5HDQA

Mntc co-structure with mab 305-78-7
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
277
structure length
273
Chain Sequence
LKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter substrate-binding protein
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein/immune system
total genus 98
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA01
2R79A 3CX3A 4OXRA 3AEKA 3UJPA 5KOHB 2PS9A 1TOAA 4WNAB 4HMOA 5CX1B 1QH8A 4CL2A 1PSZA 1G20B 3AETB 3GI1A 2YNMD 4WN9A 3BE5A 1XVLA 3LI2A 5B58T 2AFHB 2XDQB 3ZK9A 3BE6A 4M7OA 3MWGA 3R5TA 4N01A 1PQ4A 4K3VA 4WZAA 3PDIA 2PHZA 3U7QA 5KOJB 1KAEA 4B8YA 1M34B 4TKUB 1K7SN 1K2VN 4MO9A 1M1NB 3PSAA 4WESA 4UDNA 2AFIA 4UTOA 4PM4A 1N2CA 1G21B 4FKMA 3K1AA 4H0FA 5BVGB 1FP4A 3AESB 2PRSA 3HXPA 3AERA 4HMPA 4XPIA 3TEFA 4BBPA 1H1LA 4LS3A 1L5HA 3AEUB 3EIWA 4UTPA 4LJSA 2ETVA 4UDOA 3AEQA 1QGUA 3ZK8A 2OV1A 1M1YA 4WZBA 1N4DA 5JJ5A 2PS3A 2XUZA 4GICA 4H59A 3PSHA 5KOHA 4WNAA 5HX7A 3MD9A 5I4KA 3ZKAA 1N2ZA 5CX1A 4NNPA 4TKVB 1QH1B 1ESZA 2MINB 3ZK7A 5BVHA 1K75A 4OXQA 4DBLE 4IRMA 2AFHA 3G9QA 3HH8A 3MINA 3R5SA 4HMQA 4INOA 4NNOA 4PAGA 2M6LA 4ND8A 4OVKA 4MLZA 5FLYA 5AFSA 2M6KA 1EFDN 5KOJA 5M2QA 3NU1A 1M34A 4TKUA 1MIOA 5HDQA 1M1NA 3K1AB 4FILA 2XY4A 2RG7A 3AEKB 2OGWA 4MX8A 3TNYA 1G21A 2PS0A 5BVGA 1QH8B 5CR9A 5KHLB 4FI3F 3ZTTA 2XQVA 3MWFA 3HJTA 4WN9B 5JG7A 5JOQA 3AEQB 3AEUA 1QGUB 1G20A 3AETA 2OV3A 2R7AA 1K0FA 3EIXA 2WHYA 5GGYA 2XDQA 5M34A 4WZAB 3PDIB 2YNMC 2X4LA 4INPA 2XH8A 3U7QB 2QI9F 4TKVA 1QH1A 1KARA 4G07A 5BVHB 2WI8A 5JPDA 4WESB 1KAHA 2AFIB 3MINB 2MINA 1N2CB 3TLKA 4ND8B 1N4AA 4MDYA 1FP4B 2O1EA 2Q8PA 4FNAA 3AERB 4XPIB 1H1LB 1L5HB 3AESA 3LHSA 2OSVA 1MIOB 3MFQA 2Q8QA 5M3BA 2XV1A 4G09A 5GGXA 4HN9A 1M1YB 4WZBB 5M29A
chains in the Genus database with same CATH superfamily
2IYZA 3VOTA 5CPFA 3NT5A 5D2CA 3SKXA 1EE1A 4YUZA 1M5RA 3F6EX 1GU1A 1AQYA 1NN5A 1K6IA 1UXHA 3W8EA 2V8OA 2AHRA 2JL1A 1G20B 2I3DA 1E7WA 3MELA 4M0DA 3C3DA 2PCLA 2A4MA 1IMJA 3H19A 4NBLA 4Y18A 2XB8A 1TA4A 3B9PA 2I4OA 4G01B 1ONNA 5IZ4A 3NBXX 1CFZA 1NBWB 1KQFA 2NW6A 3QHAA 4BWGA 3HKDB 1G5HA 1XRLA 5C1DA 4G9BA 3TLYA 4BEJA 4DV1B 2H2FA 3CLTC 1YE3A 2OG1A 4PW0A 3OT1B 3IV9A 1R15A 5IDWA 1P4AA 3H1TA 2PH3A 4LBVA 4A10A 5JMPA 1FU8A 2ZI3A 4JBNA 3W2EA 1P7PA 5LZ2A 3W7VA 1XALA 3HKCA 3OZIA 3TO5A 3DLPX 2OGUA 3P26A 4YNBA 5LNK1 2BELA 1MW9X 4DNOA 4FGWA 3L3BA 1II9A 2GA8A 1YV9A 2BF7A 2ID9A 3M89A 4DIFA 1X7YB 2W22A 4PZCA 6ABPA 2I71A 1MX5A 3JQGA 3T34A 2HPZA 3BZUA 5ALVA 3V48A 2WC1A 1VYHA 1H9AA 1QYRA 2XVMA 1BE8A 2BFEB 3H97A 3N5KA 3PFFA 4WSOA 1KETA 4PHCA 4O4LB 2ADOA 2YY5A 5WRFA 2RMKA 1OC2A 4H08A 4CV1A 4D0LB 4OA8A 4EITA 3LYLA 4Z3DA 2VPQA 2VRCD 1SUBA 2CXPA 2AD1A 4DIBA 1XWIA 3GH3A 3T3GA 1QO7A 3G2MA 2BFWA 3DOCA 5TS2A 2RK6A 3H8VA 1UPCA 1YZUA 4KK3A 3OIUA 4EKEA 4KNYA 2XW6A 3CM0A 4EW6A 1FRQA 4AN1A 1KK0A 4LYYA 5AVJA 2IHBA 3IQEA 1ATIA 1RWOA 4XQCA 2AX4A 3KLPX 3TMYA 2I9KA 3VNBA 1BG6A 1KRXA 2YOGA 4ZV9A 3LQQA 5EFOA 1RIFA 1MO4A 1SOUA 4CTJA 2YN4A 1FDSA 2PS0A 3AHHA 4AJ9A 3BF7A 2KWIA 4HVCA 3E9CA 2F3SA 3V7UA 3JQ8B 4TTRA 3F2VA 4LJAA 2FEPA 5AJYA 1I32A 4AS2A 3FPKA 1T5HX 2IIPA 1MRZA 4JA0A 3VR4D 5EWMA 1X1QA 1U2PA 4NENA 3DTYA 5E1DA 1P4JA 3GP5A 4Y9UA 3UGTA 4CMKA 5FOXA 4XSVA 1TW3A 4YFVA 2XMRA 4A2WA 4TLBA 5M34A 1P77A 2Q7DA 2RI0A 3NIWA 2AS0A 3ZD9A 1NVVR 2QTNA 3MC1A 5LWQA 4LZPA 2AMLA 3K9NA 4J9VA 4WBNB 3TS1A 1ZR4A 1QGYA 3COZA 4IUYA 3SSMA 3SF8A 4RLFA 8GPBA 3F7MA 5AQ1A 1TCCA 4UUQA 3KJHA 3BHIA 3GLVA 1IY0A 1Y1PA 3IXQA 4EUSA 5FBRB 3G1WA 1VBNA 2CLOB 4MGIR 1JS1X 3AF5A 3O84A 3AWIA 5HZKA 5BSMA 3TM4A 3GR6A 2ZXEA 1OW3B 4ZOQI 4ERXA 4NY1A 1DKRA 4M9SA 1ENOA 2Q4EA 2ZBEA 5AM2A 2QN2A 1IRXA 4WKNA 3K70B 1D8AA 1FDIA 3TBHA 3UANA 3F8SA 1ADYA 1C50A 1VGQA 1Y1LA 3VR1A 3P7MA 1AHNA 1KJQA 3CCCA 2WYOA 1V8FA 1C1DA 4ZK2A 3E7DA 1QJCA 5HFJA 1ID1A 2P75A 1MXFA 4KRXA 3RVKA 4QTYA 5CJPA 4U2DA 4BGVA 2NV6A 3DD5A 1T8UA 4DIKA 3A9TA 3IL2A 1P0MA 2YW2A 1BX0A 1YVUA 3E8SA 2JZOA 3BH7A 5DOZA 1PQ4A 3T5CA 4D6YA 2VTBA 1TZ2A 3FSJX 5ALKA 4WINA 5KSYA 3B38A 4IIVA 5FYQA 4MR7A 4PS0A 1GPDG 5JPCA 4B6QA 1YQWA 3BMCB 1KH2A 4KREA 2NIPA 3WRXC 2X3FA 2XEDA 4K9MA 4UTOA 5CB4F 2OCLA 3LGSA 1D04A 4RFSA 3V7WA 3GX1A 2KLHA 4FUTA 1UF9A 1Y1QA 3Q3IA 1T2UA 4JJEA 2FGJA 1ZW6A 2IUYA 4B7ZA 1VLHA 2Q4TA 1UPXA 1H2YA 2VNJA 5J1SB 2FWNA 1ZUNB 3I58A 2WYWA 1NJFA 5CM9C 3ZHRA 1F4LA 3MGBA 4RZQA 2BGIA 3DAHA 5F5NA 4JXKA 2VYNA 4JLSA 1NUUA 4NU5A 5BORA 2HPVA 3EGOA 5I7VA 1SKMA 1M2KA 4MJLA 3HXMA 3MMXA 2HJWA 2JA1A 1F7UA 4HDAA 5KYYB 2FZVA 3FRHA 3VX4A 2EZTA 4JLOA 4BBZA 1B8OA 1Q6YA 4BNFA 1NI5A 2WAMA 3F9CA 5CPBA 3HCDA 4W82A 1OH7A 4A8HA 4IW3B 3L40A 5FHRA 1K2WA 4DXDA 4K6GA 2HJHA 2YCLA 1NV9A 4RENA 5JS2A 3C5HA 4B3HA 2EEZA 3DW3X 3HCPA 1FNMA 3EK2A 3WLJA 1WXQA 3WZMA 4IH4A 3I2FA 3ZJ5A 3EAGA 4IJUA 5LYJF 1PJAA 4OH7A 2XUQA 3FIUA 1IBCA 2WRZA 2XCTB 4RGYA 3B2EA 4Z7OB 2O2IA 3CX8A 2QTGA 4EI8A 3EZNA 1ZKDA 3EZ9A 3OZFA 5FOSA 1YA8A 2A33A 3RK1A 5C3UA 1IEVA 4YECA 4MX8A 2OCAA 2XUFA 4TWRA 3KJNA 3WK9A 2OCDA 4W4TA 3EZXA 1I5EA 4XKJA 3BCHA 1VSUA 3AF2A 1PR9A 4NBUA 1MJNA 1JAHA 3BPSA 3EG9B 2YFHA 3T9AA 1E2BA 1O97D 1Y3IA 1PJ3A 3M6AA 4K9PA 2COEA 2QR5A 2YV1A 1FB5A 3V1UA 4EYSA 5HIMA 2CJWA 4EM6A 1CJTC 3BBPA 4QOHA 4K03A 1FFCA 3KQHA 2WVAA 3ETCA 4ZU3A 1JSZA 3KM0A 1CG6A 5EE1A 3L4BC 4DLWA 1ODFA 4Q9NA 1NG9A 4U9UA 1JVNA 1ONPA 2JI4A 2ZUCA 3B89A 2EAUA 3D59A 3NQ41 3UAWA 3VH3A 4BYGA 5KTKA 3G5UA 3O4HA 1MRSA 1TK3A 1S3IA 1WULS 2HN9A 2EIHA 3KLBA 4JODA 4HB2A 4OHFA 4DF3A 5KU7A 3LHSA 4E2FA 4FDAA 4L5CA 2H9IA 1T6XA 3A7DA 1M8KA 5EN4A 2L17A 2XNDD 4Q3NA 4UQPA 3TRFA 4YRIA 1MQSA 2OCIA 4EI2A 5B6IA 3O2NA 3K8OE 4UQOA 3DLBA 2R6DA 4IVRA 1CP2A 1LKZA 1NVXQ 1KSJA 2ZE8A 1GFIA 5I7UA 4AD8A 2C3UA 4JELA 5IZCA 3EDQA 5AM0A 3V1NA 1U8AA 2D00A 1FUIA 4MQLA 2R7MA 3CY6A 2G1UA 2H7YA 2ZPTX 4FONA 3SLKA 2G0NA 2C2KA 3HBAA 4KIJA 4M1OA 4MZDA 1U9IC 1L7BA 3CKKA 4WBXC 1EJ2A 1V5EA 2Y1EA 4U7HA 2GCOA 3VOAA 4C21A 3HYNA 3NOVA 1H2AS 3ORRA 1LPPA 4UBLA 2AR0A 1EUZA 1MTZA 3B3FA 3GNSA 3L0IB 3KDPA 2QMHA 1A9RA 2Z04A 4AG6A 1IK4A 4BPBA 1OX6A 1RIIA 4TUYF 1I80A 4ROSA 1OXXK 4EHAA 1J6UA 3ABRB 4UAUA 2BGRA 2YWHA 3HQ4O 5DM1A 2ZRCA 1CLUA 4ZVLA 1KKUA 3ME5A 5ANRB 3A2NA 1ZM9A 3BGVA 3EVDA 4B8ZA 3M33A 1PKEA 1A97A 1IE3A 2H51A 3NHYA 3QRWA 4PQGA 3KR9A 2PRSA 4MRPA 3H99A 4JJKA 3U4QB 2RB4A 2OOKA 2BSAA 1R64A 4ZMRA 1QM5A 2JK0A 3MWEB 1BJRE 3ZWAA 3VO9A 2F43B 4EEZA 4BRWA 3LWNA 3PNQA 4H1WA 2VDVE 3EVGA 1LC0A 4A15A 1NNEA 1SAYA 1Q1GA 2QTCA 5TDHA 4HB3A 2O7VA 5IULC 1NW5A 4YWHA 5JQGF 4AY6A 3JQPA 1Z39A 1JLLB 1XPJA 2OZVA 3L0DA 3H1EA 4J2HA 4RIFA 2GEKA 2ZJOA 2GHQA 3B6MA 3UFBA 4A3SA 4M99A 1M34E 1D5CA 1GQYA 1EUCA 4KNWA 4MS3A 2AEJA 3L6EA 3K31A 4OQZA 2YIDA 1N0WA 3G2HA 1A8UA 4UBNA 5BSGA 3ODGA 1P9RA 2GARA 1O94A 4HFNA 4TKMA 1LXCA 1NASA 2FUG6 3KZVA 4HGZA 3VVBA 1MH9A 4CMEC 1TYAE 4MINA 1L5KA 2I5PO 4QXQA 4PZLA 2PS1A 1Z0AA 3L82B 1QX3A 2GX6A 4LOIA 1MC5A 2WOJA 1K86A 1U9JA 3GFSA 4NV0A 4OBEA 3CGGA 3PT9A 5FJIA 1TFRA 1U5CA 1QK5A 1U80A 2C95A 3R8CA 4Z51A 4DV3B 1YQTA 2VHVA 5BN5B 2YWCA 2W2LD 1EWTA 1P1IA 5DN6D 4ITRC 4FNGA 2BEWB 1EFRD 3DZHA 1RDFA 4ZJZA 2QMZA 2G9QA 4R51A 3CVYA 5BSUA 3B85A 1WU8A 3DV0B 3U0BA 3WTCA 3SG0A 1RPTA 2PR2A 4NYMQ 5DF1A 4YLYA 1BOFA 2IKQA 1FMCA 5AVSA 5F4BA 2ZUBA 1R5BA 3F5SA 1EBBA 3JPYA 2QYHA 2V4UA 3P2IA 3QZUA 2GBCA 2ZRMA 4PGFA 4UJ5A 4WWHA 5BQOA 4F1KA 5BOSA 1Z07A 3B6IA 3ICVA 4LGCA 4UNQA 1H22A 3O5AA 2HNAA 2ROQA 2X4IA 1U8CB 3HUFA 4EW1A 4A16A 1YR6A 3Q7TA 2UXDB 3EDYA 3A11A 2GK3A 4BV9A 1Z63A 2G04A 4FOTA 4Y1RB 3K2QA 4C4SA 2UYCA 2PSFA 2H1HA 4OYYA 1GYQA 2QN6A 3ELYA 2GEVA 1NXSA 5I8WA 2R1TA 4EYEA 3NMUF 1L1FA 1X74A 4YAEA 1V7PC 1VCNA 2I91A 5LKAA 1N3IA 4RW0A 4U2BA 1TEZA 3BCSA 4D4KA 5G2OA 5HIAA 3NOQA 3LX5A 3WB9A 1UBKS 4N7MA 4DV4B 3UKDA 3MJDA 4FMPA 1Z47A 1SWWA 2XZTA 5KWIA 1ZSNA 3BFJA 2I4MA 1KP3A 2ANCA 1EX7A 1A8IA 5BWLA 1TK2A 2D0IA 1QH8A 2FFAA 5CDHA 4WGGA 4PYIA 3GRVA 4RVNA 3GI1A 3LPDA 3CF0A 4GSYA 4CG0A 1GSAA 5CIYA 2C59A 1TJPB 4MR9A 2J6CA 4BRSA 4YRBA 1YI8A 2G72A 2UVPA 3TW0A 4E1VA 2XZLA 1F9AA 2A9FA 1TLLA 3ANLA 1QG4A 1VTKA 4DMRA 3ZD8A 5J23A 2X22A 1DG9A 2BM9A 1JU9A 3IHKA 4OX9Y 3OH8A 1A9XB 1YOVA 2OTCA 3EMKA 5H59A 4BIIA 3QWIA 2WJHA 4QHYA 2WPNA 2OFWA 2I7DA 4EPXA 1M7HA 2D2VA 2YASA 1MA3A 1TIKA 1J8MF 3D5TA 2XF2A 1R0YA 2IIQA 3Q87B 1CUYA 5ARCA 2ZR0A 1SQSA 1B6RA 4F7WA 1J07A 2A9JA 1BWRA 1G2QA 2FWIA 3A9RA 3FDFA 3H2ZA 2P69A 4LZNA 4NPCA 5EP4A 3ZGLA 4IIXA 1L8XA 1U1CA 5LUAA 3U3DA 3TTYA 2XMQA 1VECA 2J87A 2VJNA 4MUXA 1YRBA 3OPMA 5C8YB 4AKIA 2IQIA 1LNSA 4IJMA 5D3QA 1U1FA 1VKRA 4D3YA 2PFSA 1WWKA 4DQUA 1RQXA 3EDRA 3IQXA 3N8IA 3I2YX 4R41A 1CDDA 3OIGA 3VHRA 3S4YA 4EMTA 1OB2A 4OX9B 2AGVA 4B17A 2ZS8A 2CY0A 1EVLA 4CM9A 4OAPA 3EOZA 3UJHA 1WCIA 4D9FA 1QLHA 2BM1A 2Q5OA 4OPMA 4U7PB 1X15A 3S1AA 4R7GA 1UXJA 2ONCA 4NPAA 1KO1A 2JHFA 4EUHA 3BSYA 3CNOA 1H65A 3PP8A 3OTHA 5BUZA 2DZDA 2QV0A 3WV5A 4BDTA 1EI9A 2DF8A 3CPSA 3IKJA 4G5HA 4N41A 4UM7A 1DXOA 1UC4B 2QAIA 1OASA 4EF5A 4H2DA 1YHNA 2O0MA 1HTTA 3DBIA 2CSUA 4N18A 4URVR 5ELXA 1CIVA 4WAUA 3VC3A 4QQKA 3U6BA 3QQPA 5I4IA 5CVJA 4E31A 4QECA 4F4UA 3P9QA 4M8SA 4DMUB 3D1LA 2AZDA 3OOEA 4RHXA 4WFKA 2C4WA 4V1CA 4CNQA 3GU3A 5AJVB 1NU8A 1A7KA 2GAOA 3BQMB 3R3JA 1VGRA 4JEIA 5KYVA 4KN8A 2ZAIA 1D5WA 2WT4A 1RWKA 2FWAA 1A95A 1SELA 3CRVA 1Y9AA 4Y2VA 3TR0A 1T0HB 1XELA 3A1EA 5F78A 3ROZA 5IMSA 2JRCA 1NPYA 1SEPA 2WQ7A 3AR2A 3CFYA 1C1HA 1EJ6A 3V8PA 4X3OA 2IZ0A 1ZN8A 5LJLA 2MMGA 3JASA 1O4WA 1RI1A 1TJNA 1E89A 3BMQB 3LRXA 5ESDA 5TC4A 4W5HA 1OWOA 4C7MA 2DYKA 2PZFA 3OIFA 3IQIX 3H0CA 5ILQA 4B4VA 3VTFA 4E12A 1W1IA 2EP5A 3GLHB 1E2DA 2PG3A 2GBIA 2O1EA 4Y6OA 1TLTA 1D0SA 3L7OA 4PLCA 3WQHA 2YC4C 3C6ZA 4NTZA 3WNZA 2VBIA 4TTIA 1E7SA 2Q2OA 2AW3A 4BZWA 4YRTA 3P5BA 2G88A 2Q5FA 5FUYA 2WKWA 1KK3A 2O52A 2HMWA 1DAOA 4QELA 1UT5A 1W5EA 4N47A 4Q7LA 3L1JA 4ALJA 1BGVA 3UJPA 3HJHA 3LVRE 1RFLA 4IHKA 3ZXIA 5JV5A 1I2BA 4JLUA 2VZLA 2B9EA 1IJFA 3PNPA 4PLPA 1FW6A 4GR4A 4EATA 1AZLA 3MSXA 3OU7A 2CGEA 5AKZA 3WIOA 2C88A 3LPMA 2VH1A 3OZEA 3ZDXB 2E21A 1JL3A 1MENA 3WLPA 4AN4A 3HWWA 1ISIA 1Y0BA 3G5MA 1PZMA 4JC0A 5EMMA 1NQOA 3UHFA 5DM60 5K0ZA 1OGJA 3IPAA 3C87A 1PZGA 3NW9A 3OUUA 5ENVA 1XD2B 3MA0A 2HU5A 3VYUB 4C5AA 2QTFA 5J63A 3ZLUA 4IQ0A 4PC2A 3PD0A 5F1YA 5FA5A 1PJLA 2RKOA 2VPTA 2BTOA 5G41A 2GPJA 4NJOA 3WI7A 3ZIAA 1FNBA 2OEPA 5A7HA 1E3LA 3RO7A 3TQRA 3K2BA 4QDOA 4BVHA 3DVAA 5I9LA 2CDAA 1G6HA 2BI7A 4AICA 4AXBA 1X0XA 1X7ZB 3WMWA 2QVLA 3U7GA 2WJYA 3ELDA 2C92A 4Q4HA 4N76A 1Q6ZA 3U3KA 1RXSA 1DEAA 2NNLD 1HFKA 3OETA 1G38A 2IP4A 5LZ5A 2XCLA 4AY3A 3HDGA 4K81B 3UB2A 1P9LA 4OHWA 4UE6A 1SKQA 2AFHE 1F0PA 1DNPA 3NOOA 3RTBA 5K3BA 3U31A 2I76A 4BU0A 2O59A 1ST3A 3M6IA 2HU2A 2O1SA 3AI7A 3LT0A 3IGFA 2P5TB 3FBGA 4M0EA 5BNWA 2CFOA 4RTJA 2BCJQ 3NJRA 1XTBA 4K2HA 5JWOA 1IAQA 4V0ME 1JG2A 1DTWA 4JCCA 1DTSA 1L4LA 3NHMA 3FTNA 2X76A 1C4XA 1S89A 3IKMB 2JGMA 2I54A 4YO8A 4Q6WA 5HG0A 2NGRA 4BL5A 1MO2A 4QDTA 2IEDA 3UHPA 5BV1A 4DUZB 3NHAA 3KEOA 4L8VA 1N7HA 2JCSA 1UQRA 1VA5A 2ZWVA 3E81A 3A37A 3WNQA 2FSUA 4R1LA 2PQMA 1QHHB 1RXWA 1NMZA 2FSSA 2QUHA 2KYRA 5YASA 4S0XA 1PWEA 4AULA 4E03A 4E2YA 1NDHA 1UT6A 2KM1A 1Q0PA 2CVFA 2VDWB 4D25A 1R10A 1XZ8A 1UBFA 1WCYA 4K0KB 1DOZA 1PU2A 1UKZA 1L7EA 2XWSA 5CR9A 4R2JA 4H6XA 3C6QA 3VR0A 3V42A 2WHEA 1WMFA 4P33A 1R50A 4YP9A 5A3QA 2W2PA 3E2MA 4CQMB 2OVBA 4YH1A 1DWOA 5ITWA 1SVIA 2GN4A 1ML4A 5LB2A 1K5DA 2JARA 3ROXA 3QUTA 4PZYA 5DM0A 4WEOA 4WLVA 3ZVRA 4D6XA 2FSPA 4IINA 4OJNA 4YFYA 4ENPA 1QRDA 2WICA 3MF4A 3N07A 4QTTB 1GG5A 4WDQA 2AVDA 2FEKA 5KNLA 4NZMA 4F2HA 5LP6F 3K0FB 4PFJA 4XFKA 3AM5A 3QG1A 3RHFA 3CB2A 3UJBA 1N4AA 2I67A 3BIFA 2NUAA 4V3BA 1Z2DA 1XD8A 1JI0A 1XUOA 4QPPA 1QRAA 1RKVA 4D4MA 2BKXA 3D8UA 4K5QA 1OH8A 4W7HA 5JDIC 3QU9A 3GPBA 1NYLA 2JGFA 3KT3A 4GLFA 4C4OA 4KR7A 5GONF 4EHHA 2IYVA 1N2SA 3F74A 2G1JA 3I73A 3O94A 4M1MA 4ZVQA 3ZGOA 3A1TA 2BTQB 4JDPA 5EIWA 2Z08A 1L5MA 3T3MB 3G9XA 1KOJA 3NTXA 1W85B 1E6MA 1CQXA 4MCHA 1RHUA 1C9DB 2YR0A 1WEKA 3KPWA 1L8OA 3HYTA 4KXLA 1LK0A 4TVKA 2XUDA 3WIBA 1OA0A 3WMRA 4L8YA 4M7OA 1UKEA 2C77A 1MT0A 2BRUC 2GBFA 3EWNA 3LX6A 3R5TA 5EMLA 4DCCA 4E33A 1ELOA 3Q5GA 1Z8HA 2PIAA 1G291 1ZBQA 1ZD2P 2QVYX 4F5YA 4CXMA 1M34B 1GG8A 1YJQA 2NU7A 2GD1O 2O2XA 1NPTO 3HBLA 4HK4A 3RVRA 3FBTA 1OTXA 2L42A 2CL6X 1XGKA 2QKYA 1K5GA 4AY4A 3MTEA 1QV9A 1NMEA 1SOMA 3LTEA 5EJ2A 4GX5A 3O4JA 4CGYA 5C5EA 5CFPA 1CUUA 3R40A 3T9BA 1HEIA 4DMCA 1OROA 4JUBA 4DG8A 2RAUA 2UYYA 3LDGA 2WG0A 2NO6A 3DKKA 4LQ4A 2INGX 5BW8A 4G5FA 2ETVA 4TWJA 3ODPA 3WGYA 1CVLA 4FLFA 3HZOA 1FRZA 5BN4A 3TW4A 4KOEC 2AG0A 3D2CA 4TOIA 2ACVA 3MTQA 3D0KA 3RVSA 1VBKA 2IY7A 3MYYA 1WY5A 3H9BA 4Q47A 2C54A 3MRVA 3X0DA 1FEZA 1MZVA 1TO6A 4QXAA 2CLLB 4QHTA 5EE9A 3VR6H 4DWJA 3PI7A 4NNPA 4BXOA 1PL7A 3KV1A 4FSDA 3WB1A 3ZV4A 3U17A 1WE2A 2ESRA 2WSSD 3DBOB 3O8QB 3R7WA 4W5TA 3GNTA 4RC9A 1UWLA 4Z7JA 1JKJA 4PF1A 3LF2A 4K8RB 2E5LB 3NJ8A 3OIVA 3FPEA 3VAAA 1M10A 1DQRA 1ZI6A 1VCIA 3DBHA 1U8EA 3KQMA 3DWGA 1VHWA 3W6UA 4DHWA 4FE7A 4EZIA 3LHFA 4IIYA 1MNAA 4NK5A 3ZC3A 2YXPX 3PFCA 4J7XA 4TWBA 2W6IA 3BDAA 3AF3A 1PNQA 3C8ZA 2CF5A 1NL3A 3EVNA 1J9GA 2AOTB 2NVBA 3Q0EA 4JKIA 2ZIWB 1JZTA 4CEIA 3GGGA 4G5SA 5CUQA 1JAIA 3VJKA 4E5UA 4ZCIA 1DAMA 2EYQA 2VUIB 1AV7A 3N5CA 4R2HA 3WIEA 1ZA2A 3FNEA 3FSGD 3TJZA 1JEYA 5KSZA 1I9CA 2J07A 1YACA 2EKDA 4KXYA 2ODWA 1J5XA 1FQKA 1N2OA 3QP9A 2C82A 2GCNA 4ZT7A 3SPXA 1QIIA 3KEQA 2XZOA 1CY2A 3LWDA 3AKYA 1Q50A 1WX1A 3WJ2A 3ZDYB 4W1QA 4EHJA 4U00A 4II2A 4WCFA 4KFSA 2IELA 1IULA 2OCKA 3DJYA 3THXA 3H6GA 2O50A 1RE1A 2XTMA 4HNRA 4KAAA 1PL0A 1QK3A 4MQEA 2WM2A 2G06A 2PMWB 2P6NA 1E9EA 1HPLA 1OOEA 2CXHA 4FFPA 2QXUA 3ESZA 4JWTA 5JPIA 4YC7A 4JB3A 1Q0RA 4LXIA 4URFA 4CKEB 3ROFA 2ONZA 3I9JA 1XMXA 4PSVA 1Z68A 1JG3A 2CYCA 4URYR 4ZTUB 2IXGA 3N0WA 3MYRA 3VI4B 3QNWA 4IY1A 1SOWA 2CDBA 3S99A 1Z6PA 1J39A 4BKOA 3H17A 3H86A 2JAHA 2VLBA 2I62A 1QG0A 3O8DA 3JAKA 1X1SA 4IXNA 3QF4B 5GGXA 4QDKA 5EKTA 3JY6A 1QDEA 1KP9A 1LWNA 3C14C 3QE0A 2R8RA 3JZDA 5IJAA 4A03A 4MPTA 1IONA 3JQ7B 3B48A 1AOXA 1EWQA 4P7JA 4IMRA 2I29A 1KRWA 2O2DA 4O4IB 1JSCA 2Q1SA 1XLTC 1QHGA 2QQGA 4Q3LA 5DX0A 4X63A 5B4TA 4RTKA 2EZ4A 4NU8X 2V0NA 1OLSB 3E6AA 5BNIA 3KHSA 4YP7A 2HFJA 3O9ZA 2DHCA 4FR0A 2F4NA 2QG9A 3BIXA 4AKTA 1ZGCA 4IPTA 1W36C 3PDIA 5AUNB 1THGA 1J21A 3K30A 4YGYA 2MT9A 3LLMA 4HLQB 3T0GA 4V0LA 3U7JA 2A86A 4Y2PA 3KFVA 4L4ZA 3CONA 4H7JA 4RHYA 5T67A 1TVKB 2I7CA 1AHHA 3C43A 5K8CA 4WZBE 2G9UA 1A7UA 1X8XA 2CK3A 2PN1A 5A9SB 4BN4A 3ZVNA 4ZZIA 3AB7A 3KFXA 3VSEA 4Q5IA 4CKBA 1Y4UA 3DOIA 2RHWA 3PVSA 4LF8B 1LJLA 2DPGA 3H8WA 1NNLA 4NMLA 5EINA 5KTTA 2R25B 4KFRA 4N5DA 2BEKA 2QP3A 1JJFA 1JXOA 1P7YA 5CFZA 2FPIB 1T6ZA 4DC0A 2YFQA 1LJUA 4KHZA 2C29D 4LW8A 2O6LA 1X9HA 4CKWA 1QOPB 1XZFA 4H59A 4BO7A 2ID7A 1M2FA 5JSFA 4MS1B 2ACWA 2AFRA 3LSTA 4RE5A 1UWCA 1ODCA 1VL1A 2ZPUA 5F5XA 3TWOA 4IGKA 3TZBA 3ZEIA 4EKIA 5KEIA 1XKLA 2WTEA 1C30B 2DM6A 2SKDA 4ZT3A 3FF4A 2VP5A 3IQGX 4Z0TA 3WLRA 1GPJA 2CE2X 3FMVA 4PVCA 4EF4A 4MA0A 2OFFA 3JS5A 3R3WA 2ZIAA 2LNDA 3AMVA 4ZRNA 4C4PA 5DNDA 2VDOB 1JG6A 4I8IA 2DKOA 4P3NA 4KB5A 5HGJA 3W3AH 4BO1A 4L0DA 3DDWA 4UU0A 4US2R 2BONA 1Q7BA 4GI1A 1USGA 1WVIA 3CH4B 1MIOA 521PA 3KVNA 4DRZA 5JD5A 2MCFA 3REGA 1M0TA 2QZZA 2HWUA 4E0BA 4FILA 1T4CB 3FZNA 3KELA 1W73A 4IDFA 2OGWA 3M1AA 5K0BA 2VK2A 1VL5A 1R6UA 4FGUA 3O8RA 1SBZA 3FNBA 3Q1KA 5J2TA 1SXHA 2REOA 4Q19A 4PZPA 4ER3A 1YVEI 1GRQA 3JSAA 3PHIA 5F2KA 3NGXA 1O95A 1MABB 1UJ6A 1SJ9A 1X7DA 3SEAA 5HHTA 1XEXB 1BW9B 1Y1RA 1VIMA 3FCOA 1M2OA 3PFGA 2OQIA 3IEXA 2XTZA 4RKWA 3K32A 1HORA 4ZOLB 3GGDA 1CP3A 1J49A 4NBWA 3CV3A 1HNNA 2HF2A 2XYHA 4LMAA 1QH1A 3HN2A 3Q6IA 1WP9A 3W5BA 4BAZA 4IDOA 3LUGA 3KKKA 1CT9A 1KAHA 3EBLA 5JMWA 5AHKA 1WUJS 1UM8A 3OESA 4PGHA 1Y5NA 4Y2YA 1D6NA 4YAOA 5E2IA 3FOBA 5BV2P 5LFAA 3U7HB 2GPYA 1VSQA 3CWQA 1AN0A 3OCCA 1KWGA 1W6RA 2YVLA 1L5HB 1P3Y1 2WBLC 2FSHA 3GMSA 4FOPA 4KH0A 2F8LA 4B6OA 4Q4JA 5CLIA 1ZM2A 3IRVA 2R96A 3DZJA 4ZHQA 2YYAA 5IH7A 1DCKA 1N1DA 2QR2A 4AMYA 2WNHA 1KORA 1P6XA 3L7NA 5LIRA 3ZXUB 2GCPA 1WMBA 1N6RA 2JAWA 3G6KA 1Y6GA 1KYVA 2OXEA 3C3JA 3CRMA 4BKPA 1KYYA 1Z6QA 2JLXA 3ND7A 1SUEA 4CN9A 2EFCB 5KQMA 4NBNA 4I3HA 3GDHA 1L4FA 1TAHA 2Q2NA 1CR2A 4M76B 3OE5A 4KUEA 3VJMA 3WXBA 4MEJA 4AO8A 1GPAA 2GYWA 2JGDA 1ZVMA 2P2CA 3PHHA 2B36A 5DHTA 2AFHB 1D03A 4KN5A 1K5PA 4ZWNA 1OU0A 1IL0A 1LZKA 1ILWA 1T0IA 2Q3JA 4HATA 3ZQKA 4MJ7A 2V9CA 4V0KA 4WLOA 5HBGA 4AZVA 4UEJA 2WM8A 4EJ6A 1KEVA 1TC2A 1TT5B 2D8MA 4H4CA 2QTBA 4Q6BA 2BBTA 4LQLA 4NEQA 1IBMB 2YUTA 3GEHA 2WQZA 2CNOA 1N2HA 1J9ZA 3N8KA 4HQKA 1AHPA 4Z3KA 1OGYA 3OEYA 4MV9A 1CUHA 3ONVA 4DQDA 3KQSA 1WP4A 1THTA 4Z86A 1DXQA 4P1ZA 3KJGA 3RF6A 2O8DB 1JVBA 3IP1A 4YONB 4ERNA 1YO6A 2IXFA 3CF4G 2PUAA 4UXHA 3CW8X 2P4HX 4W9RA 1CEQA 4D44A 1HM5A 3DE0X 3HKBA 1OYOA 2HRBA 5G40A 1QCDA 4AL4A 4YAKA 4BFCA 3U1VA 1I94B 1M3SA 5DT9A 1R0WA 3B3QA 2JJQA 3EQZA 2OP1A 3DF7A 3B6ZA 1Q7CA 1SXJC 3QX8A 1V8DA 1AD2A 3A0UA 2O7NA 1FTNA 4LNUA 5IBCA 1JQBA 4RVUA 2PZKA 2PGIA 1UMBB 4PG4A 1ISFA 4FZJA 1E3QA 7ADHA 3OHMA 2PJZA 4WKOA 4KX3A 4DBLE 3J7TA 5F73A 5KWEA 2I1WA 4ALKA 5BWBA 2P5SA 2C0QA 3OZCA 5EHZA 3EXHA 2NXNA 2QM7A 2IV2X 4JY7A 1KYTA 3WSWA 1NR7A 4GWLA 5TMEA 4F2PA 1Z4MA 4KI0A 4M0MA 1P2SA 1DBSA 4Y2SA 1P1KA 4B2PA 1Y81A 2ON6A 2I3AA 2QRZA 2VNIA 1KI9A 3OM1A 7AT1A 5BYBA 4UBOA 1W35A 3LO8A 4YMSA 4JJ6A 1PDOA 3EZFA 3KKMA 5IAEA 4AJ4A 3KDAA 2Q4OA 4R81A 1EU1A 4OFZA 5JECA 5JSUA 2XCSB 3R3VA 4I5IA 3S8YA 2IEIA 5JSKA 4TYYA 1ARZA 4B09A 1N2IA 1XU4A 1T2DA 4NZPA 2J3DA 1OREA 4CMHA 1E60A 3ORHA 1AMUA 1U1IA 3T15A 3UATA 1MOPA 1RBMA 2VDKB 3QXHA 4Y3UA 4X65B 5DHFA 3VJRA 3SJCA 5LB4A 1TADA 4AO6A 4IICA 4LF4B 3BQ9A 2C03A 3ELBA 2J5RA 2GCIA 3CN7A 1T25A 2CUTA 4PSUA 1BN7A 1Z5WA 2YNMA 3V7YA 1F8YA 5FTNA 5BVHB 4MIEA 4YCMA 3KOXA 1M6NA 2F9LA 3Q7QA 3U7FB 3WWCA 4BMZA 3AL2A 2P9EA 4MH0R 4AUEA 2XPCA 2QJWA 2QPOA 4XLZA 1RD4A 2JIZA 5B4UA 2DU8A 3DNPA 4FFOA 1TUBA 3QA3E 1G8GA 1P72A 1S7CA 3GUZA 3KVYA 3GLKA 4YDHB 3W3ZB 3HGMA 5KSOA 3TSCA 4LFBB 4O4JF 1UCFA 3LP6A 1PZEA 2MR6A 3GEPA 1U0NA 2H9YA 3A1UA 4RL6A 4XX0B 3S29A 4QASA 3H1BA 4WLNA 1VLLA 1UZNA 2H5LA 1L7AA 3G7NA 4AF7A 2E1RA 4L02A 4PNHA 4RAOA 1ORDA 4X93A 1H5NA 1M2NA 4K40A 2QX4A 3D7RA 1CY4A 3L7LA 4GS5A 3BL8A 4DPKA 1BJKA 5CXQA 4GOLD 3R7NA 4CLRA 1BKYA 5B37A 4DNPA 2Q2QA 3NTUA 1P9WA 3MBOA 5JYBA 1VHDA 3M6UA 2W83A 3OE4A 1NOIA 3TRIA 3FDIA 4MV4A 5LCXA 5H83A 5GJVC 3G2OA 3LKVA 1L7RA 1WDWB 1WHSA 1SD1A 3HCCA 3L4KA 3GC6A 1L4GA 2DHRA 3KTAA 1Z6GA 1KJIA 4CLOB 1N1EA 1M8GA 2XBMA 1DFGA 3NHPA 3M4YA 3RS8A 4C0QC 2QUJA 3UH1A 2IEYA 1A8QA 4H7EA 4AMUA 2E49A 2Q6KA 3JVDA 3ZW8A 3IP9A 2C8KA 4BC0A 4X85A 4TV9B 1EFCA 3N58A 4H6PA 3FOZA 5JVDB 1H1TA 3IAFA 3KYIB 2ZIGA 3PPXA 4ESOA 1J1UA 1LBEA 5A5GA 5C8YF 1RI3A 1JDPA 4UDYX 4EJSC 4V39A 3ZDZB 4LDZA 5AUQA 4LPKA 1P39A 3H3FA 3HFJA 3K8QA 1BXZA 3WL3A 4Q7MB 3WGNA 5JASA 2FXVA 1Z6XA 4F3TA 2QNIA 1T8WA 1EM8B 1WHTB 3ZWMA 2VJAA 4H31A 1Z38A 1SCAA 5K51A 5CVTA 3OO1A 5AJZA 3HCFA 4IQ8A 3LY7A 5ETJA 2QVCA 1DJOA 2F17A 1DRJA 2H54A 3IPXA 3KS9A 2BP7B 1SHLA 2RIRA 4S24A 4AUNA 2RHGB 2P2ZA 2X86A 1QBKC 1BFKA 3BIJA 5CA0B 1PEKE 1Z26A 2AN5A 1RPAA 1XZCA 4I50B 3PNKA 2EX1A 5HDBB 3WRVA 1N36B 1NW6A 2SBTA 2IYPA 3WV4A 2GZHA 3A1VA 3ZCQA 1CF2O 5BN3A 1DO0A 5EGSA 1XWFA 4G0PA 5CT4A 5F9HA 1UM9A 1VKHA 2JJMA 1T6BY 1KDOA 3LPNA 3V2HA 4L85A 5FTLA 3S1SA 5JD6A 1QV7A 2QM3A 1A1VA 4MIYA 1G41A 1O3YA 1W93A 2FR8A 2ZI6A 3IBTA 2BUBA 3IERA 1FUUA 3UAVA 5LQDA 2HW8A 4DV0B 1BMTA 3E35A 3RIXA 4BX2A 1G18A 1VKOA 4FWTA 4YPVA 4WZZA 1THMA 1E77A 2QZ9A 5CVDA 1X7XA 5KJFA 4ZCLA 4LZLA 3T5MA 3MWDB 1Z4JA 2WVJA 3AEYA 4YRDA 5CTJA 3G2NA 5D5PA 3VR2D 4Q3OA 4Z7NB 1UODA 1SUCA 1JIVA 4P22A 2NQ2C 3PQ8A 4H1VA 4NOJA 3RNLA 4MROA 3RBVA 3HA7A 2ZAYA 3HCWA 1CB7A 1KK1A 2QLBA 3NH6A 3D6MA 2IV7A 3BD7A 4WZBB 3ZDDA 2ZI5A 3E84A 2DFNA 4BP8A 1KVRA 4AIRA 4ZO6A 3NZEA 6NULA 1LBIA 4U5QA 3HJNA 5JD4A 2H0RA 4R5HA 2IXDA 3ASZA 4GNKA 3R9XA 4DOMA 2Q9BA 4RK7A 3GCXA 4H17A 4ZYVA 2H2AA 1P5JA 2PVCA 3QF7A 3TVYA 3OX4A 2C98A 2A0UA 4IDHA 5HF8A 5ECYA 1KC1A 3FRJA 2VQ3A 1J1IA 3K0AA 4X44A 5BXYA 4PICA 2HK6A 3FYUC 1CYDA 3I52A 3FIJA 1P6QA 1UBJS 2VPYA 3E9QA 3QWFA 2UZ0A 4IQ4A 4KEAA 3W05A 4EUFA 2O8CA 1KO8A 3L6CA 4D7AA 2DGDA 1SA0A 1J4AA 2V6GA 3FGOA 4CEHB 2JEYA 1IXZA 2BEVA 3GLFA 3OPYA 1EFKA 2AZMA 3E58A 2C94A 4WZAE 1LPAB 3BXOA 4UARA 4XPIA 3WGMA 5M04A 4MWOA 1WUHS 2B69A 4B46A 3CF6R 4HDNB 1XQ1A 2HIMA 1M5TA 2RHOA 5DNYB 1E1CB 1RWXA 1U31A 2VJDA 1LSSA 4RY9A 4PU0A 4IH1A 1FMJA 4PSAA 4J1TC 3RWMB 4TMKA 3G0DA 4I66A 5JQWA 4L08A 2V6FA 5L6MB 3UEOA 5HX7A 2NZVG 4O4HF 4EVIA 2ADMA 3PQ2A 3G8DA 3CEAA 1OZGA 4BMOB 2JBHA 3O1LA 4EYGA 4A4DA 4B87A 1GOTA 1G4AE 3LUFA 1UC8A 4GR5A 4RVSA 5E0KB 2IEZA 2H59A 4XUCA 2GKSA 5EZ5A 3SZMA 4D3DA 1GRRA 1EJBA 3DYIA 1OF1A 2EFJA 2HZ7A 3A3YA 3EFOB 4RM2A 4IUCS 4Z1OA 3BZWA 3D7LA 4WK0B 5BUSA 3U6KA 1GZVA 1ZS9A 1CQIA 2J3IA 2OBBA 3KZKA 4UU7A 5CVUA 3Q2OA 1ZMBA 4ENWA 3VUFA 5B6JA 4PTYA 1Q95A 1E2GA 4EYOA 1OTYA 4HC4A 5KYGA 2DBRA 4FKBA 8OHMA 3CINA 4L0CA 5EJIA 2QQEA 2J7PD 4ZVTA 2J4DA 3P52A 4CCSA 4GUDA 5LC1A 4QUHA 5FXMA 4R1PA 3DXFA 1H8ED 1T26A 2O7RA 1V11B 1VCHA 4PGMA 4L72A 3MRSA 1G20A 1B23P 5IKPA 5THQA 4YMIA 1DIRA 1I3KA 2ZK7A 1QO0A 4ARCA 4FCVA 4FN5A 4GBJA 5LQJA 4XDHA 1RTTA 4G1FA 1U2GA 5H3LA 3P9IA 1NWHA 3QKIA 3TB4A 2AQKA 4YALA 7YASA 2P79A 1A5ZA 2AT1A 3OT1A 5CGQB 4WESB 5C4MA 2AJ8A 5ARDA 1SCKA 5A2QA 5SICE 2W42A 1ID8A 1JU3A 4IX1A 4N5LA 4K6OA 3AFMA 3ZGYA 5L3ZA 3UT5A 4RULA 4RY8A 2W2MA 1O9BA 3DEIA 4EHBA 3HNOA 4Y2GA 4E88A 2X0DA 1A4IA 3L06A 4BX9A 4GPEA 4HPXB 2V7XA 2FX2A 3KU1A 3OX3A 3ESCA 3QOFA 2BH2A 1P5ZB 2C1EA 1QVZA 5EI5A 3RSZA 4G23A 3DFZA 4MGHA 1YI0A 4UTRA 1Z0IA 1X7YA 1QFZA 1QYDA 2VUHB 4LHWA 4AROA 1G9XA 3QFHA 1IXSB 4LRSB 3GJYA 1LI5A 3W8DA 5CX1B 3T3PB 3MERA 1WPGA 4ZDIA 4LI3X 4HWOA 3JQAD 1M74A 1H6DA 3L4SO 4O4LA 4OYLA 5E4JA 3REQB 4DGSA 2VZ9A 5JCJD 4IGFA 1UJMA 4PO1A 3I9MA 4I1SA 5EE0A 2HBZA 3SBDA 3OHPA 3QKSA 3SI7A 2GJ4A 2ZJYA 1G63A 1IPFA 3DC2A 4GGPA 1USKA 1PWXA 3NBUA 4EW3A 4D57A 4PIMA 1XIVA 3GA5A 1EVEA 1RNLA 1GFWA 3AJRA 1LBQA 2J09A 4B6JA 4H6WA 5ALYA 1UZUA 5A4DA 5K8LA 4ND3A 1B0ZA 4UCXA 1VB3A 1JR3D 5AI9A 3ENZA 1DPGA 2GZDA 2X0NA 2ZTLA 3FY4A 2GEJA 1GPWB 2ZTVA 4JL8A 5G0UA 1JMYA 2HMAA 3A6HA 5KNBD 3RYHB 2NXWA 2WOOA 3FKJA 1MVLA 1ZNWA 4Q66C 2H1RA 4ZT6A 3ZCVA 4AZWA 1AS2A 2SCUA 5DRTA 1I7LA 2GI4A 5JBQA 1TO1E 1R8QA 3U80A 4DEXA 3D4OA 2XLCA 5AICA 3TZLA 3FVWA 4AJHA 3DOOA 1XV5A 2PM8A 2AEEA 4FW9A 1R6AA 1H0RA 2WT8A 2X6TA 2YWXA 1VPVA 4X90A 5AJWA 3SIRA 5IJ0A 4FEGA 1JPNA 3HYCA 1LW7A 1V8ZA 2BFOA 5B2FA 1U2QA 2PSDA 1VJRA 4A2QA 1SN7A 4Q1VA 1V8BA 1ZJJA 2DBZA 1K0UA 4H4DA 5BNZA 5ICCA 5JCOC 4E5MA 1T9DA 1YJ8A 1XF1A 3ADBA 1JFVA 3QXCA 2B4AA 4MRMB 4EG3A 5L6LB 2CC2A 2ZUTA 1A69A 1CRQA 1R0BA 1VCMA 2XY4A 2NSJA 2DE0X 3P4UA 1OLUA 2JFNA 3KIPA 1A5BB 4UATA 2I9PA 4YS6A 3OJEA 5JY1A 4BO9A 5HW0A 4KJZA 3DW1X 2DC1A 3AYZB 4XGQA 3D54D 3KZCA 3M81A 4K87A 4U8HA 2JFYA 3DUFA 1U0LA 1GTVA 5DFAA 4DDMA 4XWWA 5F52A 4OL0A 3H8JA 2W58A 3WZLA 2QRGA 5ECDA 4CMIB 2XMCA 3OT5A 4KRGA 5BR8B 1A2QA 1QLJA 3MTDA 1E1LA 3RC3A 3TAHA 4EKNB 2JLWA 5T8KC 1UBMS 1P3DA 1VE6A 2R6ZA 3KPYA 4JT4A 1XRNA 4M8LA 5KVSA 2OBNA 3RODA 4MVJP 4DDTA 1VJGA 4HLUC 4P36A 1XXHE 3EQ8A 4AK9A 3H0EA 4G8CA 3T94A 5J4VA 2QD3A 5JHGB 4WCDA 3TD6A 5K3FA 2PLFA 3DQPA 3I6QA 4C7VA 2VPZA 2K6GA 4O1MA 1LCIA 4BO0A 5AHRA 4BN5A 1CUAA 1HFJA 1AKQA 1ZK4A 4PBRA 1R5NA 3ZPXA 2ZB7A 3TLBA 3IVAA 4A0GA 3E53A 1YA6A 5B3JA 4H4EA 3FTQA 1R00A 4LC0A 4PBTA 3A4MA 4DRXA 5A7GA 5D3MA 1BA2A 1H2XA 4YAWA 3HRHA 4W6QA 4ENTA 1ZD5A 4EG8A 3B1WA 2JZNA 2QW0X 2YHIB 2OXTA 2VQFB 4WNAB 1VHTA 1YHYA 4O2AB 1YVPA 4FFNA 4L0QA 4RUKA 3TBKA 4JENA 1R0CA 2WP0A 2FF7A 3FUWA 1ZPDA 4N39A 4D4JA 1RRCA 4X97A 1YFZA 4ZKEA 4KITB 3OVMA 2HPHA 2JPDA 3BKWA 3K72B 1ILEA 3CG4A 4O4IF 3TRJA 3JAWA 4EA9A 4TXMA 5L7YA 5KIAA 5DLEA 4JGBA 1V6AA 1FW8A 1MX1A 3AJDA 2Q4RA 4WZAA 5DM4A 2F1RA 1AZWA 3RUDA 5KOJB 3U2QA 3UJCA 1UMCB 1GU0A 4ITVA 2DUNA 1LQTA 4WKCA 4BQNA 1H2EA 1CNEA 1VP3A 1C2YA 1DBQA 3H5LA 4H3HB 4J8PA 2YHAA 3O4GA 3TXXA 3M4ZA 2RCYA 4LNHA 4QDUA 4C3VA 3KWJA 1EG2A 4QREA 3T8YA 5FLXA 1KYQA 2RSLA 2NUBA 2YWDA 1YIDA 2W5UA 4G89A 1E66A 2OLEA 3NM6B 4EB0A 3OCUA 4UC0A 421PA 3RFUA 1CF4A 4FHCA 4WFQA 1U2TA 2D5AA 4LYGA 1XXLA 2B2NA 2XVXA 3BGOS 3KYCB 4AP5A 4AZTA 4BYMA 4QODA 3OLWA 4AQDA 1VLQA 3OY2A 4KWTA 4O3MA 3GPDG 4OMFG 5EVJA 2YWEA 1CY8A 4O0LA 4W9MC 1P18A 1XKTA 1NVAA 1JHVA 3KYBA 2QRVA 4P5DA 1L5WA 5EQDA 3KSBC 1FXWF 2QAGA 2RHBA 1B0PA 3B53X 5KJEA 3ZCUA 2ZQZA 2JKVA 3H4VA 4BNWA 4EHDA 1AUPA 4MWDA 1U0EA 3QPDA 1IZ0A 4OQQA 3NWBA 4EY3A 3KQLA 1RZRA 1A04A 3NGMA 3MWYW 1HYHA 3ZWWA 1ZRHA 3VU9A 1VHLA 1JJVA 3GFOA 1WD5A 4V02A 3RJMA 3TZCA 1L3BA 3AEKB 1KZ6A 4PC3A 1C4WA 3DTVB 2Z8ZA 3KKLA 5DNVA 1GM5A 1T36B 2Q5JA 1GAQA 1C3OA 1W34A 3H4TA 4ND5A 3HG7A 4FYVA 1JLHA 3QUBA 4A5OA 2ONYA 2HF7A 4Z0HO 1D0IA 2FX3A 1KMHB 2JCBA 4G0WA 2VPPA 2EVWX 2QSJA 3JW8A 1G8MA 1O4VA 3CZQA 2Q4DA 1C3VA 3UK7A 4C87A 4DR3B 3TW8A 2HDNB 1E6EA 2JANA 2UZ1B 2X4LA 2XH8A 2ZG6A 1GITA 4OFXA 5CYOA 2FLVA 4ZOLF 3BSSA 1WUTA 2WJ3A 3JVUA 1EWYA 2H1FA 4MW7A 4Y6RA 5DK4A 4MKGA 3CX7A 1E92A 1JHDA 5EE3A 1DDIA 3GVHA 1Z7BA 3LYUA 1NC3A 3KEGA 3OJWA 1XVTA 2CFSA 2WUDA 1LF5A 2HMVA 2YDXA 3EA5A 4IOLA 5IMBA 1FDWA 3MOSA 3KAQA 2ZANA 4KQFA 3FHJA 2X2OA 3GD5A 1ORVA 2B20A 2CXXA 3U4QA 4QU8A 3B1VA 2J46A 2IPOA 2G0AA 1VMAA 2ZWMA 4A0SA 3GFVA 1PFQA 2K4MA 4RTLA 1IN4A 4QRDA 4YUAA 1J70A 2E6KA 3EISA 1POWA 2HK7A 5EJ4A 3KFLA 4HADA 3D5EA 4L9RA 2Y1OA 3C5VA 3I8SA 3W0LB 1WB5A 1JLLA 4WN9A 3RVBA 4BO5A 9LDTA 4B84A 4XCQA 1G6KA 1BDBA 1I4LD 1XOIA 2OHVA 4GU5A 4Z54A 2X13A 3HXOA 3AG5A 3HL4A 1T9BA 2P4SA 1NQVA 2GSWA 4YCNA 1UK9A 1L4EA 5FUBA 5IJWA 3UGQA 2LCFA 4NU0A 4C4XA 1NXQA 3PDWA 3AVQA 4LK3A 4GE0A 1XJ5A 5JAOA 1DBWA 4IH9A 4F72A 5KNCD 3MCWA 4I6JA 3R44A 3RYCB 1OBCA 1W5SA 4R9RA 1A9ZA 1KQOA 2PL1A 4LRWA 2I6TA 4FYYA 4NYIR 5AO9A 3PL5A 4HRVA 5KWVA 4WXHA 1SURA 2E9SA 3DZDA 1BCRA 4O1IA 1XK6A 1Y1KE 3I72A 3N39C 4WA7A 5CTAA 2H18A 1E9VA 3RU3A 4EVRA 3T4EA 3RS0A 5JJKA 4WNYA 1W581 2GTHA 4FDMA 5E1BA 2R11A 2AOXA 4UTPA 4ZI2A 5FYDA 1EAMA 2AEMA 5ICEA 1LF0A 2W6NA 3DT6A 4EZEA 4PFKA 2IIVA 3SYKA 5BN1A 1G8PA 4F4JA 4BO4A 4L3OA 3GLTA 5CURA 1T1RA 5IC6A 4B45A 2RGDA 3OIYA 3JYNA 1XI2A 4GPD1 5FBHA 3RTGA 5A5FA 3A4NA 5KVQA 2OR3A 2E3JA 3LLUA 3UZUA 2YJ3A 1DRWA 3VYRB 1PK9A 3D64A 4HQLA 3NDRA 3DE1X 3GDOA 4PR0A 4ZODA 5AKHA 2I2DA 4U5XA 4K6FA 4ARZA 4ZI7B 4BLRA 1EEHA 1ZK2A 3FSRA 5TV2A 4PSDA 4RM3A 5HILA 3H42B 4IHJA 4KAFA 2VXBA 3QEOA 1HH4A 1V1MB 3KR2A 4LQDA 1UDBA 4OB6A 3JU3A 1LGYA 5F7ZA 4ENVA 5HDQA 1K68A 1K92A 4LVCA 3ZI0A 1EFAA 4KW7A 3NTOA 3RIYA 3TSOA 2UYGA 4YRRA 3QWHA 1CW2B 5JALA 3AGQA 2ZTSA 1F3OA 1LK5A 2VDMB 3LCVB 3WLMA 3WSVA 3WYCA 3G2IA 2SKEA 3WL6A 1RKXA 3IUEA 3HHPA 4JB2A 2FG5A 1ZN7A 3UJ8A 3VSAA 3ZTTA 5I47A 3BJZA 2B99A 1KH3A 4YCJA 5JG7A 4BRUA 2OFXA 1JIUA 5ALSA 4BMSA 1LNQA 2Z2XA 3F9IA 2OFPA 4B3XA 3UXEA 3IPYA 3LUPA 4IXMA 2ODPA 4UU8A 3SC6A 2XGJA 2XT6A 3GPIA 4PS1A 1J1ZA 3GNQA 4N0DA 3UA4A 3R5JA 3OTGA 4MQFB 2C5FA 1GT6A 1RBQA 1Q2XA 3IAHA 1QPZA 4CTKA 1CZRA 2PK3A 3WWOA 2IXAA 2WIBA 3PEWA 1TW2A 2COKA 2VBGA 1MG5A 5TJHA 3H4MA 2X0KA 3W5UA 1MPXA 4BCCA 1FQOA 1I30A 1SB9A 2JRLA 4YTEA 5ALIA 2DFLA 4GQIA 5T3UA 3RANA 4DWVA 3THWA 1GUFA 1UAYA 4EYQA 2J41A 1WXGA 5CT8A 3RQIA 1R8XA 5FP0A 2VJQA 3BH0A 5G4LA 3RUEA 5KKNB 3N2EA 1GZ6A 5FHQA 2C4TA 5HM8A 4HDRA 1VJ5A 1X1EA 3PUXA 4ZT2A 4M9XA 5A02A 2BCGY 2DUJA 3EGDB 3I23A 4NVRA 1CQJA 3DAYA 5CJJA 1GCIA 4BJ6A 2I6XA 1J09A 3DWIA 4KLZA 4UHJA 5FTJA 2PCJA 3AUSA 3DOFA 3HJAA 2E85A 2Z2KA 4C4YA 5DLDA 1HETA 3GNLA 1ZK3A 3AETB 3QEJA 4AG3A 4XVCA 2O8BA 5DWQA 3TINA 3L8YA 4OXXA 3RRFA 2FMTA 3SE7A 5SZJA 2CNBA 2CUKA 4RWZA 3L6RA 2M32A 3MWGA 2Y1GA 3R5FA 3UUWA 1JH8A 1HE8B 1ESNA 2O05A 3DOJA 4TYMA 3W6OA 3RD5A 3G5TA 4J16C 3S5JA 3V2GA 2C5BA 3EVTA 5D8DA 3SQLA 1G55A 3PXDA 2QRQA 3FAKA 1M1NB 4J91A 4LE0A 3LZCA 2XSZD 4Y2RA 4QVGA 3GVIA 1G21B 3BHJA 3I2KA 1F14A 3BXGA 3H2BA 4FFSA 4IJQA 4X1OA 4F4CA 3TEFA 3WYGA 1K66A 3ZXSA 1P5FA 3OLZA 4K3UA 3KX2A 4R1SA 4LJSA 3AEXA 3T3IA 1J7JA 1FYXA 2HY7A 2XT0A 1KU6A 1A2BA 3IAS1 3PFIA 4HY3A 2EEPA 4LBYA 4LHYA 4LVNA 3LY5A 4BGIA 4QZVA 4EBFA 1R16A 3OJ0A 4TV9F 2SHKA 2D1YA 4KNVA 4RNDB 2PKRA 3JD4A 5HF9A 4QBGB 2I6FA 5JVDF 4ZV4A 2H07A 1DPFA 4WEQA 4LJ6A 5DNAA 1GNPA 1TNDA 3K2EA 3D8HA 4BGUA 2PFGA 1ACLA 1Y5LA 1U4SA 2BZ0A 3RU7A 1R4MA 5B53A 1Q19A 4AKSA 3GLHA 4G4SP 3TD2A 5LQSA 2PGJA 5AFSA 1P5HA 2XMDA 1URPA 1T5DX 1EVYA 1LC3A 1XTKA 1ZR2A 1ENYA 5KNDD 1I3MA 1XXHB 2JVKA 4HAVA 4HZUB 3GEGA 1L5NA 1CRPA 1D7OA 1MO3A 1ZISA 3CBGA 3IPRA 4MR8B 3L7BA 4BBJA 3AHFA 5B7GA 3OM0A 2QE7D 5H81A 2W2KB 2DULA 4A0QA 3C3MA 2J0QA 3NBQA 4OKIA 1DAEA 1XO1A 3KAPA 2W8BB 3AFGA 4RZXA 5CA0F 3AB3A 5ITSA 4W5OA 2Z30A 2EQAA 1MKYA 3HJCA 5IS2A 1CZHA 1NW8A 2ALJA 4BNTA 5EFZA 1K4KA 4CKCA 3JCZA 3QE2A 1BQ3A 1Y8ZA 5EJEA 3BWDD 3KPUA 4IOKA 1VI2A 4WKGA 4ISCA 5J2UB 1SULA 1XD2A 3H5RA 1GN8A 4KQMA 4QT0A 3KB6A 4LSMA 4Y1EA 4DMHA 3CWZA 1AURA 5C9ZA 1MOZA 1KDYA 3AJ9A 3G82C 5LQUA 4IV5A 4F92B 3UW3A 2WF5A 2MINA 4RK4A 3ROGA 3IAEA 2DLNA 1FNNA 1PT8A 4OHKA 2XWJI 3SFZA 5AW6A 4RV5A 3A6JA 2VQEB 4ZYZA 1XMJA 4HYQA 4FT4A 1O6BA 5DW0A 3TKAA 3NPMA 5I7SA 1ZHHA 1XFAA 3H9JA 3HDJA 4C3UA 5HNKA 3DFIA 1U0BB 2ATIA 4I19A 4WOBA 2XOEA 3CRW1 3ZE9A 4B79A 5DSTA 4D8UA 3NVMB 2XNSA 1WKCA 1PFKA 2NSHA 2OCGA 3A9UA 3ZHXA 4JX9A 3IS3A 3ZWOA 5D85A 3AFNA 1BXGA 2ABWA 1N78A 1NUSA 1A4RA 4PONA 4Y9SA 5I7RA 3ND8A 1EBUA 2G5CA 1ZH8A 2FZ5A 5EC8A 2EW8A 2P9YA 5EWLA 5LLSA 1V3TA 4EKYA 1QP4A 1OWNA 3HKEA 4D8YA 2RGBA 1OLXB 3FLBA 3E9DA 2WMOB 3PYLA 3OG9A 4FZ3A 4Q1BA 3U3JA 4ZCTA 5LXTB 2F00A 4DA8A 4IIFA 3CUWA 3EVBA 4EUKA 1JU4A 2IIBA 3BTVA 4LY0A 3RFFA 5AESA 1ZC3A 2QLJA 5EXTA 2XXAA 5I5EA 3CLUD 3OD1A 2VRCA 2P30A 4KFCA 1XAGA 5C7OO 4UAJA 1WXWA 5ALZA 4IL5A 3I0NA 3EWAA 3EPJA 2E4WA 1HDIA 1MVNA 2Z4RA 3K6KA 3O8LA 2VDUE 1MJFA 1FP2A 3OZUA 4FCCA 3BQNB 2DEUA 5CAEB 4MDFA 2R60A 2YZ7A 4HBGA 1LLCA 1QQ6A 2PA3A 3VGPA 4DANA 4X8LA 4YRGA 2JKZA 2R3SA 1WXXA 3ENNA 4AZ0B 1FTYA 2G1AA 2QENA 4RXTA 3FMIA 1JPJA 1A2OA 3EIHA 4PPGA 1A9SA 1DADA 5DXJA 1FA9A 4TS4A 4Z4QA 1Q1ZA 1NVTA 3NRJA 4BOYA 5BY2A 4L73A 3VR4A 3SQXA 4OOEA 4IV0A 4P0QB 1NKVA 2VP0A 4G0MA 1ZVKA 1BA3A 3QXXA 1FMLA 5TR9A 4CM1A 1QP8A 1WABA 1KSHA 2YJ6A 1C7IA 3I3SR 5ENZA 1C1XB 3EEIA 1HXHA 2M6LA 1FMTA 3WGOA 1JFTA 2AC4A 2SNIE 2VHZA 4OVKA 4MLZA 1T3ZA 2YHSA 3JYLA 3W90A 2I1VB 2AE2A 2X3UA 4ND4A 3CCBA 3LDFA 5BR1A 1GV1A 2QT0A 1WW8A 3EDOA 5ERGB 3SEZA 3ZHVA 3H9GA 1DQNA 1SBNE 1GP2A 5F4ZA 3MWJA 3AXSA 1E5VA 3RTDA 1WM1A 2B6HA 3AR7A 3VR5H 3UT6A 1O57A 3H83A 3K0HA 5CM2Z 5E8RA 3RAGA 2G82A 4XSGA 4DDUA 2BGGA 2YZNA 5F2NA 2HHHB 4DM3A 1K8ZB 1JECA 5FA8A 1KDPA 1QZUA 1OXVA 2Q27A 1VJ0A 1X87A 2ZYTX 3AGPA 4PCLA 3TZEA 3W8NA 1KY5A 4CG2A 4D46A 4WACA 1XCOA 4DSTA 3CLRC 3OI7A 1DB3A 3RVQA 1N57A 1SCDA 2AN3A 4DR6B 2VT7A 5ED0A 3HBMA 4DYHA 2J3KA 4ZARA 3GLRA 2HREA 3W34A 4KPYA 4Z53A 3H1FA 4PN3A 1BEZA 3EZ2A 1RCTE 4XWGA 4Q4AA 2OHJA 1MX3A 3HP1A 2JFHA 4H7FA 4MWZA 1YDEA 5KO2A 3RRBA 2XBLA 1HT3A 1SQ0A 1Z2CA 3B7PA 4LV6A 1KYWA 4HTFB 2RAFA 1VMIA 5CFMA 5IM4A 1YFLA 4G97A 3EJWA 4KIFA 3VHXA 2DUWA 3QLVC 1M8FA 4CGZA 2BOVA 2X9LA 3NANA 1NKTA 2UYHA 3KHTA 2ZATA 2IEGA 1JIXA 3PPYA 4AZSA 1BHJA 2IU6A 3UHOA 4BNDB 3HYLA 1VL6A 2QRPA 2WJAA 1PSWA 1KI2A 5JHHB 4BNXA 3UGJA 4Z4IA 1OFVA 4FHFA 1W0JD 3SZUA 3L92A 5FUXA 1PJSA 4MVJH 4Y0VA 3TCXB 1B2RA 1BX3A 1MV5A 2AW5A 3CH5A 2C00A 3Q88A 3RUIA 2RH8A 3AVTA 2GZ1A 4NZ9A 5HFAA 3UFXB 5JW6A 2W71A 1P8JA 2BSXA 2H4ZA 4EQ6B 3O8QA 4P98A 1B8NA 3UG7A 3PNBA 1E4EA 4BO6A 4NOLA 1BGWA 2YQ4A 1Z2OX 3IULA 4N01A 3JD3A 4ISBA 4X1IB 3QFSA 5FTWA 4TRMA 1BS1A 5IAJA 1SHUX 4DS3A 2OZKA 2AD5A 2QTVB 1DI0A 2YV4A 3MOIA 3DHWC 4KACA 1VZ2A 4D3XA 4TVSA 2IS6A 4XGIA 1XTQA 3L7JA 4FNOA 2FDCA 1SRRA 2BTEA 2H11A 2C78A 2JAUA 3MMZA 2PY6A 4FMCF 1K98A 2AOTA 2IDMA 2J4FA 1W2GA 3LXMA 3CLSC 3K05A 1J33A 4BX0A 3CURA 1O9HA 1S2MA 3T7RA 5C5IA 1E7RA 3D3EA 3K8YA 4ZVUA 3THRA 4F97A 5C5DA 3ZVMA 1VBMA 4NDNE 4MCJA 4F1WA 2YZMA 2ZTUA 1U8ZA 3GLGA 5AW8A 4ALIA 5L4NA 3LUDA 2JH8A 1CUIA 4FB5A 2IYWA 4NCJA 1QIEA 3UNXA 4MWEA 1WLSA 2FNAA 4BNLA 5BW4A 1GTZA 1PW5A 3AYXB 3CF4A 4GICA 5DGCA 4G24A 1ZHFA 5DHRA 1PJQA 1QUFA 1U02A 3SQMA 2HV8A 1YJCA 2Q3FA 3UENA 2ZVQX 1JKMA 1L5VA 3QJYA 4HFRA 4FS8A 4CKEA 1JEQB 4EAQA 1WB9A 4FK8A 4A27A 1BH2A 2KI5A 2Q28A 1TD1A 2FFBA 3IVMA 1CUZA 1V4VA 4W1PA 4GMDA 1GPLA 3IAAA 1ZNQO 5TX7A 1JQ5A 1XR3A 5AJUA 5DCYA 4YQYA 4EY8A 1B6SA 4NG5A 2I65A 2DFKB 3IPCA 4DL9A 4ZI3A 5AKGA 4DLXA 4QVKA 5FWYA 3EC7A 2DR2A 1SIUA 3TKLA 4PEVA 2DLCX 1IOZA 2WPDD 3LNCA 2QS9A 3HU2A 3Q98A 2EQ5A 1RXCA 4O5OA 1FNCA 3O90A 2J0UB 4F06A 1QF6A 4G36A 4C76A 1UJ4A 1C81A 2QRKA 3F67A 3AEQB 2FP4A 2PL5A 2XNDA 3GJ3A 3N6XA 4ZQHA 3JALA 2JBAB 4Y8VA 4N1AA 1QYXA 3DO6A 3GLIB 4OP1A 1LBTA 1OLSA 1FVFA 2I55A 5BSEA 1KERA 4X1YA 4OUKX 1MJGM 1M54A 2YCBA 1M2VB 3IOMA 4MKFA 4J76A 5FI0B 3ZV7A 1O5IA 1XVUA 2AG6A 4K9QA 2ZAMA 4RLSA 3FKQA 2D13A 4O59O 3DMPA 4JX8A 5J9FA 3X2SA 1TVKA 3EVAA 5HZGA 3UJDA 1D0VA 3SDZA 3HLKA 4MKZA 2NLOA 1X2BA 2B7LA 3O3MB 2OORC 2CVPA 3DEHA 1NUAA 3Q0IA 5DTQA 4YRJA 1QFMA 4HRAA 4OMUA 4MMZB 3T1QA 4KO2S 2ORWA 3MT0A 2ASEA 2G83A 4X45A 4WLEA 4BX8A 1OX4A 1AK1A 4PYRA 1HSOA 4RF4A 1AS0A 5KYUA 3WA7A 4NAHA 4C7KA 3AHJA 2A1TS 4ML3A 1EMDA 4RSMA 3V8RA 4ZJYA 2QNRA 2RHRA 2KQUA 4YRQA 4NP6A 3U3XA 2UVDA 4LCEA 1VB5A 1XZGA 2FWPA 3CH6A 5I6DA 3CISA 1G17A 2BFDA 4PRKA 4DKJA 4G4SO 4IYJA 4O2AF 4Y2QA 5AQEA 1I9GA 2FOXA 2A1UA 5JIBA 5FLYA 3UO8B 3IOYA 1QQTA 3CE9A 4Q93A 4XA8A 4WOCA 1V96A 1E2FA 1VPDA 1G5PA 2E48A 3LHIA 1H2HA 3I30X 3M6XA 4RU1A 5CDUA 3C1UA 4UEOA 2NU8A 2NXEA 1HSZA 2G4CA 1OT3A 3LH5A 1FVHA 1W30A 4JL5A 1QTRA 1LDGA 2ZCUA 4XDGA 1JAYA 1NV8A 3GRFA 2OHXA 2VRWA 1LS1A 4HGOA 4FZ5A 2OB2A 3WTBA 3P19A 3K35A 2P2DA 1E0DA 4INAA 1E9CA 1PK7A 3VU0A 4YJ2B 3NBZC 1P61B 1SXJE 4HV4A 4D2IA 1J23A 2CHGA 2PAFA 3G2QA 3ZWCA 4MUEA 3BWMA 4XLLA 1M6VA 4TMFA 3EIWA 3FFAA 3AI3A 3DEZA 2Y93A 1UK8A 1DAFA 2IYLD 4LA4A 3VV2A 1IBLB 4OGKA 3F4KA 4RVHA 1M1YA 1BW9A 1XEXA 1E5LA 4GWKA 5HIIA 4V0NA 5IKOA 3CT4A 2W2LA 5DN6A 1WETA 1QZZA 1SHTX 5KOHA 4U7DA 1EFRA 4FEYA 3WNBA 4HQRA 3ZOZA 3RYFA 1COWD 1KKMA 1LRKA 4K6KA 2IHNA 4R8KA 3PHLA 3D31A 1S5PA 3M5DA 4AVYA 2PSEA 4L5YA 3WNVA 1GO2A 1RWWA 1Q0QA 2BEJA 4Y6LA 4D9BA 1LBSA 4E7PA 3USCS 4EG5A 2IXBA 4L8GA 4KQ1A 4PAGA 4X66B 2DY0A 5JTTA 1YBAA 5BMVA 4AMBA 3B36A 3KBOA 1NUQA 4HEA6 1EINA 2YJZA 4LRXA 1YDFA 4OB7A 4QAQA 4XQ9A 4DJ5X 3HCAA 4BFLA 4DR5B 1D2HA 4Q39A 1USVA 4C2AA 4IG4A 1ZOLA 4ABTA 3T5PA 2C2OA 4C6HA 4G5YA 3ZLVA 2GPWA 4EG0A 4RD2A 3S55A 1FQWA 1OAKA 4EJ2A 2ZRKA 4CFYA 1YI1A 2HX1A 1HKUA 2LIPA 3SBXA 2P0EA 5A9TA 1NZDA 2MSWA 1TE2A 2P2YA 4UHBA 1N0HA 3DBRB 3S3TA 3RWOA 4PYLA 1U4NA 2EL7A 3QWAA 5CP8A 3T5AA 5EKSA 4PAMA 2G17A 1IXKA 1C41A 5CNKA 1A9TA 4AMVA 2V96A 4GR9A 2XMPA 1W0CA 3DHYA 5LUBA 1LEHA 1VSVA 3OJFA 4HOYA 4WTOA 2AYXA 2RONA 1PJZA 1WF6A 3WQQA 1MZPA 5K0LA 1CQWA 2FFRA 4X00A 4ED9A 2VF4X 2P4EA 2NO1A 4B81A 3JQRA 3BK1A 1AUOA 5FB3A 3R7AA 3QUQA 1MB2A 2MYTA 3H7IA 1SVMA 2WP8J 4L0MA 5E7QA 5KCMA 3ENKA 2GAAA 5JFOA 2RE8A 1GLVA 2AXNA 1TMOA 2IF2A 5DHPA 4UBJA 1PNVA 3KSMA 4XQEA 2FU5C 2IZ7A 1QE5A 3MQFA 1NW4A 2OYCA 3BFXA 1WD7A 3GOQA 3NORA 2WIGA 3VPAA 2W70A 1G5IA 3PNYA 2PT7A 4RK5A 3BHNA 3PR2B 4G1BA 2I03A 4KUHA 5JS6A 3QYFA 4MTLA 3SHVA 4IWNA 5LOVB 1N6HA 1ORHA 1YXMA 4L7QA 2FUEA 4XIGS 4DSNA 4QT4A 1TO2E 3IQWA 1PEYA 2L19A 3MRXA 3ZXXA 2QORA 3JWHA 1WQ4A 5HR5A 5DTRA 1OJ7A 4J0FA 1GEGA 4AY5A 2Z6QA 3PX7A 1E2KA 3AZOA 3LZ6A 2ARKA 5AI6A 2V7GA 5AOCA 3OKCA 1GZDA 3OPVA 3CKMA 4G4GA 1XFDA 4H27A 1MAVA 1Z8FA 2OB1A 2DVMA 4JL6A 2OG2A 2H2WA 4ZOAA 2W98A 4LMBA 4XWTA 3N59A 4EKGA 5DTEA 1HK7A 5HQ3B 1I6LA 1W5BA 1EVKA 3EFBA 4P92A 5KYXA 1NVWQ 4ARAA 4GMXA 3AUYA 1X42A 2J33A 1LB1B 5CHEA 1FTGA 4KOAA 1PR1A 2CEAA 4QGHA 3S2EA 2JVIA 3SYRA 3TMAA 1YCGA 4GGOA 1U7UA 1Q44A 1Q21A 4OJQA 3WYEA 4LNAA 1KYIA 3ZJYA 1KFBB 2H17A 5HUJA 4CKZA 4CCYB 4IEFB 4PXYA 4FFDA 2JFPA 4O25A 5D1HA 5TXGA 2VK8A 3A4VA 3PXUA 2FSIA 1GTMA 2CFIA 4NF2A 5EIBC 2V65A 2XRYA 2W7TA 3Q4GA 2FFJA 2J9GA 3KKQA 4ZEVA 2Y1LA 1ND5A 3STTA 1JEYB 2O3JA 3WP1B 2FUG1 3FCEA 2OZEA 4JHLA 4R40A 3TOCA 4C0SA 5BVHA 3T35A 2HNBA 5K0FA 1FY2A 1KK2A 5IKXA 2G77B 2L82A 2V3VA 4RJLA 3JD2A 3NBYC 5E3IA 1U94A 1VA4A 3C6BA 5IC5A 3QV2A 2HRQA 2HBYA 5FOUA 4DV7B 2F3RA 1HDZA 2YQZA 3E3OA 4ZI7F 3VM6A 4BTEA 2HSWA 2P9QA 2V7QD 2ZRIA 3GD7A 3A32A 4O2BA 3VPDA 4X41A 3PU6A 4DDHA 2VF7A 4ZRMA 5K0CA 4DTIA 1ZM3A 5C46F 3DE6X 3Q15C 3TNYA 1RCFA 1I2MA 2XNHA 3WHPA 4XZ3A 2FW0A 5KHLB 2EFEB 1YHZA 1F17A 4A6DA 1M6HA 5JUWA 1E5TA 3RRMA 3GHHA 1MB9A 3R3SA 2J7KA 4E4YA 2Y9PB 5J43A 1QHIA 5F98A 3CVVA 1Q1AA 3AUXA 1GD1O 4HWGA 3HACA 1CXZA 1TC1A 4ER0A 2ZYRA 4ROTA 5EHGA 1RTKA 2QROA 5KU1A 2ZYWX 3QFCA 1W94A 2BGJA 2HJVA 4GRDA 3Q1LA 5EWJB 1YZFA 3DEJA 3O26A 4QGAA 1MQ9A 4UM9D 3VKGA 4CTNA 1MQ8B 3K6JA 4F6LA 3U5TA 1W36B 2ZSIA 3LCRA 2ZIXA 3H2HA 4PQFA 4X0EA 3MAAC 4I4TB 1TLFA 1MEJA 4MP8A 4UE2A 5BURA 3G88A 4U2CA 1AF4A 2RBGA 3I28A 4S1PA 1IJKA 3IEVA 1PEDA 3PRKE 5DGHA 4CLHA 5KQLA 3CCFA 5CFNA 3FMOB 4JI6B 1AO0A 4C07A 3T7KA 1EXNA 2OMKA 2QA5A 3ZU2A 3RF7A 2VRNA 3KB1A 3MCZA 2IUFA 5KMGB 3TLJA 4CDMA 5FBKA 5DO9A 3NALA 2W11A 2FN3A 1P2VA 1C80A 3ECCA 4JN6B 3PG5A 2R1VB 5A0FA 3TW6A 2E5FA 1RZ3A 2P9ZA 4HDSB 4KN9S 5FNVA 1LPNA 3WJ1A 4F4IA 5IZCC 3BDVA 4X94A 3BL5A 4TLAA 1SRQA 4LZZA 2BKAA 2X8JB 1A3CA 1EFUA 1PWHA 2OCYC 3CU5A 2PKYX 3GAFA 1P7WA 1DUVG 3PFHA 2PUCA 5F7JA 3G49A 3JARA 4CIDA 3D8BA 4G25A 1XL1A 2M1XA 1L7OA 4XB6B 3LBYA 4U8GA 1KVSA 3KJEA 4Q9LA 1YVRA 3ROKA 3OSUA 2O1WA 5K0JA 2BE7A 2CCGA 2X2PA 5ALDA 2ENUA 2PRJA 2QBYB 4K9KA 1N2BA 2XADA 4GM0A 2V7WA 3GO4A 3R0IA 3R4VA 1WPRA 4ES6A 3JR3A 1W5TA 2Y2UA 4LSZA 4N3NA 3X1XA 1GGHA 1QS0A 2WUEA 1HE5A 2YN2A 4NBSA 3OMLA 2C42A 5EXPA 1F2UB 3BTOA 3EEBA 1N2CA 2BP7A 3M70A 1FIUA 1BN6A 3ADKA 1Y34E 1JW9B 3WAGA 1IAVA 4MWGA 5ES4B 5G02A 3CEMA 4V0OA 1N33B 4I50A 5GWXA 3BMNB 3ANSA 2Y0DA 3OQJA 4LBZA 4KWCA 4CTOA 1B15A 1F6DA 2APJA 3T3DA 3ZU4A 4B9EA 1SCUA 3A3PA 4GZLA 5D01A 2QTZA 4CKYA 2FMIA 1HMPA 3DDOA 3AVOA 5H02A 4E94A 3ES9A 4R8MA 3F4LA 3PE6A 2D1SA 3CUKA 2OAEA 3PQ7A 4KKXB 4PYJA 5A3RA 4DV2B 2QAJA 1NR1A 3VSCA 4C4AA 5BQPA 4NKRA 3SSOA 1EH5A 3LCUA 1YL5A 1NURA 1NT4A 2B9VA 1PS9A 2QVGA 4GLOA 4GC9A 2RH9B 4KR0A 3WMEA 1O94C 1DBIA 4I9HA 4YV0A 1WSBA 1UWVA 1W47A 1XP8A 3WS7A 4EJFA 3I4FA 4Y67A 4DCPA 2RKBA 4TRRA 3JQDA 3AR4A 4UHHA 3I8XA 3N2KA 1UDAA 4LF7B 1TEVA 2A7QA 2B8NA 1SUAA 1EFDN 2ZSJA 4Z9FA 1NJ6A 2CF6A 4UFPA 2P67A 5KYWB 5THXA 4YMHA 4YY3B 5HKBA 2ZIZA 2QYTA 4ZV7A 3E0XA 2CXOA 3HN6A 4OKSA 1QZTA 2ZJ3A 1E99A 3BREA 3T06B 1DKNA 1QC5B 3B1JA 3R0QA 5BSTA 2E55A 3M82A 3EA4A 1ISGA 1TL7C 1U8TA 1UK6A 5F1KA 4YAUA 4WFJA 3R9IA 2ZXUA 3HA3A 3PV0A 3H3JA 1Q3TA 1T4MA 1ADJA 2HDOA 3SP1A 4E07A 1ULZA 2PLAA 5KBYA 3ZJUA 2VA8A 1B26A 3BD9A 4AJJA 4FYXA 1VLVA 2X42A 1XMQB 3ACDA 4BMNA 1TPYA 3C3BA 4WHMA 2WF9A 3O3OB 4KP7A 4M0CA 3QA9A 2WHYA 4R3UC 5I8ZA 5L8VA 3RG8A 4Z5XA 1N1MA 4FWIB 3R9WA 3OM9A 1H4TA 2IHJA 2VQSA 5IDYA 1NSYA 5IASA 5LMNB 2PBLA 3T61A 1NXOA 5EZ6B 3O8OA 3N0RA 1GU7A 4RHEA 2XRMA 5J2UF 3NO4A 3G02A 4F9TA 1JDBC 3R6DA 4R2MA 3C70A 2Z8XA 2N47A 3NWEA 1W44A 4XOIA 1TD9A 1BHQ1 2GFHA 3LVFO 4FNAA 3IIJA 2CHUA 4BJ3A 3OC6A 5JXWA 1XRJA 3TUIC 4F45A 3UJ9A 4YCSA 3ZJTA 3WGQA 4LJRA 4AWBA 4Y9RA 2OZLB 5G0WA 4RYLA 3V55A 3PXBA 3V33A 4UZEA 4YCDA 4YVFA 1ZNZA 1TJ3A 3GEMA 3EH2A 1CUXA 1SXJB 2GAFA 2NO7A 3LM8A 5J4LA 2R8ZA 3L1VA 1OA1A 4ZVVA 3RT9A 4L6AA 4ZK6A 4X7RA 1WTCA 4RWEA 4XVRA 1W52X 1XTZA 1UKBA 4GOMD 5MN4A 4PG6A 4L2IB 4F91B 2GD6A 1GWNA 1Y3FE 3JYPA 4NOKA 4RS3A 1SD2A 3RVOA 1U5BA 3PUWA 3ZE1B 1ZYUA 2B0JA 1K6EA 2K5UA 4MEAA 1H5UA 4OQNA 4EPTA 2A14A 5DU2A 2ZI4A 1YA4A 4PAQA 2FPGA 4RAQA 2FPMA 3KT0A 5LXTF 3GPLA 3UPUA 2WSSA 4QUBA 3ND6A 1LNZA 1A88A 3KAKA 1ZUIA 5F3WB 5F9FA 3NH9A 4U7TB 4U4AA 3I6YA 4MV7A 4U39A 1ZD9A 3K5PA 1TGVA 1TUIA 3PB3A 3L7IA 2HKIA 1G19A 4Z3OA 1C7EA 4ZANA 4PRZA 4RSRA 3JRWA 5K3SA 3WWPA 3TNFA 4D8TA 3E1GA 3OE7A 4YUVA 2VJYA 3W5IA 4WNCA 2GNAA 3AOEA 1KFKB 5K09A 1SZDA 2PS3A 3I53A 4DC9A 3W5VA 3FSGA 2AMJA 5AKJA 1LPBB 2PUHA 3BJIC 5GOZA 4CHGA 2OY0A 1Z5OA 4LJKA 3QK7A 5AR1A 5NLLA 2Q9CA 3TI9A 1OU4A 2Y67A 2PUDA 3GT3A 2HBQA 4OYRA 4E21A 2IUEA 3WQSB 3HK2A 3HH8A 5LYYA 3SC2B 1E2QA 1ECGA 2FA9A 4G5XA 3RKSA 5L9AA 2B34A 1RVV1 1BWPA 1VG1A 3GZNA 4ZGGA 5IJ9A 4B4OA 1HEUA 3WAJA 2GKGA 1TZBA 4DA6A 1GFZA 1IY9A 4FHGA 821PA 2WU1A 1V1JA 1YAJA 4S3MA 2ZAOA 4CI0B 2DAPA 3B8EA 1SVLA 1XEAA 2RG7A 4QJIA 3LW8A 2PXXA 1PD1A 3AJAA 3DP7A 1A0OA 4OA5A 5ALNA 4YJFA 2NTEA 3VYVA 2V55B 4J6EA 3I34X 2B5WA 5F3RA 3TNJA 2MOKA 3U3ZA 4N65A 4RO0A 3REQA 4ESVA 1HG0A 3QLTA 3A2MA 1YKFA 3DEKA 4NXNB 4DY4A 2R7AA 4UBMA 4HWPA 4MRAA 2HT6A 1FU4A 2GJKA 2BM0A 1NLFA 3CZAA 4DLYA 1DZ3A 2H4WA 1T6NA 3DG9A 4M53A 2B0CA 4NV1A 3COSA 3WLKX 4INPA 1DU4A 3NBFA 2OHIA 1EHYA 4DTCA 2EZ8A 1WMSA 4FFMA 3AVWA 5TPWB 3KB8A 2EQBA 1CDOA 1S8FA 3PK0A 3TSZA 3QG5A 4ND8B 3ADOA 1N8TA 4ARIA 2AIRA 3MJCA 4X1KB 4OAQA 3TX6A 4GKJB 3GDWA 5DHUA 3KLNA 1YMQA 3RHZA 1J5PA 5ALHA 1Q11A 2C5EA 2CHQA 4IJKA 2X0FA 4RZ2A 3CUUA 3FPGA 5FBZA 3IH5A 1P74A 6Q21A 1HT2E 3K9LA 3SFVA 4NC9A 1ZONA 2ZREA 9ABPA 4BY9E 1U65A 2SECE 3IODA 3ILVA 3N3BC 1GNSA 4LOHA 1HR0B 3H2IA 2C9CA 3M8KA 2IHZA 4KMSA 5EJAA 5A05A 4J03A 2O5CA 3TAUA 4EJSB 1Z83A 2HJ9A 1PUIA 2QV7A 4KLAA 4QUEA 4RTOA 3RFCA 4LG1A 2QGNA 2LWIA 4CUZA 5I4CA 3PWKA 1L7MA 3HSSA 4M0LA 2V1UA 3VYTB 4R2XA 1NJGA 3I05A