5HDQA

Mntc co-structure with mab 305-78-7
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
277
structure length
273
Chain Sequence
LKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein/immune system
molecule keywords ABC transporter substrate-binding protein
total genus 98
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5hdqA01
3ZK7A 1L5HB 5JPDA 5BVGA 4WESA 5KHLB 1M1NA 2XY4A 4IRMA 2AFIA 4ND8B 3G9QA 3NU1A 3AEKA 2PHZA 2R79A 2X4LA 1K2VN 3ZTTA 4UTPA 3K1AA 1H1LA 3TNYA 4INPA 3ZK8A 1M1YA 1N2CB 3PDIB 4H59A 4OVKA 4ND8A 4FI3F 3LI2A 3LHSA 3AEQB 4MO9A 4TKUB 4WESB 4UDNA 3MFQA 3R5TA 3HH8A 4BBPA 5FLYA 1PQ4A 1MIOA 4WN9B 1N4DA 4NNPA 4OXRA 4N01A 4WZAA 5KOJA 1PSZA 4K3VA 3U7QB 3UJPA 2MINB 5CX1A 3AESA 5AFSA 1M34A 5JJ5A 2O1EA 2AFHA 1QH1A 4WZBA 4FILA 4WNAB 1EFDN 4LS3A 2RG7A 4PAGA 3AERB 1ESZA 3AETA 2YNMC 4WN9A 3TEFA 2M6KA 1KAEA 1XVLA 3MWFA 4MDYA 2ETVA 4MX8A 4HMQA 4M7OA 2AFHB 1M34B 2QI9F 2YNMD 2MINA 5CX1B 2XQVA 2XDQA 3U7QA 3PDIA 5GGXA 1FP4A 4GICA 3K1AB 4INOA 1KAHA 1QGUA 4FNAA 4DBLE 5KOHB 3HJTA 2PS9A 2XH8A 1G20B 4LJSA 3AEUA 4TKVB 4HMPA 5M34A 1N4AA 3AEQA 4TKUA 4UTOA 2PS0A 1TOAA 1G21B 2Q8QA 1K0FA 1G21A 4HN9A 1K75A 2OV1A 1M1NB 2Q8PA 5JG7A 5BVGB 3AEUB 1H1LB 4TKVA 1G20A 4HMOA 4MLZA 2PS3A 5KOHA 1L5HA 5M3BA 1K7SN 3AEKB 4H0FA 2WI8A 2XDQB 2AFIB 3BE6A 5B58T 3PSAA 4G07A 5HDQA 2R7AA 3EIXA 2M6LA 1QH8B 1N2ZA 3BE5A 4FKMA 1QGUB 3AETB 3AERA 5M29A 1FP4B 3MINA 3PSHA 5BVHA 4CL2A 4WNAA 2PRSA 4B8YA 5GGYA 3MD9A 3ZK9A 5HX7A 2WHYA 2XV1A 4XPIB 2OGWA 3TLKA 1KARA 5JOQA 3MINB 4NNOA 5BVHB 3MWGA 2XUZA 4UDOA 3EIWA 1QH8A 4PM4A 5CR9A 1QH1B 4WZBB 3GI1A 4OXQA 4XPIA 3AESB 3R5SA 5I4KA 5KOJB 3CX3A 1M1YB 1N2CA 4G09A 3HXPA 4WZAB 3ZKAA 1MIOB 2OV3A 2OSVA 5M2QA
chains in the Genus database with same CATH superfamily
4MLCA 3LVFO 1H8HA 8ABPA 2AC2A 4M60A 1U9CA 4J7UA 2J9YB 3TFOA 4G9EA 4WESA 5KBYA 5A6SA 1X13A 3RARA 1GTJ1 3MCAA 3AVVA 4ANFA 1Z56C 4DV4B 5LPNA 2V45A 4IFEA 4X90A 3QXHA 3VPFA 2ZG6A 3MUNA 4FEAA 1LZLA 2I62A 4QBFA 5ES3A 3TIFA 4UTPA 2OO7A 2REBA 1QK3A 2GTIA 3W2HA 4MB2A 3V80A 1U2GA 4BB6A 3OIDA 2HRQA 2QMZA 3I53A 3EZGA 2WJJA 3AYZB 3D3KA 5LZ9A 2VP4A 4OMUA 1I9CA 1UBSB 4BAZA 5EIWA 1E7SA 1ODJA 2YHUA 3AP2A 5KVVA 3T1VA 3D2AA 1PR1A 2J7KA 1UKEA 2X8WA 1ZK2A 4NCJA 3UH0A 5A5EA 4C88A 2AIRA 1ZJJA 2JVKA 3QZUA 1LWOA 2XOKD 4BP3A 1GCOA 5T64A 1D0VA 1IN5A 2PMWB 2GBIA 2H9YA 1XQWA 1QB8A 2QP3A 2VSOA 4M98A 3JZAA 4ZVMA 1ZVKA 5BN3B 2MINB 3OM8A 5FPTA 3UK2A 2UV8A 2MSWA 3JRWA 4WEOA 2PAFA 4IP0A 1OILA 2QORA 1MORA 3D0QA 3EGVA 4KTVE 3BMQA 4MINA 1VG0B 1EFDN 1TAHA 4LXYA 4QYTA 5EXXA 4DJEC 3ZWAA 3UAWA 3V4SA 5JTTA 3GXOA 4G0OA 1SZCA 3ONEA 3UUEA 3U09A 1E1MA 1RNLA 3ZBUA 5HIAA 2PTHA 1Z29A 4NIMA 4HAWA 5EZYB 4MVCA 2WNHA 3B1YA 2JGJA 1IWOA 3E7WA 3ZGVA 1BAPA 3DCYA 4ZICA 3S40A 3VR1A 2BJHA 1L5ZA 1Z37A 2XAUA 3MYRA 4LMAA 2ZJFA 1MRZA 2CDBA 2OBYA 1JLMA 1E2HA 1W48A 3V2HA 3ICQB 2J07A 4MV1A 2EBHX 3A4LA 4DV1B 1TMYA 2X0NA 4ZAFA 1MPXA 5TEVA 4BU0A 5IKPA 3UJNA 1EWRA 4UD2A 5JUWA 3Q7QA 1EK2A 2WF6A 1E66A 4H4DA 1GKUB 2QRQA 2RHCA 2UUBB 5E6SB 2QHXA 3K8ZA 1VPTA 1ZGGA 2FG7C 1KDVA 3KAQA 4OQLA 3P0HA 3N1UA 2ZIZA 3C87A 4HDRB 3UT5B 1MHTA 2YWGA 4ARZB 2WWWA 1G98A 1J21A 4V39A 1T5BA 4S1OA 5L7YA 4F2HA 4BO8A 3FTQA 3O2QB 5D1HA 3PPXA 2NUTA 3HWSA 3CLUD 5HQTA 1WSWA 1R3UA 3EGXA 4URXR 4EMBA 4ZCPA 3KQLA 3A4MA 3SCZA 4WCDA 3RG8A 3WYEA 5ALIA 1NNSA 3LYUA 5I7AA 5CPBA 4J6EA 4ZJPA 2OCYC 3NBXX 4IZ6A 3ROKA 3LP6A 4YP7A 1H66A 3VM6A 2HBZA 3DTVB 1ZD1A 3IELA 4Y0NA 3N8GA 1RJGA 3H1GA 3S8YA 2FWRA 3U4MA 2O07A 3A3OA 3NIWA 2AFHE 5A5DA 4U3JA 4BUZA 2WPDA 2NO4A 5CA0F 2VTVA 4EGCB 3CZ4A 2E2WA 2YCLA 4B4DA 4YXWD 4CLXA 2VDQB 3LWNA 5FWNA 3UG7A 1EEXB 1P19A 4WX2B 1NXWA 3B6IA 4YECA 2AOUB 5FL7D 5L3RA 3P0RA 3P52A 2IITA 2CJPA 4NXMB 3E0XA 5AUPB 4JP1A 3P32A 3VTFA 2FUCA 3KSZO 2EW2A 2W6PA 1SUDA 3K9NA 3LSYA 5A2QA 4KFCA 2X41A 2VS1A 3BHJA 4O0LA 5F33A 3NUGA 2EIXA 4XM0A 1JMKC 5MGNA 1MGPA 1DRUA 1Y9JA 5BPFA 4CMBA 2X9LA 3CH5A 4G1EB 5DGDA 3WMRA 4EQZA 4HNAA 1PWYE 1AA9A 2CSUA 1H3EA 3FVWA 2C5SA 4F6LA 3QVGA 4QU8A 1PJSA 3RYFB 3FMVA 3H5AA 1YFZA 4CM9D 4YWHA 1Z2PX 4O59O 1OIXA 1FDVA 3QQPA 4IG4A 2YW9A 2J32A 3BRSA 4YCMA 2DFDA 2VJQA 4LTNA 4OK5A 5C1DA 1ST3A 1CZOA 2E55A 1XU9A 2YFYA 3AK4A 2A8YA 3LUKA 4O08A 4XTRA 4D8WA 4EKIA 3DAGA 4E5NA 2IPOA 1H42A 3WXBA 2HKIA 1ZLXA 2DPLA 4IJMA 2F3RA 3EYWA 4P22A 1TL7C 2OHJA 5ICSA 4OHCA 3RUFA 5F98A 1OV4A 2DH5A 3O75A 1IY9A 5P21A 3TTYA 1O5TA 2HZ7A 2A58A 4QUJA 3NV9A 2DJ5A 5HCIA 2ZSUA 3MWFA 2OCBA 4XD7D 4RTSA 1PFKA 3IYLW 5G1NA 4EUEA 4PINA 5F3WB 5AJXA 3L0BA 3ZE2B 2H1RA 4QBKA 3B3GA 4BWVA 3U1BA 2XQVA 2CW5A 3UK6A 1SZJG 1Z4LA 1ZIPA 2XNSA 4WTOA 5EVJA 3UW3A 3TGPA 4LSZA 4ZHQA 3O6VA 2L17A 4FMCB 5K0LA 2P2GA 2WLTA 5HXAA 3WA6A 4DCJA 5IJAA 3VNVA 4FWTA 4BMPB 3JARB 2H0QA 3LA8A 3OLCX 4O2AF 4EKDA 1PGQA 4MO2A 1XYGA 1ZAKA 3ZQKA 3I30X 1C4XA 4R1SA 3LK6A 3ZHBA 4DXHA 4HMOA 3BL8A 1VMKA 2WTUA 3SM3A 4C2AA 1BYIA 1XDBA 2YXLA 3PGKA 4HBZA 2BFCA 3U44A 3S81A 2VHXA 1M75A 1PR4A 2JZNA 4Z2AA 3B1JA 3MMZA 2MSCB 4KK4A 5IDYA 4V0OA 3FUTA 1LRKA 2DQ4A 2NO0A 1PS8A 3G85A 2P4HX 4PG7A 3DD5A 5BSTA 3B1WA 4PNPA 3INYA 2PT5A 3FR8A 4LRWA 3CX8A 3L0OA 3STVA 3FMIA 4OM8A 4Q4DA 4O8CA 1NN5A 1SBZA 4JZYA 1VRWA 3RNLA 2RHDA 4Z9XA 5KIAA 2ZATA 1NVBA 3N9IA 5KWVA 4WA7A 3V8BA 1B6SA 3U13A 2VBCA 2OAP1 2QW0X 3PHJA 3QFFA 1A27A 4FBLA 4IVQA 4OHPA 3D8BA 4A16A 4F5DA 1PFYA 4YMLA 4JT4A 5LA6F 4JB8A 3IIKA 3UYLA 1E64A 2O5VA 2Q5IA 1JIVA 4I14A 4LOIA 1SIOA 2AR0A 5E7QA 3KVYA 3IOMA 5HIKA 4G1CA 2ZBFA 2QRPA 1SUBA 2NPFA 1PEAA 2MTBA 5F2KA 4BL5A 1YI8A 2GESA 2GBGA 3LQKA 1THMA 2A86A 3A1TA 4GKKB 1NU8A 2CJFA 2WILA 3AHHA 3ESCA 1EZZA 3G2PA 3NEJA 4LXUA 3KWMA 4GD3Q 1COZA 2X8JA 5JJCA 3RSHA 3HU5A 2I6QA 2XT9A 4CMHA 4AMZA 2CFTA 1GRNA 1HM5A 2AMFA 4C0WA 2OOKA 3MTAA 1IDOA 3QG5A 4E5SA 1V47A 3E7XA 4MYRA 3IVRA 2B5OA 3BD9A 4QNNA 4GNKA 5ALGA 3CY6A 4ZEXA 4Z49A 3GRRA 1P62B 4NPAA 2AUNA 3C4QA 5TS3A 1EGHA 1XDUA 2VK8A 2W2PA 4NZZA 1Z0JA 4RHEA 3DAOA 1EHIA 2ZJ3A 3PEEA 4DARA 1ZGCA 1V1MB 3Q0EA 1CIPA 4AMVA 4N0DA 1U63A 3ABZA 1T1JA 4LJ7A 1IEXA 5BSUA 3ZNNA 3NIFB 2HBRA 1F2DA 3TLYA 3WJ1A 4KHPB 2XTJA 2J9ZB 3UIEA 2QN3A 4IS3A 1Y4DE 2B94A 1OXXK 5GONA 1KDTA 2ZJ5A 4XUDA 2O8FB 3EIOA 4IGAA 5B30A 3OQBA 2JC3A 1L5FA 1PJAA 3R44A 2IS2A 1R0BA 1GVNB 3GLIB 1SUFA 3G9UA 1LVHA 1TGVA 3K31A 3BILA 1LB1B 3CB4A 5K0FA 3K6SA 1OFTA 3L7DA 1BGVA 5FUWA 2OCKA 3V1TC 1C7RA 2CEAA 5AK4A 5FAKA 3EBPA 2VZ9A 5EQDA 1OJLA 5C52B 3LUHA 1X1CA 2QY6A 4TMVA 4GH5A 3WHLA 1SEPA 4F4IA 3QMVA 5HUHA 2FW6A 1UDAA 3A27A 3QTLA 4J9VA 1V26A 1YZQA 1E1RA 3O1JC 4DDUA 1P6QA 5BW6B 5BURA 2I2FA 2C9BA 4PLTA 2NTEA 4LBVA 1XKXA 4OB6A 4RTNA 1G21A 1BYUA 3A2MA 1NW4A 5H81A 5L6MB 1KJYA 3HI6A 5EN4A 4BVLA 2I5PO 1KQ3A 1IOLA 1YQUA 2B0JA 1Y5RA 1MKYA 4MRMA 3FUWA 2GX6A 1Q0QA 1QYRA 1RWMA 4H7JA 1CDOA 5TIIA 2B4YA 1FDIA 2HQRA 3SSAA 2JGAA 1WVGA 5ADHA 3SVLA 4Z9BA 3KJZA 4DA6A 4EDFA 2W6IA 1KA9H 1OASA 2G6BA 2D7DA 3N7UA 2FWIA 5FO1A 2OSBA 4YYEA 3PB3A 1ISPA 2RJNA 4YO7A 3UAVA 1NSYA 1G8GA 2OORC 4AZ3B 2ZCVA 2IS1A 2QLTA 4OJKA 5JVDF 2H2DA 3WGUA 3WGYA 3ZE6A 5G1OA 2E21A 3L0IB 3RVNA 4ARAA 5BR4A 5E1DA 2DQKA 2FWJA 3INGA 2HU8A 2WUGA 4D4HA 1JVSA 2C96A 4NSNA 1TC2A 5IZCA 1GUZA 5DZSA 1H9CA 3UPDA 1GTZA 4KEAA 4Q3DA 2LCQA 2NU9A 3LCUA 1E9AA 3I6MA 1GTL1 4HDMB 5EJEA 1KL7A 1M2OB 3DXXA 1KZ1A 3IMKA 1JKJB 1KPGA 1PX0A 4KU4A 4NE7A 1VL0A 2EWVA 5BWLA 3AKCA 2VT6A 1AUQA 3LUDA 5BRAA 2WUDA 3E82A 3IOCA 3TBFA 4BOYA 4JXZA 2P90A 4YRKA 4PQRA 4QTZA 1U2RA 2PLNA 3CRVA 1TKRA 5FL7A 1VJRA 4WH0A 3F9IA 2A7XA 1SU8A 2H18A 2OM2A 2PFSA 1JDZA 1WCIB 5C37A 1C1HA 4KAJA 4PU0A 2G9NA 3H5TA 4J1SA 5DYYA 4AZSA 2IBTA 4YIHA 1JSZA 1M76A 2FFHA 3F74A 4R8SA 4TM8A 4IDBA 3OCXA 4K40A 4XI9A 3BWYA 5D7NA 2DE0X 6PFKA 4L0CA 1WZIA 1SULA 1M5UA 4G63A 4B44A 1YDWA 4F6RB 3O8OA 2CKDA 3ZV3A 1TQ6A 3I04M 4X91A 4KRGA 1RM3A 2JGFA 1RKXA 1ORHA 4JUFA 3TW8A 1PR5A 3C48A 1SUEA 4WW0A 5E1BA 4OIFA 3HWX1 2ZKLA 2VJDA 3OZDA 3UO8B 4CMEA 4QG3A 4XD2A 2RHBA 4C3OB 4UMFA 4O4IB 3D3NA 2O2DA 2FYTA 4D02A 5AESA 2CLSA 2FF5A 3IIMA 3M6UA 4O4IA 5KUTA 1L3CA 3WQBA 1Q92A 3R7AA 4XASA 4IDHA 1FSZA 5AM0A 1K9VF 2XBLA 3P2JA 3U7JA 4A23A 1N5LA 5NLLA 3DVQX 1VFPA 4IEIA 4R9SA 3VR0A 1FYDA 4OHWA 3TINA 3NCTA 3ORFA 2NADA 4FWBA 4U6SA 4FMBB 3L7KA 4ATNA 1M10A 1UFVA 3ZVMA 2NSDA 1OZGA 4DBVO 2NQ2C 1MV5A 1LW7A 3PFWO 2HDOA 3AH8A 4HV4A 4AIIA 3IODA 3RSSA 2FMUA 4D0LB 2CF5A 2VUTA 4DQKA 4LJ6A 5D00A 1MU0A 2PS0A 3K73O 1P7YA 4IF4A 5CLGA 5DTQA 3B82A 4B5LA 1DI0A 4LISA 5F5LA 3UMRA 4MSUA 1X86B 5BWOA 5KX5B 4G5XA 2G0AA 2OR3A 3REFA 3RSCA 4MWTA 3G0HA 4ZHQF 4ZGGA 2CCJA 2XMQA 2QX4A 1CQZA 4N3AA 2YHIB 5TVGA 1QYVA 3EG9B 4C0SA 2RDMA 3DWEX 2XKKA 4YDQA 2QRUA 2F8SA 3GQVA 2O57A 5FHRA 5KYWA 1DO8A 1N2ZA 1RTKA 1VPLA 2ZI6A 2CNLA 3O31A 4ZOAA 3U37A 4D3SA 4BCCA 3T4UA 2ZUWA 2GR9A 3B70A 4E5MA 3KYDB 4OFXA 2IZZA 4EHFA 3CF4A 4U7FA 5D5QA 4B4UA 2XCSB 3GLFE 4BJ1A 3N2GB 4PYIA 3ZWCA 4RF5A 1UXGA 3ZLTA 4LDNA 2VH2A 3T9EA 2E5LB 1L8OA 3G1TA 3LDUA 2HU5A 1HSOA 3ZLBA 5I9MA 4U2CA 3CRW1 4UPDA 2ZRHA 2A57A 4RIFA 5LNK1 3DDSA 5A4AA 1IB0A 1X3SA 5IWAB 2WWTA 4MW4A 1Z6TA 2XDYA 2V3WA 1EUCB 1C30B 1M1YB 2VF7A 3JYHA 1U31A 1GAWA 3HN7A 3QI7A 5LLTA 4AIRA 3HFSA 1JYSA 1P2BA 5EGSA 1GSOA 3OC0A 1O7JA 4MS1B 3T3IA 4B4KA 3VNUA 4FI3C 1QE0A 4G1UC 3T9CA 2GLXA 3OOWA 1TUBB 1A9XB 2VYNA 1CUIA 3AKEA 3CW2A 2VUSA 4LRTB 1NMXA 3N0WA 4CW7A 3THYB 3KCQA 4MGIR 3B8HA 1TA9A 2FW8A 4RZXA 2GCOA 1KJIA 1E3LA 1ICIA 2HWUA 2JJ2D 2R47A 3DR5A 1W75A 1OD6A 3QU9A 5U4XA 5LSAA 1JECA 2VO1A 4YTEA 1SR8A 2SCUB 5A9RA 1XPOA 5KJEA 4O2BA 1ECLA 3RRMA 5BV7A 1SUPA 1FJHA 1XZQA 4PS0A 1XNHA 1NX9A 1XXHA 3ZK8A 3RVOA 2QMEA 4RJTA 3P2YA 3PFNA 1P5ZB 1X1RA 5DHSA 1MGOA 4ZCQA 2Q3HA 1DQSA 2ZW9A 4C7BA 5KNDA 2R48A 3C5WP 4JZKA 4PHTA 1U6KA 1E18A 1E1LA 2X8AA 1YDEA 3V97A 3QP9A 3KYBA 3TO5A 4FU0A 4QL3A 4R0MA 3AR8A 3VI4B 4XM1A 3AGPA 3DAPA 5DLPA 3JWHA 4KBFA 3WVNA 1IZ0A 3B5EA 3UJPA 4HH3C 4S1PA 3U4CA 1HEUA 2I0FA 2Q49A 2R6R1 5A62A 3P96A 4REMA 1KU0A 4QYIB 4YONB 7ABPA 2NO9A 1EQAA 3PJDA 4XB1A 4D4LA 4F3YA 1Y81A 1NVKA 3FH0A 5IAEA 4B80A 1N9ZA 2PPVA 2H9IA 3WLOA 2L82A 2WOJA 1E99A 1KAEA 1F9AA 3IRUA 3F1LA 1CSEE 2FGJA 2VXYA 4LHXA 4RSHA 5ADVA 2FDCA 2AFHB 4FE4A 3CISA 1X38A 4DV3B 3H5NA 1GG9A 2YHIA 4U2BA 4U7JA 3GH3A 1HTWA 1PFWA 2C29D 2O3TA 1VPEA 3WGMA 4F60A 3T1YB 5ALUA 2IYAA 4IGEA 1R74A 3F3MA 3L7AA 5CIWA 1YRWA 1ZUHA 2IZ6A 3U4HA 4DNXA 3FYCA 2FTKE 4D3XA 3HCPA 5HYVA 5HQ3B 2H4XA 3W7AA 3OPVA 1W76A 2IP2A 4QASA 2CUTA 3ZNQA 5AVTA 1TZ2A 1VYVA 2QLJA 1SPXA 4FCVA 1BH2A 4LY9A 3IX7A 4AK9A 4HXEB 1KYWA 2AG8A 3E9RA 1GTSA 3HPQA 3P2KA 4EPTA 1W19A 1IAVA 4ON9A 1E8MA 3JV7A 2P1RA 3OIFA 2Q5FA 3GFVA 3FETA 4RYLA 1JQDA 2EBFX 2ZK7A 2QJFA 3EXAA 4ZCMA 2QX8A 2W2NA 4JQZA 1GJRA 3IAFA 5HJEA 5E7MA 3GBVA 3R3XA 3V4FA 2QUHA 3IT3A 4RL4A 2H7CA 3C1TA 3GLRA 3FRHA 3MUFA 1FP4B 2P40A 1KDYA 4Z7NB 3T1TA 2NU8A 1T6YA 1KXZA 4CMEC 2I66A 1VE1A 3KSBC 5LP6C 1E79A 1AUXA 4QOGA 1MJGA 4P7JA 1D2NA 2MSNA 3AFOA 5LP6B 4RZHA 1V45E 1OLOA 3ELWA 1KFBB 2A9VA 4HAIA 2V65A 4HNHA 1FFEA 4IG9A 4PLWA 1QHEA 3ZWOA 5E4JA 3N2KA 1RQRA 1I0LA 2HK7A 1D7OA 4XWAA 1DOZA 1C1DA 1HGXA 1L7DA 1PF7E 2G67A 3IH5A 5CH5A 4JB3A 5HZKA 3RUAA 1NVFA 2G9ZA 2CB0A 4PZEA 3R23A 4MS4A 5EUQB 1K5HA 1FLVA 3QF7A 3R3ZA 4Y6LA 1B15A 3FCOA 4IDFA 2J46A 2OG2A 3DDUA 5DRYA 3O38A 5WRFA 2DCUA 3OJFA 5EPOA 1U3WA 2R66A 2D4AA 5KNBA 4HRYA 1ZKMA 3V1YA 4BEWA 5HZMA 3CMCO 2BDEA 1UC5B 1AZWA 1I4EB 1W5EA 2C77A 2FVXA 3ITNA 3LWZA 4I50A 1NQTA 2HJSA 3V8VA 5CBPA 5ICEA 4LDQA 4LJRA 3ZYCA 3H99A 4C14A 4CTOA 4NDNE 3LVQE 3NU1A 3ZW7A 4BRUA 4Q3AA 1XRQA 4LOHA 1AZSC 1ZJ6A 4RHTA 4D5EA 1KO5A 1P1JA 1S8NA 1Y1KE 1UXHA 1Q0ZA 3O2JA 4IYRA 1UJMA 4BO9A 3KXPA 3C5EA 3RFUA 2YWXA 2EFEB 1HDOA 2PZKA 2QLLA 1P9WA 3SFVA 4BMZA 1U2TA 2QRLA 1JWLA 2BUAA 3ZCVA 3B20A 4ZYVA 1MIOA 4AS2A 3CKMA 4WDQA 3SF8A 1OXSC 3E5MA 3E7PA 3JSXA 5T3YA 5BOSB 1YR9A 4H08A 1T43A 5FFFA 3B9PA 2R97A 3UHJA 1W52X 4AJKA 2JLAA 1FX0B 1OPRA 1RYNA 4I1VA 3TMKA 4ECAA 2NP6A 3ZS8A 3RVRA 4DBZA 2WWFA 1XJ0A 3RTAA 2H54A 3H5LA 3Q15C 5B64A 2J09A 3TVTA 2E5WA 3FAKA 3I5MA 4WN9A 3RIHA 4BFZA 3I83A 5IF9A 5JD5A 3LUAA 3TIGA 1PL6A 2YRWA 5FI0B 1NLFA 3NP7A 1M34B 3WLQA 1A5ZA 3BYZA 1ZVJA 2PO7A 1G7CA 1K6MA 1XD8A 2W8BA 4TZ0A 1HRKA 3BEDA 1VCIA 3E84A 3HQ4O 3IQGX 4RIIA 1YFLA 3AWDA 4J4TA 1EP2B 2JLVA 2O8CA 2QM0A 4FQ8A 3WE7A 1TXGA 2AI1A 4PY2A 5TMPA 1E4YA 1Z6XA 4P7GA 5JZOA 4PF1A 2BCEA 5CVDA 3GUVA 2BN4A 5CYFA 4RQTA 4C1NA 1M2NA 2Z3ZA 3IE2A 3QE0A 2RGDA 4KZKA 3VZQA 1CIJA 4NEGA 2JAHA 2GI4A 4L76A 2O4CA 1FL9A 2X9QA 2ZI4A 2EYQA 2EKZA 5AW5A 3I5UA 3KK0A 2VHVA 2Z2IA 4Q9DA 3CKKA 3Q0TA 1FPMA 1HDIA 3NC1C 2JH3A 2I7XA 3R3UA 1JJAA 4IO0A 1Q7BA 2C58A 1T4DA 5HE9A 5L40A 4E7PA 4HNRA 1NVUQ 1YBAA 2HQBA 4BNKA 4PX2A 3TD2A 2FW1A 1UBUS 3W5VA 4R31A 3PKJA 3HKBB 1O8CA 1SB8A 2G6TA 1O96B 2ASEA 3FUCA 3WRXC 3CGGA 4BZWA 4J0IA 4F3RA 2QUIA 2J8ZA 3DTVA 3SEAA 4QDUA 2VYCA 3V1UA 2FEAA 3K8OE 3ER6A 4RVFA 2HXSA 5LZ7A 4D9JA 1ZBDA 2UDPA 2W37A 1LU9A 2GPWA 2XQGA 1L6IA 3EGXB 2YVUA 2LW7A 3IEPA 3MOGA 4GUAA 4LQCA 4Q1AA 4GZMA 4H1WA 4HDKB 3GFPA 5LL6P 1BQ4A 1TMKA 2XE4A 3AHJA 3GB9A 5F2NA 4NOJA 4R1OA 1TM1E 4RMIA 1K8RA 4MUBA 5BYAA 1FYXA 2WQZA 3A6PC 4FHCA 4GKJB 1MR3F 1N0WA 3ML1A 821PA 1R6TA 1XAIA 3UMBA 4DLRA 1XD2B 4ILEA 2HU7A 3OM0A 4E1VA 5HTOA 3O8RA 1SXHA 4PN3A 3TPCA 4JV5B 1D2AA 1FTNA 1JVNA 2QL5A 2GN1A 4GNRA 3X44A 2LR0A 2PLFA 1QOQB 4Q01A 5CM9C 1Q1GA 3GJ5A 1NN1A 2PGOA 3V1MA 4D42A 4D98A 2GAAA 3EDQA 4PFQA 1QYDA 4UXIA 1Z7WA 3GDHA 4LHSA 4ZIRB 2GZRA 1EFRA 3PXGA 4J8PA 4U7PB 3CTMA 3UAZA 4O4JF 1TJ3A 1GPWB 3SSNA 2ZBVA 1TUEA 1TTHA 3GRCA 5AHXA 1KH2A 4F7WA 1S3IA 3A1DA 3LPNA 2K7FA 3NHBA 2PFKA 3OLVA 2PX2A 4BO0A 1I3LA 2OVBA 3R6TA 5EJ5A 3WDSA 4ZANA 1HNZB 1PD0A 4XH9B 3GRFA 3LBHA 1YULA 3D8SA 3Q3CA 2H17A 2WF7A 1PQ4A 5DW0A 4U2FA 3A28A 4I9UA 2NIPA 3JQ9C 4MEJA 1AXGA 3FYTA 3W4KA 4CI9A 2G71A 2N0SA 5HKKD 1PJQA 3V9PA 4NBUA 1E2KA 1T4CA 4WZBA 1FYWA 3NETA 5DBFA 3WNZA 2XOXA 3QEAZ 4OAOA 3IUJA 4PAGA 2F3TA 4MUNA 4HYYA 4YLYA 4O6VA 4MIKA 1J0BA 1PZEA 3KUUA 4KRXA 1LLUA 1CUEA 2F1IA 4BPRA 3GJZA 4KGZA 1Q20A 3V4VB 3BCRA 1OH7A 3IE0A 1HETA 2XWSA 5E8RA 1NP6A 4ZDJA 1Z06A 3CX4A 3OQVA 3MPOA 4X1OA 3SAJA 4YMHA 3PV0A 1YJCA 3AOEA 5CMLA 1XC7A 3LECA 4KLCA 3ZLVA 1F8XA 4IDGA 4IIJF 3BC1A 2V4UA 4PG6A 4U2KA 3FPKA 4UTOA 3ZV4A 3KETA 1L4EA 2CXXA 2ZROA 1G8KA 1PE0A 3AP3A 3T61A 3X2EA 4DRYA 3THYA 4Q4JB 4GGMX 3AR3A 4JHLA 2H4FA 4KFUA 4N39A 1SCIA 4FLEA 4KIJA 1E2UA 1VKOA 2GRJA 2RBEA 3RWMB 3WBFA 2P5UA 4JVOA 1Q7GA 2Q2NA 3FWKA 3WNBA 5C32A 1I6KA 2GF0A 3SEQA 4TSFD 1SKYB 1ZXBA 2YV3A 3OD5A 4I8DA 4PS1A 2QROA 4GPZA 4M3NA 1CQJB 3M9XA 1MPTA 4RH0A 1U8XX 3NTVA 1I1OA 1N75A 3MUEA 3L7MA 4OAQA 4GGPA 4UUMA 1GR0A 4DVGA 5DNWA 3NTLA 4OJYA 2IEIA 4CIVA 1K88A 1LNSA 1A69A 1J2TA 1MX3A 1XTQA 2CLKB 2H5JA 5LC1A 2Y1XA 3VAYA 3THWA 2YS6A 4W9RA 2RCNA 3OD1A 4X5OA 1U5AA 2BGLA 4HDNA 4TWIA 4I9FA 2BR5A 2BGKA 3IDFA 3WAGA 1XLVA 1EM6A 5CTJA 2YV2A 3RUCA 3T3NA 5LOVF 2RGAA 5GZ3A 1JALA 3S29A 4DZTA 1UMBB 2ESRA 3ZCXA 2A4MA 4Q1CA 4QD3A 1QR2A 4FFMA 3NMUF 1EAMA 1LQ2A 2XRYA 1NQUA 1YOVB 2C2MA 4WCFC 3LGSA 1W8IA 3I8SA 5SICE 4OSEA 1MV8A 4MI9A 4WCFB 3KZNA 4LZJA 3SQLA 3GZJA 3MILA 2QAGC 3WRXA 3OJXA 2A1TR 2QB5A 2V7GA 4F45A 1FCJA 5KWJA 2F55A 1YTUA 2YUIA 3LA6A 2CBXA 3QUSA 2CL7X 3PC4A 1EWVA 2W6ZA 5JCXA 4ENTA 1SC9A 4ZDKA 2MSKA 2G9VA 4L4YA 2CLLB 2QYHA 5DSXA 3ZWYA 4MJLA 1K2VN 4ER6A 5F7OA 1EFRD 2F9MA 5FT9A 1NI4A 1KIAA 1LS6A 4HGPA 3ZI7A 3PD0A 1NHWA 3GEDA 4INPA 4MV8A 1WMFA 3TVYA 3F6RA 1CY0A 2BMAA 2I3ZA 3RASA 5C31A 3PQ2A 3L4EA 4O2BF 2LVBA 3NC4A 1IUPA 1L5QA 1BZYA 2Z9BA 3R6LA 4FEYA 5FOVA 5JCJA 3UJ9A 3VVBA 3IB3A 1QDLB 1M2WA 2Z95A 3FSEA 4MI3A 3RCBA 1QCCA 1UT8A 1N6IA 1ESMA 3ILSA 1Y48E 5AXAA 5C4IA 4K9SA 2Q3EA 5CUQA 4KPEC 1YBVA 3L93A 4N3BA 1BVUA 1IHXA 1POWA 3G8BA 3PC8A 3DMTC 3GL9A 1RE0A 3LU1A 4TTSA 2DHDA 1PEYA 4HO1X 3H9JA 3MT9A 1USGA 4C6TB 2FOIA 2ETXA 3E3AA 4EJSB 1BX3A 3RK0A 2GILA 2R8PA 4DLYA 3X2FA 1EI9A 2GK6A 1FTQA 2UZ0A 1CB7A 2VQ3A 2W43A 3H2YA 3H9EO 3OJWA 1OI3A 2NZUG 4NYMQ 3KYCA 3TQIA 4J7CA 1JA0A 3A1WA 2IP4A 4HX5A 4MRRA 4JEUA 1SOUA 3B5IA 4R1QA 3DH0A 1VSTA 4F6RA 4YO8A 3HLKA 2XT6A 4Q4AB 2JKVA 4JYMA 1Q3KA 1KRWA 1SCQA 3PXCX 5AM2A 1UBTS 3C6QA 2H16A 2GN8A 2EZ4A 4S2UA 3IUSA 4JEIA 1DKLA 2RGXA 1KYVA 1NPTO 2CDCA 3QV1A 4KO4S 1N4AA 2ZS9A 2PT6A 2DLNA 3O9VA 4QYXA 4YR9A 3LDAA 4ZYWA 2BFWA 2KBFA 4PSCA 1EK1A 1JG4A 1GUBA 3GXBA 2VBIA 1YA8A 3KAKA 4X3CA 1V7PC 2QSUA 3H1EA 3QVMA 1I2DA 3QQ5A 4M53A 4MV4A 5BWMA 1EWQA 2WUEA 4DOMA 4RPCA 4Y7CA 4DSUA 4AFNA 1UZNA 4MR7B 1OGYA 3TSZA 3WLTA 2ZDHA 3HBAA 4ZRDA 1JXOA 4O2LA 4GQIA 5FWAA 1KE2A 2DBRA 3OPNA 1XDZA 5B58T 3PSAA 2J4FA 1YQXA 2PVPA 1N2SA 4YBZA 3AOGA 5EZYA 1FS4A 2JD0A 3TGWA 3LAWA 4YYZA 3PS9A 1FF9A 1GFWA 3QOWA 3TTTA 3GEGA 3H4VA 1JEQB 3AR5A 2NSJA 1ATZA 2BE9A 2KQUA 2QVXX 4PTLA 4CNQA 5JJBA 2FSGA 4FXOA 1YXMA 4AJPA 3CJQA 1HT0A 4CTKA 2FPGA 4IHKA 1CP3A 3TLCA 2AHRA 3ESBA 3U9TA 5BRJA 1IN4A 3GA7A 4MVXA 2HI0A 2NW6A 4ALIA 2BFBA 3KEGA 5F7JA 1XEWY 4RPIA 1J07A 3JVVA 4Q66C 1GEEA 1UH5A 1AJEA 1KBZA 2QGZA 2WDPA 2WSIA 4LV8B 4RLFA 2HSJA 4UHBA 3ADBA 3V7UA 4GIBA 4EAQA 4J91A 1QHYA 2QBYB 2CEKA 3OSZA 2FN7A 1KFKB 1GYPA 2REXB 3H86A 2RHWA 4OHVA 1WDKA 2EWWA 1OFUA 1QE5A 3DDZX 1N33B 1RP7A 2D2FA 3O3MB 3DQZA 3OU2A 1WPRA 4OGLA 5TMDA 2G8LA 3BMNB 1IPHA 1R6VA 1X6VA 2XTZA 4LYGA 4XIYA 2XRZA 4MLDA 3QVOA 4NBRA 4RA6A 4G0PA 1T2DA 5ALVA 3MQ4A 1XMJA 1FA9A 3O4IA 4DLWA 3RHTA 1QFJA 2BH2A 2HCFA 4RMNA 5ERYA 3OZAA 2GWHA 1DWPA 2G4CA 1G8FA 4LN1A 3EAGA 5HFJA 1TZCA 4MHOA 5JALA 4ZYXA 1QTNA 4BV2A 2IW3A 3R7LA 4GC5A 5IYZB 1YB7A 4YRZA 1LUAA 2CNOA 1WS6A 2ET6A 2FUG6 4J29A 1BXZA 3AM3A 4NNPA 4G84A 3NIGB 4PR3A 1GPJA 5DDIP 2CMGA 4LDZA 4NZMA 2Y0CA 4QIHA 5IK2A 5JCOA 4F21A 5HSGA 4LQLA 5EFOA 2Y66A 2VDMB 4RF3A 2B61A 4DMGA 5LWHA 1X39A 4BQNA 1T26A 2WVJA 4CLHA 1MHPA 4L1KA 5BSRA 2Q4OA 3I12A 1XLUA 4URHA 4KQGA 4ZT4A 2DFVA 1SXPA 3M1LA 4UU0A 5AKHA 4IIJA 2X6TA 3QYJA 4FZJA 4G37A 2TMGA 2WWGA 1JWBB 2HDHA 2QUZA 2BGNA 1PI3A 1P33A 1RWBA 2VRCD 3UGTA 1RQLA 2PPLA 2VWQA 5TB5A 3WGJA 1W0JD 1Z0UA 4W5WA 5IC6A 3H1BA 5BNWA 3CLKA 3F98A 3TIIA 1YQDA 4M2LA 1A88A 1Q74A 2GSDA 4N0EA 3JQFA 3W2FA 3U60B 4E14A 1EXWA 4BNYA 4E70A 1X92A 4X60A 1G38A 2FN8A 3NOXA 4RVHA 1F2TB 1E7QA 2G40A 2PR2A 4BZZA 5JZ9A 3IMCA 2RKOA 3EULA 3CN9A 2XCLA 1C7JA 2OV4A 1A8SA 2ODNA 1ZGBA 1FQJA 3FI0A 1LA2A 3RIYA 1B00A 3QVLA 4ALMA 4DLNA 2Z9DA 1GNPA 3JATB 4H6XA 3ZJ5A 2M6LA 2M6SA 1E2EA 3UANA 5A3RA 3CB2A 1VTKA 5AVRA 2H31A 1RQ2A 2JGLA 1ADCA 1ZJZA 3AETB 1OW3B 1GRRA 1KEWA 3OIVA 4EW1A 3DBRA 4NDAA 4N8DA 3SHFA 1IL0A 1MDBA 3A9TA 4BMXA 1TTTA 3A3YA 5TE9A 3IQXA 1E61A 1LI4A 4EPWA 2EFHB 2G17A 3HKEB 4GX0A 1EXMA 3NS7A 1THGA 4PSVA 2V7VA 3DMNA 5AJWA 5A3VA 1RT9A 2XMGA 2OHIA 3OQ6A 5DX0A 5GJBA 4OKNA 1ZW6A 2XITA 2E89A 1W0CA 1KU6A 1G17A 2QRHA 5I7OA 3SR4A 1TQHA 1I0ZA 3I62A 3ED5A 1V43A 4DPLA 2OV6A 3DQPA 4YP5A 4Z3KA 3O8CA 2DFLA 5LUBA 1VM6A 4Z4FA 1RXUA 3G59A 4JR0A 3K0SA 5GONB 3V1NA 1NC3A 2C1ZA 2PMKA 3NGMA 5CD1A 4AECA 3NM5A 2XHZA 1DWUA 1DJNA 1Y3AA 2AZDA 2WJWA 4GEGA 3F97A 3MTJA 4MRAA 4ZDWA 3ZY3A 4AO6A 5IM4F 1ZHHA 2XZTA 4D7AA 2HRBA 2WU4A 1NNLA 4LHZA 2C4TA 4TUYA 4YRPA 1ZL0A 5LQSA 3VVCA 3NHYA 2VK4A 4PYKA 4DCUA 1YL6A 5D6OA 3C3JA 1AH2A 3DFUA 5JISA 3M4NA 3Q1LA 4MP6A 4YDHB 1CFZA 2F48A 2P1DA 3JX9A 3KD2A 3LCRA 3VDXA 1P2UA 2GJ9A 5HA5A 3O4GA 2IWRA 4RZ3A 3TSWA 1NUAA 4YHHB 4BWFB 3NHZA 4OVKA 5DYTA 2QG6A 1Z2NX 1LV8A 3ZI0A 3C70A 1JJVA 5IAKA 3VZDA 4JJIA 2CXQA 4L2IA 3WZMA 2AJTA 3J81k 5GM1A 2WKSA 3ENNA 1MMFB 2KSQA 4ITVA 4ENQA 5AQEA 1Z74A 1C50A 1MOPA 2Q6VA 3K9CA 3W8RA 1ZUNB 4ISBA 3OOEA 5IKMA 1V7ZA 2VRCA 5IJ0A 1P5JA 4DEVA 1KGDA 5A3JA 1A7AA 4D9CA 10MHA 7REQA 4KFRA 3O21A 3I61A 1Z8HA 4BTVA 1ADFA 5IUJC 1FK8A 3AERB 4W9NC 3IJRA 4GQBA 1LW6E 2YV4A 2AI3A 1BHQ1 3HV0A 3QWIA 1O95D 4UCFA 4LE1A 3BN3A 2O0HA 3QFRA 3O4JA 3A36A 1DIRA 5DISB 5IC5A 1BEZA 1DQZA 1CZHA 3DXZA 4OEHA 5EHQA 3ZCRA 5FOSA 3HVRA 3PUKA 3P9CA 3HGTA 1P7WA 2YZGA 3V00A 4ZK2A 1GLGA 4B4OA 3LQFA 5G4KA 3BGIA 2CUKA 1VHWA 1KK2A 2N47A 2D2IA 3O8BA 5DM70 4TQGA 4MYUA 1QIGA 5EMMA 1U2EA 2JFOA 4X1YA 3SXUA 3PA6A 3FHCB 1IIRA 3THXB 3EGWA 2AZ4A 4H1TA 1SIUA 1OXBB 4JJAA 1E60A 2VH1A 1LPBB 4A5SA 4UEKA 1HURA 5ALHA 1LFDB 3NM4A 3O74A 1W5FA 2CNNA 3V8NA 4JOQA 4M9XA 1DKMA 4CETA 5JS6A 2C78A 3QWAA 4D2IA 3U7EB 4FKMA 1TAQA 1W93A 4EG7A 3WL7A 4I3GA 1MABA 2L2QA 2I34A 1Z0SA 4GR9A 1OAOC 5JMPA 5KI6A 4IXNA 4LXTA 4HDNB 1TLTA 4B7XA 4NAUA 4JUAA 2WHYA 4JFAA 3NHPA 5E1MA 5FI5A 3WLRA 1J90A 4NZOA 4EKYA 5JAQA 1L5GB 3DEYX 1XWFA 3W5JA 2VPTA 3N0XA 4WK6A 3WB9A 4DWVA 4GPBA 5I3ZA 2A59A 3QUAA 1JQAA 5CH8A 2RGNA 3HWRA 2WTEA 1FFXB 4KKVA 4N7BA 3V7FA 1YC5A 5KYWB 1YKFA 3GLFB 2PA0A 2GBLA 1KI7A 1VIMA 2I4IA 3F7OA 1L1RA 3DBRB 2BEVB 4YRCA 5F5XA 4L0DA 4BLQA 4MR9B 5BN5B 5HVNA 2IH2A 1GZSA 1FFSA 2ORIA 5KHAA 1M1NA 5BR7A 2G83A 3KVNA 3M5DA 2G5CA 1R6UA 3NT2A 2Y9PB 4N7JA 4JLKA 1K98A 3DKPA 3PC2A 5FNVB 1XU7A 1Z08A 2W2TA 3W6ZA 5LA6B 4AZ0A 4DW8A 3ZDBA 2PHZA 3WKCA 5CFZA 3Q7RA 2F8LA 1I2ZA 4CKEB 5CFQA 1KP2A 2FK7A 1WQ3A 3DLTA 4FE3A 5GIOE 1R3DA 1SBIA 1UJ6A 2Z6VA 4A9AA 1BOOA 4JQOA 1O6CA 1T13A 3NZEA 4B6QA 3BAFA 1V9LA 2DCMA 1YTLA 5GVSA 2IYOA 1CS0B 2H57A 4Q3KA 1A5BB 1FVHA 1C3OB 1J9GA 3GAZA 5FA6A 1PHPA 2PCLA 1JTVA 4DQ0A 2GHQA 2VJCA 4XQ0A 1C9MA 4KQCA 1J8VA 4ZCLA 3G9ZA 1X1QA 2LRHA 4FCCA 2YN2A 2OFXA 3W1VA 3E6AA 2W98A 3C2QA 3HZHA 2E85A 2XMPA 2VJPA 3IUEA 3LW7A 3QXXA 4JSRA 2CN1A 3ZWVA 4UFNA 1N7GA 4RTMA 2CV1A 3K15A 4R16A 4H27A 5IZCC 4ERXA 4PYNA 1MABB 1RI4A 1UODA 2H63A 3FOCA 3ONNA 2ZIGA 3ZWKA 1AY0A 1EJBA 2WB2A 3K6KA 1C3LA 5CHYA 4YJ3B 5EQTA 1M2JA 1DG3A 1KH1A 2D62A 2VWGA 3VNQA 2HO4A 2DUJA 2PL9A 3BXPA 3HYRA 3KEQA 4QYSA 4YI3A 4D9GA 4A1OA 4F2PA 3PR2B 5LLDA 2RGRA 1Z39A 1MOSA 2VP2A 5ALFA 1E3SA 5KQGA 1J9ZA 2IZ0A 1ECBA 1Z6ZA 4WVFA 3ETDA 1WKBA 3KZXA 1VRVA 2DBVO 1RWVA 2JANA 1M8GA 1G20B 1IPFA 3EMKA 4G4JA 4NCIA 2FPXA 3PFIA 1D8TA 1RWPA 1ZM3A 2YN0A 4HMPA 4NEHB 3RT9A 3Q8LA 1QR6A 2FGKA 4DIUA 4M46A 4EUFA 3X1KA 2YRXA 4R51A 3V7YA 1H05A 1TVCA 2X0FA 3H4MA 3SJCA 4C22A 5JCJD 3CVXA 1HE5A 1VG1A 4Y6QA 3I2FA 4B79A 1XE3A 4RE6A 3F2VA 1QVWA 1NN3A 1BROA 2X8BA 3KAJA 5HG0A 1WHSB 3OG9A 1BD3A 1PNTA 1WY7A 3CZ9A 2DTDA 2QUBA 1PG5A 3HEMA 5F78A 2JK0A 1ISRA 2EGUA 5B3AA 3T1NA 4DNPA 2IYLD 1R16A 5DB4A 1W4AA 2ZU0C 3Q7SA 5A9TA 4B8WA 3OFKA 1PJCA 2Z8XA 2FQWA 1BNCA 4GR4A 3CBGA 2IEBA 2QLNA 3QKUA 3JQGA 2M6RA 3NDBB 4FCWA 4Z0HO 4TV8B 4D41A 2UVPA 1JYFA 4LGVA 3C6YA 3CINA 1JXQA 5DHUA 1M5RA 1ULSA 1DC8A 4C4PA 1R5BA 2G9UA 3MNFA 2FPPA 3NIDB 1SD1A 4YJGA 4RJIA 4IMIB 5C4GB 5H82A 3QY0A 2B5WA 4IH9A 1Z4NA 3EJ6A 3W79A 5IJ9A 1QJ4A 4W82A 3AVOA 5MN4A 1QHGA 4YS6A 4PSKA 2X2PA 1UL1X 1H6AA 1U7HA 4OFWA 3OFNA 5KDDA 1C8BA 3B51X 1RADA 4WCVA 4I9NA 1SVNA 3DFKA 3REQB 3UMGA 3ZCUA 3DHEA 3GRUA 4DPMA 5JPCA 2JFGA 3R2JA 3IPYA 1H1DA 1JS1X 1ZXXA 3VO1A 2C2GA 1ZAYA 1L1EA 5TPZD 1EP3B 1IN7A 3K1YA 3ZK7A 1ID1A 5IBRA 3AUTA 4P0QB 2X42A 4ZODA 1JYEA 2PA3A 4ZZ2A 3WKAA 4IM7A 3A6DA 5BN4B 4Z0PA 3KSRA 3MWEB 1ZUD1 3F6BX 1GQFA 4NH4A 1FRZA 1JV2B 4W7IA 4CG0A 4C5CA 4HUQB 4KOAA 5JADA 5JYCA 4YB8A 4UFPA 1QCDA 2IDMA 5L3QB 1ESDA 1G2PA 1MC4A 4R1TA 5ESWA 5JBNA 1BDMA 2OXFA 1E3JA 2PGNA 2P3OA 4KOEC 3E8SA 1TEXA 3FWZA 5AHWA 3TNDA 3R40A 1OXTA 4DA0A 1F2UA 1L7PA 1R88A 1V16B 3HYNA 3NDJA 3ZTWA 5JSFA 1DAPA 2OHFA 1TU0A 1LSJA 1FJ2A 1Y6JA 1N78A 2ZPUA 3EMBA 1S3GA 3KQNA 1K7EB 1AG9A 3U3OA 1PVOA 5CTAA 3RRNA 4TYMA 5JDCC 3N0VA 2LUOA 4GRAA 4Q4AA 1IEWA 1Z4OA 3B2NA 1OZFA 1XRPA 5B58C 2QRMA 5L51A 4HQOA 3AU9A 2EG9A 4ZQHA 3KPWA 2Y92A 4BECA 5ITSA 3G82C 3L8ZA 2RHTA 4ZT3A 1GDTA 3VX3A 4FK8A 3AR6A 1I1QB 1MEOA 2JGKA 3OTWA 3ABOB 3MBIA 2E18A 1MXFA 4OHKA 1ZN9A 2J3LA 4YBRA 5EMHA 2FEMA 4YP6A 4HZUB 4DA9A 6NULA 3DOCA 1VMIA 4R6WA 4BP1A 4EY3A 4NBSA 3DOOA 4CODB 3AB8A 4QZVA 1ZNQO 3OLXA 4CF4A 1NBME 2GAIA 5DOVA 3VUEA 4ZZ1A 1WXXA 4DMLA 4AWAA 1ZIOA 1TK3A 3E3LA 3OZFA 1N2OA 2WIBA 2NO1A 1CJUC 1GEGA 1KAHA 1VI2A 1ESEA 1YB4A 3LQYA 5CW2A 2C03A 3SZLA 1NBMA 1V4VA 3HJTA 4A36A 2G08A 2OBXA 1PT9A 3KB6A 4YFVA 3NHUA 5AJVB 4K81B 4KAAA 3EG9A 4ONEA 1ATIA 2ECPA 1BCSB 4PWYA 1L7VC 4MVJH 4HNAB 5A5FA 1ODKA 1FMLA 1JQJC 1ZCJA 4RFSB 3PNSA 1VSVA 2WZCA 2YY6A 1MQSA 4Q12A 3QPWA 4YMWA 5JTUA 4XB6B 5LP1A 3W5IA 3UPUA 5HBGA 1N5MA 4MK4A 4UM8B 3V7WA 3BIWA 2IEAA 2CY0A 4XB2A 4FW8A 2G1JA 5IJWA 4URVR 1SA0A 2WU3A 3OJ0A 3FX2A 3GGJA 3K09C 3V3KA 5KVAA 1KC1A 4PAMA 1II8A 3ZI4A 2H48A 1E6MA 1KYTA 5E3IA 3SZOA 1RCTE 1NTRA 1UPTA 2FK8A 4F38A 3TLGB 2EP8A 1IH8A 5IT0A 1H4VB 1QP0A 3BCSA 3E1KA 3F96A 2AV6A 3H2IA 1FRFS 1DFGA 2YQ5A 3FJOA 1W85B 5EJ6A 4JLNA 4DLTA 4CI0B 2HMVA 3I76A 4RKEA 3U80A 3GARA 4QQFA 4KQ2A 1IHDA 1W73A 3HNPA 1J8MF 3H5OA 4MKHA 5CR9A 2IY7A 5IYZA 4PGMA 1SU7A 4BZXA 1SK8A 1NULA 3QPDA 4GI1A 4LX8A 1E3WA 3SF8B 1AURA 5A1JA 3DA8A 1WQ1R 2CUZA 3IERA 1YMVA 4XAQA 1T0JB 1K27A 1XZDA 2Q27A 3PUZA 4Q3CA 1ZINA 3IL2A 2Q0HA 2AFRA 3FSGD 3TRDA 3UHOA 5KQLA 3WR5A 2JEZA 1U9ZA 2B30A 4GEKA 1GUAA 1RAIA 1PT8A 3HVUA 4Q1BA 5L6LB 4MTLA 5AMXA 5JD6A 1Y34E 4DQLA 2NO5A 2RHRA 1G2IA 3KJXA 1GAEO 1CHDA 2FCAA 4XX1A 3OVMA 2O3UA 4B3DA 3NNDA 4DCVA 1NXSA 1XN1A 5EE5B 4EI7A 4ZZ0A 5ALMA 1T8SA 2ZJ7A 3LQ4A 2WT9A 4RABA 4MEAA 3QOXA 4A6EA 1P39A 4JC8A 1F14A 1VBFA 4MMZB 4RAOA 2QKYA 2JAPA 4A8HA 4DLPA 5DFAA 1A5TA 2FR1A 1V25A 1ZCBA 1GGVA 2NU6A 5GPBA 3MCVA 2VNJA 4R7GA 2GMWA 2J9GA 1AGXA 2VAPA 3T7EA 1CY6A 5KTMA 1LC3A 4KO2S 1J9EA 3BH6A 4ALNA 4XIIA 4A7PA 1WUHS 2QTLA 2IRWA 1W6UA 1E2BA 4QWWA 4ZI7B 3OZIA 1M2VA 2XUKA 2FN3A 3W90A 2ZPTX 3DBHA 4D3FA 5HF6A 3UGQA 4CTNA 2X0KA 1JZSA 3EGCA 4I1IA 4OREX 5H3HA 5EHNA 3N8IA 4P53A 3ZXSA 1TLFA 4PW0A 4C0AC 4KPFC 2VT3A 3EVGA 4WKBA 2V5AA 3LT5A 2AOTA 2NSHA 1S7CA 4C2BA 1GUFA 2C20A 3PGXA 1VJ5A 3KXKA 1KFCB 2QD2A 4A8JB 3U7QA 2BI4A 4HTFB 4JB2A 3W3AH 5I01A 1Q50A 2W2LA 2JJ1A 3D5EA 4OJMX 1C5KA 1S2LA 2VPWA 2DFPA 1NQOA 3HHEA 4AZ3A 1CQWA 4D9NA 4DBLE 4W9MC 3G5MA 4A2WA 3T0FA 4ZCSA 1J5EB 2ZYAA 2AN3A 2H7YA 2ZUCA 2Q8QA 3D7RA 1FLNA 3OCVA 4XYMA 3MYYA 4E5DA 1LVUA 1M1NB 1Y8QA 2EJTA 2NU7A 1A76A 1BG6A 1Q1QA 1UJCA 2QZSA 4MLZA 4QBHA 1J1UA 2DHRA 1H8ED 2C07A 2XT0A 3HFGA 1E0JA 1N34B 2HH9A 4RDHA 4M1YA 4X64B 4DRXB 2LWIA 2C2WA 2TMDA 3LH5A 3NAZA 1P9RA 1SBTA 4EATA 1JFFA 3RYHA 4CM4B 1VLZA 1KAGA 2J3MA 3JAWA 1GUDA 4XCXA 3IP3A 3QEMA 1VG9B 4JBNA 3B3QA 4RKYA 1JG2A 3DZ8A 1ZW1A 4HF7A 3S2SA 5A9SB 1QH0A 2GXUA 2C3MA 5K3AA 2P8SA 2RHOA 1Q16A 2COEA 4JXJA 2CJWB 2B20A 2FSVA 2FR8A 4Z8XA 1DL5A 5TJHA 2HUNA 3GGDA 3GLTA 5BYBA 1TEVA 1Y9DA 1Z0ZA 2Y1LA 4IX1A 4LNAA 3ZD8A 3ZVRA 4OA5A 1OAKA 4RA9A 2YMMA 5MHTA 5AP9A 2GD2A 3IPXA 3K6JA 4C2UA 1TQ4A 5EJ4A 2QX7A 1P1FA 4PO1A 2ZI3A 1OBHA 1DAKA 2ZIFA 4I4TB 5CA1F 4TL9A 4TS4A 4ZARA 1WBBA 3UK7A 2MT9A 2Y0BA 3NAGA 4EFKA 2DUNA 3CR7A 3MHPA 1ADYA 3N28A 4MRPA 3EZNA 1Z5ZA 5LYJA 4F86A 4RHXA 2ZSDA 2EL7A 1Y3CE 4FR5A 4U5XA 5BUSA 4PC1A 1SWVA 5JEDA 3ICWA 2EDAA 4PFJA 4Q82A 5MN5A 4P6VF 3QKSB 4NV1A 1W4BA 2H11A 2R6CA 3GWZA 4MGKR 4LVOA 4FDAA 1RKQA 1T8PA 2VDJA 3OLYA 5JDIC 2YWRA 4XRGA 4NCHA 3PBKA 3GOQA 1U2GC 3KPVA 3T54A 5ECDA 3BD8A 5GV7A 2D8MA 1WRBA 4IKPA 3KRTA 5AVVA 3SQWA 3UV6A 4LCBA 5E8JA 4ENSA 2ATIA 4YV1A 4LK2A 3WMWA 3M83A 4BLTA 5J1SB 2WAMA 3L01A 1E2QA 1RWKA 2WINI 3A32A 1YJBA 3N53A 4PLYA 1TTPB 1VP9A 3ZHXA 4DIOA 2P6UA 1N32B 5AHRA 1OYVA 4MWDA 2RMKA 5MGBA 1DKUA 1WABA 2AJDA 4HDCA 5KREA 4M9RA 1HV8A 2EJWA 2Q4RA 1J1ZA 4D3ZA 1ABEA 1ZK3A 3MELA 5IKOA 3CJRA 3STYA 4CCSA 5T4HA 1IY1A 3E5RA 2WVHA 5A02A 4DMHA 2RHLA 4BUCA 3H5RA 4YFYA 3M6MD 5CVJA 1AT1A 1XEWX 2HJ9A 3HXTA 5B57C 2R751 3EUFA 1KIFA 3IR5A 2XCIA 2BTOA 4JKIA 4DIDA 5K0JA 3CZMA 1A4XA 1V95A 3CVJA 2WIDA 3FTCA 1TF2A 1DADA 4HZUA 4FB4A 1W0KA 1PK7A 3TJZA 1BKYA 2D0PB 3OT1B 4FFVA 4A4DA 2B35A 4PYLA 3VO9A 1GXSA 1QO7A 1SQ6A 2ZB3A 1NMZA 2FU5C 4Q3OA 4YMSA 4EOGA 2CFRA 1CF9A 4A27A 1GLVA 2WSLA 2B8TA 4N7RA 1T5IA 3ESQA 4C0HA 1KH3A 1ENPA 1Z4QA 3HTXA 4XUEA 1H2EA 3HRKA 1T9DA 2XUHA 2Q4TA 4J49A 5JJIA 1IVNA 2XMBA 3H2ZA 4WLUA 2P9CA 4EENA 1T9CA 2GHIA 4BFTA 4M88A 4ZXFA 1N7HA 3AB3A 2YJ6A 4UZSA 1SURA 1G3IA 2ZRBA 3MTGA 3N8NA 2Z5GA 4GM0A 3GEPA 1QWSA 5EWJA 4CKZA 1WL8A 1NU6A 4XWGA 4C07A 4NDZA 3TRIA 1ZI8A 1S6YA 1CDEA 2IDJA 4RTOA 4J43A 2FPUA 3UJAA 1YDFA 1C9YA 1PVVA 1WTCA 2ZBRA 1HXHA 2YICA 4KFTA 3E9EA 5H02A 3BT7A 1GWNA 1OU4A 5B2FA 3QRWA 5C80A 2MJLA 2P9JA 2J33A 4DA4A 4B6SA 2G0NA 3FCXA 1ML4A 4Z4IA 1E0DA 2GZMA 4COKA 1Q15A 4KPGA 3FCSB 1JEAA 2B4KA 5DXFA 2JFQA 2CBGA 3QELA 3LXXA 1NQXA 4XE5A 3KBBA 1WKCA 5IDWA 5JY1A 3TOSA 2DJIA 5CCEA 4CIBA 4CEHA 1R0YA 3WQRA 5LXTA 2NXEA 3CZAA 2V7XA 1RIIA 1VMDA 3LIIA 1LPMA 3CEHA 1NYLA 2J6IA 3BXEA 1NF9A 2AUTA 5SV2A 2CXSA 3JU3A 1W47A 3R9WA 3PCTA 4M89A 2ZXUA 4Q9KA 1SY7A 3FOBA 1ZI9A 3L8YA 4P2GA 3GRVA 1WJGA 1Y5IA 3I2KA 3KQVA 4CT0A 6ADHA 3QKRB 1ENZA 3EHEA 4G6ZA 5DBHX 4I4CA 2WJPA 3OEWA 2RB4A 1W8DA 2K4MA 2NWQA 4KIGA 4QXRA 1G5FA 1GCGA 1W4LA 4DR6B 3SR0A 5EG5A 1LDNA 5FTJA 1G4UR 1TMGE 1J2EA 2CUNA 2WJIA 4ZV4A 1FMCA 1Y89A 1CNEA 2Z04A 2JASA 2W4IA 1U4OA 1QAMA 3W04A 1CHNA 4G5YA 2EEZA 4UU7A 3ESRA 2VYVD 4WASA 3DMPA 3Q2IA 3FGOA 2XYGA 1B0UA 3NNSA 1DLJA 4B2PA 4UFOA 4ZO9A 1Z28A 4PNHA 3CX6A 2F17A 4WY5A 1ULUA 1QVVA 1UWKA 2KB0A 4JR1A 3IOYA 1KSJA 1N2CB 1FLDA 3FCYA 3NC0C 5K3CA 2P5YA 4CQMD 3ABIA 1FTWA 2ZYWX 4F1JA 5EJIA 2NQ8A 5CH3A 3BDAA 4PZLA 4DWJA 3NTOA 2DHEA 3PGLA 4KRFA 2VHCA 1T24A 4FIDA 4BCDA 3VA7A 4O4HB 1DOHA 3F8TA 3PDWA 1PNOA 2XVAA 3Q10A 4JL8A 4N3CA 3CNOA 4BQEA 1EBBA 3QLVA 3X2SA 5FX2A 2A5JA 2Q9UA 1S8FA 4QO8A 3OQMA 1NQVA 2O1EA 2BPOA 3E9CA 1Z16A 4ODIA 2P9HA 5JXGA 3A6FA 3B9RA 3M4XA 5CCDA 2GAFA 2DPYA 3MSCA 3L02A 4MVJI 1BS9A 3IA7A 1QZ3A 2XRMA 2DRIA 4L5CA 4RVOA 2IYFA 2D1YA 1SQ5A 2B0CA 3FHOA 1O0CA 2OCXA 2Y3IA 1GKIA 5FLXA 3EXEA 2Z5FA 4HYTA 2SHKA 2F64A 3U4DA 2ZDGA 4H3VA 1DXQA 1W88B 5H7XA 1C81A 4G0YA 1P81A 4B46A 3ZY4A 2G1KA 3HLTA 3I01A 4HHEA 3GLVA 3U4AA 1QUFA 1UXIA 3C8ZA 5B1DA 5IT9A 1A2BA 1WEKA 2DQSA 2AW3A 1QDUA 4PPQA 1F06A 1C3OA 1H2ZA 2B69A 2WJAA 4REQA 1IG3A 4BHTA 5CVTA 3CZQA 4RHUA 5IVDA 1O5OA 2EJCA 4G1VA 2OL4A 4BKPA 3ADPA 3FGZA 2Q9CA 4F9GA 1HMPA 3BK1A 1K0FA 2FETA 5EJAA 4D0GA 1G5PA 1Z2OX 5DX8A 2QLBA 3FIUA 2VJAA 4J0KA 3OWOA 1Y7PA 2CNWA 3IS3A 5M3BA 4RY2A 3EVNA 4D8XA 2LE0A 3KOWA 1J6UA 3FNHA 5F4BA 3L2OB 4DR5B 2O2CA 3EIQA 1RCFA 3GOHA 3HU2A 4HDSA 4ZREA 5AR1A 4B73A 4MHTA 3R4CA 1NGSA 4OXNA 4QQ8A 2R6AA 4HSEA 4MOWA 4D92A 4IIXA 3VR4A 1WB5A 2FG5A 1IB6A 1L4BA 1NW6A 5FIUA 2P79A 3HCAA 4MGZR 4RQBA 3WO0A 4ZGWA 4CFSA 4EZEA 1R5OA 3BMCB 3HCOA 3BA6A 5ALXA 4WKNA 2IXTA 2WU8A 1FYEA 1U3GA 3GDOA 3K9LA 2I6UA 1DXHA 2BHLA 2VLIA 4Z0TA 3RAJA 3H04A 4B71A 4U7HA 2AI2A 1QIMA 1TPZA 3WLNA 2FRXA 3GCDA 3R6GA 1MRSA 3DCJA 3DOJA 4PAQA 1AOXA 2ZTUA 4YUAA 4W5TA 4M22A 1IEVA 3CZCA 2FZVA 1DKQA 3HCEA 3R8XA 3R76A 3L4SO 1W9HA 1SHJA 2PXHA 2V6FA 1N8KA 3QEJA 5G3YA 2GJ4A 5KNCD 2Q3MA 2WJ6A 3ME5A 4UVIA 2QT1A 2P4QA 2QN7A 3C85A 3TJRA 1DHTA 3TG2A 2CHEA 3O92A 5I7RA 4LF8B 1H0RA 4KVGA 3SLGA 4D9HA 2WWXA 4BVGA 1LLCA 2ZZMA 1VE9A 3NBFA 4BTLA 4NV3A 3EVAA 4D46A 1DUSA 2DZDA 2OZEA 4R2XA 3TLJA 5EE3A 5G0VA 5CVEA 4ER5A 1T2UA 4EWLA 1WXDA 3A9UA 2H06A 4F4HA 4AZWA 1TVMA 1J23A 2OP0A 1G0OA 2YHBA 3QIVA 1NPDA 1NP7A 4CL3A 1FQOA 3OJCA 1TKBA 1V39A 1ZRNA 4KDRA 2WM8A 5GJVC 1AKWA 2XWQA 3SBEA 3GCGA 4D74A 1T5OA 3QBVA 5IDVA 4HWSA 3RFXA 3L7IA 1CUVA 2OXRA 2W70A 2Z6AA 3EIUA 1QG2A 4R2IA 4CCAA 3R0VA 4HP8A 1WDLA 2MSLA 4R40A 1JUDA 3ETCA 2AD5A 4OL9A 3E1GA 1X0XA 2FG6C 2EJUA 4AB1A 5K8JB 4DMMA 1YFKA 3NORA 4X1IB 3VYWA 5BRNA 1EFHA 5BSFA 5T7BA 5C34B 1SMKA 2NPOA 5ALQA 3ESXA 2B37A 4ZI7F 1R4AA 1VZ3A 4RE5A 3LPLA 4DABA 3K0CA 2WWRA 5FOTA 1R8SA 1WP4A 1HE8B 1KZ4A 3DW3X 3EVEA 3PJFA 1WMSA 3MVEA 4L0MA 1RYFA 1LXCA 3LLSA 4MZXA 4FYPA 5ALYA 5H5JA 3GDFA 3HDVA 1QRTA 1AC5A 1II8B 3HCFA 2HWKA 4JOSA 4KQKA 4O1MA 4NNJA 3VR4D 4L15A 4C87A 4AUMA 4K86A 3RHSA 5DHRA 3M1YA 1RXCA 3IP1A 3AXTA 3P8ZA 3X1MA 2RGCA 4KUEA 1MNAA 5EP3A 2HLNA 5HQ3A 3C5HA 1GP2A 3C8DA 2F9FA 3BHNA 4IHQA 2PU7A 1U7XA 2OD7A 1GO2A 3JQ6A 5ESDA 5FI1B 5KOHA 2I22A 4B3MB 3KQYA 4IQ4A 5DGTA 3TDKA 3I52A 4H16A 4AG3A 5LKRA 1OLUB 4P3OA 3N2NA 4DSAA 5F1OA 2ZRCA 4UOZA 5GVRA 1B43A 4RKFA 1X1DA 1HZZA 1OB5A 1JB9A 4DAEA 4EDHA 3GEIA 4XX0A 3JQAB 5ICGA 2VJOA 5DVZA 2RGNC 4Q3BA 3I64A 4CKYA 5KTOA 1IJFA 4G1MB 5FP0A 5JROA 1PP4A 1T3LA 2OGTA 1R4MA 4HLQB 4I6EA 4YC7A 5ESXA 4EFDA 4KREA 2G7MC 3PX2A 2DSNA 3W8EA 1NOIA 4GOXA 1LX7A 5F7ZA 2DKNA 2Z2ZA 1SKAA 4BVEA 1U9YA 2F3PA 4GOLD 4TLEA 1Q14A 4S3MA 1RYDA 2RAVA 4I4NA 4RX1A 1H65A 4L72A 4JJ8A 2GLUA 4HLNA 1E32A 1MQ9A 2VATA 1JAZA 3FDXA 2FMHA 2HHLA 2PZMA 3LPCA 4GKBA 5JVDA 4RVCA 2TS1A 1XZEA 1TADA 3O4RA 4A15A 1T4GA 1VGQA 2CZGA 1S0UA 4LRYA 3Q11A 5C5IA 2F43B 3HGMA 3CH4B 4EJ6A 2JDIA 2O20A 2ACWA 5JRZA 5EOVA 4QU9A 1S2GA 3SK0A 4UAJA 4MMXB 3TLZA 4RPLA 5DYGA 4K2AA 3VJMA 4FQ5A 2J3QA 4RVNA 4EG1A 3O91A 4N8EA 3AWIA 4WNCA 4IIDA 4KSBA 1NKSA 4BMVA 3VR4H 4EQ6B 4ND5A 1V5IA 3PWKA 1RWOA 1Y33E 2CWDA 2VCHA 4I9HA 4JUBA 4X6XA 5H83A 4RQUA 2PR7A 4PRYA 4YRDA 1M1YA 4BJ6A 2QL6A 4LWQA 2RC5A 1GR1A 2P6MA 4FHDA 1GG2A 3BJRA 1CJMA 1N1EA 1S2DA 1U8EA 4WKPA 4BBPA 1NT4A 5T4EA 5LMNB 4P4UA 2G3YA 1L7OA 2SBTA 3IEKA 3PENA 3WKDA 3EWNA 2FEXA 4POOA 1E1QA 4G36A 4GHWA 2COKA 4UNRA 3IKTA 4OQDA 4C7VA 2EF1A 3FPCA 5EY5B 5EIXA 1ICEA 1VJGA 2JI7A 1TJ5A 3OEHA 4YV7A 3E3OA 3BRCA 3ESZA 4X7RA 2C0PA 3HO6A 5IJ9B 1XZGA 1VCOA 4OK6A 1KI1A 3KD3A 2AG0A 2H85A 4XQ9A 2R4QA 1D03A 4BATA 5B6JA 3M6VA 4DJAA 1KEEA 4CEJA 5FV7A 2V8BA 3AY3A 4F91B 2DQYA 2OE2A 2QI9F 1X7ZB 2OB1A 5ALTA 2IEYA 5EAIA 3RS5A 2AR7A 1GKKA 1SXJC 4QBTA 4CUJA 4JYZA 1TK9A 2PYZA 3NHRA 4EL0A 2HR1A 1ZWKA 4BEBA 4HLCA 1T0PA 2IXFA 3FTPA 2VBFA 1MLDA 1JL3A 1R0ZA 3SX2A 4WAUA 2PUFA 2C5BA 2GD6A 2PTGA 4RM2A 2Y4OA 5LD2C 1ISJA 4RNDB 3KZOA 3UHPA 3HE3A 2GEKA 2CLHB 4UUPA 4RULA 3AEKB 1FXSA 4Z7OB 3TQCA 4ASUD 4UHKA 1R6AA 2IOHA 4XYGA 5BV2P 4DLXA 2Q41A 3QYFA 4D0NA 3N8KA 4BMSA 2V54A 1VGRA 1IOWA 3W6PA 4KCGA 4AVYA 1GT6A 3CVYA 2BKAA 3UV3A 3GPBA 2JLBA 1N57A 3DLPX 2DR3A 3SZGA 1UZUA 2DWOA 4XDHA 3RJMA 1JKFA 1UK7A 1GU7A 2CB9A 4LVCA 1RHJA 4OQ4A 3W34A 1NR5A 4Q24A 2Z58A 5L3ZA 1BE0A 5F1YA 4F92B 2YY7A 4GBED 1BH6A 2HADA 3DXFA 1W49A 4AROA 4BX0A 3CFYA 1GZ5A 3EVTA 1D1QA 1YHNA 3PP8A 1I7LA 3MGKA 3MJFA 3KR1A 1E79D 3P9ZA 4CMJA 1QB7A 4COOA 1H2HA 3JD0A 1GT91 2DKOA 1T15A 3N86A 3DDCA 4R71A 3DQQA 2O54A 2C97A 2QD4A 5JAMA 4OF4A 1S89A 4HBGA 2B21A 2GYVA 3GELA 4QUGA 4J6FA 4ZV7A 5BORA 1FB5A 3ANXA 4Q93A 1GRCA 5DBEX 2CXUA 3F6EX 4XIGS 2Z1NA 5FHQA 1QC5B 3RREA 5CEJA 4ZVUA 5CAEB 5JZBA 5AUNB 3CVVA 1RPJA 2P6NA 1HE3A 1P2DA 4YQZA 1VLLA 1UXKA 4N47A 5JSZA 4DB2A 3S27A 1ZJ5A 1Q6YA 4NBWA 5J47A 2DERA 1Y8RB 3QNWA 1E6CA 8AT1A 2I91A 5LR6A 4JELA 2H65A 2PWYA 4S1NA 1ODIA 1QWOA 3HH8A 3KKPA 1VIDA 1FY2A 1OZHA 4RV4A 1VCHA 3TYXA 5U4QA 4NU8X 5ES4B 3STWA 1N4DA 4ZVQA 3C0KA 4JI3B 3SJBA 3W8NA 3OAAD 3MUOA 2OHOA 2WG1A 3KYCB 3NTUA 4LOKA 5AFSA 3QIAA 2W4QA 2PX0A 4UBLA 5K2MA 3WTBA 4IVNA 4E15A 2J9FB 3SE7A 4YACA 5AOBA 3G0BA 3ORRA 4C29A 3AKYA 1I0IA 5C4MA 4B6OA 5JCOC 3GLSA 4FX5A 5LQRA 2NZYA 2PYIA 1ZISA 1P8JA 2QTCA 4II2A 5DNEA 5F1KA 4MHSA 4CT4B 3SDBA 1UWLA 1ID8A 4LECA 1U3VA 1HT1E 3SYLA 3TLXA 2MYPA 3VPBA 5TNXA 3O1IC 1V16A 2GEDA 1KORA 2LDXA 2HFKA 3AC0A 4R1UA 4AZVA 5AKKA 2R96A 4EY5A 3AVYA 5CNIA 3KUCA 4P34A 4MQLA 1JLRA 3MJHA 5EMJA 3RS8A 3AR9A 2IUFA 4F5WA 1JPUA 2XZOA 1N6HA 3G13A 4LEIA 5K01A 2YRFA 3U61B 3DE1X 3T3MB 3AW9A 3M49A 4YMTA 4L6CA 1YK0A 3RUHA 1TEZA 5A7HA 3MCTA 1C1XB 3UCXA 3BHMA 1MO4A 1C9KA 3TWOA 2QP9X 4MCJA 4IXTA 5CK4A 4X1KA 4DDMA 2AMVA 2ZJ8A 3FA2A 1L4MA 1UT5A 2E82A 1WZCA 4Y9TA 4EG0A 3THXA 2ERCA 1I7NA 1CULC 3I4FA 5E9JA 1O8BA 4U00A 3R7WB 1P61B 3W4IA 2OG1A 3EDOA 2SECE 2GF2A 1Y1TA 1KFJB 2PEZA 1DV1A 2O59A 5LDGA 2ZB2A 1TUGA 4ZO4A 1OTYA 4O4LA 1RI2A 3UXMA 1QFMA 2ZYVX 4NOLA 3ZBTA 2PWBA 3D3QA 3MD9A 5REQA 1CU1A 1MC5A 1NNI1 4TN5A 1UK8A 3K5IA 1E4OA 4CYMA 121PA 5BQXA 4NFHA 5HOEA 5FUBA 3T5DA 1XZJA 5J63A 1P5FA 2BBSA 2VL7A 2ZETA 2B1GA 1INLA 1VYUA 4M9SA 5KAMA 2R6GA 4MCIA 1Z8DA 4HB2A 3B89A 5D2CA 3WGHA 2Q9AA 1U7WA 1Y98A 3TPFA 3FSRA 4P58A 3COSA 4TLDA 3VC7A 4JBYA 4HTAA 1EPUA 3EQ2A 4JN6B 4JMLA 1KKMA 4N5NA 3TKAA 4E94A 3P4UA 1W36D 3IKVA 3HXPA 4RZUA 1I6WA 4V2UA 5B5SA 3KT0A 2R3SA 4BNWA 5C8YB 1J4AA 2H8KA 2XD9A 2IT1A 4BLOA 3EXG2 4UEOA 3RVSA 3D4IA 3HCDA 2YIVX 1EQUA 2IODA 3GFBA 1TO2E 3GC6A 3HG7A 4IEEA 1LWNA 3G9QA 4KC0A 3ODPA 2BEJA 3FMPB 2ON6A 4BV8A 7GPBA 1X80A 2C61A 5LQNA 1FRNA 2BM1A 4XQEA 2ZRLA 3NONA 2VNHA 1XL0A 4M0CA 1QP8A 1NZJA 3G9XA 2IIVA 3SPXA 2XPCA 4H77A 3HDYA 4ZK6A 2W42A 1QBGA 2JIPA 4YAGA 3A4NA 2PH3A 4HSGA 2XHEA 1YGPA 4HAZA 3HCCA 4QQNA 3RU3A 1I32A 3HB7A 4ZQGA 1ZJWA 5DCWA 4DSTA 1RRVA 1TW3A 4BDTA 1S96A 3V3TA 3LUJA 3H17A 5K8IA 5KO2A 2Q29A 2WG0A 2HA4A 2XW6A 1BHJA 4TTVA 3S2EA 3N3AC 4OB8A 3IQFA 2C2BA 1SQGA 3IVCA 3M2PA 2VUUA 5B1SA 2IIQA 1EJ6A 2R44A 2RH9B 3ND6A 3WLKX 1ZYUA 3WYAA 3MTBA 3AVXA 1RIFA 1QLHA 5EQJB 1DO2A 4B87A 6Q21A 4AKGA 3OOYA 2YYZA 4ZVTA 2J5KA 4BE7B 3WWEA 1E3MA 2LBPA 5DX1A 4EK9A 2O2JA 1HO3A 3DVSX 3G23A 4BLPA 4ND6A 3P97A 4RJKA 5IHPA 1JDNA 5LQDA 3P19A 3ETEA 1E94E 1XXHB 1PV1A 1KQOA 2BGTA 1F0YA 4DJTA 2YN4A 1I7DA 4X8HA 1M6VA 2PZEA 4TLBA 3RU2A 3HP1A 2WJ3A 1O87A 3G5AA 2F8MA 2ZRNA 3U3JA 2YIDA 3CR8A 5ARDA 2R4UA 1MVOA 4KWTA 2ZB7A 4OYRA 5FLKA 4PQEA 3C14C 5E2AA 5DNUA 2PL3A 4XSGA 3DEKA 2IQIA 2R85A 1T3HA 4IGFA 1ZQ1A 4CCYB 2HBQA 1UANA 1XTSA 5EZ5A 4TROA 1I2BA 4MV3A 2BEVA 4W8OA 4JT9A 2VP3A 2XVXA 4LY0A 1W4RA 1RM4A 2I7TA 1PL0A 4BE9A 4PGHA 1FP2A 4NJEB 4JU9A 4B85A 4CLEA 1TYAE 3L1JA 5JWRA 2ODPA 3HHPA 1NXVA 2R1TA 3UMYA 4U8GA 5A05A 3GJSA 5ULLA 3GFQA 3I3SR 3K1JA 4JP8A 5HQJA 1UMDB 1NVGA 1G8JA 3GY0A 2GFHA 3SZMA 2AA3A 1VE6A 3ZQ6A 5KSPA 5ELXA 4UNNA 4CQMB 1G16A 3DZHA 3N59A 3B1XA 4RMGA 4LZZA 3QJYA 3LE8A 4PO8A 3RSZA 4J0CA 1AGRA 2D2VA 2YBDA 4BQQA 1QVRA 3KQUA 3BH0A 1A9PA 1PWHA 3ORQA 5CLHA 1AU9A 1CUFA 1ZLYA 2VR1A 3BICA 1DC5A 4Y2XA 5EWLA 4HEA6 3AVUA 3AESB 1U0BB 2R7MA 3OOHA 1BFDA 1JRLA 3IHLA 4XD7A 2OGUA 4XQCA 5KOJB 1MJHA 1Y8RA 2IU4A 3JQ7B 4CQLB 3S28A 5FQOA 1R1DA 3WWPA 4AQYB 3B3JA 4E6PA 1N6LA 5JNVA 4RSRA 3FI9A 3RROA 1L5HB 4V0SA 4UHFA 3EXIB 5I9LA 2I4LA 2I87A 2JFUA 5KQPA 3T0GA 4E30A 2PL1A 5EKSA 2XZLA 1M2EA 3AEXA 2HB6A 4C4TA 1BQ3A 1GZ4A 3JQAD 5LUAA 1R8QA 4Z1OA 3UBTA 3L6BA 1MB0A 2C92A 1CJKC 1UBHS 2Q0SA 4MWZA 3S1AB 1LD3A 1XI2A 4I1RA 4EPVA 5DM4A 3M9WA 5CGZA 2W6OA 5F9FA 4ZO6A 2C00A 1G1AA 1ZD8A 2RK4A 2WD9A 1U9IA 1NFRA 5KHOC 4FYIA 4ZEVA 4EHAA 1DDGA 1QQ7A 1KSGA 1WD5A 3M6LA 4AO7A 4U6NA 1PBNA 3AKZA 4GWGA 4QYWA 3MJTA 4LNUB 1SM4A 2PX8A 4RHYA 1KQPA 3RHZA 4HJXA 1BTOA 1E77A 1VHLA 4JWTA 4B4WA 3W1WA 4PXYA 4E2ZA 3QBJA 1G6Q1 3L1IA 1C80A 5TSDA 1JPVA 1E9BA 1M6EX 1IBSA 4ICIA 4H0NA 5BYJA 4EITA 1ACLA 1PZGA 3KTAB 4CKCA 1QANA 4R0NA 1D5WA 3Q6MA 4PHFA 3GBPA 1ESCA 4ZOEA 1EAYA 1THTA 5CG2A 3H1AA 1F3OA 2FWAA 5EJFA 3VGPA 1V35A 5FTKA 1BWSA 1E3QA 5AK6A 1FX0A 3KHKA 4R1PA 5JRJA 3O5AA 3A9VA 2PUCA 5K3FA 5CVVA 5EIAA 4G5OA 3MWJA 2CVOA 1D4FA 3G2NA 2M2IA 4FZ3A 2VF5X 4BNDA 3UAXA 2AQ8A 2NP7A 1N2GA 3EA5A 3DZKA 3HZZA 2Q2OA 3WJ2A 4C2TA 1TAUA 1T9GS 4YPOA 1Z0FA 1KMCA 1YZYA 4J07A 4X95A 5B37A 2C57A 1I6MA 1ZM7A 4JI1B 1U5BA 3H3XA 1QYCA 3JTMA 2ZSHA 3CJTA 5J2TA 1PTJA 4IINA 1E5VA 2WT8A 3MZ0A 4H18A 1E1NA 1G19A 2ZYDA 5C51B 1AXEA 4FYYA 1WW8A 2OGSA 5A6VA 4YT5A 3ZOZA 1BDIA 4W8HA 2ZRAA 3MOSA 3S2GA 2XDQB 2IPLA 3OTGA 1Y4SA 2CXNA 3GVHA 3CPJB 3NUZA 3MC1A 5LQCA 1GQRA 4MRNA 2CD9A 3ZWPA 2ZFUA 3KKNA 2HJVA 1I13A 2Q5QA 2FMTA 2TRSB 4BKOA 2G4LA 3SC6A 5HRAA 1A82A 2WJHA 3SKXA 1F6DA 1EK5A 2HA2A 3ICVA 3MQ2A 1H9BA 2G8NA 3HFRA 1WVIA 1BEEA 3I2GA 2G88A 1KEPA 3LBNA 5EEHA 2DTEA 3RFTA 3JASA 3OY2A 1HH4A 4BVKA 4CHGA 1C4OA 2X0JA 3C3AA 2VT7A 3E3MA 3O1LA 3Q8MA 1I14A 5ISMA 3L7YA 5L45A 1L4HA 1M54A 2G76A 4L74A 3WRYA 3DMFA 3WGZA 2J3EA 1DS6A 1P80A 4WLVA 1KR5A 5EP1A 2C9ZA 3IUPA 2FZ4A 3EC2A 2F1JA 3EJWA 3KFLA 3JQQA 2VHUA 4O25A 4I9GA 5HEKA 3T5MA 4KXQA 4C08A 2OMKA 4DCMA 1EVIA 4JS0A 5DTEA 5JT1A 2D7CA 3TTWA 3H13A 3PD7A 3DL2A 5FOUA 5GWXA 1M5TA 5KQMA 1ZUIA 5FXMA 4DR1B 2C31A 1RRGA 2XY4A 1RQNA 1EFPA 1FNNA 2FPIA 2JLZA 4KZPA 1BC5A 3LP8A 4QC2A 5JD4A 1C9EA 3SX0A 1X7WB 2IYPA 2VBGA 1J24A 2ZB8A 4NX2A 4QULA 3TUJC 4AJ9A 3L4KA 2ORVA 4YY3B 3O73A 1QOZA 2KLHA 4JJFA 5G2OA 2HLDA 1VDMA 3HB9A 1Q5PA 1I5RA 3RT1A 3TB6A 2IGTA 3A26A 3C3MA 2Q4DA 3N75A 3A1UA 5A4MS 3EXIA 3L7LA 3GPDG 3PKIA 3SC4A 5AW9A 4NG5A 1YL7A 5FLYA 4ER3A 3DE2X 1S8OA 1GAJA 2ZI5A 1EFTA 2WP8J 3DO6A 3MLAA 4HB4A 4D4MA 5KWSA 3KKMA 4N01A 1RRKA 3K71B 1GARA 3STTA 3ZX4A 3AZOA 2JCGA 1W85A 1DBWA 1LZKA 2DH6A 5MN6A 4LVNA 3J81A 1V4NA 3FYUA 1K89A 3TRJA 2C3YA 3TIXB 2ZAOA 2DYKA 2N42A 3TQHA 1B42A 5DNYB 1U1DA 1I4WA 1P2GA 4R98A 4ZT7A 4W1QA 3IJ5A 5KJ6A 4G8CA 4IAOA 1OB2A 1SCUA 3P1JA 4G89A 2BMDA 4M6WB 3SMVA 1MVLA 5F9HA 1J2YA 4IXDA 3E7FA 3AM1A 1JDVA 4RANA 5F9MA 4K1XA 3HCNA 4KVAA 4PXSA 1HY3A 1IJBA 1HQYE 3OE4A 2FFRA 3OTQA 1G3UA 2VPQA 3P9QA 3FAZA 4TUYF 4UM7A 3I5AA 2QR2A 3CHYA 3HRIA 4FXPA 1A3CA 4A0QA 4BO2A 3RH0A 3TE6A 2DETA 5EHXA 3RRJA 1VYTA 4L51A 1ZBQA 2ONJA 2OHXA 4DM3A 1DAGA 5JDIA 1ZN2A 3CRZA 2Z6QA 1A72A 3KR2A 3C39A 3PQEA 5LBUA 2ENWA 4HLUA 1DC6A 1E1RD 1VKJA 5LYYA 1CC1S 3ZHVA 3M4YA 1E59A 2HF7A 3BWVA 1E98A 5EIBD 4J2HA 3GAAA 4KDFA 3ZLJA 2Q45A 1Y8QB 2NU7B 2ORYA 1AZTA 1YDMA 3QUBA 3T9FA 1NW8A 2QAGA 3ETLA 3Q41A 1A9XA 3NKFA 1OAOA 1YJXA 1LDEA 3AF2A 4DDKA 5A5GA 4G8BA 4MW7A 3BE5A 1RRMA 3DHNA 3I6ZA 2VQFB 4WMLA 5CA0B 3OT5A 1OPXA 4OV6B 1W96A 1PT6A 2NNWB 4W7SA 2LIVA 3OFJA 4KFSA 2GK4A 1KKUA 5JVDB 1D7AA 2GB4A 4R84A 4G5FA 1YS7A 2BGWA 1C0EA 1T25A