3SVZA

Crystal structure of apo bt_2972, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of apo BT_2972, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
molecule keywords Putative methyltransferase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3svzA00
3BWYA 2GLUA 4QVGA 4IV8A 1RI4A 4MTLA 4PNEA 2P41A 3JWGA 3V8VA 3TMAA 1L3IA 1AV6A 4XUEA 1Q0SA 1NE2A 3ME5A 3LL7A 5B1SA 3UJ7A 3A7EA 1YFLA 3KPJA 2XVMA 4IWNA 1P39A 3HVKA 5DRTA 3M4XA 3EVGA 3ELDA 4QTUB 2ZIEA 3PFHA 4GC5A 2F8LA 4BP1A 1DUSA 3BKXA 1XCLA 3G7UA 1WS6A 4OQDA 5DPMA 1QZZA 3TLJA 4DMGA 2VDWA 2BM8A 3TKAA 3S68A 4AUKA 3DOUA 1OR8A 1RI2A 1VLMA 2IP2A 3GRUA 3HCEA 4ATNA 3LHDA 2ZVJA 5K03A 3NWEA 4P58A 1N7IA 5CVDA 4HTFB 3PFGA 3SSOA 4POOA 5GM2A 1FJXA 3ORHA 3EVCA 3HCFA 3HCCA 1X1CA 4CKCA 3R3HA 4CWAA 5LSAA 2KW5A 4PGGA 3H2BA 5DTMA 3G88A 4UOEA 3HA3A 4R6XA 2B2CA 1F38A 3GCZA 2B9EA 1NBIA 4U7PB 4F85A 1PJZA 3EEYA 3LDFA 2CWWA 3NJRA 2YXDA 3EVBA 4ISCA 3R9XB 2HTEA 5EMKA 4YMHA 2JH8A 4RVDA 3ELWA 4KDRA 5K8VA 5DX1A 2ONZA 4OBXA 2C7OA 2Z6QA 2JHAA 2P8JA 5IKMA 2JHPA 5K0JA 3KQTA 3FPEA 2IH2A 2O07A 2XYVA 4HTFA 3Q87B 3KQMA 4CKBA 5K0NA 4M36A 5M5BA 1VPTA 3GWZA 3KQQA 3T7RA 5EPEA 3OE5A 4RTMA 2YXLA 4KWCA 1EG2A 2ONYA 3C6KA 4ER5A 2ZIFA 3GNLA 2AR0A 3A26A 5CVEA 3SX0A 2I7CA 1RJEA 4RTNA 1M0EA 1XXLA 3BGIA 3TRKA 3LX6A 1NBHA 2ZZNA 2JJQA 2PX8A 5LQAA 1QAQA 4GOLD 1NW5A 1Q0TA 3DMHA 1BOOA 1YZ3A 3B3GA 5E1MA 4DM3A 2V7EA 3M6VA 2WA2A 5ERGB 5FWAA 2NP6A 1XDSA 3HCAA 4YV1A 4P7KA 2V74B 3BWCA 2OZVA 3ELYA 1TW2A 3HM2A 1UIRA 2YQZA 4E30A 1BKYA 1UWVA 2EG5A 5GWXA 4QPPA 4PYJA 4P7GA 2VZ9A 2UYQA 3R0QA 3DULA 3RW9A 3QOWA 1T43A 4RVFA 5DX8A 1N7JA 2OPBA 3TM4A 3FUWA 3LECA 4R8SA 4ER6A 3EGVA 5KQSA 3DR5A 3OE4A 4PYQA 3MERA 4GOOD 5C1IA 5E2BA 1MHTA 3B5IA 4ER0A 5FCDA 2PY6A 1FP1D 5DT2A 3RODA 2P3QA 2PVCA 4C06A 5EKUA 5CVJA 3KHKA 5E1DA 3P8ZA 3DTNA 3KQPA 5K0FA 5DM4A 3CJTA 2VDVE 3G5LA 2HMYB 5ICFA 4LWOA 4KIGA 3UJ8A 4LWPA 1XDZA 5E9QA 2UYOA 2P35A 4AZWA 4RVHA 2PWPA 2AOTB 2YVLA 4YUWA 2BH2A 2N47A 1ORHA 3OZRA 4GC9A 2PJDA 5HIMA 3UA4A 4DCGA 4FSXA 5EVJA 4Z2YA 3PVCA 2O06A 3DUWA 1SG9A 1X1AA 2OY0A 5EEGA 3E05A 2I6GA 2XYRA 5E2AA 2AOUB 3SMQA 3ELUA 3OCJA 4E2WA 3DMFA 2VS1A 3G89A 3K6RA 1N2XA 3G8BA 2WA1A 4U7TB 4C07A 4C4AA 4ER3A 3G2PA 1WY7A 5FQOA 5E8RA 2IH5A 3T7TA 4P7JA 1RJFA 5K0GA 2GS9A 3FZGA 1D2CA 5H02A 3P71T 4DCMA 1X1DA 3E8SA 4ZTBA 3ER8A 5HIJA 2PSSA 5DTQA 2B3TA 1D2GA 1JSZA 3B3JA 3HCDA 3NVMB 2CKDA 2AOWA 5KQRA 2R3SA 1YF3A 2JG3A 3OFKA 4OX9Y 1JSXA 5EHGA 3T7SA 2BR5A 2E5WA 2IDJA 3P9NA 4FSDA 5ICEA 4RTJA 2PX2A 1M6EX 2UYCA 3NW9A 4GUAA 5D1HA 1VIDA 5CCXA 5DM0A 2NP7A 3PTAA 2XVAA 4X41A 1F3LA 4RTQA 5LQRA 3O7WA 3E23A 7MHTA 1JG1A 3KR1A 4Y2HA 3P2KA 2FHPA 3AWIA 1QYRA 2QRVA 3L8DA 3MTIA 3SXJA 2ZZMA 3P9KA 2O0LA 2G70A 4HGZA 4X63A 4DF3A 2HV9A 3NMUF 1ZGAA 3PS9A 2QE6A 3HA5A 2ESRA 2ZIGA 2AZTA 3HA7A 4KRGA 3D2LA 1JTFA 4BP3A 4H0NA 2CMHA 4EQZA 2BR4A 5KS2A 1KR5A 1P91A 3JWJA 4XUDA 4BLUA 2AN4A 3CKKA 4RYLA 5LQKA 2ZCJA 2NXEA 4A6EA 1YZHA 4R05A 3NVKI 2PX5A 1L9KA 4G56A 1VBFA 5E1BA 2OXTA 5FTWA 3UJDA 2ZTHA 2PWYA 1WXXA 3GO4A 3PX2A 5ICGA 2QRVB 3VYWA 3P9IA 1O9GA 1G8AA 3GJYA 4MWZA 5GP1A 5FADA 5LQCA 4LG1A 5MHTA 1NW7A 2DULA 4QQKA 3OU6A 4C05A 4WVLA 5T67A 3SVZA 4YUXA 3P2IA 4HRAA 3HP7A 3GRRA 2BR3A 3G2MA 4IKPA 2PXAA 2GB4A 3IV6A 4QDKA 4YV0A 4BY9E 2GPYA 4JXJA 4X60A 2H00A 4V0QA 3K0BA 5KVAA 2CL5A 3EMDA 3REOA 4EKIA 1NW8A 5U4XA 2PGXA 5K0CA 5EZQA 3G2OA 3U81A 4PYLA 1JQ3A 3G2QA 2EJTA 5K0EA 2ORED 3UZUA 4FT2A 3O4FA 5CD1A 2IBSA 1AQIA 1X19A 3UJAA 2ERCA 3VC2A 1G38A 3DP7A 1RI3A 3AY0A 4GBED 5K09A 4K6MA 3HVHA 4RTSA 1SUSA 2G8NA 3PX3A 5JUWA 1JG3A 1FPQA 3FRIA 3PB3A 5EIWA 4L7VA 1Z3CA 2FYTA 2OBFA 4PYMA 5HEKA 4DA4A 1QAOA 3MB5A 2JHCA 5BW5A 3B89A 2PT6A 3KQWA 1TW3A 2EX4A 2AN3A 1I1NA 3DLCA 3Q7EA 3CCFA 4EMSA 2XBMA 3UFBA 1P1BA 2B78A 2IPXA 4V0RA 3C0KA 1YB2A 5EHIA 4F86A 3VC1A 1Y8CA 5FA5A 9MHTA 3TPZA 3FPHA 2OKCA 3FRHA 5FUBA 4EVIA 3CJQA 2UYHA 4DKJA 2GAFA 3MHTA 1G55A 2NXNA 5E9WA 2PT9A 1DCTA 5F2KA 3C3PA 3FUVA 3UJCA 1AQJA 1QANA 2QYOA 3CVOA 2NXCA 1JQEA 2P7HA 3FPJA 3SR4A 5EC8A 2G1PA 1VP9A 1NV8A 5HIKA 4PGHA 2LD4A 4FGZA 3MAGA 2FCAA 3GGDA 3MCZA 4GOND 3FTCA 5BW4A 1KIAA 2ZBPA 1VP3A 2ZSUA 4KW7A 2B25A 3CGGA 1I9GA 3F4KA 3BWBA 3LPMA 5DM2A 5FHRA 4AX8A 3A27A 1VE3A 3KR2A 3EVDA 3LCCA 3TKYA 3DXXA 5BXYA 2IH4A 3FUUA 4PINA 2OO3A 3LCUA 4HG2A 5EIFA 3NDJA 2ZWVA 4GEKA 3M6UA 4E70A 2FK8A 4OBWA 3SSMA 5HIIA 3I64A 3KQOA 2BZGA 2G72A 1HNNA 5CVUA 2PXXA 3C3YA 3OZTA 1KYZA 2Q41A 2ZBQA 3X0DA 2YXEA 4AZTA 5FHQA 4CTKA 1VQ1A 5EMJA 2JH9A 3GRYA 1P1CA 2I9KA 2I62A 5CVVA 3KU1A 3TOSA 3GDHA 3A4TA 1SKMA 4HH4A 4RTKA 5EMLA 3UBTA 3IEIA 3THRA 1G6Q1 1R6AA 1IXKA 4FT4A 3KQYA 5DXAA 3FTDA 4R6WA 5GOZA 2GH1A 1H1DA 1NV9A 3IYLW 3P9CA 3R24A 3BXOA 2K4MA 2OB2A 5K05A 4RTOA 1ORIA 3LCVB 2EJUA 4FZVA 4YV2A 3JWIA 1WZNA 1ZQ9A 3DXZA 4CKEA 3LGAA 4PYNA 1V39A 1NW3A 4X1OA 2Z6UA 3A7DA 4PIMA 5JR3A 3PT9A 1SUIA 2PBFA 3FTFA 2IDKA 3AXSA 3EEOA 3I9FA 3MQ2A 4LECA 4F84A 3EVEA 3NDIA 3TR6A 3AXTA 3OFJA 3OZSA 3OU2A 2IFTA 4YUYA 2QM3A 2ZLBA 2DPMA 5DRYA 1PRYA 3NWBA 3LDGA 3HNRA 5FA8A 2EFJA 2YUIA 2YX1A 3KPWA 2ZFUA 3V97A 3JWHA 3UJ6A 1U2ZA 4QTTB 4QQNA 4C04A 1JQDA 3FTEA 4MQ4A 1ZHFA 5CM2Z 5DXJA 2AOXA 5K0LA 5K01A 1XCJA 5EEHA 5LR6A 2Z6AA 5KYGA 1KXZA 5CUQA 4M37A 3QV2A 1INLA 1XDUA 4PCLA 1G60A 3P2EA 1SQFA 1ZKDA 1EIZA 4XCXA 1B42A 2YTZA 1KP9A 3I58A 5DLYA 5DX0A 5GIOE 2P1DA 3QOXA 4GOMD 5EKXA 3UJBA 3BGDA 3BT7A 2OB1A 2Y1WA 4AZVA 3TM5A 2WK1A 1SQGA 3A25A 3EMBA 5DM1A 3ID6C 3KPYA 2H1RA 2ZZKA 3BWMA 2FPOA 2PX4A 4B17A 2HNKA 4E2YA 1JG4A 1RJDA 2Y1XA 1KHHA 3LDUA 3DMGA 3FPGA 2P7IA 1YUBA 1TPYA 4IV0A 1HMYA 2FRXA 4PWYA 4Y30A 3WSTA 4DZRA 2AS0A 5BP7A 4KVZA 4RTLA 3EPPA 3FPFA 4MIKA 3R6TA 3G5TA 4E32A 4MHTA 1L3CA 3VSEA 2FK7A 4PIPA 5IH3A 4X61A 5EOVA 3BZBA 5T6BA 3T0IA 3CBGA 2UZ4A 1X1BA 3KQSA 1L3BA 3EVZA 5HILA 1G8SA 3UJ9A 5P8WA 2ZULA 1M6YA 3M6XA 5LQNA 1NKVA 1R8XA 3MTEA 4AZSA 2HR1A 5LQUA 1L1EA 2O57A 5EMMA 5C0OE 3GIWA 1RJGA 2O05A 10MHA 5HZMA 1R00A 2IGTA 1XVAA 1ZGJA 1UFKA 1JTEA 2CMGA 3B7PA 3DH0A 1BC5A 3FYDA 3HVJA 2IBTA 2NNWB 3LBYA 1JG2A 2VP3A 2PLWA 3GRVA 2P3LA 3FUTA 3LKZA 4HSGA 3I5UA 3KKZA 4XUCA 5FWDA 1KYWA 4E2ZA 4QVKA 5GIPE 1WXWA 3LSTA 5DTRA 2NYUA 3TQSA 3KQVA 5T64A 3KPUA 1MJFA 2NXJA 1RI1A 2HWKA 3FYCA 4KDCA 4QDJA 2ZWAA 4BLVA 4FR0A 1EJ6A 3HVIA 4RWZA 5GINE 8MHTA 4RV9A 5EGSA 1EAMA 5LQJA 2AVDA 4EK9A 4YUVA 1EQAA 3BUSA 1XJ5A 2H11A 4YMGA 1R18A 3E7PA 2A14A 4YUZA 1JR4A 2AOUA 1R74A 1O54A 3SSNA 2AN5A 3THSA 4BLWA 1QAMA 5E1OA 3KPVA 5DSXA 5E8JA 3ERCA 3M33A 3C6MA 3HCBA 4GQBA 2ZBRA 4E2XA 3TFWA 4FP9A 5DWQA 3MGGA 3CC8A 1EJ0A 3O31A 3GRZA 4NECA 1D2HA 4PYKA 2AOVA 1VL5A 2BM9A 3DXYA 3EVAA 3UWPA 3NTVA 1AF7A 1FP2A 3EGIA 4OA5A 1NW6A 3ER9A 3PLAE 1RI5A 5G02A 3P97A 4QPNA 5C9ZA 3RIEA 1YFJA 2C7RA 3IHTA 3BGVA 1DL5A 3SM3A 4GF5A 4CTJA 1BHJA 4PCAA 4C03A 4E33A 4RTRA 3HTXA 3SGLA 2VDUE 4ER7A 3KR0A 5EZSA 1IY9A 4E31A 2AVNA 4EKGA 5DSTA 5E9JA 4RVGA 2YR0A 3G8AA 2ADMA 5CCBA 5CIYA 4DQ0A 3MCTA 1R8YA 2C7PA 3M70A 3OPNA 5EG5A 5K0BA 2XYQA 5FQNA 2P3OA 2R6ZA 4RTPA 4FS8A 3HEMA 2IIPA 3BKWA 2PXCA 1O9HA 1SVUA 3FUXA 4WXHA 2P40A 1FBNA 3EGEA 4OA8A 1KPIA 2GA9A 2AOTA 5HFJA 3M6WA 1IM8A 1KPHA 4HC4A 2G71A 1WG8A 3B3FA 3DLIA 4OQEA 3KR9A 4P7FA 3AJDA 4M7RA 4RSRA 3I53A 5HOQA 5FULA 5ICCA 4CXMA 2QY6A 3OU7A 2OYRA 5F2OA 3EVFA 2C7QA 1XTPA 1ZG3A 2PV0A 2ZW9A 3CJRA 4PYIA 4R8RA 4RX1A 3UA3A 4A6DA 2PKWA 4KIFA 4PYOA 5GM1A 3LKDA 4PONA 3LBFA 1KPGA 3GU3A 4M38A 5D1NA 1NT2A 3ANXA 1I4WA 4O29A 4HGYA 3GXOA 5EQJB 4C08A 5F2NA
chains in the Genus database with same CATH superfamily
4B9AA 1GL6A 1TTPB 3N6RA 4AG3A 3EFHA 4WCFB 5TVGA 5ADWA 1LPBB 4EL5A 1SJ9A 4MQLA 1XZGA 2J6BA 3B9BA 1RLJA 2I9PA 4QA9A 1TK3A 3WGHA 1GQYA 4ESHA 3DDCA 3HU3A 2Q62A 3TVTA 5DGDA 3WADA 3IMFA 1G7TA 3M2PA 3W9BA 2PUVA 4JU8A 1ZSNA 1D07A 3MK31 2CDCA 4QXPA 1T9GR 2MOKA 2WNHA 3CUWA 4IFEA 2QUHA 2XSZD 4REQB 4IEEA 1G21B 1X3LA 2JJYA 3A6GA 4ZI5A 4BE4A 3PFHA 3DVAB 1G59A 3FY4A 4TQAA 3UEOA 1TTQB 1WAMA 4DMHA 1GDHA 1XZNA 2A6PA 2R5WA 3ZHZA 4RKYA 1CJVC 4TGLA 3KJXA 3QWBA 4MGYR 1L7BA 4XE5A 3UCXA 5FPYA 3S8YA 3KJFA 5DTEA 5E7MA 4NBNA 1IQUA 1P4GA 1V4NA 4R3WA 5K03A 2YCBA 4IIXA 1N6OA 2RI6A 3N8HA 3P9SA 1BCSA 3GFSA 3U62A 1U02A 4XUGB 5GM2A 3P0JA 3S1AB 1W88A 3SX2A 3WWCA 4G0VA 3MFQA 3U0VA 3UQYS 5I7UA 3L8EA 4CWAA 1D9ZA 3GN2A 4DVGA 4BFLA 2D59A 1CBUA 1PT8A 2M9MA 4PXAA 1ORTA 4ZVKA 3RUFA 5AM1A 4YCNA 4A03A 5AOCA 1IB0A 4PTZA 3NJRA 4KQWA 3AQIA 3QIVA 5AXBA 2B7CA 1ECCA 3GMTA 5CYFA 2PGIA 3RVOA 5ALLA 5KYYB 3CVUA 4Q21A 1XVVA 2MINB 1JHPA 1E7MA 3LT5A 4RVDA 1J70A 3LLVA 5DI9A 1VKOA 1MH9A 2PKYX 3IT3A 4EJFA 2IHZA 2WG1A 1KMQA 2AKAB 2FQXA 3QJGA 1ZH0A 4JH0A 4N54A 4UXJA 4Y1RB 1MC4A 1F6BA 2ZITA 2R5FA 3KQQA 1PJTA 2Z5VA 3CVVA 3X1KA 3JXEA 5AH0A 3DKKA 2WT8A 1EG2A 1PFYA 3GUCA 3GZTB 4H15A 4IIVA 4DPMA 3TRHA 1TLLA 3UAGA 4X85A 4ER5A 1LX6A 1OTYA 3IVCA 5IAEA 4F6RB 3KQHA 1YH3A 4O6VA 5TGDA 3O8CA 2VP2A 1UZUA 2ZTUA 4K81B 3SOZA 1BG6A 4CMEC 5B57C 1IUOA 2K2QB 2WM2A 4LYHA 1YGYA 2N9UA 4G6ZA 3GFPA 3WRXA 2YMMA 4WJKB 1SQ6A 2J8ZA 3K2BA 1NJ6A 3VDRA 3GLIE 5JD3A 5CVCA 4G1UC 2H1IA 1QHHA 1TW2A 3TXAA 4MWEA 3TLAA 1U0LA 2QM8A 4HB3A 4GAEA 1NFFA 2QMZA 1DTWA 3TW8A 2IYEA 2YZKA 2FCRA 1UXGA 3QOWA 5K8TA 1W36D 3IIEA 4E1AA 1GJRA 3HG7A 2C7GA 1KMCA 4CMEA 5KQSA 4BKQA 3CX7A 4CTMA 2K7ZA 4N8SA 2J9FA 3NIBA 3MCVA 3ZCQA 1KRXA 2AX3A 1FP1D 2KYRA 2OCDA 3RODA 2C1EA 4Z4QA 1GQOA 5IMSA 1ZUIA 2VKQA 3JALB 3GV0A 2NXWA 4DBZA 3BSWA 4Z4IA 1M2HA 2V7BA 2IXAA 4D43A 3TZCA 1OPRA 5C4IA 3LZDA 4GP6A 5KNLA 1Z5NA 3ZWQA 1GLNA 1FVHA 1NP7A 1GADO 1JLLA 3IHKA 3QVKA 4ZRDA 2JI6A 2P0EA 1OLXA 1W1UA 3E2MA 1U7TA 2IXGA 3FF1A 3STYA 3VRHA 2SKCA 1Q1GA 3UA4A 5ESRA 4FFLA 2O3QA 3BXFA 4RXUA 4KPFC 1V95A 3IR5A 4KLZA 1AHHA 3T5MA 3WK7A 1PWEA 1YR7A 5FAKA 1IBSA 4LI0A 5FEUA 1SVMA 2X77A 2VDLB 4JLJA 2I6GA 4N39A 2WOJA 4AIRA 2A5DA 4BWGA 1QH0A 4OJTA 1F8UA 5AVZA 4DY6A 2VS1A 3K96A 3CS3A 1NUUA 3HY6A 1CR1A 4AWAA 3HWX1 1B8UA 3FTQA 4MWSA 2PCLA 5K0ZA 4MB0A 1U8YA 3K0HA 2R6JA 4O2AA 1M2OA 3HI6A 1L5NA 5K0GA 5DHQA 4JMPA 2CMFA 5DBGA 1ZA1A 1K6JA 1L5WA 4LMRA 1KDZA 3AHJA 4HUTA 2LBPA 3FW1A 1D2GA 2QM7A 4IIJF 1BU5A 1JAZA 4DFDA 5H4GA 1HNWB 3FOFC 2EFDB 2WUGA 4AX4A 1NN1A 2A7XA 1EESA 3LUFA 1HETA 1PR2A 3EAFA 4C6RA 1EFLA 2GASA 1HDXA 3DFMA 4R84A 4CLEA 3VI3B 2P4SA 4A2QA 3ZJ4A 2FEXA 1MJGM 2R47A 2JH3A 2JVKA 1FQJA 3QWFA 4MW6A 4YAEA 5JS6A 2ZE7A 3E7DA 1MC8A 1SC1A 1U3DA 3AILA 3ETLA 4ARUA 5A06A 1FPMA 2O1EA 5CAEB 5BVHA 1W25A 1MPTA 2Q1YA 3LUDA 1UMBB 4Q82A 1KO5A 4LXHA 4KAAA 1WBDA 2QRVA 2R87A 3L3BA 3OIYA 3PQ7A 3R41A 1KJZA 1CJSA 4B46A 4HDKB 4BZPA 4MKHA 2ESRA 2IXBA 4GMGA 2ZJ6A 2VDPB 3C74A 2AZTA 4ICIA 5IABA 3KSUA 3QOYA 1SOUA 1Y3FE 3D8TA 5D8DA 4ALJA 2FUG1 1N5MA 1Y34E 3ZIDA 4F56A 1CNEA 4ETMA 3H0CA 1I51A 4JVNA 2FPMA 2JKYA 3VR6H 4LJLA 3EQ7A 3QVVA 3ZZTA 2GZ1A 1ZIPA 2B8WA 4DUZB 4HDMA 3U9TA 1FRVA 2IS1A 2DFPA 2PX5A 3AEUA 2E4UA 2XZDA 2OXTA 4PLHA 3I5YA 4KR9A 3T06B 4EUSA 4MV7A 4IGFA 2UZ1B 5ICGA 1S9DA 5G0UA 2M1ZA 4E3ZA 2AF3C 1JYEA 3U19A 3II6X 2HF9A 5AKHA 3ZGYA 2CXNA 4RCYA 1IM2A 1FRZA 1R12A 2MYNA 1C30A 3L7IA 4F3YA 5JH7A 1C3OB 2ASEA 2PWAA 3ND5A 1Z6YA 4RHFA 1A2QA 1XRMA 1YRHA 3NBYC 3K6SA 1KJ9A 2J7KA 3SP1A 1Z8NA 3L1JA 4CZ2A 3FNFA 1FIUA 4PYLA 4WK2B 2EJTA 3FIJA 4P9NA 3LUGA 3PQ6A 4LRWA 3UJHA 1SHTX 4KRYA 1X19A 4TL9A 1UR5A 3L1IA 3BVPA 3E61A 3WJ7A 1WEKA 5CDGA 1SFRA 5CH5A 3VHXA 1FXUA 3GD7A 1I1QB 5JUWA 1URPA 1YE5A 4L7QA 4OQ4A 1MHPA 4G5FA 5MGBA 1B8PA 3AJ9A 1OXBB 1P31A 1HM5A 1W0KD 4ISBA 1WOMA 1Z56C 1XVIA 4P4TA 4V3CA 1EHYA 1TCBA 1YBMA 1HE3A 2PGDA 2AI1A 3OPMA 2BGLA 2FPIB 2X2FA 2VBFA 2MSKA 1KNQA 3UFBA 5KYWB 3TBHA 2IPXA 2UVPA 4Q03A 3BTSA 1RJ9A 4MUEA 1GQFA 1NU6A 2OKCA 2X9NA 3FRHA 1SEPA 2FB9A 4EQ6B 1FNMA 2GAFA 4H6WA 5HF9A 1Q3HA 4JENA 4RIHA 2HSDA 5FLKA 3LUAA 1AQJA 5AHRA 2FW8A 3QSGA 4B3JA 4ASUA 2WNIA 5EN4A 3ORFA 1QANA 2QTRA 2XWBF 2B61A 421PA 4D8VA 4GGPA 3PWZA 1CZKA 3GL9A 4MW1A 1EFRD 4Q4AB 3ZBPA 1FQWA 1T6XA 4FEYA 4TLAA 4QRHA 1F0KA 2XCUA 3U7JA 1A5TA 3PNQA 1ODJA 2H2FA 1KSFX 1VE3A 2NUPA 2WTXA 3AM5A 1U04A 4FJ2A 3E9EA 2R1VA 4B4UA 3CSSA 3D5TA 2J33A 3DZGA 3E9ZA 1XAJA 4GEKA 4A2PA 4JSTA 3EWNA 3SQLA 2IHYA 5CB8A 3AG6A 1KZ6A 3TCKA 1ISSA 3M34A 3KQOA 2HMTA 1FW8A 2VWQA 1ISJA 3KQNA 3H65A 2IF2A 3OZTA 4NDZA 3OZGA 3VR1A 4CL2A 1I2AA 4FQ8A 3KSAC 1Q77A 4TRJA 5SZJA 1F7VA 1CHNA 1SBHA 3LY8A 4P3PA 1JIJA 4LUCA 4HNTA 3OQIA 1P1CA 1ZP6A 2DPYA 1KVTA 2JFGA 2WFMA 4UUBA 1IB6A 3QX7A 3P26A 1T6YA 1YR6A 1E3WA 4GI1A 4ZT7A 4B33A 3NS7A 4ZYLA 1N5LA 4DB4A 1P0QA 3GN1A 4NS4A 4RZUA 1FDRA 1KDPA 5DSZA 2WHPA 1RPTA 3IEIA 4WRRA 4L5CA 3H3FA 3PC3A 5FTMA 3UMSA 2WTNA 3X1XA 4DRZA 1M1NB 3WYGA 1P6XA 4B6RA 4EFMA 1Z5ZA 4DLWA 2QN9A 2R8RA 1DLJA 2DGDA 4AKIA 3WAJA 3V2UA 3R24A 4N6NA 3EBLA 3IP5A 1H23A 5EIBD 1IEVA 4JP5A 4WOPA 4QLAA 3U6BA 5IUNC 2IIQA 5DBEX 3MQFA 1Q19A 5F5LA 4FKMA 1NWHA 5J63A 3KAPA 1VXOA 1EP2B 3AI1A 4PYNA 4M0LA 3D4IA 4ITRC 4C7KA 1SOAA 1M8JA 3NAZA 3PUWA 3EZ9A 3KVOA 2JAPA 4W6QA 3FWPA 3JQCA 3MTJA 2B3DA 3P9ZA 3T4PA 2PYIA 3FCAA 1M8GA 1HG0A 1HSZA 1LK5A 1JIVA 3D8BA 4RS3A 1JHMA 2VHXA 1PSWA 1BX0A 1FFSA 1DTEA 2C0PA 3EEFA 1EGHA 2F67A 2NWQA 3DV9A 4XIFA 3KXPA 3WP1B 2QM3A 2IY8A 2OGTA 4BMYA 1TZJA 2R6AA 1I7LA 3U4IA 2HT1A 3DE1X 3JWHA 1U2DC 2QTMA 2YZNA 4PFQA 5FAXA 3ZJ5A 2DY0A 1T4DA 2GNPA 3TNDA 5KYGA 3FWHA 3ZD9A 1WSBA 1BHO1 3AVOA 3GEHA 5SY9A 4YT4A 1G16A 1GZUA 1CTQA 1PEKE 3CRW1 4JEHA 1E6KA 4R2WA 4WA8A 3DMTA 3BJZA 3IXLA 3ZPXA 1QIJA 2JA1A 4UU1A 5FBZA 4UHDA 2FPIA 3A3YA 3UV6A 1PGNA 1U9IA 3C87A 4RZXA 3TM5A 2OUKA 1SBTA 3RPEA 1L8QA 4ALMA 1SPBS 1U0RA 3N07A 1ZUNA 2Y1XA 2E49A 1O97D 2RJOA 3DMGA 5IASA 2EG9A 2P7IA 3CM0A 2FRXA 1C0EA 3PF8A 2FJUA 1N2SA 1U1GA 5BYBA 1DARA 2ZT7A 4MDHA 4MIKA 4TT8A 5J23A 5EYPB 2DX7A 4EO7A 4I46A 2I91A 1QFJA 1TQ4A 1X92A 4I8XA 4XGNA 4A27A 3CBGA 1RM5A 1X1BA 1L3BA 2C5GA 5GTDA 2XEDA 4GQAA 3S40A 2ZULA 3T38A 3Q7RA 3F4LA 1VA4A 1CEXA 1WE2A 1Y8QB 4OYLA 2RK3A 1RXWA 4KAFA 2L69A 1ZN7A 1MQ8B 1BN6A 4L4SA 4LDJA 2JJ1A 1QJ4A 3I2IA 3FCXA 4DHWA 4JMLA 2VUTA 2G77B 1YDGA 1TKRA 3MIIA 4DIKA 3LBYA 5JQGB 2PLWA 4NQRA 1FB5A 1FU7A 1M0WA 3FWNA 3GRAA 4G24A 1KYWA 5GIPE 2W6CX 1Z38A 3ORRA 2MMGA 5EYPA 1DZIA 1O95D 3OTWA 1DHRA 4H6PA 1VG0B 1U0OC 1RI1A 5F12A 3UMVA 4ME6A 3LUBA 4P2GA 5JEEA 4MW0A 5IAOA 2GN1A 2IEZA 3A1UA 1DIGA 1EINA 4M9CA 4PLVA 2Q7OE 4EYOA 1DLIA 5LQSA 4PFSA 9LDTA 2GBFA 1F4LA 2PLNA 5CLHA 1UFOA 5JQWA 2NN3C 4BVGA 3C7DB 2AN5A 2CLIB 2G5PA 1CY8A 1Z2NX 2DTDA 3BCSA 1FOEB 5E1OA 1RR6A 4D92A 1JKJA 4EYQA 2BBSA 4RD6A 1NWCA 4MJ7A 4R9UC 1LZLA 3GOQA 3ZHYA 1CQPA 3ZHOA 4LN1A 2I3DA 4YJFA 4BNTA 2FEAA 4FP9A 4E2XA 1CDEA 1SIWA 1F2TB 2WM8A 2XITA 3IAS6 3P2OA 3QLEA 4GX0A 1VJDA 3U9SA 3WKAA 4AJOA 4D02A 4DMCA 4F4JA 2XSZA 1C0IA 4Z7JA 1VL5A 4X1KA 2HZ7A 2PGNA 4EBFA 3DEIA 4ENPA 2IQ5A 4YC7A 5D51S 1LVGA 4R16A 3TL6A 4BQIA 2KI5A 3OCWA 5TGZA 4QU0A 3EW9A 3N28A 3HTXA 3U1BA 2XD9A 4HEHA 4PRLA 3CVXA 5COQA 2FN3A 3AESA 3WK4A 2FRDC 1BDIA 3L6UA 5DI3A 4JI5B 4TYYA 5IC5A 1YDMA 5KVQA 5HIAA 1Z0AA 3TB6A 2CW5A 2VP9A 2EQBA 3O4RA 1P4RA 1QGDA 5LLTA 1J0BA 1SC6A 3B3AA 5DGHA 5ICMA 4HGRA 5FBQB 5H3CA 5EG5A 2LP4Y 5K6RA 3ADBA 3AU9A 3RS4A 1T3TA 2P3OA 3OM8A 3STTA 4BO8A 4FYYA 4MQEA 4M7WA 3UVEA 1TJYA 3UPDA 3VZQA 1LBEA 4PHTA 1AMOA 1KPIA 3H9QA 3AU8A 1K7EB 5F33A 5AT1A 3CUVA 1VKRA 1V5FA 2WSIA 1VYUA 2M6LA 1D6SA 1T35A 3VDNB 4EJ6A 4RA6B 5KDOA 1GRQA 2V8BA 1WY5A 1KQGA 1CNFA 3BM5A 3EIFA 3L0PA 1T4MA 3NHUA 4G4JA 2PWBA 1U2PA 4O2BB 3VPCA 2QVXX 2BFNA 3HV0A 3OFSA 4AKSA 3VTFA 4WKNA 5B58C 3UKOA 1HA3A 2OXRA 1LJ8A 3ZD7A 3RS5A 2C31A 1O0BA 4IIUA 4B7XA 2JARA 4ENWA 4Y2GA 1SVWA 1Z17A 1GSOA 2DBRA 2W2OA 1ABFA 5FRDA 4PNEA 2YQ4A 5JVDA 3DM9B 1EYZA 3I2HA 1ZNZA 3C8UA 4H3HB 3HBLA 3MCUA 4ZODA 2QENA 1USKA 3PXEA 4WCVA 1Q1ZA 4PO8A 1BXKA 1AUOA 2HWUA 3HJAA 4MI6A 3TSZA 1KEZA 4FXPA 4MMYB 5DRTA 7REQB 3AHHA 3DEYX 1GNSA 3IP9A 2XUJA 4WXYB 4OQDA 3TLJA 4FC6A 2ALJA 1C4WA 3GGCA 4D0LB 5C7OO 2QPAA 5FBKA 5T3YA 3CH5A 3R9KA 1M7GA 1NYTA 1AC5A 3EQ2A 5HUJA 4JC0A 3VOSA 1TEVA 2YWRA 1QGUB 3TXYA 2ZUEA 2IP2A 3GJSA 1KETA 1R0CA 3ILXA 2C29D 4BZXA 2VBCA 3A9VA 4DSUA 2E0IA 2V58A 1N6NA 3H4MA 5KSPA 4EQ6A 3TLCA 1V47A 3NTOA 1A8IA 2YW2A 1DQZA 2YXNA 3MLAA 1MC5A 2VLBA 1OBVA 1X7DA 1ZYUA 2QTNA 2KLHA 1JZQA 3FI9A 3QKSB 5EHZA 1PW7A 2HO5A 3Q7IA 4ND8A 4QQ8A 4F85A 1XF1A 1MV8A 4D6YA 5B58T 1OT3A 1W0CA 3DO5A 3K4QA 4MYUA 5DNWA 3G9QA 3KLBA 1CF9A 1P9NA 2GZMA 1P6QA 1EHIA 1EXWA 1R9NA 2EZ8A 1U8FO 1VMEA 2ZRDA 3QEOA 1EGQA 4OSOA 1LPNA 4DLNA 3RIXA 3K73O 3NLLA 3QBVA 3H2HA 4B0PA 3GZJA 1FSPA 4NYJR 1RYEA 3KQMA 4ZTZB 4K1XA 3RFCA 4BWFB 3ANLA 4KXFB 4B83A 2Y1FA 2OESA 4B45A 3V3KA 4V38A 4C6TB 1VLLA 4M88A 1G3IA 4OJQA 4F38A 3DMYA 1AY0A 3RB8A 2ZYUX 4IPTA 3CLRD 3HDHA 3A26A 3I0MA 1D4AA 2HHAA 4DA8A 2ODAA 5TMEA 3NATA 5CLFA 3MPOA 2V9PA 2O59A 2NX2A 3V7WA 5LQAA 3WLIA 3Q7TA 1Z4IA 3MTAA 2W2MA 4BNDA 1N5KA 1QQTA 1W6UA 3GC6A 3ZCXA 3U49A 3ZVRA 5L40A 2Z1MA 2XCIA 4FDTA 5ERGB 3ON5A 3UK1A 1WV0A 2PD4A 3RKUA 3R3XA 4PGAA 4EEXA 3PITA 2BKLA 3PQFA 3W2GA 3HM2A 1VSVA 1XDGA 1YNSA 3HB9A 3MGBA 1V2GA 4ZV7A 1YZTA 2EG5A 3KKEA 1GT6A 3V8PA 3ENKA 3SAJA 4HEA1 2AA3A 3Q9SA 1M2VB 3TCNA 3OMXA 4XVUA 1G2QA 2QXYA 3EZ7A 3NT2A 1V26A 3BRQA 3NHZA 4BX9A 2ZVDA 3O2JA 4WJLA 5F73A 3VAAA 3CCBA 1AKVA 4TZKA 3OUUA 3K92A 4A8TA 3H7IA 5EQDA 3DTNA 1EM6A 2XQFA 4BLRA 4U2GA 5K0FA 4B80A 4RH3A 4ZEOA 2JK1A 4G5GA 3ITEA 1TADA 2I03A 4ZOCA 5IKEA 2AQKA 3VVMA 4WKGA 1UMDB 3C5CA 3BD7A 4Q4DA 3V8EA 5BVHB 4QD3A 3AIOA 3LAWA 2N47A 1DQYA 4YRKA 4LY3A 4UVHA 5K45A 3MD0A 1DJMA 1UFVA 5KOIA 4IJMA 1G2PA 5AJUA 4DQKA 4YRSA 2NZJA 1YCFA 2R2GA 4NX2A 3AL3A 4H7FA 3GLIA 4LPSA 2V7QA 3I0ZA 1SR8A 3OCJA 2YYAA 4D8XA 3DF7A 2VHTA 1TC1A 1YI8A 3NBAA 4L0QA 2B5OA 3K9CA 1NW9B 4DIDA 3G2PA 1YC2A 3PSHA 4MH0R 3M83A 5JPIA 1PD0A 2YYYA 3F6EX 2EATA 2W7TA 3L8CA 4RLFA 3EAGA 3LPAA 1QO9A 4QFCA 2XUDA 1K7YA 2NOAA 1STOA 1FBTA 1L5YA 1SUPA 1W9MA 5ALFA 1MVLA 3KXKA 4TV9F 4I50A 2WVGA 2VJBA 4IYRA 2GX6A 5A62A 1DKPA 3PFBA 3X1YA 3L7BA 2GKOA 4BNUA 4TPKA 1SB8A 3W7BA 1XTJA 1YHNA 3N2LA 4LOIA 1U3CA 4MW4A 2QX7A 1G5FA 5AW5A 3VU8A 1V41E 1VIDA 2D06A 4OHOA 2XCTB 2NP7A 3KOZA 1NXPA 4CDGA 5K8JB 4S2EA 3A04A 4TSRA 4RU1A 4F04A 4ZEWA 4XRRA 1OZ0A 1P7PA 2J5RA 1E2PA 3D3QA 3TQCA 2FWIA 3ETGA 5A9TA 1N2BA 2LXNA 3JQAB 4EG3A 1DQPA 2BFDA 4TLEA 5FNVA 4YMVA 1BNCA 1QG6A 2WSSA 4JLPA 1J6UA 4KR2A 4Q3DA 3U7GA 2FW6A 1XKXA 3AT1A 4LRXA 4OQLA 3NBXX 2RSLA 3QNMA 4EOGA 3TIXB 3SZGA 1T5SA 1YO6A 3S99A 4AMUA 5AVWA 2JCVA 5K8UA 2YV2A 1J2YA 2WHYA 2J0UB 3CUTA 2EZ9A 4LQCA 4BNGA 5JY6A 4EY8A 2X1MA 3GEMA 2GILA 2ZCJA 2IGBA 2HEIA 2QNBA 1U2GC 2H1HA 5BPHA 4F6LA 4Q3EA 4N03A 3ESAA 1TYAE 4X90A 4D4KA 1JDTA 2VNIA 2PAAA 1O08A 1WM1A 2A94A 4E08A 3QUAA 1F2UB 1XEXB 1RZ3A 5I5EA 1KBZA 4BRWA 4QQKA 2DULA 4KKVA 5EWJB 3D0OA 4WVLA 4CEIA 1U8ZA 2BIFA 1TI7A 2C5EA 3IVXA 4MUKA 1KQ3A 4TYWA 4JJ6A 5E7IA 1QRUA 3MT0A 4X60A 1T3SA 3OZDA 4V0QA 1UWCA 5HCNA 3LX4A 3U40A 4OUDB 3H2SA 2CVQA 2V5UA 2VRBA 5FL3A 3O92A 1PGOA 4W5QA 3RHSA 2GEVA 5BOVA 1EFCA 3U81A 5A3RA 1I0ZA 4XWWA 4NMLA 1Q5PA 3T9BA 3WQBA 1T2VA 3P0RA 4BRSA 4Y2VA 2HUNA 3ROPA 1Z6XA 1N2OA 2NPIA 4I1IA 1QQAA 2YWBA 2PL1A 2GAJA 1E20A 1IY2A 2QL5A 2ZYTX 2XUGA 3DTVD 1AGYA 3L0SA 1C7IA 4NE9A 2ISQA 3FRIA 2Y9PB 4O4IF 5LC1A 4C7VA 5CYGA 5CFQA 4B8YA 1AQUA 5K51A 4DC9A 3MLEA 4Y9DA 1ACJA 4HMQA 3OPVA 3S8EA 2WD7A 5E6RB 1I1NA 3WLNA 2F8MA 4EW2A 2GWRA 4M54A 2EWMA 1C4KA 1NBEA 3AFMA 1K75A 3WRVA 5FA5A 2RKBA 5HTKA 4GP7A 3MD9A 4PBRA 4ZDIA 1OA1A 4DMRA 4COOA 2IYQA 5GGYA 2IYVA 2V6FA 3JAKB 4LZJA 3FUVA 4RHEA 5F2KA 1DCTA 2F43B 3W3AD 5C8YB 3PNMA 4M89A 3V9AA 1TD1A 1QCYA 2HBQA 1LLCA 3KNZA 1T6NA 4IAOA 2R84A 4RD3A 1XU4A 1ZCBA 3IKJA 5A5DA 3PGMA 5K6AC 2QRPA 4PANA 1P81A 2VHUA 4E4YA 2HL6A 1JEAA 3A2NA 2WIFA 3JRWA 4XIGS 3HZRA 3KKQA 2NACA 4HATA 4H1UA 4ZAVA 3M4YA 3LCCA 4UATA 4QTZA 3DYVA 5IDYA 3MRXA 2AUNA 5FFFA 1FMJA 4DLRA 1N78A 2O5EA 2AYYA 4AJNA 3GAFA 2Q5LA 2Q1SA 2GDJA 1N5OX 3G1TA 1QHFA 4U5XA 4B6GA 1BCRA 5JS2A 1QBKC 1MEJA 2A0YA 2PL3A 2RAUA 4U9IS 5B2ZA 3VR0A 2G72A 4Q4HB 2AN1A 2PH5A 3VC3A 3IUMA 3NH6A 1QVVA 1I6KA 1APBA 4FGLA 5DW3A 2RB5A 4G8JA 2NYVA 3K7EA 3V2IA 1E2JA 4JI8B 4H7DA 3HE3A 3UMRA 3UXYA 4QYMA 5CVVA 2VJMB 3AYZB 1X38A 4EG7A 4WZAB 2WQ6A 1WB9A 2INGX 1AKEA 1X2EA 3KO8A 4PAQA 4RLQA 1O1YA 3JQ6A 2B37A 1DBSA 1Y1SA 1RWPA 2FWJA 2QORA 3RQSA 3SR3A 4YMUA 2Q2VA 4FT4A 5A6VA 3T9AA 1THTA 3SN6A 4R6WA 1RYZA 3DO8A 2H0RA 3IBCA 4GGOA 1MUUA 2QI9F 5JXJA 2UUPA 2ZQYA 3L77A 2ZU0C 1WTAA 4HDAA 1AKNA 3UMFA 2PMCA 5IEBA 2AC4A 1P1HA 3DNPA 3DXZA 4UJ3A 5D3QA 5DGTA 3KEFA 3KTAB 5FR1A 5KKCA 3C7AA 3EFEA 4NAVA 3NVAA 3H17A 1GTZA 4ZHQB 2BOVA 4PAOA 4K9KA 1GPWB 1EFKA 3Q6NA 5KKNB 2M6SA 2XCRB 4CR7A 1B7GO 1NI4B 1UC8A 5I7EA 3NVDA 2X15A 4BVEA 1T8UA 1UCFA 5KTYA 3DAFA 4US2R 1GN9A 4JQYA 3JQAD 1XHEA 3BH0A 1ZIDA 4AZ3A 5CBKA 3H2YA 3NKFA 2NU7B 4B9EA 1C1YA 2D2EA 2RAVA 4PQGA 2FPGB 5EE5B 4RA9A 4LRUA 5AJHA 2PRYA 2W2KA 3QV2A 1OJ7A 1U8CB 3K31A 1SQFA 1JMKC 3OLCX 1HQKA 4RABA 4RW0A 5LZ2A 4LF8B 2ANCA 1MA3A 3IAM6 1YBAA 1DKRA 1RLMA 2W6ZA 1EBBA 3FROA 2V45A 1I94B 1AS0A 3PRKE 1KHTA 2HU2A 2YFKA 2YH2A 2ZRAA 3NDPA 5ALUA 3SYKA 1HPLA 2OZPA 3K1ZA 4EY5A 3KLPX 2HO4A 1QX4A 3SPXA 3JTMA 1N6KA 4E5DA 3RFFA 3ZX5A 2IYNA 1Z0ZA 3QLVA 1YUBA 5DE3A 2CLDX 1XJQA 3OETA 3FCCA 1QHYA 3G5TA 3V8BA 4R71A 4RDIA 4A36A 2FSSA 4AJ1A 1V4BA 3LUHA 5HILA 3ZKAA 4DDUA 3EVZA 3Q8KA 2WJAA 1H94A 3HV2A 4NULA 4I4TF 3KEGA 4IHJB 4V24A 2C83A 5LQNA 5LYYA 1AUPA 1EFHA 4V0OA 1N2IA 4MQ6A 5CB4A 2Z08A 5LD2B 4V1CI 1UBMS 4IIEA 3VZSA 4Q7LA 4QWMA 4YHBA 3UT0A 1QMGA 1T8SA 2WF5A 1BH6A 3B7PA 2J9ZB 3OCCA 4YCJA 4FMCB 5F21A 2FPWA 4G1CA 2I9KA 1G8PA 1ZL0A 2P3LA 3CR7A 1LDBA 4A8HA 1F3OA 2BFEA 4LGMA 5TRTA 3V1YA 4KV9A 4BX2A 1OAOA 3EBPA 4JJIA 4TXHA 1Y3IA 4L5BA 1U1DA 3CX6A 1Z28A 3CONA 1PEAA 2C3OA 2JFQA 3I34X 3EPJA 3JVDA 2GHRA 1W73A 1XQWA 1L1FA 5BRNA 5BWOA 2P6UA 4CQNA 1CQJA 3AESB 3IVRA 2VTBA 4RVNA 3WLSA 2ZBEA 3NKLA 1PI3A 3PTZA 1DB3A 3WIEA 4A10A 4MVJA 1LPMA 2HA5A 2MR5A 2XDQA 1AO3A 4E15A 3L8HA 4EGAA 521PA 1P4SA 5ENDA 3F5QA 4DIFA 4OH7A 3UAWA 4NFLA 5DSXA 5HW0A 5AJWA 3RSLA 3I01A 1I01A 4IRUB 4IQ8A 1QV6A 4DPKA 2C4TA 4UCQA 3QKIA 3YASA 4Z0PA 5FUMA 2FP4B 1Z16A 3W3ZB 2ORIA 3O94A 3ZDBA 3F46A 4KACA 1WF6A 4K46A 1BQ4A 1JHDA 1S1MA 2AOVA 1AF4A 1J7KA 1X7YA 2Q6LA 4Z3DA 5BQ3A 2AKEA 1JPNA 3IAS1 4LXIA 4LK3A 1UL1X 4PEVA 5B1HA 3PQ2A 3DF9A 5CJ2A 4Q7MB 2V3WA 4UNPA 2P65A 2HDHA 3Q7QA 4C2AA 2GXAA 1L4BA 3OZEA 3EFBA 2VDMB 3DZKA 4ER7A 2Q5JA 4F2PA 1E0DA 3WGTA 4FR2A 4YROA 3NTUA 1T26A 4C7OB 3A6KA 4B81A 3A6JA 1I3KA 4CM7A 1HBJA 4G0QA 3RS3A 2BV3A 4JP1A 5A0FA 3B1YA 4BRZA 3HJHA 3TKLA 1C9YA 3H5RA 1CY0A 1VPVA 1NJ1A 4FHFA 2QVLA 3IE0A 1HE5A 1X3SA 4W82A 1N2EA 2BMWA 2JAUA 3DMTC 3IALA 2NU6A 4OQEA 4JWTA 1KPHA 1O03A 2DKFA 5F64A 3WIBA 3X1JA 4BBPA 4C0LA 4YAGA 2ZDQA 3QTBA 3HACA 3U48A 1ZBDA 3AW9A 4OMDA 2GCEA 3K70B 2WE8A 4CUKA 5EJ7A 2YQ5A 3SDBA 1ZG3A 1NQOA 3CRMA 2IOYA 3OQHA 3SHWA 3FFWA 3WKCA 3RFXA 4BLSA 4OHXA 4ZT3A 1GFZA 2EEPA 5AHKA 5JCZA 1O6CA 5FX2A 1ML4A 1QKIA 1N8NA 4ZVLA 2ZJFA 1R66A 4CQLA 5LMCA 3JCZA 3ED5A 1I6WA 3DB2A 3GROA 4IF4A 1IVNA 1QGOA 3AUJB 4R8LA 3WLQA 5DHAA 3EZ2A 2A1TR 4BU1A 3KYDA 1C1DB 4BVLA 1FP4B 3GK3A 1XZPA 3C7CB 1CJCA 2PNFA 1LPSA 2QX6A 2SNIE 4X7MA 4D80A 2O8BA 1PT7A 3VPGA 1NIJA 3BD9A 4LCEA 5CTAA 3JVVA 5JY1A 4F71A 4CW7A 3HNOA 1GGJA 2JFOA 5KJ1A 4PSAA 3ZV4A 3ESQA 4EPWA 3E3NA 4ESVA 1U6KA 2JFXA 4GC5A 1GGMA 4UQLA 2B8JA 3IA2A 1XTQA 4BMDA 2XXAB 1XDBA 2QGFA 1ZZGA 1TUBA 5U4QA 1X9GA 3DGEC 1DXQA 2C77A 2J32A 1GTJ1 2OEPA 1QIEA 4ZRMA 5AM2A 4HSEA 1OR8A 1ICIA 1O8CA 2DHCA 2YZGA 3DCIA 3K2QA 3NBFA 3OJ0A 5D7NA 2ZM6B 1ONSA 1JQ5A 3DDZX 3HK2A 2MSWA 3VNAA 3QYAA 3NWEA 1ELOA 2YWCA 4TUYA 2CZQA 1Y80A 1CS0B 2R6CA 1RJ9B 4AS3A 3ZI0A 3HCCA 4R7TA 4WZBB 1W4LA 3KLNA 4GP9A 4L3OA 3VPXA 4E12A 4M4SA 3A0UA 4DIBA 2VF5X 4NFYA 4X00A 4TLCA 4A8JB 4BKRA 5E0KB 4FFBA 3I5XA 2OAEA 3SDSA 1PJZA 1SUBA 3DXFA 121PA 2XGSA 2X19A 3GVHA 4N1AA 1G0NA 2HIHA 3LO8A 2BUAA 4R2LA 1E77A 1FP4A 5A2QA 3PDWA 1G41A 2C7OA 5J2TB 4QTXA 2JHAA 4NP6A 5FI1B 2JFFA 1UMKA 1ZD2P 4DSOA 2BFCB 4OP3A 3NIFB 4HTFA 1TYZA 5JD4A 4QXAA 2XE8A 2AW3A 4K40A 5AVJA 3OT1A 2FWMX 3W05A 3DDUA 3PEEA 3IPAA 4K1LA 5JS8A 2KB0A 1GKYA 1WUYA 2ACKA 3CVJA 3KD2A 2XUFA 4P33A 5GONF 1H9CA 4TXJA 1USGA 1K3FA 1ZL2A 1PR5A 4HWRA 3PRJA 2AG5A 4QT4A 4F92B 1C80A 1QAQA 1H2XA 1Y5MA 2XNSA 4Y2QA 3KVRA 2V7EA 3BJIC 2WA2A 5JSHA 3S44A 4UMDA 4YMSA 4NKRA 4DE5A 1J2RA 4OIMA 4YCCA 1GTSA 2X1LA 3D6UA 3RHTA 1RLTA 4S1WA 2FVYA 5AW8A 3AM3A 1IHDA 1MRNA 4L8VA 3V8RA 4JP3A 3KUDA 3RDPA 4R8SA 1DQSA 3VSAA 1JH8A 3AIKA 2X41A 1LF5A 2ZJ8A 3B5IA 3TX6A 4LJ5A 3BQNB 5IC6A 2PY6A 3HEAA 3TECE 1CFZA 2H2WA 1KR2A 4LGYA 3TEMA 3VV3A 5HHTA 3AR2A 4C1BA 2XZTA 5I45A 4N41A 4C4PA 2GZ3A 1K8RA 3L1HA 6ABPA 4Y2JA 1XKQA 3NRBA 4CM9A 5JD6A 3DQZA 1T36A 3FXAA 2H1SA 4X1KB 4CLRA 4K87A 5FF9A 3OM9A 3UF0A 4N76A 2DZDA 1GILA 3SICE 1DFIA 1OBOA 1GFWA 1Z6ZA 3QQPA 4WKCA 1VI2A 3ETNA 4MLCA 5BWCA 4YLEA 2C1ZA 4YP5A 3RVBA 4CG3A 1OV6A 4IXNA 2I67A 2NV6A 4OJMX 3ZGZA 2Y1EA 2IXFA 4YRNA 4UDXX 1U90A 2PCJA 5CCEA 4YALA 1TU0A 5TQ2B 3DMFA 1MDFA 3R3JA 3LVFO 4Z9XA 3GAZA 3H18A 3UYKA 5H9WA 5HTOA 4O2BF 1A2KC 1RRVA 2OG1A 3DCYA 5E8RA 2PS3A 3PEUA 4O4LF 1S01A 2QJWA 3H97A 4FGSA 3LQYA 1ODSA 4AUNA 2QIPA 4B44A 3ER8A 1USVA 4DLBA 3HCDA 3NB0A 4JI0B 1G63A 2B35A 1QE0A 2H06A 4AI6A 1H3EA 2ATEA 2JIBA 4HUJA 4LYYA 4MARA 2JG3A 3MJHA 1W46A 4KIWA 3VNSA 2BHSA 1PZNA 1OYYA 3L1KA 4HWTA 2OMEA 1PV4A 3TE7A 1GYPA 3ZWVA 2X4GA 1CU1A 5DM0A 4CKWB 1I0IA 4PQEA 4AF7A 4MV0A 2WJWA 2AIRA 2J3KA 5ILOA 3O7WA 3E23A 4OK6A 3VPFA 3KR1A 2UUCB 2OL4A 3FIUA 5EJ6A 2FPPB 3DE7X 4HDOB 5HDQA 3CLTD 3THOA 5B55A 3ICPA 2QTZA 3LRXA 1WCWA 4X1IA 3LXRA 2ZYSA 1QKKA 4TWAA 4DA9A 2FJ0A 2Z8YM 1T25A 2HV9A 5F7XA 4KR3A 3M1LA 2UDPA 4FMBB 4UEOA 3HA5A 3UGQA 1UBRS 1Z5GA 5L3ZA 3J80A 1ZM3A 4JJAA 2WZQA 2O5RA 5E6UB 1QTIA 2Q99A 3GDOA 1N34B 3LWBA 3RF6A 4LYGA 3PCXA 1VE5A 4YRIA 4ZWNA 3EG5A 3PA8A 5J5AA 1B8OA 4BXOA 5FJIA 2DPLA 1B0AA 3CPHA 4PTLA 4RYLA 5SYNA 4PPNA 1MX3A 4B3FX 4C5AA 4OJYA 3VR4D 3CZCA 3E1SA 5EZYB 5A4DA 1EFDN 2BFDB 2OOSA 1IMOA 5FNVB 1JLMA 2VJOA 3AR3A 2H9IA 3INNA 1GV1A 1DKOA 2C2YA 3IRUA 3P5SA 4HQKA 1QRRA 1D2NA 4FGJA 4K7JA 5ELLA 4D98A 4CETA 2P2LA 3ZHXA 2RGBA 3QKTA 3R7SA 5L53A 3RR2A 2H65A 2I76A 2NV2B 3TD2A 3SVLA 3JQRA 1G8KA 2CDBA 2IF0A 2RH9B 3K0BA 2H1OA 3M5WA 5C8DA 1DJOA 3EXEA 3REOA 4IS2A 1YZNA 1NW8A 1ONNA 1QH8A 2FR1A 2KSQA 2PMDA 2X0KA 2QXUA 4JI1B 1MU0A 3UGJA 1JQ3A 5FL7A 2GCOB 1YVRA 1QQ6A 4IJKA 2IV7A 3B1KA 1HDEA 4C4ZA 4QJ4A 4KO3S 2YN4A 4BNMA 1E4EB 1EP9A 4EDFA 1KMNA 2P0AA 1ODCA 1IUNA 1XQ6A 2FMUA 4K6MA 1KAMA 3M9XA 3NNSA 4RJIA 1S4MA 2YASA 3L5KA 3PX3A 2HWXA 4H08A 4C88A 1WO8A 2ZTSA 5CLLA 5HEKA 1W19A 3LKBA 5KYYA 2YHAA 2HGSA 1Q1NA 2N1MA 4CFZA 1JA0A 5G0WA 1RXUA 2J3JA 3BL8A 1TW3A 3IOEA 3QLJA 1SBQA 3G7SA 2I22A 2YHSA 3GH1A 3IX7A 4MS3B 8ADHA 8ATCA 1QDEA 2V1UA 4LFBB 1SWVA 2EERA 3M9WA 5IXSA 5CM9C 3BEDA 4V0RA 4LX0A 1ZOIA 1UXHA 4INOA 4B6OA 1NKSA 3O0TA 2VVTA 4QARA 1E2NA 2JIMA 1M8FA 1XP5A 2RGNC 1PHPA 4GBGA 2X4LA 3CF2A 2BGNA 3DNMA 3UWSA 3PGLA 5KU1A 4LJSA 4NNPA 3DV0B 1RMYA 5BSKA 5IJ9B 2CFIA 3F3SA 1E3WB 1JR3D 2P7HA 5HK9A 2IBMA 4RD0A 1W7AA 1VE1A 3OQIB 4CLDA 1NLUA 4FGZA 4G2NA 2W0MA 1E96A 1XB2A 4JEMA 3KJQA 3WIUA 3PD7A 3KXLA 2VAXA 1OILA 1QVAA 3KOXA 3E0QA 4ACAA 4E6PA 4B4WA 1L6RA 2R11A 1H1TA 3EC2A 1BH2A 1M1ZA 1TM5E 1K92A 3ENWA 1DHTA 1Y5LA 3H9UA 2YMPA 4FEEA 4R1QA 1Z4JA 3W6ZA 4DG5A 2P1ZA 3RANA 1WPGA 2IEIA 4W63A 1ZBQA 4E07A 3KYIB 5KC8A 1YOVA 1N3BA 2UVQA 2V0CA 3PNSA 5DCLA 3TTVA 3ZXXA 1ZJ5A 3W78A 3MBIA 5HKOA 4NYJQ 5TDHA 1GA4A 2G76A 2BF4A 2P78A 2X4DA 3ZV3A 3T0GA 3REQA 2FK8A 2OXEA 1ZRHA 3T3EA 2Q3BA 5IT9A 2GD0A 3AJEA 7ADHA 1MVNA 3WMGA 2ZE5A 2E1RA 1NRJB 2GK7A 1YRWA 4RADA 5DKFA 4DDVA 1HDGO 5LU9A 3KHUA 4TTTS 1L8OA 3PR1A 5C7LO 5KO2A 4TTPA 2JH9A 2B4TO 4JBIA 1T4CA 1FSGA 1ZXXA 5EIEA 3TOSA 5B4TA 2G80A 5BSRA 1S2GA 2IY7A 4L3WA 2I4MA 3U4HA 2F43A 1JZTA 4QYIB 5I5GA 5C8YA 1G6Q1 1NXTA 1NPDA 1S1CA 3DZCA 3KQYA 4JHLA 2GRUA 2R1ZA 1RXEA 3FTDA 2X9GA 4Q3BA 3I9LA 2Z3ZA 1H0HA 4RBNA 3T5DA 2QGZA 3BCUA 3HYRA 4DARA 3LH5A 1GTL1 5L3SB 5A0VA 4G1MB 4OV6B 3NBKA 2UKDA 1QF7A 1CVRA 1FRNA 3IUPA 3SS9X 5LXTF 4R0MA 1SCIA 1TXGA 1DKQA 4US1R 1C9KA 3KKKA 4S1OA 5BNTA 3AHFA 5FWXA 2X7HA 3IQXA 4YJGB 5JE8A 1CPYA 1C14A 2XCLA 2W4MA 1EFPB 1WCIB 1JIIA 1CY6A 2ABWA 2PUTA 2H07A 2NGRA 3OFJA 1NLZA 4EH1A 4NAUA 1WLYA 1HC7A 1U9ZA 4DQUA 1JV2B 3BS4A 1V3VA 1SD2A 2H54A 1JJAA 4LA4A 5C35A 1YDWA 1P9WA 1YBVA 1RPAA 1UAYA 3WWEA 3GEBA 1VJCA 4JLVA 4UM9D 3F7MA 1XCJA 1YA4A 2JI4A 4G5OA 3R7WB 4B32A 2YVUA 3EISA 1QK5A 2RGNA 3K8OE 3QBJA 4QGAA 4X8OA 4I5DA 5IKPA 1HG1A 1G60A 1ADGA 3PGXA 1EVKA 1HT2E 1ZD1A 2D5IA 3KSRA 4UBKA 1CP3A 1XEXA 2VF4X 4OBEA 4F4UA 1PYOA 3FZEA 1IBLB 5EFZA 4I1SA 1CDZA 4Q9NA 4J16C 4OXIA 3CRRA 4K6GA 5IVPA 4KVGA 4R2JA 2CMKA 3GRFA 1AS3A 3Q8WA 4JJEA 2EU8A 4II3A 5E3IA 4BLTA 4E2YA 1U3GA 4OXKA 5EQTA 4IP0A 2ZCVA 4XTCS 3FX2A 3I23A 3J7AC 4IDDA 5A4KA 1SXIA 4KLRA 3A6FA 3GPLA 1D8TA 2C8VA 4GZLA 1ZCFA 3KB6A 5HCUA 2C3UA 5KHAA 4C29A 4D4LA 2Q6VA 1SZPA 1YD7A 3VYTB 1U8UA 3FYUA 4G1BA 2CCJA 5KTMA 2OV1A 2OO5C 4OJNA 1TECE 1IJKA 1NULA 1GTG1 1L4YA 2HCRA 4NATA 2OV4A 5AVXA 2FGJA 1UKYA 1NMXA 3L49A 4IOKA 3BBLA 1GZ5A 2F62A 1PLJA 2FEMA 2FUEA 4H7IA 5BSTA 3ONEA 4YVFA 3TNLA 3Q3HA 4MCIA 1YDFA 2O57A 3FJ1A 5EMMA 3RT1A 3BK1A 1VTKA 3PDIB 3IP8A 4IF6A 3TLYA 4CQMB 1RJGA 4X7PA 4BVHA 4XARA 5JPDA 4L22A 2FVXA 1AKYA 4PWZA 2BI4A 1ATIA 1NM5A 2QX4A 3HVJA 1PNVA 1DU4A 3BXEA 4YDRA 2F4NA 4JGIA 4C7JA 1Q2UA 2VF2A 1CNMA 5FWDA 4C0XA 2H1VA 1YB1A 2R751 4OFZA 5EP1A 3WLJA 1ISFA 2AMJA 1ML3A 5KSOA 5AKIA 3JZAA 3ZDEA 4EGSA 2I4LA 1O0CA 3OIDA 2NXJA 5MFZA 2LCIA 3NHPA 3AQ4A 2J3EA 4E14A 4FZ3A 3VO1A 2OWEA 3E58A 4LK2A 5KNBD 2PUDA 1TNDA 5IJAA 4WXEA 4YJ2A 8MHTA 4RV9A 1UBNA 3QHQA 1KY2A 2Z4TA 4HPWA 4PAGA 2GBGA 3PC8C 3FOEC 4Y1GA 1A8UA 1ENZA 2VJNA 1FMCA 2H11A 3G1UA 5H16A 1R4AA 4ZOBA 4YRJA 3VKHA 1JN0A 1G21E 1HQDA 1KI7A 1IQ0A 2AOUA 2WMYA 4RJKA 1C7QA 1UBUS 2ILVA 2RB4A 3T1HB 5ALOA 2OORA 1QAMA 4B82A 3MCWA 5I6DA 4HMPA 1E1DA 4M0FA 1VOTA 2W93A 3AFNA 3M6AA 1RWOA 1ULUA 4FYIA 4J9VA 1KH2A 5I7HA 4OHYA 4NFHA 2JGKA 3A1CA 3OTHA 4XKJA 4B79A 4F3NA 3SQXA 2NMVA 2EL9A 1IHXA 3CN9A 2OCIA 1UZMA 2PZ8A 1MG0A 4G5XA 3GVIA 3KEOA 5JC1A 1EDEA 2VOJA 3DXYA 3OZ7A 2V6JA 3NTVA 1AF7A 2G5TA 2PPVA 2C88A 2HMWA 2NZ2A 4FFDA 2D62A 2EP5A 4A5SA 2A86A 5HQ3A 2C3PA 4J1SA 4PR3A 2QLBA 2O7NA 3ISTA 4MS1A 5G02A 3EH1A 5A3SA 4MKXA 4L0CA 5ERXA 1FNSA 2G17A 1QSGA 5A9SB 5BR7A 1T9GS 4TUYF 4YIKA 2NO5A 3V55A 1Z83A 4M1EA 1K98A 3FM9A 3GD5A 3KJZA 1XC7A 5DOZA 1AHIA 2IYFA 3ZXSA 2AG6A 2VPYA 3PJEA 4NJMA 2YR0A 1VCNA 3Q5EA 1KL7A 1M2VA 4JJ8A 4NV3A 1R8YA 2QXTA 5TT0A 5JISA 3M70A 1M0TA 3O1JC 3QFHA 4KO4S 5J2UF 3JD1A 2QP4A 4PR0A 1N9KA 3DBRB 2R6ZA 2GAIA 3D8NA 1G3MA 4R8VA 4BC0A 4LC1A 4EYEA 3L18A 5B6JA 3BKWA 1K5GA 4DV0B 2C98A 5HDBB 2EF0A 2FZVA 2VQDA 1HL7A 3Q98A 1FJGB 1ZJYA 4LQLA 3OCVA 1KIMA 4M86A 3V80A 4E5VA 3NVKI 1T8TA 3T7IA 4YQFA 1WMFA 1C8BA 4C6HA 5T41A 3OWXA 3FKQA 4Z7OB 4TWRA 3HDTA 2FRDA 3OU7A 2GSWA 3T3NA 3OHSX 3EVFA 1ACLA 3TAXA 2C7QA 1EDZA 3K6JA 3D9QX 3IBSA 1IHYA 2JRLA 2ET6A 2EYQA 1OLSA 3LBFA 3ZLBA 5BWNA 3QJ5A 3C3CA 5GONA 4W9MC 2ECQA 1C1XB 2AJ8A 3O03A 4MHOA 2ZIZA 2FFAA 4P3NA 2KBEA 1QFSA 4QIHA 1V35A 2BTQA 1S5PA 3O4GA 4JLOA 4AF8A 1QRDA 2CZCA 1RI4A 3MT9A 2ZAGA 1LS6A 1QG0A 2Z5FA 2YV5A 4U2FA 1Y81A 3KFXA 1FX1A 3AR6A 2EW2A 1YS4A 3TNFA 3UQZA 3TW6A 3WMXA 4OOFA 1H93A 3UCEA 1N2CB 3LL7A 1J24A 3DPUA 4IM7A 2OD7A 4B3BA 2H4XA 1TOAA 3SJZA 4KXVA 1D0SA 2Q3FA 3WLRA 2ZIEA 1G2IA 2ATCA 1T0JB 2CBXA 3TH5A 5CBPB 3T4EA 3NQ41 4WFQA 1Y89A 3PNBA 4C3UA 3AVUA 2BMEA 2W6JA 2F2TA 1H05A 1NVVR 4P8RA 3V7UA 1KSJA 3WYNA 2DCUA 1PDWA 4AIIA 1HOTA 2ZEJA 3HKEB 2MT9A 4HQFA 2FSVC 2G09A 1EUDB 2WC1A 1CUSA 3W5HA 1ISGA 2P67A 1QOZA 1N7IA 2IU6A 4HS4A 2Q0SA 3C98A 2QZSA 3RK0A 4POOA 4DV3B 3EVCA 3FCSB 2EV9A 2FEWB 5AW9A 3IMEA 3I61A 3E9QA 5JAIA 5AUQA 3VJRA 3ZQUA 1A4RA 2PQ2A 4WE3A 2FFRA 1FW6A 1T0HB 1F38A 4EJSB 4FFMA 1U0BB 5ENVA 1HWYA 3L4SO 4DJTA 5EP3A 1E9CA 1WKVA 3EA0A 1WNFA 1S2IA 3EVBA 1E6LA 4YFYA 1NPYA 3G2LA 3TVYA 5KTPA 2P90A 4UAGA 2LCFA 3G49A 3VU0A 4U39A 4QL3A 2JH8A 2IW3A 4H16A 2GXQA 3DE0X 1POXA 3I72A 5IKMA 4N47A 1E4EA 3DWIA 4YXWA 1BQ3A 1RWMA 3KWMA 5LUAA 1X74A 3CB4A 2W2VA 1W93A 1R4ZA 4DA7A 3FVQA 5J2UB 2Z9BA 5K3BA 2HLPA 2A3RA 3DC7A 4INPA 1UOPA 4WZZA 1BEEA 1XDDA 2JBAA 5DK4A 5GY7A 4HWGA 4NHEA 4UCWA 1M0EA 2AJTA 2H18A 3ZE1B 5DHPA 3OEYA 4DCUA 2DP4E 1U8EA 1U1CA 2XADA 3R0VA 1O94D 1W8IA 2ID9A 1CR4A 4GOLD 4MCHA 5E1MA 4RM3A 5FWAA 3GR6A 4XWOA 1V43A 1CJKC 3OLQA 2HZBA 4I36A 4P7KA 4C5BA 1N6RA 4XWAA 5EP4A 5IWAB 1W8DA 2IUSA 5D85A 4H7PA 2X0DA 3G0BA 4ZJYA 2JKZA 2YQZA 1W35A 4G0PA 4Q1VA 4RWEA 2H17A 1L7DA 2PGJA 3AJ8A 4REOA 4EMUA 3F98A 4BB5A 4MI3A 2O19A 1DQNA 2B4YA 2VK2A 1RJWA 5MF6A 4RUKA 1LPOA 1EGMB 4U2BA 4YXWD 3EZ6A 4MQFB 4O4IB 3AYXB 5BR4A 5ARBA 2ZSHA 5EKUA 4EMTA 1OLSB 3BMQB 1LSOA 1GCIA 1U7ZA 4WESB 1WXHA 3OI7A 4BZWA 2ORWA 5D86A 2P6RA 2D5AA 1SXPA 3CINA 2JZCA 1P33A 1SKYB 2WIBA 1I8TA 1U7WA 3IP1A 3G6WA 4NPHA 1SXJA 1MC1A 1Q12A 4CLHA 2XZOA 2V03A 2JLQA 2QAGC 1DCKA 4B3XA 5KJCA 2YVLA 2BH2A 1EWYA 2IOQA 1Y8RB 1CUHA 4LMPA 3OX1A 4FSXA 4Z2YA 4AMYA 1NYLA 3PCRB 3TGWA 1HF3A 1KOJA 3RSFA 4LFCB 1L4KA 4MR9A 5C5DA 4IJ5A 4ON9A 3TRFA 4C0HA 2F3UA 2WSMA 1ESMA 2AB0A 3B7WA 4E2WA 3HVRA 3VU9A 1OLUB 2V7QD 4ER3A 1G5TA 5J9FA 1HV8A 4A5OA 4BATA 4C4AA 4DDKA 3MW8A 1XLTA 2NQTA 1C50A 3PC8A 3TBFA 1TYEB 3NYIA 5E2IA 3MB8A 1TU4A 1JIKA 5H82A 1J9EA 1YR3A 3QF4B 1AX9A 3N3BC 1IM5A 1ZNQO 3PZBA 5EXPA 2AKYA 2K87A 2IV3A 1IWOA 4KQCA 3EDCA 4ZFNA 5J1SB 1M2KA 1OU0A 1I1HA 4Z1MA 2QMEA 3HLTA 4B3GA 4BC1A 5KQRA 5AJZA 5HZKA 3COJA 1KFEB 3AJAA 2AR7A 2IYXA 3DEFA 4CIAA 5B2EA 4Z1OA 2W0SA 2B21A 1QMPA 2XLCA 3T4XA 3UUFA 1UT6A 1GZDA 1KDOA 3R5TA 3NHSA 4WOKA 5DT9A 1R4NB 3IDOA 4LZWA 1OI2A 1GUFA 4WECA 3ZD8A 4Z7NB 2G1JA 3RD5A 2VRWA 2O3SA 2VUSA 2NZVG 2VZEA 4W6ZA 4U9HS 3WQRA 2R86A 4CLRB 5LN1A 4MITA 1GZVA 3VKUA 3OJXA 1UXJA 2D1SA 3SXJA 3EXHA 4L8FA 4DM4A 1DG3A 4JUDX 2N46A 3L93A 4HGZA 1AKMA 4X63A 5CPBA 2WAYA 1WOYA 3O3OB 4D82A 3PS9A 5KREA 1IEQA 2PO5A 1WF3A 1R0SA 3AL0C 2A9PA 1ZCJA 1GA6A 2WUFA 1CUGA 5ALZA 2Q8QA 4LJ7A 3W2TA 2AXEA 3ZCRA 4Y6GB 2HRDA 1H8HA 2AK2A 2BHTA 1FY2A 4BWVA 1GUDA 4ZEMA 1OGIA 1LW7A 5JDIC 3M3DA 3L04A 1F5NA 2G83A 1T3LA 1G8JA 1XU9A 2JCSA 2OCAA 1Z2AA 2QU8A 3FI0A 3H1PA 1O8BA 3A6EA 3SMVA 4D0NA 2ILTA 2GZAA 1G8AA 3H3XA 5AI4A 2EP7A 3DTYA 3F1LA 3OCUA 4RQUA 3CUYA 4HAVA 5LBUA 5DM60 3N0TA 2OHHA 3PUIA 4UZSA 3QRWA 1YCGA 3LUJA 1V7PC 1VMKA 3GUVA 1C0PA 2A0KA 1OYOA 3KHSA 4HRAA 4NVRA 3S27A 3TL3A 2YJGA 2JIPA 4MDEA 3ZY3A 2N75A 5ANRB 3RCBA 4R1UA 3BMOA 3ZDFA 2VT7A 1W36B 4C87A 5K3FB 4DILA 2J4FA 4EKIA 4P4GA 2VNSA 3CLRC 4NYIR 5GIOE 2COEA 4RO0A 3WYAA 5IZCA 4FT2A 4HB4A 3O9ZA 2ZUUA 1NSFA 2HCFA 4ZOEA 3VC2A 3DMRA 1PQYA 3O91A 3R23A 1A88A 5J2TA 1VXRA 3GLHA 1FUEA 1M2OB 1SCNE 5DYGA 1SUSA 2HXYA 4HLNA 2ZSAA 2B8TA 4WZAE 1N9GA 2GEUA 4C0WA 1ZOOA 3R5FA 4L7VA 2C2HA 2OBFA 2E21A 4O08A 1Z74A 1FNBA 2EX4A 2GPAA 2JIZA 2JLSA 2P77A 3OX2A 1SC9A 3W8DA 4EJSA 3IUYA 3I5AA 5AESA 3CU5A 3EUFA 3PE3A 3V1UA 1HQYE 3KYCA 1ILEA 1CE8B 5FUBA 2VO1A 4LZPA 1ZH6A 4E51A 4XEUA 2YICA 3BMNA 4PTYA 4M6WB 1Y37A 1EXNA 5KOJA 4DMFA 1VLQA 1BS1A 1KI6B 4AW9A 3QTTA 4PLFA 3LF2A 1NI5A 2QYOA 3BC1A 6AT1A 1NE7A 2HNBA 2OZEA 3AHIA 5KQGA 3OZVA 3R9WA 1ULHA 3T34A 3MCZA 4GOJA 4YP6A 2ATIA 621PA 4O2LA 1XA4A 1X2BA 1SRRA 4I8IA 3W6OA 4DR3B 4FMCF 1ADJA 3F4KA 4MPDA 4WOJA 1QYWA 3QMMA 1RWBA 3BGWA 3D6NB 3L0BA 1KMIY 2EKZA 2MYTA 4Z8YA 3IUQA 1WUTA 4XJSA 3RWMB 3W9SA 4NMXB 1YRYE 4LZAA 2ZWVA 4EELA 5I3CA 3KZNA 1T5IA 4X1YB 3TJMA 3WYEA 4QGGA 2BTQB 4BRUA 4COKA 3WGQA 2H4HA 3LQ4A 2WTUA 2R0QC 3F3KA 2HJGA 3SS7X 2J7PD 3K5IA 1AKTA 1KA9H 2BE7A 3LQFA 3V2HA 5KWJA 3WR5A 2EWWA 2GZRA 2P9TA 1L7OA 2YIMA 3TQIA 4LE1A 1T1SA 1DDGA 3DMDA 1WABA 2YDXA 4K3UA 3THRA 5JNSA 1O5TA 1WPXA 4INJA 3ZV7A 5EMNA 2DM6A 2VR1A 3K8ZA 3L8ZA 5GOZA 3AUKA 4CMGA 3WK8A 1DBRA 3WDMA 1SY7A 4QUDA 4YDHB 1VLVA 4EGCB 1K8ZB 1LLFA 2CL7X 4R54A 5DGIA 4G89A 5A5GA 3LGAA 3COVA 5JMOA 4BEJA 1QYXA 1UUFA 2E48A 2B20A 2W98A 1YL6A 3LI2A 2O1SA 4GPAA 3UK6A 4ARVA 5BPFA 4LKRA 3QXSA 4ZGBA 5JADA 4BPBA 4P92A 1B0ZA 4AB1A 4WCDA 2R4QA 4C7OA 3GEIA 1JKXA 1AXEA 1E5DA 2NT3A 1H2WA 3QMPA 4URZR 4MUGA 4LECA 3VVCA 1KEVA 3E3MA 4F84A 1XYYA 3C3WA 4P4UA 2GUWA 2PG3A 4QPJC 4PX2A 2VZ0A 3GLHE 3MS4A 5FLXA 4ZYUA 1XPOA 1RRPA 2JLBA 4KO2S 4BFXA 3SFTA 1MOQA 3C3DA 3PVZA 2DH6A 3DKPA 1EUDA 3F6PA 3STVA 1BVYF 4H7EA 2CNWD 5K3FA 3PYXA 1W5EA 3UJ6A 4IQ0A 1Y1PA 1G20A 1SO8A 3SBXA 5CB6A 2BT4A 5K0LA 5JH7B 3CZQA 3T3HA 2D1YA 4M37A 3U0BA 4KXNA 4P4LA 2ACWA 1I4OA 4MAMA 3W1WA 1IBMB 1TIPA 2ISCA 4IQGA 1JEQB 1KAGA 2R25B 3E82A 4QU9A 4REQA 3RHFA 1NHGA 2CJWA 5EJ2A 4RL4A 4JBXA 5KNCA 1YJ5A 3IPCA 5C8VA 3T5AA 3CHYA 2YV1A 3GT7A 2FPRA 1TT7A 3BAZA 4UM7A 2G1AA 3O6VA 4RM2A 1U4SA 3L4BC 5DNEA 1TB4A 1SRQA 4TMYA 1NT4A 2JIOA 4R1MA 4BASA 3WWYA 2IS2A 1UBJS 1SG6A 3DL2A 1W49A 3UANA 5KIAA 3DOJA 2REOA 3U7QB 1PZFA 1K97A 1Q7BA 3V4ZA 4ZI7B 5EJ4A 1SC3A 2PV7A 4LCJA 1FA9A 4X93A 5T6BA 1OBFO 3T0IA 3K09A 2Q1UA 1Z33A 1K3UB 1MJ5A 3B1JA 3OM0A 4MV6A 2DT5A 4FJ1A 5AI5A 1M6YA 4TQGA 5P8WA 3SKYA 3DONA 1R8XA 1VLHA 3CMMA 4GI3A 4L75A 6REQB 3HADA 1IMJA 1YGPA 3VO2A 3AVPA 4CEIB 1Y4AE 1EGVB 2UXCB 4F4IA 3GIWA 4AK9A 4QGFA 5CRIA 1JH9A 1GZ6A 2IXTA 1KNXA 1ZJJA 2HA0A 2JAQA 1VG9B 1AKWA 1UFKA 1W85B 2HRZA 1PS8A 3DH0A 3EZXA 4JIMA 4MP8A 3NEPX 4FU0A 1NY6A 1PG0A 3PLNA 4QJBA 3LOQA 3KKZA 1IYZA 2I8CA 5BXQC 4OQFA 3I9NA 3PNPA 5K8IA 2NYUA 2LR0A 1KO1A 4J90A 1Z2EA 3OCXA 1DAFA 3KPUA 3VYUB 1EBFA 1RQXA 4H3SA 1I7SB 1P2GA 1HYQA 1Y82A 1ZAYA 1P74A 3GT3A 4M7OA 3QOFA 1CR2A 1K4MA 1RKUA 1AIPA 2WMOB 4QXRA 2J07A 5GINE 2P9EA 2QLJA 2ZUFA 1E5VA 4YUVA 5P21A 1AQNA 4XGKA 4IQ4A 4AY6A 4QFBA 2XX3A 2C54A 3PXXA 2WVHA 1IWBB 1OLUA 5BYAA 3VU9B 1BGWA 5FA6A 3L9XA 4NC9A 4HXEB 4WNAA 3THSA 4E5KA 4EG8A 2X8WA 4LNUB 1XWWA 4DGQA 4JBWA 3TSOA 1NJ5A 2YJTD 3C5VA 1FTWA 2OVFA 4M49A 3VPDA 5BSFA 3K0SA 4CUJA 3HUFA 3V6MA 2VXOA 4LHYA 4DYVA 1XQ1A 4P5DA 3WRXC 4FLEA 3ZNQA 1YQUA 1ZXLA 2JATA 3O31A 1J8DA 4NECA 4RK6A 1D2HA 1O87A 3CB2A 1YS2X 3E35A 4UUQA 4JQZA 1MF7A 4E4RA 5A4JA 3E70C 3A6HA 3CPEA 4BTEA 2BMDA 3OJFA 1QTQA 1MH1A 2EKDA 2XODA 2XWPA 4HQ0A 2C7RA 2WWIA 4H4DA 1DL5A 4M9RA 5BUQA 4AXBA 2O6LA 2SCUB 4ZQGA 2BFMA 2WOOA 2EFCB 4RIFA 4UE2A 3FFBA 5SY6A 4HLCA 4AJLA 1UC9A 1C4OA 3E81A 4K8RB 3C2QA 1GPBA 3L40A 4QBFA 4RXMA 1JSLA 2C4UA 4YRDA 3MLBA 1YOBA 1NIPA 2ZSDA 3NV9A 3K35A 4C5CA 4RTPA 1YL5A 4ZXFA 1MD9A 1K7FB 4Y6PA 1IY0A 5JBQA 3RC3A 1C9NA 1TTHA 1LVHA 1RAHA 5FUVA 3CF6R 5BUSA 2FX2A 1FBNA 1SH7A 3R3YA 4JL5A 4MK4A 5KCZA 1VLZA 2HXSA 3GFBA 4H4EA 4ND7A 4YMWA 2QVGA 1XCBA 3RFUA 3HPQA 4HX2A 2G9ZA 4KYVA 3GLGB 2Z2ZA 3AVQA 3LY9A 1MQAA 3T7DA 3TVDA 1NBOA 1Q14A 2C1XA 2NAPA 4TLLB 4KWEA 4WZAA 1JTVA 3R20A 3QFSA 1WDMA 5IDQA 1RWVA 1U2QA 3WICA 3U60B 1B1CA 4TLBA 2O3UA 1YHZA 4QFDA 4M38A 3LZ6A 2B5VA 3D4NA 2XCSB 1XRPA 3BULA 3GXOA 4HFRA 4EHBA 1XVTA 4AL4A 2KS6A 4WOBA 1JXMA 4EITA 1I4DD 4E5UA 4DR4B 4P3KA 4N5HX 4HGPA 2BZ1A 2XPCA 2Q07A 3U9LA 3DE5X 4ZALA 1LV7A 1BRTA 3JWGA 5E0OA 721PA 1SZJG 1BX3A 2P5SA 3TMAA 4XCVA 5AOAA 2Y05A 4F97A 3FMVA 5JRZA 1XMQB 3ZHVA 1PNTA 1X77A 3CZAA 2Z2KA 1U5AA 4ZAXA 4B3MB 2IVZA 3M4XA 2WPDD 3FHCB 3PNYA 3HO1A 2F8LA 3QPBA 5ER9A 1MTZA 3D0RA 1RAIA 4HLUC 3ZOZA 3G9TA 4QBTA 1QZZA 2VDWA 3S1SA 1KU0A 2CFCA 1QHSA 2P2DA 4NRDA 4BMCA 2BLLA 3F47A 4RV5A 2CGEA 1RRMA 2VYVD 1QB8A 2LKCA 4OL9A 5D7BA 5IFLA 1TUEA 3FCYA 4U2EA 1V6CA 3JAKA 2XT6A 2B92A 3HKBB 2VUIB 3ORSA 1EU1A 4LF7B 2OFWA 1TAHA 3DVAA 3OD1A 1KF0A 1N6IA 4RGVA 3LUCA 4Q6WA 1K5HA 2FE1A 3B6ZA 3DUFA 4QDZA 1BROA 3E18A 4MVJE 3U4MA 3IIIA 4KLAA 3ZVLA 3KV1A 5DYNA 4ID3A 2QY9A 5EMKA 3Q6MA 4M1TA 3WXBA 1Y7HA 3OKAA 4HT3B 2WKQA 3IS3A 2NYAA 3FFXA 4KGXA 4ND3A 4KDRA 4R9RA 4Z9YA 2AEMA 4D2IA 4Z6KA 1M1XB 1KYQA 3IQHX 3A9CA 1X8LA 2GEDA 3HRKA 1AURA 2LRHA 3N0VA 3Q9NA 2WSYB 1QLJA 4MX8A 4I8DA 5T7BA 1Y1TA 3Q87B 1J8VA 4GWLA 4WBXC 1ZMBA 3R09A 2WMDA 2Y6UA 4CKBA 4DCPA 3T7RA 4ZIRA 4Y1FA 3RVNA 1D6NA 2G1KA 3UATA 1YVDA 4YXFA 5KYUA 5AK5A 2ETXA 4Z0NA 3TN7A 5JHGB 2YN2A 3QJYA 1FP6A 1QZTA 3L7KA 3OMLA 2V7TA 1DAKA 4CTOA 4A15A 1BOOA 5IJ0B 2Q4DA 4YHHB 2QJOA 1Q0TA 1AB6A 1RWNA 3O4JA 1K7CA 4QRIA 1EUZA 1XZHA 5I8WA 1UPBA 2JD0A 1J2TA 1VLJA 5K99A 4DCNA 1R9MA 5IAJA 4ZYYA 1TEZA 3F49S 4OXNA 1P0IA 2KPOA 4XGQA 1EI9A 4GWGA 1GR1A 1PFQA 2OV6A 3NBUA 4RZSA 2PUGA 3TM4A 4W7HA 4QUIA 2XH8A 1TAUA 3D8UA 2HMSA 3N7UA 4K28A 3FVVA 5HP4A 3IP6A 5KYXA 1H4VB 4IXWA 1Y5RA 2YMLA 5G4LA 1Z5UA 3GUHA 1VJ1A 4HXYA 2Q3HA 3GARA 3IODA 1JXQA 3TI9A 2QN8A 3VZPA 3SQOA 1T0IA 4LSGA 4S3MA 1G291 2ASVA 2DJIA 4GEGA 1CIVA 4D45A 5B1DA 1SWWA 4UVDA 5J58A 3Q41A 4J91A 3U39A 4D9CA 3VC7A 4F5DA 4WBNB 3GW8A 3GJ0A 4EG5A 2BONA 1XZQA 5JMPA 2P35A 2B98A 1UBTS 3D7SA 1L5MA 3BDVA 1UAAA 5HIMA 4OAQA 2WUWE 1QLHA 3V34A 3FNGA 4FFRA 1W6RA 3PXDA 2XKBA 1NN3A 4KDFA 2FXVA 5EEGA 4KXLA 4GR9A 1XQ9A 5DNDA 6LDHA 1Y9AA 1H2AS 2AC2A 2HMAA 3VDMA 2W6IA 4YP9A 1SXJC 3RC2A 5IDWA 1N2HA 3W5BA 2O14A 1ISHA 1UBKS 4MGIR 4UUPA 4EUHA 4MP6A 4XX0B 2E5LB 1WXEA 4NU0A 4HUQA 5HR5A 1QP0A 2C07A 3JATB 3CW2A 1LF0A 4R0NA 1Z37A 2CLMB 5J2TF 3WNCA 4CMBA 2PLAA 2EGUA 1OX6A 3AR7A 3L0DA 1OAOC 4JBHA 4CG0A 1A9XA 3OJEA 3HBAA 4M8NE 1TC2A 5JSFA 1YF3A 1CY2A 5EHGA 2YNMA 2IDJA 2BKVA 4HN4B 3NEYA 3K9W