5KPDA 3LVQE 4NYMQ 4TT3D 4MYTA 5EXSA 4E5UA 2E9SA 2XOKA 3CZQA 2BMDA 2HXYA 1BO6A 1Z2AA 2D62A 4LBVA 5AUQA 1NMXA 3THOA 3RDPA 3ZZ0A 2IYSA 3TUJC 1RKBA 1W47A 1E4YA 5KDDA 4OJQA 4FWTA 3CX8A 1AQUA 2R6DA 5HTKA 4B71A 1JR6A 1EFTA 4O25A 2QE7D 4XVQA 4NU0A 1F2UA 1CJMA 1OF1A 2GVZC 2J0UA 1YU9A 3K8YA 3OIYA 3SOPA 4A6XA 4B3FX 1K6MA 5AJYA 1PLKA 3P1JA 4CEIB 2OT3B 1P7CA 4AURA 1DTSA 1E2IA 4LZZA 4Q9KA 121PA 4WVFA 3SE0A 5KUTA 4W5HA 1S4QA 2XEXA 3TSWA 4QJ3A 3GLHE 2WZQA 4B48A 4AI6A 1Z0JA 2IS1A 1ZM9A 1LY1A 1CS4C 3FE2A 4LDJA 3K9GA 1ANKA 3MD0A 1TF2A 3QEOA 4B3CA 1TU4A 1W0JD 5JEEA 2IYXA 4F92B 4PC2A 2Z4SA 1UBEA 3DMNA 2NQ2C 3REGA 1ZD9A 1KI6B 3PUZA 4A0HA 5UKDA 3LBHA 1AS0A 1QVAA 3B5JA 3UK6A 3ZD6A 3U7GA 2WWFA 3CPJB 2GNOA 4YXWD 2HDNB 3HWSA 1W0KA 2N46A 3LRPA 1G7RA 4G1UC 3T34A 1VG0B 2FSIA 2KWIA 3M0EA 4LSGA 4RD1A 3VNUA 1Z5ZA 4CT4B 2JEOA 5AK0A 3ZYCA 1QF9A 2WSSA 1E96A 4MITA 4YQFA 5J4LA 2EW1A 4LBZA 4C0HA 1V43A 4P4SA 4IDPA 4Q7JB 1FX0A 4U00A 2JDID 3TW4A 1IOZA 4C7OA 3WRYC 4B43A 4NCNA 1KO4A 2QN6A 1G5RA 2ODEA 4IDQA 3X1YA 5KNBA 1U0LA 4PQYA 3ECCA 4ZDKA 2VIIA 2BKEA 4M53A 4DSUA 4Q19A 1C1YA 3QF7A 3N2EA 5DN6A 1N6LA 3K0CC 3A1TA 1JB1A 4NYJQ 1G3MA 2FWRA 1HE8B 2FFHA 2XB4A 1R7RA 4QBFA 4C2TA 3IEUA 1QHXA 2FEOA 1P9NA 1G8HA 1Q57A 3HR7A 3RNLA 4MRVA 3SEAA 4EUNA 1ESNA 4H9GA 5JEDA 3L8YA 3C14C 3NBXX 4OKSA 2FFAA 3ZDQA 2CE2X 3GLHB 2PMDA 4MKIA 1PLJA 1T6NA 3LW8A 4DCNA 1GL9B 1G17A 3U44A 4HLCA 3NBFA 4P0TA 3VR1A 1OB5A 1DAKA 2ZRFA 3K0CA 3KDSE 3Q3JB 1GDDA 3A4NA 3TK1A 3OFNA 2HCBA 4Q7LA 1RRGA 1HYQA 1GOTA 2GXSA 3VHLB 2YZ2A 1IXZA 3W34A 3RANA 5EP3A 2W2VA 4G01B 1KY3A 4KLNA 3NDPA 5DYGA 3BFVA 4FMCF 4XOIA 4D26A 2IS2A 3TUIC 1TU3A 1U90A 4NONA 3QY0A 4QGGA 4BPBA 5F9HA 3SBDA 4GOKA 1GP2A 2OLJA 1ZP6A 5GJWC 1XNJA 4QL3A 3BBPA 4JLDA 2CVFA 4RD6A 1JR3E 2FNAA 2H7VA 2O8DA 2ZRMA 4RZ2A 3DM9B 3W6NA 4KYUA 4POAA 5FOUA 4A92A 3LW7A 2CMKA 4O2RA 4FXPA 4TL7A 1OH6A 2ZRBA 2R6AA 3GFTA 2Q3MA 3RRMA 2QPAA 4FIDA 2IUTA 4UXJA 5BYKA 3NBYC 1N5LA 2ZREA 1K8RA 2GF0A 1CBUA 1DAMA 1ZC4A 4DIEA 2QZ4A 2B7BA 1S1CA 1J99A 2JLUA 3NG1A 2VRWA 2RKOA 1UFQA 2QGNA 2ZRDA 1II8A 3KX2A 4V0OA 4JLNA 2WWIA 5LDDC 1NG9A 2NPFA 1T0HB 2OFWA 1XJ0A 5BN3A 3HU1A 4R2HA 3T5DA 4Q7MB 1IQPA 4EDHA 2JATA 4RKEA 1KSFX 1XPRA 3CWQA 4DDTA 1OXSC 3TLXA 3DEFA 1YZNA 4JT2A 1DG1G 4NTZA 4GZLA 4B2IA 2QTFA 3EA5A 3PFIA 3NEYA 4BFVA 4GBMA 4A2PA 4JS0A 2P67A 3RRZA 3OE7D 3P20A 2O8BA 3GJ5A 1W2HA 2ZR0A 3KJHA 2AR7A 1N0VC 3TRFA 3AV0B 1BKDR 2ODBA 1G3RA 3UATA 5FTLA 3G5UA 4OQLA 4US1R 3WP1B 4F4JA 2YOFA 1MO5A 3W3ZB 4F93B 3AP1A 1A2KC 1XWIA 2KI5A 5CM8B 1LF5A 1HY3A 3QPWA 3ZLJA 2QQEA 4JBWA 1E2JA 4IXNA 3KZ1E 4P3YA 3AF1A 2CLSA 2YWFA 3EZ6A 2HXSA 1Z6GA 2JJ2D 5FOSA 3EG5A 1X6VA 2ZQ5A 5KNCA 4GT1A 3LH5A 4Q00A 2F1IA 3UKDA 5FH9A 3C5CA 4LYAA 3WY9A 1G1MA 2WJYA 3ZIAD 4TZ0A 4X8OA 1GRNA 1J8MF 1NF3A 1SXJE 2G88A 3IQWA 5EUMA 4IW3B 4CEIA 4DUGD 4RCYA 2C98A 2KE5A 1R5NA 5TDHA 3EWAA 4IHQA 1GL7A 1KJZA 2XGJA 4BWYA 3R8FA 1NMZA 2IXFA 3CX7A 4I1UA 3NKVA 1FUUA 1E79A 4EKDA 1J70A 2FU5C 4LJ9A 4CF7A 2ZS7A 1EFRA 2OILA 3EZ9A 4LRWA 3U3OA 1IBRA 2CLCX 3U5ZB 1KI6A 4XTRA 4Q4HB 2ONKA 2VLIA 3MUFA 5JBQA 1CXZA 2CHGA 3K0EA 4J0QA 4TLAA 4C9BA 2REXB 2BM1A 3CNNA 1T91A 1C4OA 4YMUA 2VH5R 1Q1QA 3A37A 4LJYA 1DO0A 1MH1A 4IFEA 4LOAA 2Z4RA 3H2YA 2R44A 2O8CB 2YHSA 4HB4A 4M1MA 1I2MA 2FA9A 1HE1C 3RHFA 5FPHA 3MSXA 1EFHA 2JLRA 1KI9A 4PHHA 4DEXA 2IL1A 3GJ0A 1KAGA 2V1XA 3OAAD 5G41A 1IHUA 3B1ZA 2CJWA 2HV8A 1DARA 2VHTA 3ZS8A 4Q5IA 4MKGA 3BFXA 3EXAA 2Z43A 5CDFE 1N6IA 2FH5B 4YONB 4IKEA 3LLMA 2O5VA 1RYHA 1E32A 4LYFA 2ORWA 2IYYA 2C99A 2G77B 3PVSA 2XZLA 4ZCMA 3GJ7A 2W0SA 4IOKA 4PO1A 3RSOA 3ZVRA 3ADDA 4IOLA 3KKOA 3B8HA 2DBYA 1RPZA 4B35A 1YE8A 2OESA 1SXJB 2ZYTX 3ASYA 5J47A 2CLDX 3WMEA 1M6NA 1P2VA 2QP4A 1SKYE 2W6ID 1YRBA 4N0EA 4NYJR 2JJ8A 4G5QA 1VHLA 3TIFA 3FKQA 2JLSA 1WMSA 1F60A 1OYWA 2PEYA 2WIBA 4KSCA 2JJ1A 4JZKA 2J9RA 2ZSBA 1DS6A 2H18A 4B34A 3WNCA 2GILA 1E69A 2GZAA 3CPEA 5JCZA 2VO1A 1AK2A 5FBLB 4US0R 3A6PC 3CX6A 1Z0KA 2FGJA 2V54A 4AKHA 3MJHA 1R10A 4BRUA 1W49A 3UWKA 2XTNA 1E2EA 1X1SA 1NI3A 2BDTA 4KBFA 1DADA 1RZ3A 1AGRA 4PPNA 4WA7A 1W44A 4PZZA 4DB4A 1R8SA 2Q6TA 2VSXA 1JEDA 1L2TA 4RD2A 4MRSA 5BWMA 2EWVA 3W6PA 4XWKA 2NTYC 5LD2B 2BHRA 1Q22A 2F1HA 4DVGA 1KGDA 4QKQA 3KTAB 3I92A 5BXQC 4B47A 4HLQB 1M74A 1XPOA 1L8QA 2DYKA 3ADBA 4GP6A 3KKPA 5JZVA 4ZDJA 1AS2A 2AWNA 4RSGA 4GMXA 2J41A 1Z22A 2DY1A 5C4GB 4NL4H 4A0RA 3FHOA 2HLDA 3QG1A 4A36A 3Q72A 1OT3A 5CJPA 4JLAA 5IT5A 4U02A 1CR4A 3A4MA 3AGQA 4L5BA 4HUQB 3A1WA 3JVVA 2IUUA 2YJTD 4TYPA 1SKYB 2GXQA 2PT5A 4KAXA 1DAFA 2ZI6A 4M1OA 3KQKA 1GRQA 1E2NA 2QL6A 3AQ4A 4G3XA 4P4UA 3KFVA 3AP2A 4MGYR 3QXJA 1N0WA 1CULC 4URUR 4V0LA 2BWJA 2B7CA 1OHHD 5AJWA 1JJ7A 4S2EA 6Q21A 1B23P 2GCOA 4X8LA 1Y3AA 4E07A 3NBZC 2FZ4A 4K8OA 2GHIA 1E1RA 1F2UB 3BRWD 5IF9A 1OXXK 2QSZA 2YKGA 4PHFA 3A1SA 1KMHB 3GJ3A 1EG7A 1QG4A 4B2PA 3MAAC 4A0FA 1CEEA 3ZVLA 2ZIAA 1O3YA 4WW0A 2N42A 2NIPA 5L3VA 3CPHA 3T5GA 1H8HD 2QBYB 5E95A 721PA 1XD9A 3PEUA 3ZVMA 1XTIA 2VSFA 2QENA 3V4RA 3OIUA 3UPUA 1JR3A 1COWD 5FBQB 2DWQA 1TQ2A 1X8KA 4OHVA 2ZRHA 3CF2A 1KJWA 4PO9A 3GLIE 1G5TA 1U8YA 5AJVB 2RGXA 5J5CA 1YR8A 2DFKB 3W90A 3QEJA 5M04A 3CR7A 1ZRHA 4MA4A 4L8GA 3M4YA 2V7QD 1MO6A 3AKEA 5LB4A 3VX4A 1R0WA 1I4TD 3K09C 1E1QD 3WMFA 1UEJA 1JALA 3C5HA 1J90A 2D3WA 2XJ4A 3RRYA 3WNDA 4KVGA 3W8NA 2ZUDA 4BUJA 2A5DA 1P2TA 1UJ2A 4RD4A 4ARZA 4BFSA 3EPHA 2RHMA 5EE0A 4BFWA 3KKNA 4LPSA 1ZM3A 3DM5A 2QTHA 3G82C 4OYHA 2R62A 3X2SA 2Z5FA 1WCV1 2B8WA 4C7OB 3K0FA 4LBYA 1KK0A 2AD5A 1U94A 5DLQC 5HKKD 5EZ6B 3C16C 1KKLA 3J81k 2EWWA 3IKJA 2ZROA 4LC1A 2IEYA 5CIQA 3R9XA 4M22A 2DPXA 2JASA 2XTMA 4CRWB 1XPUA 1NBMD 4MRNA 3T35A 2OHFA 1OXUA 1B0UA 4Q1CA 1IM2A 1E9BA 4DZZA 3A4LA 1DELA 2QROA 1ZBDA 4NH0A 4TWZA 5EP4A 4BZPA 4D6PA 2TMKA 2C78A 2ZAMA 3I1FA 2X1VA 3KJIA 2QQ0A 1GSIA 2FJUA 1TTTA 4HEJA 1SGWA 2GJAA 1HEIA 2MSCB 2R2AA 4DLUA 5FTKA 4ACBA 1HT1E 1SXJC 5H8WA 3BJIC 4Q4LA 4AY2A 4V02A 3MJRA 2CDNA 3CF0A 4OI4A 4V0ME 5SZHB 4NCIA 3K9HA 2GK7A 4YMSA 3CO5A 1RE0A 4B74A 3FKSA 3BH6A 4PC3A 4TTQA 1GFIA 5JSZB 1AQYA 4BECA 2D7CA 2XSZD 4EPTA 4ZCIA 2V6IA 1UBCA 3GLIB 3MRSA 4A6PA 2XOKD 4DEYA 3B1WA 4JVNA 1R0ZA 1YR7A 1XMJA 5CIWA 1KO5A 1E9CA 2JGNA 1IY0A 1X8LA 4TYNA 3U60B 2BJVA 5B57C 1N5IA 1ODFA 1FOEB 1SXJA 1VCOA 1NJFA 1SVIA 2ZANA 1W2GA 4NKRA 1G9XA 2AD1A 2G9NA 2ZRLA 2QNRA 4LY6A 4JBXA 1SKQA 4MYUA 3RVBA 3NHBA 3U61B 5GVRA 2VPPA 2JLVA 1YZQA 1D5CA 1Z6TA 3KL4A 3PUYA 5JJKA 3CRQA 1ZUIA 2O8DB 2GTPA 3KKMA 5TB5A 3SJCA 1TUIA 1W46A 1S9DA 2G0NA 1P3JA 1ZNZA 1NVWQ 3CUEF 5C46F 1M7HA 2F43B 1AJEA 2WM9B 4IVRA 4YLGA 3O8BA 1KHTA 4JL5A 2RGDA 1AKYA 1M7BA 3B1VA 3HU3A 2IX3A 1ZCAA 3CM0A 5BN5A 2H5EA 4M0LA 5KOYA 5EE5B 3LXRA 2FF7A 1G7TA 1PUIA 1XTQA 2GXUA 2YOGA 4JLVA 3U7FB 4OHZA 3KFXA 1P62B 2KSQA 3TSOA 3PITA 1R5BA 1II8B 2GEDA 2C9OA 1NN5A 4D4JA 2HJVA 3BD9A 4YMVA 4P4TA 4X8HA 1C9KA 5BQ5A 4PTLA 1FNMA 4WZAE 4WAUA 3U3RA 1G21E 3U7EB 2GCNA 3TGPA 4QBIA 3AVYA 1G7SA 5HE9A 3A8TA 5JHHB 2WWGA 4NZYA 5J4HA 3EPKA 3THXA 2J87A 2RGCA 4ASUA 4Q4AB 1XJCA 1G291 3WYGA 2R65A 4I4LA 3T61A 5E3HA 3BS4A 4DC9A 2W83A 3O8DA 1N6KA 5C2JB 1YHNA 4O3MA 1IXRC 1JI0A 3QXCA 3ZH9B 1UDXA 4PHTA 2NOAA 2RGAA 2MSEB 3B7GA 3EA0A 3M1IA 2V1UA 3THWA 2O8BB 4IVPA 2JLQA 2RGEA 2VP4A 4FINA 4HUQA 5DN6D 1JPNA 1ZIPA 4PO8A 1E6CA 3DKPA 2P2LA 3WP0A 3NH6A 2D4HA 1XJQA 1UKEA 2BMFA 521PA 4RVCA 4AD8A 2A7QA 3DKVA 1XTKA 4BLSA 3VNVA 3ZJYA 1TF7A 1CKEA 1TL7C 4LPKA 3LO5A 2ORVA 3LV8A 1DAHA 2C04A 4RFSB 2XJ9A 2OXRA 4JKIA 4A9AA 2R6CA 4EJSB 3VU9A 1NL3A 3LQQA 4EPYA 2EYUA 1ZD8A 2A9KA 2XNDD 2ZRKA 2J46A 1WP9A 4ZI2A 4OJKA 4UJ5A 1HH4A 4C4PA 3AF0A 3MCAA 4L9WA 5DO9A 5EE9A 8OHMA 1KMHA 5E7MA 3OFND 1U99A 2ZUBA 1IY1A 1OFUX 2QRZA 2ZRPA 4DLZA 2WMOB 3SQWA 3CB4A 2VBCA 1NSTA 2QBYA 5J4KA 1S3GA 1K5GA 3B13B 4HZIA 3PUVA 3T15A 2GA8A 2OCYC 3HU2A 3NC1C 4LUCA 3GPLA 5H1YA 3KUDA 4AYXA 1OJLA 4PC6A 4C0SA 1G5PA 1CP2A 4JSYA 4LYJA 1QHNA 1NVVQ 5AUNB 4EFNA 3BB4A 3EPJA 2I3BA 3AUXA 5P21A 4OL0A 3WBKA 2IXGA 4ESVA 3K9NA 4BFXA 2CL6X 3L43A 2ZE5A 3FWYA 3V00A 1EWQA 3UIEA 3PJRA 2ZAOA 2QAJA 4OHYA 1Z63A 1SZPA 2ZI5A 5KU1A 3DOFA 2HT1A 5FI0B 4UQOA 1JQJC 2KB0A 1X1RA 3I62A 1X8JA 1CTQA 5HCNA 3S1AA 5C4MA 4DCTA 1ZM2A 2RMKA 4Q9HA 2DHRA 3LFUA 3ZZUA 1CJUC 3IEVA 1LB1B 2IA5A 3K1JA 2AHOA 4F91B 4EFLA 4EPVA 3VMFA 4KHZA 4FW9A 5TY0A 2CJWB 3MGCA 2UZIR 3U3MA 3RC8A 1G18A 4DLVA 1ZJ6A 3A1UA 2RH5A 4UNQA 1A1VA 4EFMA 3SFVA 2D2EA 1XEWX 5A4JA 2A5JA 1KMQA 4XTCS 1VYUA 1TPZA 4TSFA 3OESA 1KYIA 5CLQA 3UMSA 3SZRA 1YR9A 1E2GA 2IYWA 1R8QA 1XZQA 3TE6A 3PQCA 5FOVA 3SBEA 2FV8A 2IYTA 2VL7A 4JSTA 3TVTA 5FL7A 2RGGA 3ND9A 2P5SA 1A4RA 4MDEA 4GOXA 4OHWA 5JSZA 5FI1B 4JBYA 1NSFA 4BZXA 4NCKA 2P3SA 4O2LA 3GLIA 2GJSA 2ZU0C 4DSOA 1OFHA 1IXSB 2WKPA 4NMMA 3L82B 3Q5DA 4KVAA 3VFDA 4DIDA 5HPYB 4QM7A 1TEVA 2PMKA 1LNZA 3U7HB 1Q3TA 2Q3HA 2UZ3A 2BKUA 1DVRA 1GILA 2X77A 1JNYA 1GNRA 4IDNA 4XSGA 3PXGA 1P5ZB 1TF5A 4TL9A 4GI7A 5B64A 3NVAA 3BH7A 1SQ5A 4HLDA 1MABB 3HYRA 3QUSA 2WJJA 2ODWA 4BEBA 3KQNA 5KSOA 1TUEA 1IN7A 2QPOA 5HZKA 4JMPA 1E9FA 2YWGA 2W0MA 3PG5A 5IRCD 2QU8A 4QGFA 3SDZA 1P75A 4AG5A 4Q48A 3BE4A 3HJNA 4FMDB 4PX9A 2HEIA 1XEWY 2CNWA 2K5UA 2PX3A 4NYIR 3VHXA 2F6RA 2PCJA 4KFSA 4NCJA 5K8UA 3QI2A 2QT0A 4LWZA 1SVKA 4QOSA 2CCGA 2F43A 3BGWA 4I1OA 1IONA 4M1YA 2BCJQ 4LYHA 1Q44A 3R7WB 3EPLA 4IXMA 4Q02A 4M1WA 1NNEA 4DCSA 1DE0A 2REBA 4MGZR 4TLBA 3DPUA 1EFRD 1W0JA 1U81A 3EIEA 3IBGA 4QBGB 4EIWA 3DOEA 4HATA 2X2FA 1Z6XA 4AYWA 3QJYA 3FMPB 3FB4A 4LJAA 4OQNA 3IHLA 1GKYA 1W36B 2IYVA 5EZ5A 2WV9A 3F8TA 1RRCA 2Q3FA 3WYAA 3T12A 2AFHE 4HYYA 5EUQB 4RZ3A 1LV7A 4QXAA 1DPFA 1ZYUA 2C03A 1A5TA 4V0MA 3CBQA 3SR0A 4HB2A 4HLUC 3ASZA 1KZGB 3EC1A 1FL9A 1T8UA 1A2BA 4P33A 2WBLC 1E0JA 2H8KA 4JLPA 4Q4AA 2A5FA 3LBNA 1BS1A 2OAP1 2V8OA 3QIAA 3LQRA 4EJSC 1SVMA 1OPXA 4QHYA 4OI1A 3IQXA 2GCOB 4NE2A 2BBWA 3SN6A 1FW6A 3Q85A 1O87A 1W4AA 2XX3A 5A5GA 4YMTA 1VIAA 4ITRC 2NO6A 1G19A 2WOJA 1QHHA 2GZDA 2ZI7A 3AUYA 3EW9A 4AIIA 1PZNA 5JLJA 1WQ1R 3ADKA 4RFVA 2EFCB 3KB2A 3WHLA 2QMOA 2PZEA 4HI0E 3NDBB 2OCAA 5F3WB 1Z47A 4IVQA 1NLFA 4HLUA 2J7PA 2LKCA 1CJKC 4NPHA 2P0EA 4B2LA 2IUSA 4TMVA 5AUPB 1KI4A 2J1LA 1R4AA 4WXPA 2W58A 4N1AA 3PENA 3N70A 4L16A 3MWKA 4Q66C 3PCRB 1KO7A 3QVUA 4EJSA 1ZAKA 2F1JA 4RFSA 421PA 2JA1A 3QKRA 2ZE7A 3MMPA 4Q1AA 5FPTA 1BYIA 1T8TA 4NYMR 2JJ1D 1IJFA 4KFRA 1QVRA 1JQLB 5J40A 1GWNA 2D2FA 2ZSDA 4ZIRA 1ZM7A 3TUZC 3X1XA 3W3AA 1KJYA 1EWRA 2H57A 2PLFA 3IHWA 2DWPA 4GP7A 4EPWA 3MLEA 4KO8A 5FOTA 4KU4A 2AKAB 4ARZB 1KO8A 3KJGA 4JT4A 3ZGXA 1SVOA 1ZUNB 5BW8A 5CJ2A 4UNSA 1JXOA 3I4LA 4JYCA 3K0FB 4OI2A 2WPDA 1KK3A 1MRSA 4V0KA 5FR2A 1IN4A 3N5CA 4FI3C 4P31A 4DLSA 2NO9A 4TQ9A 5HR5A 2F55A 4Q7KA 2UVQA 4XD7A 1E2LA 1FPMA 4CVNA 4K81B 4TLDA 4CEJB 4LGMA 1UEIA 3FMIA 3VX3A 3ONWA 2B21A 1W4BA 1OKKD 1E94E 4FCVA 4DLTA 1M7GA 4Q1DA 4II7A 1VG1A 4DB2A 1Q1ZA 3B9PA 2QEQA 1QHGA 2P6UA 2J3EA 2WSMA 2V55B 3QVVA 1N6HA 2IBMA 2L0XA 3FGNA 4IDHA 1NIJA 3RS2A 1AA9A 3O8RA 2PBRA 4A15A 1U0HC 4MGKR 3ND8A 5H68A 1Z07A 4HB3A 1N6RA 3I73A 3D3QA 4FCTA 1IAQA 2CL0X 1F2TA 3DMDA 5D3MB 5KYKA 2NZ8A 3K70B 2VEDA 2O8EA 2BEJA 1HT2E 1NG1A 1Z08A 4Q18A 3QKSA 2NO1A 3QXHA 2I4IA 2ZRGA 2VP5A 2ZITA 4WBSA 4KBGA 2ZSEA 3ZQJA 4F38A 2YWHA 4B3XA 3AVQA 3RS5A 4CYMA 4I81A 1G64A 3T1TA 1E2HA 4HDCA 3JVUA 3V4FA 2WWYA 1FQJA 1Q1BA 1NMYA 2ZS8A 2C96A 1S8FA 3KXKA 4IFBA 1E1RD 1FTSA 5CYPA 1W4CA 4IEEA 2EU8A 2X19A 3CZPA 4IJMA 3EZ7A 1T0JB 1P2SA 4TLEA 2F9MA 1M8PA 1EFUA 1G4UR 3R8CA 4RKFA 1OB2A 5G3YA 5FTNA 4Z1MA 5J4YA 1XXHB 3GJXC 4PAQA 1JR3D 3K9LA 1CLUA 2CHVA 1MOZA 4QHTA 1IJEA 3UMRA 2QI9C 2JLWA 1OFTA 1S3SA 1ZIOA 4DLWA 2ZI9A 1MABA 2DWOA 3CNOA 3WYFA 4B73A 1CRPA 2FEMA 2OG2A 3AKYA 3LWNA 1IN6A 2VTKA 4BQSA 4US2R 2XZOA 2IYLD 1LVGA 1AZTA 1QRAA 4JLBA 4MKHA 4PPQA 5C1BA 2Z6VA 3B82A 1W36C 1DG3A 4JVLA 1I4LD 1S96A 1KDTA 3BC1A 3NH9A 5IHPA 5L3RA 4GMDA 3HDTA 4DLRA 1N2CE 4IRUB 4UKDA 1LF0A 4URWR 2RAPA 4ZPXA 3QBVA 1ZNWA 1Z0FA 1E4VA 2G1KA 5GADl 2OSBA 2A5YB 1HUQA 5G40A 4LJ8A 3W8RA 3R7WA 4DLXA 4IOJA 3THXB 4PSKA 4GDFA 4MH0R 2AK3A 1U8AA 4AKGA 4DDWA 2HUPA 1UKVY 2ONJA 4JIMA 3SHWA 2GESA 3DVLA 4DCVA 2ZSAA 4MRPA 4KSBA 3R9IA 3W5IA 1TQDA 2AWOA 2YVUA 2IYZA 1KNXA 1EX7A 3L8ZA 3THWB 4LK2A 1D2NA 1UBGA 1T3SA 1RW4A 1AIPA 3B1XA 4M2LA 3W6OA 3I5XA 1CIPA 4G0NA 2ZRAA 4MUAA 5CLLA 5EXXA 5JHGB 5CITA 1XTJA 5B2ZA 1VG8A 4Q1EA 3B78A 2CCKA 1HV8A 2QTVB 2CCJA 3IGFA 1ZM4A 4HDOB 4KYIB 2MMGA 4WZBE 1UADA 2QRNA 3OAAA 3VU9B 3U6KA 5FBWB 3WNBA 1JPJA 1JJVA 2VP6A 1VECA 2EVWX 2VSOA 5GJBA 2OXCA 3FKSD 3V9PA 3U6BA 1DOAA 3F5FA 4W7SA 2YC4C 4Q9JA 4KODA 3IIJA 3BAFA 3EIHA 3AGPA 4ERNA 3LXXA 1OIVA 3SJBA 2FDCA 2YWEA 4S35A 5J4VA 3OIVA 3G0HA 1ZU4A 3NHAA 2B8TA 5JRJA 1EESA 2CE7A 2GZHA 2WJHA 1GUAA 4L9SA 3VR5A 1G3IA 1KKMA 3EARA 2GDJA 4B76A 1NVUQ 2BCGY 1SXJD 3GLFE 1L7VC 3VAAA 4DSTA 5AUOB 4B6EA 1HTWA 2QA5A 3ZZTA 4W5WA 3U3KA 5FUXA 3I72A 3JZMA 2Q9BA 2DFTA 4KI0A 2HYIC 3AVPA 3LX5A 1R2QA 1E9SA 4Z8YA 821PA 1VCMA 2HYDA 3AVOA 2IW3A 2BIFA 2C95A 3CNLA 5B58C 2ASEA 3D31A 3NWJA 3T1QA 1NP6A 3OEHA 3RS3A 5KSYA 1FMLA 4B75A 4D4KA 1U9IA 3B6EA 2EYQA 3TQCA 3AF4A 1NN3A 3LNCA 4TZ6A 1Z83A 5DHFA 3S1AB 1ESMA 3L0IB 3L2OB 3F0TA 4TQUS 3C8UA 1NN0A 1Z3IX 5KSPA 1YZKA 2N1BA 2J59A 4PANA 4URXR 1YZUA 2PL3A 2QUZA 4PPFA 3VQTA 1SULA 3AVXA 3GJ6A 5DNYB 2DFNA 2DB3A 5GVSA 4URZR 3IDQA 1VHTA 1PLLA 1MT0A 4NP6A 5G3ZA 2GJKA 2YC2C 1F3OA 3IILA 3AVUA 3K70C 1GTVA 3B85A 1BOFA 4CEJA 1U0JA 3NXSA 3DZDA 5D3QA 2X8AA 2FE4A 1E98A 1KI7A 1VCIA 1Z6AA 4ASUD 1NVXQ 2GAAA 1BYUA 4HAVA 1MRNA 1X3SA 2WHXA 5JWHA 3CRRA 4ACAA 2ATXA 1WA5A 4XSHA 3SYLA 4LV6A 1KI8A 3NIBA 4DLYA 3RC3A 4R7ZA 4M1KA 1W1WA 1TEXA 4HDQB 4WZ6A 2IT1A 5GJCA 3GCGA 2ZYWX 4QC2A 1KI2A 1NKTA 2WOOA 5D3MA 1UPTA 1Z06A 3GLFB 3WMGA 1Z0DA 1RYFA 5BYJA 1II0A 1R0YA 4MGIR 4N0DA 4PSAA 3ICQB 2H17A 2OV2A 2QORA 1FP6A 4BFZA 4BLRA 2YNMA 4BRWA 1XU4A 3QSYA 4JLMA 2R6GA 3CKLA 3M6AA 2GRJA 3BXZA 2EFEB 3X1DA 2OUKA 2X2EA 1G3UA 5K8TA 3H0KA 2ATVA 4MKFA 3EZ2A 1OHHA 2V3CC 2JIZA 3LX8A 1GZSA 4TQAA 3OEEA 4XIGS 5JECA 3UMFA 3C4JA 4D25A 2BM0A 4KFUA 3IO3A 4PHGA 2IHBA 2D06A 5JWOA 4JYBA 4D2IA 1XEFA 1OXTA 1Q1EA 3TJZA 621PA 2KBEA 4IDOA 4DBLC 1KAOA 2GAOA 1FQKA 1LS6A 4OHXA 3FHTA 2A2ZA 4MYCA 2J0QA 1BMFA 2GEVA 3BORA 4HAUA 5G53C 3DHWC 3E5HA 4PZLA 2ODNA 3H1TA 2RHDA 1OV4A 1XXHA 4MRRA 5DI9A 1N0UA 5HZHA 1COWA 2WWXA 2CHQA 3TBKA 2VP2A 3FTQA 1MV5A 3RRNA 2OLKA 1YRAA 3BOSA 5JFGA 1E2MA 3P32A 3IUYA 4M4SA 3SU8A 1H8EA 1US8B 4QGHA 2IK8A 4DDUA 2AL7A 1OW3B 3PV0A 1P2UA 4Q9IA 3TVDA 1JAIA 4QG7A 4BLQA 3TKLA 4UNNA 4YDSA 4JL6A 1RJ9B 4ZDWA 2IF2A 3FMFA 1W0KD 2OE2A 4A1FA 1QDEA 2QP3A 4L15A 4BLPA 2OBLA 2WSSD 3GD7A 4TL6A 2BBTA 4LJ7A 1WB9A 3VKGA 2RCNA 2Q21A 3T1OA 2OCPA 2G0TA 4GZMA 4CEHB 4Q1BA 2GVDC 3SHFA 3UG7A 2LCFA 1P9WA 4WOPA 5IK2A 1S2MA 4E22A 2AXNA 1KO1A 1KY2A 3P26A 4Y0VA 1TNDA 4XWAA 2JCSA 1ONBA 1SHKA 2KBFA 3F3YA 1EX6A 1NRJB 2ORIA 4HZUB 1NIPA 1UBFA 3B60A 1P72A 4OK3A 2GK6A 1QHHB 2B92A 4M8NE 4LC0A 4W5JA 5KPJA 3QKUA 4KITB 4C30A 3MWLA 2WKQA 3OHMA 1D9ZA 2CVHA 3P4XA 2VP0A 2Q9CA 2G1JA 4C3ZA 3QKTA 5H70A 2C5LA 3QOFA 2R6FA 2QT1A 1OIWA 4OQMA 3P27A 4E03A 3WBJA 4MYHA 2B6HA 1KIMA 3IIMA 2GCPA 2IC5A 1MO3A 2ZJYA 3DZ8A 4BLTA 2ZTSA 1N3BA 2WAYA 1U98A 4X8MA 3X1ZA 3QKRB 3LY5A 1V5WA 1CRQA 1Q12A 2OM2A 5FL7D 1P4SA 1YR6A 3UANA 2JAQA 4A2WA 1VG9B 4ZKEA 4ZIRB 1OIXA 1N5KA 2PLRA 4RD3A 2PH1A 4HSEA 4F4IA 3AVTA 1G20E 2BOVA 4UJ3A 3THYB 2A3RA 3U4QB 3RLFA 5JJLA 3GP8A 3PUXA 2REOA 2OAQ1 1G6HA 1IN8A 3BB3A 1MO4A 4FMCB 4FMBB 2O8FB 3CW2A 1N5JA 4JJKA 4U5XA 2ZUCA 2R9VA 3QXXA 4D80A 1MR3F 2QAGB 4CW7A 4DJTA 2GETA 1GL6A 2ZS9A 1XBTA 3I8SA 1ZD1A 4L4UA 4PC1A 1A7JA 4Q01A 4Z8XA 3SFZA 4EQ6B 1ZMXA 3RSLA 3TQFA 1Q0UA 3KB1A 1ZU5A 2KJQA 5CB6A 1GRRA 3AVWA 4G5OA 2CNWD 5K8LA 3KQLA 1DEKA 4YMWA 1GNPA 1XEXA 1R0XA 1G16A 1PV4A 1F48A 2W6JA 1Z8FA 1J7KA 2FN4A 3B1YA 3DL0A 4Q1FA 5L3QB 4ABYA 1AGPA 1FMJA 4W9MC 1E0AA 2O0HA 3RS4A 1KOFA 4GNKA 5DI3B 2J0SA 1QHIA 2Q0HA 4Z54A 1J8YF 1W5TA 4PAMA 4PQRA 5CB8A 4D4LA 3ZVNA 4FN5A 3R20A 2AK2A 4AC9A 1XF9A 5K8IA 4R9UC 2YYZA 3TMKA 1WBBA 1KK1A 1F2TB 1XP8A 1XDBA 4LV8B 5L3SB 2O8EB 3AF2A 1P61B 5DISB 1VYTA 2E1RA 4PZYA 5E7IA 3QKSB 2ZJAA 2ZRJA 5JCPA 4H1VA 1KK2A 4B3DA 4B33A 1OH8A 1G3QA 2PZFA 3I3SR 1KSHA 2GXAA 2FG5A 4A4DA 2FSHA 1DO2A 3ZQ6A 4TN1A 2NMVA 1JEEA 3EWSA 1KI1A 5FOWA 3HP1A 4RZXA 1A82A 5TVKA 3SI7A 1P9RA 2OBMA 5AR1A 2CK3A 2NG1A 3QNUA 5LPNA 2FFBA 3Q7QA 3GLGA 3I61A 5TXGA 5ELXA 2ZI4A 3AF3A 5DSZA 5TV2A 3GLFA 1JXMA 3N2IA 1OH7A 1T3HA 4B3GA 1D9XA 2A5GA 4C0QC 2ZEJA 2J7PD 1Q21A 3FFBA 5HCIA 4GL2A 1Z28A 3VR2A 5IDVA 2D7DA 4CDGA 1GG2A 3OZXA 1ZCBA 4TT3A 5SZKB 2F3TA 2F3RA 1F6BA 5B30A 1ZINA 2HCJB 4DDVA 3VR3A 2Z0MA 2GBLC 1LS1A 4HUTA 1U2RA 1Z0IA 5AJZA 1E0KA 1D2EA 2XNDA 1MKYA 2XXAB 2BBSA 1XCMA 1YQTA 2QE7A 4MDFA 2MMCA 3TH5A 1VCNA 3QPUA 2QSYA 4D0LB 1XTSA 4EAQA 3Q8XB 4JL8A 4TL8A 2O0KA 4XJXA 5AWFC 2AX4A 2V6JA 3SYKA 1J2JA 3FDIA 4F7WA 2GBLA 2J7KA 3NEJA 4A82A 3T06B 3KQUA 1S9HA 4LHZA 2WJIA 4QNRA 2ANCA 1CJVC 5FOXA 3PEYA 5KSZA 1E79D 3OF5A 2IXEA 3AH8A 3MG9A 3P4YA 1GKIA 2WPDD 4ILEA 3PIRA 4AKIA 1YVDA 1IY2A 3I8XA 2JLXA 5DYIA 1US8A 4FCWA 2R8RA 1XRJA 3QF4B 1EK0A 1ZUHA 3D6TB 2ZE8A 1JBKA 4I99A 4XD7D 3SS8A 4MQBA 4TMKA 3FOZA 3W9YA 1RJ9A 2ZR9A 2EFHB 4YXWA 1KSGA 5JJIA 2XZPA 2FPMA 2WJVA 4B6FA 1OYYA 2CL7X 2BV3A 2ZYVX 221PA 3CF6R 4H1UA 2I1VB 4XVRA 3RS7A 4JLOA 3TR5A 1TQ6A 3C15C 2WICA 1U8ZA 5EP1A 2DCUA 3O8CA 2ZYUX 3CONA 4CEHA 4RD0A 1E9DA 3WXMA 2W2TA 3PR1A 4A8JB 2JDIA 2P6NA 3FVQA 4PQFA 1E2PA 3C41J 4Y0AA 4ON9A 1EFCA 1QHYA 2BJWA 5KO2A 4HZUA 1T3LA 2BBOA 4V0NA 5LBIA 2ZU6A 2ERXA 2IYUA 5FPYA 3PUWA 2QG6A 4PAOA 3IIKA 4CZ2A 3KXIA 3HPRA 1PVOA 1LW7A 1CR1A 5E4FA 4M9ZA 4JLJA 5EP2A 4LV5B 3B9QA 2ZSFA 4AKEA 2NGRA 3KQHA 4UNPA 2EFGA 1Q20A 5CYOA 1E0SA 2VHCA 1T5IA 3LVRE 2J45A 4V03A 2WWHA 3U2QA 1L4UA 4K46A 1KDOA 2QAGC 2F7SA 4G5SA 1YJ5A 4G5RA 2C9YA 3A36A 3TAUA 1AKEA 2ZM5A 4HAXA 2HF9A 4QGAA 1VTKA 3UWOA 5FPKA 4Q4JB 4LI0A 4PXAA 5LB2A 4YC7A 5E7JA 2FSFA 2NPIA 2UKDA 4D81A 3IBYA 3U3JA 1UF9A 3THYA 3U4QA 1S0UA 1YZGA 2EFDB 4LCBA 4KV9A 4Z1MD 4DXAA 3OIWA 4R98A 5F9FA 5FBRB 3E2IA 1X86B 2C2HA 2YINC 2O8FA 3K0SA 2FGKA 1FUKA 1N6OA 4FD2A 1G6OA 4O0MA 2FFQA 4QFMA 2QAGA 1XCPA 2ANBA 2FSGA 3EZFA 4EQ6A 1G8PA 1OFIA 3VR4A 2XNSA 3EX7C 4GOJA 1HQYE 1XXHE 1GAJA 1I4DD 3SC3A 4NHOA 3CH5A 3GMTA 2WWWA 1E2FA 1NVVR 2A78A 3QQ5A 2XB2A 2C9CA 4LHWA 4R71A 3BB1A 1VMAA 4FMDF 4D0NA 5FUWA 3FYHA 1GVNB 2VF8A 4PSVA 4D0GA 5L3QA 2PT7A 1FNNA 2F9LA 1KTVA 1UDWA 1KNQA 3I32A 4LHVA 1SHZA 2VF7A 4QNMA 2AFIE 1QBKC 2Q9AA 5DI3A 2HLDD 1RC8A 1XFAA 4LJ6A 2QP9X 3ZD7A 4TYQA 3A1VA 2GF9A 5EXPA 1W36D 3GFOA 1RVDA 5L3SA 4WXRA 1SVLA 3GEEA 4F4CA 3GFPA 1Y63A 2NO7A 1NY5A 5ANRB 3RWMB 2PJRA 2HT6A 3TAHA 4AYTA 1GITA 2OCBA 1W7AA 1L4YA 2QMEA 2LWIA 2G3YA 2EQBA 3CLVA 4B44A 2XAUA 1ZC3A 4M9SA 1DAIA 1ZVQA 4QBHA 2PZGA 4OQXA 4YDHB 3REFA 3QG5A 4PPGA 2IF0A 1NBME 1TX4B 2QM8A 3QENA 1VKJA 1CU1A 3ETLA 1VPLA 5FL3A 2H1LA 1Z29A 2XITA 5KNDA 3OE7A 3IO5A 2ZJOA 4KFTA 3CIOA 3KUCA 5FTMA 2IS6A 1PUJA 2FMXA 3QXSA 5KDLA 5EE1A 1KDRA 2PJZA 3H84A 2ZJBA 3FMOB 3H86A 2AN9A 2JLYA 4C0LA 4D4MA 2IS4A 5CM9C 3EIQA 1XX6A 2IEZA 1T9HA 3NTUA 4Q21A 1I2DA 1CF4A 2C77A 1EGAA 2P65A 3AM1A 1RFLA 2VYFA 1XD2B 2QY9A 3KKQA 2V9PA 2VHQA 3Q5EA 3QE0A 1E9EA 2JJ2A 5KHOC 3GLHA 4M1TA 4LHXA 1Z2CA 3E70C 4BGDA 2XXAA 2CXXA 3X1WA 3ZIAA 1HQCA 4HB0A 2XTZA 4B32A 5DE3A 1R5OA 5KTYA 3AEZA 5DGXA 2ZVQX 5FPSA 1DAGA 3OEHD 1W4RA 5JS8A 4AK9A 4DUGA 1M34E 2WTUA 2AKYA 3UG6A 2IYRA 3CH4B 3CRMA 4TYYA 3MFYA 5FR1A 3PEWA 4XH9B 1WRBA 1OSNA 1KI3A 2RB4A 1AS3A 2NZJA 3B2EA 1E99A 2FX3A 1VYVA 1H65A 5HE8A 4A8JC 4AG6A 4TTPA 2Y8EA 3K0AB 2WIAA 4BASA 1G8GA 3QF4A 4OBEA 4EPXA 4M1SA 5CK5A 4DSNA 4DWJA 4KXFB 4P32A 3SJZA 3RAPR 3TSZA 2ZJ8A 1VIYA 1OKKA 4TMWA 1JECA 3H4MA 1UAAA 2OBNA 4KJZA 4R2IA 3VKHA 4JVSB 2MSDB 4DT1B 1K5DA 3UXMA 1Z0AA 3E1SA 1DAEA 1TADA 3SYNA 4JJZA 5EXTA 1NY6A 2ZRIA 3L0OA 4I1SA 5JI3E 4UNRA 4BFUA 2BMEA 3Q7PA 4A8JA 2P6RA 2AXPA 2CBZA 2IWRA 5A0FA 1ELOA 2ERYA 2ZVPX 3K70D 3HPQA 1NN1A 1UKZA 4IOMA 1XCGB 5F98A 3AKDA 3CRVA 3LBIA 3L0SA 1ZNYA 3LA6A 5JWRA 1E3MA 2OFOA 4FWIB 2BMJA 1WE2A 3GEIA 1XTRA 4LJ4A 2P5TB 2VA8A 1U9IC 3T1VA 4A2QA 3GLGE 4M9XA 1BIFA 1RIFA 4ZV4A 3I5YA 1TQ4A 2I1QA 4TMZA 2JIZD 4DCUA 1AN0A 1N25A 3OEED
chains in the Genus database with same CATH superfamily
1D2MA 3CCBA 3K1YA 4MWCA 1T13A 3VOBA 2PS9A 4YRDA 4D82A 5L8VA 4OLHA 1ZR4A 4L4SA 1P6QA 1XTZA 1M0EA 4KN5A 4Q4JA 4ZDIA 1E9AA 1JDBC 3T1HB 5J5VA 2ZJZA 1EAMA 1YRLA 3NBQA 4PZEA 2OZEA 3W5JA 4FBGA 5ALGA 1FP4A 5FIUA 2G1PA 2HA5A 1Z0SA 4BP8A 1LU9A 2XMZA 3EASA 3I6IA 3L0PA 1NQAO 2FOLA 2ZETA 4ALNA 4CWAA 4NNJA 2VRCA 3OZDA 5JRZA 4EG1A 1U2DA 2HRCA 1XRQA 3H75A 4BGVA 4Z53A 3UV6A 5FTJA 1UMCA 1XCBA 2QSJA 2C94A 4TLCA 1JNXX 4MB2A 4ZALA 2ZPTX 5IJ0A 5H80A 3CVWA 4M3NA 3Q9LA 3HB5X 5EJIA 3QNMA 5GGXA 4CKCB 1AQIA 1YC5A 4GHWA 4WKNA 4S12A 4LJ5A 3AP3A 3MGBA 4DUZB 4QPPA 2VEOA 3CR8A 1QJ4A 4IIYA 3PTLA 1CVIA 2FP4A 3MWEA 2NU6B 4OQFA 4EHFA 1ZCZA 1GXSA 1PSWA 3F67A 3FNHA 4YAKA 3UBTA 4BMVA 3WG9A 2EOAA 1XIVA 4OI0A 2NXWA 5D5QA 5IT0A 2IUYA 1TW3A 5IVPA 4P4SB 2Q29A 3LKBA 4RCZA 1G8FA 2A9PA 4EA9A 1JFTA 4YWJA 2X2PA 4S05A 5IK2D 1WDTA 2VP9A 1LFDB 1W5SA 1S1MA 2IGTA 3GGCA 4UUOA 4WBNF 4UASA 2QVGA 3FHCB 3L8CA 4BMXA 1CY2A 4TTRA 4DRZA 1IG0A 2AUTA 4QRHA 4RY9A 5ERGB 1E1KA 1YSCA 1QCZA 3QU9A 2PY6A 1L5NA 4AU1A 2ZSHA 3RIGA 2P68A 2YOHA 1CJTC 2VDNB 3I01A 4ND1A 5AK3A 1KU6A 2BSAA 3K09A 1Y5NA 4FBLA 4CMIB 1Z34A 4RUKA 4M21A 4QU5A 1O08A 3TR6A 3WGJA 3ZWBA 4ND5A 3ZDAA 1Z75A 4PR0A 4B3TB 3VV2A 3ZGLA 3QX7A 4LFCB 3KSZO 4JH0A 5ILOA 2G28A 4YFYA 4LHYA 1Q15A 1SC3A 4LRQA 1XSEA 4MV3A 4XD2A 5CB4B 1RZRA 3KR9A 1A72A 4R81A 3NC0C 4BS9A 3DMYA 3I37X 2WYHA 1ZI9A 4Q03A 1SUPA 1XVVA 3TTYA 1L9XA 3IOEA 1JG4A 5EVCA 3QPVA 1H3EA 3MT7A 1HDGO 4EHDA 3EFBA 3JD3A 5DTRA 1QXSA 4C7BA 1N5DA 2YIDA 5TMPA 4JYZA 4Z3OA 1CUJA 2OGUA 4FEGA 1V5GA 4DAOA 1AKNA 1YB7A 2QR2A 5KYTA 3HDQA 3HB7A 4WCFC 3PSHA 5GGYA 4JLKA 5FLYA 2E0IA 3F3MA 1OOEA 3Q8LA 3L6OO 4ZV7A 2B5VA 4PC7A 4OFBA 2VHEA 5L4LA 3P9ZA 4HBGA 3DD1A 3RU9A 3MFQA 1FYXA 2IHVA 3BH0A 1RWXA 3C48A 3OEWA 3WHKA 5ITZB 3IKLA 4M89A 1GM5A 2OO5A 3JD0A 3O1JC 2OQVA 3WBFA 3G8DA 1JWBB 2BH9A 4JUBA 4UUPA 1XD2A 2X58A 5HIMA 2W70A 4F71A 4URVR 1EHIA 4NBSA 3BIFA 1DWPA 1C3EA 1SXGA 1YFKA 2IKQA 3LIIA 4EAAA 4URYR 1RXCA 1YZLA 3C3CA 3DHVA 2O52A 1U3UA 2Q99A 1QZXA 2AN5A 3V2HA 3UJHA 1XMSA 4C0BA 2ZXUA 1QSGA 1VI5A 3BDIA 2GEFA 4S1TA 3VDNB 4AJNA 4EPRA 1NMQA 2H92A 1WBDA 4JKYA 4DXDA 3BWDD 3BMCA 4L76A 1KSJA 3DP7A 3JZDA 3O47A 1NQOA 2AFIA 1IEQA 2DR3A 2GJ9A 2RJNA 3ET4A 4FZJA 3WTCA 1D6JA 3IVGA 1OLSB 1QIEA 1Z0ZA 3LD9A 4HAWA 4NPAA 1U2EA 4OYRA 2AW5A 2NXCA 3LCRA 5SZIA 5CTAA 3S1LA 4DJFC 2WAXA 2O50A 2HPZA 3NPAA 4L0QA 3GZNB 4A8HA 3FPAA 2QGZA 4PCVA 4ZKDA 4I55F 1I7LA 3EAQA 3BWYA 1JXAA 1GKUB 2R84A 3SQXA 3D0QA 4J1NA 4JR1A 1E20A 5BWCA 5BQXA 1TCVA 1N78A 3A7DA 1XMVA 1D1PA 2NW6A 4GSYA 2PANA 5DGHA 2GEUA 3RBVA 2A9FA 3LHDA 1N4DA 2PAFA 3KCNA 4I1VA 4FILA 1SVUA 2O1SA 1NLYA 3O21A 3K0AA 3L6BA 3NCHA 5BN4A 4YDQA 2O0JA 3IE1A 1R6BX 3EY9A 3KYDB 3SZOA 3MXOA 4KLCA 2IUFA 2PMFA 3EVGA 1HZJA 4IV5A 3SXUB 4OK5A 4BCCA 4G0MA 3QBTA 3GGSA 2IU0A 2C5BA 3WB2A 1KZ7B 2RGBA 1TUBB 3HBFA 1PD1A 3AKCA 3FPGA 3HUDA 4G89A 1UM8A 4C0KA 1JPUA 4DT1A 2A33A 2PCLA 1Y6RA 4UXHA 4Q9LA 4H7HA 5TF0A 2UYYA 1DBWA 4ZPXA 2A9VA 1M2OB 4A6EA 4R1UA 5KDDA 3CG4A 3I2JA 1JTVA 2JLZA 2PUAA 1Q77A 2C97A 2IW1A 5I47A 3PQ8A 4GDMA 4KH1A 1B15A 2W2XA 3G68A 3I9V6 1C9YA 1CJBA 5AJTA 2NT4A 1G41A 1U0NA 4H7FA 2SHKA 4LBWA 3HCWA 5HSGA 4L74A 5KPDA 3NGLA 1JZTA 1YCFA 1W88A 5EXSA 1WCWA 4C4ZA 1NLMA 3I23A 1FLNA 2OVFA 4DM3A 4UCFA 3PPVA 3DO8A 4LBVA 4LJLA 3THOA 3UHJA 3OCVA 3ZZ0A 3LQKA 2CB9A 3O1IC 1E4YA 1KFJB 5LMCA 1OROA 4D46A 1A2OA 4G1EB 4KC0A 3JZFA 1AQUA 4LXUA 2HHJA 3U26A 3ILVA 2P9YA 5HTKA 4M87A 4ADSG 3GL9A 5LA6F 1JR6A 3ILYA 2QE7D 4HEA1 4XVQA 2E5LB 1CJMA 1UKCA 1WW2A 4MQEB 3VISA 5J23A 5G0TA 1UBSB 5AJYA 4B8YA 2QVYX 1YVPA 1WY7A 4CEIB 4YAFA 1DTSA 1E2IA 2AV6A 4Q9KA 5AW5A 4WVFA 3CNBA 4OV6B 2PSEA 4UBKA 1S4QA 4AZTA 3L4JA 5IG2A 1E2BA 4QJ3A 4XUCA 4YRBA 4K3VA 4AI6A 5A3SA 3UNXA 2IS1A 2HR1A 4IQGA 3NGMA 5BO5A 2ECOA 3FE2A 3K9GA 2BF7A 2Z8XA 2G06A 1QTNA 1KQFA 2H1FA 4O3FA 2W7TA 5KOJA 2W6QA 3D64A 1ULHA 4R9RA 2DKOA 3BXHA 4N65A 1TT5B 4R69A 3AIKA 2IP1A 4RTKA 1SG0A 1P2FA 3EEOA 3L7DA 4DWVA 1PV2A 1ZEMA 3JYLA 2Z5LA 3PUZA 4LF4B 5UKDA 1KERA 4CKCA 2PGDA 1L7RA 2C5GA 2EWMA 1F4VA 2HD4A 4CODB 3COSA 1W0KA 2N46A 3K0KA 1G7RA 1JU3A 1ZH6A 2NU6A 1VG0B 3T34A 4FOTA 3GRPA 4WQMA 2PZAA 1AHPA 2CY0A 1QP0A 2HMWA 2R00A 3KKLA 2P6OA 1P7ZA 3BAZA 3HDGA 2CLOB 1WUHS 3E6AA 4I66A 4LXQA 4Y0NA 5EJFA 5AVKA 4C0HA 2I1WA 2ZYAA 4P4SA 1SRQA 5DM2A 4HQFA 2JLBA 2ZFUA 1ZD4A 4IDPA 4FFBB 4U00A 4WRRA 3ORSA 5T5QA 5HOEA 1IOZA 3MVEA 1RI1A 3WRYC 4C7OA 1KO4A 3CUVA 4J03A 3E8SA 3TW6A 1YTLA 4DSAA 1UZNA 5FCDA 1L3IA 2HNAA 1E77A 3ECCA 4MV6A 3E1KA 4HGNA 1V5IA 3GFQA 1DXQA 1IPFA 1H3FA 3RU7A 5H82A 1QNLA 4MSUA 4OFWA 2MR5A 2PV7A 1C1YA 2ZJ4A 3QF7A 3N2EA 3PGA1 2OXTA 1FMTA 1JB1A 1FP1D 4RM2A 1LDBA 1Z16A 2HNBA 2ZIZA 3L4SO 2XB4A 4JHLA 1TDJA 1E5DA 1K7XB 1R7RA 1ZD2P 3FF4A 4J4TA 4M83A 1J2YA 4QO7A 3NIWA 2BSQA 2JH3A 1QHXA 1QCDA 1P9NA 2FEOA 1Q57A 3IEUA 4PZPA 4RQTA 4X93A 3STWA 4MRVA 4CM8B 3BL8A 3JSAA 4NFLA 4P22A 4EUNA 1UDCA 1VHJA 1WWKA 4RGVA 4OKSA 4ZVNA 2CE2X 2PMDA 2DBRA 4J0HA 4DRYA 5JAOA 5LIPA 1T6NA 4M99A 1E7SA 5JU6A 4JBLA 1F4PA 3RVNA 2ZQYA 1X2EA 2R60A 3AJDA 1OB5A 3BFPA 1R0LA 2G82A 2ZRFA 3KDSE 5TS2A 2VAVA 1GDDA 1E60A 4C4XA 1H93A 2ZIXB 2NLOA 3E4DA 3M5WA 2GXSA 3VHLB 2WFLA 2PT9A 2YZ2A 1IXZA 1XRMA 2J6CA 4EW2A 1H42A 1VE7A 3RUIA 4H1TA 4R1OA 1OZHA 4RIFA 3TIVA 4GPBA 3NDPA 3DQZA 5DYGA 2X9QA 3U7IA 3KLMX 1I80A 4YQZA 4Y8VA 2GBPA 3IEPA 4ZK2A 2IS2A 4Y2HA 2HRQA 1O95D 5CVDA 1KVQA 2A84A 2JGKA 3R74A 3ZV3A 3U5TA 1JQ3A 4V0RA 4QGGA 4CL0A 1T9DA 4BPBA 1Z68A 2OLJA 1VXOA 5GJWC 4C4SA 3IEIA 3BBPA 3K5IA 5EJ6A 2CVFA 3K5HA 1JR3E 2FNAA 4Y1EA 4M0KA 2ZRMA 2NTJA 4KDRA 4UE6A 4WMLA 5FOUA 3UGTA 2CMKA 1FFXA 1OH6A 1OLSA 4MJXA 2HDWA 1CYEA 2JBHA 4JC5A 2IUTA 4BMYA 5KQRA 3GZNA 3DXYA 2GF0A 1VLVA 3ZY5A 2PX5A 4A10A 3IEKA 2FTKE 4MIYA 3F8WA 1BVYF 2EARA 3RUPA 5KQSA 2ZATA 2VRWA 2RKOA 5IJ9B 1W75A 2QGNA 1II8A 4GL4A 5AW0A 2FPIA 4GUDA 2P8SA 4R1MA 5LU9A 4JLNA 2G9RA 3SSMA 4IKOA 1XRNA 1Y1PA 1NZFA 2WWIA 1BDBA 4DQUA 5LDDC 1HNWB 1MOPA 1KEVA 2QT9A 2IELA 2Q0XA 1FFGA 4BMOB 2XYHA 2JBWA 1RU3A 4ZTZB 4QXMA 1WEKA 3SXUA 3T3EA 5AVOA 3FNIA 4EDHA 2DQYA 3LECA 3PI7A 4W4TA 1IUOA 5DCLA 3ZNOA 5K20A 5A9SB 1EK6A 1OPRA 1OXSC 4RVSA 3DEFA 5EI5A 4BNXA 4R0VA 2G9QA 5ED0A 3JATB 1APBA 2YUTA 4HMQA 1WM1A 5TEWA 3VYUB 3E3LA 4BFVA 2H3HA 1M2OA 3MMXA 4LF9B 3AWIA 4KMMA 1NU6A 2IV2X 1ZY2A 3CUTA 4JS0A 3LUBA 5AOBA 2O8BA 3GUYA 4GEGA 4CKYA 2AR7A 3LUKA 2XA1A 3SC2B 5H9VA 4Z1OA 1T9KA 1FMCA 3EOBI 3R7AA 4JNCA 2HZ7A 4LKRA 5HFJA 3DOOA 4MW7A 1ZMBA 4YUZA 4JJEA 3AYZB 3KJQA 2Q5LA 2I2FA 4LG1A 4FYMA 2YN0A 3P8ZA 4GLLA 3M49A 1J8DA 1NGSA 4BWVA 3W3ZB 5DP2A 4F93B 4DR2B 2BRUC 3NETA 1A2KC 1XWIA 1P33A 3ZLJA 4K6KA 3KZ1E 5HA5A 3AF1A 3H11B 1Y48E 2ZIFA 3IBCA 3O4HA 1DINA 1Z6GA 2JJ2D 3SK0A 1WOYA 2PA3A 1X6VA 3EG5A 5K6TA 5KNCA 1XK7A 2VAMA 4JZYA 1JIKA 1Y42X 3FYCA 4LVUA 3C5CA 3UKDA 3LT1A 1HDZA 4Q05A 2NU8B 3SIWA 2RD2A 4TZ0A 5HM8A 4I1YA 4MQEA 1X7WA 5KOHB 2OQIA 1KAQA 3Q2OA 4CKBA 1ISFA 1SXPA 1NF3A 5K0FA 4BMCA 4U2CA 4CEIA 1NV9A 2CWWA 3M70A 3OBBA 1JLLB 2FRDC 2INGX 5IASA 2KE5A 2XH8A 1R5NA 2ACVA 2LGJA 2P11A 4YRGA 4F85A 1GL7A 1KJZA 2QUIA 2CHEA 4A23A 1DWUA 1TYAE 3OQHA 4N03A 3WWYA 1EGVB 1XAGA 3QW2A 4K88A 5I4KA 3DYIA 5JXHA 4NCAA 1ZGCA 1E79A 2FU5C 4LJ9A 4RH3A 3VYWA 5BVGA 1TT5A 5I7RA 1CQZA 3EZ9A 1I3LA 4LRWA 4W7HA 5C5CA 4DQVA 4AJ2A 3CZ4A 1JLHA 1IBRA 3U5ZB 5JXGA 3O8OA 3VVLA 4XTRA 3STTA 4ZTUB 1TCUA 3QPDA 2G36A 2OR3A 4C9BA 2REXB 1NDUA 5JADA 4CDNA 4YMUA 3UK2A 5CG2A 3JQGB 1Q1QA 1QB8A 2OBYA 3R3YA 4LJYA 4LOAA 5BMVF 2Z4RA 3H2YA 5JRDS 3DLBA 2JK1A 1QUFA 3RM3A 1NPDA 2UXBB 4QBTA 2YHSA 4HB4A 4M1MA 2FA9A 3KBOA 4LRYA 5AOCA 5FPHA 3WMXA 1NUPA 3MSXA 5LQDA 4MW2A 1SAYA 3R6TA 2QRLA 1UL1X 3AV3A 2G7ZA 3T3GA 4AROA 1FRZA 3EBLA 4KQHA 1XR3A 4FFBA 4JEHA 2CJYA 5G41A 1ECPA 4E51A 1YJXA 4ENWA 1BJRE 2CJWA 2FI1A 2HV8A 5JMPA 3GEGA 5TT0A 3DTYA 3L18A 3VYVA 2I80A 1XRSB 2XWSA 3GLTA 4NVRA 4RFLA 5CDFE 5B36A 3AUJB 3IURA 3PB3A 4FHCA 2FE1A 2QF7A 1BSVA 3A2KA 4PEVA 3D0KA 1U7WA 3JPWA 2C99A 4B6SA 5CPBA 2XZLA 1YR2A 3BSFA 5FI5A 3V3KA 4PO1A 1Y81A 3K0BA 4RTJA 2RHLA 3VR5D 3OX3A 4AL4A 1EFLA 4KAFA 2I03A 2DFPA 2N1MA 4AY4A 1MOQA 1JP7A 1UQUA 5AD1A 3H17A 2B30A 2C59A 4LZLA 1XN1A 1YE8A 2OESA 4MQMA 3D3WB 2AQHA 3RAJA 2AIRA 1M6NA 2QP4A 4CM8A 2QQFA 1E3SA 1PS8A 4MV9A 1EP2B 4ESEA 5IXSA 4JODA 3TIFA 1VHLA 4IIHA 5FDFA 1P80A 2JLSA 4E6EA 1WMSA 1F60A 1P77A 2XUIA 2ZBGA 4KSCA 4RBNA 1PHRA 4JZKA 4MMYB 5LQMA 1RC0A 2I3ZA 3ITNA 3IULA 5DMXA 2PDAA 3UGQA 2GPSA 4RGYA 4BCDA 1NJSA 5K3BA 1IMOA 4HTFB 1AG9A 3ME5A 4NZOA 3DEIA 4RF3A 3OM0A 4I5DA 4Q3EA 2V54A 3MJHA 3NHLA 1R10A 1Z73A 3AEXA 3TL3A 4BNZA 2WIDA 4O4IB 3UWKA 2JCBA 2FOIA 3GNLA 1KPHA 5C5EA 1E2EA 2YWCA 3K4PA 1X1SA 4AKTA 2FW8A 3BBLA 1ODLA 1OWLA 1C80A 2GZSA 1S02A 2OZLB 4HPXB 4BYGA 1FYWA 4GIBA 5B1SA 3ZZMA 1NJ2A 1OJ7A 1W1UA 2UZAA 3QYFA 1AHHA 1L9KA 4KBFA 1ONNA 3HMKA 3N7TA 4PPNA 1V1RB 4CHTA 1SNYA 3ONFA 4DB4A 4X61A 3AR5A 4LDNA 3ZI7A 2VSXA 2Z2ZA 4OP1A 2W22A 3PQ4A 3A14A 2EWVA 3TTWA 2AEMA 2V7PA 2ZUSA 3UB2A 2P2NA 1Q22A 3BXGA 5DSXA 1IFXA 1R5JA 1XLUA 2QTAA 2ZLBA 4DVGA 1KGDA 2NO4A 4QKQA 2IH4A 3SHOA 5HJ7A 2HF7A 2AMJA 3KTAB 4YMLA 4QLAA 4DM7A 1SA0B 4YBRA 4KLAA 4HLQB 4B47A 3RHTA 1UINA 5AKLA 4J49A 2ZULA 5ALNA 3EWNA 4J8PA 2DYKA 4KZKA 3ABZA 1UAGA 1TJ5A 3LUPA 4GP6A 4MPDA 4AW9A 5JZVA 1QU2A 3MBIA 1FFYA 1HDYA 3Q41A 2G7MC 1AS2A 4NRDA 3WK4A 4GMXA 4G5XA 4A0RA 1B0AA 2HLDA 2OHIA 4H6WA 3QG1A 5IJ9A 3QHAA 3Q72A 5B4VA 3T1YB 1BZYA 3NPMA 5CJPA 1PL6A 3RVDA 4FVTA 1P1IA 4F7DA 3I42A 3U80A 3VNBA 1CUZA 2R4QA 2P6PA 4JC4A 5BSRA 2JJQA 2YJTD 3PJGA 2PL1A 2GXQA 5KVSA 4Q6BA 4KO2S 4H4EA 4RVDA 1Z4JA 3TVYA 3BK2A 2B4KA 2NZYA 3AQ4A 3EWIA 3KZXA 1TLTA 4I8XA 4G3XA 4RO0A 5LZ5A 3P19A 5A9SA 3MB8A 2X9LA 4PM4A 2ZKIA 4FFDA 3IFSA 1CULC 4N5LA 4JBGA 2DT5A 4V0LA 2BWJA 4YUAA 5KWJA 3JATA 5AJWA 2H9IA 4ME6A 2YMPA 3DOIA 6Q21A 1JSXA 4IX1A 1B23P 5IZCC 3VJLA 3NBZC 2FZ4A 1U1CA 3WZ2A 5CUQA 3D5TA 5EZYF 5BQPA 3DF9A 2NWQA 4I36A 3RARA 3WGYA 2YKGA 2PZMA 4I50B 4FE3A 3DVSX 3GJ3A 2D1RA 4ROTA 1FB5A 1I01A 4Y6PA 1TTHA 1YZYA 3SC2A 2QX6A 2IHUA 1KPIA 1L5SA 3MAAC 3WTBA 1A76A 2IY9A 2ZIAA 2NIPA 3AFIA 4KE8A 4UULA 4WW0A 1H8HD 4BFYA 2QBYB 2CNLA 1BMTA 1CJSA 4EGQA 4MVJD 3DZKA 3ZGNA 5TQJA 1QFMA 2MSKA 3KO8A 3OIUA 4FHZA 4CDRA 1R6TA 1SRRA 4QSMA 1JR3A 2CNNA 1ZONA 4LQLA 4P93A 4RW0A 4ZQEA 2EP5A 3H11A 4ZOLF 4OHVA 3IJEB 4EO7A 2QIOA 4MAMA 4YMGA 1K0FA 1QR6A 3HI6A 2I2DA 5AJVB 3GJSA 5KTSA 4V24A 5BOVA 1J22A 1NC3A 2B2XA 1XKQA 4RELA 2VNKA 2DFKB 3W90A 5KVVA 5KYXB 2BONA 5FUBA 4KXQA 1ZX1A 1GYRA 2Y77A 2J48A 3AKEA 4G07A 5JNRA 1CQIB 4X45A 1R0WA 3GP5A 3K09C 1E4OA 1UEJA 1JLLA 2NXNA 4LSWA 4Y2QA 5I9BA 1J90A 1QGOA 3C39A 4F3CA 5LSAA 3PEFA 3WNDA 2GFQA 4MXDA 3VTFA 2A5DA 1P2TA 1UJ2A 3F3SA 3TDMA 1WZUA 3EPHA 4EGFA 2P9ZA 2XCUA 3UXYA 4OYHA 1BHO1 3ZCRA 4FDTA 2R62A 3X2SA 2Z5FA 3ETGA 2IIQA 1ZCFA 4D8UA 1XLTC 1XZEA 3SM3A 1XA0A 2MYNA 4M8LA 2J5KA 1H2HA 4YMIA 3UAXA 1GLGA 4YT4A 5HKKD 2OB1A 4O4LB 2EWWA 2ZROA 4PNEA 1XMOB 4GX0A 5C4IA 4TYMA 7ABPA 1X38A 5T7BA 2ZCJA 3NHMA 2IDMA 1U8UA 3MJDA 4L02A 1NBMD 3JQGA 6PFKA 3BA6A 3HCAA 4MRNA 4RXTA 1ECFA 3ILHA 3HEAA 1WKVA 4JI1B 4DZZA 4NH0A 4UPEA 1ZBDA 4D6PA 4BZPA 2ST1A 1KY4A 2HIGA 3LDHA 2NU7B 1YACA 3KSMA 1X15A 4IILA 3KJIA 2QQ0A 1JDUA 3RVQA 2WE7A 3AX6A 2MSCB 1HEIA 1S8OA 2WTMA 1KVSA 3JQFC 3O90A 4YACA 5IM4F 3NJRA 2DCMA 4L9RA 4Q4LA 2DH6A 1P5JA 4V02A 3CF0A 5SZHB 4I4NA 4NCIA 4TMFA 1GAWA 4YMSA 2VPTA 3L3BA 3OCWA 3WBBA 3BH6A 2VBIA 5JISA 2YRWA 1QGED 2R87A 1Q17A 1T5HX 5F23A 4M0FA 1G98A 2EZ4A 2D7CA 2XSZD 4EPTA 2F90A 4Q3OA 2R8BA 1UBCA 3LTNC 3DV9A 4RMIA 1M2FA 4PSUA 2AJCA 2HQ1A 1N8SA 3KEQA 4DEYA 2F4VB 3B1WA 1SZCA 3GT7A 4HLNA 2ZWAA 1R0ZA 2C5FA 2IE0A 1YR7A 2VXOA 1IY0A 3VSAA 1NW6A 4RXMA 5B57C 4ND8A 1ODFA 1CUBA 4G65A 4Z9YA 5BUZA 1VGVA 3H1PA 4UMEA 3D3WA 4F4FA 1PNRA 2ZUFA 1FDTA 1YR1A 4MP8A 5FFFA 3ZNNA 3HUEA 2VAWA 4XW2A 1TQHA 4KQJA 1CDZA 4MYUA 2FPUA 3L7CA 1NSYA 4MS1B 3NHBA 3RVBA 3RVJA 1B3RA 1CY7A 4JMLA 4UM9D 3TJMA 5GVRA 4YJ2B 3WRVA 1YZQA 1Y6GA 1TK2A 4A1OA 5FWXB 4R40A 3CRQA 1YDHA 4QQRA 5JPDA 2H1WA 1RP1A 1ZMOA 2GTPA 3KKMA 3VHXB 4EO4A 5TB5A 2J9GA 5GIOE 3D43A 5ELLA 2PX2A 1P3JA 3GA5A 4NS4A 1E3DA 1ZH2A 2YMMA 3M83A 4NJEB 1QZUA 1G8KA 1M7HA 1AJEA 4WL0A 4IVRA 4O4IA 1TXGA 5DBHX 1YS7A 3KUUA 4JL5A 3ZE0B 1LLUA 2P4EA 4HFNA 3B1VA 4AO6A 2OZLA 1FNSA 1KP3A 1GPJA 1XTQA 3D5QA 3ELWA 3R1IA 1IRXA 4JI2B 5CA1B 1N1DA 1P62B 4FONA 4GI5A 4MVJG 3G9XA 5FQNA 1V1RA 2QUBA 2WDZA 5BQOA 5DWDA 3ENKA 4Q37A 2GEDA 2C9OA 1T1RA 3C3AA 2F62A 1XEAA 5C34B 3F4LA 4G4IA 4PYJA 4FPXA 4BQRA 3RODA 2W6ZA 4NS1A 3UCXA 2QLTA 2ONCA 4PWZA 4WAUA 3L0YA 3U3RA 3U7EB 3L8FA 4C43A 2NAFA 5BN3B 2ON6A 3QLVA 3OX1A 3ORHA 5HE9A 3IB6A 1EJ2A 1SA0A 3CLTC 1ODSA 4Y1GA 5JHHB 4IO1A 3EPKA 2I5PO 1YXMA 2J87A 2RGCA 3HJBA 3ZJ5A 3NOQA 2XKAA 3U62A 3WYGA 2R65A 2WYVA 5CVJA 1N6KA 3Q88A 1LJUA 3AFMA 3BG5A 4L5AA 1RKUA 5AIAA 3WSVA 4PG6A 4O3MA 4L08A 5AQ1A 5KNBD 1QP8A 1WXIA 1Y89A 3A05A 3PQ3A 2NOAA 1E1CB 3M1IA 1O0CA 3GDWA 3G2HA 3THWA 2JLQA 5EHZA 3DWGA 4BMPB 4P7KA 5JXJA 2VP4A 5DN6D 5F7OA 3W5HA 1QQAA 1JPNA 3TQQA 2CXHA 1E6CA 3B7PA 3GJYA 1E1LA 4L27A 4D3FA 1JDZA 1PU2A 2CL5A 3KYJB 1EQUA 1XJQA 3PJDA 5JIBA 4MW0A 5K0ZA 4RVCA 4AD8A 3CVJA 3DL7A 1XZDA 2A7QA 1PR4A 3DKVA 3EXEB 4Y2UA 3VNVA 1Z5GA 1BN7A 3ZWAA 4FYXA 1UQRA 1TL7C 1CKEA 4LPKA 4RIGA 3H5WA 4JP8A 1DSSG 2ORVA 4WI1A 2QTMA 4JKIA 3U56A 2R6CA 3D7NA 4EG4A 1NL3A 4CCSA 4X1IB 4EPYA 4NEGA 5T64A 1ST2A 1WP9A 2V7XA 3W5SA 4ZI2A 3QUQA 4EI9A 4C4PA 3D4BA 5EE9A 4RANA 2K2WA 1KP9A 1PJ4A 1K7YA 4I50A 1QWOA 1TTQB 2DHCA 4DFDA 4IRXA 1U5CA 3ZU5A 1N7HA 3ECAA 4XDGA 5LZ8A 1U99A 1OFUX 3G9ZA 4C3OB 3SQWA 2QBYA 4X62B 2VBCA 4XCXA 3DV0A 5LXTB 3LX4A 3RTEA 3B13B 3LXUX 3PUVA 4AZWA 3T15A 2BAGA 2X5XA 3HCRA 3IAUA 4DF3A 3EC7A 3HU2A 1VMIA 4DLNA 1RWBA 5LP1A 2GBGA 3A70A 4LYJA 4GRIA 2NX2A 2ZIUB 3H2HA 5ECGC 2GNAA 3K20A 3Q3IA 3B6IA 2I3BA 4PN3A 5P21A 9LDBA 3WBKA 1ORHA 1ZGZA 4C4OA 4F2WA 4A27A 4B6QA 3ROKA 2ZE5A 2Q2VA 3FWYA 4R51A 4RMGA 5KYXA 4HMPA 1EWQA 2ZAOA 2PH7A 3R5KA 3ROXA 2GWRA 1HR0B 4IHAA 1SZPA 1ZVJA 1SG6A 2IHZA 4I3HA 4UQOA 5D51S 2O23A 3ESZA 3RAGA 2QTZA 2XHZA 3LP6A 4UD6A 1NQTA 1GZ5A 4HOYA 1ZM2A 3OMLA 2OMEA 3U19A 3WQSB 1ESDA 1WLYA 3LFUA 1P5FA 4RQAA 1A9SA 3ILXA 3K4HA 3IDFA 4PGHA 1RAEA 1A8SA 1L4EA 4G36A 4DMRA 3BXXA 5DGTA 2AFVA 3ABOB 3RW9A 4EPVA 2C9DA 1KJ8A 2CN1A 2CXQA 3CURA 4P98A 2BKAA 3OOSA 4GC5A 2UZIR 3V32A 2GAIA 2IOFA 4J6EA 3HJHA 4M8SA 1LZKA 3RF6A 1I9CA 4P38A 4BX3A 3L92A 4BV8A 3A1UA 3BE8A 2YV3A 4UNQA 4EK9A 3O4VA 4M36A 3PGJA 3A6EA 1B2LA 3LUHA 4IDGA 1SK8A 1XKXA 4JASB 4EFMA 2XA2A 5LN1A 1QYWA 2RHWA 4XTCS 2CT8A 1WX1A 1VYUA 1TPZA 2WEKA 4TSFA 2WD9A 4RK1A 2A86A 1KYIA 2NU7A 2B1RA 5IYZF 3SZRA 3B20A 1MAWA 3VNQA 1UFVA 2HSWA 1YZ3A 3KALA 1R8QA 4O29A 5IU6A 4J0IA 2G9ZA 2RI1A 5EJ4A 4JUIA 1DWOA 5FOVA 3ZJVA 3KYIB 1X1AA 1KYVA 3TG8A 1RHJA 3TVTA 4QD3A 1CB0A 4AXBA 4JOQA 4AX8A 1WKCA 2ACKA 2P5SA 1A4RA 3SLRA 3VH3A 4NZ9A 1NSFA 1RLMA 4NCKA 1XLWA 4AN0A 5DT2A 4DR3B 3DDWA 1Q19A 1VKHA 2VDLB 1IXSB 3O1HB 4YTEA 5A5EA 1JWAB 3A2NA 4CBVA 4DIDA 5TMEA 4QM7A 2O5RA 1DX6A 3U7HB 2Q3HA 2NUPB 3CR3C 1O9HA 3UUWA 2D13A 4F45A 1T0IA 2WQ6A 1DHRA 1DVRA 2X77A 2YRXA 3LT4A 2VZ8A 4KK3A 1J0EA 1ZITA 1JNYA 2AG6A 5DCUA 1VSQA 1P5ZB 2GHTA 4CV1A 1CC1S 1SQ5A 3P2IA 2O2GA 4RSMA 3PNBA 1BHQ1 2R86A 2ODWA 3VO2A 3IBTA 4Y6OA 3KRTA 4FHDA 1TUEA 4MS1A 4ZOBA 4EJ0A 3RUCA 3CS3A 4H1WA 5HZKA 3M6IA 2QU8A 4JA2A 3UJ9A 5IEJA 4AT1A 5FWXA 1P75A 5A9TA 3TOSA 4LOJA 2CNWA 4IZOA 3VHXA 2QUKA 4NCJA 1EQ2A 4LVCA 4MGIR 2QT0A 4H16A 4WERA 3TLYA 2I3DA 3A3YA 4NJEA 5AW8A 3EFEA 5I45A 1SVKA 1F1BA 4I1OA 1IONA 1PR6A 4H08A 4TM7A 4KH0A 1SBTA 3ZZ1A 3D8NA 2R8ZA 5E2BA 3MK31 4CLXA 5JV5A 1OX6A 3LUDA 5K51A 4CCWA 2IYOA 1KIFA 4MGZR 4TLBA 1WPQA 3DPUA 4PG8A 1SUWA 4XYMA 1L7OA 1QRTA 2Y76A 1CF2O 4HATA 2XMGA 2X2FA 2Q5QA 1Y4UA 1Q0SA 4AYWA 3IA7A 3FB4A 5CAEA 1P7WA 2V7GA 4X84A 3TLCA 1W36B 1TA0A 4ZAZA 3RTBA 2VT6A 3KZNA 2IYVA 4UZFA 3RUHA 4XGKA 4PZAA 1MG0A 4EX7A 2O7SA 2AFHE 3OMXA 4HYYA 5K2MA 4QXAA 1ZYUA 4DREA 2PSJA 3WZMA 1DIOB 2RHJA 3IUBA 4DVJA 2Y2VA 2DHQA 1M2NA 4HLUC 1KZGB 3V1NA 1V71A 4KAJA 1ODIA 2C5EA 1EDZA 2G80A 1D0VA 1JHAA 3HBAA 4HDSB 4OD0A 5EQJB 5FWDA 4BNIA 4BO2A 3RT7A 2V5AA 4K9MA 2OAP1 2R751 4EENA 1M1NB 4EJSC 4I3GA 1J06A 3OU2A 4R1QA 3VZSA 3H1AA 4NE2A 1MMFB 4EZEA 3OPVA 5A5GA 5E7QA 1Z4PX 2XDAA 4EY8A 5I9LA 2WOJA 1WW8A 2YMLA 4DDKA 2GZDA 2ZI7A 3EW9A 5F64A 4AIIA 4XYEA 4BBZA 2FQQA 5KCZA 1WQ1R 2EFCB 4TWAA 3NDRA 1JKMA 3C3YA 4HI0E 5AHWA 5ILGA 3NDBB 1NW8A 2OCAA 2XADA 3E9EA 1TI7A 2M6RA 3IV7A 5F3WB 2W2MA 4CIXA 3WOHA 1PSDA 5CYFA 1VRVA 2P0EA 3UW3A 1U9CA 4R54A 3EXEA 4ZCPA 4M76B 2FZ5A 3OE5A 5JAUA 4KR6A 4KPUB 1CEQA 4N7MA 4CM1A 3SVZA 1FJGB 2DPMA 1NA5A 3G02A 1SU7A 2WKSA 4OXNA 1KQNA 3VU1A 3GA7A 3K71B 1GSAA 1EBUA 3FOCA 4I6EA 1IVNA 3WR5A 4J16A 3SHTA 1BYIA 3GMIA 4DUYB 1V1MB 1EFAA 2B6NA 4KFRA 1QVRA 1Q11A 2HB6A 1GWNA 2JJYA 4Q3NA 4E08A 1ZM7A 2WD7A 1J5EB 3B6ZA 4RZSA 1MZPA 2QR3A 2VUIB 3I64A 4XRGA 3N0WA 2QVLA 4P86A 2H57A 3VXKA 3KAKA 3ZK7A 1K3UB 5HNKA 2RHGB 4LC9A 1WCYA 4Z3DA 2JFWA 4L4ZA 4QYTA 5LXTA 3HB1A 4WKPA 4A91A 2Q1WA 4ZZ1A 5CIYA 2CFIA 3A6JA 3VPCA 2P4QA 1KA9H 4HQKA 3L6RA 4KU4A 1IOWA 4JHXA 2YBDA 5FOTA 5LFAA 5ALXA 5FNVA 3EEBA 4ARZB 5CCDA 1QM5A 4R6WA 4B0OA 1EMDA 2AFHB 4JT4A 3PDCA 4BVBA 3ZJ4A 1EUCB 4N39A 4QPZA 3QWFA 2WPDA 4O2AA 1KK3A 3LA8A 1X74A 3N1UA 1Z5UA 4FDVA 4ZD6A 4EYKA 3LVFO 4F6LA 1XHEA 1XXLA 3N5CA 3G7NA 4FI3C 2CC2A 2NO9A 2FN9A 1USGA 1BNCA 1FPMA 2X7XA 1NHWA 5D5PA 4WY2A 1V25A 2F8SA 1UEIA 4MS4A 2JIDA 1AKRA 3VSCA 3VX3A 1XK6A 4NXNB 2B21A 4U1RA 4JJAA 2P41A 3EBOA 5CX4A 1W76A 2AZ4A 5AMXA 1E94E 1RYYA 5B6PA 3G79A 4S3MA 3THRA 3CU5A 1FTQA 1Q1ZA 2CDAA 2HK6A 2QEQA 1RRMA 2OFPA 3LLVA 1JQKA 4MLDA 5HDQA 2VJQA 1N6HA 2IBMA 3FGNA 3N39C 4X91A 5JAIA 3TW0A 5U4XA 1M67A 1MHPA 2AC7A 1ZN7A 3ND8A 3WLIA 3PGVA 1QV6A 1D04A 4UDXX 3SSOA 1KJQA 3TZLA 3VBCA 4DKJA 2ZOSA 4D6XA 5BPFA 5D3MB 4G0WA 1IAQA 3DMDA 2YIMA 2NZ8A 5JQGB 1R0RE 2BEJA 2YV1A 1NG1A 2Q4DA 1JG7A 1PJ2A 3CLRC 3QXHA 1RKQA 4Q18A 3U39A 3ULKA 1TYZA 2I4IA 2WFAA 2ZB3A 2ZRGA 4INZA 2ZITA 3BSSA 4WBSA 4KBGA 1GZ4A 2II6A 2ZSEA 4LYGA 1B76A 1EUYA 4YY3B 4AJ9A 1ES9A 4KL8S 4B3XA 4WK2B 1WQ3A