4HATA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hatA00
2V3CC 1Z6XA 3W8NA 1EFUA 5E7IA 3WMFA 4A82A 1S3SA 4OHYA 2ZYVX 3WNBA 4EJSA 3RS0A 2IYZA 4V03A 3E2IA 4JBXA 1C4OA 4IKEA 2QMEA 2QP4A 1SXJD 5IHPA 2WIAA 3AVVA 1Q1BA 1E0KA 4HLDA 4Q4HA 3MSXA 3LO5A 5KDDA 3Q7PA 4OQMA 1S4QA 4Q03A 2PX0A 3WYFA 3K53A 5JECA 3A8TA 4Z8XA 1W7AA 1T5LA 3OF5A 1BMFA 4MQBA 4MDEA 1Z6YA 1OLOA 4AYXA 4F7WA 2C9OA 3U7FB 2WVJA 3IIKA 2G1JA 4M1TA 2OFXA 3BGWA 4B74A 3K70C 3DDCA 5H8WA 1Q22A 3VR2A 2BEJA 4H1VA 4W5JA 3WYGA 1UDWA 2Z43A 3BH0A 3ZZ0A 3RRZA 1JXOA 3KL4A 1EXMA 1OIXA 3KFVA 2YOHA 4TYQA 5ANRB 4TMTA 1RIFA 2XTMA 5FOUA 2F1IA 1NNEA 4M1OA 4PSVA 4D0LB 1VIYA 1IXRC 4KJZA 1YHNA 2VSXA 3ZLJA 2BWJA 3NH6A 3IHLA 2VF7A 1KYIA 1E9RA 1DARA 2IYQA 1IY1A 4H1UA 2BBSA 3LW7A 3LQQA 4RD2A 4Y0AA 4B47A 1OH5A 3AVWA 3LFUA 3OZXA 5JCPA 4DLSA 2Q6TA 2A3RA 3IQXA 3Q3JB 4OHZA 2QPOA 1JR3E 3QPWA 1E98A 4GI7A 3W8RA 1VG8A 4DCSA 1CR1A 2ZRCA 4KCGA 3U7HB 5CJ2A 3ZJYA 4FCTA 1DO2A 3BERA 1MRSA 3T1TA 3Q5EA 1RRFA 1P9WA 1W46A 1TQ2A 4FMDB 1UKYA 1E9FA 1YZLA 1DAMA 2BJWA 4EPWA 4WA7A 1R0XA 1KO7A 1S0UA 1BYIA 4UJ5A 1N6IA 3T61A 2NZJA 3NKVA 3E1SA 3QQ5A 2YWGA 1U2RA 4IVPA 3U3OA 3P32A 5HTKA 4Q7JB 3FWYA 1E99A 1WE2A 5AJYA 3SFVA 2R65A 4QGGA 1NF3A 2O8FA 2JLUA 5DO9A 5SZIA 3SQWA 1KSFX 2HCJB 4RCYA 3QF4B 2DPXA 2QE7D 4C7OB 4TT3D 2IHYA 3CBQA 5HCNA 3TQFA 3V9PA 1KY3A 3B78A 5CITA 4XVQA 5E4FA 1NL3A 4MYTA 4Q4AB 4ARZA 1GTVA 3UWKA 2DFKB 5JJKA 3TVDA 4B3CA 2A78A 1II8A 3DOEA 1JPNA 5A0FA 4JLBA 5TARA 2IXEA 4KYUA 4CEJA 5B64A 4NONA 1OFTA 3REGA 1F3OA 2PEZA 4Q1AA 1Z47A 4WXRA 1VKJA 3VX4A 3NBZC 2CL6X 2FJUA 2OLKA 2Q21A 1N5LA 2A5JA 4G3XA 4DEYA 1SXJB 1XJQA 3A1UA 3CNOA 2GEVA 2QEQA 2H8KA 1P7CA 1V5WA 1OFIA 1KAGA 2WICA 4IVQA 4AIIA 1CS4C 4EJSC 1W4BA 4BLSA 3LBNA 1NLZA 4L4UA 3SBDA 5A4JA 1TQ4A 3AKDA 4DB4A 3GJ6A 2ZVQX 4U7DA 1E2KA 3HU3A 1HURA 4TMZA 3EC2A 3THXB 1OXUA 5EUQB 2V8OA 2N1BA 4OHWA 3T1OA 4A2QA 3SI7A 1WBDA 5HKKD 2RGNC 3OIVA 2GAOA 3CPJB 1I4TD 3WMGA 4NP6A 1NP6A 4G5SA 4JLVA 2VRWA 1CLUA 3ZVLA 2G0NA 1QHIA 3E5HA 1KIMA 1LVGA 5DSZA 5J4YA 2J7PD 5EZ6B 3GLGB 2R6GA 3MG9A 3K09A 2C99A 2GJ9A 1N5IA 4R9UC 5KNDA 4HATA 3NXSA 3SDZA 2GNOA 4KV9A 1ZM4A 4YDHB 1GM5A 3NC1C 4QNRA 4V0OA 4C0KA 2YNMA 2OM2A 3LXRA 3CH5A 3DZDA 3R9IA 3ICQB 1ZU4A 1O87A 2GCOB 1KDOA 1YZNA 3UIEA 1S96A 4MKIA 2PZGA 4JLKA 4FMDF 4ZDWA 3ZS8A 2HYIC 1Z07A 2GEUA 4TMWA 1CULC 5EXXA 1N6HA 2CNWD 5J40A 4UNQA 3GFTA 4JLAA 2DR3A 2QI9C 5B58C 1FZQA 3FTQA 2ZE5A 4D4LA 4JVMA 1RE0A 1OH6A 1Q1EA 4B32A 1GDDA 1HTWA 1AS2A 4KXFB 3HU2A 4ZDIA 5C2JB 4D25A 2GK7A 4RSGA 3O8BA 4BUJA 4DT1B 3I8SA 3IO5A 2ZQ5A 4IFBA 4LC1A 4Q21A 4RFSA 1Z6AA 3CKLA 4HAXA 4TQ9A 3TSWA 4URUR 1AN0A 2P65A 3K0EA 3WBKA 2IS2A 3DEFA 3X1XA 2WWXA 4K81B 2WV9A 2REBA 4RZ3A 3CRQA 4DLTA 4LOAA 5C1BA 3C41J 2VA8A 4A15A 2RGCA 2O8CB 2AWOA 1DADA 2VPPA 3LBIA 1C9KA 1JR6A 3GD7A 1KI2A 1OIVA 3EC1A 2FE4A 3OE7A 4JVSB 5CIWA 4OKSA 4JL8A 3AUYA 3MCAA 1QDEA 2XZLA 4JLOA 4LV5B 3L0SA 4YDSA 3EWSA 2ZRIA 3KX2A 3PEUA 1T3LA 3RYTC 3OIUA 4BFZA 5KDOA 3A36A 1ZRHA 3CRMA 2GRJA 3PXGA 3O8CA 2EW1A 4ZCIA 3KQNA 3TE6A 1RJ9B 1N6PA 4TTRA 2HV8A 2EWVA 2X1VA 1KK1A 3CRRA 4NBSA 2QPTA 3DO6A 1DAGA 3P26A 5DHFA 3SEAA 3SR0A 5KHOC 3KKQA 4IEIA 3RS2A 1RW4A 4DXAA 1E9BA 1WMSA 4JLPA 5CLLA 1RVDA 4GT1A 4KYIB 1KJZA 3BFXA 4W5WA 3SJAA 4LUCA 4BRWA 1KK3A 2C04A 2CK3A 5AK0A 1TAGA 4NCKA 1N0VC 1HE8B 1JEEA 4DZZA 2KB0A 2V54A 721PA 1KNXA 3WY9A 3CF6R 2FWRA 2GKSA 2FH5B 2HDNB 4JLMA 1Z22A 3K0FB 4M9SA 4I1UA 3R9XA 1NN0A 2FGKA 2EU8A 2ZEJA 5L3SA 2F1RA 1E79D 3QUSA 3P4YA 4HUQA 4ZO4A 1FUUA 4QJ4A 1SVOA 1E9EA 1SVWA 2W0MA 4PQRA 3O47A 5EJEA 1DAKA 2ONJA 4LYAA 2P3SA 3CWZA 1XF9A 4LHVA 3UG6A 5L8VA 4Z1MA 2KJQA 3L0OA 3UG7A 5CDFE 1W0JA 4XJXA 1P73A 4OI2A 2JIZA 4POAA 4XVRA 3RLFA 1YR8A 3W5JA 4GPTA 1T4GA 4PSAA 4AD8A 2R6CA 1R7RA 3PJRA 1LNZA 3UPUA 1J99A 2CJWB 5DH9A 1E4YA 1E2NA 1TF5A 1Z8FA 3GEHA 4WOPA 4OHVA 5JZVA 2XNSA 3BK7A 1DG1G 3KXIA 3MWLA 1W36D 1KO5A 3AVTA 1FP6A 1TEXA 1G9XA 2FNAA 2NO7A 2P6NA 1KMHA 1P62B 1KDRA 1NMZA 1P2SA 1R5BA 2ODEA 4LJ7A 3LXXA 4YMTA 4Q1FA 3TVTA 5K8UA 2ZXUA 1GAJA 3VKGA 4LHYA 4KLZA 3BBPA 2ZU0C 1J7KA 5GJCA 2ZI9A 3BC1A 4BASA 4CT4B 4QGFA 1NMXA 2AK3A 3A4LA 5EP3A 1WB9A 4EUNA 3GLHA 2W6JD 2Y8EA 1KI3A 4ZDKA 2QBYA 1FFHA 3I92A 1VTKA 2NTYC 3FDIA 4K8OA 4KI0A 4LV8B 4X8OA 3AP2A 1JAIA 2DWOA 2NGRA 3CLVA 4I1OA 3B6EA 3VR1A 1W0KD 4LZZA 2UVQA 4KAXA 2CHQA 4PTLA 3QKSA 4L9SA 1EFRA 4BFYA 1DE0A 3UATA 2P5TB 2ZI7A 3EX7C 1GNQA 1S2MA 2IT1A 4HYYA 4WXPA 3TUIC 1X8KA 3CNNA 3EA0A 4HAZA 4KLNA 1CJTC 2EYQA 3MMPA 5DI3A 4C2TA 3FKSD 2BMEA 2ZUCA 1GZSA 1ETUA 4GP7A 3U4QA 1T3HA 1CTQA 3CR7A 5JI3E 3B9PA 3F8TA 4XD7D 5JS7A 1N5JA 1G19A 3U3KA 3IILA 1P60A 4H9GA 4DHEA 1FX0B 2CE2X 2X2FA 5CM8B 2WOOA 3AP3A 4O25A 3RNLA 4KSCA 2QTVB 4WW0A 2YOGA 3DMNA 4HZUB 2XNDD 4TTPA 1LS6A 2HT6A 3FMPB 5TDHA 2D4HA 4RD3A 2IW3A 2ZJ5A 1G8HA 1FNNA 1E3MA 4DUGD 1ZCAA 3IKJA 4FWTA 2G3YA 3BH6A 4KO8A 5TMPA 2Q0HA 1Z5ZA 3I73A 4IDOA 3OAAA 4GRAA 4HAWA 4UNSA 4JKYA 1E0SA 5IK2D 3EZ2A 3KJEA 4DDTA 1AJEA 4Z51A 4LJAA 1G3MA 1G41A 2PMDA 4JL5A 4LHWA 2F9MA 2C78A 3THYA 3NDPA 5CK4A 2GBLC 3G5UA 3W6PA 3GJ0A 2CCJA 1M74A 3OFNA 1OSNA 1M7HA 1XXHA 2BDTA 3BH7A 4Q9KA 4BLOA 2VHQA 1AIPA 1GNPA 1XTIA 4TYYA 2CEAA 3OEHD 1GILA 1T91A 1MO5A 1QRAA 4M1YA 2QAGA 1A2BA 1GL6A 1N6RA 3GJXC 3OEEA 1ELOA 5FBQB 4V0MA 2IX3A 5JBQA 1SZPA 1TF2A 4L16A 1M1YE 3EIEA 1W36B 2AWNA 4U02A 4XIGS 3VU9B 1G7RA 2C2HA 3CWQA 2PBRA 2ZRBA 2JJ2A 3QENA 1I2DA 1FQJA 1E4VA 3AEZA 3KTAB 4M1KA 2BKEA 3MLEA 4MRSA 2NPFA 4BFUA 3ZD7A 4V0LA 1KSHA 1FPMA 1N6NA 4G1UC 1KI6B 2FFBA 1TQDA 3AQ4A 3QG1A 1HV8A 1IHUA 2KE5A 2W2TA 2OSBA 821PA 3EARA 1NVUQ 1QHSA 2QN6A 2BM1A 1WDTA 1GL7A 2W2XA 1Q21A 4DEXA 4LBWA 4JJZA 4ZCMA 3BOSA 1HE1C 4XOIA 1J8MF 5FR2A 5BYJA 2E87A 4QNMA 2H7VA 2NO6A 1JJ7A 1G17A 3N2IA 4Q02A 1GUAA 1PVOA 5TXGA 2D74A 1BS1A 2CVHA 4PHGA 2WJGA 3CUEF 4AYWA 1CIPA 1P2UA 3BD9A 4D2IA 2IYVA 4Q47A 1U99A 5IT5A 4D4MA 1W4CA 1G8FA 1XBTA 4X8MA 3V4FA 1PJRA 3TAUA 1W49A 1AQYA 2JLXA 3N5CA 4LPKA 4BEJA 2O8BB 1EFHA 1C1YA 2IYSA 1EG7A 2HXSA 1VCOA 2DFNA 4JS0A 2J0UB 2PCLA 2OHFA 3BB1A 4A8JB 3OIWA 3ASYA 4CVNA 3U6KA 1VYUA 4HAVA 2DWQA 3PQCA 3HDTA 4BZXA 4B35A 2ZJ8A 1F2TA 5GJBA 4UNNA 2GAAA 3SS8A 4V0KA 3HU1A 5L3QA 2ZRLA 4DIEA 3B13B 4U00A 4JT4A 1NIPA 4DLZA 3GLFA 1FTNA 3EIQA 2JJ8A 3SYLA 1QVAA 3MUFA 4JT2A 5FBVB 1YZTA 1Z06A 4DVGA 2JJ1A 2H16A 3K9HA 2OXCA 3DZ8A 1XMSA 3CZQA 3SE0A 2O0HA 4MGKR 3I1FA 3DKVA 3EPHA 2WJHA 2HJVA 2ZRDA 2V55B 4RD1A 3ZIAD 2GVDC 1E1QD 1W2HA 2A2ZA 1VG9B 1G5RA 4B3BA 1RC8A 4EKDA 2FSHA 2IK8A 5FOSA 4Z54A 5AUOB 3U44A 4IOLA 2H57A 4IOMA 4GOXA 4YC7A 2WPDA 3UMSA 3FVQA 5J5CA 5J47A 1GIAA 1UPTA 4JYBA 5FUVA 2FFAA 3IBGA 1J70A 2Z4SA 3I3SR 4Q66C 1JR3D 2AFHE 1JQLB 1T8TA 1VDZA 2J0VA 2JLRA 2W6ID 4TL6A 1XTJA 2EVWX 5EZ5A 1Z08A 4CT5A 2BMFA 3BJIC 1K8RA 1YE8A 3FHOA 1DAEA 4EIWA 4Q19A 2G77B 2OBNA 5DI3B 1OFHA 2RGXA 421PA 3HYTA 4J0QA 1DG3A 4LDJA 3TSZA 3QBTA 4OI0A 3G82C 4XWAA 2VHCA 2Z83A 2QAGC 4AK9A 1IJFA 1L8QA 2AR7A 3VQTA 3QJYA 4DB2A 2AHOA 3GLHE 4ERNA 4ZIRB 4NYMR 5FBRB 1ZBDA 4JVNA 2IL1A 3WRXC 4A0GA 5C46F 1U0JA 3VFDA 3PUVA 4IXMA 1AQUA 5CYOA 1XTRA 4RZ2A 3C5HA 3FKQA 1U9IC 3HP1A 4ACBA 1QHHA 2GF0A 3VNVA 3SJBA 4C3ZA 3KZ1E 1D9ZA 1F2UA 2OO7A 2PMKA 3X1DA 2VP5A 4F38A 3AVXA 4CGZA 2FSGA 5KSOA 1L4UA 3GFOA 5KO2A 3U3RA 3N2EA 1ZNWA 4ASUA 1MABB 1Z63A 5K8LA 5FTNA 3R7WB 2C8VA 1ZU5A 2Q3MA 4U5XA 4AWXA 5DI9A 1W2GA 3BXZA 3FYHA 4WVFA 2NZ8A 5BQ5A 1H8HA 3KKNA 4HEJA 3IEUA 2WKPA 1G1MA 4FMCF 2TMKA 2VHUA 2GILA 2V4ZA 2V6IA 3MJHA 4D6PA 5AUQA 2WWHA 1D2MA 4TLAA 5FPTA 1G64A 4B3FX 4E03A 2QQEA 4QC2A 4BLTA 1U90A 1XD9A 1DS6A 4YXWA 1OYYA 3MAAC 3NIBA 3I62A 621PA 3QXCA 2N46A 3AF3A 2GJKA 3PEVA 4WZ6A 4F4JA 4AKHA 1UBFA 3IIMA 4QJ5A 1M6NA 4EAQA 3A1TA 4JYCA 3B2EA 2J7KA 1UF9A 2A7QA 2R6DA 2HEIA 1CF4A 4ZPXA 1VMAA 3CB4A 3K0AA 2I3BA 4JLDA 1XMJA 4LJ5A 1U98A 4MGIR 5H1YA 3QE0A 4C0QC 4E5UA 1JNYA 2ZRPA 1ZD1A 2YOFA 1SGWA 5E7MA 3WHLA 4GZMA 5BW8A 1M2OB 1D2NA 3FB4A 4LPSA 1CR0A 5JI2E 1P3JA 2QMOA 1WF3A 1COWA 1ZC4A 4IDNA 3KQHA 4TZ6A 4OJKA 2B6HA 2PLRA 2RAPA 4V0ME 3ZQ6A 2RGNA 4BLPA 3GCGA 5DN6A 3NTUA 4QFMA 3CF0A 3NHAA 2ZS7A 2PLFA 5FUXA 2RB4A 4US0R 1G3QA 2YC2C 2ORWA 4DDVA 221PA 4A36A 4XSHA 1SKYB 2VO1A 3AB3A 2BJVA 4B44A 4QG7A 4JL6A 4TLDA 3RDPA 5IF9A 2QGNA 2C9CA 1P9NA 2ZRAA 5FL3A 2IC5A 4ZDJA 1DVRA 1VG0B 4Q7KA 1VECA 1TUEA 3KB1A 1N6LA 4QHYA 4MRNA 1YR9A 2IUTA 3GLIA 4AKGA 1N6KA 2ZRNA 3CR8A 3QI2A 4DIDA 3T5DA 4B73A 1TMKA 4PHTA 3ZDQA 5KNBA 4Q7MB 1ZUNB 3TW4A 4PC3A 1GITA 1XEXA 2V6JA 3CONA 1H8EA 3K9GA 1BOFA 4NYJR 4UNPA 4FINA 3RHFA 2QE7A 2XJ9A 2FSIA 3PITA 4TT3A 3BIFA 2FPKA 2IYLD 2OBLA 3TLXA 3RS3A 2CCGA 1FMLA 3QEOA 4QBFA 3CO5A 4XH9B 4B3DA 3AF2A 3UMFA 4IDPA 2QP3A 1SKYE 3IEVA 1E2LA 2RGEA 4FCWA 4PHFA 3K70B 4BGDA 2JLQA 5DISB 1UEJA 2W58A 1NBMA 5G53C 3WRYC 1YZGA 2IS6A 4C0LA 1OXVA 2F7SA 1AGRA 4PSKA 3KKMA 4N3NA 1Z28A 4FMBB 1QG4A 1NVVR 2KBEA 2QTHA 5FR1A 2FFQA 3GLFE 3WP0A 2FA9A 2EFDB 1UFQA 2F1HA 1R8QA 5FTKA 1ZUIA 3L82B 1QHNA 2C95A 3I72A 5DYGA 1ZYUA 3B9QA 1NN3A 1OE0A 2XJ4A 4LHXA 5E3HA 3NHBA 3PEYA 3ND8A 1SXJC 3PR1A 2YV5A 4WZAE 2J3EA 2ZJYA 4ZKEA 2PEYA 3KXLA 1W1WA 3D6TB 3P1JA 1MOZA 2QENA 2B7BA 4O2LA 1RYHA 4X8LA 1KNQA 1YQTA 1NLYA 2WZQA 4EQ6A 5HKKA 5DYIA 4N0DA 3WP1B 4TYNA 2F6RA 2JDID 4A6XA 3Q72A 2O0KA 4LBZA 1IAQA 1MKYA 1Z0KA 4NYJQ 2BBOA 1G18A 4GMDA 4KFUA 2J7PA 3VKHA 2EQBA 3TR0A 3BB4A 2VH5R 2O5VA 2AKYA 3SN6A 1KMQA 4PXAA 3VR4A 2ZS8A 5LB4A 2OXRA 2B21A 1XWIA 3ADKA 2ZJAA 4I99A 4Q4JB 4D4JA 3LBHA 2JLZA 4C2UA 4RJLA 5FH9A 4NCNA 5EE5B 3RWOA 4ILEA 3AM1A 1CP2A 1XD2A 5AJXA 2OE2A 4BE7B 4BFVA 3U60B 2DYKA 3P20A 1IY2A 5TVKA 1Z0DA 2ZRHA 5FTMA 4RD4A 4Q7LA 4KSBA 2CNWA 3B1WA 1NVVQ 4TLBA 1NVWQ 2LCFA 4P3YA 4QXAA 2CL7X 2D06A 3IO3A 1SULA 5HZKA 1T3SA 2WWGA 4CEIA 3JZAA 2B92A 2XXAA 4CEHA 2ZTSA 3QKRA 5HCIA 4XWOA 3ONWA 1A7JA 2XOKA 3LWNA 5JWRA 1CXZA 3GJ3A 1FUKA 1J90A 3WHKA 1YRBA 2HLDD 4URZR 3A4MA 1TQ6A 2JGNA 3X1YA 2ZUDA 1HUQA 1ZW6A 3C16C 2E1RA 4OK6A 1N25A 3THOA 2DHRA 1OHHA 4EJSB 4LK2A 1K5DA 5G3ZA 4YMSA 1EFCA 1SKQA 4EDHA 1TF7A 1GP2A 1IJEA 5E95A 4G5GA 5FI0B 2REOA 4ITRC 4Q4HB 3AVYA 3NBXX 4NPHA 2OLJA 4PAQA 1UJ2A 3GJ5A 3UKDA 4PZLA 1XDBA 2ZSFA 3TAHA 2Z0MA 2WTUA 3S1AA 3NEJA 2QM8A 2WM9B 2RGGA 3C5CA 4TWZA 2F9LA 2FEMA 3RSOA 3K0CA 1UKZA 5D3MA 2XB2A 4BECA 1EESA 1JPJA 2ZRGA 5A5GA 3PENA 1KSJA 5B57C 1US8A 4BFSA 4XTCS 3IDQA 2EFEB 3QEJA 5BN4A 2CE7A 3I61A 1DAFA 2VP0A 5AR1A 2IA5A 3U6BA 4ZCLA 2A5DA 1KJWA 1JI0A 2P67A 3AKCA 3MGCA 4PR0A 4EFLA 1ZUHA 4TLCA 2NOAA 4TQAA 4A6PA 5DLQC 1KZ7B 2ZUBA 4TSFA 4AG5A 4MITA 3A1SA 1LV7A 4PFSA 1ZNZA 5KYKA 3CRVA 3ZVRA 1A82A 1RFLA 521PA 4GL2A 3UXMA 4ON9A 3KQKA 1NJGA 1KOFA 1NSFA 2QTFA 3HJNA 3B82A 1L7VC 1NLFA 2AXNA 4Q18A 1NJFA 4W7SA 3PUWA 1LW7A 3L8ZA 3VR3A 4C9BA 5HE9A 5CJPA 3BRWD 2O8EA 1CRQA 1ZINA 4TN1A 4ZKDA 1CEEA 3T1QA 3A4NA 3K0SA 3AP1A 4QGAA 3LH5A 2EFGA 5G41A 2NG1A 4MGZR 4EFMA 1JB1A 2O8FB 4FW9A 5JHHB 2PL3A 2IYXA 4FWIB 1D6JA 1TNDA 3PFIA 4PC7A 1RZ3A 3THWA 1EWQA 2FOLA 3T34A 4AY2A 2F55A 2HCBA 4TMVA 2QRZA 2FU5C 1ZNYA 4M0LA 1G3RA 1SVLA 2GBLA 3T12A 1E0JA 2FG5A 3WBJA 4ARZB 3CH4B 5KNCA 3OE7D 4Q9IA 2C96A 5KU1A 1P9RA 1II8B 2ERXA 4OYHA 2FFHA 4D0NA 2NO0A 2A30A 2GF9A 1NBME 4CEJB 4JLNA 1ZIOA 2D7CA 4P0TA 2WIBA 3VKWA 4NDZA 4E22A 2IS1A 2FF7A 4PC6A 3SYKA 2B8WA 1XD8A 1S8FA 4US1R 2C5LA 2YHSA 1SQ5A 3GJ8A 5KPDA 3RC3A 3HWSA 3PIRA 1IONA 2CBZA 4MA4A 1Z6TA 1N2CE 5LD2B 3GJ4A 1AS3A 1W0KA 4YMWA 1JBKA 3RAPR 3L43A 2ZPTX 1DELA 4F4CA 2RGBA 4S2EA 4Y0VA 1AZSC 2CK3D 3TGPA 3IGFA 1Q1ZA 1JAHA 1E1RD 2C03A 3DOFA 1H65A 2XTZA 2ODNA 1EFTA 1SHZA 1OH7A 3KUDA 3FKSA 4FXPA 2ORIA 5C4MA 4IDQA 3PEWA 2O8DA 1I4LD 3H4MA 3LQRA 4G5OA 1WP9A 2XSZD 4L15A 3B8HA 3MFYA 4IW3B 4JJKA 4PPQA 1NG1A 2ZAOA 2WJVA 3RRYA 2YWFA 3RC8A 2HF9A 1IN8A 3K0CC 4UJ3A 4TYPA 4XD7A 5JJIA 4HDCA 4G5RA 1E2EA 1G3IA 5JSZA 2WHXA 1XNJA 1HT2E 1E9SA 4Q1DA 2VP6A 3SHWA 3Q85A 3QF7A 2J1LA 3WYAA 2FEOA 2VYFA 5C18A 2AN9A 1F48A 4EPXA 1P2TA 3QOFA 5EP4A 4P31A 1W0JD 2BBTA 1VPLA 3DKPA 3HPRA 2EFCB 3FMFA 1QG2A 1P6XA 3TKLA 2J5XA 1EX6A 4RKFA 2VEDA 1W5SA 2CLDX 1MR3F 4HUTA 4C0HA 3EPJA 3ECCA 3LX5A 4LJ8A 2DWPA 3LX8A 1Z2CA 1X1SA 2IF0A 1IN6A 3B60A 5EUMA 4HSEA 2VF8A 3IPYA 1NI3A 4RFSB 2CLSA 2XGJA 1YR7A 4OI1A 5FPKA 3ZH9B 3GPLA 1NMYA 2F3TA 5HPYB 5GJWC 4LCBA 5CIQA 4A1FA 4QM7A 5LDDC 1RPZA 1SVMA 5CB8A 2QGZA 1E6CA 4RKEA 2J59A 3TRFA 4CRWB 1D2EA 1XTKA 5B30A 1A4RA 4OI4A 5GJVC 2VBCA 1HT1E 4OL0A 2OILA 4LYHA 4GFDA 4JSTA 2QG6A 4PQFA 3WMEA 1R0WA 4UNRA 4EPYA 4Q1CA 1E9DA 1W36C 3NVAA 5HR5A 4Q00A 4D81A 2OV2A 1X86B 1Q3TA 2BV3A 1EFRD 3FMIA 5HE8A 1DEKA 1KI4A 1SVKA 4YLGA 4MUBA 3AGPA 4R98A 4OQFA 1R0YA 2C9YA 4PZZA 2JLYA 4MYHA 2ZVPX 3R8FA 1GL9B 1A1VA 3B1YA 4QBHA 5BXQC 5H70A 3B1ZA 4TL8A 5J4KA 1E2GA 2BBWA 1ZIPA 3QBVA 1XX6A 4DKXA 1OV4A 2W83A 3H86A 5K8TA 4DSOA 1Y63A 5KUTA 3FHTA 1OT3A 5FL7A 1KI8A 4V02A 1U9IA 4IEEA 3RWMB 1BO6A 4URWR 1WRBA 2HJGA 1AKYA 4LYFA 1Z6GA 2BMJA 3CIOA 4WIAA 2NO1A 2RGDA 2Z6VA 3QPVA 1U0LA 3KKPA 4DJTA 5JMTA 5DNYB 4PO8A 1BYUA 2BKUA 4A9AA 3D8BA 2WSSA 2IEYA 2JAQA 5BWMA 3P4XA 1BH2A 3RS4A 4JZKA 4M1WA 1PV4A 5TB5A 4B3XA 2WMNB 1M7GA 3NBYC 4KITB 3WXMA 2WKQA 2J9RA 2ZREA 1XPOA 2V1XA 1XJ0A 5L3SB 2H92A 1W47A 4IOKA 2W0SA 1ZAKA 4HUQB 3OAAD 4A8JC 3ZYCA 4XVUA 1Z0AA 4M1SA 4AG6A 2H5EA 1HH4A 1ZD9A 3EZFA 1MH1A 1YJ5A 3HYRA 5CLQA 1FOEB 2OFOA 4C30A 1KKLA 3TW8B 4UKDA 5CM9C 2OESA 1MT0A 4DCNA 3OFND 4F91B 4PX9A 4NMMA 2H1LA 1KHTA 2L0XA 2ZE7A 3LVRE 2ASEA 4LY6A 4NKRA 2DFLA 1OKKD 2A5YB 4GDFA 2WAYA 3ZIAA 1E1QA 2YYZA 4BWYA 1G20E 3KJGA 4CYMA 4BZPA 4UXJA 3VHLB 2IHBA 1K5GA 2VP9A 2ODBA 4FMCB 4YMUA 1PUIA 3MWKA 3Q5DA 3CM0A 2ZSAA 4M9XA 1V43A 3REFA 2Z5FA 1KMHB 5IDVA 3X2SA 2UZ3A 1JR3A 2JJ2D 2P2LA 2W6IA 4PC1A 3ZVNA 1E2QA 4JVLA 5HZHA 5P21A 2JASA 4B2IA 4RCZA 1OXSC 2XB4A 1GKIA 3VNUA 3W6OA 2QROA 4HB2A 4CDGA 2VHJA 4MRRA 4I1VA 5AJZA 1FL9A 1BKDR 2VSOA 4GP6A 3WNCA 3HR8A 1QHYA 4GSYA 5FI1B 1DO0A 3DPUA 3GLHB 1MRNA 1XZQA 1GNRA 1P61B 2QBYB 2FDCA 1UADA 4D0GA 3FGNA 4PPNA 4NTZA 1GVNB 4NH0A 4CZ2A 5AWFC 1XFAA 1UBEA 5F3WB 3IHWA 3QKSB 5L3RA 4E09A 2I4IA 2AKAB 1R5OA 3VHXA 1VHTA 1DBSA 1GRNA 4GMXA 4G5QA 3EW9A 3AVOA 2IUUA 3LLUA 3TBKA 3MJRA 1E94E 1N5KA 5JJLA 5KOYA 1CR2A 4I1SA 4JSYA 2AD5A 2DBYA 3RVBA 1E2MA 2WKRA 4B6FA 3GFPA 3U4QB 2RH5A 1NN5A 4O2RA 1KAOA 1E2JA 2BEKA 2K5UA 1Q3HA 4B76A 3T1VA 3U61B 2WMOB 1Q44A 3EZ7A 3ZS9A 3CX7A 3R9WA 5FBWB 2CDNA 1FMJA 2XEXA 3FMOB 5JWOA 3QF4A 2VL7A 4RZUA 4DLRA 3UWOA 5LBIA 1VYVA 4C7OA 1WA5A 3VMFA 3LDAA 1G16A 3AVUA 2A5GA 3AF0A 1XEWY 1JQJC 2V7QD 3ZZUA 1NG9A 4IJMA 1XMVA 3A37A 2BM0A 2R6FA 4JBWA 4Q4AA 4US2R 3EG5A 2GZAA 3L0PA 3HR7A 3PUYA 1Q1QA 1PLJA 5GVSA 4IRUB 4TL9A 4AI6A 2JCSA 1F60A 1UBCA 3K70D 4GBMA 1XTQA 1P2VA 2VHTA 5FPSA 2WPDD 1GKUB 1E32A 2IWRA 3U2QA 3THYB 3NEYA 4II7A 1IOZA 5EQTA 4DSNA 1DTSA 3EIHA 3PUZA 4HLUC 2BVNA 2OBMA 2P6UA 3BB3A 1XXHB 3CW2A 3ND9A 5KSPA 2R44A 1SXJA 5TY0A 2ZE6A 1G21E 4EPTA 1RKBA 1GSIA 3F0TA 3AF1A 2QAGB 1OIWA 2Q9CA 2ANCA 2XAUA 2ZRFA 4DSTA 3SC3A 2D62A 2BCGY 2JLWA 3AUXA 5SZJA 1LY1A 1GKYA 2RMKA 4NHOA 3DL0A 3UANA 2ZROA 3Q8XB 3H0KA 2HF8A 1KI1A 3I5XA 2ZRJA 4B33A 1KKMA 3IQWA 4KVAA 4Q01A 1EX7A 1IBRA 4PC2A 2IBMA 1LF5A 5J4HA 2VP2A 2ATXA 3DM9B 1SVSA 1XXHE 2WWIA 3H84A 3GLGA 2IYWA 2ZYWX 4GNKA 1CJMA 1Q12A 2BHRA 2GJ8A 2ZJZA 4M22A 4PHHA 4AYTA 1G4AE 3ETLA 4R2IA 1KY2A 4ASUD 1YU9A 2CHVA 1KK0A 4WAUA 2GK6A 2F1JA 1XJCA 1AM4D 2AD1A 2DY1A 2GCOA 4MRPA 3X1WA 4AURA 2D7DA 1H8HD 1B0UA 4BQSA 2RHDA 1Z0FA 1VHLA 4LRWA 4B3GA 1VG1A 4D4KA 2DCUA 4Q9HA 1G7CA 1UKEA 3H2YA 5DHAA 5B2ZA 1TPZA 1CR4A 2A9KA 5EXPA 3AVPA 4JLJA 4MYUA 3Q7QA 3EASA 5JRZA 1E9CA 1U8YA 4JIMA 3SFZA 3KQUA 2P0EA 3K1JA 1E2PA 1FP7A 1R5NA 2QORA 1XCGB 4YXWD 2GESA 1BIFA 4DT1A 1ZP6A 3C4JA 5CYPA 1F2TB 1LS1A 3KB2A 5JWHA 5L3QB 3BFKA 2OCPA 3TJZA 4EPRA 3BE4A 5F2EA 3GLFB 4PANA 2D3WA 3R20A 2ZIAA 4A0RA 5JHGB 2H17A 3O8RA 3LVQE 2PT7A 2Z4RA 1XP8A 2BIFA 5IRCD 4NYIQ 1NVXQ 1GWNA 2YJTD 3QG5A 3NG1A 4K46A 2O8CA 2ZRMA 2QNRA 2IEZA 4NCHA 5M04A 3FHCB 2WJYA 4C0SA 3KQLA 3CX6A 5G3YA 1LF0A 2D2FA 1ZD8A 4C4PA 4TQUS 8OHMA 4KODA 2ZM5A 4MKGA 2ZJ2A 1COWD 2WOJA 3U44B 3EXAA 1IN5A 1N3BA 2O52A 1UAAA 5FOTA 4B71A 2JDIA 1YRAA 4LHZA 2FMXA 4M8NE 2FPLA 1HQYE 1AA9A 2G83A 1Z29A 4X8HA 5DN6D 2YINC 2MMGA 1G5TA 4Q1BA 1G8YA 1BMFD 3PG5A 4M2LA 2KI5A 4QHTA 3CX8A 2QT1A 3P27A 1E69A 3EZ6A 1RJ9A 4F93B 2CHGA 5FUYA 5G40A 1DOAA 4HLQB 3QXJA 4B2PA 1OH8A 1D8TA 1AS0A 4HDOB 4FI3C 2Q3FA 3AKYA 2RHMA 1X6VA 3CZPA 2QL6A 3LD9A 3I8XA 2GEDA 1EK0A 2ECKA 3IPXA 3QNUA 4IOJA 1Q57A 3SJCA 4ZI2A 1B23P 1IXZA 2ZR0A 5JLJA 2GA8A 4QOSA 3GMTA 5EXTA 3NH9A 5F98A 5CDFA 2WJJA 4MH0R 3R8CA 3SNHA 3TUZC 4ESVA 5KTYA 1T0JB 5TV2A 4C0AC 1R2QA 5CK5A 4YQFA 2QMHA 4DDWA 3O8DA 1UEIA 2ZI4A 3BORA 4M4SA 3ZD6A 1A5TA 2ZS9A 2ZU6A 2J0QA 2W2VA 1H8ED 1QHHB 4FD2A 3EPLA 4B34A 4JKIA 1W44A 3IBYA 2JEOA 2J0SA 3ADBA 1F2UB 2UZIR 4TMKA 3K0FA 5H68A 3U3JA 1L2TA 1Q0UA 3A6PC 1W48A 3OIYA 3B1VA 1IM2A 2VIIA 5F9FA 1Z2AA 2E9SA 3DM5A 5FUWA 4GOJA 2HLDA 2AXPA 2FV8A 3GEIA 4QBIA 3FFBA 1RRCA 1II0A 3AF4A 4D26A 1JXMA 1E9AA 3TH5A 3B7GA 4DCUA 2QUZA 3U3MA 4QM6A 1NBMD 4AC9A 3ADCA 1CJVC 1HA3A 2G0TA 4BZQA 4IHQA 4M53A 3QIAA 4LYJA 2OT3B 3D31A 3VX3A 2CJWA 2BC9A 5DE3A 1AZTA 4NCJA 1ZM3A 4A92A 4D82A 3FOZA 1ZCBA 1P72A 2WAXA 1W5TA 1CJUC 1U81A 4I81A 5FOXA 1QHGA 4FCVA 4LC0A 4XWKA 3ZVMA 2XZOA 4DLWA 1ZJ6A 3A1WA 2YZ2A 1L4YA 4DLVA 4A2PA 2WSMA 3ADDA 5FFMA 2GETA 4DBLC 4BFWA 4OK3A 2XTNA 2QMUA 2CVFA 4LX0A 1EGAA 4CIDA 4HB0A 3EA5A 4TZ0A 4B43A 121PA 1KJYA 3PVSA 4V0NA 2IXFA 1T6NA 2YVUA 3U7GA 3Q9LA 2R6AA 4KBFA 2OG2A 1S1CA 3OHMA 2IUSA 3K0AB 3L2OB 3MRSA 3TK1A 4QKQA 2RKOA 2FX3A 1G7SA 4AKEA 4HAYA 1W4AA 1SXJE 1KI7A 1I4DD 4L8GA 3N70A 2G1KA 3PCRB 1A2KC 4BEBA 4KFTA 1UBGA 5FTLA 4OBEA 2FN4A 1IQPA 4TLEA 4BLQA 3FPAA 3I32A 3AKEA 1OB2A 1T5IA 2J46A 2PZFA 1NRJB 5AJVB 1NY5A 1QHXA 4M9ZA 4BFTA 1JJVA 3C14C 3NDBB 5EXSA 3I5YA 3ICEA 2BCJQ 3J81k 1KDPA 1WQ1R 1TTTA 1IXSB 1U94A 4JBYA 2WWFA 2NPIA 1DAIA 2C77A 3RS5A 1QZXA 2CXXA 2GZDA 4DCTA 4G0NA 5CB6A 1M8PA 2XOKD 3GLGE 1LFDB 1OFUX 3ZQJA 2QU8A 3OESA 1VCIA 3GLIB 6Q21A 1P4SA 1MO3A 3DMDA 3BS4A 1FX0A 2SHKA 4HDQB 5BYKA 3M1IA 2NIPA 3MWJA 1KO1A 2PX3A 4P33A 5SZKB 4RD0A 3RRMA 4DWJA 3MWYW 4HZUA 2OCBA 2F43A 4PAOA 1XEXB 1HEIA 2R9VA 4QBGB 4Q9JA 1NKTA 1CKEA 4A4DA 2OAP1 1OHHD 2J87A 1M34E 4RVCA 1HQCA 1IN4A 2ONKA 3NC0C 2NO9A 3B85A 1KO8A 2HYDA 3TMKA 1E79A 2UKDA 2JLVA 4P4SA 2NQ2C 4G01B 4MYCA 4OJQA 2PT5A 4RFVA 4TYWA 1VYTA 3RANA 3JVVA 2HXYA 1II9A 2HT1A 4DLUA 3TSOA 1OF1A 2OUKA 3GLIE 2QP9X 2PJZA 2XZPA 1I2MA 5FOWA 1X8JA 1D9XA 3QKUA 2V1UA 5EE0A 5KSYA 3W34A 1CRPA 4MUAA 4DC9A 1J2JA 1EWRA 2YC4C 4BFXA 3SHFA 3VU9A 3V4RA 2ZSDA 4LSGA 4OK5A 3QKTA 4LI0A 3RABA 1G4UR 1OYWA 3BAFA 3KTAA 4IFEA 4LGMA 3AV0B 1XCMA 4ACAA 4B2LA 4B75A 1K6MA 2OZEA 3EPKA 2FPMA 4DLYA 4NU0A 1KI6A 2ZANA 2I1QA 2O0JA 1J8YF 1E1RA 5LD2C 4JMPA 5LB2A 3T15A 3B1XA 4EQ6B 3UK6A 3U5ZB 4CF7A 3RS7A 2BMDA 1FW6A 3RRNA 1XEWX 3KFXA 2A5FA 2R62A 3CPHA 2XSZA 4TSFD 1YR6A 1O3YA 2ZITA 3GEEA 3LW8A 2W6JA 2YKGA 4OHXA 1F5NA 1YKSA 1AGPA 1ZM2A 5GVRA 5FTJA 4NL4H 1R4AA 4R2HA 2OEPA 3M0EA 4Q4LA 3CPEA 4ZV4A 1DAHA 4URVR 2R8RA 3EWAA 3K09C 5AUPB 1KDTA 4W5HA 4HZIA 2OCYC 4OQNA 1XD2B 5JEDA 2HUPA 2QZ4A 1FTSA 1F6BA 3SOPA 3VAAA 5EE9A 4R7ZA 2B8TA 1Z0IA 2BOVA 1KI9A 2ZJBA 5AJWA 1XEFA 2O8BA 2GTPA 1DPFA 4P4UA 1R0ZA 4Z8YA 4CEIB 2XXAB 2J0UA 2ANBA 4HI0E 2QA5A 4PQYA 4E07A 1OXTA 4A8JA 2NMVA 3K9NA 4CEHB 3TQCA 1UM8A 4DDUA 3QKRB 3W5IA 3KJHA 3W6NA 1MO4A 4LJ6A 1LTQA 1T0HB 1ESNA 1Q20A 2JLSA 5ELXA 2PZEA 2D2EA 1E2FA 3WNDA 5E7JA 3F5FA 5F9HA 3PV0A 5GADl 3W3AA 1U8AA 2XNDA 1R8SA 5JCZA 3U7EB 1E2IA 1XCPA 4P4TA 4LJ4A 4XSGA 4Z1MD 1CJKC 4DUGA 1AKEA 2JIZD 1N6OA 2GCPA 2ZSEA 1OPXA 4OQLA 3C15C 2AL7A 4KFSA 2PH1A 4QL3A 1VCMA 2IYTA 2CMKA 4TL7A 5IK2A 1CBUA 2WWWA 1NKSA 2QY9A 1GOTA 3SYNA 3A1VA 1TX4B 5JEEA 3GQBA 3BWDD 1JEDA 1QVRA 2GDJA 2ZR7A 1G3UA 1KK2A 3VR6A 3MD0A 4BRUA 1OW3B 3S1AB 2ZI5A 1IY0A 1NSTA 4HB4A 2P6RA 3V00A 1YZUA 4FN5A 3B5JA 2YWHA 3OEHA 4LBVA 3T35A 3KXKA 4BPBA 1GRRA 3QXXA 5D3MB 1JECA 4AKIA 4CW7A 2WBLC 1TEVA 1ESMA 2FZ4A 3KUCA 2R2AA 1S3GA 4PO9A 4S35A 4ESHA 4IVRA 1US8B 1QBKC 3VTKA 1M7BA 1NY6A 1OXXK 2OAQ1 4O3MA 1T9HA 3C8UA 4ZIRA 1N0WA 2CL0X 2QAJA 4Q5IA 3JVUA 2DB3A 1SVIA 4UXHA 4A2WA 1OB5A 2QPAA 2ZETA 2ZAMA 3FFAA 4N0EA 2ZRKA 2N42A 2F43B 1E0AA 3VR5A 2X8AA 5DGXA 4F92B 1Z0JA 2VP4A 2GZHA 1E2DA 1PLLA 2VQSA 2ODWA 2B7CA 4B6EA 4HLCA 3UMRA 3QVVA 2REXB 2MSEB 2ZE8A 4KBGA 4P4SB 1MABA 4PPGA 3R7WA 2DFTA 3LNCA 1E96A 2ZR9A 3W3ZB 4Q48A 2QQ0A 2FSFA 1P75A 2VSFA 4OQXA 1XMIA 1UKVY 3H1TA 1KO4A 4O0MA 2MSDB 1KZGB 3KDSE 3NWJA 2I1VB 2O8EB 3K8YA 1GRQA 1RRGA 2C98A 2J45A 2V9PA 4DRZA 2QSYA 1U8ZA 1OKKA 3ASZA 4YMVA 2IS4A 2ZSBA 3QY0A 1GFIA 2XX3A 2F3RA 1XPUA 1YZQA 4B48A 4M1MA 3DHWC 3W9YA 3L0IB 3THWB 1G291 1N0UA 1PZNA 1HY3A 1R6BX 4QRHA 3C7KA 4NCIA 4GOKA 4HLUA 2KSQA 2YWEA 3AVQA 4P32A 4URYR 2WJIA 1WCV1 1VIAA 4URXR 1WXQA 2KWIA 3SJZA 2GXSA 2IYUA 3T06B 3ZZTA 1KSGA 4D80A 3EAQA 4KHZA 2OFWA 1WBBA 5BN3A 1RYFA 1W4RA 5FPYA 3CNLA 1R10A 1Z83A 1KTVA 3HPQA 4W9MC 2GVZC 1TADA 2VLIA 1T8UA 2W00A 3KJIA 5L3VA 4LV6A 2EWWA 1ODFA 5C4GB 4YONB 2ZJOA 1XTSA 3OEED 4DSUA 3QXSA 2AK2A 1XRJA 5EE1A 1G5PA 2OCAA 3RSLA 1X8LA 5FL7D 3G0HA 3A58B 2IWHA 2GJSA 3SBEA 1X3SA 1PLKA 2ORVA 3PUXA 1E2HA 5EP2A 3SU8A 1ZVQA 2GXUA 3CF2A 2AFIE 1S9DA 1TUIA 3GJ7A 3IIJA 3QPUA 1G8PA 2GJAA 2JATA 2H18A 2G88A 2WSSD 2ERYA 3QVUA 4KU4A 4BLRA 4C0JA 2O8DB 2GXAA 1ZC3A 4F4IA 1CU1A 2LWIA 4XTRA 4A0HA 1ANKA 2X19A 5LPNA 1ONBA 2GWHA 3W90A 2EYUA 4UQOA 3LY5A 3ZGXA 4DLXA 3I4LA 4MGYR 4PO1A 1D5CA 4LJ9A 1YVDA 1SHKA 2QM7A 2X2EA 4FIDA 5JSZB 3X1ZA 3CRW1 2ZI6A 5KSZA 4HB3A 3K9LA 1X1RA 1MV5A 3D3QA 4NZYA 1YZKA 2GCNA 2V7QA 3E70C 1G8GA 4MKFA 1TU4A 1ZNXA 5J4LA 1G7TA 2MMCA 4QJ3A 1XPRA 1PUJA 2JA1A 1FNMA 3TNFA 3F3YA 1ZM7A 5JRJA 2CLCX 2FGJA 3SZRA 5EP1A 3LV8A 5BN5A 4IXNA 4PAMA 1RRPA 2CCKA 5DIFA 2ATVA 2MSCB 2ZYUX 4WBSA 4ZI3A 3TR5A 1ZM9A 5J4VA 3FE2A 1S1MA 1XU4A 2IYYA 3D7MA 4TTQA 5SZHB 3EZ9A 4M9QA 4MDFA 2LKDA 3M4YA 2JJ1D 2QSZA 4QHSA 2WWYA 4N1AA 1VCNA 3DVLA 2QT0A 4QGHA 1JALA 1G6OA 5D3QA 2PJRA 2X77A 3JZMA 1Y3AA 4KVGA 4M21A 3TIFA 4R71A 3AH8A 4MKHA 4EPVA 1TL7C 4A0FA 1NIJA 1NN1A 5JS8A 1QF9A 2Q3HA 1LB1B 2IF2A 4PZYA 2G9NA 3GP8A 2G6BA 4EFNA 2FZLA 2EFHB 3LA6A 1G6HA 2ZI3A 4RZXA 2LKCA 4Q1EA 5FPHA 2AX4A 4DCVA 2KBFA 1Z3IX 2QRNA 4C0BA 4UXIA 4L9WA 3NBFA 3TUJC 4WZBE 3T5GA 1XB2A 4IDHA 1TU3A 4RD6A 1U0HC 3LLMA 2IYRA 3IUYA 4Q4JA 3AGQA 5KDLA 5EE3A 3QXHA 2GHIA 2RGAA 2J41A 4ABYA 5JFGA 3BFVA 2ZYTX 3THXA 4Q9LA 1FQKA 4LWZA 4LJYA 5K8IA 3QSYA 2P5SA 4RY2A 3M6AA 5AUNB 4L5BA 1ZMXA 4LBYA 2VTKA 2IXGA 4GZLA 4PPFA 4TMXA 1OJLA 2GXQA 4NYIR 5FOVA 5UKDA 4MRVA 3LAWA 2PCJA 2RCNA 1S9HA 1XZPA 4KFRA 5KPJA 2XITA 1MO6A 4NE2A 3L8YA 4HAUA 1IN7A 3LRPA 1P5ZB 2Q9BA 3KKOA 1UDXA 3SQXA 2Q9AA 1KGDA 1GG2A 1HYQA 5FBLB 1AK2A 4NYMQ 4I4LA
chains in the Genus database with same CATH superfamily
1NUPA 2Y1OA 3C1AA 2WF9A 5F33A 4LF7B 3PGKA 2JC3A 3WMFA 1PNQA 2Y1GA 1O5IA 1ZVJA 3O82A 1WL8A 4BO7A 3RS0A 2IYZA 4BNVA 1A4UA 1Z0UA 1AU9A 2HDWA 3E2IA 4V03A 2OYRA 4F2GA 1DUIA 4JBXA 4JXKA 3W8EA 4IKEA 1RLUA 2QMEA 1FVHA 1K6XA 1SXJD 2QP4A 4L9RA 5K0SA 4GPBA 1YULA 1AKQA 1UMBB 2H1RA 2WIAA 3N7TA 2FQ1A 4R7TA 2YS7A 3AVVA 1LDNA 1Q1BA 5B7QA 4HLDA 3SHTA 3DZKA 3LO5A 1QXSA 3Q7PA 1B16A 4DM7A 2YW9A 3EK2A 4DAEA 4CU5A 1Z6PA 3BE6A 3K53A 4GMGA 5CNJA 3TLCA 1PF7E 3P0HA 1T5LA 3N28A 4MDEA 2PL5A 4ND1A 1OTYA 2C9OA 3V6MA 4MMZB 1I6MA 4X94A 4CIBA 1OXKB 3D6HA 2G1JA 3IIKA 4CTOA 1OI2A 4OHCA 5IZCA 3K70C 2DFVA 1Q22A 1JEAA 1Q17A 2BEJA 3GFRA 3NB0A 4RJIA 5TMDA 1AB5A 4J0DA 5KKAA 3ZZ0A 5H82A 1HYGA 2JGKA 2M1ZA 4EMSA 5IP5A 1JXOA 3JAKB 4HRXA 5FTWA 4ZAWA 4I4NA 4JLSA 5A4KA 1OIXA 1L4KA 3KFVA 2YOHA 2UYGA 4FKBA 4TYQA 1RIFA 3QUAA 1JMKC 3IT0A 5IMSA 1JP7A 4PSVA 4BVEA 4GEKA 2XKBA 1E3WA 1QB8A 4KRFA 1YHNA 2PLWA 2VSXA 2OBXA 3D02A 1K89A 1AQNA 2JI7A 2BWJA 3N7AA 3NH6A 3H5TA 3IHLA 3PKJA 4G0OA 3IEMA 2IYQA 2JHFA 2V45A 3QE2A 4H1UA 4B47A 5CLFA 2X0IA 3LHKA 2Q6TA 1G2IA 2WF7A 7REQA 3Q3JB 4OHZA 1EBBA 1C3LA 2JFZA 2XDQA 4NEHB 4ER6A 4ZOQI 3H42B 3P5BA 2NX2A 2WG2A 4GI7A 4P5DA 4ZHQF 1CR1A 1PGOA 3A1FA 2QSUA 3KYCB 3QFCA 2GARA 4X62B 3PIDA 4FCTA 2EX4A 3BERA 2X13A 4RQAA 1M0WA 1U1EA 2VSNA 1L7NA 3NFRA 4EHAA 4EP1A 2MYTA 3T1TA 1P9WA 1UK7A 3WRWA 4PRLA 4FMDB 1WMEA 4C6SA 3W2EA 4DNXA 2BJWA 1WUTA 4FEEA 1DIBA 4UHDA 3WIDA 5CVJA 1KO7A 1KPHA 1BYIA 1P7PA 1N6IA 4UJ5A 1ZR2A 4MIKA 2NZJA 4OXNA 3NKVA 10MHA 8LDHA 3LPLA 1WXWA 3U3OA 5CVEA 2C42A 2HB6A 2FWPA 4Q7JB 1WE2A 5HTKA 1C4XA 1UBRS 5I45A 1AVTA 4F5EA 2EQ5A 2GN4A 2QG4A 1AK1A 4PR3A 4QGGA 3R7BA 5IJWA 2BE9A 1JE0A 4KBYA 4YAFA 2AT1A 4R1SA 3LBAA 5SZIA 2H31A 4B79A 4Z99A 4L5YA 4ERXA 5AW2A 1N78A 2DPXA 7MHTA 2Q1WA 4RQTA 5D01A 1N2CA 4CMIB 4DR2B 1GKLA 2C0CA 3KBOA 4PGGA 5KVVA 3BG5A 3BUSA 4MA5A 2EP8A 1HXHA 5EJ5A 1KBOA 1ATZA 3B78A 3RVNA 2D59A 2REQA 2G8LA 4O8ZA 2ADFA 4M49A 4ARZA 3AR9A 3CKYA 4LDQA 5JJKA 2ZWIA 2WT8A 3CUUA 2A78A 2IOFA 4E5KA 4YUXA 1GGEA 1II8A 3LDFA 1YVPA 1JPNA 3JASB 4O4JA 2AG5A 3EXEA 4Z0PA 5A0FA 4WK0B 5TJHA 2J9YB 1DNPA 4H7PA 5IDXA 4CEJA 1N7JA 5IBPA 4EVQA 4E4RA 5A5FA 1F3OA 1SIBE 1DMSA 3F9RA 1Z47A 2R25B 4G37A 4WXRA 4A91A 1VKJA 3NBZC 1HDZA 1EZ1A 2Q07A 3LMKA 2EG5A 3U4GA 1NR1A 5LC1A 1SCAA 1QLJA 5JD6A 4G3XA 1XJQA 1P2FA 3A1UA 1Y3HA 5BW6B 3UYKA 3FUWA 4WK6A 4DGSA 5ICCA 1P2GA 4AIIA 4IVQA 2CZQA 2JFGA 1T3GA 5EWLB 2BONA 2Q1UA 3ZH2A 4EJSC 3BTOA 5L6LB 3R2JA 2C7VA 2HU5A 3MS2A 2Y1WA 1KRHA 5A4JA 1E62A 3RC7A 1CUEA 4MS3B 4U7DA 2OQVA 2A33A 1E2KA 4TOIA 1EFKA 1WUHS 3FPBA 2CSXA 1VQ1A 2FCAA 3QHQA 3KLOA 3KYIB 3I9V6 1OXUA 1PS9A 3K15A 1GUZA 3LGAA 1P7WA 3ZCXA 4LKOA 4D5GA 1GDTA 2V8OA 2OFFA 3B48A 1OAOA 4RSRA 5AQ1A 3G0BA 1WBDA 1SIUA 2OL4A 2L42A 3CRZA 1HZZC 1O6GA 3OIVA 1O95D 1YAJA 5DXAA 4NP6A 2LBPA 4K2HA 2H7CA 2VRWA 1CLUA 5E2BA 3IVAA 2JD2A 3QE3A 1S2GA 1L5HB 2II6A 4G4SO 1P5FA 2WJ6A 4FYYA 3PUIA 3L04A 4FFNA 3L5OA 4EGSA 5L7TA 4R9UC 2HPAA 3ZKAA 1VIVA 3OG9A 4HATA 4EYOA 2MINB 2Q7DA 1IOWA 3OD1A 3GVXA 3M34A 4CM9A 1RPNA 1UMDB 2D0DA 3C8HA 3NC1C 3WS7A 2AMYA 2YNMA 4NENB 4PRKA 5IJ9B 2BZ0A 2H1VA 3LXRA 2X58A 3CH5A 2QTRA 3AHIA 1G0OA 2FZGA 2QN3A 1X8XA 1YZNA 1Z75A 4L08A 4XKJA 1YFKA 4IG4A 3UIEA 3ZNPA 1L4FA 1BHJA 2B25A 2P4HX 3INNA 4JLKA 3TM4A 2IITA 1LJUA 3KTOA 3L06A 4EG7A 4YCMA 2JIDA 4H60A 3TMYA 4UNQA 3MTBA 1Q7EA 3WL3A 4WADA 2A92A 4A8PA 2DR3A 1FZQA 2W6QA 1NW8A 2A9OA 4IPTA 1I0IA 5ISMA 3ORYA 1F12A 1N2JA 4JVMA 4AMZA 1V1JA 4GLOA 3GWGA 4KXYA 3EQ2A 1XQ9A 3RAFC 1JQKA 1AY0A 1FYVA 3BRWA 1U2SA 3R0VA 3HU2A 1NR5A 4PFQA 4ZAFA 1NUSA 4D25A 2ATCA 3M5WA 3IIIA 2VYNA 3EH1A 4PLVA 4XIJA 3I8SA 4JEHA 4LW8A 1YCHA 4KAFA 3VJLA 2Y6VA 3VDMA 3CKLA 3C3AA 4HAXA 4LSMA 3TSWA 1AV7A 3FVTA 4ZYXA 2IIPA 3SEZA 3M3PA 2HJ9A 3BRCA 3IKLA 3L0ZA 4DLTA 3E3AA 5AW3A 4DCOA 2XA9A 4RKWA 4QU8A 2PQ6A 3L6CA 5AO9A 2AWOA 3NCTA 3AZOA 1C9KA 2UAGA 2V58A 2O7QA 1R15A 2QVLA 2Z3VA 3UQYS 3IE1A 1KI2A 4HDSA 3BE5A 5AI5A 1RABA 4ZYWA 3TOCA 4MROA 3KJNA 3K96A 2R1VA 3OE7A 4YJ3A 5CIWA 2A1TS 4JL8A 1QHFA 3AUYA 4RIGA 4X6YA 1IBCA 4BO9A 4DBLE 1VMIA 2GAJA 4ED9A 3EWSA 2ZBFA 1K0UA 2QE6A 5IJAA 2RK3A 3TKYA 1T3LA 1RXYA 2VPZA 3OM0A 3RYTC 5KDOA 4UAUA 3UUGA 4ZOBA 2GRJA 2PT6A 2B3TA 1X1TA 4CN8A 4F97A 4QO7A 2AC4A 3R76A 1N2XA 3UV3A 3P9KA 1N6PA 1FBNA 4YGXB 4WNAA 3WWCA 1UJ6A 4RACA 1N75A 3BWXA 4J4BA 4TTRA 5DRYA 3B9BA 4BMDA 3CRRA 5DHFA 2QPTA 2EJBA 1VHWA 3KKQA 4DXAA 3RS2A 3IEVA 4CLEA 5D85A 4KLCA 1WMSA 1NNI1 5CHEA 2HJHA 4YV7A 1RVDA 4KYIB 5K0ZA 1KJZA 2E6KA 2XCTB 5C5IA 4Q6WA 2P2CA 1O4VA 5MF6A 1KK3A 3SC4A 3BZBA 2QD5A 3DONA 4NCKA 1N0VC 2WTAA 2FHPA 3M3DA 4EFDA 5BQ3A 3GUVA 2ETXA 3ABSB 3TF5A 2UXCB 2JLBA 5I51A 4RVOA 2QL5A 4DF3A 1Y4DE 3HEBA 1R00A 4LYGA 4C04A 1LPBB 3SX2A 4CCWA 1W1IA 2HF7A 3C3DA 4RK6A 3WKDA 4O02B 3IJEB 3KVNA 2FH5B 2VUIB 1EP1B 2GAFA 2Z95A 4N7JA 1D0IA 3K0FB 4MQMA 4ZOEA 5E6UB 3WDKA 4GWKA 1G5FA 3QFTA 4Z6KA 4LGCA 4DQLA 1UBLS 2ZEJA 1Z5WA 2GA9A 2BMWA 2Q2OA 3P4YA 1W0CA 4HUQA 2W2KA 5GWXA 3V33A 1SFRA 1SVWA 1VHDA 4CL0A 3OE5A 3O47A 5EJEA 3EVFA 2IDJA 1SIWA 3JVEA 4HSGA 4LYAA 3CWZA 3ETCA 3TFQA 2AEEA 4JU8A 1C9DB 3P8ZA 1RSZA 4HPWA 4LHVA 3H7AA 4WQMA 3L0OA 1V2GA 2HK9A 2COUA 4XJXA 1ZG3A 1LJ8A 4POAA 3U3ZA 3S70A 5M34A 2AZDA 2EGGA 2R6CA 3PJRA 1R0BA 4L5AA 3L8FA 1J99A 2PUWA 1PYOA 1JLMA 1E4YA 1E2NA 3VO1A 4P2GA 4CQMD 5JZVA 1Y1QA 3EWNA 1LBSA 4Y2QA 4FFBA 1Y1LA 3ZY3A 4BKQA 4NHEA 3GZNB 3ZIDA 3ZDFA 1W36D 3AI7A 3H18A 3V7UA 2FNAA 2QTLA 4K6OA 2XB6A 2PMFA 3C3PA 4G8BA 5DW0A 1NMZA 5EUBA 4ENVA 1KJ9A 2ODEA 2FX5A 2OOKA 2PU7A 5BNFA 1JEQB 1RWBA 2VQ3A 3WSWA 4DIMA 1T9GR 4IQGA 2V7EA 4RK4A 1DAPA 1E8DA 5DMXA 5K8UA 3IALA 4OB8A 2XVAA 3VKGA 5DM70 3H2GA 4B8WA 1TM5E 3WOHA 3JQEA 1QAOA 2ZI9A 2IPNA 4R1LA 2XVYA 3VPDA 2YV2A 2YY7A 3QOYA 3DHVA 4CR6A 1OWMA 3MINB 1KERA 3A4LA 1TJ3A 2WT9A 1Y8CA 3INRA 4MUYA 3HSSA 1OBCA 3KR1A 1KI3A 1P1JA 3TZQA 1P7VA 2HK8A 4ZDKA 4QEKA 2NTYC 4KI0A 4D44A 3H6KA 5FJJA 3AP2A 4FE7A 4F0JA 1PEKE 4ZTUB 3QWIA 3SQDA 4PM4A 2XRYA 2UVQA 1BD4A 2CHQA 2P3QA 3THSA 3UGJA 2J4CA 4LXXA 3BQMB 3I3OA 2IU6A 1UBJS 1IM5A 1BROA 3CU5A 4L0DA 3CRNA 1NC3A 1JGTA 4PVCA 1CJTC 1Z74A 2P9JA 5DI3A 3D5TA 3D6AA 2G8NA 4UFPA 5IT9A 2IEDA 3FTNA 2BEVB 1WM1A 2CD7A 4S0XA 3RYHB 1DOZA 3M4NA 3S40A 5DHTA 3L92A 3NBMA 1C7RA 3ZHQA 1U11A 4GR9A 3L1VA 3F7OA 4YAIA 2I67A 4RK5A 1EVJA 2AI2A 2X2FA 2WOOA 3IUNA 2A67A 2O1EA 2YOGA 3RU3A 2JI4A 4ALMA 4DYHA 4EGQA 4N82A 3TLGA 4E5DA 2HT6A 5LN1A 3FMPB 4RWEA 2R00C 5A05A 3ORSA 3IAM6 1RZRA 4G4GA 1FLAA 1FNNA 1GQQA 3TZCA 4DUGD 4H18A 1GU0A 3DF9A 2G3YA 3HGTA 3OCZA 4O4JF 3LY7A 2APJA 4Z4EA 2Y0BA 5LMCA 3DAYA 3F6YA 5LL6P 4Y9TA 3HTXA 3OAAA 1UJCA 1LPPA 5F78A 5IT4A 3FGPA 4DDTA 1T0UA 1RWNA 2Y77A 4JEMA 4Z51A 2YBDA 1G3MA 1U4OA 2G9VA 2PMDA 2WM3A 2XWQA 3TTXA 2C78A 3ABQB 3AOEC 4LSWA 3U40A 3THYA 2GBLC 3IUMA 3G5UA 3N3AC 2K2QB 1TU0A 3GJ0A 1KGSA 4MVXA 3VR6D 3ZD9A 3WGLA 4Q9KA 1BWRA 3HVJA 4BKOA 4BLOA 2DG2A 4QOIA 4IWYA 1R6UA 3AFGA 4FE3A 3USCS 1V1MA 3DXFA 2Q5EA 3OEHD 1QQ7A 2A88A 1BG6A 1T91A 1QRAA 3QMMA 3FCUB 4M1YA 1A2BA 3F8WA 1OGYA 1GL6A 1N6RA 1NFRA 3IH5A 2FZKA 5L45A 3WIVA 1EVIA 3TE7A 1G2QA 1TF2A 3WMWA 4JYPA 3BK1A 3J7AC 1YHZA 4GH5A 4S1NA 2PBRA 3SXUB 3AMVA 3D7RA 1U6KA 1UBSB 4EEZA 1RKVA 1E4VA 2CVOA 2J6BA 4BFUA 3PX2A 4MPDA 3OHPA 4LE1A 1IZ7A 3FPEA 1M0TA 3H1EA 2MJLA 3AQ4A 2P3LA 3QG1A 1XMQB 4XQCA 3GN2A 4MIEA 2IH5A 3WGNA 5C9ZA 3EARA 1PFVA 4IDFA 3EAFA 5KWIA 1CK4A 1MZVA 1VB5A 3COVA 1AKUA 4JBHA 4X64B 1JU3A 3ESCA 2IPAB 3EVNA 4XOIA 3HLYA 1K86A 2FPXA 4QGSA 2H7VA 2NO6A 1G17A 2W4IA 4WN9A 3EHDA 4YIKA 4NCAA 1D3AA 2H2HA 1NT4A 1BS1A 1WVMA 2CNOA 4PSUA 5TXGA 1GPDG 1SEPA 2WJGA 4PHGA 4J1TA 1YL5A 3V80A 1N77A 2B0CA 4EGCB 2X14A 1L5SA 2X4DA 1RI4A 1MQSA 1CE8B 2BHLA 3GAZA 4J1SA 4O2AB 3L1JA 5SICE 4LRYA 4RV9A 4O63O 2E4UA 1MJHA 2M6SA 2NXNA 1NATA 4WXEA 1G8FA 3O0DA 3QPDA 4H3KB 3ZLVA 1REQB 1UP7A 4K0KB 2V0GA 2A35A 3N5CA 4N54A 2JLXA 3LVFO 2D13A 1XDDA 2D1RA 2CDAA 2V3WA 2Z58A 5JSFA 1A9TA 1SUSA 1QZ3A 3ZC3A 1EFHA 4NOJA 4XIFA 5MGBA 3D4OA 1WDWB 4P7KA 3FZGA 5M3BA 3HWWA 4K1XA 4UVIA 4WECA 2PCLA 4B85A 2QG9A 3NBQA 1Y5MA 2P9FA 2XTJA 5H81A 5ALHA 4M6WA 4A8JB 4H1HA 3OIDA 3UGKA 4CVNA 2QRJA 3B3FA 2DWQA 3PQCA 3UGTA 1JI3A 3HU1A 3RK0A 4CCAA 1B6TA 4I8XA 3IL2A 4O2BB 2G4CA 3B13B 4U00A 2JVKA 1JIQA 1O03A 3FNRA 4KE7A 2JJ8A 5ALTA 1UINA 1O2DA 2EP5A 2G7MC 4OJNA 1LCIA 5BMVA 4EY4A 5C3UA 1VLZA 1Z2OX 4UTXA 2H16A 3F73A 3K9HA 2I5PO 2AYXA 2OXCA 3U7QA 3NAGA 4YJ3F 1XAIA 1XMSA 1GTMA 2O0HA 2QUJA 2NNWB 2GCGA 2OD2A 2IYOA 3HADA 3DKVA 4GPD1 1J0BA 1LPNA 3B6JA 1IQUA 4QDXA 2HJVA 3E8SA 5COBA 2V55B 4QJBA 4X65B 3A2NA 1G5RA 4JEIA 4U3JB 1YMUA 2B78A 2PNJA 2ZB7A 4DIKA 4ZZ0A 1PJZA 5CVDA 2JBWA 3TRIA 4GOXA 2XUJA 1IMJA 1RCTE 4GZ5A 3FVQA 3M4ZA 4GM4A 3IHKA 5AKGA 3MT9A 1F4VA 3C1UA 1UPTA 4A2CA 4ES6A 1Y8QA 3GQBB 4Z49A 3IBGA 1SUBA 1IOVA 1VA4A 4BMYA 5EZ5A 5KTSA 1XTJA 2EVWX 3DOCA 4UAGA 4COKA 3T5CA 1Z08A 4Y30A 4MVJD 3BJIC 3WK6A 3UJNA 1YE8A 3BEOA 4DBZA 4NK5A 4HX2A 4UBNA 1Y7IA 1TT7A 4QPJC 2HMVA 1WBJB 2ZIVB 1TGVA 2OBNA 5A5EA 1Y5NA 3HACA 4OI0A 5TSDA 3QBTA 3BE8A 1I7QB 3QFRA 4P53A 4X63A 4LJRA 3KPUA 4AK9A 2BP7B 3LTEA 1BDMA 2PMEA 1JDVA 1LLCA 2JFYA 3GLHE 4NZMA 1I6LA 4RW0A 5C7YA 5I9SA 2NUPB 4L4SA 1KJJA 4JVNA 2CJYA 1BEEA 5KINB 4IXMA 4KQCA 4Y7DA 2JAOA 2PSDA 1J1IA 1QIIA 4J3JA 2FUNB 4YUYA 2BGNA 4UULA 3FKQA 3WDMA 5FWXB 5MFPA 1E77A 4I5GA 2AUMA 2IH2A 2CXNA 5AXBA 3SJBA 3KZ1E 1D9ZA 1P1BA 2OO7A 1Y80A 5B12A 5IULC 3MSCA 2PKQO 3FIJA 5HHTA 1J0CA 4CGZA 2HX1A 3TEFA 3PCTA 1X7XB 1EXNA 4CL2A 3M6FA 1BVHA 3KV3O 1DRKA 2O7VA 1L5GB 2XIQA 4AWXA 2V65A 4G97A 1W2GA 1POWA 1W88A 1QH1B 2GN1A 2FN3A 3JAMA 4PN3A 2WKPA 3PB3A 4ZODA 2B4KA 3P2JA 1YB7A 5LU9A 1BWPA 4HOYA 4M0KA 4QDJA 1OAAA 3ZGVA 4HVCA 4HN9A 1H66A 4RKQA 3RE1A 3T3GA 5REQA 1E89A 3ZU6A 4Y3UA 3NHWA 1D2MA 2SECE 4TLAA 4G0PA 2VKTA 1G64A 4E03A 4QC2A 1G38A 1XD9A 1CIVA 3OKCA 3TN7A 1ADYA 1FNDA 4YXWA 3UOAB 1U5AA 3L4EA 3MAAC 4UBJA 1CUHA 3QXCA 4JJEA 4NE7A 2G4VA 2N46A 3BWCA 2IZ0A 2GJKA 3PEVA 2NU9B 1Z38A 3UT0A 3KWJA 4F4JA 4AKHA 1V1RA 3HFGA 2WINI 5BSTA 1QGED 2B4RO 3FCCA 3PDIA 1RDFA 4JYCA 4QOJA 1U2ZA 3BQ9A 5F7JA 4J3NA 1WKVA 3O5AA 3GGJA 3FOWA 4F8JA 5BN3B 3VPXA 4ZPXA 1IK4A 1S02A 1VMAA 3CB4A 3ZEIA 4BL5A 4N5NA 4KQXA 4E5UA 3THRA 3AJ8A 4NJMA 3Q41A 3WL7A 5JXIA 2QLLA 1JBEA 2YOFA 4OM8A 4BNZA 1A7AA 1PJ4A 1GPBA 3GJSA 1MGOA 4GZMA 5BW8A 1M2OB 1D2NA 1GADO 1V9CA 3FB4A 3VO9A 4EY3A 1RI2A 5JI2E 2QMOA 3OPXA 1EGVB 2VKQA 4K6GA 5LJLA 4TZ6A 1FU8A 3TBFA 2KW5A 2RAPA 4BX0A 3AL0C 4BLPA 1HZZA 2NO4A 5CEEA 4C7BA 4QFMA 2NAFA 3CQ9A 3EFEA 1V4NA 5D00A 3NHAA 4EKIA 1FIUA 1X9HA 4YALA 1K4KA 1ZH8A 2CHUA 1LSUA 4FONA 4D57A 3AUTA 3PXXA 1DLJA 2YC2C 5GV8A 2ORWA 5TQ2A 5JARA 221PA 1DHRA 1J20A 3PXAA 1JS1X 2DKOA 1U3CA 2VO1A 3LA8A 4I3GA 3A70A 4B44A 1PR4A 3D8NA 4IDBA 1GZUA 3R4CA 2R8OA 4J49A 1B6RA 1KPGA 2QN7A 4NG4A 2ISSD 2QGNA 4OAPA 3RDPA 4BRZA 5JPIA 4YVFA 3VPSA 4DWOA 5KQGA 2N47A 1LK0A 1XNHA 1KL7A 1L7XA 1VG0B 3FWNA 4XYBA 2VA9A 3KB1A 4QHYA 5HDBB 4MWEA 1P0QA 3QI2A 2O5EA 3ZCSA 2XWJI 3DTNA 3T5DA 1OROA 4B73A 4ZMRA 5LOVB 3I9OA 2O3JA 4PHTA 3OZSA 1BMDA 5FA6A 1UK9A 5KNBA 3R3WA 1QGOA 1UBTS 2P30A 3G79A 3PT5A 1S7CA 2E55A 3TW4A 4DQDA 1XEXA 3I1IA 2NYVA 1F6WA 2ACKA 1Q0RA 3HUDA 1KZ1A 4PV7A 4UNPA 4E32A 5LR6A 3R7NA 5TLSA 2XJ9A 4BQIA 3PITA 2ZG6A 4PZEA 2MDTA 5GM1A 2SKDA 1WUJS 2B1QA 5AHOA 3UAOA 3VGJA 2JAHA 3QEOA 4QBFA 4UTVA 3CO5A 3T1NA 3ECSA 1WB4A 3AF2A 4V38A 4IDPA 5F7XA 1Q1NA 2AFRA 1HLPA 4IUDS 4CLHA 4TWJA 3SJ7A 2A0WA 5DISB 4PG7A 2C8JA 1RRKA 5G53C 3V1LA 5IANA 2BEUB 1OXVA 2YFKA 3KUXA 2XMDA 3HSKA 4YAEA 2R86A 4E2WA 2V8BA 2Z8YA 2W7TA 3W7AA 1R1DA 1Z0ZA 2DLDA 3GUYA 1ZO8A 2ZPAA 4NMHA 2A4KA 1NVVR 2DKFA 2KBEA 4PLGA 3TDNA 5FR1A 3WQHA 5JMWA 4DV6B 3NWPA 4JQYA 4FB5A 2EFDB 1CUYA 5FTKA 4H3SA 1Z4OA 3PJFA 1JU9A 3L82B 5EMKA 3JALB 1QHNA 4OB7A 3OQNA 2C95A 3E9YA 4OEHA 5EHIA 5DYGA 1ZYUA 3BGOS 3E7WA 3IURA 3OM1A 4LHXA 2JHPA 3NHBA 5E3HA 3HN7A 2BAGA 2DQKA 3DVRX 1MEEA 1X0VA 4OH7A 4TXNA 4X7RA 3PQDA 2IYFA 2HMAA 1W1WA 4XYGA 5F4ZA 3ZR4B 1JDJA 4F04A 4KNVA 1DBQA 1UODA 1JU4A 2DWUA 3SBXA 3UTDA 3ZXYA 3UJ7A 2WHYA 1RYHA 2FRDC 1NLYA 1UMKA 2PUTA 2WZQA 5DYIA 4N0DA 2ACVA 1ECBA 4A6XA 2BGJA 5HRUA 4HNUA 1YIDA 4LBZA 4BKUA 1U3UA 2MYNA 4L22A 3UM9A 4YYZA 3IULA 1G18A 2VJCA 4KFUA 4RTLA 4R1TA 2W42A 3D4PA 3EGVA 1C0LA 5EIOA 3DEZA 3JATA 2A14A 2VH5R 2O5VA 3OQ1A 2BKAA 4GRIA 5A4FS 3QUCA 3VR4A 2HNKA 2I8AA 2WYUA 4EUFA 5ARDA 1IL0A 2OXRA 4EJFA 5EG5A 2XV1A 3ZUPA 4RF4A 3IBTA 3BJZA 4D9EA 3ZWQA 4Q4CA 3KJXA 4OAQA 4PNZA 1MB3A 4CKYA 2E4AA 3LBHA 2NZUG 1X2BA 4JBGA 5FH9A 4NCNA 2JLZA 1IQ0A 2DFDA 3AM1A 1XVVA 5AJXA 5KYVA 2OE2A 3DTVA 1N0HA 1FFYA 4N8EA 4B6GA 4RD4A 3Q4GA 3A6DA 4QVGA 3KDAA 1RYDA 1IVNA 4CQJA 4MRMB 1DTEA 1FSFA 1NVWQ 1XZJA 3GUZA 4TLBA 3QLUC 4CI9A 1E5XA 2D06A 3LZ6A 1WNFA 4Y2TA 4ZC1A 4BV3A 4BYGA 3CCFA 1T3SA 5SY9A 1FQOA 3JZAA 4Q9NA 3WWDA 2D1SA 1FB5A 1YVUA 4G07A 4YYEA 4DJ5X 5JALA 3QKRA 4CEHA 3F3MA 3ONWA 4RPIA 2ZBEA 1A7JA 2RHWA 1TEHA 3BA6A 1JIXA 4D97A 3RYCA 5JWRA 1JDNA 3HA5A 3WHKA 2OZKA 5IT0A 5IAAA 2HLDD 4D43A 1YH3A 3DTTA 2JGNA 3FYSA 1NJ1A 5TNXA 2CJXA 4XDYA 4FEGA 1C8KA 3X1YA 1WCIB 1ZW6A 4UVDA 5DT9A 1W85B 4XSVA 2E4ZA 3ZXSA 4V24A 2XW6A 4OK6A 3FCXA 2ZVJA 3ED1A 1N25A 1NUHA 3OTGA 4HKTA 3S27A 3UMMA 4B7CA 2ACWA 1Z8DA 1KY4A 1LDGA 2VVTA 2QXUA 7MDHA 2CYBA 2AEJA 4H4DA 5GY7A 3TIIA 4EDHA 3A6HA 1TF7A 1C3VA 2C9DA 2O3UA 2WFLA 2IIBA 2ZBQA 3MT7A 4DV3B 2EX1A 5JAHA 2ZM6B 4ITRC 4E7PA 5AICA 1QU3A 5FAXA 3A6FA 3GF4A 4HL6A 3NBXX 2OBYA 3OZVA 4B5KA 5I01A 1J2TA 1RRVA 1UJ2A 4Q9DA 5L7YA 4EI2A 3QA3E 2QLMA 1AK9A 1XDBA 1QVVA 1SOMA 1FP1D 1F8YA 2HLNA 2O2XA 1WXIA 4X54A 1MIOB 4ZICA 2WTUA 4EM6A 6YASA 3NEJA 5ED0A 4YRIA 1VBNA 1VKHA 2BFBB 3UTCA 4WERA 4QWMA 4KRXA 4TWZA 3H0EA 3TIXB 2FEMA 5A9SB 1Q11A 2WNHA 1IJBA 1TRKA 2IE8A 1PP4A 1ACLA 4DG9A 1OBFO 1LBQA 1GPLA 5A5GA 5LVAA 1XROA 3EMDA 2YIDA 4I9NA 3WI7A 5B57C 1US8A 1DC3A 3ORRA 4NECA 3IDQA 4IXTA 4PLPA 3QEJA 1K7FB 5HQJA 2CE7A 3TI7A 1DAFA 3B36A 4J9VA 3E27A 3JQAA 3P9NA 4JUFA 4MO9A 3R7DA 4AJKA 2FMHA 2IVFA 2ZSUA 1XLTC 5K0FA 3U6BA 3N58A 3QOXA 1CY7A 4HH3C 1JI0A 4B4WA 1S6YA 1WHTB 4CM9D 5JFTA 1M76A 2A9PA 5EKXA 5KC8A 1N2HA 3P71T 4ZRDA 1C30B 4G24A 5DLQC 3UWPA 4R6XA 1RNLA 1X1EA 2IZOA 2ZUBA 2WTEA 3GRYA 4RPHA 2OLEA 3I45A 4HXGA 4U7TB 3B3QA 4K9QA 5DNCA 1YQXA 4JROA 1GTZA 4MCJA 1RLIA 4LOHA 4MR7B 5JCJA 3VNQA 5K09A 4N8DA 4D8WA 1ZNZA 4P93A 1H69A 1U7OA 1RFLA 1D8AA 1ZL0A 4QU0A 4YRNA 1DAOA 4WA8A 4FWBA 4ON9A 3UXMA 4MK4A 3ZHVA 1CX9B 2IHKA 2PHZA 2NWQA 2F3PA 4U63A 4YTEA 4MQ4A 1YA4A 3HJNA 2LDXA 3B82A 1L7VC 5TJ9A 2QDKA 2J9FB 4YQYA 2IY7A 4W7SA 5CXUA 1XNGA 4C9BA 3C3KA 3BRWD 1N2ZA 4WLFA 3C1OA 2O8EA 4PBRA 2R00A 3OSZA 1ZINA 4XZ3A 4E5NA 5CAEA 4KXMA 1QUEA 3N6VA 3AJ9A 4KWEA 3DWFA 5FYQA 3DBRA 1ADGA 5K3BA 4WOKA 2GGSA 2D0IA 4HWSA 4MGZR 4EFMA 1WKCA 1CDZA 3K4QA 5T6BA 4AZSA 1UJBA 4FWIB 1U0TA 1NXQA 2ZQYA 3G7NA 2Q28A 1FP4B 1W30A 3ST7A 4UBLA 1IHOA 2FOLA 3EYAA 1Z16A 3IA7A 5CA0A 4AY2A 1M2HA 1RYBA 1VZ2A 2QRZA 3I76A 4TMVA 3W1WA 5JSKA 2I3GA 2WUVA 2QD4A 2FU5C 4TV9A 2ZB3A 3S2IA 1ZNYA 3AOEA 5I7RA 2CF6A 2GBLA 1MRZA 2FG5A 3TXYA 2XMSA 3LCUA 1FU7A 2IRWA 4E14A 2PZLA 3HXQA 3OE7D 4BMZA 2BTEA 1ETHA 1T8PA 1W34A 4FDAA 3UEOA 4I1RA 1PL6A 4D0NA 1I1NA 1LC0A 5EMNA 1OUMA 2A30A 3TW8A 3TTVA 3KJQA 1NBME 1R12A 2QLBA 5IEJA 4BKPA 4OFWA 1VPTA 4E22A 4NDZA 1NF8A 3TTWA 4AS2A 1L0BA 2FF7A 4PC6A 2DTDA 1NVFA 4XGIA 4GAEA 5H02A 4D9IA 4XWYA 3OZRA 5DNUA 3OBBA 4JOSA 1R6AA 3HSYA 3HEMA 1V25A 4HVTA 4US1R 1SQ5A 3B3JA 3GJ8A 3EOZA 1LDYA 5K2MA 2NVWA 2X7JA 4MA4A 1Z6TA 1Q15A 1XDGA 3KZKA 5CM2Z 2GX6A 1EHCA 3GC6A 3HKCA 1IZZA 4MYDA 4DDKA 2E4YA 3BL6A 2ZPTX 3CUTA 3IR5A 1DELA 4HQ0A 4ID9A 2WTNA 1SKBA 4F4CA 4TUYA 1Z4KA 5FYDA 4FB4A 1HNXB 2HA6A 2NSLA 2W2QA 3TGPA 3T5MA 4QLOA 1XCJA 3L6DA 1E1RD 3N2LA 3JD3A 1LSOA 4QULA 1FJ2A 1TVEA 3KUDA 5EHGA 2DUMA 2ORIA 4G84A 3ADPA 4BNJA 2R11A 4E21A 3HCOA 3H17A 1J97A 3H13A 3AEQA 5JC8A 4L15A 4IW3B 3E1KA 3MFYA 4P08A 1NG1A 1U28C 1ZESA 3AW9A 2YWFA 4GXRA 4Q34A 3WB1A 1P1RA 2XEDA 4WLNA 4XD7A 3S2EA 4HDCA 4DCPA 5JJIA 1KMMA 3RBVA 1G3IA 4RJJA 1Q6YA 3PDWA 4MQ6A 1FNBA 2VPTA 4W4TA 4Z0HO 5JSZA 4AWBA 1XNJA 1HT2E 2X8LA 2WTXA 2VP6A 5F1KA 1NW4A 4H08A 3QF7A 4S0ZA 4QFCA 1UWCA 1FFWA 2FEOA 4M1EA 3WIUA 3OLVA 2AN9A 1Z73A 3OJCA 1QCDA 1S8NA 2Q0QA 2YYYA 4KAAA 5T4HA 3V6LA 1DKUA 3WDLA 4BNKA 4UTRA 3CVUA 1OILA 3DKPA 1AMOA 3K1YA 2FEPA 3SKYA 4XEHA 3FMFA 4ZVPA 4O59O 2FE1A 1G5IA 2J5XA 4IHJB 4BV9A 3O8LA 1G8AA 3NT4A 4RKFA 4X24A 1M1UA 2LP4Y 1H1TA 5IAJA 4HUTA 2QNBA 1MIHA 3LX5A 1SO8A 2B0JA 2C94A 4PQEA 4ZWNA 1X1SA 2IF0A 1EX9A 3L0BA 1USKA 4IDDA 5EUMA 5K51A 4HSEA 3VAYA 4BMPB 5CYGA 1KBQA 2NTEA 1NI3A 2R1ZA 3ZWAA 1Q0PA 2IYEA 4BFCA 1QO9A 5T8KA 4R0NA 3UJPA 2Z2ZA 5ICGA 1CRWG 1G21A 1U9JA 2A1IA 2C29D 2F3TA 4BVKA 2D2IA 1OX4A 4INPA 2RAFA 4S24A 4X6XA 3DB2A 3UAWA 4UM9D 1RPZA 1SVMA 2BFMA 5FO0A 4TTIA 4WN3A 1RP1A 4CRWB 1OFVA 3AR4A 3UXYA 3ZHOA 1AC5A 1DZIA 3N2YA 2FMUA 3IUJA 1MOSA 1Z7BA 2VBCA 3E9QA 4GICA 5JRDS 1P2BA 5G0TA 4EKYA 3E84A 2X0NA 4DXDA 5EOVA 4DPKA 4FQ8A 4QU9A 2P68A 4UNRA 1V5EA 3MB8A 3O2QB 4BHTA 3JQQA 3T8YA 4YAKA 3NVAA 3ACDA 3F6CA 4FNAA 1NXWA 4K6HA 5JQWA 1OJ7A 4Z9XA 2FKAA 4A10A 4E30A 1P4JA 1QQTA 1SVKA 4LXYA 2AIRA 2H0RA 4F6LA 1FPQA 1MUUA 4M8KA 3D54D 4PZZA 2GERA 5K01A 4MI3A 4MYSA 1KOGA 2ZVPX 3R8FA 3E6AA 1A1VA 1H4TA 1TAHA 4HNRA 5H70A 2DFPA 2G40A 3R5SA 3KUKA 2XB9A 3JRWA 3TLYA 2Q5IA 5E3IA 2YQZA 1E2GA 2P77A 2PH3A 2XYPA 3QBVA 1NDUA 2W83A 1PHPA 3PQFA 3QVSA 3B6MA 4PLWA 3ZEAA 4DSOA 3K9FC 2B8EA 1CQIB 1LI5A 1PSZA 2YZNA 1TCVA 2VWGA 4JP8A 2UVPB 4XUGB 4P3XA 1IPFA 1QF7A 2PLNA 4IEEA 4RH3A 3UENA 3D4BA 4AN0A 1AKYA 1NOKA 2ST1A 2BMJA 2YVKA 5LMZA 4IDCA 2RGDA 2Z6VA 2VQ6A 1AKTA 4CG1A 1OC2A 3KKPA 3JPYA 3NP9A 3EFHA 5JMTA 4PO8A 4OO3A 4D1YA 1G20B 2WSSA 2ISQA 3I2YX 3O9VA 1QP8A 3MM4A 3P4XA 1YB6A 3MXTA 2VS1A 2W98A 3SLGA 1N5MA 1H4SA 5L95A 4II3A 3BIXA 3I6ZA 2WKQA 5LBUA 2J9RA 5KHAA 2ZREA 3OQMA 1K3UB 4J91A 4PX5A 3ZK7A 3R9XB 1OTHA 3OD5A 4R1QA 2V1XA 3QEAZ 1MQ8B 2H92A 5DGIA 3N2KB 4W6ZA 2W0SA 3WLMA 3ONEA 5JIBA 3OAAD 5LA6B 4M7RA 3BHNA 1EYZA 2RKWA 4K9PA 4YRPA 4JB2A 2DLCX 4NSNA 3U16A 1U1DA 1JF8A 4I3HA 3LP8A 3DV2A 1B8NA 4G25A