3FX2A

Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1991-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fx2A00
2FAXA 1AMOA 2FDXA 3ESXA 3LCMA 4GR9A 3NHLA 3RPEA 3OWHA 3NHSA 4NULA 3D7NA 3GAMA 3EDOA 2FX2A 4M0CA 3B6KA 4YAFA 3QFCA 1CZNA 4ZVMA 4XDHA 2RG1A 1BVYF 3ZHOA 4U7FA 4ESEA 2FZVA 4QOIA 3ES9A 3N39C 3QFRA 4Y9UA 3OWXA 5B3KA 5FA6A 1DXOA 3F6SA 1AKWA 3W7AA 1JA1A 2QX8A 4H6PA 1FVXA 3NHWA 2BZSA 1X77A 2B3DA 1ZWLA 1WSBA 1FUEA 4DIKA 1CZOA 2Z9CA 4HEQA 1SQSA 5FUQA 1QR2A 1T0IA 5EMNA 2V9CA 4QOEA 4N82A 1J9EA 1VMEA 2QMYA 1FLAA 1KBQA 2HPVA 1OBVA 4XDGA 1H69A 2N1MA 2BN4A 1XYYA 1F4PA 2R97A 3OJXA 4FGJA 4QOHA 2OHIA 3JSXA 4YALA 3S2YA 4YQEA 4QODA 3NHFA 1QHEA 1YKGA 4FX2A 5JROA 1E5DA 1AG9A 3SVLA 4BMPB 2KLBA 3HLYA 2OHJA 1D03A 4H2DA 4C76A 5F51A 2HNAA 3NLLA 4NLLA 1FLDA 2F1OA 5EA2A 4LTDA 3EYWA 1AKUA 5LJIA 3NHYA 3U7IA 2MT9A 2FZ5A 1FTGA 1QBGA 4YAWA 4CF6A 2QR2A 4LAFA 2OHHA 3K1YA 3L9XA 4N65A 4C14A 2Z98A 1DX9A 3B6JA 5LJLA 2FOXA 3FNIA 3FVWA 2V5VA 1T5BA 1CZRA 1OBOA 4QOJA 1J9ZA 3NHPA 4J8PA 1AKTA 1YCHA 3F90A 1J8QA 4GQIA 3GFRA 4BMOB 1CZLA 2QMZA 4ICIA 4QOGA 4QOFA 5NLLA 3FJOA 4S24A 3TE7A 1D4AA 5EAIA 5F12A 2FVXA 3NHUA 3GFQA 2R96A 4C0XA 2QX4A 4DY4A 2QX9A 3N3BC 3OJWA 4PTYA 1RTTA 3F2VA 1TIKA 4Y7CA 3KLBA 4FGLA 1D04A 4F8YA 6NULA 2MWMA 3B6IA 5LBUA 1V4BA 3NHJA 2GSWA 4N9QA 4OXXA 2OYSA 4HS4A 2MTBA 4LA4A 1CZKA 4C0WA 3GFSA 3HA2A 1FLNA 2X2PA 3HR4A 3P0RA 3QE2A 1I1OA 1NNI1 3NHRA 3KAQA 1J9GA 5NULA 1XI2A 4Y9RA 3KEGA 3L9WA 3B6MA 3ESYA 4U7GA 3LT5A 2ZKIA 4GI5A 2KQUA 4R81A 4LTMA 3FX2A 1WSWA 1YCGA 3TZBA 1CZHA 2XODA 2Z9BA 2FLVA 1FX1A 3K20A 2MOKA 5LBTA 1XYVA 3W77A 3OVMA 1DXQA 2X2OA 5FX2A 3G5MA 3ESZA 5B3LA 2W5UA 1AZLA 1CZUA 3KAPA 1OFVA 3OX2A 1BU5A 5BUCA 2QX6A 4D02A 1JA0A 4ZVLA 3NHKA 3NFRA 4LTNA 1KBOA 3N3AC 1AKRA 3TEMA 1AKQA 2V5UA 2BF4A 5TGZA 1RLJA 3F6RA 2BMVA 4PTZA 2XOEA 3U7RA 1RLIA 2D5IA 2A5LA 5LMCA 1AHNA 2BPOA 1XT6A 4DILA 2ARKA 1TLLA 4U7HA 1AKVA 2FCRA 5A4KA 1B1CA 1GG5A 2WC1A 1C7FA 4CETA 4YAUA 2HNBA 3O2NA 2AMJA 1ZWKA 3W79A 3UXHA 3R6WA 1RCFA 1YCFA 1YOBA 5LLDA 4PU0A 4FGKA 1H66A 3OX1A 3OX3A 2Q9UA 4YAOA 2Q62A 3O73A 1C7EA 1SG0A 5F4BA 2M6RA 2QWXA 1YDGA 5LVAA 3W78A 3FW1A 2Z9DA 2M6SA 3UXEA 4ZVKA 4ZVNA 1YRHA 1QRDA 5ULLA 1ZX1A 1FLVA
chains in the Genus database with same CATH superfamily
2XQFA 5DBFA 4XM0A 1O2DA 4XI9A 2LWIA 4BRWA 1XA3A 4DR4B 2FSVA 4GOMD 3PQ7A 2ZCUA 1P7PA 4KJZA 1HRKA 3LUDA 3W1EA 3ZGZA 1IDOA 1X7XB 1BRMA 1UBJS 1M5UA 2P1ZA 2VF2A 2YX1A 1G5HA 2PUWA 3A1FA 3VVLA 4O29A 4YMGA 1VCMA 4FZVA 5IXYA 3GHHA 4GXNA 1MAVA 4ZU3A 4J16C 3K32A 1UDBA 3AM4A 2X0FA 4GUAA 2TMDA 3K2BA 5ITZA 5KVAA 1CKEA 1FDVA 3DJYA 3FLMA 3I62A 4HGNA 1J2JA 2HLHA 4J03A 4XOIA 4HDRB 4GBJA 4CDMA 1L1EA 2O3TA 3UK6A 2BV3A 4QIHA 2FX5A 4DMRA 1C4OA 1K3TA 2N0SA 3PHCA 1Q0LA 1BFUA 4D6XA 3I01M 3AI3A 1S7GA 1W52X 3T41A 2WMNB 1O6FA 4Q9HA 4X5OA 4BASA 2AUMA 3U0VA 3F5SA 2HSGA 2IEYA 2QX8A 2F8MA 4C4ZA 4LZZA 5KMGB 4IY1A 2CMGA 2I4MA 3CRQA 3EG9B 3KELA 3I45A 1DELA 2KLHA 4DR2B 3A9TA 3K73O 2O8BA 3G9XA 4P80A 3D5QA 1WUYA 3RBVA 2BRUA 1W9HA 4YQFA 5SZKB 4XSGA 4RKRA 4U5QA 1QV9A 1YJCA 5G41A 2EEZA 4KAAA 5KNBD 4BFSA 4G4SP 4CT4B 4I4TA 3EOZA 4LHXA 3DT8A 3MINA 1XRNA 3TX6A 4CM7A 4ESVA 4QTUB 4S12A 3AY0A 2NYRA 5L3VA 1ZD8A 2KI5A 4KJXA 1PO7A 4AI6A 3OFND 1QS0A 1IULA 1CRQA 3RT9A 3ZI4A 4ZKEA 2OM6A 4YI3A 1YZLA 3NJ8A 4Q3KA 1C3OB 2VLBA 1J9EA 1T4MA 2QZSA 3GJQA 3TW0A 2G5PA 3SIWA 1RKVA 2NSYA 4WADA 4A16A 1P9LA 4IFBA 3QLEA 3DEKA 4GECA 2X86A 1KJNA 4A0GA 2JW5A 3LLUA 4MMZB 1QB7A 4HWGA 1I94B 4J4TA 4OCZA 2R68A 3HCNA 3C6KA 1B8VA 3FMGA 2BTEA 1OXXK 1Q3TA 3CNOA 4HATA 3WIEA 1JU9A 1KEWA 3W90A 1JP7A 3LOQA 4BNDB 3IP7A 4CU5A 5K6RA 3CH5A 3DKKA 4L5AA 4TN1A 2C2WA 4C5BA 2OSBA 3LQ4A 4B83A 4DCGA 4MINA 1HYQA 1X7YA 2BGWA 4P4SA 1Q3KA 1KVRA 4EW2A 1PWHA 3F4KA 3ZHCA 1Z0FA 3TTVA 5LQSA 2JLXA 4JGIA 3LLVA 1GCUA 1S2IA 5HIJA 1BJRE 3IMFA 3KQLA 1W94A 2XSZD 3H0EA 4LSGA 2ZRQA 3M4NA 4PGHA 2XAAA 4AKTA 5C9ZA 2EOAA 3PDUA 4OMCA 1KSGA 3AFHA 1LFAA 3AYZB 3C7KA 3B1KA 2ZSKA 1OVMA 2X5JO 2XTAA 4L4ZA 2HRCA 4DSOA 2G82A 1GPH1 1R6AA 1L4NA 2A1TR 4UNIA 5DGIA 4UPEA 2Q5HA 1FJGB 2DLCX 4A9AA 5BSMA 4HWTA 2EFCB 3F3KA 1E94E 4J3JA 2D5CA 4K6MA 4B82A 4LBYA 1HC7A 4MLPA 4CM4A 4ZYLA 4CKWB 3TQRA 1J8MF 1CFJA 1XLWA 1PJSA 4FC7A 4QAQA 4EITA 5H3HA 1OCEA 4HH3C 1UEXC 3E9RA 1QMGA 1G18A 3VKVA 3MWGA 4B3MB 3J81A 5A5GA 4DUZB 3W1VA 4A27A 1FL9A 3CZCA 3IPYA 5CFQA 5MGNA 1P19A 1T5DX 2C4TA 2CMDA 5IG2A 1NBEA 3HU3A 2QVZX 1R0SA 4DWWA 4JYBA 3GRCA 1H1LB 4HNHA 3Q3IA 4Q6WA 5CXXA 2XCUA 5BV7A 5C2JB 5AICA 4YAWA 3FSRA 2BMAA 1EE2A 1FQOA 2B6HA 2FUG1 3K9FC 2ZIVB 2Q4RA 4BPRA 2YC4C 1YS7A 2IBMA 4ZCMA 1XK6A 4MYHA 2VDKB 3KK0A 2GHTA 1GN9A 1E8DA 5JCJA 4GLBA 3TLXA 2CF6A 4BFZA 1R5OA 4WXMA 5AH0A 4EA9A 2JAUA 1WO8A 3W3AA 1RLUA 3ESAA 3MELA 3Q3CA 4J9VA 3M70A 5EJFA 3X44A 3BG5A 4YR9A 5LQKA 4FKZA 3GY0A 2NUAA 4GPAA 3OEWA 3FROA 4KOAA 3GROA 2CXQA 4R7GA 5JZBA 3ZDAA 2EFJA 1V4NA 2IDMA 4BWGA 1XVUA 4D4IA 2O3UA 1KRHA 4NU8X 3SKYA 3G9UA 4KDCA 1OXVA 3CW9A 3AUSA 3CUSA 4K40A 4IYRA 3WOHA 4US0R 1CZRA 5LR6A 1AUOA 1A4RA 2Q4EA 3GPIA 4DA0A 4ENUA 3C7AA 3B51X 4QATA 2I1WA 3L0SA 2AN4A 2AG5A 4IS3A 4FD2A 3QU4A 3WKCA 1MJHA 3G5TA 1W19A 2GXSA 2OYCA 2NPIA 4WY5A 5ECWA 3FN4A 3QKSB 3GRKA 4HDMB 2MSWA 1KETA 1TUBA 4MKZA 4ISBA 2ZYVX 1J8DA 1JXQA 1X7ZB 5IS2A 1JR2A 3A7EA 1QVRA 2EL9A 3PP8A 5NLLA 3SC2A 1R0XA 4FLFA 3PYMA 3TKAA 3A05A 1X1EA 4NFYA 4OSPA 1B14A 5KEIA 3ENZA 3W6NA 2D7DA 2HSEA 3FXAA 4DANA 4I1SA 1ZRSA 2H0AA 2WWGA 2VP3A 3AYXB 1VLJA 3H5WA 1TC2A 1Z4JA 2FW7A 5IAAA 4GXTA 1L5HB 4UUQA 1A71A 4D96A 1M1YA 4KUEA 1AQLA 3BXGA 1Y3HA 1J0XO 2BJHA 2QX4A 4ZICA 4KPUA 5JYBA 3OTWA 1SCJA 3KPWA 4PIPA 4KSYA 3TPCA 2FE4A 2WTMA 1XHEA 1FDSA 1G5QA 2H2AA 3LECA 4PSDA 1QE3A 4Y2TA 3FYSA 3WGJA 2JD0A 1ST2A 4B79A 3NOXA 5I7SA 4E4RA 4EY4A 4ZVPA 2OENG 2CXTA 4DQ0A 1X1AA 1XMQB 3U39A 1GTZA 2P9QA 2I55A 1NM5A 4ARCA 3AGPA 2FFAA 1ZK0A 4HXYA 3ORRA 2WNIA 3T0GA 4C0AC 3K6KA 3KLBA 1Q0ZA 4C1BA 4FBMA 2ZLBA 4YLEA 5IJ9A 4QNMA 1UP6A 5A04A 5CTJA 3R44A 1KYTA 2FWRA 1KI2A 4JY7A 5LBUA 1OROA 1P4SA 1K5PA 1U7WA 1YRAA 3L8DA 4JP5A 5CFRA 3PFBA 3LCJA 3O8QB 3ZS8A 3D64A 1C5KA 1Q21A 4IMRA 3JTMA 1N5DA 2NXNA 2ZIXB 2HRZA 1D4OA 2RGGA 3QF4B 3DBLA 4Q01A 4V0MA 5KHAA 1PEKE 1F2VA 4FOTA 5ALWA 2WY2D 3GLIE 2QLTA 3RYIA 2J5KA 4GPZA 1TADA 1Z16A 3AHDA 2PXXA 3ZV5A 2LCQA 2ZSJA 5BSFA 3FHCB 2B1GA 4JEUA 1S2OA 3GFSA 1KZHA 8LDHA 5GIPE 3AUUA 2O4CA 3MWEB 3NWJA 1C0KA 1L7OA 5EWLB 5CAEB 3REGA 1PGPA 3KUDA 1ZRNA 1EA5A 2O8DB 2QSZA 3G49A 1E58A 2VUUA 1Y4SA 4N40A 5B1HA 2VC2B 2IV7A 1M8FA 2ZYHA 3E9NA 2BEVA 2AKAB 3PPVA 2VK1A 1G55A 5CFNA 1XDWA 2BI7A 2W90A 1LZKA 2RB4A 2WIFA 3KXDA 5B7QA 1Z2OX 5IDWA 3KOOA 4B8ZA 3OH8A 5EESA 3F8TA 5LMZA 1P2BA 4MVXA 2B3TA 2ZKIA 3QK7A 2CL5A 2WINI 5DGDA 1CR4A 4RHUA 4PWYA 3T4XA 4Z1MD 5DW0A 3AERB 4UUOA 1CUCA 1HBJA 1VGRA 3PFCA 1ZAYA 5DNYB 3EFOB 2BJVA 1GSAA 1TD1A 1NHGA 3LPCA 3OCUA 2CKMA 3FZGA 4UJ5A 4IF6A 2HYIC 4TZ0A 4W5HA 1HE1C 2ZI9A 3HV2A 3NONA 1TEVA 2K2QB 1LKZA 1MTOA 2NU6A 3EGCA 2O8VA 3IMGA 3OJOA 1FMCA 1I1HA 1WHSA 3QLVA 4FGZA 4M53A 1U3TA 2H51A 2RBEA 1I0IA 3HNPA 1VE1A 3LYHA 3OZWA 4ONEA 1M2OB 1GL3A 4AUKA 5DNEA 3W34A 4BP3A 4DJFC 1Z33A 1HKHA 1SKYB 3DHYA 5C46F 5EKUA 3ZDFA 1MR3F 2G70A 1N7JA 1NP7A 3HSYA 1TM7E 2XVXA 3M3HA 4LV5B 1C9NA 5FLXA 1BVHA 1VPVA 1Y9DA 4OFXA 4Y0AA 2PUCA 4RK6A 3FFAA 1DUIA 1HLFA 2GNOA 2H0RA 5P8WA 4FBLA 4XASA 4D57A 4O4JB 1T24A 3PE4A 3SY8A 4ITVA 3UK7A 5LP6F 2OG1A 4ZYWA 4G4SO 3VH4A 2JFOA 3WTBA 1C7RA 2IPMA 4IOKA 4CMBA 4CIDA 5BUCA 1E1QA 1SN7A 2ENUA 2GVNA 1BU8A 1FMTA 2W4QA 3BWYA 3C7DB 2PRYA 5CEJA 2H1HA 1IOWA 3QVTA 2ZTUA 3G17A 2J5XA 1J7KA 2X42A 2WIKA 3UMJA 2P8JA 3NFRA 4IG4A 1M1NB 2J9GA 2BDTA 2DFLA 3NBAA 4Q4LA 1NRJB 1AZWA 1OZ0A 4LK3A 4P3XA 4TTJA 1U94A 2Z2XA 3M6VA 1UEJA 5HS6A 4BP9A 2WDPA 3VV3A 1Z3IX 2ZPTX 3ZIUA 3CSDA 4GDFA 3CLSC 4DV4B 3UMVA 2XUQA 4F60A 3OU7A 1ZK3A 3X43A 5B7GA 2AC7A 1AX9A 2XVYA 1HT0A 3N28A 3K0FA 3NVKI 2Q5LA 2QG4A 3KSZO 2QPTA 2VDNB 3BD9A 3L4BA 3T5PA 2EKZA 2H7VA 4HN4B 2G1KA 5COAA 3A2NA 4QDJA 2PO5A 1FVHA 2BY4A 1M34A 3DEYX 4IWNA 1DDGA 3AIOA 4OGKA 3SFVA 3WADA 2JARA 1E0DA 3MXOA 1P0IA 1F3OA 2YXPX 4U0KA 1GTVA 3T8YA 4NZOA 3C3BA 2W2LA 1ACLA 5IARA 3WIUA 5HIAA 2D5IA 1GUYA 1FQJA 3AHIA 4IDOA 4TSRA 3TNDA 3M5PA 1JH8A 3NOVA 1ZM7A 3LNCA 5TARA 3L6EA 5D3MB 1QKJA 2Z4SA 3LYUA 3VPFA 2XMBA 3H9UA 4MDHA 1OKKD 1ISHA 2DKOA 5ITVA 3G0BA 4RV4A 1GADO 1VMIA 2ST1A 1CQJA 2WMOB 3QUTA 4MO2A 4R41A 4ARVA 2VH1A 1FQKA 4K2AA 2QNRA 4BPBA 1W4ZA 3WLLA 1H2HA 3AV0B 1JQDA 4CMAA 2QN3A 3O84A 1GAQA 1SKAA 5DK4A 1A9QA 3FWKA 4WCFC 4EQ6B 1JHOA 5L8VA 2E4ZA 1C7FA 1K63A 2OFFA 2AJTA 2UVPB 4M22A 4OHVA 1G6Q1 4QTTB 4JZYA 4OIFA 4YAGA 1ABBA 2XB9A 3I04M 3SNHA 4J1QA 1Z22A 4CR8A 1JI0A 1YT5A 1Z0UA 3FI9A 4ND8A 3GG9A 3P19A 3T7RA 2YXLA 5ESWA 4C7KA 1N33B 1RRCA 1FE8A 4CODB 2AMJA 1WTCA 1IG3A 5DWVA 1G7SA 3SC6A 4MV8A 1VDMA 3G2OA 4FCWA 4ZI7A 2ODNA 5JCXA 3T9AA 2OPBA 1SOVA 3I30X 5J9FA 5JSQA 3OQMA 4IICA 2A5YB 5DYNA 5E0KB 3H2KA 3IAS1 2R8RA 2Q7OE 4R05A 4G5HA 5DCUA 3B52X 4FGKA 3BZUA 1SVIA 5LLSA 3GMTA 1V4VA 3HKEB 4ZDWA 3W5UA 1EFRA 2YZGA 4QJ5A 3QUAA 1XZKA 1ZD3A 2RIPA 2I7DA 3PNBA 5K1ZA 3T5AA 2BC9A 2Q4TA 4NABA 3UB2A 3GVPA 4MS3A 2JLYA 1NF2A 2QSUA 3DPSA 4LHSA 1COZA 1JSXA 5KNDD 1WKBA 2BEJA 1U8YA 1FNSA 3TNJA 3VC3A 1Q74A 2I76A 4NFLA 4FYYA 4OQPA 3N0TA 4F7DA 2NIPA 2XQGA 3SZ3A 2J3EA 5ITWA 5GZ6A 1Z63A 4UD2A 1Z4QA 3N2ZB 1C7EA 2CZGA 5E7IA 5EIWA 4BLVA 2GEKA 1K1EA 1U1IA 3AXTA 4UTXA 2YN4A 1S5PA 4Q02A 5A5VA 3FPJA 3NI2A 4B4VA 3KRTA 1YDGA 3WLTA 1KAQA 1T1SA 3CIFA 4IHKA 1J21A 5GV7A 2WUDA 2C3YA 2OQVA 5IWCA 3H2ZA 5JDCA 3G88A 1QYCA 4IIFA 4NECA 5DTQA 1LX6A 3V4RA 1Z0JA 2QLLA 1PQUA 4FE4A 5BOSA 4YUWA 4C6TA 4EEXA 4DNPA 2PWBA 2QHXA 4TVOA 4UUBA 5I47A 4L28A 5HUQA 1H3FA 4F9EA 1N3IA 4JOBA 4MRAA 1X1BA 3PX2A 3WDSA 2I7VA 1PUJA 5GGYA 1LZLA 1ETUA 3WVNA 3KOXA 4BZZA 5JJBA 1N1EA 4JC4A 4U2EA 1M0EA 3V2UA 2VHWA 2PUVA 3VR6A 3RTDA 3AI1A 3EVDA 1E1NA 1QH8B 5C8VA 2E0IA 3DNPA 3OWHA 1HV8A 3LC1O 5AKHA 3DVAA 3GAMA 3P7MA 5HM8A 1IAQA 1ECLA 3DOUA 1ZA1A 2AXNA 5GM1A 3C3EA 2RE8A 1PI3A 2QVLA 3U61B 3KYCA 3QFCA 2C5AA 3KJXA 5CVDA 3UANA 4ZCRA 4M8IA 5JEEA 3LV8A 1ANKA 3G79A 3AF1A 1IY9A 1N7GA 3DGEC 1Y4AE 3HCEA 2W2TA 1KO7A 3HP1A 4ZHQA 3G02A 5FWXB 2VTVA 1OX5A 4GPD1 3L01A 3LAWA 2O3QA 2W37A 1FTWA 3AINA 3DEIA 3OIYA 3BMOA 2A9QA 2O3RA 3OPMA 1Z0ZA 4JVSB 3THRA 1NXWA 5KTPA 2Q3DA 2XRFA 3UWSA 5T6BA 4RZHA 3AB8A 4QUBA 3RYCB 3FAKA 1P5HA 1ECCA 4Y9UA 2OMEA 1H2RS 4LPSA 1D0VA 5CEFA 1LF5A 4YCSA 5D5PA 3P2MA 4ZIRB 3EA4A 4TKVB 4R0NA 1JA1A 2PG3A 4M60A 3ENWA 1YFZA 2GCPA 3SKXA 4QM7A 4KBFA 1NDUA 2R86A 4HN2A 3VSEA 2NSJA 3MXTA 3C39A 5BSRA 1M2FA 4Q15A 3WP1B 3CEAA 3WKBA 2VUTA 3AETB 4DLXA 2W71A 4ZO4A 5EIBC 1QO9A 4JP2A 1IB6A 5F78A 1IM8A 5JFOA 3ECSA 5IVDA 3ZIDA 4D9BA 2HU7A 4NPHA 1CS0A 5AJYA 2C9BA 1N9GA 1FTSA 1CRPA 4D4GA 4QQ8A 2Z8YA 3GCGA 2QP9X 4BMXA 1E0JA 4MCHA 4YRCA 5BP7A 2PS0A 3O8BA 1AT1A 3FGPA 3ZZNA 1FFDA 1QGUA 3D6MA 5CM2Z 1Q19A 2V7PA 4KO8A 4ARIA 4HLUC 4D9KA 3SHVA 4HAZA 2OQ2A 3WV5A 3LE8A 3MJDA 4X66B 4RGYA 1JLLB 3CGGA 3CNQS 2QAGB 1DDOA 3P0FA 1GKYA 2C88A 3CZ4A 3ZWKA 1UPUA 1LEHA 2V0CA 2OWEA 5TXGA 3O3MB 4NCIA 4RXMA 3G85A 1SCUB 5EQJB 1EMDA 2QXYA 4F9GA 2ZWVA 4LDAA 3G89A 1JJFA 3CONA 3DQQA 4FGWA 4CPDA 2YS7A 1BX1A 4DOMA 1P9NA 3SK0A 5KJFA 5F73A 4U5XA 4FN4A 3G9ZA 3OESA 3PX7A 5FUVA 1C8VB 1Q0RA 3U7JA 3GXOA 2ABWA 1P4GA 2C20A 1LJUA 5E2IA 1H5QA 1U8XX 5HQJA 2Q5EA 3U3JA 3HPQA 3EQ8A 1YRQA 3DEAA 5G0VA 4GR5A 3WIOA 4F38A 4FFRA 1T9HA 2PX0A 3KM0A 1QG0A 1UFQA 1WXGA 3N8KA 5CBPA 1TMYA 5TJ9A 5BN3A 4FX2A 3JWJA 5JO0A 3R9XA 1YIOA 3U37A 4YRKA 1ZNZA 1UOQA 3PXUA 3V2GA 1QK4A 4DA9A 1M6VA 3T3DA 2AN3A 1DX4A 1UZNA 4JUIA 4YCJA 4HUQA 1J06A 2AUTA 1A9YA 3UPTA 3RIGA 4R7TA 2CUKA 1FFYA 1IZZA 2OHJA 2YFYA 3INTA 3BTUA 1C1YA 3OE5A 3P4UA 1C4KA 4KSBA 4GBED 5JG7A 3KKEA 3MWDA 4OX9B 4IJUA 5ELLA 1IE3A 5DX0A 5HZHA 4HWKA 3HL0A 3PEVA 4INPA 3SHFA 4IDHA 4MCIA 3N7AA 4LOKA 5C4GB 1X38A 3PC7A 5AHXA 3KTFA 5HE9A 1QFZA 3JASA 1YQ9A 4ZZ0A 2HCBA 2ZIFA 2BDUA 4I99A 4EPVA 4GSYA 1RZRA 2PZBA 4OY3A 4TMZA 2JFHA 1L7QA 2BHNA 2OT3B 2NYVA 1OH6A 4O5AA 1TM2A 4YTEA 1QIMA 2Z4RA 2CMKA 1E1RA 2R1VB 3B60A 5K51A 3MCUA 5SV2A 1E5XA 4WZBE 4HFMA 4O2RA 4KPFC 1U3FA 3B82A 4QT4A 1UK6A 3M6FA 4F4HA 3M9WA 4QL3A 1WXEA 4G8JA 2NX2A 2VKQA 2WPDD 3H11A 2PFKA 4ZEOA 3DE0X 2ZP1A 4Z3DA 1IBKB 4X7RA 2OCIA 3EMVA 1E99A 1RAAA 4C1NA 4MWSA 4RVFA 3BWMA 4WKOA 2P5UA 4C14A 4E31A 3FWZA 1P91A 5AP9A 4EG6A 5LNK1 1KO1A 4PSKA 2BL4A 2HWWA 1ZP6A 1SWVA 5J2UA 1R3DA 4XQEA 4B2LA 2F9MA 1H2AS 2PGLA 4MWOA 4RKEA 4DCCA 4RD2A 4ETIA 2FOXA 1GXSB 3Q9SA 1TQHA 3FTNA 4OU4A 4Q4DA 3L6OO 4L0DA 3GFFA 4DA6A 2ZB3A 1XBTA 4M55A 5CCDA 3O75A 4OXNA 3SR0A 3U26A 5L3SA 2Y1WA 3ABSB 1BEEA 3FVWA 3RAGA 2OR3A 1TK3A 2NT4A 2WF9A 1D6SA 4XIJA 3UHFA 1TKRA 2CC2A 1NVBA 4I1YA 2VJKA 4FSHA 3RYTC 4PY2A 1QV6A 2REQB 4OYRA 4MUIA 2XADA 1HLGA 1NNLA 3U4MA 3HR8A 1JFFB 2G5CA 2HREA 5FLKA 3UY4A 4EYEA 2VDJA 1FDTA 4Q5IA 1T9ZA 5M2QA 4D9EA 1NU6A 2VO1A 3K96A 1F3LA 5BSGA 4QUEA 4HRAA 4M6WA 3HJUA 4WERA 2EARA 2R6FA 3WYBA 1G17A 3QLUA 2YDXA 4F3CA 2OCYC 4LE1A 4RDIA 2G7ZA 4ZRDA 2GOYA 2I3ZA 4M9UA 1EUDB 3ZIAD 2C9MA 4HLNA 3H7IA 1ECGA 3SX0A 3ZHZA 4CM6A 1ULUA 2CLEB 4PR3A 2G80A 3IBYA 1UF9A 2Q9CA 3OPYB 1D4AA 2ZYAA 5CH3A 5TNXA 4Q7LA 3AF4A 1O89A 3K8ZA 4RK0A 4XR9A 3PI7A 2V3CC 1J00A 1T2CA 3NDBB 4UM5A 2C1XA 1XRLA 1YD7A 1KJZA 1W25A 2SKCA 3OQVA 1N6NA 3M83A 3VZCA 1XZCA 1ZW6A 1VHJA 1X74A 2O05A 1RAFA 1NF8A 2PX2A 2VDMB 3H8VA 5BN1A 2QX9A 4KLCA 4LMPA 4ZVQA 1OYWA 2W6IA 4JLOA 5SYNA 5TS2A 2Q0XA 4A0FA 4WBNB 2J30A 5DPMA 2C7PA 1QBKC 1U0TA 1LX7A 4X60A 4YXWA 1IHUA 2WJGA 3FFXA 3GYBA 1DAHA 1NW5A 2Y05A 4QXQA 2NPOA 4ZT4A 1P5ZB 1TYCA 4N8EA 1ZD4A 2O20A 4QSHA 3UHOA 1Y5MA 4WUTA 2R8EA 2PU7A 4F85A 3EGEA 4C08A 4G0UA 1POWA 1NA5A 4JFAA 4CCYA 5JCJD 4NCNA 4C7OA 3A6EA 2X7HA 4K6HA 3ZKWA 3W3AD 1U9IC 4ME6A 3ENNA 5CUQA 4G24A 4XVHA 2IOFA 2YZKA 3WXBA 4C4TA 3ENVA 1Q0TA 3EARA 3GGGA 2WWWA 4RY0A 4XWOA 3RS4A 4EJMA 3L7YA 3MRVA 4JNCA 4WKCA 4J16A 4MR9A 2AFIA 4B6OA 2IUUA 2GLXA 2BGRA 2ZYGA 5IEBA 3QZUA 1EVZA 3BCRA 4DPLA 5H59A 2ORVA 3ACCA 3JQ7A 1ZXLA 3HYLA 1FK8A 2YWCA 3EYAA 1MO3A 4UU1A 5DRTA 3HO6A 4IDFA 3INRA 1SXJE 1WLYA 2NXCA 2A4MA 3PF9A 3UG7A 3UT5B 1U8ZA 5DI3A 1PR6A 3QEMB 4RJKA 4DGSA 5K3EA 1O0BA 4G01B 3O0TA 1YZYA 2FOIA 3QFHA 4H3SA 1M2KA 1RLMA 2P79A 3B3QA 2Q27A 3PLNA 4W9MC 3PUVA 4BS9A 1OFTA 1DOZA 1J2EA 2C5HA 1JAIA 1G0OA 2EP7A 2OGUA 3FYDA 4Y6RA 5BV2P 3GA5A 1ZAKA 2DWCA 2I8LA 2PRJA 3R7WA 2QNIA 3RAEC 2RH8A 4GP7A 4IJVA 2D3WA 5C32A 4HDAA 5H70A 1IPFA 1EIZA 2DFVA 2WFAA 3DXZA 1XTTA 3MJTA 3UXYA 1EFHA 4I1PA 3IOEA 1G42A 5GINE 1UMDA 1J23A 1GV1A 1P2GA 1HNNA 1PX2A 2YY5A 3CX7A 3AM5A 3GJ3A 5CA1A 3OURA 2QUHA 2Z4TA 3ZVKA 4AB1A 1C50A 1PZGA 1JL3A 1Y4DE 3PV0A 1XMOB 5IYZA 2H65A 2H1LA 2OXEA 3SAJA 1R8SA 1Z37A 1KC1A 4N3CA 5LBTA 1DV2A 3ADOA 3F5QA 4QEZA 3LL7A 1VCIA 1WXXA 2E89A 3U09A 4IAOA 5KINB 1PJAA 2YVUA 2X2OA 1I9GA 3JXEA 3QV1A 3KT0A 1L4UA 4JDPA 4DIOA 4EHIA 1Z0DA 1V35A 1A9OA 1Z3CA 1BX3A 3IKLA 4B31A 1CY1A 1ZJ6A 3EVBA 2HDNB 4PC6A 3HCRA 5IT4A 3L0OA 2FA9A 3CNHA 4IIEA 1AZLA 2RGYA 2W93A 1VPLA 4AG6A 1PJLA 1V7PC 1NBAA 3K0CA 1R5BA 4Z7NB 2FMXA 2W48A 3DFKA 4KX3A 4D26A 1QIDA 3A6HA 4S1OA 4G85A 4NK5A 4KFRA 2Y3IA 2YASA 2H17A 3ZE0B 3GLSA 3AXSA 3BXPA 1OV6A 5E4YA 5KQRA 4OFBA 3A1WA 4UNRA 4KNYA 4OP3A 1B0PA 4PLYA 1KE1A 2HHAA 4D4HA 2GN9A 4AQ7A 3C6QA 1HO3A 3R6DA 4UE6A 3EPLA 4H6VA 2ZUBA 3D4PA 4DTIA 1QHXA 4E7OA 3LW7A 4Q3OA 2ZRDA 1XFAA 4YFYA 4ZKDA 3ICWA 1OAAA 2IEZA 3QKRA 2V7QA 5ED4A 1W5AA 1XHLA 3UJ7A 4JI2B 5CU7A 2Q49A 3NAQA 3DBHA 3O8DA 2VCEA 4UNNA 5DNDA 1NVVR 4KQIA 1SBNE 3OZ7A 1IXSB 3SJAA 2WJ6A 1FTYA 4WX2B 5IAEA 3X0DA 2ZI6A 5MFPA 2VDVE 1NQOA 2ZXFA 4V1CI 1Z35A 1TQ2A 1XZJA 1DKNA 1WPQA 3AMVA 3NIGB 1MV5A 1OH5A 2QRVB 1RLJA 1UBOS 2Z8ZA 4R84A 4ER7A 2CJXA 4WJKB 2RK6A 2XOEA 1GDTA 2O50A 3FCEA 1KOLA 2PSSA 4DMMA 1ISIA 1RLIA 2P0YA 3MIIA 1GPDG 5MHTA 3LMKA 1EA7A 2JJ8A 1XXLA 3EXIA 2BFDA 4DWOA 4JQOA 2DHEA 4FLEA 3TB6A 4MYSA 2OMKA 2H85A 1O6ZA 2FUKA 2OGZA 2X0NA 2FCAA 5E6UB 4OU5A 3CIOA 4B7CA 1C0PA 3TYXA 5EJ2A 4MKFA 3JAMA 1X1DA 4MVJH 5J2TA 2IOQA 3GA7A 1CEYA 5ALTA 4XLLA 2W0MA 5A7HA 4HB4A 1SHLA 4QJIA 2Z5GA 4WGFA 2V55B 1COWA 1HR0B 4ERXA 4ZJYA 1ZXBA 1Y7LA 3PPYA 3U7QA 4AS2A 4QG3A 2PSDA 4WPGA 1C41A 1U8TA 4KDFA 4RPJA 4TPKA 3WHKA 3VR5H 3JZDA 2AX3A 2BM8A 1WSDA 2I65A 3KBBA 1A82A 4YP0A 3BD8A 5ECGC 2GPYA 4P33A 1KBZA 1RJFA 1IBRA 4MDFA 2PX3A 1AV7A 4KQ1A 3Q40A 1E1QD 1MO6A 2EEPA 2PWYA 2BSAA 4FI3F 4EHBA 3KB6A 4P22A 1T6YA 3GMIA 1V1RA 5IK2A 3V6LA 2FN3A 3D4LA 3RIEA 3X1DA 1W5FA 2XB2A 4BIMA 4URHA 3GGSA 1W5TA 3RSLA 3U17A 4D42A 5ITZB 1Y89A 3E6AA 3UC9A 1NE2A 1TF5A 2VZEA 4KFUA 4C3ZA 4JX8A 4MRMA 1UM8A 1MU0A 2QBYB 4LX0A 2JAOA 2HD4A 2N3ZA 5AI4A 3X1XA 3U56A 1RNLA 1ESNA 3A6JA 3AQIA 3U3MA 4Q93A 1L5SA 3IB3A 1I13A 4W7HA 5ALSA 4POAA 1JHZA 5EMHA 4E3WA 1NJ5A 2W2MA 1UXKA 3OZCA 4FFWA 5LC1A 4M9QA 4CG3A 4RS4A 4KWTA 4DL9A 1B42A 3KQTA 4UE2A 4I4TF 4LCJA 3RC3A 3S81A 1MHTA 2GZ3A 3TUIC 2E5LB 1IEQA 3OWOA 4MV5A 4J0EA 4UHFA 2OFPA 5CDFE 2ZUEA 1PNQA 3K9HA 3VVCA 2HCRA 1OFUX 2M6RA 2W2LD 1TTQB 3TSAA 2O8BB 2HQSA 1ZIDA 2WZCA 2C4WA 3A8TA 2HWYA 3LTEA 4NBVA 3SIRA 1YU6A 5K3BA 3VNSA 1ND6A 1E7WA 1N0VC 4P54A 3UHAA 3MINB 2JFNA 4TWZA 1UJCA 1UAAA 1UDXA 4OEHA 2P41A 5EXPA 4L5IA 5JQGA 1LSJA 1T5HX 3CCFA 1KXJA 4GHWA 4MHTA 1QS0B 2QZPA 5CT6A 3H6GA 1N5IA 1KQOA 1KDTA 2PMCA 1WP9A 3I1YA 3IR5A 1JR6A 1ZMXA 2NUPB 2NNWB 4HADA 3KJIA 1NSFA 2P2CA 3AB3A 3AW8A 4LGVA 3JD4A 2WK1A 1WVIA 1IZ8A 1DP4A 1PT9A 2Z8XA 2ZREA 4K2HA 3AHHA 1EWRA 1OXKB 4WH0A 5JATA 1R8XA 1E2DA 4HX9A 4QM6A 2K7ZA 4NBSA 1RJWA 4XFDA 3WGIA 4XB2A 4IDCA 4RQBA 2NACA 1Z47A 2FX2A 2H0QA 5B55A 4ZYZA 5D5HA 2O19A 1CUUA 4OXRA 2QD1A 3Q5DA 2J9RA 3BFKA 3JPWA 3MIZA 3OLWA 4ROTA 4BNKA 4EX6A 2OBMA 2VRCD 3DO5A 1X7YB 4I5GA 4P4SB 1RR6A 3OLQA 1BEZA 1PDOA 2ZETA 2ZU6A 1C9DB 4JELA 3TOXA 3VHXA 1U2PA 3FTEA 1CVLA 1W5BA 2OVBA 2Y71A 4BLQA 2C94A 3AR9A 3F8WA 1L4BA 1X1SA 1EFRD 1SVSA 1FX0A 4IOJA 3WB2A 4FNOA 4GZLA 4DJDC 4YRLA 1MQ9A 3HJCA 4B3HA 3IT3A 2Z2KA 1DXYA 2O8NA 1NE7A 5IMBA 2BZGA 1KWGA 2FP3A 2IQ5A 4PRYA 1NUHA 1E3TA 1KYVA 4RL4A 2PKXA 4HZUA 3ZU4A 3L77A 3PLAE 3I6QA 2CNWA 3ZTYA 4V0SA 4CM4B 4RMIA 4TL9A 3D3NA 2QGFA 2AQHA 3H19A 2DJIA 3ZWQA 5AVVA 4Z9YA 3WRXC 4DA4A 2P3LA 1YL7A 5AKKA 3LWNA 1TEXA 4V03A 3W6PA 4RNDB 5TX7A 3CF4A 2Q45A 2OG2A 3FJYA 3DB1A 3KKKA 1XA0A 3DCJA 4UM8B 3UMCA 2ZSFA 4ZOLF 5JMPA 4MITA 3N59A 4JU8A 2OQRA 3CXRA 1AK1A 1MB2A 4Q03A 4JSYA 4CDGA 5GONA 4AZ3A 4YAIA 5KQPA 3B89A 5JUWA 4X62B 1YDFA 4WJZA 2DOKA 2V5AA 2EV9A 3FKJA 1PJQA 1SH7A 1G5TA 3MAJA 2VXYA 2DY1A 4Z99A 2JRCA 4ZYVA 7ADHA 1GTSA 4I19A 2YY6A 5EMMA 4BLUA 3RRZA 1WNFA 2X58A 2GGSA 4LHVA 1WZEA 4ZOLB 3VR6D 3PICA 4DLUA 4TT8A 5DHUA 2B8TA 4A10A 3I12A 3DD1A 3I8OA 4WY8A 2ORED 1T5OA 4AW9A 2ZWIA 1SXGA 2C9YA 5EUQB 1T2DA 1CHNA 2CJFA 4JYCA 3I61A 4D9CA 1Z0SA 4KDRA 4YQEA 2LDXA 3HGMA 3SJ7A 3LUKA 2F62A 5EJ6A 4BGUA 1UC9A 2A59A 4Y2GA 3PFIA 5I4KA 3ZV3A 4ES6A 2XZDA 2HMVA 2NAPA 4CYMA 1UK7A 3A4NA 3ZJYA 4P6VF 4U39A 3RT7A 2R48A 3IUQA 4R0MA 2XLBA 4Q9JA 2GEJA 2ECFA 3C14C 3TGWA 3PC8A 2YC2C 1E5DA 3TSWA 4K3UA 4OD0A 2HIGA 4BMPB 1TJPB 4LRQA 5LZ9A 1TNDA 2FU5C 2Q6LA 1ILEA 2OV1A 4L78A 1G20A 4NOJA 3MSCA 3HLYA 3SBOA 3TLCA 2ETXA 3THYA 1UC5B 1RRMA 5AHOA 3EEBA 3OZSA 2IUYA 5C8ZA 4YCCA 4YT4A 1PNVA 1Y8RA 3ZU5A 1MT3A 5BO5A 1BCSB 1TJNA 4UNQA 3SC2B 4KN6A 1IWOA 1KJWA 1DIAA 2YZ7A 4C5AA 1JUDA 1TIPA 2PYDA 1Z4MA 2ZCVA 3IUSA 3NBQA 3IL2A 1CF9A 4AMUA 4Z1OA 5KTKA 1E89A 2AXPA 1MVNA 5JXJA 2RHHA 4HS9A 2HSZA 4ZODA 3TZEA 3RUAA 3HO1A 1E2FA 1GYQA 2CUNA 2XYPA 2V3WA 4I1RA 1XIVA 3WJ7A 4KE8A 5FYQA 4IIDA 4OXQA 1TYBE 2UKDA 1C2YA 1M1YB 4KPUB 3ZYZA 4UMEA 1PQYA 1JDZA 3BSSA 3BWEA 4MYDA 4QBGB 2Q28A 5JS2A 1E2MA 5KTNA 1FVFA 2MT9A 5IJWA 2RH4A 2XE8A 4QO8A 5GWXA 4LBWA 2A5GA 4BMNA 1GLNA 1TX4B 5FO1A 1TTPB 3M81A 4B3BA 2ACWA 3ER8A 4LOHA 1YACA 3RHFA 3OQBA 4HEJA 3VUEA 3UJ3X 1BXZA 1JJBA 2Z58A 4EI7A 1TXGA 2IBTA 1JE1A 3BSYA 3WOVA 4BWFB 4JOCA 3NPMA 4UTRA 3U4QA 3K09A 1JE0A 3ESQA 4BX2A 5IJ9B 5TRTA 3CF4G 4LXIA 1P6UA 3O3NB 2YWBA 4HAOA 2E4XA 1OC4A 1KOGA 4MLDA 3T5TA 3LCUA 4WE3A 5AM1A 1AS3A 4MOWA 4JYAB 4A2CA 1N36B 5JBIA 5BR8B 4H4EA 1WZIA 4OBWA 1JLRA 5KKNB 2NVWA 5UKDA 3JWGA 3RYIB 1NXVA 3F3MA 4MVJP 4HRYA 4RV9A 5FOSA 3TNYA 3JZIA 1DEHA 2VATA 5JT1A 3EQZA 1J9ZA 1QC5A 4YC7A 1N5LA 1UKYA 1YZUA 1X94A 2FUNB 3ANMA 5D00A 1VKOA 1HT2E 2JEZA 4R8VA 3GLFB 4ZYTA 1J70A 3IELA 4ALKA 3WK9A 3CUTA 4BMOB 3K6JA 4X65B 2O7NA 3T34A 4D45A 1OW3B 1QKKA 1L5MA 4L4XA 4O5OA 3N8HA 2UVDA 2VT3A 3NNDA 4GVPA 1PR9A 2BEVB 2FW9A 4MV7A 4PZAA 2QL6A 2QTHA 3HI4A 2AA3A 3OY7A 1B8UA 3Q7SA 4I3FA 4J76A 4I8XA 5EC8A 5LKRA 1NKTA 3QVWA 4H31A 2MSCB 4EHKA 1TAUA 2OSVA 1XLUA 4P7KA 3AG5A 5DBEX 2OE2A 1G8FA 1S3FA 3EZFA 4JBYA 2M6KA 4E11A 5JS1A 2VTKA 2BP7A 4MYTA 7MDHA 1RZRD 3KR0A 4KV9A 2YDYA 4L08A 1D5CA 2GO1A 3DCNA 4JOQA 1BFDA 1RBYA 4LFCB 2NU8A 3QOXA 1E1RD 4CV0A 1QRSA 3BA6A 3NT5A 1IEWA 5D6OA 2NU6B 1QZXA 3OJWA 3QNWA 1WHSB 1CUIA 2QRJA 2QS9A 5GMOA 2XA1A 1KPGA 2BBOA 2XVAA 2XQKA 4KBYA 4IEFB 4L16A 3WYNA 1N2GA 1IHPA 5CVTA 4B7AA 4TLLB 4Z5XA 2Z56A 4Y2JA 5LQNA 2AKEA 5DVZA 4FOPA 3U44B 3PIIA 3H5NA 2XKBA 4LXYA 3D6VA 3M6WA 3NHZA 3UB4A 1MQAA 1AD2A 5ES3A 1EWQA 3P0IA 2WKPA 3ZXUB 4LW8A 2IYNA 3IKVA 1L3BA 1U0JA 1PT7A 3I9V1 4PCLA 4KQXA 2HO5A 4MR8A 3VDMA 3LZCA 4RPCA 3EEIA 3KQUA 2FPGB 5CB0A 1TJ4A 4NJEA 3ZHSA 2AG0A 4JLUA 4GE0A 3AIKA 4LJSA 4OXXA 4X6XA 4JJZA 4RULA 4EDHA 1US8B 3SQOA 3I5XA 1E64A 1BXKA 1P7CA 3RVPA 1GAWA 5JVDA 4PE5B 2JIRA 8OHMA 5K2MA 3V2HA 3IPAA 5FCDA 5IAKA 1JR3E 1TAHA 1PL8A 2XBUA 3INNA 2PBRA 3L79A 1P2TA 3D1JA 4LS3A 3IHKA 3SOZA 4BEJA 2EW8A 4EZEA 1E9RA 4R98A 1YC5A 4X1KA 2GLUA 4XJXA 2PUAA 1UQTA 3GZ4A 1Y37A 5A71A 2XGSA 5FTNA 4KRFA 2NV0A 1I1OA 3RFVA 3L3BA 4CG1A 1M54A 1TZCA 4DJ5X 3FB4A 4LYEA 1C0EA 4YDSA 4AULA 3P97A 5A02A 1TIBA 1UKZA 2HWUA 2QVGA 3Q7PA 4FCCA 2C4HA 4C7XA 2FEMA 1HURA 4DLBA 3ESYA 3JYPA 4OAQA 5BQ3A 2RGXA 4TYNA 4ALNA 4R2WA 5TGDA 4NAHA 1NLYA 2HYDA 1N5JA 2J3QA 2PUHA 3ISTA 3K0FB 4M9RA 4N1AA 2E6UX 3DKRA 3NC1C 3CC8A 5SYMA 1JIUA 1TECE 2OEPA 3IURA 3W5IA 4M1WA 5FR1A 4RENA 1ODIA 2PD6A 5HILA 2R44A 3MD0A 1Y3DE 1AO0A 1EX6A 4S04A 4WZAB 1P72A 2VHTA 2GZ2A 4BNNA 1T9GR 2H16A 2W6ID 2BGIA 5BMOA 1JFLA 5KTSA 1GZVA 1A76A 3T9FA 1PFWA 4F06A 4GWGA 3D9QX 4ZMBA 2J6HA 4YXWD 1F0NA 4L4SA 2QTCA 4X85A 4DLRA 4YMVA 2PL1A 3ZTTA 4CKZA 4F7WA 2G25A 1JRLA 1P4AA 1VJTA 3FCSB 3TNLA 2R5FA 3ZOZA 1CQJB 1R5JA 3IT2A 4PFJA 3OEHD 4R2JA 3L8MA 5KAPA 1CJSA 1XU9A 3CISA 3PVCA 3M5DA 1FRNA 1W93A 4L75A 3UJBA 3SR3A 1DEAA 1U2GC 3GPCA 2VLIA 2JHFA 2GEDA 4ZI7F 1ONBA 1R12A 1SKYE 2VH5R 3T3IA 4BX9A 2V59A 1J8VA 1M0TA 5IMSA 2R4TA 5AVJA 3P52A 4Y6QA 1GR0A 1P3DA 4Z54A 1QAQA 1CV2A 2JCBA 2NO0A 3FPGA 3WK5A 1XAHA 3K2EA 4ND8B 4GXQA 1BHSA 1JA0A 3DULA 4NNJA 2XNCA 2OXTA 3B7PA 1E2BA 4L5YA 1UT8A 1L4MA 4BJ6A 1C7ZA 2D8MA 2ETVA 3EC1A 3CZAA 2MMCA 3IXLA 3RUHA 1RC8A 1G8HA 4JVMA 3TJZA 3B48A 4NRDA 4EYOA 4ZI7B 1T3ZA 1YBFA 3I83A 1KI6A 5M34A 1AC5A 3MUFA 1E69A 4I6JA 1JDVA 3A25A 4FEEA 2WWHA 3OZTA 3N7TA 2RGRA 4O4HA 4HN9A 4PBTA 2HPZA 3U9TA 3UMYA 2QM0A 2ROQA 3IIKA 2RG7A 1K7EB 3CLUD 5AVOA 4WI1A 1S01A 2OKCA 2J3DA 4GOXA 4JCOA 4MS3B 3FE2A 4O2AA 3WLJA 4CF7A 2NT3A 1R16A 2VEDA 2BSQA 1TKBA 2AD1A 4Z4HA 2ZYDA 1EEHA 2PAFA 4P2GA 4DSTA 3HMQA 3NNSA 5E6RA 4LYGA 2CE2X 5GAJA 4UBMA 3T1HB 2GSDA 3HLKA 4L0MA 1NUAA 4RSGA 4DBLC 3P2IA 1IOZA 3I05A 3LHSA 3ROMA 5JISA 1HLDA 3DP7A 4GLFA 4MB0A 1ATZA 3TRDA 4LI0A 3V8NA 1H2YA 3G0CA 3SNKA 3ISJA 4DILA 1QJ4A 3BGVA 5K0GA 4HQNA 3CJQA 4U7HA 1NBMA 1TA4A 3UGJA 1TJ5A 3BUSA 1CT9A 1O97D 1YXMA 3AR7A 4HGQA 1K27A 2B25A 2FCRA 2ILTA 3GVCA 5BOSB 1EK0A 1LLFA 3AWDA 4PV7A 2M2IA 3DT6A 3EIFA 3B7WA 4X61A 4YRJA 1Z28A 3VZSA 3SWWA 3STHA 4FYWA 4N0EA 4AJJA 2ZI5A 1FEZA 1Z6GA 2ZG6A 1U2RA 1ZOPA 1NLFA 4B7UA 3KZCA 3EGDB 4OG2A 1EFTA 1JKMA 4OV6B 2HDOA 1DCMA 2DR0A 4NBUA 4ZHQF 5AVYA 1VJCA 3IV6A 4CKBA 1MGOA 5KKAA 5IKEA 1IY2A 3GJXC 3NALA 3WBFA 2WUVA 4E5KA 5JAQA 3ZGYA 1I4OA 4CT5A 2QR3A 1ZWKA 3DVAB 1DC5A 5FPTA 3WLFA 1YA6A 3PC3A 4YAEA 5CH8A 1ACJA 1JF8A 4P98A 3G0GA 4PFSA 3ED1A 2I7CA 3AJEA 3KYCB 4TTPA 3V1MA 2WWXA 3H1EA 3RF6A 4WGGA 1HZZA 5LSAA 3PEYA 3CH4B 1VIVA 3OF5A 1QGAA 4BV2A 4MHOA 2V7QD 2W9XA 3MWKA 5GVRA 1IAVA 2F90A 1AA9A 2XLCA 5IANA 2BISA 3KNZA 3WGUA 1J6UA 4AY6A 3KOWA 3GUCA 3QXCA 4G0QA 2XUHA 5E2BA 2ZAYA 1LI7A 1WVMA 3ZCQA 5KSPA 4DA7A 2I29A 3BMOB 5IVKA 4GKJB 4LMBA 1IL0A 4YJGA 1ZM2A 1QG4A 4L4UA 2YRFA 2YXEA 3VISA 4DARA 4ZJZA 1A9XA 2J3IA 1K8QA 3I42A 5DKFA 1KSJA 4WQMA 4BECA 4YJFB 2F17A 5ICEA 1A04A 3QY9A 3W5BA 2ANCA 3BE5A 4CXMA 2MYTA 3I9JA 1SB9A 1NFRA 2EKDA 4FHZA 4N6GA 2B20A 4A73A 2DH6A 4GI7A 1E1YA 2VFAA 2YMMA 3F7MA 3OLXA 4BU0A 3ONFA 4A91A 2NO7A 2V6BA 5IKXA 5TE9A 1K4YA 2F2TA 2X9LA 3C74A 4JEMA 3P2JA 4FQ8A 2ZRNA 2PVSA 4YV7A 5EMKA 3LUHA 1JAYA 5F7ZA 4PLZA 4OGGA 1PBTA 2WFZA 5TQVA 3UK2A 5AI5A 2GAIA 1QGUB 2BIFA 1TK9A 1KAGA 1WEHA 4V0OA 3CRW1 5EJGA 1COWD 4RFSA 4IIJF 4C01A 4GKBA 1U9IA 2RKBA 2ICAA 1Z6QA 1NQXA 2OV2A 2PT7A 3W6OA 4B6GA 4U3JA 5CH5A 4GR9A 4IIYA 1HT3A 3CX3A 3TQFA 1A98A 5AIAA 5EZ6B 3MMZA 4I08A 4OI1A 1BMFA 4LY3A 2X2EA 3M1YA 1XEWX 2XCTB 1QO0A 1WDTA 1AB5A 1X0VA 1Y7TA 1BVRA 2HRDA 2JCGA 2NU7A 4GC5A 1Y5IA 2R1TB 2AHRA 1Z5ZA 1E62A 4MRVA 4RLFA 4URZR 3G5LA 1NR1A 3N2YA 4MLZA 1BE1A 4IIJB 5FAKA 4JP8A 2Y0BA 1TEZA 2VDPB 4L9AA 2UYGA 3CKLA 4GWKA 3TGPA 3N2KA 4RACA 4B3TB 4RMHA 3GVIA 3KV3O 4GLLA 2Q1TA 2ES4A 3HH8A 4O1HA 3BMQA 5ICSA 4S1VA 2PRIA 1PL7A 3Q7EA 2UU9B 1TMKA 4B47A 4IGEA 2TMKA 4B33A 3V8EA 1XVTA 1Z2EA 1X14A 4QOIA 3RVBA 3GARA 5CBPB 5CRIA 1DAKA 1RKXA 3L4KA 4NCKA 2AQ8A 5BN3B 3L49A 1XTSA 4JVLA 1EE9A 5JNRA 3R9XB 1WQ1R 3ROEA 2XNKA 4DHEA 1M6VB 1R0WA 2IHYA 3E4CA 4MYUA 5G1PA 1RSZA 2HBRA 2D2IA 5AK6A 5CD9A 4HUQB 4QDKA 1FVXA 1RM3A 1XROA 1UPFA 4MAAA 3U80A 4I9UA 1GA6A 2Q3FA 4ECEA 5LD2C 3F5FA 1MFZA 4WVFA 4EL0A 5L6LB 1F14A 2BELA 1VHTA 3MWDB 3O4VA 3W2IA 3W8RA 3LDGA 5A5EA 4NOMA 2E85A 4E30A 5IN5A 2NO4A 3R7SA 4CKCB 3O03A 3TSCA 4FEGA 4NYMR 1A9PA 5JW6A 1PVOA 1XDUA 1HE5A 3VNUA 4HAIA 2ZBUA 2DAPA 2DG2A 2OKGA 3RVDA 4PHHA 4Z7OB 4OJTA 1GG2A 3ETGA 5FJJA 5I7EA 2A0KA 1SXPA 5K5EA 2HHHB 1CWUA 2CHEA 3EGWA 4OH1A 5B58T 4G8CA 1AGRA 2QW1A 1XD9A 3CUYA 4GKVA 4QUAA 5I7FA 1P1JA 3R5FA 4QYMA 1RWNA 3G3EA 3HA7A 5J2UF 1DRKA 2Y1DA 1U2EA 1JZSA 2RHDA 3KQVA 1R74A 3ORFA 5ALUA 2PDAA 3WL8A 5I8PA 4WBNF 2NUTA 1TI7A 3H11B 3V1YA 2A9KA 5JANA 1OF1A 3E7WA 2DXIA 4C0JA 5DTJA 2YH2A 1O87A 4WV3A 4A2PA 2QZ9A 4KP7A 4PO3X 3TW8A 4XDGA 2HDHA 3NNNA 2AEJA 3EVTA 3R3XA 3TM4A 5A4DA 2GA8A 2HK9A 1H69A 2HF2A 2O23A 3OSUA 4B3JA 4EUKA 2RGBA 4IJMA 1F8YA 2GX6A 2QAIA 3BFJA 3ZW9A 5J2UB 4HV4A 2EGGA 2BKAA 5CHYA 3TZKA 1H85A 2DSNA 4URXR 2H31A 3CZ5A 4FUTA 3VJKA 2PUBA 4FE3A 1NZDA 2E5WA 4LYHA 3NKLA 1FDUA 1O8BA 5L3SB 1HFEL 3L8EA 4DW8A 1SUSA 3G2PA 4YJ2A 5H3CA 4F4CA 1Z56C 3RNOA 2BMWA 5BVHA 4DRYA 2IXDA 2Z3VA 4TV9A 3RG2A 3OHSX 4M0KA 3NTRA 4OLBA 3K53A 1DE0A 1NVKA 2FR1A 2VSFA 2ZRCA 3NTQA 1X8JA 3PHBE 1ZYUA 4K86A 4JJIA 4ZCLA 3RUEA 3B6ZA 5ELXA 1P6XA 1S2LA 1RBZA 3JQRA 5AO9A 4I6EA 1A9TA 4M6WB 5FWNA 1VGVA 4LXUA 5AW6A 2PTGA 3AEKB 2YV2A 4HQKA 1KYXA 3GJ5A 3LW8A 4L7VA 5TMBA 1UBTS 2YNMC 1RRGA 2ATVA 4NLLA 5BXQC 1FLDA 4FJ2A 3O4FA 3WO0A 5DK6A 3A9RA 2CNWD 4HNUA 1JHMA 1FCJA 1H4TA 3AKDA 4G5XA 1UXHA 3NOOA 4N8SA 2X76A 4CRWB 2CXRA 2R65A 4NP6A 1YTUA 2AD5A 1I8TA 4QO7A 3RU9A 4GEGA 1ZA2A 4EY8A 2CBXA 1KI3A 4MVJI 4PQYA 4NZNA 2Z6QA 4MQ6A 2RSLA 4RTJA 2I7TA 1ONPA 2FPUA 3ILVA 4ZAZA 4JT9A 3JQEA 4NS4A 1MHPA 3SZRA 2F3QA 5EZYF 5FUBA 4EG3A 1FNBA 1ZUD1 3QWFA 2LD4A 3IO3A 4QSMA 1SHZA 4TLCA 5FD8A 3HU5A 1OWOA 4UVIA 5EIOA 1Q7BA 1T1JA 2EHJA 4XB1A 4IQ4A 3UAOA 1YAHA 5ARCA 2C3PA 4Y1EA 4V0RA 3X1KA 4L4YA 4UPVA 3MCZA 1HT1E 4IVNA 3OIVA 4EMTA 4L6IA 3F8SA 3P0EA 2LXNA 4Q3LA 5CIQA 4CCYB 2H4JA 3WSWA 5IBCA 2PA3A 4P35A 4C7OB 5ILQA 1G7RA 1V47A 3AVPA 3GPDG 3M3PA 4QGBA 5GM2A 2MHCA 3GU3A 2RD2A 2XB6A 4FOOA 5EZYB 1YBMA 3LT0A 4RPGA 1E5QA 1XZQA 4KQWA 2JGIA 1FBTA 1G3UA 2XB4A 5FPYA 1B93A 2ZYSA 4Q66C 5LQMA 4P7FA 5U9CA 4UUNA 3VMMA 4EM6A 4BNZA 4C2TA 2PKYX 4BNLA 3S5JA 3MCAA 4MR9B 2AFIB 4PYKA 1AQNA 3ANLA 3PWSA 3V7UA 2QUIA 3LO5A 4GLOA 4HB2A 3O3CA 1EHCA 2C58A 5B1SA 5KX5A 2W6JA 4RH3A 1TF2A 3JQ7B 2RH5A 1Z34A 3ML1A 4EHDA 4TRNA 1L4EA 2FUEA 1CZLA 3P9XA 4FTWA 1WW3A 3BK7A 4HZIA 4HXGA 1EI9A 4CIYA 2M98A 2GM5A 2ORYA 4CMHA 4PYJA 3JQCA 5DI3B 3HK2A 4QOFA 3HVJA 2XMRA 3FJOA 5BQXA 1YVUA 1R2QA 3D8UA 3EY4A 2P3SA 2SKEA 4JJKA 1RI2A 3RABA 2XF8A 3FUCA 3OG9A 4E5MA 3C2QA 2KB0A 3K0AA 1K06A 5CA1F 3A2LA 1HQKA 2I33A 1T35A 2WJAA 4FGSA 1PR1A 5AJWA 1WUHS 3LOPA 2ZRLA 3ABZA 4MH0R 2XTJA 3GFQA 3NDJA 5JD3A 3Q8WA 1MN6A 1PVDA 5BRJA 1L7MA 4ZCTA 3JYNA 4K3VA 2ONJA 3UZUA 1SOWA 3DTNA 5T64A 1SPBS 2HAEA 3MJRA 4PLVA 3W9BA 2G72A 2YJGA 1DCTA 3JYQA 4W6ZA 2REBA 4JBLA 1L1RA 1XTQA 4G0OA 3LP6A 1UMDB 5CXQA 4ADSG 5CA1B 1EVQA 2WW8A 1Z2NX 4XGRA 4PQEA 4E07A 2ZBRA 1T8SA 5LCXA 3JVEA 5GPBA 1KMCA 4FKMA 4PSVA 3VUFA 4LF6B 1G4AE 4O6VA 1NAHA 1YNSA 3VGJA 1PGQA 2FDRA 3CO0S 4XD7A 3OZAA 4HAWA 4BQQA 1JT9A 2AC2A 1ZN2A 2MWMA 2R751 3P9NA 4V3BA 3IVAA 4M1KA 5CW1A 5BQPA 3S2ZA 3FJ1A 4Z4FA 1J2TA 3UBMA 1E6KA 4RHFA 4BO1A 4YRAA 4YT8A 4RIFA 1W6UA 3P2OA 4AAYA 4W7IA 1QTNA 1Z74A 1U9CA 4OSOA 1E60A 1HEUA 3CXUA 2RGUA 4LFAB 3GZTB 1TU0A 2OYSA 4BLOA 2JD1A 2VJCA 2WU1A 3HVIA 1GGNA 3RFUA 1RCTE 4RUKA 2K87A 4ED9A 2P8SA 4YRTA 3SM3A 1G5FA 2HH9A 4RA9A 4Y2HA 5JIBA 5C35A 1MAHA 3IHLA 5GIOE 2NP6A 2VDWA 2J4FA 3BAZA 4ZAGA 3KDSE 4E1BA 1RQXA 2B7CA 5K8JB 3A27A 4P3NA 3VZPA 4XLTA 3SGLA 3P0RA 4X8LA 4DLPA 3QQPA 5EJ5A 3TZLA 2X5KO 2V3VA 3FKSA 3L6CA 4AUMA 4TUYA 3BX1A 3OZFA 1ODTC 4L8VA 3REOA 2IWHA 4KK3A 3T3OA 3QKRB 4RVOA 5EE1A 3TWOA 2AMVA 4Y6OA 4HNAB 4H1HA 1ZCBA 3WR5A 3DBHB 2ZJBA 3LT5A 4DYHA 1M76A 1WCYA 2YTZA 3K5HA 1V2GA 5CYPA 4DIEA 4GBGA 2FMIA 2V74B 4FYMA 5EPUA 5JDIC 2QLFA 4MUYA 4JI3B 4AF7A 5LWQA 1IPEA 2C9CA 5TT0A 5T57A 2ZBQA 4BNYA 1I3MA 1U6KA 2VF7A 4RK1A 3GUZA 4H35A 3U7EB 1ZCZA 1QXSA 1UJ4A 1YOVA 2XCOA 5J2TF 4KG7A 3T54A 1JQAA 3TJMA 4YYEA 1CIPA 2NSLA 4H15A 1H6AA 3X3HA 1VSUA 4MUJA 5DGHA 3RNLA 2CKDA 2EDAA 3NDIA 4QDZA 4AG5A 1MGPA 1THGA 1UBLS 1A4XA 5D3ZA 3CR8A 3LFUA 4RKYA 5TDHA 1RTKA 2BFDB 3BF8A 1FX1A 1IDN1 1MNQA 3CEPB 1UM9A 3UUWA 1C2TA 3C6YA 1KAHA 3T5MA 1PLJA 2YIVX 5COQA 2JEOA 2WVHA 4QUDA 2IEAA 5JQWA 3EC2A 4HNVA 5J2TB 3C8UA 1NJ8A 1CQXA 2GJSA 3B5IA 3G13A 5ENZA 2FEKA 1IMJA 4H6XA 3KE8A 4OGWA 4PZ9A 5JBQA 3ZJTA 1D2RA 1YSCA 3HB4X 2C7GA 4HOYA 4RK4A 4XQCA 3DL4A 2BFAA 4HMPA 2IPOA 4PTLA 5TLSA 3U7QB 3UV7A 2VXCA 3QX7A 4KNWA 1LU9A 2R00C 3A6GA 3CW2A 4MW4A 4QGHA 1EXMA 1GTRA 5EQTA 3F7NA 1V0JA 1VMAA 1U1CA 4DUGA 1DJPA 2ZE7A 5H9WA 2WHQA 1NVMB 4IGIA 3W1WA 4FW9A 3ZDRA 2BM1A 1ZISA 1FNNA 1PIWA 3FLBA 2RGWA 2IFTA 4MS1A 1W29A 2DGDA 4IIHA 5A6VA 3G5AA 1QVWA 1QOPB 1V1RB 2B30A 1IQUA 1DAPA 1L4HA 1LS1A 1M74A 2ECKA 3NEYA 1OIVA 2AJCA 3K05A 3P2EA 4NDZA 4DZRA 5AM3A 1RT9A 4CMEA 1TW3A 3KR2A 5IKMA 3V8PA 1ODFA 4HEA1 5KQGA 4XM1A 4D0LB 4JQCA 4KQFA 1H0RA 5TMEA 1MT0A 4UCFA 2WQ6A 1GKUB 2FWIA 3NW9A 1WXDA 4MRMB 3I9OA 2GPSA 1JHUA 5HBRA 4PC1A 4ZGGA 3DFZA 1N3BA 2X3UA 4P7BA 2H5EA 1FW8A 4ZAWA 2G67A 5L7WA 3D3JA 4HC4A 4AZ0B 4DDWA 4YAJA 1SIWA 5G4KA 3G2IA 5B2ZA 3MWYW 5J4YA 3OLYA 5EIBD 3NFYA 2PPVA 5JFTA 3WAKA 1N32B 1YQTA 3URMA 3OMXA 5CFZA 3U7RA 1VG1A 1XTKA 4GVXA 4YB8A 2F9LA 1E63A 1YB7A 3LU1A 2GPTA 3IIMA 2VRWA 1TT7A 1Y8QA 5JQGF 1RABA 1CD5A 2OCDA 5KYWA 3RUFA 2RONA 2H57A 3HGTA 3UMFA 2AJLI 1K8RA 2FZEA 1N2SA 3A32A 1OWPA 2X6QA 3RGWS 1U2DC 2PA0A 1Y9EA 1DO8A 2Q0QA 3IQDB 1CUDA 4ZPXA 2RHRA 1UCFA 4GP6A 1BHO1 1F6DA 4E03A 1MW9X 3OFVA 3WGMA 3ZK7A 3BFVA 5FBWB 4DLZA 5KJEA 3WG9A 4AJEA 2PAAA 2W4IA 5L3RA 4P08A 1ORWA 1O5IA 3SLKA 1FP2A 1VE7A 1RXCA 2EWWA 1Q91A 2YOFA 3G2KA 1EDBA 1GG5A 2G0TA 4KAXA 4NENA 2WC1A 4RD0A 1DKQA 4EFDA 1GPWB 4NI5A 5ADVA 5HKOA 3GDGA 1V6SA 4C30A 1FFGA 4YJDA 3GQBA 1REQA 1ZHHA 2QP4A 4UTVA 5JECA 4B85A 5KC8A 3HYRA 5DM0A 2QRLA 1WHTA 2PFSA 1CE8B 1YI1A 3IO5A 2KPOA 4CFSA 2IPLA 2JCSA 3ZZTA 3AR4A 1NLUA 4N7MA 3IX7A 5K6AA 3NJRA 2YBDA 3X1JA 1FYVA 4JR2A 2Z95A 4MRRA 5EEHA 5BWOA 4FR5A 4LECA 3X1MA 1LS6A 2WV7A 2HF9A 2IY8A 2DR3A 2WG1A 2X40A 4JKYA 4WSOA 1EX1A 1N57A 2JANA 1FU7A 3T7TA 3WMXA 3PJGA 1A5SB 1LBHA 1HYBA 1UJ5A 4EMSA 4CI9A 1Z4OA 4X97A 3HJHA 4N0MA 3OQIA 1QR6A 1N77A 5CYOA 3E7PA 2PD4A 5CB4A 4OBEA 1YRWA 2UZ1A 4UDXX 1QWSA 3VHXB 1XZGA 4C29A 2R6ZA 3R23A 2HQOA 2GBGA 1GPKA 1LDMA 5DIFA 4K9PA 2IHZA 3L0YA 5ICGA 4GD3Q 1A3CA 3P9YA 5AW3A 1Y6FA 1FX0B 3OQJA 1MFPA 1V3QE 4GI2A 4ND5A 4UNSA 5IVPA 3GCXA 4HQ6A 3LBYA 4QHTA 1E8NA 2W7TA 3UTDA 3UBTA 2C8KA 4MUMA 4WXRA 2ZAMA 3TIFA 3VH3A 1EWVA 1NLZA 1E6LA 5FI0B 5JNLA 2Y4NA 2WA1A 1GQFA 3GJ8A 2G6TA 4WMLA 3I2JA 3RQSA 5BYAA 4Z49A 3PFNA 4EB0A 2VCHA 1E8MA 5IFLA 3ACBA 4RTOA 1IM2A 1CB7A 1E32A 4GS5A 4M8KA 3ZWOA 4HZUB 2Q4OA 2XGOA 4RFLA 1TOAA 1GCIA 3MN1A 5GONF 4K03A 4F5YA 5KKCA 1W36C 5LWHA 4IFTA 3I2GA 4LCEA 3ZE2B 2KS6A 3LPMA 1G6OA 4GEKA 1KK3A 4Y0NA 1O4WA 3ODPA 1MEOA 3GFBA 3M2TA 1XRMA 4D92A 2QIPA 3V4VB 4F6LA 3G59A 2B92A 3CH6A 1JFRA 3I53A 2C92A 1NBMD 4B9AA 4D8TA 3WE7A 1PWZA 1E79A 2GN2A 4BX0A 4FYHA 5GJBA 3RTCA 5AW5A 4EH1A 1ML3A 1LBIA 2O2JA 2VYVA 4DRXB 2A0YA 5GONB 1PR2A 3LXRA 4AZ3B 2O06A 1DADA 1SC3A 4DQLA 1E2IA 1NVUQ 2HFJA 5JSYA 4BMZA 1J5EB 3NHLA 4QUHA 2P9ZA 1MQSA 4Z4EA 4CLEA 1N2JA 3AHGA 4ENVA 4X3PA 1KS2A 4AKIA 1DDIA 2CSUA 3SQNA 3V7NA 3J7TA 1DWOA 3EDOA 1SHTX 5LYJA 3F96A 3H2YA 3QLJA 1HYEA 3ZGNA 4P7GA 1OGYA 3S1AA 1W4CA 2Y93A 2QVBA 2QTVA 1G291 4UOQA 5D1NA 1NYQA 2PUJA 1BVYF 2F3UA 1RQ7A 4XDHA 4B3CA 1OPXA 1PL6A 2GJ8A 1U11A 2CV2A 3BSFA 4IINA 4BV8A 1TKCA 1QFSA 4RORA 5CVUA 1XCLA 4N01A 1D6JA 1LK5A 3W8FA 4BZPA 1NF3A 2ILVA 3FVRA 3HZOA 4LJAA 4C06A 3H65A 1G5RA 3F6SA 2VPWA 3CSUA 2HCFA 3H84A 1G20B 3C6XA 3K30A 4C4AA 2J46A 1NRWA 4NVRA 3THYB 2GA9A 2P5TB 3WRWA 4EELA 1MO5A 3O6VA 1DX6A 1Y8RB 1A7JA 4EA8A 5B36A 3NZEA 1N78A 3I8SA 2R7MA 1FUEA 1CW2B 4FINA 5T6MA 1KZ6A 4N47A 1NYRA 1CFZA 2XNDA 3BGWA 2ZUTA 1SXQA 2P2LA 2ERCA 5IWAB 5CDYA 3OFJA 5HKKA 2IY9A 1Y98A 3VDNB 3FMVA 2RHGB 3O94A 2AE1A 5K0ZA 1ZRHA 4PGFA 5B53A 2BTOA 2Q6VA 4M87A 3DFUA 5HRAA 3E61A 3KQPA 5KQMA 2ZRGA 4KXVA 4PM4A 1Y4ZA 3EXHC 3DMDA 2Q1XA 1L1FA 3Q8LA 4BTLA 2FB9A 2JHAA 2VHVA 2BGNA 3NYQA 3OZDA 4PYLA 9LDTA 1KO5A 4CKYA 2I67A 1YR8A 1USIA 4R8MA 2PE5A 1BS2A 1D2AA 1IOVA 3CG4A 3G0DA 4AKSA 3CLVA 1KMHB 2CEAA 3C8ZA 4X1YA 1V3TA 3LXXA 5C5CA 3CM0A 4R9UC 1DRVA 5ALPA 2GPJA 4MPRA 5E1BA 3IUNA 5JH7A 3RADC 1BMFD 5HEKA 4CR7A 2XRMA 1QO0D 3KXIA 4N3GA 3PCRB 4DCMA 3KLOA 1QFYA 1WD5A 1VIAA 2YYAA 3NGLA 2IU0A 4PG6A 4ZV4A 2HCJB 4KACA 5ALRA 4C7VA 4W8GA 2ID7A 2UVQA 4M98A 5IAOA 1L7VC 2H1IA 1J5XA 1VCNA 2W6NA 2XGGA 2VK4A 4RKFA 4D41A 3ZGLA 5M7EA 5HP4A 2LCIA 1QC5B 3KS9A 4M7WA 1IUKA 5FNZA 3S7ZA 3A2MA 2XTMA 1BJKA 2XWBF 3CKYA 4KQ9A 2YY7A 4U2FA 5AK5A 4GL2A 3LHKA 1P39A 1P9OA 4H17A 1FQWA 2B6NA 4DLWA 4P32A 4PYRA 4X7PA 4PC3A 2VSOA 1PE0A 3L8YA 5AM0A 1C8BA 3DF7A 3I9KA 3H5IA 2Q6IA 1ZI9A 3FZEA 3I2HA 5KYVA 1C1HA 2QORA 2GARA 3FPBA 1OASA 4O25A 1J1IA 1N6LA 1D2EA 1FRFS 2WOJA 4K8RB 5CVJA 2IKQA 1AKUA 3ZE8A 1EUCB 4KYTA 4CQLA 2INGX 4XUEA 3R0VA 2B83A 2GTHA 3NU1A 2BP7B 3ICQB 4MPPA 1RP1A 3K92A 1CX9B 2FZKA 2YBEA 2RJOA 3ET4A 2FZ5A 3MT8A 5H68A 1MOZA 4LKRA 3SYTA 3ZI0A 1EJBA 5HHTA 2X0DA 1I4TD 1EP9A 1HX7A 3RRMA 1UQRA 3K1ZA 3M9LA 1JDJA 4P0TA 5DASA 4B48A 1AA6A 3UF0A 2WOOA 2DECA 1JPUA 4P7JA 2FI1A 1AXEA 3QWAA 5JVDF 2IODA 4XJSA 5KWEA 3WJ1A 3CWQA 3U6BA 3ENQA 1LPSA 3Q3HA 1SXJA 3AT1A 2QOEA 1BA2A 4RYDA 3O9MA 3A9VA 3U4AA 3HEAA 4MR8B 4UOZA 3R9KA 4ZOAA 3Q6NA 2ZIGA 2FK7A 3HACA 4BFLA 4I8IA 4BB5A 4I9FA 1B16A 1IWBB 1ETHA 1HORA 2L69A 2V5VA 4Q1AA 1GZ5A 1CUYA 4TRJA 1Q7EA 3T7IA 4JL8A 3HXKA 3WLOA 4XPIA 5HF8A 4LF7B 3C3AA 3WRYA 3LC7O 3YASA 4B9EA 4PLHA 3PQCA 4RCVA 2KMLA 4A0HA 5BSEA 1YS9A 5G0UA 1L3IA 1PJBA 1FSSA 2WYWA 1ZC4A 4X1KB 4N54A 1J24A 2CLHB 3AQ4A 3CE6A 1SEVA 3IUPA 5IHPA 4O0MA 4UTNA 3W2HA 3C4VA 1U1EA 4NZYA 4V0ME 1YK0A 2YJ4A 1AZSC 3ILXA 4CUKA 4FJ1A 4R1LA 2YWEA 1I30A 4HYQA 3H13A 3JATB 2RC5A 4S24A 3IOYA 2AVNA 4WFJA 4EPRA 1M2HA 5AW4A 4YDHB 3TFQA 1G64A 4TL8A 4RK5A 3GLFE 5M5BA 2FXIA 3NBXX 5FTMA 4ZYYA 1J97A 4ND1A 3FPLA 2X0EA 4H18A 1WF6A 2WQZA 2XMCA 3I92A 1YR3A 2XUZA 2R2GA 3OUTA 1NJ6A 3PD7A 3K8YA 3PRYA 5K8UA 1MXFA 1ZS9A 3RV3A 1DTSA 3GHYA 1OJ7A 1ZVMA 4JWTA 1SQGA 1UOOA 1WUTA 3AR8A 2F7SA 3HVKA 3R5KA 2C2OA 4MCAA 4Q3DA 3MBOA 3OM8A 4HVAA 4YCDA 3K0SA 1VG0B 1TQ6A 1NATA 4LXTA 1EK5A 4POOA 2D6FA 3DR5A 1ULTA 1T0JB 1I5OA 1TYAE 1WQ3A 2IDJA 2JAWA 4GSLA 1WIWA 1PD0A 4GYYA 2ZXUA 4GI1A 3IDSA 3RE1A 3SYMA 1CQIA 5KC9A 2J4CA 4XUGB 5JZ9A 1G5PA 2I2WA 4YPFA 3R40A 2G06A 4HQOA 3MTEA 4JHXA 3EGIA 4J6EA 2VQ6A 4O3MA 5ILOA 3K4QA 2XXAA 4XIIA 3BIXA 1JHYA 3RJ9A 3EFEA 3Q88A 1K2VN 4BHTA 2HQRA 1YO6A 2WIGA 4MVJA 3HFJA 4S35A 1NT4A 5KVQA 1C3LA 4BAUA 1B8NA 1YS1X 2GSWA 4AO8A 1FVOA 2APJA 2OHVA 1F06A 4RVUA 1MA0A 2FPKA 3Q72A 4RLHA 4LZLA 1QNFA 1HG0A 1TFRA 3NTVA 3RRNA 4M83A 5BSWA 2I2XB 1L7RA 1U63A 3OZXA 1P0PA 3EPJA 1XZAA 4JHLA 3V7FA 4EZBA 4O4HF 3FOFC 4B32A 1J39A 1HTBA 1RYBA 1KK2A 3HA2A 1JIJA 4G8DA 3KVOA 2WT8A 3L0PA 2W6JD 4PNPA 2OO5A 1YDMA 4D82A 3IUMA 5F1YA 3ADBA 1U04A 3PFGA 4MW0A 4O2AF 4QFBA 4ZK2A 3NHRA 2JFQA 1OE0A 2F64A 1GFIA 3I32A 2AG1A 5FUXA 1QORA 4C7MA 2PUDA 2IS1A 4JIGA 4E0BA 1W46A 2IYSA 4FYPA 4RK7A 1K0UA 2VJDA 3KT8A 5HXAA 4A36A 1X8LA 2IZOA 3R0IA 1BDJA 4OQXA 5D86A 2VUIB 2IHVA 1GG9A 2XA2A 4RANA 3AVXA 3D4IA 1CUAA 3KPJA 4Z3KA 4WIAA 4ZHSA 1CTQA 3KQQA 2RDMA 1Y3FE 2ZGVA 2FV8A 2XOXA 3GLKA 3FOAA 3DDUA 3LQ2A 3RV4A 2V7XA 2YFQA 3HBMA 1GL7A 1GQSA 3R77A 4MTCA 1J33A 1YCGA 3PZBA 4O2AB 3TE6A 4JBIA 3GI1A 2WWYA 4U4AA 3WBJA 5KPJA 3LJKA 4CTMA 4H77A 5FDFA 5L9AA 5BWBA 1XRPA 1XNGA 4F12A 2CXUA 5E6RB 3LL4A 5IABA 4RZQA 4DNXA 3AH8A 2FLVA 4JVOA 5GGXA 1PVVA 1VLVA 4DMHA 2J9FA 3PHLA 1NU8A 4RLSA 1IM5A 2GESA 4IJ5A 4QHYA 1XGKA 2AJBA 2W98A 1HDYA 3K20A 1WBJB 3OU6A 4UQOA 4ZVRA 3T4PA 2XUPA 3WICA 2IYLD 4EVIA 3VX3A 2PZGA 3SXPA 4JK3A 1JMYA 2Q0HA 3LP8A 4XD7D 1R4ZA 3N2LA 5A9SA 2GD6A 1TTTA 4C43A 1P7YA 2FEAA 4WZAE 6ABPA 4NZZA 5IJXA 2V45A 4IWYA 3E84A 2QN2A 4OYHA 4JGGA 3G0HA 2IVFA 3V4ZA 2OV4A 2XNSA 3CJRA 3PXAA 4MCJA 3C5CA 3LUBA 3SDBA 2P0EA 2FZCA 2VP6A 4O3FA 4MB6A 1ZUWA 5IRCD 4JA0A 4NQZA 1RWMA 1CU1A 4UW9A 3VTKA 2XJ9A 4ZC8A 1GPAA 3RARA 2P68A 5MGBA 1V41E 3H17A 1JDUA 4YQZA 3AFNA 4O33A 4Q39A 2XE6A 4YJHA 2PXCA 3TJRA 1TLTA 3UAXA 1UKCA 3LTNC 3KQHA 1Z2AA 4J1TA 4MUEA 4MVJG 4TKZA 1L9XA 3Q8MA 1KBOA 4BQIA 1RPAA 3GH1A 3FKSD 3HCFA 5DDIP 4Q7QA 3UJ9A 3PXCX 1GARA 2Y66A 3E58A 3G23A 3M1IA 1PFGA 1XELA 4LDZA 5AUPB 5D7NA 3RLIA 2ZDHA 1NNSA 1Z82A 2CLKB 3M82A 2NUBA 4Y1FA 4CQMB 3KDAA 3HBLA 4MA0A 3K70D 4B3GA 4FMCF 1J22A 5TGZA 3O1HB 1YVDA 5P21A 2IELA 2OV6A 4CMCA 3KYIB 3SG0A 2YL2A 2PLWA 3B3FA 3CB2A 4YJGB 2LKDA 4E08A 1U7TA 1DJQA 4R83A 1A9XB 3TZCA 2ZVJA 4CW7A 3AHFA 1R6BX 2WYUA 4JBHA 4CM3A 4JXXA 3N2GA 1E4OA 1P1CA 3V6MA 4F2PA 2PX5A 5C52B 1KC3A 2CY0A 3AKEA 1XJCA 3I1IA 5AUNB 3AEYA 3P0HA 3OC6A 1SWWA 1SHKA 1Q0PA 5LZ2A 3H1BA 1PTKA 4XIYA 4F5WA 4DLSA 2IITA 4FMCB 4LJKA 4P82A 5DBHX 3STVA 4ZDJA 1C3EA 1N2OA 4GL4A 2ARKA 3BRQA 2AG8A 4AMZA 3C48A 1B4DA 1DSSG 4V1CB 2HHJA 5BR7A 4FW8A 3DDWA 2W42A 3TL3A 1T9BA 1U98A 1ZL2A 3UIEA 1NKVA 4KHZA 3IC5A 3DYVA 2DFTA 2IH5A 2I4LA 4D9MA 2YV4A 4D8VA 3K1AB 3QUCA 2NZYA 1Q3HA 1T9KA 1XQYA 2WIDA 4RFSB 3JQBA 4XCQA 4KMRA 4B73A 5JRDS 2TRSB 3C5EA 1EDZA 4URYR 1TM5E 4MRSA 3ZZ0A 4HNGA 1RXYA 1U4NA 4U3JB 3WQQA 1G4UR 2QY9A 4NV3A 5DHQA 2H4ZA 2ZJOA 1EHIA 1XEWY 2VSYA 1PZNA 1X7XA 3BF7A 1O95C 3E8MA 3IA2A 5AMXA 4YRIA 4DUGD 5BT8A 1ZHOA 5IH7A 2VZ8A 2JLCA 4N7RA 4S2EA 2WFLA 5EIAA 1N1GA 5CURA 3WX0A 5FBRB 2UYHA 5HKAA 3ZLVA 3MGKA 4ARSA 1UFOA 3QEJA 1AKMA 2QRPA 2PZAA 1T8UA 1SBYA 1FFAA 2WF7A 3OAAA 4Q9LA 4Y6SA 2Q7DA 1ZDMA 1L4KA 1IXZA 3W9YA 4AX4A 3N2KB 4O08A 1X9HA 1E20A 1SC1A 3JS5A 1VKRA 1H66A 4BNMA 5AKIA 3BMQB 2H54A 3D8BA 3VZDA 4AJNA 3A3NA 3CNLA 1V8PA 3GLVA 5DYYA 1BW9B 4E5NA 3RM3A 4F92B 1NY6A 1L8LA 1MOPA 4B40A 1EZ1A 1QGDA 2BEWB 2YWXA 3G0IA 2QLBA 3QFSA 2PH5A 4OBXA 4TLMB 5KNCA 2NN3C 1PP4A 1ZN8A 2VHEA 2R25B 3GNLA 3C3KA 2XRZA 4JB0A 2PPLA 4FHDA 3VU8A 5I5EA 1XZBA 1PS8A 1E6WA 1NTOA 2X1HA 1XVVA 2OOSA 3D81A 3DOOA 3DE4X 4N5NA 1D0IA 3QW4B 3UK1A 2F3PA 4XDYA 5YASA 2IYTA 3BEOA 3ETNA 2YFHA 5A3SA 1RYNA 3E3MA 3RBXA 3N53A 4G63A 2GN8A 1KY3A 1MC4A 4U2GA 3DO6A 4RZSA 4TQGA 3IBCA 5EKSA 3B53X 4QGFA 4D4JA 3QBEA 3MVEA 2Z3ZA 1NN1A 4EAAA 3WI7A 4E5PA 4OHYA 1U3CA 2IEGA 2O2SA 3AI7A 3TINA 5F1KA 1YZTA 1U7HA 4WLUA 3R41A 2C7QA 4Z2AA 2ERYA 5AW7A 5GOZA 4EFMA 2ODWA 1NBOA 1PV2A 4KQ2A 4MUGA 4PHGA 3VR6H 3WHLA 3KB2A 1Z7YA 1U3GA 2NUTB 4ZQEA 4AF6A 2O6HA 3KJHA 1EVLA 3ZUPA 3KKOA 1JVSA 4BXOA 2Y1OA 4YJ2F 1QKIA 2O3SA 3WWCA 5FEUA 4REMA 4XWAA 5CB6A 4OM8A 1MO4A 4PX5A 4TV9F 3FAZA 4H4DA 4RFVA 1IQRA 1Y1PA 4TKLA 1JDTA 4H1WA 3U5ZB 2DHCA 2DSTA 1IRXA 1LCIA 1BC5A 2GBFA 2OK7A 4R68A 3SBEA 3FYUC 3U1VA 2D74A 3Q5EA 3OCCA 4HX5A 4RX1A 3PGKA 1SKMA 4PYMA 1OXTA 1CZNA 1Q16A 2I1VB 2QI9F 3SZMA 2I99A 4ESOA 5CBKA 3DPUA 3IOBA 2GUWA 1OWMA 1KKUA 2ZS9A 5JAPA 4BVBA 4GM1A 3V5NA 2YXNA 5CVEA 1U1FA 1C7JA 2H18A 2IDZA 3KFLA 3KZXA 4YJ2B 4YUYA 2F3RA 5K45A 4RKWA 1VI5A 2PT9A 2BM9A 4MUHA 4NE2A 2PSFA 2NADA 1PW5A 3DF9A