5HDQA

Mntc co-structure with mab 305-78-7
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
277
structure length
273
Chain Sequence
LKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/immune system
molecule keywords ABC transporter substrate-binding protein
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 98
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA01
4FKMA 2XY4A 4M7OA 5GGYA 4WZAB 1EFDN 5M29A 4XPIB 4UTOA 3ZKAA 1MIOA 2RG7A 3R5SA 4HMQA 5B58T 3BE6A 3HH8A 5CR9A 1QH8B 3UJPA 4FI3F 1N4DA 3K1AB 4MO9A 4G09A 3LHSA 5M2QA 2MINB 1PQ4A 3NU1A 1KARA 1M1NB 2XV1A 4WZAA 4XPIA 2OSVA 2QI9F 4G07A 1QH1B 2YNMC 2OGWA 3EIWA 2PHZA 1QH8A 1K0FA 1FP4B 3K1AA 1QGUB 2MINA 4IRMA 5CX1B 1K75A 4OXRA 3ZK9A 1M1NA 5JG7A 3GI1A 1QH1A 4NNOA 3G9QA 3TLKA 4PM4A 1KAHA 5HX7A 4INPA 5I4KA 3CX3A 1FP4A 3PDIB 3ZK7A 1QGUA 2AFHB 4INOA 1G21B 2ETVA 1L5HB 4HN9A 5CX1A 4WZBB 1M1YA 1M34B 2M6LA 4UDOA 1H1LB 4OXQA 4WNAB 4PAGA 2X4LA 3TNYA 3BE5A 3LI2A 4TKUB 4UDNA 4WESB 5JOQA 4LS3A 3PDIA 3AEKB 1ESZA 5KOJB 1G21A 2Q8PA 1L5HA 3MWFA 3MD9A 4WZBA 4MDYA 1M34A 3AEQB 4LJSA 1H1LA 2OV1A 4WNAA 1N2CB 4MX8A 4UTPA 4TKVB 4WESA 4TKUA 4FNAA 3EIXA 5KOHB 2OV3A 3AEKA 3HJTA 4H59A 5KOJA 1KAEA 4B8YA 2R7AA 2XDQB 2PS0A 5BVHB 5KHLB 3AEQA 3AETB 3AEUB 3PSHA 4GICA 1N2CA 3MINB 4TKVA 4MLZA 1G20B 5AFSA 3PSAA 2XUZA 2AFIB 3MWGA 5KOHA 3ZK8A 2PRSA 3TEFA 2XDQA 5BVHA 3AEUA 2AFHA 3AETA 4DBLE 4HMPA 2Q8QA 3MINA 5HDQA 1G20A 3AERB 2M6KA 3ZTTA 2XH8A 4NNPA 5FLYA 1N2ZA 5GGXA 3U7QB 2AFIA 5BVGB 4N01A 2R79A 2PS3A 2YNMD 1PSZA 2O1EA 3AESB 2PS9A 5JPDA 1K2VN 2XQVA 1XVLA 4OVKA 4WN9B 5M3BA 3AERA 3HXPA 4HMOA 4ND8B 3R5TA 3U7QA 1N4AA 5BVGA 3MFQA 4BBPA 5M34A 2WHYA 3AESA 4FILA 4H0FA 4K3VA 1TOAA 4WN9A 1MIOB 4CL2A 2WI8A 1K7SN 4ND8A 5JJ5A 1M1YB
chains in the Genus database with same CATH superfamily
3V1MA 1EK6A 4LZWA 4DC0A 1G59A 5I9TA 4YYEA 4Q1AA 2GF9A 1NR7A 2AUTA 3ED1A 1E2GA 1GADO 1JGTA 3LUJA 2ZXFA 4QOEA 2P9ZA 2VK4A 4XPIB 2RIPA 3KEFA 3WO1A 3I8OA 5EZ6B 4DJ5X 1XMQB 2QMYA 3LL7A 1EHIA 4MKGA 1CU1A 3BMQB 3BB3A 1ID8A 2ZKLA 1UDAA 2YHIA 3R5HA 2Q50A 1T5OA 3TZKA 2PKRA 1PHPA 3MD0A 2OOSA 4A82A 1YONA 1SD5A 1E6CA 1USKA 5C7YA 4LDQA 4PYIA 1T9AA 2NVBA 2QAIA 3HCFA 3UOWA 2YTZA 4E12A 2AXQA 4NULA 8OHMA 3DMNA 1YQUA 2ZT7A 1GAQA 1PJAA 1QYDA 2DTXA 3KZKA 3ZWMA 4CXMA 2XMRA 3IS3A 2OGSA 3JWIA 5BRNA 2VJLA 4B48A 1MJGM 3GHYA 1V16A 3CSDA 3I04M 1T6YA 1NF2A 3ZU5A 1E1RA 1OLOA 1WHSB 2JASA 3BZWA 3CG4A 3NVAA 5B57C 1O54A 2BEJA 3IPAA 4NEQA 5IXYA 3M2TA 1BQEA 1SIOA 5AQEA 3PJFA 1ZPDA 3K70C 1W47A 5CX1A 4EDFA 1BDIA 3RSLA 4II2A 4YREA 4V0LA 2M6LA 3U7IA 2HEIA 1G19A 3HLYA 4Z49A 1E9RA 4WV3A 3M4JA 5IEBA 4AJLA 5CGZA 4M22A 4OHMA 3DEJA 1P1CA 1T0JB 2EW8A 1GTRA 2KS6A 3NEAA 3LC7O 4IS3A 4LSMA 3IT3A 2AJ8A 2PH7A 4NS1A 1V3TA 1KHTA 3GJZA 4LECA 1BGVA 3DBOB 3JQ9C 4DZTA 3PBKA 3AM3A 2XT9A 2SKDA 4DLYA 5BN5A 1X7GA 2GJAA 4Z3DA 4US0R 4F91B 2H5JA 1EESA 4FYHA 2W9XA 2DP4E 2JJ2A 3R7DA 4ARAA 2EZ9A 3DHVA 1H6DA 3V8MA 4NZMA 3I62A 2HRDA 3ZGVA 1EFKA 5EJAA 1KAEA 1C9YA 2GHIA 3U17A 4OIFA 1KI8A 1ONOA 1CJMA 4B87A 3RVPA 4PR3A 2OBFA 4KNYA 1RAIA 5KVSA 2HHHB 1XZDA 3I1IA 3PITA 1TFRA 3ETHA 2ZYIA 1HXHA 2UVQA 3ANYB 3I52A 5L4NA 1L4KA 1VCNA 2G72A 2WJVA 2QGZA 1XQVA 1B4DA 1W4LA 1NLYA 2WLTA 3O8NA 5J4LA 4R9NA 3HUUA 1YR9A 4MUJA 2G0NA 1LJLA 1WU7A 4A8JB 4EHJA 1AE1A 4RM2A 5U4QA 4Q15A 2P3SA 4QDUA 3TSZA 3AY6A 4A8TA 4F2DA 5JFGA 3HU1A 3VAYA 3VRHA 3WWEA 5LMNB 2A86A 5BPFA 1ZHOA 1CEYA 1E0AA 1JR3A 2MOKA 1N0UA 1MXHA 1WPGA 2V7QA 1KR2A 2E7ZA 2J0QA 1R6TA 1Y3IA 4HQNA 4CIYA 2QRNA 1OXTA 3V7UA 1EGMB 2ZZMA 1W34A 3ROTA 5HJEA 1RQ2A 2QLBA 1T9CA 2REOA 4GKJB 2ZZNA 1JHDA 2YOHA 3COWA 3WWZA 4DOMA 4RZIA 3LA6A 1SEVA 2OHIA 5D3KA 1XPOA 1RYHA 2WPDA 3A1CA 1XVVA 2IGTA 3P0JA 2DCMA 4P83A 4EITA 2J30A 5KX5F 1HNXB 2GEVA 3A6KA 4NJMB 4KDCA 4ND8A 1S3GA 4L0MA 2CNWD 5DXFA 3VTKA 3ZW8A 4ARCA 4BAGA 4NARA 4Z51A 3JQRA 4EHDA 1C9EA 4YI3A 2B0JA 2WYUA 1EM8B 1KZGB 4JNKA 1ORTA 5TQ0B 3RC1A 2WTNA 3RRZA 3JW8A 3UJHA 3DFIA 3RWOA 2IZ0A 4Q3CA 1GLGA 1DXQA 3AGPA 2FWIA 1K3FA 3UXEA 3SDBA 3HV0A 3ZZNA 4C5CA 5AW5A 4B3MB 3WNZA 1QRDA 2W6OA 5DNCA 3G49A 2M2IA 4LPSA 4QEKA 5TVKA 1K68A 4IMIB 3ILXA 4UCXA 1SU7A 3L8EA 2NSHA 4FB5A 1JEQB 2C9DA 4RVSA 1L5GB 1QH9A 4B33A 4IXMA 5EQTA 1LI7A 1ZIDA 2HDNB 2PTGA 1WE2A 1V2GA 3DKKA 3B1YA 3CLSD 2QG4A 2ZT6A 2HPHA 2E4YA 1A2OA 2VDNB 2VWHA 2XEDA 3D31A 4IG9A 4LI0A 4MVXA 3ZWPA 2RSLA 2XUPA 4M4SA 1VI6A 1C8BA 4XGRA 4PLPA 5AKEA 1CQJB 3L4BA 1ENZA 3L93A 1FQWA 3IQWA 3O47A 3PJGA 2J5BA 4RMNA 3TLKA 1GAEO 4Y6OA 3QLJA 1JSXA 3V2HA 4I1VA 1DHTA 1C3JA 1T34A 2INGX 1NW8A 4KHZA 1AGRA 4Q1BA 4PYMA 4YJDA 3HJGA 2G7MC 3DCJA 3KJIA 2GPTA 3LI2A 2YZKA 3UCEA 5JOQA 1BMFD 1Z4MA 3OQIA 3EWSA 2AF4C 4KEAA 1Q95A 4LZJA 4ZP1A 3V8QA 4UM5A 1P5HA 5HS6A 1GSOA 3SS7X 3NTLA 5KOJB 4XJXA 1N0VC 3NBKA 4BLQA 1RZRA 3MWFA 4QSHA 2DETA 3EPHA 3BKWA 2R6R1 2NAPA 4PYJA 2HQSA 1H1LA 3PU6A 1GUYA 2WM9B 1OBFO 2HUPA 1QHXA 2RKOA 3Q40A 1MB0A 4KQHA 5THXA 3VAZA 1L1EA 3A1TA 3EIXA 5J4YA 2L82A 4PHHA 1J2TA 1R9MA 5HFNA 2X58A 3UJNA 4B7XA 4F04A 2FR1A 5CB4B 1OWNA 2UZ1B 1I01A 4OKSA 3AP2A 4W5RA 1KIMA 2IEGA 1YCDA 1QC5B 1DBWA 1TIPA 2FXVA 4JD5A 5ALUA 3RVQA 1PWXA 9GPBA 4EHNA 5AVWA 1GZ6A 2ACKA 5JDCC 1IBSA 4C14A 4ALLA 1KH3A 4IGKA 4PBSA 2X0IA 3OZUA 1U5AA 3A7EA 3ER6A 4B5LA 4PSVA 1Y48E 4R1OA 4AF8A 1K5HA 1FVXA 1NW6A 5AJWA 5H16A 2UXDB 4HNSA 2AMLA 1JG3A 2QN7A 1YR3A 2X6QA 3EGOA 3HNRA 4U7HA 3WO0A 3OWXA 1KAGA 3K9HA 5TARA 2X9LA 2DY1A 1GRNA 1F5SA 1BA3A 2BM9A 1P9RA 2YYAA 4URHA 1RT9A 4RZQA 3I73A 3F5QA 2WOOA 2OSBA 1YB1A 1PJ4A 1U3CA 3OZGA 4QJ5A 1HT3A 1QAQA 3HADA 2G40A 4Q5IA 2BGWA 2XXBA 2FDCA 4JYAB 3OFJA 2NYRA 3PXBA 1HE4A 1KY5A 3PVZA 5DRTA 4BEWA 4ZCIA 4Z1MD 1UBSB 2ZZKA 2I2XB 2Z2ZA 2JLRA 3NNSA 4MJ7A 4GM0A 2RHTA 4UVIA 3BL8A 4HHEA 4YAIA 2YWBA 1MIOB 5IP5A 4E1VA 4HAYA 4EL5A 1NVWQ 2WE7A 3ECCA 3KAKA 2BW0A 1F06A 3Q8LA 1G291 4JVSB 3RVDA 2ZRHA 5BNZA 1G41A 2N42A 2DQSA 4XW2A 2PGNA 1R4NA 3CEAA 3PD0A 4CQMD 2FW1A 2JGRA 5DGXA 2ZIXA 2NZUG 4EWLA 4WZ6A 4BZXA 1RBQA 1WQ1R 3JAWA 4J91A 2G4CA 2X0DA 1TLLA 3C7AA 4ZGWA 1ZISA 1PQYA 1XU4A 1ZN9A 1EK2A 2YHBA 3AR4A 1XPRA 1MB4A 4DR3B 2MSWA 2RI0A 2AJLI 1JDTA 4KN9S 5IJ9B 5L40A 2C07A 3DOUA 2AMYA 3FOCA 2D1TA 1IQ0A 3GFPA 5A9SA 2F55A 3P19A 5CXQA 1FFCA 1X8JA 2J46A 4OF4A 3N59A 3BA6A 1O1YA 2CLKB 1R8SA 3WLNA 4AWXA 4C6RA 3VO2A 1T4CB 1T9KA 2B25A 2ZBGA 3LUKA 3QV1A 5CYPA 4BGUA 1I80A 4V03A 1YB4A 1V5EA 2Z04A 2F9FA 4M9XA 4TV9F 2V65A 4YBZA 4TSKA 3OPYI 1USWA 4UU1A 4OSOA 4PG6A 2ZSJA 3EISA 2XQFA 3C3XA 3DUFB 5HX7A 4ZYUA 1C14A 1KERA 1PFWA 5LQJA 4WCFB 2QP3A 4QQKA 5E9QA 4H77A 4OGFA 1L5HB 1IN6A 1NT4A 2VUSA 2IPMA 1KBQA 5CT4A 1PE0A 4BDTA 5AW1A 2PWPA 2K2QB 4DG5A 1G3IA 4E70A 2ZW9A 4X1OA 2Q0XA 4GC5A 2A9QA 3MJVA 3NCTA 2CDCA 3WWPA 3WRWA 4BY9E 1K7YA 3D6JA 3K92A 2FUNB 2HSWA 3FVQA 3CA8A 2YRFA 4PSKA 4GR5A 4J2OA 2BHLA 2P0YA 2RCYA 5E8JA 2R6JA 4JJ4A 4M8KA 4KFSA 3AM5A 3L7BA 3OUTA 3BILA 4LAFA 3GVPA 2LVBA 1L4YA 1Z0KA 2HHLA 4ZEWA 4RWEA 1G64A 2DFDA 1GTG1 4BBAA 4FU0A 1RJFA 1SD1A 2CEAA 2Y0CA 1ECPA 9LDBA 2HJRA 5KU1A 2D0PB 2UXCB 1C4KA 1X92A 2RH9B 4F7WA 1QP0A 4ZMSA 3I9V6 4TL9A 1D8TA 3ULKA 1ULHA 3I3SR 4E5SA 1ZEJA 3S44A 3R9XA 3G5UA 2WAYA 5H83A 1TO6A 4DM4A 5FOXA 4F3CA 3KTAA 1U0LA 5T6BA 1LTQA 1OH8A 1QTRA 1LLDA 1Z34A 2J4FA 1OXBB 1R4MA 2GD1O 3G88A 3KP1A 5ELMA 3OQMA 1U7HA 3P71T 3B82A 4C21A 2AJDA 1KFKB 2B1IA 1MABA 3Q0IA 4RKWA 3ZE0B 4F46A 3RFCA 4YRFA 5IDWA 3AR3A 1YRBA 5IC5A 4DIFA 1AXRA 2Z1NA 2O54A 1BXZA 4I4TF 5FOTA 4DCNA 2PMKA 5FD8A 3GDWA 3RF7A 4P31A 2X14A 2WHQA 1UBHS 3NVMB 1X15A 3X1DA 1ZJZA 2OKCA 3MJEA 3DONA 2N47A 2W98A 2CXHA 3W6NA 3LQ2A 3C16C 2JFNA 2YYYA 3PC2A 1T3LA 5FNZA 5JI3E 1FTWA 5HIKA 2D5IA 1EQ2A 3BD8A 1C41A 3KYDA 2ANCA 3SDZA 1E1MA 2VAVA 2V4ZA 4PPFA 1E2JA 3DTVA 5DM70 1MOSA 2JLWA 3VMMA 1LD3A 1MAUA 1CIPA 3GRZA 3G5TA 1VZ3A 1TA0A 2NPFA 3VTAA 3ABOB 5LBTA 2VQFB 1NSTA 3K0KA 5KQGA 3R5FA 2Q3FA 2OB2A 5KNDA 5ERXA 5EIEA 3MOSA 3ZV3A 4DS3A 3DG9A 5DGTA 1ZIYA 4P2GA 2YZMA 4HDSA 3LBIA 3B13B 4YP7A 5JY1A 2BEWA 1CQIB 5FWXB 3RIYA 3KKZA 3EFHA 2ZUBA 3BL6A 4B2YA 5HOQA 3F6BX 1OT3A 4XWOA 3HZZA 2ZE6A 3V8EA 1JIJA 1Q3HA 4IG4A 5EWJB 1NSYA 2XA1A 4D97A 1NP6A 3N2KB 2XBUA 5EUMA 1KDYA 4ZCRA 1TZJA 4UNPA 2B4YA 2C00A 2ZSKA 2W4MA 3RQIA 3HL0A 3P2EA 5TB5A 3TYXA 2XVZA 4ID9A 2XTAA 5AW7A 1JW9B 1FMTA 2RHWA 4TX1A 3IMGA 3AF6A 3CNBA 1BMDA 2GQ0A 1Z13A 4QUDA 4ECEA 2QQEA 2H51A 1R9NA 3AL0C 1GPLA 4NSNA 1K98A 3CF6R 3CUVA 3IUPA 4H0CA 4Y0NA 2GI4A 2GERA 4HFRA 4EF5A 3BREA 1FE8A 4D80A 4I1PA 3CJTA 5BSUA 4C5AA 3SDSA 2COUA 2X1LA 2ODBA 2NACA 3K1TA 3PG5A 4DR5B 2BCEA 1MVLA 4BNTA 1YRQA 2I6XA 1I51A 2B5WA 3RIEA 5L3SB 1R3DA 2DQKA 4IIYA 3DA8A 4XQGA 4ZO7A 3HB5X 3ET4A 4HAUA 3AUSA 1U94A 2NZXA 3DZHA 4F3TA 4TSFA 3EJ6A 1RQ7A 3E4DA 4CLHA 5KCZA 1GCGA 3GVCA 4TZTA 2EXXA 5SYAA 3SAJA 1FZQA 5P21A 2PPLA 3U7RA 4A7PA 2CV0A 4UEOA 4LF9B 1Q0ZA 3OX4A 1GTJ1 5CDFE 3PUYA 2FP4A 3K0EA 1J2UA 4AKEA 1NNLA 1NXSA 2AF3C 5DT9A 1VLZA 4XH9B 4TKVA 5DDIP 4CPDA 5CIYA 3Q5DA 2ZSEA 1UDWA 2Z2IA 3B38A 3PQCA 2B4TO 4WMLA 2V59A 3NWPA 3OJLA 2QVCA 5EXSA 4GMDA 2QYTA 4F60A 3E3OA 5EMLA 1TKRA 3AY7A 5KYXB 3QVLA 3VZRA 1Q7RA 1SHZA 2H2DA 2LW7A 3GJ6A 2XIQA 5JS2A 2K4MA 2QR5A 3RK0A 3H4TA 3IGFA 1JAHA 3D8NA 2O2HA 4L72A 2O4UX 3KSDO 3BBPA 5B53A 1S2IA 6ABPA 4GDMA 1FNDA 1A2QA 1I9GA 2JIDA 2WUDA 2BGKA 2C98A 4HQ6A 3SC2B 1ZR2A 1UPAA 2BFPA 5IM4F 3RS3A 3N2GA 3U7QA 1QQ7A 5JSZB 5DM60 3E27A 1I10A 2VH2A 1B23P 5K4HA 2OGUA 2BDUA 3E9QA 3AJ8A 4JS0A 3TDMA 3GLFA 1Q0RA 2AG5A 4DZRA 3EASA 2VDVE 4QTUB 4AMGA 1CDEA 2HQ1A 3DXXA 3HABA 3FFBA 3MYRA 4Q4HA 1QQ6A 5ALKA 2XRFA 1JIVA 2ZRLA 2Q3LA 4L3OA 4EPYA 5LD2C 2BHNA 4I2VA 1THMA 4Y6QA 5C1BA 4D3FA 3E5MA 3HFSA 3K5IA 5A3VA 1RZ3A 3GT0A 1N75A 1NGSA 3COZA 3WYEA 1LF0A 3UHOA 4ABYA 4Z4FA 4U6SA 4HF7A 4I50B 4XQEA 1KYYA 4ZYWA 1DIBA 3ASUA 4MIOA 4ZHQB 1FNNA 2BKEA 3HCAA 5AICA 3B5EA 4Y2YA 1XTIA 3EW9A 5DLQC 1Z5GA 2HXYA 2YY5A 5T64A 3TQIA 5JRDS 2HV8A 1YVEI 2XYQA 5J43A 5KQMA 4JL6A 1MXFA 4PO3X 2IY8A 3K30A 3GC6A 4KQGA 1NY6A 4X54A 5KYYA 3TCNA 4Y1RB 5YASA 1OGJA 3JRNA 3VC2A 3VPHA 3MWEA 3U61B 1S7CA 4PSDA 1X86B 2A58A 3QPCA 4BCCA 3HQ4O 3NI2A 4LC1A 1JTEA 1R9GA 1PZMA 3C6YA 3QOWA 3B48A 4TTPA 2X9VA 2JCSA 1VMDA 3TS1A 3L40A 1H3FA 2IEZA 3K32A 5B37A 1MAVA 1RRMA 1T8TA 5IUKC 4AS2A 4LJRA 2PGJA 1OASA 3W4IA 2AT1A 1G6Q1 3JAKB 3I45A 4ZI3A 2VEDA 2ZWMA 3MJFA 4DQDA 5DULA 3EBOA 3DLAA 2I54A 3TQOA 3T3OA 3M70A 2I4LA 4L9AA 2W6IA 1DXOA 4K6HA 1JPVA 3LZCA 2P2ZA 3R1IA 5DSZA 5FEMA 1ZXLA 3K1JA 1Z8HA 3H9BA 2FNAA 2BUBA 4KQWA 1ZD2P 1A5ZA 2QL9A 4Q4DA 3RS2A 3TSWA 5TPZA 3VZCA 1WEHA 3VISA 4N9QA 2MDTA 4MVJD 2WOJA 3N8DA 1Q3KA 4BNUA 3QKSB 1XWIA 2X5OA 3R9KA 1A5BB 2DHCA 2O50A 1M74A 3SKXA 3W4JA 3IJRA 3NWBA 5JAMA 1VHWA 4YMIA 3ZWDA 5AIAA 4I0WB 4OJYA 3AUUA 4MQUA 5E8RA 1FUUA 1YRWA 3OTGA 4K7JA 4CM7A 1OB5A 1YL6A 1D5WA 3SOZA 2CT8A 1N2HA 1K6IA 4RPJA 1XKTA 3WYNA 2IV2X 2XI4A 3EG9B 3WNDA 4RHYA 4PZ9A 2WMNB 1QGYA 3UTCA 4EW2A 5F78A 4DNOA 4FBGA 5KYUA 1I2MA 1GKYA 5K8IA 5EC8A 3UC5A 4TKLA 3VR2D 2XGMA 3HR4A 4R1SA 4DA6A 3LUGA 2JI9A 2VR1A 1COWA 2IXFA 2GVZC 4PXSA 1E96A 1E2QA 3R44A 4L57A 3RS7A 1AMNA 2PBFA 2X13A 3I2GA 1HV8A 4PZCA 1EXMA 1AKNA 2R00C 4FWBA 3I6YA 4IPTA 4R4JA 3CR8A 5AK4A 1P5RA 1KDZA 4A03A 4MP8A 4CG2A 1UMCB 5K3SA 3FPFA 4XLTA 2ECKA 4GE3A 3OCCA 2HMSA 1DJMA 3ZTYA 1KO8A 4C3VA 1KGDA 7ADHA 4EOGA 4TLEA 3HBFA 1RHMA 4I36A 4IX9A 5IT0A 5MDHA 2WF7A 3LS2A 4YT5A 5ILOA 2JJMA 4I1RA 1JDUA 1UQRA 2WLSA 4G0XA 3FVTA 2O19A 3CRRA 4YEDA 1VC2A 5CDUA 4GUAA 2B2XA 3I92A 3LLMA 3OTHA 1JHAA 1KOLA 4UVHA 1EUCA 5A7FA 2P7IA 2QGFA 1LBQA 1JALA 2GBLA 4XVRA 1CP3A 3JATB 4AQYB 5EAIA 1K08A 4Y1GA 2C78A 6AT1A 3TG8A 5HG0A 3IX7A 5A2QA 2OZVA 3HFJA 1U1IA 1Z2AA 2H92A 4NNOA 5EPEA 3B89A 1Z7YA 4NMXB 1T2UA 3CNNA 1Q83A 5CT9A 3THYB 3ANSA 1J39A 3SF8B 1GZ5A 4TTJA 2C5EA 3MT9A 3SCZA 3ZD7A 1SXPA 2QVXX 1PW7A 1T2VA 1PR1A 1V3VA 3BN3A 4EGFA 4KPEC 1MNQA 2B1QA 4OXXA 2IW1A 2N1BA 4E5YA 1X0XA 4D8WA 5B30A 4BFWA 4EG7A 4CGZA 1II8A 4EEKA 3D81A 4IYRA 3I2JA 4P7JA 4I3FA 4Q9IA 2IH5A 4JVLA 2KWIA 3D8RA 3PDIA 4L9SA 1PJLA 5C53B 1QCCA 3LL4A 4QQRA 5LP6C 5A6SB 3O95A 2YW2A 4HLUC 1QTIA 2YY6A 4N40A 1KJWA 3ROGA 4WESA 1A8UA 4LOLA 2Y05A 2PGLA 1RNLA 2I8AA 2Q1UA 5F3WB 2JHCA 3OFSA 3W9SA 2XECA 1N6NA 2PS0A 1H0SA 3BERA 3KEMA 4X7PA 5DBEX 1XC7A 4QLBA 2WNIA 3DDOA 5FEUA 1IVYA 3FNGA 1KK3A 1LJ8A 2X42A 2XUAA 5IZCC 2Q2WA 2CK3A 1PWYE 4GOJA 4DKXA 2ZIUB 1DZIA 2P4UA 4CV1A 1OW3B 5J23A 4O4JF 1T1EA 2JIPA 1O9HA 1ZOLA 1RFLA 4N3CA 1WXXA 1XDGA 5EP2A 1J0EA 4KUEA 5I5EA 4MI1A 4JJEA 2Y99A 1R10A 2OY0A 1J5EB 1AGXA 2P9EA 4IM7A 4E2ZA 1N3YA 2JZOA 3V46A 5FKJA 3C8ZA 2J9RA 3AI7A 3DR5A 2DB3A 1Z36A 1A7AA 2L0XA 2FMKA 3VR1A 1XD8A 1U9IC 1UMDB 3EZ9A 3VVLA 5M3BA 8AT1A 4US1R 1SOAA 2G5CA 2FPPA 2PX0A 3FYDA 5IHXA 1OLXB 4FZ3A 1SPBS 4E94A 4WECA 2N0SA 1ORVA 1WCIA 3DLPX 1FDOA 4BBPA 1HORA 1ZICA 3CUUA 4W5WA 4Z0PA 4YR9A 2IOHA 3OFND 4TRJA 4EBBA 5CDTA 5D7BA 2C42A 3TZBA 4HVCA 1VHTA 4ZT7A 3E8MA 2WIDA 4CV0A 2OCBA 1MO6A 1TMGE 3KO8A 1LVHA 3CB4A 4DHEA 5EYPA 3NHSA 4CEJB 3EJWA 3OIFA 2XWSA 4L22A 2BELA 1LW7A 2HJHA 2MMCA 1T1IA 1Z88A 1TTPB 2Q3HA 1T3SA 1VI2A 4RIIA 4TTAA 5JJCA 2NV0A 3ZHOA 5IARA 1MZVA 1AHIA 5E6UB 4B3FX 2EZ8A 5ENDA 2QL5A 3EXIA 3BT7A 2VP4A 2XNHA 3VDMA 1P7ZA 4V2UA 1WJGA 4EY3A 4OI2A 1NXPA 3CT6A 3PENA 4OHRA 2H57A 2W2NA 3NIDB 3O4JA 4AUNA 1VE3A 1JHPA 4ZQBA 1TA4A 4RV4A 2QNBA 1T9GR 3JQPA 1N36B 4ID3A 2WFAA 2ZAIA 1IJEA 2BEVB 8ADHA 4LV5B 1DVRA 4XFDA 2FFBA 3I01A 2EYUA 3P1JA 2A7QA 2OBNA 3PGLA 4WVFA 5F5XA 4D1YA 1EVIA 2ID8A 3JX9A 5KCMA 1H2FA 1T36B 4NOMA 4C6TB 4B6PA 4N7MA 3EQZA 4MUBA 2BJVA 3TRDA 1HO3A 1NT2A 1MV5A 1KPIA 4H31A 5KJ6A 3JQAB 2HOQA 4HWKA 3GLUA 3FLMA 3LRXA 3ZEAA 1F2TA 4JJZA 3PHLA 2IH4A 2ACVA 1YBMA 3GMTA 3CVOA 2LPMA 3FF4A 1QLHA 4J16A 1YR2A 4Q3BA 4HWRA 4DTCA 1G7RA 3C14C 5LQUA 4NCBA 4YRNA 5CFZA 3BD6A 4MRVA 1I7PA 1DELA 5DBFA 5EXPA 1G5TA 1USGA 3OPQA 1L5VA 3LBAA 3UJ8A 4JITA 2PZGA 4RA6B 1QX3A 2L18A 2P9GA 4NYIQ 3VVMA 2R1VB 4I46A 4BX0A 3R8FA 3QUAA 4GI1A 4YMUA 4O1MA 2GCOA 1RJDA 1T0PA 1ZCFA 3PYXA 5K3FB 3AO0B 3RVMA 2FI1A 3SVZA 3V32A 5T4BA 3AZOA 3UAXA 3GCXA 1GCUA 5T8KC 2O4CA 1CZHA 2ILTA 2ZUUA 4YONB 4URZR 1QV9A 1Z0IA 1ZSYA 2C3OA 1YZVA 1NOIA 3A28A 4KO2S 5ALVA 5H9WA 1B0PA 1JAIA 1NRIA 1Z5PA 1QCYA 3UCXA 4JYBA 1Z68A 4R1UA 3TL3A 4DLPA 1U02A 1N5DA 3KXIA 4BUJA 4CM8B 1TF2A 3CF0A 1SQ6A 3PFCA 1O2DA 2H0QA 5ES3A 3KZMA 4EBFA 4ENVA 3RNOA 4QICA 1H65A 4GM4A 5D5PA 1B8VA 2GN0A 5IFKA 4KBGA 2VHZA 2VZLA 4CEHB 1WXFA 1IHPA 5E2BA 1YCHA 3L6DA 5H02A 2XBMA 2FPOA 3PFWO 2FPGA 4K9LA 3WIBA 3ZU3A 3HCRA 3ZI0A 4JBIA 1WIWA 2YIVX 3OWOA 1XG5A 3KJGA 1YJXA 5JMWA 2ZUFA 2PJRA 1HKHA 4UM7A 3AR9A 4KO3S 3M4ZA 4BVEA 1RJ9B 3IUEA 4BP9A 4CLDA 1Q1GA 4U2CA 1RCTE 2J5RA 1QB7A 1TQ4A 3BORA 4PBRA 1T6BY 1XK6A 2YJTD 3ST7A 1G17A 3VU0A 4EPTA 2KMLA 1JIIA 2Z5FA 2DHEA 2GPSA 3KAPA 3KQUA 1NVBA 1B74A 1E9FA 2ES4A 5DGHA 4B34A 4ENPA 4JEHA 5AI9A 1R0YA 3AVVA 1JHQA 2R4TA 3W3ZB 2DBRA 4F8EA 1FJXA 4ES6A 2QBYB 1XFAA 1ILWA 4LYAA 1ZD1A 3WR5A 1TKCA 2NXCA 4P3NA 3P0HA 4D6YA 3F3YA 5KC9A 5JVDB 4WXMA 1YDFA 5GVSA 2IITA 3DMRA 2F8SA 1W6UA 3GJRA 3A9TA 1AMUA 1TUIA 3UBMA 5JW6A 5U9CA 1OC4A 3VU3A 4C07A 3LPAA 1PZNA 3AL3A 1PWEA 2X0EA 2H9IA 3DD5A 3GGJA 4NR0A 3D6FA 3NU1A 4ITUA 3UK1A 5KUTA 2I1WA 3DZIA 4GX1A 3RGWS 1XEWX 2KB0A 3H5OA 3GPBA 1XMXA 1MW9X 3T4EA 4YMSA 3HNPA 3JU3A 1Q77A 4BLOA 3WL3A 1KFEB 5E7JA 2QLTA 3WAKA 3SSMA 3H9GA 1QQTA 4TLBA 5CCDA 4WBNA 1HDGO 2I2FA 1GQRA 3D6TB 1SK8A 2HK6A 3EDMA 3R3UA 3LMKA 5G1NA 2VA9A 1BGXT 1VBMA 1WXGA 1Z6AA 2HF9A 1PJBA 3HP7A 3EVZA 3QLVA 4YJ2F 3BK7A 3RRYA 1VHJA 1ZJ4A 1MX9A 1WZ2A 1QYIA 1VJ1A 1MT3A 2G88A 2GBIA 2LXNA 3FDFA 5LLSA 1IH8A 3U19A 1ST3A 3EGDA 4FD2A 4YUAA 1OH5A 3CUKA 2AI2A 5BN3A 2ZCJA 1A96A 1RZUA 3V2GA 4IW3B 3GCGA 5D7NA 4I5EA 1I14A 1EGVB 3NPMA 3DCYA 5C7IO 2FSPA 1EFVB 2VNHA 4PVDA 4QAJA 5CT6A 2Q3BA 4G5OA 4N3AA 5AIBA 3DEZA 3KSBC 4YPVA 4LBZA 4YJGB 4PV7A 2GPNA 2AQIA 4PZEA 3C3PA 1EJ6A 1FX0A 2F9LA 3M6IA 4HH1A 4DC1A 1M34A 5JWHA 2A0UA 2FPUA 3ZVMA 4IYJA 2KJQA 1X0VA 1QVZA 4PFSA 1DT3A 4RY0A 2CBXA 2FWBA 4NL4H 3RLFA 2BZSA 1I4LD 1NBOA 3NFRA 2Z57A 4CF3A 2VOEA 5G0VA 4Y9SA 1Q19A 3AP1A 4LJ5A 5FI1B 3CNEA 1E4YA 4OMUA 3DTVD 4CFYA 4F5DA 2R6DA 2I9KA 4BFTA 4BDSA 2QU8A 3CN7A 4O4LA 2G07A 5E0OA 3H97A 3X0DA 3MCTA 2H8KA 3PQ4A 3UTDA 1S8OA 3E58A 1TEXA 4K9SA 1MB3A 1V0JA 2VAMA 3C98A 2YC2C 3L2OB 4PCLA 2XNCA 1LLUA 3T3NA 1JQDA 1A97A 1M0EA 3NUQA 3KFXA 4OHXA 5CPBA 4JHLA 1OLSB 3M8KA 2BGLA 2JW5A 2XMQA 1JIXA 2ORED 2L42A 2BL4A 3DEHA 4H7KA 5FI5A 4BKPA 3P0EA 1VSQA 3K0FA 3ELDA 4F6RB 1CRLA 2QY9A 4IEFB 4RIEA 4V0NA 2SKCA 1DQNA 3AZQA 4FONA 2WILA 4QRDA 4Y2HA 2FR8C 3W34A 4DY6A 5B55A 3BGOS 2XD9A 3O74A 2HBQA 1F1BA 1TIKA 4M83A 4MQFB 3UUEA 1YL7A 4YP9A 4EQ6A 2YFQA 4TLMB 3FJYA 2MYPA 2Y1KA 4DCMA 4JB2A 4R6XA 5A0VA 2GO7A 3E1GA 3R5TA 4Z8XA 1XO1A 1BD4A 4IDNA 4Q1VA 3T06B 1SXHA 2HB6A 5DIFA 4GYYA 3UT6A 2JLAA 3ICEA 3LP5A 2QGNA 2YVQA 4P6VF 3ZZUA 1N25A 2FVXA 4PGGA 4G9BA 3OAAD 3KIPA 4PLVA 3W2TA 3B1KA 4CF4A 1E4VA 1M1UA 1FFSA 1Z7WA 4H08A 4ZXFA 2XKAA 3EGWA 1ZN7A 1TM7E 3S40A 2RGAA 1L8XA 4HOYA 3EH1A 3BWCA 4ZQHA 1K7CA 4QE3A 2C9ZA 1MAWA 1VIDA 1IJFA 1I2DA 1AM4D 2LE0A 2WSIA 1U63A 3DEIA 1Y6QA 3BE6A 3DV2A 1IXKA 2CCKA 1P2DA 1E7SA 3A0UA 5CFQA 4HDMA 1WVIA 3BGSA 2WINI 3PUXA 3H4MA 2ZJYA 3QXXA 3ZU4A 4Q7MB 4W5OA 3COVA 5E3IA 3CLKA 3OH8A 4HSEA 1RQNA 2A78A 4LY6A 2AQKA 4RFVA 1D7OA 3A9WA 1NXQA 4JJFA 2IX9A 3OEYA 3L7IA 1ONPA 1YJAA 2HWWA 2X1HA 5E1MA 1RS0A 1G6OA 5B5SA 3H84A 4ZQFA 1DFIA 2WAAA 1SR8A 2DT5A 2FFHA 4AY2A 3AHIA 2I7VA 3KKPA 5EZYB 1JEYB 1NI4A 4KGZA 3PP8A 4AUMA 1SOWA 1V26A 2ISSD 2V58A 4BFSA 4YRKA 2C61A 4BUZA 4PE5B 4HB3A 4DSNA 4DQLA 5HQJA 3THRA 3EN0A 3TFQA 4L0CA 5JNUA 4XTRA 1JSCA 4A3SA 2PUFA 2JEYA 5LUBA 3FCEA 5SY6A 1W2HA 3QX7A 4FWIB 4FR0A 3LW7A 4C0XA 3BE5A 4JIGA 1XCLA 3KJEA 1V8DA 5E7MA 1RI4A 3DE1X 3K9GA 2BE7A 3LCUA 4U5XA 3LT5A 5DP2A 2O2ZA 1ZM4A 4QXQA 1WBJB 1FBTA 3I6MA 2VT2A 1C9NA 2XBLA 3NHBA 3R5JA 3C87A 2WB2A 1XE3A 3IULA 2SHKA 2GJKA 4CCAA 2B34A 4DV1B 2GN9A 5IN5A 1P74A 2B21A 1M2GA 3RRJA 1RWQA 1T1GA 3QXGA 3U4HA 2NZJA 1BVRA 2BJWA 4B47A 1X7XA 2QUJA 3FETA 2CLCX 3LT1A 2JIRA 4OQYA 3E8SA 3LCVB 1D1TA 1I3CA 2JGAA 4EATA 2PKWA 3KTFA 1ZSNA 1K8RA 2GD2A 1C30B 1FLNA 2I2AA 2J6BA 4KPUA 1QRUA 1GGJA 4DCCA 4ZAVA 4AJPA 3PC6A 3ON5A 4H7PA 4KZKA 1N3IA 4WFIA 5AXAA 5FNVB 2VDRB 5E7IA 5DHTA 1FW8A 1A1VA 1P7YA 1TC2A 5BQPA 1W0KD 2VHUA 3JWPA 3ML1A 1TZ2A 2PLFA 3D3EA 3L4EA 4UFOA 2ZAMA 1QIMA 3EG5A 5BVGB 1JX6A 4GPD1 1NIJA 4G97A 3B36A 3TZCA 5C1OA 3W79A 1CUUA 4WBXC 4OHBA 2P5UA 4WT7A 2QLNA 3KBBA 4C03A 1E66A 1RPAA 3OF5A 2UUOA 1EZ1A 1U0HC 1VBKA 2V03A 2IYPA 4DQXA 2I4IA 1DKQA 1E3WB 2YZNA 3RIHA 3TCKA 1JDNA 1P3Y1 3WMGA 1PFYA 3FTFA 5ELLA 3CTPA 1QNFA 2WYHA 5LSAA 4DV4B 1XZJA 2I67A 1DKRA 1JDSA 1V6SA 1YHZA 3JYOA 3RVJA 3ODGA 3ITKA 2O7NA 2P2SA 2CW5A 3CM0A 4HVAA 1D1QA 2P6OA 3PQEA 4DIBA 2HW8A 3D2AA 3SEFA 5JLJA 3X2FA 1EUYA 2GYVA 1SU4A 3NHLA 1YD7A 1Y1TA 2J09A 4OJMX 4Y7DA 3THSA 1M6VA 1Z2OX 5ESRA 4B5KA 4AO8A 4WNCA 5F77A 1OFGA 1QK5A 2EV9A 1OX4B 1F7VA 2BFDA 2CUKA 5DNVA 1VB3A 5BSKA 1R16A 3IHWA 3RUPA 3GEMA 4X66B 4MVJI 5EE5B 4MRSA 1YZYA 2PZBA 4JXJA 4P82A 3HA7A 3HY6A 4CLXA 2HSEA 3PPVA 4MTLA 2CNDA 3IERA 1JVBA 4HVLA 4TGLA 1ZZEA 2FRVA 3HR7A 4FW8A 4PEVA 1RW4A 4IVRA 4MITA 5FL7A 5IBRA 1H8ED 3FFAA 1H2ZA 2OEPA 3H5AA 4IIUA 4EHKA 3VA7A 1FJGB 3MCZA 2PV7A 2WD7B 3SQXA 2O7VA 3OU7A 1RRFA 2F1OA 1Q7EA 1R4AA 1SFRA 4WQMA 4JEMA 1II9A 4P38A 5JNLA 2H2IA 4A0GA 1N2EA 1Q14A 1ZUNB 4F5ZA 5K0SA 1CUBA 4B3GA 2W6MA 5DBOA 1ZESA 3TGLA 1Z74A 1OIXA 2A5DA 2D5LA 2JBHA 4FGSA 1QFJA 4KXVA 1HQYE 1UJ5A 4E6PA 4EGAA 5I4KA 1VPEA 5K3AA 2GAFA 2P9QA 4D4JA 1FMCA 1H9CA 1EVKA 1BC5A 1GTZA 2FCAA 4NU8X 3A32A 3PA6A 3MGBA 4MS3A 2Q9CA 2HHJA 2O48X 3VNBA 5KTSA 3L7CA 3BTSA 1YZGA 2FWMX 4P4TA 3OLYA 1P9OA 3TQTA 1ETHA 2ONYA 4H1UA 3SS9X 1GUZA 3GARA 4H6VA 4AFNA 1CY8A 1J07A 1NV8A 5A4DA 3CUTA 2V5VA 4DVGA 3TSOA 5HQ3B 2ZREA 1SH7A 3KV1A 3B1XA 4NU6A 5K8UA 3NG1A 1NLUA 2A1UB 4ZT5A 3UHPA 3DFUA 1PCXA 4TLAA 1LRKA 3BXOA 4K0KB 1OX5A 4GI3A 3BQ9A 4I9GA 4OG2A 4UAVA 1C7IA 2BBWA 1ODJA 1UEIA 3C6XA 4BCBA 3PXAA 4R3NA 1ZM2A 1NNEA 3SYMA 1CRQA 1ZM3A 5EP4A 4NHEA 5FHRA 4NMWA 1QP4A 1UAAA 2ZAGA 5I3CA 1H3NA 3R3XA 2Z4SA 3OD1A 4AWBA 1EDZA 3EXEB 1G4HA 3LC2O 3VOAA 2PMBA 3LYAA 2ZJ1A 3HA3A 4WOPA 1Q5PA 3L0DA 3AMVA 1KEWA 4WK2B 5HBRA 2AX3A 3ADDA 1HEYA 3EIOA 2QJOA 1N1EA 3O82A 2YNMD 3I12A 2PS9A 1R00A 1S2LA 2HWXA 2R9VA 3U80A 1FUYB 5CFMA 2BJHA 2Y1GA 4IDGA 4DCVA 1PS8A 4HFMA 4FEYA 2LTAA 2X5JO 1WXIA 4XIIA 4CFZA 3CLUD 1UP4A 1GVHA 2CMFA 4FZVA 2ATEA 4DBLC 4UUBA 4DDMA 4B2LA 2HDHA 1ATIA 3P0RA 5KOYA 4O1IA 3GLKA 3FTEA 5B64A 2G06A 3RTEA 3OE5A 4TWRA 1M2NA 1T4BA 3IOYA 4RO0A 3M6XA 4KU4A 3QUTA 4X95A 4ZARA 3WYAA 3ZBPA 1G8MA 2JKVA 4PRZA 1N5IA 2XCLA 3PWSA 4LISA 5I9MA 3OZRA 3NTOA 2XXAB 3E05A 5HTKA 3GIWA 4R51A 1B8NA 3CZ5A 1NVEA 3FYUC 5C3MA 1ZSVA 3DBHB 3QX3A 4ZQEA 4Y6GB 1N5OX 1BHQ1 1E8DA 4V1CB 3CLRD 1M2JA 2PL9A 4AUKA 4FCVA 2WT8A 3GUCA 2Q99A 1WETA 3WIUA 5IC6A 3LQQA 2ORIA 4RAOA 2XZOA 1CB0A 4PFKA 2XOEA 3E7PA 4D6XA 2W2LA 1NX6A 5DK4A 2YJNA 3NWOA 4XIFA 2H65A 1Q44A 1MQ9A 2D54A 2VK8A 3G9ZA 4FKBA 4GI7A 4V02A 3S1SA 1KMCA 2AOXA 3S3TA 1F0PA 3IAS1 3CH6A 3UWKA 4HFJA 3SFTA 3M2PA 4IDBA 5B7PA 2OENG 3KQLA 1YFJA 1EUZA 1FLVA 3B52X 3BYZA 4Y2PA 2BP7B 1S89A 2ZIFA 3DXZA 4N03A 1EDEA 4XDHA 4Y9DA 4YAOA 4J4TA 2BMAA 3DV9A 2RGUA 1V8BA 2QZSA 3T5GA 3UV7A 1CS0A 3S27A 1P62B 2WB4A 1JV2B 1UIRA 2ZQ5A 3FVRA 4HJRA 2V7WA 4U3JB 2FUG6 4YA6A 5DNWA 1M2EA 4IHJA 5EMNA 4LWOA 5HA5A 4BC1A 2OO5C 3P5SA 4UDNA 1MX5A 2DHRA 3WHKA 1NQAO 5JEDA 3BXXA 1W5AA 2BF4A 1EG7A 1ZEMA 1DBSA 2IHUA 3WK5A 4ILKA 2FQWA 3EBPA 4HTAA 1LLCA 1FYVA 4AO7A 1YB7A 3B9BA 3UXYA 3TOCA 1HMYA 3TW4A 2QPLA 4C7VA 1JDPA 1SUWA 3B6KA 5TNXA 1XJWA 3NDPA 3F7NA 4P0TA 4WDQA 5KJEA 3S68A 2BGRA 1G16A 1FY2A 4A73A 5KVCA 4DR4B 2VPWA 4PINA 3MLEA 3V8PA 5KYVA 1CE8B 3OZSA 3RKUA 1UINA 4EVRA 4X8OA 4AC9A 4ZVTA 1GGEA 4WERA 5BSMA 1K6EA 5EJEA 2FJUA 2O2EA 2VWQA 4LQLA 2IXTA 3VVCA 2A84A 1R18A 2EKQA 3DLBA 2VZEA 4QBFA 3RS9A 3E70C 3QJYA 1U1EA 3M3PA 1HWYA 3EC7A 1LI4A 3K9FC 4NFYA 2GYWA 3N2EA 3GCDA 3RS8A 4UREA 1KBOA 1V6CA 1ZUWA 4I4NA 4D3YA 3UN1A 4LE2A 2JZNA 1CHNA 2Q9BA 5K3OA 4QUIA 3F6EX 1GKIA 1XRRA 4ZWNA 3CT4A 1GLNA 4UQOA 2D1QA 1H42A 2BDTA 2KLBA 1WQ4A 2QV7A 1OR8A 2W2OA 1HDRA 2RHHA 4Q39A 1ZO8A 5AHKA 4BO8A 3KQTA 5TLSA 2I7TA 3HACA 3WGVA 2P4HX 4LF7B 1FQOA 3FNQA 1F0KA 3CLHA 3NEPX 4ISBA 4H15A 3WSWA 4G5SA 4B7CA 2C5SA 4Q16A 4L9WA 2VHXA 1F8YA 1ZL0A 2ZDGA 3FWZA 4D99A 4MGHA 4FFBB 3BGWA 4D9HA 4IUBS 2VP5A 3IQGX 1OKKD 2J07A 1N0WA 1MLDA 2OORC 3N2LA 4IMJB 3HRIA 4OAOA 1E79A 3TW6A 2I65A 1IEWA 3I72A 4N3GA 1TMYA 1Z6TA 3LVFO 1O6CA 1XZ8A 3EHDA 1GZDA 1Z5WA 3PCXA 3VYTB 1L5WA 4G37A 4D9GA 3T1TA 2K7FA 3TH5A 4TWJA 3C3AA 1S1MA 2MTBA 1WSAA 3V1LA 2R48A 3FRIA 4XR4A 5AW0A 4PX5A 5AT1A 1XRSB 2A4KA 1W1IA 3ACCA 1XMOB 4W4TA 1SM4A 2WWVD 4D3DA 1SVOA 2YMLA 4L5CA 5FTKA 5AVKA 1L3IA 2XRYA 5AVJA 4BB0A 1FVHA 2ECPA 1LUAA 4U2KA 4L95C 3T7SA 1OLUB 3TD6A 3GNQA 3M5WA 4FGZA 3IQDB 4LOIA 4NOLA 3ZDEA 3LAWA 3HKCB 4GBJA 4Q7LA 4YRTA 3HYLA 2P11A 3UOAB 2H7YA 3C39A 2EKLA 5ITWA 2G5GX 4GQBA 1W4AA 4MWZA 1KQ3A 2ZIWB 4JBXA 1EJ2A 1WDLA 4NF2A 5FTMA 4NENB 2FFAA 1E18A 5EIFA 1LWOA 1AVTA 5DXJA 4C7OA 2GARA 4HB4A 4RKYA 5FYDA 5B3JA 4O3MA 5CH5A 3N58A 4HN9A 2ONZA 2A0XA 1DCFA 1M5RA 3OC6A 4YAEA 1Y5MA 4A10A 1P0CA 4QYIA 4ESVA 1P1HA 3STXA 4ZI7F 1DPFA 1NI5A 1TQDA 1U3TA 4HPJB 4KMOA 4B45A 5JRZA 5M7EA 1UC8A 1YIAA 3E1KA 1BS1A 2OXIA 2R5NA 2QPTA 1BMQA 3D6VA 1AKUA 5JQWA 3VDNB 3PGA1 1E1NA 4HNQA 4WCVA 5AKXA 2Y4NA 3GYBA 3W7VA 1VG0B 3ZWYA 2X8AA 1R12A 1EFLA 2A0KA 2EF0A 2MWMA 2X8WA 3KKQA 3LDUA 2C2GA 3UWMA 3L05A 2A9OA 2QMZA 4YUVA 4BOYA 5CDFA 3RT1A 4E0BA 4PN7A 2Z30A 4Z4EA 1AHNA 3VJKA 7REQB 3PQ8A 4GMXA 3HBMA 4PS0A 1P39A 3CYFA 1DZ3A 3UXMA 4W7HA 2GS9A 4AZSA 1QFMA 1IZ0A 1NXXA 2CLEB 5J5CA 1EQAA 4M0UA 2QTZA 4MIEA 4RXUA 3SYNA 1Z4IA 5DN6A 3VHXA 3R0IA 1UDCA 2G4VA 4U7DA 2JC3A 3CBGA 3R4VA 4ZN6A 2NUPB 1T8WA 5K20A 4G1FA 1O95C 1T6NA 5HGXA 5I9BA 3FCOA 4HWSA 3B2NA 4OLHA 1K5PA 3GWZA 3Q7TA 1DWOA 1Z0AA 4DTIA 1WB6A 1YULA 1FRVA 4PYRA 2H85A 4UULA 4F2HA 1KDPA 1HZZA 3QNWA 4TL6A 5DV9A 5GGXA 5BT9A 2IK8A 5TIIA 1NBHA 1O5OA 2WAMA 5ENVA 1O89A 1IFXA 3IKMB 1POXA 4UHCA 3UHAA 4EJMA 4ZYLA 4JB0A 3AJDA 4IICA 1KJIA 1P0PA 1RZVA 3WLMA 4CHGA 1SKYE 5B3KA 4EP1A 4AKGA 4MRMA 2Q28A 4JC4A 3X3HA 4V24A 5J2TA 3DMPA 2Q7XA 2WHYA 1AK2A 1U11A 3LP6A 4J0GA 4ENQA 3EHEA 3E7FA 1R0KA 2VSNA 3FCUB 1FDRA 1VB5A 1J8DA 4L08A 2PUJA 1WPQA 4JJ7A 4RVDA 2VNAA 4V0OA 1PKEA 3VOSA 4R71A 1TUBB 4C1BA 3JWEA 1GCOA 3VYVA 5A4JA 2JGDA 2JI4A 1BYUA 4RHXA 1X8LA 4LDNA 3HCBA 3PEYA 3K8YA 5DM4A 3RC8A 1SCUA 1KKLA 2QIOA 1SCDA 2D06A 2EHDA 4RDHA 4RVUA 4YQFA 4R68A 2CV1A 3QM1A 3MM4A 3TVDA 1CVRA 3K0CA 2GNAA 3FCSB 4D42A 2W8BB 3H99A 4M6WA 3HJHA 3OTWA 5LP6B 1ZXXA 1DC4A 3E2PA 4XJSA 4MJ3A 4CE6A 2VPYA 1P2FA 4F12A 4NS4A 3V1UA 1T13A 3VYRB 5BWNA 1WB4A 4WE3A 1FQJA 4MVJH 1EFTA 1WB5A 3E7DA 3IE0A 3UAGA 3V6LA 4UUAA 1FLDA 1X9GA 4G56A 3RSHA 4DRXA 4TS4A 3W4KA 2K6GA 4QIHA 1I6KA 1MO4A 5GJCA 2BMVA 5BV8A 1PR5A 1JFSA 2D8MA 5JJIA 1CDOA 4MUHA 5A3SA 2Z5LA 1CQPA 2DVMA 2ZBPA 1XLTC 4ZI2A 5ICEA 5HTOA 4QXMA 4UE2A 1G5FA 4DV5B 1ULBA 1TAUA 1X8KA 1OC2A 3LXRA 3E5RA 4R6WA 1L1FA 5MN4A 1JRLA 1S01A 2NW6A 3V3TA 3ZWVA 2C88A 4ILEA 4ND4A 2A8YA 5CHYA 5KJCA 2O5EA 2WWRA 3SR3A 2QUAA 2WABA 1P0IA 2VQEB 3THOA 1SULA 2W6JA 2WUWE 1RM4A 4HXEB 3NBYC 4R8LA 4L78A 3LGAA 1SIUA 1LX7A 4RD3A 3WB2A 4PYQA 2HU8A 3RK1A 1JU9A 2AXNA 3H16A 2QLFA 4CIWA 2B4KA 5E2IA 1XQ1A 3ZDZB 5I4IA 1RWBA 1PNVA 3CZQA 2AJTA 3GP3A 4XCVA 5IJZA 1UZAA 1CZKA 2XOKA 2HU5A 4YVFA 4MH0R 3TLYA 5KYGA 2C4NA 2EW2A 1DAIA 3WFZA 1NUTA 2IHNA 2BFBB 4FR5A 4P36A 1SO8A 5CX4A 2PZ8A 1IOZA 3BRCA 4J0HA 3ZXSA 1RACA 3L8MA 2ZJBA 5DLDA 3F9CA 4PR0A 5EWLA 5KTTA 4BVLA 3AVYA 2CJXA 1FDSA 3ORHA 4K87A 3VH1A 2RK6A 3AF2A 3ORFA 5CA1B 2PQ2A 2PH5A 3UPDA 2GZ3A 2FX3A 2V1XA 3JQ7B 4RAQA 2AFIB 3ZWBA 2WKWA 1WZEA 3PJDA 1F38A 2X76A 4X90A 2AWNA 3FGZA 3GBPA 1LY1A 5E1BA 2Y0PA 4OU5A 5HKBA 4LFCB 1FMFA 1JEJA 1J2JA 2QS9A 3LXXA 5DHFA 1I4OA 4RHCA 5BUSA 3T5MA 1KOFA 1Y7PA 4KIWA 3EXHC 4CGYA 1LQTA 2CXSA 1XQ6A 4NBVA 2GZHA 3M6VA 4ZAZA 5TF4A 2K7ZA 3B3FA 4L8FA 4MWGA 4WN9B 2ZYTX 3BSWA 5DI3B 5EWMB 2KHZA 1FFEA 5FAXA 3BRQA 5CRIA 1H4VB 4C30A 4Q3EA 5BR4A 2FMHA 1VI5A 2PZEA 4NV1A 2BGNA 4N8SA 4RL6A 2BHSA 3KAQA 3MUEA 5DJ5A 5ED0A 4F5YA 3IIIA 2GR9A 3G2PA 2Q5IA 3PFFA 1HFKA 1Y34E 2VL7A 3EBLA 5DOZA 1FNSA 5ERYA 1E5DA 4BKRA 2C7VA 2JIZA 4E33A 4G01B 4QT4A 3L8HA 4BGDA 2D5AA 3IAM6 4HJXA 4HXFB 4Z9YA 5BMVB 2DWQA 2Q4EA 5BN4B 1NM5A 3QOYA 2D4HA 5F2NA 2HMVA 2PEYA 2MSNA 3C3YA 1Y1LA 2AN3A 3GGCA 1XTSA 2J41A 2ZJAA 1KZ4A 1OBVA 5FR1A 1BXRB 4OYHA 1PZXA 3OIUA 5JS7A 2O0LA 3B6JA 4ATNA 4TV8F 3DO8A 1YZ3A 2NPOA 3WV4A 4C0HA 2I1QA 4CF6A 4CJXA 2OK8A 4QYMA 2AE2A 1MO3A 1T8SA 4BRSA 2GB4A 1NLFA 4MO9A 4A0QA 3IXQA 4GXQA 1NHGA 5J9FA 3MJSA 4O4HB 4BNDA 1NRWA 4P93A 1YA4A 3CVWA 4O4HF 3N6VA 3D8HA 4DR2B 1NYTA 5IJAA 3L07A 4QFDA 3M83A 1A9SA 1C0KA 1XPJA 3ELYA 3QF4B 3V4VB 2J7KA 3FMOB 4IO1A 4WZAE 1WMAA 3B20A 3WTCA 5A5DA 3KOMA 4Q9KA 4FFSA 4Q6BA 3U7FB 5LYJB 1F60A 4BJ6A 1YZLA 3ELWA 4OQZA 4I99A 5NULA 2RGWA 2P3OA 5ECYA 1XDDA 2IHBA 1IQPA 5LOVB 3CEPB 5KX5A 1XL0A 3OZFA 4ZCLA 3RVOA 4P08A 1X7YA 2R8OA 3HN7A 1QYRA 3T3EA 3T4UA 4XFKA 4G0ZA 4UEWA 1UZNA 2DC1A 5HQTA 1RIFA 3NEJA 1NXTA 3O26A 5F4BA 3RAGA 4OP3A 1EM8A 1WMSA 5MF6A 1HLDA 3CR3C 5JCOA 1YR7A 4G4GA 1DUIA 2E21A 1U28C 3CMCO 3A9CA 3EMDA 3FPGA 5CIWA 1PGNA 1PWHA 2E4WA 3SQLA 1X94A 1KZYC 3KC2A 3FNHA 3QPUA 4XWGA 1J8VA 1EKXA 2FMFA 1U7ZA 1P4SA 3NHRA 2Z08A 4X1IA 1M67A 1ADCA 3IYLW 3LUFA 1P75A 5LXTF 1JVNA 1M75A 4UEKA 1ZS9A 1ZDMA 2OC9A 1AC5A 1N2CB 2PTHA 2XYGA 1GU7A 4LJ9A 1VPVA 3IEMA 4BMZA 3GEPA 4C0JA 4FGJA 5F2EA 1LRJA 5G4KB 3W1WA 3LX4A 2C59A 4JBHA 3NHZA 1KYZA 3EGXA 3PRJA 4D4IA 2FE1A 1Z83A 3CZ9A 2UZAA 4L4XA 3PKJA 3NHPA 4O59O 4GNKA 3A14A 1QRAA 1QRRA 2V55B 1F6WA 3ERCA 1TW2A 4E6EA 1BRMA 1AKVA 1KVRA 4RE5A 2GF0A 3WP0A 3HVIA 2DWPA 1TM3E 1DLJA 4H7IA 3TEFA 3ZDFA 2Z56A 1XVAA 1P7VA 1IRIA 1IAVA 1RM3A 4U5QA 1ZFNA 3T12A 3DDCA 4WJZA 3PIIA 2FMTA 3QE2A 3HE3A 4K8RB 4BLPA 2WHPA 1ND6A 3FWYA 1N2ZA 3HUTA 4X5OA 2AHRA 3GJQA 1XQXA 3I0ZA 2HDOA 2ODAA 3D59A 3ICCA 3UK7A 4I6EA 2E4UA 5G2OA 3TQSA 1OF1A 1TK9A 3O93A 4TXNA 3RV4A 4YC7A 3A4LA 3SZRA 1BKSB 5LKAA 1CZRA 4IIJB 2VHEA 4W8GA 1VRWA 4G5FA 3BWVA 4V38A 5JS6A 1D9ZA 1CW2B 1ISGA 1J06A 3M6UA 3QQPA 4ZOLB 4UD6A 5K09A 4D8XA 4H0FA 1G0NA 4J1TA 2AXPA 4XX0A 2QRVB 2UZ1A 1EBUA 2C5LA 5DNAA 4J3FA 3SXPA 4Z54A 3CKMA 1W9MA 3DVQX 3A31A 1K7SN 1QC5A 4JYPA 4P3OA 4BNYA 1FUEA 5C18A 8GPBA 2ZROA 1HE5A 1M1YB 1SXJE 4GSYA 3PGKA 2OCDA 2ZRAA 3KD3A 4FFOA 4NJEB 3T7JA 1C3OB 4ETNA 1U2DA 2J1LA 3SE7A 4CIAA 1GQFA 2MYTA 3T7IA 2G04A 2PX5A 4Q34A 3DP9A 3WK7A 1V5GA 5EVJA 1XVIA 1B2LA 1LS1A 4GLJA 4BGIA 2ZRKA 1FDWA 1Q16A 16PKA 3K16A 3VX4A 2P0EA 3FOBA 3L0ZA 3HXKA 2CLFB 4UXHA 1PO7A 2QSJA 2FEXA 2VBGA 5GP1A 5JSQA 3THXB 1TT5A 3REFA 1QH8A 3IB6A 1O7JA 3DOCA 1THGA 2HPZA 1CUFA 3ZHUA 3RVSA 4RSMA 1OI7A 4WINA 4CDGA 1WV0A 3ACBA 1XTKA 1C7QA 3GEIA 3D0QA 4IEEA 4MPDA 1LPOA 4QU5A 4G0VA 1D2GA 3LECA 1D0VA 5E1DA 4FINA 3FY4A 4M1SA 4K9RA 4PAQA 1JZTA 5K8VA 3ZE1B 2JD2A 1SKAA 3MQFA 1FRQA 5AW4A 4RD1A 2X2PA 1OQAA 1QGUA 1R8YA 1ZX1A 2Q07A 3BB1A 3Q7IA 3QBJA 4MB2A 4D74A 2NZVG 4IJVA 1CLEA 3FHJA 3KZCA 2HI0A 1QSGA 2IIPA 2XA2A 1H4TA 4DQ0A 1PNOA 1E1CA 2WUEA 2QUIA 5ESWA 3VO9A 1XYGA 3O21A 3GNSA 4U7WA 3RKRA 4JQSA 4JEUA 2WSLA 5JCZA 7MHTA 1R4ZA 1OAOA 1GFZA 2B92A 3TZEA 4Q24A 3DW3X 3O8LA 2OYCA 3VPFA 3OQ1A 4DCGA 3LIPA 2A1TS 5FOUA 2YZ7A 4QATA 3ZWKA 1NBMD 1UDRA 3AH8A 2BRUA 4H35A 3GA7A 3VNVA 1TJPB 3WGGA 2I4RA 5BYJA 1MA0A 2E37A 3WGHA 5ILGA 4TV9A 2QTTA 2IPOA 3GUZA 4N8DA 3TTWA 1Z7EA 2DUWA 3KYCA 3T7DA 4C0WA 4D02A 1ZH6A 3WLLA 1EK1A 2QYOA 5A4KA 3B7WA 4EHAA 4DIUA 4QFCA 1JG7A 1EMDA 3EA4A 5FBQB 4WLEA 4FFWA 3GLGB 3M5DA 3WRXC 4Q66C 2X5KO 1NQ5A 1T1SA 1EK0A 4QARA 1NZFA 1IHYA 1PZEA 1BVUA 3KSMA 4RGBA 4HK4A 3EIUA 1BKYA 3WRYA 3PQ7A 2XGJA 1JLRA 2VAPA 4GU5A 4TTSA 5HDQA 5LQNA 2IYYA 3LU1A 5A4AA 3PRHA 1KIAA 5JH7B 1HC7A 3PCRB 2I9PA 4OQ4A 5ALXA 5L7TA 2H1IA 3M89A 3JALA 4CBVA 4IP0A 4E1BA 3QBDA 4QOJA 1A9TA 1NRXA 2IYVA 2QDKA 5FH9A 3T99A 3EX7C 2ZB2A 2GYUA 4GF5A 4RANA 4KKXB 4F4HA 1ZNYA 1A3CA 1MGPA 5I7HA 1L4LA 3PEFA 3H3XA 1NJSA 4UDXX 5EFOA 4KO4S 4FJ2A 2ZRCA 2AMVA 5HE9A 2B7LA 4LYJA 4REQA 3GFFA 1RE1A 2QW1A 4WK0B 4DT1B 1VYHA 1LS6A 2CL6X 2AEFA 4BO3A 5AM2A 3ZDDA 1IQUA 2H0RA 5JD6A 1FW6A 1YHYA 1N77A 5IABA 2D1RA 2QKYA 2Z58A 4PSCA 1GA4A 1ZGJA 1SUCA 2I2CA 5EE3A 1OV6A 1HDYA 4LJKA 1IEQA 1SC3A 2HCBA 1AU9A 3RUEA 4F84A 1CT9A 1YZKA 3SVTA 2EGHA 1EK5A 1SXGA 2GN2A 1WCV1 2ECFA 3DJFA 3FPEA 3R74A 8LDHA 1P9WA 1DKOA 3RANA 4KITB 5EL0A 2IYQA 3OBBA 1E6UA 1X77A 1UM9A 5JSYA 3TOZA 1KH1A 3KXKA 2RFLA 3E8XA 3H2SA 4I4TA 3GT7A 2UV8A 1EGAA 2Q5LA 4R7ZA 1TJYA 4EYGA 3G23A 3NTXA 2OGWA 2BMDA 3C3EA 3LBFA 4G81A 3MUOA 1HFEL 5IDVA 5AVYA 3MJCA 4OJQA 2GRJA 2IF2A 5KNDH 3GPLA 4C89A 2YHSA 3NGXA 3S2YA 5BOSB 1PK7A 4JU8A 2JCGA 3T4PA 4AT1A 1CVIA 2V9CA 3GELA 4NBUA 2B2NA 2JGJA 1JMKC 5L6LB 3REQB 1RLTA 4RS3A 1J8FA 5ALPA 3F2IA 2ZIGA 1BX0A 3V1YA 1EWTA 4D6PA 1QQAA 4B9EA 5FUVA 3T3IA 4CM4A 3WK8A 5LDDC 1RYFA 2PKCA 3KM0A 1EWVA 3QUCA 1DQRA 3EOBI 1BE8A 3NLLA 1ONSA 1QHNA 2XQGA 4IVPA 4ZVRA 3FDIA 1N33B 1E2KA 2PYZA 5JPCA 2QSYA 3Q0EA 3E9DA 5PGMA 4O2BF 5K0EA 3KQNA 4XYMA 5WRFA 3BRSA 3LT2A 1HNNA 3OQ6A 4IRUB 4FSDA 2CLOB 3T3GA 1V35A 2BSQA 3D8SA 1UOPA 1EP3B 4CCWA 1IMOA 4YQZA 1GG8A 3U7GA 1O5TA 1WWKA 2ZBRA 1S8AA 1RKQA 4UNSA 3R7AA 4I8DA 1NVDA 3JQBC 3R2JA 2AVNA 1P45A 3EVEA 2ZIVB 4YRPA 2PA0A 3FRJA 2FZWA 2QN2A 5DVZA 1CNEA 1SC6A 4FN4A 4ZQCB 3DHEA 1KY3A 2PV0A 1EX7A 3ZKWB 4HPWA 1PFGA 4B4WA 5DASA 4NESA 1H2RS 1IY8A 1UT5A 5JHGB 2W7TA 3S6JA 1L7NA 1T5IA 4PHCA 3U3ZA 3VU9B 3L8CA 3Q15C 4BNIA 4DMLA 3JQ8B 4DSAA 5AUQA 4LRYA 5GM2A 4ZO8A 2WYOA 3WK6A 1BU8A 1IOVA 1VM6A 3CPEA 1OGYA 1P81A 3HJBA 2OD2A 3LHFA 4ZOCA 2GJ9A 3I1YA 1GUFA 1DJQA 1CUXA 1ZJ5A 2J3LA 3B3JA 4NXMB 5FUMA 2BAGA 5JROA 4ETWA 3VR6D 1G20E 5AJHA 5B4UA 3UKJA 3EDOA 2IDZA 1YJ5A 4RD2A 4AMVA 5IAJA 4DBZA 4G9EA 1I33A 1H5NA 1YQGA 2YOFA 3MELA 1RQRA 4UOQA 2WZDA 4ZOEA 4ARVA 3JARB 3P9PA 3BM5A 4RTNA 2FG7C 4NE7A 1VG9B 3C5CA 1Z8FA 4BVKA 4XXHA 4NU5A 2H9YA 3DBIA 1US8B 1A98A 4XYLA 5C32A 2HR1A 3L0SA 1JEDA 5AXCA 3WJ7A 5K01A 3EH2A 3U44B 1NNSA 3UMCA 3PX7A 3ZCPA 3FTPA 4UOZA 2E6KA 4QHYA 2QF7A 1YR8A 2PH3A 2F3UA 3DV0A 4FKMA 1UXHA 3A27A 3WFIA 1YASA 3V4LA 1E1QA 1QIFA 4GBED 5TQ2A 5FF9A 2HF7A 1NLMA 3G68A 3LQFA 1QWSA 1A9ZA 4DAOA 1ESDA 1G8YA 2W22A 3UMMA 3IJEB 3R7WA 2TMKA 1ADBA 1JAZA 3KVYA 4ETIA 2SCUA 1SA0A 3OOYA 5TEWA 3RKSA 5EESA 4M49A 4X71A 4CT5A 5COAA 5C3UA 2IBTA 3R7BA 1N7GA 4CLOB 3CWCA 3G0GA 2O06A 1J5XA 2OMEA 1QH1B 2Q3JA 3KUCA 3Q85A 3SC6A 3KSUA 2CFRA 1YKSA 2ZSUA 1QWOA 2ECOA 2QVLA 3G02A 1Z63A 3FIJA 1V47A 3X1YA 4WNIA 2C4VA 5BSRA 5JZMA 3VNUA 1ZQ1A 4KMMA 5DXAA 4DXDA 3IOMA 5DW0A 3WICA 3CX4A 1QJCA 2FWJA 3SZOA 1YU6A 2WW8A 3ZV4A 2NQ2C 3L9WA 1R6DA 1R9JA 1U3WA 2XNKA 5C35A 4DREA 1N9KA 1H6AA 3EOZA 3WWCA 3W8RA 1VKHA 1TL7C 1SQ0A 1ML4A 4ZK6A 3SIXA 2J0UA 4HNRA 1RXUA 3QEJA 3WBBA 5KO2A 2QTFA 4RUKA 3HSSA 1YRLA 2CKDA 4AMUA 3LPNA 3T8YA 5JO0A 4JX8A 4E09A 1H5UA 4JDPA 2HN9A 1YZTA 2DBYA 4MQMA 2PSHA 5LZ5A 1P9LA 3A2NA 3H5TA 1NP7A 4DMHA 2HZBA 1TVKB 4UNNA 3P20A 3RTCA 4IRXA 3LKDA 4CMGA 4CQLA 2YWEA 5I3ZA 2IQ5A 3ESZA 1H8HD 2ZBQA 2XUHA 2VCHA 3HL4A 3Q3IA 4QREA 1C2TA 2AR7A 4ND5A 4W63A 1G9XA 4H17A 5K45A 1CEQA 4H59A 3AV3A 3AB3A 1BXKA 1TUGA 3F8SA 4IS2A 1U1FA 3QELB 3S7TA 1DDGA 2VJKA 4FGWA 2GRUA 1XRNA 2AWOA 1PT8A 2GA9A 3N39C 1WX1A 5CBPA 5LU9A 4FFRA 3KSRA 4M8NE 4QGHA 4FDAA 2X23A 4QLOA 5FOVA 5KOHA 1XJ0A 3K15A 3VKHA 3ND7A 1U7DA 2Z2KA 3FYUB 3NIGB 4LSGA 2CNNA 3NOXA 4TUYB 4WKCA 4CMBA 1JFFA 1L7QA 2IUFA 4N0QA 1WZNA 3F4BA 1IATA 3TGWA 5H3HA 1QKKA 5CHEA 5C7OO 1Q12A 4JCCA 4QOIA 1EQUA 1KP2A 3LO8A 2ON6A 3C5EA 5COQA 5ULLA 2BEUB 4JT2A 2V96A 2QAGB 2Q5OA 3HCDA 3LLUA 3MT8A 3R3JA 4E21A 1E3LA 2YDYA 3NH6A 3RYIA 1JJBA 1KJ8A 3PFKA 3RGGA 5C4MA 1L4UA 3FM9A 4CKCB 1UPXA 1FFWA 1XX6A 1YVRA 2NYVA 2PBRA 5EEGA 1VIYA 1NIPA 2IGBA 3LF1A 1Y6FA 1HEIA 5FP0A 2VPIA 2PX8A 3ZJTA 3MWKA 3P2JA 1GLVA 1ECCA 3UEOA 4DM3A 2ZAYA 4BIMA 4G84A 1NNI1 2I3AA 3K2BA 4OQNA 1LQ2A 4POAA 2BGJA 4HEJA 4BKOA 1Z4LA 2CL0X 2G9NA 2LIPA 1PR2A 1TK2A 2IHKA 3IILA 3INGA 2Q6LA 1W8DA 2QRJA 4RFLA 2HUNA 3ROPA 2BH9A 3EWAA 3VR5D 3OX3A 5GOZA 1QU3A 1QE0A 1P3DA 1BJTA 3MYYA 2GKGA 3PUZA 1HT1E 3PWZA 4FE7A 4YDQA 5JD4A 1W30A 2BFCA 1WMBA 4YCBA 1X1QA 1OU0A 2GDZA 3FHOA 1X7ZA 4PHTA 1BCRB 4AJOA 3D4IA 3GQBA 3KB8A 3F98A 4L4UA 3ES9A 1NJFA 3EW7A 3TLGB 1E7WA 3DEFA 5JDIA 5JIBA 1BSVA 4RJLA 4CLRA 1N3LA 1KXJA 2XTJA 1CR2A 4P34A 1M0TA 2KE5A 5KSOA 2E9SA 3ZBTA 1YBFA 1ZC4A 4F6CA 1XV5A 1U2QA 3INNA 2M1ZA 5DYTA 2WIFA 1R0WA 4MGEA 1NURA 4TT8A 4LDPA 3O84A 2PUDA 2DG2A 4PQFA 3EB9A 2QT0A 5C8YF 3FYTA 1YZHA 3NVDA 1BXGA 1AKEA 2NXWA 3OP1A 2ZJ0A 3I05A 4G4SP 3U3JA 4KMSA 4L5IA 4ESHA 4BO5A 1M9NA 5KZMB 4IZHA 4EYOA 1YAJA 3VR4A 3JVUA 4CMKA 3OVMA 1GQYA 1TYEB 4NQRA 1P44A 3OIGA 3PQ5A 3BTUA 1F20A 2ZS9A 2A5LA 1D6SA 2QA5A 4FFMA 1ZVQA 3GT4A 3I83A 1BWQA 5CM9C 3MTIA 2BGUA 1W5SA 3HVHA 3I9JA 3GLHE 4LF6B 4OLFA 3MW8A 3PDCA 4DUPA 4HTFB 2YXDA 3DF7A 5F52A 2Q8NA 3C3DA 5HF6A 3ETCA 4Y2VA 1XCPA 2PMWB 2OHVA 2D1FA 2TRSB 1NQVA 3A4VA 4NCNA 4PICA 3TEJA 5LWQA 1Y6GA 3UB2A 3G9TA 4IKPA 4N7BA 2GPBA 3H1BA 3QKRA 3MGAA 1ACMA 4NBLA 4DA0A 1JQJC 3ZDYB 3HGTA 1Z0DA 1GILA 4DUGA 4EHBA 4KVZA 4WW0A 1D4FA 4P3XA 2C2YA 4DLSA 5HRCA 1Y89A 4KE7A 2DKNA 1P2BA 3FJ1A 1EUDA 1BU5A 4RW0A 1MAAA 5CCBA 1GUDA 2CUNA 3T9AA 4US2R 2YCLA 3KKKA 3KNZA 2QX8A 2QXTA 2YJ5A 4X3CA 4KTTE 3KTDA 1OJ7A 1YMVA 4RD0A 1V5FA 2C5HA 2OPBA 3AFIA 3LOQA 1JU4A 2FV8A 4TLCA 2HZ7A 4LOKA 2YIDA 4ONEA 4MJLA 4X45A 4ARUA 3WLOA 4CZ2A 5EHXA 1M1XB 1UFQA 1IRXA 2RBGA 2W70A 2RHCA 3D64A 3GBSA 3PK0A 2X22A 3L1JA 4D9MA 1H94A 2QRUA 1SC4A 2NSDA 3C3KA 2AZTA 4PNPA 4XA8A 1EE2A 2Q1WA 2YN4A 4HGZA 1EZZA 1I4EB 4XQCA 1W29A 4H0NA 4OOFA 3OE1A 5AVZA 4U0KA 1E2NA 2QTVA 1B6SA 1C4WA 1RIIA 3NHYA 1VYTA 4J0KA 2VNIA 1UADA 4PC2A 3IP6A 1L6IA 2IP1A 1U3GA 4RVNA 2JL1A 4XCQA 2HJSA 2C0CA 3CLTD 3LZDA 4O2AF 4U9UA 3K70B 3KETA 4DANA 2Q3EA 2V7UA 5D3ZA 4ALIA 1H4SA 2DTDA 3E3LA 2IELA 2DT8A 4JXKA 2YVLA 2ZB4A 3EDRA 5LWHA 1G7SA 3W6OA 4E22A 4H7JA 1DUVG 1I1NA 1QG6A 1P60A 2FOXA 2R6CA 4ZFNA 1ORWA 1V1RA 2WZCA 4O4JA 4X6XA 3RG8A 1A95A 1PQPA 4KUHA 4DG8A 2KBFA 5CJ2A 1KZHA 2G82A 5AI6A 4L8LA 5HKKA 1GZUA 5JASA 3I09A 1A9RA 4RACA 4WGFA 4K9MA 3MPOA 4KYUA 3CUSA 4YQYA 2VSQA 5DLPA 2EGUA 1KZ7B 3RSSA 3E7WA 1IM5A 1UMDA 2BUAA 1ZAKA 4B4OA 1VYVA 2J33A 1NG9A 3OUUA 3Q6NA 4JKOA 4FEAA 1OLXA 3P45A 2F62A 3JQGB 1OFIA 3A26A 1UJBA 3GI1A 4MB6A 4LHSA 4W99A 1JQBA 4PZZA 4A6DA 3G79A 2B7BA 2GM5A 4ZCQA 4J94A 2WEKA 4BRUA 3RYCB 1A7UA 3HCPA 3NONA 1SUPA 2FTKE 4BMDA 1DIGA 2EWMA 5LA6A 3U7EB 4B6RA 3K6SB 3WA7A 3UGKA 3Q3CA 3PZBA 4LX0A 4Q48A 1ZGGA 4EIWA 5JFOA 1P61B 2Y0BA 4MOWA 3FMPB 3KHTA 5E9AA 2WP8J 5EOVA 3VNAA 1CRZA 2VSYA 5DFAA 1D5CA 5LMZA 3U9SA 1M1YE 1QK3A 5K0LA 3QYFA 5DLEA 1J0XO 5EXEA 3SSAA 3AI3A 5LNK1 5IXSA 4LY3A 4TMTA 4WNAA 2GCNA 1V9CA 2VXBA 3TW8B 2K5UA 1VMKA 2XSZA 2VI5A 1HNZB 3KDAA 5EJ8A 4XOUA 5F12A 5ICCA 2Z5GA 1WD7A 2V97A 4L0QA 4R16A 3U81A 2W2KA 1K8XB 3JYHA 1J0AA 2PG3A 1Z47A 2OO3A 5D00A 1IN8A 5JATA 4NRDA 1HNWB 2FPKA 2EBFX 3PLAE 5FUBA 1NXVA 3KWLA 2V1UA 4QJ3A 1C0LA 3VPSA 3HSYA 3MXOA 1EE9A 1CF2O 3P9SA 2BTOA 5CLGA 4CQJA 2OXRA 4OHUA 5TX7A 4RIGA 4MKIA 3LF2A 5FXMA 6PFKA 4GM1A 4X84A 5B7QA 5CFRA 5KJFA 3NDIA 2O0MA 13PKA 2FSFA 3AQ4A 2I3ZA 3PYLA 1R5NA 2M6KA 1OT5A 1LPSA 2B99A 3QIVA 3AJ9A 3AXTA 1NONA 2BUCA 4KQKA 5EMHA 2I8CA 3KPWA 4N01A 3ZYZA 4B79A 1MOQA 3PDWA 2PNFA 1IONA 8ABPA 3KQHA 4PCUA 2I3DA 2IXAA 1PL8A 1CJCA 3HDTA 3OT4A 1UK7A 5C34B 3OT5A 5JJKA 1P2TA 1ODLA 3C41J 4MKHA 4XB2A 5A04A 3ZWNA 3CW2A 3IR6A 1AA9A 3ZXYA 3DVLA 1DX4A 2C4WA 1F9EA 1APBA 1IOWA 1KEEB 2H1HA 1FFDA 2I2WA 2NXJA 4NYIR 3IIMA 4AJ1A 4NOKA 5DTEA 2BMWA 2LBPA 2BHRA 2R8YA 2BFNA 3L0IB 2UUPA 4F45A 5JD3A 3E2IA 4EO7A 2X8BA 1RCUA 4ZCMA 4JLDA 4OI1A 1W44A 2AW5A 1D1SA 1NC1A 4CUZA 4PXAA 3RT9A 2XKKA 1YFZA 4Z86A 1ZN8A 1IYZA 4H7DA 4B46A 2XDAA 4UTOA 2OLJA 4RVOA 1KQPA 3TOVA 4FJ0A 5JCJA 1UT6A 2DJ5A 1Z07A 1X80A 1DTWA 4KDEA 1OI4A 4YQEA 3DD1A 5EUBA 3QU9A 1P5FA 5AHRA 2PGDA 4I4IA 2OM2A 3R0XA 1ZIPA 4L5AA 4ZDWA 4D9KA 2IZ7A 2VTEA 2E3JA 4GW3A 1QVRA 2AG8A 2UUBB 1DEHA 4DBVO 4YXWA 4KJZA 1YDHA 5LQKA 1GTSA 1GGMA 3H4IA 1LH0A 2ZRNA 4MQEB 1EGQA 3AHHA 4MEJA 2OQRA 2YN2A 1WZCA 2HRRA 3D0RA 3D3NA 3T9BA 3WLPA 4N48A 2DAPA 2BKXA 1ESCA 3G9QA 3EYAA 3C5WP 2AV6A 2VP2A 2BKUA 4OHZA 1ZOPA 1E2BA 3AUAA 1JJVA 3K9CA 3K71B 4ND7A 4DMFA 2I99A 2H4ZA 2CZCA 5GADl 1UKBA 4IQGA 1FLAA 1D4ZA 4XGKA 4B73A 5HIIA 1CP2A 2JBAA 4RIHA 1SVIA 3TNYA 4CDMA 1U2GA 4F6LA 1QRTA 1VLQA 2PN1A 1QG0A 3EXHB 3OF2A 3PNQA 4P4GA 2PFGA 4XDZA 4EI7A 1TFUA 4IHKA 5CLIA 3KZNA 1TZKA 3O2JA 4QPDA 5KYWA 3COPA 3ONWA 1DAEA 3AEQB 3BWMA 3F6PA 3RBXA 1NMXA 4IGAA 4K46A 4KODA 4OHVA 1E2DA 4X1YB 1FMJA 4TS9A 4M1KA 2VO1A 4ZKEA 3B9RA 4AZ0B 1V4VA 1CWUA 4RHFA 2VXCA 3L4BC 4RTOA 3HEBA 3CVXA 3HJTA 2NTVA 1N7JA 4C4YA 1HLFA 3EZYA 5IN4A 5HDBB 6YASA 3MBIA 3VTZA 4JYZA 4MYRA 1E61A 1TCAA 4LV6A 1Q1QA 4DSOA 4LRUA 5JNRA 4YJ2A 1IUPA 3LNCA 1AD2A 1C1XB 1C29B 1D0IA 1F2UB 3PFHA 4MA4A 4TXLA 3VZSA 2OTCA 3MLBA 1NA5A 2FOIA 1GFIA 4AP5A 2GWRA 4K5QA 4UFPA 3MJTA 5HFAA 4HDCA 1JFRA 4PNEA 1TM5E 1ZONA 2G9UA 2L19A 2Q1SA 2VJOA 3A70A 3EEBA 3NRCA 5F73A 3RAJA 3FOAA 3OWHA 4QJBA 3SXUB 3ELBA 5AW6A 5KMGA 2BTEA 4UQLA 4MP6A 3AUFA 5ARBA 2IVFA 5MN6A 3ZYCA 4GOKA 3INTA 1GY8A 5A02A 4KRYA 3MZ0A 3QHAA 2FW7A 3VOTA 4C4SA 4XARA 3INYA 4EQZA 3DBLA 2GXUA 1XEXA 2CMHA 4MS1A 4N65A 4CT4B 4AI6A 2YX1A 1GNLA 3OPYA 1U2SA 3EDYA 3PE3A 3LIIA 3AVTA 3QVGB 4WLOA 4K86A 2PUBA 1WMEA 2C57A 2VK1A 5BOVA 5AI8A 2QUHA 4OQQA 3UAOA 5A0TA 5K0ZA 4LGVA 5FAKA 1RYNA 4R1PA 3QXSA 1K66A 4QD3A 4X65B 4LI3X 2I34A 1S3SA 2FF7A 5HP4A 5E7QA 5GONF 2HFJA 4Y2GA 1JKMA 2JJQA 3RUIA 3NV7A 3O8DA 4ENRA 5ENZA 3IUQA 1JU3A 4IL5A 1ZWLA 3VKUA 1UPCA 1MDBA 1U8EA 1XAIA 2IE0A 2O3JA 3JYLA 4H4CA 4I7EA 4JJKA 1J2RA 3S8MA 2JLZA 1SD2A 3RPEA 4IF6A 3QKIA 3FSJX 4MJXA 1XRJA 3FFXA 3I23A 3QSGA 4N7RA 3TE7A 1NBIA 1XWFA 3GXBA 3PQ3A 3F47A 4A1FA 4JT4A 5J1SB 5JAQA 4WA7A 4LNUA 1MTOA 1RJEA 4LDRA 1RWMA 3EIWA 4B74A 1JJIA 2C1ZA 4RTJA 1J8YF 1PGOA 4KW7A 5E4TA 3C85A 3QYAA 1Q21A 5DBHX 4B8ZA 2YWRA 5A7HA 4EG6A 5CCEA 1HA3A 3D5EA 3GAFA 2JG3A 4URFA 5AVRA 1QXSA 3AT1A 3NM6B 2OT3B 4YRIA 1B16A 2F3PA 1B0ZA 2QUZA 3JTMA 2PCLA 1MFZA 4RF3A 3GDFA 5IT9A 2A6PA 2RBEA 3MWLA 1KDTA 1D09A 1HT0A 2XUIA 3ZHQA 4F2PA 3UGJA 3ZQ6A 5FQNA 1GIAA 1GTVA 1Y5LA 1EVZA 1EVYA 2ODTX 3KPVA 3Q12A 3ZIAD 4F4UA 2ORVA 4MR7A 2IYNA 3T1NA 2WDPA 4XEHA 3SGLA 1Z29A 4JZYA 1MEEA 5AESA 3CGWA 1O94D 4ZPXA 3EXG1 1BWSA 4AJJA 1QDEA 2PXHA 1CQZA 2XWPA 1Z18A 4MW7A 1NUHA 1P1BA 2GN1A 1FPQA 2ZE5A 3BTVA 3QE4A 4WKGA 3WNBA 3U48A 2GNPA 3VKGA 3C4QA 3T5AA 1I6MA 1Y80A 4Q4JA 3C7DB 1I0ZA 1Z45A 2E48A 3PFGA 4JX9A 1OROA 2Q1XA 3CNOA 1X87A 2Z2YA 2FHSA 3UJ3X 4OH7A 2RJ3A 4H3HB 4W1RA 3BMCB 1QPZA 4XJVA 2PO7A 1DEKA 2IS4A 3N6XA 3FYHA 3A6GA 2GHQA 5JLAA 1BN7A 3RBVA 6REQA 4Z53A 5I8PA 4IJMA 4AULA 4GVPA 1U2PA 4PPNA 2B2CA 1CZNA 1VJCA 2HIAA 1YTLA 4EY6A 1YL5A 3LP8A 2BI8A 1EP2B 1YS9A 3TM5A 1VCIA 2QD2A 5KSZA 1ZW6A 2QVBA 2XQVA 4Q3DA 1F4LA 3SFVA 4LUCA 2JGMA 2FDXA 4EPXA 4BXOA 3I61A 2PSDA 2AK3A 2C03A 1YRHA 4BE9A 5I9LA 4QHSA 5LYYA