5HDQA

Mntc co-structure with mab 305-78-7
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
277
structure length
273
Chain Sequence
LKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter substrate-binding protein
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein/immune system
total genus 98
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA01
4UTOA 2X4LA 4HMOA 2Q8QA 3NU1A 4WESB 2OV3A 4PM4A 3EIWA 2PS0A 1M1NB 5M29A 3ZK8A 2AFIA 1G20B 4ND8B 2M6LA 3AEUA 1K2VN 4MX8A 3R5SA 5JPDA 3MD9A 3LI2A 2OV1A 4LS3A 5M3BA 4MLZA 4UDOA 3BE5A 3G9QA 4M7OA 5JG7A 3AEUB 4OVKA 3AERA 4K3VA 4BBPA 5BVHA 3U7QB 5BVGA 5CX1A 3PSAA 4INPA 3AEKA 5CR9A 4HN9A 1PQ4A 1QH8B 3AERB 4FI3F 4H59A 4FNAA 4TKVB 5HX7A 5BVHB 4FKMA 1QGUB 5BVGB 1KARA 1TOAA 5CX1B 1L5HB 3AETA 5AFSA 2PS3A 3GI1A 4MO9A 3MFQA 2XY4A 3PDIA 4WZAA 5FLYA 1K0FA 2XH8A 3AETB 3MWFA 4CL2A 1FP4A 1K7SN 2MINA 1QH1A 2AFIB 4LJSA 3TLKA 2YNMC 4UTPA 5KHLB 3PDIB 4WZAB 4OXRA 4TKUA 2WHYA 2OSVA 2XDQA 1KAHA 3PSHA 4WZBA 2O1EA 1M34A 3AEQA 3MINA 4IRMA 5M2QA 3ZK7A 4XPIA 2XQVA 2MINB 1QH1B 3BE6A 2YNMD 2QI9F 5JJ5A 3K1AA 2AFHA 4PAGA 5M34A 4WZBB 4H0FA 3MINB 3AESA 5B58T 4OXQA 3ZK9A 5KOHA 3HJTA 2PRSA 5KOJA 1N2ZA 3AEKB 5GGXA 1XVLA 1M1YA 2AFHB 2PHZA 1KAEA 3MWGA 4N01A 3TNYA 4FILA 3ZTTA 1MIOA 2RG7A 4HMQA 4WESA 1H1LA 4B8YA 4G09A 1M1YB 3HH8A 1M1NA 4MDYA 1G20A 4ND8A 4WN9A 4WNAA 3R5TA 3ZKAA 1ESZA 1FP4B 1MIOB 2R7AA 1N4AA 1K75A 1H1LB 4GICA 1G21A 4TKUB 2XDQB 3HXPA 1M34B 4WN9B 3AEQB 4G07A 2Q8PA 2PS9A 2WI8A 4WNAB 4XPIB 1PSZA 2OGWA 3UJPA 2ETVA 2M6KA 3EIXA 1N2CA 3LHSA 1G21B 3U7QA 5GGYA 3K1AB 4NNOA 1EFDN 4NNPA 3AESB 4INOA 1N4DA 3CX3A 2R79A 1QH8A 5HDQA 5KOHB 3TEFA 4TKVA 1N2CB 5I4KA 5KOJB 4DBLE 1QGUA 2XUZA 4HMPA 1L5HA 4UDNA 5JOQA 2XV1A
chains in the Genus database with same CATH superfamily
1MC1A 5KKCA 2P6UA 3GDFA 3TGWA 2XLBA 4HF7A 4JVOA 4Q82A 4RJ2A 2G76A 4ZC1A 1U3CA 4EA6A 1PFKA 4Z4GA 3GRUA 3FE2A 4GPZA 1M75A 2YWJA 1UR5A 3R0IA 4I66A 1T3HA 1X94A 3KVRA 4PPYA 5JSQA 3KQYA 4FNGA 1LW6E 2K2QB 2KLHA 4CODB 1QR6A 1VJ1A 2B3DA 4MS3A 1GRCA 2XCIA 4YJ3A 2WIAA 4BNJA 4J2OA 1C7RA 3OBBA 2A4KA 3VOSA 3W5CA 5A71A 1ZISA 4M1WA 1LJUA 3VDXA 1K7YA 4MAFA 1MDFA 2BT4A 5L95A 2ZBDA 1NG9A 4G5XA 2X22A 1G8GA 3FN4A 4M1KA 4HL6A 5K3FA 2CNNA 1HO3A 4FMBB 3DHNA 1CF4A 4U63A 4DZTA 5CNIA 4QQ8A 3OZBA 3F67A 2RHWA 4KVFA 1H2BA 4DSNA 1CUYA 3D3WA 3UKJA 2OT3B 2HLDA 3G5LA 2C78A 2HDHA 2X3YA 1J8DA 3L05A 3OC6A 5LP6F 1Q0PA 4GLOA 3WLLA 4KAXA 1CK4A 1PK8A 3S0JA 1EIWA 3G68A 1ODSA 4J0JA 4OQ4A 5IJ0A 3MRSA 1R9MA 2IXDA 5K8CA 4II7A 5J2TB 1QB8A 3SX2A 4PC6A 3VJMA 3HJCA 1C3OA 5HIAA 3WGNA 1LB1B 1H6CA 1ORTA 1P8JA 1INLA 3ENQA 3IHTA 4M86A 5AO9A 3RBXA 1WDTA 4EF6A 3UAYA 1Z07A 1QPZA 3GD7A 1XVAA 2X9VA 1CS4C 2A9KA 3B6ZA 1OUMA 2JFBA 4EB6A 1KEWA 2Q4OA 5LOVF 2M1ZA 4QGAA 4DUPA 2CT8A 4PSAA 4G5YA 4ERXA 4JI8B 3GWGA 2ZT7A 5I3ZA 5KNLA 3DPUA 4ZVRA 3HEBA 1OR8A 5F3WB 3VR2A 1E7WA 4V0MA 4ER7A 2X2FA 3ZU6A 2I87A 2ODQA 1N5MA 4Y2GA 1FVXA 1ULHA 2COKA 4O8ZA 4DQKA 1KBZA 3B5IA 5CBPB 1WKCA 1U2DC 1E1QD 2GHIA 2J1LA 2PO7A 5EKTA 1CNMA 5KREA 2ONYA 4JSRA 4TPKA 4HDKA 5HZGA 2WC1A 1FMJA 1U5AA 1YFKA 2O19A 4GOXA 2C5LA 2W0SA 1E8DA 1Y3AA 2VYND 2H2DA 2QMEA 3VHLB 4QGHA 4UUMA 3DD5A 1S2DA 1Z08A 1RHUA 2QI9C 3AR5A 3EQ8A 5EMHA 1ZNWA 3EF3A 4R2HA 4LCBA 1CF2O 1OY1A 1T9ZA 2V45A 5F73A 1YB2A 3DFKA 2AQ8A 2HJSA 4R1LA 5LQSA 4QAQA 1QYCA 1S3SA 1QFJA 1CHDA 4QRHA 5GM2A 1E2PA 3FNEA 1QVZA 1CFZA 1LSJA 1Y4ZA 2GJ9A 3BYZA 4F7WA 4XRGA 4FOSA 2YYAA 1R3DA 2I4TA 3VKUA 4FFPA 2RK6A 4WBSA 2GVDC 4L57A 2WBLC 1E7RA 2ZP1A 4RHTA 4WLFA 5L4LA 2FWJA 1QORA 4JENA 4Q48A 4BMVA 1USWA 2BGIA 3UTDA 4YYZA 2XUAA 1M2JA 2JLYA 1AZWA 2A57A 3ADPA 3OHSX 4R05A 4RVUA 2C95A 3HS3A 3D6HA 5KVCA 1REQB 4IICA 2CJXA 5IEJA 3O8QA 3RF6A 3H3FA 2X8AA 3BF8A 4XD7D 2WLSA 3Q12A 3OTIA 3DBHA 4W1RA 4Q7QA 1ZM9A 3OHMA 3LECA 1HBJA 2IU0A 1C4KA 2J08A 2I34A 2P9ZA 2ZSUA 1DOHA 1I2MA 3H83A 2WG2A 3KAJA 1KAOA 4IJ6A 1FYXA 1EE2A 4HQFA 4IS2A 4KRYA 4KSBA 5E3JA 2B1JA 4R3NA 1B6TA 1UFVA 2CFSA 3QU2A 5IZCC 1DXOA 4IGKA 4A8HA 3CT6A 3E9EA 4G01B 1FXWA 4RLQA 5CM2Z 3ADBA 3OMXA 3AERA 1NI4A 5FPHA 2QUIA 4ZOLB 4U1RA 4Z54A 3CVUA 1E3DA 4N3BA 1TZKA 2DKOA 3OWOA 4YNBA 3N0TA 5IJXA 1JH8A 1KZ4A 1MX9A 1OPRA 4YA6A 2J30A 4H7EA 1COZA 1QZTA 1UJ4A 3CYFA 3ZBQA 3WO0A 1W2GA 1XBTA 4YCCA 2F43B 2G67A 4OYRA 1OQAA 3U4AA 2V0CA 2V7UA 4GPAA 2PKEA 2WQ7A 4RJJA 4FZ3A 1JMVA 521PA 1AK9A 2XRMA 4L3WA 1YHNA 3HA3A 3SBXA 1NQ5A 7ABPA 3MELA 5AJHA 4ZKDA 2YV3A 2F1JA 2XWPA 1C3JA 1VMKA 1QS0B 4F6CA 2VDOB 4MVYA 1KMNA 4BIIA 1PLLA 4I8XA 4M6WB 5KTMA 1L7AA 3SX4A 1KDPA 3QX3A 4L8WB 2QWXA 3T5MA 2A7QA 4Z7NB 5DSTA 2WPNA 3NRCA 3OAAD 4QPZA 4KPEC 2N9UA 1WXWA 3DOOA 4S1OA 5CP8A 2EZ9A 2C8VA 2DFNA 3SF0A 2QLJA 4DLUA 4YRFA 4IQ4A 3AU8A 3DZIA 4P3XA 5G3YA 4L5AA 5EHZA 2VP3A 3W9UA 1DLJA 1U3VA 2IY9A 1LK7A 3JALA 3OCZA 4J16A 4W9RA 4MUAA 5ALUA 3V42A 3W9YA 1UM9B 1XLTC 2PU5A 3OG9A 4IGFA 4OKSA 2HIGA 4D2IA 3EASA 1WQ1R 1XPUA 3WMWA 4JB2A 1DAKA 2VP5A 4UZFA 1JDZA 1T43A 1Z6TA 2ZIXA 3OLCX 3A4VA 3NLLA 2YJ3A 4LMBA 4XTCS 2FPWA 4AUEA 5KYYB 2QRZA 1M1YB 3DE3X 4YP0A 2BCJQ 3G2HA 1ZVMA 3G1TA 3RSSA 5G3ZA 3P4YA 1BHJA 1USGA 1T8WA 2ZWMA 3DF9A 2AYYA 3TKLA 4QWMA 3ZKAA 4F5YA 5BV0A 5LQUA 4G0NA 4BWFB 4HDOB 4MS1B 4CBVA 2BGRA 1K88A 2O4UX 4IV0A 3EUEA 4O4IA 1VLVA 3RTDA 1BA2A 1XDDA 3HBAA 4R68A 3SEFA 4F2HA 1FDIA 2PLNA 2CUTA 2I2WA 2RFLA 4X7RA 2YJ4A 1JQJC 1UJ5A 4X1OA 2BR5A 1XRJA 3STTA 3JW8A 4LV5B 5DGTA 4OSEA 5JI2E 5CURA 4CV0A 1HDCA 5JE8A 3V4OA 4DG9A 4ZOCA 2P4SA 3CONA 3BWBA 2IXTA 3D0RA 5IK2A 4PRZA 3WISA 2HK8A 1PG2A 1RDFA 4GOOD 3Q3HA 5HTKA 4B4UA 1I7DA 4O4LF 3IVRA 5J5VA 1PR5A 1XRLA 4CM9D 1Z5NA 5JCOA 3CTPA 4YWJA 3RUPA 1YRLA 3EA5A 2BPOA 1VXOA 4ASUA 1CC1S 2IQ5A 5CFLA 1H22A 2LD4A 4REQA 2FY8A 3OZEA 4CFSA 4E5KA 2PG3A 1MRZA 2G7ZA 3AEUA 4C7VA 2YWGA 3ACBA 3DEJA 5G1PA 5CA0F 1RQPA 4LF4B 5H68A 5I5EA 4X85A 5LDDC 3N2ZB 4NE9A 1ILEA 5LA6B 3WZMA 3HB7A 1EEXB 9MHTA 1HORA 1A8IA 4AG6A 2CLDX 1S8FA 5E4JA 2NSLA 4GXRA 3TSWA 3T1YB 1E5TA 1TA0A 3O83A 2F8MA 5FTMA 1QV6A 2WQZA 3RWMB 4Y0NA 1EZZA 4R0MA 4LMAA 2Y9MB 5CR9A 4A0HA 4G1EB 4EDHA 1ZCAA 1XRQA 2RHCA 3AVPA 5ERYA 3UJBA 2RJNA 4NF2A 3WA7A 5L4SA 3W5SA 2G8NA 4KOAA 3KWLA 2ZSAA 3T7CA 1FMLA 3GVIA 1U80A 2QPLA 3WHPA 5J9FA 2EHDA 5LXTA 1T8SA 1F60A 4NPHA 1WULS 1EGQA 1YCDA 3A05A 2RC6A 3PNOA 5IT9A 1R00A 1D8AA 3HNPA 5A4KA 3PLRA 3OICA 4JELA 2QENA 4NFSA 1MX5A 2OZLA 3F6BX 3UJCA 3VSAA 3DMTA 1OWOA 1JIJA 1OZ0A 1D7OA 2OAGA 4EGCB 2FMTA 5J3JA 1LY1A 3DKVA 2LP4Y 1M34A 3DKIA 4YP5A 3HTXA 2GGSA 2R9VA 4IDFA 5AVOA 1XF1A 3HPRA 5CDFE 1E4EA 5IUNC 1TT7A 3ZCRA 4EHKA 3E61A 2GWHA 3EF1A 4PZ9A 1R16A 4G41A 4L6IA 4EUFA 2CV2A 3DO8A 1P4RA 1WHSB 2X42A 4DC0A 1W96A 1Z29A 1B14A 2P5UA 4BXOA 1L4GA 3UJ8A 5FV4A 1KEZA 4JL6A 3EPLA 4OFBA 4CLOA 3FOEC 5I01A 2BHRA 2XUHA 1XCJA 3R3JA 2VNIA 2KM1A 4EG4A 1I30A 2OCIA 2ZJ1A 4IFEA 1PDVA 1M3SA 3PJEA 5DPMA 4L9RA 4B4OA 2HU8A 1EE9A 3PHCA 1ZBQA 4OLAA 1A9TA 5DTQA 2LVBA 5AM3A 2BF7A 1VI6A 3P0HA 3VH2A 3NHJA 2QXTA 5JDIA 3ZJ4A 4RVFA 1A8SA 1BS9A 3GRCA 3QVSA 3D1LA 2JZCA 1I8TA 5FUQA 1ZNZA 3QF4B 1E9SA 2HMYB 2RI0A 3TCXB 1YR1A 3AJAA 3N07A 5BW6B 2AOTA 2C03A 3TSCA 3BQNB 4TV8A 5D01A 1CZRA 1OYOA 3GFRA 5SZJA 1P2SA 3M9WA 5C7YA 4LIPD 4AL4A 3E3LA 4FB4A 1NDQA 5IDXA 5JSUA 1CIPA 1JHUA 2OEPA 4R7ZA 4D25A 4MI6A 5EQFA 5CT5A 2IEZA 2V3CC 2X0EA 3NVDA 1OAOA 1R0CA 4HEJA 4R83A 4FYVA 3IAAA 3HJFA 4EWLA 1RWNA 3IUNA 5J23A 3EDMA 1NP6A 1QFYA 3UWMA 3KB1A 1PN3A 3BKXA 2H63A 2OBYA 3A1EA 3DPIA 3EG9A 1NBHA 3I9NA 4PR3A 4YK7A 1V47A 5FBQB 2YWCA 3AHCA 1DJNA 1OTYA 3LUAA 1MTOA 1THGA 4WCFB 3ZIAA 3ZHSA 1S02A 3ABQB 4XWOA 2OFXA 1A9YA 3M6WA 2LGJA 4FYXA 1NRXA 1O7JA 3FXAA 5E6UB 4Y9SA 3VU0A 1XYGA 4L2IA 1KXZA 3G0CA 2OLJA 4MX8A 1E5XA 4YJKA 1HE8B 3M1AA 3V8VA 3WADA 1G8FA 2HMVA 4KX5A 4N6OA 5GZ1A 4RQUA 2HPHA 4JL8A 3HKDB 3IPYA 1KORA 5JAZA 5K03A 1KI6A 3WL7A 1AZSC 4H7IA 4MWZA 2HHHB 1BMFD 1G63A 4RANA 2E7ZA 4C0LA 2EZUA 2GAAA 4YRDA 3QV1A 2BD0A 2P9GA 1H0HA 3IMCA 3M89A 3NVMB 3Q88A 4IGIA 3RVDA 3JYNA 5BNWA 2F1OA 1ULUA 2HA4A 1MB0A 2XGGA 3X1WA 2FR8C 4TQUS 4X3OA 4G65A 3R74A 3I1JA 3WK9A 5DP2A 3MD0A 1YF3A 2PL1A 3Q2KA 3FR8A 2VP4A 1AGXA 4IAOA 3T5DA 2I4NA 5JIBA 2WINI 1GARA 1X39A 2XCOA 1QUFA 3HBLA 3LQ1A 4U0KA 3V1YA 4QT4A 8LDHA 3I2HA 4R81A 2IHYA 3TLYA 3WBKA 1R66A 4MDHA 3O6VA 3N2YA 5TNXA 1TE2A 3LPMA 4EFKA 1CJVC 4PRYA 4XIIA 1NNI1 1E63A 1L5OA 4L15A 1HL7A 1T9GR 4MZDA 3AEZA 3CVYA 1IN5A 4MHOA 1LCIA 3CU5A 3LBFA 3SC2A 4BFCA 2FFBA 1VMEA 1W76A 4N0MA 4CEJA 1GNSA 2HYDA 1IJBA 2WKWA 4X63A 1NQVA 1XHFA 4G81A 3GFGA 4Q4LA 4V0RA 4YJ3B 2FWIA 2ZDGA 1VE3A 1XZQA 4EENA 3VVBA 3R3SA 2QV7A 4JKYA 4JU8A 4TLLB 5DBIA 3GP5A 3FFXA 1T2EA 3WL4A 4OXQA 4QDOA 3OCYA 2AV6A 3BRQA 1P6QA 4X9XA 2R62A 2J31A 1YZUA 4RDHA 2OAEA 1T2AA 1NLYA 1B00A 4D44A 3MMZA 4L0QA 2PHZA 1DKPA 4MV7A 2O2JA 4IIHA 3ISTA 4LW8A 4JWKA 4PXSA 3MTIA 4KPFC 3ZHZA 2AW5A 3RJ5A 1KP2A 1WE2A 2HADA 3D3WB 4RK7A 2OB2A 1EZ4A 3M83A 5AW2A 4KYVA 2HUNA 4N0QA 1UBRS 2ZIGA 1Y33E 1PT9A 3H5RA 3DDCA 2IYRA 4D45A 1FJ2A 2E87A 3QUAA 2ZWAA 3DAFA 4YRRA 5IJ0B 2BFEA 3VV3A 2GPAA 3GB9A 4G4GA 4UU7A 4EW2A 2PR2A 4YECA 5DDIP 1C1HA 1G42A 5DKFA 1G21A 1OFUX 1JA0A 3UTCA 3CEPB 4QUGA 2V6JA 3SXJA 3FFAA 1U65A 2PJUA 3B2QA 4E3ZA 3EFOA 1FMFA 4I3FA 1BCRA 1XD9A 3SQXA 4AJJA 2B1GA 4EB6B 3ZBUA 1U8EA 3ACDA 2DFKB 2OMEA 2Y4OA 2W6OA 4PS0A 5I47A 4NESA 1V41E 2C9DA 3MGGA 1L8AA 3T34A 1RHJA 1AH2A 1KHHA 3NHMA 1GNTA 1LWNA 3BL8A 3ODPA 4EPRA 1N2CB 3JX9A 1LDBA 1ZMTA 1W49A 1DAGA 7ADHA 3L8ZA 1ZVQA 3LLCA 4ZA2A 5GJBA 4CF5A 4D9NA 2C04A 3OEHD 3EPKA 1T2DA 4A6XA 4P3NA 2BI4A 2DT5A 5ESRA 4DDWA 2ZWIA 4HDKB 2FAXA 3IKVA 1JG1A 1GVHA 1HV8A 4A2CA 4AJIA 4PQYA 2VC2B 3KQTA 3PIDA 3EVGA 5DOVA 3UJ6A 2PH3A 5DEOA 2IH5A 1CR6A 4AJNA 1Z47A 3EY9A 3T15A 4F86A 1T6NA 4COOA 5BR1A 2EL7A 3U17A 4BASA 4KGVA 5LBTA 3EPRA 3B51X 1UBLS 1L4MA 3NAQA 2YFYA 3H87A 2D1SA 2OCXA 5LQKA 1ABBA 4RLFA 3AF0A 1IZ9A 1VA4A 4DLNA 2RAPA 2QNRA 1P44A 3INGA 1M76A 1NRWA 3OLVA 4M22A 4RL4A 4OXXA 3BBPA 5K09A 3D7KA 1WMFA 5IBRA 3RO7A 3HA5A 1YE8A 2WIBA 3H8WA 3HYSA 4FPXA 4V0SA 3GG9A 4M1SA 3DZ8A 2VUHB 1U1CA 4BGEA 4BPRA 3GN2A 5JI3E 3ZCXA 4HCJA 1X0VA 1NVMB 1JKXA 2QSYA 2FX2A 1TB4A 1HM5A 1WZNA 3GJXC 1KFBB 5A4AA 4YN3A 1QIEA 4M3NA 5IT0A 3GI1A 4NWIA 2XUGA 1WP9A 2YHSA 3MQ4A 5E4TA 3EMVA 2NPFA 2EQBA 1BG6A 1M1YE 5FLYA 3RS9A 2GASA 4JLBA 3EOAI 4OP2A 4AKHA 1K5PA 1QGDA 1IZZA 5DLEA 2OXIA 3HY3A 4YRLA 3DBHB 4J7CA 1JNYA 1QH1A 1XRPA 3GEDA 4TV9A 3O1JC 4BOYA 2X2OA 1IN6A 1P7CA 2FRVA 4A1FA 5I3CA 3EC7A 5EXSA 3V4VB 4BNFA 2Q3BA 1HNNA 5C81A 2XRYA 4A15A 3RW9A 1OH8A 1ZKMA 4EM6A 4NS4A 1H4QA 1FFXA 5HR5A 5KSYA 1R7RA 1D4ZA 2LDXA 1NW6A 1C0EA 2V4MA 2OO5C 4P5DA 5KBYA 3L6DA 1U63A 6Q21A 3HWRA 4NIMA 4OY3A 4WY5A 3ZH9B 3A0UA 4YCJA 1NI4B 2IVZA 1ZI8A 4X45A 4F71A 1W1IA 4L50A 2XMSA 1NP7A 1WLYA 2MT9A 2ZBPA 4MZXA 3TVTA 4AMZA 1DELA 3RSZA 4JSYA 3IAFA 1JU9A 2VZLA 3DE4X 3LUBA 4QGFA 4RZ2A 2NP6A 1IBCA 5BPFA 1VG8A 2AN3A 5E4FA 1JMYA 3OEED 4NYJR 1VJGA 4MJLA 4QHYA 4GR5A 4E12A 2N46A 2V3VA 3LGAA 4QHTA 4DSUA 1UP6A 5JD3A 1BRTA 1RYEA 5FULA 2GPSA 3TQIA 1MX3A 4B3DA 4B7XA 3F8SA 4C01A 3NKLA 1R50A 4QG7A 4YH1A 4I50A 5G40A 5ALJA 3ZCSA 5AI5A 2TMYA 1DNPA 1I4DD 2X6TA 3LDHA 3QOXA 5C9ZA 3UWPA 2QJWA 2R6CA 1GSOA 1H85A 1NKTA 3UYKA 2VP6A 4BQNA 4L7QA 1SBIA 3RTBA 4ZVLA 4D4GA 1G8AA 2O5EA 1DQNA 2YHUA 4LC9A 3AUAA 4ODIA 5FO1A 3GIWA 1L3CA 2QROA 1KC3A 2A30A 1T5OA 1DX6A 3AQ4A 3D3KA 3UQYS 3JALB 3GD5A 2BFBB 3WY9A 5AW4A 2XCQA 5BSRA 3ZE9A 1LBHA 4H60A 2XUZA 1MQAA 5DHTA 4KMSA 4KO3S 5AM1A 5EJ9A 1T5DX 3RJMA 2A0YA 2UUCB 3V2GA 3SYKA 3VU9B 2ZIXB 2X7HA 3JTMA 3TIXB 3WLTA 3QYJA 1YBHA 4I36A 2WE8A 1K7FB 1RJEA 2BY4A 1JP7A 4FOTA 5IH3A 2WE7A 1SEPA 3U3OA 1TKAA 2WUWE 3IAUA 2FOXA 3LWDA 1ENYA 2EZTA 2WJHA 1QE0A 3II6X 2M6LA 1V0JA 3SLKA 4AG5A 2H1OA 3FMFA 1LPNA 3U19A 4CDGA 2CMDA 4IIBA 3O2QB 5H1YA 2QYTA 5JTTA 2ERXA 1EVKA 2V6IA 3KOMA 3NBZC 3QKSA 2VQSA 4AICA 1CJUC 5AVKA 4TKMA 4ZHQF 3IXLA 5J4LA 3ZTWA 1SXJA 1DFGA 2AL7A 2X5OA 4RPGA 4ZAXA 4NCNA 1TW2A 3TCNA 2P9HA 1R3UA 1Z4PX 4X84A 3ZQUA 4DT1A 1VE6A 3DVAA 4W82A 2Z8XA 1D2CA 1DAFA 1FYWA 4TSFA 4FXPA 3I9KA 1GTRA 1GL9B 2EEZA 4M37A 1PL6A 2ENWA 2IHBA 2OG2A 5EQDA 3SYLA 5CCBA 4E7OA 2JFFA 4IUYA 1B1CA 1VKJA 5C37A 1J0AA 1PU2A 1FTSA 4P4LA 4EVIA 3OIGA 3GJZA 2XECA 1AKRA 2IYTA 4IL5A 1H6BA 1HNZB 3C45A 3FF4A 1S6YA 5KWEA 1KEUA 4A27A 4GKKB 4DGSA 1KSHA 1T1JA 3DXFA 1OTXA 2QZJA 2BKEA 1J9ZA 3FKSD 3IJRA 2FWMX 3CMCO 2Q2WA 1E2HA 4M8IA 4OHZA 2OR3A 4PYJA 4AAYA 3ICWA 2FR0A 1B3RA 4QRIA 2XXJA 3AONB 1JJFA 4G1VA 3WGLA 5KDLA 2YNMD 4M1QA 2PUHA 1F8FA 3L7JA 5THQA 4V02A 4X5OA 1FUUA 4IEIA 3BDAA 2AA3A 4JEHA 2O7NA 4IOKA 1BQ4A 4CLRA 4MIYA 2QAGA 4S0ZA 2O59A 4DMFA 1S2MA 4CIAA 1NJSA 1FFBA 3EXHA 1L2TA 5D5QA 1QK5A 4ND3A 4Q9AA 5EKUA 1YZ3A 4ESEA 2WAOA 3NKVA 2R2GA 1C4WA 2B7BA 2A0UA 4KGZA 1VL0A 3IRVA 1JAHA 4OQPA 1V1MA 2IE8A 3RPEA 1E5QA 1EX9A 1N3LA 3O3MB 3V48A 3HZZA 4TXHA 3BE8A 3TJZA 3AGPA 3SHVA 3RYCA 1W9MA 5JVDA 1A9OA 4QXPA 2VPZA 4DOMA 1SVNA 2P1ZA 4EFDA 2JH9A 4JUFA 1R4AA 4YPVA 3DOUA 3WBJA 5LB4A 1VKZA 2C4NA 4J29A 5HOQA 2VYCA 4P58A 4GLJA 1M34B 1RPNA 3U81A 1KYVA 5AVJA 4LY0A 4M0CA 1JE0A 5SV2A 4KHPB 4PHFA 5ALMA 1YR3A 2ZRFA 5HPYB 4BKQA 2Q5FA 1G7CA 1M0EA 1MJFA 2BZ0A 1CY1A 4BXOB 1M7GA 2ZROA 4CT5A 5JEEA 1MORA 4E07A 1XYYA 4GXTA 4CLOB 2UYOA 1KIFA 1GPUA 1HURA 1SB8A 1Z75A 1MLDA 2I7XA 2RK3A 4R51A 4LF7B 2IUSA 4PG6A 1PTJC 1YV9A 2JASA 3CR8A 1KH1A 3H3JA 1MW9X 4GC5A 3PK0A 4C7JA 4J1TA 1CT9A 1C0LA 2QE7D 2AYXA 2RHLA 3R0ZA 5IAOA 1QO0A 3WB0A 1UPCA 3H9EO 4RF5A 5BURA 3EF0A 5BV2P 1EJ6A 5B1YA 5KB3A 4RULA 3PKIA 1CVRA 3RU3A 1NL3A 4QODA 1I13A 2ECOA 4MUIA 1D09A 1N2OA 1P1BA 2BGGA 5CB6A 1NN5A 5I7VA 2OHFA 3OPNA 2O9JA 3R44A 2FVYA 3DDOA 1RPZA 4EGAA 4JROA 2NOAA 2VF4X 3C7TA 4KQJA 4ARZA 2AOTB 3LTNC 2DPLA 2Q2OA 3HKBA 3EZNA 4JJ6A 1NLUA 1XEFA 2QUAA 1MG0A 3G49A 2ZULA 5HVNA 4HN9A 1IBKB 4UNQA 3VNVA 4MO2A 3ZE7A 3GN1A 1A9RA 1RZVA 1CU1A 4YP6A 2ZJBA 2FSPA 3OJFA 3QI7A 3N8HA 1TF7A 2R6DA 3NC1C 5L7YA 3HM9A 2WG1A 3W3AH 1NDHA 1HUQA 2IXFA 4BFTA 2C8LA 2I6UA 2VXCA 3W79A 5JJLA 2VTDA 5F3RA 4DLPA 5K6AA 4Y1EA 1V8FA 3QOWA 3VR2D 1R0ZA 3C3AA 3AX6A 3E7DA 3IUSA 3PEEA 2XGOA 4JC8A 4UXIA 3EMKA 1QB7A 2WSLA 4OO3A 2WWTA 3IQXA 4L2IB 1WRBA 2EF1A 2D2IA 3TEMA 2ZVPX 1GR1A 2DSNA 2UYQA 4OQNA 2YQ4A 1E32A 1Q19A 3NOOA 4OHKA 4JU9A 5E7MA 1KI6B 1KZ7B 3TLZA 3K1AA 1Q1NA 3EZ6A 1X1SA 1KAMA 1ZIOA 4MRNA 3O4GA 1UKYA 2J85A 3UAXA 1DMSA 1GXSA 1K5DA 4PQRA 3HWX1 2YN4A 1E6KA 1WJGA 3B60A 3C85A 2TMGA 4JX9A 3OP4A 3A6ZA 3RVKA 4F60A 1NSTA 1U2SA 3JR3A 3VDRA 3KR1A 3OFKA 2FZGA 1JDJA 3KJHA 4M0DA 4LDZA 4BTEA 4CPDA 3VHXA 4NMHA 2HU2A 2ZZNA 2C9YA 1ZN9A 1V7PC 4AWBA 4JKOA 4XWTA 4YPFA 1IG0A 1TYZA 3H2ZA 3DV0B 3WWCA 2C5SA 1T0UA 1V45E 3ORHA 4BVLA 1D5WA 1O8BA 1S3FA 2J7KA 1EFLA 3L7MA 2JFUA 4JJKA 2IS2A 3ZJTA 2O8BA 5A3SA 1J90A 2FFQA 2NSYA 1JQBA 1JRLA 1SOVA 1XAIA 2FZ4A 2GK4A 5KYWA 3GZ4A 3MZ0A 4CEJB 3MMSA 3JAMA 1Q2XA 1W48A 1QLJA 3FPJA 2N75A 3DCIA 2I54A 5F5XA 3TJRA 4BNHA 4NXNB 2RBEA 4D96A 1YR6A 2C88A 1PI3A 3NOQA 2ZYHA 3HUUA 5K0LA 2PN1A 4AZSA 1E2KA 5I9TA 5IJAA 4WASA 3OPVA 4TTAA 1G8JA 3E23A 3QHPA 3AP2A 1KSGA 4QVIA 2XGJA 3G13A 1QF6A 2YUIA 5GONF 1FMCA 1PQPA 1NWCA 3QBVA 2FA9A 1E2FA 1J22A 4GOMD 2UZ3A 3LAWA 4GAEA 2PZFA 4JYMA 4KIWA 3LBYA 1TVKA 1OIVA 3HVUA 5H02A 2NO0A 3E2PA 3CVVA 5FWDA 1IUPA 5HW0A 2Q1SA 4PTLA 2GUGA 2OBFA 4YGXB 1J8MF 2DAPA 4AX4A 1H2AS 1TL7C 2GZ1A 2LV8A 1J7KA 5CNKA 3EEBA 4OXIA 1VBFA 1POWA 3W3ZB 4DCNA 4M1EA 2BFEB 4QYMA 1NI3A 2GLTA 3LPNA 4MCAA 2WWHA 4JC5A 3U48A 3DC2A 1W59A 4AJHA 3GP8A 2JEOA 1W35A 3PUHA 4JBLA 3IT0A 4C2AA 1ZNYA 1G2OA 2WB4A 4XH9B 4FBLA 1BCRB 3CINA 4F84A 2VBFA 4KO8A 4R1NA 3T4PA 1DDGA 1RRGA 4ZEOA 2JGAA 1N2GA 1Q22A 1UK7A 3KD3A 4G89A 4NONA 4I6GA 2XTJA 3RYFB 4IKOA 1M2VA 3PR1A 1E58A 1OD6A 3K0CC 4ZO9A 3RVLA 2G08A 3LIPA 3MIZA 1N0IA 2P69A 3RSOA 4X6XA 4AULA 4BVEA 1UANA 3OX3A 3ELYA 1JA9A 4MWTA 5DNEA 2XNHA 4IEEA 4RZUA 3BMQB 3TLMA 2Q3EA 1TDJA 1G17A 2B8WA 1HKUA 1LLQA 4X41A 2PUAA 2IHZA 4BVBA 1B4DA 1JR3D 1AT1A 3FYUC 2IV2X 4UPVA 2FW0A 4WOKA 2MSNA 4NKRA 2IF2A 3D8HA 2ASVA 3LZDA 2O6LA 4G1BA 2WJYA 5LZ5A 4BQSA 1WP4A 3TVDA 3WLAA 3MINA 1KIAA 5G4KA 5BUZA 3DL4A 4NBWA 2V0GA 3AI7A 4BLSA 1XA3A 1QVWA 1LDMA 2P35A 4D0NA 1ML4A 2ZYRA 3FUWA 4NP6A 5AK5A 1JPVA 5FJJA 4C0JA 4UTRA 1IY9A 1VL8A 3KPYA 4DCVA 5K0CA 2VNAA 4A8PA 1NVVR 3ZZ1A 1QVAA 4XJSA 4GXNA 1ZD8A 4URVR 5EJ8A 1JDBC 4WUVA 1IK4A 4KH0A 5C1IA 1NW5A 4MYRA 3P20A 4LJLA 1JKMA 2Z4SA 4FEYA 1BRMA 2ZVQX 2PFKA 3DTYA 1VKHA 2RHJA 2Z0MA 2IZZA 4XVUA 2NG1A 1L8OA 2VPWA 1SD5A 3KJFA 4Q3AA 1TKCA 1CLUA 1CZHA 3ER8A 1S4MA 1DGQA 2V5UA 4C5AA 5EZQA 2Q6VA 3D5QA 4B4WA 2NYVA 2QAIA 1O9BA 1Q1GA 1MJGA 3MUNA 4KPUB 4UJ5A 4EUSA 1IQ0A 3ABSB 5K5EA 1DEAA 3QF7A 4GOLD 3AMVA 4NX2A 4RD3A 3IVXA 2BHSA 4AWAA 5K3OA 4WN9B 1EG2A 4XDYA 5D84A 5FYDA 1FFXB 3VR1A 4F3CA 4IO0A 4FMPA 4TYMA 3DE7X 4RL6A 4RIFA 3KQLA 4U7HA 1N25A 4F11A 3BWYA 2JK0A 2XUJA 1GAXA 4F9TA 1DC4A 2JGDA 3ZYZA 2EG9A 2DFDA 1VSUA 2B9EA 4P4SA 4BFLA 2BF4A 5CPBA 5L7TA 3G23A 3PWKA 4OBBA 1NM5A 3IOCA 3R2JA 4JA2A 5E9JA 3UBMA 1M5RA 3X1DA 2UYGA 4FDAA 4DCSA 1QIMA 2ZYUX 1ZHHA 4FYMA 1L5HA 2Q7OE 3UV7A 4BWYA 3LV8A 4ND7A 3JYHA 3N7AA 3LF2A 4JBIA 2FN4A 3PCRB 2EBHX 4MGZR 5D00A 1RWMA 3BA6A 3A9RA 1QIFA 4RSRA 4UUNA 3ZWKA 4ARCA 3FKJA 3OUUA 1I5OA 2OTCA 2CN1A 1LPPA 4FCTA 1DG3A 4I50B 5DW3A 2DUUA 1FNCA 4HWOA 4DV0B 1JZTA 3VZPA 2CNDA 1YTUA 4KXUA 3PX7A 4HQRA 1QU3A 1ESNA 2IYVA 1SVWA 2Y1DA 4XIYA 3TW4A 2VKQA 3BB4A 3BFXA 1EGVB 2JLXA 2P8JA 3VOAA 3RHFA 4LXHA 4EPTA 1O97D 1WMSA 1WXDA 2VSXA 4DILA 4EY3A 4L8VA 4BQQA 4Q1CA 4AYWA 1DB3A 5JWHA 3D81A 3Q7EA 5EIOA 3VZQA 3WGUA 4C7OB 1C4OA 1S1MA 4DR6B 1HE3A 5I8WA 4P4GA 1S2NA 2MOKA 3C3CA 3B5EA 3O93A 2X0DA 3L6BA 2NLOA 1JF8A 1Z0KA 4KXNA 5IBPA 1SQ6A 4OHYA 1G6KA 3F7MA 4A5OA 2VA8A 1H2HA 3B1XA 2BBSA 2EIHA 4FHZA 3Q7QA 5LYYA 3ZJ5A 4HDRA 2GZHA 4AX8A 3QVMA 4PX9A 1D1PA 3TDNA 2J4FA 1NVFA 4MVJP 2IGTA 1BWQA 4EF4A 1SU8A 1R64A 4JZYA 1ZL0A 3AIMA 4W5WA 5DHRA 3AQIA 5K0SA 3AETB 3HVIA 5B1SA 4YMIA 4ZJYA 4NZMA 1N9GA 3NW9A 1X7DA 4E4RA 4WK2B 1PG5A 4EY7A 4UFPA 2HRQA 4K9LA 3P2IA 4NJEA 3T1NA 3ESYA 2WHYA 3ANLA 4KMRA 3IEVA 3NOVA 3PXAA 821PA 1M34E 1Z39A 3ZV4A 3OOEA 4ER6A 2H1LA 3O8LA 2MINB 1A4XA 4PYNA 1J8VA 2AJCA 3QKSB 1X14A 3IOBA 2JZOA 3UN1A 1C7QA 4B81A 3A3NA 3JSAA 4I46A 1I4OA 2IOFA 3OQOA 4WZBB 1SXJB 5K8VA 3GLFB 1K3FA 3HMKA 3L8YA 5EE9A 5IAAA 1SXHA 3Q7SA 3NDJA 3F6EX 2E5LB 4LJKA 4DT1B 3TN7A 3DVAB 4IMPA 1DPFA 1MUUA 1UWKA 2YCLA 4YQEA 2DHEA 1GGVA 5L51A 4E94A 4RKWA 1GNQA 2FN3A 2QM0A 3T9AA 1QJCA 1IMJA 4MWOA 2CL6X 3S2ZA 3BWEA 4P7FA 1T6BY 2SKEA 5ENVA 3UJ9A 2PMEA 1T8TA 4XWGA 1V3QE 3WLJA 3OKPA 1KBQA 2JHGA 3COSA 3F5SA 4YJGB 1OB2A 3UMJA 1L1EA 2VUIB 4DTCA 3W1WA 1X7HA 4IH1A 2Q5OA 2VF8A 4K87A 4B85A 4EP1A 1ZOSA 2OBBA 2O8EB 1X2EA 2CE2X 2WP0A 1PNQA 5LSAA 1ZP6A 4LF5B 5AKHA 4NPCA 4L8LA 2IWHA 4FFWA 1GQSA 4A4DA 1SWVA 2IPMA 3RGWS 2H48A 1BJRE 1PGJA 4B4KA 4GVPA 1ULTA 2ZE7A 4P53A 2NQ8A 5LCXA 5JWRA 4O4LB 2PPVA 1H2RS 1OLOA 1XKQA 1YAJA 2XGMA 3GEHA 5EZ5A 3VNSA 1NMEA 1JW9B 1NSFA 4FINA 1VBKA 5ITVA 4CLRB 1XDUA 2B20A 4RHFA 5DMXA 4D0SA 4NC9A 1TZJA 3KO8A 4NBTA 1SURA 3A9TA 3EXHB 3CF4G 3SM3A 3IIIA 3CBQA 5CA0B 1Y8CA 4WBXC 1BMQA 5CDSA 3QE3A 1T1GA 2BUAA 4ZQCB 3L1KA 4IMIB 4KUHA 1XTBA 4MICA 1V1MB 3R3XA 2PH1A 1JI3A 1OA0A 2DRIA 2WUDA 2B6HA 2B1IA 2ZIEA 3DWIA 3L7NA 1UPTA 2C2YA 3RYCB 2AVDA 2PQ0A 5JVDB 4DWJA 4J6FA 1Q2UA 1SBHA 4CL0A 3TOCA 2WKQA 3AJ8A 3G85A 3FYSA 3ZLVA 1OBHA 2XGSA 3WKEA 1ZK1A 4F93B 1SB9A 2FJ0A 1ECFA 3AWDA 3IAS6 3RNOA 4CL3A 1QHHB 1KWGA 1SVOA 4GBED 2EGUA 3JVIA 5KU1A 1NULA 1YU6A 4RVCA 4U8HA 4JI5B 4JLNA 1NHWA 5KU7A 2LCFA 1RE0A 1KQ3A 4KX3A 1SOAA 2WJAA 2PGOA 3ZI4A 4RQBA 1NG1A 2Q5JA 3GLKA 1XN4A 2EYUA 4WD3A 3L84A 4EATA 2QD2A 4CW7A 5DGIA 3KHKA 4NS1A 4NK4A 1G55A 4UU1A 3HCRA 3CZPA 3D2AA 4Q3OA 4H4EA 4B35A 1L6RA 1PR4A 2F67A 3I6IA 1K6JA 3IP5A 4CG1A 3NH9A 2OYCA 3UMMA 4JLAA 2CEAA 4KK4A 3D3NA 3U3DA 1GAJA 5ELLA 3GFVA 3A4NA 3GJ8A 2WSSD 1JFVA 1EFTA 4TMXA 3JYOA 4E2ZA 4XIJA 5DK6A 4JODA 1YS6A 3IT2A 4LGYA 4E09A 1Z0SA 3FRHA 1FNDA 2E2WA 2PMDA 3UWKA 1NN3A 2FMKA 1AX9A 5F4BA 2YXBA 2VYFA 3FCUB 1HT0A 4LSGA 3FSJX 3L6EA 4INAA 1P39A 5AYVA 5TGDA 4BFSA 2O8CB 1GVNB 1M2KA 4GP7A 4RWEA 4PZCA 2DB3A 2AQKA 1OLSA 1F5SA 3GPCA 2WM8A 1PNOA 3A6DA 1TT5A 1UXGA 3QNWA 4DV4B 5E1MA 4I8IA 5EIAA 5FB3A 5ILGA 3BXXA 3HKBB 1NRIA 3N75A 1PZMA 3FNIA 4M9SA 4DLAA 2GZAA 1OGYA 3BFPA 5JQGA 3ESDA 3F8TA 4AJLA 1V6SA 1UZNA 3H4MA 1JKJB 1D07A 1HQDA 2YWRA 2X5NA 4UDYX 4YBZA 1RQXA 4NATA 4ZV4A 1KZ1A 1R10A 3CZAA 1N57A 3WWPA 5C1OA 2D0PB 2RHDA 4QDTA 4QUBA 4R8LA 1QQ7A 3OEYA 4B6QA 4F4HA 3FOAA 2C20A 1D7AA 4V03A 4XEUA 4E03A 4JJIA 4EY8A 3BQMB 1CUDA 3PNQA 2G72A 5MFPA 4QJ4A 1OJ7A 4PPNA 4GR4A 1KI8A 1HQCA 2H92A 1D9ZA 1JDNA 2CYAA 1ZCJA 4IXDA 2PRKA 2ZBQA 1XV5A 4DIDA 2ICAA 4ALMA 2ZJ0A 3RQSA 4WNAB 2QTHA 5CDYA 1B23P 5EP4A 1EBUA 1ZJ4A 1EK2A 3I9MA 3PXGA 4D7AA 4GH5A 3ROGA 2HA6A 1WUKS 2GK3A 1P33A 1Z7GA 3I2KA 3K1AB 4MIKA 5COQA 2Q4BA 3AW9A 4D9EA 1J24A 2H7XA 3P9RA 1IUOA 4EB3A 5FADA 3KL2A 1I2AA 1I5EA 3K5HA 4TQAA 2NX2A 2PH5A 1GXSB 3I58A 1VCIA 1PT5A 1WEHA 2BJWA 3BJIC 4XIGS 3ROXA 4YMSA 1Z3IX 3DVRX 4BKUA 3FPGA 3TWOA 7YASA 4P35A 4QXMA 1F48A 2YW2A 3R9XA 2P9JA 1RLUA 4PYLA 2G9QA 1T24A 3BIWA 3CX4A 5LP1A 2IX3A 3EWIA 2XNJA 4YFYA 4G6ZA 2PT7A 2VUSA 3SICE 2WKPA 5K8TA 1F2UA 5B64A 3AYZB 3RVOA 13PKA 5ULLA 4OV6B 2P4UA 1OWPA 1XTZA 2VQDA 3AKCA 3A4IA 5KYWB 4YJ2F 1WVMA 1P75A 4I3HA 3DEFA 4D8UA 2WSIA 5BXQC 1SC4A 2QZSA 1RXEA 4KKXB 2XVYA 3VR0A 1A82A 1MOPA 5EI5A 4D0GA 4UU8A 2XQGA 2GCNA 4NHEA 1NQAO 3MAJA 2PGIA 1PQ4A 1XL0A 1E64A 3K7EA 4MH0R 4N0PA 4BNWA 3SVLA 5DTRA 1KI9A 4BGVA 2IZ0A 3NWJA 4HXFB 3ZD6A 1BEUB 1TVKB 3FLEA 3Q9SA 1JYFA 1PQYA 2FX3A 4MUBA 4CKWA 5IBCA 3RAEC 1I0LA 1I14A 1Z25A 2IYOA 1CQPA 2EIXA 1ZW6A 1JHPA 4MWSA 4H3KB 2GXUA 4W9NC 4UTXA 1JHYA 5CFQA 3K05A 3NEYA 1N7IA 4JUAA 1XNRB 3U13A 2Z2JA 1P0QA 3BXPA 3M4XA 1GQYA 2YMMA 2RARA 3I73A 4K9KA 3ZE1B 4P80A 4AKSA 1EVLA 1WAMA 4DYHA 3GO4A 4U9HS 1PQUA 1N9ZA 3Q0TA 4KQXA 4DMLA 1ZITA 1QJ4A 3BK2A 4Q12A 2ZE5A 4D26A 1U1DA 3E3NA 1PX2A 1TCCA 2W6PA 1TM7E 3GGDA 1GU0A 5CNMA 3HR8A 2XMZA 4CEHA 1A3CA 1K6MA 1M2VB 2AI3A 2Z4RA 2G71A 3WA6A 4DUYB 2JLZA 4XQ9A 3QM1A 2GN0A 4ID3A 2RONA 4KZKA 2YQ5A 1XKLA 4N01A 1Q21A 2PT6A 1KPGA 4QXOA 4LBZA 1E6MA 2JLQA 1GTVA 2SCUA 2ACKA 1B26A 5AI4A 1YUNA 2QORA 1Z6AA 4ALLA 4QULA 4G5QA 3Q72A 2GHTA 1UDRA 4ZI7F 1KOLA 1WKBA 4G5SA 3DR5A 1BS1A 3OM8A 4XJXA 5DCLA 5HRAA 2VHCA 2G36A 1PBTA 1U7OA 1NFFA 2MWMA 4XUEA 5AVVA 5GIPE 2RGNC 3HHEA 3ZVMA 5CFOA 1B7GO 3PQCA 5ALHA 1MV8A 2WF8A 4UBKA 4HB0A 4AN4A 3I5AA 1AQJA 1AURA 5G4KB 4D56A 3FDZB 1LVUA 4KRFA 1I6WA 4N8DA 1AKQA 3WHKA 1JX6A 3NDPA 4OXKA 4ZODA 4DIUA 4UM9B 4E3WA 1V4VA 1LNQA 1UC9A 1IJKA 1X1DA 3PFCA 2PAAA 3WYGA 1QHXA 1XDWA 3PUWA 4FT4A 4HADA 1ACJA 4C6HA 1TK2A 2C07A 4MQEA 1XGKA 2C2HA 2QZZA 3GDWA 4XSHA 5UKDA 3CZ5A 1E89A 5EHXA 2QN6A 4OHFA 1QHFA 3K16A 2NO4A 2GJAA 5GM1A 2F3UA 2YTZA 2XTAA 3JQQA 4EG5A 2GBCA 2DT8A 1DBSA 5LDGA 3U26A 1U3GA 3VTKA 4F85A 1WUTA 4NCXA 1EUYA 3A6GA 1ECCA 1GPDG 4ZI3A 5B30A 1G8YA 1U0JA 2JBWA 2XB6A 5A0VA 1X86B 1VGVA 2QTGA 4KG7A 2X13A 2XOEA 1ATIA 2QIOA 3COZA 1KSJA 2ZS9A 3ZIUA 1E0AA 1E6WA 4O4JA 4OAOA 2QDXA 1C4XA 2P4QA 3CKMA 3NHWA 1NP3A 1BGXT 4QHSA 1FC0A 5K3EA 1GPKA 3LH5A 5DNCA 4BRUA 4IYJA 3GLIA 2AHOA 1VE1A 3FPCA 3C3MA 3G9QA 3E03A 2OYRA 4PS1A 1P2FA 1KYWA 1FUYB 1RSZA 3PFHA 4B6JA 5G4LA 3I9LA 4DQXA 2RHTA 1FS6A 1SXJE 2H8GA 3LQQA 2CLHB 4MQLA 4N49A 1SOUA 2F1HA 4S1PA 1AUOA 2JGJA 4YRZA 2DBVO 1UBMS 2RH5A 2QD4A 4RE6A 2Q07A 2DUWA 4QJIA 1M72A 2PZEA 3QBEA 3SBOA 2MDTA 2IW3A 3FMOB 4O2BF 5BVGB 1L5HB 2AC7A 1Z6PA 3GDHA 4NDNE 3N0VA 3IH5A 4MP6A 4N5DA 4OMCA 2ID7A 2QVLA 1CDZA 3UG6A 1UDBA 1FW8A 3AB8A 4ND5A 4C0KA 1E2EA 1SCNE 3GLHA 3HHPA 3FAKA 2NPIA 2VHTA 5JAHA 1LA2A 3KQNA 1XCBA 5IC5A 4EJ0A 4F3RA 2VUTA 3LW7A 1G7TA 1IHDA 1YHZA 3R7NA 1D9XA 2E4AA 2DPMA 3DONA 3BICA 3BRWD 1U90A 3DLTA 3EVEA 4B7CA 3AHEA 2ZRBA 3IQIX 4GIBA 4C04A 2C4WA 4G5HA 5A9SA 3FM9A 2QL7A 3F7NA 5F78A 1H05A 5AHOA 5IHPA 4E88A 3W4IA 3ETLA 4WEQA 5JRJA 4DANA 1FK8A 5BQ3A 2BTEA 1XTUA 1HFEL 3F90A 2BFDA 4KYIB 5EVCA 3EWNA 1DEOA 1GRNA 2R87A 4QFCA 4CFYA 1YT5A 1PWEA 3ONDA 1UUFA 1QGYA 1VHWA 4IS3A 1K2WA 2BEWA 1U9IA 2R1VA 1G5IA 2JFNA 4HDRB 4TL9A 4TTVA 4G0UA 3FSGD 3KK0A 3RYTC 3WB9A 3D1JA 1CJSA 1J07A 2JK1A 4P0QB 4BB9A 3QBDA 3T4UA 4KDCA 3PYXA 1FTNA 4HWRA 4AS2A 3AO0B 2YVQA 1SUIA 1TZBA 3DOCA 4MR7B 2A86A 4RD4A 1F0NA 2RH9B 3R7LA 2FSSA 1QTIA 3RFVA 2WZDA 2H1VA 3WOHA 1P9LA 2WR8A 2FK7A 4G25A 2R86A 4XLTA 3WMFA 4C3OB 5LYJF 3IEMA 1HETA 4GBGA 1U4NA 3HKCA 1NBMA 3TR6A 3ZC3A 1X8KA 2C3MA 1AGNA 5AHWA 1WDWB 3EIXA 3L07A 1WSWA 1J9EA 1RRKA 1LI5A 3PGKA 3CG0A 5FUYA 4CVNA 1NYQA 2PYIA 3OFSA 3PNKA 4QOSA 4HWKA 3RRBA 3QEMB 3OE7A 2ODNA 3QY9A 3OCJA 1SVKA 3GGCA 2QPAA 4JT8A 4A03A 4GF5A 2PKXA 4CMGA 4YO8A 2ZPTX 4GWGA 5GPBA 1NSYA 1ML3A 4E21A 1QWOA 1UDCA 4RJLA 2HFKA 3TQRA 2ODTX 2QM3A 3HDVA 3HN6A 2CLEB 4OLHA 5T4BA 4UUAA 1CUBA 1WV1A 1YZKA 2RG1A 2W00A 3ESCA 3PQ8A 4PM4A 7MDHA 3VBCA 4N5MA 2PWPA 1JG3A 1V6AA 2XWJI 2XVXA 3GOQA 4EMTA 2VWPA 4XI9A 4BJ1A 1FQOA 2Z56A 1RMQA 5EXXA 1UF9A 1ZX1A 4EJSC 3MD9A 5E0OA 1WCV1 2IBTA 5C7OO 2JC3A 3AJ9A 5A02A 4URUR 2FR1A 2GD2A 3CO0S 2ILVA 1KKUA 2E89A 2H5EA 3GGGA 2VL7A 2F48A 2LKDA 3R3YA 1XU7A 4JFRA 4Y6GB 1QNFA 3C3PA 3KG2A 1EXNA 4L9SA 3FPLA 3BT7A 2ORYA 1NMZA 2CLLB 1DQYA 3G0OA 4H15A 1P2BA 4XJTA 1DXHA 1FF9A 4RD1A 3PRHA 3O84A 3RE1A 3VOBA 3LP6A 1O03A 2FSVC 3IA7A 4W5OA 2OOKA 2Z2IA 3NYWA 4KBFA 3QE2A 5C52B 4TLEA 4TRNA 3AU9A 1YUMA 3AILA 2PS3A 4X7PA 1MJHA 1VYVA 4K9SA 2XW6A 3M6FA 1USUA 4WZAA 3EVFA 2LIPA 3L3BA 3X44A 4CL2A 2J5RA 3G1WA 2BI8A 3KIPA 4AMVA 3T7TA 1DPGA 1N2IA 2QIPA 5A3QA 2B4QA 2YWDA 1KMQA 4OI1A 4HWPA 3RTAA 1CPYA 3TFOA 2OSVA 3JATA 4O1MA 4WADA 2VTBA 4JBHA 1H3FA 5U1PA 3X43A 3O95A 1PHPA 5CT8A 1P7WA 1MOQA 2YMPA 4BNKA 3AV3A 3SYNA 4BFVA 1KJWA 4BMOB 2ANBA 3ZR4B 3G8CA 4BGIA 5HKKD 3NIDB 3VVMA 1SBQA 3BX1A 2BBOA 1NXWA 2I5PO 3L5KA 3UK0A 3ITKA 3C16C 3H2YA 4YXWA 2IEBA 1BDJA 4OHXA 5E2AA 3L41A 4R2IA 4FN5A 1PT6A 5DNYB 3C1TA 2ECPA 3GK3A 1IB0A 3I0ZA 1V7CA 4JR0A 1J0XO 1Z16A 1M8FA 3RV3A 4BGUA 1JZSA 3COPA 4FQ8A 4ZDJA 4U7DA 3QE0A 4J07A 4LI0A 2FP4A 3ZQ4A 2NQTA 4H6XA 1OFGA 3ZGLA 4JT4A 4D3YA 1G6HA 1ZINA 3BD6A 3NPMA 4I55F 1UDWA 2QD5A 2CLIB 1T10A 2WK1A 3GUHA 3NTXA 3QEKA 2FLWA 1AA6A 2PBLA 4TQ9A 3M1LA 4RFVA 3I12A 4IOMA 3WLPA 3QI2A 2CVPA 1XEWX 4AKEA 3AB7A 4OKIA 1GZSA 1CRZA 1KTIA 2JGNA 3KPVA 3CLUC 3RKRA 1WCXA 4B84A 3BGDA 4KFUA 4LAFA 2RGUA 3NI2A 1TT5B 3PTZA 4TL7A 3SDZA 1W1WA 2ZCVA 2C5GA 4YFVA 5ALNA 3ZHUA 3OF5A 2A14A 2E6UX 3RS8A 1F17A 5FUBA 1U0BB 1DJMA 2A0KA 4GNKA 4INOA 1U8TA 4IX9A 3RROA 1V8DA 4Z9AA 4H1WA 1EUZA 1YDMA 4J2TA 4KE6A 2IV3A 5JQGB 3AOEC 4UOQA 2ON6A 2JATA 2W42A 2FGJA 2G9ZA 1R5JA 2H4WA 3KFXA 4FDMA 4HP8A 2JJQA 3SHWA 4ES6A 4DIOA 2C7VA 2DMRA 4MMXB 4LXUA 1SCBA 1K7EB 1FP6A 1GKKA 3SHOA 1DKMA 1CQZA 5E8RA 3JQRA 1V8ZA 1JS1X 1DX9A 2OD7A 3LRTA 3T7RA 1FYVA 3D6JA 3AVXA 1RLOA 5HIKA 1O8CA 1N6RA 3LRPA 1HDGO 3ZW8A 3IXMA 4MW1A 3V1UA 1SN7A 2PD4A 3DT9A 2QSZA 3V1LA 5JMTA 1XZ8A 1AO3A 3SEZA 4E2FA 8OHMA 2FV8A 3AFIA 1RMTA 4TOIA 5D3MA 4UAJA 4MKGA 1M0SA 3LVFO 1A04A 1AN0A 1VA5A 2B5WA 3L6OO 1XO1A 4Z9XA 2LWIA 2QP4A 3FROA 3S2EA 4MQFA 3S2GA 3BTSA 4GWLA 5EHNA 1HFWA 3VNUA 4I4NA 1T36A 3D0KA 1PL7A 3BERA 1WMBA 3WWZA 1STOA 4Y18A 1EB9A 2OXTA 2IZ1A 2AUMA 3R7WB 3I4FA 5DN9A 2O6HA 4ED9A 2C83A 4R8MA 1I7NA 2WJZB 2JFHA 4J0KA 4IMJB 1MVNA 1XEWY 2FUEA 3JQFC 3O4RA 4LC0A 4NOLA 4RTNA 3INTA 3R9XB 4QATA 4I9HA 6GPBA 3M4ZA 3OJOA 4K8RB 3K35A 2XNCA 3LT4A 1NASA 2DFVA 2ZI6A 3AH8A 4LJSA 1UK6A 3OEWA 4BFXA 1BTOA 1RWWA 3K5PA 4WGFA 1K08A 4NYMQ 2HWXA 1LRJA 5BNTA 3AUUA 3NCTA 4U2EA 3VC7A 1NFQA 4X93A 2VS1A 1C14A 2XUFA 2YJNA 4TX1A 1DRUA 3RADC 1YQWA 1YIAA 1GZHB 1THZA 2W6ID 2GCOA 3G17A 4QPNA 2R00C 3BZWA 4FOOA 1WD7A 5YASA 1ZRHA 5HYVA 3MPUA 4BCCA 4JLUA 3V4ZA 4UNRA 3RUCA 1MC4A 1LS6A 3QPVA 1WSBA 3T5AA 4D3SA 2PT9A 5CEJA 5KVSA 5E9AA 2QUZA 5HKBA 4B48A 1KQFA 4TS9A 4MKIA 1XWFA 4E5UA 3KLPX 1RWXA 1IATA 4HAYA 1BGWA 1XG5A 2I1VB 2FCRA 1ZMXA 4JR2A 2WPDA 4PLCA 2CL7X 5FTWA 4CKWB 3I09A 3LT1A 3IEXA 3BMCA 3PD1A 3EVAA 4KE9A 4RGQA 3PC4A 5KMGB 1ESDA 1WTCA 4R98A 3ZBPA 1Y5LA 3EXG2 1J20A 4IFBA 3TD9A 3TTVA 5C4IA 2DHDA 4YGYA 5ICCA 121PA 1C7ZA 1KDYA 5KSOA 1UZAA 4Y2TA 3M5DA 3B36A 1TIKA 3WFIA 3OUZA 3EA0A 1U6KA 2GBPA 1JPNA 3KUUA 4LK3A 1CY0A 2OVBA 2RBKA 2A4MA 1SK9A 2GZMA 5CVEA 2ODAA 2VDVE 4D9FA 1W4LA 3P0FA 4GRAA 1FFSA 1M2FA 2WMDA 5AOCA 3VR3A 3LD9A 5K4AA 3SIWA 1RM4A 4B7UA 4C1NA 1WUIS 1HLDA 4CNQA 3LWBA 2VPYA 4LFAB 4BHTA 4HXGA 4HRXA 3B70A 3T9EA 5B12A 1UZUA 2DP4E 2R4TA 4H6VA 3SQNA 5KTOA 1Z0ZA 2NSHA 4Y1RA 1Z0IA 2G82A 3ROKA 3KR0A 3H86A 1JEYA 4N9QA 2WKRA 1FE8A 2DJ5A 2J9ZB 2FPXA 3K8YA 3PI6A 2HHCA 1FIUA 3CA8A 1C41A 3AUFA 3CY6A 3F46A 2FUG6 3PEFA 1VLLA 1YHYA 4CIYA 4I81A 5DEIA 3SXUA 5DP1A 1D4AA 1UH5A 4Y6SA 3P0RA 2Z58A 2PDAA 4RKYA 4PHTA 1P73A 1TECE 1JXAA 2OE2A 1N0UA 1H65A 1AIPA 4Y9UA 4DREA 4EUEA 2OV1A 3OU2A 3UK7A 3KQMA 2J6BA 1XLTA 2YY7A 3HFSA 2GRAA 1T8RA 3PRKE 4I4TF 3E27A 2HWUA 4K9RA 4L95C 4YAFA 4JI1B 4YJFA 3HACA 2QTVA 4C2UA 2DY0A 2I2DA 2HHJA 5E1OA 3DB1A 2ZRMA 4C4YA 2P6RA 1ADGA 2E6KA 1UAAA 3R8CA 1TYCA 1QP0A 3H97A 2WUEA 5DI9A 3BFKA 1IAQA 3PD7A 4IFIA 2H7CA 1Y4DE 4YRNA 1Q95A 1VIVA 3E8XA 3IPLA 7AT1A 2NTVA 3C24A 4UAGA 1RPAA 3VGPA 5J47A 4XW2A 3Q8LA 5LIPA 1PJCA 2WW8A 5IKXA 3JRNA 3G5MA 421PA 2IS6A 2JFXA 2W8BB 4NPAA 2AKEA 3D3EA 1GYQA 5D5PA 2QN2A 1EWYA 2QF7A 3K6JA 1TO1E 4D0LB 4TXNA 4LHEA 5TGTA 3RFUA 1GZ6A 4UASA 1BMDA 1O5OA 3M0EA 3NOXA 4UAVA 4MRMA 4KXFB 3VPXA 4ZOBA 2FZCA 3IV6A 4KYUA 1T9HA 3MJFA 4IJKA 1E0SA 3VYSB 3GLIB 2J32A 2ZSIA 4ID9A 2PA3A 2ZVJA 1VIMA 3FMGA 4N5NA 4ECEA 3TG2A 5JD6A 3KCNA 1KC1A 4RPJA 1Z73A 4D4LA 2C2MA 2XYRA 2ZAIA 4QU0A 1SRQA 4N3AA 4HK4A 5J5CA 3C4JA 3JZAA 4EPYA 3FH0A 3NM5A 2ZI5A 3QEAZ 4NMWA 1ZN7A 1T0JB 2BSAA 2CJYA 3FZNA 4H7FA 3V8EA 4LYAA 3VSCA 1ZHFA 3EG5A 2BM9A 5HWSA 1GUYA 4NYIQ 2QN9A 2UZIR 1Y6ZA 2PSDA 2Q3CA 4DA6A 1GSAA 2VWQA 2XUPA 2AG6A 4MWEA 4MLDA 3KEFA 3EDYA 4EARA 2QYSA 2OD9A 5D7NA 5A7FA 4ABYA 1Q1ZA 2GPNA 1T5IA 2D5CA 2O05A 3PQ6A 2RGAA 1BHO1 4RMJA 3GFTA 4C4TA 4RSMA 2QRUA 4HD8A 4IOJA 2WWYA 4H2DA 2Z6AA 2EBWA 3FKQA 3GLHB 2GEKA 4LQCA 3AF1A 5K6RA 2WA2A 2YMLA 4LC1A 3K9QO 4H18A 4UE3S 1WHTA 2BUCA 1GGEA 1WSDA 1NF8A 2WFLA 5CDUA 2IF0A 2ODEA 5K0NA 3B1YA 3M2PA 4WHMA 5F9FA 1T91A 4BY9E 4COKA 1HTBA 3EWAA 3CPJB 5F1PA 3VPDA 2BMVA 4CIBA 4LZZA 4XQCA 3T5TA 3AT1A 4FCVA 3EA4A 2Q1TA 2RGCA 5ICMA 2V1UA 1VYUA 2PMCA 2DGDA 3CX8A 3ED5A 4A9AA 5A9SB 3RU2A 1BGVA 1Q6YA 3O1HB 5C80A 3GJSA 2C4UA 3I1YA 3NJ4A 1H8HA 3H13A 1HZZC 2YC4C 4KLNA 4RELA 3MT0A 2MR6A 3RKSA 3HFJA 1C9NA 2EVWX 5H3HA 2C2ZA 1MP0A 3FGPA 4G8DA 1YB1A 5KJ6A 3B78A 3CRVA 3CV3A 3GJ3A 2DTEA 3LOQA 2I1QA 1AQYA 1KO4A 2YVKA 3NC4A 2R1VB 2BEWB 4GEKA 3IMEA 4OXYA 5FT9A 3LK6A 5HFJA 3NHFA 5A05A 3D6NB 2AXPA 3H5AA 1GG2A 1XMVA 1ZWKA 4JGBA 4TTJA 3WTBA 1ODCA 4HAXA 2Q45A 4F6RA 4BNLA 2I4OA 1IULA 4UVGA 1E8MA 2HQBA 1UWVA 5K20A 4E46A 1DJQA 1TKRA 1JQ5A 3GU3A 3SR3A 4MGKR 1KJYA 2JARA 3CB2A 5FA8A 3N5CA 4ZWNA 3R76A 1N5RA 3OM0A 4G5RA 5GADl 2MSWA 2P2LA 2RGEA 4RK0A 1IY0A 2F3TA 4YP7A 4P84A 4N7MA 4PR0A 3HKCB 3I92A 5HQTA 1QKIA 3NUZA 4QARA 4Y2VA 4A8JC 4DV3B 1TA9A 1XCMA 1XU4A 2R6GA 3I2IA 4PTYA 2GN2A 5EQTA 1MCZA 1N2BA 3LY9A 1JQKA 4OB8A 5B1DA 1PEKE 4D9HA 1BN6A 1F9AA 1RQ7A 1TUBA 2RI1A 4KI7A 2ARKA 4K26A 1XWWA 4TXMA 4RIHA 3TMKA 3ETGA 5JNWA 4NFLA 3AEYA 4EKNB 1X8XA 4YUYA 3R7SA 3ESRA 2FW1A 3KNZA 4QYXA 4ZC8A 5BVHB 4G0VA 3BFVA 3OU6A 3THRA 5WRFA 1XQ6A 4YAKA 5HQJA 2BELA 4LZWA 4KR9A 1J2JA 5KX5A 3PQ4A 3L4BC 2WD7A 4S05A 1LLUA 2QVGA 3GCWA 4GOKA 2NZ8A 2QVZX 1NBIA 3CN9A 4LYDA 2AR9A 3GNTA 4KQKA 2VHYA 2XDAA 2XSZA 5L3RA 2HXYA 1ZU4A 2B0CA 2XZOA 2V7XA 3HDTA 1E5LA 2MSEB 1A27A 4ZYXA 1DWOA 9ABPA 2B34A 3HDQA 3GMDA 1JQAA 2VZ0A 2W2PA 5IAEA 1KVQA 3T1QA 2XB9A 1BFUA 2O1SA 5SYMA 5JLJA 3D1VA 2I4RA 2W8ZA 1EG7A 3RSGA 4QEDA 2R85A 1NXTA 1PFQA 2G8LA 1KNQA 1QHYA 2HJRA 3OTOB 1LC3A 1Y81A 1G66A 3OIVA 2UDPA 3PDHA 4HFJA 4DXHA 4N0EA 1I10A 1I3KA 2FZVA 3EYAA 2QR2A 2QXYA 2X77A 4H0CA 3ENWA 1LI4A 2HF2A 1XZIA 2ZKIA 1MMFB 3KYCA 3JASA 5AW0A 1F8XA 2GB4A 4G4SP 4C76A 4IDEA 4I9UA 4PSKA 1GT6A 3CLVA 1K06A 1M6VA 3L8GA 4WLOA 3R20A 5C0OE 3OLXA 2PY6A 2PKCA 2GCIA 3IR7A 3TMYA 3NAMA 3OJWA 4K7JA 5CK5A 1QGZA 2QRVA 1Y9EA 1PZNA 3E0XA 3K96A 4J16C 2DR3A 4FHCA 5BWLA 3REQB 5KJ1A 3KKZA 4DM4A 5DNUA 1AKEA 2R8BA 2QTCA 3JY6A 3W05A 1LDGA 1DO8A 2FR8A 3KUDA 3OQ6A 3V1NA 3MQFA 2BVNA 4Y7CA 1FTQA 1A8UA 3I9JA 4LYGA 3WGVA 3ADDA 2CXHA 1IOWA 1YQTA 2DH5A 4HATA 1VJ5A 4MEJA 5JYEA 10MHA 1HRDA 5CVTA 3SNHA 1N4DA 2D8AA 2GOYA 5LQAA 3T1TA 1GUFA 4K1XA 5GTDA 3TEFA 4K6CA 2C2KA 3HN2A 1FZTA 3A6PC 1YIDA 3MCWA 5F51A 1YQDA 4L22A 2XQIA 1UEXC 2RIRA 3LUFA 4UEWA 1QRTA 4C4SA 4NOJA 2J8ZA 2PTHA 1Y1PA 3GAZA 1JHDA 3RBAA 4IMRA 2FP4B 4P2GA 1KZ9A 3AIIA 2D2FA 2XOXA 4CCAA 4TMYA 4PX2A 1RMYA 2RC5A 5F2OA 3U7JA 4Z7JA 4HZUB 2VTKA 4ALKA 4DVJA 3SJAA 1VE7A 4R40A 3F6RA 2BGJA 1AUXA 3G9TA 3R09A 4MV3A 1NUUA 4Q02A 3GZNA 1JB1A 1Z5GA 2BR3A 3IAS1 5JWOA 1LWOA 2OB1A 1C3VA 2AQHA 2X58A 2ZR7A 3DQQA 3F7TA 3VO9A 3V8BA 3VSBA 4CR8A 4D9JA 3KQUA 2UYHA 1H9AA 1VI2A 3QU4A 2D6FA 3TG8A 4NI5A 5AICA 4N3NA 3UJ7A 1ZI6A 4ZTBA 3TOSA 1D1SA 1FXSA 621PA 2JI6A 2Y1FA 5IABA 5AQEA 3IKJA 5CMLA 2D2EA 2OLEA 3RAJA 5CCXA 1H6DA 5FR2A 2FDRA 2OHHA 5KDDA 5KI6A 4F4CA 1CUVA 5ITWA 2IH4A 1FVHA 3P2JA 4RBNA 1BE6A 5EGNA 3S8EA 4L07A 3ZGXA 3A3PA 4RIGA 2J46A 1O9HA 3CUVA 4UD2A 1BFDA 1AC5A 3G2LA 4OQQA 2XUKA 2OV2A 3FX2A 1WS6A 3G0HA 1FRQA 2REQB 3M4JA 3OSUA 5IAGA 4AI6A 3UCFA 3RUIA 2ZIFA 3E6AA 1JHOA 2BGTA 4Y7DA 1V48A 4QM6A 4HGNA 1KMMA 1G4UR 3K70C 3HI4A 3I9FA 3IAXA 3M5WA 3PU6A 3SLGA 2DWCA 3QUQA 3VC1A 2F3QA 2PE5A 1V1RA 5D3MB 2Y1XA 4FMDB 3JAKA 4HYEA 4YYEA 1DTWA 4MQFB 2GM9A 2YWXA 3KZVA 4JMPA 4MKXA 1LPAB 4MMYB 3H6KA 3KQKA 3AY0A 3EPHA 2D1RA 1B73A 3KSZO 1AB6A 2F8TA 2PNJA 4HNVA 4LBVA 2G6BA 4J9VA 4JOBA 3DMTC 3NM4A 4BJ6A 1F4LA 4L4RA 4QE3A 3ZWXA 5KNDA 1HNWB 4Y9DA 1TQHA 4G0XA 4G67A 1E2JA 1E98A 1K6EA 3GNLA 1E2DA 2L42A 3R6TA 4Q05A 1E18A 1I7SB 1F0PA 3EWSA 2ATCA 4IIGA 1A5AB 4MWDA 3AC0A 2OV6A 1TLFA 5ECDA 1HE2A 3MCAA 5B4VA 3DMDA 4AZWA 1YS1X 2H5LA 1FP1D 4X1IB 1SK8A 2WZBA 2ZZKA 1ZLXA 5FPQA 4ESVA 2IS4A 3CW8X 5KDOA 1X7GA 3KP1A 4R1MA 4XVHA 4BS9A 3MFYA 1ST3A 6REQB 3U80A 1ZOLA 3EAQA 1EQUA 2WNHA 2OV8A 2BH9A 3A26A 3RIXA 3NTOA 4RK4A 1FDUA 4QDXA 1V8BA 1JA1A 3OQHA 4GKVA 1QFZA 4EHLA 1J2EA 3A9UA 1DFIA 2NUTB 3B52X 2W98A 3VU3A 4FONA 4FFSA 3ZJYA 3VR5D 4J6EA 3DKPA 1ZVKA 1F3OA 4GI3A 1DTEA 4BV3A 3G0GA 5HILA 1SVIA 3OI7A 1EX1A 1Z2OX 3U9LA 5JDIC 4UDNA 2CNBA 3TTWA 1PJBA 3KVOA 3V33A 2AN4A 3NR2A 4HDQB 4S24A 3W5JA 4L7VA 1YR7A 1O4VA 4MW2A 3UK1A 1HNXB 1FTYA 3S44A 3KYBA 1E1NA 2XA9A 2HEIA 2AG1A 1PUXA 2H1CA 1ZUNA 1J0CA 2OO5A 3G89A 4PLHA 3BMCB 1T26A 1YA4A 3JSXA 5CT6A 3U6KA 1T0HB 2HSGA 4EG1A 4NBRA 4JEMA 2BKVA 1Z0DA 2C00A 2M98A 4GDMA 4PHCA 4TLAA 2QMYA 4YP1A 2Q5QA 4DPKA 4JITA 4FHFA 1DEHA 2VA9A 4M1TA 4Z9BA 4D8YA 5FWXB 3UGJA 2DLNA 2VAPA 3GLIE 3L01A 5M3BA 2CYCA 1Y7TA 4P08A 3UMSA 2V9CA 4EYKA 4TLDA 1SVLA 5K3AA 1LTHR 1M33A 1XA4A 4PYRA 4E30A 1U7DA 1X0XA 3V4SA 1RZUA 2TSYB 2IP1A 3N2LA 1JLSA 3NHZA 1KU0A 5L3SB 1K8QA 1KAQA 1GSHA 1UBJS 4X92A 3K2IA 1M2OA 4IBOA 4IJVA 3GJQA 4KXMA 3BULA 1WPRA 2G1PA 1E0JA 2Q1YA 4FHDA 2ZYAA 2EF0A 4O0MA 4CV3A 2WZQA 1LUAA 3HCAA 4GBMA 2FG6C 5CX1B 1CUWA 2VSOA 4Y1RB 3IDQA 3QXSA 4YUVA 4XSVA 1M2WA 1WEKA 3MEQA 3OP1A 3GC6A 3VAZA 3RUAA 4HNUA 1B2LA 2REBA 2O0MA 3KOOA 1V5EA 3KKEA 3H7AA 4BP8A 4DBLC 3UY4A 5HE9A 5BRJA 1VP3A 1Z2PX 3MYYA 6NULA 3GLHE 2ZUUA 4QUJA 1OFHA 2Y05A 3OZVA 3SXUB 1PT7A 2WMNB 3GJ5A 4IIVA 3S3TA 4DM7A 4YQFA 4F4DA 1R5OA 1GTSA 2RI6A 4H7KA 2DBQA 5A6VA 2AUNA 1UT8A 3MW8A 2KQUA 5K01A 1A5SB 4HYTA 3A6FA 1R0KA 4BX0A 2PPLA 1JWLA 2IYAA 4NG5A 3WICA 1V35A 4PAWA 3N6RA 3P0JA 3NORA 1F2DA 1IYZA 1LNZA 2W48A 4YJFB 3WKCA 4IV8A 5KCZA 1JHQA 1PHRA 1H1DA 3EHEA 4FX5A 3UVEA 1QKKA 1ITZA 4HO1X 5FTLA 4FKZA 3IUMA 3BF7A 3IVMA 3PGMA 2HTFA 3CFYA 1L5LA 2OSBA 4CLDA 5TIIA 4IJ5A 5BSEA 2Q7XA 4W1QA 1UKZA 2XMRA 5BR7A 3ZHQA 2BMJA 2FFAA 4AY3A 1EPUA 1RI3A 1T4CA 1ZM7A 4G4SO 5H83A 3MB8A 4YCAA 3BSFA 5L3ZA 3T99A 3GLGA 2IOQA 4WFJA 1NV8A 3T94A 4RORA 3A6LA 1G2QA 3TAUA 4Z1MD 1RQLA 2OCDA 1K98A 3DMNA 4C7MA 5J1SB 3FVVA 5JDCC 1A5TA 3H18A 1G3MA 1N4AA 1IRIA 3OECA 3TW0A 3MTEA 3WB1A 2QX7A 4KRXA 1PJLA 2B9VA 2QUBA 2J3HA 2YJ5A 2PX8A 3OZAA 1U8CB 4LXGA 4GBJA 4QEKA 2P7HA 5AK0A 1B41A 3GRZA 3QENA 3UJNA 4MINA 5AVYA 3BK1A 1NBME 1I80A 2GF0A 1KZGB 1Y8QB 4MVJH 2CUNA 5BV7A 5CA1A 1YXMA 5L3SA 4CF6A 4YRIA 2W2LA 2IZ7A 3HUFA 4N18A 4XYMA 2R79A 4ZXPA 4BNUA 1U98A 3IIKA 4HLCA 3LPAA 1MENA 2QQ0A 1HDYA 3SP1A 1V8OA 3FNBA 4AM8A 3L0YA 1H9CA 3STYA 2HK6A 3NYRA 2B61A 2CYBA 1YONA 3PTLA 2IDMA 5IG2A 3OHPA 3FOZA 2FEWB 4ND1A 1TD9A 4QO8A 5JAQA 5I51A 1LXCA 2CXRA 1ODIA 2P0AA 4NULA 3IQGX 3TLEA 4DLBA 1WHTB 4DYDA 3FTPA 2OFOA 2WFLB 1UOEA 1H23A 4WXMA 3CS3A 4WJLA 4HQNA 1UBTS 2Q4TA 3OMLA 4OBWA 1G38A 4RMNA 1MPTA 3ZY5A 4ZT7A 3L7YA 3RTEA 2JAXA 1PO7A 4KE8A 4ZVMA 1R6VA 4B6OA 4FP9A 2EJTA 1BYIA 3Q3JB 1GTL1 4L27A 3A1TA 1PP4A 1L5NA 4OQMA 3SC4A 4INPA 1Q0SA 2ECKA 1CBUA 2B37A 2FFRA 4L0MA 3WJ7A 2JLCA 1PYDA 3GLSA 3T3IA 1I4TD 4MYSA 1MQ9A 1TCUA 4PEVA 4HEA6 4MS4A 3IE0A 4PC1A 1ZLYA 5JPIA 5JV5A 1U9ZA 3V6MA 2WVHA 3KEMA 3QV2A 2VXYA 5DASA 2C61A 2AN5A 3O8RA 1UZMA 2ZBUA 3HRKA 1P77A 1YACA 2IGBA 3OZXA 1WQ4A 1D0SA 1GG8A 1I3NA 1Q0ZA 3WV4A 1K0FA 4WZAE 1DXQA 3CCBA 3PC7A 3RIMA 4EVRA 2IFTA 3FFTA 2C7OA 1OBOA 3D8BA 3KC2A 1TEHA 4OMDA 1HRKA 2XUQA 3K9HA 3UT5A 1NN1A 4HN2A 3J7AC 3F49S 3COJA 4MUGA 2IYQA 4RH0A 1L4KA 3QU9A 3HY6A 2O2YA 1AM4D 1UFRA 1Z9BA 4O59O 4ETMA 2HHLA 2ZR8A 5EVJA 5IN5A 1PF7E 3Q8WA 3FSEA 1VOTA 3VNRA 4W5HA 1ICEA 2BKUA 3A06A 1PTJA 3O2JA 1AMOA 1TO6A 4IG4A 1RACA 2ZETA 2Z2YA 1TUBB 4R1PA 3DQPA 5AK3A 1FFCA 2GPBA 2H4FA 2MSDB 2JW5A 1X74A 4ZV7A 2FXVA 1QSGA 4RZSA 5JS1A 3EULA 4P32A 3TRDA 3RC8A 3BTOA 2FFJA 5DBEX 2IUEA 1MNQA 4Q6BA 2JBHA 3ED1A 3CE6A 4CGYA 2HLPA 2P77A 3H9UA 4QGGA 1WPXA 4FW9A 2WD7B 4Q4HB 4ZU3A 5DHSA 4ARBA 1M0WA 1OX4A 1T1SA 3WJ1A 3ZGOA 3SMQA 3HJAA 2I7VA 1KVRA 3MOIA 1CUIA 1GZ5A 1JLMA 1VZ2A 5IVHA 4GM0A 1JLRA 2Y93A 4JP8A 1IVNA 1EXWA 2IZ6A 1CUUA 2PZLA 4U0JA 4B2IA 1PZGA 4E5NA 4PQEA 3PIIA 4LRQA 1PSZA 3QYPA 4WT7A 1EVJA 2JCYA 2M6KA 1O94A 3U1TA 4AXBA 1VL1A 3BA1A 8ADHA 1FU4A 4NNPA 3FLMA 4QUKA 3KKLA 4NU6A 5TB5A 2OHOA 4TZTA 2ABWA 4KQGA 1MT0A 2RDMA 1N5IA 1Z5PA 3NEJA 3JASB 1CQWA 4OGFA 4WH0A 2ZSJA 1M6VB 2Q8QA 4MUEA 4KGXA 3O82A 3G6KA 4PY2A 1NMXA 1ZM3A 4AZ0A 2C94A 3GMSA 2QRVB 2JD0A 1ZD5A 1OFUA 3AF3A 1X19A 1WCYA 3QPCA 5F52A 4C7BA 2HMUA 2A1UA 4BMXA 2B92A 1G1MA 3PUIA 2D06A 3L93A 2FZ5A 3GW8A 3JQAA 4MV1A 4BDTA 4MPJA 1Q11A 4F5WA 2FRDC 3AFHA 2VTVA 3PDWA 2HA3A 1N6PA 4JLMA 4QX6A 1FA9A 3CZMA 2B8EA 2QN3A 3KVYA 4EPXA 5IASA 1ADCA 1IHYA 3ZI7A 1T6YA 5G41A 5NLLA 4ZEXA 4UHFA 3O91A 5DYWA 4DTIA 5K2OA 1QIDA 3BMOB 4W7HA 4AD8A 2FVXA 1N6LA 1ZICA 5HUJA 2CWWA 5FWYA 1RXWA 2G88A 1JQEA 2FQQA 3OESA 5AH0A 3VMFA 1GQ2A 1F1BA 4Y2YA 3SSMA 2AMYA 1UJ2A 3LL7A 4B4DA 1G5QA 4KWHA 4Q3LA 2KWIA 5T64A 4LJ8A 4DKJA 1WABA 3JWIA 5HCUA 1FJHA 5JLAA 1P1CA 4PO9A 4F21A 5LD2C 2EJBA 2AT1A 4S1TA 5DK4A 2QD3A 2YFQA 4ZVQA 5MN5A 2G1AA 4PO3X 2HBYA 4CRWB 4NCBA 5GVSA 1YS9A 2Y9PB 4BJ5A 3A31A 1TUEA 4DZZA 5IJ9B 2PV7A 3LT5A 4U3JB 1DLIA 1E94E 4YAGA 4R8RA 3AV0B 4NOKA 3I5XA 1X7WB 3FCXA 3DDZX 1CJTC 4V0KA 2YH2A 2I4MA 1N2XA 3O1LA 1BZYA 2WJIA 2XQVA 3I6BA 3DHVA 1DC5A 5BXYA 3MWKA 2FFHA 2UZ1A 4LQDA 5EC8A 2CJPA 3PC3A 2ID4A 2I6XA 4TN5A 5J59A 3F6CA 4Q9IA 1U2EA 4IQGA 4J90A 4M0KA 4BZWA 2R8ZA 2B78A 3U3KA 3E7FA 4OFZA 4KLCA 4HBZA 1P7PA 2VDLB 1E20A 2LRHA 2BONA 4M0EA 1BQEA 4KN5A 4DHWA 1NGSA 3SG0A 3VZRA 4EPVA 3VR3D 1B6GA 4GUDA 2I67A 1Y7IA 3AGQA 2NQ2C 3M2TA 2OBLA 3BC1A 4MGHA 4QYSA 1VIYA 4BO5A 3H2HA 4Y2SA 1U81A 2QL9A 2QAGC 2NSDA 3EQ9A 3OCWA 5GWXA 1MB3A 4CG2A 2LUOA 4HXEB 4ZCQA 5DWQA 4EL0A 1NNUA 4JQCA 3D8SA 3NHPA 2NYAA 4W1SA 3V1MA 1V1RB 3D0OA 1F7UA 4OXNA 3J80A 2OBMA 1D03A 2J9YB 1DTWB 2R48A 2RB4A 2VSNA 2AUTA 1W47A 2JAPA 2QE6A 3NATA 4JEIA 2A94A 2FPPA 2PSFA 2B5VA 2J3EA 2OZPA 2PX0A 2V6FA 3QPAA 3KB2A 1Q0UA 4PPQA 1O96A 2QU7A 3ZWBA 4BO4A 2HY7A 9LDBA 3ZV3A 3FZQA 2AMVA 3OBIA 3TZHA 3JWPA 5FEMA 2JIZD 3G0IA 5E7JA 2I6SA 3BRSA 1CZKA 1E3MA 1JIIA 3QFSA 1FDTA 3Q8KA 4AF6A 4BTVA 5G0VA 2W90A 3GGPA 5DE3A 1JEQB 2WT9A 3UEOA 3AOGA 1Z5UA 1P9WA 3S7TA 3H2BA 1X1TA 3T9DA 4FHEA 3PL5A 1T13A 1OXVA 3P27A 1JEDA 4HPJB 4MWGA 3ZG6A 1DCMA 4BFWA 5KX5B 1QP7A 1ZUWA 2GBFA 3DFMA 3RIGA 3HYLA 2IYPA 3T7IA 2PLRA 1OHHA 3P45A 1X87A 1XI2A 4RVGA 4FS3A 5JSZA 1JQDA 4O4HA 4WJKB 1V9CA 4ZMBA 4J1TC 3VDNB 3LUKA 1HKHA 4LHXA 1Z0JA 4DYVA 2G5GX 4UM7A 4AQYB 5EJIA 4LTMA 2GQ0A 5KAPA 4YDQA 4OD0A 4J91A 1SD1A 2VHQA 2BGWA 1L4NA 3PC2A 3ESAA 4C0QC 4B3BA 5J2TF 1XVTA 3G2JA 3LHIA 3WG9A 2M32A 3UA3A 1KI2A 1NBOA 2JAUA 2WD8A 3H2JA 4RHCA 3QE4A 4LWZA 3HV2A 3B5JA 3WVNA 1PAUA 1Y7LA 4CHGA 2Y2VA 2CZGA 1A7UA 1NOJA 1QC5B 2VDWA 1GDTA 1LC0A 2ZSHA 1FMTA 3OFNA 4R6XA 1G18A 1TAUA 4HGYA 1LQTA 5EWLA 5F2KA 1LSUA 1XJ0A 1GL3A 2GZRA 4B75A 3IO3A 2NSJA 5U4QA 3B1JA 2E5FA 2WFZA 4EHBA 5JQWA 4JI2B 5FDFA 1KAHA 3TBHA 3O8CA 3E4CA 5EZYA 1GGMA 1P4SA 2VI5A 1HDEA 1Q6ZA 3WWOA 4CF7A 1R0SA 4KR2A 3TVYA 1KJ9A 1V6CA 4QPJC 2J5KA 4P38A 4EO4A 4E08A 2QS9A 1XNQB 3H1PA 1FQWA 3FNFA 3M6LA 4LG1A 3IGFA 4LDPA 2J0EA 3N53A 3MNFA 4NAVA 5AVZA 1XL1A 1V5IA 5M04A 1WXEA 4HX9A