3SVZA

Crystal structure of apo bt_2972, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative methyltransferase
publication title Crystal structure of apo BT_2972, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3svzA00
1VP9A 5LQCA 3FPFA 3PX2A 2ZIGA 4GOOD 5DM0A 1YB2A 5IH3A 4E70A 3OU2A 1NBIA 1ZGAA 5DSTA 3NDJA 2ESRA 4YMHA 1KYZA 4M36A 1EJ6A 4HC4A 1Q0SA 1ZG3A 3UWPA 5LQAA 2I6GA 3G8AA 2C7RA 3P2EA 1QYRA 2JHPA 3A4TA 4HSGA 1R74A 5DM4A 3C3YA 4R6XA 4AZTA 4EKIA 2PWYA 4RTNA 3OU6A 3NW9A 2JH8A 5IKMA 5EOVA 3EVFA 3TMAA 2VS1A 3VSEA 3GRYA 3C6MA 2Y1XA 3Q7EA 4ISCA 5HIKA 3NJRA 1N7IA 3UJDA 2YUIA 3G5LA 4MWZA 3PS9A 5CVEA 3RIEA 4OX9Y 4K6MA 2YXEA 3B89A 1EIZA 4B17A 3HCCA 4BLVA 4HTFA 4E32A 5E1OA 1WG8A 5EEGA 2NXEA 5LQUA 1NV9A 4IV8A 4C06A 5FADA 4PGHA 4AUKA 3AXSA 2V74B 5DM1A 3VYWA 2Z6UA 1VPTA 3P9IA 1B42A 2IPXA 4RTPA 2DULA 3MCTA 4HGZA 1M6EX 3CCFA 1RI1A 3FUUA 1ZHFA 2YTZA 2G1PA 4LWOA 1U2ZA 3LCVB 4GQBA 1O9GA 3EVDA 1QAQA 2BM9A 3RW9A 1VLMA 2ZULA 1NBHA 5DPMA 2YR0A 5FTWA 3UJ7A 5HOQA 3ER8A 2ZBPA 1KPHA 5LR6A 4RWZA 2OO3A 2PX2A 2XVAA 5GOZA 5BW4A 2OB1A 1TPYA 3KR0A 3HTXA 5CVJA 2PT9A 2JHAA 5K03A 1QANA 3EVCA 3FYDA 3R0QA 4ZTBA 3BGIA 3DUWA 4BP1A 5EMJA 5ICGA 4XCXA 3DMGA 2QM3A 1JQ3A 3DULA 3LSTA 5DXJA 4CWAA 2P8JA 3EGVA 3MERA 4CTJA 3BWCA 3HA7A 3PTAA 1WY7A 2PV0A 1JSZA 3GJYA 3GO4A 3R9XB 5KS2A 1TW2A 2O0LA 3FTCA 2IBSA 5K8VA 3HCEA 3SXJA 3E05A 3THRA 4C04A 5FUBA 5K09A 3S68A 3HA3A 3BZBA 2PY6A 2IDKA 4QVGA 4C03A 4UOEA 4RVFA 4ER6A 2F8LA 2QYOA 1RI3A 3CJTA 3IV6A 3OE5A 5GIOE 4PYKA 2OXTA 3R24A 2IFTA 4ER3A 2G8NA 2OYRA 3CJRA 4OBXA 4JXJA 3OZTA 3KR2A 3BUSA 5P8WA 3R6TA 1FJXA 1NW5A 3U81A 2BH2A 3E7PA 1VE3A 1SG9A 5K0BA 3FPEA 1G60A 3I58A 3I9FA 5ICEA 1I9GA 1SQGA 2P40A 3M6VA 4F85A 2LD4A 2AN5A 2OBFA 2AVDA 4FR0A 7MHTA 5HIJA 1TW3A 3FPGA 3BT7A 1F38A 5CCXA 5EC8A 2XVMA 1JSXA 4QPNA 5FQOA 3UJAA 3DH0A 5DTRA 2P3LA 3VC2A 4L7VA 2BZGA 3EVGA 2AVNA 3LGAA 2FRXA 3TKAA 3GU3A 1D2HA 4O29A 5DWQA 2ZIFA 1G8SA 2AOVA 2PWPA 4F86A 3B7PA 2AZTA 3AWIA 1AQIA 5K0NA 3DXZA 5GWXA 4DM3A 5C1IA 3X0DA 3B3FA 2NXJA 4PNEA 4PYJA 5K05A 4E33A 5F2NA 3AJDA 4KIFA 2XBMA 2ZIEA 2P3QA 4YUXA 3T7RA 3H2BA 1DL5A 1MJFA 3UJBA 1VQ1A 1QAOA 3DLCA 3BWBA 3EMDA 3LKZA 5FQNA 3BWYA 3KPWA 4GUAA 2ERCA 5EVJA 5H02A 3KQYA 1NW7A 3LCCA 4EMSA 4ER7A 4H0NA 5E1MA 1X1AA 3FPHA 3LCUA 3Q87B 4U7TB 4GBED 4OBWA 1INLA 4RYLA 3P2IA 3OZSA 1SQFA 4E2XA 3KQOA 4LG1A 3CVOA 5HEKA 1SVUA 10MHA 4DQ0A 4M37A 3HCDA 3EVBA 2IP2A 4MTLA 4YUVA 2R3SA 4PIPA 2R6ZA 2OPBA 3UJCA 5DRYA 3OFKA 3KQWA 5EPEA 4BY9E 4ER5A 2P7IA 2ZZKA 1D2GA 4QTUB 4IV0A 4POOA 3AY0A 2H00A 1PRYA 5FWDA 3EEYA 3GRRA 4WXHA 4X1OA 1ZQ9A 4RTSA 3ID6C 4RTRA 3LPMA 1KHHA 5DX8A 2H1RA 3M6XA 2AN4A 4E31A 4FSXA 4OA5A 1VBFA 5E8RA 2P41A 3OZRA 1XDZA 3UA4A 3PFGA 3DXYA 2PGXA 4GEKA 1NKVA 1JG3A 4P7GA 3PVCA 2AOTB 1P39A 3P8ZA 3G89A 5FWAA 3T0IA 3GNLA 2EFJA 5K0LA 5HZMA 2PSSA 3A25A 1R18A 2Y1WA 2QY6A 3QOXA 4EQZA 2ZWVA 5U4XA 1EG2A 4F84A 5CD1A 3MGGA 1NV8A 2ZLBA 1XVAA 4BLWA 3NWBA 2NXCA 2I62A 4PYIA 3EVZA 4IWNA 2GLUA 3MB5A 5BXYA 1I4WA 3REOA 3V97A 2HR1A 4PGGA 2O06A 4ER0A 3EMBA 2P35A 4RX1A 2FHPA 5GM1A 2B25A 3OPNA 4X60A 3SGLA 3G2QA 4GOND 1MHTA 1UFKA 3G2OA 5FHRA 4LECA 3OU7A 3TLJA 4AZWA 4RVDA 5D1NA 5KYGA 1DUSA 3HEMA 3I53A 2IIPA 3HNRA 5LQNA 4V0QA 5CVDA 3SX0A 4GC5A 1KIAA 1YUBA 2G70A 3NVMB 5EEHA 4A6DA 4CKEA 1ORHA 1SUIA 3TQSA 2PXAA 4DCGA 4G56A 4YMGA 1AQJA 2B3TA 3FRIA 1NW6A 1X1BA 5K01A 3FUXA 3ER9A 2XYVA 2VDVE 4FSDA 3GRZA 1AV6A 5KQRA 4PYOA 5MHTA 3UBTA 4XUCA 3I64A 2C7OA 2GAFA 2ZBQA 4QDJA 1YFJA 1G8AA 1M0EA 2PX4A 1P1CA 1QZZA 1JG1A 3HVKA 3P71T 1XTPA 4HG2A 2VDWA 3IHTA 4XUDA 5EIWA 5EMLA 5DT2A 2ZW9A 4RTJA 1G55A 4AZVA 2JHCA 2PVCA 3HM2A 3TKYA 3MHTA 1N7JA 1XCJA 1KXZA 4LWPA 3DMFA 1XDSA 3KQVA 1V39A 3FTEA 2CL5A 2ZBRA 3CKKA 5K0JA 5T64A 3JWHA 3G2MA 2UZ4A 3I5UA 2YXLA 5GP1A 2PXCA 1RI4A 3EEOA 3GRVA 1YFLA 1SKMA 4EVIA 8MHTA 1UIRA 2Z6AA 4YUYA 2CWWA 4PCLA 3C0KA 2ZVJA 2ZWAA 3G88A 2B2CA 5FHQA 3O31A 4DMGA 4QVKA 1EJ0A 4PYLA 2XYQA 5E8JA 4HRAA 5HIIA 4R8RA 5EQJB 3GCZA 1L3BA 3NWEA 2NP7A 3HP7A 5BW5A 5JUWA 4ATNA 4KDRA 3OE4A 3GGDA 3UFBA 2NP6A 1JG2A 3F4KA 2YXDA 3KQTA 3A7EA 5FULA 4HH4A 1H1DA 4R05A 3ME5A 4R6WA 2AOXA 3KR1A 2OKCA 1IXKA 3MCZA 3UA3A 5EG5A 4AX8A 4RTMA 3LKDA 4GF5A 4KDCA 3ERCA 2O07A 3ANXA 1XDUA 2H11A 4MQ4A 4R8SA 1X1CA 2CMHA 2NNWB 1WXWA 3G2PA 3TM5A 2G72A 3TFWA 3TM4A 5EGSA 3M6WA 3HVIA 3G7UA 3JWGA 3T7TA 4RTQA 3TPZA 3CBGA 5ICFA 2N47A 2FPOA 4RV9A 5E2AA 3K6RA 3AXTA 3OFJA 2CMGA 4FGZA 1YF3A 3SSOA 2EG5A 1VP3A 1JTEA 2P1DA 3B3JA 4X41A 3GWZA 2UYHA 4QQNA 2AOUB 4P7JA 2EJTA 9MHTA 4V0RA 3QOWA 3KQMA 2I9KA 2ZZNA 1FP2A 1HNNA 1G6Q1 3SR4A 3ELDA 2FYTA 3SVZA 3DLIA 2BR5A 3TR6A 1RJFA 3A26A 2IH5A 1T43A 3BGDA 4QDKA 1F3LA 2PT6A 1JQEA 3FUTA 3G5TA 3GIWA 3BKWA 4C05A 4E30A 2O57A 1ZGJA 3MAGA 4PYNA 5C9ZA 3BXOA 2GS9A 5LSAA 1KPGA 2AOTA 4QQKA 3HCAA 1WXXA 4A6EA 4Y30A 1BC5A 1O9HA 3SMQA 3LHDA 2PX5A 3WSTA 3UJ8A 1X19A 5T67A 5BP7A 5T6BA 2C7PA 4P58A 2HWKA 3JWIA 2PJDA 3G8BA 3EGIA 3PFHA 4PCAA 3KPVA 5F2KA 3FUWA 2CKDA 2BR4A 2NYUA 2UYQA 2IBTA 1AF7A 2C7QA 3KQQA 3FUVA 5CCBA 3KPYA 2GB4A 4PYQA 2PXXA 2IGTA 3R3HA 5DXAA 5E9JA 5LQKA 3FTDA 2PLWA 2ZCJA 1KR5A 1RI2A 3KQPA 4IKPA 3KR9A 3NMUF 2YX1A 3CGGA 3SM3A 2E5WA 5E9QA 4DCMA 2UYOA 2O05A 2Q41A 1FPQA 5DRTA 3HVHA 3IYLW 4BLUA 4GOLD 2BR3A 3BWMA 5DSXA 1NT2A 4FT4A 5JR3A 3B3GA 4OQDA 2PBFA 3LECA 3M33A 4PWYA 1Q0TA 4RSRA 3HCFA 3KPJA 2OZVA 3MTEA 4Y2HA 5KQSA 3DR5A 3M70A 4PIMA 2A14A 1JR4A 2HMYB 4CTKA 5F2OA 4RTOA 3M4XA 3LL7A 5HFJA 4Z2YA 1NW8A 5LQJA 3GRUA 1BHJA 5B1SA 3EPPA 5CVVA 2B9EA 5FA8A 3DOUA 2XYRA 3ELYA 4XUEA 4GC9A 4FP9A 2FK7A 1HMYA 2JJQA 4YV1A 5M5BA 4RTLA 1RJDA 3ELWA 5E9WA 1XXLA 3LX6A 2AR0A 3QV2A 5DTQA 2YVLA 4GOMD 3FPJA 1XCLA 1X1DA 2FK8A 2HV9A 3FRHA 3P97A 4AZSA 5K0CA 3D2LA 5EHGA 4BP3A 2WA2A 1RJGA 2GPYA 4DKJA 5HILA 5GINE 3NTVA 3PB3A 2ONZA 2P7HA 3B5IA 5EHIA 3O7WA 3KHKA 4NECA 3LDGA 3OCJA 1OR8A 4X63A 3LDUA 4EK9A 4HTFB 1EAMA 5DX1A 1IY9A 3HCBA 5EZQA 3GDHA 1R6AA 2B78A 4KWCA 1VIDA 5DM2A 1JG4A 1YZHA 2AN3A 3V8VA 5KVAA 2HTEA 3HA5A 1P1BA 4YUZA 4FZVA 1O54A 5HIMA 5K0GA 4FS8A 4M7RA 4C08A 3SSMA 2I7CA 3JWJA 1Y8CA 3ELUA 4PYMA 1YZ3A 5CUQA 2ZFUA 3EGEA 5EZSA 3O4FA 4OA8A 4CKCA 1NE2A 2ZSUA 3NDIA 5DTMA 5E2BA 3RODA 1KYWA 4DZRA 1R8XA 5EKXA 2BM8A 5K0FA 2EJUA 2PX8A 4YV0A 3KKZA 1JTFA 4E2YA 4C07A 1QAMA 2OB2A 1M6YA 2VZ9A 4E2WA 4HGYA 4KIGA 5K0EA 3P9CA 1KP9A 1ORIA 4CKBA 4DA4A 1L3IA 2AOWA 2IDJA 5FA5A 1WS6A 3THSA 3LBYA 3TOSA 1KPIA 4X61A 2UYCA 3HVJA 1EQAA 1WZNA 1R00A 5EKUA 1I1NA 2YQZA 3NVKI 3GXOA 1L1EA 3L8DA 5E1BA 2PKWA 3P2KA 5E1DA 1D2CA 3KU1A 4KW7A 3KQSA 4DF3A 2AOUA 3E23A 3PT9A 5D1HA 2JG3A 3C6KA 1FP1D 3A7DA 3MQ2A 4U7PB 2NXNA 4P7FA 1N2XA 3DMHA 4PONA 2HNKA 3UJ6A 1IM8A 3DXXA 4KVZA 1L3CA 5DX0A 5FCDA 2P3OA 2ZZMA 4MHTA 4CXMA 4C4AA 3SSNA 3P9NA 3EVAA 3FYCA 5GIPE 4P7KA 3M6UA 1BKYA 2V7EA 3BKXA 2DPMA 4PINA 1NW3A 5CM2Z 1R8YA 4QTTB 1BOOA 3ORHA 2G71A 3UZUA 2QRVA 2K4MA 3VC1A 1DCTA 4WVLA 5GM2A 1FBNA 4E2ZA 2FCAA 3CJQA 2Z6QA 1RJEA 3K0BA 4QPPA 2AS0A 4RVHA 5G02A 5C0OE 3UJ9A 5LQRA 3E8SA 1UWVA 1SUSA 4KRGA 4YV2A 2ZTHA 3FTFA 3KPUA 2ORED 2VP3A 2IH4A 5ICCA 2WK1A 2OY0A 3DP7A 2JH9A 3LDFA 1XJ5A 4RTKA 4RVGA 1PJZA 2QRVB 3PX3A 4OQEA 2ADMA 3TRKA 2VDUE 2QE6A 1RI5A 3C3PA 2EX4A 4M38A 3P9KA 2ONYA 3DTNA 5DLYA 1VL5A 3BGVA 4YUWA 2KW5A 3LBFA 1ZKDA 1Z3CA 2WA1A 3PLAE 3MTIA 4EKGA 3CC8A 3EVEA 5EIFA 5CVUA 4FT2A 5EMKA 2GA9A 5EMMA 5ERGB 2IH2A 2GH1A 1G38A 3T7SA 1L9KA 3FZGA 1P91A 5CIYA 1JQDA 3IEIA 4MIKA 3A27A
chains in the Genus database with same CATH superfamily
2WVGA 5IK2A 4F04A 4Y1RA 4B73A 5BSHA 1SD5A 1CLEA 2O7RA 2HJ9A 3D7RA 4OK5A 1E1NA 3M6MD 4II7A 1PR1A 5JG7A 3W7BA 3R4VA 3WYFA 1QYRA 2P2GA 4GYWA 1OW3B 1WUJS 4ZCQA 1VIYA 5EOVA 1NFRA 3EX7C 4DJ5X 3Q7EA 2I65A 3E81A 3HADA 3MWGA 2NSYA 4L2IA 5JVDA 3GT4A 3JV7A 2ZRPA 3GMDA 4EEKA 4RJTA 4B83A 5I7VA 5I45A 5DN9A 3FNGA 4XM2A 5EJMA 5IVKA 2C3YA 1FCJA 3IIKA 3NAMA 4DMKA 2Y0BA 5K9ZA 1C1DA 2GZ3A 1DRVA 5CB4A 3E2IA 4BYGA 4MW7A 4LCBA 3E22B 4EFMA 3G5UA 1BYUA 3UXEA 2AEFA 5IASA 1KH2A 4XD2A 2ZJ4A 4GPTA 1AO0A 3QF4A 2QNBA 5AW1A 1NMZA 3IDAA 4LDPA 2BFCA 2QVYX 1AZSC 3BZUA 2E9SA 3G7NA 4GR9A 3HZHA 1CTQA 2BFDB 2ZYWX 2QZJA 1O9GA 1YT5A 1E59A 1JJBA 3H19A 4IY1A 5ALUA 2X40A 2AYYA 2XHZA 2DPLA 1Z45A 2QLTA 3VU9B 3ETDA 3F6EX 3AI2A 3LU1A 5TQVA 1A5TA 5DPMA 3REQB 5IAOA 3SIRA 2QJOA 4P54A 1AKNA 1SIWA 4ZVQA 5H0IA 1QFXA 1Y7LA 2AMLA 3L8FA 1LEHA 1MEOA 1USIA 4GYKA 4RVUA 1XWFA 1U5AA 3R0QA 1Y5LA 4L7QA 4MIOA 1QKKA 4OKSA 1HRKA 4JBHA 3TIXB 1X92A 2NZXA 2NZ8A 3VMMA 4Z2AA 6REQA 4F3TA 1SXHA 3DULA 4C9BA 1C3EA 3MERA 1UJ6A 3DFZA 3EGVA 2XUQA 4EUFA 1ZK2A 4E4YA 2R66A 3HFSA 1YIDA 3QVGA 5EE3A 2NPFA 1ZRSA 3ZYCA 2CNOA 2OMEA 1TW2A 2YYZA 1K8RA 2G9VA 3DPSA 1WW3A 2AG1A 3C4VA 2XCSB 3CLRC 1NBOA 2E5FA 3KCQA 1LLQA 3NUGA 2PY6A 1PDWA 3L1VA 2PUGA 2OV8A 2Q3DA 1WSDA 5F2EA 4Z7QB 1HKUA 4JB2A 4ER6A 1T26A 4KQMA 1Q0UA 4QTXA 3M0EA 2RGBA 2DJ5A 3KNZA 3LIIA 3AVPA 3ULKA 1TECE 1OKKA 2DWOA 3R24A 4FM9A 2FGKA 3S3TA 1ZD3A 1M2VA 1PR5A 4XJTA 4CCSA 3ZWXA 3SNKA 3T3EA 4DYVA 4XWTA 2ZAYA 1F6DA 2CZCA 4UC0A 5AK6A 1E2BA 1EHYA 4UQPA 3HJTA 1W36C 4XGQA 3FLMA 3A9TA 3CINA 5EQTA 3WKBA 1VMKA 5AKZA 5IMSA 3T95A 5JANA 5HP4A 1I9GA 1SQGA 2GLXA 5BVGB 2XQGA 3RVSA 3QH4A 2EP7A 5AW9A 1K7CA 2OBFA 3HJNA 5AVOA 1O0SA 4FR0A 4W7HA 5CT9A 4BDSA 2VR1A 7MHTA 2XKAA 1T36B 1KZ4A 3HUEA 4R8KA 3W2TA 1FJGB 3ECSA 3FOFC 1M3SA 4KUHA 5JWRA 4LBZA 1E4YA 1E1RD 1R9JA 1VLJA 2HJGA 2ZI5A 3CRRA 3N7AA 4QOIA 4BCCA 1S2GA 1QTNA 3OOYA 4M1WA 1U2DA 2HHLA 3BM5A 4NBLA 4K9RA 4I1OA 5H3HA 4YAWA 4OGWA 3VZBA 1EK5A 3R5KA 4CF3A 2Z3ZA 1FDIA 5BORA 2DCUA 5JH7F 5KYNA 1LJLA 2H0RA 3U4IA 4V3CA 5IJZA 4KR2A 1JDZA 2PX0A 4HB2A 4KIFA 1WKVA 1ADFA 1YR8A 2CL0X 4N7RA 4RZIA 4C3OB 3H2BA 1O4VA 1Y63A 3CLUC 3HN7A 3GFQA 3I2GA 3PQEA 4AWAA 1L8OA 2POCA 3TGLA 3HXQA 1X86B 4L4ZA 3NHSA 4BNZA 1EP2B 9LDTA 3EPJA 2MSNA 1TM3E 4RY8A 3TDNA 5TDHA 2IE0A 3B20A 1QB7A 1CT9A 2QL7A 3MHPA 4KB5A 4N8EA 1HF3A 4R40A 4E12A 1E20A 2A5DA 3NEJA 1WHTB 3CVOA 1OI4A 2QTTA 5EJ6A 1USUA 3EVBA 4MTLA 3PQ2A 2R87A 1WUIS 3TXXA 3BRWD 4BWGA 2FW8A 4GIBA 4L15A 2VPPA 7YASA 2NX2A 1D2GA 1PE0A 5DCYA 5AJZA 5KUTA 4B7UA 3SWWA 2OVBA 5LZ9A 4A0QA 1RQPA 3WRXC 2QG9A 1JG6A 5EI5A 4A2QA 1OZAA 4HX5A 3PXGA 2TMDA 2WI8A 4B7XA 3GCXA 4QTZA 5F5LA 2QRLA 2GYVA 1M7BA 3E61A 5E8RA 5L3RA 5DH9A 2OXIA 1NOIA 2H4HA 1D2MA 3E82A 4BMCA 5ESXA 4CMKA 1X1EA 1YMQA 1SCUB 1U6IA 3T3DA 1SVOA 2D0OB 5FWAA 1XD9A 4GKBA 1B4DA 5JFGA 2W8ZA 3EA0A 2PSSA 3PPYA 3ZE7A 3ZJ5A 2ZBEA 4B6SA 2QY6A 1JGTA 3FBGA 3R0IA 4IVPA 1WUKS 1EZZA 2BFDA 2VQ3A 4URXR 3NWBA 3ONNA 1LPSA 2ZIWB 4BUZA 1K5PA 1M83A 3VU9A 1GQRA 1YQQA 1OX5A 1ITZA 2P5UA 1AT1A 4ZVLA 5G0SA 1RT9A 1U0JA 2LBPA 3AK4A 4QBIA 3S44A 5E3HA 1IEQA 2ORIA 4Q1DA 5BPFA 4CHTA 5GM1A 2X0RA 2FHPA 3L8HA 4I99A 1NRWA 1T8UA 3UC5A 1ZK1A 1KSJA 4B76A 1GHTA 4S1VA 2IV3A 1NZDA 3GFFA 4AZWA 5MF6A 3K70D 1NJ5A 3TVYA 2HDHA 2EJBA 2TMKA 4QAJA 2Z5LA 3QXJA 4V0QA 3I83A 2RKOA 1XI2A 3OQIB 3LFHA 1U0GA 1Z47A 3H2SA 3VYSB 4FB5A 4B3MB 4O3FA 2OFFA 2ISSD 3D7SA 4D8VA 1FDOA 2YYYA 4RMNA 4KVFA 4FWBA 2PT5A 1BWQA 3CH4B 4MR7B 2W2TA 1UL1X 1ZD5A 1HKHA 4PYOA 3J80A 4OO3A 4KPEC 1VYVA 4XPZA 2J4DA 3UKOA 4DY6A 3PSAA 4YCNA 3IPRA 1YF3A 2VPTA 2G17A 3O4RA 4HG2A 4LPKA 1CR2A 1Z2DA 2V0NA 1SM4A 5CA1F 4ARIA 2ZU6A 3H2YA 3QEOA 3THYB 1G41A 3DEFA 4I6EA 3IEMA 2NUTB 4GFDA 4HWGA 2W0SA 5TGZA 3ZNOA 4EJ2A 4MWGA 5HM6A 5FUWA 1H2BA 1F51E 1DG9A 1B43A 1UXKA 1ZH4A 4BQQA 3R5TA 1T1GA 2DUMA 3Q6MA 5J1SB 1UH5A 1R16A 1W4LA 5T64A 2GTPA 3ZK8A 5FTLA 1KO1A 1HDIA 3GRVA 4EHDA 2G9NA 4PLYA 3GDOA 1IN5A 4TV9A 1SKMA 2VYNA 3PZBA 4MX8A 1C9DB 8LDHA 1IPFA 1T36A 1X7ZB 2PUTA 3O4IA 3AVVA 4K6OA 4N40A 5BR4A 4BFTA 1PAUA 1LPAB 4I9HA 2ZIVB 2GSDA 1YA8A 1P1JA 4PYLA 1I7DA 2V6BA 1WDTA 4CCYB 1C9JA 3BFVA 1NUUA 1DO2A 1H69A 4YN3A 3VGPA 1GCAA 5L3QA 1AM4D 4OYLA 4FYYA 2OGZA 4YAOA 5JUWA 3D5EA 1UJ2A 3KYJB 4BLPA 2FN7A 5IKEA 1RPTA 1YK1A 2GCNA 3OE4A 1JG2A 2EKZA 5FULA 2XEXA 3A7EA 3L3BA 3OZFA 3HE3A 4MMZB 3CUEF 1GTMA 1KKUA 1GQOA 1RXIA 2WOOA 2FLVA 3TDMA 4BKQA 4D6PA 2EFYA 3O8QA 1KI6A 4F96A 3Q8LA 2I67A 1TA9A 4KDCA 3S40A 4WK6A 3M5DA 2IXDA 5GTDA 1WZEA 2RB5A 4J76A 4LJYA 4Q9JA 5JARA 5IS2A 2HJVA 2NNWB 2P2ZA 3G2PA 5MGNA 5EGSA 1Y0BA 1GKIA 2YV4A 4GI1A 3R1IA 2CXNA 2Z08A 2WG0A 2ZIUB 5EUBA 3TW4A 2CCJA 4DBLE 5LYJF 1HYQA 1U3CA 1WHTA 2CMGA 4PPFA 3HCOA 4BMNA 4WBNB 3MWJA 1AUQA 2Z1DA 4ZVOA 3BE8A 2GRUA 4A3SA 4WCFC 4XA8A 4WNYA 2M6RA 1Z17A 4IQ8A 2FLWA 2F3QA 4GOXA 1A27A 1JW9B 3MN1A 4DIKA 4IDEA 2IY9A 2F43B 2O2CA 3RJ5A 3BWVA 3CZ5A 1RJFA 3B9QA 3H13A 4RCYA 2HRRA 1GOTA 3D3QA 1RLUA 4PHFA 4LGYA 1ZGJA 3HXOA 1VSTA 3L6UA 4R2MA 5AKKA 1TKAA 2QMZA 2BF4A 1SCUA 3TIIA 2EFGA 1Y82A 2YH2A 3VAAA 1O9HA 2VLIA 1QP8A 4EJ0A 1I4LD 4IXMA 1EVQA 2XOXA 4KVGA 4CNBA 2NO9A 1RIIA 3FPLA 2PWBA 3RKUA 3PIRA 1UDCA 2ZUDA 3LCRA 3UJPA 1W19A 3N70A 3RSZA 4COKA 4DMUB 1QMPA 1QVAA 2NYUA 2P4QA 5HKOA 1U11A 3LNTA 4BIIA 4URVR 5TLSA 1PLLA 2B69A 1W75A 3HCWA 4FYPA 2V97A 1FYXA 2YJ5A 1B3BA 2Y1CA 1B0UA 2PZFA 5B6IA 4DCMA 3F97A 4ACBA 4ETMA 3DEKA 2C99A 4ID3A 5FUVA 1P5RA 2YW2A 5A5VA 4OQDA 4O2LA 2HSDA 1ZRMA 1EWQA 3O1IC 3GCWA 1NVVQ 3DOJA 1KY2A 4X8MA 4Y2HA 3EODA 4MR7A 1TTQB 2I2DA 1MABB 3IQWA 3H65A 4G89A 4BU1A 3C43A 1KJNA 2QN9A 3GLKA 3Q3EA 4KR6A 1JHDA 3RVQA 5DNAA 1XAIA 4PRZA 1HY3A 1A9OA 2ACEA 2RKWA 1RP7A 5LIRA 4KNYA 3D6TB 1ILEA 1YKSA 3C24A 4J0KA 3THYA 4TL6A 5DTQA 2NUTA 1U7PA 2ZKIA 1YNSA 3GVHA 3ECAA 1VLVA 3BB1A 3I92A 2PUFA 2HV9A 3DL2A 5EHGA 1JLMA 3DYBA 5KNCD 4GMXA 4KLRA 3WKCA 4R5MA 1YHYA 3FLEA 1DO8A 3UT6A 4C7JA 3P20A 4HEJA 4YWJA 4WKNA 2JFXA 2P8SA 2QS9A 4B7AA 4KRFA 3O7WA 2ZVPX 4I14A 3VDNB 4UMFA 1OR8A 4IOLA 3AB3A 4J75A 4C43A 3HKCB 4KPUB 4QUJA 2R65A 4MI9A 3U9TA 4BZZA 4FGJA 3PHHA 2UXBB 3ANLA 5KKCA 1QX4A 4X1IB 2VJYA 4CCYA 5A2GA 1TYZA 3R5HA 1P4SA 5KOYA 1H2RS 2C0PA 1Y6FA 1E2FA 2XYHA 1D4FA 1VSVA 2C4WA 4YMTA 5KJ1A 2J0QA 4J1TC 1MG5A 2R4UA 2ZCUA 3BGWA 4A2PA 4QNRA 1ENYA 4G23A 1YZ3A 2NIPA 1AK2A 1H85A 3ABIA 5E95A 1NE2A 4A91A 2ZSUA 2B9VA 5CXXA 4RVCA 5F78A 1GTVA 5H5JA 4LCEA 3ZKAA 1XMJA 1XN1A 1ZLYA 2OESA 3TZBA 1JTFA 2Y1GA 3B1VA 3PDUA 3ESBA 4M7WA 1E3SA 3CF6R 4ZXFA 1QLHA 3ZZTA 4CIDA 2DLNA 2RG1A 4NYMQ 4GI2A 3RFCA 1YI1A 3OZIA 1XEWX 3DLTA 4CDNA 3L40A 4RJJA 3O83A 4FDLA 1Z2AA 2UYCA 1A98A 1OTYA 3F6YA 4MJ7A 4YTEA 5K45A 2BLLA 1NNUA 1I14A 4BMDA 4RH1A 2ES4A 5JO0A 4E7PA 3EAGA 1JR3D 4KW7A 4CMJA 1PEKE 1TB4A 3DCIA 3MQFA 5EIOA 1VSBA 2HWXA 1HL3A 3A7DA 3FY4A 2ZUEA 3G1TA 1U7XA 2F43A 3X1YA 1N2XA 1ISRA 3OM9A 5TE9A 4EO9A 4FBMA 3LGSA 1IN6A 1IM8A 2HA5A 3ISTA 3QF7A 1NY6A 3DQQA 4GGMX 4HQLA 4FNAA 4Q1AA 1DOZA 2QUKA 4Q6BA 1DAOA 1DJMA 3AI3A 3K6SA 3C97A 4WK4B 3WIBA 2C8JA 1VKHA 3FOCA 2YXNA 1WMAA 1TF5A 1KQPA 4AJOA 2PX3A 2WJHA 3WS7A 2K4MA 5C18A 1U8YA 4ZAGA 3AY6A 1RWKA 3KUCA 4A0RA 4H6PA 2AXQA 1CDZA 1MB9A 5EXXA 3WGQA 4B47A 3QVLA 3ENKA 2I5PO 5M2QA 2QMQA 2GNAA 1M66A 5CFZA 1CEXA 3PUVA 1NFQA 2KX7A 4B85A 2FI1A 3ETJA 3D6NB 4TS4A 4UEJA 4ZANA 2JEZA 1JBQA 1PJZA 3PX3A 3HMQA 4G65A 3TRKA 1I36A 2B21A 2V03A 1LZLA 1Y81A 4EJFA 4IJ5A 4F72A 2FSVA 4X20A 4J4HA 1ZD8A 2XWQA 4M89A 2AUTA 2WA1A 1L7VC 2RB4A 5AM1A 2EJVA 4G4JA 5I3ZA 2XXAB 4H17A 1B0AA 3N87A 3IUQA 3AF6A 3HMKA 2AWNA 3SQWA 4P0TA 4QJ5A 5TQJA 2C3MA 2Q8PA 1OYWA 3TEJA 2BFFA 1XKTA 3A9VA 3FNHA 5AVRA 1XU7A 2ZUBA 2R4TA 1G8JA 3GA5A 1A2OA 3ISVA 4PG7A 5CW2A 4G86A 2C1ZA 1KO4A 3WDKA 4O4HF 3TJZA 3ZE1B 4HDAA 4YRAA 1ST3A 3F5SA 4MB6A 3ZIAD 4B8ZA 5LQAA 4V1CI 1SXIA 2H0QA 4HSGA 2VQFB 2GAJA 4E5VA 5HE8A 1I4DD 1ZJYA 2C4NA 3OU6A 1QS0B 2C9MA 1D7OA 1SBYA 2ZRJA 3D6UA 5K7SA 1UC9A 2WRZA 2VXYA 3F6SA 4HAZA 4HR7A 4RDHA 3UB3A 3KKLA 4KKVA 4IIGA 1XF9A 2NU9A 2AUMA 2HEIA 1NVWQ 2HWWA 3NOVA 4IIYA 4R1MA 1Y34E 3HKCA 2NVWA 4KPUA 4YJHB 5H7XA 2X9QA 3GI1A 3F5MA 4TXMA 4B74A 4EVSA 2XADA 1OC4A 1SPBS 4PGHA 2DHEA 3OZEA 2BGRA 1Y9DA 2C5BA 1ID1A 1DFIA 3DEHA 4HVCA 3H84A 2Q5IA 4ITUA 3DT6A 3ZE6A 1Y7PA 1Q1ZA 4MUFA 4GM4A 1MDBA 1NVVR 2GBLC 2FR0A 4TV8B 1YDFA 1OQAA 2ZJYA 2IOQA 4H7JA 1WOMA 1HDZA 1JDNA 5LYJA 4FHGA 4LGMA 4IFBA 5GQSA 2FPIA 2VA8A 5H82A 5KNLA 1NVGA 4XGNA 4TTPA 2CFCA 3RW9A 3G2LA 2JIZD 4HEQA 5HOQA 2RGWA 1W8DA 2I29A 4ZEMA 5C1BA 5FIUA 1YTLA 4JZYA 4J4BA 5F1KA 5LUAA 3L7DA 1CIJA 2CEKA 1GPAA 2GT1A 2QTBA 2XDAA 5GOZA 5A03A 1BE8A 2R6JA 1YC5A 1G8YA 1NN1A 3K20A 2DFLA 3OPMA 3L43A 3QU7A 4J7AA 1RJWA 1FX1A 4QBFA 2H6EA 5DZSA 1P5ZB 4ZTBA 3UQZA 4MAFA 3AUJB 3VR0A 3NONA 4LOHA 1I3MA 3I01A 4LXIA 3CTMA 3FFXA 4BVAA 3C7TA 3QX7A 4PTLA 4C6RA 3VHXB 4II2A 3RUFA 1DJQA 3F7OA 4OQZA 4Q18A 1DINA 4RBNA 3S1AA 5K8VA 4RXUA 2UXDB 1IWBB 1ZJ5A 2J87A 2PKQO 5I9IA 3NAQA 2OYCA 1DAMA 1Y7IA 3EZ6A 5DHSA 2OD2A 3OKFA 4E88A 4IS2A 3OX1A 4OGGA 1FUUA 3T4XA 2Q6IA 2JLUA 4A73A 3P9QA 2OA0A 1TCBA 2P9HA 3T5CA 5JDIC 1DELA 4OBXA 2QR2A 3HXKA 4C1BA 3MYYA 1L5GB 1KQGA 1T9DA 2O6HA 2XBUA 2LIPA 3CU5A 4QQFA 2E4UA 1ZH8A 2Y66A 4TVOA 2TS1A 1JA0A 1X1TA 3JWPA 3LOPA 3F8SA 4NOKA 4OSOA 2BH2A 2D5LA 2QEQA 3DD1A 2XKBA 4FFNA 2D4AA 1W5FA 3FWKA 4XFJA 1KORA 3WA6A 4L0QA 3PC7A 4BNMA 2F8TA 4FWIB 2ANCA 2I4LA 1U8EA 2IEDA 4NYMR 3C5VA 4PX2A 4F5ZA 3BT7A 1U7OA 3OY2A 5CURA 3U3RA 2JVIA 3QHQA 3UK6A 2NSJA 4WE3A 1NW4A 1L2TA 1ACJA 4B84A 2Y0CA 1BW9B 2YNMD 3ML1A 4TM7A 3A37A 5K8CA 4LOAA 1DLIA 3WNZA 3ANMA 4YONB 1DKQA 3PI7A 3WLNA 1U81A 1EHCA 1FFXB 3BSFA 2R84A 2ZRIA 4M86A 3K9FC 4KR7A 4IJQA 4E5NA 3QTBA 5JPCA 4G0VA 2ISQA 3OPYB 5DYGA 3PJDA 1VMEA 5F2NA 5HCNA 2GFQA 3KV3O 2P3QA 1OIVA 4D9MA 2HQ1A 5JAPA 2BI8A 3DJFA 3NCHA 2HX1A 3X1KA 4LJKA 5BSGA 1YDGA 2A35A 1MH1A 1AC5A 2GHTA 5ALNA 1JMKC 3TR0A 3OJOA 3V55A 4DDVA 4QJ3A 5IF3A 3QQPA 3ZY3A 1J1ZA 2BJVA 4F8EA 4JENA 1EBUA 1Y6QA 4YP0A 1INLA 1C9EA 2FJUA 2REBA 2QM8A 1SQFA 1L5LA 1M8JA 3AHGA 4UE3S 3T5AA 4LISA 4C0HA 5HKKD 3HCDA 4L4XA 2Q0SA 3EPKA 2IXTA 3IUSA 4M98A 3NYRA 1WU7A 4IINA 3ROMA 5M04A 5CG1A 2GNPA 1QS0A 3QY9A 3SQDA 1CS4C 1C7RA 3PXBA 1C7EA 4JQCA 1XTUA 4JVOA 3FVWA 3I0ZA 2H7VA 1ZMBA 2F9FA 1T5SA 3D3KA 1W29A 5JCJA 1SVWA 2BHTA 2OFPA 3LOQA 1WZIA 4YJHA 3U4AA 1YVPA 2PQ0A 3W8DA 4BBZA 3V8BA 5AW4A 1WXIA 2O50A 1JG3A 2H3EA 1O97D 1Q92A 2QKYA 2AOTB 3A10A 4ENVA 3I6BA 1PNVA 3P8ZA 3C6YA 3G89A 4QASA 4TYMA 1D3AA 1W35A 1ZK4A 3NTXA 4QKQA 2HUPA 2YKGA 3ZWMA 4GMKA 3UMRA 4H15A 3SSAA 2H1OA 2Q49A 4HDNA 1NVTA 3K1ZA 1V96A 1TUIA 2A7XA 2HIAA 1Z0AA 2WHPB 1MLDA 4FDUA 4BLWA 2Q0QA 1YCGA 1K88A 3RQIA 4DARA 4YRMA 4IWNA 5HSGA 5KTKA 2RBKA 3N9IA 3RVMA 3UAGA 4XDGA 2VI5A 1K3UB 1ZFNA 3CLVA 4YCAA 5JATA 3WNCA 1TUBB 4R9NA 2WIFA 1AKQA 3OCVA 4FZ5A 2NU8B 1NP3A 2JLQA 4LYHA 1T34A 4BKRA 2VP6A 3BZWA 4X85A 1X70A 2H1WA 3ROZA 1K4MA 1GG5A 1HYBA 2V7PA 3CEMA 5E9AA 2G88A 4MKGA 4K6KA 4YI3A 4HGNA 3D5QA 1DQPA 5DMXA 3ILHA 3TRFA 3NASA 4TN1A 3RYFB 2PM8A 1JB1A 3QU2A 4OP3A 1GDDA 2PUDA 3C3BA 2F3TA 4EB8A 4KQFA 5E6UB 1VZ2A 3FRIA 2O3RA 2J5BA 4QFBA 5ED4A 5JCOA 2NPIA 2EEZA 3GIDA 3MWKA 2WABA 2XYVA 5G0VA 4BBAA 3IELA 4XI9A 3SC6A 3COJA 4L9SA 1N4AA 1WL8A 1X42A 4NBVA 3HXTA 3SE0A 3TSOA 4EKDA 2Z57A 4FZRA 5KBYA 4INPA 1C4OA 3PGJA 4MLDA 1M1UA 2G0AA 1JFFB 2R9VA 2VG8A 4RJ2A 2WHRA 3L1KA 5K51A 2E6KA 2JHCA 4RPHA 1F6BA 1XDGA 4FEGA 4X3OA 3RF7A 4DDUA 4DV4B 1MIOB 1XRMA 4G5YA 1U2DC 4G1UC 3UMBA 4L5AA 3VYRB 2VZ8A 4MI1A 1LNSA 3GPDG 4NSNA 1K8YB 2JZCA 1DJOA 4OMDA 1ZH2A 3ZW7A 3UCXA 3WQSB 2Z9BA 3VXKA 4RJLA 5ITZB 4EJ6A 2XAUA 3AG6A 1CVIA 3JALA 1HRDA 4MQMA 3SCZA 4HRAA 4CW7A 2FWPA 2OCXA 3D8RA 4MLPA 3DNFA 3F47A 2RH8A 4IIEA 4IIUA 2X5JO 3P26A 4FTWA 3H1PA 2L2QA 2F8MA 1FFXA 2OCYC 4YRBA 3VI4B 2BTEA 1LFDB 1PG2A 3LL4A 3OC6A 4XVUA 3FOWA 1GG9A 3OPYA 4OK6A 3WQBA 4M0PA 1Z63A 3PC3A 1IMJA 3O4VA 3VNAA 4LBVA 3KETA 3FUCA 2C59A 1E2PA 5A2QA 1F20A 3MG9A 3TMYA 5CP8A 2GAIA 3ZXYA 1ZO8A 1F6WA 4REMA 4YREA 5JNSA 2OBMA 3A8TA 2CV1A 2IHVA 1A7AA 5C31A 3Q0EA 4O4IF 3T7TA 4AB1A 2PU7A 1LVGA 2W6IA 4B3SB 2PSHA 1EE9A 1KRHA 1GU7A 2YINC 3R09A 4OFWA 4F4DA 1G8HA 1WLSA 5BSEA 4OM8A 2B8TA 1M0WA 1TCUA 2JIPA 1K3FA 1PFYA 1B14A 1Z7YA 2EG5A 2R1UA 4IIJB 4UNQA 4BO6A 4B3RB 2GO1A 1H8EA 3ENWA 3IAS6 3UGQA 2P68A 4MRVA 4DBZA 5HQ3B 1A9SA 3FNEA 4U6NA 1QHIA 3L04A 4Y67A 4YMUA 3R74A 1NW9B 1FW8A 2DUJA 2FSIA 1GAXA 4ETWA 2JKYA 1X9HA 1NPYA 5ARCA 2YC2C 3S2FA 1HNNA 2ZZNA 4L51A 1IRXA 1C1XA 3SEAA 1QG4A 2DT8A 4V0KA 1RYHA 2VBGA 3A26A 4HNGA 3VDRA 3ZQ6A 5IKOA 4GWGA 1P2VA 2I78A 4E30A 3TLKA 2VSNA 4HWKA 1L7AA 4D98A 4HMQA 4JOBA 2W98A 4J6EA 2AOTA 1S7CA 3EOBI 4OATA 5I4KA 2LIVA 3AGPA 1WXXA 3PNBA 5FXMA 1EK6A 1MU0A 1JXQA 2RGXA 1JR6A 3R7BA 5KOHB 3PKJA 2YHSA 2C2BA 2C7PA 2Z5GA 4A27A 4M0CA 4AURA 4D4IA 1KE2A 5K3AA 1LSUA 3BTOA 1LRJA 3B85A 1K75A 4OH7A 1TUBA 2I2XB 2R6CA 4NYIQ 2PNJA 2NU8A 4RV5A 5FL3A 3RK0A 1HR0B 4AG5A 1YZVA 2K6GA 2JJYA 3FZQA 2GERA 3KB8A 3RS5A 4HS9A 3UAWA 5ALGA 3QPAA 2PR2A 5CLIA 4ZCSA 1CY0A 1PYOA 2GKGA 2R8YA 1E2KA 3MZ0A 4O5AA 1YHZA 3WLOA 4NU5A 1TO2E 1GL6A 2CK3D 1ZUNB 2COEA 1SKYB 3D3WB 4QU0A 4IILA 1SR8A 5DSXA 4EPXA 4Y18A 4IG4A 3CB4A 7ABPA 5ICSA 1PWEA 1D7AA 3HDYA 1ISHA 2AI2A 2H4XA 3O2NA 1DHRA 5E6UA 1R37A 4RADA 5CA0A 3ZWNA 4MUGA 2GESA 2VTKA 1OT5A 4LNUA 4QELA 4AYXA 1TRKA 3EQZA 1HTWA 4DM7A 1RZRA 4TWZA 3TX6A 3ZY2A 1IXZA 1ZCBA 4DS3A 5FWYB 4EELA 5JRZA 4NARA 1GFSA 3CE6A 2DU8A 5B1SA 5HJ7A 1XRQA 2C42A 2XNHA 4G2NA 1DIOB 5EZ5A 3ELYA 4K05A 1FPMA 2PH7A 4UUAA 4WNCA 4RJIA 2JD1A 4XUEA 5D5HA 3LT0A 1A9ZA 1JFFA 1T6ZA 3T94A 1IM5A 2H5JA 3LPAA 3KX2A 3OZAA 1XZQA 2FN9A 2BVNA 4IDFA 4L8FA 1U7WA 4RLSA 3CEJA 1IHUA 4GOMD 3G23A 3FPJA 2LNDA 4JP2A 1TYCA 3FAZA 1KSHA 2OTCA 3OCYA 4LQLA 5BV2P 3P9ZA 3D4PA 2PTGA 2JKZA 3LXRA 4RPJA 3OP4A 5FB3A 1QO7A 5AKIA 2K7ZA 3QX9A 4EFNA 1GRCA 4FLFA 4K7JA 1XMXA 3C48A 5AM3A 2F4VB 3ES9A 2VP5A 4AKEA 3GUYA 2O0MA 4MV8A 1TMKA 2JCYA 4MVJM 4UNIA 3QEJA 3MXTA 4Q37A 4QD3A 3TZCA 4EGAA 5K2OA 5JVDB 3VZDA 1VIDA 2VHVA 2HMAA 3V8VA 4QYMA 1H1LB 2XTMA 1AV7A 1G6OA 3V32A 1RMTA 1MX5A 2G1JA 3ROXA 4GR5A 5D8DA 4YR7A 1FFCA 1GAJA 4G1VA 4BO2A 3MCAA 3L8GA 4FS8A 3IC5A 4QHTA 1WUTA 4CGZA 2BN4A 1G6KA 4Y9SA 2AW5A 5CH8A 5CLGA 5EZSA 1H5NA 3CRQA 4OA8A 4BWVA 1Y7TA 2X9NA 2WKPA 2OHIA 3BH6A 4MA0A 4TL9A 3VDMA 4BMYA 2W2LA 4BEWA 4EJMA 5BNZA 2I03A 2O8EB 4YV0A 1S9DA 4L3OA 4ZMRA 1P44A 4DRZA 2RGNA 3BWXA 3N28A 5SZIA 4E2YA 5DHQA 2OB2A 1UZMA 3N5KA 4JXXA 4P9NA 2AX3A 4ESEA 2XF2A 4G5QA 4HGYA 2GJAA 2CLSA 2H3HA 3O3OB 5FOTA 5JI2E 1N33B 4Z4QA 1QTIA 5FJIA 5CVCA 3TOSA 1W30A 4G4SO 2VOJA 4QM6A 1G5QA 3HR8A 1G21A 3Q3JB 2AE2A 2WWYA 5B1DA 4WXMA 4MDEA 3CZMA 4NFHA 5H4HA 3UWDA 5JYDA 2CE2X 2FUEA 3W5AA 4J7UA 1Z5OA 4ZC8A 5ALZA 1GQFA 2JI6A 1WD7A 3LYAA 4JC5A 5KC8A 3H9JA 4RIIA 1Y3AA 3II6X 1YJ8A 4R8VA 4DQDA 3VR4D 4NATA 3HCRA 4OXXA 4U7HA 3EDQA 4A8JB 4PZYA 4HAVA 3RRFA 3GXBA 2IU3A 3MWFA 1MVNA 3T1YB 1N0UA 3ZDFA 1N8KA 1V8DA 3VKUA 4BFCA 3GJZA 3W77A 1R6BX 3VNUA 2CFOA 3I4LA 5GIPE 1VFNA 1JJVA 1YZLA 1SUWA 3RSSA 2GFIA 5K8UA 1SKYE 2ZTLA 2OWDA 1RLMA 3CYFA 4OIFA 4H60A 1ZRHA 1YRYE 2G71A 1TVMA 2VF2A 2DBYA 3IAS1 3ZHQA 1UBEA 3UXMA 2QN3A 4XX1A 5KOHA 4ND8B 2CLMB 3KQKA 2KQUA 1V6SA 3CW8X 3R5FA 5A1TA 3EXIB 3VPCA 1WBBA 3ZDCA 3CKYA 4AMZA 5AYVA 4BZQA 3AEUA 3VYTB 3MJHA 1L7OA 1K27A 3LDFA 3CNOA 1A50B 3EGOA 2VHUA 1OWMA 1RM0A 4RVGA 3U37A 3LAWA 2I54A 2ZRDA 1I3CA 2CHGA 2Z5FA 5BN4B 1QE0A 4M0UA 4HLQB 3T5BA 3M3PA 5EE9A 1XRJA 5F4BA 1UJCA 4J7CA 4PTZA 3RARA 3SZGA 5EMNA 5CB4F 3D3WA 4Q7EA 2RFLA 4XM1A 3T9CA 4C4SA 3EVEA 3ZWVA 3B9PA 4NABA 1U99A 1FDRA 4RLQA 4XSHA 4JLVA 3U09A 3JZFA 5KNDD 1Z7EA 1E2JA 2P0YA 4H0FA 1FFYA 1T9CA 3LHIA 3RVKA 5CB8A 2YIVX 2Z2ZA 3D6HA 4G84A 4CNQA 2Y3IA 1KWKA 2G28A 3NBFA 5CM9C 3USCS 3WWDA 3NKVA 5JASA 5FWYA 1L4GA 2R2AA 2R85A 4WZAA 3W5BA 3PX2A 4J9VA 1ZHHA 2QUHA 3QJ5A 4KBGA 4WD3A 3RU3A 3U0BA 5LP1A 3WLEA 2XWPA 2ZRCA 4UULA 1KYZA 4R1NA 2FAXA 1EVEA 4GECA 4HO1X 3U9SA 2BKAA 3P2EA 2CLKB 3QX8A 4E3WA 1JG7A 3DMPA 4JA0A 1E6CA 1QX3A 4YCSA 1BGXT 1E3WA 2HSEA 2ZM6B 1FFSA 1M5TA 3ILVA 3IP3A 4KMMA 3MCUA 4X6UA 2Y4NA 3C6MA 4D4GA 2H4ZA 1OZFA 3L8MA 2ZRLA 1VHDA 2Z3VA 1DDGA 2VQDA 3KVVA 1E6KA 2W4QA 4QEKA 6CHYA 1VLQA 2EFDB 3VSCA 4X94A 3RO7A 1A5SB 3KKMA 3WZMA 1VXOA 2NXEA 4YCLA 2QT1A 4RPGA 2CVPA 3IQIX 3UICA 5FLEX 2ZT6A 3W7AA 4ZCLA 1ZJ4A 3P9IA 2IPXA 1H1LA 2VPYA 4WPGA 1UBRS 2OL4A 1VJGA 3SIPA 4EGSA 1MR3F 5CH3A 5LLDA 1VJ1A 2L82A 2Y1OA 4LWOA 2XMRA 1YI8A 3ICPA 3COZA 3A2LA 2QRJA 4ME6A 5KTSA 4IGFA 5DJ5A 3GBPA 3P5SA 4CIXA 4U5QA 3A3OA 3VC3A 3GPBA 2GXQA 1RFGE 4GMFA 1T9KA 4B8YA 5H3LA 2HBYA 1DCMA 1EFCA 1RYZA 2ETXA 3H16A 2C9OA 4XCVA 2IIBA 3JR7A 5CVJA 1J2EA 2GEBA 2P5SA 1ORVA 1YR3A 3FYDA 4I9UA 3RYHB 3K3PA 1JVBA 3BGIA 1YJQA 4ZZ3A 1CB0A 4BO7A 1R6XA 4XQ9A 3PXCX 1UCFA 2WLSA 3LSTA 4XCXA 5T57A 5ICGA 2CVQA 4FR2A 1K66A 2QUAA 1QYCA 1HDOA 2D2VA 2F1RA 3D9QX 3N2YA 1JPNA 4L28A 4DUPA 4ENSA 2J5KA 4UNSA 3L84A 5L3SB 1E18A 1UP6A 4LYEA 4YPFA 4E07A 1Z82A 1ZXXA 1RPAA 2CCGA 4DJAA 2QX6A 3HNPA 3IUJA 5KCZA 1S6YA 1EBFA 4BAZA 2OBBA 1E3JA 2GPWA 2LTAA 3AIKA 3IQGX 4MZDA 5AT1A 2YWRA 1D8AA 3UT5A 2RGYA 1I2ZA 4EZIA 2EBWA 1DFGA 4U39A 1Y9ZA 3EE6A 3ZOKA 4QZVA 3TVTA 1B6SA 3IO3A 3P2OA 3H8VA 4RNDB 4CHGA 4CM8B 4PSUA 1Y5NA 1OYVA 5REQB 5KEIA 3AF2A 2Z30A 3BUSA 3FLAA 5P8WA 1D4ZA 2NN3C 1UWKA 2CXXA 1MNAA 2BEWB 1N3LA 3LUKA 3PGVA 4IMIB 4C1NA 3K5WA 4OI1A 2IRWA 4RGQA 3M6VA 5C7OO 1KK0A 2NTNA 4GI5A 2ZT7A 3BGSA 4BN5A 5EKTA 3O4JA 3RYIA 3GZJA 1B3RA 1C7IA 3MJRA 2D2IA 4NLLA 2PQMA 4TWBA 4FW9A 4W8OA 5EC8A 3C7DB 5DEIA 5KYUA 1BJRE 5FLXA 3A1NA 2I1QA 2G1UA 2AVNA 1WPGA 2Q1TA 4NDZA 3K09A 3EPHA 2HAEA 3IVCA 2WIAA 1DJNA 2UYYA 3FI0A 3C3KA 3H2ZA 3NHRA 4GP7A 4RKQA 3TD2A 5BN4A 3SJBA 4XRGA 4MDYA 1CY7A 3EFOB 4JI1B 3V42A 3C16C 9LDBA 2WEKA 1A9YA 2IIVA 3S4YA 4PNEA 3B3FA 1XE3A 5CCDA 1WB6A 3N75A 1JXMA 3OFSA 2IKSA 1SXJB 2JLWA 4TKUB 5DWVA 1CEEA 1ISJA 1XKXA 5TQ2B 1A8HA 1QV7A 1UJ5A 2QP9X 5JAOA 1NUPA 4QU5A 2ZJOA 1P8JA 4J91A 4BV2A 3KQYA 4HJRA 1N0HA 2WSYB 2JCSA 1MQSA 1V48A 4IQ4A 2XH8A 4WIAA 3GJTA 1BFUA 1I9CA 5H9VA 3EFEA 5F21A 3GEEA 4IIVA 4E2XA 2NO4A 1XZ8A 4L4SA 3NTUA 5GVRA 4TKVB 2AHRA 3RUAA 2PHZA 3D4OA 4Y6OA 1W9HA 2OSVA 1DC7A 4PIPA 2QY9A 2W83A 3AUAA 3COYA 3DE4X 4W8HA 4YVFA 3TZQA 1FUYB 4Z7OB 1Z7GA 1WPRA 3TLAA 5G1PA 3HEAA 3EUWA 2AXEA 1RACA 4RY9A 3GPIA 1W88B 1J33A 4XRRA 5ERXA 3ZZ1A 1I7SB 3NIFB 3LPMA 2PLNA 2O0KA 3TCXB 1VBFA 4JU8A 3LKBA 4IM7A 1ZEJA 1RM4A 4DJFC 3IV7A 3PFGA 2W5UA 1Q95A 3ND8A 3STXA 4A10A 3KXLA 3DOEA 2H8KA 3B1ZA 3ZZ0A 1MOQA 2XQJA 2IV7A 5FOSA 3PX7A 1NI5A 1Z4PX 4EQZA 1R0RE 2EWWA 1RLTA 4NE9A 2MR5A 1ZU5A 1X9IA 3U56A 1E3MA 1DRJA 4M1QA 2ZI6A 1CU1A 1N2CA 3PV0A 4GX0A 2IEZA 5TC4A 2HNAA 3QNUA 1DWOA 1KVTA 4CMBA 4EHHA 4YWHA 8ADHA 4JWTA 2HLDD 1NFFA 1T6NA 4TRJA 3WKAA 3A1VA 2QD5A 4TV9F 3UXYA 1DPFA 2D54A 4XIJA 2AG0A 4TQUS 3GJSA 3KLNA 1GNQA 3AHCA 5MN5A 3CURA 1KVSA 3RYHA 4EJSB 4C76A 4RVDA 1BU8A 3V6MA 3HM9A 1R8SA 4TTVA 5CAEB 3V8QA 2PRIA 3SX0A 4RABA 1PJLA 4PZZA 4UVIA 5L3SA 4RIHA 1HETA 3GA0A 4R2IA 5ALOA 2HRZA 1GGEA 1H0RA 4Z8YA 1OD6A 5JS7A 3TTUA 1YDWA 4PGMA 1YFJA 3MWLA 4YRIA 3ADKA 4CQMD 2FMHA 3VO2A 4B3BA 2J0SA 3G49A 4KQHA 4YROA 2VDWA 1IWPB 2VSFA 4FIDA 4MQEB 2O2IA 2UAGA 2JAHA 1XK6A 2Z2YA 3HM2A 1FNMA 3Q5DA 3QIAA 4IZ6A 5BQOA 4ERXA 4E21A 3MJFA 3RSQA 2HQOA 3D8NA 3UW3A 1K89A 3QOYA 1Y1PA 4O8ZA 4UCXA 3B82A 1SXJE 4TLLB 1F06A 4EHIA 2X7JA 4AP6A 5CX1B 1K6JA 3ET4A 1YFLA 1TU0A 1XRNA 4RFVA 4YDHB 4Z8XA 3SEQA 3T6KA 4YUYA 1FSSA 3KWLA 4A82A 1V45E 5DBFA 3BQMB 5HQTA 1W48A 2XGJA 4Q21A 2XVYA 1X7YB 4X90A 3SMVA 1VPWA 5J4KA 4X93A 1SU7A 4MOWA 1Q14A 3ZE9A 1AKUA 5IVPA 1QR2A 1OXVA 3JQAB 3TL3A 1EEXB 3NWEA 5BOSB 1W85B 8AT1A 3IIJA 4ZOCA 3KP1A 1EYZA 3TAHA 1R4MA 4ATNA 3EFOA 3T3OA 2QZSA 2C9YA 4P92A 2GD0A 4JBLA 5K6RA 4G6ZA 4KACA 1XD2A 1PJCA 4KPGA 2FKAA 2SNIE 1SXJA 3PTLA 4LDRA 4MPRA 1V5IA 1T5IA 1XHEA 4S0XA 1NU8A 1FDWA 4H31A 4I1RA 1EWTA 3NHYA 4I3GA 5DV9A 5JMWA 3I3SR 3GLGB 1LBTA 2H2AA 1X1CA 2ILVA 2LW7A 4ZU6X 1NIPA 1Q77A 1SU4A 1MPXA 3EXAA 4RDIA 3W79A 3AM1A 2AZ4A 3RBAA 4XLTA 2J08A 2GQ0A 4LZZA 3FYHA 3OOJA 5E2AA 2OFWA 3M4ZA 4Y9DA 1X2EA 1Z5ZA 4FGZA 4MLZA 2PK3A 1ZI9A 4M60A 4BFZA 4DC0A 2BFEB 1WHSB 1OAKA 1V26A 4LHWA 4TKVA 5AHRA 3RC1A 1OLUB 3E0QA 3EZFA 3PXUA 3GFRA 3M1YA 3GJ6A 2UYHA 3D0KA 1A2BA 2FPPA 3VPDA 1FNSA 2Q21A 3EZXA 5HPYB 3AHIA 4HYEA 5BR7A 1Y5RA 4ID9A 1G6Q1 4QDTA 1FFHA 1U0FA 1KEVA 1IIBA 4CDRA 4A6PA 1QC5B 1E1QD 2G9QA 2HIGA 1FFWA 1ZMXA 2PT6A 3NXKA 1RW4A 3RJ9A 1P2DA 2PRJA 5BWOA 1LI4A 5BMVB 4ONEA 4KWHA 4KL8S 1ZW6A 1PWZA 5JLJA 1JI0A 2HK9A 1ZJJA 3PJFA 3EN0A 1NN0A 4CF4A 1F2DA 4BKMA 2CVHA 1RHUA 4EL0A 2W70A 1QYVA 3OWHA 1ZUIA 4RHEA 3AEXA 1O3YA 3TCNA 5BP7A 3VAZA 2JC3A 3AIIA 4W7SA 3JWIA 5G41A 3V5NA 2WICA 1I30A 1Q1BA 4RVNA 5BPHA 4JI8B 1PZFA 1UMCA 3TR5A 2FZEA 2JCBA 3PBKA 3SJZA 3UUGA 5IDXA 5KQLA 4AY6A 4G1FA 5F9MA 4AUMA 4L5YA 1RCFA 5J2TA 4J3NA 4F4UA 1M6VB 1T0IA 1YZQA 1MO6A 2PXXA 3IXLA 3W5HA 4GGPA 4JOCA 3U3JA 4AF7A 3QFHA 4R84A 5JCOC 3CNQS 2PLWA 2KB0A 2G5PA 1CY4A 3CHYA 1X94A 3MSCA 3IAEA 4G5GA 5AI9A 1YC2A 1ZR2A 2ZCJA 2WWVD 1D5WA 3HN6A 1JT9A 3T54A 4I50B 5GONB 4EJSA 3PYXA 4LMRA 3DTTA 5DFAA 4DR1B 2X19A 3IYLW 3R41A 3SX2A 1CNEA 2F3UA 2FZLA 2GD6A 4D9IA 3QFCA 3B3GA 2A1TS 3A1EA 4HDQB 1HK7A 1LC0A 3QU9A 4OKNA 1S2LA 1TLTA 2IZZA 3Q98A 3T3IA 2WBLC 4QAQA 3R7AA 4CFZA 1E69A 3DR5A 3M70A 4PIMA 5CT4A 4BRSA 1SFRA 5BV0A 3KTOA 5ECWA 3N0RA 5AW0A 2PL5A 3VNBA 4DCCA 4GPAA 4LGCA 1SHJA 4N5MA 4XTCS 5HGXA 4FFVA 1BHJA 1GAQA 1CYDA 1QNFA 1XTVA 3NC4A 4R0MA 2XYRA 3MUOA 5GVSA 4BBJA 3ROKA 1L4KA 1LC3A 2QVCA 2YWCA 2G4LA 3FSGD 4BATA 4UD6A 1DUIA 2Z0MA 3TG8A 3U7GA 5CHEA 3M5WA 4QULA 3SBEA 3DTVB 5EUQB 4Y9RA 1N2ZA 2YVLA 3W6UA 2B20A 1DEOA 1I7PA 1K8QA 1G19A 2JD2A 4YHBA 4HLNA 1K92A 3DAPA 2QBYB 2YS6A 4XIGS 1HUQA 4OREX 5D3QA 2RKBA 4P3OA 4U8GA 1N9ZA 4URFA 1NQAO 2YWDA 3OIUA 1Y8RB 3PQCA 4JUIA 4V0LA 5LQSA 1T24A 2GDJA 3RJTA 4DMCA 2QQFA 4LBWA 5K3EA 2H7YA 3FMGA 3C3CA 2B35A 3BYZA 1X7YA 2F7SA 5DHPA 2HHCA 2MYPA 5IVIA 5SZKB 2NQTA 2QROA 4WK0B 3DZBA 3JQAA 3MRVA 4NDNE 1CUWA 1T13A 1WPXA 1XTRA 5ULLA 1P1BA 4W1PA 1ZVJA 3UB2A 2QTZA 1PJQA 1TVCA 4S04A 2Q29A 4X7BA 5TXGA 3ADDA 3OM8A 4INAA 1QG6A 1CQXA 1Y8CA 4E03A 1P4RA 1K7SN 1LBIA 4JU9A 4RIEA 4BQIA 4QYTA 2A1IA 1PT5A 4EUNA 2M32A 5KOJA 3M4JA 3HCNA 1R8XA 3ZJYA 4PEVA 5KTTA 1JHZA 3MRXA 3U44A 3SNHA 3BL6A 3PITA 4AKHA 1A5BB 2WF9A 4KQGA 4EHFA 1F8GA 3GLGA 2G0TA 3EGXB 4C07A 1JHQA 4ARVA 1K4KA 4EHLA 1MRSA 4RHUA 4INJA 2Z95A 2J45A 1RXSA 2FSFA 3IVMA 5IRCD 4YRJA 5ILGA 3EJ6A 3R8FA 1KPIA 1OGJA 3FA2A 3AC0A 4KFTA 5DLPA 2BFEA 3WQHA 2A9PA 5EJ9A 4FQ7A 1X0VA 1C80A 1RZUA 4HVTA 4PHTA 1AK1A 1HC7A 3KU1A 1BMTA 3MAAC 3OY7A 5AQEA 1O2DA 3S81A 2VIIA 4BCBA 3D6AA 3K0CA 1DKOA 2ANBA 2EX0A 3T7AA 1L7QA 3RT1A 1JEAA 4WY2A 1QKJA 1UR5A 2NZVG 2CXTA 1QC5A 4JLDA 1AF4A 1TZKA 4KVZA 4LTMA 2REXB 2ZYTX 4I9GA 2AG6A 4EI2A 4C4YA 2C5EA 2VDOB 3PSHA 3K4PA 4HLCA 3MTDA 4CL2A 5BMVA 3M8KA 1E9DA 1Y8ZA 5F1YA 4DV6B 4LHYA 3RUPA 3A1WA 4DEVA 2LWIA 4BKPA 1LNZA 5G0TA 1Y4UA 2H1VA 3RS8A 3WQQA 2VDPB 4CEHA 1SHLA 1RRGA 4HNAB 4AJIA 4IDOA 4LN1A 3G17A 1LPNA 3ROFA 5G02A 4WVFA 5C2JB 3Q3GE 1J9GA 4G9BA 5H68A 5IAKA 2J32A 3BB3A 1BRMA 4YP6A 4B2LA 3PUJA 2XCOA 3G7SA 3HWX1 2GF9A 1EDDA 2PSDA 2DGDA 3LHFA 4J29A 2EP5A 4PS1A 2PMDA 4U00A 4UD2A 4NRDA 4WKCA 1M6VA 1UBFA 4IDHA 3INYA 4IUYA 8ATCA 2J3LA 5EHXA 1QVRA 3BVPA 4OQEA 3ZWDA 4I8XA 3LD9A 1RI5A 4ZCTA 5JHHB 3ZJVA 2VPZA 3S0JA 1CR4A 4HL6A 4WHMA 3H2IA 4NPAA 3U4HA 4I50A 5GONA 3OX4A 2EC5A 3L49A 2H18A 5AOCA 4ALNA 1XCOA 5IKPA 4FT2A 4TTQA 1JAIA 1PG0A 4N12A 2O5EA 2O8VA 1CHNA 4TSRA 3ECCA 4UAGA 5HCUA 1P91A 2X58A 4JBYA 5AM5A 2PTHA 4MIKA 1YWGO 1GV0A 3A1TA 1IY2A 1YS7A 2VSQA 1RYFA 1XA4A 3E5RA 4KQEA 4MGYR 4F2DA 5LQCA 2CN1A 4P33A 4G9EA 3VUFA 4G9GA 4CT0A 2J30A 2AD5A 4PSDA 1B8NA 1PSZA 2RI6A 3CUVA 3WE7A 1OH5A 2YOHA 1A7UA 2OHFA 1WF3A 3OO0A 1ZWLA 4JBWA 4RW0A 3WIUA 4WJLA 2X7HA 5LM3A 2HU7A 2IYSA 3K05A 5AKHA 1R0BA 4AZTA 1JHRA 4GQAA 1AHPA 1D2RA 4MUIA 4RH0A 2FQYA 2Y71A 4MVJE 4FR5A 5IKMA 4W6QA 3CVWA 4RV4A 3GRYA 1X14A 3NETA 1N7IA 1U8ZA 4O02B 1FK8A 3QRWA 2J59A 4IDBA 4BN4A 1TK2A 3EG9B 3CZPA 5FL7A 5JMPA 4RHFA 1PFVA 3IQFA 4R51A 3O7MA 4Q1CA 3M49A 1E2HA 2O2ZA 1WG8A 4Y9TA 1HE8B 3UG7A 4LY0A 2LKDA 4C06A 4DIBA 5JY6A 4DR4B 5FI3A 3QU5A 1VPVA 2WZCA 4QWMA 4F1KA 3UK7A 5K1ZA 4G4SP 2XGSA 1WCV1 4QYIB 4BNGA 1S3IA 5JMTA 2RGNC 4RTPA 5B6JA 3ZDDA 2X1VA 5J40A 5KYYA 4GE3A 1V25A 1GSAA 5HDBB 2FP3A 4CI9A 1U2EA 2R47A 2ZM5A 3FPKA 1SWVA 4YAEA 4E5KA 1G5RA 1ACLA 2DJIA 1DX6A 4TMTA 2BEJA 5A6SB 2HDNB 2P5YA 2WG1A 1BG6A 1EGQA 1EP3B 1GRRA 2D7CA 3FH0A 1XIVA 1XVIA 3KJNA 3PHCA 3RS7A 3DEAA 1Y3IA 4JLNA 4RWZA 2CNBA 2QVLA 3I76A 5CDFE 2EWVA 3EGXA 3BICA 1YZGA 5BW4A 3KR0A 2PR7A 4TS1A 2KSQA 5CDHA 3CNBA 2W00A 3G0DA 3AERB 1ECPA 3BIOA 1NJFA 2F1IA 4X24A 2BYTA 2QM3A 3Q10A 3SX4A 4PZ9A 2B61A 3AB7A 5E38A 1WY7A 3O8DA 1JSZA 1EFPB 1ULSA 2AA3A 4I08A 5FI5A 1K68A 3S27A 3BB4A 2I2BA 2XMSA 4Y6GB 3SXJA 4C04A 4PAQA 3T7EA 1W44A 4YC7A 4PXSA 3NJ8A 2A67A 2VSYA 3UMFA 5BYJA 1WUHS 5K5EA 3CJTA 4L0DA 3IPLA 1T9BA 1JPUA 4HMOA 1U9YA 2HN9A 3UHOA 2H85A 3RUIA 3NM6B 3AR9A 2I66A 2O6LA 2IFTA 4AJ2A 5I7SA 1N2BA 4UAVA 2XOKD 3IDSA 4JVSB 1ISFA 3EHEA 4BVHA 1Q12A 1THZA 4CMHA 4B0OA 1VE3A 4PHGA 4QU8A 3FPEA 5DB4A 4G24A 1VJ0A 2FOLA 3K72B 3QA9A 4HNAA 4X3CA 5CTJA 1HYGA 3IQDB 2YOFA 3T41A 4F85A 2IW1A 3LLCA 4GL2A 1XZCA 2CNWD 4JX9A 3L0DA 4AW9A 4PBSA 3UWMA 4NZPA 4K9MA 4F71A 1LPBB 2JNWA 4QPNA 2I7TA 4CQLB 1T6BY 3GCDA 5DTRA 2DR3A 3WNQA 2RIPA 1SY7A 3GR6A 1GZ5A 3T9FA 1H6AA 4NU0A 1W47A 3HDVA 4NI5A 2WNHA 4YAFA 1UC4B 5IANA 2VFAA 4O29A 3BBPA 4TZKA 1KYIA 4CF6A 3WGGA 1O95A 2JAUA 3ZWYA 4UHDA 4LWQA 5C1IA 3BILA 4FONA 2R1TB 3A6JA 4OYHA 2KI5A 3SFVA 4RD3A 2ZRBA 1ZNXA 2WF8A 3DMDA 4LUCA 5HWSA 3IT3A 2X1HA 5FQNA 1FP7A 4LOJA 2ATVA 1ESMA 2YMPA 1ADGA 4WXRA 3ZQUA 1PD0A 4KAAA 4DQXA 4RU1A 3FPHA 3KEFA 3OZCA 4U7TB 5ED0A 1V11B 5DTJA 2JLSA 3QVSA 3G2IA 3BHMA 1LV8A 4ON9A 3QEAZ 2QV7A 5AJUA 3UJ3X 1QH0A 3UMJA 4CKZA 4K46A 4H9GA 4AUNA 2IP2A 4YUVA 1DMSA 3QKRB 3W6PA 1DP4A 1YZNA 2R48A 2GZRA 1HLDA 3DO6A 3HY3A 1XALA 1AMOA 2WF6A 4RCVA 1IQPA 3JYQA 5C8VA 3S2IA 1BA3A 2R96A 2P9ZA 1VBMA 3SS8A 2H06A 3I2JA 1QF9A 5EWMB 4R98A 3CBQA 3UA4A 1IZYA 2G6BA 1P0FA 4H16A 1ULBA 3DFIA 3WZ2A 2R1VB 3HRIA 2JFFA 1WPQA 4FQ8A 3WGLA 5G0WA 4B35A 1MORA 2BGNA 1MO3A 1Y48E 2PFKA 3D1VA 1AE1A 2AFIB 4JL5A 1J2YA 3ZYZA 5CX4A 4DMRA 4QYIA 1DZ3A 4HWRA 3TNYA 2AKYA 5JJBA 3NDPA 1H8HA 1WVIA 3BCSA 5LXTA 4W9RA 1AQJA 1TAGA 3OH8A 2HIMA 3VR1A 4ZQIA 3DBRB 5EJ2A 1VIMA 4JDPA 1FE8A 2QD4A 3F6RA 4XDYA 4RKWA 5JISA 1FMFA 4F6RB 3H2KA 1GZ3A 2EL7A 3GMTA 2ZQ5A 3CSDA 4LZNA 3R7WA 1ZVVA 2ZRNA 4XQEA 1QQ7A 3BE4A 1PVDA 3HRKA 4FEEA 4Q4LA 3ROGA 2VBFA 3RD5A 4X60A 3EXG2 1HFEL 1RS0A 2JEYA 4LJ8A 1M2NA 1O94D 2PA3A 4RWEA 5KYGA 3GJ7A 1PZNA 3F3YA 4HH0A 1NXQA 3LUAA 2EV9A 1HOTA 1Q7BA 3EUAA 4HGOA 1M2GA 1EFPA 2G70A 4A6DA 4URWR 1N2IA 3TQSA 4PGAA 2WB4A 3SC3A 1TF2A 2GLTA 1XEFA 4AG3A 4C01A 2COUA 1M1NB 1Z9BA 1DCFA 1GVHA 2WYIA 3FCSB 4JKYA 4HNTA 1YJXA 3LCMA 3MS7A 3H9EO 3ZVKA 1SQ5A 4KOAA 4BASA 4C2AA 2GAFA 4QDJA 2ZIXA 1GYPA 1P1CA 1U02A 2BGLA 4JP8A 3NHFA 4FOSA 5G4KA 3P71T 4AP9A 5AVYA 3ZDQA 1YL6A 1DEAA 3I0MA 1I10A 4G1CA 1H0KA 1U1EA 4QWWA 5JADA 2BRUA 2ZB2A 3P9YA 4LXUA 2EGUA 2R5WA 3R40A 5TR9A 1IY8A 2HFJA 2JRLA 4S2UA 2J5RA 4XWWA 1G18A 1VGRA 2FOXA 3O95A 4C7KA 4N03A 5BWCA 3K09C 1IEVA 2YVAA 1I24A 5T41A 4UVHA 4A0HA 1P5JA 2PMCA 4NEQA 1PL0A 2YY5A 4FHEA 3L1HA 3OTGA 4UXHA 5CYFA 5EXDA 3K8QA 3X1WA 5JPIA 3NVAA 3PFCA 2HK6A 1N2SA 1C29B 3IOBA 3Q1LA 2ZWAA 3VNRA 3VVCA 4BX8A 4F2PA 1OFUX 5KYTA 3LA8A 3LBNA 4ZKEA 4CQLA 3ROEA 4YRSA 4WKOA 2YHAA 1OHHD 4JK3A 1NZJA 5D5PA 1CRPA 1OFIA 2XSZD 4R8RA 5DGHA 5EQJB 4B87A 2HRDA 3KAPA 4LJRA 3ZIUA 1JAYA 1K6XA 1QH1B 3T7IA 3RHSA 1UT5A 1Z06A 5GMOA 4IMRA 4MCAA 1RQ2A 2OGUA 2RAUA 2X41A 1Z4JA 3AU9A 4Q1EA 4EPYA 5LOVA 3NR2A 1UM9B 2JGAA 3GGSA 1LD3A 3RRBA 3IDOA 3FDZB 1GAEO 1UBOS 1OX4B 4QX6A 4OI4A 3WAKA 4JNCA 2Q4EA 4GI3A 1FMCA 2JFZA 3EIUA 3GEIA 2G72A 3TM4A 1P9OA 1KZHA 3ZWOA 5IJ0B 1H6DA 4MNTA 1E79A 2CLLB 1ODFA 4Y2XA 3TPZA 2EERA 1U3VA 9ATCA 2C2XA 1CXZA 5J47A 4M7PA 5KWEA 2AFIE 4EARA 1D0IA 1QWSA 4PN7A 5L3ZA 1E2IA 1WDKA 2CF5A 2I8LA 5ALDA 5BSUA 1CEQA 2V4ZA 3G0CA 1OWNA 1EDOA 2QUZA 3CPJB 5CM8B 5FBQB 3L7OA 1LPPA 3NJ4A 2F3PA 1JP7A 1VP3A 2Z5VA 4NZOA 3TFQA 4A7PA 4ENWA 2IS6A 4JKOA 5J43A 1D2AA 1LJ8A 2EFEB 2YW9A 4LYFA 1GTG1 3I28A 3R9KA 4W5RA 3U3KA 3IUPA 1AQ6A 1ENZA 4LRYA 1ZI8A 5KNBD 3X1JA 3RVJA 3PDIA 5CA0F 4MV6A 2FRDA 3RDPA 2XTAA 3BRSA 2JAWA 3EASA 1M67A 1JQ5A 3OF2A 4ZIRB 1UBJS 4LHSA 2R1VA 3FAKA 4MRNA 4DG5A 1KQNA 3HDTA 1QGOA 3DF9A 4A4DA 2AFIA 2GTIA 4LKRA 4LTDA 3RC8A 1R9NA 5BRJA 5L53A 4P38A 3ZW9A 1U1IA 3JYPA 2Y6VA 3P19A 3KSAC 5DM70 1LWOA 4IIHA 3DBRA 2Y1EA 4P58A 1XLVA 2Q2QA 1Z4NA 1SBZA 2HJWA 1ZGHA 5F1PA 3H2JA 2M6KA 3TSZA 3UF0A 1P5FA 4F6RA 2JVJA 1KFEB 3FUVA 3H9BA 3V46A 4EBBA 3GJRA 1CDEA 3D43A 2C2WA 4FKMA 4HSEA 3STVA 3D02A 3EZGA 3CR8A 2WTMA 3KC2A 4Q3NA 1TAHA 2V4UA 2YX1A 2H07A 4MRRA 3HFGA 4NR0A 4PLVA 4BFSA 1AMNA 3AEQB 3N0TA 4HQRA 3LLVA 1E4EB 4TUYB 3FCYA 4NP6A 3DPUA 4Q00A 1PV4A 2V6IA 4K87A 1DRKA 5L6LB 2UUBB 3O9ZA 3DTVD 1WCXA 3SK0A 3MTEA 3C5WP 4TXLA 1M1NA 4O1IA 3INTA 1PQYA 4BNLA 1MD9A 2ZR0A 4RTOA 4WXPA 4MS1B 2UUOA 1WM1A 2OHXA 1CPYA 1Y33E 1PK9A 1C0IA 2PZMA 5K4AA 2QRNA 4FVTA 4PAGA 3H87A 2ZJ1A 3AH8A 3LQ4A 3NWJA 1MENA 1RQLA 5BURA 2C7VA 5E9WA 2A4MA 1PL6A 3O0DA 1J6UA 3OE7A 4HWSA 4R1PA 5EAIA 4E1BA 4IQGA 2NLOA 3W05A 1JFLA 1T9GS 3TD6A 3U4CA 4AZSA 4TQAA 3QUQA 1ONNA 1ZD9A 1CB7A 2PXHA 2ZIAA 3TRJA 4OL9A 4ZJYA 5GINE 4LXYA 3R3YA 4EB6B 2ZJ2A 5JSZA 1X39A 3AESA 2VNJA 1FZQA 4EG1A 2QLLA 4MVJD 1AHIA 2G40A 2FE4A 6LDHA 3I9KA 1SXJC 3EY4A 4UNPA 4GYJA 4GBMA 2OC9A 1YR9A 2CXOA 4LK2A 3SHFA 5KVAA 1WNFA 3LVBA 4H2DA 1HL7A 4IFTA 4BNHA 2PAFA 1Z0DA 3S7ZA 2IEBA 2FR1A 5FT9A 421PA 1PGPA 4MW9A 4NL4H 1RNLA 2ZFUA 3TGPA 5DDIP 3LE8A 4K1XA 1HWYA 4PU0A 3SHWA 5BUQA 3THXA 2QL6A 2OAGA 4X7MA 2ODTX 1GG8A 3STHA 1R8QA 2FPWA 3AOEA 1XYGA 2RMKA 3IDFA 1CUIA 3GJ3A 3PDCA 1WTAA 1UQTA 4RXMA 3FFTA 4REOA 5IZ4A 4ZCRA 5IJ0A 3S5JA 2FNAA 2NUPB 3H05A 3UHFA 4AP5A 5KJEA 5I7WA 3WGHA 1Z26A 4KXUA 3AHJA 5FV4A 5CB6A 3A1FA 4LBYA 4Q1BA 1L1EA 4QUHA 4LIPD 5BNWA 1Z37A 3K6JA 2C2OA 4B7ZA 4CM9D 5HFNA 1MO4A 3B2QA 4K8OA 3ND5A 4FZJA 3TQHA 2OBNA 2HJRA 4MITA 4IVQA 3AV3A 3GLQA 3ICVA 2O0HA 1GNRA 4U3JB 4FKBA 5FWXB 1J90A 1QPZA 4JC8A 4UOZA 4ZT3A 5A0VA 4W5NA 1VB3A 4DIDA 1HSOA 4G85A 5DNDA 1W6UA 1TRHA 5C4MA 3WC4A 2H8GA 4L16A 1F48A 2ZITA 4J0EA 1RXYA 4JDUA 4Z0HO 4ALJA 1MW9X 5C7YA 5CCEA 1FC0A 2F9LA 4TL8A 7REQB 2F17A 2CBXA 2CMDA 3G0HA 4OQFA 3IPAA 3R6WA 1JUDA 2HCFA 1AB6A 1B15A 2XDYA 3A14A 4LVNA 5TS2A 2IVZA 5EP1A 5ELLA 4E2ZA 4ARCA 4G41A 1GCUA 4P4UA 1RJEA 3P0IA 4QPPA 1FRFS 2H2IA 4AZ3B 5JYEA 4EJSC 4MW6A 1N9GB 4U2CA 1T4GA 4BJ6A 4EY3A 2AC7A 5A9SA 4L02A 5EZYB 1QIFA 4ZVNA 4XDHA 1YUMA 2JH9A 1V47A 5T4HA 3I52A 4C89A 1KWGA 3IMGA 4F45A 4I7EA 5TX7A 5C3MA 4FXOA 3U7QB 4CEIB 2H4YA 2YFYA 5FF9A 5ALHA 4IEFB 5EINA 1SA0B 4QSHA 4NBUA 3N05A 3R8XA 2H51A 4DCUA 4N9QA 1ZKDA 3AEQA 2HOQA 4LYDA 1CUSA 1PNOA 3PUKA 2EOAA 1E4EA 5JVDF 3CC8A 1SCDA 3JYLA 5H8WA 2E2WA 1QGUB 2A30A 2N3ZA 2NUAB 1QF6A 1Y8QB 2GH1A 2GEVA 1IJKA 2PIAA 5DHUA 4PC6A 1Z2OX 1KYXA 2L18A 1OVMA 3ER6A 4CLXA 4C21A 4GU5A 5CFQA 1NRXA 1Z74A 2P6MA 1HX7A 3FPFA 2JATA 4GOOD 4IIDA 4EG0A 1NMSA 3AL0C 3ZOZA 5K3FB 3WP1B 3HJAA 1K98A 2ESRA 2RJOA 1C3OB 3C7AA 2Q7XA 3EDMA 2R00A 3C3MA 4FFRA 4N5IX 2WOJA 2XV1A 2V5UA 2VPQA 4MI6A 3UWPA 3GZNB 4PC3A 4CTNA 2J33A 2QORA 3A4TA 2HBQA 2OLEA 3C3YA 4Z5XA 4MWOA 1QRAA 1WNTA 4AO6A 1URPA 4HPWA 1HQKA 2CFRA 3VSEA 2ZPAA 3LY9A 3OWXA 4O4LB 2CUKA 4ISCA 1ZAKA 2YUIA 3O91A 3KT8A 3UJDA 3O92A 4QOFA 1T29A 5LC1A 4B3IA 4EB6A 3AINA 1JIXA 2N0SA 5C5DA 2CLEB 2C2HA 3CSSA 4ZMSA 4BP9A 1JAXA 3R75A 1OH8A 4J49A 1CUCA 3AETB 4TKLA 2Z9DA 1K5HA 2I7DA 2BGWA 4LJ9A 2IXGA 2PZGA 2ZT5A 3BEOA 4UZSA 1UPFA 4CM4B 2GPNA 1DT5A 2V1XA 2WWXA 1KJQA 2R5NA 1DRWA 1LVUA 2A3RA 2DFVA 3FVTA 3CRNA 1KF0A 4E08A 3BJRA 3GFPA 1CJMA 1Z8NA 3O8OB 3AUFA 3KHUA 4NCBA 5SY4A 1XZGA 2REQA 3C3WA 1YCDA 3MILA 5GV8A 1K7FB 1KPHA 1U5BB 2IYAA 3IJRA 1CWUA 2QPLA 4PRLA 1FSFA 1CVLA 4W1RA 1NBMA 1TPYA 5E6RA 1D8TA 5AP9A 1KMNA 2JHFA 5B3LA 3ZGNA 3HWRA 2NVUA 1EFRD 3K0CC 3VPHA 3K9QO 4BP1A 3QJGA 1ODLA 3KZKA 5BY2A 2VN8A 3EC1A 2ZUWA 3IE2A 1AKMA 3KVOA 5T3UA 1OXBB 1Z07A 4JYCA 3RS2A 3SBDA 3VVBA 4B2YA 4ZI7A 1DNPA 4EGJA 1X1QA 4DIUA 5K09A 1Z68A 5FEUA 1NJ6A 3L0IB 1V6AA 3EXEA 4C3VA 3RC2A 2ORVA 4UOEA 4M22A 1CR1A 4Z1MA 5EIEA 3LWDA 4U3JA 5KWSA 2C5LA 2Y93A 1YAHA 2AJLI 3RG8A 3UIEA 2ONKA 3DF7A 4GE0A 4QARA 5HA5A 2JLZA 3EPLA 3OJ0A 1VPEA 3H5RA 2QLBA 3H0KA 4ER3A 1BAPA 2FW1A 3T15A 4DJJA 1JIIA 4JJ4A 2WIJA 3VSAA 1EQ2A 1IBRA 3E9EA 3D0OA 2BKLA 3I9MA 1ISSA 3L9WA 4D97A 4HAUA 1JLLB 4L74A 3PFBA 1EFHA 2NQ2C 3M1AA 2C5SA 3U40A 1T2UA 1EUCA 2EU8A 4ZEVA 1RKVA 2PUEA 5T5QA 1G20B 2CUNA 2W6ZA 4Q05A 4CV1A 4HFNA 3DZIA 2NTJA 5EHZA 1SC9A 2AN5A 2VRNA 5D2CA 1ZIDA 3ILXA 2B5VA 4Y2TA 4B43A 2WSBA 5BRNA 2IHBA 5JZBA 2OCIA 3QXHA 5B57C 3OEED 3UOGA 3W34A 4U2EA 2V8BA 2IXEA 5EZYA 1KJZA 2BY4A 3WGKA 1QE3A 1MOZA 1ND5A 2YCLA 3SHTA 3ZCRA 4Z4FA 1OSNA 1E4VA 2C82A 1AUXA 4ADSG 3U7QA 4CEIA 1LBSA 4OQMA 4QDUA 5AVJA 1U80A 1B7GO 3O9MA 2PZBA 4NEHB 2NSDA 1SA0A 4DV5B 3U7FB 1RZ3A 3H1TA 3P7MA 4CPDA 3G68A 1IG3A 1DMRA 1VLZA 3E9QA 3HI6A 3OPXA 1OA0A 1SQ6A 5DNVA 4PYJA 1ZHOA 4EKEA 3EVNA 2OO5A 5DTIA 3AJDA 1QGUA 1BE1A 3AEYA 3L0OA 4DIMA 2HLPA 3DW1X 1Y8QA 3QTTA 4FQ5A 2P6RA 1G8GA 1II0A 4KYUA 1VQ1A 1ZXLA 2C84A 2YDYA 2ZE8A 1UEIA 4GLOA 3LKZA 2GYYA 4M1SA 1EVKA 3L4KA 1RE1A 5JOQA 2ISCA 1J8VA 4EOGA 3HS3A