4HATA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 61
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hatA00
3VR1A 2DFKB 1RZ3A 4X8HA 5AK0A 2J7PD 4V02A 3KKOA 1ODFA 3ZVRA 3V4RA 2GESA 4DUGD 1N3BA 4BWYA 2VP4A 1H65A 2W83A 2ZSEA 1HE1C 4P31A 4TQUS 3AKCA 1AGRA 1LW7A 4K81B 2ZRHA 2OG2A 4Q7MB 3WMFA 1E94E 4IOJA 3W9YA 1Z3IX 2ZS7A 3X1ZA 1A2KC 4Q4AB 2AK3A 3QKTA 3AP2A 3HPQA 4B3CA 4B3BA 4A0FA 4LJ5A 4ZI2A 3W6OA 2G88A 3CRW1 3AVYA 2X77A 2V1UA 1Z2CA 1KNQA 1ZCBA 2REXB 4ASUD 1E96A 2NPIA 1IAQA 1NN3A 3MWKA 3OEED 1Z28A 2C9OA 3CR8A 1F48A 2GDJA 3W8RA 5H68A 2JJ8A 2JLRA 4HZUB 3EZFA 4EKDA 2V6JA 1DAGA 3U2QA 3UATA 5LB2A 1Z6XA 2GETA 1XEWX 4UXJA 4HAXA 2VPPA 1G3IA 2I3BA 3EZ9A 4DLTA 3VU9B 1P9WA 2YWGA 4NKRA 4U5XA 2FEMA 4RZ3A 3TVDA 3VR5A 1IQPA 1HURA 2Q6TA 2ZRKA 3C16C 4ZDKA 4AKGA 3GPLA 1I4DD 1NN5A 3PFIA 3THYA 1M8PA 2DB3A 2VTKA 3FOZA 3O8CA 1WBBA 1NG1A 2NGRA 2CNWD 1R8QA 2DWQA 4V0NA 3HR8A 3SC3A 2G3YA 3K0FA 4V0MA 4BLQA 1QF9A 4CT4B 2B8WA 2GA8A 2CHQA 1Z63A 2QORA 2UVQA 2O0HA 3MJHA 3TR0A 3FHOA 1SZPA 1J7KA 1TTTA 3R7WB 2F7SA 4N1AA 4YMTA 2ZITA 3B6EA 1ZP6A 4Z8XA 1VPLA 2ONJA 1Z83A 3TVTA 4ZCMA 2C95A 3ADCA 1UDWA 1YZKA 4P32A 4QGGA 2Q3HA 3ICEA 4DCVA 2AD1A 1U0LA 4HEJA 1HH4A 4FMDF 2F3RA 1KI3A 2AR7A 2ZANA 1KO4A 1XD2A 3CBQA 2BMJA 2IS4A 4QOSA 4QGHA 1GSIA 1JR3D 2WJGA 4C7OB 2EFDB 1EG7A 3U60B 5C2JB 1ZM2A 2VRWA 1E0KA 3KXLA 1S0UA 1G3UA 4RD3A 3SFVA 3DL0A 1Z22A 2B6HA 2QP3A 5JFGA 3KUDA 2BMDA 4CEIA 3BBPA 5GJBA 2PEYA 2YZ2A 3OE7D 5LBIA 1U0HC 3UKDA 2W0SA 3ZDQA 3QY0A 3VNUA 4YLGA 4JJKA 2QGZA 2JLQA 1G9XA 1TF2A 1XJ0A 2XTZA 4UNRA 4HAZA 2B92A 5TMPA 4PQYA 2HLDA 4W7SA 4IDNA 1WF3A 1VG1A 3CRQA 3T61A 3A1SA 1UBEA 4FINA 4PC7A 4BGDA 3KX2A 2REOA 4U02A 4CZ2A 3TIFA 4NONA 4QNMA 5FOXA 3W90A 5JJKA 5J4HA 4B35A 3JVUA 3TNFA 1Q20A 3GFPA 3QIAA 4G3XA 1SVIA 1NY5A 3NHAA 5HZKA 1VHLA 1A2BA 3LD9A 2GAAA 3UG7A 3VAAA 2JLWA 2Z6VA 3TAUA 4DIDA 3AB3A 1QDEA 5A0FA 1DELA 4LJ6A 3RS3A 1D9XA 4FMCF 3SR0A 3A1WA 1N6NA 2IL1A 3ZS9A 4DIEA 3WXMA 4NCIA 3LBNA 1E6CA 2ZAOA 5HE9A 1Z08A 4OL0A 4EPTA 2WM9B 4GMXA 1AA9A 1MRSA 4XSGA 4X8OA 2AWOA 2XTNA 3P4XA 5JZVA 2FSGA 1QRAA 3MRSA 1VG9B 3L82B 1L2TA 1CTQA 1Q3TA 3NKVA 1R4AA 1B0UA 1P5ZB 2F1HA 4MYCA 2P2LA 2XJ4A 2GXQA 2XNSA 4DCUA 1KKMA 1VMAA 3FGNA 3KKMA 2ZSDA 3GJ6A 1F60A 1S1CA 4ZI3A 3KB2A 3TBKA 2W6JD 1OXXK 1XCMA 4O2RA 1S3SA 5GJVC 1R0XA 3VX3A 1MABA 2CK3A 4IEIA 5L3SA 4QNRA 1OFIA 1YU9A 4I1SA 3BH6A 3THYB 3OIUA 4LBWA 1E0AA 1FOEB 1S4QA 4OHYA 3A4LA 4HDQB 1OH5A 3B7GA 3EPHA 3PCRB 2D62A 3K8YA 2VF7A 3CW2A 2NMVA 1OH8A 2AHOA 3ZVMA 4B71A 2REBA 2PZEA 3JZMA 1RW4A 2QPTA 2VBCA 3KQKA 4PHFA 2OV2A 4JLVA 3LLUA 3SHFA 4HDCA 1IXZA 4LSGA 4LYAA 2N1BA 4C3ZA 1T3LA 3SZRA 1HEIA 4OQXA 2ZRMA 1KK0A 3WHLA 2J7KA 2QAGC 2JA1A 2OCBA 1LVGA 1XTRA 4JT4A 1G17A 2D7CA 1FUUA 3E5HA 3LDAA 2XZOA 1EK0A 3VTKA 2EFGA 3BXZA 3RRYA 1MO6A 4DB4A 2PX0A 2RGNC 1JBKA 4IXMA 4G5RA 4NP6A 2O8FB 3EZ6A 1I2DA 1GKYA 2ZU0C 3NC0C 4C4PA 2WIBA 4IVQA 4OQMA 3G5UA 5EE9A 3NVAA 4OKSA 1L4YA 2O8DA 3I61A 4JSYA 4CEIB 1KO8A 1SULA 3ZJYA 3I8SA 3PR1A 2IUUA 2KI5A 4L5BA 4KYIB 4QBFA 5FBLB 1OPXA 1G3RA 1K5GA 1S3GA 2P5TB 4BECA 4KODA 2IHYA 5EP1A 2IUTA 3VR2A 1EFUA 3VR4A 4EPYA 5GJWC 2PJRA 2QENA 1O87A 1E3MA 4RCZA 3QXCA 5FL7A 2ATVA 1RC8A 4BEJA 3THXA 1BKDR 4CVNA 2R44A 4OHZA 2NG1A 3W8NA 4X8LA 1OW3B 2GVZC 2IS1A 4DZZA 4PQFA 4GFDA 3ZIAA 1W47A 2W2XA 4PO1A 5GVRA 3RS4A 1W4RA 3LLMA 2BBSA 2HJVA 2Q21A 2EU8A 2EWWA 2J41A 4NTZA 3CKLA 3GEIA 1UEIA 4CDGA 1EFHA 4O2LA 3ADKA 3DDCA 2RHMA 3B1XA 5DLQC 4LC0A 1XTSA 3W5JA 4FMBB 4I99A 1P3JA 2UZIR 2ZRPA 2IBMA 1QHYA 3AVPA 4TT3A 3GFTA 2QMEA 3HJNA 4NCJA 2XNDD 4PAOA 4BFVA 4AKIA 4QBIA 3WYFA 3KKNA 3TSZA 2IYRA 3LH5A 4A8JC 1KTVA 1ZM9A 5L3SB 4ESHA 2ZROA 4GT1A 2JLZA 2VSXA 5HCIA 2QU8A 2W6IA 2ZTSA 4RCYA 3ETLA 3ZD6A 1AK2A 1C4OA 1VDZA 1ETUA 3VMFA 3K70B 2Z83A 3NH6A 4V0ME 2X1VA 3SBEA 2R6CA 4WAUA 1G4UR 1GILA 4D80A 4C0KA 5CK4A 3QPVA 3CO5A 2EYQA 5GADl 3C5HA 1DADA 1W4AA 1BOFA 4B33A 1E2GA 6Q21A 2BEJA 4HDOB 1OIVA 3QBTA 1AGPA 2P3SA 5BQ5A 1N6PA 3RS0A 5C4MA 1ZIPA 4QM7A 1KGDA 4O3MA 3AVXA 2QT1A 3QPWA 3AH8A 2JAQA 4MKFA 4XVQA 2WSSA 3GJ4A 4X8MA 4DVGA 3A4NA 2ZR9A 3HR7A 1GITA 1NKSA 3C14C 4M1OA 4PANA 3MAAC 1W49A 2EW1A 3K0AA 4WXPA 1IONA 1GRRA 5AWFC 4C9BA 4BLRA 5GVSA 2XX3A 3P1JA 2PT7A 2O5VA 1E9CA 5HR5A 4M9SA 4EJSA 1VCOA 1N0VC 3TAHA 2FFHA 1LNZA 1U0JA 5JHGB 2Q9CA 1Q3HA 3Q9LA 2WMNB 2PJZA 2HJGA 3A4MA 4JKYA 1SQ5A 2ZYWX 3O8BA 5CITA 4OI0A 2FFBA 5L3QA 5JRZA 3AF4A 1XD8A 2IWRA 2VQSA 2C77A 3RRZA 4ON9A 3THXB 4E5UA 2ZYUX 1NMYA 1IXSB 1K6MA 2GRJA 1TU4A 2QTHA 3ASYA 2HUPA 3WNBA 1VCIA 4PZYA 1VG8A 2RHDA 3KDSE 3CWZA 5BYKA 4ILEA 5IK2A 3SJZA 2JEOA 2FA9A 1BH2A 4LRWA 4GNKA 1GIAA 2PCLA 5FI1B 5FOWA 4NHOA 4JLMA 3TW4A 3KFVA 2MMCA 1MOZA 2I1QA 3X1WA 4HB3A 4AKEA 1KI8A 1E9RA 2HYDA 2VF8A 2YOHA 2JJ1A 5CJPA 3TUIC 3G0HA 1SVKA 4BEBA 1F6BA 3BERA 1ZC4A 3BE4A 4K46A 4LHVA 2GNOA 3DKVA 5JWRA 3TUJC 3RSOA 2VHJA 2QMUA 3GLFB 2Q3FA 3U44A 3CRVA 1QHHA 4LY6A 2J9RA 1AN0A 2YC4C 1IJEA 1C9KA 3NH9A 4AI6A 1T5LA 1E2IA 1Q1QA 3R20A 4BLPA 3FFBA 2AK2A 2FMXA 4AY2A 4Q02A 2ZRDA 4BASA 3UWOA 4ZO4A 1RRPA 3U3JA 1G21E 4B6FA 2OBNA 4PZZA 3IKJA 4OQFA 2ZE6A 3CNNA 3AF3A 5CYPA 1CEEA 2H16A 2WPDD 4M22A 2O8BA 3QXJA 2BCGY 2ZEJA 2GBLA 3KJHA 4D26A 4QFMA 2G0NA 1OT3A 1ZIOA 4RD2A 2W2VA 2CL0X 1KI4A 1KDPA 2X2EA 4B32A 2XXAA 1OIWA 4KVAA 1OH6A 2PX3A 5E95A 5IF9A 2FWRA 2QT0A 4WIAA 2WAYA 1MO3A 2C96A 4NYJR 3ZH9B 4M9XA 3GJ8A 3QE0A 3KUCA 3H1TA 3PG5A 5KDDA 2D2FA 2NO0A 3BB3A 4TMVA 1RFLA 2ZSAA 4XH9B 3TK1A 1WRBA 3LVQE 1JAHA 2VP0A 3BC1A 5J4VA 2ZI9A 3VQTA 2ZI4A 2O8EA 2ZR0A 1IM2A 4PO8A 1F2TB 2XZLA 3B9QA 1XCPA 1LV7A 3BK7A 1UDXA 4B2IA 2AFIE 3GLIA 4EPXA 5JI2E 1YZQA 5KPDA 3MWLA 4DCNA 1MH1A 1FQKA 2JCSA 4MRNA 4OQLA 2R65A 5F98A 4V03A 4F92B 2WWIA 1R5BA 3EIEA 3I32A 3QXXA 5L3QB 1SXJA 4R9UC 2O8CA 1JB1A 1CULC 3LWNA 1CIPA 1D8TA 3FFAA 5DSZA 3KQNA 4AD8A 1G41A 1KMQA 4LJ7A 4Q48A 1GNRA 2AD5A 4CEJA 1KKLA 1QHIA 4C0LA 3O8DA 2O0JA 4ZDJA 3X2SA 2QNRA 5KSYA 2FFQA 1OFHA 4TZ0A 4WW0A 1I2MA 3TQCA 2JLSA 2V8OA 3B85A 4JL8A 4PAMA 3UANA 3QXHA 4A15A 2J1LA 1R0YA 2A78A 3HU2A 3N70A 3QUSA 3FVQA 1UJ2A 5DYIA 1ELOA 4TLBA 1IN7A 5AUNB 4TTPA 2DFLA 2GJSA 4EPRA 2OEPA 2ZVPX 2IYYA 2QN6A 1KNXA 4F7WA 4KYUA 2ZS8A 3M1IA 2KWIA 3TH5A 4XSHA 3L43A 4U7DA 2C5LA 1AKEA 3T5DA 1LF0A 1GKIA 4MYUA 1MO5A 2CMKA 3U44B 3SI7A 3WP1B 1QHHB 3QKSB 4G5OA 3U7HB 2BBWA 3BS4A 4W5HA 3AM1A 4MRVA 4URZR 3ZQJA 3Q85A 5H70A 3REGA 5J47A 1E9AA 5DHAA 3RLFA 2YHSA 4TMKA 2HV8A 2CXXA 1HT2E 4RJLA 2NOAA 1EESA 3DHWC 4MRSA 1OE0A 3DMNA 2EFEB 5JCPA 3KB1A 1Y3AA 4KV9A 3A1UA 3D3QA 3ZS8A 1Q1BA 1OB5A 3WY9A 4BFZA 2DFNA 1QHNA 5EP3A 2VP6A 2O8BB 1XXHB 5AJYA 4ZKEA 4A2QA 4IVRA 4LJ4A 1XCGB 1G5RA 1B23P 3FWYA 2DHRA 4FD2A 3OAAA 1KI1A 4ARZA 3ZZUA 2FE4A 2XXAB 3HU1A 1E2JA 1G5PA 4LYFA 2CCGA 2QTVB 4UJ5A 1GNQA 3B78A 4JBXA 4JVLA 3BRWD 3HDTA 1DTSA 1DARA 1A5TA 3VU9A 3P32A 4JKIA 3OF5A 1JECA 2DWPA 2AKAB 4EQ6B 3T1VA 2YWEA 2X19A 1PVOA 3AKYA 1PLJA 2JASA 1TUEA 1KI9A 2OCYC 3GP8A 4TTRA 2ODEA 5H8WA 3PJRA 4YQFA 3GLIB 4DSUA 4NPHA 1ZW6A 2HLDD 4ZPXA 1H8HA 5FOUA 3R7WA 1KO5A 3ZZ0A 1AQUA 1YVDA 2H1LA 3MD0A 4CT5A 3IUYA 1JXMA 2HF8A 1FPMA 3SEAA 1SXJB 4PHTA 1X86B 3K70C 4Q00A 5K8UA 2RGAA 3AVUA 1ZUNB 2P6NA 2EWVA 2IHBA 2WIAA 4C0HA 1IN4A 1ESMA 4Z51A 3QG5A 4URXR 4V0LA 1G8GA 3NG1A 3P4YA 4CEJB 1AJEA 3HYTA 4D25A 5FBVB 1DEKA 1R10A 4LBYA 4C7OA 1Q57A 4MITA 4LBZA 4A9AA 4BLOA 4TSFA 1YHNA 4IDPA 4FCWA 4TLAA 1PZNA 3I4LA 1EX7A 5CYOA 1N0UA 4MYTA 5EE5B 4MDFA 3IIKA 1L8QA 2FX3A 1E9EA 3Q3JB 1PJRA 3IGFA 5AUOB 3T1QA 1R5NA 4IXNA 1LTQA 3WBJA 4NCHA 2ZIAA 2UZ3A 2FF7A 2ZJOA 4EFNA 3QOFA 4A4DA 3FKSA 1XD9A 1TQ2A 4AYWA 1XPUA 1N6KA 3DOEA 4RY2A 4PO9A 4OK5A 2OLJA 1CJKC 4ZIRA 2CK3D 2MSEB 3LX8A 1OB2A 1VKJA 4ACAA 1JPJA 1P6XA 4WBSA 5FPYA 4TYYA 3R8CA 2ZSFA 1CLUA 5TB5A 4AYXA 3FDIA 1KK1A 2RGCA 3TKLA 1SVWA 3K70D 1E9BA 1U8YA 4TWZA 4DC9A 1W44A 1F5NA 1KSJA 4LJAA 2IYTA 221PA 1Z6GA 4MUAA 2YC2C 1UAAA 2VL7A 2N42A 2GZHA 2ZJYA 1ZBDA 2V7QA 4N0EA 4O25A 4DKXA 4XJXA 2J45A 1XF9A 2A2ZA 2DY1A 2OBLA 3SJBA 4F4IA 4HYYA 4ARZB 3NBYC 2XOKA 1NLYA 3I72A 1NLZA 1G8YA 2BJVA 5JJLA 1OJLA 2A5DA 1G7RA 2I4IA 1OV4A 3KQLA 1XEXA 2ZRJA 4JBWA 2JGNA 1LFDB 4KSCA 2VHCA 3GLHA 3RS5A 1KHTA 3UG6A 3KXKA 4D4JA 2E9SA 1GNPA 2VHTA 3UMSA 4JLAA 1GTVA 4HUTA 1M7BA 2VP5A 2F55A 4IFBA 2H5EA 5KPJA 4IEEA 5FUWA 3SQXA 4JZKA 1AS0A 4NE2A 3EZ2A 2E1RA 4HAUA 5FBRB 4UXIA 2Z5FA 1DO2A 2NZ8A 3GLIE 2BDTA 1LS1A 2XSZD 1NNEA 2AKYA 4NYMR 1NF3A 1IY1A 5CK5A 1M7GA 2GEVA 5EE3A 1ZU5A 5FL7D 1GWNA 4UNSA 1TEVA 3PVSA 3FE2A 2JATA 2F3TA 4Q19A 2J0UB 5AUQA 1DVRA 3OESA 2K5UA 1D2EA 2BMFA 1V5WA 1S2MA 1NVVQ 2OCAA 3UMFA 3ZIAD 5DN6A 4DCTA 4KITB 4M1WA 1G6HA 1T3HA 2O8FA 3L0OA 4MA4A 4OI2A 1Z0DA 5DO9A 2BBTA 4AWXA 3IIMA 3BJIC 4FN5A 5G3ZA 2F9LA 1GG2A 5C1BA 2OILA 3QENA 2YWHA 4XWKA 1MR3F 3SBDA 2WJYA 4PQRA 2HT1A 1II8A 1D2NA 3WRXC 4QC2A 4TT3D 1NVUQ 3K53A 4KVGA 4TTQA 1SVLA 5TDHA 3B2EA 4Q1EA 4PTLA 2XB2A 1DAIA 3H86A 4Q66C 4MYHA 3U3RA 3EA0A 4L9WA 5DIFA 1K5DA 1ZRHA 5HKKA 4OI1A 1E9DA 3SQWA 1V43A 5JS7A 3O47A 2IYUA 2EFHB 4ZIRB 2C2HA 1ESNA 2KE5A 4EJSC 1JR6A 1SHKA 4WZBE 1E2PA 1IOZA 2WICA 1QHSA 1UBCA 3GJXC 1GDDA 3FMFA 5UKDA 4DWJA 2RAPA 3AKDA 3W3AA 3ADBA 5CIQA 5CLLA 5ANRB 4BZQA 2KSQA 3W6PA 3HU3A 4XVUA 5JMTA 3MGCA 1FMLA 1OLOA 4WA7A 1E99A 5EUMA 1KYIA 4HAVA 3V00A 1D9ZA 1TAGA 2D74A 2ZYVX 4P0TA 3D31A 1E98A 1GOTA 1ZD8A 5CM9C 2XZPA 2WJIA 2WKRA 4I81A 3H84A 1GVNB 1VHTA 4EPVA 2A5GA 4MKIA 4A36A 3KKQA 3C15C 3QXSA 4A0GA 2WSSD 2RKOA 1TF7A 3REFA 4LHYA 1NVWQ 2OSBA 5J4YA 3NWJA 4G5QA 5IDVA 5JEEA 2D06A 2CCKA 3CZQA 1W0KA 1XEXB 1GAJA 3KKPA 3K1JA 4TMTA 2QMHA 4RFVA 4ABYA 1T3SA 3K0CC 4C2TA 4FXPA 4A92A 1WP9A 5SZHB 3GLHB 2HT6A 3I8XA 3LX5A 5CB6A 3KFXA 4GOKA 4QHTA 2W58A 2ZU6A 1M34E 2ZM5A 4KFTA 2GJ9A 1KSGA 1M74A 4IDHA 3AP1A 5L3RA 1NP6A 2QSYA 4N0DA 3SFZA 4B76A 3UPUA 1KAOA 3IHLA 4JVNA 2R6FA 1NMXA 2F43B 1OXUA 3LQRA 2AL7A 4YMWA 1P2VA 2ZRIA 4ZDWA 4QJ4A 3ND8A 2FPLA 4A6PA 3BFKA 2CBZA 1IY0A 821PA 3P27A 5EXSA 5IK2D 2ZE8A 2FGKA 3AVQA 2QMOA 5D3QA 4NU0A 2BMEA 4R2IA 2OZEA 2BM0A 1QG2A 1R7RA 2R2AA 2XJ9A 5HCNA 4RZUA 1Z06A 1UBGA 1XTIA 2V4ZA 3WNCA 4LZZA 1G291 1II8B 2NO1A 4BFYA 3BGWA 1AM4D 1G3QA 4DLYA 1NY6A 4M9ZA 1DG1G 3AUXA 2HXSA 2VLIA 4B3GA 2CE7A 1Z6TA 4KCGA 5BYJA 4QJ5A 1R8SA 4E22A 4M4SA 3EC1A 3THWB 1W0JD 2EYUA 3PV0A 1JJVA 4ESVA 1IBRA 1XEWY 5HPYB 4QRHA 1FP7A 2GF9A 4LGMA 2VA8A 4HAWA 4LYHA 4QGAA 1VG0B 2QA5A 4HI0E 1J70A 2CL7X 5JRJA 5KYKA 1X6VA 1X1RA 5TVKA 5H1YA 4TL8A 4KU4A 4S35A 4F4JA 1CU1A 3GLGB 2QQEA 4C0JA 3EPKA 4C0BA 4M53A 1W4CA 2CDNA 3KJGA 1E0SA 1FQJA 3RS2A 3QKUA 4DSOA 4V0KA 5EZ5A 4RD1A 4LJ9A 5AUPB 3CF2A 5FTKA 3W34A 5KOYA 3SHWA 1AZSC 3BWDD 3EPJA 4A2WA 1TF5A 4F38A 4TZ6A 4M1TA 1DAMA 3GLFA 4KLNA 4BLTA 1EFRA 4BFSA 4BFTA 2TMKA 2ZVQX 4G01B 1KK3A 3GLHE 3B1YA 1T8TA 3GFOA 2WJHA 3RHFA 4JJZA 3NIBA 5FUVA 3PUXA 4BFWA 5F9HA 2A5JA 1G5TA 2GJ8A 3EASA 3KJEA 3Q8XB 3I3SR 2FGJA 3HWSA 2DYKA 3ZYCA 1FW6A 521PA 4NCKA 1PLKA 4WZ6A 3EX7C 2Z0MA 3MSXA 1XEFA 4F91B 3AEZA 3ICQB 5CDFA 1KAGA 3LW8A 4IOLA 1A1VA 1N6RA 1XX6A 5FTLA 1W7AA 1GL9B 2OM2A 1KOFA 2H7VA 2EVWX 3EWAA 3K9NA 1I4LD 2QROA 4JL6A 5FBQB 3R8FA 3AQ4A 3QI2A 3WBKA 4TYNA 4LV6A 1CR0A 2D4HA 1W5TA 2HDNB 1XB2A 2WWXA 1CRQA 1ZNWA 4C2UA 3AF2A 2ZUCA 1KIMA 2A5YB 4JBYA 4HLUA 1E2NA 1KDRA 3KJIA 3WMEA 1WE2A 5A5GA 5JI3E 1U2RA 1Q21A 4A2PA 2VIIA 4JYCA 4PC6A 8OHMA 2D7DA 3VKHA 2PH1A 1JNYA 4DB2A 1X8LA 1W36B 3AP3A 3IO5A 1F2TA 1CF4A 1T5IA 4Q9JA 5EQTA 3RVBA 4JVMA 5TV2A 2CLSA 4IDQA 2JIZA 4GMDA 5BN3A 3MUFA 5E7JA 3ADDA 3LY5A 5FR2A 2ATXA 3W3ZB 1CR1A 4JLDA 1BO6A 3SYLA 4P4SA 2J0VA 2ZJ8A 2ZJZA 2GWHA 5JCZA 1M7HA 1PUIA 2GEDA 1XTQA 1N6HA 4JMPA 2EQBA 5KSZA 4Z1MA 4MH0R 1OKKA 1E69A 3DKPA 1GUAA 4B75A 4YDHB 1EWQA 3OZXA 1Z0FA 3SN6A 3QG1A 2A30A 2G77B 3SYNA 3AVOA 3KXIA 4HLDA 3B13B 4GRAA 4M1KA 3CONA 3IHWA 3FMIA 4UJ3A 4R2HA 1UADA 4YONB 4JVSB 1XNJA 2C99A 1OXTA 5L3VA 3EC2A 5KSPA 5BWMA 4FIDA 1ZCAA 2GJAA 3OEHA 3OAAD 3GJ5A 2ZI7A 4D0LB 4MQBA 1NN1A 3QSYA 1E79A 3FB4A 3LRPA 1VIAA 3QEOA 3F0TA 2ANCA 4BFXA 4LWZA 1IN5A 1E2KA 1JQLB 1P4SA 5FTJA 4MRPA 4A1FA 1CKEA 3UXMA 3VKWA 1RRFA 3B5JA 3FHTA 3LV8A 1W1WA 1NVXQ 3UIEA 1UPTA 3FYHA 4QHSA 2DR3A 1VTKA 5HTKA 5HZHA 2WV9A 4ZDIA 1Z2AA 3UK6A 3QKSA 4TYPA 1N0WA 2OE2A 4E07A 2HEIA 1K8RA 1YZTA 1ZNYA 2FH5B 3D7MA 3GD7A 1XBTA 4Q1DA 4TN1A 4M9QA 4Q7JB 1E4VA 4IOKA 1H8HD 2DCUA 3T35A 4HUQA 5FH9A 3PEYA 3Q7PA 3I73A 2A9KA 1PLLA 2R6AA 1EWRA 1U9IA 4KBFA 5DI3A 3TGPA 4QJ3A 1R0ZA 3EWSA 1Z0AA 2BKUA 2WZQA 2QL6A 4DLRA 3ASZA 4L8GA 5LD2B 1XXHA 3CH4B 3IQXA 2GXAA 1NKTA 5BXQC 3VR6A 4IKEA 4DBLC 5AJXA 2W2TA 1PV4A 1XMSA 2GK6A 3AVTA 3C41J 1U99A 4URWR 1ONBA 2ODWA 4QXAA 2XB4A 3X1DA 1JALA 2AXPA 1QBKC 1J8YF 4TSFD 4Q7KA 3OFND 3PUWA 4W5JA 1QZXA 4PFSA 2KBEA 2ZE7A 3CH5A 4EQ6A 5EXXA 2C04A 3AUYA 4DLUA 1NMZA 3IO3A 1KJZA 5EE1A 4BFUA 3N2EA 4K8OA 3LBHA 1YZNA 4L15A 2ANBA 3A8TA 2FG5A 3TLXA 3H2YA 1W46A 2P5SA 5L8VA 2QUZA 3FKSD 4DLVA 3Q72A 1RE0A 4GZMA 4II7A 1G19A 2WVJA 3M6AA 2WJVA 4M1SA 1HE8B 4A82A 1JPNA 1FUKA 1UBFA 5LDDC 5SZKB 3L0PA 2C9CA 4P4SB 1CS4C 1MRNA 2H57A 4B43A 4IVPA 1GFIA 4CGZA 1RPZA 2YNMA 1BMFA 5EZ6B 3UMRA 1N25A 3SYKA 2BHRA 4Q4LA 1G8PA 1P75A 3T5GA 3BFXA 3CR7A 2G1JA 4M1YA 4H1VA 2ODBA 2IS2A 1EFTA 2Z43A 3B8HA 4LCBA 1WBDA 2IYSA 2I1VB 2QBYB 1P61B 3KZ1E 2ZREA 3AVVA 2JDIA 3LA6A 1CJMA 5AJVB 3B1WA 4DDVA 3AV0B 3KTAB 1W48A 2WHXA 5B58C 4JSTA 4H1UA 4YC7A 4MRRA 3R9XA 4URVR 3OHMA 4P3YA 2XEXA 421PA 1ZUHA 2IYXA 1DOAA 4BZXA 3JVVA 4DLXA 2AN9A 5DHFA 4D82A 4TMZA 4W9MC 5E4FA 2ORVA 4PR0A 3E70C 3T34A 4DDTA 4B2LA 2IT1A 3MFYA 1HQCA 1YZGA 3GLFE 1IY2A 1E1QA 1COWA 2J87A 2VSFA 3AF1A 4POAA 2XTMA 2V9PA 4HATA 1NRJB 2O0KA 4LDJA 5CM8B 3U3OA 4RFSA 2ZUBA 3RC8A 4A8JA 2XGJA 2GCNA 3RDPA 3L0SA 4HUQB 4Q4HB 1ZD9A 3DZDA 4DEXA 1TNDA 5DI3B 3U5ZB 3TR5A 1E2DA 2LKCA 4B3FX 1M1YE 3IILA 2QEQA 2FOLA 1VCNA 2ZJ5A 2OHFA 1M6NA 4ZKDA 4FWTA 5F2EA 1HTWA 2ZE5A 5CDFE 1CRPA 3EA5A 1P62B 1F2UA 1N5LA 3PITA 1D6JA 3RRMA 3U4QB 1ZNXA 4EUNA 4YMUA 1E0JA 5DN6D 1TQDA 1Z47A 1E2QA 3AGPA 2QAGB 2F9MA 4BE7B 4PC1A 2HCJB 4PC2A 2BWJA 4V0OA 2CLCX 2J3EA 2PMDA 2C78A 4D81A 3ZGXA 3ZVNA 2QE7A 2GXSA 4Q21A 2FV8A 5JHHB 5C46F 4NCNA 4B73A 2ONKA 3W6NA 2YV5A 4XWAA 1E9SA 5BN4A 3LXRA 4JIMA 1XMIA 3DZ8A 4DLWA 2G0TA 2A3RA 1G7TA 1G18A 4RD6A 4KI0A 2FPKA 1XTKA 1TQ6A 3B82A 4IRUB 3V4FA 1XFAA 4YXWA 2KB0A 2WOOA 1ZAKA 1ZM3A 2RGDA 4HLQB 2J0UA 3RABA 1DPFA 4PSVA 3NBXX 3SU8A 1HYQA 4LX0A 2CE2X 1Z0KA 3ECCA 5IT5A 2IUSA 4MUBA 4JLKA 1OFUX 2H8KA 5LB4A 4A6XA 1FX0B 2BBOA 4GI7A 2QG6A 3U3KA 4DJTA 2IX3A 5KDOA 1S9HA 3SNHA 2VH5R 1NN0A 3C7KA 4OK3A 3H4MA 5JEDA 2WPDA 2GTPA 4ITRC 2DPXA 1G8HA 3PEUA 2FDCA 2CVHA 3A1TA 4FMDB 2QP9X 3WHKA 5D3MB 3GQBA 1F3OA 4CW7A 1G1MA 4Q1CA 4Q7LA 5CLQA 1FNNA 1P2UA 3WYAA 5J4LA 1W0KD 5DISB 3TW8B 4M8NE 3DPUA 1JEEA 3EZ7A 1W36C 3OIYA 3RS7A 2HF9A 1NBMA 1E2EA 4GP6A 3ZD7A 4RD4A 3GJ3A 2FJUA 2GZDA 3EW9A 4OYHA 2BM1A 1IN8A 2BEKA 3QBVA 2F1RA 4PPGA 4TLCA 4Q9IA 2FZLA 4RFSB 3T1TA 4L9SA 4A8JB 4KXFB 1LS6A 2E87A 1TADA 1E4YA 1QVRA 5FL3A 1J90A 3O8RA 1IHUA 1ZYUA 1UFQA 1UKZA 1XJCA 1ZVQA 4M0LA 1XPOA 3B1VA 1BYIA 5EUQB 1CP2A 2FU5C 3K0SA 1XZQA 1G7CA 3BORA 4PX9A 2WSMA 2IXFA 3PUZA 5KHOC 1CJUC 1F2UB 3CRRA 1XXHE 4QKQA 3U7GA 1KI6A 1SVMA 1Z0JA 4TYQA 3M4YA 2QRZA 3PIRA 3CX7A 2GKSA 4IW3B 1KO7A 1KK2A 2OFXA 2G83A 4FMCB 1DAFA 4NYIQ 5EXTA 5JLJA 3BOSA 1DO0A 2FFAA 2FSFA 2CHGA 4LUCA 3GJ7A 1CBUA 3SS8A 4PHHA 1FNMA 3VHXA 4UNQA 2WWGA 1IJFA 3D6TB 4Q9LA 4D6PA 1KZ7B 1AQYA 1W36D 3TJZA 1BIFA 2P67A 2ECKA 1E2LA 4L16A 5E3HA 5FOSA 1NJFA 1G8FA 1PUJA 1TX4B 4WZAE 4OI4A 2F6RA 2B21A 1BS1A 2QRNA 3SOPA 4EAQA 2Q9BA 1IXRC 2IA5A 3CPJB 1U90A 5G53C 3R9IA 2AFHE 3FTQA 1VCMA 4B3DA 2F43A 2NO7A 2ZRAA 3RANA 3BB4A 2FN4A 1A82A 2JJ2A 2KBFA 3F8TA 1EGAA 4BLSA 1OIXA 1UEJA 1SXJE 2BV3A 2RH5A 2LCFA 5SZIA 5P21A 3RAPR 4LJ8A 1SKQA 2ZS9A 4JLOA 4FCVA 1II0A 4DEYA 4E09A 1NG9A 1VYVA 2YVUA 5CB8A 1AS3A 2ZQ5A 4CEHA 5LD2C 1VECA 3FMPB 1OHHA 1Z6AA 4I1UA 4KFSA 1OSNA 2ERXA 5DGXA 1LF5A 3FMOB 1C1YA 4M21A 4NYJQ 4QM6A 2ZPTX 1ZC3A 2IF0A 1H8EA 3RRNA 3U7EB 1N5KA 2BCJQ 4M2LA 2Q3MA 5DE3A 2ERYA 1MT0A 2H18A 3VFDA 1Q0UA 2ZRNA 4BQSA 3V9PA 3I5YA 4HLUC 5F9FA 2PEZA 3FHCB 4DDUA 2ZRGA 5TARA 1KMHB 2ZETA 4DCSA 3EXAA 4I1VA 3TSOA 3DMDA 1VIYA 2CVFA 2WKQA 1ZNZA 2FSIA 1Z0IA 1KDOA 1P2TA 2XITA 3DEFA 4RD0A 1EFRD 2A5FA 2C9YA 2VYFA 4C0QC 4KO8A 1I4TD 1S1MA 3P20A 4JLJA 4E03A 3THWA 2V3CC 1M2OB 1CXZA 1U8ZA 5JBQA 2WWWA 4C0SA 1N6LA 5EP2A 4MDEA 4P33A 3EIQA 2DBYA 2W6ID 4ZCIA 4GDFA 2SHKA 3A6PC 3A37A 1T8UA 1UF9A 3TUZC 3Q7QA 1E1RA 2WBLC 4C0AC 2FSHA 3K0EA 4CYMA 5JSZA 3S1AA 5TXGA 1X8KA 3VR3A 1NSFA 3W5IA 2NO9A 5KUTA 3TRFA 1WA5A 3B1ZA 3GLGA 4KSBA 2ODNA 5G3YA 3PEVA 4US1R 3K9LA 3EARA 1P60A 3EAQA 4LJYA 4KJZA 2GXUA 1FFHA 1GRQA 1ZU4A 1DS6A 1KI6B 4EDHA 2ZRCA 3PUVA 2C03A 1T6NA 2H92A 5KU1A 2ORWA 4F93B 2PLRA 1Z8FA 2QAJA 4GOJA 5B57C 2WJJA 5KO2A 4L4UA 2DWOA 1N2CE 2RGBA 1T0HB 4NL4H 4AK9A 1OXVA 2H17A 1J99A 2V55B 2ZR7A 5JWOA 3KL4A 3WYGA 2RMKA 3QPUA 3OIVA 3E1SA 5KNBA 3HPRA 1Y63A 2VEDA 2JIZD 2B7CA 1XP8A 2OO7A 2QI9C 3BIFA 3R9WA 3LAWA 4H9GA 2V54A 4XD7A 3LQQA 3E2IA 3LNCA 5FTMA 1T4GA 2IEZA 3BB1A 1E2MA 2J7PA 2MSDB 2QM8A 4OJKA 4Z8YA 4DUGA 2R6DA 2R8RA 2IC5A 4Z1MD 1OKKD 2V6IA 1U9IC 4R98A 2BC9A 1TUIA 5G41A 2IWHA 4AG6A 2BKEA 4MKHA 1GL7A 3K0FB 2IYZA 4UXHA 4Y0VA 1JEDA 1US8A 4CEHB 4KAXA 1D2MA 2RGEA 3IBYA 4A0RA 2J0QA 2ORIA 2GBLC 3B9PA 1UKEA 2OESA 2WTUA 3GEHA 5SZJA 2GAOA 5AJZA 2NPFA 1SHZA 3GJ0A 4B44A 3OEHD 2MSCB 3K09A 4TYWA 3CWQA 4RZXA 4OBEA 3LXXA 3I1FA 4W5WA 5A4JA 1RRCA 1E79D 3QVVA 2O52A 4ASUA 2JJ1D 3SDZA 4DSNA 1KJWA 3VKGA 4LOAA 3OEEA 4DHEA 4CRWB 3T1OA 4B74A 3LVRE 1AIPA 1ANKA 1ZMXA 2ZRBA 3H0KA 4LHXA 4TMWA 3BH0A 1XD2B 1N6IA 1KJYA 1YR9A 3CB4A 5J40A 2IS6A 3WRYC 3CNOA 3QF7A 4HAYA 4PAQA 3TMKA 4D4MA 1X8JA 3LFUA 3ONWA 3RNLA 2V1XA 1OH7A 2QY9A 1WDTA 2WMOB 2YOGA 3ND9A 4Q03A 4ZCLA 3DO6A 1JI0A 2GK7A 5EXPA 3DM5A 1NBME 1G16A 1NSTA 1XMVA 4IDOA 3TSWA 2WWYA 3IPYA 3QVUA 1TQ4A 1UKVY 1NI3A 1YZLA 4NMMA 1WCV1 1P2SA 2CNWA 2IYWA 1G4AE 1R6BX 4KFRA 4QHYA 1SKYB 2NQ2C 2GVDC 4LC1A 3L8YA 5LPNA 4LV5B 1Q12A 1SXJC 5JSZB 3S1AB 4LHZA 5ELXA 3QEJA 4WOPA 1G20E 3A1VA 5FPHA 3NXSA 4OJQA 4P4TA 1S8FA 1HV8A 1O3YA 4GPTA 1D5CA 2XSZA 1EFCA 1Z07A 2N46A 2L0XA 4OHXA 1NJGA 2FNAA 1X1SA 2GF0A 1DAKA 1Z5ZA 2WAXA 4R7ZA 4ZV4A 1MKYA 1CR4A 121PA 3TQFA 2P6UA 4I4LA 1J2JA 2OLKA 4Q5IA 3RYTC 4QL3A 2CJWA 1Q44A 1E32A 2YWFA 3CX6A 5DH9A 3HYRA 3CF0A 3N5CA 3I62A 4NBSA 4US2R 1E2HA 2GZAA 1G64A 3L0IB 1JR3A 4Q1BA 2IXGA 3N2IA 4LPKA 4GL2A 4NDZA 2YJTD 1W2HA 2R62A 4DT1A 3PQCA 3LW7A 2QM7A 4DDWA 3NBZC 2QPOA 3X1XA 1II9A 2CCJA 4UQOA 3OE7A 3DM9B 4LBVA 2RCNA 4Q4JA 1Q1EA 3RWMB 2CL6X 2PL3A 3HP1A 3X1YA 2OT3B 4JYBA 1SXJD 2PBRA 2OXCA 2ZJ2A 2QP4A 3K9HA 3NTUA 5FOTA 2OAQ1 1S9DA 2F1IA 5K8LA 3CPHA 4PPNA 5M04A 1MABB 1QHXA 1BMFD 1FMJA 2ZRFA 1KI2A 2LKDA 1P9NA 5JWHA 4UKDA 4GOXA 4B3XA 1TU3A 1XZPA 4YMSA 2G1KA 4TLEA 2VHQA 3CPEA 3DVLA 3NEYA 1US8B 3MLEA 1OF1A 3LO5A 4RZ2A 2OFOA 3VHLB 2J5XA 1AKYA 2GCOA 1DAEA 4Q01A 5GJCA 4FWIB 4UNNA 2OFWA 2W00A 5EE0A 5FI0B 1WB9A 2JLVA 3TE6A 3MWJA 2OAP1 2ZAMA 1HUQA 2JDID 3SE0A 4BPBA 3B60A 2B8TA 1T91A 4HB2A 2QTFA 5IRCD 1HA3A 5FPTA 2AX4A 1CR2A 1YQTA 2ZJAA 4IJMA 1RRGA 3QNUA 2J46A 4PZLA 4JLBA 1T0JB 2OCPA 1TEXA 4GBMA 4LV8B 1TL7C 3BAFA 2ZJBA 3AGQA 5J5CA 2BOVA 1XPRA 3PXGA 1A4RA 3Q5DA 4OHWA 1Z6YA 1E1QD 1SVOA 1COWD 4M1MA 4Z54A 5G40A 2W6JA 3BD9A 4Q47A 4NYMQ 3NC1C 1BYUA 2O8DB 3M0EA 3CNLA 1E9FA 1P9RA 3K9GA 4GZLA 3THOA 4HB0A 2ZRLA 2D2EA 2F1JA 3CZPA 1NIPA 1QVAA 1SKYE 3CUEF 4MGYR 1RJ9A 3DOFA 3FKQA 1UKYA 1QG4A 2Y8EA 4KBGA 2AWNA 4TLDA 4XVRA 2RGGA 2QBYA 1NIJA 4DXAA 3GLGE 1N5IA 4B2PA 2VO1A 3IQWA 1P73A 3KTAA 4US0R 2IYLD 2ZXUA 4YDSA 2J59A 3Q5EA 2CJWB 4OHVA 5FUXA 1R5OA 2GJKA 3I92A 4NH0A 3C4JA 2DFTA 3QKRA 2IEYA 3NEJA 1EX6A 4JL5A 3BH7A 3CM0A 3MJRA 4LHWA 5C18A 2CLDX 4I1OA 5DI9A 4C30A 4B47A 3J81k 1KO1A 4GP7A 4Q1AA 3T06B 5EJEA 2QE7D 4TQAA 2HYIC 4UNPA 2X2FA 3P26A 3RC3A 4DT1B 5JJIA 4PSKA 3K0CA 4HSEA 4WVFA 4NYIR 3T15A 2QGNA 5FPSA 2G9NA 2YYZA 1ZJ6A 2R6GA 3D8BA 2P65A 4Q4JB 5BN5A 4Q4HA 3VNVA 3CLVA 1AS2A 1DE0A 5KSOA 3IEVA 1U8AA 4FI3C 4HZIA 2QPAA 4JS0A 4J0QA 4Q18A 5CJ2A 4YXWD 2J0SA 3F5FA 2ZI6A 3U3MA 1W0JA 1XWIA 3AVWA 3NBFA 1OYWA 2C98A 2P6RA 2QZ4A 4XTRA 3U4QA 1G3MA 1TPZA 2C8VA 4XTCS 2PCJA 1JXOA 3QQ5A 2QAGA 1YE8A 2YINC 3QF4A 5AJWA 1YR8A 2PMKA 2WWHA 1FTNA 3L2OB 3AKEA 5IHPA 2GCOB 4NZYA 2GHIA 2X8AA 4PPQA 2P0EA 2IK8A 2CHVA 621PA 1DBSA 1SVSA 3ZQ6A 4D0NA 4BZPA 2RGNA 3RWOA 2JLYA 4XOIA 1WMSA 3CRMA 1Q1ZA 2RGXA 1NVVR 3WP0A 1LY1A 2GCPA 1J8MF 3MWYW 1AZTA 3PENA 1DG3A 5B64A 1U81A 2QSZA 2BVNA 1YJ5A 2XNDA 4G1UC 4D0GA 4RKEA 4AIIA 5HE8A 4OK6A 4PPFA 1G6OA 2IF2A 2ZYTX 1CJTC 1N6OA 1NBMD 3EG5A 1YRAA 1GKUB 4QBHA 1X3SA 4AYTA 2NZJA 2D3WA 2NTYC 4AC9A 3ZVLA 1ZM4A 3U61B 4O0MA 1SGWA 1XMJA 2VSOA 2G6BA 1KY2A 3K0AB 4Q9HA 4RKFA 4QGFA 2ZSBA 4QG7A 2PZFA 1A7JA 1OXSC 2AXNA 2QQ0A 4EJSB 4DLZA 5FFMA 4MKGA 1RJ9B 1U98A 1KI7A 1T9HA 1FX0A 1TMKA 1ZD1A 5TY0A 2HCBA 3A36A 3PUYA 2BJWA 4PC3A 1UM8A 2OXRA 4JLPA 1R2QA 2V7QD 4F4CA 1GL6A 5KTYA 2A7QA 2JLUA 5FTNA 2CEAA 4FCTA 1W2GA 2Q0HA 2NO6A 3U7FB 1W5SA 2VP2A 3I5XA 2XOKD 1YR6A 5D3MA 3WMGA 1Q22A 2EFCB 3L8ZA 4S2EA 5DYGA 3QKRB 4KHZA 4TL7A 3MMPA 2Z4RA 2NIPA 3OIWA 4A0HA 5CIWA 3VX4A 4G0NA 4AKHA 2IXEA 1Z29A 3KQHA 3LBIA 2VHUA 4CF7A 5FOVA 3GEEA 1JR3E 3UWKA 4EPWA 5KNDA 5E7IA 4DRZA 5EP4A 5B2ZA 2R9VA 1E2FA 5J4KA 1OFTA 1ZUIA 3G82C 4TL9A 1XRJA 3EIHA 4LI0A 2MMGA 1KSHA 2BIFA 4FW9A 1S96A 1NLFA 5K8TA 1W4BA 2XAUA 1OYYA 2ZI5A 3MG9A 4BRWA 5DNYB 4IHQA 4B6EA 3ZZTA 4Y0AA 4EFLA 1G7SA 5JECA 1RKBA 2PT5A 1JAIA 1MV5A 2YKGA 3SJCA 2JJ2D 3IBGA 1CJVC 1VYTA 2IYVA 2B7BA 4TQ9A 4YMVA 4D4KA 5FR1A 1WXQA 2LWIA 2VP9A 4CIDA 2PZGA 4RSGA 1YRBA 2YOFA 4Q4AA 5BW8A 3GCGA 1JQJC 3CX8A 4PSAA 4WXRA 5K8IA 2Q9AA 1OHHD 1FTSA 3QF4B 4BUJA 4LK2A 2JLXA 1HY3A 5B30A 4XIGS 3MCAA 2WWFA 1N5JA 3GMTA 4DLSA 1H8ED 2PLFA 2Z4SA 5KNCA 3ZLJA 3U6KA 5E7MA 721PA 4JLNA 1P72A 4GSYA 3SJAA 3QJYA 4D2IA 3EPLA 1L4UA 3F3YA 5FBWB 4R71A 4HZUA 4AURA 3T12A 1JJ7A 4Q9KA 4P4UA 4TMXA 4LPSA 3NDPA 1QHGA 2GEUA 4HB4A 2KJQA 4EFMA 5HKKD 4BRUA 1FP6A 5C4GB 1GRNA 2OBMA 5F3WB 1U94A 4KFUA 4MGKR 4TL6A 4Q1FA 1MO4A 4PHGA 4N3NA 5KDLA 1WQ1R 2WOJA 1XU4A 3NHBA 3A58B 3PEWA 2O8EB 1KDTA 3IIJA 1E1RD 1ZINA 1RYFA 4B48A 2ZI3A 1FL9A 4URYR 2ASEA 4EIWA 3FPAA 1ZM7A 3AF0A 5JS8A 1R0WA 1P7CA 1DAHA 1NL3A 3C5CA 3C8UA 4U00A 4AG5A 1YR7A 3IEUA 3RSLA 4KLZA 4MGZR 3CIOA 4IOMA 5FUYA 2O8CB 2RB4A 3U6BA 3NDBB 2FEOA 1L7VC 4D4LA 2HXYA 1YKSA 2FPMA 2FZ4A 2GILA 1IN6A 4JT2A 4OQNA 1VYUA 1KMHA 4QBGB 2IW3A 3IPXA 1HT1E 4ERNA 4PXAA 1KY3A 4HLCA 3BFVA 4XWOA 3KQUA 3K09C 1GP2A 4IFEA 1XTJA 2OUKA 1KZGB 2ZUDA 4DSTA 1EXMA 1RYHA 4B34A 3OFNA 2W0MA 4URUR 5AR1A 3WNDA 1GM5A 1RIFA 1RVDA 1LB1B 1FZQA 1GZSA 1HQYE 1KSFX 5FPKA 3JZAA 4ACBA 1YZUA 3CF6R 3IDQA 1XJQA 4LYJA 4RVCA 2UKDA 4G5SA 1XDBA 2WKPA 4G5GA 4XD7D 2IYQA 4MGIR
chains in the Genus database with same CATH superfamily
3ZV4A 2J4DA 1SCIA 2D1TA 4ZVNA 3HY6A 3ZVRA 2O4UX 2GESA 4DUGD 1T10A 3E27A 4BWYA 2Q49A 4HEHA 4FM9A 3CX4A 4WZBB 2FG6C 1KJIA 3AKCA 3WLQA 4DMCA 4O8ZA 1LW7A 2PS3A 4G24A 1U02A 1VKNA 2OG2A 3Q7IA 4IOJA 1OD6A 4Q7MB 4TLMB 5IJAA 1MZPA 2JFPA 3NFRA 2O8NA 4RLFA 4FDVA 3QP9A 4M0KA 5A3QA 1VL2A 5BUCA 3PL1A 4A0FA 4QUIA 4UEWA 4W82A 5LU9A 2QD4A 4CUJA 4EG3A 3CKMA 2PS1A 2OGWA 1B0PA 3LA8A 3MMZA 3OTWA 2V1UA 1Z2CA 1N2XA 4BVLA 1ZCBA 1POWA 1MH9A 4M99A 1E4EB 1PTJA 1IAQA 2HRQA 2QDKA 5JXHA 1FNDA 2WF5A 3OEED 1IG3A 3CR8A 1T8PA 3W8RA 5I6DA 2AOTB 2JLRA 4M83A 5I9TA 4MWCA 3U2QA 3KT3A 3L06A 5LB2A 3H42B 3ZOZA 3OH8A 4INZA 4X3PA 3CT4A 3D2BA 1NR7A 3RIGA 1AQLA 3LXUX 1FP2A 1KBQA 5K3OA 4OF4A 2X0NA 2NXWA 2OZKA 2Z5LA 4UBKA 1KAHA 1KFCB 3A10A 2C5BA 3PXEA 1P9WA 5BV0A 1H5UA 3JQPA 3VR5A 1IQPA 2Q6TA 2R11A 2ZRKA 3C16C 3F7OA 4JUAA 3QYJA 1RPNA 5AKIA 3GPLA 1Y9ZA 3QEMB 4D4HA 4QUAA 1PO7A 1TYCA 5FWDA 1M34B 5CDYA 5CDSA 5JAZA 1U1GA 3O8CA 1ZVVA 4V0NA 2JBHA 1XRNA 1DXYA 1KJQA 2H8GA 4JJ6A 3KSUA 4KRXA 2ODTX 1QF9A 1S2LA 2WU1A 2XVMA 2YZKA 3HUFA 3KHTA 3MT7A 5DBGA 4CT4B 2A0KA 3BXFA 2CHQA 5IM4F 3FTNA 1KJNA 5KJ1A 4MGEA 1V4NA 1JLLB 1SZPA 2OM6A 5JVDF 1J7KA 3R7WB 4IWNA 2XMCA 4K9OA 2OV4A 2JCBA 4RGBA 2BP7A 3TVTA 1YVPA 1P18A 5C3MA 2C95A 5COAA 2Q3HA 3OCWA 2SNIE 1VJ0A 1O58A 2AD1A 3E7XA 4IJKA 4NOKA 4YECA 5T41A 1EM8B 3JQAB 2AR7A 4DG9A 1AY0A 2OD2A 3SXJA 1DX4A 3WKEA 2I9PA 2DFVA 1Y1RA 3FDZA 3B6MA 4RM3A 2DEUA 1XDWA 1A9XA 4DCGA 1OASA 3CKKA 4DR2B 3H2ZA 1ZSNA 3U60B 2P6PA 2IZ5A 2NXJA 2VRWA 4YS6A 2CXQA 1E0KA 1OBFO 1EEXB 2C5EA 4I4TA 1DJMA 1U7UA 3KXLA 4FSHA 1G3UA 4IHKA 4KRYA 3DL0A 1MIOB 1VBFA 2QS9A 2FZWA 4ZZ3A 1WTCA 3Q7RA 2P4UA 4KO4S 4UHEA 3R74A 4B7XA 1QIHA 5GJBA 4M98A 4XLLA 4Q3EA 3EY4A 2Q1XA 2P2DA 4OXQA 3QPDA 1D4FA 3PDJA 3QY0A 1SXGA 4I6GA 1K98A 2QT9A 4YLGA 4EYOA 3VNQA 2VQ3A 3TJRA 4DIUA 4ER0A 1G9XA 1UEXC 2XTZA 3R44A 5C3UA 3EFOA 2B92A 5BWNA 3QVJA 4IDNA 1CZHA 1I5EA 2QRQA 2VDOB 3BRSA 3CRQA 3EH2A 3E9MA 4FINA 5FBKA 4EW2A 3B70A 3HJFA 4DQKA 2UUBB 1IYZA 1JQAA 2VHEA 4IIXA 5EIEA 5JJKA 4QPNA 3W90A 4HEA1 1KU6A 4JDPA 1Q74A 1SVIA 1NY5A 2LR0A 3WB2A 4Z4EA 3LG2A 1VHLA 3LD9A 3PA6A 2GAAA 3VAAA 3FOWA 2Z6VA 3TAUA 3W5CA 4UBJA 3FUCA 2ZM6B 4XEUA 2FWAA 2OZVA 4JODA 1W88B 1QH0A 5LA6A 3A1WA 3ELDA 1TYZA 4D8TA 3K31A 3U0VA 4DIEA 3LBNA 1A9PA 2ZAOA 2UXCB 1O0SA 4BQRA 3KKKA 3SQLA 4Y9UA 2GPYA 4EDFA 4EPTA 5BSGA 1AA9A 4JXXA 2AWOA 4GOND 2P4HX 5DCLA 3I01A 4N6OA 4V0RA 1QS0A 2HU5A 3GYBA 3LBFA 5JZVA 1O9BA 4J0CA 4JB8A 2JI8A 3L82B 1L2TA 4FX2A 3NKVA 4K3UA 1B0UA 1P5ZB 2F1HA 2GR9A 2A14A 2XJ4A 2YUIA 2V98A 4PGFA 3VPXA 3QVKA 2GXQA 2XNSA 3OLQA 2G28A 1KKMA 3GGSA 3A6HA 1PR2A 5FOQA 1C3LA 4RANA 3A4YA 1S1CA 4URFA 1N1DA 1OVGA 3TBKA 2W6JD 1U7ZA 2ZSJA 5GJVC 3VX3A 1JG3A 1MABA 1XFDA 2ZYDA 4AP5A 3DBOB 3BH6A 4TS3A 4YROA 1JLKA 4UVEA 1FOEB 2OMKA 3GGJA 3A4LA 4OHYA 2PZAA 1OH5A 5DGTA 1DJLA 5JATA 3PUIA 2D5CA 1NVGA 2OO5C 5KZMB 2A59A 2NMVA 1TJ4A 3EGVA 3C3EA 1HETA 5FV4A 2REBA 3GRAA 3QVWA 3NKLA 2PZEA 1K7YA 4C4XA 5LR6A 2FLKA 4PHFA 4CG1A 3KQKA 1RBZA 5ED0A 3QLUA 4JR1A 4O4JB 1VLMA 4WY5A 4LGYA 4YDQA 4FCCA 2B69A 1Q0TA 2NUPB 4MWZA 5KWIA 4X1OA 1SWVA 5A2QA 4KK4A 3DPIA 5I8ZA 1NX6A 1YB1A 2WRZA 4J16A 2FFRA 3CVUA 2XE6A 3LJKA 4EVIA 3DFFA 2OXFA 4H3HB 1BS9A 3DBIA 1RKXA 1EK0A 2Z9DA 5AO9A 3BSSA 2CVOA 5FLKA 4RL6A 2OA0A 1JZQA 1SUWA 4IXMA 1AHIA 1ZVMA 2HB6A 5AKZA 4KQIA 3PXAA 3N1UA 1IDOA 1DV1A 4MUYA 2PQMA 2RAVA 3HEAA 2ZU0C 2BGJA 1SG6A 4FFDA 4OQMA 5BW4A 4GLBA 5EE9A 3NVAA 4OKSA 4V24A 5EG5A 3I61A 2PKXA 4M1ZA 2AFIA 2C42A 3B6IA 3E82A 4KQCA 1GGKA 2UAGA 4OJTA 3H3FA 2A1UB 1O6GA 1Z0UA 4PLFA 4JT9A 3ZGYA 6NULA 1RDFA 5CCEA 4QGSA 1JG4A 4G4SO 1R8JA 4DUZB 2EJTA 1K5GA 1S3GA 5EMJA 4INPA 4HDKA 5LYYA 1GGVA 1Q0LA 2P5TB 2H1VA 4RQBA 1PFGA 1R16A 2TMDA 4GW3A 2IUTA 4HHEA 1EFUA 4LZWA 3VR4A 2Z3ZA 1OBHA 1LRKA 3D6VA 4QYMA 2HUNA 1N5DA 2EGHA 2QENA 5LQCA 1S8AA 3PWZA 4Q82A 4RCZA 2F48A 1UH5A 1NU8A 1ABFA 4LYGA 4YWJA 3THXA 5ALGA 3FSGA 2DRIA 4NBTA 2R44A 3WIUA 3RRBA 4QLOA 4EECA 3GQVA 2ZR8A 3B53X 3IOEA 4NDNE 4X8LA 4CMJA 4IJUA 4DZZA 2OWEA 1XZCA 4PQFA 1DIOB 4MX8A 2Q4TA 3LUKA 5GOZA 4PO1A 1ISFA 1E8NA 4ZVVA 1P4RA 3ZK7A 2FWJA 3LLMA 2Q21A 3G5AA 3RAEC 1UM9B 2EWWA 2J41A 4MW6A 5TQVA 4RO0A 3GEIA 4CDGA 1EFHA 3ZJVA 2HSDA 4L6AA 3UOAB 1ZONA 2WJZB 3LQ2A 2ZIXB 1H0HA 2V7BA 3UHJA 1XTSA 4P5PA 5DGHA 3W5JA 5IN4A 3HDQA 2IBMA 1QHYA 4XZ3A 1KQPA 5T4FA 4ND6A 3WB1A 3TPCA 3COVA 1CFZA 1R0LA 1F8UA 3GFTA 3A11A 5D8DA 3TINA 4Z0PA 4BO8A 1OTXA 4EJMA 5DNVA 3RSHA 3IV7A 4LSZA 2H5IA 3OY7A 5GIOE 1KZ1A 2MTBA 3H18A 4UFPA 3BXGA 3PDHA 4QTTB 1P6QA 5CW2A 2HO4A 2ZROA 3HB4X 3NX4A 1R8XA 2HGSA 2VSXA 3QPCA 4GT1A 5TQ0A 5ULLA 3ZNPA 3P9YA 1WIWA 1AK2A 3IV6A 3OA0A 1R0RE 1PT8A 1SBHA 2A9PA 1FYVA 1VOTA 2GZSA 2IFTA 3LNTA 2X1VA 4V0ME 1NT2A 8ABPA 4IDDA 2IPNA 4WAUA 1RI2A 3WGIA 3AQIA 2UYHA 3V34A 1QH9A 4I66A 3OJOA 4DIBA 1VGVA 3ZW8A 4D80A 5CK4A 3GELA 1NDUA 1Q1NA 3CO5A 2EYQA 4UTPA 3QE2A 1GTZA 3C5HA 4JZYA 1W4AA 4B4VA 1Z4QA 4PYQA 3BRQA 4J1NA 1XTUA 4JK3A 4UE2A 3WYNA 1RE1A 2Q2WA 1ULZA 4MVJI 5K0CA 2CUNA 4FNGA 4XCVA 5G0SA 3AVXA 4RF3A 3AYZB 3GPCA 2HD4A 3H75A 4A03A 3PQ8A 1NBIA 2OCDA 5EHXA 4RTKA 3WRXA 1NA5A 4M76B 2ZR9A 1Y5IA 2PAAA 5K0NA 1CYDA 4ZVPA 4LSMA 4WADA 3WGMA 3CLUC 3ZDCA 2JIMA 4CE6A 1BE8A 1FJGB 4PANA 2NXNA 2IEDA 1W49A 1XRLA 1N75A 5BMOA 4LOKA 3U4DA 2J8ZA 1IONA 4EMSA 5DXAA 3IVCA 4MP8A 4YN3A 4EEKA 5IMSA 2AG6A 1GU1A 2XX3A 4MUIA 4OL9A 1FZTA 5ADHA 4IDCA 2AN4A 4LCJA 5G0UA 3T41A 3ROXA 4J7CA 2SKCA 4M9SA 1VCOA 1N0VC 1LNZA 1U0JA 3ZBUA 4COOA 3BSWA 4WBNB 2P9BA 1DNPA 5J2UB 4MIEA 3MWEB 2ZT5A 3K1YA 4GLFA 4EJ6A 2D5BA 1L7QA 3OY2A 3FCCA 1MENA 4DAOA 3EISA 3O8BA 2AMVA 4R2KA 5JNSA 3V9PA 4Z86A 5JRZA 1S8OA 3AF4A 4O2AF 1XD8A 4Y7CA 2QX8A 1Z2OX 4JBLA 4QBKA 2IWRA 4PGMA 4RK4A 2BGUA 3OT1A 4D8VA 2X0KA 4BKMA 1NMYA 1K6MA 1X9HA 1TU4A 1JLHA 2HUPA 3WNBA 1VCIA 1UZMA 2VPXA 2FVXA 4ND7A 2B9VA 2RHDA 3IQGX 1V48A 1U7HA 2CHUA 2GCIA 2LPMA 4MV8A 4UPDA 1XKLA 2Q1WA 4IICA 2FA9A 3R9WA 2D00A 2AEEA 1BH2A 4LDPA 1NBEA 3VC3A 3QWAA 3MQFA 1R4NB 2XRMA 3CEAA 5JAQA 3CEJA 3KEFA 3TW4A 3X1WA 4MEBA 4G0PA 4P2GA 5HS6A 1WVMA 1VI6A 4AKEA 1OXMA 2FPGB 3GO4A 2YOHA 2HYDA 5CJPA 1AUXA 4C29A 1KEEA 4JYAB 1AXGA 3L8EA 3EQ7A 4LF7B 1ODTC 4J03A 5KWSA 2OGTA 4BEBA 4LHVA 3BE4A 5I7RA 3H6HA 3I1JA 4B7ZA 2BHTA 2QMUA 4KQ1A 1CZOA 2QZPA 2BM8A 2JI9A 3E48A 1PT7A 2JF0A 3NIFB 1EINA 2QZJA 3U44A 2EQ5A 2XT0A 3EWNA 1B1AA 1SBZA 4LY6A 4OGFA 3P9QA 3TECE 1AN0A 4EITA 2J85A 1HTBA 4EATA 2ID9A 3ZWCA 3NH9A 1NXXA 1CUIA 1Y7TA 2FKNA 4AI6A 5JYEA 1YULA 1T5LA 3EVAA 1USVA 4O2BA 3FFBA 3ZTYA 4FFLA 3WMRA 4AY2A 1VFPA 1Y3IA 2JB9A 4CETA 1W96A 1O57A 2ZYGA 1AD2A 4RYDA 4EO4A 1M83A 1CT9A 2X9GA 3QSGA 4JGIA 4B6FA 2OBNA 5BT8A 3GLKA 3CNNA 1D2RA 2VRBA 4Y18A 1F8YA 3C6BA 3KXPA 2H16A 1JEAA 1VYHA 1XAHA 4GMKA 4L2IB 1TXGA 2BCGY 4M22A 4ZO6A 4BQFA 4QFMA 4EZIA 2B98A 1TZMA 2K6GA 5L4SA 1OT3A 5IAKA 4RD2A 4EVRA 2LNDA 5BW5A 2GPNA 3UKJA 1KDPA 4MMZB 4GMFA 4B32A 1OIWA 1LRLA 3SHOA 4J9UE 4IINA 3FKJA 4AZ0B 1AGYA 4C4TA 2FR0A 1CHDA 1VHJA 3JQ9A 1FY2A 3ZH9B 1D8AA 4HWPA 3PE6A 3CXUA 3EGXA 3OC6A 3PG5A 4MULA 3SBOA 3BB3A 5FYDA 4EARA 1UZNA 3PGKA 2H7CA 3DKKA 3I6IA 3K1TA 1TLTA 4RTPA 3A28A 5J4VA 1GLVA 2ZI9A 2ZI4A 5F5NA 2AHRA 2FN7A 4Y2VA 3ZE0B 3MWDA 5FWXB 2O8EA 4YHBA 3PKIA 2YIJA 4PO8A 1JYSA 1K68A 1KKUA 3OPYB 3ABOB 5LUBA 3TLGB 3BK7A 3MCVA 4EL0A 3GLIA 1I2CA 1N57A 4H3VA 2HCRA 4L22A 4DQLA 4EPXA 5JAUA 2HW8A 4Z7JA 2C4TA 3U31A 4OP1A 2B3TA 1AKVA 5KQPA 3LIIA 5LN1A 2F8TA 3JD2A 2O6LA 4E94A 2O5EA 3SBXA 3VM6A 4IXDA 4AS3A 4E12A 5L3QB 1EE9A 2F4NA 1TJ3A 1SMKA 3QHAA 5ERYA 5KMGA 2E49A 1JB1A 1CULC 2V6FA 1T25A 4EB6A 3LWNA 3AL3A 3LF1A 5HJEA 1D8TA 1WU8A 1WKBA 3BG5A 3FFAA 4PS0A 1FJHA 1GXSB 2FCAA 4AMZA 2PUDA 4IXTA 4M6WA 3ZN2A 2FYTA 4LOJA 1NWCA 3D3WA 1KKLA 5ICEA 2IZZA 5CYFA 3D4LA 4JI3B 1CZNA 3IKLA 4J90A 3V4LA 4CLHA 2O0JA 2XHEA 3F9IA 4KKXB 4NLLA 3G88A 4ZDJA 2P27A 4R8SA 5KSYA 4W5QA 1OFHA 3GNLA 2Z3VA 4N47A 4C1BA 2CJPA 3SKXA 3K6RA 4KDEA 4BUCA 3PX3A 2OYSA 2OMEA 1JE1A 4ZAFA 4DR3B 4MV5A 1P7WA 1UOQA 4JL8A 4F6CA 5BWLA 4ZVSA 3RO7A 4U7JA 1C1DB 4A15A 3HU2A 4MV1A 3W04A 1IMOA 1PK7A 2LUOA 1UJ2A 2DAPA 4NNJA 1YZVA 3A4IA 1ELOA 4JP1A 5DYIA 5A3RA 3TG8A 2DF8A 2ZTHA 5AUNB 3TR6A 4YAOA 3FTEA 1F20A 3LCMA 4G1VA 4Z7QB 1WMBA 2ZVPX 4FE4A 3V4VB 2QN6A 1KNXA 2XODA 4UMDA 3T6KA 1JQDA 3M1IA 3NM6B 3TH5A 4CMBA 1YA6A 1DGQA 4XLTA 1FP4B 4G5YA 1HZZA 3L43A 3MFQA 3T5DA 2G6TA 3FLAA 3N75A 4F2DA 1Q2XA 5U1PA 3W1EA 5T4EA 4MYUA 2C2WA 1NE7A 1M73E 2NUTB 4G25A 4WZBA 4CKWB 5AOVA 2ROQA 3SI7A 3V8EA 1A04A 1QHHB 2C8KA 2H2FA 2GCGA 2HQRA 3QKSB 4M9RA 3O26A 4CCWA 5B1YA 3U7HB 3N05A 4C06A 4R1OA 1NVDA 1VRCA 1CY4A 4P54A 4NAUA 4RK1A 3JD3A 3ZQJA 3Q85A 5H70A 5JROA 1VI2A 1WX1A 1YDMA 1E9AA 3CZ5A 2LDBA 4L95C 1HT2E 4BP3A 1A7UA 2NZYA 3DHWC 3OMXA 3DMNA 1O54A 4UEJA 1D2GA 4UTZA 5GP1A 1OB5A 1Q1BA 5BSTA 2VUTA 1LDGA 1PL7A 3N6RA 5CX4A 4GMHA 1ND6A 4HN9A 3N2YA 1R6AA 4Q37A 1XXHB 4A2QA 4IVRA 2CWWA 4LJ4A 4V0QA 3CE6A 3B3QA 4PLVA 1DWPA 1RZUA 3FWYA 2XBMA 3PF9A 3QYAA 1RBMA 4D45A 3O7WA 1UFKA 3GVIA 1Y3BE 3S2EA 3Q5GA 4NZNA 2CCGA 3PE4A 2ZUSA 3V2IA 1WMFA 2BE9A 3SIXA 2HQOA 1VE7A 1GD1O 1H2HA 2HTEA 1DTSA 2Q4RA 3BRWD 3HKEA 4RABA 4RZIA 5IBPA 1RVV1 5EHQA 3P32A 2QUHA 3K73O 5JCOC 3BSFA 1C5KA 4M89A 5DYYA 4BB6A 1JECA 1CY0A 3RNOA 2CMGA 1I24A 4UBIA 4DV5B 1PVOA 1FFEA 2B94A 2JASA 4OQFA 1M34A 1TUEA 2OCYC 5H5JA 1JEOA 2YRFA 2PUCA 2ZVJA 2G9RA 3O9MA 5KTSA 5CD1A 1TMOA 3A9UA 1MORA 3WG9A 5LUAA 1JQBA 3WGNA 1DBIA 4ZALA 2BEUA 1ZW6A 4JP5A 4OXXA 3WKCA 5HEKA 1NV8A 3ICOA 3FUXA 3R7WA 1AQUA 2Q5IA 3IXQA 1JXMA 1QGUB 3L0DA 2RKWA 4Z53A 2ADOA 4PHTA 3CNEA 4K9LA 2FRDC 3F4KA 4ZQEA 3GFSA 3FI0A 4Q00A 3JQFC 3DONA 1EM8A 1EFKA 4ZA2A 1ZUNB 3ED5A 4OO3A 4ZHQF 1SEPA 4WOBA 1EJ0A 3V6MA 2R97A 1TO6A 4HFJA 5TT0A 1G8GA 3NG1A 5EKDA 3WMXA 3ZNOA 1XHLA 3HYTA 3RJ5A 5FBVB 5IYZA 4AO8A 1RAGA 2VQ6A 3AI2A 5HUQA 1M2NA 2Y1XA 2GM9A 1JPVA 1HLDA 2PXAA 1UJNA 1U8TA 4GPEA 1YHNA 4IDPA 3I4LA 1JYFA 1TC2A 2VRCD 5BUZA 4MDFA 5E6RA 3T3NA 2BRUA 5ECWA 3ROZA 3WZLA 5A5EA 2PV7A 3Q3JB 1T0UA 1PJRA 1TKRA 4BYMA 1IY8A 3KSDO 2W37A 1R5NA 2A4MA 3DR3A 4OH1A 1TA0A 3WBJA 4W5RA 2FF7A 2ZJOA 4ARVA 1HDGO 1NONA 3QOFA 1WUJS 3CRZA 4KC0A 3FKSA 4XXHA 3IPRA 1TQ2A 2KHZA 4AYWA 3DP9A 1XRRA 2XNHA 2DT5A 2QX7A 4IR7A 2G63A 4PO9A 5DLYA 4AMGA 1FMCA 4KXWA 3RJMA 4BNFA 5KKCA 1T9BA 4EQZA 2MSEB 3LX8A 2MYTA 3N0TA 5FPYA 1P6XA 4X45A 5A71A 4MVXA 3R8CA 1QIFA 1SY7A 2GYVA 4RPLA 2HIMA 4PU0A 3WFJA 1XMXA 5KB3A 2GRUA 1D4OA 1SBIA 1ND5A 3QTBA 4NVRA 1BVHA 4DKJA 1T43A 2R5WA 4I8IA 5A5FA 5IDQA 3FUUA 1ZDMA 2AH5A 4TWZA 5DNWA 4IUBS 1SC9A 1NQ5A 5FBHA 3KHSA 5B2EA 4EGQA 4LJAA 2O2GA 3T7IA 1UOPA 5C51B 1U3GA 4U9HS 2VL7A 2EKLA 5HGJA 3N8IA 2ZJYA 3PD7A 2A0WA 3ONFA 4DC1A 4JXJA 1CUHA 1LWOA 1I1HA 1E5LA 1GPWB 1UFOA 3IESA 4LWOA 4DKXA 1RP1A 1XF9A 3C98A 2JAUA 2DY1A 1Y4DE 2P4EA 4F4IA 3GFRA 1Q83A 3CZCA 2R85A 4Z2AA 2XEDA 3I72A 1NLZA 3UA3A 4YUVA 1H4SA 2P9GA 1R6DA 5JJLA 4TUYA 1G7RA 2A0XA 3WWPA 3ZXIA 3KQLA 1EEHA 5GMOA 3MCZA 3OCJA 4Q05A 4KSCA 4OLHA 2DJIA 1FFDA 2C20A 4E5MA 5G1NA 1W5AA 2AQKA 2X40A 3QVXA 4I8DA 1XWFA 4Q9NA 4XR4A 2VHTA 3UMSA 5DNCA 3ZWOA 3C8MA 1XTVA 1M7BA 2AEJA 3EAFA 3SSAA 4ER6A 1P2BA 4IFBA 3JRNA 1VHQA 3DOJA 3G8DA 1TVEA 2PYZA 2G8LA 2IODA 3B6JA 3IMGA 4JZKA 1LXCA 3EZ2A 4QGBA 5BN4B 5EERA 3IQEA 1EIWA 4TV8F 4R8RA 1DO2A 1O77A 2BDTA 2D5IA 4LVCA 1KZHA 4UVGA 3U16A 3QKWA 1Z2PX 3KZVA 3NPAA 4KUHA 1NF3A 4V38A 3S28A 4CV1A 4YIKA 5CK5A 4F1KA 1M7GA 2BGGA 1RQXA 1RLTA 3FCOA 1DQSA 2NUPA 5FL7D 5ILOA 3IFSA 4URWR 2JFQA 3L49A 3USZA 2R96A 2C7VA 1MP0A 2F3TA 1A4XA 2J0UB 4Q19A 4QODA 1DVRA 4UZEA 3FSRA 5IZCA 2ICAA 1S2MA 5KTMA 5DN6A 2X0EA 1ZCZA 4M1WA 3S99A 1QP7A 1T3HA 3C3MA 9MHTA 3D4PA 4MA4A 4ADSG 4N18A 5JUWA 1QRUA 1W52X 3PFHA 2FN9A 2GAJA 2BBTA 3P9RA 2NSJA 3BJIC 5G3ZA 3V8QA 2VJAA 1PSZA 5C1BA 2OILA 4XWKA 1YFKA 4KQ9A 1MR3F 5IVDA 3SBDA 4KDRA 4FX5A 2R7MA 1HTTA 5CCDA 1XMQB 1WVGA 3LPLA 4QC2A 1NVUQ 1PZMA 1T0PA 2C0QA 1SVLA 3K53A 4TTQA 4L27A 4GKVA 3UUWA 1K8XB 3ZLUA 5IVHA 2HDHA 3ZJTA 2X9VA 3JWGA 1U3UA 2DWUA 4RJJA 4XSVA 3EA0A 1WKCA 1J9EA 3K7EA 3PTLA 4L9WA 2I3AA 5DIFA 5HKKA 4ANFA 3NVDA 2OORA 2XUZA 1L7AA 1HNZB 2IYUA 2R751 5K7SA 2EFHB 4BHTA 1ESCA 2NNWB 4PRZA 1UC8A 4OV6B 2I8AA 2RIRA 1ZH8A 1SHKA 1V1MA 3GJXC 5UKDA 2RAPA 3EMVA 3W3AA 3ADBA 2R00C 3AONB 4U2GA 4XVUA 2KSQA 3W6PA 2AZDA 3EXFB 1OLOA 5DTIA 3WE7A 3Q9UA 3T4UA 4HAVA 4IV0A 5HF5A 4ENSA 1TAGA 4MI1A 4R1NA 2JHFA 3D31A 1WHTB 2HPZA 5IJ0B 5B64A 2VSQA 1UM9A 2QIPA 4Y2YA 1FVFA 4ML3A 2XZPA 4M46A 2CYAA 1MJGA 2ZIXA 5K0LA 2A5GA 2QTMA 4Q24A 1VIDA 3NTXA 2H08A 1SU8A 3C15C 3TD2A 4QQRA 4A0GA 2VUUA 2FPPB 3RUDA 3K2QA 1TF7A 2IZ7A 1I0ZA 5D1NA 3REFA 1NVWQ 4M37A 1VE1A 3DEKA 3NWJA 3QU2A 5H4HA 4XIYA 4AY6A 4UHCA 2Z6AA 1QMPA 3IMKA 3CZQA 1P5HA 1QYWA 1XEXB 2KS6A 3E3OA 2VK1A 3H9CA 2ZCVA 4TMTA 5F7JA 3ER6A 4C89A 1ITZA 4B4WA 2HF2A 4N0MA 1QZTA 1KFBB 2CL5A 4RVUA 1WZ2A 4GEGA 2F3PA 4GOKA 4NX2A 2ZU6A 4W7IA 4D9GA 2XKKA 4PM4A 3H2GA 1O6BA 1DXQA 2AEFA 1PW7A 2VTBA 4GPD1 4E08A 3SAJA 4AECA 2JCGA 2C82A 5FBZA 2DQZA 3SFZA 3VOSA 3IALA 1G8JA 3VR6H 3W2GA 2WA1A 4D6XA 2Y99A 2V45A 2GD1O 4JR2A 1OXUA 5BSHA 3H5WA 2H11A 3S2GA 1P2VA 2WIJA 4C0WA 1RQPA 4RTRA 1KQOA 4EGCB 2QZZA 2Y93A 3ND8A 4ZVKA 4ZI7B 1TQ8A 2DPGA 1L1EA 3PUKA 1DMSA 1A7AA 4U6QA 1U3DA 3AERB 3KPVA 1NUHA 2WNSA 2FGKA 3EVDA 2W6PA 5AQEA 5CT4A 3CNBA 2BM0A 2DFPA 2R2AA 5FA6A 8ADHA 4RZUA 1GNSA 1Z06A 1C7RA 1QONA 1MDFA 1C3VA 5HCUA 2XVZA 4KE6A 2AR0A 2X58A 4CIXA 2R84A 3CO0S 4RK0A 4HQFA 4BNGA 1FYFA 2Y1EA 5DHQA 2LRHA 2INGX 1II8B 4K28A 2Z8YA 5C8VA 1A9QA 2WDPA 3BGWA 3F7MA 2XUIA 4IM7A 5AI6A 3NC4A 3JD0A 3SVTA 1Z45A 5JD3A 1DG1G 4WBNA 1Z39A 4UVHA 3AYXB 4ZVMA 4YV0A 3RKUA 5J2UA 2MR6A 4X92A 4QJ5A 3GLUA 2J3DA 2OXIA 1XUOA 3HHEA 3AUTA 1W6RA 4WJKB 3ZU6A 5JBIA 2P9HA 3IAEA 1IBRA 1JL3A 1FYDA 1XEWY 1Y3DE 5HPYB 1Z6PA 1FP7A 3B3FA 3RASA 2VA8A 4D9CA 3IBTA 4C6HA 2Z2ZA 5T6MA 1PVVA 4RKRA 1VG0B 1LJLA 1Z6QA 2DTEA 2J3QA 4HI0E 2PO5A 1ZXLA 2EHDA 1Z15A 1X6VA 3KYBA 5B3LA 2YFYA 4KZPA 5JSFA 2GD2A 4D3FA 4S35A 2DUJA 1QJ4A 4DBLE 3DYBA 4FFNA 2NZ2A 1SG0A 5TGTA 5JD4A 5GV7A 4ALNA 2O5RA 4RS3A 4N5LA 3EUFA 4C0BA 4KYVA 2FPGA 4G65A 4R8KA 3UMVA 4C07A 5TIIA 3GWGA 3K6SA 1SO8A 3CW8X 1FQJA 5DPMA 3W2HA 3GAZA 4KTTE 2QL5A 3D1VA 4V0KA 3UV3A 3V7YA 4FQ8A 1ENZA 2SCUB 3C5VA 4LJ9A 5AUPB 1RAAA 3QFCA 3DLCA 3PKJA 4RMGA 4DUYB 2RJOA 4RYLA 4MS4B 4I4IA 2GQ0A 3ZWQA 1DAMA 4NU6A 3VPFA 1RHMA 4JBIA 2BTQA 3IHTA 4CUZA 1LRJA 1XRPA 2YW2A 1GQ2A 1XE3A 3BMOB 4BZZA 1RAIA 2Q4OA 1TJPB 3HABA 1KPGA 1Y3FE 3B1YA 4DLNA 1FTWA 1XZHA 3VVBA 3ZE7A 4JJZA 5LXTA 3C6KA 3VJRA 3PUXA 5FKJA 1L7MA 3AR3A 4N41A 4XAQA 3Q8XB 4FXOA 3IDSA 3L8CA 2FGJA 4YRTA 3WISA 3ZYCA 2H00A 4D4GA 5J1SB 1FW6A 4PICA 5ICGA 1IPEA 3H65A 4GC5A 1LFAA 2LIVA 2R8OA 3AEZA 3ICQB 5EMLA 3LW8A 5CDFA 4DSZA 1Y4ZA 3TYXA 1XDZA 2V7GA 1NMQA 1OVMA 2OM2A 5FTLA 3O4FA 1PYDA 4L2IA 1QE0A 2EQAA 2EVWX 2H7VA 2UV8A 1I4LD 3OP4A 4UAVA 5DMXA 2A57A 3TMAA 3PRYA 2ZCJA 4O6VA 3W05A 2PUEA 3DDNA 1M10A 1HMYA 3QI2A 3R41A 1FPQA 3FROA 2G7MC 3OT4A 3V4PB 4ZI7F 3FYTA 3WK7A 3MTAA 3GRYA 4K0KB 3GRUA 1L4EA 2V0CA 4JOBA 4AZ0A 1XOIA 4C2UA 1RJFA 3P19A 4PX2A 5BYAA 1H69A 4BVGA 1PWEA 1F51E 1PSWA 2I2XB 3FYUB 2ODAA 3MILA 3KVVA 4KTVE 4L0QA 4FK8A 3BIOA 3P96A 2IEGA 3VC2A 1U2RA 1W4ZA 3W5UA 3I9LA 4A2PA 3E53A 5KNDD 4FYHA 4PC6A 4XCQA 2D7DA 3VKHA 5B1IA 1N77A 3DO5A 1AV7A 1JNYA 4JC0A 4TS1A 3IO5A 3KAKA 3OPYA 5F1PA 2XV1A 4PRLA 3NP7A 1Y9AA 1RADA 1GQRA 1H9BA 3TW0A 3PP8A 3K5PA 4B6SA 1CF4A 2OBYA 1ADGA 1ONPA 2XVYA 2A1TR 3MUFA 1F17A 1QQ7A 3LY5A 4MOWA 2EHJA 4QECA 1BGXT 5E7JA 3FDFA 5FNZA 4AJLA 4RTSA 3LX6A 4DQUA 1HE4A 4PX3A 1U2ZA 2C2YA 3LK7A 3USCS 3WA6A 1G2QA 1OGIA 4Q3OA 2BFOA 5AVYA 4LZLA 5GONB 4CCYB 2NYRA 2J0VA 1VLLA 2ZJ8A 4HWTA 4F5YA 3F5SA 1YDGA 3CUVA 1M7HA 4ZC8A 4JXKA 2HLPA 1ZRNA 3V1YA 1XTQA 1GXSA 5FHQA 4K9KA 2PR7A 1M0EA 2FK8A 3ZNQA 1EWQA 2XXBA 4O3FA 4WSOA 5FWNA 3BX1A 4MVJD 3RU3A 3NKFA 3O2SB 3SS7X 3SYNA 2VJLA 1P33A 4YT4A 4YONB 1NDHA 4R2HA 4BO9A 2A8YA 3OTOB 1RWPA 3KE9A 2IE0A 4P5DA 3X44A 1Z2EA 2GYUA 3ZIDA 2C5FA 2C99A 2DLCX 4CM8A 2YV2A 3TNLA 1WCIA 1Y7IA 3I05A 4WECA 5D7BA 5NLLA 4D0LB 5AVRA 4MQBA 5JSYA 3QSYA 2BYTA 2VT6A 4CM1A 1KPIA 3Q3IA 2YUTA 4OU5A 4KR6A 2WZBA 2BTEA 3PBKA 1DB3A 2AA3A 1UWVA 3H8WA 1DC8A 1P4SA 1FB5A 2VJBA 4IJ6A 2JKYA 2B25A 3KAJA 4LHEA 5AYVA 3LBYA 2ZZNA 3X1KA 2ONYA 4ZCSA 1RRFA 1PFQA 3I09A 4XUGB 3PFBA 3RI3A 1E3TA 2W6MA 1H85A 4F4HA 1PFUA 4LTMA 1XHFA 1NQVA 3FNBA 3UIEA 4NQZA 1T4MA 1JHMA 1L7PA 3PPYA 2NUTA 5IJZA 3UK6A 3QKSA 1G1AA 1CY1A 1N0WA 1ZL0A 2P2ZA 2V7TA 2DCMA 3K4PA 3KWMA 1FXUA 4KH0A 1YZTA 3FPGA 4Q7QA 1WSBA 1ECLA 4Q1DA 1J0AA 3LOUA 4M9QA 4Q7JB 4L6CA 1FFCA 1KYVA 2MDTA 3JQ7B 4MHOA 1CRZA 1M1YB 3PEYA 2Z30A 3ZE1B 4CM7A 1GNTA 1PLLA 3ADPA 1U9IA 1YB4A 2XKJE 3JYNA 4PLTA 4Q3AA 5DI3A 3TGPA 2DUUA 1N2GA 3MUEA 3EWSA 1Z0AA 2BKUA 3DQZA 1VXOA 4DLRA 5ECGC 3ZIUA 4S1PA 4D92A 3GVCA 1XXHA 3A9CA 1XTTA 4EHKA 3IQXA 5HIIA 4DBLC 3BGDA 2W2TA 1O7JA 2EZTA 2HX1A 5AJXA 4AQ7A 1QFYA 2J3KA 4UDYX 3VU0A 3K20A 1ONBA 2XB4A 2PBZA 3ZZ1A 1K06A 1L5NA 4PCLA 3ELBA 1QBKC 4TS4A 1J8YF 4FEEA 1Z0ZA 1QMGA 4II2A 5AJTA 5EINA 2G04A 3A7EA 1VLHA 1Y8CA 1G98A 4FNAA 3WI7A 4PFSA 3CH5A 3R3UA 3AINA 4CM4A 1UK9A 3AUYA 5EXXA 2BZ0A 1E7QA 3C8HA 3M89A 3PD0A 1TVCA 2PFKA 3IO3A 4MKZA 4RIHA 1RYBA 4QFBA 3R7BA 4MRMA 1IAVA 3N2EA 5A5DA 1B6RA 2A5LA 3CN9A 1DDIA 3LFHA 3WJ1A 4BNUA 3HKCA 3ECAA 5IEJA 1SQFA 2K4MA 3QU9A 2J9ZB 2PRIA 3OZSA 3H2YA 1W46A 4WT7A 3TLXA 2GEKA 2JAPA 5I7HA 2J3IA 3W78A 2Q0XA 2AFHA 4GZMA 2FPIB 3M6AA 4II7A 3TAXA 7YASA 5HYVA 4K6GA 4EM6A 4Y2GA 4A82A 5AM3A 3UQYS 2E48A 4ZT6A 3R76A 2OV3A 2VK8A 2P69A 4FGUA 1X70A 1UBFA 2AW5A 5LDDC 3IKTA 5DX8A 4ECEA 1L4FA 3O93A 4XW2A 3MWGA 1K08A 4S12A 4BU1A 3QLVC 1M2VA 3ICCA 4B43A 3U9SA 4IVPA 1GFIA 3A7DA 4GI2A 4BEVA 2WPNA 3QEKA 2B4KA 4HWKA 4INJA 4JJ4A 2IYPA 3BQ9A 3KTDA 2RJNA 4G4IA 3O0DA 4Y6OA 3K9WA 4KMMA 4Y1RB 4JX8A 2QVZX 4R4JA 4KX5A 2VWGA 1BEZA 1ZH2A 3NPMA 4EELA 1ISJA 1I7PA 1B8VA 2VAPA 4N3GA 3LM8A 4YNBA 5C4IA 2IPLA 2F90A 3FZEA 4ZANA 1Y81A 4AX4A 4IS2A 3SIPA 4LCBA 1LBIA 4F11A 3T99A 2ZREA 3SD7A 3WAKA 2QR3A 4IF6A 1HOTA 2Q3DA 3UAVA 4HQKA 5H9VA 2AE1A 3KTAB 5B37A 1MZVA 5B58C 1BFDA 1KBZA 1KFEB 4MRRA