3FX2A

Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1991-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fx2A00
2QX6A 4FGLA 1H66A 3OWHA 1C7FA 1FLDA 2QMZA 2N1MA 4D02A 4DY4A 1ZWLA 2FLVA 4N9QA 3O2NA 2XOEA 1WSWA 2V5VA 2BZSA 1YKGA 3NFRA 1AKUA 2OHHA 5B3KA 1CZRA 4PTZA 5LJLA 1CZHA 1OBVA 2MOKA 4C76A 3QFRA 1AHNA 3ESXA 3GFSA 4C14A 3ESYA 5NLLA 1F4PA 2B3DA 2W5UA 3FX2A 4QODA 4OXXA 2BMVA 4YAUA 2MTBA 4C0WA 4ESEA 4CF6A 3L9WA 4QOFA 1AKRA 4PU0A 2F1OA 3S2YA 4M0CA 2R97A 2A5LA 1H69A 1TIKA 1CZOA 1FUEA 3W7AA 2Z98A 5ULLA 5JROA 5LMCA 3NHJA 4YAFA 2Z9CA 5EAIA 4QOGA 5LLDA 3O73A 3N39C 3OJWA 1C7EA 3W78A 3ZHOA 4BMOB 4N65A 4NULA 1AMOA 1KBQA 2KQUA 4FX2A 1B1CA 1D04A 3KAQA 4YQEA 3GFRA 5F4BA 3L9XA 1QBGA 3B6JA 2Q9UA 2FX2A 4DILA 1RLIA 1RCFA 3OX3A 3OWXA 4ZVNA 1J9GA 3TE7A 4XDGA 1RLJA 2QR2A 3NHKA 2FCRA 1XT6A 1BU5A 3R6WA 4LTDA 4FGKA 1SG0A 1FLAA 1VMEA 3UXHA 3G5MA 2KLBA 2QMYA 3OVMA 1T0IA 2V9CA 2MT9A 1GG5A 4C0XA 2X2PA 1AKQA 2ZKIA 5LJIA 5NULA 1D4AA 1QR2A 1T5BA 3K1YA 3P0RA 3QFCA 4QOJA 2FZ5A 3UXEA 3B6MA 2Z9BA 4QOEA 2ARKA 4Y9RA 1TLLA 3GFQA 3OJXA 5BUCA 3FJOA 4S24A 4U7HA 3NHUA 3GAMA 1FLVA 3ES9A 3NHLA 3NHFA 5B3LA 3QE2A 2QX9A 5LBUA 1YCGA 3F90A 4HEQA 1KBOA 2FZVA 1DX9A 3NHWA 4LAFA 3U7RA 4GR9A 1AKWA 1YCFA 1QRDA 3NLLA 1FX1A 4BMPB 4J8PA 4PTYA 3EYWA 5A4KA 1RTTA 4NLLA 4N82A 4U7GA 5FUQA 2XODA 2HNBA 2MWMA 3SVLA 5FX2A 2WC1A 3EDOA 3FVWA 2D5IA 2FAXA 3B6IA 4YAWA 1YCHA 1CZKA 4FGJA 5EA2A 4CETA 2M6SA 4H2DA 2GSWA 3F2VA 1E5DA 3TEMA 3FNIA 4H6PA 4XDHA 3LT5A 1XI2A 1FTGA 2V5UA 3W77A 5F51A 3ESZA 4R81A 4ZVMA 2FVXA 3KAPA 3HR4A 3HA2A 1I1OA 3RPEA 5EMNA 1DXQA 1ZX1A 1AKTA 1WSBA 1NNI1 1QHEA 2BN4A 1XYYA 3NHSA 4ICIA 2QX4A 1YDGA 3B6KA 3N3AC 1X77A 3KEGA 2AMJA 4Y7CA 4ZVLA 4U7FA 3OX2A 3NHRA 1FLNA 1OBOA 3FW1A 2BF4A 4DIKA 1BVYF 4LTMA 3D7NA 4ZVKA 3F6RA 5F12A 5LVAA 3KLBA 3K20A 4GI5A 2BPOA 2Q62A 5FA6A 4QOHA 1CZLA 2FOXA 1AG9A 3LCMA 2FDXA 2OHIA 1CZUA 4GQIA 1J9EA 1SQSA 4LA4A 3NHPA 2QWXA 3N3BC 1ZWKA 4HS4A 3TZBA 6NULA 2R96A 1CZNA 3F6SA 1YRHA 2M6RA 3JSXA 1FVXA 2QX8A 1J9ZA 1JA0A 2X2OA 1OFVA 1J8QA 5LBTA 2HNAA 2HPVA 2Z9DA 5TGZA 2OYSA 4QOIA 4YAOA 1AZLA 1D03A 2OHJA 2RG1A 4LTNA 4YALA 1JA1A 1XYVA 3OX1A 3HLYA 3W79A 1AKVA 3NHYA 4Y9UA 3U7IA 1DXOA 1V4BA 4F8YA 1YOBA
chains in the Genus database with same CATH superfamily
4MYDA 2WINI 1ZJYA 1SUPA 2JHFA 2C42A 1E4EA 3CF2A 3L4KA 4RVDA 2FUG1 1GFIA 1AQ6A 1EGVB 3KZ1E 3L49A 3NUQA 4IMRA 1XZBA 2QVBA 2O0MA 4U2DA 3T7IA 2VLIA 3ZJ4A 1TC2A 1U9IC 3F3KA 3MG9A 4BC1A 3G8DA 1YS1X 3JY6A 5LQNA 1OU0A 3PUYA 3K09A 3VZPA 4I5DA 1DZIA 3RVKA 2OQRA 3DZKA 4D02A 4EATA 1IFXA 1T8WA 4RLSA 1GWNA 2VEOA 3OZGA 1L3IA 3FI9A 3CBGA 4YHBA 1GDHA 3QVKA 2FWMX 3PQ5A 2ZRIA 1VMKA 4C3OB 1HR0B 2XB4A 5JFGA 1ZZEA 2BI7A 4P4LA 3H9GA 2E4WA 1IRIA 3ORRA 4N0EA 3GUCA 5FI5A 2JHGA 3SX4A 4GLFA 3SZ3A 2V97A 1B42A 3DDHA 1ZM2A 2PWZA 4ZHSA 5L8VA 4B8ZA 3R8CA 2IYTA 1MIHA 3EJ6A 1RZUA 4HDKA 4KIFA 4KNWA 2EFYA 4CQNA 4Q4JA 2UZ1B 3LLSA 4ITUA 4JKOA 2ZSAA 1LBSA 1XTTA 4R8VA 3KJGA 4OK5A 1XN1A 2V55B 4X5OA 4RJKA 3KTOA 3DM5A 1T0BA 3CGGA 1M0EA 2WD7B 2F00A 4TV8B 2FOIA 3G5UA 4E5UA 1FDTA 1WUIS 4LZZA 3KSUA 1NPTO 2HHJA 4PIPA 4HVAA 1N2HA 3LBYA 4G1CA 5EL0A 1G66A 3CLTC 3TLYA 1J8YF 3OAAD 3VPHA 1XPOA 2PSHA 1GTSA 2DWUA 5K0JA 4MQEB 4FHDA 1GPBA 4NBRA 3B36A 3NDPA 3NZEA 3P2OA 7GPBA 1GNVA 1LLCA 1P44A 1T2UA 3LCVB 4GOMD 3AJ9A 1GARA 1I24A 1OPRA 4ZJUA 1GOTA 3QW2A 4YP1A 4ERXA 1G5PA 2IXFA 3TNFA 2RHLA 2QP3A 1Y6ZA 3KVYA 4EGCB 4YMTA 3QX7A 4X92A 4XYLA 2PBZA 4KL8S 4YJGB 1WJGA 5ULLA 1ISSA 2XDAA 1J39A 1EVEA 2VCYA 2DFDA 3M2TA 4REQB 3OKCA 1O6CA 1VCMA 1UC9A 1DBQA 2GETA 2WWGA 3FYUC 5EWLB 4DR3B 3WMWA 3HA5A 4DZRA 3U9SA 1SPBS 3KRTA 3OZAA 3VX3A 1YC5A 1FP4A 2I3GA 3UC9A 1EBFA 3QPWA 3W5IA 2HZ7A 5I8ZA 5IXYA 3WHIA 1J0EA 1E1RD 2P3SA 1WAMA 2W6JA 3QKUA 5BVGA 4DE5A 2HQ1A 5DLPA 3MSCA 1D0VA 1HE1C 2AS0A 1RXVA 3KC2A 4Q9LA 5KSOA 1UH5A 3LXRA 4OJTA 3REQB 3KJHA 3OECA 1HZJA 1WHTB 4BMOB 1ZESA 1UPCA 5EIXA 2OHFA 3W6PA 1P75A 1FFCA 3LUJA 5LYJF 1CR6A 2ZI7A 4D1YA 5IAAA 4LZOA 1Y42X 3EE6A 3UV6A 3H5LA 4IIFA 4W63A 4F3YA 3DMTC 3B1JA 3L7OA 2LDXA 1B1CA 4TQUS 1IAVA 3DCJA 4G8CA 1H5UA 1NYTA 1KI3A 2PGJA 3ILHA 1L7MA 4IOKA 3GZNA 2WDPA 3R5KA 5JG7A 4ESOA 1BDIA 5EOVA 1EGQA 3LVBA 1MV8A 3WYNA 2XJ9A 2CXRA 2XIQA 4U6SA 3K70D 2ZATA 2PO5A 3UAGA 3SN6A 1ZUNA 4OBBA 1IHOA 1E8NA 2OCBA 4ZO7A 3ZQ6A 4CBVA 4E2YA 1OW3B 5KNLA 5AMXA 2QUZA 3C1UA 1T8SA 4BNWA 4ZT4A 3MAGA 2JIQA 4JVSB 1H2FA 1KO8A 5JSHA 2EKPA 1KVSA 1RMQA 2FCAA 2G9UA 4Y6GB 3KLMX 3NTVA 3BGIA 2QM3A 5A7GA 2Y9PB 4OP2A 4B3FX 4DM3A 3DL7A 2OMKA 1A9TA 1JW9B 3TNYA 1T4MA 1DOHA 4RDCA 3EPKA 3R44A 4G8JA 5JADA 1O96A 4NV3A 2V7PA 2PMFA 3HKEB 2WR8A 4EF6A 6GPBA 1E2IA 1CRQA 2E21A 1YQUA 5EKXA 5JDIA 5D01A 1RBZA 4G24A 1PV4A 4ZQBA 3MYRA 3WLOA 3IIIA 4O59O 2F62A 2VHYA 4HP8A 5B6JA 4O29A 3A36A 5TLSA 4OMUA 3C5VA 5IDYA 4B9AA 3VU9A 5FPPA 5SZJA 5CDFE 5EPEA 3O8QA 1KH3A 1DO0A 4BEBA 2R2GA 3GG2A 3KTAB 4YVFA 2XECA 2VTDA 4LOIA 4L76A 4HOYA 1ZA1A 1G5QA 1MA3A 3TS1A 3UXHA 2I91A 3JXEA 1RRKA 1SU8A 2HFKA 1QZXA 5C51B 2I4RA 3GRPA 3MTDA 1QR6A 2VA9A 4PQEA 3CR8A 2OFFA 3TSCA 3HVIA 4K2HA 4XIJA 1N25A 4YREA 1WV1A 1N6PA 3U4GA 1NN0A 5EHQA 4QBGB 1C1HA 4B5LA 2Q5FA 1XLTA 2UYCA 4RUKA 5CDYA 3W2GA 4FEYA 1L5NA 5CCXA 2UKDA 5H3CA 4BNTA 3CUTA 4FEEA 4GKKB 1VLJA 3IQHX 5I9LA 2W8BA 3GJYA 1AZSC 3TLJA 2WJHA 2V6GA 3HS3A 4IJ5A 5T4HA 1PZMA 2GA9A 4Q21A 4ZT7A 1ZITA 5L7TA 4ZV4A 2HJSA 2MSWA 1N3IA 5ES4B 2FPPA 1D4AA 2FWNA 4IKEA 2Y1WA 2VWQA 3LNCA 3QKRA 5UKDA 4NR0A 3O4RA 1OIVA 1L4HA 2PUCA 4F5ZA 1UBSB 3PTLA 1APBA 1VI5A 4NCJA 2FMIA 1VCOA 4AS2A 1KEEA 1QFJA 3NX4A 1UBMS 2DMRA 3GFQA 3L8HA 4I4TB 4TMVA 3X2SA 2ZK7A 3E9MA 5IAOA 1WZCA 1K08A 3A8TA 5IVIA 1EX7A 3BN3A 1C7IA 4OFBA 2K2QB 4DV2B 1CFJA 1PFQA 3OCCA 4YO8A 1WUJS 1U8FO 4CL2A 2P6MA 4KKVA 3CWCA 2WAOA 4BX2A 5JXHA 2RG7A 2GBGA 5H02A 4AECA 3TUZC 3I6BA 1ZHFA 2VZ9A 3E0XA 1D2AA 1HL3A 5H7XA 1TW3A 2JPDA 1SNYA 2AR7A 1FLVA 3FKJA 4PXSA 3TL6A 4DDKA 1H05A 3LOUA 3HBMA 5CMLA 4JVLA 3ZG6A 1I2DA 3CM0A 1UK6A 1OA0A 2ZRDA 1B00A 4LWZA 1Q7TA 4MLDA 5FLKA 1XKQA 1IZ9A 2HLDD 5FYDA 2ZP1A 4U39A 2HIMA 4MW2A 1A69A 1NWHA 1QGUB 1UC4B 4G4SO 3AW9A 1N75A 3OLWA 4YACA 4KBGA 5ANRB 4A26A 4INZA 1Z37A 4CKWB 4J0IA 1MDBA 2W71A 1R9GA 1O54A 2FZVA 1EJ6A 4XGNA 5MHTA 1Q11A 3WRVA 1EP9A 3CPEA 1R0BA 3IB6A 2YWDA 3PRYA 1Z5VA 3AEXA 4DM7A 2GX6A 1FPQA 1R6AA 3NM4A 5K4AA 4N01A 1F20A 3RKRA 6LDHA 1ZVVA 4ZKEA 1PJ2A 2HJVA 2EFJA 1I4DD 3FUVA 4X1KB 5JSFA 1YCFA 3FHCB 1SD1A 3NFYA 3P26A 1TT5A 1JJIA 4L85A 2OCKA 1A5SB 3IPCA 4RV4A 1R6DA 4P0TA 4PZAA 1BN6A 1FRVA 2CLFB 1SJ9A 3KEMA 3KEFA 2OHVA 3A3YA 1MA0A 4MJ7A 3MMPA 5EJ2A 3RIEA 3JU3A 3IE2A 2ANCA 4PYMA 3NV7A 3CCCA 2WMDA 4RD1A 3D5QA 4GRIA 4WLOA 4DMKA 1NRJB 4QO8A 1Z6GA 3UNXA 1CZKA 1JUDA 2I6FA 3EF1A 5CYOA 5DHAA 3JALA 2F59A 4U7JA 4ZAFA 4HO1X 2V7QA 4MLPA 4TT3D 5T6MA 2GCOA 1E64A 5IK2D 5HQJA 2OBYA 2WFLB 2ZJBA 1JPNA 1M6YA 3G2PA 4OHPA 2GSWA 3N74A 1M2OB 4QARA 2ZI5A 2GZMA 3K70C 5BW5A 4NMWA 3B3JA 2WWVD 1D4ZA 1OWMA 3HEBA 5EJFA 4CG0A 4EG3A 5J2UF 1LPPA 1C7ZA 4F92B 4CKYA 4Y9DA 1XNHA 1W1IA 1U2EA 2PM8A 1XWIA 3PF8A 2QF7A 5KX5F 4KDCA 5KNDA 1T9DA 1OTXA 4C3VA 1MFZA 4Q66C 1L4NA 5JNSA 4CL0A 4GQBA 3U7HB 4WA7A 5IAGA 1N3BA 3L1VA 3MB8A 5EKDA 1RAAA 2BUAA 1CJBA 2C29D 4J7XA 3U9TA 1FDIA 2AEEA 4GVXA 4F3TA 1TCCA 2Y9MB 5JIBA 3HSYA 4QNNA 4WV3A 4YAEA 1YS6A 1ZMRA 4EPVA 2INGX 3QKTA 4C0HA 1NVUQ 2C94A 1VA4A 3LFTA 2O5CA 5C5DA 3X1XA 1MZPA 3TINA 1G6OA 3HA2A 4DRYA 4TMYA 1DTWB 1DAGA 3ZGYA 4MPDA 4KO3S 3NXKA 4QLAA 1PDVA 2Q3JA 3TTYA 2CVQA 4Q34A 1GPKA 3QX8A 2FPSA 2V0NA 1ONSA 4B44A 2WVJA 5ICFA 1ZO8A 2QW1A 4LW8A 1PR6A 3OD5A 4IDHA 4R1TA 4BXOB 2XUQA 1KYTA 3AETA 1W59A 2A33A 3RSFA 4QELA 5BNZA 3GNSA 4IAOA 1QU2A 1Z0JA 1MPXA 1VJTA 1FS6A 4KDFA 4UM9D 3H13A 3KZNA 1VZ3A 2WFMA 1T2EA 2XMSA 3P2KA 5IMBA 5AOAA 3QOXA 2ZBGA 1EQ2A 1Q1QA 2REQA 2V59A 4Y0VA 5ALXA 1H2YA 1AM4D 1NMSA 1UZNA 3P19A 3AOGA 3JQ8A 3Q4GA 4CR7A 4D8UA 4QXPA 4DV0B 1XXHA 4L9WA 4D8XA 3V4OA 1O03A 4GPZA 2UXCB 3B1ZA 1YIAA 3Q7EA 4NU0A 1ELOA 3E18A 3PBKA 4W5TA 2QMHA 2FN7A 3DLBA 1MC5A 4AQYB 3A6KA 4FWIB 2XY4A 2HO4A 1XTBA 1LU9A 1VHLA 2RAVA 4FOOA 3ZWOA 1WZIA 2WF8A 4WN9B 4QJ3A 4ZVKA 4AJ2A 5TIIA 3A3PA 2YHSA 5TJHA 3ROXA 2P4UA 1E9CA 2PUVA 1U7DA 2GYUA 1ZBQA 2YQZA 3DHNA 1VJCA 2FZCA 2VHTA 5T57A 1KSJA 3AR6A 5KDLA 1BHSA 3I3OA 2ZRGA 5IM5A 1NW8A 5CAEB 1GN9A 3FAKA 1XLWA 1V16A 3AF4A 1SKMA 221PA 4O33A 1ZNQO 4PBSA 1A2QA 1AF7A 3T7RA 4GT1A 4CLRB 1J33A 2H92A 4UMVA 1T10A 1ZIXA 4HEHA 4OYYA 4R16A 2CLKB 1OSNA 5AR1A 1ZOLA 3RRZA 1E1CB 1VP9A 3Q2IA 3LM8A 3SM3A 1QS0B 3QBTA 3W8EA 3U44A 3MM4A 1VLQA 3KKQA 1LF0A 2AC7A 3JAKB 4KYIB 1EQUA 4HB3A 1BHQ1 1BJTA 1U3GA 2CBXA 3LUAA 4HPWA 4S05A 2ZXUA 5TJ9A 2CC2A 2C8LA 1TMKA 3BF7A 3FYCA 3PB3A 2W6ZA 3BMXA 4L5JA 3NGMA 1N9ZA 2ZYWX 3IDOA 3U1TA 4X7MA 1JPUA 1MO5A 4FSHA 1PWYE 1LC3A 5AP9A 4ND6A 2VJBA 4PLWA 3WA6A 3S2EA 4GBGA 3CUWA 1KEZA 3G5TA 1OWLA 3H5TA 1N8SA 2G0NA 1PFGA 2FK8A 3RRBA 4ETNA 1PL0A 1AUQA 1JBKA 2BKAA 4IM7A 5J2TF 4ZZ0A 5CFZA 1IB0A 3O6VA 1CZNA 4HXFB 4YTEA 1NAHA 1RM3A 3SIWA 3EY4A 5AOVA 4I50B 5B2EA 1E2EA 2EQAA 3TRFA 3UGKA 5HOEA 5L3QB 4BS9A 7MDHA 1E61A 1UMBB 4XD7A 2YV3A 5D84A 3NC1C 4B75A 3PDCA 2P0AA 1U8ZA 1RWVA 3H99A 3Q6NA 5F1OA 1N7IA 2V9ZA 1LV7A 2X2OA 3A14A 3ANLA 1G41A 3LG2A 4LC9A 5I7VA 2NV2B 4ONEA 2HF7A 4M22A 1E9DA 5BSKA 1ZMBA 2HBYA 2VHVA 1J0XO 2ZULA 1LQTA 3OE5A 4MCAA 3GMIA 4L9RA 5A62A 4Q3BA 3ER9A 3D5EA 1ZY2A 2C2KA 2Q5HA 3M3PA 3CU5A 4AKTA 4PICA 3FMVA 5K0ZA 4MR7B 1KNQA 2XYQA 2LR0A 5ETJA 4I8XA 1HG1A 2DBQA 3WB0A 4X45A 3RNOA 1KQGA 5GJCA 1CTQA 2EKBA 3TM5A 4DC1A 1PL8A 1RLTA 3TR6A 3L8EA 4KO8A 4L5AA 4OCZA 4EGFA 4KX5A 1FZQA 3INTA 3RROA 3H2HA 3Q3JB 1XHEA 4PLYA 1XRMA 1AKVA 4EI7A 1Q3TA 1A7KA 1M2GA 3H0EA 4RJ2A 3F7OA 2N9UA 2BLNA 1J23A 2AOXA 3BXGA 5HRAA 1PYDA 2Z43A 3GD7A 4WLEA 3WYBA 4FJ1A 3KQHA 4HYTA 2I29A 3H1FA 3NBZC 1QH8A 4CG3A 2NNWB 3WJ1A 1P1FA 2K6GA 2KSQA 1CV2A 5IT9A 4Q6WA 1EEXB 1EJBA 4WXMA 1SA0A 3HU3A 4MV9A 3RVJA 1QO0D 4BGUA 3JQAD 2JLAA 2G1KA 3OWHA 4MV8A 4R0VA 4FXPA 2V1XA 4B3HA 3QX9A 5THXA 4NX2A 2ANBA 3ETDA 4K81B 4DBVO 4EB3A 4MO2A 3WRXA 1NN3A 4CNQA 1MW9X 5LOVA 4DY4A 1XKLA 2XDQB 3ZCSA 1RHQA 4CM1A 4Q18A 1V48A 4KQHA 4XIIA 1KOLA 5A04A 2ZJ1A 1YQQA 5DN6D 1HE5A 2UYYA 3V8PA 3PT9A 2JLSA 2PGDA 4WBNF 2NVWA 2V5VA 3H4VA 3PNLA 1CR1A 1JR2A 3NFRA 4Y6SA 3RYIB 5JZOA 2C57A 3NVKI 4G07A 1XMPA 3SC4A 1YK1A 3AR5A 3PIIA 1AQNA 2WQ6A 5I51A 2XGMA 1O8CA 3C14C 3KJZA 3RAGA 3ZWVA 2YR0A 4DYHA 2QTZA 5BV1A 2X9QA 1OI7A 3TPZA 5DLYA 1PLLA 2VUTA 2FQQA 3T1HB 3WKDA 3CUVA 1E1YA 1UWLA 3FTQA 1K9VF 2WUWE 1GRCA 1WV0A 1FE8A 5AK3A 1J1IA 3AM4A 3PQEA 3GWZA 3NALA 4E09A 3RARA 1QK5A 3M7IA 4HDAA 5LR6A 4R1LA 4O8ZA 3TTSA 4CM8B 3DXYA 3A4NA 2IEBA 5REQB 2ZSJA 4ANFA 4C0KA 2H2FA 2BMVA 1Q83A 4JJ6A 4CIWA 1A1VA 3D8HA 5GWXA 3X2FA 3HCDA 1QBKC 1SKYE 1ZK0A 2BLLA 2CUNA 2W2OA 3KSRA 2YHIA 3BIOA 1YV9A 2YVAA 3MMXA 2FRVA 1Z75A 3WK6A 2V8OA 4PU0A 4V0RA 3HJGA 3PR1A 3L4EA 3FTDA 2R8YA 2RK3A 1WVMA 3S2YA 1N32B 1H69A 4ASUD 2VXYA 3W7AA 3NVMB 1VXRA 5JNRA 3E5RA 1M6VB 1P9NA 1X1QA 3LIPA 4R9RA 4X6XA 4QVKA 4C07A 1YU6A 3TMAA 1VIAA 2X9NA 4JUCA 3D6HA 4FT4A 2IBSA 3I52A 3NMUF 1MU0A 4FDAA 3KLOA 1AT1A 1KK3A 5HQ3A 3FDFA 4O2BA 4XI9A 3IR6A 2R86A 2XRZA 3C8UA 2ZRBA 3EEYA 4YMGA 4RA9A 1YCDA 3AVTA 1R8YA 2JFXA 2FNAA 2G76A 5TY0A 2D1FA 5EZ6B 4AUNA 2XNDA 3R5SA 1JEQA 3ET4A 5I9IA 3H1BA 4OHCA 3JYHA 2IUUA 1QIMA 1G64A 3WA7A 1GCGA 1D5CA 2JIPA 2RONA 3EWIA 4A2CA 3JQ6A 1NQXA 5IUKC 1Q3KA 2W6MA 2F4VB 5F77A 4LQ4A 5B2ZA 5ENDA 4NQRA 3CTMA 3G8CA 4UVIA 2VF5X 2YOHA 4I0WB 4L9SA 4AJOA 1QVVA 3L01A 4PIMA 5DWVA 4AJ1A 3QUAA 4XCVA 1JSLA 2MSEB 2Z4TA 3B38A 4KAFA 4UE3S 1CRWG 3E48A 1UF9A 4XFJA 3UPUA 4C6SA 1IIRA 1MABA 1USIA 1SQFA 2BMDA 2I54A 5JAPA 5K05A 3OJFA 3B6JA 3QG5A 1TAUA 1GZ5A 3HB0A 3M5WA 1HDZA 4HX5A 1E2HA 5HCNA 5G41A 5JCOA 4QPJC 1WX1A 4KMRA 2WF6A 3BX1A 3KZKA 1RQRA 2HK7A 1Y6FA 2WHQA 2GCIA 2Y71A 1OB2A 4YCDA 2F43B 1KJYA 1VIYA 2X7HA 4BFUA 4DQKA 4PRLA 1SVOA 2HA2A 1VPEA 3EZXA 2MHCA 3S4YA 1URPA 1JGTA 3LPMA 1A5ZA 4DCOA 3I5UA 2OFWA 1NQOA 2VOJA 1G8YA 3IEPA 3LQRA 1ZD9A 1BW9A 1R66A 4KW7A 4W1RA 3S5JA 3SC2A 3Q88A 4DIDA 2PUBA 2C97A 4QXMA 3GBPA 4EEXA 1IDOA 4UBOA 4UTOA 1JXAA 1AQLA 2OWDA 2A7QA 4H6XA 4IV0A 1E4EB 1R27A 4QFBA 1FXSA 1JAXA 2PPLA 1CG6A 1PTJA 3CNLA 4OREX 4Q1FA 3UAXA 2QRPA 1TF5A 2HN9A 3K5PA 1DQSA 4PSKA 1YRBA 3LYLA 4IWNA 2GN0A 2W48A 4XDZA 4PN3A 3WTCA 4S2UA 1NRIA 3L4SO 3FE2A 1IU9A 2HXYA 2ETXA 1QV6A 2AEMA 2FMUA 2J0UA 3GJ3A 1QCZA 1FLAA 3QQPA 4JOSA 5KYVA 5SY9A 4ZICA 2P2NA 5BN3A 3UMBA 4WNIA 2UZ4A 3N0XA 4GRDA 4E7PA 5KYGA 1W7AA 3O5AA 2IP4A 2WIAA 1YA8A 4O4LA 4RLFA 1YZGA 1K2VN 1WXWA 4NOLA 1M8FA 5JQWA 4QTXA 4DNXA 1H4QA 2NTEA 4OPMA 1E1NA 3BG5A 1DG1G 1YJ8A 3F71A 4KXYA 5LIRA 4TLMB 4WADA 2EU8A 2QLJA 2WUVA 2GJAA 4KBFA 3OZWA 1MX1A 3GC6A 4HDKB 2GEFA 1GG5A 1Z74A 2DSTA 2P9BA 3EMDA 3DKKA 3LC0A 4Q4JB 5PNTA 1UJ6A 5BXQC 2ZVPX 1PGNA 2BGTA 3RS4A 5A03A 3D0OA 3A6FA 5G1PA 1JSRA 4KV7A 1U9ZA 4MS3B 2XZDA 4ZRNA 1EBUA 2QE6A 2B1GA 3R3XA 1YGYA 1H2RS 5FORA 4YWHA 4I3HA 5KOIA 2ZTUA 1RC1A 2I03A 4XYMA 3T8YA 1QP0A 3WO1A 2BY4A 4QOEA 5KC8A 1OQAA 1L4EA 3V3TA 3TLMA 4JOBA 1UBFA 3DMHA 5F76A 4B6QA 4DZZA 5FEUA 1CP2A 1XOIA 4FYPA 1JVBA 5JZMA 3BMCB 1C9NA 5H16A 2IZOA 4RJIA 2R44A 1A9SA 3L79A 1QFSA 4X94A 5E3HA 3Q2OA 4F5WA 1NPYA 5C3MA 4R68A 2JH9A 2EIHA 3KS9A 4K6KA 2OESA 4BMZA 3SYRA 5B30A 1U02A 4YAKA 3SZLA 1NT4A 1E66A 1EK1A 3IELA 5IF3A 3S8MA 1U3FA 1EXNA 4P08A 2YYAA 4GLLA 4ZO8A 1VG0B 4DMGA 1THMA 3VJKA 5C8YA 1FP4B 1UJCA 2P4HX 1C3LA 1UODA 5CDUA 2IITA 1RXSA 3G0OA 3W6NA 1HYBA 4I55F 5DM2A 4ZEMA 1Y3IA 3IPYA 2WSIA 3FR7A 2C78A 2F9FA 3G5AA 3WNVA 3V55A 3RC8A 3ACDA 1H4TA 1HFJA 2AHOA 4U2BA 1RAGA 2ZIEA 3RJZA 3H11A 2I2WA 3QYJA 3AB7A 1CPYA 3HGMA 4IIJA 3M6VA 5EEGA 3NHWA 3N5KA 1VG9B 1RYHA 2Y1OA 5IC6A 1Q84A 2TSYB 3PD7A 3S1LA 3LPLA 3PTAA 3GZNB 1YULA 1S02A 1ZHHA 2GKGA 4IJQA 4LQLA 4Q4AA 1XO1A 2H00A 1SQGA 1UT8A 3Q9LA 3V80A 3ENKA 1HF3A 3GCWA 1BJRE 4GKAA 2CW5A 3FCXA 4M55A 2W6ID 4NV0A 1M73E 5AKLA 1Z82A 5FPTA 1L5RA 1ADGA 3OC6A 3LOPA 1AURA 2GXUA 5IBCA 5FUQA 2OD7A 1NF9A 2HNBA 2XODA 3VO8A 3SVLA 1Z7WA 2IPOA 1SG6A 2J9YB 4NV1A 1U2PA 3CNNA 4CDNA 1B6RA 4GX2A 1NQUA 3FPEA 1Z4QA 4RPLA 4TTPA 1ZD1A 3GRYA 2BCGY 3WADA 5ALRA 1B4DA 1U1CA 5KTYA 3EOZA 4M9SA 4C06A 1ORDA 2AKYA 5B3AA 5K8IA 3TOCA 1YUBA 3VR4A 3ZGVA 4BFZA 1T2NA 2ZCJA 2AW5A 1DBRA 4FS8A 4L0QA 1O96B 3OCZA 3X3HA 1BVUA 1Q15A 5MN5A 3RV4A 2Y92A 3W5AA 3RTCA 1TO6A 1DBIA 5B7NA 1FDUA 4MVJA 1F8YA 3FPBA 2X77A 4P35A 4PZUA 4KK3A 3PXBA 1GCIA 1EJ2A 1PJTA 2BGJA 4RKFA 1FMLA 3K0CC 1D07A 2ZSUA 4HRYA 1E8MA 3GRAA 1T2CA 2OPBA 3RU3A 4AVYA 1NLZA 3ZLJA 5EJMA 2JRLA 2ZBQA 6AT1A 1Y6QA 2VTVA 1USVA 3EAGA 3FTPA 1NJSA 2QRGA 1AXEA 1H6AA 3IO3A 4H7DA 3LX4A 3OQIB 3GH1A 4QAQA 1JU9A 2EGUA 3CW2A 3OSZA 2NLOA 4X1YB 1M74A 1P62B 2C58A 3CLKA 3FPCA 1J2UA 3LT5A 4MVJP 1VBMA 2WLSA 4YXWD 1FTGA 1BIFA 3SAJA 3OOHA 2AKEA 3ZY5A 1XZMA 4YMVA 4RYLA 2V3WA 1QX3A 2GK4A 4P2BA 2B8WA 3NDIA 1HLDA 3JVIA 4MVJG 4PO9A 3UCEA 4ALMA 2DY0A 2NYRA 3QI2A 5BMOA 5KQLA 4JMLA 4QZVA 2W8BB 1NJ5A 2QZ4A 3FWKA 4NECA 3JWPA 1AQUA 3GRZA 4UXHA 1J8DA 1Z2EA 2EFDB 1XA0A 5DLEA 3NIWA 3SF8B 2AR9A 2R7AA 1NNI1 1XK7A 4J6FA 3LCJA 1VTKA 2LW7A 3T3MB 3HN6A 1IEXA 3EGIA 2O07A 1NVVQ 4BGVA 3R24A 3WBJA 2Q99A 3EWSA 4A10A 3WMEA 4UARA 3OBIA 4FCWA 4FBLA 1W0KD 2VJOA 5J4KA 1MQAA 2B92A 2OXIA 5FUYA 2WICA 4F9TA 5JAOA 3ZDQA 4K1LA 2RGNA 4MI9A 2G25A 3AKEA 4REMA 2YWEA 4UZSA 3X1ZA 3D1JA 4GE0A 3K31A 4JQOA 4I7EA 2GBLA 4YCAA 1OU4A 3JD2A 4PZZA 2D2VA 1YU9A 3OSUA 5FI0B 1N34B 1N78A 1MAHA 2XMBA 3NHRA 1Z5ZA 3ZTYA 1N92A 3KALA 1VKJA 5JNLA 3FR8A 3A11A 4RH0A 5FLXA 4UHEA 3AKZA 3IHLA 5LDGA 2GBCA 1O3YA 3DZCA 1T9AA 5AK4A 1ZK2A 5CM2Z 3I30X 1QGED 4CMBA 2VKQA 4OG2A 3UY4A 3HY6A 5ALPA 4QPNA 4FYYA 3GAZA 1XBTA 1Z63A 4TRMA 3LX6A 3RRYA 4FMBB 4ZAXA 1NDQA 1T3LA 1UWKA 4KMSA 1EHIA 4MPPA 1XU9A 4HY3A 5CK5A 3U17A 3ZWNA 4BNMA 1F6DA 5JR3A 3K0BA 1GD1O 4ZCQA 1IJFA 2QLFA 4AXBA 2QP4A 1A5AB 4EY3A 4DL9A 3JQQA 2EF0A 3QVGA 4ISCA 1JKJA 4K9KA 4NEQA 1NMQA 3DMDA 3D9QX 4BLOA 3QOWA 4UHFA 3Q9UA 3UHOA 4QHTA 2B21A 1CZUA 3BWEA 2IWRA 3HTXA 1EUCB 1US8B 3LE8A 2HK6A 2PMCA 2IP2A 3GRFA 3MWLA 2R8BA 4P86A 1P0QA 4G0ZA 4WLUA 5HYVA 2H4ZA 5GQSA 1TT5B 1U0RA 1COWD 1TVCA 5HM8A 3PEWA 5L95A 4KZKA 1WCXA 4AT1A 1G7RA 1O4WA 2PX0A 3VO1A 4KI7A 3C5CA 4P2GA 1ZWKA 4F4DA 1ZEMA 2O4CA 2RGGA 3D3QA 2YJTD 4M83A 4DUGA 2R751 1ZLXA 3G0CA 3QU4A 4NDZA 1M1XB 4H1WA 1J06A 3BXHA 4FLFA 2J0VA 2A86A 1RTKA 3DBOB 1Y9ZA 5JYBA 4XGKA 1CRZA 4RE6A 2V4ZA 1QLHA 2ZYAA 1PJAA 1R4MA 3HI6A 1HE2A 2IT1A 1PG0A 1IBRA 4MXDA 4U9UA 3D1VA 5TQ2A 4A1OA 3JALB 2AZXA 2RK4A 4H7KA 4MW5A 3SP1A 4CMGA 2Q0XA 1CY1A 2FSVA 2GCOB 2FEKA 5A6SA 4QUIA 3FCAA 2E1RA 1KMHA 3N8NA 4JQCA 4JI5B 3TRHA 1WPRA 2GI4A 1BHO1 1XZEA 1Y8RB 1HYEA 2GA8A 5JCJA 4DR6B 4I3GA 4IINA 3V6LA 2XEDA 1PFYA 4CR8A 2V7UA 1J8QA 1I3OA 4QGFA 1O6FA 4UREA 4XWKA 3U6KA 2ENWA 2HNAA 5C1DA 4CCAA 3HI4A 3AUSA 4HWKA 5IG2A 5JS1A 2QGNA 1YBVA 2I1WA 3A1EA 5E9AA 3F1KA 5IKPA 5AVXA 2VZ0A 4WNCA 3GRUA 3JW8A 2X5JO 2YV2A 1DMRA 2NW6A 2VP4A 4YT5A 1D09A 2GXSA 5IWAB 3GJZA 1YZ3A 4K40A 1U31A 5EJEA 3TM4A 4ZCMA 3UH1A 3E61A 3OF3A 2WM9B 3E23A 1VLLA 2CF5A 3QU9A 1LQUA 4UULA 1K8YB 4RY8A 5DCYA 1U0JA 1I4WA 3NCTA 3UMCA 1Z36A 3DOHA 2NZUG 1G20A 2Z8XA 4B45A 2BGUA 3KJEA 1OH6A 2QQ0A 4QECA 1AUXA 2AXNA 2ISQA 3ISVA 4IJ6A 3GVIA 3WY9A 1L4YA 2YDXA 1H3FA 3T5CA 1TCBA 4ZREA 3LECA 5DIFA 2NACA 1MOPA 3I73A 3A6DA 5BSRA 3AETB 3S7TA 5LNK6 3TF5A 1XROA 4FGUA 5DMHA 4UOEA 4NNOA 1FQOA 1CUXA 3RAFC 1E3TA 4HKTA 4D2IA 5FOVA 5AVZA 3ED5A 2O2GA 4BRWA 4JC8A 4ZODA 4MQLA 3VPDA 3ADKA 1ZWLA 1Z33A 1DQRA 2IYWA 3JQ8B 1ZSNA 3PGJA 3Q40A 2ASEA 1SUIA 1ZI6A 1XXHB 1YQXA 3EVBA 4KXUA 5I7SA 1Y5RA 3TQSA 5GINE 4UU0A 5A7HA 5C8ZA 4EAQA 1GUAA 1QZ3A 1JECA 5CFLA 4Q1BA 5KKCA 3S28A 1W36B 3RTGA 3KFLA 2VPTA 5AI9A 4MQ4A 2IDJA 3FUTA 3M6FA 1Z2AA 3GEMA 3TNJA 1FRFS 3KEQA 3BE5A 1CZHA 3V48A 5DGHA 3IVMA 4JDPA 4AROA 2P3LA 1OI2A 2WSBA 3AYXB 3L7CA 5F7XA 1GPAA 3LU1A 4CTOA 3NB0A 1BFDA 4MRMA 4ZAYA 2QSUA 3R7LA 3A10A 3T9EA 5FFMA 1KAMA 1S9HA 3NPMA 4H77A 1NXOA 4JSYA 3VH3A 5C5CA 2HRDA 2I4NA 1TE2A 1TA9A 3HVUA 2XBUA 2G71A 4OHMA 1TM3E 2ZDHA 1OREA 5NLLA 4MP6A 1UFQA 4NZZA 4O3MA 4WXRA 1QDUA 1XMSA 2D54A 4Q9NA 1P39A 1PNTA 4TSFA 4BAZA 5E8RA 3UOGA 4CKBA 3QLEA 1KI7A 5A4MS 3TW4A 3A6PC 2BSAA 1V16B 3GEPA 4NCAA 1Y4AE 3U60B 4RPCA 4EO4A 4MB0A 2QG9A 2A0UA 3TEJA 4MAFA 1FUIA 5TGTA 1LI4A 3UK7A 1A27A 2JATA 3P94A 1Q7GA 3UAZA 1IC6A 3K9BA 2K7ZA 2PFKA 3L9WA 2VHEA 3DD1A 1ZP6A 4N0QA 4UDNA 1NDUA 3VR5D 4EW1A 5BV8A 3U44B 3ZXYA 2Z6UA 1NF2A 4YRQA 1U1EA 3V7UA 1EDZA 2CB9A 5HF8A 1JHVA 5SY6A 1Y3DE 4FDMA 1TIKA 1UMCA 1UZMA 1U8TA 2XUIA 2DQ4A 4BV9A 4EB8A 1KY2A 1Z8FA 1JFVA 3OE1A 3TAUA 4XWOA 3LHKA 1F0KA 4WASA 4DY6A 4G41A 5IWCA 4LJYA 1FY2A 2MR5A 1TZMA 4YAFA 4KAAA 4FLMA 2RMKA 2FPXA 3LK7A 3IT0A 3N39C 1P7PA 2BOVA 4BWGA 1EP3B 4IQ0A 5MF6A 1CCWA 2YASA 1BA2A 4NP6A 1SZPA 2PCLA 2NXCA 5JQGB 1TU3A 3E7WA 3ZWPA 1AZWA 1A9ZA 2SHKA 2GPSA 4TZ6A 1FRZA 1EESA 1UT5A 2ZBRA 4EOGA 3OIYA 2AH5A 4NDAA 1NHGA 3DTNA 3WXMA 1HYQA 4N5IX 1U2DA 3ZDYB 3GFBA 3DQPA 4WY2A 2IEIA 1L4KA 3OZXA 1Z88A 4MQ5A 1G18A 4D9MA 2IHNA 3FLMA 4KN9S 2AN4A 3I04A 3D54D 3AFGA 4RK4A 2OKCA 4W5WA 1W4CA 2CLHB 4J29A 3HG7A 4OTZA 5FPYA 621PA 3TTUA 1L4UA 1Y3FE 1U63A 4MWOA 3EZ2A 2YV1A 4WA8A 5DHFA 4N8DA 3FXAA 3DAGA 3G9XA 5CVEA 1D6MA 2C5HA 3UWMA 3VPXA 3ZI0A 1CJMA 3PXCX 3Q5GA 4RD3A 4IICA 5J2UA 2WPDA 2ATXA 4YV1A 2P68A 2PRJA 4MV1A 1XKTA 1TYBE 1M3SA 2PKXA 1XE3A 3R3ZA 1DIAA 1ADFA 1NC3A 1T2VA 2FZLA 2N46A 2UYGA 3OWXA 3Q3IA 3HDVA 4F5YA 1I4EB 4P7KA 3THYA 4TVOA 3ILVA 4B6EA 3DMRA 3OOYA 4TSKA 5HNKA 4L0CA 1E9AA 1SXJE 2HAEA 4QNRA 1KMNA 2EKDA 2PS9A 3A2LA 4IGKA 3THRA 2GB4A 1DADA 1Y9JA 1OIXA 1QM5A 1X87A 3M1AA 1JU4A 2EQBA 1LRJA 3S2IA 3DLTA 4BNXA 1UDXA 1MVOA 1NVDA 4LFCB 1DO8A 2ZVJA 3H8SA 2NO7A 3TDNA 2X19A 5ECDA 3PX2A 1Q0PA 2R48A 3R0IA 5E6SA 1YJXA 1RPAA 3UXYA 1GHTA 1KJIA 4B5KA 2JHCA 3FY4A 3V00A 3HCCA 2AI2A 1JP7A 1WG8A 2ATVA 3G2QA 3O21A 1P5JA 2XUZA 4HWSA 2YIMA 4LOJA 2KLBA 1A4IA 1X39A 2XNSA 3T7SA 5HOQA 3IP6A 3THWA 2WU8A 1S4MA 3A4LA 3IJPA 4OA8A 3FDXA 3MGBA 1WP9A 4JS0A 4E6EA 4FB4A 1XJCA 2QP9X 5DEIA 1Z62A 5F4ZA 3LKDA 3LTNC 2FN4A 1FB5A 4IRXA 1JG1A 2Y93A 3DWGA 3FSJX 1ZVMA 3FOWA 2JGIA 4OHUA 4YRJA 3TXXA 3VMFA 4D7AA 3ITEA 3C6KA 2RCNA 2I99A 2X42A 4LX8A 3EK2A 4UXIA 4IKPA 2I3ZA 1RPJA 3OQVA 4AF6A 4YJFA 5BPFA 1LFAA 2VJQA 2B2CA 4BNUA 1J6UA 1PO7A 2FMKA 2W2VA 3O38A 4O4HF 2XSZA 2V03A 1OLOA 1OE0A 4I1RA 2WU1A 5E2IA 3FPFA 1BX3A 1RABA 2BFCB 3UK2A 1R3UA 4L07A 1N2OA 1YIDA 2W4QA 2X2FA 5I7WA 1N6NA 3S2FA 3EEIA 3N2EA 4HB2A 4MUXA 2I2DA 3U0VA 4TT8A 4RFVA 1EAYA 3W5SA 1CEYA 3HP4A 3IC5A 1RHUA 3FJOA 1MRNA 2ZUTA 4JBIA 4CI0B 4LYYA 3N8GA 1N6KA 3NJ4A 4PWYA 3OTGA 4EYOA 4ZVQA 1TT7A 4PC3A 5BN4A 1C3EA 1E4YA 1E6KA 1G8HA 3NGLA 4B2YA 4JLKA 3KKZA 5AJWA 4AD8A 3T54A 3U4AA 1G8PA 3THOA 3SXPA 1HDCA 4RMNA 3E2MA 3QIAA 5H68A 4Z7NB 4PV7A 4DLSA 1YZFA 3NEAA 3AHHA 3C41J 5FUBA 2A78A 4Z2YA 3AQ4A 4OMFG 3ABIA 4M1ZA 3VO2A 5HQ3B 1RXUA 4O2BB 3ZDCA 5JEDA 1FFXA 5B4TA 1IN5A 3PJFA 2QU7A 2AE1A 1ZSVA 4L1KA 5HDBB 2HDWA 2WIGA 3T9DA 3G9ZA 4I6GA 4RA9B 4DLWA 3ILSA 4JR2A 3RUCA 3W4JA 3E1SA 4XLLA 1C4WA 3EMKA 3AM1A 1BO6A 1ULHA 1E2MA 1I4TD 2ZWOA 4HEQA 2PNFA 1JEQB 2NZJA 2QW0X 4QFCA 3ZDEA 3EUWA 4IMPA 3DTVA 5DTRA 4QDUA 4RHUA 2GR9A 3TDMA 1GA6A 1PR1A 4P0PB 2HYIC 2E85A 3BBLA 2FFJA 2PWBA 1PWEA 5J2TA 5GAJA 1S3GA 2OBXA 4ND5A 1A8QA 4ZQHA 4L8GA 2LCQA 3U7RA 3Q85A 1JG2A 1C8VB 2RHRA 1DCMA 4M9CA 4TM7A 1SEPA 5EWJA 3VR6H 4J8PA 4L0DA 3UKJA 4BV2A 5DK4A 4G8DA 3H1EA 1J0AA 3RVRA 3LQQA 2O1EA 1BRTA 3L7AA 3A4YA 3D0RA 1MX3A 1QQ6A 2FPWA 4KQXA 8ATCA 1NNSA 4WOJA 2FDCA 2HADA 3TOZA 4DDUA 1WLSA 2JASA 1HLGA 3A1NA 3GRVA 3WICA 1NHWA 2WC1A 4R54A 7ABPA 1PDWA 2NTYC 3P52A 1DG3A 3CVXA 5L51A 1AHIA 4JBXA 4A2PA 4C2TA 1VMAA 2ZDQA 4ZQGA 2PKQO 1NOKA 3RLIA 4BFCA 1A9OA 3SC2B 2PSFA 4RHFA 2VNAA 4CETA 1X86B 4G1EB 4TMZA 4JYBA 4CMCA 4YYZA 1ZN7A 2XCIA 3MCVA 3ZIAD 4QICA 1PG2A 1VBFA 2C0QA 4X8OA 4C0QC 2B25A 1EGHA 5B36A 1FUKA 3KYIB 2VL7A 2V6BA 1MAAA 2Z2XA 2A35A 2X5XA 3IUQA 4CU5A 3AC0A 1WNTA 3F2VA 4RENA 1QAOA 2IA5A 4Q7KA 2QMUA 5B64A 4FMDB 4LDJA 5GGXA 2C8JA 2Y8EA 3UMFA 5KNCD 1GY8A 3OZCA 1Y4DE 4E32A 3DGEC 4CRWB 4IIYA 3LMKA 5BN3B 1QTNA 4HMQA 4RWZA 4CMIB 2PZLA 1M2NA 1QJ4A 3CZAA 5DYGA 3F7TA 2VNIA 3OBBA 2B34A 4O4LB 3UMVA 1XI2A 3DZBA 2ZU6A 1U2GA 3WGGA 2CK3D 3VJRA 2JZCA 4JI3B 3FNEA 3GJSA 4M7OA 2R8ZA 1CJSA 5D5PA 3QQ5A 4S1VA 4TL8A 4ZVMA 5JJBA 4PO1A 3T9BA 5E9WA 1FX0B 3R6GA 4G5YA 2FGKA 2R8PA 4H59A 4J0CA 4Q1AA 5EZQA 4Z4CA 5HPYB 1GKLA 1XELA 1KARA 2CWDA 3LCRA 5DEOA 5EWMB 1U2SA 4PLCA 2HYDA 3I45A 4OHKA 2R6AA 3TW6A 4EW6A 1YBAA 1Y1KE 3VBEA 5J40A 4O0LA 3H2BA 3VUEA 5TC4A 4CWAA 3UMJA 3CF4A 2ZM6B 1CC1S 3EGOA 3HU2A 1QHEA 3FOZA 5DT2A 5DHQA 3AWIA 4DC0A 2G8LA 2BHRA 1KI6A 2GAFA 4QATA 3J81k 4L4RA 1AN9A 1XDSA 4JI2B 1BFKA 3MTGA 4QXQA 3T5GA 4QUKA 4QNMA 4FOPA 2AB0A 4LECA 1V9CA 4BVAA 2VJLA 4FOTA 2EJBA 2W00A 1P7YA 1S3SA 2NO4A 4IJWA 1BE6A 3KEGA 4HWOA 3GJ4A 3AEUA 3C97A 3AI1A 3K72B 3OCVA 1SCUB 3KWMA 2N47A 1G2OA 5I7AA 4GC9A 4GDMA 3EDCA 3H17A 1P6QA 4J0HA 2ZRHA 5FKJA 4A8JC 5BWOA 1JR6A 3DFUA 2PSSA 5GZ6A 3Q6IA 1D2NA 4KJXA 2ID9A 3QU2A 2VQ6A 1V1RA 4KIJA 1UFOA 5CFQA 1HNXB 4ZMSA 4RH1A 2RBGA 2VPPA 5AK6A 5EXSA 4PGFA 4R1SA 4A6DA 2PR7A 3E27A 5JHHB 2QAIA 1NA5A 3IP9A 1G3QA 3KXDA 2BGRA 4MCHA 1R8JA 3WAGA 3ZCUA 1R4ZA 4UD6A 2QL9A 2QDXA 4X91A 3DMFA 4B83A 2F2TA 3LXXA 3T4PA 2WHXA 3H11B 4IX9A 4RMJA 4EGQA 4IIJB 2AC4A 1AG9A 2YMLA 4ZOLF 3LCMA 3WL7A 2M32A 3K1AA 3EC2A 3S40A 2WWYA 3UJPA 3SLGA 4BX8A 3QLUC 4HPXB 1GQOA 1I6LA 5EN4A 1K75A 1X2BA 1SIWA 4WKOA 5A5GA 2A9QA 3I62A 3SKXA 3C3MA 1I14A 5AK5A 1NX6A 3PPVA 4MH0R 4F8JA 4Q4AB 4X85A 3U56A 4ESHA 3MT8A 3RS0A 1V5GA 3D7LA 2MDTA 4TLCA 2YFYA 2E4ZA 2IZ5A 4HNAA 5DASA 4GEGA 1C9MA 4KR0A 2PUDA 2B61A 3E0QA 2Q5LA 4FE7A 2G5CA 4YRIA 4UASA 3C3XA 3ZV7A 5K0LA 1ENPA 2QB5A 2C5SA 2AG8A 2GPNA 4MQUA 2I80A 3E8XA 4BLTA 1C14A 3L0IB 5C46F 2A9OA 3OA0A 3U4QA 1PFUA 5I7RA 3QMWA 1E2LA 2LIPA 3R7NA 5C8XA 2Q3BA 3BZBA 2QE7D 1XD2A 3DUFA 3IQXA 1A7AA 2WA1A 5BQ5A 3L6RA 5JXJA 1I3CA 3VNSA 4URYR 4H08A 2PZFA 1AK1A 2CUKA 2IPLA 3FDIA 4JB8A 1R0YA 3PHGA 4JC0A 1I3MA 3GLVA 4LRXA 2CNBA 1MIOA 5EQDA 3V1YA 1XK6A 1I01A 2J4FA 1GRVA 2A1IA 1W1UA 4P3NA 4DANA 3NS7A 3KPWA 2CL7X 3V1LA 1UBKS 4WK6A 3LUBA 2A59A 1IDN1 3I2HA 1N0VC 4LBVA 3I04M 4FGWA 1KEKA 2DAPA 2BI8A 3O83A 3QENA 5ERYA 1UXKA 3ZV4A 4Q4HB 4QQNA 2YUTA 5CFNA 4PAOA 2PKRA 1PBNA 4G1FA 2MIIA 5ECWA 3GLQA 4KYUA 4QGGA 1TEZA 4P5PA 5EP3A 2FLWA 1E5VA 4U5QA 3DOUA 3L40A 3L7BA 1NL3A 1Z4PX 4XEUA 1O5IA 4BBPA 5CX4A 1JJVA 3SM9A 4FSXA 3FWHA 2WMNB 3ZW9A 3DLCA 4LHEA 3ZVMA 3RC9A 3SS7X 1EFVA 1ACMA 1XYVA 3BFKA 5AK0A 5HG0A 1WZNA 3W79A 1NY5A 5J58A 2GD2A 1MVLA 1V39A 3JYPA 3AF0A 2Y67A 5FT9A 5JRDS 4I8IA 3WK7A 1VSTA 1JQAA 3R6DA 4OVKA 3UN1A 1GA4A 5FCDA 2P27A 3JQEA 1OBFO 3IULA 4IIBA 3KVOA 2NAFA 4DCTA 5ALHA 1SXHA 1ULSA 4GX1A 3EEFA 3HV2A 4YNBA 2C59A 3GLRA 4RIHA 2I8AA 3IQGX 3PICA 2EKLA 4WQMA 3OEHD 3QNWA 3PQCA 5MDHA 3AR2A 4AZ0A 1U7ZA 2NG1A 1FTWA 1MG5A 3CLRD 4TYNA 3TX2A 4CTNA 2SICE 5E7JA 5T67A 4YT4A 2HWYA 2JIRA 3JX9A 3CEAA 3ABSB 4MAMA 5FI3A 2NUAA 4AP5A 4QVIA 4TWIA 1TRKA 3WV5A 2PKYX 3MLAA 5LNK1 4K6HA 1T9GS 1BOFA 3ICOA 2JD0A 2VYVD 5C7OO 1MORA 3KVVA 4HGOA 3C7DB 1V47A 2BZSA 1NM5C 1JBEA 1XZFA 3O8OA 4J7CA 5HIJA 1CUUA 1TGVA 1X80A 2A6PA 2VR1A 2GJ8A 1YJ5A 2R79A 3NTXA 1M2FA 2C4UA 2QPLA 3E70C 3KXKA 3IXLA 1E6CA 1NSYA 3ZDXB 3O94A 2DT5A 2D4HA 3EMVA 1WMAA 4TUYA 3VHRA 2QYTA 2GEKA 2XVMA 3NHZA 2XTJA 5A0FA 1XXLA 3ETCA 2Z1DA 2OYRA 1Z0AA 3DKVA 3U4MA 2ZRMA 4AQDA 5BURA 3PCXA 4GOKA 1M2WA 3EAQA 3LLUA 1WXDA 4QTYA 1GZDA 3ENZA 1XCMA 4E5DA 3MIZA 2FX3A 3OE7D 3PIRA 4KGXA 4ZFNA 3COYA 1NBME 1RAEA 1DV1A 4Y8VA 2VAMA 4JKYA 1Q77A 4YAUA 4MRNA 5CIQA 1JKJB 2O4UX 1HWYA 3ZE2B 2WJVA 3DFKA 4NZ9A 1AB5A 2BHSA 2H18A 2ZI6A 4CNBA 3MJRA 3PF9A 4RVNA 1PK8A 2CMFA 2OLKA 1UKVY 3ZUGA 1QLWA 2PKWA 4DIEA 1GZ4A 4J90A 1KXZA 1GQFA 1BMTA 3BTSA 4YR7A 3LBHA 4N39A 5GGYA 4DCNA 1N9GA 5DNWA 3R5JA 2RGEA 3EULA 2ZJAA 3F5MA 4HUQA 2HI0A 4BFTA 3SR0A 5CG1A 3BEDA 2ECFA 2H16A 4NAVA 4YI5A 5BNFA 2OCYC 3RVQA 4DR1B 4B31A 2JGEA 1QYWA 2J6IA 2YYZA 5HS6A 1AUOA 4ARAA 4A03A 2GJSA 3WO0A 2F67A 3BERA 2KBFA 5TQVA 3FOCA 2QEQA 3P9IA 1WCIA 3SZUA 2UUCB 2G70A 2OD2A 2DGDA 4F6RA 3MHTA 1N8NA 3VTKA 4RDIA 3LWZA 4MGIR 2JGLA 1VE7A 5GOTA 4AZTA 1DEAA 1AMOA 5IM4F 1ZCBA 1HA3A 1SXIA 2E37A 1VBNA 1UKAA 2V6IA 2Y4NA 2YMMA 4KJZA 4TRJA 1EGMB 3QOFA 3V4FA 4D45A 4FWTA 2VH1A 2D1SA 2YZKA 4FX2A 4YQZA 1U9IA 1LLQA 1SC4A 1V3TA 2BJVA 4JLPA 4NBWA 3BEOA 3TZKA 3BSFA 1M76A 2BR4A 3ZC3A 1ZH2A 2WM2A 1UJ2A 3SMVA 1PNOA 1E62A 4PFKA 1BSVA 3P96A 3GJQA 4QDZA 1JH9A 1AGPA 2PX8A 3TIVA 3OPYI 1YRAA 2WWIA 2P91A 1WY7A 5BYAA 4JT9A 2WB2A 3CSUA 2MR6A 3FHLA 3FPHA 1J00A 2A5JA 3OKFA 2OOSA 3R6LA 4ZCSA 1OXMA 3DL4A 1E79D 5G3YA 1JB1A 4N18A 5TSDA 2NNLD 1NNUA 2O3UA 2VYCA 2GN4A 3E5HA 3QY9A 4NI5A 3SZRA 3FWYA 5FAKA 2H1VA 4ERNA 4F11A 3FTCA 4TVBA 1TGYA 3JQGA 1I10A 1VSVA 3W1EA 3ZU2A 4D9IA 1AA9A 1WIWA 4QEKA 1RWQA 1SRRA 5EZYF 4E13A 1NG9A 3N2IA 3UG7A 2VSNA 1K2WA 5BOSB 1G20B 4E70A 1I7NA 2EEPA 5F3WB 4B85A 5JS7A 2HMWA 1CNFA 1VSQA 1YTLA 1EX6A 1F17A 2O14A 2L19A 2CJYA 3MXOA 1J2EA 4N6OA 5AICA 5AXDA 3UATA 1P80A 4BO9A 2C07A 1Q1EA 4PCAA 3WNBA 1J56A 2ACVA 3TK1A 1IOLA 4WAUA 4C4SA 1H2XA 3KQOA 1P2DA 2VSFA 3VGJA 4DKJA 2BGWA 3HN7A 5LZ7A 5CJ2A 2BISA 3UHJA 2E6UX 3VTAA 3AI3A 3O93A 4P7BA 3SEFA 1E3IA 3RRJA 1P74A 4TYWA 4XUCA 4AZ3A 1E63A 2YBEA 3RSCA 1JXMA 1ZOSA 5FBHA 3ED1A 4YQYA 3JQ7A 3AUAA 4EFLA 4OGFA 4FR5A 1SR8A 5EJ9A 2QMYA 3FGZA 4N03A 2Q0QA 2VK8A 2B20A 3D4OA 3T5BA 4CI9A 1ABEA 1T0IA 3HP1A 4UBJA 2J08A 1CUEA 3EQ8A 1JPJA 1Z07A 3OZUA 2AJBA 4RF5A 3RVLA 4WK4B 3NJ8A 4QU8A 1EVJA 1CUDA 1PRYA 3FYUA 5HKLA 3NM5A 2WUFA 3BWBA 4HD8A 2O8VA 4EYQA 4P7GA 2DUUA 1H9BA 1DXYA 4C0XA 3LHIA 3IDQA 4Z9BA 3UAYA 1C41A 4QU5A 2X3YA 1TQ6A 2WSLA 4XSGA 4CFZA 1RT9A 5F9HA 1KO5A 1QR2A 3KCQA 2XV1A 4AO7A 1AJEA 1Z2OX 2AXQA 3HDGA 2P75A 1JN0A 3CLRC 3EVEA 4MHOA 4LDAA 5TEWA 2AG6A 2IDMA 3D02A 1IZZA 2BEWA 4E6PA 5AJTA 1DIOB 5AUPB 5KHOC 1KZ7B 1KH1A 1SUCA 1XRSB 4EK9A 1T36B 1FDWA 3MTEA 1A8UA 2BTOA 5J23A 5C9ZA 2AE2A 1ZCFA 2GVZC 3DT8A 2Q1SA 5FLEX 2ZBUA 3ZU6A 4B4OA 2VPQA 3HB9A 2D62A 1QOZA 4B2PA 2QT1A 1Y0BA 2PXCA 2NO0A 2WTAA 4MKFA 5AH0A 4KQ6A 3KL4A 4E0BA 4YJ3F 4LYFA 5H0IA 1PNVA 3DDUA 4RD6A 4U8HA 3ETLA 4JDUA 4YRLA 1VSUA 1Z22A 3HFJA 4JI8B 3O0DA 2PBRA 2BIFA 3C3BA 4W6QA 5DNEA 4ZI7F 3AZPA 3RFUA 3PVZA 2WTXA 2BL4A 5IPFA 1UM9A 1NT2A 1JDBC 1MV5A 3GJTA 4MI3A 3UWKA 1IOVA 2HEGA 4C0BA 1A5BB 3EVCA 5B3LA 2O0HA 2I6XA 1IWPB 1JDZA 1G63A 2I2FA 4HS9A 3TZ6A 3V33A 3E7PA 4P9NA 3ZE6A 1O6ZA 4EVSA 4HGRA 4AY4A 1PR4A 1I2BA 4JQYA 3OM1A 4WT7A 1KF0A 3TLGA 3ZCXA 3R7FA 4X8LA 1RCTE 2QD2A 2DE0X 3TJMA 3R3SA 3VHXA 2BM1A 1RR6A 4LHZA 3PE6A 3SHQA 3V1NA 4BKQA 4CMAA 2PIAA 3MSXA 2QNRA 1DX9A 2DM6A 3RS5A 2Q8PA 2VDWA 2WJAA 4XA8A 2ZUCA 4RMHA 4YGYA 3DDOA 3KUKA 1L5VA 1YHZA 4DW8A 3CEHA 1X0VA 2YXNA 1JFFA 3HXPA 5AW1A 1QRDA 4P3PA 4HLNA 3GFPA 3RT9A 5A0TA 1SBCA 1BD4A 1M1UA 2P3QA 2B35A 4LCJA 1I5EA 4XEHA 5K3SA 4BV8A 1M10A 2GK3A 4IQFA 3EYWA 4DARA 3OOJA 4DG9A 5JSQA 3FNHA 1U04A 3LHSA 3H75A 3Q41A 4NVRA 2RGDA 2F1RA 2HT6A 3WJ2A 2XCSB 3TBHA 1G60A 1F2UA 2GRJA 2VF8A 4J94A 4KDEA 5J2UB 2PJZA 2RC5A 4WLNA 3DV2A 3P0FA 5E0OA 4QYIA 3K6SA 4NPCA 1PX0A 5KX5B 2QXTA 1IWBB 2NO9A 3EBPA 4HAZA 4Y1FA 3P2IA 1SVNA 2O7RA 3EXG2 1CIVA 4XE5A 4QDOA 1QVWA 1F0PA 1GQRA 2ID4A 1ODTC 3U37A 1XZKA 3K92A 4GKVA 1DJPA 2IUSA 2OWEA 1NR5A 3SIXA 1X42A 3LX5A 5AM2A 2ETVA 3RRNA 1DG9A 2QNBA 2XKJE 5J43A 2YWJA 3SX2A 1XA3A 5DGIA 3UMSA 4CM3A 4PFQA 2BGGA 2HSDA 1GGEA 1M0SA 3BH7A 3AXSA 2H63A 2CHEA 4YROA 5C81A 1RM5A 1KI1A 1VPTA 4GKBA 3QF4A 2QV7A 1L7AA 4MW0A 2AZDA 2YV5A 2A84A 2V7VA 3W7VA 4KPYA 5HR5A 2C5LA 2X0IA 5ALVA 1OH5A 3UA3A 4Q7QA 1I6MA 2IHBA 3SKYA 3E3MA 1V6AA 3DKPA 3JWIA 3ZNNA 1C1YA 2OORC 2ZG6A 4QFDA 4Y6OA 3NCHA 3OTIA 3T3GA 1VJDA 2FPRA 1W4ZA 4JI4B 1BGVA 3EW9A 4RVOA 4J0FA 2ZIXA 5EHNA 3STYA 3C3PA 2OYCA 2P9EA 5HZKA 3W77A 3USCS 5CVTA 1G3MA 2FZGA 3IBSA 1Z6YA 2W11A 3RVBA 3T06B 2C4KA 5A9TA 1JWLA 2XXAA 1LFDB 1RYMA 2J7PD 4NYMR 3VOAA 4EI8A 1KYZA 1OXUA 3T61A 1TKCA 1W581 3GMSA 1ZCJA 5CYFA 4PYJA 4GI7A 4H4CA 2ZS9A 3TOXA 5FPSA 5HJ5A 3OAAA 1YI8A 2CUTA 2CXUA 4RZHA 4KIGA 2QS9A 3GAAA 2Q5IA 4Q12A 4G5QA 3OY7A 4PZPA 4WKPA 4WLVA 4RACA 4Y2TA 5KYXB 2QN9A 4XB6B 3QWIA 4DTCA 1YFZA 2QG6A 3OIDA 4M1TA 4NCHA 4WOCA 5T4BA 4CV2A 4EB6A 5SICE 4FUQA 3O4VA 5C4MA 2ST1A 3U3JA 1JSXA 2L82A 2XE4A 1UKYA 3A0RB 2PE5A 3A1UA 1C8BA 1RD4A 2QX4A 3B6EA 3H84A 5IBQA 1FJXA 3B6KA 3FYSA 1GPMA 3A4IA 3M5CA 3PC6A 3BIJA 3N3AC 4DXHA 4FP9A 2NU8A 3Q0EA 5FD8A 2NUPB 3IAHA 3LQFA 3SF0A 1E1QD 1E5QA 3PX7A 3ROMA 2NV6A 1D2EA 4BX0A 2HF8A 1DOZA 4IGEA 3QFFA 4QPPA 4WXPA 4QLOA 5GJWC 5ESWA 4DCPA 5JJCA 4OYLA 2YIJA 5DBGA 3IOEA 2UUPA 5BN4B 5HW0A 5CCDA 1E1RA 4TWAA 1H94A 2XWJI 2QL6A 3IUJA 3ZZ1A 3U3ZA 4ER6A 2A4MA 4JP2A 4Q16A 3Q7IA 4XSHA 3RUFA 4EMTA 4XQGA 2CFCA 5F5NA 3JPWA 4HUJA 2PT5A 1PTKA 2VHQA 4JUFA 4F0JA 5MFPA 4AN1A 9LDTA 4LWPA 3LT0A 2ZWAA 3IKVA 2WHYA 5DW3A 3RK1A 1YJBA 3W04A 1MJNA 1EA7A 1FFXB 4WK2B 3RYFA 3C0KA 2YN4A 4UOQA 1XCLA 3N28A 4WFJA 4ZZ1A 3EISA 3L77A 3QVXA 1S7CA 4KKXB 2DPMA 4LI0A 1G8FA 1KI2A 4H7EA 3GEEA 2XOKD 3OCJA 3EODA 4K05A 5HTOA 3M34A 3DTVB 4KAJA 2EYQA 2E55A 4G8BA 1DQZA 5TXGA 3QEMA 3IT2A 4Y2XA 1MB4A 3K0AA 1O0CA 1GNTA 3GA0A 3O9ZA 3M4NA 4EGJA 4CTMA 4YGXB 3I2IA 5J2TB 4KUHA 1O95D 4FZ3A 4NMXB 3ZKWA 1X7ZB 1T3ZA 2DUNA 4BNNA 1Y8CA 1RZRA 3QUQA 3OJEA 1W35A 4IHJF 3TQIA 3TZLA 5BRJA 3HCEA 3UENA 1EK6A 5J4VA 1V5WA 2FMTA 3EC1A 1P8AA 1Z3IX 3BHIA 3BKXA 4ODIA 2NVUA 1RVV1 3ZNPA 3CZQA 1ZCZA 3AP3A 1PJCA 3COPA 3E15A 4GPBA 5EVCA 3ZDRA 4B48A 5FL3A 3RR2A 1FA9A 1KYQA 2BJWA 2YJZA 2VJAA 5KYUA 3R41A 2CVZA 3MUFA 1XVIA 5BSFA 5IVKA 1O6BA 3JD3A 2Y3IA 5E6UA 2MINA 3V1TC 2B2XA 4CHTA 3AGQA 3ZZNA 3I2JA 4NBSA 2JFQA 2NZWA 4KPUA 1K0UA 1Y8QB 3BA1A 1DSSG 5FTMA 3WFZA 2C5EA 3BM5A 1BQ3A 4XWTA 3IDZA 1Q0TA 5KCZA 2PX2A 2M6RA 1PT8A 4PANA 1CBUA 2IE0A 3QHAA 4MB2A 1Y6JA 3VKHA 3C3WA 1S3IA 2HHLA 3ETNA 1GAWA 2C2MA 4HV4A 1W48A 3AQIA 3RYHA 4KWIA 1HQYE 1XEAA 2ECPA 2Q0SA 5JZ9A 3ELBA 4L4UA 1R6VA 1XFAA 421PA 4Z5XA 4OKIA 5EINA 3P8ZA 1PV1A 1DB3A 1NVVR 3ZH2A 3T99A 1C3OA 3C24A 4H1UA 1TNDA 4ZZIA 5IYZA 4YJDA 4XR4A 1GTRA 2C4VA 3PX3A 3W9UA 2IPAB 2R87A 3T41A 3WNQA 3WYAA 5KTMA 2B8EA 3T7CA 1A7UA 1M5UA 3NT4A 1RADA 4Y6RA 1KSGA 5LD2C 3OTWA 1XZDA 4JITA 3DVSX 4JB0A 1KP2A 2Q1TA 4D0GA 2P7HA 1C3XA 4HDOB 4LJ6A 5BN5B 5AVRA 1GGVA 2BZ1A 5DHTA 4NBVA 2XVAA 2QI9F 1BKSB 2ADOA 2HA3A 2JIOA 1OAOC 2ODTX 5EUBA 4CM4B 1VHJA 4AJ9A 5HDQA 1GGMA 4F8YA 2I34A 5B57C 1F4VA 1KOJA 3DHWC 4MWBA 3DGFC 3V9PA 4NATA 4RH3A 5ED4A 4WPGA 1HSZA 4WBNB 1GU0A 1XZIA 2JFZA 2ZSKA 1OKKD 1T4GA 4YYEA 4HQOA 5CA0F 4EMUA 2CMGA 2QIPA 1E3WB 2HV9A 2ZRLA 3HKBA 1KI6B 3I01M 3K8QA 4HNQA 5IBRA 1GRRA 2JFUA 5DP2A 4F60A 4X41A 2R6CA 2DULA 1JEOA 3PL5A 1VSBA 1JWAB 1JSZA 5TE9A 3UYLA 2QXUA 2NWQA 3TSWA 3PNSA 1FJGB 3LAWA 3O2NA 4JX9A 4G4GA 4G1UC 4MYRA 1PKEA 4KQ1A 4TTIA 4ENSA 5GM1A 3E4DA 4NXMB 3UO8B 2OV4A 2O57A 2P11A 1OGJA 3K2IA 4NABA 1RXIA 1S2LA 5AD1A 1B6TA 2BFFB 2SBTA 2UVPA 3KQNA 2B4KA 1BG6A 3EIEA 4FQ8A 1CZRA 3KUUA 5EC8A 4IZIA 4TZ0A 3P32A 3VVCA 1O2DA 1Z5UA 1V8OA 3G8BA 4RIEA 1XD8A 5CVUA 1A4UA 3MS7A 1UDCA 3NNSA 4JOCA 4YJ2F 4B6GA 5KU1A 2VJKA 2IODA 2AFHA 1JEDA 4B3MB 5JAHA 2ZI9A 2NT3A 4NZNA 3ZPXA 1DUVG 1UXOA 5H4HA 5KJ6A 1PG5A 3JTMA 3DMGA 3DCIA 1ZW1A 1AS0A 1TU4A 1YH3A 3ZWCA 4MRPA 3PITA 2F3TA 3LZCA 4HF7A 4Q3DA 3WMRA 1A71A 3DVRX 3OZRA 3PJEA 4I1UA 1EAMA 2XUKA 1AA6A 2C0PA 3ADPA 1ZIDA 1QWSA 1VPLA 2QPTA 3BQMB 3GP5A 5FULA 3QU5A 5JVDA 1QGDA 2PZBA 4JXZA 4JJ4A 5E1BA 1I0LA 4F93B 3CO0S 4UEJA 2XCLA 2F1OA 1HNNA 1MT0A 3LYAA 1YL5A 3M1LA 4QXOA 2A5LA 1PSWA 3ZWBA 2AXPA 4WY5A 1X92A 3LQ2A 1LSOA 2IIPA 2BP7B 4EY5A 2QL7A 4G0QA 3ESAA 1KETA 2Z8YM 3IDSA 4JROA 2CE2X 1KAEA 1QKIA 2PS0A 2G63A 4POOA 3H83A 4AM8A 2V96A 5L3SA 4II2A 1JHDA 5K03A 4IXDA 2YWFA 4TT3A 3H5NA 5IK2A 1SH7A 3RK4A 1N0IA 4FKMA 2VYND 4HYQA 2O1WA 3DUFB 1WDMA 1XD2B 3H0CA 3TFOA 2PPVA 2RHJA 3FOBA 3HYNA 3AI2A 3DNFA 1DKNA 3D2AA 1E2FA 1UBJS 2KBEA 2J1LA 3C8HA 4S35A 3T6KA 4DLBA 3LCUA 2O5EA 4O8CA 4J49A 5LQUA 1O95C 1WKBA 4EYSA 4RGYA 2G5GX 1B74A 1ZI9A 1FP1D 4PF1A 4RZ2A 1ML4A 1PFWA 2GRAA 4OU4A 1L5LA 4RFLA 4LF9B 4PRKA 3G9TA 2JG3A 3G2LA 1HEYA 3ZTWA 4ARVA 1CY6A 1EM8B 2IBMA 2WK1A 3DBRB 3L7LA 5HRCA 5DWDA 5ECYA 4JLAA 2PN1A 4FK8A 5SY4A 2H1HA 3QTLA 2NQ8A 2YHAA 3GGCA 2QN1A 5JAZA 1R5JA 1Y34E 3P9YA 3SBXA 4HBZA 2WYWA 2IXAA 4QUEA 2IS2A 1Z6TA 1DC6A 1DIGA 2Z08A 4FZJA 1GCAA 2WM8A 2Q9AA 3LGSA 4DNQA 1NXVA 1VJGA 2FZWA 1EFVB 1CQPA 1KZ9A 1Q92A 2IPMA 3R7BA 4ZPJA 1GGJA 4FHGA 2FWRA 3UUWA 2V7GA 3WLRA 4RKQA 4F56A 3T7TA 1XVUA 3NHMA 1R0LA 2C99A 4AIIA 3MT0A 2CMHA 2HSJA 1T1IA 4RHXA 1YDMA 2QR2A 4PAMA 4HDMB 3FNFA 4Y7DA 4JA0A 4C22A 3AKCA 5KQGA 4O4IA 3QVTA 2JLYA 2WD9A 1U28A 2H6EA 4PZCA 4UHJA 1Z18A 5I8WA 4ALKA 1U5BA 3IPLA 2XWBF 3R6WA 2V45A 1MRSA 1LQ2A 1KJQA 2DHQA 4INPA 4ENWA 4XM0A 2W83A 3DV0A 1TKAA 2CY0A 5K0BA 1P7CA 3I42A 2RHGB 3PQ8A 3QIVA 2L69A 4K6MA 4PPQA 1SG0A 2D5CA 4KHPB 1A88A 4I6JA 3LD9A 4AZWA 3OICA 2WJJA 3FDJA 4BMNA 3R3UA 3O8DA 4RA6B 4CR6A 4HNHA 3A1VA 2G88A 1LA2A 3I2KA 1G5TA 1KQ3A 1OX5A 3OVMA 4J0QA 2P2SA 3N86A 4NE2A 1ZN2A 5K4GA 4RTOA 2Q7XA 2J67A 4V1CB 1GTMA 4ISBA 2X4GA 3T4EA 1PSZA 2AJ8A 3O8OB 1CF9A 5FNVF 1QHNA 3HB4X 4EA6A 6REQA 2GQ0A 5CM9C 2WMOB 4MV0A 2P4EA 4RBNA 3ELYA 2XW6A 5FFNA 2JCXA 5E9QA 4FE4A 2X3UA 3AG5A 3GEHA 4HR7A 4KOEC 4BDSA 3V8EA 2V7WA 2XNJA 1J07A 2H17A 1U6JA 1AHHA 3KLPX 4D96A 1QIKA 4N49A 3YASA 4EKDA 2QVZX 4BJ6A 2VOEA 1RJWA 1SD2A 4MV3A 1PHPA 1K3UB 4I9HA 5LP6C 1OT5A 4BB0A 1KFJB 1UQTA 3IGFA 2XNHA 3HCRA 3SHFA 3V97A 3W2TA 4A0QA 4EFDA 4ESVA 3ECCA 2KI5A 2LCFA 5CYPA 1Z28A 4KQFA 4Z2AA 1SXQA 5L4NA 1DCKA 4RPGA 2JZOA 2QTRA 3AEQA 3OFJA 1J0BA 2AFIE 3L0BA 2RHTA 4C20A 3G8AA 4XTRA 3KTFA 4I55B 1R0ZA 3WIBA 3VHQA 1RQLA 4BFWA 4Y9SA 1E69A 4M99A 4LOLA 3SLRA 2CHGA 1BD3A 1GYPA 4MUFA 1XEWY 5HP4A 1UR5A 2PGOA 2GEBA 3A9RA 4OB8A 3RVDA 5HCUA 2X23A 5DHPA 2PS3A 2XYPA 1W87A 3OY2A 1ZVJA 5EMHA 1ZGAA 4P4GA 1CUAA 1MQ9A 3TFWA 2B3TA 5BUQA 4CIBA 4M8KA 4NJOA 4HUQB 4RFSA 1PJ8A 4CQMB 4UNPA 3P5BA 4YXFA 5HJEA 3I3SR 3R9KA 2RGXA 4A15A 3ZGNA 5LA6A 1IEWA 2JGAA 4DG5A 4PZLA 3DO5A 3MCWA 3GCDA 5JECA 2ZJ8A 5IS2A 1N4DA 1X1TA 1YL7A 2PBFA 4PG6A 5DJ5A 1C3VA 2B4RO 3UJHA 3F3YA 3VPAA 3TZEA 4EJ0A 1WCIB 3HR8A 1PP4A 1I9GA 4I4NA 3G7NA 3ROQA 4ZU1X 3WGKA 4BHTA 1LDBA 4AG5A 1UEJA 1L0BA 3N5CA 4UDOA 3D1LA 2YVLA 3OT5A 4OHXA 1WR8A 2PUWA 2QRKA 4BQOA 1KHTA 1CF4A 4RIIA 4KE6A 1M6HA 1JMKC 4E07A 4ZHQA 5G0UA 2G1AA 2FG7C 3G1WA 4OQLA 2H2WA 3DCYA 3LT2A 4G5HA 3LJKA 4Z99A 3AMVA 4TXJA 4EX6A 3TSOA 5CU7A 3RF7A 2J5KA 2EZUA 3HACA 1U90A 1DAIA 1EFRD 2EP8A 5KCMA 2CHQA 1NMZA 2Q3FA 4LMPA 1T8TA 1ISJA 2J3EA 2FUKA 1TM5E 5HTKA 2BFMA 3KFXA 2A9PA 5A4KA 3A6EA 1O87A 3V8NA 1A5TA 4WNAA 4XVHA 2XCOA 3AU8A 4NSNA 3TLCA 3STWA 4CKEA 1PJ3A 2R60A 2XB9A 1EB8A 2BGMA 2MWMA 4JKIA 4CIDA 1K66A 1OHHD 4GBMA 3ZJUA 1BE1A 1EE9A 3OU6A 4RK0A 4CHGA 2XHZA 5CDTA 3PS9A 3OLYA 3EOBI 1V8ZA 4IF4A 3EDOA 4N3GA 4WX2B 2BF7A 3A6ZA 4RD2A 5JH7F 3L4BC 1FFDA 1EGAA 2D5IA 2HHAA 2CJXA 2PAAA 4DM4A 1YI0A 5DGTA 1SMKA 1JMVA 3MN1A 4XRRA 3UH0A 4OIFA 1QO0A 4GRAA 1ULZA 3JQAA 4GYKA 4MZXA 1WW3A 4BLUA 2G9VA 3DAFA 3KQSA 3RRMA 4IXMA 1N7GA 2P4SA 1QQTA 3DCNA 4D8WA 1XCPA 5B1YA 1CDDA 3DWIA 2C7BA 3D7KA 3G2OA 1F8GA 3QM1A 4LXQA 3WIDA 5J47A 2UUBB 1C1DB 1XKXA 3G2NA 1YZQA 4IUDS 4OKSA 3S44A 4OLFA 3IHKA 3CZMA 4MB6A 4EYKA 3SICE 2A88A 2TMDA 1TFUA 3GIWA 5DN6A 1XCJA 3OQNA 1LGYA 5I48A 1NMXA 2XYGA 1E9FA 1V95A 3B82A 2GMWA 2RFLA 3FVQA 3QZUA 3M2PA 4HLCA 1NIPA 1JPVA 1RCUA 4LVNA 4DMUB 1WZUA 3ETJA 4UE2A 1JYSA 1KZ4A 2HLPA 4G4JA 3WDSA 4BDTA 3JQ7B 4IVNA 2JLBA 3JV7A 4LUCA 1AMNA 3VA7A 3CW9A 1WBBA 2VHXA 4BUJA 3WBKA 4KITB 1FK8A 1POXA 3I2YX 1GGFA 2TMGA 2QRQA 4NFSA 5JHGB 4YLGA 3BQNB 1EZZA 3FYUB 4UHKA 3UMGA 3N9IA 2XLCA 1I1QB 3ORQA 2XI4A 3OT4A 4RVFA 4YRSA 5CBKA 3KAPA 3PR2B 2K7FA 5G4KB 5AKYA 1HG0A 2C2XA 4KXNA 3TQCA 2RGCA 1CB0A 3K6JA 3GRKA 5K8JB 2GF9A 3D4LA 5IJZA 1SUDA 1ZX1A 1I5OA 2W9XA 3OZTA 4YFVA 2J7KA 2PEYA 1N2CA 4IZ6A 4XSVA 4N54A 1A4RA 1ID1A 1TADA 4WK0B 2C20A 4RGBA 2Z2YA 1K89A 2FSSA 1XTPA 5CGQB 4G23A 1DX4A 4OXNA 4CDRA 3ZHVA 1JJBA 2B1JA 1N5OX 2NXNA 4RVCA 2BEWB 3ZZTA 4JLBA 3B5JA 1L5SA 1PEDA 2HNKA 4BQEA 2EC5A 3RWBA 4GMKA 4ASUA 2CV1A 3TCKA 3AZQA 3DL2A 3O90A 2I2XB 3K9LA 4PC2A 4TYMA 3Q87B 2R8RA 3HADA 2OK7A 4RIGA 2D2EA 1DAHA 1DJLA 3L8FA 1AOXA 4ZVLA 2R6DA 4A92A 1NVXQ 4Q47A 1BJKA 1LBIA 3KTDA 3QHPA 4V39A 5DULA 3QK7A 4LVUA 5CXSA 1C0IA 1FLNA 5L45A 1REQB 1X0XA 1YDFA 2R5FA 1QNLA 2C3OA 4G97A 3WZLA 1Y89A 4H7HA 2B8JA 1LJ8A 1D2MA 3B9QA 5E6RA 4DIKA 4IH1A 3LC7O 1UM9B 4Q1EA 1AV7A 3HJNA 3O4FA 4UAGA 3S55A 3VSEA 1XZJA 4BZPA 4DSZA 1NRXA 1K4MA 3EGCA 3IP1A 4OFZA 2W37A 3IO5A 2FW8A 1E1LA 2QTGA 3HCBA 4D9EA 4JI7B 1OB5A 3IUSA 3TLGB 2J3LA 4AMYA 4GNKA 1J0CA 4UXJA 5ERXA 1WS6A 2JGNA 3A1CA 2BPOA 1UBCA 1M75A 2EFHB 3N8IA 3GFVA 4DA7A 3WKAA 3VHXB 4LYJA 5H9VA 1AKYA 1QUFA 3TNDA 4ZI3A 5HUHA 1VKOA 2CUZA 4GVLA 5LDDC 5KPDA 3FM9A 2QN2A 2GBFA 2QG4A 3K0CA 3OESA 4IY1A 4V2IA 2E49A 2ODWA 2QLBA 4LRTB 4JXKA 3Q5EA 1YONA 4QL3A 1DRKA 5AVUA 1UMDA 1S4QA 1P91A 2MMCA 3M82A 4IUCS 2W6NA 5BOVA 2O6LA 2OM2A 2XUDA 1V8FA 1ZD4A 4EHKA 1T5SA 2QWXA 4JEMA 3DAOA 3UJBA 2C31A 4JT2A 3N3BC 2VF2A 1UFVA 4JNKA 5EYPA 1CUHA 2WJWA 4MQFB 4TSRA 1TVEA 2WJ4A 3P45A 2YC4C 3E5MA 3R0XA 4R5HA 4ZYYA 3STXA 3AUXA 4XD2A 1CJTC 1QH9A 4KWCA 1MB9A 4W9NC 2DFKB 1YR2A 3FAZA 1F7VA 3KQQA 4YHHB 1QGYA 3K6SB 3FLAA 1QVAA 4QYIB 6PFKA 1UKCA 2W22A 1PK9A 4BQRA 2WWFA 1KYWA 3RUPA 5G02A 5AUNB 1GNQA 1UKZA 3BORA 3M49A 4KR2A 4E88A 1NUAA 1G9SA 4RXTA 4NOJA 2I55A 2IZ0A 3A9UA 4R40A 1RYZA 5AHOA 5DX0A 4A3SA 3L93A 4KRXA 5ECGC 2I2BA 2YCBA 4HX9A 4ZT3A 1J25A 2BD0A 3K1TA 4EI2A 3OIVA 4F9EA 3HJFA 3AVPA 2AMVA 2ZYDA 1UPUA 1BDBA 4GDFA 1XP5A 2AD5A 4AJIA 3JARB 3QF4B 2ZTSA 3UOAB 4B6OA 1WXEA 2G82A 3FHOA 1N2GA 3ZTTA 4D4KA 2FPIA 1MBZA 1JHYA 4ZQEA 3ID6C 4RCYA 3D4IA 5EMMA 5JPIA 2AK3A 4ZAZA 1RKBA 2DWOA 3URKA 2Q3LA 2PSEA 1T1SA 1Y1QA 2OHJA 4LTNA 4YALA 2MSCB 2ZGVA 3BWYA 1GQQA 1JQKA 2ZIXB 5DM60 5CA1A 1ESZA 3O8RA 2Q4BA 3CRZA 4AN0A 8LDHA 3NI2A 2E5WA 1L5OA 5MN6A 1BKDR 4O1HA 3HLYA 3VAZA 5GV7A 4M6WA 5CDGA 1GXSA 3DLIA 3TR0A 3W06A 4ND3A 4D9JA 1YDHA 1QC5A 4QM7A 1ZXLA 4ZT6A 1YVPA 1V6CA 2QPOA 1M0WA 1QU3A 5IBPA 2MYUA 4E14A 5CH5A 1ZQ1A 5BQFA 4W5QA 2J4CA 4KXVA 3EA0A 4TS1A 4ZTUB 4AU1A 3QLVC 1BRMA 4PR0A 2BH9A 4YRNA 3TQFA 1Y6RA 3CF0A 4G4SP 4U4AA 2H7VA 1T8UA 3H3XA 4L4SA 4URZR 1Q2UA 4PIVA 1KVRA 4I99A 4EB6B 4INAA 3W8DA 4H0FA 1BX0A 1MO4A 4MA0A 4ZT2A 3HWX1 4MVYA 5CVCA 3U40A 3HB1A 2N1MA 1GNRA 2XX3A 4YUZA 2WYUA 3AHCA 1GUFA 2FLVA 3O7MA 4N9QA 3HR7A 3W2FA 3DHEA 2NU8B 2NTNA 1ZIOA 2H4HA 2W2QA 4Q3LA 4EO9A 2AUNA 3AR3A 4ER0A 5ELMA 1IAQA 1LY1A 2LV8A 1FMJA 1Z0KA 3JYNA 1CYEA 1E2JA 1T0HB 2WILA 2ORIA 2J6BA 3W2EA 3FWNA 2A0KA 2Y2UA 4I1SA 1IBMB 3VFDA 1IK6A 5ALLA 3CE9A 4OF4A 3M6XA 1AKUA 3RYCB 1UJMA 3HMKA 3AV3A 2JBWA 2ZXFA 3EFBA 4L4XA 2AJCA 4W9MC 4OLAA 1PD0A 1Y3CE 1L1EA 2RJNA 3OA2A 4UNRA 3LBIA 1SUEA 1VXOA