4HATA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 61
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hatA00
3CWQA 3KJIA 1AGRA 2PX3A 3MLEA 2V6IA 1NI3A 4DCNA 1C9KA 1MO4A 1RZ3A 5AJVB 4OQFA 4HATA 2GJ8A 4G5SA 4QJ3A 5KSYA 3CRRA 4X8LA 1GP2A 1SVWA 2KB0A 4OHVA 1QHSA 2QAGC 1G3QA 5E4FA 1U94A 1NP6A 1XEWX 5F3WB 3QBTA 1CS4C 2WKQA 3SYKA 3GJ8A 2WJVA 1J2JA 4ZV4A 2ORVA 3A1UA 2WAXA 1D5CA 3BH6A 4LV6A 3L82B 4UQOA 5FUYA 2AK2A 1NVWQ 5AJWA 3AVXA 3RS0A 4B32A 1N6HA 3GLIB 1QHHB 1FNMA 4MDFA 1JBKA 4Q03A 5E7IA 1Z6GA 4JJZA 4KFRA 2ZJ8A 2BCJQ 1UKEA 2NO0A 4HDQB 4A9AA 2FSGA 1IN5A 4TL6A 4P4SB 1OFTA 4PQRA 4QHTA 3OIUA 5EE0A 3RWMB 4Q01A 1EFUA 1E1QA 2WSSA 2Q21A 2QG6A 3T15A 1ZP6A 4IFEA 4TTPA 2A7QA 2DR3A 5EZ6B 3CR7A 3BOSA 3D8BA 4JLOA 5AR1A 4JLKA 3W5JA 1U9IC 4IW3B 2D2EA 4ACBA 2CHGA 3ADKA 4A0GA 3GLFA 8OHMA 4KVGA 1NG1A 4DLUA 2JA1A 1Q1QA 1YZUA 2A5GA 2OV2A 6Q21A 5FBLB 1L4YA 1PUIA 1U8ZA 3EZ6A 3IEVA 3GD7A 4M53A 3K0CA 3VX4A 4BFSA 3SR0A 3K0AB 4IOKA 5TVKA 2I4IA 4PC6A 1P73A 2C8VA 3L8YA 5L8VA 3SJBA 4R2IA 1OXXK 1TF7A 1QG4A 2OBNA 5L3SA 3ECCA 1Z8FA 2HCBA 1OFUX 3QY0A 5KSPA 3M4YA 3BBPA 4GI7A 5TXGA 2WMNB 2ZAMA 3GCGA 3WP0A 1EFHA 2IYQA 3PEYA 5FUVA 1P72A 2QP9X 4IDOA 1H8ED 5FOSA 3CLVA 4QGHA 1P3JA 1ZUHA 3NBYC 1E1QD 4Q4HA 4MKGA 4IOMA 1UKVY 3GEIA 4V0KA 2C2HA 1UBGA 521PA 1R4AA 3BJIC 4Q4HB 4M9XA 2ERXA 4FMDB 2O8CB 1RKBA 1KDPA 1ZU5A 1SXJB 1NBME 4M1MA 1U98A 1YU9A 1J7KA 2F3TA 1T8TA 4NYIQ 5EE5B 4GOJA 4L9WA 5IRCD 1XMIA 4KFSA 1E9DA 2QY9A 1N0UA 2BBWA 2FPMA 1W36C 3QPUA 1LF5A 2XEXA 2JJ8A 3K70B 1U0JA 2WPDA 3OEEA 1M6NA 2O0JA 3EARA 5JSZB 4A15A 3H86A 1GKIA 4MUBA 3HWSA 3DDCA 1CKEA 2EU8A 1AZTA 3EZ2A 2ZUBA 2J46A 3R7WA 1Z5ZA 2BVNA 5D3QA 3LDAA 2GEDA 4RCYA 4B44A 3PIRA 1OHHA 5JRJA 2O5VA 3M1IA 1LS6A 3WMEA 2IS4A 2KSQA 1N5KA 3OEED 1BMFD 4B33A 2QRZA 2NZJA 2W6JA 3QF7A 2C99A 1IAQA 4MDEA 4XD7A 4KI0A 4ILEA 3SI7A 1XZQA 4LHVA 4N1AA 3K8YA 3EIQA 1KDTA 5KO2A 5M04A 4JVLA 821PA 4ASUA 5CDFE 1PV4A 1XWIA 2W0MA 2FFQA 4L16A 4RZ2A 2UZIR 5C18A 3LO5A 4LYFA 3WHKA 2A5DA 1MABB 1NIJA 2ZPTX 2FPLA 3SYLA 1ELOA 1MT0A 1EESA 4TZ6A 1OSNA 4KLNA 1TEVA 4PPFA 4ZDWA 4Y0AA 3NTUA 5AUPB 4XVQA 3K09A 2ZJ5A 1NN1A 2G1KA 4M1WA 2A5FA 1V43A 2IHBA 2WV9A 1G5PA 3F3YA 2X77A 1SVMA 1JQLB 1G3IA 2J9RA 3HR7A 4MRVA 3GLGB 5C4MA 2WSSD 3OEHD 3CRVA 1ZRHA 3W3ZB 4M1OA 1GAJA 2GJSA 3L0SA 4AD8A 4BGDA 3TRFA 1GNPA 3AF1A 3QVVA 3IIKA 1TU4A 2ODEA 3C14C 2YWFA 4LWZA 2YZ2A 4RVCA 2BWJA 5KNCA 1GNRA 1GKUB 4A36A 3EZFA 4KODA 3T5DA 2EFCB 5G41A 1RIFA 3AUXA 3LNCA 3TJZA 1XP8A 1N6IA 1NMZA 3LX8A 5AUOB 3GEEA 4OL0A 4C30A 1W4RA 2QPTA 1XTKA 1R0ZA 2X1VA 3FDIA 1NLYA 3K9LA 1KK0A 1Z08A 3AP1A 3H4MA 4JVNA 4URYR 2W2TA 3IQWA 4TMWA 1S0UA 2IC5A 5JS8A 2RCNA 1QRAA 4YC7A 4CRWB 4JL5A 4L8GA 5FL7D 2ZRIA 4FW9A 2JJ1A 2FGJA 1BMFA 2XB4A 1P2SA 3B6EA 4OK6A 4HZUB 1EGAA 2HXYA 5JSZA 2QROA 4GSYA 4Z8YA 2F1RA 3FVQA 4B75A 5C46F 3NH9A 4DWJA 3I32A 3KTAA 1W0JD 2F3RA 3THWA 2ZUDA 1COWD 2OHFA 2GVDC 3KKQA 5ANRB 4ZCMA 1Z6YA 3MRSA 4E22A 5JI3E 2NMVA 3VMFA 4NCHA 2BC9A 4M9SA 4YONB 4A1FA 4YLGA 1A2KC 3AKEA 4A8JC 4P31A 3UPUA 4PAQA 4C2TA 4OJKA 4Q4JA 5SZIA 5FPSA 1IN4A 3F0TA 4MKFA 2JLWA 2D7DA 4BE7B 4EAQA 3AVPA 4OHZA 4PR0A 2CEAA 1GRRA 3KDSE 4B76A 2J0SA 2FEOA 3KKPA 3C5CA 1ZINA 3THWB 1J8MF 1C4OA 3EWSA 1W47A 1LB1B 1DTSA 1F2UB 4XTRA 2A5JA 1P4SA 4JBWA 121PA 3NKVA 4CT5A 3IHLA 4B3BA 4HUTA 1C1YA 1ZVQA 4YXWD 5AK0A 2O8EA 5HZHA 4RD4A 2GHIA 4V0LA 1CULC 2PJZA 3U3MA 3VX3A 4JVMA 4BECA 2CCJA 5EQTA 1RRPA 3AF0A 4GOKA 5HTKA 2OLJA 4JKIA 1T8UA 4B71A 2O8DA 3IPXA 1HEIA 5F9FA 4DCVA 4TL9A 2O8BB 1UFQA 5J4KA 5L3QB 3B1VA 2P6RA 3ZDQA 2VLIA 4XVRA 2GXQA 3DOEA 4UNNA 3QKSA 3RS5A 3AKDA 3FHTA 3W90A 2FU5C 3A37A 2JCSA 2GXUA 1LF0A 4W9MC 2OE2A 3RWOA 3VKWA 2GK7A 3BERA 4PC7A 3QOFA 3ZVRA 3TUZC 4AYTA 4KBGA 3G82C 4PXAA 2A30A 4DLWA 4N0EA 1H8EA 1KZ7B 4GBMA 4B3DA 3FKQA 2F1IA 2ZI3A 4QBHA 1CJUC 4UJ5A 4DB2A 3PUYA 4R71A 4DCTA 2V7QD 3K0EA 1XJQA 5L3QA 3U60B 1ZAKA 3IIJA 2CVFA 5LD2B 5EE1A 1E1RA 1ZYUA 2OCPA 5K8IA 2W83A 4A8JA 3MJHA 2ZSAA 1AS2A 1SKQA 4Q21A 5KYKA 3RRZA 2GWHA 1WE2A 1E4VA 3E5HA 3PUWA 5D3MA 4NMMA 3Q8XB 2XTNA 4HLQB 1XB2A 4V0NA 2AFIE 4A82A 2C5LA 2CNWD 3QKSB 2OBMA 5KUTA 1YHNA 4PO8A 2C95A 4Q47A 2ZE6A 4DUGD 4YMTA 3IDQA 1GRNA 5DN6A 3UG6A 4N3NA 4W7SA 3WXMA 2FF7A 3WY9A 621PA 1W44A 1IM2A 5KSZA 3TH5A 1E2JA 4RD2A 1Y63A 4JLJA 1GIAA 3CF2A 3QKUA 3VR4A 2GEUA 3F5FA 2ZE7A 5B30A 1E0JA 2XOKD 1UF9A 2PLFA 2WKPA 5FOTA 1FFHA 4MYTA 5TARA 2ONKA 4JYBA 2R8RA 1N6LA 2AXNA 1Z0FA 2D4HA 4TTRA 4FCVA 4DUGA 1GL9B 1R7RA 2CK3D 3REFA 4B6EA 3E70C 4NYMR 1CR0A 5L3RA 1X3SA 2QBYA 2P6NA 1Q1EA 3KXLA 2QBYB 4JT4A 1NVVR 4MYCA 4MRRA 1R10A 3RS3A 2DBYA 4BFXA 5JRZA 4QM7A 4BPBA 1RVDA 4LPSA 3I72A 4U00A 3AUYA 5FPHA 1TQ4A 2ZEJA 4IEIA 3RRMA 1A82A 5EUQB 2QQEA 4R7ZA 2WBLC 4NPHA 5K8UA 2XZLA 1ZMXA 2MSCB 3FMOB 4HLCA 4Y0VA 2ZQ5A 4US1R 4Q9IA 1E4YA 4BLSA 4PO9A 4Z8XA 3OESA 3CM0A 2Q9AA 2G3YA 4O25A 1GKYA 4LHWA 4M2LA 3AGPA 4ZKDA 1W4CA 3KQLA 5L3SB 4UNQA 5JZVA 2QT1A 5CLQA 3ZIAD 2QMHA 4B73A 3U6KA 4X8MA 5EE3A 1WBBA 1AN0A 1W4BA 1XMVA 3L0PA 4ABYA 1T4GA 2CDNA 3R9XA 3H2YA 1FTSA 3OIYA 2R65A 3ND8A 4QBGB 4ZDIA 2BKUA 3A1SA 3ZS8A 4B34A 2QM8A 1X8JA 3TNFA 3OFNA 3ZQJA 4URZR 2CCKA 3R20A 5FTMA 2ZJOA 1HA3A 3RS2A 3NH6A 1Z2AA 3MSXA 2G6BA 3T34A 4G5QA 1P9NA 4MA4A 1RRFA 4RD1A 3ASZA 1XXHA 3PG5A 2ZREA 2AX4A 5B64A 2QEQA 4C3ZA 1G8PA 3I5YA 1HH4A 2YKGA 3GFPA 2DY1A 1AQUA 2VYFA 2CL6X 1KKLA 1XZPA 2FJUA 2J7PD 3ASYA 3ZS9A 1AS3A 1KAGA 2Y8EA 4EFLA 3VU9A 2IYXA 2VP9A 3BB1A 1G3MA 1R6BX 1R5OA 3VU9B 4AIIA 4EFNA 4HB3A 4RCZA 3HP1A 3N2IA 4GMXA 2E1RA 4X8HA 4URXR 2ZVPX 1J90A 2O0KA 1F3OA 3QPVA 1E9FA 1EXMA 3CNOA 5SZKB 3SJCA 5FI0B 2QAGA 2AKYA 4IOJA 4YDHB 1F5NA 2ZRJA 4HB2A 4DIEA 5IF9A 2YVUA 2WJYA 2IF2A 2ZRLA 4IXNA 4WZ6A 1TADA 4C9BA 2ZETA 2YWEA 2J41A 3AQ4A 3PUZA 5E3HA 2RGCA 1N25A 3ADDA 1RYHA 4Q1EA 3PQCA 1U90A 4C0AC 2YJTD 4RFSA 3C5HA 3ZVLA 1N6RA 3Q5DA 3P4YA 4IJMA 2RGNA 2YOFA 4KU4A 3MD0A 4C0HA 3PUXA 4JBXA 1SXJD 5J5CA 2HJVA 3KX2A 3Q72A 1KMQA 1KK1A 3H1TA 2VF8A 4GRAA 2ZRHA 1ZJ6A 1QBKC 3P1JA 5AUQA 5FTLA 2P5TB 2GF9A 1PZNA 2W58A 3X1YA 4KSCA 4LK2A 2WJHA 4ASUD 2WOOA 4BASA 1II8B 1OF1A 2R2AA 1KO8A 1T3HA 2A2ZA 2AK3A 3A8TA 2JLUA 1OYWA 3ADCA 1E96A 4KYIB 1XFAA 3NBZC 4MUAA 2OZEA 3SHWA 2A78A 2ZRBA 5DE3A 4WIAA 2ZSEA 2GRJA 4M4SA 3FGNA 1HURA 4HAWA 4I1VA 4LBVA 2ZU0C 4P4TA 3TSZA 2A9KA 1BS1A 2WWWA 3TKLA 3ETLA 1SVLA 1NJGA 4JLMA 3TMKA 4LI0A 5JFGA 2QI9C 5CIWA 1YR7A 1DELA 2IS6A 1Z0IA 1N2CE 1V5WA 1E98A 1WP9A 4CEJA 3J81k 3ZH9B 3QKRA 1D2MA 5KPJA 2V54A 1T91A 2VO1A 4D4JA 4LPKA 3KKMA 1SKYB 3OE7D 4KAXA 2OESA 2EQBA 3DZDA 1W4AA 3HDTA 4PC3A 1NRJB 3U7FB 2AFHE 1VHLA 1ZD8A 3AP3A 3K9HA 3HYTA 4RY2A 2FZ4A 1KSHA 4TT3D 1AGPA 2ZRAA 2FFHA 3TR5A 4B2IA 3B1ZA 3GLFB 3PR1A 4ZDJA 4DT1A 3OIWA 1R0YA 4M21A 1KSJA 4MGIR 5CM8B 2W2XA 4XOIA 3AVOA 2Z4RA 1M7GA 1XPUA 2ERYA 1EX6A 2CJWA 1PJRA 2CMKA 3BB3A 4RD6A 1EK0A 1XD9A 4CEHB 2LCFA 2OG2A 4OBEA 2XSZA 2ZYWX 4D82A 1JR6A 2WKRA 3HU1A 4P32A 1JPJA 4P3YA 1ZCAA 3ZVMA 1KI7A 4TMZA 3NDBB 3HU2A 1RFLA 3TUIC 4DSUA 1CIPA 2IYTA 2ZJBA 3EZ9A 3KJEA 1MO5A 3E2IA 1KDRA 4K8OA 4L5BA 1SVIA 2D74A 3IBGA 2WM9B 2CHVA 4OHYA 4I1OA 2FX3A 3FMIA 2CLSA 4PZLA 1IN7A 1US8B 3AB3A 3PEVA 1DOAA 4RFSB 1SXJE 5KTYA 3GJ7A 2GZHA 1FW6A 2NTYC 3FHCB 1KJZA 5A0FA 3RC3A 3CO5A 3FMFA 5JJLA 4HEJA 1EFCA 2GCPA 1HTWA 1II9A 1M1YE 5FR2A 4EQ6A 1B23P 3FTQA 1WCV1 4Q4AB 3S1AB 2OBLA 2PBRA 3QF4A 2V1XA 4BFZA 4XTCS 3K0FB 5DN6D 1XTSA 3DVLA 2IYLD 3GJ3A 1ZCBA 2J5XA 3IUYA 2NO7A 5E95A 2ZRKA 1KSGA 4MKHA 2YWHA 1OJLA 4DCSA 3GLIE 4QGAA 3THXB 1TU3A 4IDQA 2JAQA 3KFXA 5H70A 2L0XA 5AJYA 4Q48A 1IXZA 4LHXA 5EXTA 2DCUA 3WMFA 3AF2A 3TSWA 1QHIA 3CPJB 3U7EB 1XTQA 2ODBA 2E87A 4JMPA 4CYMA 1TTTA 1DS6A 2JJ1D 3K9GA 1E0KA 4PPGA 2ZRDA 1G16A 3V4RA 3CNLA 4PPQA 2D2FA 4AKGA 3KQKA 2W00A 3R8CA 4L4UA 1YE8A 3QKRB 1QVRA 4A2QA 4URWR 4Q1CA 4A92A 4LHZA 4AURA 4G5GA 3LW7A 1CJMA 5IT5A 3Q3JB 5C2JB 2WWGA 2WTUA 3N70A 4WW0A 1RC8A 2QSYA 3C41J 3CRMA 3BH7A 2MMCA 4JBYA 4PSKA 1FQKA 4AKHA 4NTZA 1YZQA 5SZHB 1FMJA 2IYSA 2GXAA 3GLHE 1E9AA 4G01B 1KOFA 5DSZA 2BDTA 4WA7A 5SZJA 4E03A 4BFTA 1DVRA 1JEEA 4XVUA 3IGFA 1K6MA 1BO6A 4A0HA 2HT6A 2YOGA 4NCIA 1D2EA 1MV5A 3LBHA 2IEZA 5BWMA 4EPYA 1ESMA 1DAKA 2R6CA 4UKDA 3EPHA 2Q0HA 5JCZA 2ZJZA 3LVRE 3TAHA 3OIVA 1PVOA 3PEUA 1NN5A 2XTMA 2WJGA 4HZUA 2PZGA 2G88A 3C8UA 4Q1DA 4BLRA 3IEUA 1G5TA 1NBMD 2GXSA 4BFVA 4MGKR 3HJNA 2RB4A 1IOZA 4KFUA 3RRYA 3UK6A 4NYIR 5JHGB 3SS8A 3KQNA 3MWYW 3LQQA 1MOZA 1BKDR 3QE0A 2FG5A 3LV8A 3ADBA 1CR4A 4V03A 3QKTA 4MRSA 4EUNA 1RE0A 3CKLA 1N0WA 3I8SA 1OH5A 4RD3A 3S1AA 1EFRA 1KY3A 2LKDA 2DFKB 3KKOA 1I4TD 2VQSA 3U4QA 2P2LA 2VF7A 3EG5A 4KSBA 4TL8A 3ZVNA 1M74A 5B58C 5H1YA 2VL7A 1HQCA 3BE4A 4HAXA 1A2BA 2PT5A 4DLYA 2VRWA 5E7JA 1XPOA 1AJEA 1JPNA 2ZRFA 1WRBA 4WZAE 1TUEA 1KI6A 1Q12A 3K0FA 3U3RA 4FCWA 2Q9BA 3NWJA 1E2FA 4PZZA 3SBDA 2C9CA 1BH2A 1OB5A 3KUDA 2FE4A 3ICQB 3EIEA 1I2MA 2ZRMA 1VG9B 2FWRA 4LJYA 5KOYA 2XNDA 1PLJA 4D0GA 1ZM9A 3D3QA 4YMSA 4FXPA 2J7KA 1O3YA 4KLZA 3O8DA 1JECA 3AH8A 4OQLA 5DNYB 1M7BA 2YC4C 1H8HA 1WXQA 2VP0A 2A3RA 4QBIA 4FD2A 1P6XA 1DG1G 2CHQA 1WB9A 1E2EA 2RGNC 1KI6B 2IWRA 4FN5A 5A5GA 1E2DA 4E5UA 5BN5A 1M2OB 2WWFA 3I3SR 1TF5A 3B8HA 1UBCA 3SZRA 3VNVA 4M1KA 1OYYA 4NDZA 2OAP1 1OIWA 4IVQA 3D7MA 3C16C 1Z06A 3KQHA 3MFYA 1ZC3A 3TK1A 2G1JA 4DLVA 2IA5A 2G9NA 1LTQA 3AF3A 1VDZA 1W36B 1GZSA 4AI6A 1K8RA 3QENA 2WIAA 4UXIA 5LPNA 4YQFA 4LJ5A 4UNRA 5FPKA 4LY6A 4LRWA 4Q7KA 4II7A 4OQXA 4LDJA 4F7WA 2HCJB 3PFIA 1HV8A 1Z3IX 2BMEA 1ZD9A 4V0MA 5HZKA 4C0SA 1QF9A 1E9RA 3GJ4A 4MKIA 4IRUB 2GAAA 1TMKA 3SQWA 3FPAA 3T1VA 4E09A 1OB2A 1FPMA 2CNWA 2DB3A 3WMGA 2FPKA 4QGGA 4PO1A 3DKPA 3B1WA 4AG5A 2DHRA 2IK8A 2XZOA 2IUTA 4BZXA 3SC3A 2XSZD 1GSIA 5GADl 3R9WA 3KTAB 1NVVQ 2IL1A 4V0OA 4UNSA 5TV2A 4LYJA 1G7RA 3LA6A 4YMUA 3T61A 4NE2A 3KXIA 3HU3A 3A1VA 1IY2A 1NL3A 1RRGA 3GFTA 2G83A 4GP6A 3KB1A 4Z1MD 2OO7A 2YYZA 5UKDA 3WRYC 3M0EA 2O8CA 2QE7A 3TW8B 2GDJA 2RKOA 1H8HD 1GNQA 1ODFA 3A4LA 4B74A 1OIVA 2ZM5A 4LV5B 1NMYA 1XU4A 3UKDA 3RHFA 1R5BA 2KBEA 1LVGA 1DE0A 4S2EA 1YQTA 2WHXA 2ZIAA 4QHSA 2QN6A 1B0UA 2G77B 1XD2A 4AK9A 4OI2A 1NLFA 2REOA 3TIFA 3C4JA 3QVUA 3I73A 5FUXA 4D26A 1IJFA 5J40A 4C4PA 2W0SA 5JLJA 2R6AA 2I1QA 1IQPA 5J4YA 1KNQA 3A1WA 5FOWA 2SHKA 2GILA 3TE6A 5DH9A 5EXPA 4IEEA 1OV4A 1GL6A 4EKDA 4LYHA 4EPWA 4TWZA 1EFTA 2WJJA 4FCTA 1TQ2A 4PSVA 1CBUA 1EWRA 1TL7C 4ZCLA 2B8TA 1UEIA 3MCAA 4M22A 3K0SA 4CVNA 1W7AA 1UDXA 3NC0C 4Q4AA 2B21A 1U8AA 2R6FA 2QE7D 1NBMA 4GL2A 3W6NA 4WXRA 3FYHA 4QOSA 3NXSA 2J87A 1SQ5A 4J0QA 1ZD1A 1F2TA 4JLPA 4NL4H 1UAAA 2PJRA 1R5NA 3DMNA 2OILA 3O8BA 1S9DA 2QA5A 4EPRA 2ZAOA 4FWTA 2IT1A 2HV8A 1MH1A 1VYTA 3OE7A 4TSFA 1YR9A 2IUSA 1XCPA 3RABA 5DI9A 1CJVC 1NIPA 2X8AA 1YZGA 2P5SA 2OXCA 1BYIA 5JS7A 3VQTA 3U5ZB 1GUAA 1X8KA 2VP2A 1X6VA 1FX0B 3RDPA 4MYHA 2EFDB 3L43A 1KI8A 2RGBA 5EUMA 3W6PA 3VR5A 3WYFA 4DDVA 1DAMA 1QVAA 1FP6A 1XF9A 3JVVA 1NN3A 3CF6R 4CEHA 1G17A 1IY1A 4HLDA 1UBFA 2JLQA 2AN9A 2ZE8A 4A8JB 1D6JA 1G9XA 3EC2A 1AIPA 1FOEB 5FTJA 1AA9A 4D80A 4US0R 2QGNA 4DZZA 1SGWA 4D81A 2CXXA 1XMJA 4CEJB 3LLUA 4CEIA 3B7GA 3UMSA 5CLLA 3KB2A 5JWOA 1GDDA 5J4LA 4A6XA 4LBYA 5CK4A 1G4UR 1R2QA 2JATA 1RW4A 2HUPA 1JJ7A 1II0A 3UANA 2PLRA 1FX0A 4LJAA 4HDCA 2XGJA 3RNLA 2ZR0A 4TLAA 3CBQA 4PAOA 1NLZA 3OEHA 4KBFA 4O3MA 3L0IB 2XXAA 1E2LA 3T12A 1I4LD 4TYPA 1Z0KA 1OFHA 2BEKA 4KVAA 2VP5A 1PUJA 4IXMA 3LVQE 5C4GB 4Q7JB 4IVPA 3AM1A 2EFGA 2CCGA 3CX6A 2NZ8A 1F2TB 3A36A 1TF2A 1BYUA 2ZTSA 1P2TA 3B82A 4D4LA 3PUVA 3U44A 4MRNA 5FOXA 2GBLC 3LWNA 1Z63A 1T5IA 1WMSA 5KPDA 1NMXA 2ZXUA 5J47A 4MH0R 2WWIA 3QXSA 2ZYVX 2C98A 4QXAA 1G6OA 1W0KD 2R6GA 4DC9A 1NSTA 2ZYTX 1P9RA 4GT1A 3U6BA 4OHXA 3PCRB 4DEXA 1JNYA 3FFAA 2DWQA 4BEJA 2DPXA 2REBA 4H1UA 4V02A 1A5TA 5KNBA 3JVUA 3WBJA 1AQYA 1JI0A 2Q6TA 2QSZA 3KL4A 3Q7PA 2J0QA 2Q3MA 1NNEA 2H7VA 3MWJA 5KDDA 1N5JA 4URVR 3SHFA 4YMWA 2H17A 2PZFA 2KBFA 3U44B 4LHYA 2ODNA 5CJ2A 4F93B 1E9BA 2IBMA 4C7OA 3EIHA 1SZPA 1XXHE 4CZ2A 1G19A 3OFND 4Q19A 1D2NA 3BK7A 3BRWD 1S3GA 1YRAA 3GPLA 3THXA 2OFWA 1VCNA 3BAFA 4LJ6A 3NDPA 1U2RA 2O0HA 2FH5B 2WAYA 4PQFA 2W6IA 2ATXA 2FGKA 1XMSA 1E0AA 4TSFD 3FKSD 1LS1A 1X1SA 3MJRA 1OHHD 2ZS8A 4LC1A 1TPZA 3BC1A 1QZXA 2CE7A 2HYDA 2UKDA 4AC9A 2P65A 4G1UC 4RFVA 4G5RA 1DO0A 1PLKA 3VAAA 3CRW1 3P20A 4ZKEA 2W6JD 4XWKA 3EASA 1P61B 1TQDA 4QBFA 2V4ZA 1KI3A 1Z6TA 1Z6XA 2C78A 2W2VA 2IYWA 4KHZA 3N2EA 1Q1BA 1CJKC 2QQ0A 1ETUA 2FFBA 5EP2A 3EC1A 1ZIPA 3AVYA 1US8A 1S4QA 2F9MA 4ARZB 4DSNA 3NEYA 3ZD6A 1VCIA 5TMPA 3P26A 1CRQA 4F4CA 2X19A 2IYVA 4HAUA 2J1LA 2NO1A 1G7CA 3G5UA 4UJ3A 3ZJYA 4DXAA 1T5LA 5FR1A 1ZC4A 1IXSB 3I61A 2J59A 5A4JA 2YNMA 3DL0A 4KO8A 1U8YA 5EJEA 1HQYE 1HYQA 1QHHA 2JLRA 2ORWA 2QORA 5HE8A 1U0HC 1ZM7A 4GZMA 3RC8A 1ZNYA 4ZIRA 4KYUA 4Q9JA 2NO6A 2OFXA 4EIWA 1TX4B 4HUQB 1SHKA 2MSEB 2ZI9A 5GJCA 2VHCA 4A2WA 4F4JA 2WSMA 1E3MA 4W5HA 3U3OA 1FP7A 3QXCA 1S3SA 3U7GA 1N5IA 2VBCA 2PZEA 2QRNA 5CIQA 2XX3A 4I99A 5FI1B 1CLUA 1M7HA 2J0UA 3KKNA 3EWAA 1HY3A 2ANBA 3RLFA 5FTNA 1YRBA 5FTKA 1FMLA 1Z22A 2JLSA 3B1YA 2JLZA 1UKYA 2D62A 3ZQ6A 1MRSA 2QPOA 1LY1A 2BKEA 5DYGA 1E2IA 2QT0A 1QHXA 3B5JA 1NVXQ 4A2PA 3TAUA 1VTKA 3KJHA 4HLUC 1AK2A 2BV3A 2V55B 2FV8A 1SVKA 2JIZA 2QTHA 3B60A 3R7WB 3KXKA 4QNMA 1HT1E 1WQ1R 3RVBA 5HE9A 4RKEA 4PHFA 3T35A 3W8NA 1NY6A 3NC1C 5DI3B 4CIDA 5IHPA 1DO2A 5B57C 1VCOA 2J7PA 2ZSFA 3A4NA 3QXXA 1P75A 2BHRA 1NN0A 1G20E 4UXJA 2BEJA 4Q5IA 4KITB 4NKRA 4B35A 4POAA 4Q9LA 2HLDA 2ZUCA 1Q21A 4B3XA 4US2R 1OXSC 4BLOA 4BZQA 4V0ME 1DAEA 5EXXA 1E94E 2ZS9A 3Q85A 5IDVA 2B8WA 1MO6A 2AXPA 3UMFA 3BGWA 4D4KA 3RSOA 5JCPA 4BLQA 4PC2A 1G8YA 5DHFA 5BQ5A 1OH6A 4ZCIA 1KI1A 1SVSA 2OSBA 4XWOA 1XTRA 1E79D 2XJ4A 2PX0A 5JWHA 4AY2A 3LBIA 3SBEA 4DRZA 3VKHA 4NONA 4ESVA 2HJGA 3SU8A 4DJTA 4B6FA 4IFBA 1KK2A 1P7CA 1ZM3A 2PT7A 3BFVA 2IF0A 5D3MB 5BW8A 4GMDA 1KNXA 1GM5A 1SHZA 3LRPA 2EYUA 5KDLA 4C0QC 4URUR 2H5EA 1HE1C 2GCOA 2R44A 1TUIA 1G4AE 2N1BA 3KUCA 4LJ9A 4TYQA 5DO9A 2KE5A 3GLHB 1OT3A 2BJVA 4OI1A 2OXRA 2VA8A 1HE8B 2WIBA 3D6TB 2IXEA 3HYRA 3NIBA 5DISB 1XBTA 1XPRA 2JDID 4AKIA 2BMJA 1Q57A 3BORA 3VTKA 3C15C 4DDWA 2CLCX 5FUWA 3EX7C 2ZRPA 1QDEA 2LWIA 3MG9A 5G40A 2K5UA 1KMHA 3LD9A 2O8EB 2IXGA 2C9YA 2DWOA 1IONA 3U7HB 2QTVB 3FHOA 3I62A 2PEYA 1UM8A 2C96A 4DLZA 5GJBA 4HLUA 3PITA 4B43A 4UXHA 2IX3A 1Q3HA 1OPXA 3RAPR 3WNBA 1T9HA 2OM2A 4BZPA 2IWHA 4PX9A 4RSGA 1CEEA 2HT1A 3PXGA 1CR2A 3SNHA 3K09C 4CT4B 4F91B 4FMCF 3VFDA 4EFMA 5FBVB 1KAOA 5KU1A 1OW3B 4LJ8A 3QIAA 4PC1A 4PSAA 2IEYA 2XTZA 2F55A 3K70D 5EZ5A 3CH5A 3IQXA 2OCYC 1EX7A 5HCIA 3X1DA 1IHUA 4KJZA 1T3SA 4Q00A 4BLPA 3OAAA 1E2MA 5EP4A 4WVFA 3U2QA 3EAQA 1E1RD 4LBWA 5GVSA 4TZ0A 2LKCA 4GP7A 3GMTA 1Q22A 3QBVA 2QMEA 5DIFA 1ZIOA 1Q0UA 2EWWA 1N6OA 4EJSB 3HPQA 3P32A 5IK2D 1RRCA 2HYIC 2ZJ2A 3Q5EA 4K81B 2IUUA 4ESHA 2FEMA 2H18A 5BN3A 2VP6A 4PTLA 2GVZC 4Q02A 4U7DA 2JDIA 1SXJC 4HDOB 1K5GA 1F2UA 3B78A 2XNSA 3WNCA 2HF8A 4HI0E 4RJLA 2ZVQX 4R98A 3A6PC 2Z0MA 2EFHB 1QG2A 4P0TA 1YR6A 4Q66C 4TQ9A 4IDNA 3K70C 4QFMA 4EJSA 2VHQA 4U02A 4Q1BA 4JIMA 1E2KA 1KZGB 1VECA 5FFMA 3LQRA 2OCAA 2XNDD 3K0AA 1T0HB 2J0VA 1HUQA 4L9SA 1N6NA 3RRNA 1WBDA 4DDUA 5BYKA 3LBNA 2JGNA 2MMGA 1DEKA 4CEIB 3T5GA 2BBTA 2YINC 5JEEA 3DKVA 3NHAA 3VR2A 1JJVA 2ZSBA 2AHOA 3TQCA 2BJWA 2GZAA 2JEOA 1R0WA 2WWHA 2I3BA 1UDWA 3GFOA 3IKJA 3QUSA 5JMTA 5K8LA 5JJKA 3QXJA 4AWXA 3K53A 2ZS7A 3DPUA 3R9IA 3FOZA 2IHYA 1XEFA 1ZM4A 1T6NA 1P2UA 1Z29A 3GJ5A 4RZUA 1DADA 3ZLJA 1UEJA 2NQ2C 2F9LA 1VPLA 4Z51A 4Z1MA 4PHTA 4QJ5A 3M6AA 2X2FA 2R62A 3EW9A 5DGXA 2ZE5A 1KO7A 3GJ6A 1RJ9B 2F1HA 1TAGA 1NKSA 2H8KA 1MO3A 4XH9B 1GOTA 1RJ9A 1YVDA 3NBFA 3AVTA 4C0BA 4ZIRB 5GJWC 2P6UA 3WBKA 2GETA 1F6BA 4GFDA 5E7MA 3W6OA 3W8RA 2GZDA 3T1TA 4HUQA 3FE2A 2ZRNA 3A58B 3AKYA 1E2PA 3CH4B 3BD9A 4S35A 5F98A 1VKJA 2H16A 4IKEA 1G5RA 4IOLA 2XITA 3UWOA 5CB6A 1KI4A 4NZYA 2V9PA 2GTPA 2X2EA 4IHQA 5FL7A 1J8YF 3CIOA 3ZZUA 2ZI4A 3DZ8A 3IHWA 1L2TA 1L8QA 1NY5A 3WRXC 3THYA 1AS0A 2P0EA 1ZM2A 1O87A 5CITA 4OQMA 1P2VA 1L4UA 3ZD7A 3SFZA 1ZNXA 3VR6A 4JT2A 3GLGA 3U4QB 1ZW6A 3U61B 3RSLA 3B13B 2RGEA 1Q1ZA 3TVDA 1VHTA 4DSOA 2YC2C 3CX8A 1Q44A 4C0LA 2BBSA 2VEDA 3GEHA 3QI2A 2J3EA 1WF3A 1WDTA 4KCGA 1VIYA 2HXSA 1E9CA 2DYKA 2ZI5A 4OYHA 4EJSC 1JXMA 2AWNA 4BQSA 4B2PA 1G3RA 5JECA 3CRQA 3CWZA 3WP1B 1NG9A 3RANA 4NH0A 3X1WA 2NGRA 3X1XA 1VG8A 1UKZA 1FUUA 2WJIA 3DOFA 4QC2A 1X86B 5JEDA 3LLMA 5B2ZA 2Z6VA 5G3ZA 4XJXA 3P4XA 2NO9A 4QL3A 1CP2A 2ZSDA 421PA 2NG1A 4LZZA 3IPYA 2V7QA 1N6KA 5JJIA 1ZU4A 5TB5A 1A1VA 3WNDA 3C7KA 2IW3A 4AKEA 1XD2B 3LY5A 4PANA 1E9EA 4LBZA 3KZ1E 1KY2A 3V9PA 4CGZA 1OFIA 4EPTA 2VPPA 1FNNA 1YZKA 4WXPA 4XSGA 3VR3A 1KO1A 1YZNA 4E07A 1S9HA 4C2UA 5FPTA 2FNAA 1G64A 5EXSA 1KDOA 1KGDA 4JVSB 3UWKA 5FOUA 1K5DA 4QJ4A 4B2LA 4ZI2A 1LNZA 1XX6A 5TY0A 3TR0A 1JXOA 2JJ2D 2CBZA 1JB1A 1T0JB 2YOHA 1Z0DA 4LSGA 3LX5A 3UXMA 2JLYA 1JR3A 4AYWA 1E0SA 3EA5A 4HSEA 4TN1A 1J99A 4TQAA 1KJYA 4ZI3A 2WZQA 2ZITA 4IDHA 1NF3A 1VYVA 3O8RA 4DHEA 3NEJA 1MRNA 4PHHA 2I1VB 3ZZTA 1KHTA 2G0TA 4I1UA 4KV9A 2O52A 3L0OA 2AKAB 1S1MA 4TMTA 5LBIA 3GP8A 1ESNA 3RS4A 5JBQA 3D31A 1G1MA 2B7BA 3W34A 1W48A 4QGFA 5CB8A 3PJRA 3Q9LA 1E2HA 4JLAA 4UNPA 1S1CA 2JASA 3AVUA 2VHUA 3LXRA 5J4HA 2DWPA 2PEZA 4I81A 2KJQA 3FB4A 4LOAA 1AKEA 4G0NA 4D0LB 3QNUA 4JKYA 4JLDA 4W5WA 2GA8A 4D25A 1I2DA 2GBLA 3RS7A 1U9IA 2B92A 4LCBA 3T1OA 4HAVA 5H8WA 4RZXA 2NOAA 3KFVA 3THOA 1G3UA 5LD2C 1JR3D 5HKKA 1P5ZB 2B6HA 1KKMA 1XD8A 3KJGA 5FL3A 3LFUA 2QNRA 3I5XA 1XNJA 2WVJA 2Z83A 4ARZA 4EPXA 5AUNB 2NIPA 3UATA 2XB2A 1A7JA 2C03A 2ZR9A 4G5OA 3IO5A 4ITRC 3N5CA 1OE0A 4WOPA 4DVGA 3FMPB 3AV0B 1E79A 3CONA 2CJWB 4ZPXA 1T3LA 3IO3A 4TYYA 5ELXA 1OXVA 2BOVA 3THYB 5HCNA 2VHTA 4PAMA 1IBRA 1U99A 1DPFA 1W0JA 2IYYA 2KI5A 2EYQA 1OXUA 1VG1A 3AEZA 1TNDA 2F7SA 4CW7A 2PMDA 2QAGB 1OIXA 4FWIB 2B7CA 1CR1A 3MAAC 1JEDA 2N46A 3QG1A 2DFNA 1XTIA 3FWYA 4TLBA 3AKCA 2CK3A 2VTKA 4LUCA 2J45A 3B9PA 3TGPA 3OAAD 2V3CC 4DSTA 5EP1A 1OH8A 1CU1A 1Z0AA 1KSFX 1UJ2A 2EVWX 3SJAA 2RHDA 5EE9A 2NPFA 4BWYA 3VHXA 1VIAA 1GFIA 3AP2A 2AWOA 2BMDA 2FFAA 1S2MA 1ONBA 4JSTA 1SXJA 1G7SA 1QHNA 5G53C 2FOLA 3LW8A 2H57A 1X1RA 2VH5R 1R8QA 4ZO4A 1G8GA 1ZBDA 5AWFC 1AM4D 2EFEB 3E1SA 4Q1FA 1XEXA 3QJYA 1U0LA 1XDBA 4EPVA 2A5YB 3GJ0A 3X2SA 1YZTA 5LB2A 3R8FA 3ICEA 1KIMA 2QL6A 1Q3TA 1YZLA 2PCJA 1GTVA 1R8SA 3ZYCA 3SOPA 3DMDA 4BFYA 4DB4A 1LW7A 4G3XA 4D4MA 2D3WA 4M1TA 2O8FA 3GJXC 3PV0A 4BRUA 4HB4A 2ZROA 1XCMA 2FSFA 2EWVA 3U3KA 5HPYB 1E2GA 1LV7A 4Q9HA 5J4VA 4YXWA 2YHSA 1KO5A 3K9NA 5CYPA 1G8FA 2OUKA 1UPTA 2ANCA 1KI9A 4IDPA 2ZI7A 3QEOA 1XJ0A 2ZYUX 5DI3A 2CE2X 3QSYA 4FMCB 2R9VA 2ATVA 3PENA 4Q7LA 4X8OA 3QQ5A 2WMOB 3TUJC 2OCBA 4JL8A 4Q7MB 3SE0A 4NCJA 3MUFA 2XJ9A 3A4MA 4BFUA 1SULA 1XRJA 3ZIAA 5BN4A 1ZNZA 4XD7D 2D06A 4OK3A 3EA0A 5FPYA 4D6PA 1W49A 3EPJA 3NVAA 1XEXB 2V1UA 4TLEA 1DAFA 2E9SA 4Q1AA 4BEBA 5LB4A 3BFXA 2YV5A 1NKTA 3BIFA 4L15A 3SYNA 3WHLA 3EXAA 4NP6A 3FFBA 1KK3A 1GVNB 4QNRA 4PPNA 4M1YA 4MQBA 1IY0A 3CZQA 2RMKA 4TT3A 1F60A 2IS2A 1M34E 1WA5A 4C0KA 2D7CA 4TMVA 1W1WA 2J0UB 1YJ5A 4PZYA 3NBXX 2VSFA 1JR3E 1D9ZA 2EW1A 4KXFB 5C1BA 2QTFA 4LJ4A 2WOJA 4R9UC 2ZJYA 3QF4B 2TMKA 4Q18A 2QUZA 4DLSA 1UADA 4HAYA 3GLIA 2OEPA 1G7TA 4NYMQ 5F2EA 2QM7A 1GL7A 1X8LA 2AD1A 2GESA 2ZU6A 3BWDD 3DEFA 3CZPA 3Q7QA 1BIFA 4GZLA 3V4FA 1RPZA 2C9OA 1XXHB 1N0VC 3CF0A 4B3GA 5GVRA 3LH5A 3DM9B 4JS0A 3EZ7A 3I8XA 5DHAA 2ZR7A 1EG7A 1NJFA 2GJAA 4OKSA 4P4SA 5GJVC 3SJZA 3TW4A 1N6PA 3O47A 1MABA 4RZ3A 5JWRA 2MSDB 2W6ID 2R6DA 3U3JA 4MRPA 4NU0A 3L2OB 2OFOA 4PFSA 1GRQA 2GJKA 2JJ2A 3I4LA 4MGZR 2H1LA 2VSOA 4WBSA 4O2RA 5KSOA 4XIGS 3UMRA 2GNOA 3AVVA 4GNKA 4OJQA 3RYTC 1LFDB 3TSOA 1XEWY 2P3SA 2ZJAA 3IILA 4RKFA 1DG3A 4BRWA 2P67A 4GOXA 2JLXA 1FZQA 2GCOB 1VYUA 1S8FA 3CPEA 5CYOA 2QGZA 1JAHA 2GCNA 3JZMA 3GLHA 4YMVA 2VSXA 4FMBB 1IXRC 1OKKD 2QMUA 4JSYA 1Z6AA 5CM9C 4K46A 2NPIA 3VHLB 3CB4A 2AR7A 2HF9A 3AVQA 5FOVA 3TLXA 2HDNB 5EP3A 1R0XA 2XOKA 1OXTA 2FN4A 4P33A 4TMKA 4DT1B 4IVRA 4Q9KA 2IYUA 3VNUA 4NYJQ 4DBLC 3GLGE 1F48A 2RH5A 3SQXA 2ZANA 4AYXA 1ZUIA 2IYZA 2GEVA 1CTQA 1YKSA 2JIZD 3REGA 3A1TA 4B47A 3OHMA 2QPAA 1OKKA 2DFTA 2HEIA 4A6PA 3G0HA 2Q3FA 1II8A 4MITA 4N0DA 1AZSC 2VIIA 4AG6A 3GLFE 1Y3AA 4QM6A 4M1SA 4C0JA 4BUJA 4O0MA 3BH0A 4QHYA 4ON9A 1A4RA 4FMDF 4JYCA 2G0NA 3AGQA 2C77A 2KWIA 1EWQA 1XTJA 1P60A 1W46A 3OZXA 5FBRB 4DKXA 1BOFA 3CUEF 2ZRGA 3AF4A 2BBOA 1SVOA 3HR8A 1YR8A 3VR1A 1QHGA 4XWAA 1KYIA 2QP3A 3IBYA 2PL3A 1NSFA 1Z47A 3TQFA 3QXHA 4JLBA 3VKGA 4FIDA 3P27A 1M8PA 4CF7A 4TMXA 4DLRA 3SN6A 2QU8A 4B48A 1W2GA 3O8CA 4NCNA 3NG1A 5KHOC 1DARA 3CPHA 4OK5A 2Z5FA 4F38A 1P9WA 1G6HA 3PEWA 4OHWA 4BFWA 1DBSA 1KTVA 2CL7X 1J70A 1W5TA 1XCGB 3CX7A 4FINA 1P62B 3UIEA 1Q20A 4DIDA 5L3VA 3B9QA 5LDDC 3WYAA 1QHYA 2DFLA 4M9ZA 4DDTA 5CK5A 2F1JA 4LC0A 2WPDD 1I4DD 1W2HA 4W5JA 4F92B 5JHHB 2IYRA 1EFRD 1XJCA 3AVWA 4ACAA 5CDFA 1FL9A 3I92A 4JLNA 1KMHB 2GF0A 1JQJC 2AD5A 3MWLA 2BIFA 2ZI6A 3B85A 4RD0A 4DEYA 4F4IA 3FKSA 1KO4A 1CRPA 1W0KA 3DHWC 4LX0A 4OI4A 1Z83A 3EPKA 4YDSA 4EDHA 5KNDA 2RHMA 1E2NA 1OLOA 4HAZA 3OF5A 4ZDKA 2RGAA 4ERNA 3CNNA 3UG7A 4XSHA 4TL7A 1VG0B 4CDGA 1AKYA 4TQUS 2UZ3A 4HYYA 2RGDA 1W36D 2HLDD 721PA 3GQBA 4QKQA 2RGXA 1RYFA 3V00A 3CW2A 2AL7A 2Z4SA 1COWA 4DLXA 1CXZA 3K1JA 1MR3F 4TLDA 3TVTA 3H84A 2ZRCA 4D2IA 1Z2CA 4DLTA 1IN8A 1ZUNB 3W3AA 1TQ6A 2WWXA 2VHJA 3BB4A 3ND9A 4JL6A 4NYJR 3WYGA 4JZKA 4PQYA 5JI2E 4TTQA 3F8TA 3QPWA 2QAJA 5CJPA 3W5IA 2OT3B 2UVQA 4EQ6B 2WWYA 2O8BA 1HT2E 5AJZA 4NCKA 2Q3HA 4D0NA 5KDOA 3PVSA 2FSHA 2XZPA 2OLKA 2OAQ1 2GAOA 4M0LA 2Z43A 2QMOA 4PHGA 1MKYA 1UBEA 3MWKA 4FI3C 4HZIA 1E99A 5DYIA 3QEJA 4LYAA 3IIMA 2ODWA 3JZAA 2PMKA 4DCUA 4WZBE 5BXQC 1N3BA 2PCLA 1GWNA 2FA9A 3CR8A 221PA 4Z54A 2FMXA 2IXFA 3MGCA 5FBQB 4BLTA 5F9HA 4R2HA 2RAPA 3L8ZA 3NHBA 1FUKA 2CLDX 2QZ4A 1IJEA 1GITA 4U5XA 4M9QA 3TBKA 2O8DB 2PH1A 4Q4LA 1ZNWA 3LAWA 2YWGA 4Q4JB 1E6CA 2BCGY 1Z28A 4H9GA 4A0RA 2FSIA 2N42A 2FZLA 5FH9A 1GILA 2V8OA 4KFTA 2IS1A 2QENA 1GG2A 3I1FA 2RGGA 3X1ZA 5IK2A 4NBSA 1S96A 4LJ7A 5G3YA 1E9SA 1NVUQ 3T1QA 5HR5A 4B3FX 1CF4A 1E32A 5K8TA 5FBWB 3ZZ0A 2VP4A 3ZGXA 3QG5A 5H68A 2JLVA 2BM0A 2FDCA 3KQUA 2ASEA 2F43B 2BMFA 2ONJA 1Z07A 4NHOA 1D9XA 2GJ9A 4C7OB 1JALA 1G18A 3BXZA 1G8HA 1TEXA 4I1SA 1DAHA 4O2LA 2BM1A 4MYUA 4JLVA 5HKKD 2C04A 4OI0A 4I4LA 4WAUA 2GKSA 2CVHA 2XXAB 3H0KA 1FQJA 1IN6A 3SEAA 2WICA 5TDHA 3B2EA 1H65A 3MMPA 2V6JA 2F6RA 4H1VA 4P4UA 3HPRA 5BYJA 1G291 4TLCA 1VCMA 2CL0X 4TYWA 1KJWA 1D8TA 1CJTC 4QG7A 1W5SA 4HB0A 3SFVA 2F43A 2XAUA 2QP4A 3ONWA 3W9YA 3EPLA 3BS4A 4A4DA 3BFKA 1FTNA 1G41A 1DAIA 3LXXA 2O8FB 1E69A 3K0CC 4MGYR 4OQNA 4A0FA 1SKYE 4GPTA 4LV8B 4B3CA 1L7VC 3DM5A 4TYNA 1Z0JA 5P21A 1PLLA 2REXB 1G21E 1JAIA 1N5LA 2Q9CA 4JJKA 4M8NE 1VMAA 1ANKA 5DLQC 3SDZA 3T06B 3B1XA 4GDFA 3DO6A 1OH7A 5AJXA 2H92A 1KI2A 4QRHA 1U81A 2ECKA 4LGMA 1DAGA 2GK6A 1E2QA 2ORIA
chains in the Genus database with same CATH superfamily
4WLOA 3AY0A 3CWQA 2X40A 1AGRA 3KJIA 2HMAA 4GX5A 3ZE6A 3EVDA 1IYZA 4D44A 2OA0A 1W5BA 5G0UA 1TM7E 1YS4A 3QA9A 1VJCA 2BFOA 4MJ3A 5KSYA 4YQEA 5B1HA 3UC9A 2DBQA 1RFGE 3F6EX 2QAGC 1G3QA 3K1AB 3NIWA 4K9LA 4P6VF 4BQPA 3HVRA 1WW8A 2YQ4A 2ZIXA 3FCAA 2PPLA 4G1BA 5HIMA 3V97A 3O2SB 4R81A 4HEA1 2JRCA 3SYKA 8MHTA 3T7TA 1S02A 5F4ZA 5DNDA 2Q2NA 3SIXA 2XUGA 3A1UA 1D5CA 3BH6A 3PCXA 3PWSA 5FP0A 1KYVA 7ABPA 5J4VA 3FY4A 2DX7A 2O59A 2EKDA 1FW8A 2P27A 3CUYA 4NNPA 4X95A 1Z6GA 1XDSA 1YUMA 3EOZA 3HKBA 4KQ9A 3B7WA 5JYBA 5JRDS 3RF6A 4HDQB 4EHLA 1TZBA 8ABPA 3KOOA 4OCZA 3IRVA 5NULA 4LMAA 2V97A 2ZSKA 1P7PA 4CL2A 1EDBA 3WV5A 3JSAA 5ALTA 4B5KA 2WSSA 1I1HA 2QG6A 3I1JA 5FAXA 4LTMA 4TTPA 3T15A 5ED4A 5EZ6B 3CR7A 3D8BA 3H65A 4JLOA 5AR1A 5THXA 2GNAA 1U9IC 4IW3B 2D2EA 4BB6A 3ADKA 4CUJA 2GN4A 4TS4A 2E21A 3HJFA 2V7BA 1LLFA 2XT0A 4DV1B 1TIBA 1M6WA 1U7PA 2A5GA 2NPOA 1EFLA 2OV2A 5A2GA 1JKJB 1MPXA 4ZT6A 4BCCA 1C7RA 3WHIA 1YVRA 5L9AA 1V6AA 2F8MA 3TQHA 2NV2B 3PXXA 3K0CA 1H1LA 3BL6A 4ZAVA 4FT4A 4IOKA 2I4IA 4PC6A 5TVKA 1H9AA 5CX1B 2QD3A 3EF0A 3H9BA 5HS4A 4BO0A 4WD3A 4D42A 2Q1XA 2VJQA 3Q2KA 4R2IA 4U8GA 5F2NA 1ETHA 1JR4A 4O4JB 2C4TA 3ECCA 3LP5A 2VUSA 1DC3A 4ZJUA 5JCOC 1K9VF 3QY0A 5CPBA 3T0IA 3O84A 4MEAA 3BBPA 1GPJA 3LO8A 4Z53A 1RACA 5DWVA 2W5UA 1XVVA 1B43A 3WP0A 3PKIA 3WJ2A 2Y1FA 1PX2A 5C8DA 1P72A 3PC3A 4C4SA 5E8RA 3FOBA 5THQA 1P7YA 4JU9A 4QGHA 4Q4HA 1E1QD 2JC3A 3C3BA 1EFPA 2PLNA 521PA 1MN6A 3GEIA 1JFLA 3ELBA 4L74A 3IX7A 3LQFA 5DV9A 3BJIC 4H7KA 4Q4HB 4WKGA 2ERXA 1KS9A 4QATA 3AZOA 3QVWA 1RKBA 2OD2A 1U3GA 4OMCA 3VZCA 4CM9A 3AWIA 2XUKA 4M1MA 5M29A 1I33A 4NJMB 1J0DA 2F3TA 1T8TA 1XUOA 3JQPA 3WK5A 1SA0A 4NYIQ 1HFEL 1FSGA 4CQMA 4D4GA 4L9WA 1ZK2A 1H05A 4BAGA 3G23A 1E9DA 1WDKA 1UWVA 2BBWA 1IB6A 2XEXA 2PKRA 3PR2B 3D3JA 4XM2A 2WPDA 3SC2A 4UAUA 3UIEA 4M7WA 1QAMA 3U7QB 1A9RA 5FUBA 1N2BA 4MUBA 1MJ5A 3WAKA 2EU8A 1AZTA 2ZBDA 3R24A 4AB1A 5DMHA 4EF6A 2ZUBA 2YZKA 1REQB 2BVNA 4B3RB 4OXKA 2M9MA 5EG5A 4B44A 3PIRA 4ZHSA 2P79A 5F1YA 3M1IA 1I9GA 2Z30A 1AZLA 3PC8C 2UV8A 3HWWA 1MHPA 4GQAA 1N5KA 1OAAA 2P2ZA 2IIPA 2PGNA 2QRZA 2W6JA 3NTQA 4QAQA 3QF7A 3RH0A 1PD0A 5EFZA 2I3ZA 5LDHA 2C99A 4QOGA 4LNUB 2BSAA 3QEMA 1NFQA 4KI0A 3DH0A 4ILEA 4TRJA 2JAOA 3M82A 3IIIA 1JG1A 3LUFA 3RBXA 3OTHA 3SI7A 4ZGWA 5K0CA 3CNHA 5DX1A 4CV1A 3KSAC 5JU6A 3I04M 2E4YA 3V7WA 2CFIA 4L27A 1T5BA 4QXOA 4HY3A 2W0MA 5CDFE 1RQNA 2FFQA 3MT9A 1C7ZA 3LO5A 5JARA 3WHKA 2A5DA 2JBAB 3AHCA 2IU4A 3IUPA 4HLNA 4G4IA 1ZJWA 4JQSA 3SYLA 1RIIA 1ELOA 3QLUC 4S0ZA 1OSNA 5TC4A 5I7WA 5ALHA 4MI6A 1WHSB 5LQDA 1QPZA 4ZDWA 4JEIA 3NTUA 4Y0AA 4F2PA 4F97A 2ZJ5A 1P2FA 2NT4A 4LRTB 2G1KA 4WEQA 1LJUA 2ZYDA 4FW8A 3ENVA 5DGDA 5AICA 1X7YB 1XTVA 2IHBA 2B6NA 1YASA 1PR9A 5CCXA 3F3YA 2GEBA 3ANTA 1SVMA 4LVNA 3HR7A 3A1NA 3FUVA 3QBEA 4YRPA 4C4XA 3TLGA 3PVCA 2ZFUA 4UUAA 3HXQA 1VMIA 1A5ZA 4M89A 1WU7A 3QE3A 2P2GA 4MS1B 5EIAA 2QYTA 3W3ZB 1N32B 1H6DA 1GAJA 2XOEA 2RK3A 4QDOA 4AD8A 2D6FA 4J1QA 3HWRA 1T24A 5FNZA 4D8UA 4IQGA 5BP7A 1TU4A 2ODEA 3CCBA 2Z8XA 2E4XA 2BWJA 2P1ZA 3K5WA 1CX9B 3AFOA 1GKUB 5JD3A 5B1YA 3EZFA 2PLAA 3ASUA 3H17A 4QJBA 5ERGB 2QG9A 5FHQA 5TF4A 3T5DA 5A1TA 3FYUC 4YWJA 1Y8QA 4ZTUB 1T4BA 1WW2A 1M2VA 1P1BA 3GN2A 4BO8A 4U2GA 1DOHA 2FLKA 1NVAA 1UK7A 2RC6A 1OLXA 2X1VA 3K9LA 5IC4A 3VOAA 2O3QA 5CD1A 1DIHA 3GV0A 1WP4A 2DHQA 5IS2A 5SY9A 2JJYA 4JVNA 4TMWA 4PXSA 1PL7A 1JG2A 4FBGA 4B2YA 2IYNA 3Q15C 4JL5A 4CRWB 4P7BA 1B2LA 3HSYA 4QULA 5FL7D 2WA1A 2VG8A 3PT9A 3EQ2A 2PQ0A 4KXLA 4CFSA 5FPQA 1PU2A 2EJBA 4HZUB 4JB0A 5DCUA 1FYFA 5K3BA 1EGAA 5JSZA 2BEWB 2C92A 2VZ8A 3V1UA 2X1LA 2XEDA 4B75A 3KUUA 1MJNA 4I0WB 5DYYA 4DWJA 5C46F 3KTAA 2Q29A 2V03A 4NBWA 3LCUA 4I50F 4DAEA 4H27A 1XVTA 3KKQA 1JFTA 1EUQA 4TSKA 3DLIA 4ZCMA 1N2ZA 3MRSA 5TRTA 2QVBA 3MLBA 1MXFA 2NMVA 4NCHA 4EQZA 3BMOA 4MJ7A 5G0WA 4YONB 4LRSB 3NBMA 4A1FA 2P41A 4YLGA 3AKEA 3ROQA 1BNCA 5LBTA 2FFRA 3AR4A 4YV7A 3QE2A 4KQIA 4CMIB 4ZQGA 1WOYA 4C2TA 2A7XA 4OJKA 4Q4JA 4L78A 5KVQA 5SZIA 2X0DA 1PR4A 1FVXA 1POXA 5FPSA 2BFEB 3O95A 4TV8A 1HNWB 1LBQA 1TEHA 1Z2OX 2I66A 4KUGA 3AVPA 3W0LB 3TZQA 3DC2A 2O2JA 1R18A 4DQDA 1DKMA 3R7FA 5ESWA 4YGXB 3IE0A 2FG7C 3JALB 3FCCA 3U7RA 3CZ4A 3KKPA 1FFBA 1CRZA 3INRA 4I4TF 3H8WA 1RQRA 1NUSA 1ZINA 3T9FA 4LGVA 4YAJA 5CVTA 2VJMA 4ZOQI 2Q0SA 3LNTA 5A9SA 4N5IX 4H0CA 1GZHB 3RC7A 4JXZA 2BEVA 1O5IA 3FDJA 4JBWA 1SCUB 3D8RA 3NKVA 3BE5A 1ULZA 3T7CA 3H1BA 1Z8DA 1QTQA 1GPUA 2X9VA 1NSYA 2VSQA 3U0BA 3U1TA 2L2QA 3C39A 1C1YA 1Y98A 4MP6A 4MQEA 5AK0A 3M6WA 5T4EA 3W8DA 4D3DA 5HZHA 2DERA 4EELA 1RT9A 2O8EA 1NF9A 2W2KA 4MLPA 3W1VA 4BTEA 5EIEA 4JVMA 4QVKA 3E35A 4FB4A 1KFEB 5AHOA 4XJVA 3TXYA 1ZL2A 1RRPA 1ODCA 4JKIA 4UVGA 1T9ZA 3OUZA 2O8DA 3C8MA 3DA8A 1HEIA 3CUVA 5LQRA 3AF6A 4IIJF 2Q5JA 4TL9A 4Y2QA 4L3OA 3PE6A 2EZ9A 2P6RA 5JC1A 4YH1A 1GSHA 4JASB 3ZDQA 2XYQA 3VTFA 2VLIA 2RI0A 4D4IA 1ZHOA 4U2KA 2GXQA 1PD1A 3QKSA 1A8PA 1QCDA 1QCYA 3E58A 4LOLA 2NUBA 3FVRA 3FHTA 3JARB 2B4TO 3A37A 3E9NA 3O8NA 1ZJJA 1T8RA 1H42A 2TS1A 3PYMA 3ZWKA 1XZJA 1FTQA 2N0SA 3OEYA 2GK7A 2QMZA 3P7MA 4ZQIA 3UHJA 3L1HA 2X9QA 3ST7A 1RQPA 1MG0A 2PIDA 3U62A 3ZCQA 4G0OA 4HVCA 4RTLA 5C4IA 3MPUA 3ZCTA 1R3UA 4O2BB 4GX2A 2A30A 3H4TA 4N0EA 1H8EA 4GBMA 4PXAA 4TN5A 1UXHA 2G9UA 1NVBA 3FKQA 4QDZA 5E1OA 5EJGA 4QBHA 1KDYA 4B6RA 4BNJA 1Z5GA 2XUPA 3GZTB 3PUYA 3BXFA 1IQRA 2V7QD 4HYEA 1DINA 1X1TA 1H1TA 2EJWA 3HDYA 2GS9A 2QN7A 5FT9A 4C3OB 5L3QA 4ZVKA 2V4MA 5K8CA 1OILA 5EE1A 1S7CA 1Q11A 2AOUA 4BVBA 3OQOA 3HEBA 1F14A 2VDLB 1SKQA 4HWPA 1CW2B 1WE2A 4D92A 5ICGA 3NM4A 3IBSA 1AU9A 4KUEA 1D0VA 2Z4TA 2XF2A 4OREX 5TQ2A 1YJBA 2ZQYA 5C5CA 4RDIA 1V47A 2CNWD 1PT7A 2FN8A 3RQIA 4ZT3A 1NGSA 4OV6B 5KUTA 3B9BA 5E2IA 2JPDA 1H6BA 2Q2QA 4NAVA 1YHNA 3QVLA 4JOSA 4MR8B 1BWPA 1GUZA 4KTTE 3EFOB 1XN1A 3C74A 3IDQA 1DKRA 1JAYA 1GRNA 3JAWA 3QMPA 4FI3F 4KUHA 4CF5A 5KSZA 2HRZA 2PLWA 3THYB 1E2JA 1NLUA 5DWQA 3RWBA 2AEEA 5CG2A 3QKUA 2V5UA 4WUVA 1OBFO 2H1SA 2WVAA 4UCWA 3VR4A 4BNZA 4NMHA 3PZRA 5TS3A 2B83A 1MEJA 3K20A 4QXQA 4CDRA 1FYWA 4E15A 4TQGA 2EERA 2XOKD 5A1JA 4WCFB 1NC1A 2WKPA 3Q6MA 5FOTA 5CNIA 2YY6A 4GLJA 2OCIA 1EJ0A 4LAFA 5EC8A 1V8PA 1VSQA 4GOOD 3KYDB 1Z0FA 3DDUA 1TMYA 3DOHA 1TUBA 3B36A 3L92A 5H0IA 4IMJB 3H1PA 2CK3D 1TECE 1VYHA 4GO1A 3ICCA 1T29A 4JJ8A 3E82A 4L9RA 3U3DA 4C43A 3P9SA 2IE8A 2DEUA 1DU4A 1ZH6A 3U37A 5L3RA 3WNVA 4JYZA 3IIEA 1Q1GA 5D1NA 4BLUA 3OPVA 4F06A 2Q0QA 4XVCA 2ZSUA 4JT4A 4DUYB 3O0TA 4MYCA 4RL4A 1R10A 5JRZA 3VU0A 4BFXA 1RVDA 4LPSA 3MTBA 1K4MA 2AF4C 4H7EA 1TQ4A 3G1TA 1KEEA 4KBYA 3C85A 4YIHA 1O57A 2XKBA 3T52A 4GI2A 3GJYA 1X7GA 2WBLC 1GKKA 1IHPA 1YE5A 5K8UA 3OZGA 4HLCA 4CG1A 4N9WA 2R00A 3NIDB 1JTFA 4OGLA 5CNKA 1YULA 2YRXA 4Z8XA 3OESA 2Q9AA 1VMKA 3NNDA 2G3YA 3GT3A 4MIYA 3OMLA 4OH7A 4WTOA 3RVKA 3DS8A 3I58A 1I3CA 4TKVB 4EHJA 3AGPA 4I2NA 1T2DA 4UE6A 4AMYA 2P68A 4C89A 2Q8NA 3H16A 5CLQA 1VB3A 2CNLA 1VLMA 1ZXBA 4RIEA 3U61B 3I9KA 2G4VA 3NYRA 3IFSA 3WWZA 1PFYA 4NSNA 4YAOA 3L01A 3IR7A 5DCWA 4U7TB 1QQBA 1JWAB 3NWPA 2ZPAA 4D3SA 1N8KA 4ENTA 4WOJA 2OB2A 2J3QA 1ZCZA 3DVRX 5ALLA 2IH4A 3RPEA 3FZNA 3EOAI 3MINA 3DLBA 4QBGB 1WXGA 4PPYA 3D1JA 3L5OA 1X8JA 3ZQJA 13PKA 2BY4A 1O95A 3BJZA 1L4EA 4Y7CA 3T1HB 4KPGA 4UVIA 5AW8A 5K6AC 1UMDA 2ZJOA 2JGDB 1E62A 3QK7A 5J58A 1OVMA 1VE9A 3KP1A 3RS2A 4KNYA 3H9UA 3U26A 3GLKA 3WLRA 2HJSA 2RHWA 5DKFA 1V8ZA 2D0OB 3V4OA 3W5BA 3V7FA 3NIGB 3MLAA 1QGOA 1DC8A 4EYOA 3B5IA 2E37A 3ZK7A 1ISPA 2DPHA 1G8PA 3TLJA 3I5YA 4GAEA 3KQQA 2GZRA 1ULBA 3WWOA 1AQUA 1DCFA 1KKLA 3ASYA 3L6BA 1R9JA 4ENWA 5B53A 1IJKA 4BX3A 2KLHA 1KAGA 2Y8EA 3WL5A 2H65A 1NR7A 3I2FA 2IYXA 2VP9A 3BB1A 3RC2A 3L1VA 3MGKA 3GGSA 1UQRA 2TRSB 1R5OA 3O92A 4EFNA 4V2UA 4HB3A 5JZSA 3HP1A 1JSZA 5KYGA 4J0KA 4GMXA 4MPPA 1FFDA 5EWMB 1JDVA 4X8HA 4URXR 4QRIA 3UMYA 1J90A 3ZXYA 3ITKA 2C61A 3KT6A 3QPVA 3ZX4A 1EXMA 5SZKB 2V96A 4NZPA 3SBOA 2GLXA 2QAGA 2W9XA 4A6DA 3CVUA 4ENVA 5ALEA 1C0LA 1ES9A 1RWQA 2OO5A 3DL7A 1EWYA 1JSCA 4ZK6A 2ZRLA 4WZ6A 1EE2A 1NTOA 2ZETA 3IYLW 5B1IA 1OCEA 2UU9B 2PA3A 3B5EA 2WDPA 3PUZA 5BSTA 2I62A 4GPBA 1N1EA 3G9XA 4MOWA 5BO5A 3DP9A 2I4MA 4DPKA 5DCLA 3OHPA 4EJFA 3WL6A 1U90A 4C0AC 3G2LA 4GI3A 1GZ3A 2D2IA 1RWBA 3C3CA 3JQ9C 4JA0A 3QE9Y 1M1YA 3DQZA 3PL1A 1EQUA 5JAMA 5EQJB 3PUXA 4JBXA 2AZTA 3CNEA 2HJVA 2PFGA 3PNSA 4G23A 1PHRA 3HVIA 4NBTA 3PPVA 1I4EB 2TYSB 2WWTA 4BQIA 4GRAA 2ZRHA 5AUQA 5C31A 4G1VA 2W58A 3PRYA 5ALOA 2A1TR 4LK2A 3WKAA 5HK9A 2G40A 2WOOA 1CUFA 1OF1A 2X1MA 3Q6IA 5CT8A 2AK3A 3A8TA 3NZEA 4K1XA 1DHRA 3NNSA 4YLEA 4Z1OA 1OYWA 2OAGA 2JLUA 5KKAA 1E96A 3ZWBA 1RCTE 3FD8A 3EJWA 3VZDA 4AO8A 2BCEA 3G2QA 4UDXX 3E0XA 3K2EA 2A78A 5AOVA 4FYKA 5DE3A 1LBHA 3R5SA 3LQKA 1JG6A 2ZSEA 4NV0A 3WJAA 3PHLA 4EW6A 5ECYA 1G60A 2YHIA 2J5KA 3ZXUB 2C9MA 4LFCB 4DMRA 2R5NA 4I3GA 5FA5A 4EGQA 3LWZA 3W7VA 3PTAA 3UV3A 3OLCX 3CUKA 5TEWA 2WWWA 3TKLA 4ZI7B 4JLMA 3OCVA 1NJGA 1HDRA 1WSWA 2C97A 2V7EA 4DV4B 3QNWA 1YR7A 1DELA 2NVBA 1HFJA 1V5WA 4JC0A 4FFNA 1NJ5A 4CEJA 3K2IA 4M0FA 1A9TA 3TQIA 2FG6C 3R5TA 4GWKA 4OQDA 3HCNA 3JWPA 1AO0A 1VBFA 1SKYB 2P2YA 1DIOB 2R8OA 4KAXA 2OESA 3DZDA 4QT0A 1W4AA 4YP0A 5E3IA 5HBGA 1TK9A 1Y8RB 3LDUA 3TZEA 1J07A 1U3WA 4YWHA 4ZOLB 1VHLA 4UHHA 5K6TA 3HYTA 2FZ4A 4TT3D 4BS9A 2O7RA 2X8JB 2XA2A 1SK9A 3SYTA 2JAWA 3GLFB 4IRMA 4ZDJA 1LDNA 3ZCUA 5C9ZA 2G4CA 4FEAA 2QW1A 3FYDA 1R00A 2ATCA 4MGIR 3LVBA 4X90A 3KAJA 1OGYA 3IMEA 3RT7A 1PJRA 3VC7A 1SBZA 2P4HX 1EK0A 3QHQA 1ULSA 4CQMD 3UV7A 4Q7QA 1U7OA 2ZYWX 4D82A 1Z38A 4ZZ1A 4K9KA 1TTPB 4P3YA 4UUOA 3QXGA 3ZVMA 3K1ZA 4XYLA 4DZTA 1E9VA 3TUIC 2V7UA 2SKCA 3KJEA 2FP4B 1MO5A 3DDZX 4Y6PA 5B7GA 5HBRA 1GNSA 1MTOA 5K0NA 3RU7A 3QWIA 5CBPA 1VRCA 4DMHA 2AUNA 3SY8A 3VYTB 1W0CA 4ND1A 3FMIA 4TGLA 1IN7A 2QZZA 3PEVA 3HYLA 4LOHA 3WV4A 1SC9A 4UM9B 2IKQA 3GJ7A 4JEUA 5HF9A 1P29A 3RIEA 3O2QB 3RIMA 3RC3A 5A0FA 1M10A 1QGZA 2VYCA 4J7AA 3VNSA 3FMFA 5LNK1 2YR0A 2ZQZA 3PR3A 4EQ6A 1V25A 5FR2A 2VNIA 1EM8B 2NXEA 2GM3A 2GPYA 3R0IA 1MAVA 2GHRA 3LRXA 4Q4AB 1V71A 4UUQA 4MYRA 1YIDA 3T7EA 3ZWVA 3QF4A 2JLCA 1TYAE 5DN6D 1XTSA 4TV9F 3I12A 2NO7A 3IUYA 4YFYA 1SXPA 2Q07A 3LIPA 3KWLA 1JDZA 3JATA 4QGAA 2FR8A 5DTJA 3THXB 4IDQA 3DE6X 4IPTA 1KJ9A 4OJYA 2JAQA 4XKJA 5H70A 3OD5A 3TXAA 3WMFA 2YBDA 4CKYA 1RCUA 1SOWA 3AF2A 1PVOA 1KBOA 3CPJB 2G9QA 4C08A 3KALA 1PGJA 2ODBA 5JO0A 3R1IA 3PF9A 2I7VA 2JJ1D 3IUSA 2FMKA 1AGNA 5TPZD 1GLGA 5L7YA 3C1AA 3V4RA 2HL6A 2IW1A 3DBVO 3DF9A 2GLUA 4TRRA 1BROA 1FUYB 2ZZKA 3PC4A 1OZ0A 1PFWA 2E55A 3GK3A 3EEQA 3QKRB 3O4RA 2OPBA 3PWTA 1PJ4A 2O3SA 4S05A 3BGDA 1JU9A 4KC0A 1AG9A 2IU3A 3N9IA 4JT9A 2YH2A 2H51A 4ZK2A 4FSDA 3B38A 3FGPA 3MCWA 4GM4A 2B2XA 4XARA 3Q3JB 4CQMB 1PWEA 4LFAB 1NPYA 2HT1A 3JTMA 1XZBA 2WWGA 3BGIA 1RC8A 2RH4A 2Q41A 4UQPA 1YDHA 4MX8A 2OZPA 2QSYA 1ZWKA 4HN4B 2GN0A 3BH7A 1E1CB 2J3JA 2ZJ1A 4PSKA 1MEEA 3R3ZA 2FEKA 4G5HA 4XB1A 3NV9A 4NTZA 4DBLE 1FMJA 2J9XB 4QPCA 4CR6A 3AUJB 4ZCQA 3GLHE 3M2PA 3QW2A 4AJ4A 4C6TA 3J81A 3TPCA 4J1NA 2HEGA 3DE2X 4E03A 3V7YA 3TTVA 4BFTA 4AZ0B 1DVRA 1XDUA 3LECA 4HGPA 3WOHA 2PGXA 1U3VA 3IGFA 1G9TA 4PLTA 5PNTA 4A0HA 2P62A 1BWRA 2ZJ0A 3TM4A 1PG5A 1WCWA 4WA8A 1D2EA 1CUJA 2Q8PA 4HDMB 4KEAA 4PZUA 5E6SA 3VOTA 3G2OA 1MV5A 1I3LA 2IEZA 5BWMA 1ESMA 2AW5A 3GIWA 4DJEC 1L5OA 4R1PA 4HX2A 1P0MA 1IOLA 4WOKA 4E88A 2R6CA 1ZITA 5T6BA 5JCZA 2A9JA 4R3NA 2HQOA 2H48A 3GGPA 3TAHA 3EHEA 4MVYA 3IEPA 1NN5A 3PEUA 5GP1A 3UZUA 2PZGA 2IH5A 2WUGA 2E82A 2WYUA 4F9EA 3OT4A 1G5TA 2VDOB 2GXSA 4O2AB 4EKEA 2WLTA 2JJQA 3O21A 5AI0A 4PXYA 4BFVA 1YQGA 4FN4A 2JK0A 4NIMA 2RB4A 5BWNA 1IOZA 1TKRA 3EMDA 1Z4PX 3H3JA 3RRYA 5JHGB 1SD1A 3WLLA 1SCDA 3WLSA 5AM2A 4MPRA 1MOZA 4PIVA 3CE6A 1FFYA 5KQRA 3QE0A 3JAWB 4W5TA 5DTEA 3KTOA 3LV8A 4HBZA 3U80A 1PZHA 1CR4A 3H13A 3HDGA 4UTOA 4Z0NA 1C7FA 4EUNA 1RE0A 1N0WA 3HCCA 3KYBA 3O26A 3OM1A 4IQ8A 1KY3A 3S1AA 2HW8A 5JSYA 4G1EB 1JDJA 3JQEA 2VQSA 4CV2A 4D46A 4X00A 4EATA 3U4QA 1ZD3A 4OP2A 5B58C 2HAEA 3UBTA 4OLBA 2BMVA 4JX9A 2AFHA 2HJWA 1HQCA 2Z08A 3EGEA 4Q39A 3ZU6A 2BHLA 1A2BA 2W22A 4O3FA 3WAGA 4RPGA 1J00A 1XVIA 1QHFA 1QB8A 2V7XA 2ZRFA 1WRBA 3KQVA 4QO8A 3RVPA 4RHUA 5JCJA 3K0FA 1SCBA 3KZMA 4ZVSA 1QVVA 2C9CA 3OKAA 4IO0A 4OFBA 4OYYA 3SMVA 3ITDA 1E5XA 3IUNA 1OB5A 1I24A 1RYNA 2ACEA 2N9UA 2CDRA 5IC6A 4WKPA 3V7UA 5CPFA 5EZSA 5DM60 4HYQA 5KOYA 1PLJA 3ZCXA 4CKXA 4D3YA 3V6MA 4EYGA 3KWFA 3ZWYA 4AJ9A 4UTPA 3FCSB 4YO8A 1ZM9A 3MTIA 4YMSA 4Y1RB 1R6DA 1EP9A 2L42A 3DD5A 1PUXA 2UZ0A 2A9PA 4IBOA 1LBIA 2Z2YA 4OQLA 1T4CA 1GCGA 1UJ5A 2C00A 3DV0A 3U9SA 1ZGAA 3OJFA 5MFZA 2G80A 3NB0A 2A1TS 3SXUA 1XCOA 1P6XA 1QE0A 4TKUA 2NXJA 1WB9A 4HQLA 4QFCA 3KL2A 1JPUA 4JFAA 2NW6A 1GEGA 4D45A 2IXBA 1H69A 1M2OB 1U8CB 1GT91 1Y7TA 4W9RA 3TCNA 5C1OA 4EHAA 3COVA 5IJ9A 2AN5A 2R7AA 1CUYA 2XUHA 5LWQA 1OYYA 5CEJA 4OBWA 1OIWA 4IVQA 1T0BA 2OYSA 2R7NA 3C16C 1V8BA 2O9JA 4DBZA 4D5GA 1RJGA 5JOQA 1J9EA 4GC5A 2FPPA 1S2IA 3A27A 5CCDA 2X8JA 3AF3A 1IQUA 2ACWA 3R77A 1N2XA 4J7XA 3NHLA 3ZNNA 1CG6A 2JIPA 3NOVA 3STWA 4YQFA 5LZ4A 4ZVTA 5ALMA 3GROA 1P1IA 1JMVA 4LY6A 4QUKA 4PE5B 4Q7KA 4CMIA 4F7WA 2E7ZA 3KJQA 2HCJB 4XX0B 2PKEA 4V0MA 1WTAA 1ZD9A 2WIFA 2O7SA 4G4JA 1SC1A 2PGLA 3AW8A 3JPWA 4R05A 1QF9A 3HY3A 4FB5A 4F6RB 2VRNA 4TKLA 2JAHA 2JJMA 5KTOA 2UZ4A 3L1IA 1L1EA 2PSEA 1DMSA 4IRUB 1IHOA 1KXZA 2FRDA 1N2CA 3FPAA 3G5AA 2BTQA 3V4VB 1FPMA 3C97A 2DB3A 2RGWA 3DR3A 5DEIA 5F9MA 1FDTA 1PJAA 1JIQA 2A0XA 1T6YA 3BD6A 3IAM6 4PO1A 4WPGA 3WGJA 2C8LA 2VCYA 3KM0A 3H2GA 3B1WA 4XGIA 2YW9A 2IUTA 2IZOA 2E0IA 5IFKA 5B3JC 3QOYA 2XSZD 2ZBFA 2IL1A 3E4DA 4UNSA 3NAGA 3PTLA 2H9IA 4MQFB 4YPVA 3T61A 4QA9A 4AVYA 2XRFA 5B36A 5AVRA 2O8NA 4ER3A 3GCDA 2NUPA 3HU3A 3A1VA 3INTA 4RF5A 4REQB 1PSDA 4M0CA 1X7ZB 1IY2A 1Q15A 3GFTA 3HG7A 3KSUA 3UT5B 3KB1A 1BA3A 2EL7A 5UKDA 1U5BA 1XRLA 1Q7BA 2VJOA 3O3CA 4GNRA 4ND2A 3VU8A 3A4LA 3FTPA 3AYZB 1IRIA 2QTGA 4LV5B 4XR9A 1Y4SA 1NMYA 5ALXA 5JE8A 1GFWA 2HHJA 1EFVA 3HZHA 3OWXA 4PNHA 3UKDA 2W37A 4BMCA 5BQPA 1UFVA 1I36A 2YWRA 2O14A 1EM6A 1LVGA 2BFBB 2YIVX 3CLKA 1NQUA 3Q87B 4UTRA 1YQTA 2A9OA 2G77B 2B8EA 3ILVA 2OMKA 3C4JA 3I73A 4NPAA 5FUXA 4UAVA 5J40A 3LZ6A 5SICE 2OG1A 3VSBA 4CLHA 2OM6A 2YHBA 1ZKMA 4L4RA 1JEAA 1SZCA 2HWWA 3VDNB 2XQFA 4A5SA 1LKZA 3HA7A 2DHDA 2PUHA 1GLVA 4N0QA 5DW0A 3TCXB 4YS6A 1GL6A 2BDEA 4LYHA 2F8SA 4M7OA 4EMBA 2R1TB 2WJJA 3DUWA 4RULA 1FP4A 2VLBA 1EWRA 3HJHA 2C2BA 4ZRNA 4XEUA 3MHTA 1UEIA 2XE8A 3MCAA 4U7JA 3K0SA 1T9BA 4KQMA 1W7AA 3NC0C 3ODPA 3QPDA 4HFNA 3GHYA 3OQJA 4PZDA 5JMPA 3ZEAA 5KAPA 4O0LA 4UHJA 4QOSA 4CQNA 1AT1A 1ZD1A 4JGBA 3I28A 1VZ3A 1JW9B 2B4QA 1WZEA 2FPUA 3BMXA 4GC9A 1UPCA 3D1VA 5TQ2B 4D4HA 4FWTA 2CKDA 2Z1NA 3N0RA 3JPYA 3A9RA 2PJRA 1U2PA 1VYTA 3OE7A 3T8YA 2DKFA 1B1AA 5DI9A 3HJRA 5EKTA 1U3CA 3NT2A 1VMDA 4UMEA 5TR9A 5KHAA 1GUAA 5AW6A 5IT9A 3F4BA 2EFDB 1SG6A 5ILQA 3L43A 1KI8A 1NTRA 4E7OA 5EUMA 1D03A 1CY1A 2NUAA 1QX4A 2DT8A 2ECOA 4DDVA 2RD2A 1DAMA 1QVAA 1R0LA 2XNKA 3H7IA 3ROGA 4C1NA 2QN8A 1ONOA 4F4DA 1SKAA 1XF9A 4EG1A 3CF6R 4J7CA 1I7QB 1KL7A 1U0EA 1NJ2A 3LXUX 1JL3A 1AHNA 1YTLA 4FHFA 1UBFA 5A4KA 1HZJA 1KDVA 2QM3A 4DRYA 2GEJA 2JB9A 2ZE8A 1D6JA 1T2FA 5C81A 1GGHA 3SS9X 2EZ8A 2PS3A 1AKNA 1AA9A 2X14A 3IQZA 3D9QX 4XIYA 1PE0A 1SGWA 4D81A 1VXOA 4N7MA 4CEJB 2Y0BA 1NXSA 4CE6A 3TW0A 4P3OA 1X74A 3UMSA 5CLLA 5AKJA 3G59A 3K4HA 4CKBA 4WNIA 2IXAA 4L07A 5JWOA 3VDRA 4Y67A 4PVDA 4ZD6A 4A6XA 2QHXA 5CK4A 4LFBB 2XY4A 1QYVA 1U6JA 2AXEA 5DXFA 3PF8A 1MAAA 3K15A 1DWUA 1II0A 4DLAA 1GG5A 4BMYA 1FX0A 2IEIA 4HDCA 3RNLA 1KAEA 4XI9A 1MAHA 1DKNA 3WDSA 4PAOA 4F1JA 3OEHA 3D8SA 1I6LA 1PN3A 4ITUA 4KBFA 1BXZA 1X38A 1WUYA 1XROA 1TGYA 1V9CA 4IH4A 2O1WA 1KQNA 3X43A 1OBOA 1KC1A 3LFHA 5JIBA 3OA0A 1L8LA 1QIIA 3LKDA 4DTIA 2UYYA 2GAJA 1OFHA 5IULC 2VP5A 4NU8X 1XVLA 2EFGA 3CX6A 2NZ8A 1F2TB 1TF2A 2CN1A 3QVXA 1BYUA 1GNLA 3FGOA 1NU6A 4XASA 3W9SA 3B82A 4EB6A 2PRJA 3PE4A 3DDNA 4MRNA 5FOXA 1C7QA 3HYNA 3EZYA 3LWNA 4LZOA 4M98A 3IURA 5L4SA 1KARA 4WKNA 5CDGA 1CFJA 4XGQA 1XRRA 2LDXA 2NSDA 3O82A 1NXXA 3QXSA 4OYLA 4R8SA 2C98A 1PT9A 3GO4A 3SKYA 2C1ZA 1PSZA 1W0KD 2R6GA 3TLYA 1POWA 1NSTA 3GCXA 1O2DA 1P9RA 4I5EA 4KE7A 4L8FA 5IZCC 3EXIB 3U6BA 3FOEC 1Y3BE 1U5AA 2B82A 1URPA 2FCAA 1PEKE 3DMFA 5DHTA 3GG2A 1Y3IA 2DWQA 2YS7A 1NT2A 3HCEA 1ABBA 2BUAA 1QQ7A 2WYOA 4G2TA 2D5LA 3FTNA 4H1UA 3MC1A 2J0QA 3KL4A 3WJ1A 2JCBA 3U09A 4BO9A 1Q2UA 2H7VA 2W2NA 3QE4A 4WK0B 3NW9A 4R0MA 4EG3A 4AMGA 2H17A 2WG1A 2C57A 1H6CA 1CT9A 1UKCA 4IHJA 2ODNA 1L4NA 5CJ2A 3O4JA 4CMKA 1E9BA 2IBMA 3USZA 4C6HA 1YJXA 3EIHA 1A7AA 4NULA 4UBMA 2W6CX 4JR2A 1YT5A 1FYVA 3ZV4A 1HRKA 5IG2A 2C83A 3FA2A 1D2NA 3QFCA 5F12A 3E18A 1S3GA 3GPLA 3THXA 1BX1A 3KETA 2BSXA 4JSRA 1JDNA 3NP9A 2XR1A 2FVYA 3NDPA 4ZCPA 1U2RA 2O0HA 2P9CA 2FH5B 2M6RA 3PPIA 2VPYA 3UAZA 2FGKA 3VHXB 5LIRA 1ML3A 2P11A 5BMVA 3MJRA 1KWGA 1FU7A 4LC1A 5CYFA 1JKXA 1MFPA 5CA0F 1NOJA 3OJWA 3U4IA 5LVAA 3D3KA 2PSFA 1RJEA 1EBUA 1SRRA 3HXPA 3VAAA 3P20A 1AHPA 4C88A 4DIUA 1XKTA 1P61B 1W1UA 3F3KA 4QUEA 3SPXA 1JEQB 1OC2A 1RYZA 2EP5A 1JZQA 2A6PA 2V58A 2EIHA 1P5HA 4LJLA 2OP0A 1VLJA 2C78A 4HDNA 2A9RA 4GGMX 2IYWA 4NG4A 4H31A 4ZHQF 4KHZA 1J0CA 4MS4A 4HDNB 3FG9A 3S5JA 3ZU5A 2QQ0A 4E5DA 3RUHA 2B1RA 5EP2A 2QV7A 1ZIPA 2V98A 2OC9A 3F7TA 1QONA 1ZJ5A 3MILA 4GKAA 3DDHA 5DHRA 5FWDA 3AT1A 3A6EA 2XTAA 3WKDA 3VSDA 1T6XA 1VCIA 4AJKA 2DXIA 2NZYA 4BVHA 1WPGA 5TMPA 2JGEA 1H5QA 3NXKA 4J1SA 1LXCA 1XCBA 2Y9MB 4HAUA 3KHTA 1TQHA 4AZWA 5J43A 3L7JA 2GD1O 1G7CA 2NSYA 5D3KA 3ZJYA 1FX1A 3QHAA 4XJSA 4DXAA 5FR1A 3LIIA 2UVPB 3T5AA 4Y1GA 3DL0A 3O8OB 4KO8A 3KSBC 3JAKA 1L6RA 2AH5A 2IPNA 1H2WA 4EYQA 4RM2A 5EERA 3RKSA 3WGVA 2C2XA 5BSWA 4RVFA 1X0XA 3T9AA 3VPBA 2OGZA 2QZ9A 3UJDA 4GZMA 3D0KA 3RC8A 1ZNYA 5K01A 3OHSX 2QZJA 3JU3A 3NV7A 2J09A 3DLHA 1IEWA 3GVIA 5CH8A 2NO6A 1IWOA 5LQMA 4EGCB 4P93A 4ZI5A 1KVSA 1AXRA 1PJCA 2GNPA 4PGHA 2MSEB 2ZI9A 3HL0A 1P1RA 2CL5A 1HSZA 2WSMA 1WULS 4LGYA 5LZ7A 1U31A 2VVTA 4CM1A 1E3MA 3D6FA 4RENA 2BZ0A 2ECFA 3OZEA 3U3OA 4CCYB 1P0CA 3C6ZA 3OM8A 4XLZA 4WESA 3QXCA 1S3SA 4JBHA 1YQQA 1ZD2P 3PYLA 5ETJA 4WFQA 4QELA 4B7CA 4F12A 1CLUA 1M7HA 3WLHA 2WKSA 4MQ4A 3L7IA 2C0CA 3RLFA 2FWPA 1DJOA 4DE5A 2RKWA 1GTG1 4V0SA 3B1YA 1EJ2A 2JD2A 4MKZA 3SQNA