3SVZA

Crystal structure of apo bt_2972, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of apo BT_2972, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3svzA00
3QV2A 3GRZA 2P41A 3SXJA 5GINE 3DH0A 2G70A 3FUTA 3FYCA 1JTFA 4DCMA 4DQ0A 2IH2A 5CD1A 2DULA 2ZVJA 2OB1A 2AS0A 2AOTB 2GAFA 2NYUA 3P8ZA 3I53A 3LDFA 3P2KA 4PINA 3ANXA 2BM8A 1YZ3A 2G71A 3EVDA 4R8SA 4PIPA 3IYLW 4ZTBA 4PGHA 1M6EX 1X1DA 1P91A 3OFKA 2P40A 3TMAA 2H00A 3UZUA 4C07A 3B5IA 5FUBA 4YV0A 5K0FA 4RSRA 3NDIA 5EHIA 1NBHA 1BOOA 1G55A 3NJRA 1UIRA 3CJTA 1RI3A 5DPMA 4WXHA 3F4KA 4PYJA 3FTEA 3LKDA 3X0DA 3EVAA 3KPVA 3PB3A 1KYWA 2EX4A 1YFJA 4FSDA 4CTJA 5K03A 3SM3A 1NKVA 3ID6C 2V74B 2ZBPA 3P9KA 2IFTA 3MAGA 2YX1A 1HNNA 3KU1A 3P2IA 3JWJA 2B3TA 5GWXA 5DSTA 3RIEA 4AZWA 9MHTA 5CM2Z 4M37A 5LQKA 2CMHA 4GOMD 5E9JA 1O54A 1X1CA 1FBNA 3E23A 1P39A 5FHRA 5FULA 4BLVA 3K6RA 1G38A 4RVFA 1DL5A 3GXOA 5FQNA 5GOZA 3OPNA 4QQNA 2HWKA 4HGZA 2B25A 2YR0A 3G89A 3LCVB 1YZHA 3GIWA 3R6TA 2C7OA 5HIJA 3EVFA 1ZGAA 3GGDA 2FCAA 5HIIA 4DKJA 1X1AA 1L3BA 2ZBQA 3UJBA 1BKYA 2I7CA 3BWMA 3DXYA 1JG3A 3M70A 5F2OA 4C03A 4P7KA 4MTLA 1L3CA 3KQVA 4HC4A 3UA4A 3VC2A 5C9ZA 3T0IA 3UJCA 5ICGA 3P9CA 2VDVE 3M6XA 4X41A 3I64A 3DP7A 3P9IA 3KR9A 5EZSA 3CBGA 3GU3A 1R8XA 2JHAA 5CVUA 3NW9A 2VDWA 3KQYA 4M36A 5EEGA 5FHQA 4F86A 4OX9Y 2O05A 3OZSA 1RI4A 4DMGA 2AR0A 3FZGA 5DM0A 3AXTA 4U7PB 4X63A 4GC5A 5ICCA 3E05A 3LBFA 2PXCA 1HMYA 1F3LA 2PGXA 3HCCA 2QRVB 3KR2A 5K0EA 1AV6A 3G8AA 4E33A 2GS9A 3BGVA 1NW8A 5K0LA 4YUXA 4LWOA 1Q0SA 4EVIA 1G8SA 2PXAA 5EG5A 3EVCA 3G2MA 3R24A 1QANA 3I58A 2PSSA 3LGAA 2XYQA 1QAQA 3EVEA 2IDJA 3NWEA 2AOWA 3Q7EA 3C6KA 3R0QA 3JWIA 3EGIA 3EEOA 1Z3CA 3S68A 2Y1WA 4RTPA 4M7RA 2UYHA 2HV9A 3KPWA 3PFGA 3RW9A 1NW7A 1TW3A 2P3OA 3NWBA 1EIZA 4LWPA 1JG1A 1KPIA 3KQQA 3ORHA 4OQEA 3HA3A 3M6VA 2IH4A 5K8VA 1VLMA 3M6WA 2G72A 2F8LA 2ONZA 3I5UA 2HNKA 4P58A 3DUWA 5GM1A 3TOSA 4RTNA 2H1RA 2NXEA 4RTQA 3TM5A 4F84A 2N47A 4PYOA 3ELDA 2GLUA 3PVCA 1TW2A 1L3IA 3K0BA 2AVDA 2K4MA 2PY6A 4P7JA 4R6WA 3PTAA 2GPYA 3PX2A 2ONYA 4ER7A 4QTTB 4C06A 3HA7A 4O29A 4Y2HA 3ELUA 3GCZA 1JQ3A 2QYOA 3KHKA 2QE6A 2OY0A 4RV9A 2R6ZA 3O7WA 4WVLA 1SKMA 1IM8A 1XJ5A 3MGGA 4RVGA 5GP1A 1RJEA 4AZTA 1X19A 3R3HA 1X1BA 2JH8A 3UJDA 3BWBA 3RODA 4QVGA 5T6BA 4MWZA 3KQMA 3HNRA 4HH4A 3FPJA 1PJZA 2AN3A 4DCGA 4E70A 3GRRA 4PCLA 1G8AA 4E2ZA 4FS8A 3JWHA 4PYLA 4KRGA 1I1NA 2EJUA 2YXLA 3LCUA 4AUKA 5LR6A 4X1OA 3LSTA 4R8RA 1Q0TA 2H11A 2YUIA 4QQKA 2FYTA 5K0BA 3FPGA 1I9GA 5EIFA 3LDGA 4RTKA 3TRKA 4YUVA 4ER6A 5P8WA 3UA3A 1ZKDA 5FTWA 5DTMA 3MTIA 4RTOA 3FRHA 1Y8CA 5DLYA 4A6DA 3ER9A 1DUSA 5FWAA 2YTZA 3BUSA 4QDJA 4E2YA 3R9XB 2FK8A 2OZVA 3DLCA 3DULA 3OU2A 1FPQA 2PT6A 2I6GA 4IWNA 3OE4A 5ERGB 3UBTA 2PX8A 2XVMA 3HCDA 2ZIFA 1ZG3A 4GOND 2QY6A 4KIFA 5DTQA 5E2BA 3ELYA 5IH3A 3SMQA 4EKIA 4EQZA 4CTKA 3EMDA 2GA9A 8MHTA 5K0NA 3LPMA 4EMSA 5K09A 1R74A 2G8NA 2HMYB 2VDUE 2GB4A 3ME5A 3PFHA 1OR8A 1XVAA 4OA8A 2PKWA 3CKKA 3T7TA 4GQBA 3LCCA 1N7JA 4M38A 4OQDA 2BR3A 5EMMA 2ZTHA 1RI5A 5KS2A 2PT9A 3OZTA 5BXYA 5EEHA 5K0JA 1SG9A 1ZQ9A 4FT2A 4ER5A 5BP7A 4Z2YA 3V97A 4C05A 5FA5A 5KYGA 4RWZA 3HEMA 2ZZNA 2EFJA 2VP3A 4KDRA 2ZULA 1SQFA 4FZVA 2O57A 1H1DA 5CCBA 2CMGA 4EKGA 2ZZKA 4YMGA 2ZLBA 4YV2A 1VIDA 5CVEA 4U7TB 3BKXA 5DM4A 5IKMA 5LQNA 2AVNA 4RTJA 5H02A 3EMBA 5CIYA 2IBSA 1VE3A 2ZCJA 1ORHA 1RI2A 3P97A 3GRVA 2ERCA 4IKPA 5C1IA 5G02A 1BHJA 1VL5A 2AZTA 1WXXA 1RJFA 2A14A 4HTFA 2EG5A 3O4FA 4OBWA 3VC1A 5DRTA 1I4WA 2JJQA 2P1DA 5CVDA 2FK7A 2GH1A 1WXWA 4FGZA 4HSGA 5DX0A 3THRA 1YUBA 1D2HA 2PX4A 3DMHA 3EPPA 2Z6AA 3V8VA 4QTUB 2I9KA 3BZBA 1SUIA 5EQJB 3G7UA 1R6AA 5U4XA 2ESRA 2UZ4A 3BWYA 5CVVA 1KPHA 5ICFA 3FTFA 2CL5A 3LL7A 4ISCA 3A4TA 5LQRA 4LECA 1QAOA 3FPEA 3BT7A 1V39A 4XCXA 2V7EA 1ORIA 2BR5A 4GF5A 3HA5A 3KQTA 1VPTA 4BP1A 4GEKA 5HZMA 4PWYA 2EJTA 3LKZA 4R6XA 1EJ0A 3AXSA 4L7VA 5JUWA 4RTRA 5EKXA 1NV8A 5CVJA 5E8RA 1YF3A 2PWYA 4KVZA 2P3QA 2HTEA 1B42A 2P7HA 2P8JA 4AX8A 4FP9A 5E8JA 3HTXA 3DLIA 1RJGA 5M5BA 2AOUA 3GNLA 2R3SA 2IPXA 3EVZA 1QYRA 1XXLA 2B9EA 2JHPA 3LHDA 3SGLA 3I9FA 4P7FA 3O31A 4BY9E 3U81A 2Y1XA 1N2XA 4BP3A 5B1SA 2Z6QA 3DTNA 3FUWA 2QM3A 1F38A 3LX6A 5EGSA 5FA8A 3JWGA 1WG8A 2PVCA 5CCXA 3B89A 3BXOA 1JQDA 5E2AA 2ZBRA 5CUQA 3NVKI 4XUDA 2ZWAA 3NVMB 3UFBA 4BLUA 3M4XA 5DT2A 3G2PA 3FPFA 2PX2A 2NP7A 3NDJA 1NT2A 2FPOA 4E32A 4RTLA 4ER0A 5GIOE 2O06A 4MHTA 1EQAA 5EOVA 5K05A 5EZQA 5E1MA 4KDCA 3KPJA 3TFWA 5JR3A 4PIMA 1WY7A 3FYDA 4PYIA 5LQUA 1INLA 1O9HA 3G8BA 4DF3A 4QPNA 2NNWB 2UYOA 3E7PA 4LG1A 2P35A 4H0NA 4C08A 1WZNA 1WS6A 2ZWVA 2YVLA 3Q87B 5FADA 2O07A 2XYRA 3A7DA 4QPPA 4PYQA 1SUSA 5E1BA 5KQRA 2Z6UA 3DR5A 2OYRA 3FRIA 3UJAA 2HR1A 2OPBA 2WA1A 3HP7A 1O9GA 1MJFA 5E9QA 4PCAA 3PT9A 4POOA 1EAMA 2BZGA 1IY9A 1EG2A 2PX5A 1JSZA 3QOWA 1UWVA 1XCJA 1ZHFA 4QDKA 3OFJA 3P2EA 1UFKA 5EMKA 5ICEA 5FCDA 2ORED 2YQZA 4QVKA 1XTPA 3IV6A 4A6EA 1XDSA 4AZVA 3KQSA 4HG2A 3TQSA 1BC5A 3C0KA 3FUVA 5HEKA 3G2OA 2ZSUA 3OU6A 4DA4A 1G6Q1 5E1DA 1DCTA 5LQJA 1VP9A 4G56A 2WA2A 4RVHA 2FHPA 2UYCA 2PLWA 3LDUA 5DX1A 1VP3A 5C0OE 1FP2A 1L1EA 1ZGJA 3G5LA 5EVJA 1JSXA 4KWCA 2BH2A 4PYMA 3EVGA 3HCAA 1XCLA 2PBFA 5DM2A 3BWCA 1YFLA 2G1PA 2B2CA 1P1BA 3FPHA 3EGVA 3MERA 5DXJA 3SSMA 3UWPA 1M0EA 3ERCA 3CVOA 3B3JA 1AF7A 2ZFUA 3C3YA 3E8SA 4GBED 3FTDA 4FSXA 2PWPA 3HVHA 2AN4A 1AQIA 2QRVA 3DXZA 1RJDA 3G88A 3A26A 2I62A 4IV8A 4XUEA 5HILA 3KQOA 4RYLA 4MQ4A 4DM3A 5KVAA 2UYQA 2OB2A 3HVKA 3WSTA 3A27A 5LSAA 2IGTA 5EMLA 10MHA 2NP6A 3MB5A 3P9NA 4B17A 3LBYA 2OXTA 3DMFA 3M33A 3T7SA 1KPGA 3L8DA 3GRYA 1L9KA 2E5WA 3EVBA 3P71T 1RI1A 2AN5A 1MHTA 4HGYA 3SX0A 3AY0A 1QAMA 4HRAA 3TKYA 4CKEA 5HIKA 3MCZA 1R18A 3CC8A 3AWIA 2XYVA 3PS9A 4FR0A 5DSXA 3TKAA 3HM2A 1QZZA 3HCEA 3HCFA 3TR6A 3BKWA 3KQWA 4PYNA 5FWDA 4CKBA 3B3FA 3DMGA 5LQAA 3NMUF 5K01A 5DX8A 5EIWA 3TM4A 4V0RA 1NV9A 2OBFA 4E31A 1M6YA 3SSNA 2C7QA 2KW5A 4OA5A 2OKCA 2P7IA 3A25A 3GO4A 3GDHA 2XVAA 1SVUA 3C6MA 5DWQA 1FP1D 5EHGA 3OZRA 3KKZA 3TLJA 4C04A 3FUUA 2PV0A 4E30A 3NTVA 4EK9A 2IH5A 5F2KA 4RTMA 3HVJA 5HIMA 1G60A 5K0GA 4AZSA 2NXCA 2PXXA 3DXXA 4KIGA 4R05A 4YUYA 4PYKA 1NW5A 5DTRA 5EPEA 1SQGA 3SVZA 4X61A 3T7RA 2JH9A 4RX1A 5GM2A 2DPMA 2AOVA 3VSEA 1NW3A 3KR1A 2Q41A 4DZRA 5BW4A 3BGIA 3D2LA 1KYZA 2VS1A 4PONA 3GJYA 4ER3A 4K6MA 2YXDA 3B7PA 4UOEA 5KQSA 1KXZA 1JR4A 3EEYA 4GUAA 4PNEA 1JG2A 5HOQA 1FJXA 4XUCA 4Y30A 4YMHA 4E2WA 2WK1A 3MHTA 3FUXA 2ZIEA 3UJ6A 2ADMA 5EKUA 3KR0A 1P1CA 2OO3A 4RTSA 2NXJA 1PRYA 2P3LA 5E9WA 4YUZA 5DXAA 3MQ2A 4JXJA 1D2GA 3CJRA 2JG3A 3PLAE 3KPUA 3MTEA 4HTFB 2ZZMA 2AOXA 1AQJA 4GC9A 4FT4A 2AOTA 3EGEA 1KR5A 1D2CA 3VYWA 4YUWA 3BGDA 3KPYA 4V0QA 5DRYA 5T64A 2C7RA 2BM9A 1JQEA 2YXEA 3OE5A 2BR4A 4GOLD 1XDUA 3DOUA 3C3PA 3GRUA 1EJ6A 4KW7A 4PGGA 2JHCA 4IV0A 1XDZA 3QOXA 4GOOD 4E2XA 4OBXA 5DM1A 1R8YA 1N7IA 2NXNA 3HCBA 5E1OA 1KHHA 2ZIGA 5EC8A 3TPZA 4MIKA 4CXMA 3UJ9A 5F2NA 2VZ9A 4YV1A 7MHTA 2PJDA 3SSOA 3M6UA 5K0CA 2O0LA 3UJ7A 2C7PA 3GWZA 3LECA 3OCJA 3SR4A 3G5TA 1VQ1A 2ZW9A 3HVIA 1JG4A 3MCTA 2IDKA 1U2ZA 3PX3A 4C4AA 2XBMA 3G2QA 3CGGA 5MHTA 4X60A 5T67A 1IXKA 5EMJA 5LQCA 3AJDA 3CJQA 3REOA 4ATNA 5FQOA 1JTEA 3FTCA 3B3GA 5D1HA 1NE2A 3H2BA 2IP2A 1YB2A 2IBTA 1R00A 1TPYA 2LD4A 4P7GA 2AOUB 3ER8A 1NW6A 3A7EA 3CCFA 5BW5A 3OU7A 2FRXA 3KQPA 2IIPA 3THSA 5GIPE 3IEIA 1KIAA 4CKCA 1KP9A 2B78A 4NECA 4RVDA 4F85A 3UJ8A 3IHTA 3ELWA 4CWAA 2CKDA 4BLWA 1T43A 5D1NA 2CWWA 1NBIA 5HFJA 1VBFA
chains in the Genus database with same CATH superfamily
1E79A 1V26A 4IM7A 3RHTA 4PNPA 4V3BA 3ZVLA 2CCJA 3DH0A 1NG9A 3MWDB 3FYUA 9ATCA 4XUDA 2Z1MA 3N8NA 4Z9YA 2PTGA 2PLFA 2XBUA 2QSUA 3A6JA 3O21A 1H94A 4BVKA 3VX3A 3LBHA 1EFVA 1NF9A 1MIOB 1V7PC 3EEFA 4UXIA 4CPDA 4F5EA 4U7DA 3AKCA 5A0FA 1USGA 1MB3A 1P6QA 2M98A 2R8RA 3IJPA 4KI7A 1FYWA 1NXWA 4XWOA 3SXPA 1P72A 3BOSA 1CNMA 2XW6A 4MB2A 1XKXA 2FLWA 1OGJA 4Y6RA 5IDYA 2O8EB 1QHIA 3LZCA 1W0JA 2DPXA 4PZLA 4YNBA 3L84A 1HL7A 3L43A 2WKQA 4ZOLB 1G3RA 3JQPA 3OTQA 2HDWA 3D2BA 3AVPA 4IIEA 4NOKA 1CC1S 1L8LA 2YV4A 3QVMA 4TLAA 5I9MA 2FF7A 5EYPA 4QXMA 1YR9A 1SHKA 3E1GA 3TW0A 1BGVA 2O8CB 2DT8A 1X8XA 4ZO7A 1NONA 2FWAA 2FSGA 5FOUA 2OFPA 1A96A 4DSOA 4JOBA 3IAXA 1FBNA 3E23A 3O4IA 1JYSA 3YASA 3K6RA 4XE5A 2GAOA 4UOZA 3TJRA 4GNKA 3UAZA 4DG9A 4QX6A 1D6NA 2FQQA 4MUNA 3G89A 3HJUA 3R6TA 3FVQA 3TW4A 2Z4SA 4JLUA 5CBPB 3MS2A 4FKMA 4JIMA 4NJOA 4UDOA 2KX7A 3VAAA 4Q18A 5MF6A 1WUJS 1RHQA 3PJEA 2J4FA 5F78A 2KSQA 5K3CA 2GN2A 3HN6A 3JXEA 1WU7A 3M70A 5LXTF 4Z7QB 3SVTA 3CLSD 2PV7A 2OFWA 4QXOA 4F04A 1YJCA 3PJFA 5ICGA 2OYSA 5GVRA 4DADA 2O3TA 2PMWB 3CKLA 4KFTA 3CE9A 2GBFA 3DBHB 5BUZA 3PA8A 4O33A 1ODCA 5HDBB 3E8XA 1K8QA 4HWGA 2R66A 3FZGA 1TB4A 5AVUA 3PWSA 1XEFA 1Z4QA 4IO0A 4OHXA 4UEJA 2VUHB 3H87A 5BN5B 1KFKB 2Q5OA 4DV5B 2I3DA 2R25B 3SQWA 3PEEA 2W71A 1MB9A 4EPRA 1N34B 5FR2A 1TGVA 4G63A 3U4QB 2HU2A 3G2MA 4KXXA 1DQSA 3CEJA 4Q1AA 4UTZA 8ATCA 4KRFA 1CUVA 1QFMA 4EY7A 5LNK6 1VI5A 2XGJA 3EYWA 4TX1A 5DYWA 4XFJA 1HMPA 1NI5A 1IY2A 1PV4A 1Q0QA 1O6FA 1SXGA 2HXYA 3ULKA 1PF7E 3T9CA 2C1XA 4EMTA 2Y1WA 1C0EA 3VR2D 3WLTA 4B8YA 3CF4G 3RW9A 4Y1FA 3D2CA 5FUMA 1QVVA 4ZTUB 4F71A 1NPTO 5HQ3B 1QFJA 2BEKA 1AIPA 1ORDA 2K2WA 4EJMA 1YDFA 1TT5A 3EQ9A 2CE7A 4PM4A 3U4MA 4LRSB 1CUAA 3KBBA 1D2MA 5JS1A 4PSVA 1DRJA 1DX9A 1YOBA 1Q84A 1X7ZA 2ZB7A 1X9IA 1U5BA 1CTQA 3CUEF 3GRFA 1GGKA 3SM9A 1C9JA 1CY8A 1NA5A 4YN3A 4X66B 4C89A 3ACCA 3ETEA 4JLPA 2JAUA 4HB2A 4IWXA 1ZQ1A 5KUTA 1U28C 2ONYA 5KVQA 1I5OA 3W6UA 3LIPA 4TS1A 4XLZA 4KWTA 2ZRBA 5AIBA 3CVUA 1XAJA 2P4HX 1LC3A 1TQ2A 3OZUA 3KAKA 2H65A 3ZXXA 5CPBA 1PAUA 1DB3A 5TJ9A 2IP1A 4NJMB 1QDUA 2A5JA 4TMXA 2ATEA 4WV3A 4X5OA 4A73A 2AWOA 4YAWA 5IK2D 3AERB 4RA6A 3SQMA 3OLXA 4OJYA 2FSPA 2BZSA 4Q1FA 1XRMA 1EGQA 1DWUA 3WK8A 4M55A 4IJWA 1DWQA 1WNTA 1MVLA 2HA2A 3GARA 3IQHX 4EG3A 3JWHA 5JXJA 2ZB3A 1I1NA 4FVTA 4GMKA 3Q8XB 1D9ZA 1GQSA 1CZUA 2FKNA 4KO2S 4DTIA 3TSOA 4FONA 3LE8A 1VSQA 4ACBA 3IP6A 1SVSA 1PZXA 2MTBA 5JCXA 4YJKA 3NIDB 4FPXA 1GTJ1 4UKDA 4KV7A 1FDOA 2ZJ4A 4X20A 2MSLA 3MJ4A 3KVRA 1U04A 3CLUC 4X94A 1FNMA 4ZGWA 3HDHA 4HDKA 4MYHA 5I7VA 1AZWA 4INAA 4DVGA 5K7SA 1JEAA 1F6WA 2PX8A 3V7UA 1U7ZA 5B2FA 1QU2A 3LP6A 2XLCA 1WDMA 5I9LA 5CG1A 1NIJA 2ZUTA 3E22A 1IZYA 2Q5HA 1QS0B 2I8AA 2VDUE 2WICA 3PFCA 4ZT4A 1TYAE 1WPGA 5FX2A 1U8CB 2WMDA 3AEQB 1P7PA 3FGZA 4JU8A 3IOMA 2BR3A 2X2FA 3D4IA 4RVNA 3SS7X 1YR1A 4TN5A 1IJKA 2VZ8A 4PLTA 3GW8A 4QTYA 1ZHOA 2OVFA 3W5DA 3P9PA 4ER5A 3I83A 3WK7A 2A88A 3CX7A 1GUAA 1BGWA 2JFZA 3MLAA 4AQDA 3J7AC 3EXG2 1A77A 5IASA 3P45A 1G7RA 2O1SA 3DZDA 4FZVA 2I6XA 4F8JA 2PUGA 2HJRA 4TTSA 3ZE1B 1RBMA 3ILXA 2Q5QA 4M8KA 4HR7A 5GAJA 4YMGA 1QO0A 3IP5A 4LHZA 4CEHA 2WLSA 4Q82A 5DZSA 2IBSA 3QKSA 2HK8A 5CCDA 1L5VA 3EIQA 3OZ7A 1USIA 1Z2EA 2G9UA 3NP7A 4XIGS 2AA3A 1C9NA 4FR5A 4XGRA 1NXQA 3USZA 1DV1A 2ERCA 5C1IA 3TTUA 1NWCA 4Z3KA 1BYIA 1EXNA 4OBWA 3OZBA 4Z7NB 5AHRA 1Z4OA 3C3EA 2I65A 3ZCSA 1OI4A 1GKLA 3VYTB 2YJNA 3QFSA 2Q6OA 1D2HA 2F48A 2Z6AA 3DEZA 1D09A 4IIFA 5AW9A 4A2QA 1FDWA 2WRZA 1XRRA 1KOFA 3G8DA 4JKYA 2Q07A 1M2OB 3HI6A 4ENVA 3BWYA 1KPHA 1Y1PA 4YJ3F 1GCIA 1N2GA 2IPLA 1RYFA 1HDZA 1L7VC 4TV9A 1DFIA 1UXIA 4JX9A 5EZYA 1NX6A 1U90A 3H0KA 4P98A 3OE7A 3ZCRA 1C4XA 4LZOA 2P1RA 4PWYA 2X4DA 5DCYA 2I55A 1K0FA 2JRLA 2TECE 3LKZA 1ANKA 1T6ZA 4ON9A 5AVRA 1G8JA 1O5TA 4JBHA 1E3SA 3S2SA 3F3YA 5JUWA 1BVRA 4RZSA 4R8VA 5LWQA 3R4VA 3E9DA 3SZOA 4LJ7A 2JGLA 1BG6A 1JFLA 1XTTA 4JELA 3NT5A 1WMAA 2AEMA 4NBSA 3WYCA 4C7OB 5C34B 4ZMRA 4GMGA 1T6NA 2GEJA 1EX6A 3RUAA 2HUNA 3T41A 2R3SA 4JN6B 5BN3A 1ACLA 3LHIA 4Z49A 1GKUB 2HA3A 3W04A 3TUJC 3ESBA 5HFNA 2Z6QA 4N0EA 1XVLA 2CLFB 4AP9A 1JHVA 4KPGA 1PR9A 3PV0A 4ZZ1A 2PA3A 3IKTA 4MWSA 4BKOA 3UCEA 1XO1A 1CZRA 1UT8A 3HM9A 3CX6A 4U2GA 3GPCA 1G18A 3V1UA 1U3FA 4I4CA 5I4BA 221PA 4MVJF 1SHJA 3AUJB 1RWVA 1K86A 3LHSA 3MMZA 1WUYA 1IN4A 1CZOA 4O4HB 1C0LA 2IXAA 1Z56C 2Z2IA 3O9VA 4MHTA 1NHGA 1EQAA 1TT7A 2IOFK 3HB1A 4Z9BA 3M4ZA 3KPJA 5CNMA 5CJPA 1KYVA 5CK4A 3OA2A 2B36A 1TVKB 2QJWA 4C7JA 4IFEA 1D8AA 4FBMA 1R4NA 5AKKA 1C4OA 2G9NA 4PGFA 1H4QA 4CL3A 4YAUA 2W5UA 5JCZA 3RS8A 4FWTA 2PJZA 2V5AA 3CEMA 3QW2A 1Z74A 4CLHA 2O0MA 1DP4A 3MWEB 4MI3A 3LQFA 4Q9DA 4NY1A 5U4QA 1PFVA 1CEQA 3A9TA 3A1CA 3KD3A 3DBRB 2RJNA 3RADC 2PBRA 2XQJA 3IILA 3R9KA 3FLMA 4UVGA 3AI2A 1SIUA 4GI7A 4WGGA 1L8XA 2B4YA 3QG1A 4CQLB 4WBNA 1NNSA 1Z88A 4INJA 4X8OA 1T4DA 1FFWA 1YA8A 1ZKMA 4BFYA 2Q0QA 4AC9A 4WD3A 4TQGA 5ALQA 5EHZA 4FYPA 5FPTA 1LW6E 1GUYA 1M0SA 4YJ2B 2CDAA 2CNWA 4KQWA 4WZAA 2JFGA 2JFWA 3KYJB 3UK2A 4DCSA 4TKVA 3VMFA 1SVIA 3PBKA 5AYVA 2QRZA 1TX4B 1E6WA 4DA4A 4ENTA 2R8EA 2V6BA 4DIFA 1XU4A 3FGPA 2J87A 3RGWS 4Y2SA 4D0NA 4N41A 4MW4A 3RU9A 1UH5A 3DONA 4FOPA 3OWHA 4OFBA 2NN3C 3LK6A 2GERA 2YJ3A 1O89A 2IEYA 1VP3A 1V5WA 3G1TA 3GAAA 3I2IA 3LDUA 3QUSA 4H7IA 4AWAA 1HDOA 1FF9A 2Y67A 2V5VA 3ZD9A 4EIWA 4MUBA 3WP0A 1T4CB 3MERA 1L4KA 1PJLA 4UNNA 2I2DA 3R0VA 4YRQA 4B7AA 3AC0A 1MVNA 4CG0A 5K6AA 3B70A 2IEIA 5DGTA 1C7ZA 3KLPX 1JR6A 1FS5A 2WOOA 4Q3OA 5JWRA 3DYBA 4PZCA 1BGXT 1RJDA 1BQEA 2C03A 3E1KA 3QBJA 1HNZB 3FNFA 3HA2A 4HNGA 1QVAA 3PF8A 5LSAA 2J0EA 1CE8B 2WYUA 2IU4A 2P9HA 1UKEA 1OX4B 1KPGA 1ZESA 1KKMA 1HQYE 1QM5A 2QGNA 1GUZA 4W5WA 2ATCA 2EG9A 2QD5A 3EX7C 2BGJA 3ETJA 4AY2A 2YC4C 1EEXB 2ZR9A 4GR5A 3EIOA 1QYVA 3JSAA 2XOKA 2ZRHA 4TMVA 3TW6A 1C1XB 3B3FA 5FOSA 2XDQB 1L7XA 4XFKA 1IH8A 3NMUF 1NXTA 2DM6A 3TM4A 2O52A 3BXXA 1B0AA 1PK8A 4KAFA 4PFQA 4EJ2A 3AIMA 1CJUC 2WSYB 2P7IA 3QJGA 1RQ7A 2CFTA 1R0YA 2V9PA 4JT2A 3LC7O 4WKGA 3D8BA 3WQQA 3WISA 3EWNA 1EDBA 5EESA 5TGTA 2WNSA 3P5SA 1GU7A 3RVNA 2LPMA 2PXXA 4CL0A 4R05A 3IMEA 1IRIA 3GEEA 4MWEA 5DGXA 5AP9A 3SVZA 1SQGA 5EP3A 3UMVA 1LJUA 4O1IA 1VPWA 2BHRA 4S1NA 4DIDA 4LOIA 4RX1A 3VYSB 4DSTA 2C7BA 1N9GB 3QMWA 4CIDA 2J5XA 1CB0A 2F1RA 3IAM1 4TTJA 1AHPA 1QDLB 5FPHA 4BNKA 3IERA 3EUAA 4HH1A 1C9YA 3ZHTA 2EKPA 2YVUA 4FILA 3RVPA 3CV3A 3OIGA 4UBOA 1JG2A 1DS6A 5FFNA 2DHRA 4NYMR 4N49A 1KQNA 1VDZA 3OZCA 4ZQHA 2C04A 4OBEA 4Y2PA 1ZCZA 5C35A 2E85A 2FW1A 1LNSA 3DW1X 4JA0A 4KNVA 2YMLA 2VSFA 2IXBA 4GZ3A 1DC3A 4LJSA 1L1FA 5BUCA 5KINB 4B81A 5E6UA 3PEYA 2Q1WA 2ZKIA 4DLLA 5DBOA 1GYPA 1QP0A 1SUBA 1SXJE 4DLWA 4MRVA 1MZPA 1YUMA 1Z33A 1M1UA 3EGEA 5ARCA 1G2IA 4PBTA 1OAKA 1Y9AA 3W1EA 4A0RA 2EL9A 2HQOA 3C1AA 1BXGB 3UMBA 2HPAA 1EFTA 3DCYA 4KQKA 3RIYA 2DQZA 1L5NA 2VNJA 3EA5A 1MC8A 4GOLD 4QUIA 5BQFA 1G8HA 2FWPA 3DE1X 1MO4A 1EJ6A 1WQ4A 2X5XA 3WYDA 1BDJA 4ZICA 4DYHA 1HDXA 1IVNA 4E22A 5DCUA 1VYTA 1FK8A 1W0JD 3U7FB 1SOUA 1CIJA 5KNCH 2OGSA 3I1JA 2VZ9A 4UCFA 3WBBA 2P1ZA 9LDTA 3CVXA 3PD1A 4BTEA 1KNQA 4C20A 3FLBA 1POWA 2C4VA 1VQ1A 3NTQA 4M53A 1YKGA 4D9NA 1JIVA 1QUEA 3A1NA 3P2MA 2O3SA 2YJTD 5CBKA 4RKQA 1FMTA 4TROA 3GRKA 3VTFA 2F00A 3IDAA 3R5TA 4ADSG 3AJDA 1XNRB 1Y5NA 4QGSA 5FQOA 4JHLA 3HUUA 3M89A 1K66A 4URUR 3LFHA 2IHZA 2ATIA 1KF0A 3DGFC 5I8PA 2QF7A 1T5TA 2QKYA 2J5QA 3CRRA 2R1TA 3SJBA 1VZ3A 3TQRA 1NW6A 2DXIA 1PZMA 4X6LA 3OU7A 5C7OO 5IJZA 2IHVA 3CHYA 1H2XA 1IBMB 1CYEA 1Z26A 3IHTA 3Q7RA 1REQB 3OECA 4XPIA 3WLKX 4CWAA 5JPCA 1AKEA 2VWPA 1GFSA 4L9SA 3NFRA 4YO7A 1MJHA 2PH1A 3AILA 4UW9A 1IEWA 4DPLA 2JH3A 3F7OA 3IP9A 3A9SA 3PKJA 4JI7B 3AONB 4RVFA 5TQ2A 4CTOA 2AOTB 3KXIA 4DNFA 4RPLA 1BROA 3K0FA 3VPCA 1YB1A 2JIBA 3P0EA 1Z2CA 2QZJA 4ILKA 4M1KA 5K0FA 3OOSA 1N2OA 2X9LA 5DBGA 1JLLB 4DV3B 2P8SA 2Z98A 3FOBA 2BFBB 2VG8A 4BEJA 4HQFA 3ZIUA 1GNRA 3RGGA 5AVWA 2ZUSA 3RROA 1L4FA 3KZMA 3TSWA 4EYQA 1E3TA 2DFNA 2J9XB 5A4MS 4EQ6A 4UPVA 1E3DA 3GOQA 1VMEA 2PU7A 5GZ3A 1VJCA 1EVYA 2ZPUA 1ZN2A 2WUGA 1M7BA 3GBPA 1MX5A 3MUOA 1UP6A 4BKUA 4I50F 2IYZA 2JK0A 2QTAA 4JMLA 5EWMB 4EPVA 1ZRSA 5KCMA 3TRFA 3W2IA 5K8CA 3NV7A 3AL2A 4EGJA 3FYSA 4FNMA 3LCJA 3H2ZA 5TMDA 1H42A 1KZ6A 4LYYA 2PK3A 3M6FA 2H5LA 4HNHA 4Y2QA 3BRQA 5FLYA 3OPNA 1XHFA 6CHYA 3IJEB 1H2YA 1AH2A 2HH9A 3CURA 1VL2A 4EDHA 2C4MA 3TINA 2KS6A 1NOJA 2IYOA 1KQPA 1ZM2A 2VLBA 1X8JA 4HNAA 4JEUA 4MQLA 4PAGA 5JH7A 4L8VA 2RAUA 3WMFA 3F4BA 4DKJA 5LYJF 4GM1A 4NZMA 1ZM9A 5KIAA 5HS4A 5CRIA 1OLSA 3IEKA 3BB3A 3L8MA 2SICE 5C9ZA 4YRDA 1Z28A 5KU1A 4V39A 3G8CA 3R7AA 4YUAA 3CBGA 3JQ8B 1UBUS 1Y1RA 1R8XA 5C3UA 3QBDA 4EFNA 4HEJA 2R8YA 1XAGA 3CLRD 3NTRA 3O8LA 2CF6A 1CQZA 4G0YA 4LHVA 5DM0A 4V1CA 1JIJA 4U7PB 1CG6A 5ICCA 3OEEA 2NAFA 3KR2A 4MB0A 2JKZA 3FF1A 2DOKA 1OZHA 1QGUA 3CRMA 3PNKA 4QOFA 4C0SA 4BE4A 4GMHA 3UWKA 3CNNA 4H4EA 2HCFA 5DOZA 3E48A 4UNQA 1R6DA 2AMLA 1CHDA 4TWIA 4NFYA 4HFJA 1YJ5A 2ZSBA 4IHQA 4Y3UA 3KXDA 4K2HA 3RHFA 4EG6A 1IG3A 1W2GA 1IZ0A 1VZ2A 1Y3DE 1ZY2A 1Z7WA 3DBVO 5AJTA 3RSHA 3U3KA 1MZVA 2GEUA 2ZI5A 3OO1A 3JPYA 4EW1A 3G9ZA 5IPFA 1CQWA 2NU8A 1T5LA 1I2AA 3GBSA 4IXDA 5HF5A 4CKBB 4UJ5A 4Y7CA 4L8YA 3DDHA 3ORHA 4Q4LA 1Y0BA 1A9XA 1JEQA 3R9IA 4KSBA 3H2HA 1P1KA 3D7KA 3OQMA 2PR2A 1PR2A 1ST3A 2MSCB 4P58A 1U2PA 1NVFA 3MBIA 2E4YA 4OL0A 3T06B 1NVVQ 3LT1A 5ALEA 1N2JA 5ELMA 3FNQA 4KXQA 4N7RA 3FB4A 4WN9A 3KSDO 1MDFA 2J48A 3I9MA 4XSHA 1B8PA 4AJOA 4EHHA 2LWIA 3N7AA 4XB2A 4PTZA 1ZJYA 5A1JA 4K81B 1JIXA 5FWNA 1RYZA 3D6FA 3GLGE 2SKDA 3B9RA 3GNTA 4Z51A 3M2PA 3V5NA 5M7EA 2PZMA 3S2UA 1GTVA 1NR7A 3CCBA 3IEXA 2V9CA 4Q4DA 2XTMA 1SKMA 4IHJB 2HMVA 2OZKA 1E77A 2FSVA 1U7DA 1VLJA 2R1UA 2WB4A 3F6SA 3KJNA 1QO0D 3KZKA 3ND9A 2FMTA 3GZTB 1R9MA 1X1BA 2YS7A 1XZFA 4DJTA 1LDNA 4U3JA 5IG2A 1EFPA 1WL8A 1B3RA 2WJGA 2VJQA 1XFAA 3FPJA 3OF5A 4I8DA 5BSEA 3GMDA 3P32A 3AUTA 1M6VB 2J3JA 5BMVA 5LR6A 4X1OA 4EGFA 4BNDB 2Y76A 3PR2B 1OBCA 1CUWA 3OQVA 3TBHA 5CFMA 5EIFA 4MIOA 4A03A 4P36A 2Z8YM 3RQIA 1GEEA 3RAEC 2GUGA 3W5BA 1N1GA 1W36B 3T94A 5KNLA 2PFSA 2IEAA 2NZWA 4Q39A 1H5NA 4YCNA 2RI0A 4CT4B 4JODA 1TFRA 4HUTA 4C43A 4DV0B 2WWWA 4TZ6A 4D42A 1FPQA 2IYYA 4D97A 3NWJA 3ZY4A 4EK9A 3SAJA 5HRCA 3L4BA 4LC1A 1N5DA 2VP6A 3ELYA 5L7TA 2R1VA 4COKA 3OE7D 5EWJB 1PP4A 3BD6A 3RYIB 1SBCA 3C3KA 4YLGA 2GLTA 1JQKA 1CEYA 1OR8A 4HWSA 1N6LA 3T7TA 4D96A 2H7XA 2HRDA 2J5BA 3IIMA 3JQ9C 1I6WA 3WG9A 5B36A 2VRNA 1DQZA 3AV0B 1MA0A 3VR4H 4NOMA 3C24A 4PPNA 1NGSA 5L3RA 1MO2A 4IIVA 3HKBA 1O1YA 2W8ZA 4BO6A 3ZWQA 1GZUA 2GAJA 5FBVB 3AFHA 5HKBA 5KYGA 1H2HA 4I3FA 5BUSA 2V7UA 4BZWA 3D7MA 3II6X 5JFGA 1A4UA 3NXSA 5CFLA 5CCBA 3Q6MA 4L76A 4CVNA 2ZRNA 1SUAA 1MABB 1YMVA 1DAGA 3U4HA 3TO5A 3V2GA 5J4HA 1WETA 2CKMA 3KOUA 1W35A 4KQIA 2NX2A 3ZE7A 2C2GA 2D8MA 4NU0A 2Y0CA 4D46A 2HJ9A 5CIYA 2NV0A 3OQIB 4D9EA 1KK1A 3GD7A 4MLZA 1D6JA 5JJBA 4G0VA 3E58A 3L7DA 4B8WA 1KQ3A 2GCOA 2FWBA 4IKPA 1WXXA 2HSWA 2ENUA 2F43A 2GF0A 2I33A 2O2YA 1YD7A 2AYZA 3GRPA 2IOYA 2V54A 2DRIA 3K20A 4TYPA 4EG7A 4P9NA 1W87A 3G7SA 1JFRA 4W6QA 4A2CA 5J4KA 5LKRA 1ZNZA 3K3PA 3P0RA 1CP2A 1SJ9A 4WK2B 2HCRA 3BB1A 4WNYA 3G02A 1XZPA 1UEXC 1Y8QA 2D13A 4FYIA 4DCCA 1EWYA 4TWZA 2XKAA 5KQMA 5U4XA 4YP6A 1UDCA 3K8OE 3UAXA 1TYDE 4W6ZA 4BFUA 3AO0B 1P45A 1IM5A 2LUOA 3LL7A 3Q5DA 3A4TA 3R6DA 3BULA 1WMDA 1JHYA 4ZRNA 4YMIA 5KMGA 2B20A 1FDSA 1Y80A 4UFNA 3L7BA 2ENWA 2XNSA 3BMNA 3KYCA 3F5MA 1M1NB 2QTWB 2SKCA 4W1SA 4AMUA 4C6TA 1SXJA 4FOLA 1VXRA 4F2PA 1ZOIA 1Z4NA 4V0MA 1DEXA 2PWYA 5CA1B 4DC0A 3WL4A 2YBEA 4FX2A 1I33A 4XW2A 1RZUA 1EJ2A 2Q50A 5BVHB 1XRSB 5C8XA 3DHNA 2CHEA 3IMKA 1JWAB 2GCIA 1KS2A 4S1VA 1LPMA 4QNMA 1JMVA 3ICPA 3KTAB 4TQ9A 5FOWA 2CXPA 1UKYA 4ZZIA 3H2IA 2AEJA 2CNWD 3EVZA 4I7EA 4I5GA 5DJ5A 5LUBA 3QUCA 1Y6GA 3H97A 3TLGB 4J1SA 3RYFA 3EN0A 5G4KA 4HQLA 1OAOA 4UUQA 2DB3A 3BZUA 4RETA 1NNEA 3P1JA 3BL8A 2VRCA 2ZJFA 3N8KA 3WIEA 4LFAB 5AHKA 2WYOA 3B13B 3EF3A 2N9UA 1VLLA 2WWYA 1E3IA 2FMUA 4Q0MA 4JENA 3M4XA 4BLUA 2D7DA 2VPIA 1TUBA 4Q4AA 3VYUB 4QGHA 5FRDA 3WQHA 2PJUA 1NT2A 2AMYA 1CP3A 1BZYA 1QZXA 1VBKA 1P1IA 3DT9A 1H05A 4QL3A 4DAOA 1I5EA 4G0OA 3T9AA 4M1SA 3X1JA 5CDFE 4KWIA 1D0SA 1ZVQA 4WNCA 5A6VA 1TC1A 4F4FA 5A3RA 2CSXA 4KJZA 3PFKA 4CHTA 1YGPA 3D8UA 3R3YA 1AU9A 1ETHA 4LZAA 3PTZA 3QE4A 1QRDA 2P2LA 1FLAA 4PQFA 1SZPA 1YIAA 3S7ZA 2D00A 3SIPA 3NNDA 4PG8A 1XLTC 3F71A 5KYUB 2CNBA 2YVLA 3EIXA 1VFPA 4WZZA 5H7XA 4DG5A 2DX7A 1T3GA 2I3ZA 1OI2A 2DBRA 5BR8B 4KN6A 1YVDA 3IT1A 4B5LA 4TSFA 4XQCA 1RQRA 1EVKA 1SU7A 3DDSA 5E9QA 3PT9A 3A1UA 3N2IA 1L4LA 1Y4AE 3FZYA 4FZRA 3VZDA 1S2MA 1T5BA 3E3LA 4D4IA 3E5RA 2ASEA 3O8OA 5EWLB 4E94A 4F2HA 1CW2B 1NDUA 2Q8QA 2XOKD 4K3VA 1NLYA 1JVSA 4Q7EA 4MPTA 5EMKA 5FD8A 4LY0A 3VVMA 3WQRA 1QC5A 4QVKA 1W7AA 3EFOB 1HQDA 1XDSA 1Z2DA 3E82A 3IOCA 3KQSA 3OAAD 1RWWA 3NUQA 4TUYF 4ALKA 1BC5A 1ZI9A 1Z0AA 3EGDA 4JUAA 3DMTC 4D8VA 1DC7A 3F5FA 4E14A 3MOSA 1IN7A 3N59A 1IOVA 1OZ0A 1T0IA 1C0KA 2QTVB 1B8OA 1C3OA 5H3CA 2CJPA 3OY2A 5FBLB 2EBWA 2NXWA 3IHWA 4NBNA 2XXBA 4MR7A 5E0KB 3SD7A 2VA8A 2OLJA 4X7MA 3OMWA 4A8HA 5TF4A 4HATA 4P4NA 2WHPB 5IT9A 2H1HA 4GQIA 1DIBA 4OHVA 1DUVG 1TTHA 4LS3A 1VECA 1E89A 1U2GA 4M1OA 3TZHA 1HYGA 2SHKA 3GPLA 1PLJA 3PA6A 4XUEA 1CJKC 1F48A 1IY0A 2I62A 1X7GA 3E35A 3LNCA 5KVAA 1OFGA 1U2DA 1Z08A 2RH8A 5KVCA 3DYVA 3U9LA 1KHTA 4F46A 1KI4A 3AM5A 4A0HA 4B17A 1K8ZB 3OT1B 3U09A 1KAQA 4PLYA 2CLEB 2VLIA 1XRLA 4KH0A 4Q48A 1JBEA 4LGYA 4PSDA 2YRXA 3D6NB 2PSJA 5IF9A 1RR6A 4UFOA 2AC7A 3DA8A 1B3BA 2YNMA 4LDQA 1DO8A 4OATA 1AKMA 1LVGA 2ZG6A 4Z4GA 3OZGA 4EW3A 4F2GA 3RTGA 4AYWA 2CZCA 2W2PA 5IBQA 4X1YB 1JKJB 3PE6A 1QTIA 1H3EA 5LQMA 5ECYA 3SSNA 3L0ZA 1Q83A 2Z2XA 3KALA 2FPIB 1MV5A 2C8KA 4U00A 4CR6A 1S4MA 4RTMA 3EW9A 2W0MA 4B7XA 3DXXA 5FNVF 2OKGA 2ILTA 2OFFA 1FS6A 5F9MA 1RXUA 4DQLA 2NTJA 1M66A 3ZCXA 4HTAA 4J7UA 5LM3A 4M1YA 3O8RA 1Q17A 3ISTA 5LP1A 3QEMB 2C58A 2SECE 1N5LA 5TQVA 1JAYA 2GLXA 4R0MA 4BO7A 3LC1O 1E6MA 4CMIA 5C4MA 4PONA 3IMGA 3G9UA 5TQJA 1GLNA 1TUEA 2Y1FA 3ND8A 5JYCA 4Q21A 1YCGA 2IYSA 2ZI4A 1FVOA 1DT3A 3WHIA 1XQ1A 5KQSA 1FJXA 1LD3A 2P2NA 3B1YA 4V0KA 4MW0A 4WXMA 3O3NB 5BYKA 2ID4A 1QYWA 1FE8A 3BMXA 5CB4F 4QU8A 1I4TD 1G66A 1E1DA 3L0PA 1C7IA 1IL0A 4DLPA 2ZYRA 3HXPA 3LT0A 5A5FA 1CETA 5AVXA 3L5KA 4C6SA 3LGSA 1RABA 2PZEA 2QN1A 3IUMA 3VYRB 4Z4HA 2HU8A 2NUAA 2ZAMA 1FQJA 4DQXA 3MTEA 2GHIA 1TPZA 3PQCA 3H1TA 5AQ1A 4Z53A 1M72A 1JXOA 1GHTA 4L3WA 1KR5A 1XR3A 1GZ4A 1D2CA 2VNIA 3G0CA 3GLGA 4PEVA 5HK8A 1T2DA 3BGDA 4YRMA 5BV1A 3N58A 1C7EA 1EB8A 5E4YA 3PZBA 5TQ0B 4RF5A 2GNAA 4G6ZA 3TBFA 1XPRA 2X77A 4CEIA 4X93A 5JHGB 1W4BA 1B23P 3G0OA 3T9DA 4Y6QA 1QR6A 3ZU3A 1WDLA 3ZHUA 5CXQA 1GGFA 3NJ8A 3TIGA 4IDNA 1CJSA 4Q3NA 5JJKA 4XTCS 1XZNA 4G89A 5AXCA 4QGFA 1RXIA 3TQHA 1IU9A 3ZLUA 3UJ9A 3UJPA 2NVUA 4JROA 1ZD8A 1BDHA 3K5IA 1T9ZA 2DKNA 3LECA 3KX2A 4WNAA 2GKSA 1L5SA 2B5WA 2ZW9A 4HAYA 2NYRA 3IOYA 2DYKA 2AMFA 2CXXA 4DR2B 1GRQA 5EMJA 1J90A 3IO5A 4DTCA 3WJ7A 1M7GA 1NR1A 4WOKA 4MEBA 2G36A 1PCXA 1G98A 6YASA 4WJLA 1ZMXA 3VPHA 3D4OA 1I2DA 4B9AA 1S2DA 4AF7A 3A7EA 1QHXA 2NADA 3GA7A 3RTDA 4I46A 3NALA 1JJBA 1LSSA 1MEEA 1R5JA 4NECA 4BVLA 3O38A 1O94C 1KKUA 3C85A 2GT1A 2FFQA 1P29A 3QV2A 4Y1RA 4JVSB 4LSZA 1E2DA 4AAYA 2LDBA 1W4AA 1ZN7A 2NO6A 2WAXA 3C3BA 4ZRDA 1QVRA 2YXPX 5EFOA 3VC2A 1K98A 3EMKA 3VC3A 2BM8A 4PF1A 4P93A 4NRDA 5BORA 2IOHA 2AMJA 1Z4KA 4H0CA 1VE9A 2PUVA 5FUBA 3VSAA 3K5PA 4HUQA 1ENOA 1NYLA 4UDYX 3S4YA 1L4EA 2C0PA 1Y37A 2NO1A 1AKWA 2AK2A 3F5DA 3PRJA 1NBEA 3IUBA 5JPIA 1IZ8A 2QLBA 2W00A 4AMBA 1JAHA 1R9GA 3JALA 1UANA 1H65A 3C6XA 3K9GA 1EM8A 5JZ9A 1SXJC 2O0JA 1DDOA 3ED1A 4EJ6A 2CZQA 1Y82A 3DBIA 4ZV7A 3A1WA 2EAUA 4XUGB 3IO3A 2R11A 3P9KA 3MAGA 3A9WA 2GJKA 1E64A 4Q3EA 5DSTA 4M2LA 2VJAA 2NQ8A 3H6KA 1JZSA 3S29A 2J31A 4M37A 1GG9A 1K3TA 3QSYA 1O54A 3AR3A 4FFBB 4OGKA 5CJ2A 4BLVA 3ONDA 3CZ9A 4LWZA 3G3EA 4CGYA 4PPGA 1QIGA 2V0CA 3PLNA 3WIUA 4QUAA 4HGOA 2UXDB 2ZBFA 3D4LA 4P6VF 4DBVO 1N25A 2XKBA 2VJNA 3GIWA 3Q7IA 2OG1A 4RVSA 5AUQA 1JA9A 2WF6A 1KH2A 2CLIB 5AHOA 1VTKA 2AQKA 2HPVA 2BTQB 3JQRA 4IZ6A 4KLRA 4KRXA 3B6IA 1PNVA 4S24A 5DGIA 5AM4A 2LTAA 2OFXA 2VK8A 4B3BA 4UTVA 1A9RA 1CUGA 4XGQA 3TLZA 5KNDA 2B2NA 1QP8A 4M88A 3K72B 3H6HA 3GLKA 3V2IA 3F6PA 1F6DA 1JMYA 2L18A 1Z6ZA 2RAVA 3A1FA 5C53B 2JFOA 2YUTA 1CFZA 3PNYA 3VR3A 3KB1A 3H17A 3NHLA 3NW9A 5I7SA 2F1IA 1NJGA 1EVIA 4TN1A 3UENA 1NJ2A 4R2JA 2R7MA 2IPMA 3CEPB 5JECA 4OLHA 2J6CA 5EJGA 4XIYA 4XWKA 3IUPA 4WBSA 2PGXA 2QRVB 3MW8A 4ZQBA 5HNKA 1VRWA 4GPTA 5B4VA 4KAAA 2G5TA 4N1AA 2H8KA 1ESMA 1AS2A 1DAPA 3ZX5A 2XZDA 3BXPA 5K8IA 2C82A 5CB0A 2ZJAA 2PG3A 3SJUA 1HUQA 2BEVB 1G8SA 1W88B 4ND3A 5BXQC 5ALKA 3SS9X 2F3SA 1KY5A 2CUNA 2ONKA 2WFAA 3BTUA 1N92A 3K35A 4D56A 4QTXA 3VH3A 3EVEA 1MX3A 1US8B 3RJTA 3I3OA 1N3BA 2BI7A 3LI2A 1NVXQ 2HF2A 3SY8A 3VKVA 1A0OA 3WTCA 1FOEB 1QXSA 2XEDA 3IAUA 4YV7A 1DKNA 2UYHA 1FSSA 2P2DA 5CDFA 1HA3A 4BNYA 4L8LA 4E5PA 3CUKA 3LPDA 4OU4A 4L5JA 1AE1A 3T95A 3L07A 2O8FA 1CJVC 1WEKA 1Z6GA 4E1AA 5F3WB 1U11A 1Y48E 1SXHA 1VJRA 3FCEA 4G23A 2EWMA 2W42A 3B3QA 1JH9A 2CV2A 3E9ZA 5JAOA 1PSDA 1ZEJA 2WU0A 3EA0A 4RTQA 1AZLA 2IK8A 2P3SA 4RIGA 3IPYA 3X1DA 2KB0A 3CUYA 3EULA 4R6WA 3U1BA 4MDFA 2OC9A 1RKXA 1XNGA 1JHOA 1T9BA 2AKAB 4JP2A 4ER7A 1ZIXA 4QTTB 1JLSA 1U0EA 3GCZA 1DV2A 4ISBA 1HE8B 5IP5A 2RHTA 4YRZA 5I7EA 4YWJA 4RQBA 1OZAA 5JLJA 1W8DA 1IBLB 3IT2A 1IZ7A 3W5AA 1R1DA 4IDQA 1Y5MA 3KUCA 5HMMA 4AZTA 4DLXA 1XZBA 4PN3A 1KY3A 1W6RA 3GJXC 2AB0A 3UJDA 2WINI 2Y2VA 4DJJA 3KQMA 2F64A 1U3WA 4HLCA 2OHXA 3BXZA 1MO6A 3E0QA 2Q3HA 1GTSA 2YXLA 1RWNA 1N5MA 4X7BA 2NPFA 4W8HA 4EHDA 4F92B 3LLVA 3VH4A 1O94D 2QTZA 2ZKLA 3LDGA 3K1YA 4MEJA 2I3BA 5DIZA 3AJEA 1QFZA 4QQRA 4Z7OB 4UXHA 3UG6A 1Z07A 2WSMA 5DLYA 3L79A 1LS6A 1SY7A 5ETJA 3VI4B 2EOAA 3UW3A 3FPBA 3KJIA 2YTZA 3FHOA 4GHWA 4XSVA 3DV0A 5JTUA 2O1XA 4M0FA 5DB4A 1Q12A 4YI5A 4QVIA 3C3XA 3OU2A 2Z9CA 1LLQA 5ERGB 4Z1MA 2UDPA 3LX5A 2XVZA 3ASZA 2X13A 3I45A 2R6AA 5E2BA 4H3VA 3KKNA 3OX1A 1NRIA 4B34A 2PE5A 1EWTA 3I09A 4P5PA 3WGLA 4CMBA 3DLTA 5AVVA 2N0SA 4NNJA 3N2KB 2RK6A 2VSNA 4B5KA 4MDYA 3EQ7A 1KJWA 1UXHA 1XVAA 1EBBA 3A37A 3IA7A 2VKTA 4LYEA 1AN0A 4OL9A 1SXJD 1TQ4A 2V8OA 3LCCA 4WZBB 2FR1A 3URKA 3O3OB 1G63A 3F49S 1E5LA 3PFIA 1YJ8A 2ZTHA 2J07A 3LAWA 1HH4A 1WMSA 2DBVO 2JASA 2VK1A 2QAGC 1K63A 4MOWA 4YP1A 4Z2YA 4NNPA 4OJMX 1TAHA 1M3SA 3L0DA 1T2EA 2CBZA 3DWGA 2BP7B 2IKQA 2FPGB 2FJPA 4JVOA 4KDRA 1YS1X 3BFVA 4QUBA 2JGMA 3RHZA 5DH9A 3VSBA 3FY4A 4TRRA 3T3DA 1P4JA 1G4HA 5HTKA 3FR7A 4B4OA 4DR5B 1G8PA 1CV2A 4HAIA 3L8ZA 1JWBB 1L5QA 2DHCA 3LBAA 1EUDB 3O47A 5HVNA 4ZU3A 5H02A 2FGJA 2L2QA 2XT9A 3MT7A 4HEA1 1ORHA 2VRCD 2BMVA 3HB0A 3BTVA 3BMCA 4BMPB 4DR4B 2FW8A 1PR3A 1J8MF 1Q21A 2YCBA 3F96A 1E1LA 4G07A 5LP6B 5AHWA 1FL9A 1NKSA 5DI9A 1XYGA 4MS1B 1V7CA 1NXVA 3NDPA 4R2LA 1NQOA 4A2PA 5BW8A 3H5TA 2ZAIA 4MICA 2AF4C 1GNPA 1NUAA 5EAIA 4BFCA 1YRLA 2QG6A 4JI0B 1VKHA 3M3PA 1U7HA 3FTFA 2RCYA 4F6RA 4F96A 1RCTE 1NJ6A 2H5JA 1XQVA 4JNKA 3QXJA 4ITUA 4RZQA 1SU6A 2X5JO 2AV6A 2DH6A 3A3OA 3A31A 4LXIA 4DZZA 5HR5A 4TL6A 3WGQA 3X43A 2DHQA 2IYEA 1WUHS 3AF3A 4Z9FA 1LQTA 4YQZA 2P9ZA 4QPCA 1F2UB 4JP8A 1BCRB 4Z0HO 4TSFD 5CVJA 3P9RA 1GPH1 4MW1A 4HDNA 4WH0A 4BO3A 3RS0A 2IZ1A 1CVRA 1YZQA 1VL1A 2ZYUX 3FF4A 3JTEA 1UINA 1U9IA 3DMPA 4LZNA 1PR0A 1CY0A 5BO5A 4AZ0A 1IB6A 1SCUB 1UXKA 3QQPA 3TD6A 2OV1A 3FSGA 1KNXA 1XL0A 1UXGA 2H6EA 3F6YA 1QWOA 2QT9A 3KEQA 3NG1A 2HA5A 4ZOAA 3DLIA 4NWIA 1QOPB 3O9MA 1CUUA 1TECE 4MR9B 2X14A 3DHWC 1IUNA 4P3NA 4WGFA 2FR8C 2WSIA 4JBLA 1KI6B 1W44A 2V3VA 1HETA 2H1IA 3UKJA 3WL3A 1KC3A 1T15A 2C5LA 4YC7A 5BR7A 1BXKA 3FUWA 3S5JA 5LLDA 1JL3A 5A5EA 5IVHA 2C7VA 5JMTA 1UP4A 2NPIA 3DZFA 1JI0A 1Z4LA 2X76A 5AESA 2ZBRA 2P2GA 3DKPA 2YFQA 2JNWA 5DSZA 2AD1A 4UREA 1ZZGA 1T3HA 3P0IA 5JSFA 3CMCO 4HDRB 1JAIA 1G21E 2RONA 3RCBA 4OK3A 2ZIXA 2BGUA 1E2UA 1S2OA 1E1CB 3A1SA 3GLFB 3C3AA 3GFRA 4KDCA 3FPKA 4TMWA 3TFWA 3WK4A 1DG3A 2EBHX 4PRZA 3MFYA 4C2BA 4DHWA 4GPAA 1O9HA 4XX0B 4EX6A 4NYMQ 1CJTC 2NNWB 3TL6A 2AFHE 3TLKA 3UXHA 3OFNA 3TBKA 1WZNA 4ESVA 2B37A 1ZNWA 2C4NA 4BU1A 4REQB 3OFVA 1BS2A 4J8PA 2ZDQA 3PL1A 4QPPA 1CY7A 1DJMA 4F3TA 1CY4A 1ESEA 2GD2A 4NK5A 3ZIAD 2VDKB 4YJFA 5REQB 2XB9A 2YNMD 5A9RA 5CMLA 3E84A 5AVKA 2VDPB 1XWWA 3EJWA 4ND7A 4YJGA 1JSZA 2ORWA 4GOXA 4U5XA 5C7LO 4MUMA 5G0UA 2O2DA 5CK5A 2MINA 3GG9A 2DKOA 2JJ1A 4ZQFA 5J5AA 3VTAA 3AL3A 3GA5A 4AKEA 5A02A 1ULTA 4L57A 1TQHA 4QAQA 1V9SA 3ZV7A 3S1AA 1TCAA 3H11A 2WR8A 3AKDA 2NT4A 2ZRIA 2AN9A 4XIIA 1IXSB 2OR3A 1PTKA 4IDFA 3WV5A 4A3SA 1J07A 3TQOA 5JSZB 2B35A 5JISA 2PM8A 4LI0A 3EXIA 3TNLA 1JPUA 1VKRA 1S2LA 4R31A 2FE1A 5D84A 1XCBA 1E2IA 1G0OA 3M34A 4QGAA 3CLVA 5DM2A 4B2IA 2DY0A 3EC2A 1NVGA 4G4JA 5THKA 5IFLA 4EY8A 2C9DA 2VCYA 3JVIA 4YMSA 2CUZA 1XOIA 4JJ8A 1N3LA 5BQ5A 2BFEB 2CNDA 3UM9A 2ZUVA 1KI9A 3KJZA 1GQFA 2FSHA 3E4CA 3NH9A 4Z5XA 1C7RA 1NY6A 1U7XA 3FTPA 3A26A 4IV8A 4LN1A 1UXJA 2WVHA 4LY9A 4ZP1A 1VB5A 4UVEA 5HILA 1J5XA 2JD0A 3RNOA 3UMJA 3URMA 3WSTA 2WJYA 2J32A 3P9NA 4MWBA 1KO1A 4RHYA 1D03A 1XB2A 2ZJ6A 3R7BA 4CM8B 1P0MA 1LDBA 1XMIA 1GV0A 1QHHA 2E5WA 1NJ1A 1PDWA 1RI1A 1TM1E 4HGYA 1NI4B 3SC6A 1ZPDA 4CMJA 4HNTA 1Z6TA 3ASVA 3DQPA 4LXUA 3F1KA 4OM8A 3CC8A 3A0RB 4KBGA 1RRKA 4QYIA 4YBZA 4TKUB 2KM1A 5EXDA 3TKAA 4DMLA 4ZXFA 4IQ0A 1ULUA 2CXQA 5LFAA 1W4LA 2EF0A 1SOWA 4Q9LA 2NUTA 3OH8A 2XKKA 3B7WA 1GITA 2F17A 1B41A 4JYCA 2C7QA 1DPGA 4PLVA 1P2UA 3NUGA 1MJNA 4YRNA 4NG4A 4LV6A 1SVUA 1Z0SA 5JJIA 1QOZA 1G9SA 3AEKB 1DIRA 3V4VB 3B82A 4L2IA 2F2TA 1U1IA 3K1AA 1MT0A 4CLOA 4LK3A 2IH5A 4GX5A 3HVJA 5BSWA 5K0GA 2DBYA 3TLBA 1LRJA 2HYIC 1N7GA 1R5NA 2BJHA 1KSJA 3WLAA 2CYAA 4J3FA 3QUAA 2GZRA 2JCBA 4HRYA 4QU0A 3PXGA 4CDRA 5IRCD 4OH1A 3L06A 3PGJA 4ARZA 1KJZA 4Q1EA 1FEZA 2CVZA 2PS1A 3I9JA 1YASA 4K6MA 2A9FA 2PQ0A 4D44A 2R8OA 3SEZA 1AO3A 2BBWA 2ZTUA 3A1EA 5HOQA 1S7CA 2P6OA 5FTMA 3BDVA 1F12A 5C31A 1IATA 2EU8A 3R76A 3NTUA 4NOLA 4OGLA 2Q7XA 1GILA 3HYTA 3T5CA 1MAHA 1VE6A 3KEMA 4ZVPA 1UKBA 3INGA 3WIVA 4YUZA 5B58C 5E9WA 3I76A 4MWOA 3FDIA 2P11A 5LDHA 1D2GA 1EQUA 1JLHA 1R0RE 1E9BA 3WB1A 1MFPA 4HTFB 3QMMA 1P8AA 1SH7A 4G9BA 4US1R 2FXIA 3KZNA 1YIOA 4IHAA 3ZWKA 2FZVA 3SYLA 3DFKA 5F7XA 5JEDA 1ZM7A 1KP2A 1ZD1A 3BHMA 3GDGA 1GLGA 1THGA 4XOIA 4V0QA 4Z86A 4PRYA 3SE7A 4Z7JA 1H4TA 3O1JC 4JJIA 3EW7A 3SFVA 4YFVA 4L78A 1F2TA 1RMTA 1PJQA 3TZQA 1GA6A 3UGTA 1OTYA 1K7EB 4KSCA 5IAEA 2EFEB 3EXFB 3I6IA 2XWSA 1SURA 3GPBA 4MYSA 2VXYA 4RSMA 2CD7A 4RPKA 4HB4A 4RU1A 4MGHA 3JQGA 5E1OA 2H48A 4J0KA 4DG8A 4MUIA 2ZIGA 1O97C 4IQGA 4ZK6A 1J24A 2HL6A 3HL0A 4UD6A 4BBPA 5DBHX 4BWFB 5B1YA 3BL5A 1LPNA 1U0TA 1T91A 3GP3A 1Z16A 1YL5A 1YS6A 4B3SB 3QMPA 1ODFA 3FJ1A 3QSGA 4WAUA 1C3XA 1UMCA 2JARA 4XD7A 3CJQA 1SGWA 3H65A 1VJTA 2VOEA 3LUHA 4H1UA 4EYEA 1PD1A 4O4IB 1JTEA 3FTCA 4A0QA 1N8SA 2QX7A 3AB3A 3JZIA 5EP1A 2AZDA 3RJZA 4I1PA 1YB2A 2ZYWX 3FMPB 3ER8A 3L7OA 1P73A 2FRXA 3KQPA 5FEUA 5CFQA 1MT3A 2DQKA 3P9SA 1VB3A 1Y8ZA 1QQ5A 1IN8A 1FZQA 1MC5A 1P0CA 1GTMA 3I12A 3M6LA 4GOJA 1AZTA 3ZWYA 1NUHA 1A50B 4A1FA 1T43A 1H2AS 4N3CA 3R3XA 3JD2A 2JFXA 4LCJA 4K6CA 3NQ41 2I2XB 4V38A 4RE5A 2XE7A 5A1TA 5GINE 5KNDD 2WAOA 1PHRA 5D3KA 2CMKA 4DQ0A 3LPCA 2GKGA 2LIVA 4BFTA 4QAJA 2QTLA 2XY4A 2C20A 2NYUA 1ZOPA 3CW9A 5HKLA 4PLPA 3TJZA 4L75A 3VR3D 2W6JA 4V1CI 4WCFA 3JQEA 1A9SA 4YQFA 1SCQA 4LYHA 1Q44A 3B5IA 4YV0A 3H5WA 5LUAA 1AQNA 2IF2A 1U0BB 1TAUA 2WTEA 3U26A 5EHIA 4RXMA 1NBHA 3NJ4A 1R0CA 3ROTA 1G55A 4L85A 1EFDN 1R6TA 2R9VA 4O2BA 1CF4A 2Q62A 1K7XB 4I5DA 4UMVA 5EKTA 4MARA 1U4OA 4A8JA 4N7BA 2OESA 3HI4A 4H18A 1CRLA 7REQB 2XMRA 1IE3A 4N65A 1WDWB 4QATA 4OAPA 4GH5A 2I76A 4YRFA 5L3SB 5AOAA 2FZWA 4HXGA 2BC9A 2B3TA 2H18A 3LV8A 3RIEA 3PR1A 5BPFA 1X7WB 4TLMB 5I51A 4ND2A 3GOHA 1LLFA 2LVBA 3ZW9A 4HLUA 2C57A 1KMHB 1ZNQO 5M34A 5FKJA 2JL1A 5CA0A 1B4DA 2W2OA 3PNMA 4TOIA 3T15A 4OQLA 2J0QA 4AY4A 1X7XA 2Q5EA 3Q7PA 5HSGA 4MVCA 2IHNA 4WZ6A 4BNHA 4J2TA 1A7UA 3SQNA 4ZANA 2Q5FA 3E9YA 1O95A 4WOPA 1F9EA 3T61A 5KI6A 4R9NA 2HW8A 1PYOA 2PGDA 1VHDA 2GSDA 3OPYA 5EE1A 4DLAA 4RIIA 4AG3A 4AROA 3A4NA 1Z0IA 4PSCA 1P3DA 4TZ0A 3EWSA 3UEOA 5KCZA 1FFAA 4RADA 4P4LA 4C2UA 1ICEA 1O03A 4OLJA 1RZRA 2W2VA 1OIWA 3WGZA 4N5MA 3TQCA 5AKEA 4ZCMA 4M36A 2OCXA 5FHQA 1ZOOA 1JDNA 4FFVA 3O8QB 4F2WA 3D4PA 4UE2A 4DMGA 3LYLA 4PCUA 2P69A 4GP9A 5D6NA 5E3HA 1SMKA 2QG9A 5BSHA 3DBLB 3KZ1E 1PFUA 3L1IA 1HMYA 1F3LA 3TB4A 1GVHA 2N46A 4FW8A 3RSFA 3HPQA 1MUUA 4LWOA 1FUIA 3KCQA 3Q41A 3HVRA 1V4VA 4N5DA 1XMQB 1MH9A 3EVCA 4RCZA 4UM7A 5FTNA 1AUQA 3SE0A 4ZYZA 1PK9A 4IOJA 1ZUIA 5EYPB 1LGYA 1HV8A 3WI7A 1IQ0A 4IXMA 1JBKA 4BWGA 1RRPA 4D02A 4YRIA 4L0CA 4KWEA 3UHFA 3MTQA 3WGHA 1G21A 3B1WA 3LUJA 4G5GA 4NF2A 3TCKA 3WQBA 3RTCA 3ZNOA 2LCFA 1K9SA 1IWPB 3PFGA 4NZ9A 4K1XA 4KN9S 3R9XA 4F45A 1F7UA 2PGOA 4Z1MD 2REQB 1EFLA 1W49A 3IRUA 1YUNA 3ZWNA 4NCIA 4U0JA 3TVDA 3N8HA 2HKIA 3B85A 3NU1A 3M6WA 4FFMA 3PFWO 4K3UA 3QFFA 4UQOA 2FPRA 3WMXA 2AFHA 3OA0A 2FZCA 3W9SA 5EE3A 4NPHA 1WULS 2J3EA 3V34A 2XT6A 3VGPA 4XYLA 4D8YA 4RDHA 3OWOA 2GBLA 4G67A 3PE4A 1QGED 2O3RA 3BFKA 5PGMA 2NUPA 2CEKA 4DLSA 2CVQA 1T3SA 3H3XA 2ZK7A 1S3SA 1EWKA 3AIIA 3PQ8A 3WA6A 1OV4A 1CJMA 2NO4A 4INPA 3N5CA 2CNLA 1TZMA 4UARA 1YDWA 4LXQA 1NZDA 1KI2A 2K6GA 1CDZA 1M0TA 3CY6A 4DRXB 1TMYA 1R3DA 1KH1A 1QVZA 3L02A 4UEWA 3NXKA 2HWWA 4XCVA 4HQKA 5AK3A 4H17A 3O90A 1XJ5A 3MGGA 1TEZA 1G3IA 5ABPA 4QJ3A 1UWKA 2RCNA 4J16C 2JH8A 5BR4A 2G80A 2DUWA 2QRGA 3BWBA 3H8WA 3IPRA 4PZUA 1X8LA 1YRHA 1B0ZA 3QLUC 5AJHA 4DMKA 5JO0A 1U0RA 5L51A 3HY4A 2QVGA 4LZWA 1P2TA 4E2ZA 2FEWB 1YR3A 4G8BA 4MCJA 2EJUA 4A23A 2LGJA 4R8RA 3ZQ4A 5GTDA 4HXFB 4QXQA 4CNQA 1KZYC 4DW8A 1QKJA 2PLNA 3TRKA 4H7FA 3KLOA 4AJPA 4ER6A 3A9RA 1J8QA 2JI6A 3UANA 1SCAA 3GFGA 3UXEA 1Z5OA 4FU0A 2WYVA 1TF2A 3OM1A 4R83A 4TQAA 4E2YA 3JQFC 2Q9UA 2D1TA 2OZVA 3DL7A 2IPNA 4OQNA 1ZWLA 4F97A 3GV0A 4KODA 1HEUA 1QK3A 2IY8A 1HBJA 1P74A 2PT6A 4U5QA 4ZYXA 3BGSA 1LW7A 5ALXA 3SYRA 2R8XA 2YOGA 4S2UA 1TVCA 4FHDA 4LRYA 1QTQA 2AWNA 4NCAA 4KFUA 1NURA 2F7SA 1H3FA 5K09A 3UCXA 3HS3A 1Z25A 2JIRA 4FGSA 3QELA 4KPFC 3BCSA 1JDVA 1UMBB 3RC9A 5H80A 1WKBA 4WY2A 3THWB 3CVWA 1IBRA 1U7UA 2VAWA 4C7MA 1UC4B 3LX4A 5BP7A 3IE1A 5AXDA 3DFUA 2RI1A 3GQBA 3DE7X 4N8SA 3FSGD 3HEMA 2EFJA 3IKLA 4DXAA 4Z4IA 2H4FA 1SQFA 3IXQA 4QT4A 2FX5A 1G8MA 2OSBA 3HWRA 3UICA 2CMGA 1YB6A 4EKGA 1SUPA 2GXQA 4DAEA 1E1QA 2ODNA 4N6OA 5IKMA 1G6KA 4YONB 5FPYA 3VHXA 4O3MA 5IT5A 1UBSB 3ZGOA 4I1IA 2FWRA 1X15A 1Y6QA 2O20A 3BEDA 3HZHA 1WUIS 1J0EA 2NUBA 3O0DA 4WNIA 4V02A 1DIAA 3FLEA 4WXPA 4B3CA 2WPDA 1NVKA 4IRXA 3UMCA 2CB0A 4DUYB 4AZ3B 4EB8A 2CB9A 1K8YB 4HLDA 1OJ7A 4LRQA 3M6MD 3T5TA 3IEVA 3BD7A 5CIWA 3SC2B 1DG9A 3EE6A 1BDMA 1R6AA 1SKYB 5I5GA 1H9BA 2ZI6A 3BE4A 4JZYA 2BMJA 2VJLA 2FSFA 2XE4A 2R6HA 4UTXA 2EFDB 2BF7A 1PL7A 2IZ7A 3OFND 4WKNA 4F11A 1GPYA 4Z0PA 2AL7A 4MUXA 4U7JA 4GF5A 1GZHB 2WF5A 3OUTA 2B94A 4NEGA 2WOJA 2MYTA 4FMCB 3WYBA 3ONFA 4Q9IA 3ICOA 4B3IA 1UPFA 5DCLA 4R6XA 1THMA 2AQHA 4MRAA 2VJKA 2IDZA 2JBAB 2N1BA 4KVZA 4M46A 3RT1A 3W2HA 4KFSA 2H0QA 2EDAA 1E7SA 2B1IA 2I3GA 1FFEA 2XQGA 3IIKA 3X1ZA 3HXOA 2WT8A 4BX8A 1P9WA 1E0SA 1XVVA 3ZVMA 3ZWAA 1OPRA 2PRYA 2MCFA 1GNQA 4PR3A 4F60A 3RC8A 3W1VA 3QJYA 2JJ1D 2VH5R 3U61B 3PGA1 5B6JA 4C30A 2YZKA 3RFTA 1VMDA 2PIDA 3OPQA 2B5VA 4PNZA 1J2UA 3SGLA 1SD5A 2C98A 2Y1XA 4GYYA 3GL9A 1FBTA 3QKSB 1FSGA 3OZDA 4EWLA 2YJ5A 2AYXA 3NHBA 4GR9A 4P08A 1N1EA 1ZD3A 2JFPA 2PVCA 2RGNA 7YASA 1CF2O 2UUPA 3CTMA 1VMKA 3NR2A 4W5QA 1XJCA 1WQ3A 5ER9A 3QVLA 3ESRA 1IJBA 1NLMA 3MWDA 3EB9A 3EVTA 4MUYA 4TTTS 2VSOA 3E70C 4DCTA 5A06A 1LBEA 2ZUWA 1M6NA 4YPVA 3VUFA 3MJSA 3N0TA 3OQHA 4DWVA 3U7RA 2C9CA 3NDJA 3C8MA 1AHHA 2CJYA 1KI7A 3VO1A 4C7BA 4D9GA 3GH1A 2P9CA 4W82A 2BFNA 5DASA 2OHVA 3GQVA 4XZ3A 4ZJPA 1J8YF 1YRAA 2OAQ1 4LGCA 4CDMA 1WY7A 2ZB2A 4U8GA 4Y8VA 5SY6A 4ZVRA 4PX5A 3BK1A 4MMYB 1BXRB 4N8EA 4OOFA 3UJHA 2OBNA 1PFYA 4L8WB 4GFDA 4ZOLA 5KWVA 4JSTA 2XYRA 3D7NA 4H77A 3IIEA 3GJ8A 4NMLA 3EGCA 1E4OA 2Z6UA 1C0PA 4F4IA 5DGHA 1T3TA 2HADA 2O8CA 1K6IA 2Z5GA 2OPBA 1F17A 4PZAA 1W30A 2NVWA 3NOOA 1XD8A 4KUGA 2HRCA 2P0AA 5KJ6A 1SOMA 5T6MA 3QOWA 2C0QA 1G1MA 1WOMA 3FNBA 3CZMA 1OC4A 2VAPA 3JQBA 5FBZA 2YFHA 1L8OA 3DVLA 4MCIA 5FCDA 1LA2A 3RR2A 4BJHB 4EO7A 1QVWA 1XTPA 4MMXB 5BN3B 3V8MA 4FHFA 1YSCA 3NHKA 4MP8A 1U5CA 3H4IA 1I7NA 3ZEIA 2XCRB 2JAXA 1WUTA 4X3CA 4CFYA 3KKEA 5CBPA 3GUZA 1JTVA 2GK7A 2JI4A 2JHGA 2ZPTX 1B2RA 3ZU4A 2QJTA 3U1VA 4DLTA 2G77B 5KYTA 3U6KA 1YTUA 5KSOA 1K2VN 3IAM6 4TWJA 5BQPA 1NM5C 4CJXA 1NNI1 2F9MA 8ABPA 4RVHA 1BMFA 1VLHA 1K6XA 1FQKA 1ZCFA 2NQTA 4MUEA 4UEKA 1Z73A 2HX1A 5EVJA 1WNFA 2IW1A 1KMIY 4EO9A 3A6PC 1X77A 5B58T 2G1UA 3JYOA 3DBHA 1ZIYA 1CT9A 1EK2A 4KO4S 1XCLA 5ERYA 4MDEA 3BWCA 3KVOA 5JS8A 4PHGA 3LO8A 2G1PA 1R5BA 5A4KA 3TX2A 1T10A 3NHZA 3RPEA 3FMGA 4Z4FA 4JJFA 1M8KA 2G7MC 4JY7A 4FSXA 5JANA 1M5RA 4FFLA 3DO6A 2ZI9A 4AKIA 4CIYA 3STWA 3KKPA 2UYQA 4I3GA 4QDZA 1A2BA 2Y77A 4ZAVA 4J3NA 3CKYA 3SHWA 4EMBA 3LBYA 1QRTA 1Q0HA 1H3NA 4H60A 3GRYA 4G8CA 4O2LA 4TMKA 1YS9A 1PEYA 1Z15A 2QQ0A 4KITB 4A7PA 1EE1A 1T1IA 1KO7A 4KVAA 2JFBA 2JKYA 4IH4A 4P84A 1Y1KE 4FR0A 4QOJA 5ALPA 4NENB 1YZTA 4P38A 3E15A 2X5NA 4JJ7A 2B0CA 4DWJA 1CYDA 4FCCA 4XQ9A 4GVPA 4BB5A 5HQ3A 1K97A 2XD4A 3DEHA 2XNDA 3HK2A 3DFIA 1XTQA 2D1RA 8AT1A 3WGUA 4MVJM 3C6MA 1NUPA 2RHCA 3R7WB 4R1TA 3QWBA 3DWIA 4KOEC 4L1KA 1M76A 2PRZA 4A8PA 5TE9A 5K4HA 2GI4A 5LQNA 3KKMA 2Y6UA 3BDAA 1WX1A 4BXOA 2I7VA 2BFFB 2L82A 1DJPA 4O1MA 3IGFA 2JIMA 2J4DA 4X61A 3NHPA 3LUDA 1E3WB 5H16A 1K4MA 2GD6A 3ZNQA 2WEKA 4H6VA 2FZKA 2GN1A 4RNDB 1R9JA 3FDZA 4OHZA 5BW4A 5L9AA 3NS7A 1VYVA 4NJMA 4RJTA 1XU9A 4K8RB 4ER3A 2YCLA 3DE3X 2BKXA 2XA1A 3HGTA 3U4DA 1Q2XA 3MUNA 4H6XA 4O4JB 1JQAA 4UQPA 3LVRE 1U0NA 2P5YA 3AERA 1J21A 5FP0A 2WUFA 1Q0LA 4IDOA 1A8IA 5A0TA 1GRNA 1YT5A 3DS8A 2V8BA 3NYQA 4YYZA 2VAVA 4LJYA 1MAWA 2FQYA 2ZIEA 1AS3A 3K32A 1VA5A 2F1HA 4RWEA 2GPWA 1N8NA 5ECGC 2OO3A 5KO2A 3AF5A 3GLSA 3ORFA 5EQFA 2PUDA 4MYRA 1Q91A 1YHNA 3M9LA 3GI1A 2BEWA 4WXEA 1CUJA 3WGKA 4D8XA 3PLAE 2UZIR 4AUMA 3JR3A 1MA3A 1DAEA 1AQJA 3K71B 3R3WA 2YASA 2W6JD 3NEAA 2BF4A 1ZMRA 4FGLA 1PV2A 3WL8A 1DXOA 1PWYE 3M1AA 2N3ZA 2J3HA 5T64A 1YHYA 4PLGA 2AHRA 3QEBZ 1Z62A 4LEIA 4G0PA 3DOUA 3FGOA 5IVDA 4II3A 5KNBA 1RXVA 4HNUA 3I73A 2PA0A 3QOXA 5GADl 4BXOB 2LXNA 4Y0VA 3WHPA 1EGMB 1BMQA 2CXTA 3VDRA 1QS0A 1FPMA 3L0BA 1LI5A 1NULA 2FSUA 2R62A 3NBYC 3AEQA 5FTLA 3CUVA 1LPOA 3MS7A 3LC2O 1AUXA 2V7BA 3EZXA 2VK4A 1RKUA 1T6XA 1Z29A 1EE9A 2IDKA 1KP3A 2NVBA 2ZT8A 3F98A 4UAVA 1TO2E 3G2QA 4B46A 3K4HA 4EZIA 4ZHQB 5T67A 2Z9BA 4OVKA 2J09A 2BFWA 2OV3A 4F4JA 4G0NA 3T7JA 2WJWA 3GGGA 5K3FB 1USUA 1GR1A 2JFQA 5D1HA 1JH8A 4NS1A 1C1DB 1TJYA 1PGPA 3O1LA 2IYXA 2IBTA 1N9ZA 4LE2A 2JJMA 2LD4A 2YV2A 2AOUB 3MHPA 4L5CA 3N39C 3L8HA 4JL8A 3REQB 4HBZA 1PGNA 1R2QA 1T1GA 3WKEA 2JW5A 4A10A 2AGVA 4B4KA 3EA4A 1EFHA 4IJ6A 4RCVA 1UWCA 4C3OB 5H9VA 3R0JA 1BDBA 1GNSA 4Y6GB 4CYMA 1DXYA 4B6FA 2ODPA 2VPXA 2GZSA 1T9HA 2XHEA 2ZYGA 2WYHA 1E2JA 4DB2A 3QH4A 3CSUA 3L6OO 3FWYA 2O7RA 2WSBA 3R5SA 3NT2A 1SOVA 4DCMA 3IKMB 2HQ1A 1FMFA 3LD9A 1IOLA 4MVJH 2CDRA 2GAFA 4B40A 1RZRD 4GVXA 1YZ3A 4EPTA 4YMUA 1H69A 4HOYA 2FX2A 1M2JA 2HD4A 5NULA 4PX9A 1M2OA 2XGSA 2VQSA 3VDNB 4KL8S 4R1NA 2HZBA 2HYDA 4GX2A 3FWHA 3L9WA 2GQ0A 1T4MA 2BI8A 4HQNA 3QG5A 4Q3CA 4DM7A 4NDNE 4D74A 2EX4A 3V8RA 1FYFA 3IXMA 5K03A 4KJXA 3GLQA 3QUQA 3LYHA 1EX9A 3Q0TA 3A32A 4HP8A 4EDFA 2ZWPA 1T34A 3AJAA 3O82A 4GGMX 3UK6A 1RAAA 3JWJA 1GTG1 4RFSB 5DNDA 5ARBA 2BCEA 2DWPA 3HB7A 2IXEA 5HKKA 1GG2A 4X92A 4PQEA 4M1MA 5E9JA 2Q4EA 4I55B 4C7OA 1EDDA 1LZKA 1RAEA 1U94A 3OLZA 4EY6A 1I3CA 2R1TB 2OVBA 2DLCX 3RD5A 4FWBA 4A26A 4QQNA 4BPRA 4EL0A 4AFNA 1RAHA 2PJRA 1IQUA 2WF7A 4KBYA 3ZZTA 3L7MA 4HS9A 4W9NC 1FQWA 1GNVA 3PYLA 1IEVA 2FH5B 1L4BA 4M0MA 1WLSA 1N78A 3GGDA 3WSVA 2JLUA 3GVPA 2RBGA 4UUAA 4L5IA 1L3BA 3I04A 3N8IA 4NU6A 5AM5A 3TJMA 1XAHA 1R37A 3BSYA 4KO1S 1O57A 1Q7BA 1DHTA 5GZ6A 4LDZA 2IU3A 4X3PA 3P9CA 5C1DA 3DP7A 2H9IA 2DG2A 4O4HA 1P2DA 1JAXA 2GCNA 3VU0A 4L8GA 2H1WA 4Y0NA 2JK1A 4W7SA 4BJ3A 1IUKA 3OZSA 5TF0A 4QECA 3RWOA 4YRSA 4YT8A 2PKXA 5T4EA 3MCUA 1TVKA 5U1PA 3FMOB 3TRDA 3HACA 2GASA 5I8WA 4D82A 2OUIA 1UFVA 1XMVA 2IPOA 2QRKA 3EQ2A 3L9XA 2E9SA 1Z5VA 2BHLA 1GO2A 2YDYA 5DHTA 5A03A 1BJTA 3F2VA 3MWEA 2VP2A 1U8ZA 1ZD9A 2X8AA 3JVVA 4GYJA 4RMGA 5IAGA 3WYAA 1QANA 2OGZA 3I58A 3K16A 5I47A 3DBRA 4MA5A 5IXSA 2RHOA 5K20A 5M3BA 4RY9A 3NWEA 2WIDA 5DHQA 1RPJA 2BGNA 3RIHA 4CQLA 1FXUA 3IESA 3LL4A 4JWTA 1VE1A 4XQEA 4RTPA 2HV9A 3G85A 1XSEA 1R5OA 4GKBA 4EVSA 3VSDA 2NV2B 4ZT7A 5J5CA 4GUDA 4DQDA 2ZT7A 4YJ2A 4NBVA 2FEXA 2DQ4A 4JJAA 3SJAA 2IH4A 4RAOA 4KQ6A 2B8EA 2C5HA 3U2QA 4HNAB 4BYMA 2ZYTX 1GPJA 5JH7B 1DGQA 3O5AA 4P82A 5ELLA 1SCIA 1I1OA 4RTNA 4QO7A 3KJXA 1N77A 2ZXEA 1FDVA 4D57A 2E1RA 4EA6A 4HPXB 1KVTA 4JQOA 2H2FA 1A88A 2I7TA 1G6OA 3PTAA 4C21A 1VDMA 1BX1A 2I4MA 5TLSA 3C70A 1ULHA 1V48A 2R5WA 5E7JA 5J4YA 3FVTA 1L5OA 1WBBA 4RM2A 4CF6A 5T3UA 1AB5A 1T4CA 3ELUA 2VH1A 4A5OA 3R5HA 1U0LA 4CKXA 2ZI7A 4RM3A 1QTRA 1PWEA 1OA1A 4ND8B 4V24A 5DYNA 2OPHA 4ZIRB 4RVGA 4R81A 5TMEA 3VDMA 3OKCA 2IQ5A 3G82C 4E51A 4KPEC 3ITKA 4EX7A 1E1QD 1Q1NA 1HDRA 8OHMA 2ZE8A 3IQDB 4JLBA 4DCGA 2AN3A 1CE8A 2R65A 1VCMA 4KYIB 4FZJA 4QM7A 1W2HA 1OX4A 5B64A 2WIFA 3B6ZA 4JR0A 3LCUA 5IAOA 4YIHA 2YUIA 4DCOA 4HWKA 2WPDD 4DBLC 3D7SA 1N1DA 3MJRA 2C07A 4D45A 3BF8A 1TK3A 4Q3DA 3ZCPA 3BXGA 1K6EA 2J67A 4B0PA 5A6SA 5KYWA 3QY0A 1XP8A 5FWAA 3CLTC 5CVCA 5A3JA 1C1XA 3EXHC 2FK8A 2J6BA 4LGVA 4KMSA 4IWNA 3OE4A 3A06A 2EKBA 2J7KA 3WLQA 2QN2A 2A3RA 4GMXA 5E4TA 2H4XA 4EB6B 1BVUA 4BLPA 1UJBA 3ZDFA 1D6SA 2P9BA 4J4BA 1E32A 3LPMA 4NV3A 4PZYA 4D98A