2OCGA

Crystal structure of human valacyclovir hydrolase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
254
structure length
254
Chain Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Valacyclovir hydrolase
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ocgA00
3AIMA 4E15A 2EDAA 1XRQA 4X00A 2QTBA 4O08A 4XWGA 4P93A 3W9UA 4X85A 5HKAA 2QJRA 3R3YA 4CCYA 3AUKA 1CUZA 3K6KA 4G9GA 5ALGA 4FKBA 4OYYA 4F21A 5IVHA 5CH8A 4C6HA 2OCLA 3R3XA 3E4DA 3P2MA 2VJCA 5A7FA 4J7AA 4U2FA 1ZIYA 1VLQA 3BL8A 1XZLA 2YASA 5ALMA 2X5XA 1QO7A 3PE6A 1YAHA 2QUBA 1XZCA 3D2CA 4UBOA 1IUNA 5AKJA 1MX1A 1QIIA 5DNWA 4NS4A 1XZBA 1N5MA 1QZ3A 2BGNA 2ZYHA 4QNNA 3PICA 1GXSA 2ROQA 3FSGD 3G9TA 3RARA 1NX9A 4X6YA 3IUQA 1Q83A 2PU5A 1BN6A 1ZJ4A 1THGA 2QS9A 5FUMA 2VATA 1ODSA 3OTQA 5ALTA 4C4XA 2QKYA 2C7BA 3DOHA 4MWTA 2Z8XA 3A2MA 1VZ3A 2HA4A 3DL4A 3A2NA 4HRXA 1XZMA 2RGUA 2OQIA 2PBLA 3WL8A 3FYTA 4Y2YA 5FPPA 1WM1A 4HVTA 2H9YA 2WIJA 1XKTA 1PFQA 2HA5A 3WZMA 3GROA 3ZPXA 3DS8A 4OUKX 4F60A 4C01A 2QOEA 1ZGCA 1N5RA 2ZYSA 3A2LA 4NVRA 4B84A 5EHXA 5EIAA 2JEYA 1F0PA 1G4HA 4BCDA 4BYMA 5BWCA 3DNMA 1AMNA 4Y7DA 4UHEA 5AK4A 1EDEA 1P0IA 1QIDA 3HJUA 4X91A 4WY8A 1BE0A 4Q3KA 3IUMA 1TCBA 1CR6A 3FVTA 4ZV7A 1EINA 4CG1A 1W6RA 1SFRA 1S8OA 5C81A 1W1IA 1CUSA 5A7GA 1TCAA 4CIAA 3F98A 5AI6A 3E1GA 5T4BA 4LYEA 4OB6A 4PO3X 5AKKA 5J3JA 1JI3A 1VXRA 2QJWA 4EUSA 4PSDA 4FMPA 1T4MA 3HABA 2XMZA 2GYWA 5HF6A 4Z49A 3MGAA 1OCEA 5EI5A 1X2EA 3G8YA 3WKAA 2ACKA 5ALJA 1DWQA 4OD0A 1QONA 1XZFA 2XQGA 1CFJA 4HXEB 4BE9A 4BVKA 5JD5A 4FNGA 5I9IA 3WIBA 3IURA 3RK4A 5F4ZA 4B0OA 3DDUA 3QPDA 1U65A 1U4NA 2PM8A 1XQYA 3SX4A 1GPNA 1A8UA 1XZGA 4H7DA 4AO6A 2XMGA 1K8QA 1CEXA 5FDFA 1DTEA 4L72A 2XI4A 1ODCA 4J03A 5T4FA 4YK7A 3ZLTA 2XUKA 3BDVA 4JH0A 1CUFA 3WK7A 2VAVA 2WFLB 3BWXA 2PX6A 2WFLA 1GQSA 5AI9A 1EB9A 3IB3A 4OPMA 1MTZA 3RLIA 5CTAA 4E46A 1JJBA 3WK9A 1BCRA 3O95A 4L3WA 5D7BA 4IHAA 3VVMA 2XDWA 3WWCA 2CMFA 4GBGA 4Q82A 3WWOA 4DSAA 2HU8A 5FXMA 2D5LA 4KAJA 2HDWA 4QDTA 5CXXA 2BKLA 4PV7A 4ARBA 4KJXA 4EZIA 1AC5A 2O7VA 1WB6A 1USWA 3JWEA 3HSSA 3ANTA 2OG1A 2QMQA 4TPKA 1KU6A 4FDMA 1MU0A 3I1YA 5K3AA 1AKNA 4B9EA 4FOLA 4MQLA 4XIIA 5ALRA 2E3JA 4AMZA 3WK4A 1CUEA 1TQHA 3ESBA 2O7RA 3W2TA 1VZ2A 4QLOA 3HACA 3OPMA 3ZLVA 3VJLA 4MEBA 1FFDA 1TK3A 3DYIA 5LLSA 1T2NA 3Q8WA 4OB8A 2BAGA 4F0JA 4H7FA 2WFZA 5E2IA 2Y6UA 1CQZA 3BIXA 4DLNA 3DQZA 2D0DA 4FLEA 3BIWA 3G0DA 4X90A 4MJ3A 3IBTA 3MUNA 1ORVA 3O0DA 3FYUB 2PUHA 1CIJA 1ZI6A 2WIKA 2VAXA 1W76A 4MYDA 1XZAA 5E4TA 3ED1A 3WLAA 5HQ3B 4Y2XA 2B4KA 1QFSA 1MX5A 1YS1X 3IULA 4LYDA 3CCCA 3IUNA 3WQHA 1DWOA 4ZXFA 3OURA 4Q1VA 4AZ0A 3D4LA 4LXHA 4CIBA 3AJAA 2WUGA 1K6EA 5LZ9A 2QM0A 2EDCA 5AM0A 1QGED 1CUJA 3CCBA 3FSGA 4RE5A 2DHCA 3V1MA 4G4JA 3PFCA 4MXDA 1NU6A 1UOOA 3VISA 2FJ0A 4DNQA 3GZJA 3O9MA 5KBYA 3CN9A 3L1HA 2VQ6A 1LPOA 5FOQA 5BOVA 2BUBA 5CT9A 5ALSA 1F0NA 4WFKA 5A2GA 2DSNA 3GA7A 1OXMA 1CLEA 1XROA 4G8DA 1QTIA 2WHQA 5LIPA 4M0FA 1EVQA 2H7YA 3KDAA 3R3UA 1EDBA 1XQWA 2B20A 4D9JA 5AKGA 1XZJA 4H7KA 4B0PA 2G63A 4KE6A 2IITA 3I1IA 1EVEA 3DKKA 1JKMA 1E8DA 1J07A 2WKWA 1JU3A 1KU0A 2YXPX 5AI8A 4J0IA 5AH0A 2WUFA 1XRRA 1GPKA 1H2WA 1EK2A 4ZV9A 6YASA 2CJPA 2V9ZA 4JEIA 3EQ8A 1VXOA 4DGQA 3BDIA 3D2BA 1A8QA 2ZSHA 2GBFA 1QJ4A 1CUVA 5K3FB 1EA5A 2ZJ6A 5A71A 3R41A 3VKFA 1ZD2P 5A62A 2WG1A 3G7NA 1CQWA 2PSDA 2WU4A 2Z5GA 2V97A 1XZIA 5HF8A 1LZLA 4FLFA 4X95A 1E89A 3MUOA 2FJPA 2NW6A 3I6MA 5EGNA 5ALKA 3STXA 4IH1A 1R88A 2AJCA 4HXFB 5CURA 4KYVA 4ZREA 4J0KA 3TJMA 3G0GA 3STUA 3HZOA 1X70A 1FFEA 1UK6A 1OILA 3HXKA 2Z3WA 1EH5A 4BC0A 4UHDA 2HA3A 3KD2A 1E8MA 5AKYA 2RI6A 4MYSA 2WLSA 2HL6A 4MWSA 4GHWA 2W6CX 5FPQA 3FYUC 2G5PA 2GYUA 3WWEA 4CCYB 2I3ZA 2IIVA 3KSRA 2DQZA 4TVKA 4GWLA 3OM8A 5AKXA 5ISMA 4I3FA 1VOTA 2XLBA 1QIFA 5FRDA 2GZSA 5AOAA 3WL5A 1ZICA 3HC7A 2BCEA 1ZGBA 3R40A 4P92A 1WB5A 3G0IA 5HF5A 4NMWA 5JD4A 2J4FA 3H19A 1W52X 3AILA 2DR0A 1E3QA 3B5EA 4AX4A 1WPRA 2ZSIA 4C88A 3WL6A 1BRTA 1GQRA 4AB1A 3K2IA 5CT4A 5JALA 1XLUA 3ESDA 4M0MA 3ESCA 2PUJA 1SCQA 4BZWA 2WFMA 3C70A 3NGMA 3WI7A 5ALUA 4BVJA 3FVRA 5SYNA 3M3DA 3BXPA 5ALFA 1LPMA 4HTAA 4N8SA 4X71A 2OLEA 3JW8A 1RYYA 4CG2A 1AURA 3KWFA 4Y9SA 4BB0A 2FX5A 3C45A 2WHPA 4HS9A 5IKXA 5E4JA 3D7RA 4HAIA 4UBKA 5AK6A 2OCIA 3K9BA 3FNBA 2HA7A 4BRSA 5AM3A 4B9AA 5JANA 4DSZA 1MPXA 4I19A 1ZI8A 4YASA 5AKLA 3HYSA 1BCSA 3W04A 3QYJA 1Y7HA 3R0VA 4CFSA 4P9NA 4OCZA 3WJ2A 1LGYA 1UKCA 3ZI7A 4BP8A 3N2ZB 5AO9A 3FLEA 5HCUA 3WK5A 2CUTA 4K6KA 4CG3A 2AJLI 3D2AA 5CT8A 3WJ1A 4C4ZA 2ZYRA 4OU5A 2C0PA 2ZYIA 2HU7A 3BJRA 3C6ZA 2XQIA 5EFZA 1DX4A 2XUOA 5EHQA 3O9VA 4LIPD 4UBJA 2XMBA 4BE4A 4EY8A 2WIGA 1QLWA 1HDEA 3GUUA 2ACEA 1CUGA 1YASA 4F5ZA 2PSEA 2V98A 2DHDA 2HHAA 2IX9A 3KOOA 3WYDA 1UK7A 1QIMA 5IVDA 4U2BA 4GDMA 4BZZA 5AI4A 2CKMA 3TEJA 1P0QA 4G4IA 3CN7A 1E8NA 4N8EA 1L7QA 3RKSA 4W1PA 1Z68A 4XVCA 3H18A 1ETHA 1ZIXA 1XZDA 1IUPA 4ETWA 1ZD3A 4H35A 2Y2VA 1LLFA 1GZ7A 1HKHA 3RM3A 1QFMA 1L7RA 4LXGA 4W1RA 2HIHA 4FNMA 4QZVA 2BGRA 3ZLUA 1TKRA 2OXEA 1YA8A 3F8SA 4UBNA 3C5VA 4KE8A 2UZ0A 4J0JA 1CUAA 1KEZA 3V48A 4OSEA 1LBTA 3FCXA 1R9MA 2XUIA 3WWPA 3F97A 3C8HA 5HK9A 1XRMA 1H2ZA 2C0QA 4BP9A 4B85A 3DKRA 1B6GA 4IO0A 3NOXA 2ZJ7A 1CRLA 4BBZA 3IDAA 3AFIA 3G0BA 4YX9A 2HU5A 1LNSA 2JGEA 2GBIA 2GZRA 4Y2VA 1PV1A 2HFJA 3FOBA 2G4LA 5H3HA 1JFRA 4AN1A 5AI5A 3WIOA 5IH7A 2HRRA 2PSHA 1THTA 1HBJA 5BV7A 4H77A 1CUDA 4PSUA 5AM2A 3UUEA 4S0XA 5DYTA 5CW2A 1EXWA 3IIIA 1R1DA 2JBWA 1QIJA 1YB7A 5T4HA 3LS2A 4GI1A 4JUIA 1CV2A 1O6GA 4X92A 4B82A 4NZZA 4H7HA 2WG2A 4HRYA 3DEAA 5DTJA 1BN7A 5FLKA 3FWHA 3B3QA 4Y2RA 3LLCA 1EDDA 3QPCA 3WKEA 4ITVA 2YYSA 2WIDA 4CI9A 2JEZA 2QRUA 1WCYA 4FFWA 4KAAA 3DJYA 3WMRA 1LPNA 1C7JA 5AM5A 1G5FA 2G5TA 1XLWA 1YCDA 5AM4A 1BROA 4UHBA 5JASA 4ZWNA 4JYPA 5AOBA 3WKDA 5CBKA 4DNOA 4E11A 3D0KA 4Y2PA 4KAFA 1MT3A 2HA6A 3WK8A 5DNVA 1QO9A 2ES4A 3O4HA 4BC1A 4BAUA 4UBLA 4BDSA 1QOZA 2VA9A 3EQ7A 1AGYA 4EY7A 4J0CA 5ALEA 3VDXA 2AJBA 2W22A 3R3WA 2Z3ZA 1A7UA 1VE6A 2HADA 1TIBA 2ONCA 3R3VA 2PU7A 3C6XA 3KWJA 1ODTC 1K4YA 4QE3A 5JD6A 2J3QA 1UZAA 1XLVA 3BJMA 1ZOIA 4N8DA 2XT0A 2O2HA 1XKLA 2K2QB 2PSFA 2HFKA 1ACJA 1U8EA 3I2IA 1QIKA 1VA5A 4HXGA 3SK0A 3WKBA 3ZWQA 4BTLA 1K63A 1CUUA 1IUOA 1HL7A 1DWPA 1ZJ5A 4BVLA 5D6OA 4Q05A 5AIBA 1HLGA 5BWBA 3PF9A 1QIHA 5AHXA 4K6GA 1MAHA 1ZD4A 5AKEA 3D59A 5EIHA 2PSJA 5C8VA 4GXNA 3WWDA 3TRDA 2XMDA 1GGVA 5FKJA 3EQ9A 5ESRA 1CPYA 3UMJA 5C7YA 2C5FA 4G5XA 1ORWA 2GYVA 1XQXA 1EHYA 4ZI5A 2JGFA 1UK9A 4Y2TA 3G9ZA 3M81A 2RHWA 3WYNA 4B81A 2BJHA 4DNPA 1GKKA 4X94A 3QITA 1B41A 3LIIA 1CUXA 5AOCA 1XRPA 4B83A 4WFIA 1XRNA 1AZWA 2WJ6A 3CXUA 1G42A 2Y6VA 4A23A 1A8SA 1MO2A 4I4CA 3C43A 4GECA 4K5QA 5JYCA 4BCCA 5KWJA 4G8BA 1MN6A 1BU8A 5ALXA 1WPXA 4AQDA 3QMMA 4FHZA 4WY5A 4QA9A 1ISPA 5KWIA 3QMVA 4QDZA 4KRYA 1YR2A 4UHCA 1LPAB 5JAHA 3VJKA 2JGIA 4Q3OA 4W63A 5K3EA 5ALDA 3T4UA 5JATA 2Y1KA 5A7HA 5AK3A 3W06A 5EHNA 5EIEA 3M82A 3I2JA 5DYYA 2BUAA 3I2KA 5EHZA 2WTMA 2XMRA 5JAPA 3AIOA 4J3JA 2HRQA 2XE4A 2XUHA 4RNCA 3FBWA 4QLAA 2PKYX 3OOSA 4H7IA 3H17A 4B80A 3DD5A 3H1BA 3V1LA 2JGMA 5JZBA 3IUJA 4WCVA 2XUGA 3O4JA 4L0CA 4J0DA 3ZV7A 2H1IA 5LZ5A 1QIGA 1AQLA 1I6WA 2XQFA 2R8BA 5HFAA 3AZQA 4U2CA 3E3AA 1DX6A 2XUFA 1QE3A 1VE7A 2FUKA 4PQEA 3V1KA 5YASA 1C4XA 1R4ZA 1Q84A 3T52A 5AKIA 2QUAA 1JJIA 3IVMA 5C8ZA 1XZHA 1IZ7A 1XQVA 2J3DA 3QPAA 5HF9A 2OGSA 2HM7A 2OGTA 1BS9A 1R9NA 4UUQA 5JAUA 1XZEA 4RE6A 4B7ZA 2HA2A 4FWBA 1WHTA 2WJ3A 4DMCA 1W75A 5AK5A 2DHEA 4BDTA 2AJDA 3A6ZA 4UPDA 1EI9A 1X2BA 3O4IA 4MQMA 3H2HA 3STWA 2PVSA 4P08A 3VXKA 1SCIA 3WA7A 4B6GA 1VKHA 4KACA 4J0GA 1R50A 4OYLA 2WHPB 4G8CA 2XLCA 4U2EA 3QMWA 4Q3LA 1FFCA 4K6HA 2XMCA 3N0TA 5KREA 2B61A 1VA4A 5ALQA 2LIPA 3V1NA 4N5HX 3O4GA 3SC2A 2I78A 2JGLA 1VJ5A 2GBGA 4BAGA 4Q34A 3D5EA 4Y2JA 3AIKA 2XMQA 4QDUA 5K3CA 5AP9A 3F67A 4EY4A 2ECFA 2V96A 3BE8A 2HA0A 2DQYA 3ILSA 4X97A 2VJAA 3VVLA 3QM1A 4G1FA 5HKBA 1Q0ZA 1DQZA 2WQZA 1UOPA 1XZKA 4FBMA 3R3ZA 3BF8A 1YA4A 4BCBA 4QDXA 5IVIA 1M33A 3DOIA 2Z8ZA 5LZ7A 3C87A 4WDRA 1QTRA 3WK6A 4C87A 2O2IA 1SOMA 4UFOA 5DWDA 2XUDA 5IVKA 2AXEA 4W1QA 1DQYA 2QT9A 3YASA 4XX1A 1FSSA 3GBSA 2C4HA 3WZLA 2C5GA 1H2YA 1H23A 4Y2UA 3STTA 5LKAA 3L1IA 4V2IA 4JYMA 3FAKA 2WIFA 3QVMA 4AMYA 3G02A 4X93A 3NUZA 4WDQA 2O2GA 2P8SA 1UKBA 3QZUA 4LHEA 3ESAA 1PJAA 3C8DA 3BF7A 3S2ZA 4UFNA 1CUHA 2XUJA 4AXBA 2H7CA 4EB0A 4EBBA 5DYWA 1DT5A 5ALPA 1IZ8A 5HK8A 1IVYA 1LPBB 4GLBA 5LZ8A 4AO7A 4DTCA 1EX9A 2QXUA 4GEGA 2QZPA 4H0CA 5CRIA 4G4GA 4DMKA 2OCKA 4KRXA 3DL7A 3X3HA 2JF0A 5JIBA 4Y2SA 1GT6A 5CT5A 2X8BA 1Q0RA 3FLBA 1CUIA 3H2IA 4M0EA 5K3DA 2BFNA 3DLTA 1E66A 3A70A 3L1JA 1UKAA 4A16A 3B12A 3C5WP 4X6XA 1UFOA 5ALIA 4CCWA 1BEEA 3WKCA 5CXUA 5DNUA 3I2FA 5DLPA 1DINA 3U0VA 2WG0A 4HZGA 3JYHA 5LZ4A 1GKLA 2BUCA 3S8YA 2PPLA 3ANSA 3G9XA 1EB8A 4ZGBA 2OAGA 4AN0A 5I8PA 1WOMA 2DCMA 4OU4A 2WTNA 2JIDA 2R11A 1JMYA 4W9RA 4X7BA 2CZQA 2B9VA 4QDOA 1P0MA 1UXOA 4KE9A 4BRZA 5AIAA 3VJMA 3NWOA 4KE7A 4EHBA 1J06A 5AICA 5CT6A 3F96A 5ALHA 5T4EA 4FLMA 4DIUA 5AJHA 4N5IX 3HEAA 3QBJA 1K5PA 3H04A 3H2JA 5ALWA 5AKHA 3I28A 5CH3A 4DYHA 5AM1A 1HQDA 5JARA 1XRLA 4L9AA 4MEAA 3C6BA 4INZA 3ICWA 3GELA 1RWQA 1Y7IA 2CB9A 1TAHA 1AX9A 4LKOA 4UBIA 5HZGA 1IMJA 4KEAA 1DU4A 1LPSA 2VEOA 4C89A 3STYA 2VF2A 3FCYA 1C7IA 2VT7A 2CBGA 2I3DA 4J0HA 3GFFA 5K5EA 1MNQA 4BATA 5CMLA 5JZ9A 3DCNA 3C6YA 4YPVA 1MX9A 2WILA 3I6YA 4H7JA 4WFJA 4IH4A 1D07A 2WSLA 1JU4A 2RHTA 3G9UA 3PUHA 1QIEA 3H2GA 1JT2A 1UT6A 4ZRDA 1MJ5A 4X6UA 2RONA 4OB7A 4A5SA 4FTWA 2DFPA 2AJ8A 4UHHA 1UWCA 4DMHA 3EBLA 5ALZA 2OAEA 3PDCA 4K2AA 1BEZA 3SWWA 1FFAA 1DT3A 1E5TA 2XUAA 1SCKA 1XFDA 4BTVA 1UOQA 2XUQA 4RGYA 5SYMA 4UFPA 2OQVA 3I2HA 5LYYA 3E0XA 1H2XA 1A88A 5C8XA 2GBCA 5FP0A 2WM2A 3H1AA 4UBMA 3AZOA 4Y2QA 1LZKA 1N8SA 2CEKA 1RP1A 1F8UA 3FYUA 3STVA 2WUDA 3KXPA 1JJFA 1ACLA 2VSQA 2XB6A 1FJ2A 1UK8A 4DNFA 2YH2A 2J4CA 3EIOA 5DTIA 5HQ3A 5CH5A 1SC9A 2RIPA 1H22A 5I7UA 5JAOA 3UUFA 3ICVA 2Y2UA 4PW0A 3EF3A 3F9CA 3WA6A 3HI4A 4U2DA 3W05A 1WB4A 4AO8A 2VJBA 2C58A 4WJLA 5HFNA 5E4YA 2VTVA 2PL5A 2Q0XA 2OCGA 2RAUA 4QEKA 4E14A 4FFVA 5ALOA 2ZJFA 1P0PA 1GPLA 3Q0TA 7YASA 4EA6A 2WJ4A 2QXTA 1YB6A 3AINA 4IH9A 2WHRA 1J2EA 5D3ZA 4FBLA 1W4LA 4H18A 2X76A 3D3NA 4C4YA 3WL7A 2XMSA 3QH4A 1YSCA 1MAAA 3PF8A 3LIPA 1CUYA 1FFBA 2JGJA 5AI0A 2QVBA 2QR5A 1O6FA 3H0CA 3I6ZA 4RPCA 3V9AA 2ORYA 3PUIA 4ARAA 2VJDA 3FLAA 1R3DA 4TGLA 4UHFA 2JGKA 5FV4A 1WHSA 3PI6A 4ROTA 2XQJA 3AZPA 5JADA 2WUEA 5DJ5A 4W1SA 2ZVDA 3PFBA 4QWMA 3OG9A 4PF1A 1CUCA 3LCRA 3OC0A 2OGZA 2VT6A 1TCCA 4AZ3A 1G66A 4G9EA 3LP5A 3DYVA 4JNCA 1N1MA 2WU3A 2I03A 3TGLA 1HPLA 5K3FA 3W9BA 5D3KA 1U2EA 4DMFA 2XQKA 4QWWA 1CVLA 1AUOA 5JZSA 4KR0A 4EY5A 1JMKC 5ALNA 3HLKA 1YAJA 1MNAA 2EEPA 1EK1A 3I2GA 5AKZA 4EY6A 4PSCA 5ALYA 1L7AA 4BAZA 1F6WA 5K3BA 3G0CA 1J1IA 3HRHA 5ALVA 5LZ2A 1ZI9A 1LPPA 5LKRA 1ZD5A 2XUPA 3M83A 4IQ4A 2OPHA 1CUBA 5ALLA 2H7XA 5LP1A 4U2GA 3MVEA 3U1TA 1CUWA 4X3CA 4H7EA 1TRHA 4DM7A 4XJVA 3IA2A 5A6VA 4GW3A 1Y37A 1YS2X 1LBSA 4LXIA 1NU8A 3H2KA 4PNZA
chains in the Genus database with same CATH superfamily
3L0OA 1MP0A 1I1NA 2HLDA 3F90A 3X1ZA 4TLAA 3T9DA 1ONOA 1XRQA 4KITB 4RJ2A 2ZSAA 3ZWKA 5KS2A 4P1ZA 2QTBA 1DC7A 2YJ4A 1R5NA 2P2YA 3FPCA 4J6FA 3WLQA 2ZRGA 4X85A 5HKAA 2Q29A 2IVZA 2QJRA 3MT7A 3OLQA 3RF6A 5LNK1 3S70A 3R3YA 1GNLA 1JIIA 3JWGA 4LJRA 4KQWA 4KMRA 3K6KA 1JQAA 5ALGA 4ZYWA 1QQAA 4BMDA 3MTIA 1D8TA 1EXNA 3Q11A 4HMQA 1II9A 4JJ6A 4JSRA 4BVEA 3NHUA 1K88A 4G63A 4F21A 1W7AA 4HNTA 3QNWA 5KYYB 2OCLA 3EZXA 1XCMA 2C8VA 2MYTA 3FKQA 3P2MA 5AQEA 5FO1A 5LQKA 1FIUA 3L9XA 4CKYA 3IDFA 1A2OA 4IG9A 3FPHA 3K32A 3DOJA 4U2FA 1TD9A 1PZEA 3QX8A 5SZIA 3FKJA 4JIGA 2WUWE 2YASA 1XMVA 2CDCA 1NQUA 3EZ9A 4R9RA 3RABA 2CLIB 3ODPA 2JFNA 4OHKA 3PJRA 4JBGA 4WZBB 3TDNA 4RAOA 3JQ7A 2X5XA 4ZOCA 1PEKE 3ZCPA 1GT91 1QO7A 2K5UA 4X54A 3OF3A 3PVCA 3VPAA 3P9KA 5KYWB 1YZTA 3BWCA 2GKSA 2QUBA 3SP1A 4L28A 4LECA 4Z1OA 3UIEA 2J32A 1E32A 1Q7BA 1ZCBA 2CK3D 3D2CA 3MINB 5AKJA 1MX1A 1QIIA 3DCYA 4C7KA 5COAA 1OV6A 4EO9A 3KQHA 1QO0A 2DFDA 4JK3A 5LYJA 1CY1A 1QR2A 2FF7A 2X58A 1K6JA 1AS3A 1DJQA 3AY6A 3ITKA 3OT1A 2WRZA 4CQMB 3HWRA 4NS4A 2MWMA 3AO0B 2QRNA 4R5MA 1Y1SA 5LBUA 3U3JA 4E5KA 2VSXA 2F67A 5G0SA 5BV2P 2FZVA 3FTDA 4W9NA 5G0UA 5JZMA 3IE1A 4L16A 1KFJB 5JNWA 2WYUA 3K1ZA 3PG5A 4HYYA 3C4VA 3EWIA 2GH1A 5I4KA 4YY3B 1T5LA 3W6PA 2XY4A 3CNHA 3GDOA 4DKXA 1Q83A 4CMGA 1OW3B 1LI7A 2W2QA 2BBOA 1ZJ4A 3AC0A 4MUJA 5G0WA 4ZCPA 3NV7A 3S0JA 3EHEA 3ZGOA 1GLNA 3DHWC 5FUMA 3ER6A 2YZ2A 2RHOA 4K9NA 2QN2A 4TS1A 4U3JB 5F21A 1I1QB 1ND6A 2PNJA 1DBRA 5LPNA 4GC5A 3PRHA 3SC6A 2WJYA 2IUEA 3EGWA 3MILA 4FD3A 4LZZA 2VJPA 1E6MA 2GYYA 3AEUB 4MKRA 2JAOA 4NYIR 3ETCA 5CLIA 2Z8XA 1R15A 4QOHA 2NQ8A 1TIPA 3A2MA 1N7GA 1XPJA 3K2EA 1PLLA 3SFZA 1R0BA 4LJ8A 1SUSA 1VG1A 2Y0EA 3A2NA 3EIXA 3LKDA 4ND8B 4J4TA 4BZXA 3FOFC 4LK2A 3JXEA 5DLEA 2ZIEA 3QOXA 4UEOA 1XCJA 1T10A 4LDZA 4LVNA 3TPCA 5JI2E 4JMPA 2CHVA 2LGJA 3IP5A 4HXYA 3WGTA 3PYMA 4RK4A 3FPEA 1U4SA 2W8BB 3GJSA 3LCCA 3IT3A 3FYTA 3Q4GA 3R0IA 4MP8A 5KNBA 3KXLA 4QJIA 1MFZA 3RS0A 3QIAA 3NP7A 3LUAA 3DE5X 1WM1A 1N0HA 2IYWA 1W29A 2R8EA 3FJ1A 3PWSA 4U5QA 2NVUA 2H9YA 2JAPA 1LJLA 1K3TA 5F52A 2HA5A 3WZMA 5IWCA 3GROA 4FU0A 2OFWA 3ZR4B 4UAGA 3ZPXA 5IRCD 3J81A 4FCCA 3K0CA 1XTRA 3M2TA 1Q6YA 3FD8A 1VLJA 2OBLA 3N8DA 4I8XA 3D02A 4RVUA 1KI7A 3H9CA 4C1BA 3OQIA 3E8XA 3EJWA 5FOUA 4ZYZA 2X19A 2ZYSA 5ICEA 5BT8A 4NVRA 4WXYB 1PNQA 1WZEA 4OQNA 4ZVNA 2W6ID 4B84A 5EIAA 4FX2A 3JD1A 4WXHA 1G4HA 4DQ0A 4JEHA 2OQRA 2IWRA 1GNQA 3AF5A 3CT4A 2HQSA 2ZW9A 4JLOA 4C22A 1H4TA 1O58A 1JFFA 3M1YA 2B69A 4KO4S 4Q00A 1RXEA 5DX1A 3LYUA 3ONWA 4G56A 1ULHA 3EIEA 4FR2A 4Y6QA 5AK4A 5FWAA 1BYUA 3K30A 4AECA 1KBOA 2PT9A 5FBZA 1T9GR 3FHCB 4FYXA 4YWHA 1AKRA 2A7QA 3II6X 1M1YB 3OEHD 3IMCA 2QD4A 4K9SA 3R0XA 1GO2A 1K68A 4OHUA 1R6BX 2VKTA 4FYYA 3IUMA 2M32A 1MOZA 1CR6A 2AZ4A 2P77A 3AEQA 1EINA 2FMXA 3GVIA 2IEAA 3M5DA 2ODAA 3CLUC 1MOSA 1VSBA 2BONA 2XBMA 1N5KA 5KSYA 3DE2X 3DXZA 1W6RA 2IEGA 2O48X 1S8OA 2RMKA 3OP4A 3PEVA 1M1UA 3B9BA 4BFLA 4B40A 1CQXA 3WTBA 1QYVA 3U56A 2QX7A 1MZVA 2R47A 1TT5B 2YIJA 1NNUA 5F1OA 8ABPA 1FTSA 1UBJS 2J0UB 3ZD6A 1LK5A 1RPTA 1LDYA 1JL3A 1SJ9A 1V95A 3CKKA 1QGAA 3H8JA 4RSHA 5AI6A 4CIAA 1M5RA 1FFYA 5EIXA 4TTVA 2GB4A 5EY5B 1GGMA 1JS1X 1R4NA 1YH3A 1W48A 2Q5JA 3D4IA 1JDJA 3MRTA 1KMHB 1Q1NA 4LYEA 1NDHA 5IUJC 4HJXA 2KB0A 1O97C 4FQ8A 4Q9JA 4XSHA 4CCSA 1EM8A 2AG1A 4M49A 4W5HA 3JQAA 3TBFA 4YJ2B 3OZEA 5DW0A 4CIXA 3UMSA 5JLAA 3CE6A 2G71A 3ZU6A 3MJEA 2VYQA 3FI9A 1D0VA 3ZWXA 4FMPA 3CLUD 4O0LA 1T4MA 5KCMA 3HABA 1E4VA 1EJBA 2GBLA 1BFDA 3DR3A 3A1VA 4Z49A 1Q0TA 3BXEA 1OCEA 1PFUA 2V7VA 4CM9D 3ESQA 5FV7A 1TJNA 1Z0JA 2AQ8A 3QI7A 1SVNA 5FJJA 5IJXA 4CKCA 1A4UA 4KODA 1QV9A 4YRCA 2JA2A 1UPUA 2JD0A 5ALJA 4ZJUA 3M70A 3L6OO 2FI1A 1H2HA 2OEPA 2VK8A 2X1HA 4NDNE 2HHHB 1LEHA 3PDUA 4JJ4A 1SBYA 2FSFA 3V6MA 2LCFA 1Q5PA 1CFJA 2P1ZA 3KNZA 2Z5FA 4TLLB 3RUEA 3ZCXA 1O97D 4RFSB 4BE9A 1U99A 2ZIWB 1P19A 2B1JA 2VAMA 5AMXA 3TW8A 3USZA 5EMNA 4CM1A 5I9IA 5JD5A 4RXUA 2J0QA 1VBMA 4OGGA 5B2FA 1PJLA 4AG5A 4DAOA 5KNDH 5DN6A 2ADMA 5B2ZA 4DV0B 1PV4A 1QGUB 2F17A 5F4ZA 3EVCA 4YQZA 1FXWF 1NUUA 2FG5A 6NULA 1Z4OA 2PGIA 3BYZA 2QQFA 1N0WA 2CVZA 5T41A 4BFXA 5H16A 3V55A 1HFJA 1YR9A 1GQYA 3PPVA 1WUTA 3C2QA 4Q16A 3V6LA 4LE2A 4TL7A 4E5SA 2H3HA 1AV7A 2JD1A 3U3RA 1U8YA 3LUBA 1FP2A 1NW8A 3SGLA 2JLAA 1DTEA 1OBCA 3JATB 2D6FA 2X1LA 1HDOA 1ZM4A 2B0CA 2LZ0A 2XI4A 3TL3A 1JQDA 3HUUA 4LRXA 4EG3A 3F3YA 4YK7A 4BNDB 1EBBA 2HK8A 2PV7A 3T4XA 3C3AA 2HYDA 4J6EA 3DFUA 5E6SA 1Y7PA 2E4UA 3HNRA 5E1OA 2PZ8A 1A9PA 1ZHHA 2VAVA 2GM4A 3B85A 5U4QA 5P21A 2OXTA 3T1QA 2V3VA 2WFLA 1KTVA 2P62A 3UJBA 2ZJYA 2CCJA 1MTZA 3MWDA 2MR5A 3P19A 4I6GA 4TWJA 1JJBA 3KQLA 1V9SA 2AG0A 4XVQA 2CJWA 1IBRA 1BCRA 1NQWA 3ZJVA 1EZ4A 2VQ3A 4DCNA 1QUFA 4EW1A 1Q0HA 2CXSA 1O95A 2Q5EA 3E9MA 4OMCA 4P54A 5E0OA 4N7MA 1ADCA 3VVMA 1CE8A 4ISBA 3UH0A 2WD7B 2XYRA 5FR1A 5J40A 1OAOC 5LC1A 4YR7A 4GBGA 1OHHA 3CW2A 4Q82A 4B33A 5JV5A 4P35A 3E1KA 4DSAA 1T6BY 2HU8A 4XSVA 4BMCA 2HJVA 3EAGA 1IJEA 4WNIA 5JFGA 4BUJA 2PJUA 3L0DA 1IXKA 4U6SA 3KJNA 3QSGA 4HOYA 1U11A 2VF8A 2WA2A 1X1RA 1Z22A 2DBVO 4NE9A 1UBTS 2OO5A 4BUCA 3OIFA 4Q3NA 2HDWA 1UDXA 2IYYA 1DSSG 1RMQA 3CNNA 3DTNA 2NO5A 2HJRA 2FV8A 2IXDA 2YVLA 2CHFA 3LLUA 4ZJPA 2AWNA 2BEKA 1UCFA 2EHJA 2HCJB 5CXXA 3R6TA 4JJIA 4HVCA 4MH0R 1I51A 4H1WA 4RS3A 3UT5B 2QVXX 1USWA 3H5IA 3JWEA 1ULTA 3ANTA 4IGIA 1A82A 4QL3A 5KTNA 5BN3B 4ZOEA 1YWGO 3QKIA 4FW9A 5CEEA 1IE3A 2EGUA 5K3AA 1ZN8A 1EFCA 4JUBA 1A4XA 2NO1A 3P0FA 4LWPA 4F1KA 2GRUA 4DLXA 2C98A 3IMGA 3VKHA 1RWVA 4XIIA 5ALRA 4CL0A 3MTAA 2ZRJA 5CG2A 1NYRA 1GL3A 3TZEA 4O3MA 1KP2A 2R66A 3R5KA 4UM9B 1CZHA 2PGNA 1QYIA 2WC1A 3RU2A 1R0RE 3R8XA 1CZLA 4RXMA 1X1AA 1J49A 1JNYA 1N2CE 2VYND 3PVSA 2DPYA 3ZWOA 1TM4E 3VC2A 2H4JA 3UF0A 1NXOA 1P31A 1U8TA 4GL2A 5KKNB 4MJLA 3BTVA 3RFTA 3PLRA 3NJ4A 1YQWA 3W2TA 2QVCA 3QHQA 1A9OA 3HACA 3C3JA 3RVNA 2VLIA 3OPMA 4CDMA 2J5RA 2CDBA 3LSTA 4RMGA 2NU7A 5TPWA 4BRWA 1FFDA 3CX4A 2QM3A 2G1AA 2OVBA 1TK3A 1WF6A 4NULA 4ETIA 3CLRC 4DHEA 2PK3A 2AYYA 2B6NA 3O91A 4EJ6A 1I3OA 2C2YA 5LMCA 1UDBA 2IWHA 3VZBA 3NDBB 2HHJA 4OB8A 5H59A 3RC1A 3BTSA 1GU0A 1UFKA 3EZNA 4ZVMA 3TNYA 4C7JA 4GBED 1D7AA 2H00A 1GG5A 4HH1A 4JVMA 5IAOA 3THWB 2YIVX 4YFYA 1TIKA 2BWJA 1WVMA 1CQZA 3ZVRA 6Q21A 1QP0A 1D0IA 4WKBA 1ZYUA 3H4MA 1A5ZA 2DQ4A 4JVLA 4XUCA 3LWBA 1A97A 1M2NA 4PZUA 1T26A 4Y9SA 2FX3A 4QQ8A 1U7DA 3RR2A 2PD3A 3ID6C 1BGVA 4X90A 1L8OA 4EF5A 2BFAA 3PZRA 3FF4A 1DEKA 4BNYA 2BFPA 4QRDA 4R01A 1LNQA 4X1OA 2XD4A 5HGJA 2NUTA 3TGWA 1CRPA 3A27A 2ZYVX 3ANYB 2PUHA 3O0DA 1C1XB 1QTNA 5GGYA 1E2EA 3RVQA 2O2DA 5I7AA 1E7SA 1CDZA 2WIKA 1YU9A 3MCUA 4WVLA 1K86A 3O7MA 3UGKA 2YXBA 5I3ZA 1IBMB 4L8VA 3KT8A 1JDNA 4IX1A 2J09A 3CLRD 5E7IA 3S27A 1QFSA 4UNNA 2QMHA 3TI7A 2L18A 3K0SA 2AFRA 2WWWA 1PWXA 5JI3E 2AZMA 3IULA 1R4MA 4AY5A 3WQHA 4X20A 3KTFA 5DI3A 2H31A 5F2OA 1AKUA 5CA0B 4R2HA 3WGYA 3F73A 2JAHA 3WY9A 2PZEA 4BRUA 1SU6A 1IPFA 4JLPA 4Q12A 4Q93A 3IQHX 2YMQA 4X8OA 4ZK6A 1C0KA 2SKDA 2QD1A 4HNVA 4RZXA 3U7FB 4ZDIA 4D9NA 1NRWA 1I7PA 2IDZA 3OURA 4RHUA 4D3YA 1WO8A 3FOEC 1HSZA 2OV2A 4EF6A 1V16B 3HDTA 3DFZA 2PJRA 1SCJA 3VNUA 2JJ2D 4L76A 3GFVA 4LXHA 4CIBA 3P27A 2PH3A 1W2HA 2Q7XA 3NEJA 1PLKA 4FT2A 4I5FA 3SICE 1JT9A 2QM0A 1I33A 1E3SA 3NM6B 3DKPA 4G1EB 5AW4A 1OASA 2OT3B 1QGED 3CCBA 4GYYA 4LDQA 3MGGA 1Y63A 3N75A 3EIFA 4MRAA 1DV2A 3OPVA 4JLSA 1PR4A 2DR3A 3B53X 3CTPA 4G4JA 4A8TA 1Z45A 3QE2A 5I01A 3PFCA 1I4TD 1NU6A 1UOOA 2A9VA 2FJ0A 1JN0A 3LPLA 1X8JA 3U40A 1M67A 3GZJA 3LD9A 1EP9A 5BSTA 3QWIA 4HDMA 4XM0A 3SVLA 4M8LA 1P9NA 3UV3A 2RGXA 3W4KA 5KBYA 3L1HA 2PRSA 2VQ6A 2C54A 3QWBA 1KZGB 1QP4A 2ZAGA 1QS0A 1E7WA 3H0KA 1LPOA 1RAAA 2QL9A 3N74A 4FS8A 4R8SA 3GDFA 2Q7DA 1N3BA 2I91A 2BUBA 2ZSUA 5BSFA 1F0NA 4QHTA 1WA5A 2BYTA 1PT5A 5EJ2A 4BPRA 5A2GA 2FN8A 1XDSA 3L6EA 3LNCA 3NHMA 1AUPA 1X92A 1FU8A 2FW1A 3QLVC 4YRJA 1LBHA 5K7SA 3SHVA 1XU4A 1BG6A 1KF0A 2FPWA 2G5CA 1K1EA 1XWFA 4G8DA 2X0NA 4HX5A 2G72A 3KZMA 2G0TA 1IM5A 4WIAA 4HV4A 4KJZA 1IVNA 5EZQA 4HEJA 3P1JA 3UFBA 1SOWA 1XA0A 1KMNA 4FINA 4L0MA 2SCUB 1XJWA 3IBYA 5FUBA 4BMVA 3H4TA 3ZG6A 4LMBA 1T0PA 3KSZO 2ZI5A 1Y5NA 1XQWA 2CXRA 2JBAB 3OCXA 3R7AA 4RH0A 1FQKA 1WHSB 1XEWX 2IPAB 5F7OA 3T5AA 5AKGA 2FPRA 2VTBB 2OXFA 3QKWA 4B0PA 1FA9A 4XD2A 5J9FA 2W6MA 2FP3A 3GJYA 4O2RA 2ZIFA 4KE6A 2IITA 2Q3JA 3I1IA 4RY0A 3PHJA 2JJQA 1P3Y1 3N0WA 2D2FA 1PS0A 1HDZA 2WP0A 3HR4A 5FLEX 4TKVB 1XJQA 3AL2A 1X7HA 2BGKA 4J0IA 3K9HA 4LHXA 2AV6A 1C41A 2ZT5A 5J4KA 2V03A 3MRXA 3LX4A 3VU9A 1BHQ1 1H2WA 1FX1A 2ORED 3LX8A 5J4YA 2B1QA 1G60A 2CN1A 2C2OA 3G23A 4H17A 5F35A 4PGMA 4BQFA 3QE0A 3K96A 4JEIA 4C05A 1SBZA 1WW3A 2OQ2A 2Y0BA 5JFTA 1KTIA 1NDUA 1KAHA 2ALJA 3D2BA 3HK2A 2IS6A 5C80A 4J0EA 1A8QA 3EEFA 2ENWA 1KJJA 1UDAA 1VYTA 2E4YA 2FKAA 2WSMA 2ZSHA 3NX4A 4DYDA 2HD4A 3GGPA 3H13A 4PN3A 4LDJA 1ZP6A 1RQPA 5L6LB 1G6Q1 3ZDDA 4JJ8A 4IIXA 4TVOA 3WWYA 1PL6A 2P9ZA 3KE9A 2GOYA 3EFHA 1JA1A 4YP1A 1KWGA 3KHKA 2AMJA 4AYTA 2PSDA 3LPCA 1RZUA 4DQXA 2JLCA 1SXIA 3MD0A 1I2CA 1WVGA 1KE2A 3ZHOA 5LR6A 4TKUB 1P8JA 2FN7A 2X4GA 4OYHA 1VG9B 2W2PA 3TLXA 4B7UA 1U7UA 2V7PA 3C3KA 3FTCA 3KOXA 1X7YB 1L7OA 1R8SA 5L3QB 3VR5D 4DIEA 4J2TA 1GSHA 4WZAE 3SPXA 4EX6A 4POOA 1GUBA 2CDRA 4O4JA 5FUQA 3BH6A 4FFRA 3TLJA 4B43A 4G89A 1KSHA 2O6LA 4OHMA 1QMGA 4AICA 5DRTA 4EUFA 2F8SA 1C3VA 3KFLA 2WM9B 3MWEA 3QFSA 5REQB 3RODA 3X2SA 2QRQA 1J0DA 2AJCA 1E2JA 1KS2A 2NU8A 4E94A 3EODA 3AVQA 1CR0A 1RQ7A 4YRPA 1XZPA 4D3SA 1XXHA 3KLMX 4BNKA 2AQKA 3TJMA 2X2FA 1ORHA 4HDRA 8ATCA 1AG9A 4J16A 1V2GA 2P75A 1RHUA 2H1SA 3HZOA 3CVVA 3VRHA 4DLAA 4BFUA 6REQA 1OILA 1FQJA 4TMWA 9ATCA 5K8VA 1EH5A 3WLNA 5C0OE 1T35A 1FMCA 3NATA 5HTOA 2P9FA 2F9LA 5KWSA 3JQ8A 1ZN2A 2BGUA 2VOEA 1PT9A 4S1TA 2TMKA 2F1KA 4GPEA 1L5YA 3CRMA 3FSEA 4XLZA 1E8MA 2QY9A 3E5MA 2Y93A 3GRUA 4IQGA 4XSGA 3U7QA 2WF8A 2X40A 3DNPA 4NDZA 3VYUB 1GNPA 3MAGA 3MMZA 3R75A 3K0FB 3RS8A 3KEOA 3WBKA 3Q87B 1F2TB 1MKYA 3HGQA 3C3PA 4JENA 4JP1A 1VSUA 3V2HA 3WLMA 4BZQA 4ABTA 4HWOA 1JKFA 1ONBA 3A6KA 4F12A 1M7GA 1HORA 5M34A 1DFHA 4NYMQ 4GHWA 1RCTE 3OZSA 3SYRA 4JXZA 3IODA 3QF4B 4U9HS 2CFSA 2ZTSA 2UV8A 3V9PA 3O8QA 4CTOA 4CGZA 2ABWA 3KUKA 4GWLA 3OM8A 4Q4LA 4CG0A 3CVUA 3TVYA 2F1RA 4G97A 1BDJA 1BWSA 3VUEA 1VOTA 1NW3A 2OM2A 3W8NA 1N2XA 2MT9A 3NS7A 3GEPA 3WL5A 2IU6A 2PPVA 5IVPA 2F3UA 2VNJA 3KUXA 3HC7A 1W96A 3JVIA 4XGNA 2IU3A 3B6KA 5I7VA 3BMOA 1Q15A 4BY9E 5DNAA 4TROA 3HI6A 5HF5A 3A1CA 4MRMA 5BRAA 1U8UA 4FSXA 5JD4A 4MDEA 2ZQ5A 1A04A 1C14A 3F6BX 1QQTA 2B0JA 1ABFA 2DR0A 2BFMA 3AJRA 3CW9A 3DLAA 4UHFA 2PYIA 4AJEA 2QYOA 3ZXUB 1U2GC 1MLDA 1XDZA 3QEMA 1VLVA 1HK7A 5EEHA 1FYFA 4ZVRA 3OU2A 3UQZA 3V8EA 2EKZA 1WXWA 2H08A 3WL6A 4TLEA 1U8CB 1WSAA 1GQRA 5EYPB 2CW5A 2HMUA 4O3FA 5CT4A 3VO2A 5JALA 2G9NA 4R1UA 4DLLA 1JDBB 1OZAA 4AD8A 2JFYA 4KPGA 5I8ZA 5TGTA 1RHQA 2YYZA 4BZWA 1WUJS 4B3MB 2WFMA 1GL9B 3C70A 3O73A 1GXSB 1JQ5A 3D8BA 3NP9A 5KTSA 4GKVA 3FVRA 4YMUA 2AOTA 1ZJJA 1XCPA 4LJAA 2HWWA 2FN9A 4MQEA 5ALFA 2JIMA 4RTSA 3LXRA 1MG0A 1NXWA 4P53A 1OPRA 4IOLA 5F1KA 5B36A 2PQMA 3RD5A 5JSQA 3K70C 2JLBA 4D5GA 2ZT6A 1YTUA 2OENG 4EJMA 1NJ1A 3B2QA 1AURA 1KMIY 2YWFA 3Q10A 4M83A 4XAQA 1Y8QA 1P74A 2B1RA 2CNOA 1J6UA 2FX5A 4YMHA 2J0SA 4AKGA 4HH3C 2JCYA 2WSYB 1NULA 3OQ1A 4TKLA 3RREA 4LQCA 1IWPB 1J21A 1V1JA 4MMXB 1RRGA 1H2EA 2NSHA 3FB4A 1HNXB 5E4JA 3D7RA 1OJ7A 1UPBA 4CMKA 5CX1A 2GT1A 1AS0A 1Y3AA 4M0KA 2Z6VA 2XTAA 4B3DA 4AY6A 5AK6A 3GXOA 1GCGA 2OCIA 4HF7A 4TYWA 3COPA 4BNUA 1T9BA 2GA8A 5JEDA 5AHRA 4BRSA 3DUFB 3Q15C 2R4UA 2JFQA 4CUKA 2NTJA 1MPXA 3BREA 5JC1A 9MHTA 4CEJA 4I19A 4DSOA 4MR7B 1SUWA 4ZYUA 5JJIA 3S5JA 1UFRA 4NCXA 3EX7C 3B5JA 4YASA 5AKLA 3P9QA 3HB4X 1UFVA 3Q88A 2DB3A 1K8YB 3F46A 3MHPA 3T7DA 3K70D 1BQEA 4FQ7A 4B4WA 3QYJA 3AGQA 1Y7HA 1RBMA 1HDYA 4IJKA 1QB8A 1SXJE 2DTDA 2PWAA 5DHQA 3W8RA 4E4TA 5IBCA 721PA 1EK6A 1JI0A 1L7PA 1SBNE 3OQBA 5FADA 3WJ2A 2ZEJA 1T9AA 2DLCX 2A1IA 4NV3A 2XUZA 1XK6A 3LW7A 1ZQ9A 1UKCA 3G2KA 3ZI7A 2CHGA 4DPKA 3GMIA 2HRZA 3EZLA 3P96A 1RWXA 2XTMA 3DMFA 3Q41A 5HCUA 4OATA 4IINA 3N58A 5BR4A 3SHFA 1PK9A 4ZGWA 1VLMA 3K0EA 3AJ8A 4CG3A 5K2MA 1OFUA 2R1TB 3D2AA 3WNCA 5IKEA 3KB8A 4FB5A 2ZYRA 1F3OA 3ZZ1A 4EK9A 5K0ZA 3SQXA 4HFRA 4W5QA 3ABRB 4IYJA 2LW7A 2J6CA 2FPOA 3QEKA 3BJRA 4MWCA 1UOEA 4HLUA 4B7AA 1U1EA 4KN6A 4G0OA 4Q15A 3THXA 3IP9A 3O2SB 1JP7A 1SBQA 2Q3BA 3QVOA 3M6IA 5EHQA 5HOEA 3BXGA 4BOYA 4RMNA 1RI5A 2UUBB 4FQ5A 1OBVA 1JF8A 2WIGA 2OAP1 1HDEA 4ZYTA 1E6LA 3EW9A 4ZVLA 5LA6A 1NWCA 2YMPA 3EUWA 3Q85A 4FC7A 3UJ8A 4F5ZA 1LWOA 5L3RA 3VNVA 3AERB 3N7TA 3NYWA 1K6XA 3KLPX 1YRAA 4RD2A 4Y1RB 5BURA 1N6LA 4HLDA 3ANNA 4AJIA 3RYCA 3OCCA 2HHAA 2CXUA 4QC2A 3WYDA 2CXPA 3KKKA 1BHJA 4YIKA 5C8YF 2YQ4A 4GKAA 1KEEB 5KHAA 5K2OA 4GDMA 1P33A 1EWYA 2UUPA 3HVJA 4BZZA 2P35A 3KYCB 3UWSA 3TEMA 3L7MA 5B1EA 2IH2A 1TVKB 1Y1RA 3L8YA 1E2LA 1S02A 3PT9A 4WESA 2HTEA 3B48A 5EZYF 3DAGA 3I64A 3WR5A 4LOHA 3RYIA 4K28A 3I1FA 4ER5A 2ZAIA 1Z68A 5HCIA 3B9QA 4XVCA 2HU2A 1YGYA 4LJ7A 3Q3HA 1VJGA 1ZIXA 3B1JA 1IDN1 1PJ4A 5FI1B 5G0TA 3KXDA 3ZY6A 1WKVA 4A0RA 5EUBA 4EJ0A 2HJGA 2ZQZA 3BQMB 3VI3B 1YRWA 4NQZA 3U7JA 2Y2VA 3C7AA 2DFTA 3LBYA 5JVDF 1DJPA 1LVGA 1WCV1 2GD2A 2XODA 4WOBA 3L7NA 4QDKA 4E7OA 1CY6A 1C7FA 2XOKA 1JALA 4K9MA 5IXJA 1Y98A 2Q4TA 3GR6A 4W1RA 3GOHA 1X42A 1P5HA 2WOJA 3ROEA 1TADA 2D62A 1YA8A 3O82A 4US2R 5JZOA 3IT2A 3C5VA 4UBNA 3E9NA 5CR9A 1YS6A 1G9SA 2I2XB 3OLCX 4G4SP 3A6LA 3FDIA 1F4PA 1JMVA 3BD9A 5DGDA 4GP7A 3SF8B 1QMPA 1VC2A 4QFMA 1KEZA 4UXJA 3PWTA 4C21A 2LWIA 2WBLC 3FCXA 4FMDB 5AICA 4QHSA 3RT1A 3D7KA 3SMQA 3WLIA 2EEZA 4C3OB 1YDFA 1R9MA 1JZQA 4F3CA 4RTMA 4B3IA 3WWPA 2VHCA 2ZREA 2PCLA 1GA4A 1AIPA 3T7EA 3WWZA 2P4HX 5U4XA 4F38A 2GCOA 2YC4C 3UXMA 1JKJB 1JDVA 3PC2A 4F86A 4H4EA 1BTOA 3EG9B 4AC9A 1PX2A 4EEKA 4WEOA 3ZJ5A 3KOYA 4B85A 2H3EA 5CX4A 3BUSA 1D4FA 4IO0A 3NOXA 2B99A 2Z2JA 1HDXA 4INJA 3RVPA 4XEUA 1I3CA 2BKAA 2EP8A 3OTGA 1PWYE 2YNMC 4GICA 3G0BA 2P9QA 1J7KA 2XB8A 5EPEA 1VBNA 2FSHA 2ZIVB 1SRQA 4KFUA 5GIOE 3BL6A 3QXGA 4LRUA 1CSEE 1KDYA 4G3XA 2G9ZA 4NJEB 4TM8A 4ZVOA 1ISFA 3N86A 4EKGA 2FUNB 5ILGA 2GZRA 3A4LA 3DVSX 3MW8A 1MUUA 1G20E 1Z4QA 1YDHA 2FSPA 4BS9A 4OI0A 4DIDA 4KXLA 4PU0A 3CV3A 3QVKA 4WADA 1F6DA 4AN1A 5JQWA 2FK8A 2IBTA 3SR0A 2ESRA 3VZSA 1PZNA 4JDUA 3FNIA 5ULLA 3TIFA 3WIOA 2PR7A 4N1AA 1IK6A 3K9WA 2HSGA 2WAAA 3GEHA 3EA0A 3VBCA 1X8XA 1DKMA 3KKNA 2AFIE 3MPOA 4Z54A 3PHHA 4OQFA 5AM2A 1OXTA 3WSTA 1CK4A 1A9QA 1DQSA 1WIWA 2QN3A 2X0JA 3F5QA 4D5EA 4L0QA 1RJDA 3E3NA 3D1LA 4BO6A 1XP8A 2ORIA 1FFWA 3IDOA 4US0R 3FIUA 4NBUA 5B57C 1L0BA 8LDHA 3DC7A 3MJ4A 3IIIA 1R1DA 3QUAA 4DCJA 2AR0A 1QIJA 1K3FA 1YQGA 3H16A 3SU8A 4GI1A 4JUIA 4CV1A 1YZ3A 1C9EA 3EE6A 3M3PA 3OAAA 3WO1A 2FN4A 3MB8A 3AR6A 4Q02A 3LCJA 1T2FA 1XVLA 2VXYA 2VH2A 3ZWYA 5IPFA 2QJTA 3RG8A 4ZI7A 3OFNA 1VIDA 1P9WA 2PHZA 3ZGXA 4HVLA 5DNCA 1SKUA 1YRQA 2WG2A 4L2IA 2FDCA 4ASUD 4KLCA 2Q4BA 4XWYA 4JHLA 1M2KA 2HXYA 2FW7A 2XBLA 2ZUSA 1PTJA 1WCIA 2LDXA 3IDQA 3R3SA 1BN7A 1Y82A 4MZXA 4OQDA 5DTJA 2XE7A 3CXRA 1RYZA 2B30A 1E3WA 5DSTA 5ARDA 1V1RA 2PMCA 3L06A 4ALLA 4AZVA 5HIAA 1RYEA 4C4PA 3LLCA 2J87A 3BXFA 2E49A 4PYIA 2GKOA 3LDHA 3L3BA 4FHDA 5AJXA 1XU9A 2DTEA 2VRCA 1UUFA 4LZPA 1NMXA 4OXQA 4OJQA 2WIDA 5LUBA 4G01B 3RUAA 3UY4A 1S96A 3TVDA 2EBFX 2J46A 4J0QA 2QRUA 2DH6A 2WWRA 4ODIA 4FFWA 4GKKB 1U7WA 2H0AA 3DJYA 2ZBRA 4XX0A 1ZLYA 4H0NA 3DD1A 3EIUA 5GV7A 2EIXA 1KWKA 1E2HA 3AMVA 2QAGB 1BOOA 3STHA 2GTPA 4JBNA 1KJYA 1C7JA 4AMGA 3Q7PA 3MS4A 4UOEA 1G5FA 3LL4A 1YCDA 5AM4A 5JROA 4NI5A 1CF2O 3TQFA 2FG7C 4UHBA 1YHZA 5FFMA 1Z9BA 3TL6A 4EWLA 2W00A 2XJ9A 3EZFA 3QVJA 4IXWA 4B3GA 1S3GA 2IKSA 1ND5A 1GL7A 3TCKA 1NC3A 4ON9A 4YCLA 4R9NA 2MYUA 3OZVA 4OMDA 5LP6B 4YECA 2R62A 4LE1A 4M7WA 1ZVVA 5IM5A 1Z15A 1BVRA 1UR5A 1MT3A 4OX9B 3ZW7A 1T8WA 4R8KA 4RTQA 3WK8A 4FSDA 4LJ9A 2CB0A 3VHQA 1D9ZA 1X1EA 1T5HX 2HRBA 3O3MB 3OETA 2CNLA 2MCFA 4BC1A 1UDWA 4JIMA 5KQMA 4NMMA 5EQFA 5I9LA 1IOZA 1EUCA 2J45A 3QKRB 4YO8A 4F4DA 4EJFA 2QR2A 5C1OA 5D51S 1BH2A 2D4AA 4OAOA 1H5UA 1NN3A 3HY3A 3GCGA 3F47A 3WB2A 1HEIA 1XMXA 1UBUS 2D7JA 5IJZA 1TYCA 1U2ZA 4NDAA 3VR4H 3MBKA 1VE6A 1AM4D 4A26A 1AQIA 3RTBA 1TIBA 1M2OB 1QHEA 1UANA 4NCHA 3ZWPA 2BFDB 5INTA 3R3VA 3I61A 4DADA 4ZRMA 1GRCA 2PU7A 1VI2A 5SZHB 4JUAA 3PXXA 4BO5A 4DA7A 1ETUA 1SC6A 2OBXA 2DC1A 2JS7A 4MV8A 4W7SA 2APJA 3C6XA 5AVUA 1VJRA 2V6GA 1NF3A 5NULA 4LF8B 2XAUA 3T9BA 3ZGLA 3BJMA 4MUIA 2IOFK 1ZOIA 2YVAA 3QUSA 4X24A 5K8LA 4J7UA 4L74A 4N8DA 3VYWA 4F8EA 2QRHA 3J7TA 2Z2ZA 3IR6A 4EW2A 3C4JA 3MSXA 4RMIA 3MCAA 2XRFA 2PSFA 3A0RB 1ULSA 5JYDA 3QELB 2D1FA 5FTLA 1BE1A 1U8EA 1UBEA 1BXGA 2G25A 4HB0A 1JEYA 4R1QA 2ZXEA 1DLIA 4WXPA 4BMPB 4CLXA 5MDHA 3N0XA 4B09A 4IR7A 3H1EA 3ZWQA 1OI7A 3A9SA 1FLNA 1P7WA 2CJXA 2WSSD 4NSNA 4U0KA 5JCJA 1BGXT 4KFRA 3GP3A 4K2HA 4MVJE 3NRCA 4B71A 4ZC1A 1ZJ5A 3RRBA 3Q8LA 4MYUA 2I6TA 3FFXA 4GZ3A 3EZ2A 4H2DA 5JHHB 1CQIA 4Q05A 1M1NA 1JPJA 4AY4A 2C84A 5IBQA 2CHEA 1AK9A 4ZCIA 1KO4A 4PCAA 2P2ZA 4JBYA 4AJOA 4CMBA 1WXIA 2JKZA 3QHAA 2Q1SA 5A0FA 4KR6A 3FUWA 3QNMA 4UREA 5B1DA 2GEVA 4D3FA 3CB2A 1CVIA 5EIHA 1R0XA 2IKQA 3GLGB 1Z3IX 3WLLA 3M6UA 1P61B 4Z0PA 4RULA 4KXQA 5T8KC 2B2CA 1KJ8A 2RKWA 3TRDA 1Y9JA 3GLSA 1VSTA 2KPOA 1QH8B 4MGZR 3DBHB 4M89A 2DOKA 1PP4A 3EGEA 3P2KA 3EQ9A 1G3QA 1HETA 2QV0A 3OPXA 4MIEA 3USCS 5KOIA 3GZTB 4B3RB 2OB1A 1GRNA 3EVZA 1N6HA 2GGSA 3JD4A 3NEPX 3NFYA 4C4RA 3EJ6A 2Q8QA 1OX5A 3I01A 4NMXB 2I4LA 4G5HA 1CJTC 2QVGA 3KM0A 1QDEA 1EA7A 1Z6TA 4X0EA 1NATA 4A6PA 2C5FA 4BQPA 3NUGA 5I7FA 5KNDA 2F3RA 4ZPXA 4QM6A 1IY9A 3E81A 2QUZA 1B26A 2PBFA 5F5XA 4DREA 4HQLA 4G5XA 1S3IA 1X94A 1RJWA 3W2EA 2H8KA 2DLDA 3F3KA 3H2SA 3OY2A 4N6GA 4JP5A 1E4YA 1UK9A 4AZSA 4RA6B 1WSWA 1ZA1A 1PUJA 2NUAA 2ZP1A 1UH5A 4D9KA 2C95A 5FL3A 4DV4B 1VE5A 5EWMA 1VPTA 2QVLA 2J9YB 5ERYA 1D4ZA 3PNBA 4B81A 2BJHA 4WCFB 5JXJA 1REQB 1A9XA 2N3ZA 4PLYA 3ZV5A 2EW2A 2HSDA 1B41A 1ZONA 2HJ9A 5M3BA 2JJ8A 3LIIA 1CUXA 1DPFA 3W7AA 4JYAB 1USGA 3KYDA 2P5YA 1LSJA 1NP6A 4G1UC 4OLBA 2WYVA 3CRRA 4HRVA 3NNNA 4UTOA 1T8YA 4LMRA 4HAOA 1CHDA 3O5AA 4L4YA 2C07A 2VYVA 4AUKA 3C43A 4J29A 1QXSA 3DT6A 3EGOA 4DB4A 1LS6A 1C30A 3DOCA 5LXTA 3PQ4A 3KR0A 5CEFA 1J7JA 3E58A 3HZHA 1QC5B 5LDGA 5ALXA 5L51A 4ZQHA 4HNAA 4E3WA 4RPHA 2Q6IA 5EQTA 4QA9A 2P0YA 4MNTA 1PAUA 1WL8A 3N0RA 3O4FA 5EZYB 4KI0A 3SIWA 3ZGVA 4WERA 5KSWB 2BC9A 3NTXA 4BO7A 1KC1A 1SZPA 3G59A 1JSZA 3OZBA 4HGOA 3EYAA 3QLEA 4IFTA 3UM9A 4A8JB 1LWNA 3WGIA 1GVNB 2OB2A 1CX9B 2PMWB 5JH7F 5K0JA 1GGHA 1XE3A 2H0QA 2PKQO 4MUAA 1LU9A 3F6EX 1LPAB 2HRDA 1G8MA 2JFBA 2ZQYA 4UHCA 1V37A 5DTMA 3VJKA 4PAOA 3IP8A 4W63A 2FXIA 2VHJA 2FSSA 4QUJA 1T5DX 1YJBA 5ALDA 1N3IA 3BB1A 4C0KA 1I2DA 2QMEA 3UZUA 3VSDA 1XG5A 1YCFA 2I2AA 4U7DA 1C9YA 3W5SA 2O8FB 1WXFA 2QAGC 2CJFA 4KH1A 4YRNA 2VDMB 1MX3A 2NAPA 1QKKA 3I2JA 4KXXA 4OI1A 5D6NA 2IGTA 2WTMA 1TPZA 1M8FA 1M34B 1TLFA 2AA3A 3HM2A 3QUTA 2ZIUB 4RL6A 1TB4A 3IUBA 2XGOA 3MQ4A 5AHKA 3UGJA 1DKOA 4NCIA 3VO1A 1E9BA 4TL6A 2QL5A 2I2FA 3GLIB 1YS4A 2WNIA 3MYRA 2HJHA 2IUSA 5CDFA 3LZDA 3FUVA 4QLAA 1JKXA 2REQA 3H17A 1ZXXA 3GFRA 3DHNA 4MW5A 2IX3A 2XWQA 4YV7A 1XAHA 3H1BA 3KEGA 1YS7A 1OFTA 4FWTA 4R6XA 3LVQE 1R18A 3KYJB 4CN9A 3IUJA 3PT5A 3ND6A 4WCVA 4LNHA 5CXSA 2XUGA 1Z36A 4JLWA 2QU7A 4JN6B 1XNGA 3R20A 3RE1A 1QP7A 1SUEA 4LOIA 1QUEA 2H1IA 3QEBZ 1WXGA 3MT8A 2YWCA 2IPMA 2I34A 4DLKA 3ROGA 3S28A 3AW8A 3UV6A 4MUGA 2WF6A 2VVTA 5LFAA 2I3BA 1E58A 1B42A 2R6DA 3IOBA 4HQNA 1GLVA 5HFAA 5IMSA 1J42A 2CMDA 2Q1YA 2W43A 4GRIA 4R2IA 4DR4B 4IDGA 1DX6A 1K8RA 2XUFA 1XHLA 4ZVTA 4E4RA 4R40A 4TZTA 3URMA 5BN1A 5AJZA 3ADCA 3WLSA 2WWYA 4CFZA 5J1SB 1VE7A 2FUKA 3I09A 1ULZA 3O84A 4HEQA 4W7IA 1UP6A 1O4WA 4Z1MA 4BNWA 1F48A 3I53A 2XKKA 2J3JA 3K09C 2LXNA 3FFBA 1GGNA 1MB2A 3TOCA 1O0SA 1E20A 1K4MA 1E18A 2YZNA 3FH0A 4O6VA 3IGFA 2XH8A 4MS3B 1X1QA 2XXJA 4YMLA 1W44A 2VBGA 4L5YA 1TECE 2BM0A 3FVQA 5AXDA 2HT6A 3RRZA 2QDXA 4DIFA 5IG2A 1P1CA 3DF9A 3ISTA 4HDOB 2VF5X 2FDXA 4TS4A 5D2CA 3EAFA 1AZTA 1GGJA 2O07A 3AOGA 5C8ZA 1IXYA 4J4HA 4QOEA 1XZHA 1IZ7A 1OX4B 1T36B 4F9FA 1UBNA 4HDQB 5D00A 3QPAA 3AHCA 2OYCA 2N42A 3AR7A 3ZIAA 4FGKA 2Z6UA 1L7MA 2OBMA 1UXGA 1JYEA 3OHPA 4XZ3A 2XNJA 3MLAA 3W5VA 1BS9A 4OM8A 1TJYA 3HCDA 1ZUNB 2DCUA 3NM5A 4TN1A 3IMEA 1WR8A 3D4BA 3ET4A 1QBKC 2GPNA 3OJEA 4YJ2A 4U39A 5G2OA 1PS8A 2AOXA 4B7ZA 4FHCA 1MXFA 1W75A 1RKVA 2DHEA 3EB9A 5HIJA 1JH8A 2GEBA 2XB4A 2ZKLA 4QRHA 2V9CA 3C6QA 3P9IA 4KX5A 1K89A 3AX6A 2AJDA 1CZNA 1A8HA 2VH1A 3DEKA 2VXCA 2XKBA 3I30X 5ES3A 4XDHA 4L50A 4M8SA 3JVUA 5BW4A 2PLNA 3PC4A 3NDJA 3O4IA 4KQKA 2ISQA 1EGAA 3LHIA 1PE0A 3STWA 5KYYA 1GNSA 2B1IA 1HQKA 3I45A 2VDWB 2QAIA 4FMBB 4MVJI 1MC1A 1FW8A 4B6GA 2REOA 1NVAA 1JYSA 1VKHA 1SPBS 3JQ9C 4NJOA 3AF2A 3KTOA 5D7NA 2FSIA 2K87A 3RC3A 1R50A 3EY9A 5AVWA 1T24A 4WZBA 4EECA 1XBTA 3F78A 3B38A 4QQFA 1GTVA 1VDZA 4Y7CA 3WV4A 5KYWA 2R44A 3NLLA 2IHYA 1TKCA 4ZO6A 5F3RA 3VU1A 3MINA 2ZCJA 2C94A 2BSAA 2XMCA 4YT5A 4L8GA 2GR9A 5H7XA 4B8ZA 5D8DA 4BLQA 2OV3A 1Z75A 1I0LA 3KX2A 3EDQA 1P62B 3PJGA 2YJ6A 4PNEA 2ZB8A 4CQMA 2GVNA 2ZM6B 2PZKA 4G67A 2C59A 3TNFA 4M36A 4WCFC 3ICCA 4Z0NA 3VVBA 3V1NA 2IUTA 2YXDA 4A91A 2OTCA 2XIJA 3VJRA 3IS3A 3KAQA 4YUAA 1T9HA 3LGAA 1SCDA 1VHJA 1X7ZB 4L9WA 3E18A 4V0MA 1C8KA 2ZRHA 4YYEA 2MOKA 4EGCB 3M89A 2BGLA 4F4JA 4U2KA 3Q7EA 3T3HA 2RHJA 4HYTA 3VU3A 4BMOB 2WPDA 3JQFA 3HVRA 2YN0A 2EL9A 3F67A 1DX9A 1PFGA 4IS3A 4MUFA 4YONB 3ZVNA 3LJKA 1Z37A 4M76B 4R05A 2ECFA 2V96A 1V4NA 3BE8A 1NJ8A 2QM8A 2CV2A 5A9SB 3K31A 2ZRAA 4U3JA 3NOQA 2AKYA 2DQYA 4IDBA 4KGZA 1B73A 2MYPA 2VTEA 4MLZA 1JLHA 3PRYA 5HKBA 3C16C 3DTVB 3OC6A 1FP4B 3GGJA 4Q48A 4UXIA 2ZWAA 4I9UA 3AEUA 3TO5A 1DQZA 2RKBA 2QN6A 2I4TA 1PIWA 3HYRA 4GXTA 2WYHA 4X44A 1XZKA 4ZICA 1G41A 3UMRA 1RAGA 1OWPA 2J59A 1VLLA 3BF8A 4HDNB 4OREX 4BCBA 1IEQA 4UMDA 3V1UA 4GOLD 1ZO8A 4ND8A 4A8JC 4OJMX 4MQ4A 1TVCA 2LUOA 1JR4A 2H57A 4WDRA 1M5UA 2XPCA 2F6RA 5JNLA 1G8GA 4JQOA 5EKDA 2O2IA 2X9VA 2MSNA 2JLYA 3R6DA 1OC4A 1QGYA 2A1TS 4LDRA 1PN3A 4TRRA 5EP3A 1G8JA 2W8BA 4TLCA 5AOVA 1KOJA 4QJBA 4W1QA 4CU2A 1BX1A 4TZ0A 4YACA 2ID7A 1DQYA 2ZWVA 4P33A 4BO9A 4PPQA 1SVWA 3CINA 2JI7A 4TWBA 2QJFA 4KQHA 4OIFA 2PN1A 4XFJA 1V2HE 4S2EA 4MGYR 3RRNA 2WTUA 4B79A 4Q7JB 4XX1A 1FSSA 1T2CA 2CDNA 3GBSA 1KJIA 2FMIA 4DBVO 2OXCA 1YZQA 1YACA 1V96A 4HCJA 3WZLA 2YY6A 1O0BA 1KNXA 1JQ3A 1H23A 2F62A 3UW1A 5IN4A 5M5BA 2JJ1A 4PYRA 1RLMA 2B7BA 2DAPA 4R8VA 5TQ0A 3OKAA 1JXMA 2NWQA 3MJCA 2LRHA 4DMLA 4X93A 2B8JA 4AMUA 2PUEA 2DJIA 1F1BA 5DV9A 4C3UA 3VR6H 3PEEA 5DX0A 2WZQA 3DWEX 4R7ZA 5FCDA 1N5LA 1SCNE 4ZAGA 1CJBA 3AEYA 1ZVJA 4PC2A 2BOVA 1PJAA 4LKRA 1I4EB 1KAMA 2CGEA 3BF7A 3AKZA 2XWJI 4D92A 2GZHA 2P2GA 4MW6A 3HJGA 3OH8A 3QUCA 3V00A 1FSPA 3PSAA 3IE0A 5C53B 4LOLA 4YRAA 3BRWD 4MWOA 4AXBA 2J3EA 1M1YA 3VNSA 1CP3A 4FGJA 4EFKA 4FDLA 1KQFA 1J2RA 5DW3A 1DT5A 3AL3A 3W5CA 3GFBA 1G98A 3FNGA 3GDHA 2DQSA 1HRKA 2ZU0C 5HK8A 2J3IA 3RSFA 3DQQA 4ALNA 3V34A 1RI3A 1SZDA 1GWNA 1XTVA 3GG9A 3SS7X 1N6KA 1QRRA 1RLUA 3G82C 3H2ZA 1DAPA 1G1AA 3E5RA 3TRJA 5MHTA 4DTCA 5HDBB 1E3IA 3L0BA 1JU9A 4URZR 1U0RA 3GAZA 2QXUA 1NR1A 4H0CA 4UHKA 4X64B 1HDCA 2HWKA 1TT5A 4QQRA 4AY3A 4D74A 1PYGA 1H8HA 2J0UA 3SQOA 4C20A 4OQPA 1L5QA 1J5PA 5TGZA 3LXXA 4BKUA 1GZHB 2FPMA 3LT5A 4UTXA 2YKGA 4QATA 1WW8A 4I1VA 4B2YA 4DA4A 1YE8A 1W0CA 1IH8A 1KMHA 2JAXA 4I1UA 2GHIA 5HFJA 2NP6A 2GZAA 4S35A 3AFGA 5AVQA 1CY7A 1SC3A 2WMNB 3CKYA 3EN0A 3MGBA 3X3HA 4IS2A 4O2BB 4CIDA 3SHQA 1ZEMA 4BFYA 4N0EA 1CUIA 4ZPJA 2GSWA 1NBAA 3BAFA 3IE2A 4KN9S 5E6UB 5J5CA 2BFNA 4AF7A 4DBZA 4DRYA 1H1DA 4YQEA 2KHZA 4M1YA 2FMFA 1FP6A 1K8XB 2RHBA 3B12A 5K3FA 4P36A 1L5SA 1ELOA 4GR4A 3C1AA 5B4VA 1U1IA 2GD6A 4OHXA 3TQCA 1P2UA 1BEEA 1YVUA 2H1VA 2QX9A 3FCEA 4ZMSA 2H54A 3I2FA 5DLPA 3DJFA 1NI5A 1D6JA 1JHOA 2FLKA 2NU6B 2R7KA 5JE8A 1TZCA 3OFVA 4HUJA 2DPHA 2IODA 5DNEA 4D8YA 2CNBA 2AE1A 4M1EA 1WMSA 3OZXA 1ZXLA 4WE3A 1Z16A 2W2LD 2PPLA 3ANSA 2JIRA 1FL9A 1TI7A 4GOJA 3ROMA 4YP7A 2OORA 2TRSB 4H4CA 1K6MA 4H3KB 5CXQA 2SHKA 1W34A 3K8QA 2H52A 3NNSA 4RFSA 4BP3A 1WV1A 4DXHA 2H11A 1GHTA 1K5GA 1SKYE 1AY0A 2Q3FA 3BFVA 3COSA 5BN4B 5I8PA 3AVUA 1JSLA 3WRXC 1VHWA 1WOMA 4R2MA 4OU4A 2EBHX 4EEZA 3E9CA 1I7LA 3N70A 1WEHA 2JIDA 2OGUA 2R11A 3QYAA 1QE5A 1QGUA 4X1IB 4MKHA 3OPYI 5CB0A 1NVVQ 2QIPA 4AVYA 4P83A 3EXHC 1OAKA 3PDHA 1RVV1 4QDJA 4W9RA 1KZ4A 2QN9A 2B3DA 5BYKA 4QDOA 5LB2A 2O8CB 1OIWA 1QZTA 4Q6BA 1XK7A 5EE0A 2HGZA 4BRZA 2P7IA 4HATA 4ND6A 2ZRLA 3FMVA 4WGFA 3VJMA 1RZRD 1R0KA 3JATA 3QFRA 2G07A 3QLVA 5G3ZA 2PLAA 4RMJA 2AUTA 3T15A 1EVKA 2BRUC 3KEQA 3HJFA 1GAJA 1OYOA 4BNDA 3B3GA 4JOQA 2L42A 1E2KA 4HWPA 4EGSA 1BD3A 1N5OX 3L2OB 2JGDB 4FLMA 4AJ1A 4F8YA 4KFSA 2IEZA 4DIUA 3PXCX 4KVAA 1ZKMA 3NTVA 4LXQA 3ZWCA 3P20A 5BOSB 1AHIA 1UMKA 1RXWA 4FT4A 1K5PA 3H04A 1RRPA 2P4UA 3H2JA 4ZOAA 3U80A 4DEXA 4NQRA 1A5AB 1JWBB 3G2HA 3I28A 5AKHA 3AB7A 2ZGVA 4AIRA 3D8TA 5AM1A 5IDYA 1XNQB 3FTEA 5ARBA 1X74A 1XRLA 4NXNB 4RMHA 1P2SA 6ABPA 3C6BA 2C57A 3PQ7A 3TKAA 3SHOA 1GUDA 4DJEC 4R4JA 1GGEA 1UT5A 2HK7A 1FFXB 5FT9A 2Q0SA 1DIHA 1GCOA 1L4EA 4K87A 4XVUA 2ZB2A 2A59A 3DW3X 2XKJE 5L8VA 4X9XA 3S81A 2VWHA 3K2BA 1CQPA 3LO8A 2WD7A 4QRIA 4R31A 3RUHA 4TUYF 4P5EA 4QOJA 4N0QA 1AVTA 3DOOA 3R7SA 1KRHA 1IMJA 2JZNA 1JHMA 2ZYWX 3VAYA 2WICA 2BTEA 2PYDA 1BDIA 5HWSA 3HYTA 5I45A 3STYA 2VQEB 2BFWA 3PPYA 3ZK9A 3EASA 1U9CA 3FCYA 2A8YA 1G7TA 2PY6A 3ORSA 3BOSA 3TR0A 4EDHA 5LQCA 1UODA 1KQ3A 2C2WA 4QPPA 4UCWA 2AI1A 1IEWA 2RGAA 4J0FA 1GDDA 2FUG1 1R0LA 1C8VB 5C5CA 1UXHA 3EGIA 3GFFA 5AHOA 1TK9A 3A06A 3RFCA 4BJ3A 4R0MA 1S2MA 4QBGB 1L6RA 2NG1A 3UT5A 3ZHRA 1C7EA 4C29A 3HPQA 1Q0PA 1L7BA 1P2DA 2W2KB 4HAXA 5LMNB 4DC9A 1XRSB 4D99A 3CQ9A 4JYCA 1XTPA 5BN3A 5HKKD 2V55B 4TYMA 3ZY3A 4UATA 4YPVA 1DADA 1MX9A 3I6YA 1QVRA 4NBWA 5A3JA 4HAUA 3OTHA 3F2VA 4I6EA 3CTMA 3LZ6A 4H7JA 4X61A 4WFJA 4MZDA 4IUCS 3QFHA 3QU7A 1ZUWA 3FHOA 2OO7A 1JU4A 2PS9A 2RHTA 1P7CA 2EWWA 3IKTA 1FRNA 3H2GA 4J1SA 1E1LA 3R09A 4BUZA 2X5JO 4R3WA 1Z06A 3D7MA 3GQBB 1N2IA 3V8QA 2BMEA 2PMFA 3WSWA 4CCAA 1MC8A 3GI1A 2BGIA 3S8EA 1MEJA 2BDUA 5L9AA 2FR0A 3N39C 1KNQA 2R79A 4FGWA 4X6UA 1ML4A 4OB7A 4C08A 1Q0UA 4IVNA 3EK2A 4D9GA 2IZ0A 4FTWA 5D5HA 3IBGA 1ZJ6A 2HLNA 2DFPA 3HFJA 4GO1A 5F7JA 2DFLA 3VYSB 5BWNA 3GPLA 3ADOA 4L0DA 3N7AA 1UINA 1RWOA 3OQJA 2ANCA 1STOA 4A3SA 1GN8A 2ERXA 5JYBA 3KKMA 1V9LA 3C7KA 3CWCA 3GH3A 4XGKA 2Q2WA 1I8TA 3G7UA 4WLUA 3RROA 3P9NA 4XQ9A 3C8MA 2FHPA 3JALB 1FFAA 1GTG1 5CLHA 5ADVA 3PTAA 4FDAA 2UYHA 1CDDA 4KQCA 1E5TA 1ABBA 3TR6A 3WDLA 4D9EA 3LWDA 2YJ5A 4AW9A 4UULA 4URXR 2PZBA 1EUQA 2LKCA 1JTEA 5LYYA 1F20A 5HJEA 2WB2A 2JK1A 2NPFA 3THWA 1NJFA 1ZSNA 1ZCZA 3R24A 2GBCA 2NTYC 2VDJA 4L4SA 4Q01A 3ETGA 3VC7A 3S1AB 2ILVA 2WM2A 1MIHA 3ULKA 3KB1A 4GEKA 5TVKA 4B7XA 3EPRA 3L0IB 4LGYA 4Y2QA 2VHQA 3FSJX 2HSZA 5JPIA 1LZKA 3L4EA 2TSYB 4OX9Y 1OFVA 1TGVA 1WNFA 2VDUE 2WTBA 4K9OA 2VBCA 4WLNA 5J4VA 2FLVA 3HY6A 4MRRA 1INLA 3A4TA 1C1XA 4O5OA 3STVA 2CY0A 3CZPA 3T1VA 2WUDA 2D1YA 3CUKA 3RVJA 4JL8A 3TOZA 5JY1A 3A8TA 3O83A 4CTJA 4A1FA 1JJFA 1RYMA 1ACLA 2ZKIA 1XMOB 1E2DA 4PLTA 3VC1A 2YR0A 1U5BB 1IHOA 1E1CB 2Y1FA 4JB2A 4FR5A 5KVAA 3QLTA 2PX8A 5D87A 3LCVB 1E3LA 6LDHA 3EOBI 1YFZA 4HMOA 5JD3A 3P71T 1I7DA 2GJ8A 1XTKA 5CW1A 3WIDA 2P41A 1LI4A 4CNBA 3AUFA 5CA0A 4HLCA 3T3NA 3MELA 3EF3A 2BMDA 5J5VA 2C29D 2RE8A 2J08A 5FX2A 3TZBA 1PNRA 1U2GA 3Q5GA 3A3KA 1VB5A 4X60A 5D3QA 4EKDA 1RQRA 3B1ZA 1WB4A 3IQDB 3KJIA 3FG9A 3PUZA 3KZOA 3QXCA 1V16A 1YDEA 4PAQA 2C58A 4XB1A 5KSPA 3VDRA 5BXQC 5IC4A 3TUIC 5FPHA 4RIGA 3LYAA 3QX7A 3TMYA 3WQSB 1FYWA 1SWVA 1VGRA 1PT8A 2OCGA 2Q0XA 1E9FA 2V8BA 2VUUA 4Q1CA 4RUKA 2UXDB 2XX3A 3W1EA 3PFKA 5BSGA 4NWIA 4FFDA 1B2LA 3AI1A 4GS5A 4QAJA 4QEKA 3BDAA 3ACBA 3ZXIA 4BJHB 1DG3A 1AKEA 1K5HA 2C97A 5A0VA 4LFCB 3GEEA 1H0SA 3GA0A 1GPLA 4XLLA 1UPAA 4LYGA 4UCXA 2Y8EA 3OZ7A 4FHGA 2C0CA 2IU4A 3D0OA 4D98A 1GAXA 3AINA 2WHRA 4KPUB 2H51A 4OP1A 4ZQFA 5JU6A 2XAAA 3MUEA 4Z5XA 1ENOA 1XNHA 3GW8A 2X76A 4H18A 4KWTA 1T6NA 4AI6A 3WL7A 4EENA 3MTBA 1X9GA 2MSCB 2WKPA 2Z1MA 3W3AH 5DMHA 3EEOA 4DIKA 3M9XA 3PF8A 3ESXA 3LIPA 3TIGA 1PSDA 1CUYA 4D8VA 2JGJA 1LTKA 5FL7D 5C46F 1X9IA 3D43A 4N6NA 2QR5A 2LCQA 3TFQA 1O6FA 3H0CA 4LXTA 3K9QO 1I4WA 1N92A 1YDMA 2FH5B 2R8RA 2WP8J 3HCCA 5CUQA 4ARIA 1BS1A 3FIJA 4UUOA 3AG5A 1DO8A 3DLCA 1KZ6A 1ECBA 2JLSA 3P45A 2W6ZA 2SCUA 1MH1A 2VJDA 4KQXA 4Q3BA 4TWRA 1L5RA 1DEHA 1K92A 1OI2A 2PIDA 1XTZA 2ZYDA 3E48A 2JBAA 3FLAA 4S0ZA 1RJ9B 3H6GA 1ZK4A 2JGKA 1VLZA 3ELWA 2IY8A 1WHSA 3FPKA 3GT7A 2BTOA 5F2NA 4EHFA 2NSYA 2Q1WA 3ME5A 2ZDQA 3CU5A 4JZKA 5DHTA 4N41A 1VPWA 2XQJA 3BAZA 5F9MA 3RBAA 3QXXA 4Q9IA 3V4VB 4MQUA 4MW7A 5KWVA 3D1JA 4RCYA 1QNFA 1TQ4A 2J3MA 2GEFA 3R4CA 5DJ5A 4W1SA 3G9QA 2BI8A 1LLUA 3D5TA 1U3DA 1WPGA 3PQ8A 4N9WA 1DRJA 1NV8A 1Z74A 3OG9A 4TKVA 5HUQA 1DJOA 4AYXA 3L43A 1AZLA 1CUCA 4DOMA 4BQNA 1XAJA 1MJFA 4OQYA 4DLTA 2VJKA 2WKQA 2OGZA 2IPOA 1XJCA 4HYQA 2ZSFA 3K5IA 4WKOA 3ZWWA 2VT6A 4KO2S 3E5HA 4BMSA 5ENVA 5HBRA 4C7XA 4F93B 4NKRA 1U3VA 2WJZB 2RH4A 5I9SA 1F3LA 2E1PA 2O50A 2WVHA 2OK8A 4FHEA 4X3PA 4GPTA 3RRXA 1BFUA 1MB9A 2WU3A 3FOCA 2ZM5A 3SSNA 4HP8A 1OI3A 2FQXA 2XVZA 3M6XA 4I55F 2FRXA 4ZT4A 4E70A 2G9UA 4NH0A 5J59A 1U7TA 3K71B 3VNBA 2Y1OA 2RHRA 1BWPA 4ZTBA 3IAEA 3U4DA 5K9ZA 2Z9BA 3LA6A 1TAUA 4G86A 1ZH4A 3FOWA 3G6KA 2X5KO 5DT2A 3R8CA 3RSLA 4LFAB 2QRPA 3FCCA 1JMKC 5ALNA 3HVUA 5MN6A 4DIMA 2SICE 3EDRA 1HLDA 4TKUA 1RJFA 2OCAA 1YULA 4YRBA 3N8GA 2H1RA 5EIBC 1MT0A 4RD6A 4EY6A 5L3QA 1X7YA 3FNHA 1L7AA 2NACA 4RM3A 4BAZA 1S3FA 4Z0HO 3VR4A 1RJGA 5C2JB 1TMGE 1UBFA 3G0CA 3P2OA 1U2QA 4G0MA 4MPPA 4ARUA 1J1IA 2NXEA 1BFKA 3HVHA 5ALVA 2ZBGA 1KK1A 3IKMB 4KBFA 3R5TA 3MTQA 1DCMA 3TAXA 3Q3IA 1Q7RA 3W4IA 4XIYA 1GADO 5REQA 2J5XA 1YZVA 4NZ9A 3BWBA 5JSYA 5LKRA 3ETLA 3V7YA 4OXNA 2VHWA 1PI3A 4B3BA 3UHJA 2ZS7A 2O2EA 1T29A 2DR2A 1CUBA 2QE7A 3IQZA 2H7XA 2JRLA 3EEBA 4D41A 3HSYA 4M1TA 2ZROA 4KQFA 2VPIA 3AFNA 3ZY2A 3U1TA 3ZWMA 2I2BA 3RS4A 1FXWA 4I4TB 2AEFA 1E79D 1XZ8A 2YMMA 2O7QA 3N6VA 1MC5A 1C9NA 2EX4A 2R7MA 2VPWA 3ILXA 4BQRA 5B6IA 1ZWKA 1CCWA 1NLUA 2G9QA 5GINE 1O94D 5EIBD 5K0FA 4D6XA 5DISB 2AHRA 3GDWA 1Y37A 5EESA 4EY3A 5HM8A 1FF9A 3FN4A 3L4JA 2IZ7A 3U0BA