3FX2A

Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
b'AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1991-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fx2A00
4LTDA 1QHEA 1CZOA 3TEMA 3NHPA 1BU5A 4NULA 2FX2A 2N1MA 3GFQA 4XDGA 1YCHA 1J9EA 3LCMA 2QR2A 3LT5A 3L9WA 3K1YA 1C7FA 1AKTA 3O2NA 2OHHA 1AKRA 1V4BA 3QFRA 4QOFA 1CZKA 1ZX1A 1D04A 4Y9UA 4PTYA 1TLLA 3U7IA 5B3LA 4M0CA 3OWHA 3NHSA 4BMOB 3GAMA 3N39C 2BPOA 1DX9A 3ZHOA 4FGKA 1D03A 4YAUA 1KBOA 4QOIA 4F8YA 2F1OA 3R6WA 4FGJA 3ES9A 3NHJA 4C14A 5BUCA 3U7RA 1ZWKA 3FNIA 3B6MA 2QX4A 4YALA 4QOGA 2OHIA 1E5DA 4ZVNA 1X77A 2R96A 4N9QA 1AMOA 1AG9A 1DXOA 3KAQA 6NULA 1FLNA 1AKWA 3KLBA 5JROA 1T0IA 1C7EA 4H6PA 4C0WA 3KEGA 5LMCA 3OWXA 3OX1A 4LTNA 1XYYA 3UXHA 5B3KA 4J8PA 1RCFA 4U7GA 4HEQA 1FLDA 3GFRA 1FLAA 2FLVA 2FZ5A 2V5VA 5EAIA 4ZVMA 1AKUA 4NLLA 4YAWA 5LJLA 1YCGA 3UXEA 4DILA 1OBVA 1CZUA 3QFCA 4PU0A 1CZNA 3NHKA 4ICIA 4C0XA 2ARKA 1OBOA 4QOHA 2A5LA 1QR2A 1YCFA 4Y9RA 3HR4A 2M6RA 2QX6A 1B1CA 3RPEA 3W78A 4N82A 4BMPB 3NHUA 1OFVA 3NHYA 2FOXA 3HA2A 2KQUA 5FX2A 1WSBA 1XYVA 4ESEA 1SG0A 1RLJA 4C76A 1AKQA 3OX3A 3TE7A 4YQEA 3EYWA 3N3BC 1AKVA 3NFRA 4CETA 5ULLA 2WC1A 2R97A 2Q9UA 3W7AA 3L9XA 2QWXA 1T5BA 2ZKIA 3OX2A 2FAXA 1F4PA 1RTTA 3SVLA 1QRDA 3NLLA 5LJIA 4R81A 3FX2A 1JA0A 2BF4A 4HS4A 2B3DA 3NHRA 2Z9BA 4QOJA 5LBTA 3GFSA 1RLIA 5A4KA 3O73A 2XODA 3JSXA 4XDHA 2XOEA 1D4AA 4GQIA 4LTMA 1QBGA 4QODA 3OVMA 2BN4A 4CF6A 1YDGA 1FTGA 2QMYA 2M6SA 1AZLA 4DIKA 2MTBA 2Z9DA 3TZBA 5FA6A 4OXXA 4ZVKA 3F2VA 2RG1A 3W79A 2Z9CA 3ESXA 3NHWA 1CZLA 1XI2A 2FCRA 3S2YA 5EMNA 2MT9A 2QMZA 3HLYA 4LAFA 2HNAA 4GR9A 1J9ZA 3FJOA 3B6IA 4LA4A 4H2DA 2Z98A 3ESZA 3F6RA 4DY4A 5FUQA 2BZSA 1H66A 5EA2A 5TGZA 4U7FA 3OJXA 3B6JA 2W5UA 3W77A 3ESYA 3NHFA 3KAPA 2MWMA 2D5IA 2FZVA 3D7NA 1YRHA 3F90A 2OHJA 1FVXA 2V9CA 2X2PA 2KLBA 1XT6A 4Y7CA 4N65A 5LBUA 5F51A 2FVXA 1KBQA 1ZWLA 5NLLA 5LVAA 1FX1A 5LLDA 1DXQA 3QE2A 1H69A 4ZVLA 1CZRA 3FW1A 4D02A 3P0RA 1YKGA 1FUEA 2BMVA 5F12A 1JA1A 2GSWA 2AMJA 2HPVA 3B6KA 5F4BA 2V5UA 4YAFA 4FX2A 1BVYF 5NULA 2QX9A 4FGLA 1NNI1 3OJWA 4PTZA 4S24A 1VMEA 3N3AC 1GG5A 3NHLA 1I1OA 1J8QA 1FLVA 3K20A 4GI5A 2X2OA 4U7HA 1J9GA 1CZHA 1SQSA 3EDOA 2QX8A 1WSWA 3F6SA 3G5MA 1YOBA 2OYSA 2HNBA 4YAOA 1AHNA 2MOKA 2Q62A 3FVWA 4QOEA 1TIKA 2FDXA
chains in the Genus database with same CATH superfamily
4CKEB 2W2NA 3GO4A 4HG2A 5AVYA 5ELLA 1W581 5DBHX 1Q14A 4JOBA 3E9CA 3K9GA 4M9CA 3P96A 1XMQB 2G5CA 2ZUVA 5B6PA 3TEMA 4B6SA 3A4NA 1OVMA 3PEEA 5AKEA 2EJWA 2Z2ZA 3WRXA 5JFGA 1AY0A 2WIFA 4RPJA 1CR4A 4EF6A 3MCZA 3O26A 5L7WA 3PRHA 2I2BA 4JIGA 4MNTA 3I8XA 4N5HX 4PNHA 3TKLA 4I4IA 3VNUA 2FEXA 2PLNA 3BJMA 5KWVA 1DXYA 2NTJA 3MRSA 1KJZA 2WHEA 3CWQA 1IEXA 5AOVA 1XQYA 3DWEX 3LT5A 3AVQA 2YVLA 2XOKD 2QX7A 3IAUA 3TSYA 1T26A 2MYTA 2QZ4A 4NMHA 3TR6A 1IQRA 1UODA 5H5JA 2UZIR 4GOJA 5AW8A 3AQ4A 3SN6A 3U44A 1E7SA 2A30A 2SCUB 2ZIXB 3TEJA 1LWOA 2VPPA 4RGVA 1SUAA 3R7DA 3TUJC 2WD7B 2R68A 3A3PA 1E7RA 5CR9A 4MICA 4L76A 1D04A 2YWCA 4KPUB 5FFFA 1IC6A 4NZMA 4KVZA 1EHYA 4O2AA 3U4QA 2CCGA 4ZYTA 1ND6A 3BF8A 3FHLA 1TRKA 1N5RA 4PIVA 3SEQA 2BFFB 3IJRA 2O8CB 3N39C 1QO9A 4L5CA 3K2BA 4H7FA 3F74A 3WK9A 2BPOA 1CS0A 4TKZA 2GBGA 3RAGA 1R16A 3DDNA 3EXG2 4INZA 5KJEA 3LY9A 4BQRA 3TECE 4Z0NA 1XZFA 4R41A 3SG0A 4MVJH 4F1JA 3IMEA 2VDQB 2P1DA 4GXQA 4X1IB 4AZ0A 1GRVA 2QQ0A 1WULS 4PQYA 5CDTA 2CFTA 3GWZA 1KPHA 4KLCA 3I42A 4NS4A 2WWIA 1CYDA 1V7ZA 1K8RA 4W5OA 3R44A 1S8FA 2X9NA 1T2NA 4KR2A 3PI7A 4GP9A 4W82A 3WVNA 2NTNA 8AT1A 5K0CA 1U31A 1SKAA 3W5CA 5A5GA 2VT6A 2VR1A 3B6MA 3O4RA 4NS1A 4QUGA 1XQ6A 4DBVO 3ADCA 2NO5A 2O5EA 2DHQA 3U7HB 4NCIA 3A1UA 2EKZA 1SUWA 2YTZA 3EMBA 3Q7TA 4RXTA 3AIMA 2OHFA 4QHSA 3HJBA 3UWPA 4ETIA 4US1R 4F11A 2EFHB 4ZQIA 4X63A 4FFMA 2DGDA 4OYYA 1KEEB 3ZCUA 2A5DA 4QGFA 4Z9BA 1YA4A 4JJ8A 5L51A 2FPOA 1BDHA 1WF6A 2Q07A 3TAUA 2JLWA 1VJ0A 5L7TA 1FFDA 1WTAA 5HYVA 1BHO1 4RV4A 3IKTA 1RADA 2N0SA 1M5TA 5T4BA 2WWRA 3ETJA 1A9XA 1AKYA 2NIPA 4YRJA 3MWEB 1ECJA 3GP3A 3P9NA 4L8VA 4LQLA 3WK7A 2FSIA 3FWKA 1HZZA 3K2IA 4PZZA 4Q9HA 1CUXA 4FDUA 2VHVA 1ESZA 2LV8A 3FF1A 2BMDA 3GLHE 2G77B 5F7XA 3HCWA 5H1YA 3D2CA 1JIXA 1V96A 1G8PA 3FG9A 4WLUA 1SNYA 4DA6A 2C4TA 1QONA 2H4JA 2ZB7A 3KZVA 3RYCA 1T3HA 1WOYA 5LMCA 1TM5E 1TQ6A 1UP4A 3E9ZA 1VRWA 2WJJA 1M8GA 4O1MA 4PBSA 2XXBA 2IIBA 2VXYA 2ROQA 3UAXA 3MJ4A 3ANTA 4A8TA 4AIIA 3AF6A 4GE0A 3GP5A 3QXXA 4V2UA 1J25A 1BXRB 4IIJF 3FYCA 4I3FA 3RV4A 4B7ZA 1FP7A 1KK1A 1SIBE 3PNLA 3RE1A 1LCIA 2MSDB 3FLAA 2VT2A 3DFFA 4LN1A 4EG4A 3TL3A 1ELOA 2FEOA 3OSUA 4EPTA 2C2MA 4YC7A 3R9XB 5AHKA 2XMQA 3EZNA 2AEJA 3G2MA 4DC1A 1YASA 3GBVA 4ZVMA 1YF3A 4GI2A 2HFKA 1GYRA 3VYWA 1TK2A 3FTFA 1U99A 3O8NA 3UKOA 4PFKA 2IUSA 1JLMA 1KYIA 3PS9A 4E6EA 4LXQA 1SUPA 1JS1X 3ASUA 1U28A 3EOZA 3GEEA 3H42B 3N5KA 3V8PA 5IN4A 4RF4A 2HDHA 1Z7EA 1A71A 2P40A 3JALB 5B1SA 2BGIA 1KI6A 2CDBA 4U0KA 3HC7A 1KQPA 4I9GA 2NVUB 5ECGC 4D96A 3FE2A 2Q4EA 2OPHA 4D92A 2AFVA 3I05A 1H4TA 4E14A 2BE9A 2Q3CA 1GPUA 3C1OA 1FXWF 3KDPA 2JPDA 3EVFA 4AZVA 3COZA 3HUUA 1LBHA 5CMLA 1ZK0A 4X6XA 2GASA 1UMBB 3A4IA 3FB1A 3OOSA 4J94A 3DZIA 3E9YA 3EGEA 4CODB 3HA7A 4C7XA 1U3CA 2D13A 3BWBA 2CJWA 4N8DA 1AQLA 1VIYA 4E1AA 1BN6A 2JFPA 4EO7A 2BZ1A 3AY3A 3EVNA 1ZC4A 2O52A 2ZRPA 4Y2QA 5AESA 2OKGA 3NHYA 4EDHA 4C0LA 3TFWA 4AJ9A 3S2IA 2ZB8A 1B16A 1A27A 3KIPA 5DM60 1BGXT 2HIMA 1HQKA 2RHLA 2Q1UA 4KSCA 3FRIA 3V1KA 4JI1B 3VX4A 2P2ZA 4I81A 3MTIA 1BJRE 2SNIE 5TDHA 3NI2A 1MU0A 1SG0A 2Z2JA 5IBCA 1B0AA 2HNKA 4J49A 1Z5UA 4HN4B 1CNMA 4FSXA 1UQTA 4X8LA 1VI5A 1ZUHA 2X8LA 3CUKA 3G6WA 1Z7YA 4LY9A 1A04A 3KTOA 5AUPB 3OE1A 3KQUA 3E61A 3GV0A 4V2IA 1TJ3A 1NATA 2O3UA 3ESDA 4XIIA 4KEAA 3TUIC 4CETA 3C39A 1VYHA 2Q9UA 5KU7A 5AM4A 2GA8A 3G8BA 4RFLA 2GWRA 2WTUA 1UOOA 3RUEA 5IT9A 5C80A 4GSLA 5JJ5A 1JFVA 2E4VA 3QJGA 4OGKA 3V7WA 3G68A 4IIJA 3RO7A 3SMVA 2BGRA 2XE6A 3FHCB 3UK0A 1E2FA 4JY7A 1VPDA 3ROTA 2DULA 3H65A 4Z4HA 1TJNA 1JG2A 2ZJ8A 2OT3B 3NWBA 4G2NA 3QRWA 3TOCA 4LF6B 4D5EA 1Q19A 1XZKA 3PDHA 4UZEA 5GPBA 3ZX4A 5BN3A 5EZ5A 2Q2OA 4DG9A 3GPDG 1N2CA 2WJVA 4XE5A 2YZ7A 2H1WA 1FVFA 5JSZB 1KY5A 4TTRA 5AM3A 2WU0A 4WI1A 4B79A 4BJ3A 3N05A 1J20A 2E5LB 4AX8A 4EYSA 3VPSA 4EA8A 1ZD1A 3U6KA 1YDHA 4QL3A 2WF5A 1O7JA 4N3BA 3GX1A 2AZTA 1PBTA 1BYUA 1NVBA 4BFLA 3ASVA 1VYVA 3ITNA 1G20A 4TKLA 3WGZA 2A2ZA 4O0LA 3V4PB 1P1HA 2MYNA 3QUBA 3T8YA 4E5UA 1XNRB 4NYIQ 3G79A 3RBZA 1Q3KA 4LY0A 5AW7A 2VNIA 2BJHA 3PC6A 4BFTA 1GEGA 5KSWB 2IK8A 3MJRA 3HYTA 3ID6C 3DFZA 3LIIA 2YWFA 4X7PA 4ZVPA 1PS0A 2B1QA 4E32A 2IFTA 2ZRFA 3RU7A 2LZ0A 5BYKA 3LWBA 1U8YA 1A2QA 2GN2A 2OZVA 4UNNA 4YA6A 3H9JA 2DOKA 3DO6A 1O5TA 5IMSA 5LCXA 1JXOA 5J2TB 1XXHA 4D3DA 2CLFB 3Q9LA 3TQRA 1QPZA 5HILA 4DAEA 3SC2A 3UG6A 2CUZA 4DV5B 3G5UA 1ZVVA 3L7BA 1NE7A 2J30A 3FBGA 2JGDA 2VEOA 4K40A 4XR4A 2NYUA 4UFOA 5B7QA 3NATA 4LF8B 2YQ5A 5F23A 1UJCA 5DI9A 2ECKA 5C9ZA 5KKNB 3SBDA 2AB0A 3RNOA 4B44A 2XMGA 2Z58A 1LNZA 3R7AA 2A9VA 4R71A 5ICEA 5H81A 1A9PA 2HM7A 2Z2XA 1ZGJA 4MQEB 1F1JA 5AMXA 4LK3A 4QYSA 1SU6A 2PGXA 5H4GA 3IUSA 1FFEA 3RF6A 1F8UA 1F17A 2IXDA 3EGVA 2P2CA 2QRVA 4G0OA 5D2CA 3KRTA 3DQQA 4RK6A 2C2HA 4P7KA 4PG4A 3ROEA 3IAS6 2OB2A 3H7AA 3RFXA 1LDYA 1RMYA 1MF7A 1C80A 4RSRA 3HN7A 4WKBA 4E3ZA 4YUWA 5KQMA 3QEBZ 1ML3A 2OLKA 2XTAA 4U9IS 1SCNE 3W2HA 2PLAA 4D9HA 5FTMA 1ZK4A 3GVCA 4OQPA 4F2PA 3ICEA 5FBLB 1JAYA 1DC7A 1YQWA 1Z8HA 5LMUB 3HR7A 3LVFO 3OJXA 4YY3B 2ZUCA 5CK5A 1RCUA 1V71A 3AINA 3D3KA 3GGOA 1LK0A 4KI7A 1LDNA 3ZOKA 5AVKA 1L7MA 5G2OA 4CT4B 4JODA 2FEMA 3LP8A 2FXVA 3VI3B 5LYJF 2QUBA 3O90A 3N86A 2PS1A 5DASA 5IAKA 3U80A 1PLJA 3LTEA 1HV8A 2QJTA 4FCWA 4GO1A 3AHCA 4UEKA 4DWOA 4BLTA 1UT5A 5ELMA 3BMQA 1MNAA 2WTEA 3KYCA 4U2BA 1U3TA 2OHJA 3UWSA 1U8AA 2CLEB 4JBWA 2O1XA 3CW9A 1IMJA 3ZU6A 3CUYA 3NDRA 2VNKA 1O96B 2KLBA 1K08A 1Y3AA 1ODLA 1OXVA 3N0XA 5CH8A 4D6XA 4DPKA 3T3OA 3ORRA 4L75A 5KYXB 4HPJB 3L7JA 4BGIA 1CR1A 3NG1A 4LBWA 3NNDA 4EJSB 1AXEA 1NTOA 4MLZA 3N2IA 2EIXA 2CCKA 2AFHA 1WVIA 1Z4PX 5FBHA 1Y3IA 2FVXA 3ZI7A 4DNXA 3V4RA 3ZGYA 1O6CA 3R0JA 4MRNA 3DJFA 3DWIA 2IDZA 4E5KA 2F62A 2NXCA 3Q87B 5LVAA 1ZJ6A 1NNLA 1V5FA 1AS3A 2WQ6A 4DV0B 1UL1X 2JS7A 4Y98A 2HDWA 2YUTA 3CZRA 4J3FA 2X0DA 5IJAA 3U4GA 1ULAA 1GSHA 4UNSA 3C3DA 2GLXA 2RGAA 4E4RA 1VECA 3E9NA 1Z56C 2G76A 5A4DA 4I4CA 2DBYA 3DOHA 4MS1A 4TZ6A 3A70A 4C0SA 1YQ9A 2AS0A 4BNWA 1M6HA 4RAOA 3QLJA 4UUOA 5EQDA 4D02A 3BIFA 3NDJA 4IIEA 2I2WA 5KWEA 5J1SB 4EJMA 5AVQA 3RVSA 4A8JA 3OCYA 4MITA 1IHDA 2IBSA 1NRXA 1KKMA 3ICCA 5ADHA 4N76A 5DBIA 1NY5A 2A0KA 4ZEWA 2X40A 2QPTA 2EHJA 1ITZA 3ZE0B 2W6JD 5HTOA 1XFAA 3CZPA 1JJVA 2WI8A 1PEAA 4AWXA 1EUDA 4R8SA 3UMBA 3ETCA 5AT1A 1AHIA 3X1KA 4MV8A 3QKIA 4ZJZA 3C3KA 3MVEA 5EIHA 5C5DA 1MPTA 2ZU6A 4UBKA 1ZSVA 1VE6A 2PWAA 2B92A 1IFXA 2MCFA 5HQ3A 1VJ5A 1ZPDA 2CWWA 2ZBPA 4LQDA 4A16A 4D3YA 1PTKA 4BGDA 5L8VA 1JFFB 1ULZA 1X8LA 5A6SA 2NXEA 3PGJA 1HNWB 1OF1A 4NARA 3D81A 4JHXA 4M7WA 4IZIA 1Y9EA 1BA3A 4WCFC 4QJBA 2QY6A 4L4XA 3SICE 2X0NA 1CJMA 2CL7X 5ALNA 4UTRA 3SFZA 4N47A 3WLAA 4RPLA 4UM5A 2JHGA 1HRKA 5D5PA 3MWFA 2E4WA 1C1DB 2AKAB 1C9EA 1UMKA 4KGDA 5KKCA 3A28A 5EE0A 1C8KA 2VFAA 2PGAA 2V8OA 2YJ5A 4PR0A 5DLDA 1FU4A 2EZUA 3HCBA 3OO0A 1ZHOA 5TR9A 3WBKA 5CHEA 1KFJB 1YVUA 3OZGA 5EP2A 1S6YA 4RKRA 4QLAA 3S7TA 4Q3EA 1EX7A 2EYUA 1NQXA 4CLHA 1WTCA 1TVEA 3DM9B 3JPWA 5KJ6A 3G0OA 1LVHA 2WP8J 4W1SA 5TVGA 3F6SA 1VP3A 2ILVA 1SVKA 1VL2A 1GA4A 4XUGB 1DXHA 3QI2A 1VL8A 3C6KA 2IS2A 4F8EA 4GM4A 2KLHA 2GZAA 2CNBA 5IWAB 4LJSA 2MOKA 3O8LA 2EKPA 4LWZA 4DCNA 5DHUA 4RXMA 2P6NA 2WDZA 4ZCTA 9MHTA 4M99A 2PUJA 1CRZA 1FP4B 3NIWA 4Q47A 2KYRA 3HZRA 4B1FA 3OJEA 4C4YA 1ARZA 5JWRA 1QU3A 5L4LA 1THMA 1FFBA 1TYBE 2DJ5A 3A14A 3I73A 5DHSA 3VKVA 3N28A 4NE9A 1KORA 1SFRA 3GVIA 5K3OA 4GLOA 1MB3A 5DHFA 4G81A 3DULA 5A1JA 2GTPA 1S2MA 1HC7A 4MQFB 1KEKA 3CV3A 4P31A 5IXJA 4EKGA 3GFBA 3LY7A 3OX4A 3DD5A 4KXXA 1K98A 3ETEA 3ANSA 3WGQA 5CT4A 5CEFA 1IUPA 2QLJA 2XJ9A 3KVNA 1XTBA 3Q85A 1BFKA 4YACA 3H9BA 4EZIA 4FYWA 1MG0A 2XZTA 2FZ4A 2VTBA 3P19A 1X8JA 1P6XA 3F8WA 3GGGA 4FNGA 1YQXA 3T9AA 1EEHA 1O9GA 2GI4A 2VJLA 1BS2A 4ZWNA 3NBQA 1T3GA 2BBOA 1B43A 1U0FA 3AUFA 4PLFA 1IU9A 3H3FA 1KHHA 3JQ6A 3N2ZB 3DBHA 4JB2A 1FCJA 2AVNA 4JX9A 4QPCA 3V48A 3OZSA 3K70D 3NGXA 3OZBA 4HATA 1XDZA 4MI6A 3IKMB 1IOLA 1VCHA 3R75A 3IO3A 2ZDHA 4KGXA 4QICA 1WW8A 4G9BA 1I6WA 4A6DA 4EIWA 4Z7OB 3QFRA 3FOZA 4K03A 4JJIA 8GPBA 4OLBA 2E3JA 5CLHA 3OZ7A 4DXDA 2DHRA 5FO1A 1G8SA 1XOIA 2NGRA 3TX2A 1DG3A 3U56A 2I6SA 5EJIA 3M3PA 2BJWA 3CLRD 4HFMA 5CIWA 1C4XA 1NULA 1FSSA 3JVEA 1HFWA 1UDRA 1A8PA 3NM5A 4E07A 4ZCIA 5DNAA 4ARCA 4TWZA 1JEYA 3RDPA 4N5DA 4RV5A 4YYZA 1L5VA 4B8WA 1V3QE 3A9SA 3EEBA 4OXIA 2PQMA 2FVYA 3PEWA 1WUIS 4OGLA 3K0FA 4URWR 2BSAA 2FQQA 2PZAA 4IJWA 4I55A 4IHJB 4L4UA 3TBFA 2ZR0A 4A03A 10MHA 3WNQA 3AVPA 1KL7A 2CFSA 4ZZ3A 2O1EA 4PYJA 2REQB 3GARA 3I23A 4G9EA 3RODA 3H0EA 4KFSA 4QC2A 3UKJA 1G8HA 1NQTA 2YXEA 3A3YA 2X22A 3M49A 1NPTO 2EFEB 1PJSA 4DQVA 2CDAA 1WD5A 3DEIA 2OM2A 4DDMA 4YRMA 4HYYA 4J0CA 4G67A 2I67A 3MTDA 4NZYA 3K35A 5AW2A 3SQXA 4A0QA 4RTPA 2ZK7A 1J70A 2G1AA 3FPLA 1V95A 3QSGA 2D6FA 5BV0A 3PPYA 4TWIA 3L4KA 2WPDA 4DIBA 1NN3A 4LRXA 4PX2A 2IQ5A 4DLZA 1MZVA 3OU7A 4YFVA 1MBZA 3ILXA 3LRTA 4POAA 1JEOA 4PTLA 4W8GA 1SZJG 3SPXA 2PEZA 2MINA 3KQOA 4JI3B 1C5KA 2QNRA 4IMJB 1DC8A 1HGXA 1TZCA 2CYBA 2DFDA 2FPPB 2VF8A 1JDNA 3QUAA 4HH4A 4JOSA 4FE4A 1KE2A 2GF9A 3P9SA 1EZZA 1US8A 5CBPB 3NHBA 4IDAA 4YMGA 1KO1A 2RHDA 2FSPA 1C50A 2DBRA 3ESBA 3TDNA 1FDUA 1VG8A 3FDXA 1OIXA 2QTFA 2ZBEA 4M1SA 3BFKA 4MI9A 5EIAA 3USES 5H82A 5AM2A 3HKDB 1QORA 2ZR8A 5JEDA 3ACCA 1P61B 2OGWA 2A5YB 4B09A 3DQZA 4Q4JB 2EBFX 1DKMA 1LRJA 4JI7B 1ZXXA 3EIUA 1E2UA 3ICVA 3MINB 4EZBA 2IUTA 4NOJA 1DVRA 5GZ6A 3WLTA 3T3MB 1GNTA 2M98A 3A11A 4QJ4A 1LZKA 2UUOA 4DLNA 2G71A 4G85A 3WQBA 1G0OA 1IIBA 3PVSA 2XE8A 1JI0A 4P1ZA 4ZP1A 1K8QA 4F3YA 2ZUBA 1JPJA 4BNHA 2WEKA 4XYMA 4OAOA 2RJNA 2FLVA 3AQIA 2W90A 3VVMA 3LDFA 2EZ4A 1IHPA 1NUHA 3IBGA 3VX3A 4B6RA 4NOKA 4CG3A 2Y1XA 3UAWA 4ZZ0A 2IIPA 3F2IA 4WHMA 4IXDA 4UMDA 5BNZA 1NMQA 3PR1A 5C1PA 5KO2A 1NU6A 1PO7A 2PL5A 1EH5A 1UZNA 1VE1A 4QFMA 3O3NB 5K0LA 2YMQA 1IEQA 4P5EA 3WIDA 3F78A 3OC6A 3TLXA 1IVNA 1F2DA 1CETA 4Z6KA 1BMFD 1CQIA 3OO1A 3UW1A 2BFWA 2X3FA 3AK4A 3GN2A 4H7EA 3PE4A 4QYTA 1OBVA 3DL2A 3SVTA 4JYAB 1FMLA 1CZNA 2VRWA 1IHXA 3B1JA 2HHHB 4AO8A 5K05A 1P9NA 3E6AA 3DP9A 5F33A 5DCYA 3LY5A 4ICIA 1Z6ZA 4XB2A 1IL0A 2I8CA 1SG9A 2G1KA 3DLTA 4R54A 5DF1A 2Q7DA 3U31A 4ZKEA 5I8WA 4QOHA 1QRAA 1QR2A 3E9QA 2ZJ4A 3OLZA 4JJKA 3RVRA 3KJFA 3BMNA 4RQUA 2TSYB 3REGA 1OIWA 2XDQB 3REOA 1IG0A 5KSZA 3FGOA 4YRNA 1MC8A 2OO3A 2PZKA 1W36C 3HYNA 3PNBA 4X91A 2Q5OA 2UVQA 2V55B 4KFRA 3WIVA 1EK2A 3LXXA 2R47A 4DXAA 4GPAA 4DR7B 2WV7A 1O94C 1M66A 1QB7A 3C8MA 4GXNA 1YHYA 4K9LA 4XM2A 1JPUA 5ERYA 4DMMA 5D3QA 2W6MA 3ND7A 1SB8A 3A6FA 4IMRA 4XIJA 5FX2A 3S3TA 1P4JA 1M73E 2IH4A 3FKSD 5EJ7A 4BQPA 5DIFA 1L7VC 1L8AA 4P7FA 4PSKA 3HBMA 4X1OA 5LB4A 1E6EA 4AMBA 3M34A 3QTTA 2MHCA 4JVSB 5GV7A 3HU2A 1YJXA 4C1NA 3AZPA 3H9QA 1TGVA 1NVVQ 3EQ2A 3DOJA 4UPDA 1R0SA 3L84A 3O0DA 3IALA 2VDRB 2FR1A 2XMCA 2WC1A 2O57A 4GX0A 3ZGZA 4RVHA 1GQYA 1X15A 2QM7A 2YS6A 3HACA 3INRA 3WZ2A 2C4KA 4R9SA 3PQ5A 3CVUA 2JAHA 2XTJA 1MEJA 2X5XA 3AU9A 4I4TA 4KO2S 5DM4A 3R8XA 2VBIA 3UHFA 4LF5B 2WLSA 4CKBA 1F4PA 1KHTA 4OHKA 5BXQC 1KMQA 1QG4A 3N8GA 3RARA 4RSMA 1ZNWA 4KR6A 1CP2A 1FYDA 1RTTA 4P7GA 4OFWA 2I6XA 1VQ1A 3CX3A 1SXHA 1P0CA 4DLUA 1G7SA 3WL4A 3N0WA 2OBLA 3ZD8A 4TTVA 4BMNA 3EF0A 1TYZA 1GQ2A 3NBKA 1JU4A 2VK8A 2WM9B 4MGZR 3HCAA 3RVLA 1ECBA 4C43A 4V0SA 5ADUS 5MDHA 4Y1GA 3GMDA 2WT9A 5U9CA 2NXNA 4KH1A 3G9QA 2B37A 1WBDA 5HRCA 3QPAA 3NONA 3RU3A 4JC5A 1E1CB 1UK9A 4ND3A 2EDAA 1AF7A 2QN3A 2GD1O 1R0LA 2GAJA 3OESA 2WG2A 4AZTA 1P75A 2JEYA 3O6VA 4ALJA 2M6LA 3DWGA 4D4MA 4C2UA 2KW5A 1JG3A 4QU9A 1UBEA 3ANLA 1T6ZA 1G2OA 2IF0A 1YRBA 3CVYA 4Q3LA 4YMVA 1OXKB 2D5AA 3VSAA 2C1ZA 2GRJA 1T8TA 2X5NA 1NUSA 1N3IA 3C3XA 2Y1LA 5FTWA 2ZANA 3NIBA 4DRXA 5JPCA 3GVXA 4Y2JA 2C77A 1IXKA 4MVJA 5ESXA 5BSHA 3B85A 3JARB 1BDBA 2ZR9A 3N2KA 2B4AA 4R31A 2X0JA 1H9BA 3FR8A 1PN3A 3O2JA 5EIBD 3I8SA 3VPXA 1FXSA 2ZDGA 1O08A 5IC4A 2VP5A 3W6OA 3GJ6A 4KYVA 2YBDA 4WY2A 2CLMB 3P8ZA 1H3EA 1P4RA 3EWAA 1LQ2A 4X92A 2Q41A 4FKBA 2VBCA 2D5LA 2CV0A 2YNMD 4G4IA 3N6VA 3BHJA 2DH6A 5CLQA 5BSEA 5K20A 4BLRA 1AVTA 2AYYA 1JIIA 4ENQA 1TX4B 1UC5B 3KO8A 4H0NA 5BXYA 2XY4A 4NH4A 1MXHA 2OG2A 2R751 2UVPA 1L5FA 4ZJUA 3DKIA 1SD5A 4MUEA 4OK3A 5KIAA 3D6UA 4U8HA 4LYAA 1BDMA 3QVKA 3DMYA 4DAOA 1A0OA 2PX5A 5HGJA 2HNAA 1KMHB 3PGLA 1V5EA 4PYOA 3DE5X 3S70A 3TDMA 1UIRA 5KNCA 3B6IA 4MS4B 2ZWOA 3B3AA 3B1ZA 4UNRA 1JEJA 4P5PA 4AP6A 1UIMA 1Q16A 2I03A 5CM9C 1Y3FE 2CD7A 3FH0A 3THYB 1DI0A 3AJEA 3INTA 2EFDB 3GK3A 1XMPA 1Z3CA 4JUIA 3LBHA 4J75A 4LFBB 1C2YA 1UMDB 3BEDA 1P7CA 4RKYA 5DTMA 1MAVA 3PFCA 3R3ZA 2VXCA 4U7FA 2PGLA 4NENB 1IXZA 3FGPA 4MAMA 5HMLA 4BCDA 5C7IO 2RIPA 4DN6A 3PP8A 3W77A 1D2CA 1RQXA 3NHFA 3KVOA 3V1LA 1D5CA 2C04A 5IAAA 3B38A 3E23A 4FJ1A 2FEAA 2R8RA 1OLOA 1Z6TA 4D26A 1E0SA 1FDIA 3AP2A 1XDSA 1TA4A 1CRWG 1ECFA 4WZBB 3U37A 3OT1B 3HDHA 2C2XA 3KU4A 4AJJA 3VR2A 1C4KA 3OLWA 4CCSA 5AK3A 1TCVA 1NLYA 3VU3A 4JI5B 2JH8A 1U0NA 5JISA 1ISSA 2XW6A 4BUCA 3NT4A 4MULA 4XB6B 1HEUA 1CJUC 1GL9B 1LLCA 1VLLA 2VYND 2ZCVA 1KVTA 5IFLA 3AR8A 1HTBA 3R6TA 5D87A 3WB0A 1EFAA 2AGVA 4YEDA 2OV1A 3T1OA 3DF7A 3KJGA 3KJNA 4DDHA 1T9AA 1FRQA 1PEDA 4P7BA 4ZV7A 3GRPA 4DWVA 4U6SA 1ES9A 3NTLA 2B2XA 3KFLA 4JQCA 4KW7A 2I80A 4RK7A 4PYLA 5DSXA 1TJ4A 3LAWA 3AW9A 3IT3A 3PA6A 5FXMA 4Z54A 2B1GA 2QT9A 3GRYA 4JJAA 2XB2A 1RYEA 4Z4QA 3FOAA 1T4BA 2GXQA 3HB4X 1RFGE 3DMNA 3PNSA 3VNBA 2R4UA 1PLLA 3VAAA 4EFNA 2VZ0A 2ZAIA 1YVEI 5KSOA 3FHTA 2VZLA 2ANBA 4R84A 1A5BB 3QVGA 4YV0A 3G6KA 2GO7A 3HJFA 4MUFA 4CDNA 1WG8A 4GNRA 4X6UA 4DADA 4RH3A 2CK3A 1P7ZA 3FLMA 4BNNA 4PYQA 4Q9AA 1JXQA 1OY1A 1AXGA 3TKYA 3QVWA 4LOHA 4R68A 1RHQA 3D0KA 1EDZA 2HA2A 1M2OB 1YKGA 5DRTA 1JQKA 4OQZA 1L5LA 2JGRA 4IUYA 2AG5A 1DX4A 3OU6A 2ZYIA 5FYQA 4ZCSA 5IKEA 4LY3A 3F96A 3WKBA 7AT1A 3O2SB 3AUKA 3STUA 1EBUA 4KJXA 3BQ9A 1A2OA 4L4ZA 1SC1A 3F6EX 5LLSA 3B36A 1TAGA 3GJ4A 5A0TA 1M67A 2BR5A 2C00A 1NP7A 2IUEA 3LUAA 4BBZA 1AMUA 1B73A 1IE3A 4N5IX 4K28A 3AL2A 4BLWA 4CMEC 3BGWA 3B9BA 3T1VA 3V8MA 4RTOA 3D6TB 1QH8A 1E2JA 2JJ1D 2VDJA 1OAKA 2G04A 2Y4OA 2ET6A 3PFWO 3PNVA 3JQBA 4HLCA 4J2OA 4P5DA 1MJGA 3SQDA 1EM8B 4O4JB 5KPDA 1YS4A 1G4AE 4HLNA 4S24A 4NYMR 4F3KA 3WRYC 3DNPA 4F93B 1VMEA 4H6WA 4M76B 4GKVA 3NJ8A 3CEPB 1NV8A 4K1LA 4NDZA 4RY8A 4EA7A 2GLUA 3DZCA 1XQXA 3IP6A 3PDIA 1JAIA 1XELA 2WZBA 1A4XA 2ZEJA 3B13B 4L73A 1SU7A 2PRSA 4LV8B 3IDSA 4OOEA 4TXNA 2JFVA 2W2QA 8OHMA 1POWA 3JYOA 4YJHA 5FFNA 5CFZA 3FPKA 5EYPB 1WSWA 2V4UA 4GBED 2KMLA 4DM7A 3ZLTA 2X42A 1GFIA 3JWPA 1H4QA 2GCIA 3TMKA 2J46A 4UQOA 2FMIA 2BH2A 3DFKA 4GC5A 4HRVA 2VJOA 3MN1A 4LVNA 3WYDA 8ADHA 4Q19A 4NXMB 3Q6IA 4KUGA 2GBCA 4LE2A 3VPFA 2CLOB 4ZV4A 3WKDA 5JXGA 1DOHA 2O8DB 4RJKA 2BH9A 3PKJA 4ARZB 1E9FA 3AESA 4XASA 1TIKA 1D2NA 1HFJA 1U2ZA 1C1HA 1XVIA 2QB5A 3RFTA 5EZYB 3S81A 2CLLB 2POQX 3GXBA 2NVBA 1LY1A 1EJ6A 2BKVA 4RANA 3RKRA 3WGYA 2ZUWA 4AY3A 2O7VA 4PC2A 1ETUA 2ORWA 3G8CA 4WESA 1I2DA 1M6VA 4CKWA 2JARA 4HDQB 5ED0A 1L8OA 3NX4A 1JDBB 1XVVA 5TPZA 1Z7GA 1JDPA 4NBVA 5G1NA 2X5KO 5FEUA 1YCHA 1Z5ZA 1Z0AA 2ZRMA 4EAAA 2A9QA 4L74A 5BWBA 5IVDA 3IEUA 1BX1A 2PZBA 1Z68A 3RJ9A 4N39A 1DKUA 2KHZA 4K6FA 3A4VA 1XU4A 3VHXA 4RTKA 4NRDA 5IC5A 4LF4B 3OCCA 3IVGA 4X97A 4B3MB 4FYJA 3EISA 4YGXB 3UK2A 5KCZA 2F9MA 2Z4SA 3DV0B 1I9CA 2K5UA 5T64A 3P2IA 2Z3ZA 5CJPA 1WU7A 1OWNA 2QBYA 3K94A 1VLZA 2FETA 3NCTA 3OMXA 3UJPA 2CXPA 2Y9MB 4BVBA 3U81A 4ERXA 2CLHB 3IVMA 4LPKA 3L7YA 3SBOA 1ZICA 2D0IA 2RKOA 2Y1KA 1NOKA 3G1WA 3RUIA 2GJ9A 3KZCA 4U0JA 4D6YA 1DX9A 2DUJA 1C3OB 4EJ2A 1TYCA 4MV7A 1USVA 3LT2A 3G8YA 2QI9C 3DDUA 1POXA 2A35A 2WHQA 3JPYA 4KWEA 1E6KA 2AN3A 2OY0A 3HGMA 3HU1A 1RRKA 4TSFA 3WRYA 1G5HA 3CURA 3ES9A 4Y2YA 2GLTA 1R0WA 2UKDA 2F64A 1K7YA 3N6XA 1V2GA 1EK6A 5PGMA 4Q1DA 1RCTE 1GLVA 2G9RA 2YMLA 1M8KA 1U9IC 2QTZA 4WY5A 1F6DA 5KNDA 4MUBA 2HA3A 2DHDA 1WNFA 1RQGA 2HBQA 2RGBA 1KEWA 3IP7A 4TV9B 3RYHB 4BNFA 1IUOA 1YNOA 4BNKA 1E99A 2C7PA 3G0HA 1H6DA 4V0RA 4QUHA 2X0EA 7MHTA 4PYMA 4I19A 5DW3A 1U3GA 5CVEA 3A27A 1IJEA 4RC9A 4ND2A 3GLGA 3LY8A 1LTKA 3FVTA 4IWNA 5DHQA 3UEOA 4DWWA 3O7WA 2CW5A 1NWHA 3MWGA 1E5DA 4CLEA 1R4ZA 2KBEA 3IAEA 4FUTA 5BQXA 1YFJA 2OC9A 3NR2A 4QHTA 2GAFA 2B20A 5FBQB 1C30A 2WB4A 1Z4LA 5F3DA 3PJFA 4JWTA 2FP4B 4P3PA 4EQ6A 2I2DA 4PZ9A 4QHYA 5CG1A 5J5VA 2ZBDA 2OAGA 4DMHA 3R6GA 1ZUNB 4IDQA 5DXFA 3GWGA 2FHPA 1MB0A 5BYAA 2F00A 1KVRA 2XVXA 3CEMA 4UUQA 3DXYA 4URYR 5M34A 5LQSA 1ZK2A 3IDZA 2OO5C 5IFKA 1OROA 2G40A 2IV2X 4B40A 4GU5A 3CVWA 2XA1A 2JCVA 3KPJA 1RXEA 2RIRA 2WSSD 3ST7A 1COWD 1YRAA 3BIXA 3OPYB 4GR4A 2C7OA 1X38A 3KDAA 5C37A 1L5YA 2VZEA 1GL3A 4FLFA 1NV9A 1JV2B 3WRWA 2XT0A 2BSXA 4OU4A 4LTNA 2FSVA 4OHUA 2AE1A 3P2YA 3FTCA 4CL3A 1M1YB 4J2TA 5C1OA 1RRFA 4CNQA 4YRKA 1L7BA 2FUKA 1T1GA 4ZXFA 5A9SB 2VPXA 3FWZA 4DB2A 1TQ2A 2AOTA 3W6ZA 3OPXA 2ZE6A 5FA5A 2HX1A 4GMFA 2IZ7A 3GFRA 3PGKA 1GGJA 2W0SA 3UGQA 2WFZA 4ZMSA 1MW9X 1PV1A 3O8QB 3I61A 3L3BA 1YE3A 2JCGA 3CM0A 3F9IA 3IKVA 5ERGB 1EZ1A 3UGKA 3D8TA 1P9OA 1EXDA 2VYQA 3PGA1 1DEOA 2J1LA 2Y2UA 5BN1A 1A2BA 1KWGA 3ADBA 4C01A 5HCNA 5J4LA 3W9UA 2VG8A 5JECA 3QEOA 5AICA 4BX9A 4F91B 1AKUA 1OTYA 2NPFA 4DUPA 5FT9A 3WNCA 5H83A 3F1KA 4UEWA 5JE8A 1YCGA 4F9GA 1JMKC 1ZU5A 3HYLA 2HTEA 4OBXA 421PA 3I0MA 2C1EA 1EVLA 2HXSA 2VXOA 4N12A 2DEUA 4FGZA 4XYEA 3VOBA 1CIJA 2I5PO 1IMOA 4MJLA 1U8TA 2FPRA 5TE9A 1QCCA 3VDNB 4BL5A 3TSCA 1H1DA 3N8NA 2R7LA 3BRWA 3HO6A 3MXOA 3SZGA 3EGDA 2KJQA 3KG2A 4ON9A 1VSUA 1OILA 2VA8A 3KVYA 5MN6A 4IILA 2FN9A 3K4HA 4O08A 1QG2A 5JI3E 3WL8A 1S8NA 1MV5A 4LDZA 4GEGA 2IUUA 3SZMA 3ZX5A 2OMKA 2RHJA 5LZ2A 2J4DA 3LBNA 2CVHA 4KV7A 4HNAA 4OHBA 4GI7A 1E2GA 4J9VA 4FN5A 4CKYA 3Q8MA 2ZPTX 2ON6A 1J1ZA 1ZHFA 2H0QA 2REXB 4UAVA 1Q0QA 3WKEA 2CVZA 5BWCA 2PUGA 4E21A 1QIFA 4QXQA 1LPNA 3MTGA 3E15A 2HCRA 4JBYA 4N0MA 3WIUA 1YMUA 3VR3D 3WWZA 5C8YB 2AFIB 1E3LA 1QNFA 3E9RA 3EG9A 4HUQA 3HQ4O 3UICA 3Q2IA 3ZUPA 5CA1F 3ESRA 2WYHA 1Z08A 2HU5A 2FPIA 3CNHA 3NWOA 4UHCA 1V11B 2QE7D 4ALIA 4FOPA 1R4NB 4BPRA 5B7PA 1X3SA 5GOZA 4G8CA 3OKPA 4B3BA 1E9VA 1V9CA 4V0KA 5JHGB 3L0YA 4FNMA 3IOBA 2PSDA 1U8FO 3I6IA 1UF9A 4L9WA 2XCOA 1MQ8B 2J3KA 2HCJB 4X8HA 2GAAA 2WRZA 3GVHA 5KI6A 5JXHA 4LHXA 1MGPA 4WBXC 1MAWA 2QL5A 4N0PA 1DELA 1B74A 3I39X 2H6EA 3QE4A 4GOMD 5J63A 3TDKA 4EUNA 2OO5A 4PC6A 4HF7A 5KX5B 3NVKI 1TU3A 2PUWA 2P4SA 2Y9PB 5AHXA 1QSGA 2V1UA 1EGQA 2DY0A 3EGOA 2VSOA 3VXKA 1U02A 4NNPA 3FLBA 4I50B 3L1IA 4HTFB 4P2BA 1GFWA 3T61A 2QRHA 4HP8A 3SSMA 2AF3C 4PONA 1LF0A 3K0AB 1ZIPA 6AT1A 2GN0A 1HMYA 4AO7A 4RVCA 1GXSA 1N8KA 1FK8A 3BWMA 4EX7A 1H2XA 1RLOA 2EG5A 1HKUA 3PIDA 4IFBA 4Q9JA 1IZ7A 5AW5A 4D4IA 5JANA 4D97A 1T9ZA 4PPYA 1YB1A 3RTCA 4BEBA 2ACWA 3QE9Y 3U4CA 2TMKA 1CNFA 1J8VA 3PD0A 1JR3A 3DE6X 1W4AA 3GT0A 4W5JA 5CTAA 2XQVA 5EP4A 2H48A 4D4JA 5TB5A 5GVSA 2CEAA 1BWSA 4RDHA 1SHLA 4D4GA 3PNYA 2ATIA 1TEXA 4OUKX 1XTRA 4XH9B 2IYLD 3RIYA 4GYKA 3TCKA 3ZD6A 4B6EA 1GRRA 2FZLA 3DFUA 3HUDA 3ROMA 3T7AA 3ZGLA 2WKPA 1B1AA 1SZPA 2EKBA 3S7ZA 4FZ5A 4HS9A 3QOWA 2XODA 2YW9A 6REQA 2G4CA 2H0RA 5LQDA 1N0VC 4N6OA 1Q2XA 2F55A 4NYJR 1FP1D 4GL4A 1XL1A 2VBGA 3DGEC 4HNHA 1BMDA 4K3UA 1DAPA 3V7YA 5E3HA 3HE3A 1JDTA 2R8EA 2JLSA 5G4LA 2F43B 5G0VA 2R11A 2OCDA 4R0MA 2YHIB 1T4GA 1TQ4A 2PMWB 5EKTA 4ZVRA 1FPQA 4MWBA 2NVWA 3GELA 3D59A 2R6FA 4LRUA 1V3VA 3W8NA 3WL7A 4ZHSA 5K6AC 1Z82A 3R5KA 1SCBA 5HDQA 2GJSA 3QXSA 1DADA 1ZY2A 2JHAA 4U2KA 2DPXA 2J41A 4TQGA 3UH1A 3SHVA 3CF4A 1R0CA 3HY6A 4LCBA 1QKIA 4FIZA 1Z28A 1I5EA 2BGMA 2CCJA 2RGXA 2BTOA 4MW4A 4UATA 4FW9A 1ORVA 5FKJA 3K9NA 4YMTA 1P2TA 2P2DA 3AHHA 4IX1A 5DK4A 1XAHA 4KBFA 4BZZA 1NYQA 3V42A 3UHAA 5CA1A 1FP6A 4HQFA 2Z9CA 4C1BA 4EG7A 2P9YA 4UU0A 1JTEA 5EWMA 2VLBA 2RI1A 4XPIB 4WZZA 4GECA 3HH8A 2IWHA 4OM8A 4OX9Y 3VDMA 1U1FA 3RWMB 4D8YA 2WWGA 3RAJA 2FCRA 1K1EA 2E1RA 3IBYA 2PA0A 2XECA 3LW7A 3D4IA 1TYEB 3UA3A 2OP0A 4QT0A 3N5CA 3OZXA 2OO7A 1M1NB 4CQMA 4FK8A 3D6JA 4E94A 3EJWA 4GYYA 3CH5A 4KOAA 4R9UC 1AK1A 1PR5A 3C6BA 5ALMA 4CMJA 4QAQA 4WZBE 1IY0A 1N3BA 1HDOA 1NRIA 3DEFA 4H2DA 1UBCA 4JT2A 2BCEA 3NBUA 4EH1A 1DUVG 3F97A 1D0IA 1BYIA 1L3IA 3GEDA 3H13A 1O95D 2TYSB 4ZRNA 5FTJA 3AM5A 1C1YA 5JZVA 5LU8A 3F4BA 2G0TA 3HDVA 3BK2A 1YZNA 4KR0A 4WV3A 1EP3B 2ID7A 2HHJA 1ATZA 3DCJA 1CUZA 1SPXA 4HC4A 4PWYA 4BP3A 1TUEA 2HA5A 4A23A 3K9CA 2GRAA 5BN4B 4BP1A 3TLAA 4FD3A 5FI0B 1TADA 1ORTA 4ER5A 3VZCA 3IPLA 2P5UA 3DZBA 1URPA 4KPEC 1ZGZA 2YL2A 3A2MA 2Z5LA 3F9CA 4K9RA 1Y5IA 3EODA 1QG6A 4L0QA 3RUHA 3WLIA 4JI8B 3J7AC 1DIBA 2GN4A 2D5IA 1E8NA 3AR5A 2B2CA 3G0GA 2ATXA 3BHIA 3IE2A 3WQRA 3PFGA 4PCUA 2WTAA 3NBMA 4DGSA 4DJAA 4B35A 3N53A 3QUSA 2EKDA 1JN0A 1F06A 3LK6A 1WETA 3ZHSA 1GTL1 3GRVA 2VP0A 2ZW9A 3WNDA 1TQDA 4ZQFA 3DHNA 3PPIA 1C1XB 1QO0D 2JBAA 2WTNA 3E4CA 4M21A 1GU7A 1Y1KE 1U2EA 4WK6A 3V1YA 3QVVA 4N65A 2HZBA 3COWA 3J7TA 3IDOA 2SBTA 2W0MA 3EVAA 2OCBA 4TRRA 1OLXB 2GM9A 4PWZA 4EPVA 5I7FA 3CO0S 2DSTA 4OB7A 1L6IA 1YK0A 3I6BA 3LP5A 1RM4A 3PQ7A 3Q7SA 3ZK8A 3THWA 3CZ4A 1AK9A 3KE8A 4DCGA 5G1OA 1KAEA 4ZZIA 5LA6F 1Y6FA 2O2YA 5TPWB 5LQNA 3IBTA 3NOOA 5F78A 2CHGA 3SR4A 3WMEA 3KOUA 3OAAA 2Z83A 3NP7A 1Y3DE 4Z4GA 1C0IA 3DE2X 4MR7B 3WFIA 3AI7A 5DH9A 5DWVA 4MWCA 1LW7A 1GOTA 2Z5GA 5LM3A 1YQUA 1RHUA 5D3ZA 2ICAA 3I2HA 1L5HA 5DHPA 1NW8A 4CTJA 3EQ6A 3U4IA 2AOWA 4H9GA 2W4QA 2ZRLA 4BX8A 5DLYA 2IIQA 3OJOA 4JLUA 5G1PA 3TZQA 2XF2A 3RVBA 3T0IA 1Q1GA 2JIRA 2Q4OA 4IXNA 3LO8A 1I4LD 5D6NA 4D3SA 3EIFA 2K7FA 2O3TA 5GADl 3GZTB 2IXEA 1VA4A 4R3UC 5FWXB 4X44A 1TF2A 1R66A 1RDFA 3Q15C 3I62A 3PQCA 4GXRA 2CZGA 2GZ2A 3BGVA 4GGOA 4KL8S 3PC3A 4L22A 2UZAA 5CVUA 3WLQA 3ZQ6A 4EHIA 1KP3A 5CEEA 4IV0A 3UNXA 4A5OA 16PKA 4ZREA 1ZBDA 1E18A 1RAFA 5I9BA 1Z62A 4MVJM 2ZRKA 4A7PA 1EKXA 1SVSA 2GF2A 4UUPA 4EI8A 5A5DA 4B7CA 5KNBA 8ABPA 4QM6A 1H8ED 1I5RA 1I0IA 5F73A 1IN4A 4DV1B 4LUCA 4NG5A 3PFNA 1ECCA 4BNGA 5ICGA 3GPCA 2JFFA 4M7RA 3W6NA 1NONA 2QJFA 2G06A 3AI1A 3HN2A 3T54A 4CV3A 1V8OA 5F1YA 3DUFB 2J9YB 2PQ0A 1O0CA 2QN2A 3HCCA 2O8NA 3OKAA 2EJUA 4OHXA 4RDCA 1IATA 4YXWA 3N2NA 1GRNA 4B3IA 3MHTA 3VOTA 3F5QA 3ZKWB 4I7EA 5I9IA 3GD7A 4QYXA 3QLVA 2J45A 4BO3A 1L9KA 3LSYA 1QRRA 1ZGAA 1L5GB 4KDFA 1KRXA 1LS1A 1EJ0A 1GZHB 4G24A 1J9GA 1TQHA 3IB6A 2O07A 3R3SA 4G1CA 2LKDA 2Z09A 2JLBA 3G9ZA 5KYWA 3IUPA 3M8KA 5AVJA 1PYOA 2JDID 4M98A 4FD2A 1L9XA 1V5IA 1MV8A 3QELA 1P8JA 4XYLA 3KD3A 5H70A 1YU9A 3K09A 3OBBA 2XSZD 4Q6BA 1XZCA 1ZD9A 3WX0A 4U2FA 4NBWA 4G6ZA 3P9IA 3E1KA 1QIHA 3HO1A 4QPNA 3RUPA 4MJ7A 1LRKA 5KS2A 2X1VA 2HTFA 4J0DA 3IYLW 4FMBB 2J3IA 4QGAA 2ATVA 3SF8B 2JL1A 4KE9A 3U40A 2O2SA 3PGVA 4UOEA 4DLBA 1U98A 2XDWA 3NRBA 2C8VA 3K5WA 4DYHA 4YUYA 4IHKA 2XWJI 1Q7GA 1XNJA 4Z2YA 3PPXA 1BXKA 2AUMA 5THQA 1E5XA 1VBKA 1S8OA 2IA5A 1U8UA 5EWJA 2HRQA 3L2OB 1E4OA 4H17A 4ZOAA 1XDDA 3GRUA 1W5EA 4XIGS 1GPDG 3VM6A 1IXRC 4JT9A 2V6BA 4EPXA 1J39A 1HRDA 2B99A 3OQ6A 2OECA 5MGNA 2ZR7A 4LJ9A 4WWHA 3KXDA 1MX5A 5AR1A 4DUGA 1EK1A 1F2TA 3B2NA 2QVYX 4MTLA 1BGVA 2FG5A 3O8OB 1M6EX 4PXSA 4QGGA 4XARA 4KK4A 1D1TA 2B21A 2XEDA 3N2LA 4UJ5A 4P0QB 1KDRA 2VRNA 2VRCD 1K7SN 2XNCA 2H7YA 3LTNC 1B2LA 1VMAA 3LCMA 3SLRA 3I2IA 3OTIA 4EY6A 1U6JA 4ITVA 3V46A 4ZI7F 3DKKA 1NPYA 1T25A 4AUEA 4JOCA 5K03A 2FLWA 1DC4A 4K9KA 5ARBA 1PZEA 4ROSA 3VTAA 4URXR 2QTVB 1HPLA 4NX2A 5ALYA 5FOWA 2BGNA 3PEFA 4MHOA 3I2FA 1FMTA 4F38A 4K0KB 2BBTA 1K4MA 2J6IA 4RY0A 3GRCA 2R84A 3FUWA 2ZKLA 1M1XB 3GL9A 3GFTA 3L8GA 3TLKA 1ZKMA 4FFSA 4J1NA 1ORHA 1YXMA 1C3LA 3BMCA 4Q00A 4RENA 5FPYA 3WAGA 4BV2A 4HXYA 3ZU2A 4DCSA 1U1CA 1J49A 2ERYA 3BICA 3DHVA 3CUVA 4BMOB 1U0EA 3GAMA 1JBKA 2F48A 1QLJA 5AYVA 3ZHXA 4MWSA 3QPWA 5F1PA 2WSYB 3R7WB 3LUBA 4YAUA 4PBTA 1ZGBA 3QKRB 3LQFA 2X5OA 1KI9A 1BQEA 3P2MA 2YJ3A 1EG7A 3NBXX 3QX3A 4WDQA 3GYGA 7REQA 3U7JA 1YDFA 1DWPA 1E5VA 3U17A 1TNDA 3AYXB 1T1SA 1PQ4A 4KNWA 4M6WA 2A1UB 2IPLA 3KOXA 4G3XA 4MRMA 4WFIA 3T52A 5LR6A 4O4HA 1GYQA 4FEYA 2VZ8A 4QPZA 4POOA 3AVOA 2X77A 4KDCA 1FVHA 4M9RA 4BRUA 3GVPA 2OXTA 5EJ5A 2R66A 2CDCA 1Z25A 5TQVA 4XJSA 1G55A 1ZLYA 3KS9A 4AWAA 1F8FA 2YIVX 3JRNA 1IJKA 4GVPA 2P7IA 3L43A 4D8WA 2IS4A 4TV8B 5AW9A 6ADHA 3LHIA 2XQKA 3OIGA 5JWHA 2NNLD 4L5AA 4G1VA 2XOKA 2R1VB 4UCWA 1ZH6A 1VHQA 2RI6A 1QGAA 1RI4A 3BTUA 1U5BA 2ZP1A 4M37A 2YHUA 3HB5X 3I5XA 4TYYA 1GY8A 4DV4B 4FDAA 1F0YA 4GKBA 2ZTVA 4Y6OA 2IU0A 3D02A 3QU9A 4NNOA 4Y0VA 3ROGA 4M7PA 4AMYA 5EE9A 2B1JA 1PL0A 4NVRA 3QMMA 4C4RA 1O5OA 3IEXA 1N6PA 5F76A 1DJNA 1DB3A 4YV1A 5DWDA 1TVKA 3CONA 4A26A 3VYTB 3SXUA 1U0TA 3DUWA 1APBA 3NT5A 4KWTA 5JROA 3Q72A 3IRVA 1BS1A 3TOXA 3EVCA 5A7HA 1J1UA 1WEHA 1W29A 3ILYA 3R5FA 5IMBA 2AYXA 3ZV6A 4F06A 2W8BB 4KKXB 3RUAA 4KUEA 5GONB 2Q0XA 4WLEA 4QXOA 5IJ0A 1RZRD 4WLFA 4JYCA 2PJZA 1QFXA 4FWBA 3Q98A 2ZVPX 4I4NA 4TX1A 1V25A 3WLOA 1N78A 2I4TA 3ET5A 1X1AA 1EFHA 3LKDA 3ZIAA 1KJNA 1NBOA 3OMLA 1P5RA 3AERB 3GW8A 4QYIB 1Q6YA 1RCFA 3RRYA 3JQCA 3RTGA 5A5VA 5TMEA 3GLIA 2CUTA 4W9NA 1NHWA 4BC0A 1GJRA 3DAFA 4A6XA 4DTIA 1SXJA 2ECPA 3LGXA 3CB4A 3L6RA 5KQGA 4GOXA 5EEGA 2V5VA 1CV2A 5HEKA 5IVKA 3PK0A 1CQJB 1CUIA 2IPXA 5LQAA 3Q8WA 2JGIA 2FKAA 1N0WA 4LQ4A 4BKMA 2NZWA 1GL6A 1FNBA 5LBIA 4KPYA 1T0JB 3NWPA 2VNHA 2CZQA 3DOUA 2PLFA 3AIOA 3GH1A 4NLLA 4K8RB 3ZLUA 1N6OA 3D8SA 5FD8A 1UDXA 2AFIE 5FLEX 3UT5A 2Z1DA 4D3ZA 3P71T 4E2ZA 3LE8A 1KR2A 5JRJA 6GPBA 2VQFB 3T15A 2REOA 4MUXA 3T9BA 3QFCA 1UBLS 4XWAA 3TLZA 4C7MA 4EW2A 5H9WA 4HB2A 1F8XA 3JV7A 4LX0A 3OQVA 3VSCA 3TPFA 3KELA 4DQXA 3VVCA 1SOWA 3A4TA 3CRZA 3HKEA 3L8CA 4QGBA 4TOIA 4ENUA 4J16C 1RI2A 1C3EA 4RK0A 1QTNA 4XQEA 4WNAA 5D7NA 5G40A 1MPXA 3Q11A 4MPDA 4YMUA 1WDTA 2IEZA 2J5BA 1P9LA 3G89A 3NOXA 1I94B 1YS9A 3DXFA 1P60A 1NQUA 1VL0A 2CF5A 5BSMA 3KYIB 4CMIB 3TIIA 1K4KA 2Q1WA 1B1CA 2ZTUA 1IWPB 1Q0SA 4M0FA 4XIYA 3H1FA 5DGCA 1ST3A 4OB6A 4ED9A 1JU9A 3Q0TA 3EBPA 1O6GA 5IUNC 2ID4A 3B51X 2XCSB 2J09A 1YVPA 2SICE 2WTMA 1ACMA 4WFQA 1S0UA 2PX8A 2OAP1 3GEGA 4KV9A 1JAHA 1XEXB 1SEVA 3B60A 4R5HA 2OQVA 4D6PA 1N9ZA 1XJ5A 1I33A 3MCTA 3UUEA 1G16A 3PWTA 1W4RA 4EDFA 2PL3A 3O83A 4IDDA 2ZYRA 2W2XA 4NZ9A 4BRWA 4Z1MD 4C76A 1CDOA 4S0ZA 1PQYA 4X8OA 3LW8A 3ONVA 5IH3A 2C3MA 3FMPB 1JWAB 4X1YB 3TQFA 1MOSA 1T34A 1X1SA 2E21A 3NM4A 4MWOA 5JR3A 2A7XA 4OM7A 4FHZA 3VZDA 4DIEA 4MV3A 3ZCXA 3WWCA 3LPLA 4CLOA 4HNSA 1TW2A 2FZCA 2RARA 3IPRA 5CT9A 5JWOA 1G7RA 2PWZA 4XTRA 2JRLA 4KPFC 2IRWA 1EFCA 4MO9A 4OKNA 3EFBA 3TTUA 4LXYA 4D3FA 2XZDA 3BGIA 1NBHA 4IJQA 2EYQA 5B7NA 1C0EA 3D54D 1P7PA 2GNAA 3CRMA 3L7AA 2C5LA 4F3TA 4ZVOA 1WNTA 3FPHA 3MCVA 4OMFG 4DNFA 5H02A 3GDOA 4CTKA 2Y0DA 1BE8A 1Z35A 3KKLA 5DGXA 2XGMA 1GZSA 5EKDA 1HM5A 5F1KA 3ZQJA 3ZCSA 4AC9A 4NBLA 2X8JA 4G0UA 4FQ5A 1RC1A 3PYLA 4OQNA 4NQZA 3PNOA 1XF1A 2I7CA 3RC9A 1AO0A 4UTPA 3CO5A 1F7VA 2O6HA 2HB6A 2B6NA 5LP6C 1EVZA 2PSFA 2OFFA 2WICA 5SV2A 1R8JA 2FWRA 2P2NA 2F3SA 4GR5A 3QIVA 5CH5A 4ZVQA 4MUHA 3NALA 1OWMA 1YQTA 2C82A 3COVA 2XNHA 3L7NA 4L51A 4TLDA 2EFGA 1XVAA 4BVFA 2PJRA 5H59A 4WCVA 2R6R1 1DSSG 2RBGA 5DK6A 2Z08A 1L5QA 3EVBA 3JQGA 1GGHA 1N1GA 4FDMA 3H5RA 3F67A 2EEPA 3PL1A 4CMBA 5LC1A 1NF2A 4O02B 2YFQA 3IXQA 4RLFA 4CGZA 3ROQA 3SZUA 3DTYA 3ADDA 3HYCA 3H19A 1A1SA 1H2AS 1V0JA 4V0OA 1WMFA 3AF0A 3CUTA 3EFHA 3P7MA 2O23A 3VYVA 4XLTA 3CEHA 2OPBA 2CL0X 3V4FA 5KTMA 4I6EA 1SXPA 1PX2A 2XKAA 4ZODA 3PXUA 4UE3S 2TMGA 2D1FA 2HU2A 4UE6A 4B3HA 3ZQ4A 1GG8A 1YGPA 3KL4A 1XHFA 3NHMA 4Z1OA 2ZSAA 1H2EA 4DA7A 1JWBB 4HN2A 2C8KA 2EZTA 4N7JA 1JQEA 2O8FA 4DV7B 4WIAA 4D9KA 3ZWPA 1KTVA 4NFYA 1VE9A 1Z06A 2P3SA 1YZ3A 3O7MA 3OE7D 1ONPA 4YASA 2A94A 2GN6A 1S2OA 4QO7A 2WIGA 4RH0A 5FRDA 4ZC1A 2DHCA 2J0UA 5JYCA 1CULC 3AIIA 3MJEA 3RLFA 2Y76A 3WGLA 4DM4A 1AGYA 2RMKA 1DZ3A 3NTVA 3TSAA 2H2WA 1KO8A 3GLRA 3HMKA 2NSYA 1GKLA 4RA6A 4TKMA 5E6SA 3I04A 3TPCA 1AQUA 1LLUA 1RXCA 3TVTA 4XRRA 2A4MA 1QF7A 1UKEA 3DLCA 3PV0A 1OJ7A 2BHNA 2GKOA 1DT5A 3S2YA 3SHQA 3CX6A 1E2QA 2X0RA 4GPIB 1VGVA 4I8DA 4FR0A 4RF5A 1JFTA 3X2SA 1E5TA 5G3ZA 3OPQA 4II3A 1KYYA 3QVJA 5TQ0B 3KPYA 4GMGA 4JMLA 1PQPA 1T9CA 1AM4D 2DR0A 2NTVA 2O1SA 2OCLA 1U4OA 2LKCA 2WIKA 3HR8A 4LNUA 3LQRA 5E1BA 5THKA 3ZDBA 3OICA 5JNSA 5JBIA 1SXGA 3LWNA 5KTTA 3LHFA 4ENWA 3SE0A 4WKNA 3TOZA 3ECAA 4KO3S 1GV0A 1RPTA 1BROA 2OC4A 3ULKA 4BNVA 1FF9A 2QD1A 4N18A 1SBQA 4REMA 1DU4A 3GUZA 4ZT6A 4KWCA 4LYFA 4DNOA 1P4SA 1QIKA 1U1IA 4UTXA 3FCAA 1A95A 3GT7A 1Z29A 1CLEA 4WPGA 3T5TA 3LXUX 5AW6A 1B0PA 1ORIA 2R7KA 4YJFA 3S8EA 4Z3OA 4A1FA 5H3HA 2X9QA 1KQNA 3H0CA 3UGJA 1NXPA 4IG4A 3LHDA 3SEAA 4WA8A 3DOOA 3LC0A 4UHBA 4EYGA 4KVFA 2VJMB 3RC8A 2I4MA 2FZVA 3AKCA 4TLBA 4MR8B 3HKBA 3AHDA 4WMLA 3T6KA 3HBAA 2FUCA 5C34B 4Q5IA 3UGTA 4C6RA 4IINA 4XGQA 1VSTA 1DBVO 4GRDA 4P4SB 4RY2A 3ZZMA 1GDHA 3IUYA 3JQAD 4WN9B 2OYRA 3JASB 3QWAA 5FBZA 1XT6A 1L7EA 2XBMA 3BXXA 1OX6A 1TAHA 2ID8A 2PYZA 5IN5A 3BE5A 3OEYA 2UXCB 5L6LB 4PSVA 1S9HA 2LRHA 3KXKA 5JZOA 2ORYA 3DXXA 3ORYA 3QTBA 1S01A 4MW5A 2P6RA 1YZVA 4LYEA 1LSUA 3F7MA 3FPGA 1Z2EA 2GDZA 2RK6A 3PGMA 4LGCA 2RGWA 3L07A 1CUEA 1I24A 1L5SA 1NUAA 3GZNB 4OVKA 1EGAA 1RRGA 2WJGA 2ZJ5A 3GEHA 4E31A 4MAFA 5JAPA 4GKKB 1CY0A 2PGJA 3G7UA 3EPRA 1CB7A 3CGGA 4LDPA 2WWYA 4U02A 1UQRA 5EERA 3ZHUA 4C20A 4G0WA 4MW0A 2WT4A 3U4AA 2O48X 4JVNA 1L8QA 2P67A 5GIOE 1NM5C 2WBLC 2B8TA 4UAUA 1ZKDA 2I9KA 3ZVLA 5B55A 2OHOA 2W58A 3ESAA 3ZE2B 4E5VA 1TTHA 2GWHA 1KEVA 3QFSA 1J5PA 1EUYA 3U62A 4X0EA 1M75A 1CYEA 1EGVB 3IEPA 4HX9A 1XU7A 3AEQB 2JJ2D 2QZJA 4GSKA 4K9SA 3QF7A 2WVGA 4JD5A 3BHMA 3CE9A 5I3ZA 1FUEA 4RQBA 1QHHB 4BKPA 4JEMA 5HK8A 2LGJA 4Z7NB 3NJRA 4O2BF 1NYLA 3GCWA 4OSEA 3ZJYA 2Y3IA 4UZFA 2DFNA 1Y3HA 1PL8A 4YHBA 1W5BA 4YGYA 5GJWC 5J40A 3W5AA 1P0MA 1DEAA 3OQMA 4AJ4A 1NMZA 4PPQA 1TZ2A 4RK1A 2ZIUB 4UKDA 3NXSA 4MCHA 2QJOA 3M83A 2YV3A 4OFZA 4YP5A 1NMEA 2FJPA 3V1NA 3EAGA 3UPDA 4B34A 3LPMA 4S0XA 4BEVA 5FL3A 5KYYA 1U8ZA 1LJLA 2J3DA 2DH5A 2WOOA 3PYXA 4KQCA 2Z6VA 5NULA 3TLBA 4G56A 2P0AA 3ZQKA 4LXUA 4TM7A 3F5MA 1NDUA 5FR2A 2WJHA 1CDEA 3D4NA 1YZLA 4HI0E 4JEIA 1AKEA 4JKIA 3UPTA 4A36A 4WLOA 5DI3A 4UZSA 3O31A 4U7DA 4HWTA 3THSA 3U1VA 3ZE9A 4URVR 1GUZA 3V7FA 4EENA 2I2FA 4RHTA 3C85A 1TK3A 1U2TA 2PSSA 3B8EA 1ZYUA 3VR0A 5CIQA 1VI6A 2W71A 4PGHA 4UUAA 3I32A 5KOHB 3W6PA 1A96A 1L4HA 2LIPA 2FZKA 1L7RA 3EZ6A 3OLXA 8LDHA 5LL6P 1SVIA 4JKOA 4QREA 3AEKA 3T7SA 5JRZA 4RTMA 2NO6A 3CT4A 3EPLA 1CR0A 1KYZA 4ZAGA 2QX8A 3R7SA 1TEZA 3JQ9A 4A2WA 2BFEA 1F48A 3F5SA 1G8KA 2V7QD 3KKNA 3D3WB 1Q44A 4HAUA 3EASA 4S05A 3MTBA 1G9SA 5CDHA 5COAA 1RJWA 1Z2AA 2WZQA 3GJTA 4BNDA 3WGJA 4HLUC 4J0QA 1IULA 1YAJA 2QRLA 4AY4A 4U2CA 4EUHA 5K0EA 4KNYA 5JYBA 3E8XA 4C07A 1BJKA 1B42A 1XTKA 4R98A 1MW8X 4OG2A 1IB6A 2P8SA 1Q7RA 2PPVA 3GD5A 3LO5A 4N54A 5HF5A 1E0JA 2W6JA 3I1FA 5BQPA 3QNWA 4MYUA 2OK7A 3CUSA 3IKLA 3OLQA 1L4KA 3V2IA 1HFEL 4G23A 7YASA 4KRGA 1AUOA 1AB6A 4UNQA 1R9GA 1E7QA 2PUTA 5AXAA 2W6OA 3FDZA 3SKYA 3ITEA 1V48A 2FSSA 2FDXA 4DCUA 3CLRC 5BV2P 2EGHA 2BM1A 2GM4A 3EHDA 1M2JA 4IYRA 3FPEA 4HK4A 3OPVA 5CUQA 2AQIA 1JJAA 1TO6A 3BWYA 3I2GA 2FW8A 3CJRA 4YJ2B 1VKJA 4YB8A 5DB4A 4CT0A 2BM8A 3C7KA 2DERA 1EFVA 2WMDA 4MYHA 4GI3A 4AG5A 4AY6A 1B6GA 2FV8A 3PNQA 2PPLA 1KSHA 3TW8B 1E3IA 4CKCB 5JH7F 1CTQA 3NHPA 4JXXA 2GX6A 1C8BA 1KIFA 2BHLA 1JLLB 4XQGA 1I7NA 1S2GA 3DVRX 2IVFA 5C2JB 1MDFA 3EXHC 1CQWA 1H5NA 4IUCS 3WIEA 4YPVA 5JAZA 1R4MB 5CNKA 3UPUA 2C94A 3V2UA 3VR6D 3L02A 4WCDA 2PY6A 5AW1A 1PVDA 2OFOA 1UEJA 4JQSA 4KLNA 1MCZA 1IHOA 2ZJOA 1NZDA 1Y4UA 2YFHA 3HBJA 1C7FA 1BXZA 1B0ZA 1SJ9A 4RJIA 4ZPJA 1PE0A 5I47A 1WD7A 1WPRA 3HU3A 5K0TA 3CLSC 3GLFA 4Q3NA 1OX4A 2AJTA 4ZU1X 3UTCA 1J6UA 2H1CA 5EJ9A 3JQ8A 3AC0A 3HKCB 1MRZA 1QO7A 4RXUA 4EUEA 1NXTA 1U3UA 1FRNA 1PJZA 4PAOA 3Q40A 4G86A 3WAKA 5IARA 1YR8A 4C0AC 2HBYA 3B3GA 1SKMA 1DAFA 1FMJA 3HI4A 4D8UA 3OCXA 4DNQA 5B3LA 5JC8A 5KB3A 3X1WA 4YRPA 1VJCA 1NQOA 2G25A 3T7IA 4JCCA 3AJ9A 2OORC 3E81A 2AOUA 4B71A 1QGED 3L6BA 3DBRB 2DBZA 3V6LA 3JATA 4KN5A 2J5RA 3JQDA 1I4TD 4IQ4A 4YPFA 3SS8A 1E0KA 4JJZA 4UAJA 1YRYE 4W1PA 1MA3A 1YA6A 4KQMA 3OKCA 1DJOA 1MABA 4EKNB 2UZ4A 2VHJA 3SYTA 3HY4A 5FTLA 4NICA 2BFBA 2FSGA 2P9EA 3LBAA 4EATA 2Q5FA 2B7BA 2ZT5A 2FFHA 3IUMA 3TRJA 2FWAA 2IYQA 3N75A 2XXAA 4C5BA 3FBTA 3PLNA 2F17A 4ABYA 4YRSA 1XDBA 2RKWA 3PNPA 3LZCA 4ZYLA 5IJ9A 3QOXA 1GIAA 2J08A 2JC3A 4XEHA 1J5XA 5IP5A 4Q21A 5IVPA 2BZGA 3DT8A 4FCTA 1P73A 4LHWA 5IS2A 3IUJA 3AFOA 4KYTA 1M3SA 1VPTA 5JLJA 2X41A 1G3RA 5LMZA 3VKUA 2P75A 3C5EA 3AGQA 4V0QA 4BVHA 1JH8A 1UBMS 1XZBA 5L3QA 5BMVB 2AOVA 2PVPA 5EKUA 2MSEB 1BWQA 2WMNB 1ZNXA 4RYLA 2WKSA 2C0PA 4HLUA 4NDNE 2XNDD 2XYHA 4UBMA 2HJRA 1WUTA 2I87A 3GLVA 1XJCA 3DB1A 2JGJA 3DYBA 4MA5A 5AJZA 4ETNA 1R50A 2RSLA 3LWDA 2ONKA 4NPCA 5F4ZA 4ZZ2A 3UMJA 1J97A 3CKMA 2B83A 3EARA 3ELYA 1RZ3A 1PW7A 5L95A 1A5AB 5SY9A 4G25A 4LJRA 3WQQA 3WLSA 4MVYA 4IUBS 2CBGA 1DEKA 3GHYA 4M86A 4KX5A 1GPWB 1JJ7A 3KLBA 3MOIA 1D0SA 2AFRA 3MYYA 4LHYA 4OV6B 4UVEA 1OI4A 5FBKA 5A1TA 5KDLA 3DBLA 4O5AA 5LDHA 4UHJA 3CVVA 2GJAA 1EWYA 4BVGA 1ZOSA 3BSSA 2F8LA 1B23P 1M8PA 4DJJA 4DJ5X 2X2FA 1D8AA 5IEJA 3UUWA 2G1UA 4LK2A 3P0IA 3QV1A 3UK1A 2ECFA 5IZCC 2KSQA 1N2JA 2JFOA 3UXHA 3NAGA 5B3KA 1ZJJA 1JHVA 4GL2A 3ICQB 4FYVA 1E3WA 2JEOA 1Z6GA 5ILOA 3GEMA 5AI9A 4KC0A 3P5BA 1QM5A 2HJ9A 4AO6A 3WDLA 4XA8A 1T2UA 1E7YA 1NVEA 3FAZA 3EDQA 4K86A 3GJXC 2H1FA 1FMFA 2IOHA 1IM5A 1PQUA 1L1QA 2JZOA 1YZTA 2PFGA 1H23A 2Q49A 2QRQA 3MB5A 4IJKA 3I1JA 4JLJA 3V00A 1HDEA 3RYIB 3S2UA 1SVUA 4H3VA 3P4UA 4OP3A 3JXEA 1KSGA 4H1WA 1WUHS 3W9YA 1GLNA 1M7GA 2R1UA 2V6FA 2YV2A 1UJNA 1QU2A 1TQ8A 4P81A 2QTAA 1QQ6A 4DXHA 3WOHA 1B26A 1YA8A 2B8JA 3KKEA 1VPLA 4QUIA 1SZCA 1EVEA 2OORA 3EVGA 1CG6A 2VTKA 3ZV5A 2ZCUA 1IIRA 4EA6A 3U4QB 2QN7A 1DAIA 2DUMA 5IM5A 2QTRA 4W6QA 1L5NA 4N40A 5GV8A 1YR7A 1XRSB 1I3NA 5JADA 3E8SA 2EG9A 2GPJA 2FPMA 3Q1KA 2V7XA 2DLNA 2ARKA 3S1AA 1WMEA 1CU1A 5B7GA 4C89A 2DQYA 4QFDA 3CRRA 3DYIA 1NLUA 1ZIDA 4MUYA 3OZIA 4NATA 1DBSA 3HR4A 4OP1A 5AIBA 1SA0A 2FOIA 1GV1A 2M6RA 2FMXA 5BOSA 3GNLA 2QV0A 3DEJA 1IQUA 1NAHA 3BKXA 4L78A 3U61B 4BVJA 3TZLA 3T9DA 1UBGA 5KYVA 3GLHA 2AC2A 1K75A 3WNBA 4I46A 4CEJB 2RAFA 1MT3A 2JIMA 2V7GA 5FNZA 4RHCA 5GJCA 4F6RB 2YKGA 2X6RA 3DW1X 4TV9F 4C2BA 1C9JA 1L4EA 2YIMA 3BCRA 2YICA 3HFGA 3W5UA 4QU5A 5IPFA 5EFZA 3KC2A 5AIAA 1YD7A 3V32A 2JFHA 3ABZA 4TYNA 1I3OA 1Q20A 4FKMA 1G8GA 3L7MA 3GMSA 4PX3A 3FHJA 1KAMA 2IYOA 4FHEA 1E4EA 4HRAA 3KYJB 1ABFA 1EFPB 5JG7A 2Z2IA 3FOFC 2VJKA 3LLUA 3RI3A 1IH8A 4KQIA 2Q3LA 1KJ8A 4BNZA 3DD1A 1QHSA 4HX5A 2QKYA 1Y3CE 2R48A 1G5FA 2Q5QA 4TVSA 4HZUA 2OLEA 2GVNA 4FE3A 1A9XB 4J07A 2D1YA 1BMFA 2KE5A 2QIOA 3PNKA 4MZDA 1UAYA 3TAHA 1LDGA 4PX5A 1S96A 1WHTB 3OURA 4FYYA 2YYAA 3DE7X 3QK7A 4MRVA 4UFPA 4V1CI 4IIDA 1Z2OX 3BE4A 2FFAA 1C9NA 2GJKA 5TF0A 5EJ4A 3O1JC 2BFCA 3HDJA 4Q02A 1T4CA 2R7NA 4HD8A 3IJPA 4O6VA 1KFKB 3TRHA 4E2FA 1BHJA 2VAXA 4E2YA 1FX0A 3KEOA 4RMGA 5CD1A 3O95A 4NBUA 3IODA 1UP7A 1O97D 1F9EA 5FULA 5HE8A 3RYCB 5JALA 3G2LA 4B76A 1T2FA 3OA2A 3H4IA 4IXWA 4YIKA 4L85A 3URKA 4U9UA 3HBFA 5FV4A 1JEEA 4YBZA 3DTTA 2Q3JA 2XQIA 4HBGA 3HTXA 1XTSA 2EF0A 4CEHA 5SZKB 3KALA 1XCMA 1PUJA 2W00A 5C8VA 2H5IA 3BXEA 2HMAA 3AR6A 3M9LA 1EAYA 4Q01A 3GFSA 1QGZA 3KUUA 4PLYA 3GGPA 1LGYA 4OQYA 2VQDA 5JI2E 1EESA 2YYSA 1SWWA 3HCPA 3O73A 2PBRA 2QVBA 1U2GA 1YR1A 3B1WA 2CVQA 3UCXA 2P90A 3FKSA 3EXFA 3O4IA 4Y2HA 4GQIA 2XUGA 3C7AA 2HWXA 4IV5A 1F2UA 2DTEA 1JE0A 4Z5XA 3KQLA 3DT9A 4KDEA 1TF5A 4BYGA 1Q1AA 4QUKA 3VPDA 1P4GA 1UBOS 2GCGA 3EMKA 2EJCA 4Q3DA 4J7XA 1DPGA 3M6AA 4YP1A 3EVZA 5L3ZA 3QOFA 5AK5A 4QVGA 1D4FA 1I13A 2OXCA 3L40A 3CBQA 3CG4A 3DV9A 1K4YA 4IW3B 4IS3A 4L9AA 4DIKA 4C7OA 1IEWA 3PL5A 1P72A 1E32A 2CSUA 4YNBA 2K4MA 3QMPA 2O3JA 4RKFA 2INGX 4K6MA 4HFRA 1XZEA 5ARCA 1JLSA 2QZZA 3F2VA 2WA1A 2FMFA 1YK1A 2QRKA 3AT1A 1JRLA 3PSHA 2IF2A 3HVRA 1LPSA 1JVBA 1WE2A 3SSNA 2CJWB 3A1WA 3HHPA 2GZRA 1LSJA 1PG2A 4JL5A 1YRWA 3CLUD 3FCOA 1E6UA 1CZLA 4BATA 1GHTA 2PKWA 4RWZA 5LKRA 5ITSA 5C7LO 1U4SA 4UJ3A 2ZYVX 4M9QA 3G2NA 5KOJB 3B2EA 4JLOA 2JD2A 5IKPA 5BNIA 3WK6A 2B82A 3QWBA 1I0ZA 4M1MA 2LDBA 3GT4A 1U3FA 2BKLA 2E4ZA 3R2JA 1WDWB 1FFXB 4RSHA 4U1RA 3FWNA 3ELBA 5IUJC 2F9LA 1J9ZA 4OQDA 4ZYUA 2A5GA 2ZAOA 5BURA 4P0PB 1XROA 1XV5A 1CEYA 4AU1A 4LRTB 1FDWA 3TXYA 1ZZGA 1DWOA 4IY1A 3IUNA 1Z5WA 3AMVA 3HB1A 1NBME 4A8HA 3VU9A 5K3SA 3X1YA 2FW6A 5FUBA 4Y9DA 3TLEA 3QQPA 1CUBA 3KE9A 4ND5A 2DKOA 5E7JA 3AEXA 2VJQA 2AF4C 2WU8A 3GB9A 4FJ2A 5F5NA 2AUNA 2XD9A 1MC1A 4RJ2A 3WI7A 2FWPA 2VDKB 1NIPA 3FSRA 4LKOA 1KSFX 3C3JA 5BSGA 4JU9A 5A3QA 4TMZA 1KDTA 4DEXA 3U0VA 3IAM6 1W4ZA 2R3SA 3BE8A 4IIJB 1DAHA 4QXAA 1QP7A 1PGPA 1D6MA 4XSHA 4OO3A 4AN1A 4EYEA 4X64B 4ZIRA 2QZ9A 4JZKA 3TBHA 5HKKD 3FSGA 3NZEA 3SK0A 3MIIA 4Y9SA 3M6XA 3HCEA 5FR1A 1WXIA 3GA0A 4LJYA 5BN3B 2YNMA 3D6VA 4DM3A 1G19A 5I9LA 5C7YA 4CU5A 2I34A 3L0SA 1HBJA 2P65A 3BH7A 4A4DA 2YHSA 2RH8A 5ELXA 2PGDA 4TL8A 1OXUA 4E2XA 3D9QX 5HKAA 4FWTA 3AJDA 1Z0ZA 1JF8A 3KDSE 3JYHA 4YLYA 1J22A 4Z53A 5GINE 1FA9A 5EQFA 4XSGA 4LRQA 1UXGA 2PR7A 1R6BX 4NH0A 5KPJA 1M2KA 1G20B 1UH5A 2C4UA 3PTLA 4IVPA 4YAGA 4YDQA 2Q6TA 1OXMA 3LZDA 1NXVA 3A1SA 4FBLA 1QCYA 2C4HA 2OB1A 5IHPA 5JNRA 5EXDA 2E82A 4RVFA 2H65A 4BMCA 1DXQA 3R8CA 3OIFA 5JD4A 4ISCA 4WK4B 2JANA 3IMGA 4D4KA 1GL7A 2PZFA 2DFLA 3OPNA 1K5PA 3UTDA 1WO8A 1WA5A 4FFBA 5MGBA 1JT9A 3VJKA 1B3BA 4HNRA 1W44A 1WXHA 2L82A 4O25A 3IQFA 1CQXA 4YP6A 3E70C 1XXHB 1Z5OA 2C8LA 1JLKA 3HEAA 4BQIA 1BVHA 5CCXA 2XI4A 3ELWA 1P1IA 1MTZA 1U1GA 3SC2B 1TCUA 4JKYA 2Q46A 2QVCA 1R3UA 2FN7A 2V0NA 3L93A 4KI0A 3RRFA 1C0LA 2JGDB 1XRPA 3UIEA 1I3LA 4PQRA 4CTMA 1QQ5A 5A7FA 5JU6A 2VA9A 3D4BA 3I3OA 1TTPB 4E6PA 5ES4B 3B6KA 3C15C 5DM1A 4EY7A 1AK2A 3ND5A 3MRXA 1E5QA 2CVPA 5FLXA 5CEJA 1CQPA 3DBIA 3X1JA 1QHYA 1YS7A 2VYNA 3AV0B 4GOLD 4H27A 1ZRMA 2OHGA 2IV7A 3GUHA 3ZPXA 2P3QA 2QRVB 4KQFA 5TQ2A 4O3MA 5EY5B 3ZC3A 1V8FA 3VUFA 3BFPA 4C87A 5EUQB 3OJWA 1JYFA 4EF4A 2NSHA 1GA1A 4MV1A 1WHSA 3AVVA 3I9FA 4Z99A 3I04M 4X84A 5CJJA 5I9MA 3VNRA 4G07A 1FNNA 3P9PA 5L7YA 1ULSA 3SOZA 2GXSA 2AI2A 4HDSA 4PC7A 3T9CA 4BGVA 2ZZMA 5F2KA 3AEUA 3VZPA 2ABWA 4UUMA 3MJSA 4DL9A 4EEXA 1W8DA 4CQNA 4EHAA 3LOPA 2W6CX 2BM9A 3KTFA 2YMPA 4M0EA 4MQ4A 4YWHA 2DJIA 5EVJA 4BWVA 4P4GA 3UM9A 1UWLA 1KZ4A 3LM8A 2EW1A 1MX1A 4B7UA 4PICA 2FGKA 1ONSA 2C88A 4PR3A 3TF5A 3VZBA 2P69A 1HWYA 1YOBA 4BMYA 3VYRB 1SCKA 4QJIA 5CK4A 6PFKA 2WB2A 1VSQA 4DT1B 4QOSA 4EW3A 2EQBA 1FFGA 4RHXA 3HVIA 4Q18A 5B4VA 3NC1C 1NJ1A 4ZOEA 4BUJA 3EVEA 1OBFO 2AMVA 3FFBA 3K6KA 3VI4B 2Z6UA 3EWSA 3H3XA 4UVIA 2NNWB 1Z34A 2BSQA 4R2JA 3V8BA 4JR1A 4RHUA 2GBLC 1HQDA 4I9FA 3OLCX 1REQA 3K6RA 3KOOA 4HFJA 4MRPA 4Q05A 3DMHA 3EF3A 1Q3HA 1D07A 1GAJA 4Z3DA 1DAMA 3VDRA 3SU8A 4EG8A 5CDGA 4FEEA 4UXJA 3O84A 1JQLB 2XUJA 4BCCA 3M7IA 1YT5A 1CY4A 3HJTA 1PGNA 4IO1A 2V3CC 4AX4A 3DDZX 4ZRMA 1BU5A 2NAPA 3Q41A 4UDNA 3U1BA 3BUSA 3W2EA 4OLFA 3BXPA 1K3UB 5IJWA 2PCJA 5CB6A 3PDJA 4RQAA 3DA8A 4X3CA 4AAYA 4XDGA 3GQVA 1MHPA 3ZLJA 3ICOA 4HZIA 3U9SA 1T0UA 4MRRA 5HUQA 1XA4A 4DLKA 3FTQA 2CXTA 3FR7A 1NLFA 4KE8A 2ZITA 1W1WA 3ON5A 1N3LA 3PJRA 2QXYA