3SVZA

Crystal structure of apo bt_2972, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
b'FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of apo BT_2972, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3svzA00
1JSZA 1NT2A 5EHIA 4PWYA 4A6EA 1I1NA 2ORED 2YR0A 3C6MA 3THSA 3BWMA 1QANA 1NBHA 1U2ZA 3M6XA 1NW8A 2OPBA 1HMYA 2ERCA 3FZGA 5E9JA 2EG5A 3OZTA 4YUYA 3EEOA 3GRYA 5LQUA 3HCBA 4P7FA 1R74A 5D1NA 5HOQA 4PYIA 1D2HA 2OB2A 3DLIA 3EGIA 4YUVA 2HTEA 1RJGA 5EOVA 3SR4A 4GQBA 3C6KA 1G60A 4E70A 3GJYA 3HM2A 1RJEA 3KQMA 10MHA 2IDKA 2P35A 4YUXA 3QOXA 1YUBA 4F86A 3LBYA 2GA9A 3KQPA 2QYOA 4KVZA 3TM5A 4E2ZA 5BW4A 2XBMA 1G8AA 5EIWA 3KPWA 4M38A 1N7JA 1IXKA 3EVZA 1JSXA 3DLCA 3KU1A 3PFGA 1WZNA 3CJTA 1EG2A 3LDUA 3O7WA 3PT9A 1O54A 2ZWAA 2QRVB 3L8DA 4FT2A 5DTQA 4GOLD 3DMFA 4DCGA 3P2KA 1L3CA 4RTMA 3HCEA 4MQ4A 2B9EA 2ZLBA 4C03A 3OU7A 4PYMA 1Q0TA 4QDKA 4POOA 1SQGA 5FQOA 4ER5A 2YX1A 4IKPA 5K0GA 2ZBQA 3C3PA 2I62A 2R6ZA 3DUWA 1EAMA 2WA1A 3ELDA 5CVJA 5E1DA 4C07A 2Z6QA 4YV2A 3LGAA 3T7RA 4DA4A 1H1DA 2O06A 1KYWA 4KDCA 1RI1A 2IGTA 2P8JA 5EGSA 5K0JA 5E9QA 2IDJA 1KIAA 3UJ9A 2B2CA 3FUVA 2AN3A 3T7TA 2C7PA 3A7DA 1WY7A 1SG9A 4QTTB 3CVOA 3EVEA 3UZUA 4RVHA 5EEGA 3B3FA 1Y8CA 5EKUA 1QAMA 5HILA 4AZTA 4R6XA 4RTQA 3EPPA 1NW7A 2VDUE 3GCZA 3JWJA 4ATNA 2AOUB 2BH2A 2BR4A 3M6WA 3DH0A 3AJDA 2QM3A 3OZRA 3B89A 3UWPA 1L3IA 5MHTA 2JH9A 3PS9A 2YQZA 1AQJA 1G6Q1 4WVLA 1ZHFA 3KQYA 4PYLA 2O07A 3MAGA 3NTVA 1OR8A 5CVEA 3VSEA 3LDFA 1D2GA 2YTZA 4GC5A 4QVKA 4QTUB 3BGIA 3MQ2A 2VDVE 4GOOD 2IBSA 4HG2A 1KXZA 2HMYB 2LD4A 2PGXA 2Y1XA 3KR0A 3PX3A 2ZSUA 5KQRA 4RTNA 3AXTA 3M33A 4F84A 5HZMA 3BT7A 3FTCA 3P9KA 3HEMA 4V0RA 4M36A 5FCDA 3UBTA 5U4XA 1P1BA 2AR0A 2VP3A 3GRRA 5JR3A 2NXCA 3G8AA 1NKVA 4X61A 1XCLA 2FRXA 2JH8A 2PT9A 1SUIA 3IV6A 3KPVA 2PT6A 2OZVA 4AUKA 2HR1A 2GH1A 1EJ0A 3EGVA 2IIPA 4X41A 3BXOA 2UYHA 2P7IA 4ER3A 2CMGA 3A27A 5EZQA 5HIIA 3FYCA 3LCVB 5GIOE 4C08A 2ZIGA 2F8LA 3EEYA 4E31A 3IHTA 4JXJA 5LQJA 5LQCA 3FUWA 1IY9A 3O31A 3THRA 5K05A 5K8VA 3HCDA 5M5BA 3KQWA 4YMHA 2IH4A 3ELUA 4YUWA 1FPQA 3AY0A 5T64A 3SGLA 1YZ3A 3ER8A 3FPEA 4RTPA 1PRYA 3G8BA 4E30A 1X1DA 2YUIA 3TM4A 2FYTA 2PXXA 4HGYA 4LECA 3ERCA 4FGZA 5EC8A 3LHDA 4FT4A 4YUZA 5C0OE 4P7JA 3V8VA 3WSTA 2ZIFA 2AOTA 3A26A 5D1HA 3MCTA 3P97A 5EIFA 1FJXA 3SMQA 2PX4A 4AZSA 5FA8A 1NE2A 2ZZKA 2AOXA 3VC1A 5DSXA 4KRGA 1DL5A 2PSSA 4RX1A 4LWPA 2OYRA 5FULA 2H00A 1PJZA 4CTJA 2O0LA 2ZCJA 3ID6C 1V39A 1KPGA 3H2BA 3P9NA 3G2PA 4MTLA 5EVJA 2JJQA 4XUDA 3FPJA 3JWIA 3OE4A 5KVAA 2OBFA 4AX8A 4RTOA 4M37A 3KR9A 3SSNA 1RI2A 4DF3A 4FSDA 5ICFA 3UJ6A 2B3TA 2PXCA 2NXEA 2OB1A 1ORIA 3HA5A 4R8RA 4LG1A 2QE6A 3GU3A 5K0EA 3V97A 5EMJA 3LCCA 1O9HA 4XCXA 4HC4A 1ZQ9A 4K6MA 2I6GA 2NNWB 4GUAA 4F85A 3LCUA 3TMAA 4EK9A 4HTFB 3LSTA 3K0BA 2AN4A 5LQAA 2ZZNA 1NW3A 3DP7A 1P91A 2UYOA 4BLUA 4C04A 3G2QA 5EZSA 3NDIA 4OA5A 3REOA 3PLAE 3BKWA 3GRUA 4OBWA 2XVMA 5K0CA 5GINE 2V7EA 3G5TA 3I64A 3SM3A 1T43A 4RTSA 3R0QA 3MTEA 4QDJA 4RTLA 3AXSA 1QZZA 4XUCA 1WXWA 4GOND 5K0FA 2O57A 1XTPA 4EKIA 1RJFA 1EQAA 1FP2A 4G56A 3ANXA 5HEKA 5BXYA 3RW9A 3Q87B 4KWCA 3SX0A 7MHTA 4R8SA 2BR5A 2JHCA 3FUUA 4RTRA 1VP3A 3LL7A 4RWZA 3P9CA 4XUEA 3DXYA 5DRYA 3I58A 1TW3A 2AS0A 2G8NA 3BGDA 4RYLA 5FTWA 3HVHA 2ONZA 3EVGA 1L9KA 2BM8A 3C0KA 3GRVA 3QV2A 4HGZA 4OQEA 4RVDA 5T67A 3MHTA 5IKMA 4HSGA 3UJ7A 2PX8A 2UYQA 5BW5A 1G38A 3C3YA 3SSMA 2XVAA 3NW9A 2A14A 5E8RA 2H1RA 2NP6A 2YVLA 3OZSA 1JTFA 3AWIA 4KIFA 1WS6A 3FPFA 2UYCA 3ELWA 5E2AA 1BKYA 4CKBA 4OBXA 5ICGA 5DT2A 5CVVA 1YB2A 3NVKI 2NXNA 4CXMA 4PYKA 1UFKA 3G89A 1NW6A 1RI5A 2AOWA 4EQZA 4C4AA 1R8XA 3PX2A 1JG4A 2ADMA 5FWDA 2VDWA 2R3SA 3K6RA 2C7RA 3KQVA 4HRAA 2ZIEA 3IYLW 3KPUA 3E8SA 3KHKA 2PLWA 4GEKA 1WG8A 4OA8A 4PCLA 5IH3A 5LQRA 1Q0SA 5KQSA 1VQ1A 3A25A 2AN5A 3TQSA 3P71T 1ZG3A 2IPXA 2IBTA 3M4XA 4DKJA 5DSTA 5K0NA 3ME5A 4DZRA 1G8SA 2B78A 5DXAA 2PXAA 3E7PA 3UJCA 2O05A 3G7UA 3R6TA 1P1CA 1XDZA 4PINA 4CTKA 3CJRA 3CCFA 1JR4A 2IFTA 3KR1A 5E1BA 1FBNA 5ERGB 3S68A 2ESRA 3TKYA 2I7CA 3LKDA 1KP9A 5B1SA 1R6AA 3IEIA 4BP3A 4LWOA 2GLUA 1YFJA 2JG3A 4GBED 4MHTA 5ICCA 3HVIA 2IP2A 1JTEA 3NVMB 2PWPA 2BZGA 2PJDA 2CMHA 4RSRA 3GWZA 2WA2A 1VPTA 2FHPA 3CJQA 3SXJA 3MB5A 4YV1A 3P9IA 1QAOA 2XYRA 5FHQA 2OXTA 3EVDA 3HVJA 1RI3A 3HA3A 4RV9A 3GIWA 5DWQA 5FQNA 2AVDA 4GC9A 3FRHA 3GXOA 2H11A 3GDHA 1IM8A 1P39A 2BM9A 3G88A 5EMMA 3FTEA 1SVUA 4PNEA 2NXJA 4E2WA 3OPNA 3B7PA 2CL5A 3ER9A 1NW5A 2ZULA 3DMGA 2EX4A 3KR2A 4CKCA 5CVDA 3GO4A 2CWWA 2ZTHA 1VE3A 3DR5A 1BHJA 3OFJA 5JUWA 3KPYA 1UIRA 1XDSA 2DPMA 2G71A 2QRVA 2ZVJA 2P3QA 3EVCA 3EVFA 3OFKA 3KKZA 3NDJA 3DXXA 3P8ZA 3TOSA 4BY9E 1M6YA 4GF5A 3OU6A 3P2IA 3T0IA 2Z6UA 4FP9A 4OQDA 4BLVA 1R8YA 4DQ0A 5BP7A 2P3LA 4CWAA 5K01A 3R24A 4AZWA 1F38A 4A6DA 5F2NA 4ER7A 2AOVA 3OCJA 4QVGA 3B5IA 2PWYA 5F2OA 4C05A 1BC5A 2PKWA 5P8WA 5K09A 3PTAA 4QPNA 2I9KA 1ZGAA 1QYRA 5H02A 2YXDA 5FA5A 3TR6A 2GPYA 3F4KA 5DLYA 3KQTA 3BUSA 3TFWA 3G5LA 2PX5A 4PIPA 4CKEA 2ZFUA 3LPMA 5DTRA 3TLJA 4E2YA 1YZHA 3E23A 3TRKA 3HCAA 3PVCA 2ZW9A 4R6WA 5GWXA 4DCMA 3FRIA 3UJDA 1INLA 2OY0A 3LX6A 4M7RA 5LR6A 3BWYA 4PYOA 3NWBA 4X1OA 4IV8A 5DM4A 2AOUA 3HNRA 2IH2A 5EMLA 1XJ5A 2OO3A 1VL5A 5DX8A 2AZTA 3ELYA 1X1AA 5CM2Z 2HWKA 8MHTA 3G2MA 3HP7A 5EHGA 4FSXA 1ZKDA 1L3BA 2CKDA 1QAQA 3EMDA 4RTKA 5CCBA 2PV0A 2EJTA 4R05A 5GP1A 4IV0A 2G70A 5GIPE 1TPYA 2ZWVA 5EPEA 3T7SA 3FUXA 3X0DA 1VLMA 1JQDA 2DULA 4RVGA 5CUQA 1NBIA 4KIGA 1AF7A 1ZGJA 2ONYA 3PB3A 4KW7A 1VBFA 4E2XA 3FTFA 2P7HA 3DXZA 5DM0A 2YXEA 5EMKA 5FADA 3MGGA 1SUSA 3DOUA 3FUTA 3GNLA 5C9ZA 3BWBA 5FHRA 2YXLA 2AOTB 2FK7A 3FYDA 2KW5A 3LKZA 2IH5A 5GM2A 2Z6AA 3A4TA 1YFLA 4U7PB 3CBGA 1N2XA 2OKCA 2XYVA 2GAFA 1B42A 1KR5A 5EEHA 5CD1A 1DCTA 1JQ3A 4ISCA 3NMUF 4PONA 3NJRA 3BGVA 1I9GA 4FZVA 3A7EA 5DPMA 3VC2A 3HCCA 1WXXA 1RI4A 3MTIA 1KYZA 3I53A 4U7TB 4QQNA 5DM1A 5DX0A 4WXHA 2C7OA 2EJUA 3KQOA 5E1MA 2VS1A 3KPJA 1EJ6A 1YF3A 5FUBA 1X1BA 2JHPA 4DMGA 4P58A 3HVKA 3EGEA 4PGGA 3VYWA 1SKMA 3MCZA 5DTMA 1EIZA 2P1DA 3EVBA 3EMBA 5E9WA 5HIKA 4O29A 4UOEA 3FPGA 3B3JA 3EVAA 4PIMA 1KPIA 2HNKA 4AZVA 4EKGA 3RIEA 3KQSA 4H0NA 3I9FA 4B17A 5E8JA 5K0BA 2P41A 3QOWA 1KHHA 2N47A 3GRZA 5CVUA 3CGGA 2FPOA 3TPZA 5E2BA 2ZBPA 5DM2A 2PY6A 2C7QA 3G2OA 3SSOA 4X63A 3UJBA 5GM1A 1JG1A 4RVFA 3R9XB 4FS8A 4P7GA 2BR3A 2P40A 5EQJB 1R00A 3M70A 5EG5A 5KYGA 3CKKA 3UJ8A 5E1OA 5LSAA 5CCXA 2JHAA 3E05A 3D2LA 4C06A 1F3LA 1VIDA 4MWZA 1XCJA 3RODA 5HIJA 5K0LA 3M6VA 4ER0A 4YMGA 3OE5A 4MIKA 1XDUA 4GOMD 3LDGA 1N7IA 4L7VA 5C1IA 3JWGA 4QPPA 3LBFA 1ORHA 4PYNA 3UA3A 3HTXA 2FK8A 1M6EX 1XXLA 3Q7EA 4DM3A 5FWAA 1MJFA 3GGDA 1AQIA 4PGHA 1NV9A 4KDRA 5ICEA 2GS9A 3MERA 4QQKA 4Z2YA 5LQKA 4IWNA 1D2CA 1NV8A 5DRTA 4HTFA 5DXJA 1VP9A 5CIYA 3CC8A 1KPHA 3P2EA 1JG3A 2Q41A 1FP1D 4P7KA 1SQFA 2AVNA 3SVZA 3U81A 3BWCA 3UJAA 3DULA 3HCFA 4EVIA 1O9GA 9MHTA 3FPHA 3JWHA 5DX1A 3O4FA 4Y2HA 2V74B 2PVCA 5G02A 4BP1A 2ZZMA 4FR0A 4BLWA 1TW2A 3DMHA 4PYQA 2G1PA 1I4WA 5T6BA 5GOZA 5HFJA 2EFJA 3BZBA 1UWVA 1RJDA 2K4MA 3HA7A 3ORHA 3TKAA 3I5UA 2ZBRA 4HH4A 5LQNA 4Y30A 2VZ9A 4NECA 1AV6A 2B25A 3R3HA 2G72A 4RTJA 1M0EA 3M6UA 1Z3CA 1JQEA 1X1CA 3FTDA 5EKXA 1R18A 2NYUA 2XYQA 3UA4A 4PCAA 5HIMA 4EMSA 3KQQA 2Y1WA 5KS2A 2PX2A 1MHTA 2NP7A 2PBFA 1BOOA 4E32A 3OU2A 2WK1A 2HV9A 1X19A 3PFHA 4X60A 5F2KA 4V0QA 4E33A 1JG2A 1HNNA 1L1EA 3DTNA 4PYJA 3NWEA 4ER6A 5K03A 4ZTBA 1G55A 4OX9Y 2UZ4A 3LECA 2FCAA 2E5WA 1XVAA 4YV0A 3UFBA 3BKXA 1DUSA 2P3OA 2QY6A 2GB4A 3B3GA
chains in the Genus database with same CATH superfamily
2EYUA 3UB4A 4PO3X 4BNVA 4D98A 4AKHA 2CDRA 4PWYA 2QK4A 1PIWA 3OSZA 5CITA 1X38A 1DEOA 4C89A 4CU2A 5JHHB 4JC5A 3TRJA 4MVYA 4TLMB 4ZZ2A 3QX7A 1U2ZA 1YCGA 1NW8A 1Y9JA 4NXNB 2C7VA 3H18A 1N4DA 2NQ2C 4TTPA 4KAXA 2D06A 3AF3A 1P4GA 2LKCA 1RWMA 3DVSX 3GG2A 4QDTA 5EJ4A 5DMXA 2VF5X 1E3DA 3JQ6A 4XKJA 1ELOA 1RJGA 2ZWMA 2ECFA 4YC7A 1AURA 4E70A 3KC2A 5F35A 1JQKA 2CF6A 4P86A 4UTVA 3PU6A 1PFKA 4N18A 1DO8A 4L4YA 4QC2A 5JXHA 1IXYA 4LF6B 3EC7A 3IOBA 2WIDA 3C4QA 5EIWA 1YJBA 5DHTA 3D2AA 2WIBA 2BFFA 4MLZA 4OTZA 1WDTA 1R0YA 1KFKB 4LQDA 1CS0A 2VPTA 4B1FA 1IY8A 3TNYA 2OGUA 2MMCA 2ZS7A 4CMEA 1E1NA 3B5EA 3OHMA 4I1OA 3SZMA 1OI2A 4ZGBA 5AQ1A 4GKBA 2FW1A 5K8JB 3GARA 1TYBE 2CLKB 2PAAA 2WVJA 1C9YA 1YI8A 4BMZA 4ZVPA 5I8WA 4QFDA 2YN2A 4JIGA 4TWBA 3MUOA 1XVLA 3Q8KA 3BE4A 3CUTA 1I7PA 4WOCA 4DA4A 1DKNA 5FPYA 2W2VA 2AG8A 3OC6A 3TD2A 2HW8A 3BF8A 4PHFA 2C07A 2RH4A 2M6LA 4ZZIA 2YXNA 1G63A 5BWBA 5K0JA 3QE3A 3U3OA 1UKCA 1C2YA 2Q9BA 5FLXA 3LDHA 4ZOLB 3WRXA 2VA9A 1E1CB 3O93A 2QPAA 3ZUPA 2VRWA 1SG9A 1W5SA 3V1NA 3CZPA 2I71A 2JATA 3P9SA 4GMGA 2XOXA 2ZR0A 4LDNA 4NXMB 5AW1A 1DJQA 5KWVA 4AZTA 3JR7A 3L7KA 5DN6D 2CXPA 3H16A 3KZNA 2RGRA 1J5XA 1VJTA 1BXGB 2AOUB 2AIRA 2J5XA 4BQRA 2OENG 1YBHA 5DCLA 3A6FA 2PKXA 1UQRA 1R4ZA 1EGQA 4GP6A 2C00A 1ZJ5A 3C8HA 3G2JA 2NU8A 2JDID 1JLLB 3LOQA 4KIWA 3S2ZA 1LBEA 4QBTA 3W79A 2O8DB 4Y0VA 4PYLA 3DP9A 4ZI2A 1RAGA 5AO9A 5EJ9A 1S4MA 3ZLTA 2GEDA 2XDAA 1E96A 4TYNA 3KR0A 2P2SA 5KQRA 3TI7A 4ZVUA 4U39A 4Q4HA 4RHTA 2GJ8A 1UJ6A 3BGSA 3N07A 5B2ZA 1DX4A 4OFWA 2CB0A 5U4XA 2CV2A 2EAUA 4UE6A 1NKVA 3HYTA 1QDUA 4R51A 4CEHA 3BFJA 3QBEA 4NNJA 1XHFA 3TIFA 2HR1A 3BCRA 1CEXA 3DGEC 1UJ5A 2G7MC 5D7BA 2NUAB 1XG5A 3BXOA 4RLFA 4LQ4A 4J0GA 2ZXUA 2J8ZA 4MKXA 5F21A 3GOQA 1ONOA 4LRWA 4ENQA 3H1EA 4KK3A 1UDWA 2Q5LA 1QFXA 1YBAA 4NBUA 2R4QA 3GUZA 1YR2A 2P30A 4MA4A 5K05A 4O4HA 4NICA 2CXTA 4ZWNA 1PL6A 3RVBA 3QX8A 1CU1A 1L7VC 2DWQA 2OD2A 3DDCA 3NHKA 1X0XA 3VDRA 4FBGA 2ZU0C 5TEVA 1PNQA 4GX1A 3TAUA 3FVTA 4B6SA 5A2QA 3E5NA 4KGZA 4YIKA 3RRJA 1H3FA 5DBOA 3JQCA 1UBFA 1OF1A 1CRZA 1L7XA 1IIBA 5EWMB 3NFYA 1K08A 1WVMA 1DAEA 1IY0A 3JVIA 3PWSA 3M9XA 4A26A 2I3AA 3TXYA 2NV6A 5K2MA 3C43A 4PTLA 5H70A 1CUVA 1AG9A 3EASA 4AZSA 1FP6A 1C3XA 1C1YA 1G291 1RXSA 2F3QA 3BMNB 2XWSA 2NQTA 1HE4A 3KT0A 4A5SA 4DXAA 1QFMA 4MW6A 4LWPA 4P4SB 1QB7A 1Z0AA 3MJSA 2WVHA 3LP8A 1IM2A 4RZIA 3UXMA 4DPKA 3RYHB 1VSQA 1ZNZA 3OE4A 3CB4A 4HADA 3MG9A 4FFRA 4OSEA 2VJBA 2ECOA 4RTOA 1LQTA 1H8ED 1NY6A 1NRXA 4ZCLA 1ZM3A 2EFGA 5F4BA 3UQZA 1J6UA 3CUSA 4JP8A 1Z29A 2Q6OA 4BNHA 1ORIA 1L6IA 2XTNA 4LG1A 3TCXB 2QE6A 3ED1A 3KDSE 5L40A 3UOGA 5ESXA 1QXSA 2W2KA 3LCCA 5AM2A 2CZQA 5DBHX 3VO1A 3RIYA 1QX4A 4CHTA 1NW3A 2EZ8A 1ZNYA 3CLSC 3NETA 4WJZA 1QGDA 4J1NA 2Q5OA 2VQ6A 1LRKA 2OCGA 3TTSA 2C8VA 3DSRA 1KMHB 5KQGA 3BVPA 4MINA 3QI7A 4WMLA 4OHVA 5K0CA 3OTOB 3F73A 1P9RA 5H68A 1SQ0A 3EGDA 4LCBA 2V45A 3AF0A 3OLZA 1UDXA 1G21E 3WLSA 1XNQB 1LVGA 2YDYA 4GOND 4A7PA 5FH9A 4G41A 1S3GA 1TZJA 3T1TA 4DIKA 1GR0A 1JR6A 3AERA 3R09A 4G56A 4BX9A 3P9ZA 4F11A 4JLBA 1LSOA 3Q41A 4F5ZA 5A1TA 3LF1A 1DS6A 3QU7A 2CFSA 2JHCA 4TLCA 4B6OA 1V0JA 1WIWA 4PXAA 1DC4A 1PKEA 3C7AA 3H9UA 3TR5A 2XXAB 3S8YA 1Z34A 3M82A 3NAGA 1TT7A 1DFGA 3RM3A 4EEZA 4D26A 4DEVA 2ACVA 2JIOA 3GRVA 2L0XA 4OQEA 4BXOA 5AVYA 3MGAA 2GBLC 2VQFB 1M9NA 3FCXA 2WUVA 1CDDA 1HGXA 2EJVA 4OQZA 2GASA 4F5EA 4Z3KA 1C7ZA 2ASEA 3UWMA 3ZOZA 1DQZA 3C85A 1KVSA 3FPFA 4ND6A 4Q4JB 4PV7A 1V71A 1E3IA 3D3JA 5E2AA 4CKBA 1M6VB 4JODA 4XWTA 5CVVA 4L5BA 1OBFO 3IBFA 3NONA 4ZK2A 4OGKA 2IYQA 5C4MA 2QD5A 2ZRNA 5DYGA 1WXQA 4EQZA 3HPQA 3IALA 2ON6A 4BGEA 3AYZB 3FGPA 2Z2JA 3HDTA 4WJKB 4WCVA 3K6JA 4XLZA 1W5AA 1NUHA 1W48A 2WHPB 3DTVB 3IYLW 3KPUA 1XYGA 5G0VA 4KR7A 2IEIA 1WP9A 1WG8A 5AXDA 2R47A 5IAAA 3DEHA 4XPZA 1JX6A 3P0RA 4Z9YA 3CIFA 3L5KA 3Q3VA 4PO1A 5HFAA 3CMCO 1KS9A 3IAXA 5U1PA 1QC5B 1P8AA 1LEHA 1KZ4A 1RXYA 2NO9A 3ME5A 5IKOA 4KXNA 4EVRA 4TS4A 3QE9Y 2ZUUA 5DXAA 4YO7A 2FSGA 3DFZA 4GS5A 1UC4B 3GD7A 1AA6A 2JF0A 4CVNA 1JR4A 1MEJA 5EE5B 4BNLA 4BEVA 4B0PA 4OI0A 4KUGA 3E6AA 3ZWVA 1XMVA 2G5TA 2GLUA 4MHTA 3JD4A 3KUDA 2O8CB 3SS8A 2JBWA 4IIFA 2FZLA 2R2AA 3EBPA 2X5XA 4JP2A 4WWHA 3DE2X 5AHXA 5DO9A 4DA8A 5E9AA 3ZDYB 4YV1A 3OPMA 1C9NA 4HDRA 4YCSA 1NJGA 1NUUA 1PK7A 3GUYA 2GZ2A 1DIGA 4TUYF 4AUMA 1CW2B 4KTVE 3HA3A 3QV1A 16PKA 3QOFA 5E38A 5FQNA 4BVGA 5AUNB 1EEXB 2BFPA 2C8LA 2Q4DA 4KLCA 2JIZA 2VF4X 1N3YA 3SJZA 4UCQA 1Q11A 2C5GA 2Q9AA 2PMKA 1QHIA 4RETA 2DFDA 2X4DA 3IKJA 3WMXA 2F17A 1HNZB 3UT5B 3EGWA 2X0FA 4YRIA 4GL2A 1BD3A 1M74A 1ZU5A 3FI9A 3O9MA 2WF7A 3LPLA 4FW8A 5D3ZA 4YXWA 3RNOA 3H9GA 5DWVA 2G71A 2WYOA 2Q4BA 1DAHA 3T9AA 1JBEA 1BX0A 3KYDA 4NMWA 2IS4A 3LWBA 4EGJA 4IGEA 4TLAA 3NNNA 5CM8B 2A4KA 2BEUA 1ORDA 3VISA 1YJAA 4MDFA 4XJXA 2LXNA 3NOOA 4H2DA 2ZR8A 4NJEB 2Z5GA 5KJ1A 1FFCA 4DLTA 2WI8A 5CW2A 4NENA 3EWAA 3LUDA 4DPLA 1SXJB 1MA3A 2J48A 3BH6A 4MB2A 3VTKA 3T3NA 5DI9A 2VNHA 1K89A 2BUBA 1GPBA 2FW0A 3TR6A 2QTMA 1FYVA 3WRVA 1U0TA 3H2KA 3TSOA 4ZOLA 1NQXA 2ZB7A 2ZB2A 4GSLA 3T5AA 1CK4A 4G0VA 3E23A 5C80A 3K5HA 3RO7A 1XEXB 1TO1E 1Z4QA 4NEQA 3WLAA 4CMIB 3AEUB 4GAEA 4WINA 4DWOA 4RK7A 3RS9A 2XHEA 1EDBA 4D56A 1VI2A 4KL8S 1TJNA 1QG4A 2AOUA 2GM5A 3RVNA 4E11A 5JJKA 5EMLA 1Q19A 2ZUWA 1GT91 3H17A 1OAAA 4QECA 4AECA 4ECAA 5KSWB 1M0TA 3LM8A 3MOGA 1L1RA 5J2UF 4KPUB 2A7QA 1NLUA 3DVAB 4MQLA 3X1MA 8MHTA 2O8DA 4WKCA 3FAZA 4IDHA 2VJOA 1G9XA 5I7UA 4CF3A 2YMMA 1EXNA 1ZM4A 1QS0A 2PV7A 3NOVA 3O9ZA 3QENA 1T2UA 2OV2A 2WUEA 5CCBA 2ZDQA 3DONA 3ZGYA 3HCNA 4W6QA 4NZOA 5EPEA 4CE6A 3DOIA 1JU4A 3HH8A 3TL6A 1C50A 3K09A 1I1QB 1VLMA 3CSUA 4UUMA 4XM1A 4RQUA 2JS7A 5BMVB 1ZGJA 4MS1A 3WLLA 1GLGA 3FKJA 2YQ5A 4IICA 3RK4A 3ZHTA 4E2XA 4G81A 2P7HA 2FOIA 5SZKB 1QZTA 3PVSA 4EH1A 4F1KA 1XVUA 4R98A 4XFJA 2FEKA 4A0HA 1U98A 4RMIA 2I0FA 2I65A 3I62A 1IG0A 5EE1A 2QT9A 1ZONA 2QVCA 2YICA 2PLNA 3KG2A 5MFZA 1Z5VA 3LMKA 1DCTA 3RD5A 2D00A 4EECA 1AUVA 3NUGA 3D0RA 3GLSA 1GXSA 1NXOA 1VCNA 3A10A 3BHMA 4O1MA 4CV1A 1A9QA 1GKYA 2YYZA 3GCGA 3R5HA 1NDHA 2AMFA 1Z0ZA 4U7TB 4NQRA 4WXHA 1OBOA 5CJPA 3H4IA 4Z9FA 1KI9A 1T5SA 2F3UA 3T06B 3FHJA 4ZEMA 2NU6B 3ZDEA 5BSFA 2AWNA 3WB0A 4FYXA 3BB4A 4LI0A 3AFOA 4QWWA 5JFTA 2YC4C 3RHTA 1B0AA 3FFTA 5E9WA 3BERA 2CJWB 3DS8A 1XP8A 3QY0A 5AM0A 1L4NA 2B9VA 2WMNB 3Q3GE 3UJNA 3KTDA 1DKPA 1SVMA 4ZO9A 2CL0X 2PZJA 4U2GA 3KQSA 4A0SA 4A2PA 5KNDD 4JWKA 3W7BA 2Y0CA 4FHGA 1VI5A 2GUGA 4DUGD 3DWIA 1PO7A 1MB3A 4IFIA 3RWOA 1X7YB 3U2QA 3R9XB 2ZYIA 4P4SA 4YDHB 5DJ5A 4IIDA 2P40A 4CMKA 2A78A 1SIWA 4CQJA 3WQHA 1E1RA 2YYSA 3MRTA 5DCUA 3RYHA 1H65A 5TXGA 4RADA 3S55A 3JQEA 3VPAA 2YOFA 3D2LA 4H59A 1ONBA 5JNRA 1DWPA 4M0KA 4IIVA 4HS9A 4OJTA 2AUMA 2PZ8A 3TIGA 3K4HA 5GZ6A 1BFDA 2B4KA 2J7KA 4EX6A 1XVVA 1NN5A 2HA3A 1RC8A 1F0PA 1Z82A 4FGSA 4G5FA 4B7XA 5F77A 5SY9A 3SE7A 5DEIA 3X43A 5ADVA 5KPJA 2FFBA 3SICE 2H29A 4KNWA 3CISA 4MRMB 3IBTA 3WV4A 4HKTA 2GK3A 3M6MD 2CHFA 4TWZA 2Z2XA 4WZBB 4XB1A 5AQEA 5DW3A 1H5UA 3QVJA 1VHDA 4YWJA 5B2FA 2CDAA 5C34B 1G3MA 1KPHA 2VP5A 4G0NA 1VG9B 4IRMA 3DTTA 5DMHA 5A9RA 1P7CA 4BNNA 5LZ8A 3U81A 3GC6A 2WAXA 1ZCAA 1QIDA 3TTYA 1GV1A 1TVCA 3L8GA 1AE1A 1FYFA 1OHHA 4KIJA 5H16A 1QHXA 1Z17A 4LYYA 3GFFA 4UNRA 2A5YB 3ZPXA 5JBQA 4JU9A 1HTTA 3UG6A 3EMVA 5C31A 1UBCA 1A8UA 1QKKA 1NP3A 4G1EB 3ZK7A 5FUVA 1XP5A 5JQGB 3UHFA 1GQQA 5HRAA 3CZRA 3PDUA 3HG7A 1DC6A 3ROXA 1P7YA 2ECKA 3E22B 3O8LA 4IJ6A 3A11A 4NEGA 2C3YA 1AV6A 2B25A 2DWOA 2YZKA 2GXSA 4PQRA 5TVGA 1QG0A 1VCOA 3FYTA 3N8HA 2XXAA 1LD3A 1JQEA 4R16A 1F4PA 5BWLA 5EKXA 4WZZA 1VHQA 3T34A 2IIBA 2WJHA 3F5SA 5ILGA 5C7IO 1CSEE 3CVXA 4DDUA 1B8PA 4RO0A 3HADA 3UATA 4R2LA 2PUWA 2ZAYA 3PR1A 4KU4A 4N0EA 3D81A 3GUCA 4WOKA 5FB3A 3DTNA 4E33A 2XD9A 4E51A 3MELA 3CLHA 4X44A 4ZTBA 2ACWA 1DPGA 3N2NA 1ZH6A 4B47A 1P6QA 3W8FA 1VL2A 1ZWLA 3C45A 1M6VA 4IJQA 4LE2A 3ZVNA 3U7GA 1DSSG 4KAFA 1PD0A 2RCNA 2RH8A 1I1NA 3QG1A 4B8ZA 1UKZA 4HJRA 4Q39A 1YZUA 5BT8A 1NVVQ 3HN6A 1OKKA 2CXNA 4AXBA 1SK9A 2WHPA 3DTVA 2IHVA 1E79A 1QR6A 3COVA 3T9CA 4BTLA 3F49S 4D0GA 4E09A 4FE3A 2R6FA 3TEJA 1EIWA 4O5OA 4XUGB 5HS4A 1KRWA 2VUUA 4E08A 3W2IA 3EE6A 1G60A 5JSZB 2NZJA 3WQRA 1QC5A 5IYZB 1VIMA 1M8GA 2I5PO 3G9XA 1I3NA 3NM6B 4B4VA 1IOLA 1H2WA 3KQPA 1MDBA 3IVRA 2D59A 1N6RA 4ALIA 3OKFA 4XI9A 1BSVA 4H4EA 3E5RA 2QKYA 3L8EA 2GPSA 2NSLA 3O74A 2BHSA 2QM0A 1W1IA 1HT3A 5H1YA 1WUKS 4UVDA 1O54A 1JDBB 3ML1A 3WKBA 2JFWA 3DAGA 2DC1A 1X7HA 3W78A 3OU7A 4MW9A 3WQQA 3A1CA 5AUQA 1Z47A 1PAUA 1YDEA 1BVHA 4YAOA 2GTPA 3RHFA 4BQPA 4OJYA 5FQOA 5BWMA 1R5OA 1LDBA 1U9JA 1X7XA 2UZ3A 3ST7A 3HCWA 1UKAA 3GP5A 2QXTA 3DUWA 3C3PA 3KB2A 3S1AB 1NUTA 5LBIA 2ZWPA 3V4SA 2YW2A 5MFPA 2Q6KA 2XUJA 1SPBS 4YBZA 4Z5XA 5I51A 2AT1A 2BAGA 1V8FA 1V5EA 2I87A 1V1RB 3C7KA 3DAPA 1G8PA 3E9DA 1A4XA 3PUJA 4FMBB 4EB8A 5DYTA 4EPRA 3T7TA 2QXUA 3A7DA 3BPSA 3IAAA 4QOJA 4B4WA 1FMCA 3IDAA 4XB6B 1HO3A 1AZTA 1O8CA 1TCAA 1G6HA 3PQFA 4LVOA 1AXGA 1Y8CA 2GSDA 3L41A 5KDOA 5KREA 4C5AA 4IHJA 4KXFB 1T9GS 4CR6A 4WX2B 2DY1A 1KDRA 2OLJA 3CEJA 4P5DA 4DEYA 1T34A 1BMTA 2H7CA 4YFVA 5JROA 2EDCA 4KQEA 4ZTZB 1RWBA 4Q1CA 2D0DA 3PUHA 4BNWA 4DLAA 1SBTA 1GVNB 1GQ2A 3R0ZA 4GD3Q 1RP7A 1SXJA 3SE0A 3AZQA 5L9AA 3JYPA 1KC3A 1AQLA 1ODJA 2BELA 4G2NA 5DXFA 3KELA 4OHCA 3VSEA 3RAFC 3AP3A 2XSZA 4DFDA 4XTRA 2VSYA 3MIIA 3LTNC 1IAQA 2AQKA 1WU8A 3RUHA 4BFLA 3CLUC 5IDQA 4AJ4A 2QVXX 5A9SB 1OD6A 1G8MA 5ALNA 4CMIA 3HUDA 2QUJA 1ZK1A 1ST3A 1R0CA 4GX5A 5AJVB 5HHTA 2BGNA 1AO0A 1JEOA 3G8AA 4DVGA 2YWDA 3JQRA 2J09A 3EN0A 1O6FA 2VI5A 3BWDD 3KHSA 2WYVA 2C0PA 5GGYA 1FUIA 2VAPA 2XUGA 5ISMA 3DLAA 1E0AA 1WF3A 4YACA 3T7EA 1S3SA 4KPUA 3DMRA 1RYBA 5D3KA 3S3TA 2O0MA 2WDZA 1RKXA 3F5FA 4S2UA 4A0QA 3DW3X 1PBNA 1UZLA 2O8NA 5LQJA 2P77A 3O31A 3OQMA 1E4YA 4C2AA 2OCAA 1NIJA 3P7MA 3KLPX 3SHTA 3V8BA 5EJIA 1NI4B 3ELUA 1PUIA 3GK3A 1OJLA 3E3NA 3IOMA 1A9ZA 1L4KA 3K8QA 4JT2A 1U3CA 2K7ZA 2PUJA 3HKCB 1J5EB 5BMVA 1XCMA 3OQJA 3FSEA 4A2QA 1DI0A 1TF5A 3E7DA 4LECA 4D4LA 3AGQA 1DKQA 3SQWA 5ALGA 3KRTA 1SFRA 3MGKA 1JIKA 5JSYA 4WXPA 3T99A 3WGKA 3X1YA 2PUTA 4YUZA 2CLOB 4X7MA 1EFPA 1U1FA 1FRQA 2O2DA 1ODCA 4RPLA 3STHA 2QZZA 4DNFA 1RKVA 1NE2A 3PUXA 2Q4TA 4R9NA 4ZRNA 5DSXA 4G1BA 2XB6A 4F45A 5KBYA 3V8PA 3VR2A 2AJBA 2NLOA 1H1LB 1UBNA 4PRLA 3CH7A 3QUSA 4NE9A 1RIFA 2ZT5A 3IP7A 3GV0A 2NU6A 2X3FA 2CD9A 1KRHA 2XJ4A 4MI3A 1P0CA 5JH7B 4QZVA 4LFBB 3W3AH 2CVOA 3KEOA 3G2LA 3QFCA 1L1FA 3PUYA 2CJWA 2CHEA 3PR3A 4R8RA 1J8YF 1E5VA 4W9RA 2A92A 1XI2A 5HJ5A 3Q7TA 3DBOB 3NOQA 2JD0A 2BSQA 4IMIB 1Y4UA 3WGVA 1M10A 2HBZA 3D4PA 2B1IA 5JEEA 4OB7A 3ADKA 4WFIA 2PIDA 1DXOA 4MUKA 1C3OA 4W4TA 2CNBA 3LP6A 2DGDA 3BXEA 4HEA6 4JLNA 1B14A 4U9UA 5AXBA 4MUXA 3H5LA 1X7YA 1H2AS 4ZI3A 3R9XA 2I66A 4C1BA 3B6KA 4BO1A 4ZCRA 3RHZA 3QVUA 4RHXA 1HQDA 2H31A 2V7EA 2WIJA 1TJYA 3EZLA 1T43A 1NUAA 3NU1A 3O1IC 4GT1A 3QFFA 1E4OA 4RTLA 4C21A 4DC0A 1U7UA 4FFLA 4QYWA 1M1YE 4HB4A 1LVUA 4BMYA 1PTJA 4YGYA 4ZEVA 4G5GA 2Q8QA 1C3EA 3L1HA 2DSNA 5IJZA 4HR7A 5HEKA 1V16B 5FLEX 5JT1A 1CY1A 3QOYA 3L3BA 4MRMA 1PS0A 2WNSA 3DD5A 5TIIA 4FC7A 5J2TA 3WB9A 2DQZA 4FWTA 3K35A 3ZD8A 1ENOA 4WZBA 3I58A 3R9IA 3LH5A 3HLKA 1Z63A 3FKSD 2E3JA 2YZGA 3CN7A 1HORA 2NO6A 5C18A 5LFAA 1SBHA 1S1MA 4HLNA 1BEZA 5E8RA 1PJTA 1DAIA 1PJSA 1WDLA 3IKVA 3ICEA 4BO0A 2JHFA 4UHBA 2QU7A 3CLRD 3ZZTA 2JFVA 3THXA 4AY3A 2QRQA 2NXWA 4ON9A 4FTWA 2J9FB 5JQGA 2EFEB 4JOCA 3QJYA 1RQXA 4MCAA 3ULKA 3AR4A 4G4SP 1CLUA 1RI5A 3LLVA 3AVQA 1R8XA 3AJAA 1R3UA 1K6IA 3B8EA 1DO2A 3O5AA 3JS5A 5ALDA 5TMEA 4DNOA 5AYVA 4FLEA 1LRJA 2EIXA 2GWRA 2QAGC 4HY3A 4OHWA 5JSKA 2WWVD 3SYLA 1DDOA 1GNVA 3L18A 3RSHA 2IF0A 3UFXA 3TW6A 3TLAA 5F7JA 5LP1A 3UPTA 4OXKA 2JFUA 3L6CA 3DCIA 4RABA 2O2ZA 4XIIA 3UCEA 3R0IA 4TSRA 3OP4A 4C4RA 4BEWA 4Y1FA 5G1NA 5AW5A 2P9TA 3H7IA 3JTMA 1ZUHA 4LOHA 4J1TA 3UT6A 2EZ9A 4U7FA 2IV3A 1NPYA 2F1KA 1MX1A 3QLTA 4H27A 4MKFA 3WAJA 1P1CA 2YVQA 4Z9BA 1THGA 2GERA 4N5NA 1KQFA 4DB2A 3O8QB 4MS4A 1UJCA 4EA8A 1DAPA 3TTXA 2ZUBA 1JWLA 4OU5A 2A58A 2XJ9A 5HZKA 1QWOA 1YKGA 2ADFA 3C5VA 4Q4DA 4EUKA 5JMOA 3WG9A 5K20A 4Z7JA 1CZKA 1KERA 1UPFA 2E1PA 4HNQA 4N49A 5HF5A 4RZQA 3RVKA 4QEZA 3NHYA 1FMJA 4JOSA 1GTJ1 4UDNA 2UDPA 3ICCA 5B3AA 1GAEO 2H1IA 5JD5A 2ZOSA 4HAIA 4TYMA 2C4VA 3UHAA 4OQMA 2HGZA 1P72A 2R2GA 3BCHA 2FG7C 3LY7A 3I30X 3NGMA 4J2TA 2WQZA 4OCZA 5JSZA 2D0OB 1UDCA 3I04A 4GQIA 3CVJA 4ZTUB 1P39A 1GPJA 3O1HB 3FTEA 3TN7A 1IZ8A 1T9HA 2G76A 4PNEA 5GAJA 4EYQA 1O4VA 4X90A 2R5FA 3BHNA 1JP7A 3OPNA 4E2WA 1PVOA 2ZULA 1Q7RA 4JD5A 3UWOA 1N2SA 4H1TA 4JLOA 1W75A 3GA5A 1Z7GA 4WA8A 3E7FA 2X6TA 3GO4A 1E1YA 2ZQYA 1V6SA 5C4IA 3U56A 1W5TA 2QYSA 1KEWA 2VJNA 3WL7A 2B4AA 4ALJA 3H2HA 2CXXA 4V3CA 4GXQA 5CX1A 2RK4A 3RK0A 1QP4A 2Q6LA 3R3ZA 3OU6A 4X8HA 2Z4SA 3NAQA 4OQDA 4BZPA 2PH3A 1VRCA 4AS1A 2PD3A 4HUJA 3LOPA 1KEPA 1RHQA 2KX7A 4GLFA 5F2OA 2PWYA 1KETA 3S1AA 3OSUA 1PHPA 4Z51A 1EGVB 1NW9B 4UVGA 5DW0A 1X8JA 1U3GA 2YY5A 4EMTA 3QXHA 4L73A 3NIWA 3PEVA 1V1RA 2P5TB 3KQTA 5KOJB 1YD7A 4JHLA 2ZFUA 4PIPA 3LNTA 3TLJA 1U2GC 3E0QA 4CR7A 1X74A 4LBWA 5IJXA 3HCAA 3M1IA 1FFSA 5H80A 3RFUA 3N58A 1LZLA 1INLA 2JCYA 2VAWA 2VDQB 2XMSA 3LT4A 3LV8A 4M7RA 4PYOA 5LR6A 5T3UA 1E6CA 1Q2UA 3K96A 4Y6LA 4YP7A 1JDNA 4GR9A 3WKEA 4KVAA 3I2FA 1QUEA 1GUZA 1CB0A 2H2WA 1N1MA 2FSFA 4JAVC 4L08A 3VGJA 4ZDJA 4OP3A 4DMUB 2GK7A 3L7JA 5THXA 4PLHA 4N47A 1A9OA 3EMDA 4QJ5A 5KTTA 1KP2A 2TS1A 2YRXA 3KLNA 4Q82A 2ZYHA 2Z9CA 3FUXA 1JAIA 3AUAA 3PEUA 3WWZA 1QNLA 2NO7A 1EU1A 2V1XA 3PXXA 3OEHA 4M4SA 4J6EA 4YP1A 5KNCA 5A9SA 4TL7A 5FTNA 5I4BA 3VMFA 1AGRA 2A0XA 3AEXA 2ECQA 2WJWA 3NM4A 2LCQA 2PL9A 1KZ7B 1MOZA 4UM9D 1T1GA 1K6EA 5EPOA 2V6GA 4DN6A 2HFJA 4Q1VA 3RR2A 3C3BA 2IH5A 2AQ8A 2BGUA 2IOQA 3JXEA 3T54A 4XJTA 4BNDB 5BV0A 3BRSA 4X20B 2A9VA 5BR4A 4EHLA 4KITB 2XRZA 4YRFA 3G68A 3VJMA 4D1YA 4MITA 4TTQA 3OQVA 3S0JA 2PRKA 3QVWA 1FQWA 1CEQA 2DQSA 3EQ6A 5LU9A 5LWHA 2EXXA 2FKNA 4WXYB 3DW1X 3KPJA 3DE6X 1VOTA 4GDMA 2X6RA 1XR3A 4RE6A 4RAQA 1KQGA 1NPTO 3F97A 3KLBA 4O29A 4JI5B 3LS2A 3U60B 2JLSA 4CMCA 3B3JA 4BMXA 2QLBA 3RKSA 3TLKA 2RBKA 3DDSA 3TSYA 5IUNC 4FYVA 4H0NA 2HL6A 4BNJA 1X1TA 2GJSA 3LC0A 4YS6A 3X2FA 5HW0A 1NBWB 2X8LA 3O38A 4JJ6A 3RTEA 5ILOA 1RQ7A 2FWPA 5HE9A 3RE1A 3WB1A 4P84A 1OFIA 1ZA2A 1LWOA 2ZWOA 4IO0A 1RHMA 2H4FA 3KJEA 4RZ2A 5AHOA 2BGKA 2UUOA 4Z4QA 2WF5A 1GQOA 1VSVA 2PJZA 2WLSA 3KWLA 2B3DA 4TMWA 3VR0A 5BWOA 1J0EA 3RUEA 2NACA 2HUPA 5FL3A 1EVEA 3II6X 2P9FA 2B82A 3EGCA 1J25A 2VVTA 4FOSA 4KMRA 5EESA 5EZYA 2ZXFA 2HHCA 2ZIUB 2MYUA 2R79A 5JH7A 4LXHA 3DB1A 3EPRA 4LJ5A 3IJRA 4N1AA 4Y98A 5ANRB 4AJPA 1GUAA 2WJZB 4ZP1A 4XEUA 1X39A 2HZ7A 4FEAA 3WJ1A 2FOLA 4IYRA 4KKXB 3RKUA 3ZV6A 1G8HA 2CVFA 4YAJA 2Y93A 1SK8A 3AL3A 1MFPA 3DLPX 4I5DA 3PCRB 3WBJA 4CCYB 1NV9A 1H8HA 2YJTD 3PR2B 5CD9A 3COJA 4F71A 1SC6A 1SU8A 2EJWA 2HCTA 4OXXA 2PZMA 2FPLA 1NIPA 4LC9A 1EH5A 1L6RA 3CC8A 3TPFA 4CGYA 5I9BA 2ORYA 1LK5A 3P9PA 4KRXA 3ZE7A 2H1CA 3HCFA 2ETVA 4AU1A 1XAIA 1FYWA 4K9NA 2P68A 2ZZMA 3WSVA 3QUQA 4V0NA 5SV2A 3P0HA 2A35A 3F6RA 4G1VA 3SZLA 4HNHA 5JMTA 4PYQA 5DGIA 1N1DA 1I4WA 5A3QA 1N32B 4TKVB 3QM1A 4B81A 3K30A 2Q4RA 3LZ6A 1V16A 3R5TA 5DKFA 3MINB 1GG9A 2VA8A 1QK5A 1H6BA 4XGQA 4JI3B 2E6UX 3GNTA 4H3SA 1VE1A 1YRHA 2ZB4A 2OO7A 4PLCA 1R3DA 6REQA 3RJTA 4FNMA 2QZSA 3VOBA 2QNBA 1MVLA 2A9OA 3UA4A 4F5DA 3KQQA 4G25A 5LBUA 3ZW8A 5KS2A 3ZV7A 2YMQA 1L4LA 4D6XA 1QYWA 1W5BA 5F2KA 3ROFA 4F06A 2H52A 4HSEA 4URHA 2LNDA 5K03A 3VZSA 3VZRA 3IMEA 3UXYA 1PT9A 1QOQB 3E70C 3LECA 3AF5A 1GCUA 2I1LA 3UFBA 1D0VA 5KTNA 1XEWX 1DEHA 2ZYGA 3IBSA 3PGA1 4LZZA 3DFUA 4O2BB 1MKYA 2C9MA 4A6EA 1KI2A 2GBCA 2NU7B 5AR1A 1QYXA 1Z6PA 3NTQA 5FPKA 4U2DA 4NX2A 1EFLA 4CUJA 1SPXA 4DGSA 4UUOA 4WKOA 3ZWPA 3SQMA 3KCQA 3ICPA 3OZTA 4L07A 4B31A 5I9LA 5KOJA 2XZDA 2C2GA 5JZOA 1OTXA 4ITRC 1D2HA 3HACA 1PT7A 2WZDA 3CX7A 5CNKA 2P9BA 1VBKA 3WTCA 5CB6A 2D7JA 3ZCRA 1DIAA 4LZLA 4RJTA 2ZM6B 3F8WA 2QRZA 4EHHA 5CT8A 1TAQA 3GLGA 1Y6FA 3A3YA 1T10A 4KQCA 2VWGA 2ZSKA 3TQRA 1KE1A 5FPPA 2QXYA 3ZWXA 1Q6YA 4AICA 2FZWA 2XVXA 3VR6A 3O8QA 3JQFA 3I1IA 3K2IA 3TLMA 5B1IA 2VTEA 3OQHA 5LIRA 4X7PA 1G2IA 2Y05A 4OQQA 2XCOA 3TKLA 1USVA 1NC1A 2HQRA 2W11A 3I6QA 3NPAA 5ICSA 2P62A 2Z3VA 1OXKB 3BEDA 2GAOA 4M1ZA 4R2MA 4YAKA 4DYVA 1P6XA 1J2YA 3ON5A 4DC9A 4QGAA 4Y9UA 3L4BC 4UTRA 4IIEA 4G9EA 1KSGA 1NVTA 3T7RA 5CVTA 1BDIA 1YKSA 4QOEA 2A6PA 1RPTA 4PIVA 4G8CA 5LYYA 3ZJYA 4D4GA 1L4GA 2FI1A 2Q4OA 1Y5LA 4EYKA 2OG1A 1HE2A 1PK9A 3HXQA 4B7CA 2WILA 2HBRA 2EFCB 5KTOA 5IJ0B 1XLWA 2AXNA 3UQYS 1WY7A 4EBFA 1XHLA 4RVHA 1XEFA 3BF7A 2HJ9A 3C8DA 2E48A 2D4HA 3M5CA 3P4YA 4IHJF 4R6XA 4RJIA 3T52A 4GMDA 4B0OA 2ZETA 5A04A 1AK1A 3EY9A 5H9VA 5ALUA 3PC8C 3HQ4O 4GYWA 1ZN2A 4ZQBA 5ERXA 1TM3E 1FUYB 2G6TA 1T3SA 3VV3A 2QMHA 5FBVB 3A6KA 1W36B 1JI3A 2YQZA 1AQJA 2C31A 3AUXA 3FHLA 2BKUA 2AD1A 2VYNA 2WFAA 1YRLA 3E15A 4EVSA 1ECPA 2O07A 1WMEA 5KOHB 2FPPB 2O8BA 2BGLA 2AR7A 3BB3A 3MT8A 1ZS9A 4GC5A 2VDVE 3K9WA 4BFSA 1CQWA 4HG2A 3U7RA 1WPRA 1XD2B 4TZKA 3ZBQA 4LKOA 4BKQA 4EAAA 2YZMA 3LC1O 3QUTA 5FFFA 2C9CA 4NBRA 5FFMA 4B34A 4D4MA 2ZREA 2Z1NA 5CG1A 3W2EA 3BRWA 1GYRA 2Z83A 3CZ9A 3N2KA 5AW4A 4MPDA 3UAZA 4AL4A 4Y2UA 3GRRA 2VP3A 2HLNA 5ICMA 4Q21A 1ISJA 2X9LA 3SEAA 4RKFA 4S04A 3OFVA 2FRXA 1SUIA 4LBVA 3SR3A 1ZOSA 2RBGA 1JDPA 2YFKA 3E8XA 2GH1A 4FFDA 4MRVA 4GLLA 1XTZA 1Z7BA 2UYHA 3T3PB 4BNZA 1C1XA 3KTFA 3M0EA 1Z8HA 3G6KA 3TMKA 4MGIR 2Y68A 1NLMA 3LCVB 1I01A 5TGZA 4C08A 2HQSA 3DEIA 2AZMA 2OYSA 4I9NA 2JHGA 3GAMA 1IY9A 5K8VA 3C16C 1J20A 3CR3C 1GZ5A 1RM5A 3I9V6 4CQLB 2QUKA 1TJ4A 5FUYA 3ZH9B 1SCIA 5C8VA 4TVSA 3TVTA 5C51B 3WNDA 3WLIA 2GN0A 1TZBA 2D4AA 1FCJA 1PI3A 2OCDA 5FOQA 1R9MA 1YHNA 1FRVA 1LFAA 2GFIA 5TPZA 3K9HA 1OT5A 3R0VA 3ERCA 1R16A 5EC8A 1UC8A 3UY4A 2P4SA 1LPNA 2I2BA 3IOCA 2QQGA 4HQ0A 5CJJA 4G23A 4P4NA 3WWOA 3MCTA 1NTOA 2OBYA 3L7BA 1CZLA 1W4ZA 1KJNA 1H9BA 1TCUA 2VAXA 5GV8A 5JBNA 2D1SA 1SC3A 2DRIA 3E1KA 3R6GA 4P38A 4BNDA 3MYYA 5IT4A 2AOXA 1GNSA 4OQPA 9ABPA 5JDIC 3PD7A 2XOKA 1T8SA 4EPXA 3IQHX 2HF2A 4IDOA 2J3LA 3K1YA 5HPYB 5CK4A 3ZDCA 4CTJA 3X44A 2DUUA 3BJZA 2GHTA 1VMEA 4I1IA 2B69A 2D74A 2Z8YA 1H2EA 1Q3TA 4H4DA 3GWGA 4CEJA 5TY0A 2HJHA 3QPCA 1W88B 4M37A 3S7TA 4DDHA 1KYIA 3FMPB 2AN9A 1T6NA 2RONA 3WLOA 4AYXA 2IGBA 1USWA 4WRRA 2HPAA 4DQUA 5AVZA 2MU1A 3MNFA 4HPWA 5A4DA 4WLUA 2Z0MA 3V97A 2HMSA 3AETB 1AQNA 1HG1A 3HGTA 2ZJ3A 2F9MA 4BX0A 1KE2A 4Z3OA 1GGMA 3RJ5A 3PEYA 2GHQA 4F85A 4AX4A 4QODA 4YJ3F 5KYNA 5JCOA 3ZU3A 5IARA 2QN7A 5K6AC 3C1UA 1M5RA 1FEZA 1NF2A 3EY4A 4L5YA 4CR8A 3KZOA 2V6IA 3L8YA 1QLWA 4JA2A 4KR0A 1ZICA 1R5NA 4HVTA 5IWCA 4MIYA 3B6JA 4PLTA 2GDJA 4PEVA 5EAIA 2PGDA 5K3CA 1WXDA 4BJ5A 3H6HA 3DBVO 1SCKA 4PZLA 1V37A 4R1PA 3RW9A 3AEYA 3EUWA 4RK5A 1DOAA 3RRFA 1G7TA 2EWMA 5AP9A 4LJSA 2V3WA 1S8NA 2E55A 2YIMA 1X77A 3IAS6 3VFDA 4CCYA 1Q1BA 4E03A 3N0RA 3A31A 4U0KA 1AVTA 3E9EA 1SG0A 2YMLA 1E1MA 1K9SA 2OL4A 1I8TA 3DZBA 3BH7A 2QRLA 1U1CA 1NQAO 3BXPA 5BN3B 3CHYA 4GRAA 4H7JA 4M86A 3WZLA 4U5QA 2JGEA 4R9VA 5IAGA 4ZDKA 1SO8A 1QJCA 1Z4PX 2I6TA 2QTVB 4V24A 1OZHA 1OFVA 5JZMA 2N0SA 4TLLB 5CK5A 1FSSA 5DF1A 2LKDA 1SCQA 3N6RA 2ZRIA 4TKVA 1OWOA 4GIBA 4PR0A 3P45A 3AUSA 4RA9B 1TD9A 3TZKA 3ZWQA 4TL8A 3GDGA 2DLCX 2NO5A 3PD0A 4R01A 3MINA 5BY2A 3AL0C 3D1LA 4ND4A 3UAXA 3P0JA 3ZI7A 1K5HA 1E59A 3PHGA 5TJ9A 2AFHE 1XJWA 1N7HA 1P4RA 2HA5A 1L4MA 4JSRA 1GZUA 4FMCB 4EWLA 1WDMA 5JSUA 1Y8RA 2W6CX 2IBTA 2BE9A 1QGUB 1X1RA 3A9UA 3O0DA 1IEWA 1N9KA 4R71A 4IEFB 1O95C 5K0NA 5TQ0B 4DZRA 2JJYA 4PE5B 4UNIA 2DPXA 3EZ2A 4P32A 4PTYA 5A5EA 1BHSA 4DV0B 3QWBA 3M6AA 1N6NA 1E62A 1TU4A 1Z5WA 1GU7A 1CUWA 1UDBA 3MUEA 5FR1A 4NZNA 4O2BA 4ID9A 4B3FX 2P2LA 1E0JA 2I7CA 3RWBA 2I1WA 1Z6YA 2SICE 3DUFA 2FLWA 1JT9A 1R88A 1RACA 3T61A 1ZPDA 1ZOLA 2POQX 3Q4GA 1OE0A 3EYAA 4IFEA 5AKLA 2FFJA 4IWXA 3DBRB 4QYXA 1PX0A 1RABA 3TJRA 3LBAA 3AHDA 3PGJA 5T4BA 5JQWA 1E18A 1LBSA 4LNHA 4DLSA 1WXIA 1EFTA 4GP7A 4DQLA 1AKWA 3WIEA 1AA9A 1ND6A 3NWPA 3ZKAA 2XMRA 2A8YA 4CF5A 3OJXA 1C9DB 2QX8A 2EX4A 4MVJA 2P79A 3VVLA 1ATZA 1RLMA 2AXQA 2OQVA 4QBHA 2YWRA 4TVKA 2KJQA 3TQFA 5F9FA 4ZGWA 4PNHA 4BUJA 2XMQA 3B9QA 1U2QA 3F5MA 5I8PA 2QSJA 1Q44A 1RRGA 5CYGA 4OEHA 5I9MA 1QX3A 2RGEA 4QBKA 1UK9A 3L4JA 1Z18A 3G9ZA 4B7UA 2GQ0A 3L1IA 4FINA 3GZJA 3NCHA 3QH4A 3E8MA 3F6BX 5F2NA 1ZNXA 3UHPA 4CM9A 5LYJB 4HGQA 1GTRA 2O2GA 2G40A 3RC2A 3OT4A 2PSJA 1OA1A 2NZWA 3DWFA 4G0QA 4WQMA 4F9FA 2B30A 4DSZA 1W87A 4M0EA 4Z0NA 2RC5A 4D8XA 2DR0A 4OHMA 1JYFA 1MIHA 3SVTA 4JLJA 1R8JA 4BL5A 4B6JA 4D3YA 3BMXA 2FWIA 2R00A 3CNQS 4RF5A 5DLYA 3BUSA 3GYBA 3Q2IA 4LA4A 1L5SA 5ECDA 4F2WA 1H4QA 2C92A 4XASA 4K9MA 4RD4A 1U0NA 3BG5A 3A1UA 4NULA 4YJ2A 5CLIA 2QSZA 3PVCA 4XDHA 1M8JA 2H57A 4G0ZA 4CLOA 4RJKA 3NLLA 2IYUA 1VJDA 4MPRA 1P7WA 4JZYA 3SFZA 5A4FS 3DWEX 4UXIA 3VO9A 4E6PA 4NCBA 3GEEA 4YI5A 4D79A 3IUQA 2G8LA 1NVFA 4RF3A 1ECCA 2MOKA 1PWHA 3GN2A 3LUGA 3QGMA 4DLPA 2VQ3A 2WFLB 3LC2O 2AZTA 2B4RO 2IEAA 4WNAB 2HK9A 5BR8B 2V7BA 4TWRA 1TMKA 2AJTA 3DV0B 4ANFA 1F1BA 1I2CA 4FSXA 1PTKA 1JS1X 4B4OA 1C7JA 2DE0X 1MO6A 4JASB 3CWCA 2E4UA 2FPPA 3VKFA 1M2KA 1W73A 1WQ1R 3GUHA 1XD2A 1YE5A 1S2OA 3AG5A 3EEIA 3IT1A 4O4JB 1D1PA 1GITA 3M83A 2PS3A 4AUNA 1G21B 5IULC 4DV6B 1OLOA 1P17A 2ONYA 3NS7A 5EWLB 4EPWA 2VJLA 3DAFA 5FF9A 3RU2A 1TKRA 2A59A 1CXZA 1ZIPA 3I8OA 3WIBA 1CUZA 1GZVA 3ZQ6A 1SUSA 3FUTA 3GNLA 1VXRA 3LNCA 3EXIA 2XHZA 3BWBA 2OFOA 3MRXA 4N76A 1Z4MA 3KOOA 4ZHQF 4J2OA 4CZ2A 2L17A 7GPBA 3UPUA 5JCZA 5DGCA 2X7JA 4RWEA 2YXPX 3NMUF 2PUEA 1KNXA 2KLBA 3COYA 4PFSA 1EXVA 4OHYA 4BECA 3R5FA 1ZL0A 1SR8A 2OA0A 1GRRA 1XWFA 4V0LA 3E61A 5CXUA 3N0WA 2HTFA 1JN0A 3JQ8B 3TGLA 4CQLA 3ESRA 3GZ4A 3KQOA 1Z28A 3WYEA 4EMBA 1HKHA 3FNRA 1JRLA 4UBKA 1HQYE 5J1TB 4IRXA 7ABPA 2GZDA 3HO6A 3ZLJA 3HVKA 4ZDIA 4BVLA 4H3VA 3DE7X 2JIBA 3PJRA 2P1DA 2WJPA 3K8ZA 3RANA 1N6OA 1XROA 1BDMA 1E9DA 2VSOA 1G6OA 2VNAA 4BAUA 3GVXA 1ITZA 1Z8DA 1E6EA 2W4QA 2P41A 4MP6A 4MP8A 5TJHA 5IDYA 3CGGA 2P9QA 1RBZA 2AUTA 3TRIA 1C8VB 2AWOA 1HFJA 2QMZA 3HVUA 1UPAA 4HN9A 5ULLA 1JG1A 2JIZD 3BL6A 4GMHA 4LOAA 3SM9A 1ZRMA 2GCEA 3TVDA 2B6HA 2VTBA 1PUJA 4RHYA 2G83A 2P0AA 4P3YA 5ALYA 4ZAFA 5EQJB 1B8NA 3D4LA 2Z9DA 5EZYF 5E1OA 5KQPA 2XMZA 5FAXA 1FDUA 1XZEA 2XQGA 4YXWD 1F3LA 4GXTA 4EG6A 5ITZA 1MB9A 1PT8A 3DNPA 3OIVA 1W88A 3R1IA 2CK3A 1G7CA 4GOMD 3WIUA 4BQEA 4N65A 4PLPA 3OH8A 3E9MA 3VKUA 2VQEB 1NN1A 3ENWA 3ACDA 1SZJG 2XMCA 1UK7A 4RKEA 4X0EA 3N7AA 3H9EO 1RTKA 1FZQA 1U8EA 2WU4A 4BYGA 4FGUA 2OG2A 4QUJA 1VCIA 2Y66A 3AETA 4RF4A 2FPWA 1AQIA 5EIAA 3B70A 1S96A 2DJIA 2JA1A 3UV7A 3NTLA 1T24A 1KSJA 4X1YB 1U8CB 5JANA 2X7XA 1KFCB 2QW1A 3E48A 4L28A 5DXJA 1VP9A 4HMPA 4UULA 3WHIA 2OFXA 4LRTB 4X64B 3WAGA 5G3YA 1BX1A 5HYVA 1AUOA 4NRDA 3RIMA 4XVCA 1MAVA 5BOSA 1T8RA 3QP9A 4EATA 5ITSA 3PEFA 4IQ0A 4INJA 3FPHA 5LMCA 2GZ3A 3COPA 2GNPA 4RQTA 3AFHA 2QMUA 5FBHA 1RTTA 3DMHA 5EIEA 1JIQA 4EARA 4JDPA 1GUDA 1DIBA 4NL4H 1XLTC 1I7DA 4HYYA 3IVGA 1EGMB 1JTVA 4TSKA 1OZFA 4LC0A 4NQZA 3WMEA 1T0IA 1VI6A 1FE8A 2BOVA 2FFAA 2VP0A 1JFVA 3A9VA 3LT1A 4XX0B 4BIIA 5KNBA 3NPMA 4CDMA 2JAXA 1NVWQ 3DAHA 4K86A 4Z4HA 4KN5A 3RTAA 5LB4A 1TJ3A 1WNFA 3ITEA 3HJNA 4OM8A 4RIGA 2Y1WA 4ZVOA 3GAAA 3NBXX 4PAMA 2EYQA 1PFYA 4TM8A 3SC6A 1FX0B 5BN3A 3NKVA 3PX7A 5EJ6A 2HV9A 5CXXA 3NHPA 2AC2A 3I04M 4W5OA 5FOSA 1BH6A 1BQ4A 1DHRA 3OOSA 4GVXA 4QUKA 3BL8A 3OQBA 1G55A 1JR3A 2GRAA 2HADA 2QTVA 2XQVA 3EDYA 3GRPA 2F9FA 3JATB 2JIPA 4C9BA 5J1SB 1DUSA 1MQ9A 1P73A 1Z4OA 3WWPA 5IXJA 4GZMA 4E21A 4LISA 3UOAB 1NT2A 1QGOA 1QZXA 1RYDA 4ZD6A 3R8XA 2WWWA 1QGYA 4KN8A 1QANA 3KHTA 4N48A 1B8VA 1QFZA 2XT9A 2PSFA 1FOEB 2IQ5A 4L4UA 3GY0A 2XB8A 5DCYA 5DNCA 3C98A 3L1UA 3GRYA 3HV2A 3KTOA 3HCBA 1K6XA 4W7IA 4ZAXA 4BDTA 3VU3A 2V7UA 2W22A 2UXCB 1C5KA 1T3ZA 1QGUA 1RJEA 3HM2A 3KB6A 4YUXA 2IBMA 5TQ0A 3QOXA 3T1VA 4V1CB 3L1JA 1X9GA 3ZHRA 4E2ZA 5BW4A 2X2EA 4QREA 1JHRA 2EJBA 3OE1A 4IHQA 2C82A 5KJFA 2H1WA 4EUEA 3AR5A 2NYAA 3P9YA 1AV7A 2CNLA 2VFAA 4Z0TA 4KB5A 1V8ZA 2FEPA 4EIWA 2LV8A 4P83A 2WHXA 4EYGA 2OXCA 3D7RA 1QHSA 5FOXA 1E2FA 2X1LA 2M9MA 1UZAA 4BQQA 4RTMA 3Q0EA 3O9VA 1EM8B 4I9HA 4X3OA 3ET5A 3WYBA 4RZXA 1FJ2A 3DEYX 3R3WA 3BTVA 3I39X 4GI7A 4Y9DA 1RRMA 5FFNA 1ZH0A 3ZNNA 3RVOA 1IYZA 5GZ1A 4AJEA 3X1XA 3I6YA 2ACEA 5FOWA 4TN5A 4KPYA 4N3CA 5BUZA 1YVUA 3TOCA 4B82A 1NTRA 1WQ4A 5JD6A 5EI5A 1I4TD 1E1RD 1PDVA 2O06A 4KDCA 2EDAA 1Z68A 1HEYA 1DFHA 2P9CA 4I7EA 2I4OA 2IDJA 4J16A 4EI8A 5LU8A 1AIPA 1RC1A 2E4ZA 2I4IA 1BHO1 3M3PA 4FE7A 2B1JA 1NE7A 3GA7A 2I6QA 3ZOKA 4CKEB 2VHZA 2B6NA 3D2BA 4ZVLA 2P5YA 3JYNA 1THMA 3MJDA 4E1BA 3V4VB 3WNCA 1T29A 5HILA 2W7TA 3EPPA 4CRWB 3QVMA 4S1TA 2AUNA 3H5WA 2EKBA 5E3JA 3SHWA 1GNRA 2OSVA 4BMSA 2Q2VA 2QVGA 2YVAA 3WGYA 2LE0A 2QM3A 1A5SB 3UTDA 4BEBA 1L3IA 1NFRA 1EZ4A 5ITWA 1FUEA 2VDNB 3C3DA 2G0TA 3CWZA 4MP3A 2WNIA 1GCIA 3KOMA 3STVA 3V7FA 3T1YB 1ZRSA 3Q7PA 4RL6A 1RR6A 3ICQB 4EFDA 5CLGA 1OHHD 2YXBA 4JS0A 3R74A 5E95A 1PDOA 2EP7A 3LW8A 1RP1A 3PX3A 3SIWA 3W5HA 2PBZA 1RCFA 1M8KA 1MRZA 2AF3C 2H63A 5A05A 4D8WA 2IEZA 3PQCA 3QEOA 4V0RA 3LF2A 5JCJA 5JR3A 3RS3A 3N9IA 5CEEA 2AJDA 1XMQB 5CPFA 1T6YA 3TQHA 3GLFB 1IBKB 1XPUA 2HMAA 4GICA 1MTZA 4N41A 3UH1A 1XTTA 5C5IA 4J8PA 2F43B 3KD2A 3ZS9A 1C4OA 4W7SA 3ER9A 3D02A 4WNAA 4LV6A 3RNLA 3E27A 3A27A 3G2NA 4L5AA 5CFRA 1DQRA 2W5UA 4FDLA 4R4JA 3VJRA 3DV0A 5CRIA 2WM2A 1R0ZA 5IS2A 4CG1A 5IM4F 3IHTA 1HI9A 4JUFA 3AI3A 2CBGA 3EG5A 5CR9A 2BC9A 5T4FA 3THRA 4W9MC 2AG6A 2OUKA 1R10A 4YRGA 3LUKA 1ZVVA 2JLRA 5LQDA 4K6GA 1GTSA 4LF5B 3A1SA 5A7GA 2YC2C 4EGQA 4O4JA 3OJ0A 1VGRA 4GMKA 2XF8A 2WQ6A 4OMCA 5EWLA 4DDTA 4XWKA 1YWGO 5C8YB 1QK3A 3E3AA 3GELA 2ID4A 1UBSB 1FQKA 3DMTA 1OKKD 1XXHB 1ZUIA 4AP6A 7REQA 3DTVD 1VBNA 1E79D 2FXIA 4YK7A 3TOZA 1M66A 3JQGB 3OMWA 5KYWA 3MCAA 2CLMB 3LQYA 4CIYA 1L8OA 3I3OA 1QCDA 1UBUS 3E2MA 3MCUA 2HRZA 1BRMA 4OAPA 4R40A 5GV7A 2P75A 1MNQA 1PJZA 5JW6A 4QFCA 2QN3A 2QYHA 1K27A 1NU8A 3TQCA 1NASA 1V39A 2ZKLA 3PGLA 4MR8A 4UBMA 4G65A 3WK5A 2DT5A 3G0GA 1G2PA 2BRUC 1LFDB 2ZTUA 3C24A 4GI2A 4HUQB 4XJSA 2NTYC 3WGNA 3KR9A 1ECBA 1KMQA 1KNQA 1Z2EA 5HZGA 1WW8A 1NQWA 4AMZA 2Q5CA 4L85A 2NXEA 4EZEA 3CVWA 3VR5A 4JYCA 2JZCA 4TV9A 3ZLUA 3T3OA 3HJRA 3M4YA 4LV5B 2YWHA 3RVDA 2QF7A 3TL3A 5HM6A 4I50F 3FPBA 1PZGA 2IUTA 4K81B 4EO9A 1FPMA 3OTGA 2HK6A 4EP1A 2NNWB 1ZOPA 3PGKA 2QLTA 2Z2IA 2FVXA 4R9UC 3TMAA 3F1KA 5LQAA 3IH5A 4BVAA 4M7PA 3M4ZA 3QW2A 1F2TA 4B8WA 4Q12A 2YZ2A 1JAZA 4OBWA 3JW8A 3OLWA 2GX6A 4M60A 1SXPA 1AN9A 1W94A 1IMJA 4Y7DA 3L0CA 3M4JA 3DXFA 4B3DA 4JCCA 4JR2A 5BO5A 2C2HA 2P4EA 1WKBA 4F8JA 2CDCA 4YP9A 4O2LA 3KFVA 4OKIA 4CM4B 3VGPA 4PLZA 4ETWA 5K8UA 1U8YA 3PUWA 5A4IS 3F8TA 4TOIA 4MDEA 2CDBA 4CLRA 2IWHA 4G63A 4TV8A 1T4GA 2ZSHA 1VG0B 2EEZA 2AS0A 4D46A 2NZ2A 1ZK0A 2VR1A 1DKLA 1YC2A 3DHEA 1WULS 3GFBA 3OA2A 1ZRNA 1U7TA 1SXJD 5C52B 5EERA 3MHTA 5AOCA 1XQVA 3KXPA 2V55B 4QTXA 3PSAA 1EK0A 2AEFA 3QWHA 1VPWA 3V9PA 1R6BX 1U0HC 3OJWA 2XSZD 3DDOA 3T9EA 3L82B 4CL0A 1KH1A 4ARAA 1A95A 2WMDA 1L5RA 1YZNA 3D3QA 3PNVA 2OE2A 3ZDFA 4BVHA 3UK6A 1F48A 1CUAA 4RORA 3TSZA 2UYGA 3NHSA 1C3LA 1Y33E 2Z56A 4RDHA 3ZQKA 3EQZA 2GSWA 2ID7A 1UADA 4I9UA 5K4AA 4IJWA 2B7LA 1GL7A 1U0SY 2ZIEA 1Z37A 1LLCA 3RSOA 4D81A 3FVVA 3QF4B 4ESOA 2OAP1 3HCPA 3NM5A 2PIAA 4LI3X 4M9UA 2BKAA 2JGJA 4AW9A 3PG5A 4KSCA 3F8SA 5E3HA 4QKQA 2AN5A 3PKZA 4BEJA 1QMPA 3DEFA 4D44A 3AR3A 4HWPA 2D1RA 2G9UA 3D6NB 1FX0A 1SHTX 4B46A 3K71B 3BMCA 3LK6A 3KXLA 2D62A 5A4KA 3FHOA 3GPLA 3ZIDA 2B8NA 3OKAA 3QEMB 1WDKA 4Z2AA 5IRCD 4I4IA 2C7GA 3WR5A 2DFLA 1NOIA 2ZRJA 2PX6A 2HSJA 3KR1A 3PPVA 4CT0A 4BPRA 5LZ5A 1KP9A 2P6OA 2GCIA 3KL2A 1LJLA 2ZBFA 2IP2A 2WSLA 3S8EA 2BGMA 2J33A 4RDIA 1FSFA 1KI6A 2VPPA 1UCFA 4RJJA 1SD5A 2IXBA 1CHNA 2BVNA 5HBRA 3SJAA 3TB4A 1U2DC 4MRPA 5CCEA 1VJGA 2QLFA 2QRJA 3B3AA 4QO7A 1QLJA 2J4FA 4HLUC 3EA5A 4NZ9A 1HDCA 1NHGA 2HMTA 2OPHA 4J4HA 4RMGA 1VL0A 4G07A 2CWDA 2QDKA 3VR2D 3WMRA 1SVUA 4V1CA 2Y8EA 1TYZA 4KH0A 2C58A 3G5MA 4GYKA 5C3MA 4BQSA 4MVJF 5TE9A 1QVVA 5A0TA 1LU9A 5EY5B 3DR5A 5CFLA 2RHBA 4I6EA 4Y2XA 2MSEB 4U6NA 5JUWA 2DPMA 4LWZA 2C7PA 4M8NE 3RUPA 4YASA 1CJTC 1YK1A 3DDNA 1W76A 3JWPA 1U9IC 2GK6A 1JVBA 1EM8A 2ZTLA 5I3ZA 1NQUA 3ZWDA 3ZXUB 1J5PA 4ZU1X 1AKEA 1QM5A 3D7LA 2GPNA 3JTEA 4CWAA 2BTOA 3AC0A 1SC1A 3OMXA 4EY6A 1X14A 1Y3DE 2V6BA 4IDBA 1KY3A 5ARDA 3SQOA 3TUIC 2HKIA 1CQPA 1F8UA 1W8DA 1PEDA 1QCZA 3CF2A 1E4EA 2IPMA 4LQLA 1L5MA 1QYRA 4CL2A 1ISHA 3O4JA 3STWA 3NH6A 3CPEA 4UU0A 2GBLA 2C2YA 1JHVA 4CKEA 2HQBA 3G13A 5DTRA 1YC5A 2EKPA 4YJ2F 3OETA 1A4IA 5DBEX 4QM7A 5GWXA 4R6WA 3ONDA 5GJWC 2RSLA 3I2YX 5AUPB 5AMXA 2HRQA 3I23A 2Q3CA 1PJ2A 1FYXA 2CHGA 3QUCA 3KQKA 4UKDA 5DGHA 3ZHOA 3GMDA 1XJ5A 1UXHA 2HQOA 4DMFA 3RS7A 2OO3A 1VL5A 2QN2A 3DCJA 4WH0A 3C6ZA 2C88A 4YP5A 2DOKA 1FW6A 2BBSA 3K6SB 1X1AA 4E5DA 2A9KA 3PXBA 2WJJA 2WYHA 3LO8A 4W5HA 2BEWA 4IG4A 1Y4ZA 1OXBB 2D5LA 4YJDA 2C9OA 3MF4A 1P9NA 5AKJA 3K2QA 1W8IA 2IOFA 1SVNA 3A1WA 1JNXX 2ZWIA 1GKKA 2CXOA 2Z8YM 3B1WA 4YLYA 3AHJA 5AW6A 3ZU2A 1K7SN 4ERXA 1AF7A 1QHYA 3G7SA 1Z5UA 2BMFA 5J40A 3UV3A 1GWNA 5FADA 5JCPA 2TMGA 5A62A 1KGDA 3GLFA 3UXHA 4OG2A 3T3IA 2PGNA 3KO8A 3GFPA 4C7JA 2QN1A 3R23A 5CA0B 4V3BA 3WQSB 5CD1A 1KR5A 1NF8A 3ZX5A 2PUCA 2XGJA 2A5DA 4D25A 1KJYA 4ZOCA 4MGEA 5E6UB 1UJMA 1MX5A 2J08A 1PJLA 3ABQB 2CLHB 2WTXA 4IBOA 3U13A 1C7IA 3QFTA 3ADOA 3UUWA 3WL8A 3BFKA 1WY5A 1LPMA 2CLLB 2IZ1A 4INOA 4MULA 1QR2A 1DDIA 1I3LA 2PBLA 5JIBA 3MJFA 1DADA 2Y2VA 1GRQA 4AP9A 4Q1DA 5C8YA 5ED4A 5HIKA 2WJYA 1KDOA 2EBHX 4Z86A 1QONA 3SYNA 1S2IA 2DWPA 5CJ2A 1LDGA 3JARB 1XXHA 4IMPA 1A9YA 1BWPA 3QMVA 5CVCA 3VSCA 1M34B 5BYBA 3IRUA 3W1EA 5IZCC 1PN3A 4B76A 1F9AA 1JIIA 1RT9A 2FRVA 1LPOA 3JQGA 2FNAA 4CCWA 3DLBA 4KO3S 1Q50A 4QPJC 2BEVB 4GEGA 4XCVA 4EHFA 4RACA 3DYBA 1RBMA 3L7OA 4IDCA 1C4WA 2A67A 3PYMA 1D2AA 3TRFA 3DT6A 1WXFA 3NYQA 1C80A 3D4IA 4JBWA 2AX4A 2JLQA 8GPBA 4IV5A 3GLTA 4PX2A 2GRJA 5JAMA 3J81A 4C6SA 4ZQEA 3OY7A 2A3RA 3OE7A 4X71A 1P2BA 5CTAA 1U8ZA 2B2NA 3JAWB 2QE7A 1EA5A 2B0JA 2I54A 3LUHA 4TRJA 4FOLA 3N8IA 1F17A 1XXLA 3LXRA 1I3OA 4Q9HA 2E4XA 4Q9KA 1BHQ1 3BHIA 1R6DA 2PAFA 3A70A 3CZ5A 4A27A 5ALVA 1NX9A 4RK6A 1RJWA 5JECA 3FUCA 5B3JC 2Z30A 3OCWA 5AJZA 2ZRKA 1YQTA 5FI3A 5T7BA 1OH7A 1CZHA 3F7NA 1GG5A 1UBEA 3P2EA 3OJLA 1MORA 3WK8A 3DC7A 4RBNA 3OUZA 4L2IB 4EVIA 1IZYA 2PGJA 1GAJA 2DR3A 2CNDA 1Y4DE 3C87A 3JVEA 4EX7A 1F5NA 2R7MA 2G88A 2QPLA 2YUTA 3A9WA 2FEXA 1TW2A 2DAPA 2ZYUX 4LHZA 1S2GA 1AZLA 5HFJA 2WG2A 5HCIA 4L5IA 4CM4A 4DIOA 1OX5A 1SXHA 1WMFA 2Z8XA 4HK4A 4N5HX 2VDWB 4PAOA 5BSUA 1PR3A 1UEIA 1IHOA 1ADCA 4M9ZA 4RIFA 1QU3A 4OVKA 2ZIWB 3KIPA 1TO2E 4FKZA 1Y80A 1Z3CA 2C4WA 2DHQA 3OX3A 5DEOA 2H4ZA 3ROTA 4FEYA 1HDOA 2BFDB 1I7SB 3C97A 1UUFA 4CKZA 1QHFA 1XAJA 2A94A 4MROA 4CMHA 2N46A 1IWOA 4E32A 2P6NA 1RRPA 1RPNA 1X19A 2JAQA 2DTEA 3QTBA 1YQEA 4MJ3A 1PS8A 1KA9H 1V8DA 2HK8A 4L1KA 2R6R1 4PBRA 1DC7A 1I2ZA 2V7VA 5KNCD 1XVAA 1NYRA 3IOYA 3OEHD 4JJ7A 1RJ9B 2EBUA 3X1KA 4IJKA 2WU0A 1MB2A 2AKAB 3OZEA 4RLHA 2HCRA 3OOWA 2DU8A 1DG9A 4C7KA 2WM8A 1KI7A 1NBAA 1CZUA 3M6XA 3L40A 4JLWA 2ATCA 4JEUA 4LSZA 2FV8A 1ZZEA 3QF4A 2CY0A 1MU0A 1R74A 2B35A 3CLKA 1ADFA 4MYUA 4MLDA 1C8LA 3ECAA 4F8EA 3HNOA 2MINA 5L4LA 4J4BA 1AMUA 1EJBA 1LK7A 1E8MA 2WKSA 3KKQA 2XDQB 3TBFA 4NU8X 1DV1A 1DTWB 1P1JA 2A0WA 3LBYA 4JI4B 4BVBA 3FVRA 2F9LA 3NEPX 4IIUA 1JQBA 3TNLA 3C7DB 3ODPA 2CNKA 3RG2A 4PC7A 1HDXA 1S2LA 3IUSA 4G0XA 4NEHB 4Z8XA 4ROTA 2FHSA 4CKCB 3W8RA 1UP4A 3GGJA 1KAQA 2ZIXB 3AUJB 5GJBA 1KY2A 1F60A 1SY7A 1RM4A 1T8TA 3I12A 4MVJP 1Z13A 3FM9A 1I36A 1K68A 1YS9A 3CTMA 4I55F 4PYMA 4A91A 4E5MA 2RGXA 5IUJC 4ZV7A 1FFGA 1HC7A 5ETJA 5JNTA 1U1IA 2L19A 4LJLA 4ZAZA 1D3AA 3WGGA 3SOZA 4IKPA 5DYYA 2FE1A 3PITA 3ELDA 1LZKA 3FWHA 2OO5C 4ZMSA 5HUJA 2VHUA 1LV7A 2Z6QA 3LGAA 3OIWA 1QJ4A 2O3QA 2ZKIA 4ITUA 2UZ0A 2DQKA 4K9QA 1PP4A 3EX7C 4HRYA 3QSGA 1N2JA 3BJEA 2OCXA 5E9QA 5L4NA 2R1TB 2UXDB 2JI4A 3BD7A 1M5TA 4YYEA 2FJ0A 4LOIA 2ZJ5A 4Z4IA 5ECWA 3OZIA 1NG9A 1USUA 4EY4A 1P3Y1 4Z1OA 4E2FA 2RI6A 4P3XA 5KB3A 1TK9A 1ML4A 5BSMA 2N1MA 4UNSA 3GXBA 5JNVA 3EPJA 2ICAA 2WUGA 5DTJA 3D6VA 4LDRA 1KFJB 5TGTA 4C6TB 3DE1X 3PXDA 1MXFA 2G6BA 1H8HD 2RI0A 3JCZA 4INPA 5DGXA 3VH1A 2Q7XA 3AFIA 1DG3A 4EPTA 2QUHA 5B6PA 3AKEA 4DEXA 2R8RA 1RFLA 5TC4A 4BO8A 3PS9A 3JY6A 1O58A 1XU7A 2XUPA 2FPMA 1QE5A 4P34A 1J33A 1ZHFA 2PL5A 1X3LA 4GXRA 3BFPA 3COWA 3E3OA 3KQYA 3RVQA 1K63A 3HBJA 3OQIB 4HRVA 2VKTA 1J0XO 3CPHA 3NTVA 4KQHA 2HSDA 5EZ6B 3WYDA 5BNZA 2V4ZA 5LIPA 2D1YA 1KXZA 5AKGA 3NC4A 4D2IA 1T4CA 3A36A 1MC4A 3M9WA 2NZXA 2Q2OA 2RFLA 5CX4A 1XK6A 4EO4A 3U7EB 3BT7A 3U39A 4LHVA 1CIPA 5BXQC 2ZE7A 3A6LA 3RIGA 3RYCB 2GO1A 1O89A 3KEQA 4DW8A 1EXMA 2I55A 1NF3A 3WHPA 3EUEA 3GG9A 1CDEA 1BOFA 3ONWA 5HK9A 1M1NB 1YQQA 2QTWB 5LA6B 2XCSB 4ER3A 2VUIB 3K6SA 1FDIA 2YOHA 3L8HA 4H17A 3GRAA 4Q3OA 4JP1A 3PZRA 1MVNA 3PF8A 2LP4Y 2BUCA 3DE3X 1X13A 2G17A 3FUWA 1XYVA 4TS9A 5KJ6A 3GHHA 3INYA 5KMGA 5AKEA 5FWXB 4FDAA 3RT7A 4H3KB 3HY6A 4I6JA 1U3TA 4G8DA 4MLCA 4UATA 4XARA 4FHEA 5EL0A 4YXFA 2FSVC 1JHQA 1JWBB 4WADA 4ZVNA 5HCUA 4FFBB 1PJ4A 5JFOA 1TMGE 1N2OA 4HGYA 4EG8A 1JJVA 4L72A 2V0NA 3VYUB 2NSHA 2PM8A 4IXTA 1FS4A 1NN3A 1Q0ZA 1Q0HA 3K4PA 3H7AA 5DCWA 3VNAA 5AKKA 4ZN6A 2AQIA 3K9CA 1CVLA 4P0PB 2PX4A 2AMJA 5CA0A 5EYPB 5K8TA 1GNLA 1A9XB 1U2RA 1VL1A 2E18A 2PMWB 3EZFA 3G5UA 3E9QA 3EAGA 3JYHA 4PYRA 5E6UA 2IE0A 4D41A 1O6GA 5FX2A 1UPUA 4XVQA 3V1MA 1U9CA 3TAXA 3D6UA 2WSSA 1ILWA 1F4LA 5T8KA 3UO8B 1UBRS 1XNGA 1CETA 3O3OB 3VR6D 1GU0A 5GONB 3ROZA 2GKGA 5KSPA 1C4KA 2A5GA 3EPHA 3DO6A 2EFDB 2AYZA 1NG1A 2VJYA 3OOJA 2PRZA 1GT6A 3OZGA 3HP1A 3PE4A 4TV9F 4JK3A 2F3RA 2ZUSA 2OZPA 3JARA 2ZI4A 4PO8A 5K0EA 1E1LA 1M34A 2VDLB 2W2PA 4BIMA 4RSHA 2WT4A 3KB1A 3BXXA