5HDQA

Mntc co-structure with mab 305-78-7
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
277
structure length
273
Chain Sequence
b'LKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter substrate-binding protein
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein/immune system
total genus 98
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA01
4FNAA 4G07A 4WESB 1N2CA 1KAHA 5B58T 5M3BA 4WNAA 1ESZA 4LS3A 5CX1B 3UJPA 2AFHA 3AEKB 4OXQA 2XDQB 5HX7A 1L5HB 4HMOA 3MWGA 3BE6A 3HJTA 3GI1A 4MO9A 3HH8A 2XV1A 4UTPA 4DBLE 4H59A 4OXRA 4WNAB 2AFHB 1KARA 1G20A 1M1YA 5KOJA 5JG7A 2XUZA 3AEKA 3PDIA 4INOA 3ZTTA 2OV3A 4CL2A 4TKVA 2XH8A 4MLZA 4M7OA 1QGUA 4NNOA 3U7QA 2RG7A 1G20B 1M1YB 1M1NA 5KOJB 3G9QA 3ZKAA 3PSAA 3R5TA 4ND8A 5FLYA 3ZK8A 3PDIB 3TEFA 2O1EA 4HMPA 3LHSA 4TKVB 3AEUA 3LI2A 1PSZA 4GICA 3EIXA 1QGUB 3U7QB 2PS3A 4WZAA 3AEQA 3PSHA 3ZK7A 4NNPA 1M1NB 4WZBA 1H1LA 1N4AA 4ND8B 5BVHA 2OV1A 4BBPA 3MFQA 2OGWA 4G09A 3MD9A 3AERA 2PS0A 3AEUB 5CR9A 1M34A 4UDOA 3K1AA 5KHLB 4PAGA 2R7AA 2WI8A 4WZAB 3AEQB 1QH1A 2R79A 3AETA 4WZBB 5JOQA 1H1LB 5JPDA 2QI9F 2WHYA 3MWFA 5BVHB 3AESA 1EFDN 1PQ4A 1QH8A 1N2ZA 3ZK9A 3AERB 2AFIA 1K2VN 3MINA 4MX8A 1M34B 3TNYA 4FI3F 3K1AB 4HMQA 2OSVA 5JJ5A 1QH1B 3AETB 2PRSA 3EIWA 4HN9A 4B8YA 1K0FA 3AESB 2X4LA 1QH8B 4TKUA 4N01A 4XPIA 4FILA 2AFIB 3MINB 1KAEA 2PHZA 3HXPA 4UDNA 2M6LA 5M2QA 5GGXA 2Q8QA 5BVGA 4INPA 4IRMA 1FP4A 2PS9A 3CX3A 5GGYA 5AFSA 3R5SA 1MIOA 4UTOA 2ETVA 4WN9A 1K7SN 4TKUB 3TLKA 1TOAA 5KOHA 2YNMD 4XPIB 5M34A 2MINA 2Q8PA 1N4DA 4K3VA 4MDYA 1G21A 2M6KA 5BVGB 2XQVA 3NU1A 1FP4B 1N2CB 3BE5A 4WESA 2XY4A 4WN9B 1MIOB 4PM4A 5I4KA 5CX1A 5KOHB 2MINB 4H0FA 2YNMC 2XDQA 1K75A 4FKMA 4LJSA 4OVKA 1L5HA 1G21B 5M29A 1XVLA 5HDQA
chains in the Genus database with same CATH superfamily
4WKGA 1E4EA 4U6QA 4V02A 4BV2A 5CEJA 1QMGA 4ZV4A 3JZAA 3UJPA 2Z04A 2ZBUA 1UMCA 1DIRA 2XOEA 1YIAA 2V6MA 4GG1A 4P4LA 3RHFA 4Q9LA 2NNWB 4IUDS 4TL9A 2RKWA 3R7DA 1MQAA 1EK2A 1FFXB 4LVNA 3T0GA 2ATXA 2F90A 4CMCA 6Q21A 3GLHB 3QV1A 1EWQA 3VH4A 3HEBA 4GKVA 1WHSA 2COEA 4X20B 1FLAA 4Q9NA 4EG1A 1KYZA 4M0MA 4KR7A 3QX8A 5CB4B 3UFXA 2OV3A 3Q8WA 3VTZA 1NUUA 2P68A 4BP1A 2WD9A 1JXQA 3BRQA 4TVOA 1E69A 1QYXA 1BKYA 1KMHA 2Z2IA 3BJEA 2NU7B 4JC4A 4MW4A 2RG7A 3SD7A 3H2SA 3G9QA 4IP0A 3LQKA 3W2IA 1DAHA 1L7RA 3FZYA 3CRW1 1U6KA 2PGAA 2WKQA 5LQRA 4J75A 5IT9A 3IULA 1T25A 1UPUA 2BGRA 5G0WA 1IU9A 2CFIA 4AZ3A 1V3VA 3LGXA 2Y9PB 2D1FA 1ZUD1 3QP9A 1ISGA 1DQZA 3PVCA 2C3YA 5IDWA 1D2AA 2HFKA 3FD8A 2NO7A 4KOAA 1EBFA 2HUNA 2BE9A 2GQ0A 4MRNA 1N34B 2AJDA 2IPAB 4GQBA 4NARA 5E95A 4LNUA 2FG6C 2VUHB 3EGEA 2WWHA 2DY1A 4DLSA 3B38A 4P86A 3S2GA 3V4VB 1NYRA 3JWIA 3W6ZA 3JALB 3U1BA 1FP2A 2IUTA 1O95A 2VYNA 1GAEO 1QIFA 1LTQA 1NW3A 1WF3A 3ZU5A 5IAAA 3M9LA 1NG9A 4KUGA 4U39A 3T3PB 3MTGA 1YK0A 2PTGA 1M2NA 5ED4A 1E3DA 1PRYA 3FCYA 4BNMA 1ILEA 1KMQA 1T8WA 2XKKA 4G5FA 3K2EA 4G1BA 1XFDA 4IYRA 1KSGA 1Y5RA 2YJ4A 4KIUA 2BP7A 1V8OA 4RXUA 3EHEA 1DT5A 1U3CA 3JQ8B 3U4DA 3WKEA 3ORQA 4CKBA 7ADHA 4ZT3A 2FEAA 1OT3A 3EDOA 3CVUA 1M1ZA 4GRAA 3DLBA 4MHOA 4TZ6A 4NYIQ 2GEJA 2O19A 4IILA 3ZHZA 16PKA 5HEKA 3SYLA 5EWMA 2EW8A 2BTEA 1SBQA 2BMFA 3EZNA 3WRXC 3I12A 3A4TA 3T1VA 3NGMA 5CYPA 3ZLBA 3HFSA 4A0GA 3W5BA 4GRDA 2OP0A 4NCIA 3KHSA 2NYAA 4Q15A 3LXXA 4XEUA 1LBIA 4Q48A 4M38A 1VSBA 4ETWA 1O6FA 1DC6A 1FP7A 2ILTA 1RFLA 2EVWX 2Q28A 1TMOA 2NXJA 2NX2A 4PFSA 4TZ0A 2RI1A 1FJGB 2NAPA 2GSWA 1O77A 1DBPA 3H2JA 3KFVA 1E6CA 4PM4A 3VHRA 1SHJA 1MT3A 3O7WA 1YFKA 2OAGA 1TQ2A 3LBYA 2MINB 1XKLA 4IJWA 3I4CA 4PGHA 4AJPA 2OLKA 4Q3OA 5IYZA 4XWKA 2DJ5A 2IQ5A 2WIGA 5KNBH 3DV0B 2WKWA 3PUXA 1AN9A 2ABWA 2ZE8A 1K0UA 1YZVA 3INRA 2I4LA 1VJCA 5CW1A 1ZJZA 3VAZA 2VP5A 5CFPA 4XLLA 3GJXC 4GZ6A 3EWNA 4N47A 5KTSA 3G0HA 1GR1A 4KV9A 3VOBA 3HKDA 2AOUA 2R87A 2VDLB 2B4TO 2A78A 4KE7A 5CJ2A 3JQCA 2EV9A 4LXUA 1ZFNA 1JIVA 4TTRA 2R1TB 1JJFA 1VGVA 3FGOA 4RUKA 4A6DA 1DCKA 5JBNA 5KVAA 1JKFA 1OW3B 1OTXA 3UUFA 4PPQA 1FPMA 4OOEA 5G40A 5AXDA 5C37A 1S2OA 2IZ1A 3MUFA 4R3WA 2Q3BA 3AU8A 4L3WA 3UH1A 1PYOA 2BDTA 1ZK4A 2QR5A 1XF1A 1Q15A 1JT9A 2O0HA 2Y3IA 1VBKA 3ASUA 3JVVA 4NJEB 3N0TA 4OHCA 1RZRD 4EJMA 3Q72A 2AN3A 4ISCA 4OAPA 3BXGA 1GRCA 2P79A 5G1OA 1QGUA 3E6AA 3R9IA 1ESDA 3G9UA 3GDOA 1QZ3A 4HXGA 4NBWA 3QNWA 4MB2A 3KZNA 5IKPA 2XUJA 1YT5A 1WUIS 3KHUA 2OV8A 3PGVA 4GXTA 2RH9B 3OOYA 4QJ5A 4LE0A 4UOZA 5I7SA 3L8ZA 4LOHA 3FTCA 5IAGA 3BWMA 4HRVA 5BOSB 3PWKA 3ITKA 4B0PA 3LQ2A 3R3ZA 3EGDB 3OFSA 5BR7A 1NLFA 2V4MA 3WGIA 3ZLJA 3HA2A 4EAQA 1KORA 2JAHA 4QU9A 1X1CA 5BVHA 4UM9B 4Q39A 1HKHA 1SOWA 1UAYA 5BYJA 2OCDA 2FR0A 4AX8A 1CE8A 4JXZA 3DL2A 3A7EA 4CDMA 1Q0TA 4J3JA 2GCOA 3G5MA 1NBWB 1VL5A 2Q1SA 1QIKA 4JUIA 3L2OB 4KIGA 3F4LA 5EMMA 2BMVA 3ETEA 5FKJA 2VHZA 1EWTA 1PR3A 3PDCA 4GLLA 4GSKA 3PRYA 1AZSC 4HFJA 1UMKA 1X1TA 2IVZA 2NZXA 3F7OA 4EJ0A 5C5EA 1NLYA 1VLLA 3KQOA 1M1UA 5I9TA 1LBEA 1QK3A 3X0DA 4QKQA 1Y3FE 4JYCA 3STWA 1NXQA 1GL7A 4YT8A 2IPMA 3LBIA 4MRPA 4HMQA 4WDRA 5AVTA 2JFVA 3FVRA 1X14A 4S35A 4E22A 1P1IA 5JDCA 5LD2C 4AS1A 2OTCA 1JTFA 1SCNE 5JS6A 4GC9A 2GBFA 3K3PA 2Q0HA 4EPYA 3VAAA 4XA8A 5FH9A 1U8CB 3M5PA 2ECFA 3GC6A 4I4NA 5K1ZA 4GH5A 4HVTA 3H4MA 1P1HA 4N8SA 5F2EA 3QE9Y 1XL1A 1T8YA 3QFSA 1AZTA 5CT5A 4S1WA 1J99A 2ACEA 4F2PA 2ZT8A 3AM4A 3LC1O 4PYNA 3F46A 3I52A 2WIFA 1J8YF 1O87A 2OVFA 4WOJA 2YNMD 4KE8A 5JJCA 5TQVA 4R2MA 3LT0A 3UOGA 2D0IA 2XQIA 2ZANA 2NG1A 2ZS8A 3CNLA 4Y9SA 5D3MA 2AE1A 3DB1A 5HF5A 5IVIA 2F3UA 3IUEA 3BGDA 1WNTA 3WV4A 2CNKA 1QFMA 1Z39A 4OJYA 4UNIA 3PX3A 5K3SA 3M6FA 5IJ9A 1XOIA 3W5CA 5EAIA 1TCAA 2Z58A 3ONWA 4Z9AA 1CY6A 3M0EA 4FFVA 2BDEA 3DLCA 5HZKA 1LU9A 4MJLA 3UCEA 4BX8A 2Z1NA 3J7TA 2X2EA 1VYTA 1ZMXA 3BZUA 3SYMA 1IJFA 2GBGA 2GN9A 5JU6A 3MT0A 1JR4A 4MQ5A 2IYNA 2HBRA 3AV3A 1SBCA 2XA1A 4ICIA 4A1FA 5FWDA 1AH2A 4DMRA 2XDQB 4MRAA 3M9XA 1BU8A 3OEEA 4YJ3A 4ZT5A 5ITWA 3AKZA 4QG7A 4JB3A 1HXHA 2Z4SA 2C5LA 3I2FA 3QPDA 1QF7A 4P34A 8LDHA 1E9DA 2JH9A 1MC1A 1Q19A 2FAXA 4PANA 5ECWA 4G4JA 4UTPA 4OREX 2F9MA 2GCIA 1CQJA 4UOQA 3DF9A 2OBBA 1CDDA 4PBSA 1FFYA 2FRDC 4UULA 2QP4A 2Z08A 1X1QA 4LVOA 2P40A 3UM9A 3V9AA 4UXHA 4U9UA 1I7DA 4LGMA 1OKKA 3C24A 4PYIA 2C3UA 5COAA 4C0BA 2HA3A 3MQ2A 4FMBB 4R9SA 5IAJA 2CK3A 1QJCA 2D74A 1RAFA 2LPMA 4P4UA 1XCPA 1RBMA 3CKYA 3LHFA 4N03A 1MJNA 1PYGA 1BGVA 3UK6A 3SR3A 1Y98A 1ITZA 1U9JA 1MB9A 3CLKA 4ZCIA 5CB8A 5FLKA 3PSAA 3G8CA 3PQ7A 5CX4A 4F4UA 2F7SA 3EIFA 3QH4A 2XUKA 3HRIA 3KDPA 2XWSA 1ZBQA 1UMDA 3M3PA 3L8CA 2Q7XA 4I50B 1JZTA 2J1LA 2PX6A 3QFCA 2R4UA 1SG9A 1R0YA 1O08A 4TT3A 3ZGNA 3MTDA 3UY4A 3O73A 2PZGA 3SHWA 5FFFA 4GL4A 2BPOA 3ZS9A 1KP3A 1RACA 2YTZA 4E5MA 2LWIA 3P52A 1E2GA 4HB0A 4CHGA 3GBVA 3LL7A 5EJ8A 4MDFA 1BX1A 5A4KA 2E4ZA 4R81A 1U0TA 2O7RA 1FTQA 2I6FA 5BT9A 2IIPA 4JU9A 1XZQA 3IJ5A 4RCZA 1KYVA 1QLHA 3ZWDA 2ZYWX 3OOSA 5TQ2A 2CNBA 4C3OB 3LKVA 2JHPA 3O93A 3G0OA 1GAWA 1TM5E 2DM6A 3JQGB 2H29A 5K3FB 4DLKA 1JQDA 5TXGA 1OBFO 1UK9A 3TPCA 1LFAA 1D2MA 1YRLA 1X87A 3QNUA 5CEEA 1DWUA 4WL0A 3E7DA 4B9AA 1OGIA 3NIWA 4XARA 4JVMA 4V0SA 3BTOA 4ZOQI 3WICA 4YRNA 4Z7OB 2R8OA 1ECLA 2FUG6 3S2EA 3CH6A 4WJZA 2EKLA 5T57A 4FEEA 4ZGBA 5DNDA 3FDXA 1Q95A 1LLUA 4R8KA 4J0IA 1D6SA 2A58A 3MUNA 4CKXA 3TPZA 5A3SA 1KWKA 3AIIA 4K9QA 5JSHA 4E33A 1P2VA 1XA0A 3N0XA 4HQLA 1ONNA 3PUIA 4XJSA 3ESCA 2BC9A 3VPBA 4C01A 1KDPA 5HKKA 2FN9A 3GF4A 1LDYA 1EFCA 3N8HA 3O8OB 7REQB 5JFOA 5KWVA 2KYRA 3FPEA 4W5QA 4JT8A 3GJ6A 2ZRLA 4D42A 1R3DA 5JR3A 1WMDA 4W6QA 4WCFC 3W0LB 2C4KA 3TTXA 1XP5A 2VSYA 3QKRB 3QV2A 3QG5A 3K53A 1DTWB 3FLAA 4PO8A 4QC2A 1UJCA 3NWBA 1WQ4A 4X66B 4ONEA 2OBMA 3AV0B 3ZIUA 1MR3F 4YT4A 1T5SA 4MIEA 2FEMA 1AC5A 3HCFA 4B3BA 5A4JA 4RK6A 3FGNA 2NYUA 4YROA 3UWKA 2BBWA 4Q1CA 3G7NA 4II2A 4W5RA 4C4OA 5EERA 1U1FA 1XWFA 3H17A 5HFAA 4ARVA 4GMHA 1C1HA 4E31A 1OWMA 4TKZA 4ND7A 1HTBA 3VZSA 3DXYA 1JSCA 4HMOA 3I01A 3NW9A 4RTPA 1JFTA 1TQ8A 3EARA 1DIHA 2IHTA 1JVBA 3JRXA 1HT1E 3C5WP 4QBIA 5CA0A 2I65A 2WAYA 3TRFA 5D00A 2HIGA 1SNYA 2G06A 1PO7A 2XSZA 2XZDA 3VQTA 4F38A 4HVCA 4KPYA 4NQZA 2W83A 1WETA 1J0BA 3KAQA 1EM8B 2RAUA 4ZYWA 2FSHA 3H18A 3G9XA 1W4RA 4FEYA 4GQAA 1OWNA 1QJ4A 3GFBA 2JEYA 3H0EA 4JC0A 4J7CA 2O8NA 3STTA 4DA7A 2QIPA 4QLBA 2IYWA 2H1FA 2QENA 4RHCA 4TM8A 1K6MA 2Y1LA 4JLBA 2H51A 3V7WA 1TYBE 2AQKA 4CXMA 1XWIA 3OZBA 4J91A 4JJZA 4TVBA 3ZPXA 4Z4FA 2B8WA 4G0NA 1AURA 2IIQA 4AJIA 3DE0X 1PTKA 2D0PB 3KQWA 1U4SA 5DULA 2NUTA 1TUBA 1G98A 1CQXA 1XI2A 2DFDA 2WUVA 1D4OA 1RKQA 3OZTA 5FHRA 2V0NA 3SXUB 2QD4A 4QPPA 2O20A 2HHAA 3PDHA 1RQNA 1WZIA 3B20A 2C5EA 3BICA 5BXQC 2LE0A 4D0NA 2ADMA 3P9KA 4ZRDA 2WQ6A 4ZCQA 1BVRA 1SIBE 3AU9A 4FK8A 2C9BA 2RC6A 1FW8A 1SIOA 3HRHA 3NHUA 4HG2A 3UMGA 3NJ4A 2HNAA 2BONA 3CINA 4MPJA 4UBIA 1I6MA 4WOKA 5SZJA 3BX1A 3WTCA 3TLXA 1S7CA 5LUBA 1KDZA 1M3SA 5AVRA 3ZU4A 1TT5B 1Q0RA 1W6RA 1L0BA 2DUJA 2TMKA 3DHVA 2L82A 1IMOA 3NJ8A 3T9AA 2J9ZB 3T1NA 1CY0A 1ZI8A 5EJIA 4EECA 1QH9A 5EMNA 3TL6A 1A9OA 3PDJA 4F3KA 2V7VA 4BKOA 1RWBA 3EC1A 5F7JA 3B70A 1QVZA 1PV2A 1K6JA 4ZEOA 4L0DA 1W2HA 4RK7A 5KVCA 1I94B 4X60A 3L0BA 4O3MA 2Z83A 1Y1TA 3RJ5A 5LLTA 1CG6A 1OBOA 1TK2A 1OWPA 4GVLA 2J3HA 3OKFA 1A95A 4B8WA 3U7GA 3RVMA 2OG1A 3MTQA 2PX5A 2VDOB 2GFIA 3BB1A 2VZ9A 4H6XA 4GYWA 1NAHA 4X64B 3Q88A 5BUQA 3O8CA 4IWYA 2PX8A 2RGWA 4X3OA 4MHTA 5CVTA 4MEJA 3WGQA 1KYXA 1U0SY 4OPMA 4RZ2A 1ZYUA 2GF9A 2CNWA 3OIYA 3OZFA 4PZUA 5F2KA 5SZHB 3RREA 1QG4A 4LXQA 1LFDB 3FTDA 1ESMA 2VXBA 4Z4IA 1ZJYA 1KERA 2CZGA 2WYWA 3EB9A 5JI2E 4LSGA 3AF5A 2VBCA 4KXUA 3W4IA 1AUVA 1YS2X 1KA9H 1TA9A 3PZBA 4LYJA 5E3JA 1XT6A 4GVPA 4ZPJA 4BBAA 4KPGA 1OFVA 1RWPA 3N2KA 4WESB 1X92A 1DI0A 1JYSA 4BVBA 4ZDJA 2W42A 5BWNA 1M6YA 3PG5A 4MPRA 3EF0A 4CMEC 1U5BA 1E3WA 1QIDA 2E4YA 2M32A 1K92A 1GG8A 3PFBA 4IDHA 1A71A 1J70A 5CH5A 1KEWA 2C9CA 5TQ0B 2ZJAA 2PT5A 2KB0A 4XJTA 4YDSA 3IVAA 5JLAA 3EZYA 1DARA 4B47A 1O6ZA 4RSHA 3N9IA 3BDVA 4J0DA 5IBRA 1XYYA 4NOKA 1ZX1A 4C6TB 1CNEA 4J29A 1Y8ZA 3AHGA 3W8NA 1X8KA 2HAEA 3BF8A 2C00A 3OLWA 4L3OA 4TMVA 1HUQA 1KMCA 5JNUA 3SVTA 2I34A 3A1DA 1XN4A 4OU5A 4WN3A 2LCFA 5K3CA 5LR6A 1ULAA 5KJEA 1ODSA 1U7TA 2PK3A 2BBSA 4C30A 2BGKA 2RDMA 3PRHA 2NLOA 2DGDA 2NP6A 1J2UA 1EXNA 1PCXA 1QLWA 3HGMA 3AVQA 4D4HA 3Q8MA 5KSOA 3LWNA 1W44A 4X45A 2D5CA 1QG2A 1X9IA 2LNDA 3K0KA 4HB4A 4ASUA 4XDGA 2IYVA 3NHSA 4MW5A 2ACKA 2LZ0A 1FTSA 3W5SA 3REOA 2AF3C 1LLFA 5A5DA 1WV0A 1FK8A 1U8ZA 3NUGA 4P84A 4TLCA 4MVJM 3VSEA 1HYQA 1PE0A 2IXGA 2CJFA 4RTRA 4UZEA 1GZUA 4YRGA 2GK6A 3ZHBA 5I45A 1CP2A 1L7PA 2IZOA 1CJVC 3B5IA 2CVZA 3EPPA 4V0LA 1E60A 4PWZA 4D6PA 3PC3A 5JSZA 3NM6B 2ZEJA 3ETGA 5LLSA 4ZYYA 2Q46A 1OASA 2O3SA 1C30B 2OAP1 4NZYA 5TJ9A 2G1PA 4YXFA 1YR8A 2QL9A 4J1QA 3T7CA 4RESA 3NBAA 5DXFA 3ICVA 3OWXA 3MEQA 3VPSA 4B81A 5LYYA 3OE7D 1S0UA 1Z47A 3I92A 4IGEA 4WKPA 5JEEA 5T6BA 1M0EA 2GWHA 4C4RA 2AEJA 5FJJA 4ZAVA 4WVFA 3QJGA 2VH5R 3GD5A 3PUYA 5HW0A 4ZTUB 3C6BA 4NS1A 5AKGA 4EQ6A 3C8DA 4HN9A 1JW9B 1LBTA 5HRUA 2FMTA 3IP6A 5LXTF 3TAUA 2IS2A 4PXYA 3DUFA 4NZNA 5JMOA 5LP6A 1ZQ9A 2IRWA 3N2GB 1F0YA 1ZR4A 1O95D 2X1VA 1XDDA 4OYLA 2F9FA 1GUDA 2YXPX 5AXAA 3BE8A 4B2IA 1T9GS 4CIXA 4D4JA 4HXEB 4EY6A 2JJ8A 3WGOA 3V8NA 4DAOA 3KOZA 4EGJA 2C4UA 3WHKA 3DR5A 4JENA 1MNQA 3VI4B 5AUOB 3TZ6A 2NVUA 2D5AA 4LHVA 3PVZA 4G8BA 5CTAA 3Q87B 2VBGA 1S96A 3TSCA 1QP0A 1AHIA 3HDJA 3BYZA 2GERA 1QP7A 2VJMA 4EW6A 4MK4A 4WECA 5EJAA 1JBKA 2JI9A 2XCTB 3EXIB 3GOHA 4GPD1 5KX5B 5HS6A 5K3EA 2KX7A 5B36A 3KEQA 4NI5A 2Q4EA 4LZOA 1VA4A 2N1MA 5K6TA 1O7JA 1RZUA 3BREA 3GB9A 4O3FA 4O4HA 3B5EA 3MGKA 1MO2A 4N5LA 4OK3A 1QF6A 1RDFA 1ZU4A 1E3EA 1II8B 1O9GA 3UPDA 1KH1A 4JJGA 5KINB 1I4OA 2I62A 4TSKA 3R4VA 1PJ4A 4CEJB 2JLRA 5B58T 5J9FA 5DISB 2I9PA 5FO1A 1PZGA 2CD9A 1DTSA 4YLEA 1LSJA 3FSEA 3GMIA 4AMBA 1GSAA 1NVBA 2PZAA 4PLYA 4OGLA 4XDHA 3MTEA 3MWGA 4Q4CA 5F3DA 2W6PA 3D31A 2DG2A 4QULA 3GUUA 4MOWA 4MQEB 3BA6A 2AMVA 5D5QA 5KTNA 3RANA 3GPBA 2YASA 2YXNA 4KRFA 1ECBA 3H9JA 4D80A 4J03A 2EX4A 2O2XA 1KP9A 4YCJA 3TBFA 2P4SA 3L7OA 4N18A 4XB6B 3GQBA 5D1NA 3DQPA 2BI8A 2GZDA 3KT3A 3GROA 3E1SA 3LV8A 2HIAA 5FYDA 3ICQB 5F23A 5ALNA 2FR8A 3ZXYA 3VC2A 3HVHA 4HAOA 5CRIA 2FWBA 1D7OA 4OEHA 1GDTA 1CD5A 1Z56C 2XRYA 5LDGA 4CEIA 3R7FA 4A23A 1SIUA 2C8LA 2WWWA 3FKSD 3I04A 5L3QA 5LWHA 4N76A 1N33B 3BFKA 3U6KA 3V6MA 1ZH6A 3HYSA 4YP9A 2C7OA 4NTZA 2O7QA 5DKFA 4JYZA 1CU1A 1NDUA 2XGSA 3D2BA 4Y0NA 3S7ZA 1SWVA 5CB4F 4E1AA 1WHTB 5IDQA 1CJCA 1ZAKA 4HUQA 4RJJA 4HBZA 3RRYA 4DCTA 4MWCA 2ZDQA 3CWZA 2ISSD 3IQWA 1U3FA 2FK7A 4KXVA 5JS7A 5AW0A 3ACBA 1B15A 4E1VA 1L5LA 1TM2A 3C8ZA 5FTLA 1FJXA 2CNDA 3T3OA 3D64A 2RSLA 3Q5DA 2V6JA 1N8SA 2WD7B 3GEGA 1OV4A 3GLGA 2DERA 2D54A 5LKRA 4Q00A 2NZ2A 3TDNA 4NYJR 2OESA 3TNFA 4GOXA 4Z1MD 2P5SA 5DCWA 4CMKA 3PTLA 5E6UA 1TVMA 4MA4A 3ONDA 5CFQA 2IBTA 4B3RB 5KJ1A 4ZCSA 4RIGA 4HGPA 2MJLA 3MINA 4JI1B 3MGAA 2XT9A 3ZBTA 4TTAA 4QARA 4E5YA 1OYWA 3RS3A 2XF8A 2X0RA 2YS6A 3JASA 4FFBA 5F33A 3RYHB 4R0MA 2HMAA 5KYWB 1G20E 5KO2A 2V7QD 3NJRA 3FN4A 1QHFA 4NS4A 1KFBB 3CW2A 4QYIB 5C8DA 3QPBA 1HNWB 4DV5B 4ECEA 1UAGA 4MCHA 4GKBA 4N7JA 4IVRA 1E2IA 3SIXA 3KSUA 5M2QA 1LQ2A 1Z4LA 4QQKA 4KNYA 3GPDG 3H9CA 4I2VA 4INPA 1PLKA 2V7XA 2O3TA 4QLOA 2HF2A 3Q7RA 5CXQA 1S8NA 2AXEA 2VHEA 4CG3A 1E66A 1RM3A 2ZAYA 4L8LA 3IVMA 4REMA 2GJ9A 1M6VA 3KKOA 4V38A 2H2AA 1X2BA 3F5FA 4EMTA 3U4CA 1RRGA 2VNSA 4G3XA 2HW8A 1JFVA 1J39A 3MGGA 4K5QA 2FDRA 2I7DA 2YYYA 3FYUC 1CTQA 4XWWA 4D9MA 1HZJA 3U62A 1M9NA 5DGDA 2BFFB 1DG1G 4BYMA 5J2UB 4J16C 5H4GA 4D8WA 4U7JA 2OZVA 2IEIA 4H3VA 5G02A 1UXHA 3ZG6A 4X92A 1TQDA 3K8ZA 5DLYA 3RKSA 3DOJA 4LECA 1N3LA 4ZAYA 5AYVA 3VNBA 4M3NA 1NQWA 2JIZD 5BNFA 1EX1A 2CCJA 1L5SA 2I2AA 1UPFA 3VXKA 5IJWA 3SI7A 3C8MA 2BJWA 2JGFA 4QPCA 3SDBA 4A82A 3SP1A 2GN4A 4J94A 3AR7A 4S12A 1CW2B 2IU4A 3DVQX 3VZCA 3FKJA 2CFRA 3FNFA 1IYZA 2H31A 5FJIA 2RGCA 1ZOLA 2W9XA 3FFXA 5HJ5A 1W87A 4MR8B 3FDZA 3FI9A 2AN4A 2RBKA 2F1KA 3P9CA 3P45A 4WZZA 5AI8A 4PZLA 5I4IA 2GJ8A 5A5GA 1H5NA 3CF0A 3BAZA 1ONOA 1ODKA 4IRXA 4AECA 2FMXA 3GXOA 1GPLA 2JIMA 3H97A 1B3RA 1TD1A 1N57A 1VXOA 3OZSA 4Q7LA 5BR1A 1ZDMA 3LDUA 4AZWA 3QPCA 4C07A 2ZYGA 4H0NA 4RGYA 3NTVA 2XBMA 4BO5A 1UJ6A 1I2AA 4YAWA 3ZOZA 2DB3A 3RUDA 3Q3HA 2JI6A 1XEXA 3WMXA 2CUZA 4ARSA 4UUNA 3LL4A 2ATVA 2I6SA 3LGAA 4YAFA 4YH1A 5ALTA 3A4NA 3U44A 1VG1A 3C8HA 3KOWA 3ZEIA 1J8VA 2FPKA 5KYTA 4C0JA 3H1AA 2RI0A 2BMAA 3IQGX 5FA8A 1MEOA 2ZOSA 3SBDA 1WNFA 2ZJ2A 4JMPA 3ZJ4A 3TKAA 3VOSA 3HGTA 3OU7A 3ZW8A 3U61B 3KEGA 5KYGA 2GXAA 1QUFA 4TS3A 1FX0B 2AN9A 1NULA 1ZN9A 1B14A 2YWDA 2BI4A 3KR1A 3UMVA 1XPRA 4KR6A 4G09A 3PQ5A 4QVIA 4CUJA 4INZA 3LPCA 3RUPA 2J3DA 1E3QA 1P17A 1SXIA 3CBQA 4HH1A 4K8OA 3ROXA 2PZMA 4ZIRA 2WJHA 1E6WA 3N2EA 5DPMA 3FCEA 4Z4QA 1PDVA 4KFCA 2P2NA 3IE1A 4WFKA 2OL4A 1ZSNA 1P7WA 4F71A 3JQQA 3IC5A 4H2DA 1GLVA 1NPDA 3I2GA 1OVMA 3K1AB 4E15A 1QVVA 1K3FA 1L4UA 2VP0A 3UMBA 4BVKA 5CEFA 4NCAA 2H1IA 3K9GA 1U3WA 2E21A 2B3DA 3HFRA 3HR7A 1YQ9A 1JHPA 3K16A 4NKRA 2PUBA 1U28A 4TKUA 4I0WB 1UP4A 3KB2A 1Z16A 5MFPA 3FGZA 2DXIA 3C16C 3AM5A 3KIPA 3DAHA 3IRUA 1KKLA 4PG7A 3H6HA 1BHJA 3ZHUA 4P36A 2BFWA 1ZRNA 3KJQA 2GEFA 3A6JA 2AX3A 1OF1A 1YUBA 4B79A 1YA8A 2DTEA 2DTXA 4IEEA 4K9NA 3ZDCA 1E8DA 2W2LA 4EY4A 1YHZA 5F5XA 1A5ZA 1JHUA 1N2HA 1IM2A 3QXCA 5DSTA 5FQOA 1RWNA 1V48A 3RFXA 2AN5A 4AYXA 3L1IA 5EXDA 1W4ZA 2ZLBA 4YUVA 2J07A 2A9JA 3BMOB 3KNZA 1UZLA 3B3QA 4KXWA 5IM4F 3L4BC 1OWOA 2XUGA 4FGUA 4PQFA 1ZP6A 3OU2A 2O7VA 3UGTA 1L1FA 1Y8AA 1CC1S 5INTA 1R5JA 2FZVA 4MCJA 5ALMA 1QS0B 3R3JA 1W93A 3G8YA 4OB7A 3ETJA 5IF9A 3VNSA 2XX3A 1CNMA 3FPSA 1MG5A 2C2GA 3K9CA 5T6MA 3ADDA 4MDHA 4PXSA 4Y2VA 2CGEA 2CL7X 3TQRA 3FM9A 2Y27A 4O2AA 1XZJA 2GM5A 3K6KA 4CCAA 3UAZA 2Y1OA 2W6ID 1NM5C 2ZUVA 4TRNA 1SCIA 1IBLB 3BDIA 1ZAYA 1EEHA 2H9IA 3QYPA 4U63A 2CE2X 3PJEA 5SYNA 4C7XA 3EPJA 2X7JA 1TM3E 3DBHB 3SK0A 3EPKA 3E2PA 1VE9A 3GD7A 2IZ6A 2PXAA 1FRVA 1PZHA 2FZ4A 5HFNA 3TAXA 3O4HA 1U8FO 3H2GA 2HREA 4BCBA 5EE0A 4JIGA 3LY9A 3IDFA 4KXFB 4QXMA 4CR6A 1H2FA 2C07A 2HFJA 2QXUA 4HN2A 2FVXA 4D56A 4G5YA 4R40A 3N5CA 1ADFA 1OLUA 3LXRA 4TKVA 4H6PA 2CWDA 1T6YA 4GO1A 5AVQA 4YIHA 5JFTA 2HSJA 4U9IS 3AUFA 3LYHA 3TLGA 1QV9A 1XZDA 3G0DA 3WE7A 1NP7A 3A9SA 3CX4A 3RSSA 1LS6A 2DFLA 3GJSA 1GOTA 1DC4A 2NNLD 2UZ1A 5T4BA 3JD3A 1MCZA 3DFUA 4Q9AA 1DELA 3AWDA 3QGMA 4REQA 1B0PA 1F9EA 2XSZD 3KVOA 2XVXA 2Y66A 4E2XA 1C3OA 3OPYB 1IWBB 2GEDA 2QU7A 3HU3A 1HEIA 4PX9A 5C80A 5HZHA 1LLDA 4HNRA 3QVKA 4H7IA 1WS6A 3JQFC 3REQB 2IYXA 4CPDA 4F06A 1P6UA 3I6YA 1QIGA 4NZPA 5KWEA 2FGJA 3CISA 1L7VC 4GSYA 2C8KA 1X7HA 3TCNA 3TOCA 1THGA 2NXCA 4HD8A 5IAEA 1OILA 1PDWA 3L4EA 2VYFA 1AA9A 4I50F 4Q4LA 4X1KB 2PUVA 2ZUUA 1JG6A 1TGVA 1VBFA 2QI9F 1NL3A 2OYSA 3OVMA 4PQGA 1PL6A 4YCCA 2OV6A 4EARA 5E1BA 1DV2A 4UU1A 3K0FA 1USIA 3PEEA 5CDFE 3HB5X 4NFHA 4DMMA 2JC3A 3UUWA 4IDOA 2RHLA 3FCXA 5EP1A 3ROZA 2VTEA 3PR2B 4HPXB 3SZLA 3TRHA 3VKFA 1NVMB 3AZPA 5GVRA 4MQBA 2JDID 4NCJA 2X76A 4B85A 5D6NA 4D8XA 4F3TA 1M7HA 4ER5A 4KACA 1PJTA 3ZC3A 1FBTA 3AL3A 4PW0A 4RF2A 2J87A 1T9AA 3BE4A 2J6BA 4Q3AA 1RWKA 1H94A 5DNEA 5JZSA 1KDOA 1NW5A 3B1WA 3HNPA 1O8BA 1VE6A 2JFHA 2ZPUA 4C29A 4U5QA 2O23A 4WCDA 2GS9A 1I5RA 3V33A 1PGJA 3WX0A 1SU6A 1U2PA 4H6WA 5L9AA 3TQFA 1ZCAA 1N75A 2PLAA 1XQYA 3OC0A 1JIXA 2WBLC 1JPVA 4HNHA 1V4VA 1J0DA 1H66A 5THKA 2C77A 1G8HA 3C4JA 1TQHA 2P41A 3I0ZA 3EVNA 3TLEA 3TNLA 1BG6A 2Y9MB 4DDWA 3CZQA 3CNEA 3DKIA 2GF2A 2GN8A 1U0OC 2WOJA 3D3NA 4GI2A 1H69A 5AM4A 5C1IA 2BFBA 3NOQA 1SHTX 4HDSB 5DYNA 4Y2YA 4GT1A 3ME5A 2VJAA 1RYMA 1YS6A 1HDCA 3OPMA 1ZESA 1K3TA 2IU0A 3EG9B 3WB2A 1ULUA 2VWQA 4XYMA 4J1NA 2YFYA 3ZQ6A 2AE2A 2W2NA 1EUDB 3ILVA 5IUKC 2VCYA 1CLUA 1TA4A 1FSGA 3VPAA 3SFTA 3ZE6A 2AI1A 2PA3A 1O58A 1R6BX 2J7PD 4FYMA 3FYCA 3BRSA 3FDJA 4LXIA 1I7LA 1YRAA 2E6KA 2OUKA 3ND9A 4WLOA 3N75A 4BAUA 5JT1A 2XXAA 1EP9A 1T0BA 2Z3WA 4V3CA 3X2SA 1M33A 1C9YA 3L6OO 5L3SA 3ZY4A 4OHZA 4BMYA 3EGWA 2I3GA 3FIUA 2XVYA 4HF7A 4KGZA 5I9IA 1DDOA 1LI7A 2EIXA 3TF5A 1QIHA 4QNMA 3KPWA 4UCFA 5ES3A 2ZJOA 4EYGA 5DIFA 2A9OA 1XMJA 1T2CA 3IA7A 3OBBA 1MV5A 1Y81A 1IM8A 2B30A 3PFCA 5CLIA 4ZARA 5HBGA 3RK0A 2VJNA 3ADPA 5DDIP 3RU3A 5LDDC 4ETIA 5CG2A 1G6HA 2PFSA 3BB4A 1MJGA 1ONBA 3P2MA 3SVLA 2N46A 4RK0A 3ZGZA 2P5TB 1SCQA 1CFJA 2H1OA 3JCZA 1XG5A 4K86A 1HYBA 2OBLA 4RJLA 2NXWA 3D5TA 2VJLA 3B1KA 4KMRA 1Q7EA 4L4SA 5CNIA 5A4DA 1G38A 4DQ0A 5F12A 3KTAA 4R69A 3R7NA 3BILA 4YCDA 2YIVX 3HP7A 5KKNB 5DI3B 2QAGA 5JYDA 2OHFA 4ESHA 4HAUA 2H9YA 1C50A 4WE3A 5ABPA 4BE9A 4YMWA 3AJDA 3EJWA 3HDHA 4W9RA 4CQLB 4B84A 1KDRA 4XQ9A 1IN7A 4UMVA 3TSZA 3I9KA 3ZZ0A 1ULSA 1PEKE 3HJBA 2IZ0A 5JSYA 4ASUD 3G2JA 4C0QC 2HCTA 2VYVA 3MWFA 3MWLA 2AK2A 2FSVA 3FHCB 3SYRA 3Q7IA 1TEXA 1VYVA 3UIEA 4C87A 2RGRA 4JXKA 3FBTA 2I6QA 1RXYA 2QV7A 4X8HA 4AG6A 1CQWA 1E1KA 3ESZA 2FSUA 2PT6A 2A5LA 2BEWA 3TOSA 2W2QA 2GWRA 3ZWOA 3E0QA 1FUUA 1CQIB 3ZE2B 1SEPA 4RJ2A 4O2LA 3IOCA 3LUHA 1W85A 5EYPA 1YZKA 2X1LA 3EVAA 1KBOA 4Q1AA 4TLEA 5C8XA 3WQRA 1X7YB 2NU9A 4JHLA 4JFAA 5IZ4A 3SZUA 3GGJA 2HDNB 1OLXA 4XQCA 3VOTA 4OX9Y 2Q8QA 3H1FA 2ZP1A 1W5EA 4D82A 1KVRA 3DDHA 1F8XA 1KI1A 3L9WA 4XDZA 1OFIA 5CXUA 4N54A 1VL2A 1ML4A 4OD0A 1R9JA 3WNZA 1T3SA 1SXJC 1W8DA 3CWQA 4RV9A 3R24A 1C8VB 3RWOA 6PFKA 5CDGA 2IPNA 2YJ5A 3GRCA 5K4AA 3UNXA 2HK8A 3H75A 4V0MA 1CEEA 1G3RA 4YV0A 4E5VA 1EPUA 2FLWA 3EXHC 5JD4A 3RSCA 4DSAA 3KWFA 3RF7A 5HJ7A 5A0VA 4MPDA 2J30A 3DSRA 5CFRA 1RKBA 1EWVA 3OPVA 5BNIA 1H4SA 4IKOA 2Q4TA 1OYVA 3HMQA 3UJ9A 3LVBA 3KQSA 4C04A 4QSMA 2IIVA 2APJA 3HADA 4PIPA 1QX3A 1OR8A 4RD0A 4OQYA 2QE6A 3PLRA 4BNGA 4FYJA 2FJ0A 3GN1A 1V5GA 3D8BA 1R0RE 2HMVA 2OQRA 4PLCA 4PPFA 1ECJA 5DTQA 1K8QA 1C7IA 3K9LA 3O1HB 2ZDGA 1O6BA 1FVFA 3CX6A 3T95A 2H2IA 2P9QA 1SD1A 2RB4A 3UHPA 1KSJA 4HJXA 4EMSA 2F8TA 2GYUA 4ZCTA 1F38A 1YKGA 4D9KA 1VPTA 2YWRA 3B52X 4E1BA 3LBNA 3ZX4A 2IFTA 4G36A 2ENUA 2W2MA 1JEEA 2A8YA 3T4EA 3SKYA 1NMYA 3HDQA 5ITVA 1NXPA 1R6AA 4LSZA 3M81A 3JQ6A 3W6UA 3RR2A 1YRYE 2FZLA 3QVXA 3GAMA 3L01A 1DOZA 4MLZA 2FN8A 4B7XA 1TNDA 2G80A 5FUVA 2JAWA 3IX7A 4ZAFA 3LT1A 2W2VA 2JGDA 2PZBA 3BK1A 2GPAA 2H9AA 5EHIA 3H9QA 2P4HX 2V96A 4HLNA 3SG0A 5IULC 4OJMX 2QTAA 4HEQA 2UXCB 3GCGA 4ZD6A 3O2QB 4DKXA 1OAOC 1WKVA 3NANA 1Y8CA 1Y37A 4G24A 3SX4A 3C3EA 5IVPA 3CBGA 3OF3A 5IASA 1Z2NX 1J9GA 4GNRA 3IV7A 4MJ7A 4NMLA 1DFHA 1N6HA 3DVLA 3L0IB 4TUYA 2HI0A 3CZMA 3GWGA 3QUTA 4KXNA 1V8PA 5AKIA 3WKAA 1GKKA 2CT8A 1NJSA 4ND8B 4DIKA 1QQBA 5LOVB 5JHHB 5JFGA 4XQGA 4ND5A 3BK2A 3D3WB 4JR2A 3ADCA 1M6NA 2O3RA 3SM3A 1POXA 4M21A 3BMCB 5KHLB 1R66A 2H1HA 2CDNA 4ERXA 3CGWA 3EVZA 3NDRA 4CQMA 1K5GA 1RPNA 3LMKA 4U8HA 2H63A 4RE5A 4ZXFA 2EJUA 5F2NA 1Z63A 1EIWA 2GLTA 2Y67A 4R3UC 2X2OA 2VK8A 3L4SO 1Z4NA 2ES4A 3GNQA 4JAVC 3R7WB 2HR1A 4BQPA 3FYSA 1QCCA 1WSBA 3PHCA 4F5WA 1JALA 1T10A 1Z0KA 2IDJA 1F8UA 5HFJA 4ZYZA 3IJRA 3RVRA 4C22A 4B3TB 1E98A 5AJZA 5DM4A 2FPXA 2HIHA 4LVCA 3F74A 3CT6A 1XVTA 5IC6A 5FPTA 1JFFB 1L7EA 1ZMOA 2B2XA 5AWFC 3A32A 3P2JA 1Y9ZA 1T0UA 4POOA 5EJ6A 3E9DA 4PQYA 4XJXA 2VQFB 4IIJA 3G7UA 4DQKA 1CBUA 3EC2A 3KJNA 3OCWA 2QX7A 4KLNA 5DJ5A 4DA4A 3ST7A 2KM1A 4DCJA 5AM2A 1MKYA 5BURA 2E0IA 1P31A 1Z4PX 3VUEA 1E1CA 1SQ5A 2XB8A 4GE3A 1ECGA 1SQSA 2PX2A 2R66A 1EKXA 2PTHA 1E7SA 4GX1A 4B3GA 5BW6B 3MBOA 1CR1A 4FUQA 3DVAA 3USES 3BG5A 4LYGA 3C74A 5CT9A 3PJRA 3OHMA 4YV1A 4QXOA 2UU9B 4G8DA 1T9ZA 5BN4B 1YACA 2GO7A 5TARA 4LDAA 1VLQA 3QELA 3KQUA 2C5GA 1ISJA 2FY8A 2Z9BA 1JZSA 3A7DA 3NEYA 1WBBA 1VSQA 2VPWA 2VYCA 1FDUA 2XRMA 3CZPA 4UBLA 3VAYA 3ZW7A 2QTMA 3EBPA 3O1LA 1KRWA 3GZNB 1TJPB 4RVUA 4H35A 3E27A 1Y8QB 3KCNA 2ONCA 4TN1A 3IKVA 4JU8A 5JNVA 2OUIA 4Z0NA 1DUSA 4ZEWA 1OHHA 4F9GA 1QHSA 4GX0A 2YV3A 4AC9A 2B1RA 3ZY6A 1VG8A 4C3ZA 2R7MA 1H2BA 2BE7A 3KXPA 4MH0R 4MKHA 1BEEA 3IUSA 1RCFA 3NAZA 4JI8B 1WL8A 1HLFA 2O3UA 2Z1MA 3CS3A 3DUWA 1N8KA 1M1YA 3QU7A 4KNWA 3TQCA 1TT7A 2A5FA 1X1AA 5AUQA 3E8MA 2ZXEA 3VTAA 1UPTA 3HWSA 1L7NA 1KJWA 3GUZA 1IN5A 1F2TA 2C3OA 1NJ5A 3RBAA 1UBTS 2R5NA 2WDPA 3LPDA 4EI9A 6YASA 1JDZA 5IT0A 4BN5A 5KYUB 2G5CA 1E9BA 2PMBA 3IQIX 1ZJ5A 4IUBS 1IOVA 1AF7A 3K9QO 1RP7A 2JD1A 4AB1A 1JFSA 1PNOA 3CONA 4R68A 1USGA 3QMWA 1Q0HA 2GA8A 4DLPA 2BLNA 2IZ5A 4UE2A 4UTNA 1GVHA 4TYYA 4UNSA 3ESQA 1SC3A 2I80A 4TYMA 1GFIA 4OG2A 3EQ7A 1AM4D 1WB6A 2AI3A 2ZE5A 4BEJA 2DKNA 5C1PA 2B25A 3V8VA 1ULHA 1MEJA 3W5JA 1IXRC 4C0XA 2BHSA 4OFXA 3WSVA 2IYFA 5AESA 3RFUA 1GGNA 1HDRA 3B9PA 2H0AA 2PVPA 1NN5A 3M1LA 1V8DA 4B5KA 4GP7A 1YV9A 1Z12A 1N1GA 4CR7A 4EJSA 1WLSA 4RELA 2GAAA 1MAHA 5J5CA 1YB6A 5K0CA 9ATCA 5DHPA 1JDVA 1QVRA 1RYNA 3ZDZB 4BWYA 2J3JA 1YS4A 1NF3A 5ARCA 5BQPA 4BX2A 1E2PA 4TTIA 1CPYA 3HEMA 4KTVE 4MR9B 4RVGA 1X19A 2QE7D 4V2UA 2A7QA 4Q4DA 4ABYA 1S3FA 1GXSA 4RPKA 4YRTA 4BO1A 1GPWB 2HL6A 2VF4X 4A5SA 4TTTS 3C45A 1EFTA 2G36A 2FQ1A 4ZREA 1IQPA 2ZM6B 2VT3A 1NUQA 2PYDA 3TM5A 5FBRB 1UOQA 3E5RA 1OZFA 2Q41A 1W0KD 4B34A 1IPFA 1LF5A 1A9ZA 1WPXA 3H4TA 3PYLA 4LGCA 4CL8A 5LYJB 4FFSA 1LV8A 1P74A 4FX5A 2OLEA 3LCVB 4LY9A 2OK8A 5C5DA 3GFGA 3UV6A 1JEOA 2AG1A 1KVSA 3KZOA 4KQMA 3E3AA 2VKQA 1QCZA 3VGJA 4I5EA 5CYGA 3AL0C 4Q4AB 2M6RA 5CD1A 2WZQA 4WLVA 3VO9A 2OHXA 1CRWG 4YRMA 5KYXB 4JS0A 3AQ4A 2WT8A 3SJZA 1CIPA 3NASA 5DBGA 2FW0A 4JQCA 5AXCA 4J1SA 4K6OA 4LC1A 5EG5A 1FP4B 1QMPA 4ZEVA 2C5FA 3NIFB 4L8WB 1G64A 3MCWA 1NMQA 2FSSA 5DM0A 1TAGA 1TVCA 4L5JA 1QV6A 3UOWA 3IV9A 3W3AD 4NCBA 3F97A 2O8FA 2HDHA 3I01M 2FPWA 4QFMA 1UPCA 1H0RA 1WVIA 3GA0A 2Z6VA 3I45A 1R8JA 4IIEA 4M55A 1MX3A 4LQ4A 5A7GA 1L4YA 5LQNA 3HVKA 3I2JA 4M49A 4OA8A 1Y9JA 5B12A 3QTBA 3VGPA 3HJRA 4JR1A 1QC5B 1AB5A 1RZVA 1PG2A 1RJDA 1SB9A 3A6GA 4LJ8A 1N2CA 2B83A 1NUTA 2NVBA 1ICEA 2XIQA 3HFGA 4J0EA 3OIFA 4TXLA 5J2UF 3UT0A 3OZVA 4YQFA 3IAFA 3P9XA 1C1YA 2UV8A 1FFHA 1QZTA 3STUA 3PEWA 1Q7BA 4AZ0A 1N78A 4DBLE 1KMIY 2Z3ZA 4EKDA 2Z1DA 3TB4A 5B3JC 1ESNA 4R8LA 1DXHA 2EHDA 2IYSA 1Q12A 3BD8A 4QICA 4Q9KA 5B2EA 1NWHA 3KRTA 1PG0A 4Q3CA 3NNDA 3LD9A 1RLMA 3MWEB 3LQ1A 3WZLA 4EITA 3RASA 4CL2A 4O1IA 4NMWA 1ZXXA 3IJEB 4GR5A 1GGKA 1G2OA 1GO2A 2B5OA 1U2SA 4H7EA 3N7UA 4XOIA 5D3QA 2ZIXA 3EY4A 4MVJD 5BWBA 5FLXA 1C80A 1G20B 1FQWA 3QVMA 4FQ5A 1M83A 3K71B 3M5WA 1H2WA 3UGQA 2SHKA 3UTDA 2ZIGA 3ZHQA 1X9GA 3R0VA 1CF2O 3DZCA 4LCBA 3LDAA 3EOAI 3E15A 4W5HA 4YQYA 3SCZA 1HDZA 2EU8A 2OCPA 5HBRA 4ZOCA 3SN6A 3O2NA 2PS3A 3S2SA 1GHTA 1U3TA 3UB2A 3ZWNA 3R1IA 2WNIA 3LT4A 4Q9IA 4G0XA 1I5OA 4XDYA 5F9HA 1JLLA 1UQRA 3M33A 2OD2A 1W36C 3JARA 2EKQA 5L40A 3EGCA 4YBZA 1SWWA 2YDYA 1UM9B 4MVYA 2R68A 2AXQA 4FBLA 4JK3A 3SHVA 1AK9A 1E3JA 2XGOA 3WJ7A 4BGEA 4HGNA 4Z9FA 2EX1A 2EAUA 3OPXA 4PG6A 4XVRA 1PWXA 5CGQB 3A0RB 3TIVA 5E6SA 4DLYA 4ENUA 2I9KA 2ODEA 1T4MA 2QLBA 3OMXA 2Y05A 4AD8A 4EDFA 1VKOA 3K6SB 1N77A 4RD3A 4PF1A 3UMMA 4B6FA 2AZMA 2UXDB 1VHJA 1LSOA 1X7XA 3BZBA 3K0CC 4GBMA 5FBLB 1A9XB 2EP8A 4H3SA 1CZHA 5FORA 3CQ9A 1LC0A 4UOEA 1GJRA 5F1YA 4PVCA 3U3XA 3BFXA 1HFKA 1IN8A 1FMTA 3SBOA 2PWBA 3T4PA 5EJEA 4K0RA 3K30A 3PC8A 1J1UA 1EK1A 3VSDA 3PE6A 1DKRA 1LZKA 4UFOA 1MMFB 1RRPA 2BISA 2JAOA 4BQNA 2OBXA 3DMHA 4LAFA 2DAPA 2ZWAA 1E3SA 1JR3D 3G2HA 4LJ4A 2NPIA 1AQYA 4BMCA 4RPGA 5JSQA 3M8KA 1FJHA 3RAFC 5LBTA 3WOVA 1ZU5A 1Z5GA 4G41A 3RT7A 4MP6A 3OJ0A 1KAOA 3A05A 2ZR7A 3OIVA 1P7PA 2BUCA 3PITA 2DOKA 3TW4A 3PTZA 4IFIA 2J6HA 4X5OA 4BKQA 3D2LA 1Y80A 1SCBA 3KT6A 2ZJ4A 3ETHA 3MJVA 5L3VA 1SRQA 3K92A 3N6RA 4PG8A 3DOCA 1TA0A 2VRWA 3NHKA 2XD4A 1L7MA 1NAIA 3F5QA 3DOFA 4IDCA 2ICAA 5JVDB 3ZV4A 1GZ6A 5FPPA 3PC6A 4A73A 1DO0A 2PVSA 4CMJA 2FZ5A 3SPXA 3G02A 4GPTA 1CT9A 4L0CA 2W6JA 3RTAA 4RDCA 3JAKA 3W2FA 1OXXK 2EL7A 3PPIA 3OMLA 3NBKA 2PQ2A 3FWHA 2VDRB 3BL5A 1XTJA 1BVYF 1M5TA 3QKIA 1NTOA 1CUIA 2OZKA 5EHNA 3JQBA 2HA4A 3M49A 4EGSA 1V7ZA 3KYDA 1R9GA 2ZR0A 4OXYA 5A05A 1XNQB 3QF4B 5IHXA 2CHQA 3OIDA 1YF3A 4DIOA 3JQEA 3Q3VA 3RH0A 3S8MA 1IY8A 1PBNA 3N2YA 4AMZA 4KPUB 4X1IB 3VHXB 2ZU6A 4MKZA 4BBZA 1E2NA 1XA3A 2EEPA 2RHOA 2X8BA 3ZGOA 1OXTA 4EYOA 4KYUA 5SYMA 4DR4B 2JEZA 2EBHX 1JHYA 5G4LA 3I9LA 1KZHA 3ROMA 3H05A 2QUBA 3OJEA 1HG1A 1UXIA 2NOAA 3DM9B 3R20A 6REQB 4R6XA 4V39A 4LBVA 4PC2A 2VF2A 1US8A 1N6RA 2Y6VA 4RW0A 1KVUA 3RBVA 2IXAA 3PC2A 3SJ7A 1KPHA 3GNSA 3LVFO 3BPSA 3HSKA 1LV7A 3O8NA 3JXEA 4Q47A 4KOEC 2VNHA 3FY4A 1L5ZA 1ZK1A 3P4YA 4CLOA 1RHKA 2EL9A 2WVGA 1RQPA 5FWYB 1FJ2A 1P1JA 3F3MA 1KYTA 3IP9A 2KE5A 5ITZA 2QZ9A 4LYHA 3OQNA 2BGTA 1ZUNA 4URHA 4HXFB 3U26A 1IQ0A 4PC1A 1MJHA 4QOIA 5ALOA 4BRSA 4EVSA 2H54A 4R2XA 1J6UA 3THYB 4LYFA 4QATA 3U4HA 2WM9B 1T29A 3NIGB 4OO3A 5LQAA 5LPNA 4G1MB 4Y6OA 3A9UA 2PPVA 5HIKA 2C4NA 5E7MA 1I2ZA 1L4EA 1XXHB 5C7OO 1BS2A 5A7HA 3T7AA 1IBKB 5CBPA 2J4CA 3AUJB 3ZYCA 3JYHA 3ITDA 2CL6X 3GAFA 3JAWB 2SICE 2HXYA 3JYLA 3ZKWA 1FP6A 1JVSA 1BMFD 4JL5A 1ANKA 2ERYA 4LDJA 4AWAA 3GT7A 4P3NA 4W1QA 5TV2A 4KN8A 4ID3A 1K2VN 1XRNA 5LQDA 3DQQA 1QB8A 4KRYA 2QN3A 2XKJE 1RJ9A 3U19A 2OORC 1NI4A 3NT4A 1YBAA 5LM3A 2RHRA 5KTKA 4QU0A 3LUBA 3URKA 5KU1A 1N92A 1TC1A 1JBEA 2V5VA 1E2DA 1Q7CA 3NC0C 2FZGA 3Q7TA 1LX6A 4PO1A 1T26A 2O1WA 5KWSA 2C3PA 2IGTA 5ALXA 1G8AA 2B8NA 2FW1A 1OAKA 3K0BA 4ANFA 5HHTA 1BGWA 2W0MA 5TB5A 4PN3A 1FOEB 4HDNA 2DWPA 4U2CA 3QWBA 4LYAA 3RVPA 4DV7B 2H4XA 4I36A 4L76A 2R6HA 2F3PA 1YZTA 4BNJA 1ZA2A 2FRDA 2ZUFA 3S6JA 4EOGA 4NX2A 3RJTA 1XCBA 1JIUA 1TJYA 4WFQA 4Y2GA 5AI4A 1JB9A 3VZQA 3DOIA 4W1RA 2PMCA 4AZSA 4D9HA 4ZK6A 1XPOA 1ULBA 1YNSA 3R3WA 8ATCA 2VZ8A 1UBEA 4KG7A 3VR5D 3PT9A 1NLUA 2ZCUA 1NN1A 3TD9A 4DM4A 1GM5A 2ZZMA 2FMKA 2QJOA 2RCYA 4IQ0A 4MGEA 1NNLA 3I05A 5M29A 4H4DA 3ZCPA 2P5YA 5LMZA 1P4AA 1FFXA 3AEXA 1FYFA 4DFDA 2J3LA 1QFYA 1XAJA 5AVXA 4QO8A 4G1EB 4R8RA 3GLHA 3D3JA 2O1XA 4UREA 4X20A 3L0OA 3E58A 3BE6A 2MCFA 3A3NA 4JL6A 5CB4A 4OAOA 1Z29A 1C1DB 4BQFA 3TVTA 3ORSA 4RO0A 1NBIA 3SIRA 5I8PA 2NU7A 4JBYA 1MB3A 4LRWA 2IH4A 3GMSA 4DCOA 4MUIA 1I5EA 1AXEA 1NR7A 1TM1E 2HSWA 2KWIA 2Z43A 3Q6MA 3VR1A 3EISA 4IMRA 1M74A 5BYBA 2EW1A 2NADA 5K0GA 1Z08A 3K8OE 4OLHA 4CODB 3FPFA 4DIEA 1MJ5A 2P9GA 1MAWA 3HUEA 1UC8A 1YZYA 2XB6A 3FOCA 1DCTA 3K0AB 5ETJA 3CX7A 5GJCA 2IF0A 4LG1A 4G0UA 3ND7A 1XK7A 3QYAA 2JLUA 3KAKA 5GQSA 3KQYA 1DBIA 4S04A 1YJQA 2ZYAA 3GJ8A 2G67A 2P6MA 2ZJ5A 4KR0A 1GV0A 1ZOOA 3EVCA 4FZRA 4H15A 4HNSA 5AHOA 2VNAA 1R6UA 4ZT7A 3JALA 4ZP1A 5DK6A 3EPRA 2OOKA 2YYAA 1Y4UA 4NC9A 4AI6A 1J07A 1U04A 4GF5A 1NF9A 2OO5A 5F1KA 1ZGAA 3H6GA 4C0KA 4OGFA 3MJEA 5JAPA 2IS1A 4PQRA 1KIFA 2CLCX 4GBED 4FCWA 3DZGA 5FOUA 2VDVE 3WIVA 2OAEA 3KPJA 2Y4NA 5ARDA 3A36A 2WHQA 3KHKA 5CYFA 1G55A 2EARA 3OFNA 2LKDA 5A1TA 1DLJA 5CK4A 3JQ8A 4FGKA 2YINC 2WB2A 3I42A 3BSFA 2B35A 2C9DA 3EA0A 4R51A 4CIBA 4PS0A 3D1LA 3ASZA 3ZVLA 3GFQA 2QLNA 1U1DA 1DBWA 2Y1XA 1F5SA 3AKDA 2B6HA 3P0JA 4F9TA 4QGHA 1QGDA 1NA5A 1UMBB 2X9LA 3KUKA 3L0ZA 4M8LA 3OTWA 4B3JA 4GW3A 1ZD4A 3AFNA 2A86A 1DFIA 4ZVMA 2BD0A 4ZO6A 4FI3C 4ZYXA 3GLGE 4R1MA 2CMFA 1SXPA 4KIFA 1V26A 2YXDA 3IRVA 2RHDA 2QTHA 2OC9A 4C21A 4PNPA 4CQMD 5CH3A 3WMFA 1E58A 3KYBA 5DVZA 1DKNA 5EA2A 2I71A 1QZUA 4EHKA 3F6RA 5FEMA 1X80B 2MINA 4JC8A 4CV2A 4YV2A 1Z38A 2BF7A 2HYIC 2QRMA 2DWOA 3D4IA 3L0SA 3AHEA 3DV0A 2CLHB 3F3YA 5AKXA 2WF9A 2B99A 1FFAA 4WN9B 1NXVA 4R8MA 3ET5A 1T4DA 5F64A 4ENRA 3SICE 3GEHA 2R1TA 1EE9A 5CJJA 2ZWMA 4A8JB 1U7HA 4OP3A 2HTFA 2A0WA 3QYFA 3L92A 4MNTA 3SM9A 2QX4A 3BKXA 4Q3KA 5A1JA 2FWAA 1ESZA 4MB6A 3RHTA 1YS7A 4KIJA 3TX6A 3JRWA 3EPHA 1LTKA 4MKGA 2QD2A 2OD9A 4BAGA 4EGFA 1T5OA 3EF1A 1ISHA 1LDEA 3Q4GA 2FQQA 3LZCA 4NJEA 5CXSA 3CNBA 4D8UA 4YV7A 2YXLA 2PSDA 3VDXA 2QRHA 3MTIA 4DC0A 3HQ4O 2C1ZA 1HRKA 2KSQA 4WXMA 4XLZA 3M4ZA 4H16A 4YFVA 2P9HA 4TLDA 3SDSA 3SF8A 4IF4A 4HGOA 2VDMB 4AO6A 4JLAA 3TBHA 4AZ3B 2YXEA 2ZAIA 1SM4A 3CEPB 3V48A 4H31A 5BOSA 5J4HA 2OC4A 1G8MA 4RHYA 2VDPB 1VBMA 4BEVA 5JAOA 1J09A 3EGDA 1RLIA 5C34B 2CXOA 4HUJA 2BM1A 4LJKA 3ZKAA 1UDRA 1YR9A 3DMTA 5A0FA 1AQJA 3E9QA 3IPXA 4PCUA 4UEQA 5T8KC 1IPEA 4BMVA 3COVA 1ZPDA 2O3QA 1KBQA 2ZJ3A 1GNRA 1LGYA 4KRGA 5AKHA 2OWDA 2VT6A 4ZZ1A 1N7JA 5IFLA 5JNTA 1GCIA 1H6AA 4ZHQB 1OB2A 1CUJA 1MGOA 3NEPX 4OM8A 4EFLA 2V98A 3FPJA 3TO5A 5ITSA 4B4WA 2PZFA 2Q07A 4OH1A 4WKBA 4MVJG 2PXCA 3TNDA 1SCKA 3CNOA 4Q01A 4WIAA 5EPUA 5ER9A 4LZLA 2A88A 4BNUA 2ILVA 5ERGB 5EWLB 4LFCB 4FFRA 5ADHA 3C39A 1GRRA 2HQBA 3NIDB 4MUMA 3UUEA 2XWBF 5ALFA 3OTOB 1MHPA 3ZN2A 3BCSA 5E4TA 1I4LD 4XH9B 5T5QA 1U80A 5LOVF 5LQKA 3H1GA 3KB6A 3CNQS 3ZCSA 1ATZA 3DDNA 3LFTA 4P7JA 4QEKA 1EDDA 4UAGA 5DLEA 3ZH2A 3DBLB 3O38A 3EH1A 4YI5A 1J1IA 2P30A 2DQYA 3EWAA 1R8XA 3GDGA 3L6EA 3OFJA 3N74A 5HGXA 5IM4A 1BNCA 2ZCJA 2WTNA 3QWAA 1J8DA 1K0FA 1Z5PA 2YWCA 1KAQA 3QA9A 3IB6A 3IMFA 3VRHA 4P4NA 3RQSA 4OTZA 4B6QA 2BHRA 1SKMA 1T3LA 1OLSB 4TSFA 4YP6A 5HK8A 7GPBA 1NZFA 2MR6A 3LWZA 4B75A 2Z6AA 4MSUA 4A36A 5SV2A 3VJMA 2PWPA 2GVDC 1XVUA 3S68A 3ZLTA 1R16A 3O91A 4XPIB 3J80A 3B5JA 4KVAA 4FN5A 3K96A 3MGBA 1C5KA 1WUKS 1RC1A 3KBBA 5C81A 5CAEB 4TWIA 2YZ2A 4QTXA 5E2BA 4RY0A 5B1YA 1BA3A 5F1PA 1DRJA 3WYNA 3F71A 3OUZA 2R1ZA 3QE2A 4EY5A 2XODA 2F9LA 4F8YA 4HDKB 4YT5A 4EF5A 1DJPA 3OO1A 2HJHA 1EUCB 3WA7A 1FZTA 4QT4A 2XCOA 2XDQA 4GBGA 3NI2A 2XNCA 2MSKA 1QR6A 4DGSA 1GZ3A 1P4GA 1RBQA 4EYQA 4FJ1A 3TXYA 3QPAA 4KLAA 1E1DA 3C87A 1M8PA 2YFHA 4KSCA 4DDMA 4D3YA 1UBNA 1UZUA 2G88A 1AKYA 3K0EA 4RXMA 2CMDA 4NICA 3OKPA 5TT1A 6ABPA 3CJTA 1RT9A 3UJ6A 5F7OA 1U81A 3H7AA 3H8WA 1R74A 4KQKA 4C78A 1X7GA 5AM5A 2XVMA 4AL4A 4HAVA 1CKEA 3EODA 1VJ1A 3UO8B 4AJ4A 1ZD3A 3DDUA 5KQSA 2IW1A 3N28A 1RMQA 3HP4A 1HQCA 2XT0A 3DZBA 5HG0A 4M4SA 5CCDA 3UT5B 4UNPA 1XWWA 1R4AA 2C92A 1A96A 5EJGA 3T38A 3V8RA 1RWWA 4EF6A 3UATA 1VXRA 4M76B 1YKSA 3RU9A 1ZI6A 2C7VA 3TOZA 3FGPA 2ZUTA 1KY2A 3ZY2A 4I50A 4C88A 4KU4A 3UC9A 2YHAA 1B42A 1U7OA 4OQFA 2V7EA 4RHFA 4U6SA 3RTDA 1YQTA 3D6TB 3ADKA 3Q2KA 5EIBC 1JXOA 1RI3A 1XF9A 2QJFA 2FDXA 1IOWA 2R84A 1GKYA 4NBTA 1QTQA 3LF1A 1MRSA 1TD9A 1Z83A 3VFDA 4F46A 2EXXA 1RXWA 3S5UA 4CF7A 2E7ZA 4ISBA 5JYEA 1IULA 4HQ6A 4B46A 4KO3S 1J2EA 1XGKA 1P81A 5LC1A 3ROFA 5IEJA 4B3MB 3SEAA 2VC2B 3VHLB 3JYOA 2C9ZA 5B7PA 3JQGA 3A3PA 5BSWA 4DA0A 2XB4A 2B7CA 3DO6A 4BJ1A 5K3FA 1YTUA 1EK0A 4UQPA 2WI8A 3AEQB 5I9SA 1DSSG 4HGRA 1Z74A 2JLXA 5U1PA 5A02A 2FSIA 4B7ZA 2CJWB 1ONPA 5LZ4A 5EIXA 4GI3A 4XOUA 3C6YA 1OX6A 3N7AA 4DANA 3HA3A 3N2IA 3GVXA 2BH9A 2H07A 4KK3A 5JCPA 3K9FC 4GKKB 2R6GA 4QA9A 1N2SA 4YXWA 4X6LA 4NFLA 1RBZA 2B0CA 3EIWA 2R0QC 1U8EA 4ED9A 4B45A 5KSWB 2ASEA 2RHTA 3N53A 1NVFA 3T5GA 3WGNA 2PSSA 2JPDA 2VS1A 3O8OA 1LUAA 1CY8A 2NT3A 1JR3E 1I0LA 5DBEX 5C2JB 7REQA 2ZIUB 3O03A 3MJCA 4U9HS 4UE6A 2IP1A 3DZKA 3EIUA 1O94D 4P81A 5GIOE 1FQOA 1JJ7A 2VTBB 2QNRA 1KY5A 2VQ6A 2XMRA 1UP7A 3BXZA 3ILYA 3O7MA 4RKYA 3B1JA 2VQEB 1KL7A 4Y18A 4J43A 4YQEA 1FRQA 3QKRA 2Z2KA 4QHYA 5FQNA 1DTWA 2IOQA 4DUGA 1SEVA 3GVCA 4MAMA 4MDYA 4NABA 4XR9A 1DMRA 2NYRA 3LIIA 1Q0PA 2CMKA 5AKKA 4PG5A 2WAXA 3HCDA 4ZU3A 1UK6A 1XIVA 2HXSA 4BNFA 2I33A 3NWPA 3NVAA 2DHQA 4IPTA 3CVWA 2ZTVA 1QP4A 2DQKA 2K2WA 4MULA 4Y6QA 1G7CA 4ENWA 2J5QA 3D81A 1ABEA 1AZWA 4MUHA 1KRXA 2CSUA 3O82A 2VNIA 4ZDWA 3OQOA 5TGDA 4RFSB 4B6JA 1TECE 1YCFA 4ZC8A 4DMKA 4F92B 3CNNA 3OMWA 5KREA 2XHEA 1T8RA 1XAGA 3HZHA 1P0PA 1P1BA 3IQDB 4JROA 4UEOA 4N1AA 1VPEA 3VR6D 1XRMA 1I9GA 1BE0A 3MF4A 2P3QA 4LXGA 4JVLA 5G4KB 1EM8A 1XP8A 2QW8A 4AYTA 3R44A 4M0PA 1HOTA 1Z13A 4CLHA 5EZ5A 1MJGM 2XMDA 1DWOA 1P8JA 2EZUA 2O2JA 3M4JA 2VFAA 2NPOA 2G9RA 1IZYA 3K70C 2CV0A 4ZJPA 4DR3B 1Z75A 2ZI6A 3LSYA 4BNZA 4EL0A 3EXFB 3R5KA 5LL6P 2QIOA 1XN1A 3QG1A 2QR3A 4HNAB 4O08A 3UAWA 3HO6A 3RAJA 3B1ZA 3WLEA 1EMDA 4BJ3A 4YAOA 3MJ4A 4ZOBA 4RU1A 5IKMA 3B82A 1R0XA 1XTSA 2PWYA 3L7AA 4P54A 4UBOA 5JZ9A 3SXUA 3P26A 1R27A 4LBZA 3T35A 2BDUA 4M1QA 1OA1A 2YVUA 3EZXA 3OTHA 1B6GA 1KR5A 1ONSA 3ETNA 4H08A 2VO1A 1IY1A 3OLQA 4OHUA 1SOAA 1YZLA 4ZI7B 1ZUHA 4C08A 1UBMS 2XXJA 4IV5A 4XZ3A 4DSTA 3EX7C 1ZSYA 2E4WA 4J7AA 4HDCA 1Z3IX 1SC4A 2D3WA 3MQ4A 4PYRA 2XRZA 3QTLA 4F2HA 3FPKA 5JCZA 1WOYA 4G5OA 5LQSA 1A7KA 3HCPA 1EUQA 2R85A 2MMCA 1TT5A 4K0KB 2FFRA 2NO5A 1BMDA 2FUG1 4EGAA 2VH2A 2XGMA 5HIIA 2Z2XA 4TQ9A 3DGEC 1S4QA 2GASA 4MEBA 4YCSA 5K4GA 3ZZUA 3K9HA 2DP4E 1I8TA 1QF9A 1EP2B 1U99A 2DWQA 3HWRA 3L77A 2IP4A 4JITA 3USCS 4MMXB 5AMXA 2GUWA 2I67A 3W2GA 1FB5A 3I62A 3LP6A 4FI3F 1K86A 3I37X 1FBNA 4E11A 2C1EA 3DZDA 4ZQHA 3HCBA 2QUKA 1NIJA 4DZRA 3DAFA 2FLKA 3IFSA 4TMKA 4BC1A 4F3RA 1DQRA 3FUXA 2QRLA 3RUHA 2ZYSA 5CVUA 4KQHA 4ZRMA 4EB6B 3VNVA 1WKBA 1E2QA 4K9KA 1BOOA 3B7PA 1G6Q1 2BCGY 5CT6A 1B8OA 2O50A 2WE8A 1DZ3A 2YQ4A 3D7MA 2OA0A 4DQLA 5LZ5A 4QNRA 3O94A 3A6PC 121PA 3HWWA 2WWFA 3RRMA 1JXAA 2XNKA 2BGMA 2GEKA 2NSYA 2AQIA 3ZE7A 3ICOA 3ZBUA 4QVKA 1E4YA 3HSSA 3T1OA 4BB5A 3QKUA 2QM7A 3EHDA 3TZCA 2JKVA 1VLVA 2WM3A 5FBQB 1P6QA 1DC7A 1O4WA 4PR0A 1NYQA 2QRKA 4G0YA 2F59A 1VQ1A 2WFLB 3EEFA 3MK31 3FHLA 5SYAA 5KOIA 3KWLA 4WESA 3NT5A 5JD6A 5A9TA 4BE7B 2GR9A 1J24A 5KVVA 1AKRA 2XQKA 4L50A 1OAAA 2ODWA 4LWQA 4WNIA 3TIIA 5KCZA 3CEJA 3A6FA 3PX2A 1K7EB 1PHRA 1IBCA 2OM2A 2C88A 5TQ0A 3CRMA 1PI3A 3U7JA 4UUOA 4DS3A 1NUAA 3OQVA 5CA0B 4C6TA 1GQQA 2PL1A 3ELYA 4RL6A 4X71A 4MO2A 4FFMA 4WPGA 5JVDF 2H1CA 1SHUX 1WOMA 2CNLA 4HH4A 5HX7A 5TMPA 1YH3A 1ZMTA 3BDAA 3W8EA 4CT0A 2WHRA 5FTJA 4F91B 1DRKA 1WMBA 1NV8A 1QAQA 2BIFA 2C7GA 4ZYVA 3UAXA 1GCOA 5BSKA 2L18A 4J6FA 2BFEB 3OSZA 4ZV7A 1UR5A 1WXFA 2OEPA 3SSAA 5AW4A 3A2KA 2DFPA 2F1HA 2CFSA 3QXHA 5B3AA 5A2GA 5J5VA 3LC0A 3ZWQA 4BZPA 3AOEA 3QU5A 2YZMA 2QAIA 4G01B 2UUOA 4LWPA 2C84A 4EABA 2ODQA 2AFVA 1HV8A 3AP2A 1NY6A 2WVHA 3DO8A 4QT0A 3IQXA 5AJHA 1GAXA 2CUTA 2D5IA 4IGFA 4C3UA 1CUBA 3U17A 3Q8LA 1NJGA 4FEAA 3Q6IA 4JJ6A 3R6LA 1IMJA 3TIXB 1GAJA 3VOAA 3ZWPA 2V74B 2QTFA 1Q1NA 2CF5A 4DEYA 4P98A 3VYWA 3NC1C 1V41E 2O2YA 1XXLA 3I9V1 3BWYA 4ODIA 4ADSG 4EI8A 2EKDA 3NLLA 2JIRA 1KZ7B 3EIXA 3I6MA 3HFJA 1KSHA 3NM4A 4GICA 3B48A 5ALEA 5C31A 5IN5A 1KWGA 2FFJA 3MCVA 3NDJA 4OHWA 4D81A 4XIGS 2O2EA 4DIBA 1KS2A 3F9IA 3H8VA 1FS6A 3M4NA 3UJNA 3VBCA 1N4AA 2HHHB 3MBIA 5KTMA 3AEUB 2XYVA 3R76A 2JS7A 5B6JA 5CVJA 4OKSA 4UDOA 1XZMA 4DV4B 1SHZA 2C8JA 4W9NA 2WV7A 4R1PA 3UJHA 5IXJA 1XU7A 3CG0A 4BB9A 4AULA 2V6GA 2PN1A 3H5LA 1E4VA 5ALHA 4E6EA 2VP2A 5TMEA 3SEFA 3QE3A 1CUEA 3UJ7A 3ZK9A 3N2GA 3R23A 4IHJF 4IQFA 5ECDA 3RG8A 1JJBA 1QO9A 2Z56A 1FEZA 1GG5A 1OVGA 2V9ZA 3AETB 3GJ4A 4HGZA 2HRBA 1P2UA 3PL1A 1NATA 4MHSA 2CVFA 3ESYA 4FOLA 5AVVA 3U1VA 4X7RA 3E9YA 4LHYA 4AF6A 4AP9A 1AV6A 1Z37A 1E7WA 1FX1A 4NPAA 1C2TA 4H60A 2HZ7A 3OQ6A 4E7OA 4OK5A 1DBVO 1NYLA 5K5EA 1UDXA 3ZWYA 1OB5A 2A5JA 2QROA 2HXGA 3QSYA 1GU0A 3RC7A 1J5EB 3EXIA 1PT9A 5IW8A 5KX5A 1Y4AE 4HVLA 4QJIA 3P9PA 3IR5A 2X9NA 4N5MA 4FLMA 3H9UA 1MBZA 4NSNA 4CEHB 3PHHA 3SZMA 4L0QA 4D3DA 2ASVA 1GV1A 2HJVA 3ANLA 3QOWA 5ICEA 1C41A 2HU5A 3QSGA 5L3ZA 3CF4G 1IOZA 1O9BA 1Q1AA 4CEJA 4QUIA 5F78A 4AWBA 3DDCA 1E79A 3L8GA 2ZJ8A 1NE7A 1ZBDA 4AVYA 2WUGA 5EUMA 3QBTA 1OQAA 5AK3A 5LU9A 2WYUA 3LZDA 4PBTA 3NYWA 2YOHA 1BXZA 2ZSAA 4HB2A 2Y68A 4MQFB 5ADUS 2YV4A 3B2QA 1UEXC 2I3DA 3EFOB 4HWSA 3AVVA 4MQEA 4FMDB 1SK9A 2AGVA 5JATA 2D0OB 3CHYA 1UADA 1OXUA 3R0JA 4RJKA 2MOKA 2JVIA 2Q9AA 1RMYA 3W1WA 4E4RA 2XHZA 2V54A 1PNTA 4F04A 3OU6A 5AHXA 1JU3A 2HCBA 2OVBA 2D2FA 3A28A 3VU8A 2TECE 4NL4H 1Y1RA 4IDBA 5KNDH 1DJOA 2QTWB 4D43A 5BORA 1Q7RA 3P0HA 4QGFA 4L6CA 2LDBA 3KZKA 4BV8A 5FNVB 3C4VA 2WTMA 4F5DA 1X7WB 3DZJA 3DVSX 3OURA 1Z0ZA 2DHCA 2B5WA 2BLLA 1LSUA 1EQ2A 4Q6WA 3CVVA 1JHMA 1P2DA 1WHTA 2JHAA 1A88A 2OGSA 2J3EA 3IUMA 1W6UA 1OBCA 3G3EA 3GLTA 3R6WA 4UHJA 4QDTA 3H3XA 4X8OA 3D5QA 3KDSE 2CHEA 1CV2A 5KYKA 1I36A 3Q3JB 1SXGA 4KXLA 4H0CA 2J5BA 1U5AA 2C7BA 1XKTA 1GUAA 1H6BA 3FVQA 1GNSA 5LJLA 1MUUA 2WD7A 4JQSA 4BP8A 3EDYA 4KZKA 2IZ7A 3N2NA 3SMVA 3TTTA 2NP7A 4YONB 5EHXA 1GUBA 4I8XA 3C6KA 5FPHA 2QN6A 1UODA 3H8JA 3N8GA 5HCUA 2ANCA 2SKDA 2BAGA 1T8SA 2SECE 3QX7A 1G8FA 5BV0A 2JANA 1Q3KA 4W5JA 4WEQA 2A5YB 2X15A 5JE8A 4EGCB 5JO0A 2PL5A 1BDBA 3L8MA 2EJVA 3RYHA 1KI2A 2BZGA 1CJBA 4HNGA 5ALDA 5KYWA 4OIFA 4F96A 2P9JA 3DUFB 4QYIA 3BERA 1U2DC 3U40A 1OX5A 1OT5A 4LI0A 2OYRA 4R2IA 2PJZA 2QL6A 1DJMA 5BQ3A 3EULA 2BR3A 1PFQA 2Q3EA 3GLSA 4KLCA 4ME6A 3W2HA 2VCHA 4Q9JA 3VR4D 5ICMA 5EKSA 3S29A 5GOTA 4A0FA 3WAGA 1XJWA 2ORWA 3FCSB 1VLZA 2AOXA 3T52A 4MI1A 3O26A 4RF5A 5KKCA 2ZSUA 5ULLA 1O4VA 1NW7A 1NQVA 1MA0A 3AF0A 1D1QA 1XNRB 4W99A 1GY8A 1L8AA 2XNDD 4DDHA 1TC2A 1ACMA 2BFFA 3GZJA 2I22A 4QEZA 3TW6A 4ACBA 3WIOA 2Z3VA 3OG9A 4NBLA 3N6VA 1P4SA 1QKJA 1RKVA 3LNCA 4IH4A 1XZBA 1NXSA 4K3VA 1EM6A 1GZDA 2GN1A 2X4GA 1V39A 3FWZA 3LGSA 4P7GA 7MDHA 3E1KA 4ALNA 4PICA 4B17A 2XY4A 3WL7A 1DEOA 5AH0A 4YLYA 3ESXA 2VPYA 3IOMA 2V58A 3W79A 1ESEA 3QPWA 4H0FA 2WSSA 3V00A 4Q21A 2V4ZA 2C42A 4ZOLB 3UK2A 3UA4A 1T2UA 2GI4A 3ZWWA 4EJ2A 1VJTA 1ZN7A 4ZVLA 1L5NA 4Z4EA 1KOJA 1UKYA 4M87A 5JADA 1IBMB 2R8ZA 1NSYA 1D5CA 5J3JA 3ESDA 4MWOA 4KCGA 3H3JA 4MR8A 3RNLA 4GWGA 2J6IA 1MV8A 3BM5A 2C2HA 3E84A 3GVPA 1FRZA 1KU6A 3PYXA 2GVZC 4U3JB 4PN7A 3KB8A 3SFZA 2W2PA 1AGPA 4I1YA 4FIZA 3PWTA 4QODA 4MYTA 4ALMA 2R48A 1ZM9A 2W43A 5AHWA 4B3IA 4DSOA 4YRAA 1Y42X 1MX5A 1QYWA 1GR0A 1HE4A 2NWQA 3AG5A 3P32A 1AGNA 4H59A 5DYWA 4E3WA 4JL8A 2UYQA 4ZGGA 7MHTA 5L45A 3IL2A 1U0BB 2IEDA 3UICA 4B43A 5HQTA 1AKEA 3ANYB 1IFXA 2FFQA 3LPMA 5DNUA 3G2KA 4GC5A 3WRYA 2QBYB 2YV1A 4ILKA 1A76A 3FWPA 1N2CE 3N8DA 4AKEA 1NVEA 5KNCD 4AK9A 4LRXA 5DHRA 2FHPA 2W8BB 1CVLA 1LK5A 3GLQA 3TSYA 5IK2D 3DMYA 3IIKA 5G2OA 4COOA 2NTYC 2YBDA 3W5DA 1K5HA 2FPPB 4WASA 4LKRA 3ONVA 1V6CA 2GSDA 4JNKA 1FX0A 3HRKA 4GGOA 2O8DB 5T41A 4PLTA 4FOSA 1B6SA 3A10A 5IN4A 1Y6JA 3A9TA 1Z0JA 2YBEA 3RGGA 3SX0A 3TM4A 4RA9B 3U16A 1R8SA 3DO5A 1F4PA 1G19A 1RHJA 2DMRA 2FG7C 2DCMA 4F1JA 1THMA 3UFBA 2O2GA 2GBCA 4PLWA 1KEPA 4BUZA 3HYNA 5JASA 2LTAA 1N3BA 2B3TA 4K9DA 1GRQA 1DPGA 3H6KA 4GP9A 4PZDA 1ZIYA 1OGYA 1YTLA 3K1AA 4IIHA 1IZ8A 3BIOA 1NBEA 1G9TA 5H8WA 4G1VA 1DFGA 3PCRB 4OH7A 2MSWA 5H0IA 3OQJA 3EXHA 4RK4A 4G0QA 4ZHQF 1A4IA 3A06A 1KEVA 3OUUA 2FDCA 2R8PA 3OY7A 4QUBA 4MX8A 1FMCA 1NXXA 1QGAA 3PNYA 3MM4A 4XVQA 4XD2A 3W04A 2ZRIA 4BNLA 2IE8A 2RGUA 3IEUA 3ICCA 2H18A 2PKQP 2B2NA 4QBGB 1YQEA 4W5WA 3F1KA 3KKZA 3ZQUA 3VBEA 3BMXA 1GU1A 1FMLA 1ZINA 4P80A 3BSSA 3CUUA 1SAYA 1ETUA 2P0EA 4E13A 1XVAA 5GGXA 3D7LA 3BMOA 1VMIA 1JE1A 3T5TA 1JQKA 1YZUA 2HN9A 3ENKA 2W00A 4YMIA 3WB1A 3SS7X 4Z7JA 5J4YA 1X94A 2HRCA 3JSXA 4GU5A 1YD7A 2WWTA 4KGXA 1LRLA 1GQOA 4E2ZA 5AP9A 1NRWA 4XM0A 1MLDA 1QS0A 4IMJB 2GCPA 2EWVA 4NOJA 2O05A 4UCWA 2WWVD 3TI7A 4L07A 1LNQA 2EZTA 5LN1A 2P90A 3JVUA 2YR0A 3GRVA 4ALJA 3A9CA 1BCRB 4PLGA 3CLUC 4DV2B 3RVJA 2OXTA 4WGGA 2QVGA 1NVGA 2CVOA 3URMA 1M34E 2ID7A 1XZHA 4AO8A 4HJRA 4ZVNA 4GOJA 3FDZB 3PX7A 1QYVA 3DBHA 2ZI5A 4BXOB 1NSTA 2VNJA 3L8DA 4UEKA 4FQ7A 2XBUA 4BQRA 2WA2A 4WMLA 2X5OA 1PT5A 5BV2P 2YMQA 1DWPA 4DGQA 4J0KA 3QLUA 3ODPA 1Z0IA 1TU4A 1NPYA 1S7GA 2Q1UA 2A35A 4NV0A 2JVJA 3TE6A 3TSAA 2GVNA 1M10A 2FR1A 3R7SA 2EFJA 1G9SA 4HT3B 4JHXA 3EMBA 4AU1A 2FPSA 5BYAA 1I7PA 3WXBA 4Q7QA 1FFCA 1C3XA 2FMHA 3K35A 4FHGA 4H1TA 5G41A 3K6RA 3TL3A 2FN7A 5AJTA 5HILA 2YY5A 5ALLA 3DKRA 3EAFA 3L07A 4BQSA 2QHXA 1FA9A 4ARCA 3LC7O 2MSLA 4G97A 4WD3A 2OY0A 5FOXA 3IUQA 1KJZA 3WLJA 2Q49A 3RO7A 3TK1A 3ANSA 2EQBA 5KVSA 1PV4A 5EIOA 4I4IA 5IM5A 3AKCA 5A4FS 4CTOA 1WCV1 4L6AA 5FULA 2G0AA 1T2AA 3OPYA 3B8EA 5JLJA 1ZC4A 2HLDA 2Z5FA 4C5BA 1WPGA 3EEIA 2O1EA 3GEBA 3O9ZA 3REQA 1JTEA 2X0FA 1LF0A 4BPBA 1JQLB 5T64A 2PM8A 5CLHA 1QQAA 4QBTA 3V9PA 4D3ZA 2LIVA 3U7QB 3W06A 2Y2VA 4X1KA 5IMSA 2UUCB 2XITA 3VR0A 3L41A 4ZEMA 1U6JA 4G0OA 2EZ8A 2YWXA 3ACCA 4QL3A 3BGOS 3G8BA 1T9GR 2P6PA 4URFA