3SVZA

Crystal structure of apo bt_2972, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of apo BT_2972, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3svzA00
2YTZA 2YUIA 2AZTA 3SGLA 4FT2A 4RV9A 3T0IA 3FTEA 1NW6A 2PXCA 2GH1A 3DUWA 4KWCA 4OQEA 4RVDA 5KQRA 1EG2A 5EMKA 3PB3A 3FPHA 3GRUA 5E2AA 4CKEA 5BXYA 3BT7A 3VC1A 5D1HA 1G60A 2VDVE 2NXCA 3SR4A 1JQDA 5JR3A 3OZRA 2ESRA 4Y2HA 2G72A 2ZTHA 1HMYA 4RVHA 3ER9A 1RI5A 4UOEA 2AR0A 4EVIA 2PX5A 2ZZKA 4QVGA 4RTMA 5EIWA 4PINA 5FWAA 2FYTA 1JQ3A 1G6Q1 3GGDA 3LCCA 4DZRA 1M0EA 2IGTA 3HCDA 3LX6A 4ISCA 3R0QA 4LG1A 1QANA 4V0QA 5G02A 3REOA 5LR6A 1KIAA 3I58A 3KR2A 4B17A 4PYMA 3B89A 3CKKA 3WSTA 3G2MA 4MQ4A 2P7IA 3NVMB 5HIKA 3UJCA 5D1NA 4AUKA 5K01A 3BWBA 3MCTA 2QM3A 3T7RA 2AS0A 2BM9A 4M37A 4QQNA 4F86A 5DX1A 2VDWA 3OFKA 2AOTA 3BWMA 3TRKA 5K0JA 4XCXA 2O07A 4RTRA 1RI2A 1XJ5A 5K0CA 3HVKA 4YUZA 2IDKA 3A7DA 3NJRA 3CCFA 1P1BA 2PVCA 4C05A 3UZUA 1EJ6A 3LPMA 1IY9A 1R6AA 1VE3A 1G55A 4FGZA 3G88A 5BW5A 1WXWA 1F38A 1ZGJA 4P7FA 4EK9A 4PCLA 3HVJA 3ERCA 4GF5A 4Z2YA 2IFTA 2PY6A 1EIZA 5FA8A 2C7PA 1Z3CA 2XVMA 3DXYA 4M38A 4OX9Y 5DTRA 3M6VA 2ZIEA 3P9IA 4JXJA 2CMGA 4RTOA 3I53A 1XDSA 3HA5A 4P7GA 3BWYA 3FUXA 5C9ZA 3PX2A 2NXJA 4QTUB 2ZVJA 3KHKA 4PGHA 3TKYA 2Q41A 4C06A 1U2ZA 1VLMA 2P35A 5HOQA 2WK1A 4X1OA 2XYQA 4R05A 2EFJA 2OYRA 4RTJA 5E2BA 2GLUA 2O0LA 2QY6A 3C3PA 4KIGA 4M36A 1IXKA 2VDUE 4XUDA 3KR1A 4DM3A 3CGGA 4QQKA 3LDGA 1B42A 5CVDA 4YV0A 1SG9A 3PLAE 5GWXA 4RTSA 5GM1A 2AOVA 2HNKA 3IYLW 1SVUA 3TLJA 1NV9A 3UFBA 3TMAA 2WA1A 4E2YA 2FCAA 2UYQA 5P8WA 3G5TA 3EVGA 3FUVA 2IDJA 5DX8A 3DXZA 3BZBA 2NP7A 1KXZA 3GWZA 2OPBA 3OU7A 4HTFA 1KP9A 2O06A 5ICEA 2H00A 4M7RA 2YXLA 1TW2A 3OPNA 4GEKA 5E1DA 1N7JA 2XVAA 3KR0A 5FWDA 1JTFA 4FP9A 4R8SA 4V0RA 5EOVA 9MHTA 3DH0A 1M6YA 4HH4A 5JUWA 4O29A 3VYWA 4YUVA 4E30A 3QOXA 5M5BA 4YV1A 5EQJB 3OCJA 4LWPA 5BW4A 3E8SA 2CL5A 2GAFA 5K0NA 3GJYA 3AJDA 5FTWA 5C0OE 1FP2A 1H1DA 3R24A 4IV0A 4QPPA 1EQAA 3FPGA 2OO3A 3DMHA 5DT2A 3DLIA 3EGEA 4ER6A 5K0EA 5GINE 4PYQA 3KQQA 4YV2A 4ER3A 2FK7A 2ZIGA 2XYRA 3UBTA 2OKCA 3LBYA 2P3QA 5EPEA 4A6DA 1FJXA 3CC8A 1G38A 1HNNA 3I64A 3UJDA 4FZVA 2BR3A 3DMGA 5HFJA 2UZ4A 4BY9E 3NWEA 5CUQA 4DF3A 2ZBRA 2I62A 1KHHA 4GBED 3DLCA 2ZULA 1RI4A 4CWAA 3PFHA 4P7KA 4DCGA 5F2KA 2ZSUA 3MB5A 3R3HA 4C08A 4CTKA 3I5UA 3KPYA 1XDZA 2JG3A 1TPYA 2P41A 3ELDA 1RI1A 2ZFUA 1G8SA 5EKUA 3UJ8A 4RTKA 2HR1A 3FPEA 2EG5A 4GOLD 1NV8A 2ZWVA 5C1IA 2BR4A 4NECA 3HP7A 2QYOA 2BR5A 3EVCA 3K0BA 3KQSA 3HA7A 2GS9A 3A26A 3A7EA 3G5LA 1JG4A 5FULA 1M6EX 2AOUA 5K8VA 2XYVA 1YUBA 3PX3A 2VZ9A 5EMJA 2V7EA 3BGVA 2ZZNA 2PWYA 2YVLA 4R6WA 3DR5A 3SXJA 5K05A 3D2LA 3JWJA 2JH8A 5LQRA 1XTPA 4AZVA 3LKZA 1P39A 4Y30A 4DQ0A 4PYJA 1XCLA 1R74A 2AVNA 2YQZA 3I9FA 3Q7EA 1NT2A 4OQDA 2ZW9A 5CVUA 3NVKI 2BZGA 2O57A 3EVEA 4YMHA 1SQFA 4DA4A 5T64A 4PNEA 2PWPA 1JG1A 1NW3A 3EVZA 3P9CA 2PXXA 3GIWA 3MHTA 1AQJA 1INLA 4FSXA 2AOWA 4YUYA 5LQKA 3R9XB 2AN3A 1MJFA 1FBNA 2JJQA 3KPVA 2FHPA 1QYRA 4GOOD 5FA5A 4RYLA 3KQPA 3MAGA 3LECA 1WXXA 1L3CA 2QE6A 2PJDA 4PYKA 2GA9A 3UA3A 3GDHA 5DXAA 2DULA 4E2XA 4MHTA 2P7HA 3LDUA 3HCAA 3KQOA 3LHDA 4RVGA 4ATNA 1R8YA 1QAQA 4KW7A 1ZG3A 4DMGA 3SSOA 3THSA 2ONYA 3ELYA 3P9NA 2OXTA 4FR0A 3ORHA 4HG2A 4RTLA 1RJGA 1L1EA 4R8RA 2E5WA 3HM2A 3EVBA 4X41A 1BOOA 3FYCA 5CM2Z 3SVZA 2P8JA 3IV6A 5KQSA 3GCZA 2HTEA 1VP9A 2BM8A 3HVHA 5CD1A 2IPXA 2P3LA 3A4TA 3FUUA 1FPQA 3P97A 4CTJA 1I9GA 2HWKA 3O31A 1FP1D 5GIOE 1JSZA 3LCUA 2HMYB 4PYOA 3G2QA 4HGZA 2PV0A 4KVZA 5EMMA 3TFWA 4F85A 1KPHA 3P2KA 5DTMA 3T7TA 3HTXA 5E1OA 4RTPA 1YZ3A 1NW8A 2H11A 3CJQA 4CKBA 1RI3A 2KW5A 3FTCA 2CKDA 4X60A 5LQNA 1YZHA 5CVJA 4KDRA 3SMQA 2C7QA 2NXNA 5DXJA 3DXXA 2ZIFA 2ONZA 3ANXA 3BUSA 3UWPA 3EMDA 3ER8A 2CMHA 2Y1XA 4WVLA 3KQMA 3G2OA 4XUEA 2Z6AA 2H1RA 3KU1A 4RTNA 2JHAA 4AZTA 1KR5A 2QRVA 4OA8A 1BHJA 4POOA 3HVIA 1R8XA 3M6UA 3P8ZA 1D2CA 5U4XA 5GM2A 3TM5A 4E2WA 3PTAA 2HV9A 3NWBA 2PX4A 2PX8A 1T43A 3FPFA 4HC4A 10MHA 2I7CA 1Y8CA 1NE2A 2ORED 3C6KA 5K0LA 3C6MA 2ZCJA 2ZBQA 4GOND 3O4FA 4PIPA 1EJ0A 1BKYA 4PYIA 1JR4A 1WZNA 5EZSA 3AY0A 3KPUA 5F2NA 1YFLA 5HIMA 3LGAA 5E9WA 4EKIA 8MHTA 3EEYA 2B3TA 3FUWA 4FT4A 3UJ7A 4XUCA 5LQCA 1DCTA 1KPGA 3JWIA 1X1DA 3CBGA 5EMLA 5EHIA 3VC2A 2G8NA 3G7UA 5EGSA 4DKJA 1KYZA 1SKMA 5K09A 1ZHFA 2B25A 4HSGA 3TM4A 4ER0A 2ZZMA 1SUSA 2EJUA 2WA2A 3AWIA 3M6XA 3NTVA 3TR6A 1DUSA 2PBFA 3FTDA 2IH5A 3B3GA 3MGGA 2Y1WA 2VP3A 4AZWA 3M70A 3GXOA 2YXDA 4E31A 1XCJA 4C07A 1L3IA 4ER7A 3G2PA 1O9HA 5EVJA 3FUTA 3A27A 3B5IA 3LSTA 1VIDA 5HIJA 5LQJA 3ME5A 5FQNA 3OE4A 5E1MA 1NW7A 2UYOA 1RJDA 4GC9A 4BP3A 4ER5A 3OZSA 5E9JA 3ELUA 1JSXA 1O54A 2ZLBA 4DCMA 3U81A 2PX2A 4FSDA 3TPZA 5T67A 3PT9A 4P58A 3GRZA 5DM4A 5EIFA 2EJTA 4QTTB 1KPIA 4BLWA 3DULA 3SM3A 1L3BA 3LDFA 1WY7A 4PONA 1X1AA 2IP2A 3BWCA 2PLWA 3VSEA 2GPYA 3MERA 3PFGA 5E8JA 5GIPE 1X1CA 4IV8A 5ICCA 3RODA 4P7JA 3SX0A 3LKDA 3TQSA 5IKMA 1WG8A 5DM2A 3BGIA 2I6GA 3EPPA 3V97A 4C03A 1Q0TA 7MHTA 3JWGA 2O05A 2IIPA 2IBSA 4IKPA 5GP1A 1PRYA 1R18A 1XDUA 1XXLA 3A25A 3KQTA 1X1BA 4OA5A 5EKXA 2R6ZA 5FUBA 2EX4A 5HZMA 5DSXA 2YR0A 5K0FA 1SQGA 5LSAA 2YXEA 3HEMA 2BH2A 4E70A 3OZTA 3L8DA 1D2HA 2CWWA 3KQVA 2B78A 2AVDA 4GUAA 2AOUB 5MHTA 5KYGA 3GRVA 5ERGB 1DL5A 3GU3A 5DLYA 3G8BA 3RIEA 3SSNA 1QAOA 5HILA 2YX1A 5B1SA 1EAMA 3HNRA 1BC5A 3QV2A 3B3FA 5FQOA 1NBHA 4RX1A 5HIIA 2JHCA 2IH2A 1VP3A 1V39A 3EGIA 3P2EA 5FADA 2NNWB 3O7WA 2UYHA 1VL5A 5EZQA 3NMUF 1I1NA 3K6RA 4GC5A 2FRXA 1P91A 3DP7A 5E9QA 3G8AA 3CJTA 4X63A 5ICFA 3KR9A 2OZVA 3B7PA 1RJFA 3IHTA 1ZQ9A 5EG5A 3DOUA 3HCEA 2N47A 1TW3A 2PSSA 1JG3A 3DTNA 3MTEA 4PYLA 4A6EA 4LECA 3KQYA 2XBMA 4OBWA 4MIKA 1UIRA 1IM8A 3NDJA 2AOTB 4K6MA 2JH9A 4KDCA 4QDKA 4BLUA 4OBXA 3FZGA 3MCZA 1VPTA 2B2CA 2GB4A 3NDIA 4H0NA 3UJ6A 4QDJA 2VS1A 3PVCA 4CXMA 1L9KA 1Q0SA 3Q87B 3EVDA 5IH3A 2B9EA 2ADMA 3FTFA 5CIYA 4LWOA 5EHGA 3FRIA 4U7TB 3P71T 2FPOA 3BGDA 3GRYA 5KS2A 1KYWA 3OU2A 5DRYA 5LQUA 3THRA 2ERCA 3G89A 3T7SA 1WS6A 1SUIA 3EMBA 5E8RA 3BKXA 2AN5A 1NW5A 2OB1A 1XVAA 4RWZA 4E33A 3C3YA 1QZZA 3ELWA 3JWHA 4KRGA 1AF7A 2PGXA 3M33A 3KPWA 3RW9A 3S68A 5BP7A 3EVAA 2OY0A 2LD4A 3CVOA 3DMFA 3HCCA 3R6TA 3PS9A 4PCAA 5T6BA 1I4WA 2NXEA 3C0KA 3OU6A 1ZGAA 4R6XA 4AZSA 1ORIA 2P1DA 5H02A 5DM0A 3NW9A 3UJBA 2FK8A 3M4XA 2K4MA 4G56A 4HGYA 2ZWAA 3LBFA 4BP1A 3HCBA 4MWZA 1PJZA 1O9GA 1R00A 2IH4A 5FHRA 4PGGA 5DWQA 2DPMA 4YUXA 3FYDA 1NBIA 1AQIA 3EEOA 5HEKA 1UWVA 2P3OA 3HCFA 5CVEA 3GNLA 5DM1A 4X61A 2R3SA 1VQ1A 2PT6A 4RTQA 2G70A 2QRVB 2OB2A 3AXSA 4MTLA 5DPMA 3H2BA 5EEHA 5FCDA 3KKZA 3AXTA 3LL7A 3OE5A 3MQ2A 4E32A 2AN4A 2AOXA 1P1CA 1UFKA 3TKAA 2I9KA 5ICGA 1N2XA 4HRAA 2G71A 4C04A 4WXHA 5E1BA 5K0BA 4HTFB 3GRRA 5EC8A 4EMSA 2JHPA 5EEGA 4C4AA 3EGVA 4PIMA 4RSRA 1OR8A 2G1PA 2NP6A 2NYUA 4QVKA 3OFJA 3EVFA 4PWYA 5GOZA 4F84A 1VBFA 1N7IA 1ORHA 1RJEA 2PXAA 1F3LA 2A14A 1NKVA 1X19A 4AX8A 1MHTA 3E7PA 3V8VA 4GOMD 3KQWA 3B3JA 1YFJA 4FS8A 1G8AA 1JG2A 4CKCA 5LQAA 5CCXA 3X0DA 2Z6QA 4EKGA 2UYCA 4PYNA 1ZKDA 3BKWA 1YF3A 2IBTA 4QPNA 3HA3A 3ID6C 5K0GA 5KVAA 2F8LA 2PKWA 5DTQA 4GQBA 4IWNA 4U7PB 3FRHA 5DX0A 5F2OA 5K03A 3UJAA 5CCBA 4KIFA 3TOSA 4E2ZA 3E05A 3M6WA 1QAMA 1JQEA 2P40A 3BXOA 4RVFA 5FHQA 1AV6A 3FPJA 4EQZA 1YB2A 2PT9A 3F4KA 3P9KA 3UJ9A 2ZBPA 3IEIA 5DRTA 2C7RA 2OBFA 4BLVA 2Z6UA 3UA4A 3LCVB 3SSMA 2V74B 3GO4A 3MTIA 4ZTBA 2C7OA 5DSTA 3E23A 1D2GA 1JTEA 3P2IA 3QOWA 5CVVA 4YMGA 4L7VA 3KPJA 4YUWA 3CJRA
chains in the Genus database with same CATH superfamily
4B3TB 4ZHQF 1TZKA 4JB2A 2AFHB 4N5IX 1Z0AA 2YNMC 2O5VA 3T0IA 1A82A 4IDGA 3ZCXA 3E70C 4OQEA 2GWHA 4F46A 2XDQA 5CW2A 1IXYA 2ZRDA 4XM2A 2BWJA 4V0ME 4NH4A 1EM8B 1B4DA 2GK7A 1QK4A 4X20B 5CFQA 1J8MF 1X77A 1KGDA 2VDVE 3E9YA 4JB3A 3R0ZA 3OZRA 2LPMA 3U2QA 2C00A 3BXPA 3K9BA 1D1TA 3CNOA 3DEJA 4GPTA 3ZHQA 1OA0A 4MQMA 4RVHA 5GGXA 4WY5A 3RFUA 2ZXUA 3OOSA 1DCMA 1M2NA 1V5EA 2PO7A 3LXUX 2RONA 3DMDA 1DX9A 4DZRA 4NMLA 1A9TA 2R751 5LXTB 3TVYA 4Q0MA 3L6CA 4B17A 3M89A 4C87A 1UQUA 2P2YA 3K6JA 4DA4A 3K2BA 4DREA 3ZJTA 4KBFA 4OP1A 1J42A 7GPBA 4QYMA 3RHTA 1T4BA 2OVFA 4U2DA 4WZBB 2GD6A 2FUCA 3FNRA 4FQ8A 4IH4A 3HU2A 3FA2A 4LUCA 5DF1A 2JIZD 3HSYA 3VO1A 1DJNA 2SICE 1XZIA 3CU5A 4G0VA 4LHWA 1KKLA 3EWAA 3HYSA 3A7DA 4MVXA 2WWFA 2CZQA 3GAMA 5KCZA 1DJLA 1M6VA 2ZBDA 3U60B 4QQFA 3UZUA 2VFAA 3RASA 1EJ6A 4RS3A 1QGUA 2C84A 2WPDA 4D3SA 4I66A 2DFLA 1U9YA 2WYIA 5ESXA 3W5BA 3WTCA 4Q15A 1USUA 2Z0MA 4Y98A 3EEQA 3MA0A 1V7ZA 3LGSA 1ISJA 1U0HC 4MVJF 2PRKA 1TTPB 1E1NA 3L04A 5FYQA 5JNRA 2QGZA 4JXJA 3CISA 3N5KA 2SECE 2WKWA 1CY2A 5JSHA 3FUXA 3P9ZA 1DT3A 1SWVA 1K0UA 3W5DA 3NRCA 5UKDA 4C06A 4F6RA 1U2ZA 2WQZA 4YMVA 2RHOA 1FNNA 1NUUA 1CNMA 1V95A 1ZPDA 3E58A 4H1TA 4NIMA 1XTKA 4IWXA 3IX7A 4R1UA 1JDPA 3R6WA 4OHFA 2C9BA 3TD9A 2QJWA 4TN1A 1QU3A 4S0ZA 2DQKA 3OH8A 1QFSA 1P0CA 5TPWB 2CLEB 2Q3FA 4U7DA 1WX1A 5KVVA 2PL1A 4RTSA 2BBWA 1HEIA 2AN9A 4N3BA 1VMIA 4A0FA 1BXKA 1AZTA 3FJYA 5K4AA 2I34A 3BMQA 1OYVA 1RDFA 3JATA 2FCAA 1OT3A 1N2EA 1F7VA 1VECA 2B20A 1ZJJA 3JVDA 4O4LF 1AXGA 1UEIA 2P2LA 4AJKA 3OT4A 3PNOA 3WHLA 3KJQA 2VJYA 3H1GA 4QUHA 3EIHA 3BGOS 1UINA 2OPBA 3LCMA 4IDNA 5EP1A 1U80A 3V1UA 3GLHA 2IE8A 2O06A 5BN5A 4ND5A 3WWZA 1WKCA 1VJ1A 1KHTA 2EL9A 4LVUA 1UZAA 2WIFA 1W59A 3E9DA 5E1DA 5JO0A 2P0AA 5AJYA 5FWDA 3ETNA 3LY8A 4CM6A 5IPFA 4GWLA 1LPSA 4FLEA 3JQ6A 2W58A 1T1RA 3REGA 3SP1A 1AA9A 3SY8A 4CMHA 1CZRA 1QO0A 2OFPA 1GTMA 1KXJA 2FXVA 1YS6A 1ZUNB 2EEZA 2AJCA 2QUKA 4GM4A 4LDPA 4D9GA 2OHIA 1NI3A 3TTXA 1E0DA 4ZOLA 1TU3A 3IQXA 3QA9A 5IBCA 1WA5A 1USWA 1Q14A 1SUFA 4HLQB 3ZR4B 2PFKA 1KQFA 1DIHA 5CVCA 4B8WA 1K2VN 1J0AA 3MINB 1ISFA 5JH7F 2EOAA 3EASA 3F6RA 5JPCA 3WRVA 5JE8A 2PVSA 3IC5A 3OEHD 1RYMA 2AKAB 2DX7A 3O0DA 4HNAB 3G0HA 2VQSA 3ESRA 4G5QA 2PL9A 4U6QA 5JCJD 2ZUFA 5K2MA 4P0QB 1N1DA 1UDBA 2QR5A 4UCFA 1TJYA 3G79A 4G4GA 5KSZA 3KLBA 5I4BA 5IN4A 2ARKA 5D3KA 2P41A 3IIKA 4L27A 3JQ9A 1WSBA 2R7KA 5B1EA 2LCQA 2HR1A 1UJ2A 2NVOA 5ARBA 2VEDA 5CB4A 1NV8A 1YVDA 1ZA2A 1MH9A 4BX0A 4WZAA 2OQVA 2H65A 2FPPA 1QTNA 2BR5A 1F0NA 2GXQA 2D0IA 2OCBA 3AY6A 3PNLA 3UWDA 2RHGB 1G8PA 2D59A 3D8HA 2H7VA 4D5EA 2XYVA 2QD3A 3PX3A 1VIVA 2BGRA 2O0JA 2VIIA 3BEOA 3QPUA 4OMCA 4ANFA 4BAGA 1DADA 1PT6A 3IDSA 1T6ZA 2DPLA 2XQFA 4ALLA 3PFIA 5D2CA 3LKZA 1P39A 3H4IA 3PUZA 4OSEA 4Y30A 4RF5A 1OF1A 2EKLA 3RYIB 3WSWA 2QK4A 5B57C 1GYQA 1TA4A 2C2MA 3NIWA 4ERXA 4P36A 3R7BA 3SZRA 4ZI5A 2WF7A 1MJGM 4BX8A 5KVQA 4KTTE 4B3SB 3M4NA 3N3BC 3P45A 3C7AA 5ER6A 3GIWA 3AESA 3N76A 3H84A 2YIDA 4MVJD 3RANA 3LK7A 2IL1A 4FSXA 3V7UA 2AOWA 1UC4B 4YUYA 4K9NA 3OTOB 1OH8A 1MJFA 3R9XB 4L3OA 1JA1A 1JT2A 1X7XA 1UP6A 1HDEA 2R6JA 2WVAA 1UOQA 3A9TA 4Y2VA 2CYCA 4RYLA 1IDOA 2WWYA 1P8JA 3P5SA 3FFAA 4Q7JB 1QP8A 9LDTA 5CA1F 3TWOA 2D0OB 3H5WA 5DXAA 3V46A 1VPDA 1IJBA 1ZS9A 1DBPA 3ZU4A 2FQQA 1KYQA 5I47A 1QH8B 4WACA 5KYNA 1NHGA 2WD7B 1S7GA 2C1EA 5ISMA 2A5YB 4IJ5A 1XELA 1N0VC 3ECSA 3QEAZ 1AMOA 4TLDA 1XTRA 2QM7A 5BSVA 2YJZA 3AJ9A 3D8RA 4RTLA 1E9FA 1BO6A 1GPAA 1E1CB 3EVBA 5IJZA 3DFFA 2R1TA 4HAXA 3SDBA 1OKKA 1XLVA 4JUIA 4NF2A 5ALTA 1HDGO 1JDBC 2NIPA 4YEDA 1MX5A 4BJHB 5C4MA 3AHEA 3CH6A 3BRQA 5C1BA 1N34B 1QQTA 1N0UA 3VR3D 2JK0A 5K8JB 3HJUA 1R5JA 2K5UA 5BQXA 4B83A 4JI4B 5C7YA 2HMYB 3D7NA 3RC9A 4QQRA 4RDCA 1SN7A 3OLVA 3O8DA 4MV3A 3HR8A 3DNFA 4JP3A 1HDRA 1RRVA 3DPSA 4J4TA 5LZ2A 2OCIA 3SJBA 2R0QC 4OU5A 5FWNA 4J8PA 3L8CA 3BORA 1FXWF 4NBVA 3FHTA 2DFPA 3EMDA 3H1BA 2Y1XA 4OIFA 4TS3A 1YB4A 4Y2YA 4KODA 3OWXA 5HS4A 5LZ8A 1VJGA 4YP6A 3TTSA 3VAAA 1KR5A 1H23A 2H4XA 3WYBA 3NI2A 4EWLA 3HVIA 2QZJA 3KOWA 5I9BA 1CVIA 5L6LB 5DU2A 1E5TA 1Z3IX 2BKUA 2IYQA 3PNPA 3MAJA 3QLVA 2G07A 2GPSA 4HC4A 1IVYA 2AL7A 3TN7A 2VH2A 3CUEF 2H8GA 4FINA 1M0WA 2KI5A 3MMXA 4CU5A 1EWRA 3WYNA 1F14A 2EYQA 5LNK6 3IE1A 1F2UB 1YB1A 4XM1A 2V55B 3H1TA 3AY0A 1E9VA 4EKIA 5LYJF 4LEIA 4E15A 3L9XA 4XUCA 2DECA 1OCEA 2G8NA 1TT5B 2PX3A 2QX7A 1T1SA 2D2IA 3DEFA 3E9QA 1I7SB 2OWDA 4INZA 4XTCS 2UVDA 3MMNA 3I8SA 1DQZA 3AWIA 2OQIA 1WW2A 1DLJA 2VRBA 2UUPA 3CO0S 1LB1B 1IBCA 4EMTA 3B3GA 3MGGA 2Y1WA 2Y66A 2OYSA 2ADOA 2O2SA 2YW2A 2BW0A 4ND2A 5KMGA 3VHLB 3HABA 2A8YA 1Z4JA 4PPYA 3KKKA 1X2EA 2IOQA 2QM0A 2FEWB 4H15A 1VL6A 4KR9A 2G1KA 2HQ1A 3DW3X 3E3AA 3OCYA 4FFDA 4JITA 4IIJB 4KXFB 1NT4A 3QFRA 2X8WA 3ZIUA 1BJTA 1RJDA 3C16C 4GC9A 4JMPA 2ICAA 3OZSA 1VI6A 2PT7A 5CFZA 3FB1A 3KBOA 4KHZA 5CXUA 5F21A 3QX3A 1E2MA 3FPSA 3EC7A 4HI0E 2E7ZA 3FVWA 1Y3IA 4UTNA 3S2SA 1WCIA 5CA1B 1NC3A 1OAOA 2R68A 2R84A 2B99A 2WBLC 3HB9A 1I2ZA 2OC4A 4H6XA 3ZWDA 4QXMA 3IP8A 4YXFA 4J03A 1UDAA 2QI9F 1J24A 1FTQA 1DKLA 2DZDA 4HYTA 1W2HA 4X8LA 3I5XA 5TVKA 1EX6A 1WG8A 2QTVB 3ABQB 4BMDA 2FW6A 3V4LA 3NHSA 5HHTA 1RE0A 2IPLA 4NCHA 2O05A 3MWYW 1EP1B 1S3IA 1SXIA 3BSYA 4Q4LA 2ZI5A 4DPMA 5ALPA 2ZSDA 3KQTA 4NOMA 2BMDA 4DDKA 5EKXA 2GLXA 1WB6A 3K30A 1BVUA 1ORDA 3HEMA 1SOMA 5J9FA 4OHZA 4EUHA 3S1SA 3L8DA 2BV3A 1UZLA 2R6FA 5BSEA 2AGVA 4GUAA 3Q7PA 3K0CC 3ZXSA 1RIIA 2XI4A 3EGXB 1UWLA 3LVFO 1S3GA 2NYRA 2Q6IA 5YASA 5DLYA 1YZQA 1TM3E 3DO5A 5AW1A 5AVQA 4WL0A 3L84A 4HJRA 2HDOA 1WO8A 1ZYUA 2OSVA 5HIIA 4X8MA 4GBMA 2NO4A 3OA2A 1IBLB 1N6PA 1HRKA 5FADA 4HGNA 4KPGA 1EJBA 4ZT7A 3UB3A 2QDKA 1X14A 3EIQA 3O73A 4AFNA 4EHDA 2Y6VA 2IS1A 2O3RA 8OHMA 1OXUA 1EVZA 1I3OA 2C07A 2C3PA 3QE4A 4R2LA 5A9SA 3A2MA 3B6JA 4PYLA 2VJCA 1NUQA 2QRZA 4MKFA 1I6WA 5IVPA 4JYZA 2C5EA 3U6BA 1TD9A 3E61A 4KR0A 3D1VA 4QX6A 4ND7A 4QDKA 4AQDA 2H8KA 3DOOA 3MTJA 5DBFA 1VI5A 3OESA 4L4XA 4DDUA 1LNZA 2ZRKA 3RSCA 3VH3A 5L40A 3TQTA 1GGMA 1XZFA 4AKEA 3KJNA 1Y1KE 2J5XA 2OL4A 1TKBA 3EFOA 2V7UA 3GXBA 4MS3A 1OYYA 1B2RA 1M5UA 1VG1A 3RUCA 4A8PA 2DKOA 4DLAA 2P11A 1G21A 1MB9A 3OM1A 1VKJA 4JYPA 4TV8F 3AUKA 1FIUA 2WVHA 4BLQA 3THRA 4YRMA 4MV6A 3RLIA 1E6WA 2NZJA 5K8IA 4A0HA 3PFKA 4KRGA 2B2XA 3DWGA 3CRW1 1V48A 1X9GA 4ZV9A 1MPXA 3GPCA 4ZYUA 3CT4A 5EJMA 2X86A 4INOA 1ZNWA 1KFCB 4ZGWA 3RTEA 3JZAA 4LY6A 3CMCO 3GLGE 1H6BA 2DFVA 2D1QA 3C4VA 2BLNA 4O25A 3TX6A 1OU0A 4PANA 4PCUA 4W5OA 4JI0B 1ONSA 1ECJA 2VT7A 4W7IA 4J43A 3RU9A 4BP1A 4W63A 4OM8A 1R88A 1R16A 3MRVA 4XDYA 5CIWA 2IH4A 2YZGA 1YOBA 3E22A 1V1JA 2XEXA 5JZBA 4Q1DA 1UWVA 1NI4B 4CVNA 4C01A 2XIJA 3NGLA 1JG6A 3NHBA 5J5AA 1QMGA 1U2GC 3AEYA 1TAHA 5GONF 4LDZA 5REQA 4LX8A 3SC2B 4G24A 4HLUC 3A1UA 4UJ5A 1TNDA 1EK5A 5FPYA 1JPJA 5L3SA 2XCOA 3C7DB 4KE9A 4QT0A 1TE2A 1YOVB 3AY7A 1YONA 4PSCA 3UMCA 3W2HA 5LZ9A 1K6IA 2YJ5A 3JAMA 1W87A 4P8RA 4WXHA 2LIPA 1QUFA 4NV0A 1BS2A 2ASEA 3TOZA 5K0TA 4B6OA 1Q11A 4LTDA 4PPQA 1T9AA 3DNPA 4TM8A 1P44A 4C1BA 4BO1A 4H1WA 2MIIA 2OBBA 3LI2A 2BEUA 3EVFA 4RIEA 1WB5A 2PBLA 3B85A 4HDCA 2WE8A 3TQOA 1RJEA 1VHJA 2PZJA 4I14A 3SZOA 3VU0A 4AX8A 3V8VA 5KU1A 1J39A 4KDEA 1BGVA 5DP2A 3O92A 3SNKA 1L7BA 3D4PA 3PJFA 1M74A 4D79A 4DLKA 4J1TC 5AI0A 2ZUEA 4EHHA 1ZGZA 3K8YA 1QH0A 5B55A 1Y4AE 2C9YA 1IN7A 2PGAA 3A06A 4D43A 2PUDA 3RUIA 1D5CA 3VH2A 2PS0A 1MOPA 2BF7A 4RYDA 5C32A 4AZ0B 1U98A 1I1QB 2RAVA 3TQRA 3IQHX 3TIXB 4QOJA 5F78A 1G1MA 1YZYA 1A27A 1J99A 3E05A 3S2IA 4O33A 2C0PA 4FIDA 3WNBA 3AL0C 2PKEA 3UJ9A 3CPJB 4INJA 4NBTA 4KAXA 3H5IA 4FS3A 1QCYA 3FNBA 4HYQA 4JZKA 2CXHA 3GLTA 3LQQA 2XQGA 2F9LA 3E23A 3KLMX 1AK2A 4NCIA 1CF2O 3D02A 3P0HA 5CVVA 2OCDA 3PITA 4ZREA 2AQKA 4KPUA 1V8FA 4OB7A 3U3MA 3CJRA 4ND6A 3L49A 2AZTA 1NN0A 1FS6A 2BFAA 2ZDGA 3FZEA 2BONA 3HLKA 3KWLA 3C3AA 1U7UA 1NW6A 3L4BA 3DV0A 4HUQA 3ODGA 3CW9A 3R4CA 1G64A 4E6EA 1QHHA 3U7JA 1QQ7A 2LZ0A 4HN4B 5B6PA 3FPHA 2V6IA 4R1NA 4PGMA 1T26A 3WLAA 2P9QA 2RFLA 4NG4A 3DMRA 1RMQA 3L0PA 3LBIA 1Z6XA 1Q21A 3FPCA 4Y2HA 7MDHA 3S5UA 1BE8A 1LTHR 3QU2A 1ZAKA 3Q0TA 1EXNA 4J0CA 2JLUA 1A1SA 3AGPA 4MQBA 3VR0A 2ODTX 2ODBA 2XAAA 3CLTD 2VHXA 5KNCD 1A9RA 5CAEA 3BMOB 3LCCA 3DBRB 3DHNA 4WOPA 5DISB 5JAIA 4LRTB 2PUAA 4V0QA 4LV5B 2V7WA 4K0RA 1TA0A 2MOKA 3P2JA 4GDFA 2KHZA 1P2GA 5HIKA 3TBKA 4J90A 1JJVA 1GZUA 2QM3A 1NR5A 1OMOA 2Q5OA 4MGYR 3SS7X 4X97A 4ZOQI 1CJMA 3VZSA 4FCWA 2I80A 4M0KA 1UT5A 4WJZA 3LTEA 1NZJA 4WTOA 1GGNA 2AMJA 2OHVA 4S2UA 1VFNA 2HXSA 5HJ5A 5K0CA 3ORQA 1CLEA 3VAZA 1P1BA 4JBHA 4NBWA 5C8YA 1ISRA 3M2TA 2DBZA 2IYAA 4HN2A 4YRSA 4C6TB 4C78A 3QOYA 3VYRB 1JAZA 5JSKA 5ELMA 5L3VA 2O3SA 1HNXB 5EE9A 5FI5A 2PCLA 4L8YA 4EEKA 3DDNA 1Y82A 4M9ZA 4K5QA 2C7PA 3FETA 1Q77A 1E8NA 4IKOA 4F9FA 4FNGA 1ICIA 1LFDB 3E9CA 3P9IA 2NV0A 1N8SA 2G9UA 4H7EA 1E79D 3UW3A 4D82A 3KRTA 1MENA 3PC2A 3LFTA 1U2SA 3EXEB 4W5NA 1RAHA 1HE3A 2IUTA 3COWA 5C9ZA 1TKCA 2Y27A 3K4QA 3W4JA 5CTAA 1I0ZA 1C8KA 3VUEA 4JI2B 4HT3B 4UFOA 5JO9A 3ES9A 1QQ6A 3OLCX 2AFVA 2INGX 3V8QA 3O4GA 1SZCA 3MNFA 3WL4A 1DTWB 4RTJA 1VKRA 2A0YA 4LZZA 3PUHA 1VLHA 3SNHA 4A2WA 1I01A 5A2GA 3TGLA 2WNHA 1T9GR 2G67A 2H51A 3Q8WA 1BQ4A 2IZ1A 3LDGA 5IMBA 2P2DA 1SG9A 3V2GA 1HT2E 2J0UB 1XZQA 3LC1O 2PMBA 2WYOA 2ZJ7A 4D6XA 2QL7A 5D87A 1NG9A 1PVVA 2ZS7A 4PQFA 1Y6JA 4LRYA 1DEOA 2YWCA 4D57A 3S40A 3GP8A 1ZGGA 3WAJA 5CCDA 3RBZA 2VNHA 5KVCA 1HE2A 2AFIB 2J5BA 3PCXA 1OXTA 2XOEA 5C80A 3RBVA 3WYGA 5ALHA 2QAJA 3FOCA 1IEQA 1IBKB 3T35A 1NVDA 5AI4A 1Q17A 1FLDA 1T0PA 2N0SA 1C7IA 2Q29A 3CH7A 3OPNA 5FV7A 4BYMA 1N7JA 4DCOA 2OQRA 3TNDA 1FJGB 1PIWA 3LP6A 4E30A 5DIFA 3PGLA 3QOXA 1B6GA 4EL5A 4RKWA 4WN9B 5HRCA 1PL8A 5IN5A 1FFHA 3TW6A 1DQRA 4TV9F 4YDRA 2P2GA 4RZ2A 3C39A 2XUDA 5HXAA 4YO8A 4C2AA 4WW0A 3EYWA 3KQQA 4DM4A 5ITZB 2VDMB 3AJAA 3IEVA 2OGTA 1TVEA 3FSRA 1UM8A 5JRDS 4EZIA 1LDBA 1G18A 3AERA 3AM3A 2KWIA 3BXHA 1R3DA 2BGKA 3NATA 1EFUA 4HEA6 1JR3A 1QRAA 1YJ5A 2XRMA 1L5VA 2D5CA 4C21A 4GOKA 4DVGA 4C76A 1W5SA 1EI9A 2X1MA 3KZ1E 3I72A 4E22A 3AYXB 2IEGA 5K8LA 3LJKA 4Q9AA 2IXAA 2J85A 4J2TA 5EQTA 4K9DA 2HW8A 1NSYA 1EQUA 1VA4A 2ZULA 3SX2A 2YHUA 5T4BA 1N92A 3O8QA 1E66A 4R8KA 4DDTA 1KH1A 2HHJA 1A4XA 2WUFA 4WV3A 1MRSA 1S9HA 1G8SA 1DQSA 2XVZA 3NH9A 3ESQA 5EKUA 4MQLA 3WDLA 1W1WA 1UM9B 4AMBA 3EISA 4NECA 5JAHA 2QSYA 1OAAA 4IOMA 1OGYA 1JGTA 1A2BA 1ZRMA 2B7LA 2W71A 2YDYA 3A7EA 3GN1A 2E18A 1JG4A 1R2QA 3PIIA 2C4NA 4ZQCB 3HWWA 5FOWA 1CZNA 3NEPX 2C2GA 1TVKA 1YE8A 3AEKA 4DLWA 1TM5E 4DSOA 5IJ0A 4M8NE 5JS6A 3WFJA 3ZJUA 2B7CA 5F7XA 2ERXA 2Z8YM 1PNOA 3QF4A 2IW3A 3NDBB 1CY8A 3CT6A 3LRTA 3QUBA 1FUIA 4G5YA 2YQZA 2P6OA 1Z4NA 3T06B 4Z1MD 2OCKA 2C5GA 4BVJA 3QI2A 5P21A 1ZSYA 1KVUA 2O57A 2QMOA 3G82C 1GEEA 3OI7A 1SQFA 1Q20A 2V7PA 3UW1A 1L5ZA 4ARAA 5BMVA 4H35A 3COVA 2ZBGA 1ZM3A 1NBOA 4YQEA 3TGPA 4B34A 1JNXX 1G3RA 4EITA 1HQKA 2IYPA 2A0KA 3O38A 3ODPA 1NR7A 4RNDB 4HDMA 1JLRA 1KAQA 2J9YB 2WE7A 4O59O 3OOWA 4TTTS 5AUPB 4FJ0A 1VDMA 3BJIC 5JMTA 1JHOA 2NZVG 4W5RA 1NVBA 2DFNA 4ZYWA 4YP5A 3DLBA 1PD0A 5ADUS 1ZD1A 2Y77A 1OFTA 2WNIA 1U3GA 3DZKA 1DRKA 1HI9A 1QIDA 4MI9A 4ZTUB 1V9SA 4E03A 1ABEA 4HQLA 1IG3A 1T1GA 1ZG3A 2X42A 3THSA 2ODPA 3NAGA 5AXAA 4IDDA 4FN5A 3U4HA 1V3VA 3I62A 4RADA 4BGUA 4E1VA 1RJGA 3B82A 3DC2A 5DNEA 4UD6A 1WZIA 3CRQA 1RZRA 3AETA 4I8IA 2E4YA 2QV0A 5TMDA 3U31A 1SRRA 2G4LA 1RHQA 1E9DA 1S96A 2HBRA 2CDBA 2ORWA 2QPAA 4MQEB 1SBNE 1O57A 2GNOA 2IPXA 3B9PA 4R2WA 5DLEA 4C89A 1EFAA 2R8BA 3JRXA 4LXIA 2ZJBA 4UUAA 3M5DA 3ZE9A 4K9QA 1PZMA 3TRIA 1PVDA 3SJCA 3KVRA 1I6MA 3O75A 2ENWA 3Q8LA 4IDCA 4KX3A 1DZ3A 4PYOA 2NPFA 4KVZA 5FOXA 3HK2A 1GR1A 1A5BB 1V7QA 2ISSD 4TLBA 5DTMA 1KAEA 1L5HB 1E1YA 2AH5A 3RRFA 3SYLA 1CETA 4EG4A 3T1QA 1VZ3A 4FWIB 2CKDA 2OKGA 3P9XA 1P4JA 4M60A 4GLOA 3NHRA 3SXUB 1RXVA 1U0TA 3OTIA 3GVHA 2F7SA 3LY7A 4JENA 3S0JA 5EJ8A 2FPGA 1RM0A 1Y5IA 3UWPA 2NUPB 2VPYA 2I1VB 2F64A 3BGWA 5A06A 2DR2A 1YS1X 4XVUA 2V7BA 3DG9A 5IKEA 4LRSB 5LD2C 5FF9A 1SHKA 2YVQA 3G1TA 4UBNA 4WCVA 2YASA 4MVJM 2OAP1 1Z5PA 3E8MA 2JEYA 4M86A 2HV9A 4DRXA 3NWBA 3IHWA 3IPLA 1V41E 3E5RA 2CXNA 3NHKA 3QUCA 4UBLA 4BGIA 2FSHA 2I7CA 2C98A 3OLXA 3SKYA 3STUA 2HD4A 3HRKA 3FKSA 2ZBVA 3FSEA 1WULS 4N18A 4OV6B 2NQTA 4IO0A 4PS0A 3C41J 3W1EA 3W2FA 3OPYI 4ZZ1A 3JTMA 1IHXA 3DD5A 1CJUC 2QPLA 1DC8A 4Y9SA 1Z4LA 4UEWA 2QROA 1UKAA 3L6OO 3ZE7A 1KE2A 3ZCTA 2QNBA 4OMFG 4CW7A 4DIDA 3EE6A 3CBGA 4IJKA 3C6ZA 3ILVA 4DA7A 3CLKA 4DKJA 2QXTA 2ATEA 1FOEB 2GAAA 3IUEA 5E7MA 3IEUA 2VDLB 2HREA 1ODSA 4II3A 4UNRA 1W4LA 1PT7A 3NBKA 3PR3A 4TSFA 3O82A 3IODA 4LHSA 4B5KA 4E88A 4AZWA 2AX4A 3PEEA 1YKSA 4TLLB 2QL5A 4HH0A 1A3CA 1E4VA 1U0EA 2DTXA 5FNVF 2QVLA 5CT4A 5BW6B 4OQMA 4CGYA 4EG8A 5K8UA 1O9HA 3DZ8A 4NZOA 5KHAA 2XZTA 3COJA 1VLZA 1L5LA 2E4ZA 2IZ5A 3C85A 3P9PA 3WRWA 4D1YA 4FW8A 4R41A 5EJ5A 2NWQA 2VATA 2ZJ8A 3RAFC 3F71A 1U2GA 3NC4A 2QTCA 3ZDYB 4ENTA 2WT9A 4DCMA 3RYCA 2IUYA 4MV1A 4I3FA 1Q0PA 1ZD2P 4P58A 4Q1CA 1P4HA 4D9NA 2FVXA 1S02A 2IXTA 3IR7A 1I5EA 1CUFA 4L4RA 3V7WA 4DLYA 3RYTC 2CWDA 4LDRA 2VJPA 5EWJA 4RKFA 4Y9UA 3KJFA 5JEEA 3PE6A 2FJPA 3BWCA 4WBNA 1JA0A 4OFXA 2GPYA 3HGMA 2BTQA 5I9MA 3EZXA 3WNVA 4LOHA 1D1SA 1HWYA 5HSGA 4FYKA 1KU6A 4UD2A 5KO2A 1Q1AA 3SX0A 4ED9A 5F9FA 2HM7A 1U0SY 2GZSA 4MS4B 4XM0A 1IK4A 3HEBA 4J9VA 3RIXA 2FDXA 3VO2A 1KEEA 4C7KA 1DU4A 1K0FA 1WTAA 2GGSA 2IIPA 2UYYA 2VJAA 1OLSA 3ASZA 4FYXA 4EGFA 4L75A 2FFRA 1MOSA 2HWWA 3A4YA 1UXJA 4S2EA 2EX4A 2DETA 4TT3D 5EZ5A 1NGSA 1WL8A 1UPXA 2QXUA 2X15A 1KVSA 2EJCA 3C3JA 3I32A 3K9HA 4J1TA 4MEAA 4ENUA 3FAZA 1DPGA 3K9GA 1R4MB 2A67A 3IAS6 4D6PA 2H1OA 1YE5A 3BC1A 4YBZA 2G77B 2CNLA 1CY4A 1V9LA 1W9MA 1SCIA 2QTBA 3GU3A 2FY8A 5B1SA 3AF2A 1A72A 3TIFA 1DAGA 1JPNA 3QEJA 3S81A 3TNLA 3CUSA 1SUCA 1ZWKA 3U0VA 1K7YA 3WOVA 3QVGA 4ALIA 3GLFB 2FMXA 2ZM5A 3U44A 4HDNA 1V39A 3D3WA 1SHTX 3W5VA 4G65A 3V4OA 1ML4A 1PZEA 3OAAA 4GGMX 2P9ZA 4MIYA 4PFQA 3AKDA 4O2LA 2V4UA 5IYZF 2CK3A 3CF4A 1KMMA 1Z36A 5ALOA 5G4KB 3W7BA 2E1PA 1LKZA 1WVIA 3IHTA 3DMPA 4JBYA 4OAPA 4PHFA 4MVWA 2G0TA 5G1PA 4G0PA 4IEIA 4KCGA 2CLFB 4D7AA 1HV8A 3K0FB 3JU3A 1E3JA 1ZJZA 4PAQA 2FX2A 2B5WA 2JH9A 4UVEA 5IT9A 1NLZA 2NADA 1VPTA 3EEBA 3EXFB 3I4FA 4U9IS 4Z0NA 3IQIX 1K88A 3GWGA 3EVDA 2ADMA 4KTVE 1FVFA 1QH1B 3E15A 3N8GA 4U0KA 2F8TA 3P71T 4H7JA 3ZKWB 4EY5A 4R0MA 3JTEA 1QTRA 3WWEA 4IFBA 4MQ6A 2XSZA 4IH1A 3WGTA 3PHJA 4K7JA 2GBPA 3EVAA 1RQGA 4ILEA 2QL6A 4R1MA 4EFKA 1QOPB 2G5PA 2W2QA 5J47A 4BBAA 5AK5A 4NEGA 4S3MA 5EIBC 1OI4A 1HTBA 2FE4A 5B3KA 1PEYA 3FYUA 1E3TA 3PEFA 3EAQA 1XI2A 3HHEA 4XVRA 3VPDA 3K9WA 1HYQA 4UU0A 2H0QA 1JECA 1GAQA 1QR6A 4A1FA 1QYXA 2X9QA 1P18A 2GVZC 3R40A 4HAIA 3ABIA 4BO4A 5MN6A 3QEBZ 4G97A 2Z56A 1YBAA 2AR9A 5TC4A 4KGVA 3GJSA 1JYSA 5AH0A 4YUXA 1G0OA 1ZBDA 2JD2A 3A0UA 1RWBA 1Z12A 3G0CA 4MW4A 3WL3A 4FTWA 4B7AA 1YZUA 3LCJA 5EUQB 1XEXA 2ZJ3A 1Z5UA 1ZN7A 5CJPA 1H2ZA 2XWJI 2X0NA 1ZM2A 4C7BA 4ZMBA 3RV3A 4DC9A 4JT2A 4LOKA 1DX4A 3D2BA 2HLNA 2HXYA 4UCWA 4F3RA 3KQLA 3SJUA 4BV2A 1YRWA 2FNAA 3OE5A 5B7QA 4GPD1 3ZCSA 6GPBA 4Z4IA 2I9KA 1DKOA 2PK3A 2XWQA 3MGAA 3SWWA 1PHRA 1XVUA 1ZOSA 1VXOA 2J87A 1BE1A 4R3NA 2DUMA 2D0DA 5EEGA 2Z9BA 1YI1A 4BVLA 4N8EA 3R7WB 2I1QA 2XGSA 3BEDA 3RK1A 4PQGA 2R66A 4FI3C 2O2GA 2Q9UA 4WA7A 1N7IA 1OV6A 3HBFA 2JGNA 3NNSA 1XRPA 4RHCA 1K7EB 4V03A 4MICA 4B9EA 2V7QA 1XQ1A 3IBCA 4U8HA 1OIWA 4N47A 2PGOA 2P1ZA 2VBFA 3OIUA 3EY4A 5DW3A 2WJHA 4TROA 3JCZA 1C0KA 4JLVA 4EKYA 1ZL0A 3ZLVA 1MJ5A 3B1FA 3RIYA 3EOBI 2P62A 1KF0A 4BNHA 1NWHA 2M1ZA 4OHVA 4ZICA 1IDN1 4QOEA 4WKNA 3P5BA 3UJAA 1Y33E 4RJKA 5KQMA 2VRWA 2QN2A 3OQOA 4KIFA 1X7ZA 2DBRA 4YAFA 4IMJB 1II8B 2OMKA 4DMKA 1IAQA 1N5IA 1PKXA 2P40A 2WIKA 5H0IA 3SR0A 3KAJA 2X7JA 4CKWA 2Q21A 3EC2A 1XYYA 4B73A 3DCNA 1RWPA 3K0AB 4IW3B 2V74B 4EG0A 2VSNA 3HFRA 3GEEA 3ZHXA 1QOQB 3HCRA 3PHLA 3HJCA 2ZCUA 1JHYA 1PR3A 3OZAA 3ZD9A 2NSJA 2IZOA 3QP9A 4IFTA 1J56A 3TUZC 3GUCA 4RV9A 1BWSA 3SI7A 2CF6A 3ESZA 3LQRA 3QEKA 3T7EA 3JASA 4V2IA 4CF7A 2P5SA 1V7CA 2X76A 4RVDA 3RTDA 5AM3A 1ACJA 1VCNA 4IQFA 2BVNA 1VJ0A 3QX7A 3DDUA 3AILA 3LF1A 1G20A 3LL4A 1GPLA 1LW6E 3NDRA 2HT1A 5EJIA 1MZVA 4P80A 4CQLB 1JSLA 3PR1A 2H16A 2C20A 1R9GA 5AYVA 1GDDA 2G3YA 2VYNA 2G25A 3B1XA 3KEOA 1DRJA 2G72A 2VWPA 3IR5A 4KXWA 1B23P 2FW1A 2GDZA 1NONA 1RI5A 3BL8A 3IESA 4UCXA 4BJ5A 1JEEA 4N0EA 1WCXA 4QVGA 2VT6A 2IXFA 2GK4A 2PZFA 1YFKA 4LY0A 1JEOA 4YCBA 3W3AH 1KK2A 2POCA 3AF5A 4RF4A 1MJHA 4JLMA 1G6Q1 1ONNA 1JB1A 1SKAA 1XT6A 3FWPA 5LZ7A 3SBEA 3IOYA 1IMOA 4LXTA 3UWOA 4F8JA 4GM1A 4NESA 4MYUA 3C87A 1TMGE 1GRCA 3WSTA 2FPWA 4KC0A 2UVPA 1BGWA 5B5SA 5NULA 5JRJA 1BXGA 4AUKA 4P81A 5K01A 4Y7DA 4X62B 2VTBA 3UT0A 2ATVA 5HWSA 4YMUA 1K5PA 1NOJA 2BJWA 1NBMA 3DSRA 3Q15C 4I5DA 5IT5A 3VKHA 4HX5A 2YWRA 3WWDA 3BCUA 4KH0A 1M34A 5HA5A 4KSCA 1QNFA 4Y2QA 3ZGZA 2FETA 2VEOA 5KDOA 1N9ZA 1N32B 3PGMA 1Z73A 4HDQB 4QTXA 3IAFA 1B15A 4C05A 4CCSA 5A4MS 3F78A 2JFPA 4QASA 4YP1A 1M8GA 1Z8DA 3G88A 5IKXA 1JVBA 1W35A 1O96B 2JFQA 4PCLA 2Y1KA 4WCFB 4PQRA 3ZC3A 3G17A 1G16A 4RPIA 1D2RA 3IQZA 3FSGD 3OQHA 4GF5A 1E1QA 4UQOA 4UTXA 5THKA 3IEMA 3D0KA 2GA8A 4OX9Y 4JVSB 2ZUVA 1LJUA 1E5VA 3LQ4A 3OJXA 4ZJPA 2UXDB 3OFND 1Z34A 2MSDB 3AJEA 3EXAA 1RP7A 4M9RA 13PKA 2X4IA 3HA5A 1HPLA 4Q4HB 5I6DA 4DIFA 1MOZA 1JSRA 4I55F 3LX8A 5CNKA 3UCFA 4IGAA 4KJXA 1TFUA 3DZJA 4AIIA 1L4HA 4JSTA 3FKQA 1G8JA 1TQDA 2BFMA 2Q2OA 4KR6A 3KOMA 2OYRA 2IRWA 2J4CA 4W5TA 3WB2A 3ZWCA 4QAJA 1EIWA 4GUDA 4C0QC 1KBZA 4LOJA 3TNJA 4XUDA 3DOCA 2UVQA 1ZK0A 3DBVO 4QXAA 1G66A 2CNNA 1J8FA 2RH5A 1PJ2A 3E1KA 2O14A 2IT1A 4ZO6A 4F97A 4HNRA 5G3ZA 1QGAA 4BLOA 1TMYA 4P86A 1DXQA 3EVGA 2UU9B 5DX8A 3UOGA 2I4TA 2ZDHA 2NQ2C 3GPIA 3WKDA 3LHIA 4MLCA 3IVRA 5BW8A 3GV0A 2Q50A 2DUNA 4CV1A 2V96A 4ZAZA 3HZZA 3WRXA 4JJEA 3TR0A 2YFYA 2H4WA 4FOSA 4UUBA 2WP0A 3IPYA 5ALDA 2W4MA 2ANCA 1IHPA 3OP4A 3SK0A 3TTUA 3TW0A 5M7EA 1VL1A 5M5BA 4NFLA 4YV1A 3K6SA 3OZWA 2XJ9A 2CL5A 2GAFA 4UNQA 4JX9A 3TYXA 4B6GA 4FOLA 4E5NA 5T64A 3BJEA 4MUMA 4KE8A 4F2GA 3NNDA 1J21A 2GXAA 1NDQA 1DAPA 1FSSA 1ZD8A 3DWEX 3JPYA 2W2TA 4BJ3A 3EZ2A 3NKLA 5E6SA 4CM1A 4ARZA 4B71A 3JYQA 3J80A 1IATA 1B0UA 1N4AA 4XYLA 3D4BA 5K45A 1XTQA 5EPEA 5KTRA 4HWKA 4PBSA 5I7SA 3A6HA 3ZX5A 1T8TA 3BPSA 4ZO9A 3AR2A 1B8OA 4HQRA 1Q3KA 3WSVA 2B8NA 2WICA 4J6FA 1KDYA 1A8UA 2ZIAA 2PSJA 3EGDB 1DPFA 1RI4A 1T2VA 4FE3A 5J23A 2DHRA 4WLEA 3HFJA 3OJEA 1KMHB 5H9WA 3O8NA 2FCRA 1RI1A 4RTKA 3I30X 4GWKA 4H7HA 1CUGA 3N1UA 1JMVA 5FBVB 3AR6A 1XPUA 3VX3A 4PRLA 1JEQB 3ETLA 3PTZA 4RZUA 4Z5XA 1V9CA 5LZ5A 2IOHA 1FNDA 2Q6OA 3HMKA 2D7DA 1BXRA 1UBJS 3F6SA 1JALA 1KOLA 1SFRA 2QQEA 2QTGA 4X1KA 1MA3A 3IOEA 4H3VA 4OHUA 3UO8B 2ZS9A 1R0RE 5EIEA 5I3CA 3QJYA 2Z8ZA 3QKIA 4ACBA 4D97A 5BSFA 2B36A 1P9LA 1K75A 1OXKB 2BHTA 1ZN9A 1EINA 2PZBA 5A62A 3TTWA 3OBIA 3EVEA 3MJCA 1ZVQA 4YMHA 2HXGA 2UZ0A 2FTKE 3T61A 3JQCA 4TLAA 1K9SA 2Q1SA 3KB6A 3IAHA 5CVTA 3SBDA 3VR4H 1Z74A 3C1AA 4E5KA 4GOOD 2VL7A 5FA5A 3NIDB 2QV7A 3LLCA 1XBTA 1O9BA 1XMJA 3GGGA 3CE9A 2R87A 2RKWA 4XYGA 2BAGA 2ZRNA 1E8DA 3LIPA 3GDHA 1T5TA 1U3VA 3SEZA 1R0LA 2DULA 3EF3A 4ARUA 2SNIE 4ZXPA 4NONA 1C81A 3EQ8A 3LHDA 4JDUA 1CPYA 3N39C 2ZIXB 4Y2GA 1YRQA 3VKGA 4X95A 3B7GA 1N8NA 3D6VA 4RF2A 3M6IA 4BNXA 1QGDA 2FPUA 4OQNA 3QUSA 1QV6A 4F4IA 4L6CA 1UBFA 5B2FA 2R6CA 3T3EA 2VNIA 2E5WA 1QJ4A 2X14A 4OAOA 4GGPA 3KUCA 2GX6A 3INGA 3LZDA 3VNSA 1GQYA 1W36C 3VHRA 3L41A 2Y3IA 3O3CA 1FPQA 1JKJB 3H5TA 4RIHA 3TLXA 4NEHB 2WFMA 1YA8A 4WCDA 5DNDA 1J70A 5AW2A 4JBXA 3KM0A 5B6JA 2O8BB 3I2FA 4ZEOA 4J3NA 1SVMA 2PANA 1U9ZA 3CEPB 3KHUA 4MVCA 5EMMA 4B79A 3P9RA 3FH0A 4CIYA 2XD4A 1T3ZA 2XODA 4RTPA 1A98A 1CX9B 2H11A 4B6JA 4RMNA 3LNCA 5IT4A 1LK7A 1SPBS 2QRMA 2JIBA 2RHCA 3ZVKA 2YS7A 3HB0A 3GA5A 1QP0A 1C1YA 4KDRA 4BOYA 1H42A 3KOUA 2FJUA 4UASA 3LQKA 4YJ2B 1ODCA 1LPNA 3IOBA 3KQMA 3VR5D 4Q3KA 1A9XA 3S2YA 1OFUX 1KMCA 3OJFA 1DBIA 1AQLA 1GUZA 1RWVA 3BHMA 2II6A 4JNKA 3II6X 4X3OA 5J4LA 5L45A 3U4QB 4ETMA 3ZIAD 4DDWA 5EIHA 4O5OA 1N78A 2VKQA 3UT5B 5B4UA 4QFBA 1USIA 2PX8A 3DLAA 3SEAA 1Y6FA 1GRNA 3W8NA 2GUWA 5E0OA 1Y42X 4MJ3A 2IEYA 2V7TA 1NNI1 3KB8A 5CX4A 5MF6A 3S8MA 1FE8A 5TQJA 2OLKA 1I4DD 1EFLA 3O9ZA 2HLDD 3AUJB 4O4IF 5EZSA 1QHNA 4B6FA 2EW2A 2HNBA 3BXGA 4FEAA 1Z16A 2BTEA 3I1FA 3LGAA 4NMXB 5E9WA 2Y4NA 4OB8A 3AVPA 3FUWA 4NFHA 8MHTA 4FDLA 3IT2A 4GKBA 4FBGA 1TZCA 2VQ6A 4LJKA 5AJHA 1G8FA 1X1DA 1SA0A 1XSEA 2YIJA 3RVSA 3F9IA 3MT9A 4ALKA 3QELA 3L06A 1BHO1 3TM4A 4CGZA 1C3OB 1TF7A 4F21A 3WL5A 3FPKA 1FVOA 1S2NA 1UKBA 4MMZB 4TMXA 4LBWA 1Z5VA 3JQFA 2EX0A 4EJMA 3CO5A 3C15C 2WYUA 3LPCA 2XADA 4Z7QB 1QBKC 3WK9A 5JJLA 1C30B 1OH6A 2B1QA 1HORA 3TSWA 1JQLB 2BGTA 3KQKA 1ZN8A 3FUTA 2AF4C 2QP3A 1DWUA 1KI1A 1POXA 4KMMA 2IYUA 1RQNA 1MT0A 3PNKA 2PX2A 2ILVA 1MZPA 1U3FA 1IWOA 1F60A 2VF8A 4FFBB 3GHHA 5K51A 4EM6A 4O0LA 4XTRA 3EZLA 4ZRMA 1OGJA 1F4PA 1IXSB 2P65A 1U99A 2HSJA 3C5EA 3QVSA 5HZGA 4HDOB 1EA7A 1X1CA 1YQTA 5FI1B 4MUAA 1QRUA 4H16A 2PKXA 3NR2A 3PQCA 3K15A 4RS4A 4A91A 4PNZA 3WLNA 4FKZA 1NIPA 1KJ9A 1P8AA 1H2BA 1XZ8A 3JWGA 4KFSA 7MHTA 5DM60 4GE3A 4EW3A 3UKOA 1XDUA 2ZSAA 4G0YA 2O8FB 3GGOA 2BEWA 4ZARA 2I1WA 3UPUA 3N8HA 4GYYA 2WSLA 5DMHA 4W82A 1GUDA 1RAFA 2RK3A 4YRCA 4GT1A 1M6WA 1Q83A 1XXHE 3DOHA 1K7XB 3I9LA 3PCRB 4ROSA 4CG3A 5A5FA 4OQXA 1WM1A 2NO9A 3GRVA 3RVJA 1JQ5A 1N5RA 4P7BA 3AFMA 1BMFA 4H08A 4YQYA 3C6BA 4M88A 3TLAA 2VVTA 4TTAA 4I8XA 5H16A 1DLIA 2OV2A 5C5IA 3KJGA 1E3WA 1LLUA 5EIAA 4DA8A 4EPXA 2X5NA 5TMPA 4NBUA 1BRMA 4RV5A 5IT0A 2CJFA 1MVLA 4A7PA 3ICPA 1QLHA 4M1MA 2F43A 2ZSKA 4LZPA 1H8EA 1P91A 4JYCA 1BE0A 5DN9A 1WPQA 5U9CA 3R7SA 3GZJA 1KQNA 2YBDA 3B52X 2I6FA 1USKA 4DNXA 5K05A 1RJFA 2I2AA 1ZIPA 3CNNA 5I9LA 4KFRA 3HKBB 2A1UA 2XXBA 3DTNA 4C6SA 5JFGA 4B80A 2GESA 5IAOA 1EVQA 1XAGA 2FZCA 1VYUA 4BLUA 4FMCF 4M46A 5CYOA 1V6SA 2R1UA 2OV8A 4UE2A 4C88A 3LT2A 4FMPA 4MR8A 3GZNB 4JFRA 4DW8A 3GHYA 1ZW6A 4EA8A 1QB7A 1OTHA 4JEMA 4XPIA 4JMLA 3PYXA 1KH2A 4HHEA 3E7DA 4BNJA 3PUVA 5HDQA 1CE8B 2DH6A 2P2NA 4GQIA 4R98A 5JXJA 2QBYA 4INPA 4ZWNA 5LQUA 4FD2A 1WS6A 1X70A 4Q3CA 2ISQA 4MVJH 2E37A 4WIAA 3TE6A 2OB1A 3A6KA 4LSWA 1WOYA 2ACWA 2MJLA 1E4EB 1EDEA 1Z0DA 2GRJA 2ZIZA 3P0EA 3M33A 2ZI7A 4BO5A 2JFBA 2WW8A 5HUHA 3WRYC 5LM3A 5FKJA 2P9HA 3D9QX 3NOVA 4H6VA 1GHTA 3MWEB 4IZOA 5I7WA 3E3OA 3HDGA 1VYTA 3HN2A 3MSCA 2X0EA 3WB0A 1C9KA 1GPMA 1U8ZA 2ZJAA 1M0SA 1XMPA 3UJBA 2BF4A 4YR9A 1P1FA 2VPTA 4CMEC 3F7OA 3ZY2A 4EL0A 3UMMA 3MHPA 1M1NA 3NTXA 1G42A 4QDZA 4CKBB 1XAHA 1PS9A 2FH5B 3N0RA 4ZYVA 1GZDA 3HGTA 1XEAA 1NMYA 3FYDA 1NBIA 4UEOA 2SCUA 4UKDA 5FPQA 1SC6A 5BQ3A 1V1RB 3TD2A 1KTIA 4K88A 2WUDA 3VR2D 1P9NA 1VB5A 1F9EA 1T4DA 4DPKA 4MR7A 4DV6B 3GFGA 4H6PA 1ZCFA 1V11A 2Z8XA 3PXXA 4H18A 4RH3A 4HX9A 3ILSA 1UBGA 2YDXA 3U26A 1U7WA 3K09A 4BX2A 2HMVA 4HS4A 3BBLA 4TN5A 1ZUHA 1N8KA 4E2FA 3R7FA 3RS7A 4GZ6A 4JZYA 1DKPA 3VO8A 5L53A 5M29A 2CDCA 2I2BA 2XCUA 1TEVA 3THXB 3SSAA 1TT7A 5IAEA 3R7LA 5K0BA 3Q8KA 4C6HA 2NSDA 4NNPA 3K0EA 4Q1FA 1YCHA 1JWBB 3WBJA 5GOZA 1V1MA 4NMWA 2X8JB 1TM4E 2J9RA 3KLPX 4PRKA 3VMFA 2EQ5A 3QPWA 3CHYA 4X1IA 2E48A 3GRAA 1A4UA 4DR5B 2GBFA 3GUVA 2JJMA 1CUWA 1H2RS 1U0GA 1PR1A 1JG2A 3EPRA 2J31A 4O2BB 3DQQA 1ZM4A 2EYUA 2E4AA 1Y1TA 4GECA 4Z3OA 2QZ9A 5JZVA 4U0JA 5D3MB 5DHFA 1H85A 2PD3A 2O3QA 2Q3CA 2ZB2A 4YK7A 4YRJA 3RR2A 1NN3A 4DPLA 3BIJA 2HDHA 4UNPA 4Z99A 5LDGA 3VNBA 1QQAA 3BA6A 1IB0A 5BV2P 2I7VA 5FTLA 3Q3JB 3BXOA 4RVFA 4YT2A 3FZYA 2JB9A 1FFBA 2NVBA 2JFZA 2CHGA 4JC8A 4KYVA 4I5EA 5JW6A 4K3VA 2YJGA 4D4LA 1EUYA 1U8FO 5F5XA 3ZV3A 1JIXA 1B16A 5CPBA 1NXOA 1ZU4A 1L9XA 3FROA 4L74A 4R1PA 4YGYA 1RM4A 1WBDA 1Q44A 3NVAA 4FMCB 4GVXA 5IU6A 5JC8A 1B00A 2WVGA 4BFSA 5AM2A 4ASUD 3RG8A 3T3IA 1S0UA 4PZEA 2N75A 5KHOC 4ZVOA 4FGLA 1CHDA 2UZ1A 1C2TA 2H07A 2IYOA 2OD7A 1M2VB 1JQDA 2MMCA 2Z5FA 5AKJA 4ZT4A 3MCWA 1KNQA 1VI2A 4LPKA 1J0DA 2XUPA 2QY9A 4LKOA 4RPJA 2XWSA 3NTUA 4DBVO 1EWQA 4B40A 3FGOA 1XZPA 2CHFA 1YNSA 2DTEA 4ROTA 4KQKA 4MAFA 2PVPA 3W9SA 3G0OA 4I4NA 1NSTA 3ZWYA 1N9GB 2F59A 3OE1A 4A03A 2IPNA 3P4UA 3WK8A 1UZMA 5ERXA 1M0EA 1NPYA 1GWNA 1SOWA 4X3PA 5LR6A 5G02A 2OK7A 4Q37A 4ZVSA 5CEJA 1CNFA 5TJHA 3HG7A 3FWZA 3VMMA 4MQ4A 4JKIA 1EVLA 3L8ZA 2YMPA 1ACMA 2NUAB 5JSZB 1KEUA 2IPOA 1IRIA 2WSMA 3I6QA 2AOTA 3F74A 3GOQA 3DDWA 3RVRA 4UM9D 2EZUA 1CW2B 1AKUA 1LA2A 3UMYA 3K6KA 4C0KA 4RFSB 1UXOA 3OJOA 5AM0A 4DILA 1UOEA 3OZGA 4MWGA 1M2WA 4DNFA 2AN1A 4JQZA 3DAPA 1G55A 4DWWA 5E2IA 3SVTA 1Q91A 1D6NA 4KE6A 1F38A 1WHSA 1ZMRA 4J1NA 2VHQA 2HJHA 3A4VA 3A9VA 1WMAA 2GSWA 2V9CA 3F96A 1U0FA 4N7JA 4HAOA 3DHVA 3BRCA 4D45A 2YY6A 2W2VA 2MSWA 4M38A 1T2UA 3LYUA 4H7KA 1DDOA 3Q9SA 2GEFA 5BNZA 2RHJA 1NQOA 4H27A 1O77A 3VKWA 2X5OA 3OJWA 3BHNA 3GT4A 2ZI9A 3PUJA 3PX2A 4LZOA 5ARCA 4QTUB 2IXEA 1XDDA 2CLLB 3ZZ0A 3HLYA 2X8LA 1R4NB 1A8QA 3QXCA 4X1OA 4F3NA 3A6ZA 3G9XA 3V80A 3X3HA 4P98A 3ZE8A 1KOJA 1T8WA 2IELA 4QG3A 3TXXA 5JLAA 3DO8A 4DM7A 5EKDA 4IFIA 4CM7A 2Y1CA 1L5FA 1R0XA 5CVDA 1SB8A 5GWXA 1I51A 3DB2A 1Z38A 4KAFA 4L5IA 4ZK2A 2PUWA 2BM0A 4X1YB 3C8HA 1WE2A 3BD9A 3KKNA 4LMPA 2HSEA 3TLJA 1VE6A 3ZI0A 3LT4A 2AJBA 3KB1A 4KRXA 1N2CE 1IHOA 2BI8A 5IBQA 2R2AA 4B43A 3QVJA 5L7YA 4A2QA 3LXXA 1QG6A 2L17A 2VAPA 1KXZA 3W7VA 4KUHA 3WAKA 1VIMA 3IUNA 4CLEA 2PXHA 1VGQA 3JR3A 2WU1A 1U1DA 4M7RA 4OLFA 1MQ9A 1Q74A 2VR1A 4PZDA 4KUGA 1HNWB 1NYRA 5ALWA 4V0RA 1DIBA 5KQLA 1M6YA 3ROKA 1ZMTA 1VHWA 3FR7A 4HZUA 2P6PA 3T3GA 5TMBA 1BQ3A 1NJ1A 3L1JA 5FI0B 4DJEC 2HIAA 4LZWA 3BK2A 1OZGA 5DN6A 4UVGA 4E5VA 2VP9A 3W90A 1JDJA 2QEQA 2FFAA 3AR8A 1C41A 1K63A 3RKRA 4B32A 1Y5LA 4YV2A 3C24A 1Z7YA 1S2MA 5IDXA 3UBTA 2IW1A 3GA0A 4DV1B 1FZTA 4DCCA 3LBNA 5JU6A 3HXQA 2IEDA 2W0SA 4BV8A 3R76A 1BKSB 3GUZA 4JLWA 2J67A 2HPZA 2W7TA 4HEA1 4BUJA 4U2CA 4BY9E 4OJYA 4BASA 2AWOA 2VCYA 2C4MA 3CE6A 2VP6A 1L1RA 1RQLA 2F8SA 4MYCA 4JOSA 4GPIB 1OILA 1QGYA 3KPYA 4OMDA 2DQZA 1AA6A 1UODA 2FPSA 1P75A 3TLZA 2Q3DA 4BL5A 3DNMA 1NXSA 3GUUA 4DJ5X 2PBZA 3GJ0A 5FFFA 2ZWVA 3TIIA 1R15A 1E6LA 3S99A 1MIHA 2AFHA 3K8OE 4KL8S 1MB4A 2QN6A 5HBGA 5JBNA 4BLPA 2Q1UA 3FYTA 3GYBA 2OGZA 3K8QA 2K6GA 2B92A 3H5VA 2BGLA 2QT0A 4X20A 1EM8A 1E92A 3ITDA 3TZEA 1A9QA 2PWYA 4FNAA 4URXR 2ZZNA 4UDOA 1H69A 4O5AA 3Q3CA 2EU8A 5DHUA 4UZFA 2NU7B 2ST1A 1K7FB 4PHGA 4RA9B 5JS7A 4A10A 1CDZA 4CM9A 1NC1A 1NLFA 3E2PA 2XDQB 4IIUA 3DE6X 3U7IA 2OOSA 4YAUA 3C45A 3CLRC 2J7PD 3BB3A 2WHYA 4TKZA 1XF9A 1XGKA 1U2QA 1QCDA 2HBYA 3ABZA 3IV7A 2F62A 4X5OA 1Y1LA 2GKOA 3UOAB 4ZI7F 2RAUA 2PKQO 1DNPA 5F51A 2Y76A 1REQB 4NCXA 1O03A 1C14A 2E4VA 3JYLA 1FA9A 1W4BA 2DE0X 2GA9A 3IAM1 4WZBA 5B58T 2TMGA 1U2DC 1PJLA 5ILQA 1RRCA 5DGHA 1TQ8A 3RCBA 1FYVA 3HSKA 3CV3A 4NBLA 2DWUA 4C3ZA 1QAQA 4BECA 3CM0A 2FFHA 5KJ1A 4HAVA 1N57A 5HQJA 1WMEA 3MTQA 5L51A 2X0KA 1DP4A 2DU8A 4GR4A 4AY4A 5M34A 3T1TA 1HFJA 1L2TA 1L1EA 1A7JA 1BS9A 1T2AA 4LRXA 2IYTA 5KQSA 3C48A 3AJ8A 3X1WA 3GCXA 3R23A 4GVPA 2BGWA 3F3YA 1R10A 2QI9C 2O2IA 1XRQA 2HWKA 4I7EA 2X22A 5J1TB 5KNCH 3NEAA 4PQYA 5CXQA 5KKCA 2GRAA 1XTUA 1QGUB 3N9IA 2CEKA 4ACAA 2ZCVA 3MRSA 5EI5A 2REQA 2PV0A 2Z9CA 4L95C 5T4HA 1B7GO 3T7TA 4F45A 1GTRA 1W0JD 2WRZA 2C4VA 1S2IA 1VLVA 1YTUA 1RI3A 2KW5A 3NPMA 3WZLA 3I6ZA 1L1FA 2DRIA 4Y2JA 5BWOA 5G0VA 3SMQA 4FXOA 1SKYB 4AULA 4CIXA 5DXJA 4CMJA 2D8MA 1MEEA 2FMUA 2EDAA 2Y0DA 5TPWA 1F12A 5HKKD 2B94A 3G2OA 5F1PA 3L7IA 1KERA 3AR7A 3R8XA 3BILA 3L6EA 1WXGA 1PR2A 4D9IA 3CUTA 2FEKA 4N54A 4TL7A 1GL3A 5G2OA 3VH1A 2JAXA 3K2QA 4EBFA 4F5ZA 4XW2A 2H4YA 3BIWA 3TZKA 1GUYA 4OQZA 4QZVA 2IU4A 1JFRA 2HA2A 1BKYA 2HB6A 4BKMA 3TZHA 1OFGA 2GM3A 4A2CA 5LZ4A 1TAUA 1EDZA 4XFDA 1QMPA 4ZAGA 1YR8A 3BMQB 2QVGA 2VAXA 4KDFA 4L76A 4KXYA 5CFLA 3KHTA 4QJIA 3OZXA 2RGEA 2AA3A 2ET6A 4EJ2A 1WZUA 5K09A 2JEOA 2AJ8A 4NYIQ 1TXGA 2YZNA 4I1UA 2MTBA 3UMBA 1ZUNA 4BB9A 1RFGE 2Y1LA 4WJLA 2VYCA 3GLHB 3N87A 4WECA 1R9JA 3NP7A 1C3EA 4UHKA 1YCGA 4OH7A 4YXWD 1O5IA 2EW8A 5T3YA 2FHSA 2Z9DA 3WO0A 3H9UA 5ALRA 3CNLA 2JI4A 2C9CA 3MINA 4YMWA 3U3KA 5FRDA 2OXIA 1J9EA 2XUGA 1F9AA 2IHTA 5CFMA 3AVTA 2QAGB 2XITA 3IPAA 1NMEA 2UYGA 4FEGA 4ZC1A 5BSHA 4HNAA 4CKCB 5LQJA 4OAQA 5FO0A 3T4XA 1NKSA 3HDHA 3KD2A 4U4AA 3MFYA 2ZLBA 1CEQA 4CCWA 1SC3A 4BNWA 4DHEA 3DVQX 2OTCA 6YASA 2EJTA 4QTTB 1EWYA 3SHFA 3HUUA 1M73E 1KDZA 1M1YB 2IP2A 1YMUA 3AUYA 4JJKA 4RE5A 5U1PA 5GIPE 2VJBA 2WM2A 2UXCB 4YCNA 3PWSA 4MKGA 5BUQA 1J9GA 4RKQA 3V6LA 3DT6A 2YJNA 2V65A 2X8BA 1Y3HA 4NX2A 2SKCA 2X6TA 3UIEA 3LUDA 3ZCUA 2FMHA 3A25A 3STXA 2XNHA 4IRUB 4Q3AA 1PFUA 3E7WA 5CB4B 4L7QA 4YRAA 5HQ3A 4YJGB 1ZITA 2X4GA 4WZAB 3S55A 3PQEA 3RYIA 1Z4KA 4B3IA 1RACA 3EGCA 4RZSA 3OZTA 4H17A 3B9QA 1D2HA 2WFAA 1UFQA 1X1RA 3IJRA 4KQFA 4AMUA 4G4SO 1RIFA 3B20A 3OKCA 2H1WA 2CXRA 1W1UA 2OZPA 3FMVA 4YCJA 4DMRA 4ZZ0A 2PUGA 5IANA 4N6GA 4MVJP 1ZINA 4XI9A 1FP4A 4EW6A 4ZQBA 5FQOA 3R9XA 3H99A 1XAIA 4JODA 3UMVA 2D5IA 1GSIA 1HQYE 3QE0A 4DB4A 3SYNA 2H92A 2I7XA 2E6UX 5G3YA 2UYHA 4DMLA 1EXVA 3AIKA 1Q50A 1QH8A 4DSZA 2H9YA 3H75A 2WD7A 2W11A 3CJTA 4X63A 3C3DA 1CRWG 1NBEA 1Y1PA 1GY8A 1ZQ9A 1AB6A 2WD8A 3HCEA 1K8QA 1X7XB 2V7XA 3TQCA 3J81A 3I8OA 3G6WA 3GCDA 4G89A 2QORA 2VOJA 3GJ3A 3OTGA 4F60A 4KDCA 3FDJA 4YTEA 4KAJA 4NAUA 3W5IA 3PWKA 4JEHA 2VDPB 3PVCA 2QLLA 2BSXA 3ZV4A 4MB2A 3VM6A 1IYZA 2P77A 2WMOB 8AT1A 3WK6A 3CZMA 2C2KA 4PC3A 3QKRB 1GAWA 1KORA 2PYIA 2NTNA 4HRXA 3SHTA 1CIVA 3ISVA 4PX9A 1NKTA 5C5EA 2POQX 4H60A 3C8UA 1C1XB 1HE8B 1N75A 2OY0A 4QT4A 2W6ZA 4JDPA 2W6JA 3I04A 3C0KA 4XWYA 2PQ2A 4DARA 3EA0A 4HGRA 4L5YA 2EATA 4XJXA 2P1DA 2WJWA 2G6BA 1FLNA 1XRSB 2FK8A 2ZG6A 3OQMA 4BFYA 2KBEA 5JH7A 1N5MA 1YSCA 5C51B 3E82A 4N6NA 3URMA 2R00C 1EGVB 1GA4A 1SXJE 4UZEA 3ZLUA 3TGWA 4BEWA 3HFGA 2XYGA 4RGBA 2FEOA 3G0BA 2K87A 4I6JA 1JIUA 1OE0A 4J4HA 3WNCA 5C53B 4HV4A 4AP5A 3NRBA 5K3AA 4X61A 1KZ9A 4NYMR 1XROA 4DG5A 1R12A 2ZTMA 1F2UA 4J16A 1T3LA 2O7SA 5DTEA 3KQNA 4Z0TA 1HL3A 5F7JA 1QIGA 4J4BA 5K3BA 1W75A 1C9DB 1PX0A 3L0OA 1DC7A 3MQ2A 4DV0B 2P5UA 2WJIA 3QH4A 1Y7PA 1UFKA 5ALGA 3O1IC 4EPTA 5KTPA 1IUOA 1TT5A 4MCAA 4MW2A 3W1VA 2OR3A 3ZDCA 5E1BA 5AKIA 3JQGB 5EHQA 5EC8A 1OYOA 3PV0A 4UHEA 2LP4Y 4EX7A 4TTPA 3DFIA 3UICA 2G1PA 4K9PA 2IITA 2FI1A 5IK2A 1GDHA 1R50A 4EHFA 4BWFB 2EZTA 3DZGA 1ENZA 3LOPA 5WRFA 3HRHA 3IP9A 821PA 1IHUA 5LJLA 2PGNA 2B30A 5JNTA 3H11B 2EWWA 2EKPA 2VWGA 3N6RA 2D1YA 4IUCS 3RJ5A 1P7YA 3KCNA 3KO8A 4CMIB 4IIJA 3FWKA 2CLIB 3T5BA 1GN9A 1J0XO 1Z37A 1RS0A 2Q2QA 2W22A 4G84A 4KP7A 1YF3A 3QE9Y 4IMPA 2NO5A 3HA3A 5A7GA 5J40A 5K03A 2VQ3A 4IZ6A 4U7PB 3FMOB 1GPBA 1ESCA 1B3BA 2O4CA 3FLBA 1NWCA 4D44A 4IGKA 1E9BA 2P0EA 3OCCA 3X2FA 1RT9A 4Z54A 4PLGA 5CA1A 2CC2A 3BFXA 1F5SA 1MVOA 3NTOA 1Z7BA 3RUDA 4BPRA 3COYA 5BWBA 1Z0IA 1U11A 3PIDA 4XAQA 1V8ZA 4JNCA 5COQA 4XFKA 5JQGF 3UEOA 1Y3FE 3FBTA 3MAAC 1KOFA 4P33A 3QOWA 2F17A 2C92A 2M98A 4YMGA 5I4CA 1LVUA 2VBCA 1DIRA 4CL2A 1MX9A 1GPNA 4NULA 1WKBA 1W6RA 5AVYA 2HA6A 1QF7A 4YQFA 4F9EA 2FWNA 3I2KA 2VRCA 4CFYA 1HYHA 4K6FA 5CURA 3QA3E 2PYDA 4EELA 3BT7A 3EZ7A 4ADSG 3OA0A 3SJ7A 1N6KA 4EHKA 5D1HA 4G23A 4Q4DA 4RJTA 1P7CA 1KAHA 1D2MA 4MX8A 3UWSA 3R0IA 5AW0A 2RGGA 2CJWA 4HEJA 1LPMA 4AG3A 2X1VA 4X8OA 1Z17A 5E3IA 3CEAA 3WYDA 3NAZA 2Q07A 4US2R 1JJAA 4PN7A 1EFPB 1FXWA 3DF7A 3FE2A 4ISCA 5K3FB 1MFPA 5CA0F 5TF4A 3G2LA 4KO2S 4Q21A 5KINB 5L95A 3B89A 2EFHB 5KTTA 4L9AA 3A32A 4ZKDA 4NCNA 4CFZA 1HT3A 3OKFA 3E81A 1JHPA 3BZUA 3IIMA 5AMXA 2ZDQA 5I7EA 3C4JA 1JN0A 3FBGA 5FOQA 2YW9A 1Z6AA 2I8CA 4POAA 1I6LA 1LLFA 5AKEA 5IUKC 4I6GA 3ZEIA 3ZJVA 2DOKA 4ZFNA 1Q0HA 3UVEA 4DS3A 2C31A 4ZVQA 2ZSBA 4DHWA 1O1YA 2OFXA 2O0HA 1CY7A 4MZDA 1PCXA 1PUJA 2WIBA 1XHEA 1ZAYA 1T5BA 2XTAA 2GPTA 3ORYA 1GRQA 3KZNA 4OYRA 4CI0B 2R6GA 2IFTA 3C5HA 4KHPB 1VL8A 4WQMA 3UHPA 2RCNA 4CDNA 3KZOA 1A1VA 5JS1A 1C0LA 1U04A 2ZIEA 5CLLA 3L79A 8LDHA 5ICSA 3QTBA 2QW0X 2QX8A 4UREA 5E6UB 4AN0A 1M72A 2JRLA 3FN4A 5AKGA 3BFJA 3GLKA 2GN8A 2I6TA 3PFFA 3KHKA 2B5VA 3AU9A 3GJQA 4Y9DA 5ALUA 2WAAA 4G5HA 3IP3A 5H80A 5A1JA 4ZAWA 3M7IA 5E6RA 1ZK3A 1CUUA 1U2DA 2PIDA 1Y8QB 1SOAA 2G06A 2WPNA 4U1RA 2BISA 4AKIA 3TB6A 4DM3A 4MWCA 3CGGA 4QQKA 5HKKA 3TCXB 5BUZA 4JFAA 4N76A 1NI4A 3WMGA 3VU9B 1DO8A 2AOVA 3PRHA 3LF2A 4MRPA 3OMLA 3W78A 3IYLW 5HF5A 2W4QA 4CF5A 3R20A 2NO6A 4P22A 1BH2A 3UFBA 3TRDA 3TLMA 2JZCA 1KEZA 2I91A 4JP2A 1B26A 2EBWA 4EECA 3FUVA 1KSGA 3AFNA 2IF2A 3I9KA 5KJCA 1I32A 5JQGB 1YOVA 3E22B 5TGDA 3TG8A 2NP7A 3HQ4O 1KI2A 5TMEA 2LCFA 3QKTA 4XD2A 2WZCA 1DJMA 1E0SA 1RPTA 4MGZR 3P7MA 1O4VA 4KYIB 3SIWA 1JQAA 2BHRA 1XU4A 1K5DA 2ZSJA 4NCJA 1D1QA 4RQBA 5REQB 4G4JA 1VKNA 1RXUA 3MK31 4K40A 3DH0A 4YV7A 1FVXA 3VPBA 2QG6A 5L6MB 4D3FA 5L3SB 5B3LA 5JD4A 5JMPA 1GNPA 1GG5A 1JXQA 2D2EA 5EQJB 5FYDA 3QVLA 5B53A 1H1DA 1BIFA 1WRBA 4IV0A 2ETVA 2BJVA 4PPGA 3PR2B 1BXZA 2A9PA 4NP6A 4YJKA 4JGIA 1QGOA 4MV4A 2E2WA 1N25A 2FPIB 2OKCA 2X13A 3MRXA 3VR6A 1GDTA 4CEHB 1Q7TA 4W5HA 3W34A 3WL6A 2GCOB 4YI5A 3K72B 3JYOA 3WB1A 2PV7A 2Q1XA 2RBGA 4QNNA 3AL3A 4WBXC 5JWOA 3C4QA 1JLMA 1GN8A 5KCMA 1G21E 4N0QA 1A04A 2R1ZA 2ZBRA 2I62A 3KYDB 5IULC 1KHHA 1FEZA 1ORVA 1JI0A 2FAXA 1B2LA 2QB5A 3DHEA 2ZAYA 5CM8B 1YQGA 1FSFA 1SJ9A 3NBYC 2EFCB 4MPDA 1XNGA 4RY8A 3JD0A 5AQEA 4G6ZA 5IUJC 3NQ41 3H87A 2FW8A 5C2JB 2A5GA 4UCQA 1EEHA 3NHLA 2IHUA 3L01A 2HQOA 1C3XA 1OJLA 1CR1A 4FDAA 5TVGA 1VJDA 2WV7A 4EYQA 3U7HB 1NF2A 4DFDA 3AVWA 2FQXA 1D03A 1F6BA 1JL3A 1K8RA 4ZRDA 4AUMA 2Q5JA 1RPAA 1XALA 4GIBA 4XXHA 5D8DA 3W9YA 1AV7A 1O97C 1OD6A 4YT8A 4TRNA 3VC3A 4HRVA 3T3PB 1R0KA 1TF2A 2C58A 2IKQA 4TV8A 1PT5A 3MJHA 4WZZA 4ZP1A 2YFKA 4PLWA 4C14A 4YX9A 1EXMA 4MI6A 4DQ0A 3S70A 1NN5A 2YWDA 4XARA 5I9SA 2A9FA 4XDZA 3K2EA 4PG7A 3L8EA 1MAUA 3DV0B 4OHRA 5JV5A 1LSOA 3GFOA 4HWSA 2EBFX 1ZR2A 4IJMA 3BMOA 3IP6A 3DBRA 1RKBA 1VE7A 4TVKA 3TL2A 3PNSA 1BN6A 4A8JC 1P61B 2JJQA 3G5AA 1ZU5A 2G9QA 2JGEA 2PQ6A 3L0ZA 1ZM7A