4YCSA

Crystal structure of putative lipoprotein from peptoclostridium difficile 630 (fragment)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
SKKSVSMILDIEGTNNEAMNNSALLALNNAQKKLNIDTNKVESDDSSTFSNSIDILCNDNYDLIIAVGARFAKPLEMVAKKYPKQQFAIIDYEYDKQPSNITSISYEDNKSGYLAGLIAGKMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of putative lipoprotein from Peptoclostridium difficile 630 (fragment)
rcsb
source organism Peptoclostridium difficile 630
molecule tags Hydrolase
total genus 42
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ycsA00
1AB5A 3EODA 5BRAA 1D4ZA 3O74A 5DCLA 2FMIA 3C97A 1JYFA 3UK0A 4KV7A 3F6CA 2MYPA 4RK6A 4N0PA 5I4CA 5GOTA 3OO0A 2FXIA 5CNJA 1IIBA 4RXTA 1M2EA 2PJUA 1DBQA 4RY9A 6ABPA 4N41A 2N9UA 3TB6A 3O1IC 5EWMA 3QEMA 3LFTA 4EY3A 3F6PA 3BRSA 2R25B 3LTEA 4XFKA 3ROTA 4OG2A 3RVNA 3O1JC 7ABPA 2FMKA 3K4HA 1SXIA 2JVIA 2FMFA 2F8SA 1KRWA 3KLNA 2MYUA 3RVOA 4HYEA 1TJYA 3QK7A 3MA0A 3C3WA 4MLCA 3QEMB 1TLFA 4W5QA 1BA2A 1QO0D 2PL9A 3Q7SA 3F7NA 4MS3A 1U2QA 2WY2D 1YS7A 3NHMA 3Q7RA 1MB3A 4TMYA 2FLKA 3DLBA 2IPNA 4MR8A 3NNSA 2LPMA 3H5LA 2JK1A 3LUJA 1OXBB 4ETIA 2E4VA 1R8JA 3QLTA 5IUJC 3E61A 1Z26A 1K68A 4MYRA 4S05A 3KCNA 3N75A 3FFTA 4O5AA 5IULC 5JNWA 4YGXB 3JVIA 4MS3B 2X7XA 2CWDA 4G0YA 3OQMA 1EAYA 1LJLA 4G97A 2O20A 2MSKA 4MS1A 3OMXA 4MR8B 1VRVA 1JDPA 3T95A 4G0MA 2LBPA 5TQ0B 3URMA 4EYOA 2FN9A 4YWHA 2PUEA 2NUBA 3IPAA 1QKKA 4RSMA 2PL1A 1VPWA 4XAQA 3CTPA 4KK4A 3DGEC 4KREA 1A2OA 3LMKA 3OLXA 3B2NA 6CHYA 1U0SY 3C6QA 3QLVC 3O75A 1PNTA 5IC5A 2NT4A 1RXEA 3CRNA 3RVPA 4DQDA 2LIVA 5TQJA 3OQOA 1D2AA 4HNSA 3LUFA 2IPLA 3C3MA 4MS1B 3MMNA 3N0WA 4E7OA 2WJWA 1Y1LA 1H9CA 2QVCA 3G85A 3QX8A 3LUHA 4IGAA 4Q7EA 3JY6A 4KRFA 4JAVC 3RVKA 5JNVA 3NNDA 1APBA 4D74A 4Q6BA 4MR9B 1BDJA 3A0RB 3Q9SA 1EWVA 1DCFA 3Q15C 1Z13A 4KK3A 3GA5A 4MS4A 5EWJB 3O21A 4MQEA 2OQRA 3SM9A 1JBEA 4UHJA 4MQFA 4W5OA 1ABFA 4JASB 4G0ZA 1NATA 1DBWA 3LOPA 2L17A 3M6MD 4QYWA 3EAFA 1TVMA 1UDRA 1ZN2A 3CFYA 3KJXA 5IEBA 1BVHA 4RK1A 1NXWA 2AYXA 3VNBA 4LE1A 5BQ3A 1PUXA 4LDAA 4MS4B 2FEWB 3HO1A 3A3KA 1E6MA 2P9HA 4MQEB 1ZITA 3RVJA 4N0QA 4RY0A 4MQFB 2L19A 2B1JA 1JHZA 1TM2A 3T8YA 1SD5A 2HSGA 1ISRA 3CS3A 4PZ0A 2IKSA 1F51E 1QO0A 3IP6A 3L49A 3N53A 1XWWA 2QSJA 5IUNC 3GV0A 2CHEA 4QYMA 5DTEA 3RVMA 3JPWA 1FFGA 3GL9A 3H1GA 3IP7A 4KQCA 1ZDMA 4KPYA 3G1WA 2A9PA 4KMRA 4P98A 3N6VA 1DRJA 1YS6A 2PUBA 2DRIA 1L5ZA 1P8AA 1JYEA 5KQMA 1DZ3A 2B4AA 1P6QA 3H5WA 3UKJA 4OLBA 4WUTA 1URPA 3QLVA 3QLUA 1Z25A 4Q6WA 3JPYA 4YCSA 1YTUA 1C4WA 3LUKA 5KQPA 3NNNA 2H0AA 1DRKA 3OLWA 5D2CA 1CYEA 4RXUA 4ZPJA 1ZVVA 4Z4GA 4LDZA 2FN8A 2CHFA 4NCBA 2PUFA 1P2FA 3KHTA 4RS3A 4F12A 4ETMA 1U04A 3E3MA 3EJWA 2R47A 4F06A 3QX9A 3T38A 5CNMA 5B3JC 4LRQA 3I5AA 1GUDA 4W5RA 4NV3A 3FFXA 2JCGA 5IUKC 4LZLA 1AB6A 3HJFA 4DADA 2Q5CA 2FSPA 2NZVG 3H1FA 4W5TA 2FQYA 4LX8A 3OO1A 4XXHA 1USIA 4KQ9A 5IBQA 1M2FA 1Z17A 1Z16A 2A9OA 2LP4Y 3ILYA 3O1HB 1QMPA 1B00A 1FQWA 3D8UA 5JS1A 4LE0A 1Z12A 1ZGGA 4L4UA 2GWRA 3VNAA 5HSGA 4W5NA 3H5TA 4M88A 2OENG 4OTZA 4EVRA 3Q7TA 3IDOA 5KC9A 3GBVA 5KC8A 1QP7A 2PUCA 3KS9A 4S04A 5TQ0A 2E4YA 4ZMRA 4RK5A 2L2QA 3O2JA 2P4UA 3OLYA 4N03A 2H3HA 3TMYA 2ZWMA 1PEAA 3DLHA 4DN6A 1W9HA 4YV7A 3CLKA 4WWHA 1RNLA 2IDMA 2CD7A 4HNQA 3MF4A 1SXGA 3OM0A 4Z9BA 2M1ZA 4HNRA 2QZJA 3OMWA 3O2QB 4RXMA 5E3JA 4MLDA 4MRMA 1HEYA 5JNTA 5KQLA 4OLAA 3DZDA 3HDVA 4Z9AA 5FWXB 1CHNA 3D02A 3FDFA 4MR9A 3HUUA 4F8JA 2FW0A 4ETNA 4ZYLA 2VYCA 4E7PA 4N47A 5EWJA 1A0OA 2ID7A 2YHAA 4KVFA 1JH9A 2FVYA 2MSLA 4H60A 1SXHA 4ML3A 5PNTA 2PUAA 1PHRA 2JBAA 4MRMB 1YMVA 2JB9A 3H5VA 4MGEA 2PKXA 4N76A 3JVDA 4MR7A 3ROFA 3KYJB 2FEPA 4GNRA 4XLTA 4Z0NA 4NCAA 4D6XA 2FKAA 3IP9A 3M9WA 2PLNA 4G0OA 4YS6A 1D5WA 5C5CA 2JBAB 1YK0A 3KSMA 5KI6A 3SG0A 1ZESA 4RKRA 3MQ4A 1DCKA 3CNBA 4RK7A 3DBIA 4MR7B 4RWEA 3EQ2A 1ZAYA 3BBLA 1W25A 3IP5A 4KZKA 2JVKA 5FBKA 4O1IA 4F3TA 4Z4FA 1NXTA 3I09A 2FQWA 2E4WA 5KQGA 2NT3A 4IILA 2WMYA 2IPMA 5ABPA 1LK0A 3SAJA 1A04A 3OM1A 4JB2A 1JFSA 4YR7A 2QV0A 3RQIA 3OLZA 3S99A 3GYBA 2FQXA 1ZY2A 1MAVA 5HQJA 1E6LA 4WT7A 5TPZD 1TMYA 3C3KA 4PE5B 4H3KB 5C5EA 1YVUA 3HUTA 1DC7A 2VK2A 3KG2A 3N8IA 4Z4EA 1ZGZA 3A0UA 3SNKA 5HM6A 1SRRA 2YHBA 1LBHA 8ABPA 4IF4A 3H5IA 1FFWA 1E2BA 4RDCA 4G0PA 3LUDA 3JTEA 1GUBA 3EQZA 2KYRA 4IMJB 5FBHA 5BR1A 3A10A 5DGCA 4PEVA 3HSYA 2HQBA 2J48A 2JVJA 3FGZA 3H1EA 1ZH4A 3LKBA 4TN5A 1NY5A 2MYTA 5TE9A 2A9QA 3K9CA 4RV5A 3CG0A 5GQSA 1JL3A 1NXXA 2WWVD 4EYGA 1NXVA 2NZUG 1T34A 2QW1A 2VUHB 4EGSA 1QP4A 3BRQA 1QQBA 4QICA 5JNRA 4EVQA 1I3CA 1PEYA 2QVGA 2M98A 5F64A 1ZH2A 3SQNA 4O1HA 3EDCA 3NHZA 1VLZA 1XHFA 1P6UA 2HQRA 4PYRA 3HV2A 3T6KA 4D6YA 1QNLA 3QEKA 1USGA 4RU1A 3RVQA 3MYYA 1Z2DA 3FFWA 4FB4A 5BRJA 4H3HB 1YIOA 1RXIA 2HPHA 1ISSA 3FMVA 5T7BA 3SY8A 1JX6A 5CNIA 3N0RA 1JLKA 4GPAA 2FEKA 3ILHA 5ED4A 3P9YA 4ZJPA 1RZRD 1D1QA 3NBMA 4XARA 3I42A 9ABPA 3MIZA 3HM9A 3HVRA 4TLLB 4WZZA 4KFCA 4P1ZA 2FMHA 2BGGA 4Y9TA 1BDIA 1M5TA 1DCMA 1Z2EA 1NTRA 5FWXA 1EHCA 4FE4A 3GRCA 5EWMB 5CNKA 1BDHA 1GCGA 2QR3A 3CZ5A 3QELA 5JNUA 2HQOA 3HDGA 1C0EA 5TPZA 2JRLA 2QXYA 2GKGA 4OATA 4YO7A 3RVSA 1DBPA 3IPCA 4G0QA 2VUIB 4RK0A 1DJMA 3TD9A 2IYNA 1DP4A 2I6FA 1LJUA 1RPJA 2IOYA 3LUCA 1MB0A 2L18A 3CHYA 1FFSA 2MYNA 1NXPA 3QELB 2PUGA 1J56A 1Z15A 1USKA 4Z4HA 3H6GA 4G0XA 5CHYA 2PAFA 4YLEA 1JFVA 1FSPA 2AYZA 5B3JA 4IRXA 2WJAA 1U2PA 4LE2A 1S8NA 3BREA 1EFAA 2LUOA 1VKRA 4FE7A 2E4UA 4QPJC 4PICA 4JP1A 2RJNA 1DG9A 3H5OA 1MVOA 3QLUC 4EYKA 1XHEA 4G86A 3GBPA 2A9RA 1D1PA 2FTKE 3RVLA 5FWYA 3OQNA 5IEJA 1DC8A 3HEBA 2PUDA 4WXEA 1E6KA 1WETA 4YRZA 3EULA 5DLEA 2W42A 1L5YA 2RGYA 2R4QA 3RVRA 1JFTA 1BAPA 3CKMA 1MIHA 2IPAB 3R0JA 4MAAA 4NQRA 5DKFA 5FWYB 3KLOA 1KRXA 1JF8A 4ZMSA 2WRZA 2QU7A 5TPWA 4F11A 3DGFC 4OBBA 5EWLA 2GI4A 3TX6A 1QPZA 4Z99A 1GCAA 5HKOA 3HXMA 4EYQA 1M5UA 1RZRA 3HS3A 3KKEA 3KTOA 3TO5A 3LUAA 2XDYA 4L85A 3H75A 2PMCA 4JA2A 4XASA 2GBPA 1GLGA 2RJOA 3HCWA 3N0XA 3F73A 5TQ2A 1LBIA 1KGSA 3LKVA 1U8TA 5JNSA 4YP9A 5KWSA 3H6HA 5TPWB 5EWLB 1JDNA 4EVSA 2TMYA 1YMUA 3LUGA 4Z4IA 5JS2A 1ZHHA 4RY8A 4B09A 3I45A 3M9XA 3RH0A 3HK2A 3O2SB 4UHKA 3UUGA 4MPTA 1EWTA 2MSWA 3EGCA 4RKQA 3OLVA 2E4XA 3MM4A 1K66A 1KMIY 4EUKA 1NXOA 3CU5A 5T3YA 1NXSA 2R48A 5TQ2B 1JWLA 2FLWA 1PNRA 3Q41A 4JB0A 3L6UA 3CG4A 4Z4CA 2GX6A 4RZSA 2ZAYA 2RDMA 2HJ9A 1QQAA 3GT7A 4JOQA 4RK4A 4NICA 3BILA 3JS5A 3KYIB 2F8TA 2V0NA 5IX8A 4CBVA 3W9SA 2PE5A 1YK1A 1F4VA 2E4ZA 3GWGA 3CZCA 4TLMB 1QP0A 1OXKB 1Z18A 4KNYA 1CEYA 2WB4A 4WXMA 2ID9A 4IMIB 1ABEA 1EWKA 3HZHA
chains in the Genus database with same CATH superfamily
3IQWA 2WLTA 1YL6A 1TU4A 3Q6NA 2CDAA 3HDTA 4I9NA 2QAGB 5BQOA 3IV7A 3I4CA 5JRZA 2JFQA 3KZCA 4MH0R 3OJLA 4F2HA 2WYUA 4XDHA 1R4MB 1IEXA 1K97A 1NR1A 2C78A 3HBLA 3PFFA 3WRWA 1QHFA 2QLNA 1H3NA 3TB6A 3LOQA 1JH8A 3O9MA 4RF2A 3WO0A 3WYNA 3PEFA 1MOQA 3O1JC 1GFZA 1I2AA 4BB9A 4EHDA 3U19A 3FOAA 1QBGA 4KW7A 2F8SA 3TVDA 1VYVA 2XZLA 3T9BA 1NQTA 2RI6A 5D1NA 1XZGA 3DLPX 3C7TA 3H3JA 1Y3CE 1J23A 1WDLA 4OK3A 2W2QA 4DLKA 3U2QA 3ZDQA 5JS6A 2R79A 3HWRA 3KWJA 2NO9A 4KBGA 5FFNA 3EPJA 1F2UB 3E4DA 3VZQA 3KQHA 4C04A 4YRSA 4YRTA 1N8KA 4REOA 2GB4A 4ZYUA 2Q2OA 3AI2A 1GKIA 5DYNA 1RJ9B 4FQ8A 5A7FA 4MR8A 3HN7A 3NNSA 4EG5A 1KNQA 1D4AA 1GQFA 4UVDA 4DLUA 4LZAA 3U0BA 3L41A 3BSFA 1NVAA 3Q0TA 1QLHA 2C8VA 1DXHA 1M1YB 4MS3B 4YUAA 3ZLVA 4FZRA 1E3SA 1BS9A 3LIPA 1FDRA 1ZL2A 2FN7A 4J1QA 4KQFA 4NZ9A 1EAYA 4PYKA 3QW2A 4KB5A 3IB3A 3BGWA 4QASA 3SI7A 3ZGYA 5KTTA 2FF5A 4GP7A 2V6IA 1GM5A 3EGVA 3IPAA 3DE3X 1Y4DE 2VDUE 1MJFA 3CSUA 1VLQA 1FL9A 4GZ3A 3PBKA 4DQDA 4QXRA 3SSMA 4B2LA 1QG2A 2V7TA 1V8DA 1K5HA 3ANXA 3MMNA 5HCNA 3TQTA 4E7OA 3LPAA 2XADA 3RK1A 4Q9NA 3GLGA 1E6WA 1RTKA 1UFVA 3Q0EA 4LGVA 4D81A 1N7GA 3DYVA 5K0BA 3KB6A 4KDFA 4GKJB 1ONOA 3WLNA 1NR5A 3ZY6A 2P2ZA 5JNVA 4BNGA 2C42A 3B6JA 3KXPA 5HS4A 1O5IA 1Y1RA 3PUWA 4LZZA 3PTAA 1S5PA 2J32A 3PI7A 4MS4A 5EWJB 3DULA 1ZL0A 4NHOA 4V0MA 1CULC 3QOYA 2CEKA 2WWTA 2XUOA 3PXUA 3H8VA 3T0FA 1ABFA 1NVMB 3WK5A 1NATA 1FTWA 1U28A 2ATVA 1UJMA 3F8TA 4NECA 3VVCA 4B33A 3QE9Y 5F5XA 2IK8A 1NLZA 4J4BA 1K6MA 1UJ2A 2O1WA 1BVHA 4UEQA 2AYXA 4TQUS 1DC4A 3MWYW 2D7DA 1ZNQO 2H52A 3AM4A 4JYAB 2VUUA 2JLQA 2D1YA 1P4JA 3JU3A 3W9BA 1XB2A 2QP9X 2H51A 4KOAA 4H6XA 4U2CA 1D07A 2XMGA 3EZXA 3FNRA 3L9WA 4JIMA 3R76A 3BRWA 2RGDA 4KUGA 5TQVA 4CYMA 1J42A 1M72A 2JASA 3HP7A 3FMIA 3X2SA 3LLUA 3DR3A 3UMJA 4EJ2A 1SH7A 1O95D 2BC9A 2BUBA 1R00A 3A4VA 5IUNC 4D8VA 3NFYA 4CLEA 3K0CA 3TINA 4LV5B 3WY9A 2DBQA 4EZBA 1L7BA 4H18A 1FFGA 1C81A 4LZJA 5EZSA 2J7PD 2A2ZA 2RGAA 2ZRGA 3G2NA 3JQBC 3K1YA 3EUFA 2A9PA 1O87A 1RQLA 1Y1QA 1UBGA 1O95C 1X7XA 3HJCA 4MV4A 4ZO9A 1OFUA 4BGEA 4D4JA 3DC2A 5CEEA 1I0LA 5HJ5A 3T1YB 1REQA 4G8DA 1KYIA 2B4AA 4C2AA 2V6GA 2FZWA 1SBCA 1N2BA 1WHTB 1XTIA 4RIIA 4MUNA 5DISB 5I9BA 5EJ9A 4PO3X 3GD5A 1A2BA 3X1DA 3D1VA 2GVZC 1Q7GA 1NA5A 4JVLA 2QE7A 1Z83A 3CKLA 4ZVPA 5A6SB 1ZONA 4DPLA 4RXUA 1H94A 5AVRA 2J3IA 1IZZA 4KIFA 3TPZA 5B30A 5C7IO 4BNIA 4RHCA 4U39A 1P2FA 4R0NA 4PN3A 4UMFA 3JV7A 4I19A 2R47A 2HA0A 3QX9A 3BQMB 1J8YF 3G6WA 1DAHA 4JL6A 1UMDB 1R12A 1L5LA 2FSHA 1J49A 1X80A 2RHBA 4NAVA 1F8GA 2HK6A 4NV3A 2GPWA 4W8OA 4U7DA 1PKXA 1T1IA 2YICA 1QGUA 3ZKWA 1ENPA 2FSPA 1Z8FA 1N78A 2ZBEA 4W5TA 1FP7A 1D6JA 1QK5A 1JLLA 3MINB 4IAOA 4YDSA 3DMTA 5JJIA 2C00A 2X6TA 3RRXA 5EUCA 4LA4A 4QD3A 2BEWA 1SKYE 3TEMA 4Q9LA 4L4ZA 5ALHA 3VZDA 4BJHB 4X93A 3WFJA 1G1MA 1PZNA 5EMLA 1TFRA 4PFQA 2O7SA 1X7GA 2Q46A 3ABQB 1PJ3A 4YI3A 3NDBB 3HKDA 2PK3A 2NU6B 5CYFA 1CR4A 2OC4A 1W76A 1O9BA 1ZI8A 3D8NA 3G9XA 4KP7A 1F9EA 4PLHA 4RD6A 2I71A 2XKAA 3E9NA 4YDRA 4ZZ0A 1ESMA 1JRLA 1P1KA 1EK6A 3JQAA 4KWCA 4MQBA 2HOQA 3S44A 4F46A 2YDYA 1JEQB 1I51A 2QF7A 5E4FA 2FPKA 1AF4A 2F1KA 2WA2A 4FD3A 1QQ7A 2AFIA 1LPPA 2NVUA 3CX4A 1KMMA 2XMDA 1PEAA 3QYPA 4HEA6 1Y98A 2OM6A 5EJEA 4EUFA 2WPDA 1DO0A 2B2NA 4FOPA 4NR0A 1RZ3A 5D84A 3ZQ4A 2YBEA 4Z9BA 1TLLA 1G3UA 2CVQA 2EEPA 3N8NA 1TEHA 3GC6A 1KBZA 2IUEA 2OHXA 4FBMA 4OLAA 5JNTA 2AKEA 2OLEA 2ASEA 4EY7A 2O1XA 4OB6A 1HETA 2P78A 3CNEA 2IYVA 3D02A 5FWDA 3EY9A 4EJ6A 2O8CA 4JV5B 3UQYS 2BY4A 2QSYA 2YZ2A 3V5NA 1JJAA 1V16A 4CT4B 4YRKA 2QTGA 3CUWA 3G9UA 3IAXA 1EGHA 1NUSA 1XD2B 1IBLB 1V4BA 1DKLA 4U0KA 3CTMA 3LVRE 4IZHA 3JWGA 2WM3A 4BO8A 1CK4A 3K94A 4TSRA 1NV8A 3GDGA 4FNMA 4WDQA 5EERA 2PKXA 3ZX4A 4N76A 4YXWD 1VGQA 3OZIA 2IEIA 1S01A 1XVTA 2VAWA 2EEZA 4CCAA 3P8ZA 2YZGA 4PO9A 3ZE9A 1VMAA 1BVRA 2G9QA 3H4TA 1ATIA 3O92A 5CBPA 1N32B 2KHZA 2C2BA 4MVXA 5CEFA 4GYKA 5IW8A 4IGEA 3JYPA 3RRJA 1KO5A 3SE0A 2YWBA 1IATA 3A14A 1T0IA 2HRDA 1KYWA 3EWNA 2YJGA 3R44A 5DV9A 1I4EB 1IY1A 2RMKA 1ANKA 1Y63A 3A04A 3KSMA 3LD9A 2BFDB 4WCDA 5F1YA 2RKOA 2SCUB 2V7XA 4HADA 2IEZA 2Q3DA 3H84A 5CX1A 4EKDA 5KCZA 3ER6A 1OIXA 1NBAA 1RC1A 1TTHA 1XEXA 2G1KA 2I3GA 4J03A 1OV6A 2W6QA 1QK4A 3K92A 4NYIR 4S0XA 5A71A 1A69A 4EHHA 2VH1A 2E4WA 3DWEX 1S2LA 4L4SA 3MT7A 5D3ZA 1JIUA 3BXPA 4F3CA 5BQ5A 3SAJA 2DHRA 2ORVA 4IG9A 4WY8A 4DLRA 1FXWF 2H1RA 3KXLA 4IDQA 4QX6A 5DM0A 1MABA 2C5LA 2DTEA 2JBWA 2AJBA 3JSXA 3O4JA 3S99A 3SKYA 1U80A 4JNKA 2PSDA 4Y0NA 1U2SA 1XBTA 1P75A 2F6RA 3MJTA 4Y8VA 4NF2A 5JPCA 4RTSA 3CLVA 3DOIA 2YWHA 1UXKA 3I37X 3OIWA 1XF1A 4O6VA 5FA6A 5ADWA 2ZI6A 1BU8A 3DMYA 4WK6A 4YECA 2QBYB 4M76B 2NU9B 1SHTX 5KTMA 4N8DA 4HGZA 2X8WA 5HM6A 3PA8A 5IJXA 5BNIA 4IIXA 3ZWPA 1SU8A 1BFDA 1BW9A 2E0IA 5JVDA 1UT5A 1JZTA 3TKLA 1XA0A 4YIHA 1DKRA 2PPVA 5JS8A 1F48A 4BAZA 5ISMA 5EYPB 4IYRA 2JDID 1XFDA 2H1SA 3N2GB 1XPRA 3TLZA 2QORA 3QMMA 2HBYA 2C1ZA 2WD7B 3KYCB 5D1HA 2JLWA 1SIOA 2EJUA 1E89A 1MFPA 1OBHA 2UZ3A 2QY6A 3D8TA 4OQNA 4AX8A 1ZFNA 4DR4B 1ZNWA 2A9QA 2BUCA 2P3LA 2ZITA 2HHCA 3TKYA 2CJWB 1XTSA 4MEJA 5H83A 3BHJA 2CL5A 3BZWA 3T0IA 2Y93A 4MSUA 1ELOA 1LPSA 4FP9A 4XVUA 1KYZA 5HKKD 5DM70 4RLFA 4QICA 5KYXA 3I5MA 2X8JB 2IC5A 1XZPA 2WT8A 1VJCA 1JLMA 3I2YX 1UAGA 4Q01A 3HV2A 1D1TA 1JHYA 3O8LA 1CQIA 3PFGA 5IJ0B 2FPRA 4FIDA 1KC1A 2V7BA 2NSYA 1L7EA 3LNCA 3IIMA 3QV1A 2BFFB 2RB4A 4KDCA 3QA9A 5BN5B 3SC4A 3UT6A 4B75A 2HO5A 2JFHA 3TS1A 5CM2Z 5C4MA 1CR1A 4I5IA 4M0CA 3ISVA 1CFJA 1OBVA 1Z2DA 2VHTA 3JALB 3K1AA 4QBIA 5A05A 5HVNA 1WLYA 2Q1UA 4MP3A 3ZV4A 1BEUB 4BX0A 1PSDA 2D5LA 3H1PA 4MVJP 4DQKA 4LYHA 5I9TA 4FBLA 2CDRA 2G06A 3D6FA 1C8BA 4CEHA 4KQJA 2YFQA 5IABA 2LDBA 1WJGA 2GRUA 3NUZA 2CXHA 3WIUA 3OY7A 1TYEB 1ZRMA 4TVSA 4P36A 2I3BA 4RC9A 4DNOA 2GKOA 1UQTA 1NF8A 1LW7A 3WNDA 4Q4HB 5D01A 4TLLB 4JJFA 4QOJA 1M6EX 3P9ZA 3HJBA 3V7WA 1FK8A 4F4CA 1P7CA 2GQ0A 3MJVA 5FOVA 4H6WA 1YOVB 3RWBA 1V25A 2DTXA 4CEJA 4FE4A 3AB7A 3NB0A 1VLHA 4KIUA 4RW0A 4TT8A 3WMXA 4BTVA 3K32A 4R8RA 4M49A 1Z82A 2Z4TA 1Z4IA 3T1HB 1YL7A 1C0EA 3INYA 4IIYA 4ZHSA 2JG3A 1UANA 1MD9A 3DTTA 3MRSA 4YNBA 2ALJA 1I2DA 4PO8A 1T1JA 2V9PA 2Q45A 3DL2A 5DX1A 2VJNA 4MROA 2IYAA 1SULA 2V03A 1YONA 2GZAA 1WZIA 3CHYA 2Y6VA 4NYJR 4U2GA 3EARA 2K4MA 3H9QA 3U1TA 1JQBA 1XMIA 1J56A 5B37A 3LT2A 4P34A 3H6GA 4F45A 2ACEA 4OJKA 1R8YA 3G89A 3JZAA 1SZCA 3QPBA 4DSTA 4WCFB 3OOHA 1V9LA 2AYZA 4LWOA 4EA8A 1Z0SA 3GA0A 4LE2A 1MQAA 4ABYA 4CPDA 2LUOA 2OLKA 3USES 5FJJA 3NU1A 1UADA 1QHGA 2HQSA 3P9PA 3TLGB 2QRVB 4QBGB 3UJ7A 1YRBA 3TFOA 4ZVRA 3I2HA 1V6SA 2DHCA 1X8KA 5C81A 1ZC4A 4JUIA 4PSUA 1KZ4A 2FW8A 1QCCA 2H7YA 1RPZA 3CVWA 4NAHA 2P11A 4KCGA 1L4FA 2PSFA 3DFUA 4JFAA 1AXRA 1IEWA 2J9FA 2FWAA 3HJTA 5DNEA 3LSTA 1U81A 1E62A 1F8YA 4QOGA 3RPEA 3SYLA 1YVEI 2XB8A 3IT1A 1I32A 1YASA 4LK3A 1NMEA 1XU4A 1FX0A 4WERA 5FWYB 1F7VA 2ACKA 5IAGA 2OGUA 1GADO 3ECAA 3KKMA 4IH1A 3QEAZ 1DX6A 3KWFA 1E3QA 1JSRA 2YV2A 4O4HA 3HJNA 3R3YA 5GM2A 5IXYA 2ERCA 5KWIA 3ELBA 1HH4A 3UV3A 2R11A 3QITA 2BAGA 4IKPA 4KQIA 1IU9A 3C6MA 4QFCA 1L5VA 2O2ZA 2FLVA 3N2NA 1AURA 3PC8C 4X0EA 3LLSA 3Q5GA 4H7HA 4EZEA 1CJKC 3ENNA 4QHYA 1GPAA 4A2WA 1J06A 3A2MA 3BQ9A 4QQNA 3KXDA 3LKVA 1BOOA 2DUMA 1KAQA 5EOVA 1ODTC 1P0QA 3WI7A 4CMKA 1XMSA 1TL7C 2H63A 3EWIA 3HDHA 1U5BA 1U0OC 2XVAA 4J7AA 4NDZA 1IIRA 1J2RA 5JW6A 5A5FA 3FKSA 3FYUB 4B5KA 2J9XB 3K0EA 1CZOA 3C7AA 2QX8A 2F3TA 5EJFA 1H8HD 3TW4A 5JE8A 4WBXC 4ZI5A 3IAM1 2R48A 3I0ZA 4DMCA 1HORA 4IDFA 2HIAA 4CV3A 2X22A 5DTQA 2ZZMA 2WVGA 1H6DA 1GZ5A 4JYZA 1KRHA 3R5KA 3BM5A 2QHXA 3QIAA 1WKBA 2GXQA 3BERA 4G5YA 4Q9AA 4QDXA 5ILQA 4B6RA 4Q9DA 5K4AA 4BE4A 4D9EA 2V0NA 4V39A 2PE5A 3DMNA 4U6QA 4U6NA 4UDNA 2COUA 1FU7A 3REQB 4MUGA 4KO4S 5ULLA 2JI8A 1BYIA 4ZI2A 4BQIA 2WB4A 3OZUA 1PL0A 4RIGA 2G88A 3ZDCA 1GZ7A 1RHUA 1Z2CA 3ZHTA 2PZKA 3NX4A 4BOYA 1VHTA 2IYPA 1ZGCA 9LDTA 3C3BA 3GNSA 3ILSA 4EQ6B 4HX5A 2MYPA 4ZAXA 1EGVB 4Q1FA 3GP5A 3PKJA 4GQIA 3JQRA 3V00A 3DXYA 1VB3A 4UDOA 1WU8A 3ZJ5A 3BJMA 4RY9A 5JWHA 3A37A 3BWDD 2AMJA 2I1VB 4HR7A 5DYTA 4HGPA 1PNQA 4MV1A 3ZW9A 1AUXA 1AQLA 4DCMA 2GEFA 3UA4A 3VYWA 3RVNA 2QL9A 2Q6LA 4LC1A 5AO9A 3VOBA 3UH1A 4RPLA 2O19A 9MHTA 1FPQA 2GZMA 2QLFA 1I7SB 2C0CA 3UAXA 2JIZA 2Y0CA 3MCAA 5LP1A 5AKKA 4Y0AA 1ND5A 1L1EA 1BMFD 5GTDA 3WK8A 3H2YA 2PZBA 5DHRA 5B36A 4JI2B 2BRUA 3KTFA 5DK6A 2XVYA 1Q91A 4DCSA 3SJBA 2QJRA 1K2WA 3BH0A 2N3ZA 5IH7A 1E79D 1TZMA 1ICEA 4YFVA 2Z4RA 1DAEA 2BSAA 2EX0A 2RH8A 1UXJA 3EXG2 4LZPA 4KAFA 4YTEA 3W6ZA 3CT6A 3PYLA 3S2SA 4EI9A 1AQUA 3ORQA 3EXEA 5A4MS 2YRWA 5KX5F 1XV5A 4J29A 1MP0A 4S05A 4QM6A 3K1JA 4HXEB 5IF9A 1IXZA 1X15A 3NC0C 1GUYA 4I6EA 3H13A 4HN2A 4O4JA 4BB0A 2O0JA 1RQPA 4LCEA 4X1OA 4CLOA 5ER9A 1JN0A 2X9QA 4PR0A 1UKBA 1VG0B 3DYBA 3BDIA 2VVTA 4J8PA 3SIWA 4WZ6A 3BK2A 4MVCA 1F2TA 2A7QA 2F48A 4LCJA 1OI2A 3HFSA 1EZZA 3GQBB 1X39A 2FWRA 3OSUA 1B15A 1Q95A 2AC7A 2B0JA 1KMHB 2GBIA 2QG4A 3C6QA 4BGIA 4MYSA 1QIFA 3FCCA 3R7BA 5CA0B 3NAZA 3P32A 4QATA 2WM2A 2BBSA 4XGNA 3NAQA 3IDZA 2P41A 2NXEA 4I4NA 3LW8A 4YAKA 5TIIA 4IGAA 3V6LA 1L3IA 1M2VA 1SUWA 1BEZA 3N2ZB 1TKAA 1Z29A 4UD6A 5HYVA 5IT4A 1QCZA 1XQXA 1G8PA 1XCPA 1KI8A 3LWBA 3WRXC 1EWVA 3AIOA 3CR7A 1DIRA 1DCFA 3Q15C 3TRIA 1LPNA 1P29A 1LQ2A 2TS1A 5KYKA 1R27A 2GCOB 1VM6A 3ZY2A 1NMXA 3FMGA 3PLNA 5KSWB 4HD8A 4UHCA 5JMTA 2F1RA 4XM2A 1SXPA 3LOPA 2J08A 1F0NA 2GK3A 1ZN2A 5LOVA 3A1EA 3HCNA 1FP4B 1RQXA 5DLQC 4D0LB 4EL5A 1CTQA 1QR6A 1N9ZA 1UBFA 2H0RA 3QKWA 2W6CX 4KL8S 5CLHA 4RTMA 2Y2VA 3GJQA 2J8ZA 1IK4A 4MYTA 5LB2A 2A94A 2WMDA 3K0HA 2L19A 4P4SA 3VX3A 1SKQA 3TMKA 3S68A 2AZXA 1M75A 1WE2A 3NETA 2B1IA 1AGNA 1ISRA 3D7MA 1OPXA 4TWJA 4XTRA 3IP6A 3PGKA 1FNMA 1NRXA 1VPTA 4G5HA 2OFXA 4PAQA 1NURA 4KYTA 4QM7A 2GLTA 3CW8X 3PKIA 3JPWA 4O2AB 1KDVA 1B26A 4BDSA 3AL3A 1KSFX 1RKXA 2OCBA 4GC9A 4FLFA 5IJAA 2OAQ1 1ITZA 4JFRA 4LISA 4MW1A 4XGQA 4Z9XA 4TS9A 5J59A 1ZZEA 3G1WA 4R01A 3U7QA 1WSDA 2CUNA 1QQTA 2Q3MA 2XWQA 3FWPA 4FFVA 1AUPA 2W22A 3LH5A 3A11A 5EIOA 2NSDA 2WUVA 5KNBD 1GSOA 1DZ3A 1I4TD 1L7OA 1PJSA 1VKNA 1XZKA 3S55A 2RK3A 2BDEA 2Y9PB 1KZ9A 3D4PA 3UK2A 3IEVA 5ALQA 1TT7A 1DBSA 1I2ZA 2ZCJA 2OMEA 3TTVA 1A96A 2QOEA 5BSVA 3FH0A 3K53A 4CFSA 4WEOA 1Q6YA 4IRUB 4RD1A 1WDTA 1XTQA 3A6LA 4GZMA 3OQJA 4RQTA 4X41A 1P1FA 1QYVA 3FXAA 3S2FA 5C5DA 1EUDA 2HA7A 3KP1A 4Q4DA 3H7AA 1WZCA 2WAMA 3GMDA 2FK8A 4MMZB 2OHVA 5JCZA 5KQMA 4YRMA 2EV9A 3X1YA 5L3SB 3K9LA 1RPNA 1U04A 2C5SA 1SVUA 1J00A 2V54A 3L7CA 4PPNA 3T4UA 3T5TA 4LRQA 1E3EA 5AH0A 4TYPA 4YAGA 2DR3A 4ZVMA 5AXCA 5F9FA 3SR3A 4IJ6A 1H2EA 3T3HA 4BPRA 1POXA 1CUEA 1JSXA 1DUIA 4PBSA 2HX1A 1AMUA 1E1LA 1ENZA 3N2YA 1YCFA 3ZQJA 1R0BA 4LX8A 3FTPA 2RK4A 2DSNA 5I7HA 1N5LA 3Q2IA 221PA 1UT8A 1A7KA 3BMOB 3A1VA 5HIJA 1W46A 5KYVA 5AW1A 5HFAA 1MRNA 2Y1XA 4E2XA 5ITSA 3NDIA 1KSGA 4DYVA 5JS1A 1Z12A 4GLLA 1P4AA 1Z56C 2BMWA 2GWRA 4ZQFA 3H5TA 1SD2A 4M7PA 1U65A 1PS0A 2Z08A 1E7RA 1SXJA 2P9TA 4GPIB 5KC9A 2OBFA 2OO3A 1HE1C 1CUVA 1WBBA 4HKTA 2KQUA 1CZRA 4RK5A 2NUAA 3L0PA 3WMWA 2NXNA 2H4YA 3NXKA 2O1EA 3I4LA 2BI4A 4JXJA 2A0XA 5D6NA 2JHCA 3QVSA 2G7ZA 1MV8A 1WG8A 4XD7A 1KEEA 2UUOA 4QDKA 9GPBA 5JALA 1T6ZA 3ENQA 3VGJA 1GTG1 2IF0A 2M9MA 1TJPB 1XC7A 1NJ1A 1IQPA 2V6JA 3A6JA 4BP1A 4LPKA 4YJFA 4CM8B 2FWNA 1U2EA 4EKGA 5DN6D 2HF7A 1KI6A 2AX3A 2ZI4A 2HXGA 2QZJA 4YRGA 1KEPA 4MP8A 1S2MA 3NR2A 5ICEA 5K3OA 2XMBA 3QFCA 4YB8A 4EKIA 4CM9D 4FQ5A 3AVUA 3UMGA 4YC7A 4HDNB 2OK7A 4OM8A 3DE6X 4QRHA 1V1RA 3EE6A 1C4OA 1GR0A 1Q7BA 3ESDA 3LCRA 3K09A 2V98A 2MSLA 3UJNA 3ZCUA 3H42B 4B7AA 5PNTA 1V8ZA 1RWQA 1PHRA 1GVHA 3PUJA 4LHWA 2DULA 1SO8A 1QHIA 1Q1GA 3RABA 5CCDA 4DAOA 4QGAA 4AY6A 4BKQA 4CQJA 2YHIA 2OQIA 2G82A 2Y99A 3EPRA 1P2UA 4GNRA 3ID6C 1RC8A 5BV0A 3O4RA 1NAIA 4FNOA 1R9MA 4WVLA 5ITZA 1PZEA 4NBWA 2AXPA 4JLBA 3Q5EA 4R31A 4EKYA 1D5WA 3KT6A 1NZFA 1RP7A 2IU6A 4B4VA 2PG3A 3AI3A 3U3JA 1GPYA 1EP9A 1K0FA 1FXUA 3OJCA 4BVHA 4G5SA 4ILKA 4Y18A 1SUAA 4G63A 1XXLA 1SVWA 2RHRA 2QX7A 1XXHB 4FNAA 4CR8A 4V1CB 1JR6A 3HA5A 1FDIA 1DOHA 5KTSA 4BAGA 3IDAA 1D4FA 3R6LA 1ORVA 1NBOA 1YA4A 2CZQA 1HDCA 2JLSA 4KXYA 3RJZA 4DBLC 2P9CA 1UWKA 1VIYA 1L8OA 2PGNA 3GAFA 3KQSA 2EKDA 3AKEA 3PUIA 4PWZA 3IA2A 1OLUA 2WFLA 3WISA 5ABPA 3RVDA 5DMHA 1VLLA 5CT5A 1ACMA 2DU8A 2R1TA 3OM1A 3PGLA 3GK3A 2EIXA 2I5PO 3FYCA 1N0WA 4QUKA 4URYR 4DJ5X 4BXOA 3TSYA 3B1ZA 4FJ1A 4M1YA 3WYEA 3OEHD 3CEPB 4NIMA 3U09A 1CDDA 1NONA 4BO2A 5IKMA 1XAGA 3Q8XB 5A62A 4ZIRA 4CKWA 1EP2B 4M0MA 1G3RA 1RBYA 4RCVA 3OCYA 1NYLA 3CY6A 1GA6A 4J0IA 5E0OA 3WLFA 3OKCA 4EB0A 2IS6A 1TMKA 3QE4A 4RA9B 2C92A 2NQTA 4K6HA 1U4SA 3VKWA 4TMWA 2WSYB 4BNLA 4F8YA 3NTVA 3QPWA 3H11A 2W7TA 5I7UA 1E3JA 1R0YA 1X9HA 5TC4A 3EF3A 3E84A 1MOPA 2FK7A 4KR9A 4LRUA 3S5JA 2O2XA 3ZWBA 4EW3A 1V5FA 2HQBA 2PCJA 5AVSA 2Y92A 2J9ZB 2BMEA 4E21A 1S2DA 2XUZA 5K6TA 1JECA 3MUOA 5IT9A 4I3GA 3QKSB 1K4YA 4FGZA 5FOQA 5JOQA 4KJXA 4EFLA 1AMOA 4B84A 3AV0B 4V0ME 2QLLA 2F1OA 1Q7TA 3LX5A 5HPYB 1NXXA 1NULA 5F1OA 2O48X 1KMCA 1E1CB 1K06A 2CJPA 3GIWA 4IDOA 5IANA 2E2WA 1E2HA 4RA6B 3WGJA 5BUSA 4EVQA 2HYDA 1F6DA 2JI9A 1XHFA 1K8XB 3T5PA 2XYGA 3QKRA 1P0MA 2WJPA 4HO1X 2ZCUA 4PZZA 4URZR 1E6EA 1C7RA 1GFSA 3ANSA 4GKAA 4AJKA 3ZD7A 5J5AA 3QWFA 4D79A 3ZGNA 2QMHA 3N86A 1DEOA 5DTMA 4H2DA 1C29B 1TU3A 2AMLA 4ZCQA 3PC4A 3P0RA 3KYDA 4ZCSA 3V4SA 3DBOB 3CGWA 3VR4A 4AJ4A 1WQ1R 4K05A 1L4EA 3I6QA 3QUCA 1JFFB 5ALTA 4I4CA 1PFYA 4R6WA 1JX6A 4HUTA 3P94A 4HVLA 2NZWA 3L1JA 4I4TF 4LNAA 3TXXA 1EGAA 2JATA 2ZRCA 2PWPA 2D1TA 3EG9B 3G9TA 3P9YA 2RHOA 4IXMA 2XMSA 2ODEA 4KWIA 4Y2SA 2PANA 2V7QA 5COBA 4XWKA 4HS9A 4GLOA 2PYIA 2GTPA 2V8OA 3VZCA 6LDHA 4ZD6A 3DVLA 4F4UA 3QFFA 1TQDA 1FFEA 2PZFA 3NGLA 3FE2A 5AUQA 1LF0A 5CGZA 1IL0A 1KAGA 2BKAA 2DF8A 1PQUA 5BV8A 2PUVA 3SDSA 3WLTA 3A3PA 4Z54A 1PDWA 1LVHA 2XUKA 1JQ3A 4NNOA 1ZO8A 3C1TA 1UMBA 4PHHA 1U7TA 4CL3A 3CINA 4BRUA 2ONKA 3WGZA 3WYGA 3IC5A 3LFUA 5EJ8A 3QUTA 4L8GA 4PYNA 1TAGA 4WOCA 4I50A 2QXYA 3FGPA 2QUHA 4B3TB 1F6BA 1R66A 2CFTA 5LQJA 5ELMA 1VL0A 4JHLA 1NMYA 2Z2YA 3CVXA 2JAWA 2F43A 2YXDA 1FFSA 2V45A 3CISA 3FFAA 4IXWA 4OQYA 3X1WA 3TQIA 1XLUA 5IC4A 1FZTA 3JYOA 3QM1A 3MS7A 1DTSA 4DDUA 1QAQA 5GV8A 1YDGA 4C5CA 4O4IF 2PJRA 4GBGA 4Z7QB 1Q5PA 3DBVO 4KOEC 3ANMA 3VO2A 1W49A 4OSEA 4J7CA 4WZBA 1KZGB 2H3EA 4UZFA 4BWGA 3PDHA 3I30X 4QE3A 3TRKA 3A1UA 1A95A 5LUBA 4KHZA 1JPJA 3W78A 4AKSA 4B32A 5F7OA 5E4YA 5KTRA 1VPEA 3B36A 3TTUA 3IQHX 1K89A 1WTCA 2W90A 2JGDA 4ONEA 2A9RA 1ULBA 4QUEA 4BNTA 1D1PA 4IOMA 5L3QA 2HWXA 4QXPA 4TWIA 3A26A 2JGRA 1P3DA 2R2GA 3SDZA 1PL7A 1YIAA 2BSQA 5KOYA 4ZO6A 4AI6A 1P0CA 3C3YA 4YRZA 1VSBA 3HGMA 3OTWA 1SIBE 2AFIE 5ALWA 2Z6UA 3IEPA 1R0KA 1WB6A 4H35A 4MVJM 4BFZA 2V1XA 4YCNA 3W3AA 1VECA 2XDWA 2ZE5A 2EZ4A 5AVQA 3RFVA 4FDTA 1OH8A 2R8PA 1SVSA 4A8JC 4OXQA 2JANA 4M1EA 4B6PA 2B3DA 1V6AA 2QN8A 3ITKA 3SS8A 1ILEA 4Z99A 5HKOA 4COOA 2PH5A 1VI6A 3HS3A 2PR2A 2NN3C 3OZAA 5K8LA 4B9AA 4B6OA 5H0IA 5KOHA 1U2GC 4A26A 1HDYA 3JD2A 1EM8A 5IFKA 5LXTB 4RVNA 4JOSA 1XZNA 3B3AA 4PSAA 4ZEWA 4KXFB 3TNDA 5JNSA 2EW1A 1UPUA 1CY8A 2VPXA 3PXDA 2ZGVA 2XDQA 2Q1SA 2JHAA 4NONA 4Z3KA 2HV9A 4EA7A 2FP4A 3N74A 3GPDG 3PNVA 5BWOA 2JJ1A 4GDMA 1HQDA 2C58A 2ZYUX 3K6SA 1ND6A 2AHOA 3OPMA 2VH2A 2NZJA 5EZ6B 1NXSA 5HQTA 5D5QA 5JSHA 3Q41A 1E4EB 3L0YA 1ODFA 2AZ4A 1PEDA 4QGBA 3UAGA 4MVJA 3TZEA 4D9FA 1DS6A 1ZP6A 4JI8B 1T9ZA 2GSDA 1QBKC 2A5YB 2XOKD 2P0YA 4AVYA 5L45A 2JFPA 1NIPA 1WUHS 1GN8A 2UAGA 1PF7E 2E48A 4GU5A 2FW1A 3AOEC 2OCGA 4F9TA 1UZMA 4JT2A 3CWZA 5FDFA 5F9HA 1VJ1A 1T3GA 1W85B 2BDUA 2H2IA 2CC2A 4DG9A 1AXEA 2QGNA 1V11B 1JU4A 3HVIA 3GEHA 2XUFA 1HSZA 1YA6A 4ZVSA 3UMRA 5M2QA 1ZH6A 3HO8A 1N5OX 4S1VA 3SFTA 1Y3DE 2PU7A 1BH2A 1N4DA 3UAVA 4X45A 4DB4A 1U3FA 3Q3VA 4ZC8A 1GPDG 4J0FA 4H27A 4QOEA 1C3XA 1VP3A 2D4HA 1RQ2A 3ORHA 1PUJA 4G1VA 3BFKA 2D2IA 5JCPA 1W5SA 3GHYA 1T35A 4QQ8A 1EG7A 2VHQA 3PR2B 3I61A 2QKYA 2X1VA 3QK7A 1L8XA 2YUIA 3B20A 3C3WA 3EQ8A 3MA0A 4J2HA 1YVPA 2B83A 4QTZA 2HCRA 5E6RA 4FEGA 3DCIA 1QIDA 1A97A 1UWVA 1A76A 2IQIA 2QAJA 2WJ6A 4FFNA 4ND5A 3AIIA 5A3VA 3THWA 2BZSA 1P74A 5EKXA 1NF2A 3VHXA 2I65A 4BFTA 4ALMA 3D43A 5BY2A 5KUTA 1K7YA 3LA6A 4OMDA 5KKNB 1XRSB 5HMLA 1KTIA 1ESCA 4IIJF 4OGLA 2VS1A 3VU8A 3U3DA 4DMKA 5AJVB 2B78A 3PZRA 5E4TA 3RTDA 1TCBA 4C29A 3AEUB 4Q3LA 3H2HA 2JGKA 1PFQA 4OV6B 4RKFA 1J8MF 3WADA 1OAAA 4ZOCA 3U4QA 4TXLA 4PC6A 1T0BA 1P2SA 3M5DA 2B8WA 1GO2A 3X2EA 4UHEA 3DVAA 3JQAB 3OIGA 3LF1A 1NV9A 3F5DA 2B7BA 3ICVA 4MV6A 1ZJ6A 4A0RA 2FN9A 2IFTA 5A3QA 1SJ9A 3JWHA 3K15A 4JBHA 4KREA 4AIIA 3WB2A 4Q3DA 3S8MA 4C05A 3QLVC 3DKVA 5KYUA 1GCUA 2AFIB 2NVUB 5IMSA 1LSSA 1LF5A 4QOHA 4YJGA 1Y5MA 1R0CA 1R6XA 1EKXA 3BRCA 4IGKA 5HF6A 4RDXA 3AFMA 5EPOA 2GD1O 1EFTA 5BSRA 1WV0A 1E32A 2WAXA 1CDOA 3ZWXA 3EXFA 3G85A 3OVMA 5CTJA 3LUHA 4KPUA 1LI4A 2Y6UA 1DEAA 2AOUB 3L8YA 4L74A 1U6IA 3BFJA 3JZDA 3PG5A 1HF3A 4PLPA 5CH8A 2DVMA 3DQPA 5HWSA 5CP8A 3RASA 4A7PA 4BO7A 1ZSNA 4A16A 1AH2A 3GUZA 2YNMC 4UHJA 3RAFC 2EFDB 8GPBA 1KYQA 1B6GA 4EJSB 3DE5X 4ZT2A 5K0SA 3RREA 1T3HA 2QJOA 1M2OB 1XN1A 3CZ4A 1Z4MA 5BURA 3VXKA 4ATNA 5BMVA 3HZZA 4O8ZA 2CXQA 4GPD1 2HDHA 1LWNA 3HNRA 5JROA 1I3OA 3HUDA 2C88A 3DW1X 1J7JA 1PHPA 1QU3A 3AI1A 4RY0A 3DAHA 4O02B 1PO7A 4RVGA 4TKMA 3KKQA 5A5DA 1QPBA 1GKUB 3L8EA 4KITB 2DFKB 2GCEA 4G23A 1Y3FE 4JITA 4ZV9A 3L49A 1L5HA 5LQKA 4QZVA 1O4VA 5FLYA 3A7EA 1QRAA 1UDCA 1YNSA 2PBZA 4FYMA 1XYYA 4OAQA 3BKWA 3SEFA 2IY8A 2VR1A 1CEEA 1P60A 1ZDMA 3NBFA 5C1IA 5K2MA 3TGWA 3NHKA 4EFMA 2QVZX 3V7FA 1L5MA 3MB8A 1MIOA 3A9UA 3D8HA 2OG2A 3IE2A 1PIWA 2WU1A 4DV1B 1MABB 1AKTA 5IK2A 1P6QA 3F8SA 4X44A 3DZFA 2FFQA 3GVHA 2OSBA 2WDZA 1HYHA 2NU7A 1OLOA 2FZVA 3I05A 1BWRA 2R0QC 3ESXA 1KDTA 2SNIE 4FI3C 1PGQA 3CB4A 3HVJA 4RY2A 4BLWA 2V59A 4OF4A 3T3GA 3UAYA 2ODQA 1XCOA 1RU3A 1Y5IA 3UJ3X 3A6ZA 3GCDA 3FWNA 5KNCH 4ZTUB 3OZBA 3DBRA 2HIHA 1R6TA 3BBPA 5EXEA 3TIFA 1MX3A 2YOFA 1BW9B 2PH7A 2CXSA 3UJ6A 3PRYA 4AMVA 2PUFA 4IEEA 2OV6A 2OGTA 2ZM5A 4F12A 3PFKA 2ZAMA 1XR3A 3C8HA 1CF4A 4IIVA 2IPXA 5TB5A 2NTJA 1WU7A 1Q74A 2FETA 3K9QO 3I2FA 2A9KA 4S1OA 4ZI7A 1WXXA 3II6X 3HPRA 4I55B 4EG8A 2JCGA 4LW8A 4EPTA 1TAUA 4WBNF 2R1ZA 4IHJA 2V0GA 2FJUA 3H1BA 3KB2A 2WHRA 3CO0S 4N5DA 5ENDA 1AUVA 2R7MA 4XUDA 4EFNA 5IKPA 1C3JA 2XNDA 5HIMA 3T52A 4IIUA 4EHAA 2XCIA 1NVTA 4XVRA 4EG0A 1B73A 1OA0A 3QPAA 5KYXB 2FZLA 5JZ9A 1PR1A 3IHLA 3USCS 3AZPA 2QI9F 3ZDYB 5AXDA 5JCOA 1WD7A 2VSXA 2GJAA 4AZ0A 3WICA 4DB2A 5HSGA 2ZI3A 1TZJA 3ELWA 1QTQA 1CZNA 5JIBA 2PH1A 4J1TC 5EIAA 2HGZA 3KFLA 3NV9A 3Q7PA 3ZDDA 3OFKA 3DEFA 3H5AA 1SOAA 2PGLA 1MFZA 1HDZA 1NN5A 2PIDA 2FPSA 5JFTA 2Q9AA 2ZWAA 4H0CA 4HJRA 3FW1A 4WOBA 3LK6A 4XCXA 4UVHA 5DXAA 1O8CA 3ORSA 4X95A 4X1KA 1JE0A 2OCIA 5I7AA 3WO1A 5T4EA 4LXXA 3PX3A 3ZWYA 4MA0A 1E2LA 1UKYA 3O8QB 2A30A 4DGQA 3AXTA 3RTBA 4W8GA 4CQNA 3KUXA 4GPBA 4NCIA 5JZVA 4EY8A 2ZUWA 1CB0A 3TAXA 2QXUA 16PKA 2ZUBA 1JVSA 3H05A 2WMOB 2VDMB 4CLRB 4ZV4A 4HVCA 1DHTA 2AW3A 3ZZUA 4P83A 2VTDA 5KQLA 2YWRA 3LZDA 3QY0A 1VIVA 1MO2A 3W1VA 1Q0ZA 3HUFA 1KAOA 5CM9C 1ZIPA 4F8JA 3A9RA 3AP2A 5K0FA 1BXGB 3NHUA 4H59A 2B61A 1YRHA 2XTZA 1NX6A 2JZCA 1SKUA 3RYCA 3RUIA 4J6EA 2YC4C 4H17A 5F51A 4H60A 2XAUA 2N0SA 2OGSA 3FDZB 4FIZA 1Q0SA 3AKDA 3HDYA 3QMPA 4EB8A 3BB3A 4EATA 3NWPA 3DJFA 1TA9A 1TEXA 1NLMA 2Z09A 3E9ZA 1YI0A 4TTAA 2W98A 5BSKA 1NFQA 1RRPA 4B4WA 3TD2A 2AD1A 1AZWA 3P7MA 1OWPA 3ZY4A 1X92A 2NPFA 1Z4KA 1I3MA 1N2ZA 4BB6A 2SBTA 3DT8A 4J0GA 2J09A 4LNHA 1UBLS 3FR8A 4DLWA 3WAGA 4HAUA 2VAMA 5EIHA 3U7FB 1DOZA 4YRPA 3GQVA 4LHXA 1SHUX 4MHTA 1S8FA 2A5LA 3D3WB 4IZIA 5EHQA 5CDFA 3UK6A 3SG0A 5I9NA 4UZSA 2ZJ6A 2YKGA 4NRDA 1DCKA 1OV4A 3AY3A 1VLVA 5DT2A 1W0JA 1W25A 5JLJA 1NN1A 1G1AA 1J25A 1YS2X 3AHFA 3LGAA 4INPA 1L9KA 3JYQA 1MU0A 5F7XA 3NBYC 3R8CA 1CWUA 1Y9ZA 1NQXA 3F1LA 4BGVA 1AKQA 3ADPA 3DEIA 4NFLA 1RLUA 3MPOA 2MCFA 5LBUA 1PDVA 1GZSA 4LY3A 2Z3WA 4AJ9A 1JAHA 3BOSA 2WWWA 3LCVB 3GCWA 1H2FA 3N70A 1D03A 4DIMA 4KWTA 1R16A 2Q9CA 4ZMSA 3EXAA 5K2OA 1KH2A 5BPFA 2WJJA 1MJGM 3VH4A 4KYVA 2X9VA 421PA 1C8KA 2EAUA 3LVBA 3T3OA 4EDFA 1FX0B 4RV4A 5F5NA 1UEJA 3ICWA 1R15A 3PE3A 3PUZA 4FGJA 1L5QA 1U0NA 4WINA 4Y0VA 4MO2A 5FPTA 4RDCA 1CUHA 4HWSA 2P2DA 2JJ8A 5DP1A 2X76A 4R1SA 4W5WA 5AVTA 5IZCA 4MKXA 1LQTA 2PKEA 5H3CA 1A98A 4DCVA 5EIEA 3GN1A 3OCUA 2J48A 2ZUVA 1WF6A 3U4IA 4EX7A 4PZEA 3WV4A 1XAJA 4W9MC 3C41J 2WPNA 1KI1A 1VSTA 1EDOA 1GV1A 4HI0E 5HCUA 5K3EA 1O9HA 3THOA 3AGQA 5AM0A 3V1KA 1UXGA 5NULA 2C5AA 4ESOA 1W44A 2NYVA 4EYGA 3W5CA 3P0JA 2IUTA 4BRZA 3A4LA 4N3AA 1EFLA 2GCGA 4BO3A 1NYRA 3SICE 1PEYA 1RYBA 2ZRIA 4N49A 3V7UA 4CXMA 2NTNA 2F00A 2C8KA 4M46A 1WX1A 1KK1A 4Q21A 5KVAA 1T6BY 1XZMA 3UJHA 3IUJA 3EPHA 1USGA 2XE4A 4A15A 3SQWA 2I4NA 3FNHA 4LDNA 5DWVA 3ZV3A 2OCAA 3HB9A 3TRFA 2BUAA 4AO8A 5DLPA 1VI5A 4I8XA 5F78A 4WKNA 1QOPB 2EWVA 2R8RA 3VI4B 1CD5A 2WU0A 3MK31 1L4LA 2CXRA 2XVMA 1EK0A 4E5KA 1RQNA 1TUIA 1CE8B 2Z1NA 1J4AA 2H5JA 3P9CA 4IW3B 5BSGA 3A3OA 4L6AA 3R0QA 2KI5A 3SFZA 4GPAA 1COZA 1GXSA 3H9JA 1YGPA 3WTBA 4ALKA 3GLSA 3NOXA 2ZRHA 4YCDA 4V0OA 3ZNOA 5MFPA 2DY1A 3KVVA 2IV3A 2PUTA 1C7EA 1TRHA 2QNBA 3OQ1A 1L5FA 2WI8A 2DFDA 1ZGBA 4I6GA 4J3FA 5AW4A 4JMLA 1IAVA 4KO3S 3L6RA 4UZEA 1ZINA 4CL0A 1NZJA 3BE5A 1TUBA 1NTRA 1FBTA 3JD3A 5LQMA 1X1TA 4WOPA 4MI9A 1UBTS 2WNSA 2IEYA 5EKUA 2RONA 4WJKB 1DV1A 2G0AA 4NJEA 2P5UA 5CHEA 3ZWDA 2O8DA 3DHEA 5CVUA 3S8YA 4J43A 5IM4A 2HQOA 4OXIA 4NNJA 1YRQA 4K5QA 5FTJA 4ETWA 1RBQA 2IY7A 3H2KA 3O8OA 4KFUA 2ZSBA 2XRMA 2C9ZA 4QUBA 2QNRA 1JJ7A 2JI7A 1OY1A 3AWIA 3KC2A 2V65A 5KHOC 4HC4A 4HG2A 1LPAB 2IOYA 4PLCA 5FJIA 1CPYA 4CQLA 2SKEA 2YMMA 2NM0A 2P75A 5FQNA 3WIVA 3IUBA 4YBRA 3TIVA 3E2IA 5E95A 1U7PA 3MT8A 2Y0DA 4TXHA 2O1SA 1ULZA 4H7PA 1PJBA 3HU2A 4COKA 4IIEA 4S3MA 3DWFA 5HF8A 5EE5B 3NHPA 4FFBA 1QFYA 1QDLB 3NFRA 1T8PA 3R41A 3AP3A 3BWEA 4FR5A 5AW3A 3O90A 2BKVA 3BSWA 2RKBA 3G8DA 2PN1A 2C77A 3HNPA 4BVBA 4YA6A 2AI2A 4CR6A 4FN4A 5BQFA 1M6WA 1GGFA 1PQ4A 2VCEA 4KDRA 4WVFA 4MYUA 3W7VA 4O4HF 1VHWA 2VNSA 2JFWA 3JQGB 3AJRA 1UZNA 2ASVA 5ALXA 5EJGA 4ZQIA 5IEJA 4S1WA 1Y81A 3T4EA 3I6MA 4WQMA 3R9XB 1E7WA 1KI9A 4OI2A 3ZYZA 3GLRA 1HNXB 1OLSA 3C8MA 1B6TA 1MNQA 2EHJA 1OT5A 2Q1YA 4L6CA 1QPGA 2JI4A 1HQYE 3KLOA 2I2BA 1FBNA 5DEIA 2FFHA 2M2IA 2HQ1A 5EP2A 2HM7A 2QD5A 3PHLA 5EWLA 1RIIA 4JBXA 1XD9A 2V0CA 4BIIA 1O08A 3DLTA 3DL4A 1NW8A 3KKEA 2G9ZA 3TN7A 2R7KA 3UJ8A 1SCBA 2A59A 2GKSA 2RD2A 1NNUA 3PQ8A 1H2HA 1B7GO 4JQCA 4ZAYA 1KGSA 2K7ZA 1SK8A 3C8ZA 3LHDA 4GWKA 2GN4A 2OXEA 2BZGA 3FTQA 5EQDA 5COAA 2IPOA 5B53A 1FTNA 3WNZA 3T54A 2ZBQA 1U9IC 1A88A 5AI5A 5AKJA 1VZ3A 4LC9A 1LLQA 2Q6KA 1ZMTA 3D6JA 3MS2A 5CH3A 3RODA 3T5DA 3ZE6A 1H0RA 5LOVB 1GG5A 2H9AA 1U3UA 1BFKA 4B34A 3HYLA 2Z57A 3CUYA 5EL0A 4G5QA 1M2GA 4TKUA 2CVHA 3E48A 4D98A 1Q44A 2W70A 1CBUA 3L6UA 4B44A 4D9HA 5JR3A 3L46A 1EX6A 3JD0A 2BPOA 2BMAA 5DNVA 4WZAA 3I6BA 4DT1A 3IBFA 2V6FA 4L7VA 1E7QA 3MJRA 4HY3A 4MOWA 5IX8A 1KAMA 4ND6A 1D9XA 3W5IA 4B3RB 1NWHA 2GBFA 4WLUA 1DSSG 2PGIA 3VR5A 1I5OA 2E4ZA 1QP0A 1PNVA 2FP3A 1OXKB 4JX8A 1NP6A 4IY1A 3ZH9B 3TGPA 4V2UA 4WDRA 3U7QB 1T13A 4XUEA 3CVJA 5HQJA 1SUBA 3OX3A 4P9NA 4RIHA 3BMNA 1C8LA 3TSCA 3M6UA 4CM5A 3B9BA 3EC1A 1RT9A 1YBHA 4C4OA 2WHEA 1YBFA 2YVAA 3LHSA 4BV8A 2B6NA 3BEDA 1M2EA 3BDAA 3RYIA 1K92A 2FG7C 1K7SN 2AG0A 2ZYIA 4DF3A 4N5NA 4AY4A 5F98A 2EW8A 4HJXA 2XTNA 3LS2A 3LRTA 3TLCA 4ESHA 3K70B 1C30A 2H2FA 3GWZA 1LRJA 7ABPA 3TJRA 5C8XA 1ZLXA 2OVFA 1E6UA 4UTVA 1FU8A 2FMFA 1W4CA 2G5TA 3ZI4A 4J7XA 2BF7A 4MJ7A 3RIMA 1R3DA 3KLNA 1IHDA 2MYUA 3GRAA 3PR3A 4CDMA 1YZFA 3J81A 2QQ0A 1HT0A 1KPIA 2DUWA 2PWYA 3W5HA 4UVEA 4ALLA 4P3YA 2EX1A 5JAUA 2QN9A 3QEMB 4O4JF 2O05A 1QJ4A 2TRSB 5E9QA 3RFTA 2PL9A 2WWFA 3GJZA 2B20A 2QRQA 2GERA 1IMJA 1DRVA 2P4HX 3Q7RA 4FYJA 4X1IA 1Z88A 3EA5A 1U0BB 3AHDA 3B1VA 4RYLA 1U9CA 1HO3A 2REQA 4AKHA 1QORA 5FT9A 3L7KA 1DX9A 3VSCA 5M7EA 4ETIA 1K86A 2WHPB 4OBWA 1J0AA 1R8JA 4YQZA 5DW3A 5SZJA 1K6EA 5ADVA 2JGNA 4MUFA 4D43A 4IJUA 2B8NA 1DINA 1W1UA 3P0FA 4F5YA 2H7CA 1T8UA 1VCIA 2X7XA 4IVPA 1WB4A 4UMDA 4CCYA 5E6SB 1Z22A 1BCSB 1OD6A 3EZ9A 5T5QA 1NUQA 4DIBA 1JDPA 1BOFA 1JLHA 4HQNA 5IRCD 4CUJA 4TZ6A 1N8TA 2RHTA 3ASZA 1DJQA 1QKKA 2PL1A 2GAJA 2R97A 4KK4A 3RFFA 3RJMA 2XB2A 1FDUA 2HMAA 2BI8A 4CI9A 1I1NA 1PVOA 2J5QA 1KO8A 1KEEB 2QVXX 2YWCA 3F9RA 3F5MA 2I33A 2BEUB 2A9VA 3L4BC 1Y6ZA 2HMYB 2QLJA 3A8TA 4YJFB 3ITNA 1J2TA 1NSFA 2D0OB 4G8BA 4R8MA 5T4HA 2BR5A 5D6OA 3V97A 1L4MA 3G2JA 2WICA 2FPIA 2I1QA 3ODPA 3L1VA 4XVHA 4LECA 3WIBA 4DRZA 2HZ7A 1IHUA 3PNQA 1M67A 2WW8A 3KR9A 3LU1A 3MTQA 2Z58A 4DPMA 4TKVA 4KRFA 3MWEA 2IKQA 4URXR 1KMNA 3STHA 4MKIA 3LXMA 4Q6BA 5DW0A 2X1MA 2P6MA 3FX2A 3Q9SA 3AERA 4J0EA 4NE2A 5EQJB 3KSBC 1Z13A 2FAXA 2BJWA 4ZARA 1Z47A 4ZYTA 5IAAA 2H1IA 1ZM9A 1FFYA 4DVGA 1IH8A 1PVVA 2JIQA 4Q1AA 5ILGA 4KQMA 1U63A 5FL7A 3DD1A 2G1AA 5AXAA 2I29A 2IHZA 5JXJA 3M83A 2DH6A 2NPIA 2X3FA 1UDRA 4M1QA 1YRYE 3NKFA 2MINA 4MI6A 5JO9A 1RRVA 2DBRA 3WYDA 3RUHA 4G0UA 2DUUA 2IQ5A 3EZGA 4HDSA 3NGMA 3VNBA 5ITZB 3ETNA 4A0FA 2I2WA 3DHWC 3LKZA 1QYIA 3IEUA 4B73A 2QTBA 3KT0A 1DHRA 1JHUA 3ESCA 3RU3A 2B9EA 4MLZA 3IIEA 1IY0A 1J5XA 4GX0A 3T8YA 1TM2A 3AY7A 1E5XA 3AETB 3OT4A 5KYYA 2DXIA 1XMXA 3GDHA 2WUGA 3RT1A 3CS3A 3H5NA 4WZBE 1F51E 1FDOA 2WE8A 2HEGA 5ECDA 3FBGA 4MRNA 4KU4A 5FQOA 4RIEA 4Q1VA 4DILA 3IP7A 2GZ3A 4A8TA 1QHXA 4G25A 4EA6A 3R9WA 1RJFA 4KMRA 4L1KA 4LG1A 1J22A 4LJLA 4OHZA 3ZHXA 5KEIA 2XZOA 1N8NA 1JSCA 1XI2A 4A5SA 4BXOB 1SPXA 2BP7A 2VOJA 3UYKA 3QE3A 3FPAA 1D3AA 4D25A 3ZG6A 1PP4A 1YE8A 3G2QA 4D5GA 4I1UA 1R7RA 2A67A 3ES9A 1Z25A 2VSNA 4CKWB 3E9QA 4GXQA 3TCXB 2IEGA 2B0CA 4LYAA 4IVNA 3ZE1B 2PYDA 4PRLA 1D04A 4JGBA 5BOSA 4I4IA 3VR2A 4E4RA 2O2SA 1E8NA 1LEHA 1A7AA 1FTGA 4IJMA 4PGMA 4NCBA 5DXJA 3H11B 5E2IA 1P0FA 3GJ4A 4O59O 2IHVA 4AJNA 4HZGA 5AJXA 1OZ0A 1O0BA 2IYEA 1W8IA 4X66B 1E2JA 2QZ4A 3HDQA 4JBIA 1TQHA 3OF5A 4AP5A 1SIWA 2ZBDA 2IYSA 1UBJS 3OMLA 3PQCA 4FXOA 2ONJA 3CF2A 3QRWA 4JVSB 3GLIA 3QLJA 1T3ZA 2FSSA 2NZVG 3HB5X 1CEXA 1DFIA 1AZTA 3P0EA 3ZI0A 5J2TA 1U1FA 1BS2A 1EUZA 1NN3A 2ECKA 3OPYA 4XSVA 2V3CC 3NKVA 1R0WA 1YZVA 2W2LA 3O1HB 4HGRA 2R00C 2ENWA 5H7XA 1JB9A 1B00A 1W0KA 4DEXA 1FQWA 4Y1GA 3WL3A 1ZYUA 3LXRA 3K2EA 1E1QD 3BWVA 2G0NA 4U8HA 3OKPA 3OICA 2VHWA 1XKQA 2EJVA 1E66A 1G20E 3KPYA 4L9AA 2HSZA 3KHSA 2XBMA 1HFKA 4MVJE 2G1PA 4JJAA 5FADA 1QSGA 3CV3A 2JAPA 5SY6A 1NNSA 3IE0A 3BXEA 3R7AA 4NZMA 3SXUB 3VPHA 4QG3A 1F5SA 4Y98A 2ZE8A 1QTRA 4DSOA 5CU7A 2IYFA 4INJA 1LV7A 2L2QA 1L4UA 3GN2A 2ONYA 2QS9A 1Z6YA 4N03A 1TEVA 3V8RA 4QDTA 1VJTA 4BDTA 2WV7A 1NQAO 3BZBA 5CXUA 3ONDA 4X65B 4EG3A 4DN6A 4BNNA 4JI0B 1H3EA 5J4VA 1ECFA 1EX9A 1H1TA 4K9PA 2Y1CA 3DEZA 2CD7A 3QVXA 5ALFA 5K9ZA 3HN6A 2ZE6A 3RSQA 4PZPA 2MSCB 1C3OB 5LP6F 1Q0QA 1H1DA 2ZSEA 2XKBA 2O6LA 2V7EA 4CKCB 3L2OB 1EUYA 2V6MA 4GM1A 4OMFG 4DRYA 3EX7C 1SOVA 5I7OA 4TZKA 1IAQA 4GXTA 1Z28A 1NDUA 1OW3B 2JJ2A 1PTKA 2ZB4A 1UMBB 1PK8A 4IDEA 5SZIA 4AULA 2BCGY 3ICQB 3FPBA 4P5EA 4OP3A 1PG5A 2KWIA 2OCKA 4C0AC 5L3VA 5LD2B 3TDNA 3Q8MA 2JH3A 3QVGA 4EBBA 3LCUA 2JRCA 4PV7A 2FEMA 2OO5C 2WIKA 4M98A 3DKKA 4WNAA 4Z86A 1AQIA 3FTCA 5JBQA 2AGVA 2F4NA 1SHLA 2Z04A 3K05A 1MAHA 4URUR 4XOIA 2GUGA 3WLAA 5K8UA 3FPCA 3IAFA 4KACA 5EC8A 2GN6A 1E99A 2PT5A 3PUVA 3QPCA 1FYXA 4B3CA 4BO5A 2IYTA 2V9CA 2ZIWB 4A73A 4EO9A 3M9WA 3WGTA 5FLKA 3VR0A 1M2JA 1FU4A 1I24A 1Q92A 1FFAA 1JEEA 1RJDA 2WHXA 3U7IA 2QRMA 5EIWA 1NW4A 4WZBB 4A1FA 5CW2A 2AQKA 1TD9A 1YJXA 3IDQA 5CRIA 5AJUA 3W9YA 1T4MA 3BIFA 3CX6A 2GPSA 1N2OA 3CSDA 3U9LA 1RXSA 4MUAA 1VBFA 2ODBA 1P1RA 4YP7A 1ADBA 2WMYA 3K9NA 5JISA 3EXHC 1N6OA 1NMQA 4NYMQ 1ESDA 1LK0A 1THZA 3LLCA 1HE8B 2A3RA 4R1QA 3V42A 4D0GA 1DLJA 1R74A 4JB2A 3FCEA 4QXMA 1NJGA 1TNDA 3GMSA 2JLCA 2R6JA 5T4BA 5IBCA 3ELYA 3GFGA 3OQIA 5C3MA 5HILA 4NHEA 5FD8A 2DB3A 1E79A 1JJIA 1O6CA 1DNPA 2WTUA 3W9UA 1X94A 1RBZA 2Z4SA 3DTVA 4BBJA 1UQRA 5I9IA 1ZGZA 3ZWQA 1UPXA 2O2IA 3TXAA 3O84A 3U3ZA 2W2XA 3IPRA 4ZAZA 4A0GA 4JJ6A 2ZTUA 3A10A 4TROA 3T34A 2LD4A 1IZ7A 4PEVA 4M37A 4M1OA 2PRSA 3MUNA 2ZULA 4OI4A 1KKLA 3DAPA 3EDQA 3QKIA 4RSHA 5FEMA 3WP1B 1K4MA 5KOHB 5BR4A 3C45A 1EM8B 4IM7A 4Y6QA 4B2PA 3GGDA 2WMNB 1H93A 1DQZA 4LJ4A 4E11A 2IWRA 1Q0RA 2Z83A 5JO0A 3A06A 1ZPDA 2XDQB 2H5LA 4M38A 1DIAA 1UEIA 4L8YA 2CLSA 1B42A 1I3CA 1ODSA 5LZ4A 2ICAA 4QSHA 3CGGA 3H2JA 1UPCA 5F64A 2HJVA 1IPFA 1Z0FA 3NHZA 3PD0A 1UDBA 4MO9A 4UTZA 3ZK9A 4ZCRA 3K6SB 4UCXA 2X4DA 1ONNA 2ZPUA 4IIBA 3BN3A 7ADHA 4AKGA 3UG7A 5I7EA 1G20B 2VYNA 4WESB 2IV7A 1Y1TA 4ZVKA 2BEVA 2CWWA 1UBUS 4W7SA 4M0UA 5FOTA 4KFRA 3VTFA 2CF6A 1QK3A 1CFZA 1WZUA 2DFPA 1YIOA 2P65A 4PFJA 3JQ6A 4W82A 5AKYA 2Q6TA 1ISSA 4JI1B 4B1FA 3HWSA 1YQQA 4AP6A 1O58A 2VBIA 1KAEA 4BP9A 4MQLA 2YY6A 4F56A 4OYRA 1VIAA 1XQ9A 2VHEA 5FX2A 1GZHB 3BCSA 2P7HA 3AWDA 3NBMA 1BH6A 4I50F 3R2JA 4F97A 5C1OA 2P90A 1C7ZA 4L28A 1GNRA 4G4GA 5KYNA 1M0EA 2IELA 4HH0A 4WFJA 1Y8QA 2BGGA 3RNLA 4YJ3F 1K7CA 5T67A 5DMXA 3RBZA 2BBOA 1AK1A 1J2EA 3HCDA 4E88A 2ZIVB 5FWXA 2NUTA 2D6FA 2RHLA 3UKJA 4AJEA 5JI2E 3S1AA 3V4PB 2ISQA 3EY4A 2MIIA 1DADA 3PHGA 5H1YA 4IHAA 3QELA 2I6GA 5E7JA 1U9YA 4AU1A 4CDNA 1TADA 2AE2A 4HEHA 2JRLA 4YO7A 3CJQA 1SQ5A 4FFPA 3LA8A 3QEJA 4MKGA 1OYVA 4GI1A 4BKOA 1DP4A 3K0KA 4EUHA 3LQ4A 2HNAA 4FFRA 4R6XA 2R62A 3LUCA 3UJ9A 2B98A 4MK4A 3AUJB 2Z9CA 4ND8B 3THWB 1H2BA 1EFPB 5JYDA 2X2EA 1FIUA 1K98A 1U1EA 4D57A 2VRWA 4QUGA 1RAFA 4IWNA 5IM5A 4G85A 4DR6B 5IVHA 2HADA 2JIDA 1NBIA 5F2NA 2OHOA 2CXTA 1S8NA 2DCUA 4I2VA 4B6EA 5MGNA 2I76A 1BKDR 1SMKA 1IOLA 4D02A 5C35A 3C5EA 2FMTA 1GPUA 1MVOA 1ZUHA 3Q11A 1VL5A 3DQZA 3COJA 2YMQA 3KO8A 5BSFA 2ZVJA 4PG6A 1R9NA 3FKQA 1I4OA 3M6LA 5CB6A 3MRVA 3GBSA 2OD7A 3UQZA 2YY5A 1K7FB 1QLJA 2IXAA 3IIIA 3KZKA 2DX7A 1HTWA 2GXUA 3M3PA 4HBGA 2GAOA 4TLCA 5B1SA 1EJ0A 5A2GA 1IXRC 4E09A 2PR7A 2VBGA 3INGA 3MCVA 2MT9A 4U9HS 3HP1A 5DWDA 1BWQA 3M81A 2QGZA 1ONBA 3G02A 3ZX5A 4DR5B 2O8BA 4FMCB 2GZHA 3EXFB 4AB1A 1E1MA 2NTVA 1U0JA 4BWVA 3L7AA 2VJOA 4KPUB 2AQ8A 2O8EB 3HDJA 2BR3A 1P5JA 4HN9A 4UUMA 1UP7A 4UM9D 5JPIA 5C0OE 4D82A 4MMYB 2COEA 4MIEA 1HT2E 1FFXB 4BQSA 4E30A 4PHGA 4FKZA 4BEVA 1ZZGA 1CY1A 5B7QA 3ER9A 1A9PA 3IH5A 4HPJB 2YYSA 3KSRA 3LUPA 2XYRA 2IZ0A 3M1YA 4XPZA 4C5AA 1OA1A 3GUCA 2VDRB 1KIMA 3Q3EA 5H59A 4UHKA 3UUGA 3FSEA 4CQMD 5MN4A 3THXA 2MSWA 4J90A 2IU3A 2POCA 5BMVB 4U7WA 5E2BA 1VDZA 1C0IA 1K66A 1KMIY 3F7OA 4IXDA 5DHTA 5FUQA 5CITA 2OM2A 1SOWA 2RHJA 3MGCA 4JB0A 4Z4CA 2QYOA 1IUOA 1QQAA 1OYYA 3IBSA 5KSPA 2EGHA 3AU8A 4DNFA 1N2EA 3I9NA 3O93A 3JS5A 1TECE 3KB8A 2GF0A 3ZXXA 3OZSA 4OAPA 4F6CA 2H1OA 2D8AA 2JIBA 4TT3D 3GA7A 5HUHA 1F4VA 5E38A 3GWGA 2O5RA 1EBUA 3DMHA 1EHYA 2CNWA 1VA5A 4ENUA 1S96A 1SHJA 1CEYA 2ID9A 2OV8A 5ETJA 2VATA 3UGKA 4RVFA 1MIOB 2QRNA 4MJXA 1SHZA 1C4XA 1D4ZA 2FMIA 1E4OA 1CF9A 4KV7A 1RS0A 3FDJA 3TL2A 2ISSD 3KOZA 3WGMA 3EH1A 3NAMA 3JAWA 3IYLW 5H80A 1ZM2A 3WLSA 3L05A 5JAPA 2JI6A 3ZD8A 4DR7B 1DBQA 1ZXBA 2CNKA 1XLWA 4X91A 5HCIA 2N9UA 2RAVA 5HF9A 4D26A 4BFWA 2PTGA 3LDHA 2FR0A 1D0IA 2Z5GA 3BCRA 3CPJB 3RT9A 3WGVA 3F6PA 4D9NA 3LTEA 4XFKA 5HQ3B 2IA5A 3SZLA 3UJBA 1NP3A 2JVIA 2YWXA 3TTXA 4KIGA 1KOGA 4QARA 1FOEB 1SR8A 1F3LA 3CSSA 5BN4B 3L7IA 5C32A 1P0PA 3T7TA 4MKFA 2PNFA 4MNTA 1PGNA 4HTAA 1X42A 2HEIA 1JI3A 1FRVA 3IP8A 1Z07A 4TZTA 1BGWA 1UOPA 4FE3A 5MN5A 4W5QA 4B79A 3M3HA 1IFXA 4FS8A 1OGYA 2XUQA 2VZ9A 1U0TA 4URHA 1I7LA 1SC6A 5EHXA 4FLEA 5LDHA 3QU5A 1OC4A 1SIUA 2GXAA 2P5TB 4N9WA 3ZJTA 4TMKA 2C9BA 2I4IA 5KSZA 4EIWA 1ISIA 2H2HA 4J91A 1R4NB 3PB3A 3WIDA 3RRNA 4FI3F 2E4VA 1A8SA 1E8DA 1NU6A 1T3SA 3VR6D 5CJPA 4X71A 3WB0A 1E2MA 1RWOA 4HLNA 3PWSA 4O5AA 1W4RA 4X92A 4ZVLA 4AZ0B 5CXXA 4ZJUA 5IULC 1DZIA 3MGAA 3AR5A 2CLKB 2X1HA 3L6OO 1JHOA 4JP5A 2HRCA 1XEFA 3WK4A 4H7IA 2EZ9A 3SVLA 2QRKA 3T5MA 1T2EA 5I6DA 2VZLA 3JAKB 4N6OA 5DLDA 4RZ2A 2C29D 1VPWA 3OLQA 1MRSA 3R7LA 1A2OA 1P45A 1Z73A 3FCXA 4X1KB 4XCVA 4ZOEA 1ZLYA 6CHYA 4AWAA 3ZCQA 2HXSA 2HKIA 3G3EA 5LM3A 3GJYA 3U3RA 4XYEA 4A8HA 2EHDA 3JARA 1W36D 5K99A 3GXBA 2VF5X 3Q10A 4ZODA 1PSZA 4ZVQA 3D4NA 3NV7A 5CT9A 2WJWA 3GJRA 1K9SA 3I1YA 5FPHA 2HA4A 5JD5A 3E7PA 1UDWA 3E7DA 3EIQA 1I5EA 3AJEA 5F23A 5DM2A 3TK1A 2HRRA 4WK0B 1A1VA 1J39A 4DEVA 1W36C 3STWA 2OV1A 1OFHA 3NNDA 2QM7A 4E5DA 1YC2A 4BKRA 1XMPA 5F2EA 2O0MA 2ZAGA 4W9NC 1HNWB 1T6YA 2WUWE 4AYTA 2XE6A 2P79A 3OESA 2Z5VA 2CE2X 3IHWA 3RFUA 2WINI 4ZQEA 4EKEA 5ECWA 3L79A 5EQFA 2FEXA 1NY6A 3MLBA 3RSZA 1V1MB 4PAWA 2ZW9A 1A2KC 3CX3A 1IWOA 3TZKA 1EXNA 4RK1A 3PDWA 4UNPA 4LDAA 3UXMA 2F2TA 4LEIA 1OR8A 1X1RA 1Y1KE 3P9SA 3VDXA 2P9HA 1FE8A 3ZWOA 3PYMA 1S6YA 2R86A 1NT4A 4DQXA 1C9DB 1PR4A 1CQJA 4DA8A 1TX4B 1JHZA 3KOUA 4YYZA 4Y1RA 1PJQA 1Z08A 2WZBA 2QTNA 4X8HA 5AM1A 5G4KB 4EH1A 3I2IA 1YO6A 4PZAA 4H3VA 4YJHB 4Z0PA 2QSJA 1MO5A 2GAFA 3PNLA 4DCTA 5KMGA 2MSEB 3EB9A 2ODWA 3FN4A 3MRXA 3V3TA 4GEGA 5SYMA 1DJLA 4DDTA 1XU7A 2QDKA 5TXGA 1EK1A 1XNGA 3P9IA 3WFZA 4C2UA 3IAUA 1RWWA 3JQEA 2OUKA 5FPYA 3VO8A 4BEBA 1E1RD 2Y76A 2AZTA 2Z8YM 2A1TS 1ODKA 1BJKA 3RJTA 3ZQ6A 3NVAA 4KQXA 3ADCA 4Q4LA 2XA1A 1S4MA 4F9FA 5DDIP 4YHHB 2X9NA 4ZI7F 4Q7JB 3UAOA 4LSWA 3RUFA 4Q7QA 1M0TA 4IHJF 5JQGA 3AF4A 2IEBA 4G5RA 5DPMA 2O23A 3N8GA 3KZMA 3K72B 4L3WA 5IMBA 3WMFA 4XIIA 4ZPJA 4LQCA 4YP5A 1LS6A 1Z9BA 1CJMA 2I2DA 2QX4A 3IR5A 4DMRA 5JTTA 3I6ZA 3B5IA 3QENA 4J0KA 4RS3A 5CW1A 5LB4A 3EJWA 5IAEA 1L4BA 3O3MB 4DZZA 3K9FC 2R7AA 4JYMA 5TVKA 5CNMA 2HTFA 2VJMA 1U5CA 4GX2A 1UFRA 1FYEA 5A5GA 4KQ2A 3A1WA 1GUDA 1RD4A 4BQPA 2I91A 1FP6A 3NBZC 2B37A 1ZOSA 2OY0A 3IAAA 5C8YF 2AQHA 5E7IA 4DADA 1A5TA 4XI9A 3F78A 5IVDA 4A8JA 3TQOA 4DUGA 2YXLA 2GBLC 2VYVA 4P80A 2ZIEA 3OPQA 1PS9A 4BASA 3DAFA 4NSNA 3DT6A 4V0LA 4PQRA 4QKQA 4O2RA 3DV0A 1CEQA 3I1JA 1WMBA 2EKQA 2SHKA 2Z8YA 1LZLA 2DR2A 4LJRA 2CLDX 2Z6AA 5BORA 2VCHA 1GL6A 3KLPX 5EJ7A 2AOWA 3H2GA 4LK2A 3HYTA 1M7GA 1SFRA 1Y4AE 1B14A 3TDKA 3JTMA 4NBRA 1G8HA 4N3CA 4KSBA 4EVRA 3TL6A 4MWSA 1U31A 2XQKA 3IDOA 1NVWQ 1ACLA 3T7CA 4AJ2A 2ZM6B 1YQXA 4NE9A 1RLOA 2Z9DA 3GGOA 4ZQCB 1Z4PX 2JIMA 4WZAE 3K0FA 1ST2A 1PYDA 4B2IA 2CNBA 4DLLA 5AW7A 2GHQA 1TQ6A 4V3BA 3WNCA 3TOCA 4Q37A 2DZDA 4CMIA 1GZDA 3O2JA 4AG3A 5A2QA 3WWOA 4CV2A 4EW6A 4MHSA 5TMPA 4H4CA 1YE5A 1X7HA 4GECA 4HNAA 1JHXA 1DAFA 1A4IA 3A1NA 1XU9A 4HRAA 4Z8YA 4D3YA 1N0IA 3PL1A 4H4EA 1JHPA 3W5BA 4I3HA 5B57C 3D5TA 2Z2JA 4KWHA 4RQUA 3VH3A 4G67A 2WG2A 1HE3A 3O2QB 3AJAA 3DKPA 4KYUA 1EEHA 1JLRA 1TZCA 3BMCA 1FYFA 4URVR 5FHQA 4BUJA 2PRJA 1EB8A 2XKJE 2BFCB 4L5YA 2HUNA 3DTNA 1ZMOA 3E3LA 3ISJA 1T3LA 4J9UE 3CVOA 4YAIA 4E3ZA 2XOKA 1V8PA 2ZQYA 4CM4A 4PFSA 4QBKA 1JQDA 4ETNA 4TYYA 2O8DB 3WG9A 3B3GA 1SC1A 4HQOA 1O1YA 3PNPA 5EJAA 3KEFA 3TLMA 4EA9A 4NOJA 4ML3A 4PHCA 4Q7KA 4UAGA 3RDPA 1CUFA 5CT8A 2YZNA 3FVQA 4WLFA 1BQ4A 4DLYA 3TBFA 3G49A 4LDJA 3RAJA 2IJGX 3SC2B 1CVIA 5EUMA 5I8PA 3I1FA 1V8FA 1NIJA 3N1UA 3UZUA 4Y2UA 1KBQA 2EDCA 5THQA 3SHOA 4MP6A 5F2OA 3AM5A 3ENKA 2D7CA 4YS6A 3IXQA 2ZUEA 2G1UA 3OFND 1NI3A 1ZD1A 4LNUA 1AY0A 3NGXA 4FFBB 1XTTA 5EUBA 4ZDKA 5AM5A 3FCOA 3PEYA 5LQNA 4R7ZA 3DBIA 3PRJA 4GPTA 2PT9A 4RWEA 1BSVA 1EDZA 1W87A 5TGZA 3VU9A 1C7QA 1JU9A 2IBMA 4QJIA 1ZIDA 3RS9A 4UBJA 1UPFA 3BJIC