2OCGA

Crystal structure of human valacyclovir hydrolase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
254
structure length
254
Chain Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Valacyclovir hydrolase
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ocgA00
5HF8A 4ETWA 4QA9A 4B83A 1DX6A 4NVRA 5FP0A 1O6FA 3OURA 4C4ZA 1P0PA 4P92A 1H2YA 4UBNA 3H19A 1RYYA 1VKHA 4DLNA 2CBGA 2OCLA 3SK0A 4CG1A 4G9GA 3CCBA 1QIMA 1UK7A 2CEKA 1CUHA 5EHQA 1LNSA 2Z8XA 5CH8A 1CUJA 1EXWA 1YA8A 3HI4A 5ALQA 2WLSA 1T4MA 3OC0A 3QH4A 4J0CA 3R41A 3IIIA 3WL6A 3EF3A 3HC7A 5JZBA 1KU6A 4B85A 4KE7A 5EGNA 1QGED 1CUFA 5HCUA 3WZLA 2OQIA 4G4JA 3RLIA 1CIJA 3I2GA 2OCGA 4AMYA 1CUBA 3SC2A 2Y6VA 1MNAA 2D5LA 3RKSA 5ALSA 2VJAA 1ZD4A 4H7HA 1C7JA 4MXDA 1UZAA 3UUEA 1L7RA 5CH5A 2RHTA 5JAHA 5DWDA 2DHDA 5CXUA 3O4GA 2XMSA 3A2NA 5A7HA 4DNPA 4DNOA 3ANSA 3AJAA 3C8DA 2Z3WA 3G8YA 1CUCA 3IURA 1Q0ZA 5ALWA 5ALPA 1ODTC 5ALXA 3P2MA 2WQZA 5ALNA 3F96A 2BUBA 2WIDA 3G0IA 2QT9A 3VDXA 1JJIA 2V98A 5IVIA 2QUBA 3DL7A 4OYYA 3AZPA 1K5PA 1EVEA 1YB7A 4RPCA 2JGLA 4S0XA 2WFZA 4BVLA 3VVLA 3WA7A 1J06A 4FLMA 1XZAA 2J3DA 1AUOA 2WJ6A 5CRIA 5IH7A 4BE9A 2XUGA 4KAFA 4M0EA 4XX1A 3FYTA 5LLSA 2H9YA 2BCEA 2WHPA 1EDEA 2CKMA 1JU4A 3D4LA 2FX5A 2YH2A 2C58A 4A5SA 2RIPA 3QMVA 2WU3A 4AZ3A 1KU0A 3H2HA 3WKCA 4FLEA 2HFJA 1UKCA 1YCDA 4ZREA 2J3QA 4DNQA 2ORYA 1U65A 1A8QA 2G5TA 4U2DA 1CUWA 3NGMA 4FNGA 1KEZA 3CCCA 3H2IA 4BATA 5CT6A 4X00A 2VT6A 3C8HA 4QNNA 5FLKA 5KBYA 1BEEA 2HU5A 4EY5A 3F97A 3QZUA 3D2AA 3FVRA 1CRLA 1DT5A 1UWCA 4H7DA 5FPPA 4EY4A 1DTEA 2K2QB 4HAIA 1WB4A 4U2EA 1YAJA 4BVJA 1BCRA 4PSCA 2VJCA 4H0CA 5HQ3B 5CT4A 1LBSA 2OGZA 3BJRA 1MX5A 3FLAA 1EH5A 3HACA 3I28A 5IVKA 1QO7A 3ZPXA 4DMHA 5EIEA 5SYNA 1HKHA 1E89A 4ZV7A 5A7GA 3R3ZA 5C81A 3FAKA 3AZQA 4QEKA 1GPNA 1HLGA 1OXMA 2ZJ7A 4ZGBA 4UHBA 2PSFA 4QWWA 2CJPA 1VLQA 2DHEA 3HLKA 3HRHA 2D0DA 4QDTA 3STWA 3M82A 4GW3A 1YS1X 1XZKA 2DFPA 5AI8A 1IZ8A 1CV2A 2XLBA 3MVEA 1R50A 2ES4A 2OXEA 4WY8A 2VSQA 5AM5A 4B84A 1C7IA 2B61A 2WG2A 3H1AA 5LP1A 4IQ4A 4FKBA 4J03A 5DYWA 2JGKA 3IBTA 3IUNA 3ZWQA 4N5HX 5I7UA 1WHSA 1G5FA 5JALA 1N5MA 2AJCA 3I6MA 3AIMA 4Y2UA 1QIDA 2ZJFA 2I78A 3AINA 3ICWA 2GYWA 1C4XA 4EA6A 2VJDA 4C88A 2PPLA 1QIHA 1TKRA 3STUA 1XZBA 5CT8A 2ECFA 4CIAA 2XUKA 3V9AA 4Q3KA 3I2FA 3BWXA 3OPMA 4OYLA 5I8PA 3FYUC 1SFRA 1SOMA 5JAUA 4DGQA 5DLPA 5CURA 1W4LA 3C70A 1YSCA 5ALYA 1NX9A 3LIPA 1LPOA 1MT3A 5AK5A 1EI9A 1EX9A 1PJAA 1D07A 3M83A 1ZIYA 3JYHA 5AKLA 1Q84A 4H35A 2QMQA 4Q05A 4GLBA 2V97A 5ALVA 3MGAA 2HRRA 4G5XA 5EI5A 1ZJ5A 3F67A 4Y2XA 1TAHA 5AI5A 1CVLA 1Y7HA 1ZI6A 1LZKA 5YASA 5ALTA 4Y2YA 4L0CA 1G66A 4B9AA 2ZJ6A 3G9ZA 2XQGA 3GUUA 1U8EA 1ORWA 4IHAA 2WIGA 5AHXA 5SYMA 2HA2A 3UUFA 2HA3A 1R4ZA 4BTLA 3SWWA 3ZLVA 3FYUA 4ROTA 3M81A 5AJHA 2RGUA 5K3EA 1UOOA 3RK4A 4YPVA 4F60A 1XKLA 4BB0A 1FFBA 2IX9A 1FJ2A 4U2BA 2WM2A 2H7YA 5K3FA 3FSGD 5J3JA 3WYDA 3FOBA 1TRHA 4LIPD 3FSGA 2HADA 1J07A 3WA6A 4MEAA 4H7KA 4G8BA 1N8SA 2PU5A 3HZOA 5FRDA 3R3WA 5JD5A 5HF9A 1PFQA 2JIDA 3I2KA 3K2IA 4RE5A 4KRXA 1QZ3A 4W63A 2C4HA 1FFAA 1UOQA 4J0DA 2PSJA 2ZYIA 4NS4A 3L1JA 5ALKA 1XLWA 5AKEA 2VTVA 3LIIA 1W1IA 1AX9A 1EK1A 2EDAA 3DKRA 1CUDA 4Y7DA 1VA4A 5ALDA 3W9BA 4FTWA 3OOSA 5E4JA 2VEOA 4FBMA 1DINA 1EB9A 4X7BA 3AILA 5LZ7A 4C4YA 3Q8WA 5AM0A 2PUJA 1O6GA 3O4JA 3R3UA 1USWA 4CCWA 4M0MA 1IUOA 2CZQA 3D0KA 2XMGA 4H7JA 4Q3LA 2HDWA 1QFMA 3STXA 5EFZA 3YASA 4BDTA 3C6BA 5LYYA 1YAHA 3I1YA 1VE7A 2O2IA 3EBLA 1JJFA 3QMWA 3EQ8A 3GA7A 5CT9A 3W04A 4CCYB 2VF2A 3GROA 2XMBA 1R1DA 3G9XA 1XZJA 3PF8A 5AH0A 3HABA 1PV1A 2FJ0A 2HL6A 2Z8ZA 5LIPA 4AQDA 4X92A 2FJPA 2RAUA 4YASA 4BC0A 5LZ2A 2QR5A 4KE9A 1HL7A 4X85A 1AC5A 3WK4A 1TCBA 2WTNA 1LLFA 3BIWA 3G0DA 1N1MA 4PQEA 1CFJA 4OB6A 4PO3X 1R9MA 3V1MA 1TCCA 4ZV9A 2W6CX 4GWLA 3LS2A 3NOXA 5K3CA 5JARA 3WI7A 5AI6A 3IA2A 3WZMA 4G8CA 1VJ5A 4OB8A 4XJVA 4MEBA 3WIBA 2HM7A 2B9VA 3WWOA 5FDFA 4AXBA 4Y2TA 1WB6A 2Y6UA 4UHDA 1UOPA 2XLCA 1E66A 2WHQA 2WFMA 1N5RA 1LZLA 4MWSA 1I6WA 1JT2A 4BYMA 3STTA 1SCQA 4BCCA 4M0FA 1XRQA 1A8UA 1XZLA 3OM8A 4LXGA 3BL8A 4AB1A 2QVBA 4W1PA 2OPHA 2O2HA 1Q83A 5DTJA 1GXSA 1SCIA 4RE6A 5JZ9A 1W76A 5A71A 4FWBA 2OCIA 1F0PA 2XUQA 1XROA 1A7UA 4IH4A 4UBJA 3V1KA 4EB0A 3VVMA 5DNUA 4KRYA 4Y2SA 4LYDA 4F21A 3D2CA 2IIVA 1F0NA 5AKZA 5DYYA 3G9UA 4J3JA 2PX6A 3KWFA 4HXEB 4UFNA 3DL4A 4BP9A 1R9NA 4J0IA 3KDAA 1AGYA 4QDZA 5IVDA 5C7YA 3WK9A 1EK2A 4P08A 2PM8A 3R40A 1VZ3A 4FMPA 1TIBA 3UMJA 1CPYA 3V1NA 3FCYA 5ALZA 2J4CA 1XRMA 2I03A 1WCYA 4JEIA 1A88A 2XT0A 5I9IA 1DWQA 5T4HA 4L9AA 2DCMA 2V96A 3WKBA 2JGMA 2XMQA 3MUOA 5ALFA 5ALJA 4W1RA 2E3JA 1YB6A 1GGVA 2BGNA 3HYSA 4G9EA 4GDMA 3G0CA 1W6RA 4UBIA 1E5TA 3PICA 5AKXA 4X71A 5LKAA 4YK7A 2Q0XA 3BF8A 1K6EA 4C87A 2HRQA 4JYMA 1AQLA 3ANTA 2VAXA 4W1QA 4UFPA 3WK5A 3QVMA 2WJ4A 3AZOA 2PSEA 4X6YA 1MU0A 5ALIA 1ZJ4A 4K6GA 5HKAA 1QTIA 3WIOA 1E8MA 2ZVDA 3WWCA 3IULA 2XMDA 3I1IA 5HF5A 5EHZA 2WTMA 3ESBA 3AUKA 3F8SA 1EB8A 2J4FA 2WG1A 3WJ1A 2XMZA 3F98A 2H7CA 5LKRA 2QXTA 5A6VA 5FV4A 4X6XA 3PFBA 2H1IA 1BCSA 2JGIA 5HQ3A 1S8OA 3DS8A 4L3WA 1JU3A 3WKAA 4Q34A 1ZOIA 2JGEA 1EVQA 1X70A 5JAPA 4QDUA 3HEAA 2VQ6A 2HU7A 1XZMA 1BRTA 4DNFA 4X97A 2DQZA 5KWJA 2HA6A 4QZVA 2O7VA 1LPAB 5LZ4A 3QBJA 4BAGA 2XQJA 3FLBA 4Z49A 3DDUA 4B81A 4MQLA 4XIIA 4W9RA 2X8BA 1XQXA 3E0XA 3DYVA 3PDCA 2OGTA 5EIAA 2C0PA 4DIUA 2CMFA 2QRUA 1LGYA 4EHBA 4OCZA 3T4UA 4OU4A 4HXFB 2B4KA 4O08A 3WQHA 3QMMA 4UFOA 5HFNA 4DTCA 1YA4A 2VAVA 3V1LA 1J2EA 1JI3A 3WK7A 4UHCA 3O0DA 5JAOA 1FFCA 1OCEA 2OAEA 4YX9A 3ESAA 3LCRA 4J7AA 6YASA 4GI1A 1XLVA 4XWGA 4C01A 3MUNA 4HXGA 1E8NA 4QLAA 1SCKA 5K3BA 1ZI8A 4NZZA 4IH1A 1ACLA 3C5VA 5C8XA 4JYPA 5JZSA 3ED1A 3D7RA 2WSLA 1JFRA 1GT6A 4BTVA 3G0GA 3DYIA 5A62A 2WUGA 2ONCA 3GBSA 3E1GA 1ISPA 1JJBA 3ESDA 2WIFA 1UKBA 5AICA 2QXUA 3DJYA 3I2HA 2OQVA 2XUOA 4OU5A 1UFOA 4KACA 1ORVA 1BE0A 2GYUA 3D3NA 5IVHA 1ZGCA 4FFWA 4OD0A 3STVA 1CUSA 4BVKA 1VZ2A 4RGYA 4MYSA 2EDCA 1M33A 3A2LA 3QPDA 3E4DA 4V2IA 2HA0A 1QIJA 3V48A 3H1BA 1WM1A 4N5IX 1BROA 3X3HA 3BDVA 4WDRA 1TQHA 2BJHA 3DOIA 2IITA 2AXEA 1IUPA 3L1HA 4XVCA 4EY6A 2YXPX 1XLUA 3VKFA 1UT6A 4QE3A 1ACJA 5HFAA 4BC1A 4ARBA 4J0KA 3IB3A 1CUUA 2Z5GA 3GZJA 2Z3ZA 3EQ9A 2Y2VA 1R3DA 3CN9A 4Q82A 3QYJA 2ACEA 5CTAA 1LPPA 5K5EA 4CI9A 4JH0A 2XUPA 4MWTA 4X91A 3TJMA 2VATA 1H2WA 1CR6A 2EEPA 3W06A 2YYSA 3KD2A 4KE8A 1VA5A 2WUFA 1VXOA 3EIOA 1X2BA 3H04A 2CB9A 4AMZA 3ZV7A 5FPQA 2HA7A 1WB5A 3TEJA 5FKJA 4ARAA 1Z68A 4DSZA 4TGLA 1UK8A 1VXRA 3DLTA 4UBKA 2C0QA 4Q1VA 2WKWA 1A8SA 1WOMA 4E14A 5AOBA 2O7RA 2RHWA 2XMRA 1RP1A 1QLWA 1G42A 4K6KA 4BP8A 4AO6A 4H7IA 2Y2UA 1VOTA 2XQKA 2ZYHA 4G4GA 5JATA 1QTRA 1HQDA 5ALGA 5ALOA 4WY5A 4JUIA 3DCNA 4E15A 3VXKA 1HDEA 4B0PA 1SC9A 1XFDA 1QIEA 2OLEA 3H17A 5D3ZA 2GBCA 2XDWA 5ESRA 3OTQA 3SX4A 2X76A 3BIXA 4MQMA 2QS9A 3QITA 1XZGA 4GBGA 5JYCA 3I6YA 4N8EA 3WK6A 3WLAA 3QPCA 4G4IA 5HKBA 2RI6A 1IMJA 1CUYA 1U2EA 2GBFA 3HSSA 1T2NA 2ZSIA 2QJWA 3GELA 1H23A 3OG9A 2PSHA 4BRSA 1XQYA 2RONA 3ICVA 5JANA 3RM3A 3WL8A 1EHYA 1CUGA 1QONA 3BDIA 4OUKX 2WFLB 4H7EA 1X2EA 4CCYA 4F5ZA 4DM7A 2AJ8A 1CUVA 3DD5A 1QIIA 2ZYRA 2X5XA 3S8YA 1OILA 3LP5A 4QLOA 4K5QA 4H77A 4GECA 1AZWA 4CIBA 1DX4A 1W52X 5LZ8A 3I2IA 3DOHA 2WUDA 3B12A 1JKMA 1RWQA 1DU4A 5LZ9A 4L72A 4DMCA 3Q0TA 3I2JA 4PSDA 5AO9A 2PBLA 1MX9A 1UKAA 2BFNA 4OB7A 4I19A 2HU8A 2QJRA 3C43A 2XUHA 2HA5A 4MJ3A 4B0OA 1XKTA 4U2GA 5KWIA 5CH3A 3VJMA 2XUFA 1UK6A 1H2ZA 1XRPA 1MAHA 1JMYA 2WIKA 3WJ2A 4QDXA 5ALEA 1H2XA 4E11A 2XQIA 2QTBA 4WDQA 1HPLA 4C89A 1CUEA 1FSSA 3G7NA 5LZ5A 5C8VA 2OG1A 4KAAA 3K6KA 4HTAA 3S2ZA 1ZICA 2WHRA 1NU6A 2WIJA 1DT3A 5ALHA 2XMCA 1DWOA 2QOEA 3IDAA 5E2IA 3ZLTA 4ITVA 2JF0A 4GXNA 2DSNA 3G0BA 1GPKA 3AFIA 4HS9A 1XZHA 1W75A 4G8DA 3WYNA 4ZXFA 4C6HA 1ZI9A 4Y9SA 4J0HA 1EA5A 1J1IA 1WPRA 2ZYSA 1P0MA 1LPMA 3WKEA 1XZCA 1THGA 2WJ3A 3EQ7A 3NWOA 1BN6A 4U2FA 3VJKA 2PL5A 5DTIA 1FFDA 3FBWA 3TRDA 4RNCA 1FFEA 4C4XA 1YASA 5FXMA 1QIKA 1Y7IA 3W05A 3VISA 1GKLA 1LPBB 4B82A 4CFSA 1E3QA 2PUHA 4IO0A 3H2GA 2PU7A 2O2GA 3HXKA 3WWDA 4Y2QA 1R88A 4Y2PA 4UBMA 3NUZA 2CUTA 4H7FA 1XZFA 2PSDA 3BJMA 4Y2VA 3IUMA 3I6ZA 4LXHA 4GEGA 1QIFA 3B5EA 3DQZA 1LPNA 1WHTA 1ZGBA 4X6UA 1P0QA 4Y2RA 2OCKA 4AN0A 4KAJA 5K3DA 3U1TA 3WWEA 1QIGA 2B20A 5CT5A 4EUSA 1CQZA 2BUAA 1CUAA 2OGSA 2OAGA 5A7FA 4UHHA 5AM4A 5T4EA 4W1SA 1L7QA 5JASA 1QJ4A 5T4BA 5JADA 5AK3A 2GZRA 2BUCA 2WG0A 5KREA 3H2KA 2DQYA 5AI9A 5D6OA 3FLEA 4A23A 4ZWNA 3FWHA 4AZ0A 1ODSA 5BOVA 3QPAA 1BS9A 4BCBA 4FOLA 3R3XA 3KSRA 4WJLA 5DNWA 3ILSA 3H0CA 5CMLA 4LYEA 3O9VA 5A2GA 2UZ0A 1QFSA 1ZIXA 1QOZA 4FFVA 3A2MA 4D9JA 3M3DA 3LLCA 4ZRDA 1XQWA 4PW0A 4LHEA 1H22A 2WHPB 1F6WA 5DYTA 2ZSHA 3C6YA 1EINA 3ESCA 4PNZA 5EIHA 1Q0RA 4PV7A 4X94A 4BDSA 4P9NA 2LIPA 3WMRA 1GZ7A 3IUQA 2VA9A 1DWPA 2C5FA 3E3AA 4JNCA 4EY7A 1LBTA 4N8SA 2WUEA 1EDBA 5AIBA 4OSEA 3W2TA 3WKDA 2ROQA 4WFIA 3AIKA 1XQVA 2QUAA 4LKOA 5AOCA 1IVYA 3FVTA 5AM2A 1BU8A 1IUNA 5E4YA 5HK9A 4J0JA 3HJUA 3FCXA 1CUIA 4TPKA 4AX4A 5JIBA 3O95A 1XZEA 2HFKA 2DR0A 2VT7A 5F4ZA 1P0IA 1UXOA 2GYVA 5ALLA 4INZA 1CEXA 2GBIA 4CG3A 1B6GA 1GKKA 2PVSA 5EHNA 2QZPA 1DQYA 4BAZA 4AO8A 3C87A 1TK3A 3A6ZA 2HIHA 3A70A 1MN6A 2AJBA 1ETHA 3N0TA 1ZD5A 1NU8A 4BE4A 4OPMA 5D3KA 4K6HA 3ZLUA 3G9TA 2C5GA 3VJLA 5AKKA 3WWPA 5IKXA 2YASA 2XI4A 2H7XA 3R3VA 4FDMA 1JMKC 2G63A 3D59A 5HZGA 2R8BA 1CUXA 4UHFA 4UBOA 4F0JA 4UHEA 1XZIA 1CQWA 2XQFA 5BV7A 4TVKA 5AM1A 1EDDA 5JD4A 3IVMA 2XUIA 3O9MA 3O4HA 5ISMA 5FOQA 1IZ7A 1HBJA 3ZI7A 4B80A 4FLFA 1XRLA 2I3ZA 1K63A 4E46A 5CW2A 4AO7A 5FUMA 3RARA 1ODCA 3O4IA 2JGJA 4WFKA 1F8UA 2HA4A 2V9ZA 4J0GA 3WL5A 4DMFA 4KE6A 2JEZA 2ACKA 3D5EA 3BXPA 4B9EA 1U4NA 4GHWA 3U0VA 1XRRA 1AURA 5T4FA 4N8DA 1L7AA 3C45A 4X93A 3BF7A 4PF1A 4K2AA 4KEAA 1GPLA 3WL7A 4BZWA 1QE3A 2XUAA 2Y1KA 2GBGA 4BRZA 2GZSA 2JGFA 1DQZA 4BZZA 2C7BA 3TGLA 1K4YA 4PSUA 1G4HA 4LXIA 4P93A 4NMWA 1CUZA 3PE6A 4CG2A 1MX1A 4WCVA 5AP9A 4Q3OA 4HRXA 5BWCA 1AMNA 4FNMA 4UUQA 1Y37A 1YS2X 5AKGA 4QWMA 2QKYA 3PUIA 1GQRA 5BWBA 5CXXA 2BAGA 4X3CA 1WPXA 2WU4A 5HK8A 3IUJA 3PF9A 1VE6A 3PFCA 2JBWA 5CBKA 4X90A 3C5WP 5DNVA 1TCAA 1THTA 4KYVA 5AKYA 2I3DA 2PKYX 3CN7A 1CLEA 1XZDA 3WK8A 5E4TA 5ALMA 3R3YA 2W22A 3FNBA 4X95A 3FYUB 1ZD3A 5JD6A 2WILA 4IH9A 4BAUA 2FUKA 5AK4A 4HVTA 5ALRA 4KJXA 3C6XA 4EY8A 1K8QA 1BEZA 2NW6A 3CXUA 3JWEA 5K3FB 4BCDA 4BBZA 1MTZA 1ZD2P 3L1IA 5AKJA 3W9UA 4B7ZA 1AKNA 7YASA 4WFJA 4AN1A 4A16A 4EZIA 1MJ5A 5D7BA 5H3HA 4QDOA 3GFFA 4DMKA 4DSAA 5AK6A 2G5PA 2DHCA 2AJLI 1MPXA 3KWJA 2VJBA 3DKKA 3T52A 3K9BA 1B41A 4FBLA 2XUJA 2BGRA 1GQSA 2BKLA 2QM0A 2WFLA 2R11A 5AOAA 4U2CA 1YR2A 1E8DA 3G02A 2G4LA 5ALUA 2XUDA 4DYHA 1MO2A 3BE8A 4H18A 2XE4A 4I3FA 3DEAA 3DNMA 3KOOA 2HHAA 5AI0A 1UK9A 2P8SA 4B6GA 3N2ZB 5K3AA 2JEYA 1LPSA 3D2BA 4I4CA 4ZI5A 5HF6A 4UPDA 5AIAA 4G1FA 5AKHA 3H18A 1BN7A 4HZGA 5AKIA 3AIOA 3R0VA 5C8ZA 1QO9A 5AM3A 3JW8A 3KXPA 4Y2JA 4MYDA 5DJ5A 3C6ZA 3H2JA 3QM1A 2XB6A 1MNQA 4KR0A 3PI6A 1XRNA 3B3QA 3F9CA 1MAAA 4UBLA 4HRYA 5AI4A 5EHXA 3STYA 4EBBA 4FHZA 2AJDA 3PUHA
chains in the Genus database with same CATH superfamily
2YZ7A 3INRA 2ZIFA 5AFSA 2CLCX 2PH3A 2EKPA 2ZRPA 3DLCA 1DX6A 2AN5A 3BDAA 3Q10A 4IYRA 4NVRA 5T6BA 4CU2A 2X4DA 2Y8EA 2NYRA 4OQMA 3RTGA 4ZARA 4DTIA 2W4IA 3NWPA 2YFKA 3FPCA 3I3SR 4KWEA 3QWBA 2M6SA 1AXGA 1SU7A 3OURA 1P0PA 3OX3A 4XR9A 3SJAA 4UAUA 4I4LA 2O3SA 5DPMA 2ZQYA 2Z2KA 2BSAA 1GCGA 1N7HA 3E5MA 4QLBA 3IMGA 2YDXA 3TX6A 1ZYUA 3DT8A 1QH1B 4MV4A 4F5YA 1FYDA 2HV8A 4NEQA 4J1TA 4DLNA 1T9GR 2EFEB 3KZKA 3P9YA 5IM4A 2P27A 2CBGA 2ENWA 3UN1A 2H1LA 4G9GA 3CZ5A 1AA6A 4WERA 2UV8A 1T8TA 5ESWA 1ZQ9A 2HXSA 1XDZA 4Z7NB 4OUDA 5L3QA 5HP4A 4JZKA 1ZJWA 2CJWB 3FNQA 3H5RA 3WXBA 4M89A 4R2HA 2Z8XA 1HKUA 5CH8A 5DEIA 1O58A 3CURA 4D41A 2I2WA 5G0WA 2ZUTA 1EXWA 1U0EA 1NY5A 3F3MA 3FM9A 1NXXA 1T4MA 4WA7A 5KSYA 1TO6A 3HWSA 4BU1A 1YZLA 3RW9A 1M1ZA 1QSGA 4OBXA 5CPFA 4IRUB 3GEDA 1B1AA 4LF6B 1J42A 2FMXA 3HVKA 2BM1A 4UC0A 1YIOA 1VIYA 4F1WA 3HC7A 3RRBA 3AR7A 1KY3A 3ZKWA 4BGUA 5JZBA 5F9HA 4CF3A 1NUAA 3G5AA 2PX8A 3SBDA 2ZE6A 4HWOA 1EHCA 3N0RA 1PUXA 2IPOA 3D5QA 2C4UA 1N6LA 3EMBA 3RLIA 4YCCA 1CIJA 3HB9A 721PA 5B4VA 3KS9A 4LEIA 3O2QB 5DV9A 3WFJA 4CG0A 4TQ9A 1NVXQ 2Q1TA 4E08A 2KMLA 1ABBA 1YJCA 4MICA 4ETWA 4PPYA 1BOFA 1E32A 4ZPJA 3K6SA 1B43A 1TIPA 1NV9A 2XR1A 3G2IA 3OA0A 1MEOA 2YNMD 3EXEA 4FU0A 3RKSA 5CG2A 4MB2A 2I76A 2ERXA 2P78A 4XDYA 3V8BA 4AWAA 2PZJA 4AJEA 1K8RA 2TMKA 3IOBA 5ILGA 2GEBA 2G1PA 2VJAA 3Q15C 3EZGA 3RAGA 1ZD4A 2XYRA 1BS2A 4X54A 4Y6SA 4Q4AB 5F3DA 3T3NA 2XITA 4RX1A 2ZSFA 2A4MA 3ZVNA 4PYIA 4HX5A 2AC7A 2GD0A 3EC1A 3EPRA 3VHLB 1NVMB 2ZTUA 5TXGA 1KGSA 1T4CB 1LK0A 2ZWAA 1E63A 2FZKA 5HILA 3OE1A 2P7IA 3GN1A 4H1TA 3VYWA 3ZGZA 3VR5H 3N7TA 3FMVA 1I01A 5DWDA 1PFWA 3B13B 5FO1A 2FR8C 5BQFA 5KIAA 3BUSA 1IATA 1EUDB 5I7OA 1JGTA 2RGXA 1FTSA 3A10A 2GKOA 3FTDA 2ID4A 2IYTA 4QOSA 3MRXA 1JR2A 3ZE6A 4GM1A 2H07A 3ZHQA 4C3UA 2XMSA 1SO8A 3LAWA 2B1QA 1X38A 1G8KA 5IX8A 3F6EX 2QTCA 4FC7A 3AJ9A 3COPA 3ANSA 3PXXA 2VTBA 1K3TA 3C7KA 3C8DA 1GEGA 5HWSA 3ENVA 3AP1A 4MUNA 2Z4RA 3FJYA 3HKCB 1E7SA 2A2ZA 5EA2A 3ZZTA 1E3MA 1K4MA 1RZ3A 3G8YA 2PMKA 3H9GA 4IIEA 1JDBC 1IWBB 4WZAB 5ERGB 3C3KA 2FUNB 4HDKB 1Q0ZA 2W4QA 5AJWA 1Z5VA 1OT3A 3FCSB 2WIAA 1ODTC 1H0RA 3EIHA 2ZJ2A 3B70A 4GI5A 4HCJA 5ALXA 1BHSA 1VSBA 1YUMA 2QUKA 3OZ7A 4HAZA 1A5TA 1Y8RB 2II6A 4GGPA 1NUSA 1U7WA 2BUBA 2HTFA 3ETDA 4JJAA 3E22B 4KQ6A 2CFTA 3RG8A 1SD1A 5IF3A 3FHLA 1OWMA 4Q0MA 1JJIA 1TKCA 2WV7A 2ZRCA 1UBSB 3NTRA 4L08A 4MRMB 5IVIA 1P4AA 2I65A 2X86A 3GJXC 5JJCA 2QRLA 1HV8A 2FMIA 3M6MD 4JQOA 4CKYA 5M7EA 3ADDA 3W7VA 3V3KA 5HDQA 1SB8A 4Q1FA 3ZQKA 3AZPA 4DZZA 3W8RA 3NO4A 1K5PA 2IRWA 1SR8A 1K6MA 3KWLA 4KV9A 4N0MA 1YR9A 1IK4A 4U7WA 1NBAA 4CMIB 1IEXA 2WZCA 3NXKA 1PE0A 1CJCA 3EGXA 1JXMA 3Q3EA 4PO9A 2Q8PA 4W6ZA 1T2VA 3QXSA 3F2VA 3Q7TA 5H81A 1OJ7A 1Y3DE 1O57A 1M6WA 3UO8B 1J06A 1TRKA 2C54A 2Q5OA 1A7JA 4HQ0A 5FYDA 2J3DA 3GVPA 2AVNA 3B1KA 4ZQCB 2ZRKA 1JRLA 2HQOA 3D3WB 2GF9A 4MQBA 3V97A 2GJKA 1ISGA 2DULA 5JSKA 5IH7A 1JNXX 4YRCA 3V46A 3QEAZ 4D7AA 2ZXEA 1NXPA 3VC3A 4CM4B 4KAFA 2Z30A 3VHRA 3GHYA 1FDOA 1S1MA 3BWMA 1LVHA 4AKSA 4XX1A 4B5LA 2YVLA 4RTSA 3LPCA 4D44A 3EEBA 2PDAA 2FW9A 4P7KA 2PS3A 1JIUA 3B1XA 3J80A 3ABZA 4MB0A 3RUPA 4DV3B 4V0ME 1RHJA 1VIVA 1EFRD 1Y8AA 5EKXA 4CTMA 3GLGB 5KTPA 4IYJA 1HQKA 1T2EA 2CKMA 1DVRA 3B3JA 3QXXA 4JWKA 4DZTA 1ULHA 1NOKA 4WPGA 2FSVC 4KXVA 3AB7A 1L0BA 1T36A 3J7TA 4UCXA 1Z38A 3I61A 1ESNA 1XTBA 1Y81A 2ZGVA 5EUMA 5TMDA 4KODA 4TQGA 1E79A 3DHEA 5FHQA 3ZXSA 1ZAKA 3DMTC 3MTEA 4AZ3A 3ASUA 1IY9A 4TT8A 1KFJB 1RWOA 3I6BA 4JJIA 1ZONA 3EN0A 4CMAA 2AG0A 3KZOA 4QKQA 2P11A 3ZTTA 1BX1A 1ENPA 3GEHA 4FLEA 4GMHA 4YRJA 2QUIA 4BWVA 1N75A 1VBNA 2CBZA 1E7RA 1SC3A 1UKCA 3QOWA 4ZREA 1GRQA 1HDOA 3NHPA 2P90A 4TWJA 2I62A 5CA0B 3EXIA 1G6HA 2IHZA 4JCCA 2ORYA 4L6IA 4RULA 3GRKA 1T3TA 4CV1A 1HDZA 1YB5A 4FNGA 3H2IA 5CD9A 1SHLA 2B34A 2ECOA 3WYFA 4UXJA 4PLFA 4Q3CA 4RH3A 4PXSA 4KR7A 2VT6A 4YCDA 1KWGA 1KEPA 1IOLA 1Q19A 2JIPA 4RTOA 1X94A 3VZBA 5IC5A 4EY5A 1FVHA 3F97A 3FN4A 3KSDO 4YP0A 2D1FA 1ZJYA 2XYHA 2JAHA 1W29A 3BWVA 3FVRA 1HDGO 1CRLA 4ZVRA 1LVGA 3RU9A 1DEHA 2BFFB 3UGTA 4HAIA 5EE0A 4DUGA 3PEYA 1ADYA 3MYYA 4I4TB 4EX7A 4CV3A 2CL6X 3CV3A 5JZOA 4DLWA 1YAJA 1WKVA 1P9OA 3ZWXA 3KSAC 1RHRA 1QH9A 1G5QA 2FG7C 1AZSC 1P74A 1SJ9A 3GRVA 1KMHA 4MGEA 3WLHA 4C1NA 4F3TA 2IS6A 1SXPA 4EMSA 2HIAA 2I7XA 5F3RA 4PSCA 1BJTA 1JG3A 1MZPA 1KYQA 2ZPTX 4OXRA 4PZEA 3WLFA 4XRRA 5D01A 1Z33A 2RAPA 2PH1A 4J4HA 3DDWA 5EINA 1C9KA 2OGZA 4MW2A 2WF7A 5EFOA 1X1EA 3ROZA 1IPFA 1SKAA 5CNMA 1G3RA 4DRZA 5C51B 2AN4A 4HPWA 3M34A 4EG0A 3B9PA 4XIGS 2XWSA 2CD9A 1L5YA 2FPPB 2CHUA 4L1KA 3AVYA 3CVWA 4Z9YA 1CP3A 5IZCA 1ZXBA 3KP1A 3B2EA 4PZ0A 1X0VA 3F71A 5EMLA 2QRVA 5EIEA 3IAHA 3LUJA 3I9OA 2HWWA 1L4FA 4KITB 1JQDA 1QCZA 1X1AA 3CE9A 1HKHA 1WE2A 3K1TA 2FRDC 3N8HA 4RV5A 3T61A 3B3GA 2D00A 4BEVA 2P0EA 3ANLA 3E82A 2VJYA 3UEOA 1YZ3A 1KJNA 1XJ5A 2C3MA 3MIIA 2OR3A 3NHFA 4MA0A 5AQEA 3TIFA 2V0NA 2VRBA 4A8JA 5K6TA 1JIXA 3FVVA 5EUQB 5K0GA 1XLTA 1T5SA 3FAKA 3FMFA 3AZQA 3IO5A 3WISA 2AG1A 2REXB 2CLDX 2VLBA 2YV3A 4IMPA 1PR4A 3DHVA 4V03A 1NUHA 2B4QA 3BMQB 3OOYA 1JHRA 3DFFA 4RZQA 3SEQA 5FL3A 1OXMA 1Z36A 4P7JA 2JFWA 4UHBA 4X63A 4EVRA 1UEJA 2Q4DA 1YQEA 1Y1LA 2H1SA 4ETMA 3R1IA 2R1VB 3PUWA 1PJ2A 1U2PA 2WMOB 5F35A 1ODFA 4R68A 2O8DB 4MUEA 1SU8A 4DQKA 3SOPA 4ZDIA 1IN8A 5CYOA 5BYKA 5CLJA 2FDRA 5JPDA 2UUPA 2XE7A 5CDSA 2NU7B 2ZUBA 2FPGB 1JSXA 4DCJA 1SMKA 4YAWA 3GL9A 4D99A 4CFZA 5JMTA 1XZKA 4JHXA 2YW2A 3Q41A 2A6PA 3OU7A 3MBKA 3Q0IA 2ZI6A 3I9JA 1R50A 2IKQA 3O26A 4IQ0A 2WWTA 4MJ7A 4WY8A 5DN9A 3B5IA 4BO4A 5C4IA 2P4QA 1U3WA 2GEUA 2X19A 3IIEA 1BWQA 1ES9A 1GITA 3PWSA 1ZNWA 1N6RA 3JQBA 2WG2A 2DPHA 2A88A 1VDZA 1Z8DA 2NM0A 4N49A 3UK2A 2IDZA 3SJCA 3U4GA 5J4VA 3H87A 4O2BB 5I8ZA 1TM4E 4GC5A 4IQ4A 3UW1A 4B75A 2ZIEA 5FIUA 1PL8A 2R5FA 4ZYYA 3CZ4A 1B3BA 4FKBA 1OKKD 1PD1A 3OP4A 3S6JA 1UPAA 4AROA 5J9FA 3PKJA 4BVAA 2BPOA 4YAFA 3MM4A 5AK0A 3QVGA 2FMTA 1VGVA 4MCJA 5JH7F 1K27A 2I7CA 4E4RA 1ZA1A 4G0PA 3OTWA 4N5HX 2F1KA 5JEEA 1QAMA 1WHSA 2TMDA 3FG9A 5FTLA 1HEUA 2W6ZA 3MJFA 3LOUA 3RD5A 4LK2A 2NO5A 4IXMA 4EYGA 1SXHA 2F43B 3AIMA 4IRXA 4Y2UA 3N87A 1KNXA 3JQFC 3BJZA 3I42A 1V4VA 4KZKA 3TW6A 1C8LA 3JWPA 4B17A 2XTZA 1NF8A 3KK0A 3KQHA 4G0MA 3U62A 3AINA 2ZR9A 4CUZA 5C1BA 1UWLA 2D5CA 1C4XA 3OIWA 4HATA 3UK7A 1YZKA 4A0HA 2OD9A 1RXYA 1U3TA 3CRMA 3AR9A 3K9CA 1L1RA 1FNMA 4MRRA 2PPLA 2W43A 4FYVA 5DTRA 4DUYB 2J0QA 2F48A 3M49A 3C3DA 1QHHB 2OHFA 4PU0A 3I37X 1W0KD 3ZWDA 2PZAA 1L7BA 4CIAA 4LCJA 1V5EA 5IK2A 1NX6A 1RBQA 3OPMA 4MHSA 3BHJA 1M8JA 1Z75A 4NECA 1QZXA 2YZKA 1PEKE 3W5IA 1SOMA 2VWQA 3BIOA 4Q01A 4ICIA 2CY0A 5CURA 1TYEB 2TMGA 1S2DA 3C70A 2VCYA 3DBRA 1E59A 4FCCA 4PS1A 4ZODA 2OXFA 2AEJA 1QHGA 1NX9A 3LIPA 1GGJA 1WEKA 1LPOA 4DVJA 2V7QD 3OQNA 1G8FA 1EI9A 1NVGA 3HL4A 3B5JA 1PJAA 3IDFA 4XDZA 2R86A 1ZIYA 2V7TA 3JYHA 1AUVA 1Q0PA 1MUUA 2J9FA 3ET5A 3JQ7A 3L0PA 2SKDA 1F60A 2XYQA 4JIMA 5AJXA 3D6NB 1M2WA 2PWPA 1RE0A 3OCUA 2QMQA 4DQUA 3LOPA 1SXGA 4Q9IA 5HJ5A 4KNYA 3HYLA 2YWHA 3MCVA 1GUBA 1A71A 2V97A 1E2BA 3HKEB 4QL3A 4D3ZA 2RAVA 1I7SB 5EXXA 3AHCA 3OLZA 3OSZA 3CF6R 3FPSA 3LFTA 5G1NA 3WLSA 4HDCA 4WXPA 2J5QA 1L4KA 3D6FA 2OC4A 1P3Y1 2Q3JA 4Y2XA 5B3AA 3RRJA 4BZPA 3IP6A 3GJTA 3PNPA 4DJFC 5BXQC 6AT1A 2IHVA 3DGFC 4ES6A 5AI5A 4B73A 4NJEA 3WJAA 1Y7HA 3ASYA 3EOAI 2PQ6A 3I3OA 2ZSUA 2W8BA 4UZSA 4B4DA 1FNBA 4RY2A 3TTWA 4RY0A 1U2RA 4PAGA 2BRUA 4W7SA 5FT9A 5JCXA 5DK4A 5YASA 5HEKA 2BN4A 2EFDB 2H59A 3QKSB 3QXHA 5L7WA 5DDIP 1N32B 1KIAA 2ZJ6A 3HMKA 3MMPA 2FK8A 4Y7CA 4QM6A 2QDKA 5KTSA 3IIKA 3FKSA 2VDUE 1ZSVA 4H3HB 4LAFA 5C8YB 3C3BA 2XOKA 2QAGA 3EUWA 1RADA 1M2OB 4ZVKA 2WM3A 3ZZMA 4BMDA 2MWMA 1RRFA 1GZHB 2JJ1A 2WIGA 2V6GA 1XE3A 1L4NA 1AH2A 2BZSA 2XAUA 4DWOA 1EFTA 1EVIA 1ZFNA 3A4NA 4B31A 3BWYA 3SCZA 3OZWA 2HJHA 3D8BA 1VYUA 1R4ZA 1EIZA 4OJKA 2HQRA 4GQAA 2NVWA 1JFSA 1KEKA 4NCBA 3M81A 1HT3A 2L42A 2E87A 4RTJA 1WBBA 3B3FA 1SVLA 2YWEA 2ODQA 1MC4A 1K8XB 4R8KA 3JZFA 2W6MA 4GPD1 3K0CC 5K3EA 1W87A 4IJWA 1CSEE 1N57A 3DZDA 2MINB 3HY4A 4RJ2A 1R6BX 4YPVA 4P3OA 3OE4A 1U2SA 3E7FA 2V1UA 5EZYB 4V24A 5HMLA 4MR9B 2B1GA 2FSFA 3DO8A 1TF5A 4NICA 2IX9A 3MK31 4FEEA 3T94A 3FTCA 4D8XA 4U2BA 2A92A 2C2BA 1GVNB 1K97A 4JJGA 1VLZA 2WM2A 1COZA 2MDTA 4NE9A 1T6YA 1USVA 3MERA 3PA6A 4U3JA 2QRHA 1KZ6A 5K3FA 1R6DA 2B99A 1FP7A 5F76A 2MSEB 4OLJA 3W7AA 4MRAA 3ELYA 2OKGA 2NVUA 1TRHA 3I04A 3LY8A 4ND8B 1U1EA 2Q5LA 3NJRA 1D2HA 4FXOA 2R9VA 4WCDA 3AT1A 4YMIA 3FSGA 5G0TA 4P5EA 3IESA 4FYYA 4B87A 3R75A 1NQVA 3U4CA 1I14A 4BEWA 2JGDB 3MJTA 4M8SA 2VH1A 2DOKA 2P1DA 1N1EA 2G28A 4ZC1A 4L85A 1E6MA 1FUIA 1YS4A 3NBQA 3NFYA 3RUIA 4DDTA 3RF6A 3UJ6A 3JX9A 4UMDA 4G8BA 3UAXA 2K87A 3VPCA 3ZU6A 1YXMA 5COQA 4E30A 2PU5A 1Z4KA 3O8OB 5FRDA 4D4IA 2XADA 5KDOA 3SEFA 2E4ZA 3CW9A 4PY2A 3VH1A 1T5LA 1PFQA 4BO1A 4EJSA 1D2RA 3NB0A 5E0OA 1DLJA 2PZGA 1EMDA 4W63A 1CRWG 1YT5A 4UU8A 2G82A 3B48A 1BZYA 2I2XB 2ZYIA 3N0VA 2XA2A 1DBIA 1XAGA 4D8VA 2DT5A 2WM9B 4C4TA 3JVVA 3T3HA 2OQRA 1GU0A 1I4TD 1XLWA 1CHNA 3N6RA 5DKFA 2HD4A 1PG2A 4D8WA 4ZYWA 1OFVA 3OX4A 4FQ7A 4XIFA 1S0UA 3FCUB 3BRWD 4YB8A 3IQGX 3LIIA 1L6RA 1VPVA 2Z4SA 3RVOA 5JECA 4YAGA 1KH3A 4W8GA 1AX9A 4EFNA 1E2MA 1YZYA 2CF5A 2ZP1A 3OJXA 3F5QA 2OHXA 1XCJA 4Y7DA 3IS3A 1VA4A 2XHEA 4FFOA 3G85A 5ALDA 5F2NA 1VMEA 2FY8A 1L8QA 2VI5A 1XGKA 2D5IA 3T7SA 2IVFA 4EYQA 2VEOA 1FYVA 4E2WA 2DR2A 2VHXA 3QP9A 3MRVA 4X7BA 4MR7B 3RIGA 3KAPA 5LZ7A 1Z4MA 4B8YA 5AOVA 4QXOA 1SHUX 4UCFA 3V7WA 4FD2A 2DFKB 1DELA 4JC8A 3VR1A 3H13A 1F9EA 1RC1A 4O4HB 2FWPA 3RVSA 2F8SA 4OHKA 5KOHB 2DWQA 2O2ZA 3DMDA 3GJ5A 3O4JA 4MVYA 3ROGA 2Y93A 5ICFA 1AHIA 1WP4A 4M0MA 3K53A 2JFQA 4RXMA 1LV8A 4EENA 2CEAA 1QC5B 2PS0A 3PEWA 4QQKA 3EZYA 3RADC 5KAMA 1J2RA 3GBVA 3K0KA 3PHBE 3STXA 5C5EA 3L7IA 3YASA 1H5UA 4N9QA 4LDRA 3C6BA 2EL9A 2FQQA 4FW9A 1W59A 1BKDR 4TL6A 2W42A 2FOLA 2QPTA 3HDTA 3LX8A 2OGUA 4J7XA 4JQSA 3TTSA 4QJ5A 3HVRA 2GR9A 4HMOA 1VE7A 4IEIA 3VHXA 3VPAA 1OX6A 1OXXK 1VJRA 4G41A 4HB0A 3VPFA 5TLSA 2Q49A 3E9ZA 3CLSC 3PFGA 4D74A 4ZCMA 4UZFA 2VH5R 3FPAA 4B3HA 1L1FA 3V1YA 4CCYB 2VNKA 3DT9A 2HMVA 3HS3A 4LW8A 4Y2GA 4DIMA 4EQ6A 2CE7A 1SKQA 1FFXB 2XMBA 1PR3A 3AESA 4CL8A 4TTIA 1C3JA 4EG3A 1JAHA 1SA0B 2XZOA 3HUUA 3FHOA 1RI5A 4XX0B 4A2WA 3G9XA 3PF8A 1SVWA 4G81A 4L5BA 5H9WA 1BAPA 3RFUA 1OU4A 4KMMA 2CHFA 1E18A 4LXUA 1QGUB 3QSYA 4AKGA 4JSYA 1WU7A 2EJVA 4WD3A 5J4LA 2AJTA 4A27A 3HGMA 1PQWA 1QH1A 1U6JA 3D4BA 4PCAA 2MU1A 3DULA 3ETGA 4R8MA 4LHYA 4B3BA 5F7OA 4CF7A 2R25B 2WP8J 3PXEA 4PPFA 1M73E 4YASA 4J6EA 3F6YA 2JHFA 3DL2A 3LT0A 1G17A 2HRCA 3PHIA 3PU6A 1R64A 1ZUWA 2HEIA 4X85A 3JALB 4JBWA 3QPVA 5FJIA 2FUG1 5KO2A 2CJWA 1USKA 2H11A 1ISSA 1QM5A 3ZKAA 4XQGA 1GV0A 1JPVA 2QR2A 4KO8A 2V7VA 2XNSA 1NW7A 3MILA 5DYNA 4HPJB 4DRXB 1P9NA 3K6RA 3ZS8A 1GTZA 1C4OA 2WYOA 4OYRA 1ZPDA 4I1OA 4OJQA 2ZCJA 2QA5A 3NRJA 4O25A 5TE9A 1TMOA 4JBNA 1QPGA 3AEUB 4N18A 4U7PB 4B45A 1C1XB 4LMPA 4JJZA 4RENA 2D0PB 1RXSA 1TCCA 2I8LA 4PLGA 2B6NA 1L9XA 1V3VA 3CR8A 3LS2A 4CLOB 4MP8A 5K3CA 3UXEA 4FE7A 1E5QA 2ZIUB 3EVDA 1N3BA 2C4MA 2NT4A 2Q4TA 1OWNA 1YRWA 3L7AA 3H4VA 2FETA 3DZFA 4FOTA 4JXJA 1UUFA 1R00A 1C7ZA 2NSDA 2ZE5A 4MYUA 4CMHA 2GD1O 2OENG 2R47A 3F9RA 4GF5A 1SXJC 5FQNA 1T5DX 3ZZ1A 5SICE 1P4SA 2YOHA 3Q2OA 4KZPA 2ZSBA 3WWOA 5ES3A 2PX0A 1NNSA 1O87A 1WB6A 2ZWPA 4KOEC 2P62A 5DWVA 3WR5A 2YHAA 4DEVA 4F12A 2GEKA 1XK7A 3HZRA 1HRKA 1OFGA 3T1VA 4HYYA 1W46A 4ONEA 4Q4AA 4JX9A 2G67A 1PCXA 2JFUA 4YIKA 1JHZA 3I39X 4ETNA 1D8AA 4OG2A 4MVJM 1DKRA 2ISSD 2ZTSA 3QI7A 3CNNA 2QWXA 2QLLA 4HEQA 1NJSA 4NYMR 5K4GA 1FRQA 1XEWX 1T4CA 3KT3A 3E5HA 4FHCA 1V7PC 4B44A 2QSUA 1C1YA 2FVXA 4YT2A 5BWLA 2Q45A 2QIPA 1C5KA 3JQ6A 3WLKX 1E0AA 2AZDA 2NGRA 3TZ6A 1GPMA 1P1KA 2QTVA 4JXXA 2ASEA 2WU8A 4ARSA 2WWVD 1EUDA 1K1EA 3OO1A 2OP1A 4TTQA 3SYRA 2AWOA 2C5EA 2QD1A 3DDCA 4QUIA 3RBAA 3AG6A 4YCJA 1PSZA 4AB1A 4F2PA 2ZIAA 3ELUA 1UP6A 3NDPA 2O2HA 4IIUA 5AW0A 4RKFA 1VE9A 1QK4A 4UUMA 3B36A 3HKCA 3OM9A 3ZV5A 3ZWBA 5CDTA 5JBIA 16PKA 1W76A 3FF1A 3RS4A 2H1CA 4WTOA 2R5WA 3LECA 4WZAA 4Z4GA 3SLGA 2ZQZA 4LECA 4HDKA 4D81A 2OCIA 2Q46A 3L6BA 1VG1A 1QYXA 5LJIA 4YAKA 3NNSA 4QQFA 3LCCA 4UBJA 4IJ6A 4Q9KA 4UUOA 3SR3A 2HF9A 2ADOA 4BNJA 1B76A 2JASA 4KXWA 1Y8RA 3L5OA 4EB0A 5DNUA 4TL7A 2JLVA 1YMUA 2ZRFA 4QUJA 1QO0D 3E22A 1NQTA 3L4SO 3AFGA 4KV7A 3KVNA 3UHOA 3USES 4QTUB 1SKBA 1EFLA 3CM0A 4C76A 4F21A 4MRMA 3Q5EA 4UEKA 1NR1A 2QRNA 3IP1A 1X39A 1F4LA 4GBJA 4NK5A 4PLCA 5AKZA 3K0AB 5DYYA 3WDLA 5A3QA 4FHEA 1T2UA 3F6PA 1RWMA 1L8OA 5CXUA 1B2RA 2C2YA 2CDRA 4OQEA 3IA7A 2UZ4A 2C59A 3QKTA 4ILKA 3D31A 2YBEA 1DRVA 2FMHA 1AS3A 1V11A 4UASA 4BMXA 1BD3A 4NR0A 4YLEA 4CMIA 1KH1A 4D79A 3VR5D 4J0IA 5TPWB 4XFKA 1P2DA 4ZD6A 3COVA 3TD6A 2G88A 3KDAA 3W5BA 3ZV4A 2XKKA 1OB2A 2F8TA 3WK9A 1MAVA 1MJHA 1CULC 3PHCA 3M1YA 4LHXA 4PFSA 4W5JA 4URHA 5EJ2A 4DDMA 4DABA 1RZUA 3L2OB 2FF5A 3BRSA 4AKEA 1WHTB 4XOIA 3FOFC 3K0SA 3B6MA 3D3WA 1CPYA 2IYXA 2AK3A 1YKSA 1DEKA 2A5DA 2IH5A 5D5HA 5ALZA 2J4CA 1M0TA 3SGLA 3WBJA 4CM4A 3DAFA 1FSFA 1K6IA 4D9GA 2VH2A 4P3YA 3SQXA 4JEIA 1A88A 4WI1A 5I9IA 2AA3A 3AUFA 4BV2A 1MRZA 3UJBA 1LUAA 1EM6A 2D7DA 4C4AA 3PC3A 3NTVA 1VJGA 4L9AA 4B6PA 5JUWA 1SCDA 2FW8A 2QN7A 1NYRA 3KUCA 4GYKA 5B37A 2XMQA 3GLGA 5GADl 1S2NA 2KHZA 1U1IA 1Y3FE 3HCAA 2ISCA 4TSKA 1E3IA 2DPXA 3T9AA 4W1RA 4QEZA 2O1WA 4S1WA 3QV1A 5IUKC 2P8JA 2XH8A 2Y67A 2AQHA 2W6QA 3OCZA 1DC4A 3SSAA 4F4CA 2JVJA 2DUNA 5FUVA 5HIKA 2PNFA 4OH7A 2MSCB 2C04A 1I32A 3SHVA 1E20A 1W6RA 4FGZA 4IQFA 2C7RA 4UBIA 2PWAA 2JAUA 4BBAA 4EEZA 3LUPA 4AUEA 1SY7A 2GQ0A 2YHUA 1ZH4A 3W5SA 1XAJA 1NOJA 2OFXA 2HXYA 4QUHA 2O1EA 5FA6A 4BQEA 2H2AA 3ADPA 3RFVA 3ZY2A 1ZC4A 2J33A 3HCNA 2I1QA 2NYVA 3IIJA 5EMMA 2ZUDA 5CA0A 1U8UA 3KX2A 5T5QA 2CSXA 1T0BA 4JYMA 4MQ6A 4A4DA 4XD7D 1NWCA 5ITVA 2NXWA 4W1QA 2A0YA 2PJDA 4TUYB 3GDFA 1GO2A 1EGVB 1RQ2A 1RQNA 2PXCA 4HC4A 4YPOA 3OQOA 1YJAA 4W6QA 1ZMRA 4FX2A 2HDHA 4DLPA 4IUYA 5JYBA 5HKAA 5EZQA 1KHTA 1A50B 1SPBS 2IXEA 2K5UA 1UXJA 4L0QA 3SFVA 3WIOA 3GWZA 3MTIA 3OT5A 3TX2A 1KORA 2VLIA 3TB4A 3WGQA 1L5OA 1DAGA 1QLJA 2JAXA 2NXNA 2BFFA 2WTMA 2CLSA 3OIUA 3MTBA 4G0ZA 4RIGA 1EAMA 3GPBA 3M6WA 1N0IA 2XNKA 3VNVA 1EB8A 3PQ4A 2WG1A 3F47A 3WJ1A 2UZ3A 1Z25A 2XMZA 3F98A 3NHKA 1RU3A 3MT9A 2WWFA 4FYPA 3T0GA 3B1FA 3GARA 1IBKB 2JAOA 2O7NA 5B3JC 1E5LA 4GOXA 4RW0A 4D5GA 2PV7A 4FM9A 4LI3X 2BKAA 3ZY6A 4U63A 4ZYZA 1D0SA 2NSHA 5IJZA 4AF6A 3WKAA 4HNSA 2JPDA 2F67A 3REOA 5FUQA 5IT4A 5JRJA 1DXQA 3W6OA 1UXIA 4XWYA 1VG8A 4U9IS 4IDHA 1S8AA 3WSVA 1XJWA 3GZNA 4X41A 4CFYA 2FPPA 1F0YA 5JAPA 3GJ0A 5J1TB 4OI1A 2CMDA 4G0QA 1YDHA 1VJCA 2XAAA 1E3DA 1V3QE 4YDQA 5TRTA 3CVYA 4BHTA 2QYOA 1L7PA 2YV2A 1BX3A 1O77A 1MB9A 2CFOA 2JC3A 5CTJA 4XKJA 2IHUA 1JA1A 1WZNA 2RG7A 3NHRA 2G72A 1ZMXA 2PL1A 3DBOB 3HVJA 2HCRA 3A1EA 4MDHA 2E1PA 4X97A 3W8NA 5HM6A 3EWSA 1J7JA 5BV1A 4Q7JB 3OT1B 3ZR4B 5CJPA 3PIDA 4QZVA 2AH5A 3T1OA 3IHTA 1FDUA 2HHCA 4EY3A 4NNJA 4QNMA 3S8MA 3KR0A 4M1TA 1OPXA 5CLLA 2XODA 3BMQA 4EL5A 4PFJA 1OV4A 2HO5A 5DLYA 4BAGA 5DEOA 3FLBA 3PNBA 5M29A 2Z6UA 1U7PA 4YPFA 3QY9A 5LQNA 4JFRA 2IP2A 3SBEA 4C21A 2IOFA 3ETJA 1VL1A 3IR6A 3OF2A 5CIWA 4COKA 4W9RA 4PIMA 5ES4B 3L8YA 1JMVA 3UY4A 1J5EB 3PDCA 2OGTA 3OLWA 1XVVA 3QGMA 4KW7A 4BX2A 1XQ9A 1F7UA 2CMFA 2VTDA 1LGYA 1RPNA 1XYGA 2WWHA 3E8SA 3FDZB 2P9TA 1KP3A 2AIRA 2B4KA 2R6CA 1E77A 1PZEA 2NU7A 1WF6A 3KL2A 1DARA 2FPGA 3NORA 4O08A 3IEIA 3CX3A 5F5XA 2GVDC 3PRHA 3MCWA 3U3RA 1MJGM 1Q20A 1K7XB 3TDMA 3U61B 3TFWA 1O5OA 1O7JA 4UFOA 2LRHA 1RI1A 4Z9AA 1IXRC 3ECSA 5F2EA 1YA4A 5I7SA 1GPDG 1KDOA 2VAVA 1S3SA 1HORA 1J2EA 5H1YA 3O94A 3VSBA 3TXXA 3EZ2A 3O0DA 5JEDA 2E55A 1CDDA 3JVUA 1N5OX 1TTHA 2FGJA 2VUUA 1EDOA 4ZAVA 1ODKA 2O57A 3SHOA 3D6UA 3ZE8A 4Z0TA 1E2KA 3O74A 4BQPA 1WULS 2D2EA 3U13A 4TL9A 3ESAA 3FKQA 1OXTA 3O1HB 4J7AA 2HOQA 4AS3A 1TJYA 1V1RB 4RD3A 3U9SA 2IIQA 5J2TF 1V7CA 3ENZA 1AV7A 2IOYA 1HDRA 3E2MA 4O2BA 2DERA 2ZJ3A 2GFHA 1OYYA 4G24A 4C01A 4B4UA 3VUFA 4AY3A 1E8NA 1HZZA 2BR4A 2DUWA 4QLAA 1SCKA 3W8EA 1ZI8A 3ECAA 4HEA1 3JQCA 2X1HA 1ACLA 1F9AA 2WD9A 4GPTA 3PXBA 4BFYA 2NN3C 4ZVNA 5JZSA 5CLIA 5FLXA 2YVKA 3OUUA 4WKNA 3ZY4A 3D7RA 1TA0A 4I2NA 4IGKA 1GEEA 4I7EA 1JFRA 1BS1A 2C57A 1VRCA 5E1OA 3VKVA 2IF0A 4F92B 4CQNA 3G0GA 4IFIA 2VQ3A 1J25A 4O8ZA 1DIGA 2JFYA 2N1BA 4OJMX 2ONCA 1OKKA 1JKJB 2AFVA 3GBSA 3VU0A 4LGVA 4A2CA 3PEEA 4QUDA 3ZVRA 1RP7A 4RZXA 2H0QA 2AHRA 3OQJA 1A7AA 1UKBA 2I22A 5TDHA 3W4JA 4DR4B 1KJWA 1JJ7A 2IZ1A 1ECCA 3KELA 4TQUS 1F6BA 2QXUA 4Q7KA 2JL1A 4Y6LA 5AICA 1EFAA 2V6FA 4BP3A 3T9BA 4D6XA 2R8ZA 3DJYA 3TQHA 5G02A 4C0HA 1T0PA 8GPBA 1EK5A 1KJ9A 2P2NA 3FYCA 1NTOA 3U40A 3RE1A 1L4HA 1NRXA 3CRZA 1QHHA 3HWWA 2HBRA 3PKZA 1D1SA 3AM4A 4PWZA 2EF0A 2CJYA 1ORVA 2RBKA 1NR5A 3L0CA 4MUGA 5H80A 3WOVA 2VZEA 3B52X 3BTOA 4NXNB 1VB3A 2DBQA 4BE7B 2QTRA 4MWZA 4DIOA 4OD0A 2DGDA 3OMLA 1C0LA 2GM5A 1AQIA 2HF2A 2BE7A 3R0JA 5E6RB 1IQPA 2RGCA 4BVKA 4D5EA 1Z06A 2QDXA 1SC1A 4ZO7A 4I36A 1RQRA 3Q3GE 5HOEA 5K05A 5ENDA 1LK7A 3U6BA 3CNQS 1Y33E 1W0KA 1IVSA 3ER9A 5CBPB 4F1KA 3QPDA 1NFFA 4KPUB 1KJJA 4LGCA 4V2IA 1EP2B 4URWR 2HA0A 2WAXA 3WQBA 3ENKA 5HE8A 3RDPA 4MO9A 1J56A 1R4MB 1R9JA 3CW2A 3HUEA 3PSHA 4NZOA 1J8FA 4DLTA 4YMVA 1OASA 5ER9A 3EEYA 1VYVA 1VFNA 3TR0A 3IT2A 4B7AA 1A8IA 3ZWVA 3OZDA 3HKEA 2ZU6A 4WE3A 3W5AA 4RWZA 4WDRA 2PA3A 2V7QA 2Q6TA 1XI2A 1P33A 2IITA 2PWYA 2YXLA 4G01B 3LVBA 2J0VA 2G1KA 1J0AA 1YQUA 2IEAA 1ONNA 1IUPA 3DZBA 1VSUA 4HJXA 2RDMA 2AFHB 5IUJC 4TKLA 2YXPX 3NGLA 4MV7A 5BT8A 3ENWA 4FD3A 4R3NA 1XD9A 2ETVA 5HFAA 1GL9B 4XYMA 3D9QX 4JI7B 3RHZA 1X3SA 5KNCA 5AJVB 1Y5IA 2VR1A 3UHFA 1CUUA 3DVRX 3QKSA 4C04A 1UJBA 5THKA 3WLJA 1SUSA 1GUDA 1CCWA 1E9SA 4NV1A 3OIDA 2OEPA 4I99A 1JQ5A 4C3VA 1YRLA 3PRYA 1CDZA 2IPLA 1JVNA 3OIVA 1OQAA 4I81A 2Y0DA 3EQ9A 3F4KA 5C8YA 4FCTA 1S89A 1M2OA 2XTAA 1R3DA 2ZRQA 1VL0A 3T0FA 4GT1A 4B6QA 3QYJA 1OBOA 3TE6A 5BV0A 4D3XA 4ZI7B 2D2IA 1DBQA 1KK1A 1OBVA 3KM0A 5IMBA 1LPPA 4CI9A 1KS9A 5CLQA 5DB4A 1FJGB 2LKCA 2WYWA 4CR6A 3S2FA 7ABPA 1T6XA 1UBTS 2NNLD 4MIOA 3VR0A 4EYOA 2DJ5A 2O6LA 1N2CB 5JXHA 1UBUS 1H2WA 3GW8A 4HUTA 4ZAYA 4B3MB 1XJ0A 3K4QA 2YYSA 4FJ0A 4U7JA 5L6MB 1J9ZA 3KD2A 1I6LA 4KE8A 3LCUA 2MINA 4DB2A 2WUFA 4LYYA 5B4UA 5H5JA 2Q6IA 3U1BA 5EZYA 4RHXA 4AU1A 5C7IO 2IF2A 3AJEA 2WWXA 3A6JA 3E3OA 3H04A 4MR9A 2G7MC 4NABA 4RJIA 2CDCA 4K9QA 2LIVA 1VJ0A 1UKZA 4LZLA 1PVDA 2HA7A 4AMGA 1WB5A 4EW3A 1NJ6A 1UODA 3TEJA 2V7EA 4TYQA 5B1IA 4J1NA 5DLQC 2QRGA 4KRFA 1NKTA 4DSZA 4ZOQI 6NULA 5ITWA 2GDZA 3H7AA 2I34A 1JR4A 1QV6A 4ND8A 5FPHA 1L7XA 2PEYA 2C0QA 5ICSA 2XX3A 2JD0A 4TMFA 4PRLA 3WGTA 1A8SA 1AKMA 1IXZA 4N3CA 4E14A 3IDQA 4WNCA 3OETA 1UJ4A 3AHIA 4M1KA 2ZWVA 3MWGA 1Y34E 3NC0C 3NHWA 4QUBA 5L6LB 1C8BA 1V35A 3WNBA 4GOJA 1JF8A 2RGYA 2N0SA 3IV7A 3UENA 1G7RA 1U28C 5J5VA 4DYVA 2GVNA 4S0ZA 5I9SA 3O8OA 2HK7A 3D1JA 4MRVA 1GNQA 2P2YA 3NCHA 4K6KA 3TKYA 1EP1B 2D7JA 2WV9A 4AO6A 5JC1A 1XYVA 2A8YA 2Y2UA 3RT1A 1G5IA 2GWRA 5I4IA 3R8FA 4AJLA 3OZUA 3ZXUB 1A9TA 2BM9A 1LDMA 2P9YA 2ZYHA 4WVFA 4JS0A 1L5NA 3C2QA 4BVEA 1X1BA 1HT1E 2WUVA 5IS2A 5TQ2B 2ZI7A 4J1SA 3VKUA 4ED9A 1BQ3A 5IH3A 3JVIA 3VXKA 1FOEB 2CYBA 2RJOA 4JD5A 4JWTA 1KOJA 3E5NA 4DGSA 4MQEB 2V7XA 2CK3D 2WQ7A 1VE3A 3LWBA 1M8FA 1CF2O 4K3UA 4PQYA 1ZZEA 3VZRA 9MHTA 2XDWA 2I2CA 1ISHA 2VPXA 3VR2D 3S1SA 3LC1O 1TQ2A 1USGA 1M34B 4C07A 1E7YA 3RAJA 3SJ7A 3SX4A 7GPBA 1JDZA 2AUNA 2X76A 4GO1A 4L75A 4OGFA 4AP6A 2IP1A 4I55F 3QITA 2RHRA 3T5PA 2IIPA 2IHBA 1BGVA 3QPWA 3LX5A 5JI2E 3AK4A 1S9HA 3IPXA 4NCAA 5JJIA 4ILEA 4HQFA 3EPKA 3WMWA 1AGXA 5HKBA 1SQSA 4OI0A 4MR7A 1O96B 2TMYA 4KL8S 2G6BA 1AB6A 2NZ8A 2OP0A 3JD3A 3D4IA 2GBFA 1XN1A 4WWHA 4XLZA 4G84A 3H2ZA 2QJWA 2OILA 1L5HA 1BVHA 3ZJYA 1SBCA 4QYIB 4O4HA 1Z56C 1NJ2A 2GF2A 2ZI4A 3L0IB 3OG9A 3GCZA 4L4UA 4K0RA 4ZT5A 5KOHA 1XQYA 5IDQA 2AB0A 2J7KA 4P1ZA 3UB4A 3Q87B 4Y8VA 4L8WB 5JANA 1OA0A 4EYEA 2PN1A 3DHNA 1QC5A 2P40A 3WL8A 3L0OA 4XYBA 4MAFA 1GZVA 4AKHA 4US0R 3IUBA 5B6IA 3N58A 3BT7A 3ZE1B 1QONA 1P1RA 3SKYA 2NQ2C 2XECA 4PPQA 3BDIA 1KIFA 4ZO6A 3CSUA 4IWYA 4YCAA 1KI1A 2QI9F 4U00A 2DEUA 1C0PA 2WFLB 2IK8A 4OFWA 5TEVA 2RHCA 2AXPA 2PZ8A 1IJFA 1NUTA 4OTZA 3JASB 1X2EA 4PNEA 1N9GB 4L4SA 4CCYA 3AQ4A 4F5ZA 4F6CA 5JLJA 1QIIA 2CVFA 2ZYRA 5AVQA 2XVMA 1FFXA 1ZN9A 1TGYA 2FUEA 1U9YA 4RHEA 1D09A 1MQ9A 1OILA 1SA0A 4KWHA 1V5GA 4R9NA 4OQFA 4OXQA 3E05A 2YCBA 3VYUB 5TT1A 4QLOA 2MR5A 3K2EA 4K5QA 2OCYC 3SG0A 1CKEA 4LI0A 4C0KA 2W0MA 2UYYA 1LW6E 4OHYA 3ZX5A 5LNK1 5LZ8A 4YRIA 2YMQA 3Q2KA 1QGUA 3IJPA 1TTPB 1BU5A 3E1SA 1ZISA 5F7ZA 2WUDA 4IDOA 1JKMA 2G8NA 5DIZA 3AHJA 5EXPA 4BU0A 1DU4A 1JUDA 1MDFA 2XXBA 3DEYX 4DJTA 1BDMA 2FP4B 1OAKA 5LZ9A 3ZHYA 1Z2PX 2C9ZA 3IAS6 4DMCA 3D4NA 4PRYA 1KBOA 4ZU1X 1IG3A 2J9GA 3ZGOA 3H5TA 3T12A 1USIA 1T10A 3COSA 5AO9A 3E9CA 1EAYA 1MX9A 1UKAA 1SUAA 3JALA 1JDPA 4Q02A 4BNTA 4OB7A 3UHJA 2ZUCA 2HU8A 2FN4A 2Q27A 2HNAA 2QJRA 4BGEA 4NPAA 1XZQA 1JHMA 3DV9A 3LCJA 4F4UA 2XUHA 2HA5A 2PGXA 2GK7A 3R77A 4DRXA 3ND9A 1DAIA 4DA8A 1RZRD 3H65A 4N39A 3HBAA 2R6ZA 5CH3A 4ENPA 2CWDA 2RH8A 1RAHA 1DMSA 4D9MA 1E92A 1S02A 3H5VA 3IQHX 1DEXA 1V6CA 3AEUA 1SUWA 3C3MA 1I3LA 4FC6A 4QGAA 3ZDFA 1MAHA 1JMYA 3NVMB 2P2CA 3HZHA 2I87A 1QOPB 1R2QA 3LLSA 4JAVC 1U2GC 3CSSA 4CLOA 4QDXA 4XQ9A 4GGOA 2Y1CA 2PT7A 2AF4C 4JLMA 4LYGA 5ALEA 3KOMA 1B8NA 4AJJA 4PQFA 4XJSA 3LA8A 4WDQA 3T7IA 2G7ZA 3AU8A 1I0LA 5CA1F 3HDHA 3BXXA 1X42A 1FRZA 3IPRA 5FBHA 4ZVSA 4QDKA 4EX6A 2QNRA 1TW3A 1NASA 3GPDG 3NALA 4Y3UA 4LDPA 3OPYB 3HFRA 4GICA 3K96A 1PS0A 5F1PA 5CFPA 1YRYE 2WVJA 1N4DA 3PNQA 5C8VA 1XVUA 2PUGA 3D3JA 2WDZA 4KAAA 4HTAA 4UVGA 3S2ZA 1KMQA 5AKEA 4RJTA 4XTCS 3IP7A 3VR3D 1WLSA 2WIJA 5FTKA 1DT3A 4PAMA 2E1RA 5BYJA 3RVPA 4A10A 3DWGA 4DCVA 3TQFA 3ZWPA 1MQAA 3HXOA 5DW3A 2XMCA 6GPBA 2QMYA 4C2AA 2E49A 4XWKA 1L4UA 2QOEA 4C30A 1SH7A 2UYQA 5BSVA 3D8HA 5COBA 1C30B 5E2IA 1YJ5A 3ZLTA 5FNZA 4OLBA 4GXNA 4HP8A 3RT9A 3VV3A 4GP7A 2B9EA 5DP1A 2WAAA 2JH9A 2J3KA 1J00A 3PLRA 2UUCB 2ODAA 3PDIA 1NMSA 2QMOA 4D9HA 1RRMA 4R81A 4QU5A 1XTQA 5DH9A 1IPHA 4E03A 4PGMA 4ZQFA 3KR9A 4ZXFA 3GJRA 3RH0A 2AOUB 4C6HA 2IZ5A 1TMYA 3R7FA 4J0HA 4CV0A 3LWDA 5J43A 2WB4A 3WGIA 1EA5A 2FUCA 2GFQA 1P0MA 1LPMA 1ZJZA 2I6XA 2VDJA 2X58A 4MW7A 5JAQA 1SXQA 3ZNOA 4XVRA 3U4IA 2DUJA 4BFCA 4TXLA 2NTJA 5B7NA 3VJKA 2W0SA 3DVQX 1Z28A 3FZEA 2GERA 1GCIA 2V1XA 3DMYA 1B8PA 1ECLA 2C97A 3L7JA 4PO1A 4EJ2A 1E0KA 4KX5A 4WCFA 5DGCA 4CTKA 4ZZ1A 2OORC 1F1JA 4PXAA 4RNCA 2YY7A 3KJNA 3NBFA 3HBMA 2MSWA 2C9DA 4AMUA 2Q2NA 1ILWA 2IWRA 5JQWA 3X1KA 4JP5A 4AYWA 3GUVA 3VISA 3MINB 3A0UA 4CFSA 4UTVA 5ED4A 1E3QA 4WLFA 2PQMA 3URMA 4KHPB 1PO7A 3H2GA 4NP6A 4P31A 4G26A 3K0AA 4Y2QA 1VG0B 1R88A 2HZ7A 1YCHA 1V9CA 1JLKA 2M32A 3EZLA 1DQSA 3GAAA 5CB0A 1DBWA 2FMUA 4FMBB 1TM7E 1A7KA 1J0CA 1ZK0A 1ECPA 2GXSA 3CINA 2PSDA 3LDUA 2A9JA 2I1LA 2DWUA 3A05A 1STOA 3BJMA 4GVPA 5TPWA 3UB2A 4XWOA 1JTVA 4NOLA 1NLUA 1SZCA 3GRCA 2B8NA 3BGVA 2POQX 5UKDA 1FX1A 1KMNA 4DV0B 3JYOA 3WGZA 2ZYWX 3F74A 1G8HA 3ZJ5A 1ZK4A 3DQZA 4RTRA 3A32A 3C3PA 1WHTA 1GTRA 3N3BC 3TDNA 3DM9B 4LQDA 1IAVA 1XEWY 4BFUA 2RGNC 4Z86A 5FR2A 4KIWA 2VRWA 3VR5A 5CB4B 2QZ9A 1SBTA 3JVEA 2W6NA 3IIMA 4G1MB 4AN0A 3EEQA 5A9SB 5KYUB 1NZJA 3L1UA 5KDDA 2IYVA 2JFFA 3PQDA 3K30A 1J70A 2NVBA 3MUEA 4PZCA 3X2FA 2Q62A 5DNDA 1FMLA 3IDZA 1Q11A 3IEKA 5B58C 4ND1A 1HQYE 3PYMA 5F7XA 3N2GA 2C0CA 3TK1A 5C7OO 4OK3A 5FUYA 2B20A 3L8CA 1E3JA 1PLKA 3AKEA 4IJUA 4HLUC 1U3FA 2BUAA 1CQZA 1DB3A 1KPGA 1UEXC 2OGSA 3EGWA 4WFJA 4N5LA 4O4JF 5A7FA 5A3RA 3JQDA 2PH5A 2QTAA 5DIFA 3TZEA 2PFKA 1O95C 1GL3A 3AV3A 3DE1X 5KYVA 3K5IA 3KVRA 2V5UA 1QJ4A 4JU8A 4NXMB 3L43A 3NBAA 1N2IA 4P0TA 1G5TA 4OA5A 5IN4A 4CDRA 3CB4A 4O4LF 3RSHA 4JC0A 4W8HA 1EKXA 2NXEA 4ZHQB 3DVAB 1O1YA 3B20A 2CV0A 4KWTA 4E3ZA 5D6OA 1EGHA 1Z6YA 3TBHA 2EIHA 2QD2A 4ZWNA 3F49S 3FWHA 4XA8A 1M7GA 4G4SP 1WEHA 2OO5A 4ZVQA 1DC7A 4X20B 5C3UA 3F7TA 1ODSA 2C96A 4EJFA 1J97A 2P9EA 3BGSA 5ARDA 3ZZUA 3NETA 1MG5A 4IX9A 5BW6B 3R3XA 1RCTE 4GPZA 2QLBA 4LZNA 3WE7A 5HKLA 2QORA 3P2EA 3ILSA 4OH1A 3C6MA 4X44A 5HKKD 1SKYE 2IYOA 1P18A 5LBTA 1CVRA 3H97A 1SN7A 1VE5A 1I7LA 1MJFA 1GAWA 1GNSA 5BQ5A 1ZIXA 3ZVKA 3GCDA 4B32A 1NN3A 1QOZA 1X13A 2IUSA 2P5UA 3A2MA 3QEKA 4B3IA 1WF3A 2B2XA 1ZU4A 4MYTA 4XD7A 1BXZA 4JC4A 1XQWA 4PW0A 2I4LA 4F3CA 1S2MA 4ID3A 1XZNA 5E4FA 3OQ6A 2B78A 5JHGB 1ZRNA 3CRNA 2Q3LA 3UVEA 1BHJA 2CMKA 2OHIA 1F6WA 1A8HA 1MEEA 1SZJG 5IEBA 5BSMA 1U2DA 2F1OA 2B0CA 4PGGA 4AI6A 3AQIA 3C6YA 3F7OA 3OLQA 3ESCA 4LJ6A 2CVQA 3HFJA 3QW2A 4YQFA 5C1PA 3FGNA 1LJ8A 5EIHA 1Q0RA 1RAEA 1P1IA 2D1RA 4NFLA 4X94A 4PINA 1KTVA 5DBEX 3MTGA 1HTWA 1T9AA 3P9XA 3PSAA 5BR4A 3KJQA 4RD0A 3BA1A 1AOXA 3W3AD 2V54A 3ZK7A 2LIPA 1KZ4A 2BKVA 3E2IA 1H8ED 1ODIA 3LL4A 4W5QA 2IUEA 3WAGA 2XOEA 3W2EA 3ZH2A 1FRFS 3ZGVA 9LDTA 1ZGHA 3E3AA 2FWMX 4EFKA 1Y1TA 4FZJA 2X5KO 2Q5CA 1LDGA 4PCVA 3RTDA 2YICA 4EY7A 2Q5FA 1RE1A 4IIYA 4YRDA 4L5IA 2A1TS 2RH9B 3RK0A 3OCJA 5KWEA 1WY7A 2WUEA 4TLMB 5H3CA 4FWIB 4EA7A 2W2VA 4RFLA 4FYJA 5A9RA 1XHFA 4ESOA 1K7YA 1O89A 3QA3E 3W4KA 3K1YA 3DKIA 3WKDA 1ZVJA 4XJTA 4F84A 2JA2A 4FFDA 4F3KA 2ANCA 2O19A 2R65A 1SHZA 5DCUA 3OT1A 3G8DA 5FTJA 4CEIA 4LKOA 1EQUA 2G9NA 4IHQA 3FVTA 2ZBFA 4WINA 3ETCA 2A9VA 4E51A 3S68A 2OOSA 1T9ZA 4D98A 4M9XA 4TMWA 2W98A 1G64A 1ZRSA 4IV8A 1H3FA 3ND6A 2CNWD 3PI7A 4K9RA 2BYTA 3REGA 3V7UA 1XEXB 2MIIA 2PGOA 1YTUA 2PX5A 2HPHA 1J20A 1JG7A 1YFLA 4JZYA 3KQQA 4P84A 4PGHA 5EEHA 5JQGB 1FS5A 3GFTA 3O95A 2VBGA 3PNLA 4IMRA 4X7MA 1XCOA 1DRUA 2X9VA 1UJ5A 3N75A 1Y1PA 3UV7A 3VO1A 3H6KA 2DR0A 5KI6A 1VKOA 4BKQA 3FDZA 1KYVA 3WRYC 2H5JA 4HX2A 4YAIA 3M9WA 2ZR8A 1TM1E 4NCNA 1SULA 4TM8A 4Y9TA 2ORWA 1RLMA 3AIIA 3GI1A 3PDUA 4D4MA 4FYMA 3U4HA 1CZNA 5T8KA 4CL3A 1DAMA 1OIXA 1V7QA 2COUA 3F8WA 4HLDA 4XPIB 3PPVA 5EJGA 5SY4A 1R6TA 2O9JA 3OU2A 3QPUA 4ADSG 5BY2A 1KFBB 1T8UA 4UOZA 3IXMA 2FEKA 3A7DA 4QU0A 3HZZA 2V4ZA 1N2GA 1DQYA 1JFVA 3P4YA 4BAZA 4B2LA 3GLHA 4GL4A 1PWYE 3UJDA 2W5UA 1KKLA 1K08A 4RVGA 1I8TA 5EKTA 5K09A 3HXPA 5F12A 5A5VA 5ICEA 1D1TA 1JHOA 3A3NA 3IJRA 2CXXA 3U60B 3SD7A 3UT0A 2V45A 1U0GA 1DI0A 1V1RA 1P5HA 1MN6A 3A28A 1QH8A 3M89A 1QR6A 3MAGA 4I2VA 1O9BA 3NHBA 9ABPA 2AJBA 3FOZA 1FTGA 4KI7A 2QG6A 4QGHA 3VBEA 3AKCA 2A3RA 2Z6VA 3PNYA 4LBVA 5ESXA 3WP1B 3ZHTA 1U90A 3EDMA 4V0NA 1NR7A 4K28A 3FH0A 5HCNA 3RS5A 3HY6A 3K9FC 1E6EA 3KD3A 4HMQA 1E9CA 3GLUA 4KLZA 4LOLA 5D3KA 5LP6C 1QTNA 3VSCA 2CHGA 2J6HA 5CFOA 3OEED 4ND2A 2FPIB 3VJLA 2PJUA 3KYIB 3A1DA 2YBDA 4DXHA 4UEOA 2YFYA 2B5WA 4FJ1A 1DX9A 4KVFA 4KXLA 1KE2A 1LI7A 1IY2A 1KI3A 2YASA 2H7XA 4N1AA 1T5BA 3V4OA 1JMKC 3C48A 3LH5A 1JKJA 3EDRA 3TW0A 3E84A 3TUZC 4INOA 4Y0AA 3WB0A 2ZWIA 1BC5A 2BGKA 3IAUA 1Y6QA 1CUXA 5EUCA 3V4FA 3X1JA 4YBRA 1XZIA 2NYAA 4ON9A 5HDBB 1FQOA 4PBRA 1KEEA 4KQEA 1L4GA 5MN6A 4TVKA 5AM1A 1NE7A 2EEZA 2C9CA 4BNLA 5C18A 3ODPA 4LSZA 1WAMA 2IU3A 1AXRA 3IVMA 4HDMB 5FR1A 2XUIA 3RABA 3T15A 3ZTYA 4V1CB 1ZXLA 2SICE 3B6KA 3BPSA 3Q5GA 1TM5E 4ZOLB 4Z4FA 4URYR 4WNAB 4X5OA 4IZHA 5T67A 4BQRA 4CN8A 2Q21A 3JWIA 4DIFA 4CIYA 2LDXA 1JAZA 1XRLA 4KLRA 2I3ZA 4M37A 4OL9A 1C4KA 1E7QA 1N5IA 3PIIA 1L3IA 4REQB 4B6SA 3RHFA 6LDHA 2F3RA 4YWJA 2VK4A 2ASVA 3I5UA 4RIIA 4AO7A 5E6RA 4IVPA 4GZ6A 4G5OA 5A0FA 2Q9AA 2FA9A 3RARA 4AK9A 3I5XA 5EKUA 2FPXA 3MWYW 1KF0A 4NAUA 1PTKA 3FROA 5HGXA 2PQ0A 5M34A 2Y1OA 1YE5A 2B1RA 1WXEA 4JOSA 1ECGA 1ULAA 1ESEA 1ZUIA 2JGJA 5CBPA 4UJ5A 1F8UA 3NDJA 5BSKA 2DBRA 4QASA 1AK2A 4JIGA 5CITA 2V9ZA 3Q9UA 4BMPB 2F59A 1R4MA 4H6VA 5BNIA 1YKGA 2JEZA 3TOVA 5FWYB 2ETXA 5ADWA 1V2HE 4PVCA 1LQUA 2C5HA 2VJLA 2IV7A 3AR2A 2BD0A 1P1CA 1IL0A 3U0VA 3CX7A 1CRZA 2WW8A 2MCFA 4MVJE 2YC4C 4IFEA 5LA6B 1V9SA 4CKWB 4R7ZA 2AFHA 1W44A 3C45A 3ZVLA 5K3OA 1KQ3A 3CUYA 3RLFA 5A4MS 3QLUC 1ZVMA 3FZYA 2F3SA 4D0SA 3SZOA 2VO1A 1ZBDA 3O7MA 2IHNA 1SQ0A 3DH0A 1OPRA 1MW9X 4F2HA 1GPLA 3WL7A 2PRSA 2Z04A 2XUAA 5BVGB 4POOA 1IG0A 2BELA 1KGDA 3ND5A 4NZYA 4D9BA 1EUQA 3C16C 4NNOA 4ZCPA 4QO8A 3T35A 3RK1A 1VIDA 1L7DA 1XU9A 3S2UA 2I3BA 1QZUA 1WP9A 1WVIA 3FFAA 3TQQA 4PSUA 1OYOA 1UL1X 4P93A 5DO9A 1KEEB 4JLUA 1B93A 1BQEA 4NZMA 4RK0A 1PEYA 5G1PA 5KTMA 1W581 5TPZD 1SBIA 2CUZA 4ZI7A 4WCVA 5FEUA 3G13A 1KO8A 1CYDA 1J8YF 1E9RA 1ZWLA 2R7KA 3L8EA 4LDJA 4Q3OA 4QOFA 3LRXA 4HRXA 2AF3C 2QRQA 1IZ0A 3O3MB 3PRKE 4W5NA 1N2CA 1OAAA 1IMOA 4RUKA 1AMNA 4ROSA 4UUQA 4E13A 5IDVA 3AF6A 5JVDF 4I1RA 2HSWA 4LOKA 3C5EA 5AKGA 3PCXA 3WLTA 1N36B 4IILA 3BJEA 3PUIA 2H51A 1IRIA 4NIMA 2L82A 1SVSA 4MWGA 5CXXA 4F11A 4MINA 5I8WA 5K8UA 1CQXA 1QVRA 3FNEA 2FZWA 2JIMA 4A0FA 1MGPA 4CZ2A 5K03A 1Z88A 2GCGA 2ZJ4A 3IPCA 1NLMA 2WNIA 4XGNA 2FQ1A 3IAM1 3PFCA 4AULA 4A9AA 5CBKA 5FBZA 4X90A 2ONYA 2OYRA 3QA9A 3WGHA 1LLUA 1H3EA 2O8NA 3C5WP 1HNNA 2OSVA 2C88A 2VHUA 3MBIA 3Q3JB 1R0YA 1ILEA 1QQAA 4B7CA 5AKYA 2VJPA 4I4TF 5E6SB 3KXIA 1T8WA 2C7VA 4ZDJA 1CLEA 1FQJA 1S7CA 2JIZA 3L5KA 5BMVB 2LXNA 2ZUEA 1H1LB 2HX1A 5E4TA 4C06A 2Y77A 1HYHA 5IJXA 1ZKMA 3TEFA 2KWIA 4XRGA 4ND5A 3EPJA 1JAIA 3IEUA 3GN2A 2Q5JA 1U99A 5DBGA 4ZZ3A 4BY9E 5BSEA 4LHVA 3SAJA 2Y0CA 2A9FA 1VMIA 1SOAA 1VPTA 2FFBA 2LKDA 1UBLS 3KTFA 4XCXA 4Y9UA 1G6OA 2W22A 3C7TA 2HLDD 2ZRMA 3GYGA 4JITA 3O8LA 4MQ5A 2H18A 4DV2B 3BGIA 2VZ9A 4P38A 3KE8A 1WOYA 2AMYA 5KTTA 4RKWA 1BKSB 1GAQA 2IBMA 2ZJ0A 3FYUB 3M6VA 5DYIA 3UA4A 2X8WA 5KX5F 3T1TA 1GZ6A 2ZBGA 5FLEX 2WILA 1NQ5A 1SOUA 3IP3A 3H5IA 3WSWA 3ZE7A 4A82A 5TQ2A 2XNCA 3HR7A 3ZGYA 2PXXA 2Z2JA 2NYUA 4AL4A 1HMPA 3P97A 5A4AA 3DA8A 1T0IA 1QVVA 3KT0A 3RVMA 2JCGA 2DQ4A 2Q99A 4MQEA 3WHIA 2DFNA 2G9RA 4M7WA 4CM8B 1BDJA 1BTOA 1Z2CA 1A95A 2B1IA 4BQNA 5CM9C 4DBZA 4B3DA 2V7WA 2ZU0C 1M34A 2WAMA 4RJKA 3FR8A 3LXMA 3K9GA 3GFSA 5SZIA 3L1IA 3GLIE 3KJGA 5AKJA 1Z4JA 4LXQA 3NASA 3W9UA 3Q7PA 3IBSA 1BNCA 4L02A 3I8XA 5EXTA 1KI6B 3FI0A 1VKZA 3DMRA 1Q3KA 3HU3A 3K5HA 1J7KA 2NO4A 1VI2A 3KCQA 1V0JA 4FUQA 1EZ4A 4HB2A 4RSRA 2XNDD 4Q3DA 2HB6A 4F72A 1X1DA 5D7BA 5EWLB 5BSGA 5ECGC 3BCUA 4TSRA 3MLAA 3R5HA 3DE4X 2H7VA 1F8YA 3UWSA 3IB6A 5JROA 4QYIA 5IT9A 4LSWA 3DC7A 3V4RA 4PFKA 4OHUA 1NE2A 3I9FA 4GFDA 3P0JA 4DXDA 4YAUA 1Q6ZA 2H4ZA 3KWJA 4I4IA 1RYZA 3EODA 3EG9B 3EPHA 5E8RA 4DR3B 1NRWA 3MJ4A 1B41A 3TGWA 4HUJA 1BH6A 2L18A 2RGRA 1YJ8A 3V42A 3TI7A 1T8RA 3DZ8A 3PP8A 2BMVA 4XB1A 4GLOA