1UC4B

Structure of diol dehydratase complexed with (s)-1,2-propanediol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
b'GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diol dehydrase alpha subunit
molecule tags Lyase
source organism Klebsiella oxytoca
publication title Structural rationalization for the lack of stereospecificity in coenzyme B12-dependent diol dehydratase
pubmed doi rcsb
total genus 63
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1uc4B00
1NBWB 1UC5B 3BRCA 5D5PA 1EGMB 3WB1A 2D0PB 1IWPB 1DIOB 3AUJB 3WB2A 3WB0A 1MMFB 1IWBB 5D5QA 1UC4B 1EEXB 1EGVB 2D0OB
chains in the Genus database with same CATH superfamily
4ZQCB 1N0VC 1QGUB 2OBNA 3G6KA 4RA9A 2GZ2A 4ARUA 1UZMA 4GLJA 4D43A 5FUQA 2CNWA 3BMNB 3OX1A 1E6EA 4QLBA 5MN5A 2I2CA 1WPQA 4YPVA 7YASA 1D6SA 2LP4Y 4D3YA 1QKKA 1AO0A 1V1MB 3VU0A 4UNRA 3QMWA 2QTGA 1IG3A 1E4OA 3CR3C 2W8BB 1N57A 1V6CA 1X1EA 1WHSA 2FI1A 4TM7A 3C6MA 4X63A 2Y1DA 4E5PA 4EQ6B 4F4HA 3WAGA 1IG0A 4WOJA 1HDIA 2WIGA 4E22A 4GMKA 3GI1A 3JQ8A 3AF1A 3NHWA 1GCIA 1SBTA 1E2MA 2GD6A 3T3NA 3EPHA 3WRYC 1ZAKA 4GS5A 4PS0A 5SY4A 2RB5A 1CDDA 1Z2PX 4X20A 3PQ5A 3CJRA 4JYZA 4GP9A 5JZSA 3VA7A 3HSSA 1KBQA 2YZ2A 2YNMA 3W5SA 1I4LD 4QVKA 4P4UA 4Q19A 4BEJA 3FPHA 2HT6A 1QCZA 3CF4A 4CMBA 2G1AA 1IMOA 2ZIEA 3UK2A 4MMZB 1DAOA 2X4LA 1I4DD 1B1AA 1RW4A 3ODGA 3ANMA 3Q41A 5E9WA 3HU5A 4EECA 3V4OA 4ESOA 5C80A 5JJIA 5AW7A 4R8MA 2LW7A 1BS9A 1JPJA 4OGFA 5AJHA 1A97A 4LFCB 1US8A 4BNGA 1GARA 4G0MA 4KNVA 1M8FA 2DZDA 4XRRA 3LT2A 4BGDA 1IXYA 4ZT4A 1RM0A 4I0WB 1WMAA 1JIJA 5FXMA 5HK8A 2PHZA 4MVXA 2VZEA 4KNWA 2XXBA 3JYPA 4MVJA 1T4CA 1F8GA 4JLJA 2AKEA 1VL6A 4BBAA 3RIMA 3C70A 4KQ6A 1QK5A 4DLZA 1UQRA 4Z0HO 4DCTA 1O9GA 1R0WA 1WTCA 1QH1A 3RVOA 1N6NA 1XNGA 3OZ7A 5DTMA 2G0AA 4P93A 1MDFA 4E5VA 1DNPA 1SPXA 3N07A 2YRXA 4QYTA 5SZIA 3MXOA 3X2FA 4B6SA 4BMYA 3LLVA 2WJIA 4Y98A 2HF7A 3WHKA 5CLQA 3DFIA 1SGWA 2MSKA 2XKAA 1EX9A 5F1OA 4IDOA 3WGUA 1ZD8A 4QO8A 3FWZA 5JNVA 1G98A 2OB1A 2P5UA 2H4FA 2XA1A 1GCUA 3H11B 3MCVA 1H2FA 1FNNA 4ED9A 4Z49A 2V7PA 3ZW7A 1VL1A 4TLMB 3ZGNA 5LVAA 5BY2A 3U6KA 1HYEA 1XRJA 3BA1A 3PC3A 2X2EA 1Z13A 2JBHA 3Q15C 3L9WA 4PZYA 3V1LA 2FP3A 3KKKA 2HGZA 3E3NA 3D6AA 3NKVA 5JS2A 3WIBA 2OLEA 3F74A 3VOTA 1TKAA 4AF6A 4DMRA 2YV3A 5FV4A 4WN3A 2RBEA 3A27A 3EXFA 1ZU5A 2VHEA 2YWFA 1WCIA 2DPYA 3P9SA 5EHIA 3QVOA 3S2SA 1VKHA 1VLJA 2VK4A 1GTSA 1HBJA 4TYMA 3SYNA 5L3RA 2MJLA 3KLMX 2YQ5A 4V0LA 5B5SA 1AQNA 3B36A 3QI7A 2J9RA 3M0EA 2X41A 2FPMA 5B2ZA 2ADOA 1K06A 2C8LA 4ROSA 3SOZA 3TSWA 3WK4A 4DGSA 1GPUA 2Y66A 4AUKA 4UATA 1NPTO 3H6HA 2ZUSA 3DOUA 3E2IA 3Q10A 4ACAA 2Q7XA 3B6KA 4JJ8A 5TGTA 3BQNB 3UT5B 2LE0A 3KWLA 3T9BA 1B41A 3UAXA 4ZGWA 2QT0A 1OB5A 2HRRA 3RVLA 4I1IA 1J0AA 5HJ7A 1OAOC 1N1GA 2B30A 2NXCA 4PTYA 1TF2A 5DLPA 1RBMA 2QRNA 3ESDA 3ROFA 2C88A 1C41A 3KZCA 4ZQGA 4AY5A 4B3BA 1KU6A 2JIQA 2ZYUX 3BMNA 2HOQA 3GJ5A 1U11A 4RK7A 4A6EA 4F04A 3QM1A 3QU2A 1A9PA 2VF7A 3QWIA 4S1OA 4W99A 4UE6A 1ORVA 2D1RA 3O8QB 2DBQA 1IHPA 2CSUA 5E6RA 5T8KA 1TZ2A 2FA9A 2ZJ8A 4J43A 3ZHOA 1KDOA 3PLRA 1U0GA 3H4IA 3Q12A 1R18A 2O8BA 4YAWA 1YRBA 2DX7A 1QQAA 4R1TA 1G8AA 2HY7A 3IBSA 4HYTA 1R9GA 3RFTA 5FI1B 2ZYGA 5I3ZA 2QRMA 1AGPA 1N32B 3VFDA 2C20A 4EX6A 1IHDA 1YCHA 4LJAA 1QK4A 2CLHB 2HKIA 1KYZA 1CUXA 1FDSA 4DA9A 5JCJD 5KYXB 1S2DA 2H7XA 2WWWA 2Y76A 4L3VA 3JD1A 1FE8A 2VJQA 2QN1A 1UKEA 4G0XA 5CURA 4A03A 2WRZA 1ONNA 1YVDA 2XT0A 4E09A 1QANA 2I34A 5D3QA 2I22A 3T3PB 2DLDA 1EGMB 1NFQA 1OCEA 5KHLB 1MCZA 3GD7A 3I6YA 1EWVA 3GRPA 4UUNA 5IMBA 1KZHA 4CKZA 3EXAA 5JZ9A 3RVSA 3IQHX 1ZCFA 1UXOA 5L40A 4Q3BA 1ISIA 1TK9A 2BGKA 2AZTA 2RGNC 1JEEA 4GPBA 4WIAA 1R9NA 3OLVA 2YDXA 3BWYA 3G0OA 3Q3JB 3KSMA 4RX1A 5MF6A 1JDJA 2WAMA 3K96A 5LNK6 2R8PA 4MA5A 3JPWA 2QAGC 2OTCA 3UQYS 2IU4A 3WVNA 2ZATA 2HD4A 1E7MA 1I2AA 5HMLA 3KQSA 1YMUA 4O3MA 3CKMA 2Q5CA 4DIFA 4KQ2A 5AVRA 1HKUA 4FPXA 3QU7A 4HZGA 3RO7A 2SNIE 4AWXA 2W70A 1FZTA 1HT3A 2A7XA 1TCAA 3GZJA 2QWXA 3DV2A 4IVNA 4YAKA 5BNIA 2ZITA 1YS6A 4GOOD 4RGBA 5BSTA 4XDGA 4LAFA 1PEAA 1TA9A 1WHTB 1VG9B 3WLNA 2P2GA 4KYVA 3KLOA 5COQA 3H05A 3G9ZA 2QGFA 3S7TA 4DUZB 4C7OB 3W5JA 1Q74A 1H1LA 2FWAA 1V3UA 3QXSA 4M0UA 3VDNB 5ITVA 2PKEA 1JH9A 3LP8A 1WBDA 3IQIX 1GNPA 1WDTA 2ZOSA 4HOYA 4BVKA 1T1RA 4QATA 3GGGA 2DBRA 3L8YA 3M1YA 5CG1A 4CG3A 4OQ4A 3NNDA 4XVHA 1QFMA 4OFWA 5I48A 1R8YA 4FDLA 4O4JA 1Y9AA 3C3WA 1XJWA 4J16C 2A6PA 3GY0A 4KLZA 1NASA 4IFIA 3R3UA 5D87A 1NSTA 5FOXA 2O57A 4PXAA 1P61B 4BHTA 1L1EA 2HWYA 4N7RA 4F9EA 2HHCA 1ZVKA 3QVSA 1FTGA 5KI6A 5BXYA 5K0BA 5J2TF 3FZGA 2BM0A 1Q44A 1DOAA 2PMCA 2X5JO 3EPRA 4L22A 4YREA 2G7MC 4MKRA 4BFZA 3H4VA 1T2VA 1ZRMA 4U6QA 1D8AA 4ZDKA 2H7VA 2ZRFA 2VHXA 3CLHA 1B23P 1HC7A 1OA1A 2YWCA 1V6SA 4NQRA 4OQPA 4U7PB 4B4DA 4YUXA 3IR6A 2IBSA 4H59A 3OIVA 4RXMA 4H7HA 5JQGF 3ZDQA 5CA1A 3BJZA 2EOAA 3W78A 3WL5A 4CI0B 3L8CA 2JHAA 1DIAA 1TQDA 1YS1X 3LQRA 1SUIA 2BFFB 5E7IA 4IEEA 5L3QA 4TTVA 1OXMA 1ZNQO 1BCRB 1Z4NA 1H42A 3GFTA 2A2ZA 2OVBA 3NC0C 2HT1A 1OJ7A 4PG4A 3U4QA 2EFJA 1KERA 3H04A 3E4CA 3E22B 2YJ4A 3K31A 1OA0A 3F7OA 1H2YA 4U2EA 1MB0A 2J87A 4UCQA 3W4JA 4UCXA 2VZ9A 4G5OA 2I76A 3PQ7A 4DLYA 1GQRA 6GPBA 1GTJ1 2PBFA 2FZGA 4IQGA 3IRVA 2FEOA 1AKVA 1PEYA 2BFNA 5KVCA 4GI3A 1UBMS 3HUDA 3V8NA 1SVOA 3HFGA 1DPFA 3A2NA 3RVPA 3A06A 5DGIA 2DHQA 2QM7A 1ESEA 1EEHA 4M21A 4LPSA 3T8YA 3GLGB 3UATA 2IYOA 4R69A 4OHWA 5JBIA 3M83A 2XQGA 5CDTA 3P2IA 4MKIA 4MLZA 5K0NA 2HXYA 4GEGA 4MB2A 4DJDC 3EXG1 3D6UA 1N0IA 2B1GA 1Q0UA 1Y7IA 1ZIDA 2IHVA 2JIDA 2W2LD 1CQPA 1E63A 1N3IA 1R6DA 1PZMA 1TUGA 2GKGA 1VMIA 3MG9A 2W6PA 1Z0ZA 2YMPA 3ITDA 5B7NA 2X14A 4U2GA 1I2BA 1JWLA 2X3FA 4TTQA 3Q3IA 3I9OA 4OX9B 1V41E 1MO6A 1ORRA 2VLBA 3EDCA 3HDTA 3GJ8A 3U80A 4BLSA 1L5HB 3EA5A 4GQIA 4YAOA 2ZYAA 5BVHB 2CHGA 2F3TA 5FTNA 1UT8A 4LDAA 1PL0A 5FQNA 2ZE8A 3PJEA 5E1BA 2PR7A 2BM1A 1XKQA 2ZBVA 4BO8A 1TCCA 3PG5A 4YWJA 4E03A 1Q50A 4OYYA 4UULA 4FHGA 4GZ5A 1G5IA 2WUDA 4DMMA 5C32A 2A33A 4MA4A 2ZSIA 2HIHA 3A4VA 3E27A 4YRCA 1PG0A 1NKVA 5DHAA 3W7AA 5LN1A 4HQRA 2V7UA 5CX4A 3OPQA 5FHQA 4RZQA 4N9QA 3TEFA 1KY4A 1THZA 3BFVA 2WK1A 2OM6A 2G4LA 3RS5A 1K68A 2A0XA 5I9BA 5E6SB 2NX2A 3N2KB 1SCDA 1U5BB 7AT1A 2ICAA 1D4ZA 2C7QA 1QH1B 4HX5A 4A82A 3CF6R 1JEDA 3INRA 2DFDA 3GF4A 1KMHA 3BDVA 2NO5A 4FE4A 3RRJA 3VNBA 2R97A 2CLIB 4HWPA 1Y3HA 1EM6A 3CC8A 4W9MC 4KRGA 2M32A 3PJFA 2YL2A 1N5KA 4TPKA 5BUZA 1QGOA 3KQUA 2Y99A 1SIWA 5FWXB 2AYXA 4PHHA 1QYVA 2J6CA 1N34B 4YGYA 1VL0A 3OFJA 3AOGA 4F3RA 1BSVA 2RFLA 4XGKA 5KTMA 4J6FA 4FYJA 4MWBA 4ZEVA 4ZYLA 4O2BB 4QAQA 3WYEA 4BMDA 4CNQA 3N76A 1J23A 1PYGA 1PFVA 5F4BA 5KCZA 1XPRA 1JXAA 2WUFA 3DWEX 1XTBA 3RUPA 4HDMA 4B4UA 3UXEA 3OTWA 2FFBA 1X74A 3D3JA 3G8DA 3COWA 3QEJA 3TS1A 4B6GA 4DCCA 1ZKMA 4JBLA 3GA0A 1UZUA 3B3JA 3ROMA 3UYKA 4RH3A 1E2HA 1OFGA 4X1IA 1U0BB 5DULA 1K7FB 1SG9A 3F7TA 4QXRA 4TWBA 1J8YF 2EL9A 3TTVA 5FFFA 4URWR 3MOSA 4YCSA 1FK8A 1M3SA 3PXBA 5D00A 1DUVG 2GJSA 5L3SA 3BT7A 1LLCA 3LY7A 1YQGA 4WEQA 1JSCA 1TM5E 4JP2A 4N0PA 4IV5A 2G5PA 3V4ZA 2YOFA 1M1ZA 4WK0B 3NZEA 4L0MA 1B93A 4DLBA 3LE8A 3GEPA 2LR0A 1XA4A 4P4TA 4MVJM 4ZICA 1VIMA 3OJ0A 1RYBA 4ZYYA 2CCGA 1K86A 4NWIA 1GTZA 1DO8A 5B1HA 3IAS1 3DKIA 1DWQA 2RHTA 5HXAA 1MUUA 1XXHA 3K70D 1QE3A 1AU9A 1P3DA 4MUFA 1YTUA 2KPOA 3VDRA 1Y81A 4LQLA 4TLLB 2NSHA 3F7NA 4X97A 5EKUA 2JJYA 4UMFA 3CE6A 3LCVB 4Z3OA 2CFOA 2I4MA 2PMBA 3LV8A 4E46A 4P38A 3T7EA 5EVJA 3TCKA 4IIJB 4NY1A 2Y6VA 2YWBA 5LBTA 3HHPA 4CKEB 4YRKA 5B57C 5HKBA 3TF5A 16PKA 3UC5A 4E5MA 1PZHA 3W2FA 1V8BA 3U7JA 2PMFA 3EAGA 1NP7A 1KJNA 1R27A 2O50A 3NYIA 5LJIA 4AN4A 4D4GA 3EXHB 3ROGA 2PGAA 3AC0A 1CQWA 3OECA 4NAVA 3HADA 2H9AA 4YP7A 4CMIB 2GPBA 3T9EA 1YQTA 1OLXA 2L0XA 2OOKA 3C43A 5GPBA 1QP4A 3RODA 4ER5A 1KOJA 4UXIA 3KE9A 3THYB 4KN8A 1AHIA 2C42A 1TCVA 4Q7LA 3L04A 5KCMA 1P0CA 2XUFA 1RSZA 4EZIA 1GG5A 2OYCA 5FPYA 2W8ZA 1FTSA 3RLFA 5AH0A 3RVMA 1E69A 2GLUA 1EFTA 1V7ZA 2C5HA 2JCBA 3DF9A 3EMBA 3I9LA 3NWEA 4OBWA 3BRSA 2QRQA 4CM7A 1N25A 4KE7A 1NRWA 1FPMA 1P4JA 2HQOA 4KXWA 5ER9A 3VSCA 5L4NA 4DVJA 4NE9A 4C78A 2BMDA 4TWJA 1PT7A 1EUZA 1C5KA 2IGBA 4GYJA 1W0JA 4TSFA 4H60A 3SSAA 3A9WA 2NTNA 4JT8A 2WJPA 3IAAA 5EJEA 3DVQX 1AS0A 1WG8A 3GGCA 2P6OA 4L4SA 3CWCA 1XLUA 2Z04A 4JB3A 4NKRA 4LX8A 8LDHA 1ZISA 1R4MB 1C0IA 4Q1DA 4JELA 3REOA 3DYIA 5NLLA 3M6AA 4WOPA 3AJ8A 4R54A 4W5TA 5KYWB 3QZUA 3G9UA 3PQ6A 3Q3EA 4JJ6A 4B43A 1YULA 1IZYA 4MI6A 3F1KA 1A5SB 3GH3A 1F2TA 2Z4RA 3TZBA 4JN6B 2W2TA 3DE1X 3OIYA 4OK6A 4OQLA 1MEJA 4IUDS 3ANSA 3NOXA 2IC5A 4MIEA 4NMMA 5AOBA 2G9NA 1UAAA 1L5GB 4HAWA 3I32A 3KEGA 1EX1A 2DHDA 3OFSA 1LVUA 3OZVA 3GLUA 2QM3A 4HGYA 2PUEA 3GFQA 4MUYA 4O2AB 5T4BA 1NA5A 1X8KA 3ONWA 3PRKE 3R8CA 3RC2A 4AJ2A 1UODA 4C43A 4HNTA 4BUZA 1Y1RA 3CBQA 4GWKA 2WILA 2FPUA 1IXRC 3ICOA 2G4CA 5JMOA 3A25A 1TTHA 4HBGA 1GLGA 4C0BA 4ZZ0A 5KTNA 1ZM7A 3K30A 4ZODA 4UW9A 1TK3A 3UZUA 3RUDA 2OCYC 3FG9A 3KJZA 2VQSA 3PC8C 3OHPA 3OPYA 4I55F 5CVTA 3BTVA 4AUMA 4D0GA 2C2OA 1C1YA 5CDFE 1ZN2A 2EW8A 3OQVA 4YASA 3LDAA 4LYAA 2F1OA 3LP6A 3T3OA 2GB4A 1CXZA 3X1YA 1JJVA 3C2QA 1KMMA 4URFA 4Z9YA 3EQ6A 1A27A 2RGWA 1C2TA 4CLOA 1GPNA 1F8UA 2QRPA 3WP1B 2F2TA 4AM8A 3KJEA 3IQGX 2QLMA 2VJYA 4EH1A 5ALQA 4MP8A 1E2NA 2XDWA 4LK2A 3QA3E 4GKKB 4BZXA 4HPWA 1DEXA 5AKIA 3RRMA 1FRFS 4HDSA 1X7HA 2R1TB 3RIGA 4RD2A 2ERYA 1YKFA 1DSSG 1RXWA 5KX5F 2VK1A 1FNDA 1T9BA 4DLWA 4V2UA 1A9QA 4NIMA 4IJKA 3SYLA 1QZZA 3TYXA 3G5LA 4A6PA 1X42A 1KEUA 1ACMA 5D5HA 3J80A 1N3YA 4L28A 4BFVA 1MF7A 3NOOA 1NBHA 4IIJA 2ZPUA 2J30A 2JGDA 3DP7A 4GT1A 1WZNA 2JFBA 1KKUA 2JI9A 4YCDA 1F17A 1ZL0A 3M6UA 1KH2A 3PWTA 1JFSA 3HGTA 3BL5A 4CDGA 4HX2A 3TLGB 5J2UF 3ZCTA 2YJZA 4HKTA 1I94B 3NAMA 4J07A 3NBMA 4ND7A 2BSQA 2Q4DA 4GHWA 5CX1A 4KOEC 4YK7A 1R0CA 3LQYA 4HRXA 5ICGA 1OLUB 5HF9A 5HFNA 4CCSA 4BX8A 3UTCA 3RJ9A 3F5SA 4MVJI 3T4XA 2Q8PA 3WQRA 3QIAA 2G7ZA 2QN6A 4ER0A 5CLGA 1VZ2A 4GD3Q 1F5SA 2V03A 3KTOA 4Z8XA 3V7NA 3BGIA 4LYFA 3OZCA 1A5AB 1M8JA 4KQCA 4NMWA 5HBGA 3E1SA 4JVMA 4BNVA 4PQFA 5L3QB 3OCUA 1QDEA 1Y9EA 1YGPA 2BPOA 3GP8A 1NNLA 1TA4A 3LNTA 4KR7A 3ZGLA 3W34A 1M1NA 4C29A 2HV9A 1OXSC 5JRJA 1SXPA 3P9YA 1EX7A 2QRJA 5CDFA 1BQ4A 1OAOA 1Y3FE 3LHFA 2E87A 1KNQA 4GVPA 2XMZA 3V8RA 3FKSD 1JFTA 1K7EB 1WP4A 1YKSA 2H59A 2XUZA 4ZAFA 1XMOB 3M6VA 2NIPA 4UXHA 5A9RA 5A7GA 4D3FA 4MHSA 4Q05A 5JIBA 3FPEA 4W1QA 3U7QB 1NN0A 2ZI4A 4D0NA 3WL6A 1QZTA 4QYMA 1EG7A 3IYLW 1Q0HA 1BWQA 2WF8A 1R8JA 2I9KA 2WPDD 1AB6A 5EWMB 4GX2A 4AN0A 1WB4A 6LDHA 3Q4GA 4C4SA 3D9QX 4F5YA 3LX8A 4XX1A 2XRFA 3RSOA 4FQ5A 3JQ9C 4TTIA 4WNAB 1CY6A 3SC2A 2XE8A 2WM3A 4LG1A 3AW9A 3T0FA 1S0UA 1HT0A 5DIZA 4CM8B 2V3VA 1GFIA 3KTFA 2JLRA 4FUTA 1GOTA 1Y7HA 3VBCA 1L9XA 4UJ3A 3L46A 1QHYA 4R8RA 5A6SA 4C7OA 1WE2A 1U2RA 3WRVA 4KO8A 2X6QA 3E7PA 1C4WA 4RE6A 3GL9A 4DWWA 1T91A 2IU3A 2WNHA 3I39X 4BMSA 2HMWA 2OV2A 5BN5B 1Q92A 3C7KA 3DVRX 2B4YA 3WXMA 3CT6A 1Z6PA 2XOXA 4ZEWA 1MC4A 4BMPB 1AM4D 3S8YA 2AOWA 5LPNA 5LZ7A 3GLFA 2J5KA 1ZGBA 4Y6RA 2OQVA 4BAZA 2ZK7A 1MN6A 2CZCA 3LA8A 3NPAA 4CMEC 4P5PA 1BQ3A 2QUBA 3KXLA 4P7GA 4RF4A 1SXGA 4CG1A 4RTPA 3JAWA 1DT5A 1OU0A 2JLAA 3DGEC 5ALLA 3TB4A 3U60B 3W6PA 4G0OA 4R2MA 2BH9A 2NZ8A 3HRIA 4BNLA 4DMLA 3C7DB 1TDJA 2FPIA 4ZEOA 2AR9A 3CG4A 4P22A 1X39A 3E2PA 1KDTA 3VVMA 1X3SA 4ZU1X 1VE3A 5T4HA 3WADA 4A8PA 1BAPA 3OEEA 1L7DA 3ZTWA 4EG3A 3IP8A 4H35A 2O8DA 3NH6A 4RGQA 3FB4A 4KCGA 5JBQA 4KVGA 2O1XA 3PNQA 1XWIA 1YS4A 4ZP1A 3VNSA 5F5LA 4YJ3B 4EY3A 1VB5A 5BOVA 3W2GA 1WW8A 2DG2A 4U6NA 4G5QA 3WL3A 2WFAA 2H08A 4GZMA 4Q1EA 4XVRA 3DPIA 3PXGA 2QRLA 2E5LB 3JS5A 3U9SA 1G20B 3IKMB 2XAAA 5ECYA 1XXHE 2W2NA 4MQEA 4Y6SA 3FGOA 2CNKA 1NQ5A 4OLJA 4OA8A 2GBIA 4ZJUA 2C03A 5IUJC 3HZRA 4R1UA 1J1IA 4IQ4A 3UMRA 5KJ6A 2C9CA 4X8MA 3BH0A 4AS2A 2HR1A 4DAEA 2REQB 3EOZA 3FOBA 4FIDA 3DEAA 5BN4A 2BD0A 1PV4A 1W581 3AF0A 4OB7A 2DCUA 5FA5A 2P69A 2GF0A 1CF9A 1VGVA 3T61A 1ZCZA 4FLFA 2MMCA 4PEVA 4Q82A 3THXB 3CRMA 4OQXA 5C2JB 5CDGA 2HUNA 3QELB 2I2DA 4KVAA 1CQZA 4QU0A 4A8TA 4EBFA 1KZ9A 4TYWA 4ZOAA 3KZXA 4CKWA 2DR3A 5KVSA 5ILGA 2KX7A 1GEGA 4QVIA 3HCCA 4A4DA 4JP3A 5KX5B 2IPMA 4JAVC 4LYEA 2ZJOA 3KQQA 4EIWA 1H6DA 1WCV1 2Q28A 2VBCA 2PTHA 3L0DA 3T7SA 1JYSA 3C8DA 1E9VA 4IXDA 4B73A 1A5ZA 1HDZA 2GPTA 2KM1A 3TXAA 5BV8A 2WVGA 1G5TA 1QTRA 4FC6A 1M76A 1QHHA 4DPLA 4EY6A 5KPJA 4ZYVA 1Z0SA 1K6IA 3ADCA 3TW6A 1CLUA 3JWEA 4BIIA 2PXHA 2G17A 2P9YA 1B6GA 1N2CB 3AEKB 2X2OA 4E11A 4QXMA 1KOGA 3GB9A 3ZE9A 1R66A 1ZSVA 3F97A 2QJRA 3LWBA 4JC8A 1DJQA 3R24A 4RVNA 3H1PA 1DKNA 3WGOA 1KWGA 4X1YB 3QW4B 3GJRA 4GG1A 3ZW8A 3O2SB 4CM8A 1DX9A 3EOBI 1GGMA 1KMNA 5LCXA 4Y0AA 3X1MA 2XWPA 3ICCA 4Q4JB 1GL3A 3RG2A 4OHYA 1WXQA 1PEKE 1U1DA 4Z9AA 1RAHA 1FW6A 4Q7QA 4JUCA 4P4GA 5CDYA 4S05A 1CRQA 2VPTA 2FXIA 4HWGA 3TXYA 2OHFA 3BFPA 1DHRA 3MJSA 3U1TA 2PRYA 2ZRHA 4H6PA 2QZSA 4L7VA 4S1WA 4X85A 1AVTA 1W75A 2C2ZA 3HN2A 3AO0B 3BJEA 3P0RA 4XD7D 2JDID 3R74A 3RHFA 5LMCA 2EXXA 3WO1A 1LW7A 3DBLB 4RF2A 1DC7A 2HMYB 4ND5A 3OBIA 4O4JF 4EY8A 1KYTA 2OXTA 3ZDRA 2IEYA 2VKTA 3P0FA 1T43A 5C0OE 1E3IA 2OV1A 2L82A 3AX6A 4NCNA 3B6IA 2PZMA 4DIOA 2B4AA 1FBNA 1FCJA 4MB6A 1ZCJA 2HB6A 3PPVA 1FQJA 3TRHA 4B7UA 4OFXA 5E6UB 3ZWVA 4MVCA 5JPIA 3QOWA 4ZVRA 2D2FA 3I9KA 4X64B 3DBRA 4ZOEA 1KETA 4IDCA 1QM5A 3BPSA 2OM2A 3T5CA 1A4IA 2J9ZB 4E7OA 3F3SA 4OMCA 4XB2A 3CZMA 5CIQA 1SBNE 1YRHA 2V45A 3AI2A 2VEOA 4UC0A 1V37A 4E6EA 4ZANA 2L42A 1RC0A 2LBPA 2EG9A 1XJQA 4P83A 2PX3A 4EY4A 1ZD3A 1XNJA 2FPIB 3GNQA 3OZTA 4PAGA 4BMOB 1P74A 4JJFA 5JPCA 3FSGD 1G4HA 2R4TA 3MRXA 1OH6A 2C4VA 4WCFC 2FK8A 3FZYA 2GA8A 5FH9A 3RS4A 4EEKA 3E18A 2IU0A 2QX4A 2BF7A 3STXA 1RE0A 1MZVA 4R3UC 1GXSA 1NQAO 4JY7A 3UH0A 1T0BA 2QVLA 3AY3A 3OZEA 4QYIA 1PR6A 3L0IB 1L4HA 1C7JA 3MUEA 4P3KA 1NHWA 2YICA 4MK4A 2Z08A 4O2AF 3OIGA 1NRXA 4B8ZA 3LF2A 2P9JA 4XJSA 2GYWA 2NYAA 2Q1XA 3CA8A 3DEYX 1V2HE 5AHRA 9ABPA 3DG9A 2NU7B 1V8OA 2ZYWX 1TT5B 3KD3A 4RMJA 3SX4A 5EHQA 4PZ9A 5HFAA 4CM3A 3M9XA 4FGJA 4YAGA 3ZLJA 5IVIA 3THXA 4LY6A 4MO2A 4EPYA 1P0FA 3C5WP 4B76A 1JAHA 3IE2A 5EP2A 4E08A 4RS4A 3CB4A 2CVFA 3L8ZA 1CVLA 3NQ41 1XYYA 3NFRA 4BNXA 1EUYA 3LWZA 4NXNB 4Y2JA 1RHRA 2W2QA 1OIXA 4Y1EA 4YJFB 2BYTA 3JW8A 3ZCRA 3LA6A 3H0KA 4PWZA 1C8BA 3ORYA 4Y7CA 2V7EA 3KR1A 5T3UA 4C0XA 2Q5EA 4AJNA 3FNIA 3BIJA 3BORA 3FA2A 5KINB 5CGQB 4W9NA 1O5TA 1IQRA 5K7SA 5FV7A 5AK6A 5FPPA 1UC5B 1KDYA 1YB7A 2PX8A 3MWYW 1RPZA 1TM7E 4PZEA 1OXTA 1TK2A 1A1SA 4R51A 1OSNA 1NXPA 4FZJA 4MQLA 4YA6A 5KEIA 1L6IA 2C95A 3TLGA 3V1UA 1FSGA 3WLQA 4D41A 5TMBA 3U16A 3ZHUA 4YMWA 3NT4A 4LFBB 4UM8B 1W7AA 3GPCA 3TQHA 1NC3A 3OIDA 5J4VA 1WBJB 1T9DA 1PJ3A 5JAOA 1Q1BA 1DAPA 1L5QA 2AQHA 2H51A 3OOSA 2IBMA 3K0KA 3VZPA 5BWNA 5JTTA 3ZJVA 1OLOA 3BXHA 3A04A 5G1NA 4ZVNA 3TW4A 2HQSA 4EYKA 4I1VA 2NVWA 2GRJA 2Y1FA 1XTSA 5DX0A 4B17A 2GFHA 5I4CA 4CKBB 2AJLI 2OCBA 3HVUA 3LIPA 2I71A 3V46A 1BHQ1 1LXCA 5FLEX 3LWNA 4LWOA 3TPZA 3U62A 3W1WA 4BQIA 5A1JA 5LMUB 4NF2A 2CHUA 1OWLA 3OWHA 2A4KA 1R64A 5EPOA 2OWDA 3KTAB 2PWBA 1FFXB 1RADA 3N1UA 3NHRA 4P92A 2RK6A 1EZ4A 1QHEA 4L07A 1LPOA 5FBWB 1AUVA 4OXIA 2OENG 3AQIA 2FG5A 2GCEA 4LOJA 3WIUA 4CBVA 1P5HA 5BV1A 1VYUA 3S70A 1LPBB 2D0OB 4ITUA 1U63A 3GEGA 2OK7A 1OGYA 3IKJA 3P2MA 2B8JA 4DNQA 1ESNA 5FR1A 1HFKA 1KNXA 1L7NA 1S4QA 4ETNA 1O8CA 1AKWA 1KIMA 3D6TB 4MWCA 4YT2A 1NUTA 5KWVA 3N3BC 1TIKA 1QAMA 1OFVA 4ZMRA 4FT2A 1MVNA 5CVEA 2GWHA 5FKJA 3CUTA 4OSEA 2X0KA 2QW1A 4RD1A 1U7DA 3VKVA 4DJFC 4U2CA 2XMSA 3ZNPA 4KSCA 3TNYA 2EZUA 3C45A 3IKVA 3RT9A 3GLIE 4BUCA 1C7IA 4MWDA 1FSFA 4M88A 4AO7A 1XTIA 1W93A 1SBZA 1JALA 3ESRA 1WBBA 3TECE 3ILXA 2WJWA 3I23A 1K5GA 2JGFA 4PSUA 2XYPA 4DEVA 5KWIA 3HM9A 2HK6A 3LFUA 1U2PA 4FFRA 4V0QA 3TOVA 4B3DA 4TKUB 1SQ6A 3AUFA 3QEOA 1M8PA 3DKKA 4OXNA 4L9WA 3AR9A 4M1SA 4ZMBA 2D5CA 2DBZA 4JL5A 2JFYA 1DKQA 4GSYA 4PYOA 2ECOA 1EFVB 2ALJA 2VNIA 5ELLA 2WYOA 4JI0B 2WB2A 3OU7A 3L4SO 5IKMA 1ZBDA 2PX5A 2XBMA 5DGDA 4M89A 4Q93A 2P27A 1T8PA 3OAAD 1W0KD 2CXXA 2VDRB 4UUBA 3UHAA 3AB3A 3O0DA 1V6AA 1CIVA 4ZT6A 5DRYA 3ELDA 1M6EX 2LTAA 5DWDA 1A77A 3KXPA 1DDGA 4ZAYA 1M1YA 1NXVA 1U7TA 5AIBA 3EFOA 4MQ5A 4XA8A 2PNJA 4QYWA 1LJUA 2C97A 1MLDA 3BAFA 4DWJA 2ZS7A 2C7RA 3P0IA 5HS6A 2J3DA 4CHGA 4RANA 3EF0A 2J3KA 2POQX 3B89A 4U9UA 1EVKA 5GIOE 3AVOA 1UBHS 1Z47A 4H6VA 4HP8A 5EXEA 4G07A 1FTWA 1PUIA 4K5QA 1G8JA 1KYYA 1V0JA 2WQZA 5DHTA 3GEIA 3B7PA 2XQVA 3NHLA 1PFWA 3BIFA 1KYXA 3G2KA 5AVVA 1ZW1A 1KORA 4NCIA 4UTPA 2WJAA 3QHPA 5JEDA 2VT3A 4J0GA 4RJJA 5A9SB 1C9YA 3BZUA 4D99A 3TQQA 1YU6A 3RFCA 5K05A 3EG9A 1DAGA 1J20A 1FP1D 2H1LA 4GVXA 4M0EA 3LIIA 3U44A 2BRUA 5BPFA 3O91A 4RY9A 3FZQA 1V47A 2ZRIA 1ZESA 4JSYA 3RFXA 2XUHA 3I01A 3QLVA 4AN1A 1OFIA 5JSZA 1EUQA 1X9HA 3ST7A 3MRVA 1E2EA 4P4SB 3T5BA 1H9BA 1J99A 2AQIA 1Y63A 4CMEA 3F6RA 3PWKA 5LQCA 1XTTA 3H1TA 1K4MA 4I4CA 1IZ8A 3ZI0A 5AVUA 3E5HA 3SMQA 2XQIA 1NW4A 2AZDA 4RO0A 1L5LA 4GE0A 4G8CA 2FPXA 1FFBA 1GSOA 3KSUA 1YCFA 3T1NA 2WWIA 1G5QA 1ZH8A 4OOFA 2HWWA 3OPNA 1GU7A 4PZCA 4RVGA 5H68A 2G1KA 3LZCA 2XTNA 5FT9A 4JQZA 1LS6A 1LUAA 4PSCA 3LCCA 2AOXA 4FYMA 4EF6A 1E1DA 2WZQA 2BGLA 4NDAA 3AL2A 3KT8A 3ZCQA 5JJKA 1NVKA 4AJOA 3QE0A 1I3OA 4OU4A 1HURA 4GUAA 1U0LA 4GPAA 2ZTLA 1T1JA 5CYFA 2JA1A 4MKZA 3PUHA 2W22A 2KHZA 3WLPA 2IGTA 4GDFA 4KQKA 5CT9A 2IXDA 2WZDA 3RYCA 3IEIA 3RVDA 1KH3A 4I55A 1HZZA 4O8ZA 3RVJA 5LKRA 1XDWA 4V0NA 3WNVA 1OLSA 2X0NA 3GWGA 3IALA 4HXEB 1T3ZA 3UJBA 3GP5A 3E0QA 1YI0A 4IMRA 2MINA 2P7IA 1JNYA 3UUEA 1KEEA 4EL0A 1LRKA 1JT2A 2XRMA 3MTJA 4TMVA 3K9CA 4QFBA 4NCJA 4JMPA 5KYUB 4QT0A 2H2WA 5ALEA 5LZ9A 3JZIA 1G7TA 3JQEA 1I13A 2FMFA 2J9FB 5EIBC 4Q3LA 4NBRA 2H54A 5CCDA 3VI3B 1F1JA 2O4CA 2OHXA 3L05A 1H1LB 1UKZA 3NALA 2XNHA 4FOOA 4L15A 2X8BA 1GTL1 4NYMQ 3MB8A 4JOCA 4B6OA 5M2QA 2QL5A 1R5BA 3R7SA 3LO5A 2JFXA 1OFUX 5GMOA 3LUHA 3PJDA 2JVIA 2O52A 2C2GA 2IZ5A 4P1ZA 1N0HA 1H4QA 4B09A 4WZAA 4B3SB 1CC1S 3AEZA 2IZ6A 2C31A 4FCCA 5KSOA 1ZH0A 1V39A 2RI6A 4GLLA 2JFWA 3QI2A 5TRTA 2I6XA 4QLOA 4CMJA 4JJAA 4D5GA 4J0HA 1D3AA 4D25A 1DJMA 1P5FA 3IC5A 4P4NA 1JJFA 3JAMA 3L4BC 1DKRA 5TMDA 3PVSA 2GN4A 4C05A 4OSPA 4YMVA 4MEBA 4PYQA 5EUMA 5C81A 3RSSA 1RRKA 1SUBA 1VBFA 3AR6A 2BEWA 1UC4B 1B8OA 1G3IA 1M1YB 2H3HA 1C7EA 2VC2B 3ETNA 2AMJA 1VI6A 2EX1A 3IDFA 3AP3A 4XX0A 3UHJA 3SWWA 5CRIA 1U8CB 2QN9A 2X13A 3ROTA 3AF4A 3SR3A 3BCUA 3PR1A 3EJ6A 5TT0A 4P81A 3HGMA 3IOYA 2VT7A 3X3HA 4F9TA 2GZMA 1W19A 1FP4A 2NU6B 2O3RA 2Q1SA 2R4QA 1FMJA 3DVLA 3EIFA 3H97A 3IMEA 2JEZA 3JTEA 3NANA 4HNSA 2A7QA 4NEGA 4EKIA 1CEEA 2WTNA 5CBKA 3CGGA 3GC6A 3QHQA 4MOWA 2JHCA 3G5UA 5JVDA 4LSWA 4LOHA 1J2YA 3URKA 4JQOA 3BSWA 3BAZA 3ASYA 2YIVX 4DQKA 4FNAA 3B1FA 2IYPA 7ADHA 2O2XA 4CL2A 3QEBZ 1Y6GA 1BVHA 2I3ZA 2JJQA 2YOHA 4TTTS 2GVZC 4D02A 2CB0A 3WB2A 2OSVA 3IUQA 4K1XA 1ANKA 2RGDA 3IAM1 1UH5A 3HJRA 3IPRA 3JQBA 3PYLA 4KL8S 3SKYA 3O1JC 4X7RA 2J0UB 2OBMA 4PRZA 3RC9A 4AG3A 1JKFA 4D3DA 4IDAA 3I04A 2FWMX 1CULC 1CU1A 1ECPA 3QSGA 4KI7A 4MINA 3SS7X 4R16A 3JYOA 1SBIA 1QDLB 2HC9A 4RDHA 3NIFB 4FXPA 2D74A 4K40A 4LZAA 5CHEA 3LGSA 2PYDA 4G8JA 1K1EA 1LTQA 2EYQA 2AF4C 3PYMA 1PQ4A 1CUUA 4EUEA 1N2CA 4JXZA 4E2FA 2I8CA 1M7GA 2O8FA 2QW0X 3GJ0A 1YA8A 1NLYA 1XL0A 3EVEA 2V96A 3IBFA 2FPGB 4M1ZA 4B3FX 3AI1A 1RT9A 3CN9A 3WG9A 3OTQA 1ID1A 5IVDA 3SXUA 3W77A 4MUHA 1D9ZA 1BHJA 3TTYA 1YH3A 4ZYZA 5AVJA 3RSZA 3AJRA 1L5ZA 2R7KA 4R8KA 3DZKA 3U3RA 4DDUA 3GGOA 2WTUA 1XSEA 4N5MA 4LJYA 3OCWA 1FMCA 9GPBA 3K5IA 4AC9A 1DKMA 1T6XA 2CDBA 1QUEA 5ALGA 4O3FA 1USIA 5AM2A 2NO4A 1TQ6A 1VBNA 1P62B 3PS9A 4ISCA 3V9PA 4QKQA 3OUTA 3FUTA 3DZCA 1ZCBA 3M33A 2DAPA 3DBHB 5E1DA 3KHTA 1DXQA 2PA3A 2I9PA 4HV4A 2ZXUA 3F9RA 1ABBA 5JY1A 1YDFA 4BECA 2R11A 3C8MA 3EWIA 2HZBA 4OGKA 3BUSA 4DLUA 4D8YA 3EGCA 1HLGA 2C84A 3MJ4A 1T9GS 5JI2E 1ORHA 1CJTC 2BSXA 2FZVA 2X4GA 5E4TA 3VVBA 4ARZB 4JK3A 4ZZ3A 1B26A 3ABOB 5FJIA 2C2MA 3EWSA 2B6HA 5ECDA 2PG3A 5AKXA 4EI9A 4QOFA 4ZPXA 3C5EA 2CLCX 1KZ7B 3WGGA 1BOOA 2HSZA 4FWIB 1DARA 4D3SA 4BS9A 1Z0DA 4CKBA 5FBLB 4W8GA 3ROEA 4Z1MD 5T8KC 2QQEA 2WICA 3G9TA 3KEFA 1N2HA 4D9IA 4BEBA 4AKEA 1V5IA 1ZU4A 1L8XA 1NG1A 1UANA 1SR8A 3N70A 4IJVA 1L7BA 1EFPA 1KK0A 4H27A 1E8DA 1OROA 2OT3B 2WHPA 2A14A 4XW2A 1TLTA 2IHBA 5HA5A 3DCIA 1ONPA 4QNRA 1KFBB 4ZXFA 2ZT7A 2RGUA 3EXIA 4IL5A 1SVNA 4V1CI 5J5CA 4IUBS 1RM5A 3LCRA 1P3JA 1SCUB 1VYHA 1ZIPA 4DREA 3JAWB 4EI8A 4TV9F 1X1TA 1C29B 3FUCA 5HK9A 1CZLA 2QJWA 1ZSNA 2ZJBA 3AUTA 4P5EA 4GI1A 2HA0A 2XXAB 4Z53A 3SFTA 4B7ZA 2ZB4A 5BORA 4E5NA 4OTZA 1ISHA 1XROA 4XUDA 4XRGA 2EAUA 2XVYA 1OILA 4LW8A 5KMGB 3HA3A 4C30A 1Y80A 3DW3X 3Q3VA 4W5WA 4KPFC 1KYWA 4PTLA 2QR5A 2D1TA 2DJIA 3R76A 4C08A 2YIJA 1A4UA 3S5UA 3L82B 4WXHA 4I4TF 4JNKA 5EY5B 1C30B 1P0PA 3JAKA 2DT5A 3CUWA 2BFCB 4D9JA 4Q9AA 5G02A 1XPJA 3C24A 4PBSA 2V7TA 4HWOA 3RYHA 1SCNE 4ZGGA 3ELUA 2IWHA 2ATCA 5BR7A 3CY6A 3KT0A 3EFBA 3UFXB 2F9FA 3A4TA 4X61A 2KI5A 2Q2VA 3G17A 3IAXA 3U48A 2XADA 4EHNA 2G04A 1DJNA 3VU3A 1WV0A 4GICA 4Y6PA 5JECA 3SC4A 5LDGA 2CNWD 1FLVA 1HK7A 3IXMA 3DKVA 4WRRA 1V1RA 2BONA 4M22A 2QYHA 3HJTA 3M5PA 1FYEA 2I99A 4JMLA 4UZFA 3CE9A 5DNAA 1GA6A 3Q9SA 2EFHB 5KOJB 3B1XA 2BHNA 1IVSA 1XLWA 2P9FA 1RYEA 3F9CA 1SKYE 5K4GA 2OKCA 1P7VA 2X19A 2QQGA 4LRYA 3GRVA 3I01M 2Y77A 1WUJS 4ND3A 1E1QD 3LLMA 1KQOA 2C5GA 5LYYA 1E62A 4LGVA 3VO8A 2X9NA 3IUBA 3ZHQA 3LYUA 1A2BA 2PH7A 3E1KA 1QLJA 1NMZA 1RMYA 5DXAA 5F2KA 2W6CX 2VHYA 5DIFA 1YO6A 1YZLA 2IVFA 1EK5A 1DWOA 4LRUA 1QRUA 3PE4A 3T1HB 3FPBA 1MHPA 1GRVA 3OOWA 3ZY2A 4M37A 4ZN6A 4NCBA 3IBCA 1JAXA 4ZVSA 4BY9E 3HRKA 2PKQO 1Y3DE 3JVDA 1XN4A 1ADFA 4MJXA 4LNHA 5BW4A 3SJZA 1YJQA 2RGXA 4JP5A 2FQ1A 1LGYA 3PUXA 4PC3A 2NGRA 5JRZA 2Q3EA 4B3JA 1JG2A 3IBTA 1LC3A 1K92A 1R5NA 1Z0AA 4KXVA 3ZU5A 1QO0D 1SKAA 1Z62A 1O4WA 3KUDA 3EH2A 1YZVA 3GH1A 4HDKA 4PZPA 1FMFA 2IOFK 1TGVA 2ERXA 1DRUA 4XUCA 3KBOA 2DE0X 4TWRA 4YQYA 2CL7X 2EQBA 3BE6A 4II3A 5CX1B 2R44A 1OXKB 2V97A 5L3ZA 2WQ7A 1YFJA 3S8MA 5DJ5A 4E70A 1JBKA 3TLEA 2OQIA 2NACA 5ADHA 1J0CA 2QTWB 1RZRA 2QP3A 4IJUA 4MLPA 5BURA 4MVWA 1G8KA 1GRCA 2J6HA 3AP1A 2ECPA 4YO7A 5EHGA 3W5UA 4B74A 4BWYA 5HP4A 1F6DA 5CFNA 5LYJF 5KJCA 4JI8B 4QRHA 4OA5A 2O4UX 1Z5UA 1NURA 2JLUA 2I6GA 1RWKA 2W2PA 2W4QA 4I2VA 3ZWKA 3OCCA 5CB0A 3AL3A 4D0LB 1IBSA 4HRVA 5DGTA 4HZUB 3A28A 5LZ5A 3TR0A 4JLSA 3W0LB 1E1RA 1SZCA 5C1OA 3KRTA 2QRVB 3EFHA 3JQDA 4OHRA 3RBXA 2QVCA 1ZL2A 1AKMA 2CDRA 3BK2A 3MQFA 4K81B 5I8PA 1PS8A 1C8VB 3FIJA 4YAIA 1CUWA 2O8FB 5KU7A 4O08A 1MG5A 1Z4JA 2ZANA 2Q8NA 2XXAA 4UFPA 1B14A 2GD2A 2YY5A 1IOWA 2WJJA 4XX0B 2DFPA 1E9FA 4LMPA 4PS1A 3V5NA 1UXHA 5D5PA 3RAGA 4TTRA 2YYZA 4F3CA 4HMOA 3Q98A 2XNJA 1V5WA 2J4CA 3L7YA 3QVUA 3TVTA 2GBPA 3EYAA 3R8FA 3HKCA 1UBSB 2O2SA 4ZMSA 1ZQ9A 1EG2A 1EQAA 2AB0A 2HNKA 4GYKA 4AK9A 1BRTA 1WMDA 1UP7A 5TVGA 4HVLA 1O6GA 2FSUA 1CUDA 3IPAA 1JG4A 1T1IA 5H4HA 3IP1A 5LXTF 1Z34A 4QBHA 4QXQA 2GD1O 4K1LA 5IJAA 3BQMB 1S02A 4R31A 1YDGA 1RJWA 3OKAA 4REOA 5LYJB 4OVKA 3L8EA 3UEOA 5LMNB 4KFTA 1MXHA 3HO1A 4FMDF 5HFJA 1BWPA 5MN4A 3V7WA 3KQKA 2YW9A 3D8NA 1UFVA 3ZBUA 5IVKA 4KR6A 2ZBGA 3GYBA 4ILEA 5KDDA 3UXMA 3D81A 3BEDA 2CB9A 5LL6P 4J76A 3U7EB 1VL5A 1OKKD 2ZB2A 4QPPA 1NATA 1NZFA 1MJGA 2HMVA 4MVJG 3RT7A 4D9HA 4EELA 1ZICA 4YDQA 2I7CA 1QQBA 1AXGA 1I1NA 2K87A 4QU5A 5I4KA 4RA6A 1FA9A 1U1FA 2FCAA 3HDQA 3WGKA 2ZI3A 2CDAA 4YCNA 221PA 4NICA 3DZJA 1BH2A 3H19A 2DEUA 1CR0A 2C04A 2QDXA 1NVAA 4Z2AA 3EVCA 2WYIA 5ICMA 1YZHA 4R83A 3LMKA 4XB1A 2E0IA 2H2HA 3Q8WA 3PNLA 3BIOA 4F8YA 5KO2A 1GFSA 4FR5A 3G2QA 3JQPA 4GKVA 2PUJA 1WZCA 1Y9JA 2EQAA 2WAAA 1TM4E 2Q2QA 1BN6A 2ZIAA 5IBRA 2GYYA 3DQPA 4RNDB 3DDZX 1OX6A 3B6JA 1G6KA 4LJ4A 2JZOA 5H8WA 1DOHA 3K0AB 1MENA 4A0GA 5C5IA 1WSDA 4PXSA 4XYEA 5CW2A 3RYFB 2XUDA 3INTA 5E3IA 1PJLA 2CNLA 2ZREA 3OFVA 4C14A 3T9DA 5A5VA 2Q49A 1DAMA 4DYVA 4HAXA 1QFZA 5KQLA 4D9FA 1WETA 3KZOA 4HDNB 5LQNA 1T26A 3NBXX 4FZRA 2IYTA 1G21E 3R5XA 3R75A 4EB6B 3K7EA 2PRJA 2PUFA 2VRBA 3QUSA 3CRNA 3GPBA 5EPUA 5IT0A 4LHWA 1D7AA 1F51E 2JNWA 1QHHB 1MA0A 2I3AA 2RCYA 3GVCA 1PL6A 2GN8A 1YVRA 2DT8A 2K5UA 1RP7A 1KJQA 1PVVA 1UBEA 2C7VA 2E48A 2CL0X 1CR4A 3GUHA 5DEOA 5DNVA 3WFJA 1EP3B 3MTAA 1NJ5A 2QRHA 2DUUA 4FIZA 3A32A 4QUHA 2D7DA 3UJHA 1Y6FA 3HJFA 3FTEA 4H08A 3VSBA 2VRWA 4IX9A 2BBOA 1UWVA 4R4JA 4BV9A 3EQ2A 3LF1A 5KNDH 3LTNC 3I62A 3ORHA 2PH5A 1T3GA 4FDMA 4MI9A 5I7SA 3COPA 4TKVB 3T7CA 3UUFA 3W8EA 3DE3X 2JGRA 1LEHA 5C5EA 5JO0A 4Y6LA 1YR3A 2Q0QA 3ZE2B 1XZDA 1QE0A 1U9CA 1VDZA 1TUBB 1LSSA 1UOPA 3Q6IA 1GYQA 4G97A 4MRMB 5A6SB 4CN9A 1E5QA 1Z25A 1WZ2A 3SC3A 2VL7A 1JKJA 1GPAA 4UNQA 4F92B 3KJHA 1JXMA 3U39A 4ZCSA 3HJBA 3ZH2A 8ATCA 3R9XB 3B13B 2MTBA 1B0UA 3OICA 2GJ8A 2ZI5A 5ALSA 4LXGA 1UEXC 4TQUS 1DEAA 2ONZA 2WYVA 1QX3A 5TJ9A 1US8B 1YB4A 2QIOA 3LVFO 3H5OA 4EFLA 4C07A 4BTVA 1C0KA 2Q45A 4IQ8A 4N40A 2OG1A 3J81A 1VE9A 2NQ2C 4EGJA 1N5OX 4MHTA 2C4HA 3N0TA 3D3WA 3IXQA 1NI4B 2JIZD 1DQRA 1FFEA 3D7KA 3ESAA 3UBMA 3GFOA 1YB2A 2E4AA 3NM6B 2QYOA 2FWBA 3ROQA 3ZJYA 4Z4GA 2A5FA 3T3EA 4WD3A 4OPMA 2V3WA 3AF3A 1ZHHA 1Y33E 1U65A 2EKDA 3P71T 1ZUWA 1E58A 3O74A 1M10A 1XU7A 2C9OA 2QVXX 1QGYA 2AJTA 1OTXA 2QE6A 3CB2A 4G3XA 3K2BA 1EVEA 3H6GA 4GPEA 4KUEA 3V8MA 3ZDFA 2JFNA 2VYNA 3OIFA 2PR2A 3HXOA 4LXHA 4YCBA 4BNWA 4RQAA 2MSNA 2CWWA 3PL1A 1SKUA 4NS1A 1P9WA 1UJ5A 4RWEA 2PV0A 4R9VA 4ALNA 2P3SA 3MC1A 5I6DA 2ODTX 1BGXT 3DULA 5EL0A 1EFCA 1E3TA 2NO7A 4PLFA 4WZBA 4P33A 1A2KC 4EW1A 4EBBA 1DRWA 1LPAB 4MPDA 4Z99A 5ALVA 1Q7EA 1K88A 1B6SA 2C8VA 2W2XA 1L7QA 3B2QA 5IXSA 1VLMA 2PS1A 2JHFA 3C41J 3TSCA 3GAZA 4YMIA 1GA4A 1Z83A 2PUTA 3A1FA 5DTIA 4RGYA 4RU1A 5EVCA 3E9NA 1TEHA 3M70A 2QYSA 2VPPA 4CLXA 3WB1A 1XZIA 3K8YA 4MUIA 4C21A 4NFHA 1QKIA 1M2JA 5IUKC 2CV0A 1D7OA 3L6DA 1YZTA 2R68A 2QTBA 2TMYA 3U7FB 3VR6H 3HV2A 3OIWA 2GN1A 3HKDA 3GGJA 2ZVJA 3G9XA 1HTWA 5BW8A 1RXCA 4M87A 4YY3B 4PX5A 4XLTA 4Y2VA 3B5IA 4WXYB 1M5RA 1KO4A 2HTFA 4NZNA 5A0VA 2X9QA 2LPMA 2AFIB 5BRNA 3ZH9B 1RVDA 4WFKA 5KDLA 4F9GA 1Y4DE 5ER6A 1U7HA 3NAQA 2ZWAA 3IIKA 2XKJE 3OCJA 3PU6A 1XO1A 1ZW6A 3AEUA 3C4JA 1V45E 4MR8A 4PLTA 4C1BA 4CF6A 3Q9UA 4PM4A 4Y30A 1SAYA 5TJHA 2R8OA 4R68A 4CIAA 5LQRA 3CVWA 5FTKA 1NY6A 2I1WA 5I9TA 5BN3A 3SQMA 1TJ5A 4V39A 5FUXA 2XTZA 2O2CA 4FB4A 4W5HA 1Z07A 1KJJA 2PJUA 1UPAA 2Y1OA 3SZOA 5B2EA 5JNUA 3LKDA 3R6GA 4Q5IA 4ZCRA 2QNRA 1H22A 3A3OA 1RWOA 1ISFA 4WESA 1PJ4A 2EJBA 2I2FA 1NWHA 4CKEA 5KQRA 2IS6A 3K1ZA 3A6HA 1TEVA 3OI7A 3KB8A 3PYXA 4WJZA 4OJTA 3RV3A 4HEA1 1WKCA 2RK4A 3HZHA 5IJXA 3SD7A 4JLUA 2PWAA 3TD2A 4A0RA 3GLGA 1KSHA 1YDMA 2GO1A 5SYAA 5TDHA 3SLRA 3Q85A 5DYGA 2XHEA 3ZD9A 4ZVMA 4E31A 1GZ4A 1R7RA 2P4EA 2ON6A 3Q7EA 3TDKA 1W96A 1JDBB 5I7VA 3IA2A 3VXKA 5J9FA 1NMQA 3KS9A 2BEJA 1WV1A 1TZMA 3OP4A 1KEWA 4ES6A 4CDNA 3FLEA 2P79A 5EIEA 5JYCA 1QP0A 2CLFB 4GGPA 4F8EA 1ZX1A 3R9XA 1CY7A 1EFLA 3L92A 2JFVA 3PT5A 4JT9A 4ZDJA 3VC3A 4J7CA 2HL6A 4HG2A 2JD1A 1XRNA 2I1LA 1Q11A 1Y3IA 4I8IA 2HWUA 4NQZA 5D7NA 4A2CA 4BOYA 4YUYA 1HX7A 1H69A 4WBSA 3L0OA 4KITB 2A9OA 2OAQ1 2RH9B 4NV0A 3WNBA 2IIVA 4EJ6A 3QE2A 5HGJA 1L7OA 1M7HA 3TIXB 1T3LA 3OCXA 1PZEA 4ZOQI 1FIUA 4CCYB 1G5HA 1U1CA 1D1TA 5AVZA 4TV9A 5LA6B 1ADGA 1HKHA 2R7LA 2UYGA 4X95A 5AOAA 4Q4HA 1EDOA 4PQRA 3M5DA 2DLNA 1Z2AA 3I0ZA 3F49S 2O0KA 4L57A 1NI4A 4HPJB 3FHLA 1W5BA 1H66A 3RUIA 4NZ9A 4L5AA 3WMFA 1HEYA 3A6KA 2B4RO 2DHCA 3MTQA 4BFWA 2CCJA 3GJ7A 2IXEA 1MH9A 2F3QA 5EA2A 2G9RA 2LV8A 1X9GA 3N8GA 3P2EA 2C78A 4I4TA 1RCTE 3P2OA 3ZCPA 3OTHA 3PPYA 4LY9A 2NZYA 2VP5A 4K6OA 2RJOA 2O8CB 3IVGA 3V6MA 1MRZA 2JW5A 2OWEA 2Z1DA 4PR3A 3M4XA 5TE9A 1TO6A 3DL2A 2IEDA 2HAEA 3QK7A 1ZUNB 3OWXA 3DLIA 1D2CA 4I50B 3UWPA 1D5WA 5FLYA 4NYIR 1E8NA 3W5BA 2VF4X 4XJXA 1EUCA 3H9JA 2AMYA 3FMPB 4B4VA 2SBTA 1VPLA 4OQEA 5F1YA 4B3IA 3F6PA 1U8XX 2P1ZA 1NXOA 3D8TA 1P18A 1T1EA 2BE7A 1T3HA 2ZBEA 3JSAA 5D6NA 1OOEA 1ISPA 3FVRA 1IDN1 3TPFA 1L7EA 5IJ0A 3TFQA 3QX3A 3Q3CA 3TVDA 1JEAA 2FH5B 1G16A 2B2CA 1ONBA 3FUVA 2I8LA 3QLUC 3ZCSA 4D6YA 1VYVA 1KEKA 2Z1NA 1ZOSA 1WOYA 1KTVA 4MI1A 2VWQA 4B3TB 4AYWA 1NXXA 1WMSA 2XVAA 1JP7A 1XTKA 1LWNA 2G72A 4WBNA 5GJVC 5F9FA 5TY0A 3SQNA 1I5EA 3UMMA 3BMXA 1K75A 1RWWA 1ZXLA 2Z3ZA 2ZRKA 3HCRA 1JU9A 5KC8A 4M1WA 1CZKA 1KI2A 4BMVA 3HP7A 4EHKA 1GZHB 2RC5A 3G3EA 3GJXC 5JNLA 4C2UA 1GJRA 3PCTA 2RE8A 5BN3B 1IUKA 2PIAA 4JLOA 4HYYA 4OLBA 3I09A 4TYYA 4QASA 2X9LA 5LLTA 1OXBB 1ZN8A 4L50A 3RFFA 4EGQA 4Q39A 3ZVLA 3WBKA 1UQUA 1AMNA 2IT1A 1LPMA 2B0CA 4OLAA 2E37A 3T9CA 3OEHD 2IX9A 1A8PA 1M6HA 1ISMA 1TVKA 2RHBA 1SVSA 3AESA 3CW8X 3DDUA 3PCRB 4S1TA 1ORTA 3KE8A 5LZ2A 1GRRA 1YB6A 1YB1A 2BR4A 3IESA 1JAYA 3PKIA 4DLVA 1U8ZA 2H57A 4DGQA 2QHXA 3NHUA 5E7QA 1NNEA 3NTRA 3GDOA 2ETXA 1GNTA 2ZBPA 3MNFA 4KO1S 1BX0A 1Q0RA 4RVUA 2FAXA 2QW8A 5LB2A 5HRAA 3H2KA 1X80A 2PKCA 2IYVA 1AKNA 3A11A 3QNUA 4LXTA 5JANA 1PX0A 1HT2E 2O2ZA 1IVNA 3NLLA 2I6TA 5F9MA 4D8XA 3SVLA 2PUAA 2FKAA 3DOHA 5F23A 4YRQA 3TSYA 4XJVA 4GOKA 2R5WA 2O6HA 2R25B 5B3JC 2GAFA 5JS7A 4YRJA 3QY9A 5BVHA 1KJ8A 1I3LA 3C8ZA 2VRNA 1OWNA 2P30A 3W9YA 4RULA 4EYSA 4NDNE 1PVDA 3B6MA 3THSA 1XZKA 1ZMRA 5LUAA 2VRCA 3S68A 4KZPA 5IP5A 3HHEA 2V7XA 1Z0FA 3E9MA 2PO5A 3ZYCA 1VLQA 4RJIA 2HU8A 1J4AA 1F3LA 1KI3A 2B78A 3F4KA 1TXGA 3FCEA 2NPFA 3F46A 3T12A 3BQ9A 4UAGA 3H4MA 1CY1A 1XNRB 4C4OA 1WB6A 2RAUA 5BP7A 1UXIA 3HJCA 5I9LA 3D8UA 4YJ2B 5JZMA 1ITZA 4Q16A 3HJAA 3SYTA 4WPGA 1RPJA 2OHVA 3DNMA 3E9EA 3TZQA 1BROA 1CX9B 2XAUA 2DY0A 2OXEA 5G0UA 2IZ0A 3V7UA 4G5RA 5CXXA 4U00A 4J8PA 1DKOA 3TSZA 2G9VA 3Q8MA 1SY7A 1BEEA 2QJFA 1LSJA 3OESA 4DDTA 3TG2A 3AERB 1T5BA 2NUPA 3AB8A 4FK8A 4L73A 4I4NA 5AM5A 4ZT5A 3ER9A 1EWYA 3A9RA 1GCGA 3Q88A 5JATA 3CNEA 4RM2A 1VG8A 4G65A 4FNOA 1D07A 1NY5A 1XG5A 2YDYA 5CLJA 2WJZB 4WEOA 4D9NA 1UM9B 1ZOOA 3BBLA 3ADBA 1V16A 2JH3A 2P3OA 3E5RA 5I01A 2WWRA 4Z3DA 1ZRSA 2K7FA 1YSCA 2VAXA 3OTIA 3WGLA 3VPXA 5THXA 5ADVA 2NYUA 4OGWA 1EXNA 2QRVA 3O92A 1NX9A 3Q5GA 3Q7TA 3WNDA 4ZJZA 4QQRA 3EA0A 3WMGA 3U40A 1JSZA 1FRNA 2KBEA 4BO3A 2ILTA 4EJSB 4K9MA 3PGA1 1G3UA 4P7BA 1W6UA 4FGUA 2EVWX 5EJ5A 3FOFC 3LL4A 2O2YA 3O6VA 2QT1A 4S24A 1RRVA 1IY9A 1B43A 1VGQA 1E3JA 1K9VF 4ERXA 3ZLUA 2FHPA 4AULA 1G8MA 1WXEA 3KC2A 4HNVA 1YFKA 2H1IA 2PZJA 1XDBA 4LWZA 3ETHA 4TRNA 5A3JA 1IM2A 3DUFB 4WVFA 5C3UA 2R6HA 3IEPA 4PGFA 1M54A 4F84A 1QU3A 3ZNOA 4JENA 4KXMA 5DK4A 3V32A 4M0PA 3QJYA 4Q6BA 1KY2A 3O4FA 1Z5GA 2X9VA 1TFUA 5IMSA 2PKWA 3LC1O 4D9MA 3A6PC 4CLRB 4WXEA 2PD4A 5DNWA 1R6BX 3I30X 2OHGA 4ZD6A 1YC2A 2DU8A 4JHXA 3ZHZA 1V95A 3LPDA 3MWJA 5EJIA 1O97D 2H9YA 5FOVA 2OK8A 4XM2A 3KAPA 2W2VA 4BKMA 1JHZA 2INGX 4ZEXA 2X9GA 1JDUA 1FSSA 4OGLA 5HE9A 5BXQC 2W83A 4C6SA 4CG2A 3CM0A 3G9QA 3FNEA 1BHO1 4QEKA 4CIWA 5CFRA 3VSDA 4EMTA 4Y2TA 3UTDA 5TLSA 3B6ZA 1N1MA 2IYFA 5FPQA 2C0QA 3WLRA 4TRRA 4YUAA 1H2AS 3P8ZA 2F8SA 1PR0A 1LV7A 1EHCA 4YXWA 1HQDA 2ID7A 1L7RA 1S2IA 2Q5JA 4WLFA 2XITA 4KKVA 3SDBA 5H82A 2OSBA 1DGQA 5JO9A 1JPNA 4TTSA 2X7JA 3CPJB 2FE1A 2GM4A 1P7PA 2R62A 4NVRA 4Q66C 2K2QB 4P84A 3ZHSA 3PEVA 1MO4A 2XWSA 4H17A 4G1CA 1AX9A 4TZ0A 2HDOA 1V8ZA 5IBPA 4B6RA 2XQJA 4EUKA 2BEVA 4QTXA 2A5JA 5CVCA 2A0UA 3R09A 3UAOA 2IPAB 5IH3A 2P3QA 1C3OB 3EPKA 3MFYA 5MFZA 2H1FA 3FM9A 1YS7A 2P65A 2WAXA 3HFJA 4J7XA 1KI1A 2V7BA 3CYFA 1RQ7A 5IAOA 3IQZA 2VWPA 3S8EA 1K7XB 3B2NA 1NU6A 4JU9A 3WNQA 5J5VA 4V2IA 1T9CA 4FCTA 5AOCA 1NJSA 4YRDA 4XARA 2IH2A 3DLCA 2OPHA 1G8SA 2IYZA 2VZ0A 3ABIA 3K1TA 3QU9A 4BGIA 4HDKB 4J4HA 4AF8A 4ZHQA 5E9QA 3L4JA 1F8FA 4LKOA 3X1ZA 1V96A 3OBBA 4LKRA 5FNZA 3KYJB 2D3WA 2HK9A 5CNMA 1K98A 2QUKA 5AW8A 1XK7A 4KP7A 2XGJA 3KSRA 3DTVB 4X7MA 3ED1A 1RTTA 3DO8A 1ZK0A 5JQGB 2VQ3A 4MVJH 3BICA 1DEOA 3FDFA 4CLDA 3UAYA 3WISA 4PYMA 3NIGB 4YR7A 2GCNA 2Q5LA 1M33A 4WCDA 4RJKA 2PEYA 1NJGA 4NZOA 1TADA 1VGRA 3DBOB 1IN8A 4CHTA 3L8MA 5ESRA 4MPJA 3X2EA 3VKWA 3AJEA 3PNMA 5ILQA 2B4QA 3ZDCA 1SZJG 1H8ED 1QCDA 3DL7A 5E38A 1XCLA 3UYLA 3V4PB 3REGA 2P4SA 1QFXA 2FZCA 3SF0A 3ZG6A 4YAUA 3FUUA 4DCJA 1K2WA 4QULA 4R71A 2AHOA 2Y0DA 4NLLA 1JQKA 1XU4A 1T6ZA 3AB7A 4HNHA 1W0CA 1H85A 3CT4A 1EVQA 2DYKA 3EBOA 3GLFB 2OXIA 3RK0A 1Y8RB 2P2ZA 2N75A 2TMDA 3ZUPA 1I2ZA 5FO0A 2OVFA 3FPSA 3CNNA 3N7TA 3KSDO 1WO8A 2HDNB 4E2ZA 4NU6A 1M8GA 2VOJA 3NHBA 2GGSA 2SKEA 4C4AA 2FFJA 3DB2A 1RNLA 3KPYA 1LLDA 3D3NA 2NW6A 1GAQA 3E70C 1YA4A 2BP7B 2G0NA 1MX3A 2NT3A 3BKWA 5B1IA 3NDPA 1UFOA 4QRDA 2W6ZA 4WNYA 4EABA 1GKYA 1E1YA 2PK3A 1WMEA 3HY6A 1UBCA 3PQEA 5DNEA 1DHTA 2C3YA 1XTQA 3W8DA 1IIBA 1QJ4A 1LDEA 1Z12A 3IUYA 4FXOA 4ITVA 4W9NC 5DBFA 2HFKA 2A0FA 1GGEA 1QG6A 3H11A 4IIVA 1SXIA 1X70A 2QAGA 5DDIP 2M6RA 2RARA 1XZFA 4H2DA 1EE2A 4ITRC 2HGSA 4Q02A 4WW0A 1O77A 2PGNA 3FUXA 5FORA 2ZYIA 4DFDA 1A9ZA 1SVUA 3NX4A 1JFFB 1RRMA 5CLLA 1CLEA 1C1DA 1OZHA 5EE5B 2EGGA 5AKJA 2HU2A 4HNAA 3UV3A 3E8SA 2V9CA 3DEZA 3G8YA 1L5OA 3MQ2A 3OPXA 2X58A 3MS2A 5IPFA 3SAJA 1QS0A 2JJMA 3O2JA 5KKCA 2BH2A 1K8XB 4Q4AB 2PLRA 3BWCA 1JDBC 4KMMA 3IMFA 2Y27A 1MW9X 1U94A 4D0RA 1CE8B 4KDRA 4FYWA 2J48A 1RRCA 3H7IA 1AE1A 2VF8A 3KXKA 2IOYA 4UTNA 3ZLTA 3EC7A 1NDQA 4G67A 3UGKA 1RMQA 1ZY2A 4I5IA 3VX4A 5H02A 4Z9BA 4LDRA 1NMSA 1O1YA 2WU0A 4N65A 5CH5A 1K2VN 2Y1KA 1P8JA 1A8IA 1TZJA 3IBGA 2J0VA 3TX2A 1UK7A 2EX4A 4NNOA 1ZR2A 1BTOA 4BNTA 1Z0JA 4N1AA 2IYAA 3BOSA 1JU3A 1XMVA 3E03A 3KLPX 4UDOA 3GFRA 1IBMB 3J81k 2IU6A 4J0QA 2Z43A 2B1QA 3G7NA 5DHQA 1QHGA 3PNKA 4ATNA 5JCOA 1D2EA 4R9RA 2W6QA 5IYZF 1OI4A 5IHXA 4QDUA 3B3QA 1NFRA 2FZWA 2WMNB 3DM5A 4MCHA 4UBNA 4L1KA 2JDIA 3H18A 3L6OO 2ODAA 1MABA 2R5FA 1IZZA 1Q1AA 2L18A 3S99A 4C03A 1ZM2A 4P9NA 3PEFA 3UA4A 2DWUA 1XOIA 4CEIA 5A6VA 2Q3JA 3QENA 3WYNA 4PC1A 2BM9A 4C6HA 2CN1A 2D4AA 2XA9A 4MYSA 5BSHA 3HBLA 3U7GA 5FNVF 1SXJB 2SHKA 5J2UA 2D4HA 1GUDA 4NAUA 2JD2A 1B3RA 4UVIA 5HTKA 2WG2A 2XX3A 3CPHA 3VHRA 3G2HA 5IJWA 2ATXA 2GDJA 1KP3A 5E3HA 3RSLA 3FDIA 2M98A 1EE9A 1KU0A 4FCVA 4JT2A 5K3DA 2JLXA 4WKGA 3NTVA 3DSRA 3EMDA 4LYJA 4PG8A 5BWLA 1FNMA 3VR1A 5FHRA 1L3IA 1EAMA 3AOEC 2QQ5A 3UV7A 1B0ZA 4GU5A 2XEXA 4HAIA 4UCFA 5A3SA 2BKVA 4F3YA 3E53A 5MN6A 3PX3A 3F5QA 5SY9A 4XQEA 3GRKA 2R7NA 3TUZC 3U61B 4HLCA 3KZKA 4MQFA 5K0LA 1KO8A 1ZJJA 1W59A 1OBHA 1VXRA 2NADA 4OV6B 1FP6A 3G2NA 1YBFA 1BZYA 1P7YA 3GCZA 3JVIA 4UEOA 5IDQA 5CT8A 1XZGA 2RBGA 4INZA 4WADA 3ZKWB 1TQ2A 4I81A 1YBMA 3AEQB 3PQFA 2G8LA 3MGKA 5EXPA 2ISQA 4HSGA 4OLFA 3ZWBA 4US0R 5C3MA 2BFAA 1PGQA 3H2GA 4TTAA 2EKBA 5IAJA 3FHJA 4JUIA 5EGNA 1BU5A 4LVCA 2WDPA 2Z8YM 4DIMA 4QBGB 2LCFA 1E89A 3DWGA 4MWOA 2GM5A 4UU1A 2H85A 3K0FB 4DR5B 2YRFA 3RF6A 4RPLA 3X44A 3M7IA 1UOQA 4BNHA 1G3QA 5I9IA 4MYCA 5K6AC 4FWTA 2HRCA 2QPLA 1Y34E 1GADO 2JATA 3I6QA 5DI3A 3E5MA 2W5UA 1K89A 4M9QA 1W52X 2MCFA 1JHQA 5T57A 2XF2A 2QAIA 3JQ6A 1NLMA 4M53A 4UM7A 1TVEA 1D8TA 2AG5A 1CEQA 1ECLA 2HA2A 3AWIA 1EFUA 4A15A 2XCSB 4TUYF 1N6RA 1XZMA 4MCIA 3RTBA 1NBOA 3FTQA 3BREA 4GR5A 2WHQA 1DUIA 1R0KA 1I4WA 3EXEA 4M8SA 3DZIA 2OECA 4PNHA 4QFMA 1CIPA 1PWZA 1NVGA 2IP2A 4PZLA 5EE3A 5AP9A 2WIBA 2Q4OA 4W7HA 5IANA 1NN5A 2W9XA 3P9ZA 5DV9A 3R9WA 4V0OA 1SKYB 2GCOA 2ZAYA 1T4DA 2AC4A 1GNRA 2O2JA 1W5AA 3JVEA 5JE8A 1UDWA 1W88A 2PVPA 5AK4A 5GJWC 2R7AA 4BGVA 1BEUB 1EPUA 2FN4A 5JDCA 4QBTA 3H87A 3M6IA 1QF7A 4J9VA 1N0WA 1T4MA 4QC2A 2II6A 2PBRA 1NUHA 2ZYTX 1K3UB 1QKJA 1SA0A 1SURA 3JD3A 1QH8B 4TXMA 2APJA 4Z2YA 1ML3A 3M6WA 1JB9A 5T41A 4CTKA 2FZ4A 2F3PA 4EG6A 1HRKA 4H7PA 4XEHA 3D02A 5I51A 5T7BA 3AUAA 1IU9A 2XZDA 1DC6A 1SNYA 5LU8A 3M8KA 1UP4A 4RACA 4DSAA 2PKRA 2AG6A 1F4LA 1B4DA 4DNPA 2F55A 2JH8A 5L7WA 2W7TA 2E85A 3HQ4O 4G1UC 4XWGA 4MRNA 5HE8A 1Z37A 3TR6A 3X2SA 1S8FA 5FPTA 2VO1A 3STTA 2CW5A 4DWVA 3MJCA 2QOEA 4AXBA 3E9CA 5KSYA 2CLLB 3BK7A 3N74A 1BJRE 1CP3A 1FJ2A 4L0DA 4YRAA 1FYDA 5BMVB 1T0HB 4WSOA 5A05A 3DEFA 1TD9A 2I3GA 3I53A 3U4DA 3MS4A 1SELA 4WXPA 1NULA 2AK3A 1PNOA 1V4VA 3DVSX 4QUJA 2IW1A 4BLWA 2DHEA 3VOAA 1G60A 3FHCB 3MCZA 4G4GA 4RESA 4CXMA 1ZJZA 4IDQA 5KQMA 2F43B 5FBQB 2UYQA 1EFHA 2QLFA 4E7PA 2DWOA 4QGSA 1Q0PA 3PTAA 1NPYA 3QUQA 2HHHB 1DUSA 4ZVKA 1QVVA 3ILHA 4UAJA 2ZS8A 1CDOA 3EVFA 4PIVA 5F51A 1B74A 4UOEA 2VTBB 4NE2A 2PNFA 4NCHA 4BE7B 1J97A 2B94A 5FUMA 5AI4A 1EUDB 5DOVA 3O8BA 1BGWA 1UMBB 4TXLA 2PSDA 1PL8A 3I9MA 3MQ4A 3ZZ1A 4DILA 2QTRA 1SK8A 1DQZA 3TIFA 4E13A 3GEBA 3JQRA 2UKDA 3TOCA 4AG5A 5BV0A 1YU9A 4DDMA 4V0RA 2O5EA 2ERCA 2OZVA 3LRPA 4JYPA 4TWIA 2X0EA 5BUCA 1L4MA 1W44A 4I2NA 1FVFA 2CHEA 5CVVA 1XALA 3N8IA 3UPUA 2BVNA 2OMEA 4OHXA 2XECA 1D4FA 1MX9A 4YV0A 5A0TA 3Q7RA 1SXJC 5DSZA 5KOIA 5JU6A 2I2XB 1T8UA 4ALMA 4C2AA 1I9CA 3IO3A 3PICA 1YBHA 2VP6A 4RYLA 3SN6A 2Y93A 3A10A 3W9SA 5B7QA 1A5BB 4CDRA 3OJCA 1VMEA 5AUNB 3KQLA 5DNDA 3F2IA 5G3YA 6Q21A 1C9DB 4D8VA 2UXCB 3PPXA 1I3NA 2R6ZA 2R66A 1XQVA 1P9NA 3FBTA 4CQMA 2HF9A 4MXDA 5HBRA 1M0EA 1CUBA 3RPEA 2FYTA 4GL4A 1YJ5A 2Y71A 4Y0NA 4GPD1 2JS7A 1RLMA 4XYBA 4GX1A 3JQ7A 3KDSE 1G1AA 3OQJA 3PDIA 5BYKA 3EE6A 1F7VA 2LKCA 4Q9NA 4DV3B 1XAIA 3FSEA 1NBAA 3HDJA 4PZZA 2OC4A 2MU1A 2RGGA 4CW7A 4DR1B 1K4KA 3VPDA 4M8KA 3GNLA 4GOMD 3UPDA 1N1DA 3DHEA 3UMFA 1NVUQ 4GZ6A 3E23A 2D7CA 4DRZA 1O6CA 1EK1A 2W4MA 4HTAA 3I83A 1RWBA 2NTEA 1ZNYA 8ABPA 2Z58A 1E92A 4HMPA 4D9BA 1L4BA 4DB4A 4L9RA 2B5OA 5ES3A 3PUJA 2YHSA 4EPVA 2JFUA 2HU5A 3RUCA 4L4UA 5AFSA 2AJ8A 2Q4BA 3JXEA 4TXJA 5FFMA 2ACWA 2ZUCA 2GKSA 4OOEA 1EXMA 3DTNA 3LLCA 2NU7A 3DC2A 3NHZA 3OLWA 1SA0B 4WE3A 3ZBTA 4B2PA 2PL9A 2R9VA 4ARAA 4BZQA 3HBAA 4NJMA 5D6OA 4JLDA 4AKSA 2ANBA 3ZE1B 5L7YA 3TJMA 2H1CA 4OHKA 3EAFA 2C4WA 4B3MB 1CB0A 1H2EA 5BQFA 2Q7DA 5B36A 1FB5A 5BT8A 5LIRA 3PXXA 3T4UA 5AM4A 4ZI3A 1ZGGA 3CLSC 2O14A 2P2YA 4QARA 2HO4A 3DGFC 3N59A 1Y6JA 1AH2A 3JX9A 4LYDA 2CVPA 3RVQA 2LUOA 4Q7JB 2A1TS 4FQ8A 1BCRA 4ZHQF 3TCNA 4ESVA 5FWXA 3TWOA 1DIBA 3PSHA 1MJHA 1K08A 3TQIA 3BHMA 1U2DA 2GS9A 4HWKA 4P53A 2AFVA 3I1JA 4UFNA 3WB0A 4NCKA 1K66A 4MROA 3L18A 4GI5A 1MC1A 3W5AA 4OM7A 5ALOA 4JJ4A 1ZD9A 5G53C 2ZS9A 3H5NA 4G5FA 4R8LA 3SK0A 2BMFA 3HH8A 4PN7A 3MPOA 3FMIA 3QVGA 4MPRA 3SJUA 2JIMA 3B9RA 4J94A 1DRVA 4JD5A 5E2AA 3WS7A 1VYTA 4IXNA 4R98A 5HIMA 4Q9IA 1RKUA 4N0QA 5KC9A 3D6HA 1OHHD 3FW1A 4QUEA 1I01A 4PAMA 3RK1A 4BUJA 2Y67A 5DVZA 3VOSA 4QDZA 4ZO4A 2DPXA 2REQA 3NUQA 4Y9RA 3F4LA 5C51B 4E15A 3KFVA 4N7MA 1TO1E 3AF5A 1EDBA 1Y5NA 4GR4A 5JMWA 4DCMA 5B1DA 3INYA 2ZEJA 4HN9A 3KWMA 4PLHA 3ENKA 4PYLA 5EJMA 4ZKEA 5C5CA 1GPH1 2ZZMA 3HM2A 2GJ9A 3LTEA 3MJRA 4PR0A 3VYUB 1XEXA 1M74A 1ULSA 1UM8A 3QMPA 3V9AA 3WYAA 1LFDB 1F2VA 2F8MA 3BWEA 5ALRA 2ZCUA 1W1WA 2YASA 4D5EA 4XVCA 3QFSA 1ZLYA 1KJIA 1MAVA 4UM9D 5AW2A 4KR3A 1HYQA 1ISGA 2A67A 4GPZA 5ITSA 1JHVA 2KW5A 3GBSA 3ZWYA 4AWAA 1V4NA 3BCHA 4KK3A 2J59A 4BWVA 1D2MA 3JATB 1C9KA 2B7CA 4CKCB 4C4RA 1G8HA 2UVDA 3TOXA 3I6IA 2XVXA 3G0HA 2KWIA 3QKRA 3BWBA 3FR7A 1QDUA 4RLHA 4ENPA 1T5SA 5IASA 2AE2A 4GSKA 1GZ6A 1XGKA 1BU8A 2HBQA 1VB3A 3B52X 3NVAA 2ZPAA 3D4PA 4UM5A 2ONYA 4YQEA 2H6EA 1IJKA 5ESXA 3DWFA 1O95A 1ZS9A 3AIMA 5TC4A 2Z5VA 2PSJA 5CAEB 1V11A 3OQOA 5JALA 1RXYA 2WIDA 3PDHA 5CVJA 2OESA 5JBNA 1VKOA 3L8HA 4L8VA 2RH5A 7ABPA 1FLNA 3AL0C 5BNFA 2HLDA 4ML3A 5EG5A 3PI7A 2AW3A 1AKTA 3F0TA 4INOA 3I9V1 1P29A 1F20A 5TARA 4OXYA 1T1SA 4BJ5A 4ND1A 2ZKLA 4EAQA 1QB7A 1WXDA 3GAMA 4E94A 3EA4A 1ND5A 2YY6A 3F47A 4FFBA 4Z8YA 2JJ8A 1KO5A 3GBVA 3H65A 3JVVA 3N2KA 1NVDA 2H0RA 4BIMA 2WOOA 1PWXA 3JYQA 2X8WA 4K8OA 1KEPA 2FWNA 2P0YA 4UUQA 1ZXBA 1Z56C 3OOEA 1T5IA 1NDUA 1N6OA 2IZ7A 1RYHA 2DFLA 1NF8A 4N18A 1N3LA 4JXKA 3COJA 4MAFA 4QXAA 4RK6A 4JP8A 4J90A 3MLAA 4KX5A 1W9HA 2VUTA 1E96A 3IB6A 4KQJA 3STYA 5GVRA 3UCEA 1UCFA 2FPSA 4PLWA 1M67A 1R15A 1XF9A 5KVAA 2NVUB 3TFWA 1Y6ZA 2PAAA 1O94C 2R85A 5KYVA 4FGWA 1EGHA 1YKGA 4YDSA 1CQJB 3FCYA 5KOHB 2C5EA 1L4UA 2X3YA 2X5XA 4PHCA 2JJ1A 4GMDA 2C8JA 4PHFA 1DIGA 2HYIC 3NDRA 3PKJA 1SU6A 2YQ4A 4LDPA 1S2OA 2CYCA 1D2AA 4L16A 2VATA 3AR7A 1U8TA 4QT4A 2Q9AA 4G89A 1YVUA 1HE1C 3ET4A 1FVOA 1K7YA 2VF2A 1S2GA 1L5MA 2F6RA 3K9BA 3PPWA 3JQFA 4YWHA 1JDVA 5JT1A 1AKQA 3KEOA 3OC6A 5EINA 5M3BA 2ZRBA 3EEFA 4DJ5X 1J1ZA 4E4RA 1QG4A 3NHFA 3FMOB 5JAIA 3FE2A 4RKYA 2C61A 4JU8A 1OWMA 1RYFA 3BJMA 2JHPA 4OP1A 1B6TA 2OP0A 4Y2HA 1DT3A 1UPXA 2VG8A 3RVRA 1QFYA 1ECJA 1TKRA 1SC1A 4AJPA 1GM5A 4L78A 2RGNA 4IV0A 2UYHA 1FUYB 1RRFA 1B00A 4EJ2A 1AZSC 3EQ8A 4HATA 5SY6A 3AI7A 2BJWA 3DXZA 4D92A 1XDZA 1X7YA 4JR0A 4JROA 4TGLA 1TC1A 2PQMA 1A2QA 3ZHCA 1YACA 4MRAA 3ABQB 1MVOA 2VAVA 4BDSA 1UWCA 4CRWB 4QQ8A 4RIEA 2ESRA 4MV4A 5IVPA 1Y1SA 1JDZA 1Y9ZA 1JG1A 5FNVB 3E6AA 1I3CA 2VSFA 3B8EA 2W0SA 4UQPA 4WASA 1CZHA 3BGSA 2ZJ3A 1NIPA 4L5JA 4ZVVA 3CVVA 4D98A 1YQDA 1E4EB 4JQCA 3VZSA 3SX2A 3KB1A 3X1JA 1K0UA 1Z7GA 4P3PA 3GHYA 5J2TB 3D1VA 4CTNA 3ZE6A 1IY1A 2IXBA 3L8GA 2XBUA 4HI0E 4V38A 4KBGA 4XI9A 5ARCA 4JI2B 4RZHA 3FIUA 3MFQA 1PKXA 1CQIA 3FROA 3UG6A 3LW7A 4C0SA 2AXQA 3OT4A 5EUBA 1NZJA 2JARA 3OKCA 4QGAA 2AN4A 1N6HA 3HG7A 1IB6A 1PG5A 3ESBA 4KFSA 4YRTA 4RK1A 4PRYA 4UU8A 2ZT8A 3OJFA 2O19A 2ONKA 1S2NA 3IHTA 3ZGYA 3USZA 2JBAA 3R0ZA 4OJMX 4B83A 1J5PA 2LD4A 5HQJA 3V8VA 1YWGO 4Q7MB 3QXCA 3COVA 2FMHA 3MTGA 4L74A 5C7IO 2CXNA 2XE4A 3HJUA 4B33A 4GOJA 3O83A 2E1PA 2POCA 3H8WA 3UWMA 3FMVA 1U5CA 2B82A 3TAHA 3TKAA 4PYIA 5BNWA 1IMJA 1SC4A 2GRUA 3W5VA 5BR8B 3NASA 2PSSA 3JV7A 1IOLA 2VBIA 3GUZA 1J5XA 3B9BA 4FFBB 4RHTA 4N7BA 1P4GA 1ZK2A 1HDCA 2BEUB 2P9EA 1ZMBA 2OBFA 2PSFA 2ZTMA 1P1KA 3CV3A 1ODTC 3HJHA 3LGAA 2YWRA 5YASA 3ZXSA 2EX0A 4B44A 1E18A 3M1AA 3PCXA 1SU8A 5FA6A 4D3XA 3N2NA 2EDCA 1DWUA 1NL3A 2EWMA 1CKEA 2PX6A 3AEKA 2EW1A 3BG5A 4OUDA 4G4SO 2MSEB 4B6QA 4UHDA 4JCOA 2QZZA 2FPRA 2PY6A 4ZQFA 1M34B 3TFOA 4FFDA 4A92A 4QTUB 1ONSA 5JAZA 2WYHA 3AT1A 2DFVA 1SFRA 1EFAA 3CRRA 2W43A 1QMGA 5JWRA 5EGSA 3MWEB 2OGUA 3H5AA 2BHRA 4ZCLA 1XTUA 1Z5ZA 4J1QA 4L51A 5J43A 2O8DB 4TL9A 1A8SA 4N76A