3SVZA

Crystal structure of apo bt_2972, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of apo BT_2972, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
molecule keywords Putative methyltransferase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3svzA00
3UA3A 2QM3A 3GIWA 3RODA 3MCTA 4DQ0A 1PJZA 4FSDA 5E9QA 3B5IA 2K4MA 5EGSA 4RTOA 3O31A 3FPEA 5DXAA 5EZQA 2JH8A 3FRHA 3MB5A 4V0RA 5ICEA 4CXMA 4RTMA 4BP1A 2EX4A 3SX0A 3LCCA 4E70A 1NW7A 2H1RA 2IIPA 3LBYA 3PFGA 4KRGA 1N2XA 5DM1A 2R3SA 2PT9A 2UYQA 1EQAA 2BR4A 4OBXA 5E8JA 2P7IA 1ZHFA 2AOUA 3V8VA 5EEHA 4C08A 3EVBA 3FUTA 2IP2A 1KPIA 4A6EA 3LDGA 4CKCA 4EQZA 5EC8A 3FPJA 3SGLA 3QOWA 2VP3A 3G2OA 1DUSA 3T7RA 5KYGA 5BW5A 4ER5A 4ZTBA 2OB1A 2OO3A 3LX6A 1UWVA 1BKYA 3L8DA 4C06A 1SUSA 2YUIA 3DLCA 5K0FA 4WVLA 2JHAA 3CJQA 1XTPA 4O29A 4R05A 4FGZA 4PYLA 2NYUA 2QE6A 5K03A 2IH2A 3CGGA 4RTNA 2EJTA 4YMHA 4PGHA 2UYOA 1XCJA 3QV2A 4PYQA 2NXJA 4C05A 1SQFA 1VBFA 3HCAA 3KPJA 1O54A 3LKDA 4GOOD 2JHPA 2ZLBA 3P71T 4K6MA 4Y2HA 1D2GA 5G02A 3KQYA 3M70A 1WXWA 1EJ6A 3GRRA 4AZWA 3CJTA 5LQJA 2YTZA 3OU2A 4R8RA 3K0BA 2AOTA 1KP9A 2NNWB 5H02A 3NWEA 3HCDA 5C1IA 1XDSA 1Y8CA 3GU3A 1P1CA 2PGXA 3ID6C 3LBFA 5FTWA 3G7UA 4DCMA 4RVDA 2YQZA 2YXDA 3MGGA 4QTUB 4QVGA 1TW3A 1ZKDA 3UJAA 4RV9A 3GNLA 2YX1A 3F4KA 4XUDA 1D2CA 5JUWA 3DMHA 3DXXA 4HC4A 2XBMA 1FBNA 3M6XA 2B2CA 5LQNA 3ELYA 4E2YA 2QY6A 1RI3A 1IM8A 1YFJA 3C3YA 4HTFA 2AOUB 3KQPA 1P1BA 5FWDA 3SSOA 1RI5A 2P1DA 4L7VA 1G6Q1 3GGDA 2IBTA 1NBHA 5EMMA 1KIAA 2BM9A 3V97A 3EVCA 1JQ3A 5GM2A 2G72A 2G71A 3P2KA 3X0DA 3ME5A 5LQCA 2Q41A 4QQKA 4PYOA 5DLYA 3FPHA 2B3TA 3REOA 2AN3A 1NV8A 2NXCA 5K05A 2GPYA 5CCXA 2PT6A 4MHTA 1R8YA 3OFKA 5CVEA 2IGTA 1YB2A 3B3GA 4DA4A 2G8NA 1UFKA 4OQEA 1L3IA 1G60A 2P8JA 2PX2A 5FA8A 1VPTA 1UIRA 2IFTA 3HCEA 1M6YA 1MJFA 1AQIA 3FTFA 1SVUA 4M7RA 3NVKI 5CUQA 2GAFA 5DM0A 1F38A 4Z2YA 2BZGA 3BXOA 4PINA 2WA2A 2VS1A 3PB3A 3TLJA 2ZIGA 4OA8A 2AVNA 2QRVA 3ELDA 1MHTA 4G56A 1VQ1A 2PXCA 3KPVA 4RX1A 4H0NA 4U7PB 4KW7A 3G2MA 4PIPA 3NW9A 1DCTA 4PYIA 2EFJA 3B7PA 3EEOA 4BP3A 2ZIFA 4F86A 1NW6A 4LG1A 3UJBA 3A26A 3OPNA 2O57A 2GA9A 4ER0A 3PTAA 4OQDA 2ADMA 3CKKA 10MHA 2YXEA 3PFHA 4GOLD 1L9KA 2ZBQA 5K0LA 5T6BA 2IH5A 5MHTA 4KIFA 5EHIA 4GF5A 5FA5A 7MHTA 2OBFA 2A14A 1FP1D 5DM4A 4U7TB 3ELWA 3KQTA 5K01A 1ZG3A 3U81A 1ORHA 3DP7A 2AN5A 1EAMA 2JG3A 3EMBA 1NW5A 2PXXA 3KR2A 4AZTA 3EVDA 4PYMA 1M6EX 3OZSA 3SVZA 4Y30A 2XYVA 5E1DA 4R6WA 3BGDA 4IV8A 5GWXA 3BGVA 3G8BA 1EG2A 3FTEA 3T0IA 5M5BA 3IV6A 3P9KA 5HZMA 1F3LA 3KQQA 3LHDA 4MQ4A 2HNKA 4JXJA 5EKXA 3KKZA 4YV0A 1BC5A 1RI4A 3AWIA 3BWMA 2ONYA 3EMDA 4GUAA 1RJGA 1R6AA 3R0QA 2DPMA 2PKWA 1INLA 3A7EA 3EGVA 1RJDA 4IV0A 1JSXA 3HNRA 4HSGA 1B42A 4RVHA 5KQSA 4OX9Y 3LGAA 3I58A 5EPEA 4XUEA 3C6MA 4PGGA 5HFJA 1RI2A 3RW9A 5CD1A 4POOA 2BH2A 1VP9A 3ELUA 4MWZA 1RJFA 4BLVA 1X1CA 3P9NA 4KDRA 4DZRA 2V74B 4C03A 4RTPA 5K8VA 5HIJA 2O06A 4GQBA 4BLWA 2ZW9A 3BKXA 1L3CA 4LWOA 5LR6A 1G8SA 5FADA 4AUKA 1ZGJA 1HNNA 1Z3CA 3TM4A 4A6DA 3H2BA 2ESRA 3EVZA 3P2EA 4QPPA 3SSNA 3LSTA 3ERCA 1OR8A 5EVJA 3DULA 3KQVA 2NP7A 1YUBA 8MHTA 3EPPA 2PLWA 3KR1A 3SMQA 3G2QA 2HWKA 1EIZA 2PBFA 3NMUF 4DF3A 3T7TA 2ZCJA 3NTVA 4CKBA 1Q0SA 2BR5A 3DXYA 2ORED 4DM3A 3M33A 1L3BA 1YZ3A 3PX2A 1JQDA 1SUIA 2I7CA 2GLUA 4YV2A 1TPYA 5E1MA 2XYQA 3KHKA 4RWZA 1KYWA 3GO4A 1RJEA 1Q0TA 5U4XA 3ANXA 3JWJA 2R6ZA 2ZIEA 1JG1A 4M36A 4OA5A 4RYLA 4V0QA 3VC1A 1NW3A 2C7OA 3AJDA 4HGYA 3Q7EA 3TR6A 1AV6A 5C0OE 4E2ZA 3BKWA 4PCLA 4RVFA 4KVZA 3SM3A 4CTJA 3ER9A 1QAQA 1U2ZA 1X1DA 2OXTA 3HEMA 2I9KA 2IBSA 3FUUA 3VC2A 4X1OA 2JJQA 1H1DA 5FQNA 1O9GA 3CJRA 4GC9A 5LQUA 1XVAA 3GXOA 2FK7A 2P3QA 3HM2A 4E2WA 2I6GA 5B1SA 4YV1A 5K0GA 4HRAA 3NVMB 5GINE 2VZ9A 4GOMD 2VDUE 3HCBA 1NT2A 1VLMA 3DR5A 3G5LA 2AOXA 3R6TA 4ER3A 3THSA 3ER8A 3HVJA 3IEIA 3DTNA 4X61A 5EMLA 4GOND 2XVMA 1WY7A 3HA7A 3SR4A 4PYJA 4RTSA 3TRKA 3DH0A 3MHTA 2LD4A 1SKMA 4IKPA 1R8XA 4R6XA 2UYHA 3OE4A 2AOWA 1KYZA 3FZGA 2YVLA 4LWPA 4B17A 4PWYA 2IH4A 1HMYA 3M6VA 2CMGA 4E31A 3OZTA 1FPQA 5EHGA 9MHTA 3UJ6A 2ERCA 2B25A 1NV9A 3NDJA 5FCDA 3AY0A 5LSAA 2JH9A 4FZVA 2E5WA 2FHPA 2CMHA 4EMSA 2ZBPA 2FYTA 2HMYB 3GRZA 4PIMA 1SG9A 1VL5A 4X60A 5T64A 4NECA 3HA3A 5EMKA 5K0BA 5KVAA 3P97A 3GCZA 5E2AA 3TFWA 2IPXA 4PNEA 3THRA 2HR1A 3IYLW 3E7PA 3MAGA 2B78A 1TW2A 1NKVA 2PJDA 5DX0A 4FT4A 1KPHA 3PVCA 4C07A 1IY9A 4YUWA 5CCBA 2ZWAA 4X41A 5DSTA 5DWQA 2FPOA 1KR5A 4GC5A 3SSMA 1X19A 2EJUA 4LECA 3LL7A 5EKUA 3I64A 3KQOA 4EVIA 3UJCA 5P8WA 2PSSA 3OFJA 2O0LA 2ZZKA 3TM5A 1N7IA 3MERA 1KHHA 2ZSUA 3KPUA 4F84A 4UOEA 2OY0A 4GEKA 5DRYA 3JWIA 2WK1A 4E30A 4YMGA 5EMJA 1P39A 3KPWA 3MCZA 4OBWA 2Y1WA 3R9XB 1KPGA 2IDKA 3JWHA 2QYOA 5EQJB 1IXKA 2WA1A 3A4TA 5EEGA 2ZZMA 4HGZA 2V7EA 2PVCA 5FUBA 1I4WA 2BR3A 3O7WA 4AX8A 1BOOA 2OKCA 3GDHA 3TKAA 2I62A 1R74A 5CIYA 1KXZA 1T43A 2P7HA 3VYWA 3BWCA 4X63A 4YUZA 2AOVA 4P7GA 4YUXA 3FPGA 3HVHA 5E2BA 3MTEA 3B89A 3ORHA 5EOVA 2PX8A 5FWAA 4P58A 3WSTA 1YZHA 2H00A 3D2LA 3NDIA 2PXAA 3O4FA 1EJ0A 3CVOA 3EEYA 2OPBA 3LDUA 5ICCA 5FQOA 3UWPA 3GRVA 3TOSA 2UYCA 2UZ4A 1QYRA 3FYDA 5LQKA 5CM2Z 5CVDA 5K0CA 3NWBA 5E9JA 3FUVA 5D1HA 2YR0A 3DOUA 3HTXA 1X1BA 3BZBA 3M4XA 5CVVA 3LCUA 3EGEA 2DULA 2GB4A 3CCFA 2G70A 3KQMA 4QQNA 2O07A 3CBGA 2OB2A 2P40A 1QAMA 3GRYA 3R24A 3FTCA 3B3JA 5E1OA 5DTQA 3UJDA 4AZVA 5GIOE 1JG3A 1NE2A 4M37A 2XYRA 3A7DA 3BWBA 2OZVA 3C6KA 2G1PA 3EVFA 3CC8A 1VE3A 5CVUA 3G8AA 1D2HA 2Z6AA 1I1NA 4PONA 3TPZA 5BXYA 1JG2A 2FRXA 1WZNA 3OCJA 5IH3A 5DX8A 3MTIA 2NXEA 3RIEA 4RTJA 5ERGB 2BM8A 2AR0A 3LDFA 4PYKA 4QTTB 3T7SA 2HTEA 3FUXA 3TQSA 4M38A 3PX3A 3UJ9A 4FR0A 2P41A 3E23A 3DXZA 3I53A 3LCVB 2N47A 3PS9A 2VDVE 3HA5A 3OE5A 4FP9A 4AZSA 4CWAA 5E8RA 2Y1XA 4GBED 3UZUA 2OYRA 5GOZA 2AOTB 1G8AA 2ZBRA 4EKGA 4EK9A 2ZWVA 3HCFA 4RTLA 1FP2A 4KWCA 2F8LA 5DT2A 4RTQA 5BW4A 1RI1A 3G89A 4CTKA 4XCXA 5FULA 3BWYA 3UFBA 5HEKA 3E05A 5HILA 5EZSA 5GM1A 5ICFA 1AQJA 1FJXA 1XXLA 5KS2A 1M0EA 2HV9A 4QVKA 4KIGA 1X1AA 4FS8A 2YXLA 3FRIA 4E33A 1L1EA 3LECA 4R8SA 3IHTA 2NP6A 4RSRA 3OZRA 4HTFB 4PCAA 3TMAA 5KQRA 1XDUA 3KR9A 3HVKA 5K0EA 1XJ5A 4KDCA 5F2KA 5DTRA 2IDJA 3AXTA 3MQ2A 5HIIA 4ER6A 1QANA 4RTKA 1VP3A 3DUWA 2AVDA 4MTLA 1WXXA 1JSZA 4HG2A 2AN4A 4MIKA 5D1NA 3OU7A 2C7RA 3A27A 4ATNA 4YUYA 3AXSA 1R00A 5ICGA 1R18A 1WS6A 3UBTA 1JR4A 3LKZA 5C9ZA 2CKDA 5E9WA 1N7JA 2PX5A 5GP1A 5FHRA 1G55A 2EG5A 2GH1A 3EGIA 1XCLA 3I5UA 3KPYA 3C0KA 2B9EA 2ZTHA 3EVAA 1G38A 5K0NA 5F2NA 5LQAA 4HH4A 3KQWA 1JQEA 4IWNA 5E1BA 4F85A 2P35A 5EIFA 5HIKA 4C4AA 3R3HA 4RTRA 3KU1A 3HCCA 2CL5A 3UJ7A 3KR0A 3K6RA 4ISCA 5FHQA 4BLUA 1QAOA 2PWYA 4WXHA 1V39A 3BUSA 4BY9E 2ZFUA 3G88A 2Z6QA 2PX4A 3LPMA 3BGIA 3I9FA 4FSXA 3EVEA 3Q87B 5F2OA 1JTEA 5GIPE 4DCGA 1XDZA 5LQRA 4DKJA 1AF7A 4YUVA 2PWPA 2JHCA 3HVIA 4XUCA 3UJ8A 3E8SA 3GWZA 3P9CA 4E32A 3P8ZA 1QZZA 1SQGA 3DMFA 3PT9A 3HP7A 4PYNA 5T67A 4ER7A 1WG8A 5BP7A 4CKEA 4RVGA 5DTMA 3EVGA 3FPFA 5JR3A 5DM2A 1YF3A 3G2PA 3BT7A 3P9IA 1O9HA 2FCAA 4E2XA 2ZULA 3DMGA 3JWGA 4QDKA 1BHJA 2P3OA 2XVAA 2PY6A 2ONZA 5CVJA 4P7KA 3TKYA 5IKMA 1YFLA 3VSEA 2PV0A 1DL5A 2C7QA 1JG4A 1NW8A 3KQSA 3QOXA 5EG5A 5K09A 1VIDA 3S68A 3G5TA 3M6UA 3FYCA 3M6WA 2CWWA 3GRUA 3GJYA 3OU6A 3SXJA 1ZGAA 2C7PA 1JTFA 2ZVJA 5EIWA 1NBIA 2H11A 3NJRA 1ZQ9A 5DPMA 2QRVB 4DMGA 5K0JA 1ORIA 2O05A 4P7JA 3PLAE 2ZZNA 2NXNA 1I9GA 5HIMA 2GS9A 4FT2A 2FK8A 3P2IA 5DRTA 2P3LA 5DX1A 5DSXA 4QPNA 4QDJA 3C3PA 3FUWA 4EKIA 5DXJA 2Z6UA 2VDWA 2AZTA 4P7FA 2AS0A 3UA4A 3FTDA 3DLIA 1P91A 4C04A 3B3FA 5HOQA 2KW5A 3A25A 1PRYA
chains in the Genus database with same CATH superfamily
2WNSA 5ALJA 4DMLA 3R75A 4DQ0A 1XNHA 1ZD9A 3O31A 1ZH0A 4EBBA 3U3JA 3FRHA 3OUZA 3ASUA 4Q0MA 4CMBA 4CMEC 5JH7F 2RGDA 1EK2A 2X15A 1T0HB 3ESCA 4O4HB 3SX0A 1NW7A 2QTGA 3QBEA 3PFGA 4KRGA 4B7CA 3MQ4A 3OOSA 2P7IA 5TC4A 3NNDA 1VLQA 3I4FA 5AW8A 2JLUA 4GP6A 4B33A 4MO2A 4WJKB 4XRGA 2OAEA 4YIKA 4FFNA 4L9RA 4PZUA 1T5SA 3IH5A 3GRFA 2YHUA 3A9VA 4FILA 3SYTA 1I7PA 1LV8A 5BT9A 2MSKA 1ICIA 5CA1F 4NZNA 4TLLB 3MJCA 4ZU3A 1FFGA 2C1EA 1R0XA 3EAFA 2QPAA 5F5XA 5K3OA 2YUIA 4B35A 1QFYA 2BFDB 5KVQA 4O29A 3ADCA 1VA5A 5K8LA 1JAZA 2YV5A 2Z43A 2JZCA 4XDGA 2MOKA 3EN0A 4GYKA 1C7EA 2QJFA 2I5PO 1C0KA 2CYAA 2Z2JA 1KI6B 4L5IA 4N39A 3VDXA 4AMGA 4PO1A 4M46A 4ZO7A 5DN9A 1SH7A 4OKNA 1YRLA 5AJZA 2OMKA 1K8YB 1TM5E 4S0ZA 1RHRA 1CULC 2WFLB 5FBVB 1P4SA 4F7WA 3ID6C 2C4NA 3D7RA 2BVNA 3OE7D 1KAGA 1SIBE 1EFVB 4LYFA 1XXHE 3CH4B 3I8OA 1GL3A 4C21A 1CUCA 3AI1A 2O2EA 5AKJA 1TA0A 2EBUA 3S1AB 3GLGE 4JP1A 1OREA 3LWDA 4NFHA 4Z2AA 5LZ2A 2JVJA 2DPYA 3IQHX 4RY8A 3ZJ5A 3WJAA 1NNSA 3LLSA 2W2NA 2AOUB 4HVAA 2FMFA 2DRIA 3FPLA 4KQ9A 5DHRA 2WPDA 2P1DA 3IXMA 4U1RA 2XLCA 4Q1BA 4WZ6A 4D43A 1Z22A 1KOLA 3PSAA 1EK5A 1Z5VA 3K1AB 1U0TA 4JAVC 4LZOA 5EESA 4BBZA 4DA7A 1X8LA 2ZJBA 1P18A 3P2JA 2DM6A 4OU5A 1B6TA 4AD8A 2V6BA 1Z6YA 4ENPA 2B3TA 2FVYA 4K05A 4GG1A 5FTKA 3E8XA 2C07A 3TZBA 5IABA 4BMZA 1RWMA 3E7FA 3JD0A 1VJ1A 3PITA 4MDFA 1FCJA 1DQNA 2GXQA 2QLTA 2Z95A 1W46A 3B6IA 2FZLA 4I4LA 1LPOA 1TD9A 4I8XA 3WZLA 2ZI3A 1NSYA 5A02A 1MJFA 4L4RA 3HUEA 4X66B 3PR2B 4M7RA 4CKZA 3I01A 4YQFA 3H04A 3WLOA 3KZNA 3FKQA 1R6DA 2Q1XA 2IELA 2JJ1A 2QRVA 1P2FA 2ZK7A 1U8YA 4JT4A 4K0RA 4RX1A 4AUMA 3P2YA 1UOEA 4G1CA 1WDWB 3JD1A 3TOZA 1NW6A 3QGMA 5DSZA 1K6JA 3V2UA 1ECPA 4NMXB 4TROA 4KLCA 3MWLA 1B2LA 2D1QA 4RJTA 4QUHA 2GZ3A 3HGTA 3I9KA 5HIAA 2IYFA 4IP0A 2H31A 3E18A 1M8PA 2CVQA 1G8KA 2E6UX 2QRQA 5H0IA 1DPGA 1UBTS 2GASA 3JYQA 2F3TA 4X95A 1XZDA 2X4LA 1SVSA 3EIWA 3DDZX 3KQTA 4UBOA 2R6R1 5HW0A 1SUCA 3QVTA 1QH1B 1X3SA 1QGUA 3IHWA 2QRPA 2X13A 1CY8A 4ZC8A 5E1DA 1FJ2A 1LBIA 3ZBQA 5LP6F 4RKFA 1DKOA 1I5RA 4Y2QA 3X1YA 1MW8X 2PS9A 1BVUA 5IXYA 4MNTA 1E5DA 4FYMA 2B6HA 4M0DA 2P9JA 2VPTA 1F3LA 4FLMA 3LHDA 4IM7A 4E14A 2EFHB 1JIJA 1DAHA 3VKUA 2C96A 4HO1X 3TPCA 3R8FA 1JMKC 5EXEA 1IMJA 4QOEA 2XCLA 2JDIA 2XMZA 3IUBA 3OFSA 2RBKA 5FYDA 4M9CA 2BFBB 2YYYA 4PPYA 1M67A 2J5QA 3CNLA 3PC6A 1P9WA 2Q2VA 3QF4A 2EF1A 2FN7A 3AR8A 5KQSA 4IGIA 5SZHB 2X41A 3ENKA 1RKVA 5HDQA 1BX0A 4B73A 2XDWA 3C6MA 4LJSA 4PGGA 3AETA 5G4KB 4JR2A 3N2NA 4EKNB 5BV7A 5LLTA 2VK2A 5AW7A 2GM9A 2BEVA 4EQ6B 3LVRE 5KO2A 1W0KA 1EM6A 3QBTA 1EQUA 4YV7A 5IEBA 1GRRA 3DDUA 2ZUSA 3HHEA 4GPZA 4J16C 5E7JA 1DQYA 1JKIA 1UWKA 3LL4A 3P2EA 1G4UR 2DJ5A 3LSTA 2RKWA 1ZH8A 3KQVA 3UB2A 2J3KA 5HM8A 1MFPA 1V8DA 1FDRA 2CY0A 4W7SA 3G2QA 3KJXA 1JPVA 1V1MA 4DF3A 2XNDD 3JTMA 3FZNA 4HFJA 3GZNA 2DFPA 1F6BA 1D4FA 1NP7A 1OT3A 2JBWA 1QYCA 1NXQA 3BTVA 3BYZA 4IDGA 2DC1A 4KDEA 4QVIA 3ZGNA 3ZVNA 4PIVA 3HCRA 1BHO1 1OGJA 1ORDA 1GNTA 4K9LA 3HU3A 1QR6A 3G9TA 4A8JC 3Q3EA 3NRJA 5L9AA 2AUTA 3MD9A 1RRGA 4HEA6 1RJEA 5JT1A 4WFKA 1BX1A 4MHOA 3LA6A 4JKYA 4OXQA 2BFDA 1L8QA 4G0QA 3NAQA 4RHEA 1G5HA 1COWA 1DJQA 4L74A 1OILA 4O0LA 5KDOA 3K9BA 1YC5A 5DGTA 5CB6A 3LNCA 4RVFA 1U8XX 3GROA 2C3OA 3OJXA 1WD7A 4KV9A 1S2OA 2BOVA 2DUNA 3GFOA 3OZCA 3L1KA 2EGUA 1DO0A 1Q11A 1TM4E 2C4WA 3DL7A 4B8WA 2GRUA 4BQRA 2ZQ5A 4MPDA 4C0SA 3IEUA 3TZKA 3FI9A 1W44A 4HWRA 3HCBA 4LE0A 5TNXA 2R8OA 3DR5A 4ZAZA 4Q1FA 4C43A 3RANA 5JE8A 1IJKA 1U4SA 5HTOA 4DDVA 4XQ0A 5DZSA 2FPXA 2PL3A 1YB4A 2OZKA 2GBCA 2IIQA 2XOKA 1LFDB 4HFRA 4XGKA 4Y0NA 4QTYA 3I4LA 1JR6A 3DH0A 4GIBA 1IEXA 4Q6BA 3T15A 4LSGA 1EDZA 5L4SA 2G5CA 1L1FA 4LBZA 4MOWA 1NSTA 1RXVA 3GCDA 3NH6A 4PFKA 4MWGA 2J8ZA 4UE6A 1DZIA 3TIIA 5BW6B 2B25A 1PJLA 4L0MA 3VTKA 2ZRBA 3W6ZA 1CIJA 4UUBA 2GD2A 5CLHA 1XZ8A 4PAQA 2IYYA 1Q19A 4I46A 4A10A 2AKEA 1QLWA 4DA8A 2C3YA 4J94A 1HRKA 3VR4H 1D8AA 1Q17A 2O20A 1I7QB 3TQOA 5JRDS 5IYZF 3THRA 2QSUA 3QU4A 2VEOA 3KJHA 4XQCA 1VOTA 5IT0A 2FN4A 3EW9A 2BE9A 4BEJA 4YUWA 4BNKA 2IWRA 3OQBA 4ND8B 2J67A 5CYPA 1CCWA 2G5PA 3BGSA 3TCKA 3E3AA 4EFMA 3STTA 2MMCA 4PZAA 4FHFA 1J42A 2GESA 2FPGB 4M55A 1DG1G 1IY8A 2VHXA 4K5QA 4EUKA 2C3PA 4UM8B 3WL3A 5AK0A 3WGVA 3NFRA 3KPUA 3JZIA 1DAIA 3O3NB 2F90A 5JRJA 1ONBA 1P39A 4XR4A 2A92A 1PYGA 4PCUA 2DWCA 1A5BB 1IXKA 1N2EA 3EZGA 1QDLB 2OKCA 5CIYA 4K81B 1V7CA 1OXBB 2XDQB 3N2EA 1YV9A 1UT8A 2PBLA 13PKA 2OCAA 3AW8A 3B1KA 1GUZA 3HL4A 2AOVA 4DPKA 3W4JA 4WXRA 1CJSA 1DLJA 1MG0A 4RUKA 2H00A 2DWOA 5M04A 4NR0A 2Z2IA 4C14A 3RU2A 2UZ4A 1QYRA 4TMWA 3F73A 2AMYA 5CEEA 2YR0A 5LN1A 1GRVA 1M3SA 1EHIA 1ZDMA 1F4VA 3CVJA 1YNOA 3KL4A 4FMCF 4E46A 3W5CA 4DC0A 1PD1A 4EA9A 3OE1A 4L5YA 3K1JA 3WBKA 2RGXA 2WF8A 6ADHA 1ABEA 1E1QD 1ATZA 1QB7A 1WMFA 4BGUA 3C6KA 3CHYA 1Z0JA 4O1HA 5FD8A 4MTCA 3MAAC 4JKIA 1VYUA 3SBEA 1UQUA 4MDHA 1JG2A 1NY5A 5I01A 2CGEA 1FP6A 1DSSG 2J07A 4R69A 3W04A 3WOHA 2OO7A 1AK1A 5A7GA 2HTEA 3H0CA 1CQIA 5AK6A 3JZDA 3DE5X 4ZREA 3AETB 1JT2A 3PS9A 2DFVA 4JI0B 3U17A 1EE9A 4J2HA 3BMNB 1RZVA 4LGVA 2CFOA 2R00C 2VKQA 1MC1A 4K88A 4UUMA 1MHPA 4TTAA 4PW0A 4DG5A 4LCJA 5TQ0A 5MN6A 4MROA 1E7SA 1HDXA 1VIYA 2Z8XA 4CTKA 5KOYA 2V1XA 3NLLA 3EPHA 1UDAA 2QIPA 3WAKA 2CZQA 3C5WP 2HI0A 1YQTA 5EUBA 4PG8A 1PV1A 5CPFA 1C9DB 2CXQA 2V8BA 1Z0DA 1N77A 2CJXA 4QGAA 4HUQA 3F8WA 4IL5A 4JC5A 1YQUA 3M83A 4M6WB 4R8SA 4CV3A 3JTEA 1QVVA 4H35A 4DDWA 5BPFA 5KQRA 5B2ZA 1P73A 3JR7A 4LUCA 5FPSA 1FRVA 1R88A 1SG0A 5HIIA 4ER6A 3KOYA 4EARA 3O47A 4HQNA 4QBTA 2NTJA 4G25A 1U9YA 1R6XA 3I6BA 2GZRA 3II6X 4JLVA 2XTAA 3B2NA 5AM1A 2UZ1B 1GA6A 2O1XA 3PU6A 3LKZA 4F3CA 5E2IA 2RK6A 2O8CB 2FX3A 3IKMB 3PX7A 1JMYA 3T52A 3KYDA 2PGDA 4O0MA 3FPKA 2PA0A 1QX3A 2CLSA 5T4BA 2BDUA 2FRDC 1WXHA 3OWXA 4FFMA 2QLBA 1EFVA 1SBTA 3EOBI 1UFVA 4WKNA 4BE4A 4UOZA 3GFSA 4GL4A 1AKNA 1X1SA 2P11A 2QXTA 1ENOA 1EUCB 5CBPA 1LBSA 3BA6A 4BO7A 1KFBB 3B9PA 3NXKA 1IM5A 2HMAA 3LPMA 4CL2A 3OZDA 3BGIA 4ZCTA 1ZAKA 3PC7A 1GR0A 1JTEA 1LFAA 1M0SA 4KGXA 1VJCA 4DLXA 2DFLA 3ZVRA 2YXPX 5LQRA 4JI8B 4FDTA 4G8BA 5E38A 1KFCB 2ONKA 4HDRA 1DPFA 1JLSA 1GWNA 4M9UA 4Q7EA 3IDZA 3FZYA 3KEQA 4DSOA 3EQ8A 3H2YA 2EBHX 2GKGA 3HP7A 4QA9A 3RADC 1HM5A 1UBLS 2WILA 1CJUC 1THMA 1LSJA 2HLDA 4YXFA 5J5CA 4A7PA 4CN9A 3G2PA 3BT7A 2C57A 2BE7A 3V7WA 3PQDA 4H3SA 5TV2A 3GY0A 4C6TB 2FDRA 2XVAA 3AHGA 2X0FA 2YHAA 4OHWA 5CX1A 3D59A 1Z4OA 3VSEA 4EMUA 1ZK2A 4Q9AA 4UEQA 2FZEA 4UU1A 1DX9A 2CFCA 1VIDA 4HRXA 4YRIA 1PAUA 4LK2A 3ZGLA 1XAHA 4JKOA 1BH6A 3OM1A 3K9LA 2JVIA 4BVBA 1MOSA 1YGYA 1ZVKA 5IJZA 1ZR4A 2YY6A 3HJUA 1GGEA 2GF2A 1FFWA 1ISSA 1RLUA 2GN9A 2VDJA 4Y9TA 4QDZA 3ZG6A 1IU9A 1JWLA 1A88A 2QRVB 3DOCA 2PUVA 4R71A 4PYJA 1NLMA 1HE8B 2II6A 1V11B 3TI9A 3K35A 2CXTA 5DFAA 4YAWA 1NGSA 4WOKA 4HNQA 3UV6A 3Q8KA 1YDFA 1TZMA 4C7OA 4S1PA 2BEJA 4B7XA 2IS6A 1AZWA 1VKNA 4M86A 3JR3A 3AZOA 4UBKA 1N5LA 1DWPA 1NJGA 3EWNA 5JAUA 5KNDD 1RPNA 1PVOA 3GJTA 4H0FA 1Z6QA 1KAHA 4QYWA 1JEAA 1DC8A 3DLIA 3TNLA 1QQTA 5M29A 5JQGF 1CP3A 1PRYA 1Z06A 2JCSA 3RODA 5L7TA 5B3JC 4V0NA 5T3YA 2CCKA 1T8SA 2JH8A 3I30X 3P52A 1DBSA 2X0IA 4UD2A 4YDQA 4CXMA 3OKCA 3KDAA 4AS1A 4NFSA 4BCBA 4GSKA 4RZQA 3CX6A 5TPWB 5DM1A 3NDPA 4R2IA 4LAFA 2BR4A 4G81A 1Z4MA 3PDJA 1E2FA 4IZOA 3V8VA 3C8UA 1TYBE 4P81A 4MV0A 1XWWA 3DLTA 3OPMA 1GAXA 2V58A 4RD1A 4NSNA 2J31A 4QU5A 4V03A 1J2EA 1RYBA 2ZUUA 1SBIA 2CVPA 2JIQA 4G84A 4AX4A 1DU4A 4EG6A 5JZSA 3W4IA 4ZI3A 5A4JA 2Y67A 4Q16A 3JVUA 1LGYA 1C3OB 3GN2A 2QX6A 3QHQA 4KLZA 4QXPA 1Z34A 2JFBA 4NNOA 1KU6A 3R6LA 2RI1A 4R41A 4FCCA 1O8BA 2X7JA 4J03A 1TQ6A 3W5DA 2XDYA 1H2FA 3AV0B 3OD1A 3DBOB 2WMDA 2ORIA 4LZNA 4QNRA 3RUEA 3ZDXB 4FKBA 3W2HA 2BEVB 3PDCA 1E3DA 4RMGA 4V38A 3LSYA 3SZUA 3M2TA 2E4UA 2YZKA 2JHPA 4NWIA 2ACEA 4B74A 2ILTA 4UUOA 1LRJA 3GB9A 3KZOA 2EL7A 1PQYA 3I52A 5IAOA 1DADA 5BORA 3QF4B 2HNAA 1JJIA 2OWDA 3I4CA 3Q9LA 4R51A 4KPUA 1EFLA 3NIDB 3EXFB 5ESDA 1NUHA 1CZHA 2NU6A 3TZ6A 1NVGA 3QPVA 3ZX4A 1FNNA 1E3QA 3QVJA 1Z63A 2Q2NA 1QO0A 5DV9A 4Q21A 5DYIA 3WLLA 1DQRA 4TVKA 4UAUA 3U48A 2J3EA 4E2YA 3QYAA 3HSSA 4WZZA 3OCYA 4IHJF 1QU2A 4O5OA 4LMBA 1VC2A 1UP7A 4PQRA 1E9AA 4J4BA 1NT4A 4YQEA 1BEZA 4PCVA 1HURA 3ZWYA 4NFLA 1BYIA 1ZA1A 3RHTA 4N3AA 1J2TA 1SU8A 4L7VA 4OHUA 3FWKA 1TUBB 5EQFA 5DYTA 1T9DA 2E48A 1STOA 1H3FA 2GZ1A 2JASA 3WTBA 4RK4A 2FP4A 1U8CB 3VKVA 5JHGB 3UC9A 2IXFA 4A26A 3A14A 3THYA 3I73A 2XE7A 2C9OA 2G9RA 3IBFA 2ZU6A 4ZEVA 5LQCA 2XJ4A 3F3YA 3DONA 2GN0A 4L6IA 5CA1A 2AN3A 4FI3F 4QUIA 3T1NA 5CCXA 2OBXA 3TBFA 3D8UA 2BHRA 3OFKA 4ZYWA 5BN3A 2BDEA 2ODBA 4RKYA 1L3IA 2QSJA 3DCJA 4YJ3F 4YMUA 4RPLA 3DZCA 1W5TA 2EF0A 2PMFA 1M6YA 3BE4A 3K7EA 1L5SA 4D98A 4JQSA 1AQ6A 3VR5D 4FEGA 2UU9B 3AB8A 3GIDA 4G5FA 3O9VA 1Z0KA 4WEOA 3UHOA 1A4XA 4B81A 1KO7A 2ZVDA 3L9WA 4ZK6A 5AVVA 1MHTA 4D26A 2CNLA 1V3UA 4U2DA 5AKHA 3JQ6A 3RQIA 3QQPA 1WAMA 1QNLA 4K0KB 1MP0A 2OBNA 1JEYB 1GL7A 2FY8A 3OCXA 2BI4A 2LKDA 1PR6A 1TXGA 4G24A 3LHSA 1UBRS 5AWFC 5BN5B 5KNLA 3PJGA 3REQA 4OGGA 4F72A 3RTEA 5CLJA 3TW4A 4G0PA 4JBHA 5KTNA 4UM7A 2XHZA 4MQMA 3X1ZA 2V9CA 5EHIA 5B6PA 2A1UA 3TZQA 3NTXA 3T7JA 4TKVA 2X86A 2D59A 1A2KC 1ORHA 2VNAA 4H7FA 4H7HA 2HUPA 2GF0A 1JIQA 3LJKA 1VPDA 4MYTA 4G0VA 4YFYA 5K6RA 1MQAA 5CX1B 2AQ8A 3D7MA 3P0IA 4LIPD 1BJKA 5EJFA 3ZDDA 4IV8A 2E3JA 1X38A 1QIIA 1ZRNA 1Y1RA 2B0JA 4K9KA 5IWCA 4MRAA 3RJTA 1DBIA 2OD9A 1R15A 1XEFA 2V5AA 2YMLA 4FOSA 2CT8A 3CUVA 4KXLA 5JSZA 2XRYA 5HCUA 1ZI6A 2HNKA 3PRYA 4Z53A 5BWBA 1MNQA 1BC5A 3ICEA 3EMDA 3QKTA 2SCUA 4BFXA 2ZSAA 4PG7A 1EP2B 4QAJA 4JU8A 2BMVA 5FB3A 4W5WA 1FUUA 2QW8A 1DJNA 4EYEA 4HH0A 5HS6A 1A9XA 1YI1A 1U8FO 4RVHA 3HJFA 2AI1A 3A2MA 4JOCA 5HHTA 2JAQA 3Q7QA 5EPEA 1HSOA 1YUNA 1WE2A 2ZYVX 4REOA 3B52X 1MOZA 4XLTA 4YLYA 5A1JA 4ACAA 2JAPA 4TXJA 3ZHVA 3DL4A 4F1WA 5K51A 5GY7A 3UMGA 4C03A 4GHWA 1UZAA 1WU8A 2YJ6A 1P77A 1HRDA 1DFHA 3QE2A 2E89A 1L3CA 3JVIA 2ZAMA 3DHVA 3EGXA 3NHJA 4LVOA 3NC1C 1D7OA 4FGWA 4F45A 5DP1A 3DWIA 2QSYA 3BIFA 4QPPA 2HGZA 4W7HA 4U8GA 3WL5A 2IYXA 3O3CA 4JJZA 4S0XA 1BSVA 1QZXA 3UW3A 3ZE8A 2CCJA 2QDKA 4B79A 5BWOA 1KY5A 3GCXA 4D8XA 4YP7A 2GN4A 1A8HA 1EIZA 2C4TA 5CT9A 3RYHA 3ZQJA 2AMJA 4PSDA 2ZCJA 3GLIA 2Y0DA 4MEAA 1L3BA 4HPWA 3GLIE 2Z4TA 1ONPA 3FYUB 4JJ6A 2FN9A 4POAA 5EE3A 2IF0A 1JQDA 5HF6A 2Z8ZA 1F51E 2V7XA 4QPCA 3PGKA 3ZWVA 4YV2A 3T34A 1E5VA 1TPYA 3KVOA 3NEJA 2Z3VA 2GCGA 1SUAA 3NEAA 3QX3A 3KKKA 2BSXA 5J4VA 1Z7YA 2JATA 4LE2A 1XELA 4OA5A 1KMCA 2PGAA 3BK1A 1U7TA 4NZPA 1C14A 4Q4AB 3IL2A 1UXIA 2QVYX 4DJEC 4KNWA 2ZJ6A 2Q3EA 3T3PB 2CHGA 1DTWA 3LLVA 3K9GA 4WDRA 5J2UF 3WRYC 5EP3A 3LVQE 1H2EA 4UM5A 3L8GA 4LY3A 3R20A 3T9FA 1KK2A 4NS4A 3HM2A 3TSAA 5JYDA 2Z9DA 4HXGA 3V4OA 5IVDA 1FNBA 4AMBA 1G5IA 3C1AA 3RSGA 4LWZA 4DLYA 1QVAA 1GDDA 3IO3A 1MTZA 3IAEA 4NCHA 3GVCA 5H81A 2FE1A 1QV7A 3AK4A 1O57A 4N40A 3OMLA 4JEIA 4WZBE 1WY7A 3QTBA 3UTDA 4UD6A 1UEIA 1ONOA 1WV0A 3QVVA 3TRKA 2OHVA 1FDSA 2C2OA 4KAJA 1NN1A 3RVQA 3EXIB 2LD4A 4IKPA 2X9GA 4X0EA 4KYUA 3QOFA 4K3UA 2G67A 4XD2A 3MT7A 1I2CA 4FBMA 4MVJI 2DGDA 4CCSA 4ZO4A 5F1OA 3TD6A 1F06A 3LRPA 1EMDA 4Q3CA 3DD1A 1Y1TA 3QKWA 1A1VA 3PPYA 2AFHB 4PGAA 4TS3A 5FCDA 4X54A 5DISB 1RXEA 2E9SA 1IBLB 2BFCA 4A4DA 1RMQA 2HWUA 3L43A 4PIMA 5BR8B 5LZ9A 4N48A 5JCJA 1D1PA 3DAPA 3DJYA 3T3GA 4HNTA 3LF1A 4MS4B 4BN0A 1HYQA 1K9SA 1UEXC 1Q14A 2VUIB 3MCAA 3B1XA 3AEYA 4GPTA 3WE7A 3R40A 3U19A 2D3TA 2NN3C 3H6HA 2WSBA 5JQGA 3QXHA 1Q0PA 3KEFA 1KPHA 2NSLA 4B8ZA 4KWEA 1QRUA 2GZHA 1A9RA 3HDYA 4XB2A 3TRFA 1H6CA 1KR5A 4H6WA 1JIKA 3FIJA 5JZOA 1Z7WA 4KQ6A 3D6VA 3I64A 3UJCA 1KJNA 2A5DA 1BNCA 1LJLA 2ZZKA 3N0VA 2ZDQA 3GMSA 1XMXA 3H05A 1WJGA 1XZFA 4JJ8A 2FEAA 3W2FA 2GAOA 1EUDA 5DVZA 1P6UA 4IJVA 1GAWA 1MD9A 1IZYA 3TZHA 4WKOA 1XXHA 1DBQA 2JI7A 3CUKA 3KYJB 1AOXA 3HKEB 4O4LB 2AL7A 3EXHA 3KKOA 5J4YA 4BNWA 1DZ3A 1YDMA 3IPXA 4IIFA 5KYXA 4G63A 3TW8A 1TOAA 4UCXA 1RKUA 4JD5A 4JJIA 1T9AA 1NR7A 1QTRA 1VZ3A 2D5CA 3NIBA 2QP9X 1OSNA 3QFRA 4Y9DA 3WSTA 4CG0A 2VHZA 3DMYA 4NBUA 4U2BA 2CLKB 4R0NA 4KRFA 1T5OA 1UJBA 2XUFA 1JUDA 3Q85A 4KFCA 2B82A 1T24A 1QQ6A 1U9JA 5CM2Z 3TQIA 3NWBA 3U44B 1NQXA 1ZW1A 2EW8A 5EKSA 4A91A 1U3UA 1X1BA 2Q7OE 1EEHA 5ITVA 2ZJ4A 1E79D 1I80A 5BSWA 3AHHA 3CZ4A 2O7VA 3GLKA 5HUJA 4XSHA 2P40A 3PXUA 1WX1A 4HQRA 2A78A 4PHCA 1FP4A 3EFEA 1O6BA 2RSLA 2FPMA 5ALVA 2VPIA 4I50B 1MJGM 1F1JA 1HPLA 2R7MA 3E84A 3TUJC 1HE3A 3ZHZA 5DM70 5IVKA 4J1SA 4QUDA 3OY2A 4MV6A 3KCNA 1XV5A 4MKZA 5I47A 3SPXA 3Q72A 2K2WA 3QG5A 1QJ4A 5L3ZA 3VKGA 2J0QA 3UCEA 1ZU5A 4Q3AA 3SAJA 3SE7A 1ZISA 3P45A 3ZNOA 2NSDA 4BX9A 1VL0A 1R3UA 5FR2A 4MUBA 2XXAB 3GGGA 3O1JC 2PFSA 1WDMA 1ZNXA 2Y1FA 1T2FA 4YRRA 4N4AA 2YCLA 2TECE 4LOHA 2HDHA 3RUFA 1CRZA 4MR9B 1HSZA 1PX2A 5TPWA 1FB5A 2ZBRA 1FUKA 2JGDB 3NALA 3V1NA 5DIFA 1VCHA 2EWVA 3RRNA 2F8LA 5HE9A 5C32A 1HNZB 3QXCA 5EYPA 1SRQA 2Y4NA 3I45A 3LZ6A 3CRQA 3D2BA 4DG9A 4M0CA 4ZJUA 1LDGA 2G17A 1I0IA 2Y93A 2ZETA 2GEUA 3CB4A 1USIA 4PAMA 3BHJA 1KE1A 3WFZA 1WB4A 3OHPA 3LPNA 1M0EA 4G4JA 5SYMA 3UXMA 4LDNA 2J0EA 3EUAA 5DBHX 4ZJPA 3G13A 1OWLA 4NPAA 4RSRA 5IM4A 1M1YA 2R751 3H8VA 5BSGA 1J5EB 4OVKA 1NLFA 1KQOA 1C3JA 4WDQA 1R66A 4KDFA 4RU1A 4PC2A 1C1XB 1RAFA 4CT0A 1WF3A 5THQA 3VYUB 4BNIA 4YJHA 4FZ5A 1DXYA 5B6IA 2F55A 4MTLA 1RM3A 2FEPA 1HT0A 2YMPA 3P0JA 3WADA 4Z9FA 4L8LA 3SWWA 4OX9B 5JJKA 2PRSA 2JLWA 2BDTA 2VZEA 2Z5GA 3DE1X 1B76A 2CLOB 2VH5R 1JR4A 4J4TA 2CKDA 2HSZA 1N7JA 2H8GA 1ZJ6A 4R5MA 2ZQZA 5FHRA 2WJWA 2OGZA 3O21A 4PXSA 2ZCVA 1JECA 4MAMA 3HJGA 1T0JB 3UH1A 4P08A 4A0GA 1EFAA 2R8EA 2BGIA 2OESA 2QJOA 4LVCA 1PJQA 2PR7A 4G01B 3CYFA 4PC6A 1V8BA 1X39A 2RHDA 3ENNA 4EPWA 5HGXA 4ALMA 5LZ5A 1Y5NA 1KRXA 2IUUA 5LWQA 1OPXA 2XW6A 1RP1A 4F12A 1FFHA 1WXDA 4QOSA 2VBFA 3GP3A 1HYEA 4RDHA 3EWIA 3Q87B 1LF0A 3PKZA 4TLBA 5AHXA 1WCYA 5EKTA 3EXIA 2EZ9A 3R5KA 1DEHA 2P9HA 1VMDA 3BFVA 3GGOA 4YRFA 5H4GA 1CR6A 1WVMA 1BQ4A 2QD4A 2BV3A 3IEPA 1NUAA 4H15A 3EOAI 1XTKA 2BBSA 1M34B 2A5JA 2XTMA 3MUFA 4R3NA 1C5KA 1A9YA 3C5CA 4MUGA 3BDAA 3LBHA 4ALNA 5DM2A 3PA8A 1SKQA 3N75A 2NU6B 3PEFA 1DIAA 3P9IA 1WUHS 2AC2A 3JWGA 4QDKA 1M8KA 2P3OA 2LV8A 5CVJA 1XHLA 1D8TA 3KG2A 1OAOC 4ZYZA 4PQGA 5C51B 3WHPA 1NDUA 1Z0UA 2JCGA 3DQPA 3FFBA 4O8CA 5DGDA 2Z1DA 3KQSA 1ML3A 5IKXA 3JQFA 3IPRA 2G36A 1XRLA 4MKFA 1P0FA 3MRSA 5I3CA 3GC6A 3N0TA 5B12A 3TTYA 4B71A 3IJ5A 5KAMA 3GAMA 3ZNPA 2LNDA 1XQWA 2YMQA 1F6DA 2I99A 3ROXA 5IT5A 1SN7A 1XGKA 2Q45A 3P9SA 5EZ6B 4AAYA 3E9RA 3L93A 4DMGA 3OPYA 1G8FA 2WIGA 2X4IA 3FVQA 3O95A 1LSUA 4QFBA 3R7BA 2ES4A 3KK0A 3UGQA 4A15A 1E7QA 4N5HX 4TMXA 5HGJA 2W5UA 2VYND 2GS9A 1RAIA 4K6GA 5ABPA 3EZ7A 3KOOA 2P3LA 3K15A 2YWJA 1D0SA 3EMKA 2ZG6A 1XRNA 4QXOA 5DXJA 1NUUA 4YGYA 1QHNA 5CMLA 1X3LA 2GPTA 1ADGA 4I7EA 1XXHB 2E0IA 2IX9A 4LDPA 4MCAA 1FX0A 3EXHB 4HWOA 2NTNA 3C24A 3N8KA 3D31A 2V65A 4DC1A 3Q2KA 3FSEA 4RHUA 4UZEA 3GUYA 1F9EA 2PGLA 3ADPA 2KSQA 1EGHA 1DO2A 2C8KA 1ST2A 3FA2A 4XD7A 4ZT3A 2CE7A 3ET4A 4FZ3A 1BGXT 4MRNA 3R5TA 4YDHB 5J4KA 1ZGGA 4OPMA 1M73E 5EJ9A 4KL8S 1JEYA 1VMEA 1J0DA 1RFGE 2AOUA 4GI1A 2ZB2A 4X8HA 3R76A 4CKEB 4DBLE 4NENA 3T12A 3DKVA 1UH5A 2Z6QA 2QVCA 2WJPA 4RD4A 3SGLA 2MYTA 4DMMA 4ACBA 5BR1A 3BFJA 2JK1A 3WIBA 1G2PA 3DFKA 2FPSA 3AFMA 3GLSA 4X24A 5BW5A 1RZRA 1KJQA 2OHFA 2R0QC 2BIFA 3I5XA 3PWKA 2AXNA 2OO3A 3CUEF 3HUUA 3Q6IA 3G9QA 5GONB 1NX6A 3RS3A 3WKBA 3AF0A 5KZMB 4Q1VA 1PT5A 1JA1A 1SUSA 4I50A 5H3CA 1QCYA 5A3RA 5JNWA 4LDQA 4C5CA 1UBCA 1H93A 2QMEA 1XKQA 4G0XA 2Q29A 5C8YA 1XD9A 3CGGA 3QKUA 1C0LA 2JJ2A 2ODNA 3L1JA 4JIMA 4HDAA 4NRDA 3UMCA 4KH0A 3UG6A 1LWNA 1SCNE 1UIMA 1JEQA 4P6VF 5CK5A 1PNQA 8ATCA 2VWHA 1P17A 1T2CA 1YZYA 2WP8J 5G02A 1E1KA 1BQEA 1W25A 4U6SA 3DZFA 2OBLA 3R5SA 4EG0A 2J48A 3AHDA 3FSJX 4P7BA 4B75A 3LX8A 3N86A 4MITA 4YRAA 5C1IA 1N5RA 2WSLA 4ESEA 1FUIA 2FW0A 3UAWA 1LJUA 3RYHB 3T7AA 4B87A 1MRZA 1RHQA 1JAIA 1QGAA 1W4LA 1TW3A 3OQMA 1C7JA 2C95A 3GUHA 2WSIA 3C45A 1QZ3A 2A0KA 1IHUA 1QJCA 1A3CA 2RI0A 3RVDA 1SIOA 2B2CA 4JQZA 4B7UA 1Z2AA 2Z6VA 1HX7A 2VNIA 2Z8YM 3V8EA 2IS2A 3P0HA 5EPOA 1IULA 1M1YB 2V5VA 3BXEA 3RK0A 3SSOA 2H2AA 3F9IA 4FDVA 1G6Q1 3WK5A 2FETA 5EWLB 1II8A 3EEFA 2SBTA 1PFKA 1REQB 1DAGA 1XKXA 1ECCA 4P84A 4MKRA 4GXRA 3T3DA 2AKAB 2B4QA 4C78A 3W9UA 3DA8A 1ZHOA 5LNK6 2ZJ5A 1NONA 4GMFA 2CVZA 2V7QA 3O90A 4D4KA 3NHUA 1P33A 5LQDA 1JU3A 1OH5A 3PQFA 4OXXA 4XCQA 1AQLA 1IDOA 3FMPB 3NBZC 3VPCA 1XZHA 4KTVE 3RYFB 4NYMR 1O5TA 4OLFA 3CLRC 4HWKA 4Z3OA 1VIVA 1UC9A 1X7XA 2SHKA 3UUWA 1H0SA 2H1LA 2VSXA 1QHEA 4BAGA 1TKCA 1Y7LA 2WHPA 1N6IA 2V7TA 1L5QA 3PCRB 4LXQA 4R68A 2MHCA 4WECA 4IAOA 4Q4AA 1ZXBA 5BVGA 1YQ9A 2B6NA 4Z2YA 3PB3A 2YASA 2B92A 2QTZA 4YLEA 1GQ2A 4P4SA 4YO8A 1VQ1A 5I5GA 3W8RA 2CLDX 5FWYA 2YL2A 4K9OA 4BVLA 4MB6A 3D7NA 1NBMD 1NI5A 3I2KA 2EFJA 4G1EB 3PT5A 4IH1A 4EO9A 4G09A 2ZKLA 4GPIB 4G5OA 4Q37A 3HN7A 3UOWA 1N2HA 3FKSA 4QZVA 1CZLA 1O5OA 2AXQA 4FGKA 4Z4IA 1VGVA 3GJ3A 1TJ4A 1K2VN 1T6XA 2GYVA 10MHA 4YAGA 1XZBA 1HGXA 2CJYA 4YVFA 1F1BA 4B46A 5DM4A 5B30A 1XHEA 1ZG3A 4L78A 3U81A 4MWEA 3K9WA 3ZGVA 2PS3A 3BE8A 3PYMA 5DGXA 3U62A 4PYMA 2RAPA 1Y6JA 3Q1KA 1LB1B 4CFZA 3RH0A 1TNDA 2QOEA 2Y27A 1IXZA 2ZBFA 4PPQA 2UKDA 3TQTA 2HUNA 4UU8A 2FRVA 4FJ0A 2BTQA 1LDYA 2V3WA 1R12A 4RF4A 3SYNA 4N01A 3ZGOA 3KCQA 3R3WA 4PGMA 5K3FB 3AI7A 4R2KA 1SR8A 4LY9A 1OHHA 1RI4A 3BWMA 4INZA 3NYIA 3R0QA 2PKWA 4DCPA 1FRNA 4XUGB 3EGVA 3ICWA 2D13A 3K72B 4FKZA 4NABA 4PVCA 3U26A 3FZQA 3SHVA 4BNNA 3VHLB 4RLQA 5IDQA 2GTPA 3Q0IA 2BGWA 1M1ZA 1V6AA 3C14C 3M8KA 4I6EA 4CTMA 4II7A 3RRMA 2J85A 3R7DA 3H86A 5KYXB 4GMXA 2OENG 1SOMA 1PJCA 1EX6A 2X8LA 4Z49A 2AF4C 2NO0A 4X65B 3PPVA 1TM1E 1YRBA 2ZW9A 4UPDA 2BT4A 2YVQA 4LJAA 3VSBA 3OJFA 4JR0A 5A9SB 1PHPA 4L5CA 1DJOA 4OFBA 4G5RA 3MJEA 2ZPUA 4IOJA 2EU8A 4X1YA 2VATA 5SZKB 3SOPA 2QEQA 3GZ4A 3L7KA 3EBPA 1C0EA 5ALGA 1OI7A 1OXSC 1UAYA 2IOFA 2X0NA 3IFSA 4O4LA 4ODIA 5EKDA 4YPFA 3V7UA 1EG7A 2OXFA 2Q3LA 5EERA 1HKUA 1W2GA 1WULS 4CKBA 3U9LA 5L3QB 3IUMA 5M34A 1WHSA 4BFSA 4S05A 3GLRA 3PIRA 5E7MA 4GMKA 4HLNA 1WV1A 1HH4A 2WUFA 2FHSA 4HQLA 4TXNA 4Y7CA 3QW2A 2MCFA 4DT1B 3AVYA 3IOEA 4JBLA 1QP0A 4MYDA 3FR7A 3GO4A 4OI4A 3JWJA 2JJ1D 4F4HA 4PM4A 4MW1A 2NO5A 3V4SA 1V47A 1CP2A 4AC9A 3I28A 3LA8A 3LS2A 5IHPA 2NU9B 1B8NA 2B94A 5EN4A 1X1DA 2RGUA 5IJ0B 2R85A 3MHPA 1O0SA 3IMFA 3ESDA 2CJWB 2JD2A 1NNEA 4KREA 2NPFA 2OCLA 3HRHA 3IR6A 4LYJA 1Q1EA 2Q46A 3AGQA 4ZPXA 3U0BA 3AI2A 3ZUGA 1JPNA 1ZXXA 1A9SA 1JYFA 3LRXA 3WL6A 3K96A 2H0QA 4MUXA 4N5MA 5AXBA 3PEYA 3CXUA 1Z39A 4JC8A 3G5LA 1SQ6A 4R2MA 5AUOB 2H2IA 3THSA 5JJBA 4BO8A 2YJ5A 3WV5A 4KE9A 4GOND 3N74A 1BKSB 3DYVA 1FTNA 1VLHA 2NUAA 2NGRA 3EXEB 3FKSD 3M81A 3LD9A 4JLDA 1H4QA 1SKMA 1K5DA 1F17A 3NBKA 2BUCA 1VA4A 2HJVA 2HMWA 2DPGA 2B0CA 2FKNA 2E4ZA 1A8UA 2QLMA 3UQZA 5I9MA 2CMGA 3OSZA 4A2QA 2JGDA 4EB0A 3SCZA 1NR1A 1UDBA 2J3DA 1T26A 3L6DA 1YJ8A 3B1WA 1ABBA 3KQLA 4YRBA 2PKYX 4HATA 4L6AA 1YB7A 5IK2D 2XMSA 4WY2A 4OSOA 1TTPB 1R5NA 3AIIA 1EE1A 1NU6A 2WKWA 2CUKA 2JFQA 2PT7A 4NE7A 5JNLA 3AJ9A 3UK6A 2F3QA 3SJBA 3BCSA 1KBOA 3PGMA 4OH7A 4ZVTA 4B4UA 3IQFA 4Z6KA 2W83A 4Q3LA 1TKBA 4FOTA 3KKPA 2Y0EA 4EX6A 1CJCA 2XKAA 4PBSA 5AVTA 4QBIA 7ADHA 5IVHA 4G4SP 1TEHA 2GPAA 3GP8A 4A0RA 2P30A 1CUXA 3QWHA 4RGYA 1GR1A 4EPVA 4X94A 1RHMA 4YCJA 3BTUA 2FR8C 1TMGE 3DEZA 4JYAB 1G8MA 1NOIA 3KXLA 4DJFC 1JKJA 4F60A 1WZ2A 1U1DA 5JNRA 2DQKA 4OJQA 4MQEA 2B8NA 3LX4A 1NJ2A 3AU9A 4UE2A 1U2SA 1MEOA 2XAAA 5HKBA 5A3QA 3ECCA 4PEVA 3BORA 3QUSA 1K7XB 2AX3A 2WK1A 2Q9UA 2QRZA 4PR3A 5CPBA 2YJNA 5BRNA 1D2EA 1Z35A 2IDKA 3JWHA 4YTEA 5ADVA 4CEHB 2ZZMA 1Q2XA 5TQ0B 3EMVA 3TRIA 4ZVRA 1FTWA 3O7WA 5ED0A 1VHQA 5FT9A 1E3JA 3PZBA 3ZHTA 3C3WA 4ENRA 3DV9A 4XTCS 3DAOA 1P4GA 3IBGA 3FDXA 1RWVA 4YUZA 2FCRA 4GRDA 4R54A 4DREA 4QUJA 4J0KA 4JH0A 4ARIA 1YZHA 4P83A 1XDDA 3WFIA 2D2EA 1SC1A 1BFDA 4HF7A 1I4LD 1KQPA 3OA2A 3OOEA 4LYHA 1L7MA 3SHFA 1M33A 3GFGA 1JU4A 1R9NA 1TTTA 4FS3A 3A6DA 4D6XA 3OA0A 3EAGA 2GB4A 2O9JA 1WQ4A 1M34A 3P0EA 3Q2OA 2IZ1A 4O2RA 4Y2JA 3JALB 4B31A 3CBGA 2VRBA 1D1SA 1FC0A 1N8TA 1UKYA 4OBBA 3KHTA 5DTQA 1BVYF 2HF7A 1YBVA 1AS0A 1SIUA 3QFTA 3EISA 1EXVA 4JHXA 2RHLA 2V59A 1UBFA 4JLWA 1YFKA 5HG0A 2FRXA 2FW7A 2I2WA 4CKWB 4EHAA 1XMSA 2QJRA 1XQVA 2WKPA 1RU3A 2WAMA 4I55A 1FFXA 2A0WA 3OQ1A 1Z08A 2UZAA 3H2JA 3IOBA 5BMVA 1YJCA 1PV2A 2C61A 3D0RA 3STVA 2QLLA 1EUCA 3HY3A 4FFBB 4QE3A 2FJPA 5CBPB 5INTA 2UUCB 1GL6A 2ZBEA 3UICA 2V6GA 4TSKA 3KHUA 2AR7A 1U2QA 4EF5A 3VU1A 3HCFA 5A71A 3PWZA 3IEVA 5F5LA 1VG8A 1YAHA 2DHDA 2GXAA 1KXJA 1KS9A 2P9BA 1OXMA 2AYXA 3E05A 3K32A 4I1UA 5GM1A 1XXLA 4OI2A 5DBGA 2XKKA 2HV9A 1E4EB 1NQAO 2C29D 4MGEA 3SHQA 4HYQA 1L5WA 4OREX 4GECA 2ZIWB 3TMAA 2R60A 2WDZA 3HCNA 1EZ4A 1KWGA 4R2WA 3ZDQA 5CYGA 2AEEA 4C6TA 2DKOA 4H1HA 3MXTA 1J0AA 2IVFA 3WGMA 1ZRHA 2QNIA 4MP3A 1W5EA 2F64A 4RTKA 2O3TA 3ASVA 5CM8B 3UB3A 3E1KA 4C0LA 2RGAA 4CVNA 5HZHA 3JQ9C 1MDFA 5A9TA 4UBLA 5SY6A 3WDLA 1U2PA 5BT8A 5JVDA 1O6GA 5C52B 4EFKA 2HQSA 3GOQA 3GNTA 3SEQA 2OFPA 4BDTA 3ZWAA 5JY1A 3NHRA 1ZOLA 3Q11A 1SXHA 3ZKWA 3PR3A 1Q50A 3AR6A 1V7ZA 3F78A 1T1SA 4J43A 4AZ0B 4DJDC 3AFIA 3EGOA 5LP1A 4Q1CA 3NTRA 4LHEA 2EFDB 4C4AA 2IEZA 1FU8A 1DIBA 3E1SA 3LUBA 1THGA 1AKQA 1Z6ZA 2Q50A 2ZVQX 4NZZA 2FPPB 4PRZA 3I1JA 4JOQA 4BLUA 3BH7A 3WK9A 3BB3A 2YNMA 3TJRA 2ZR9A 1V39A 4BC0A 3AX6A 2HA4A 3ACBA 2CKMA 1N9ZA 4HDKB 3MIZA 2GN6A 5K8TA 1WU7A 4RPJA 4MWCA 4NYMQ 4GKJB 4R1SA 2J33A 3PDHA 4U8HA 5HF9A 4J2OA 4MWOA 5GADl 2PWPA 3OX4A 1R5BA 3L0SA 4EAAA 2PJRA 1LD3A 3HVIA 3RARA 4E32A 1YMVA 2QWXA 2YQ4A 4M99A 2V4MA 4REMA 2OV8A 2EXXA 3ZW9A 2XVZA 2LUOA 3MFQA 4L16A 4Q6WA 2X4GA 1HDRA 1I4DD 3CV3A 3F5MA 1XYYA 3FPFA 1JDVA 4Q3KA 4JXKA 4PICA 4K9NA 1QIJA 4JB3A 3ROZA 1MJHA 4Y2PA 4MK4A 3TDMA 3FKJA 1ZH4A 3TKYA 3VKWA 3K0CC 4J0HA 3T5TA 3TNJA 4DXAA 5F3WB 3UIEA 3AC0A 3U6BA 2B3DA 3ABRB 3BE6A 4BMYA 4JJEA 4RY2A 1PR1A 1QS0A 2VAVA 3UF0A 4LCBA 1OMOA 1RE1A 4G1BA 2R1TB 2YN0A 1UM9B 1MPTA 3LGXA 3PWSA 3ORQA 1ZGAA 1ZHHA 1DFGA 4F2GA 1LDMA 4ILEA 4HNRA 2O1WA 1M7BA 4ZCRA 4PX9A 5FWYB 2A7QA 2HK6A 1RQRA 4ZAWA 1U2DA 1UMDA 2R6HA 2OZLA 3GLHA 4R2LA 4ZAVA 1HMPA 3A4VA 4L9SA 1BMTA 1S2IA 5MGBA 4B9EA 7REQA 4NH0A 1K5PA 2VWGA 3TX2A 3WGYA 3UG7A 2K6GA 2D5BA 4MS3B 1O89A 1SBHA 4RORA 3IUQA 3ROEA 4CYMA 1APBA 4JEUA 4M1EA 5FI0B 1OBFO 1Y8QA 2A5FA 3OD5A 4GX0A 2GVNA 4LMPA 3RYFA 1V9LA 4ZMRA 3GGPA 1VFPA 2VTBB 3BXXA 3O4HA 2EW2A 3WGIA 1P91A 3BEOA 2AD5A 1NX9A 1E99A 3H84A 4KPUB 4Y2YA 3UA3A 3WRXA 3DW3X 2F4NA 4ZC1A 4F9TA 5BVGB 2FMUA 4WPGA 5EGSA 1IMOA 4FR5A 4XQEA 3FPEA 2G9UA 5DXAA 3MB5A 5CFZA 3E7XA 1FW6A 1PF7E 1JJBA 3TECE 3I83A 4OYLA 1IUOA 1EFRA 3KEMA 4HK4A 3B8EA 1CQJB 1QNFA 2H2FA 1Z12A 3SZMA 3B1ZA 4I1PA 1Z5ZA 4BMCA 5DTEA 3H11A 1LRKA 4GS5A 3FUTA 3ILVA 1BW9B 5C3UA 1WETA 4CKCA 2WAOA 3FPJA 1QBGA 3GVHA 1N0WA 3I0NA 4FMDB 1W85A 2BELA 3T1VA 4BQQA 2YWEA 3CM0A 4DBVO 4TTIA 4DYDA 1GPUA 3JVEA 5AIAA 5DE3A 5DT9A 1SVLA 1ZGBA 4AKEA 3RTAA 4D4MA 4O6VA 1GIAA 1R4NB 4Z7QB 3P19A 4DA0A 1O97D 3DLCA 3Q4GA 4EITA 2ICAA 4R05A 2EWWA 7MDHA 4L4ZA 3ABIA 4F91B 2QE6A 4YXWA 2H29A 3WMRA 3REFA 5BN3B 2O3RA 2ZWOA 2J3HA 4PTZA 3KZXA 3O8OB 2BFNA 3K4PA 2IUTA 4PGHA 1M6VB 4O1MA 2DR0A 1E2UA 3PI6A 4WW0A 4L8VA 2B4RO 1GUDA 3LY9A 4AY5A 4C05A 1FFXB 1Y5MA 4ECEA 2ZRPA 3UW1A 1O54A 3AESA 2KPOA 3NRCA 4ASUD 4US2R 1EVKA 3KQYA 5CFOA 1IK4A 1ZOPA 4B3IA 2XYGA 5LQJA 2AZDA 2F3PA 2HWWA 4R8RA 3S8YA 1KP9A 1YZNA 5HF8A 4DTCA 1LTHR 3RE1A 2GFQA 4CQNA 4KIWA 3GU3A 4FCTA 2BGKA 4HLUA 3RC9A 4BKOA 4R1NA 2VJAA 5ALRA 5IT9A 1NHGA 3EGWA 3H1PA 1EFDN 3IBYA 3QBDA 4DUZB 4MP6A 2G7MC 1PEYA 3TOXA 4DJ5X 2O3QA 3F4KA 2Q5EA 1PUIA 3F9CA 2QTBA 3QQ5A 3AOEC 1G9TA 3HCPA 3QNMA 5EQTA 1F5NA 1FYXA 1PP4A 1MC8A 2QY6A 4JJ4A 5KYTA 4HTFA 4I1IA 3RKSA 3MN1A 2WRZA 3V42A 2YVAA 3HG7A 4E5UA 3PYLA 3BXPA 3ICCA 2IBTA 4CUZA 1QVRA 4BE9A 2ZRGA 5K6AA 1S4QA 5GZ6A 3K5HA 4H6VA 3FOAA 1MJNA 3OAAA 2ANBA 4JQOA 5TGTA 5LMZA 1X7GA 4KCGA 1R16A 1Y9EA 2FRDA 3UT5B 3VO8A 2E4WA 1L4NA 2Q41A 4DR4B 3WNCA 5KNBA 1R0YA 2JI9A 3W1EA 2WKSA 5L3QA 4ND3A 4PBRA 2R1VA 4RAQA 5IWAB 4G1FA 4MHTA 2ORYA 3F8TA 1PR9A 3HDVA 4KI0A 2FVXA 3HJTA 2VK8A 4NV0A 5COAA 1YJAA 2W6JD 2ZUVA 3IMGA 4G4GA 3U56A 2VN8A 2XCUA 3X3HA 3PFKA 4XIJA 4OP3A 3L6EA 2LCIA 2QR2A 3RHSA 3VR6H 5I7RA 3AR3A 3SDZA 1EFTA 3OFND 1L5ZA 1OIXA 3N5KA 1CNEA 1I01A 4WUVA 2PH5A 1G3UA 4D2IA 1JQ5A 3UJHA 2NU9A 2BPOA 2DFNA 1YS6A 1LZLA 1A97A 2DX7A 3IMCA 3G2MA 1EP3B 2PSJA 1IY1A 5IMBA 1N6OA 1DCTA 4KC0A 1YZQA 5HTKA 1JQBA 1KNXA 3EUEA 5F1PA 4TZ6A 1GG5A 5JI2E 2P5TB 2QGNA 3EE6A 2C31A 2HA6A 4KKVA 4B45A 4MLPA 2W37A 3PBKA 4TWIA 5K4GA 4HQOA 3ZIAD 4D3YA 1BS9A 3ENWA 3ILXA 3GUVA 4INPA 4KACA 5T6BA 1CUVA 2OG2A 7MHTA 3R74A 1YQDA 5I7HA 4E15A 1JHDA 3IULA 1KSHA 4KZPA 1D6NA 3GLIB 4E7PA 2JG3A 1B1AA 1NW5A 1SBCA 3D1JA 1XF9A 3M6FA 4OQXA 1U0GA 3M5PA 4LOKA 2G77B 1YRWA 3PPIA 1ZNZA 3SVZA 3A11A 3WHKA 1CT9A 5I7OA 2V6IA 5KVSA 1E92A 2PHZA 2XWBF 4WX2B 3ZNQA 3QNUA 3VPBA 1Z2EA 5TVGA 2W11A 4XPIB 2YWFA 4JXJA 5CIWA 2Z98A 3HV0A 1GPKA 4ZMBA 4BKPA 4LOLA 4TLAA 2AIRA 2P0YA 3AOEA 3FDZB 1LPPA 2I2FA 4YJGA 3AF2A 2EDCA 1EVEA 1IN8A 1XFDA 5IASA 1Z33A 2OYCA 3PRKE 2HJSA 3HEAA 1N1EA 1WBBA 1JDZA 3PQCA 4MS3A 4XUEA 2EARA 3EZFA 3KZVA 1QPBA 1BOFA 5F1KA 5C34B 5LUBA 5J23A 3V2IA 3ELUA 4W9NA 3M6LA 3SDBA 1XVUA 4P35A 4IDEA 5AI6A 3VDMA 4PZYA 4DLAA 4E5PA 1BMDA 3DBRA 4AURA 4GZLA 1FDWA 1I5OA 4GPD1 3RS0A 4LWOA 4C4TA 1E6UA 2I03A 4U7WA 3VNQA 2DETA 3DUFB 1FDVA 1I6KA 1GFWA 3ONNA 2ETVA 1HFWA 2YZGA 4XX1A 5LWHA 2BEUA 2E1RA 4E12A 1YA8A 2NT3A 1D2NA 4XIIA 1NRIA 1UXKA 5AJTA 1UJ6A 3TIVA 3W2GA 4DL9A 2AFHE 2HWKA 3R3JA 4XIGS 3PE6A 3COSA 3DZDA 4MV5A 4D9FA 1KJ8A 3JZAA 3MJSA 3RS9A 3SS7X 2QG6A 4MW5A 5EE9A 2AWNA 4HCJA 4B3JA 4DM3A 3Q8MA 5F98A 4M53A 4IJWA 3O82A 3JQAD 2VSNA 2HOQA 2OECA 4PGFA 5HDBB 1T10A 3CTMA 4BRUA 2R5NA 3PA6A 1A96A 1ESZA 2AEJA 3OWOA 4X85A 3Q2IA 2LVBA 5ADWA 2B2XA 3W9YA 1RC8A 2AJDA 2VKTA 3OT1A 1Y5LA 1FTSA 1H23A 1LI4A 3DZ8A 4IYJA 4M36A 1YL5A 4MJXA 5D3MA 4NXMB 4HDOB 1I7LA 4RNDB 3GGSA 3TW0A 2WUWE 1RYZA 3S7TA 2PZ8A 3ZU4A 1FJGB 5ED4A 1M6VA 2JFXA 4FZRA 3FUUA 3X2SA 1GU0A 5THKA 4E11A 3GXOA 3D6AA 4KFTA 1IZ9A 2CXOA 2ST1A 1MO5A 3B6EA 4RXMA 2VJMA 3U13A 1E2HA 4DDKA 3NVMB 4I81A 4M1SA 2VZ9A 4YDSA 4D3DA 3DPSA 1TEZA 3EZ2A 3R0VA 5KYNA 1NQWA 1YAJA 4ER3A 1UC4B 2AOXA 5M2QA 3ZDAA 3P27A 4QO8A 2V96A 3H8SA 2NVOA 1QIKA 3DCIA 3CX3A 4FTWA 4X61A 1CZKA 1XYGA 2QAGC 3SR4A 1SURA 2WU4A 2I6FA 2OT3B 4EJFA 2N9UA 2XXJA 1M8JA 4WOBA 3SYRA 1MPXA 2IEGA 2N3ZA 3OTIA 4LRTB 1AF4A 3DFUA 3PE3A 5EUMA 1BN7A 1L4YA 3BFKA 3LQQA 1D4OA 4FHZA 3ZTYA 3ZJUA 2VHQA 5B58C 4R9SA 1KJIA 2QTAA 1FVFA 1S89A 2JH9A 3TO5A 2E5WA 3QU7A 2Q8PA 2QVXX 4NBTA 4FLFA 4PQYA 3B1VA 4N7MA 1CF4A 3LUCA 5E6SA 3FVTA 2XA1A 3PUZA 2QZSA 3P97A 2GBPA 1PHRA 1TQ8A 4RPIA 3KSMA 5LUAA 1K86A 3BB1A 1E8MA 1L7OA 4Q5IA 3T7DA 1HBJA 3E7PA 3MAGA 5HM6A 5ENVA 3OSUA 1TJ5A 1TW2A 3F5DA 4IVRA 3FOEC 4YAFA 1Q6ZA 3AL3A 3N07A 1K7EB 2IYSA 4FT4A 3PVCA 3A9RA 2AMVA 5KYWB 1XU7A 2R2AA 2ZPAA 1TGVA 1U1FA 4NLLA 5FFNA 3RUDA 3S2GA 1N2SA 1IFXA 3MINA 4TL6A 5CEFA 4HDKA 2CUNA 1FMFA 4R1PA 3GN1A 4YT8A 3HEBA 2O0LA 4MYRA 5KQLA 3GGCA 3P0RA 4U7HA 2HX1A 2QN9A 2V54A 4GEKA 3K9NA 2QJTA 4A2PA 1CW2B 2FLWA 3EFHA 1C7IA 3O4JA 1U9CA 1U0NA 1VI2A 3SQXA 2CEAA 3MS7A 1HQCA 3L7CA 5LMCA 2DBZA 4JU9A 1O08A 2QG4A 2VUTA 4MUJA 4W5OA 3S44A 2J5KA 4EL5A 5E0KB 2J6HA 3ZDZB 2GQ0A 5HKAA 1V8ZA 1TKAA 2MINB 2FV8A 4HDMA 4J7UA 5IDVA 5IDWA 4YX9A 2WMYA 2WTNA 4P7GA 3LPCA 4JBNA 4ZT7A 2PU7A 2GAJA 3ZBTA 5CT4A 2PZKA 3B89A 3O4VA 3SMVA 4CM4B 2ZT7A 5BN4B 3D2LA 3NI2A 5TDHA 3TLMA 4UREA 5KU7A 5FL7D 2EJWA 3NTUA 1GCGA 2VQSA 1QHSA 4IDQA 1O03A 2J7KA 3PDUA 3PYXA 4JX9A 5LQKA 2PZJA 3PL1A 4TYQA 2IKSA 3P2MA 1C1XA 3HB0A 4TUYB 4B43A 3S6JA 3NATA 3DPUA 4KYTA 4ENWA 3SDSA 1LLCA 5KNCH 3PNPA 4EY8A 2I3ZA 1HYBA 4R9VA 1H65A 1U0SY 3K9HA 2XSZA 4UBMA 4F04A 6Q21A 4GSLA 1U81A 4HWPA 3ZY2A 4JVOA 3STWA 2XZOA 1YR6A 2V98A 2XYRA 3G82C 1WMAA 4Q18A 5JTUA 1I1NA 4O59O 2YJ3A 1OLOA 4J8PA 2M98A 1HORA 4UEOA 1JVBA 5JAOA 4MZXA 2ZUEA 2WFMA 1L4LA 3AF3A 1CUDA 3LXXA 4OB6A 3OPYI 2AR0A 1R9MA 2BSAA 1L7BA 3R5JA 4LX0A 4C3VA 3UBMA 2G06A 4V0MA 2HBYA 1AKEA 1DVRA 2B69A 3O2SB 3ORFA 4KXMA 4V24A 1OGIA 4BEWA 4MMYB 3ORRA 5E8RA 1T8YA 4L0CA 5AKIA 4Z4EA 2QR5A 5ALNA 3OP4A 1CQJA 2HT6A 4B6JA 5HP4A 3BDVA 1KAEA 2I6XA 1KDPA 3GLHB 5AKKA 5K3SA 1OUMA 4WFIA 4BV2A 2XIQA 1GRCA 1PTJA 3GFFA 1BW9A 3OZGA 2Z9CA 4FFPA 2F1RA 4Z8YA 2FW8A 2GFHA 2X5JO 3L8EA 1FJXA 3ESXA 2HDWA 2IXDA 4KO4S 4BAUA 1HLPA 2FZGA 3DEJA 1UP6A 5A5GA 1R6BX 2WJIA 2ATCA 2PRJA 3SF0A 1RXYA 3UUEA 3F9RA 1VM6A 2XWSA 1L9XA 4YRNA 4KDCA 3AH8A 3OETA 3KQUA 2ZDGA 4BNXA 4EJSC 2D7DA 5KMGA 3DLHA 4K9DA 2IS4A 1VP3A 1I7DA 4DARA 3G8YA 5F21A 1YQEA 2FUCA 3LFTA 3L7YA 4WZAB 3D4OA 4YJFA 3TAHA 1SCUA 1MW9X 1U65A 1GP2A 1V3VA 2ZYTX 3T35A 3CVYA 3OZWA 3EF3A 4NZOA 1E9VA 4CJXA 1WKBA 3LIPA 2FX2A 1G3MA 1NVTA 1GEGA 4BO1A 2J3LA 3RBVA 1UKCA 2ORWA 1Q74A 3ODGA 1ZM4A 3QWFA 4YRMA 4IWNA 1BYUA 1E0JA 4FGJA 4DS3A 5EIFA 3W6NA 3IBTA 4WNAA 5HJ5A 2FZWA 2P5SA 4BLPA 3UJ7A 1VRWA 3M49A 5KJ1A 5F9FA 4TYYA 3MILA 3K6RA 4X71A 3OJLA 1OB5A 1AB6A 1SELA 3DLPX 2Q4TA 3I2IA 2Q4EA 4WXHA 2GBLC 4RA6A 1MDBA 1K5HA 3AB3A 2VJBA 5JLJA 4OOEA 4IR7A 4O2BF 4CKYA 5ALWA 1GTJ1 1WTAA 4OGKA 2QQGA 1XUOA 3ANNA 4O63O 4KQIA 5DM60 1WNFA 4YUVA 3ZDCA 3ANLA 1NYLA 1U0RA 3S1LA 3DC7A 3O93A 4DIUA 1SG6A 1RQPA 1VCOA 2FSSA 2ZYWX 4QG3A 3P9CA 3Q3IA 4D80A 4RH3A 3VVCA 3TQCA 1MAHA 3CG0A 4H7DA 4CIBA 4EG5A 1Y48E 4E5SA 4X97A 2I3AA 3NOOA 5DASA 1Y1QA 3COVA 4AQ7A 2D3WA 4CCWA 4CKEA 2NAPA 5AK3A 3EVGA 4OI0A 3AVWA 1KO1A 1L4FA 3MS4A 3W8NA 1P2BA 3INRA 3TIXB 2OM2A 2Q9BA 2ZULA 4KMSA 3TQRA 3ZZNA 4D9KA 3GEGA 4AJEA 3G9UA 2CE2X 4MSUA 4O4JF 6NULA 5AQ1A 5D3KA 1J0BA 4RD0A 1A50B 4PLZA 4B1FA 1KTVA 2YN2A 1CHDA 2D8MA 2JW5A 5HCNA 4PLHA 4ENQA 2EKQA 2Q28A 4GH5A 3RT9A 3TRDA 1WOMA 4B3BA 4NJOA 3SXJA 3IP5A 2IITA 2VYQA 4FPXA 3K8QA 4N7BA 2ZJAA 1FF9A 3D3WB 1H85A 3IAAA 2C4KA 4EGCB 5JAHA 2WWWA 5ALLA 2QTVB 1KDZA 5T4HA 2VK1A 1CWUA 5LA6F 1V43A 4RSHA 4OH1A 5AVRA 4Y6GB 5BYKA 2VRCD 1I9GA 2XITA 1QSGA 4H3HB 4IX9A 5WRFA 1K63A 4BMNA 3W5AA 5CDFE 2YHSA 4FMCB 4ITUA 1TYZA 2IY9A 4K7JA 4KXNA 4RCYA 1RM4A 2NQ2C 3LCRA 4OK5A 1FXWF 3CLKA 4BYMA 4YBRA 4EJ6A 3AVUA 1UBEA 3CTPA 2C5FA 1I2MA 1MB0A 4P7FA 4PPFA 2ZJ1A 2W7TA 3UMRA 3LRTA 5B37A 3DW1X 4QLAA 4X1IA 3PTLA 3B38A 1EFRD 5E9AA 1WUYA 1W5SA 4CMEA 1A04A 2XE6A 4XARA 1DOZA 4GOKA 3RAEC 2WFZA 3NP9A 3EPJA 4RZHA 2NO7A 3CLVA 2DHRA 2IIPA 3A4MA 3BE5A 3IP8A 4CF5A 1M1YE 4LGCA 2WVHA 1MGPA 1Z36A 3QPWA 4OAQA 1OYYA 1MQ9A 1EQAA 2WU3A 4E6PA 1KTIA 3KV1A 2XRFA 3EG9B 4GX5A 2WHYA 1KORA 2JAHA 3H2IA 3LDGA 1B3RA 1XA0A 3H0EA 2VP3A 1GY8A 1ZC4A 1KWKA 5I8PA 2MSNA 3ED1A 3GA5A 5DK4A 5KYGA 2Z2YA 3D5TA 4Z1MA 2QD5A 2Q4OA 3BHMA 1NQTA 3EQZA 3G9XA 3B78A 1E96A 2D5AA 4FW8A 4TKMA 5C18A 4AG3A 4QELA 4OXKA 3L8DA 4C06A 1H8EA 1BE1A 2PH3A 3DAHA 3GEHA 4HNSA 3KYIB 1OBVA 2JIDA 5G1PA 1BXKA 5FUMA 4ZVVA 4EHKA 1NF8A 2X7HA 3G23A 3W3AA 4J6FA 3ZXXA 2FTKE 1NBME 4CW7A 2I3BA 3LHFA 3K73O 1Y6QA 3KE9A 5T4FA 5BV1A 2WOJA 3QYFA 4Y2SA 4Q3DA 3NTLA 2VQ6A 4XIYA 4A03A 2EV9A 2NO4A 2C0PA 2D7JA 4LDRA 4XPIA 5AVOA 2ZITA 1E6WA 4I8DA 4UU7A 1GG8A 3IUEA 5CGZA 4XOIA 2DUMA 1VYHA 1LDBA 2WZCA 5CNIA 2AW3A 3QUCA 4YJGB 4FFSA 4YONB 4AJNA 2AUNA 1C0IA 1HOXA 1YDGA 4YHBA 1P1CA 3GI1A 4GNRA 4IRXA 3QVKA 5LP6B 1DCKA 4CMGA 2EAUA 4M4SA 4S04A 2B7CA 2AK3A 1NPDA 2H5IA 5ALOA 5H70A 3L04A 4YWJA 3DFIA 3A9CA 3HDJA 4K8OA 2NPOA 5I9SA 3FE2A 4LK3A 5JDIC 1ZD4A 1G1AA 4MVJA 4XPZA 4JXZA 3RHZA 4ALKA 3OEED 1M2EA 3DUFA 1P1BA 2X1LA 2YFYA 3OQIB 3RGGA 1WDTA 2FEMA 2FJ0A 3ZY4A 1C1DB 3UMJA 4PSVA 1X13A 3V97A 3EK2A 4KG7A 2X5OA 3WWZA 2ZSDA 4NCJA 2A3RA 5AKGA 2G71A 1B2RA 1KIMA 4YJFB 3RVLA 1L7EA 2ANCA 1OWMA 5DU2A 2W6JA 1I6LA 2JLZA 2FPKA 4OI1A 4BJHB 3REOA 2BC9A 5LBTA 2GPYA 1ZUNB 3DWFA 1DRKA 2WINI 4HDQB 1N4AA 3WIVA 3TLZA 2IVZA 4HS9A 4U2FA 1OBHA 4AN4A 4C3UA 2FEKA 3H2KA 3BD8A 4AWXA 3TG8A 1PT7A 2PX2A 3DL2A 5KX5B 1BZYA 2VAMA 2ARKA 1WNTA 4CMAA 3FF4A 4A0FA 1OZ0A 1UL1X 3N70A 1A1SA 2W98A 4KQ2A 3BXZA 4UHCA 3L82B 2VG8A 4OHRA 3ZDEA 1QIMA 2PKCA 4KQHA 3BXOA 5REQA 3IQDB 4L2IB 5BVHA 3STXA 3G5MA 4UNPA 4CM7A 4GX1A 4H0NA 2Q1SA 2BKVA 4JVMA 1KMQA 2FOLA 4HR7A 4OP2A 1E6MA 2DUWA 4PIPA 3VVLA 4J3FA 4PYIA 3L7DA 5J5VA 4UHHA 1TZKA 4IMIB 1YCHA 3VPDA 2NMVA 1D6JA 2JS7A 1ZSYA 3JU3A 2WC1A 2X1MA 3FBTA 1OV4A 3OPNA 3QW4B 4ML3A 5A9SA 1BEEA 3CPEA 4OQ4A 4EUEA 4P0PB 2ZATA 4YP9A 2Q3HA 4KN6A 4BKRA 2JD1A 2IH5A 3UK0A 3GEBA 1ESDA 3ZZTA 3AVOA 2Y77A 5A9RA 1Q22A 5IBRA 4CKBB 4ZCMA 1TAHA 2ZSHA 1M0TA 3RFCA 1PJ8A 2QXUA 3IRUA 4NNJA 1RMTA 1TVCA 1PO7A 1M6EX 1Z73A 2GBGA 2IGBA 2X2FA 2F3SA 4MINA 1GG9A 1XPJA 3JAKA 2EKLA 1GKLA 5U1PA 4YWHA 2HADA 4AZ3B 3ZCPA 3AVVA 1Z4NA 5EY5B 5TPZD 2FPRA 2HO4A 1H8HA 1FNMA 2JCYA 2EC5A 3DGEC 1WXGA 3KJIA 3QKRA 1RRPA 5AW1A 2WU0A 3DBLB 1QYWA 3QMWA 1L4BA 2XVXA 3E9YA 1LDEA 2Z30A 5H3HA 1TO2E 1IEVA 1P7WA 2AR9A 2PS1A 2QTVA 2WF9A 3BS4A 1E4YA 2IPOA 2ET6A 2WI8A 3E0QA 5E6SB 1E3MA 3BWVA 4QLOA 4UEJA 1KGSA 1SC6A 3FCAA 1SHLA 3D8TA 4CF6A 1X8JA 3JWPA 3EIHA 4FFWA 3W5HA 3WIOA 4IZHA 4GXQA 5D3QA 4DM7A 1G21B 2AK2A 4TSRA 2JAXA 1JHYA 1N8KA 4JLSA 3TR5A 3LC0A 1OTHA 4EFDA 3RLFA 5BUQA 1LUAA 3ETHA 2YS6A 3VX4A 2P2CA 2JEZA 3H18A 1S8OA 2RI6A 3TTSA 4RKRA 3H75A 1G8SA 3PFFA 3H4VA 3K2BA 3S5UA 5C3MA 2OCXA 1Z3CA 2IXBA 2NG1A 2R86A 3LVFO 4KBGA 4LZWA 1QK4A 4OJNA 4XGNA 5DNVA 2F8MA 2ZSFA 3IVMA 5TF0A 2O48X 4F56A 2JFVA 5B58T 1Z6TA 2BKEA 4ZIRA 3EH1A 4N8DA 1PJAA 1IK6A 3KEOA 1YVDA 4BIMA 2PQ6A 4Q4CA 4I4IA 3KTOA 3MWEB 1JE0A 4F06A 3DXYA 4AKTA 3T5PA 4H7EA 1HLGA 5J40A 1P1RA 2HQBA 3CGWA 2D54A 3RROA 4DVJA 2WIDA 3V1LA 4CIDA 2HD4A 2OYSA 2HK8A 2KE5A 1NUPA 5BN4A 3IAS1 1JI0A 4BZQA 1ESMA 5DI9A 2CL0X 1QQAA 3RC8A 1FU7A 1IPEA 2C1ZA 1Z2OX 2ZIEA 1ZFNA 2GZMA 3TDKA 4PRLA 3CO5A 3LOUA 2A9PA 5E6UA 2GILA 4HRVA 4CL0A 2OGT