2OCGA

Crystal structure of human valacyclovir hydrolase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
254
structure length
254
Chain Sequence
b'SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Valacyclovir hydrolase
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ocgA00
3WYNA 4ROTA 4PO3X 3K6KA 3W2TA 1QOZA 3C8HA 5K3EA 1ETHA 4BP8A 1X70A 3QYJA 2JGKA 3AIKA 3IUMA 5HFAA 5AI5A 2BAGA 2O2GA 5K5EA 2J4CA 2QKYA 2LIPA 2XUAA 3K9BA 3FYUC 5FRDA 2H7CA 4E46A 1YB7A 3WZMA 4TGLA 5AJHA 1XZLA 2WFLB 4DNOA 1E3QA 5DYTA 4HRYA 4LYEA 1ZIYA 1FSSA 3GROA 4CCYB 3H17A 2HA2A 5ALTA 5JYCA 3RM3A 2PU7A 4INZA 4PSDA 4AO8A 1MO2A 3CN7A 3HEAA 1H22A 3I28A 4HVTA 2VA9A 4ARBA 4QDXA 2GYWA 2H7YA 3M81A 4GBGA 3W05A 3AFIA 1ZI8A 4HRXA 4UBMA 3DQZA 2DHDA 2OAGA 3STVA 1FFAA 5ALSA 3FSGA 2HU5A 1BCSA 5E4YA 3WIBA 2DQYA 5LZ8A 4B82A 2I3ZA 2AXEA 5ALVA 2RGUA 1W1IA 5CW2A 5CXUA 3ICWA 2VTVA 1A8SA 4EY7A 3W9UA 3I1YA 4FBLA 1YS2X 4BZWA 1JU4A 3SK0A 3AINA 3WKEA 4C87A 4EY8A 5DNUA 2XQJA 5K3CA 4WFIA 4K6KA 4JYMA 4QDOA 3IVMA 4H18A 3MUNA 4DMCA 3BXPA 5HCUA 4HZGA 1HL7A 5ALKA 5LZ5A 2PL5A 2WU3A 1E8MA 1AGYA 1BS9A 1P0IA 4K6HA 3FYUA 1B41A 4XWGA 3QBJA 3D2AA 3I6YA 3C6BA 5AOBA 4X00A 5CT9A 5ISMA 5H3HA 5JZ9A 3EQ9A 3IURA 3S2ZA 3V1LA 3UMJA 1E89A 2HIHA 4WFKA 2RAUA 4DNQA 4BE9A 2BGNA 4BVLA 1ZJ4A 5K3DA 3WK9A 1QFMA 5KWIA 4C89A 4LXIA 1UWCA 5DYWA 4M0FA 3CN9A 1QO9A 5HKAA 1MAHA 2O2IA 3ESDA 1IZ8A 3A2NA 2OGTA 2B4KA 1QIJA 2I3DA 1MU0A 4KRYA 1UK6A 1CVLA 5D7BA 4PW0A 1UK7A 2WU4A 1EI9A 3VJKA 4B83A 1VXRA 4OU4A 2PUHA 1QGED 5AM3A 1QONA 2AJBA 3WLAA 1UZAA 1H2ZA 1CUIA 2DSNA 5ALOA 4BYMA 1CUAA 1BN7A 3PUIA 4I4CA 2B20A 2OQVA 5D3ZA 5A62A 2O2HA 3A2LA 3QZUA 3B5EA 5J3JA 3RKSA 2FJ0A 2VQ6A 5A6VA 1NU8A 3R0VA 2C5FA 2EEPA 4X6XA 1JKMA 1R4ZA 2GBCA 4X93A 1LPPA 2J3QA 5EIEA 3WK5A 2GZRA 4E15A 4M0MA 2VJDA 2QJWA 1ZOIA 1G4HA 4ZRDA 3BL8A 3IUQA 3I2JA 3N0TA 5CH3A 2PSDA 1MTZA 1TCBA 2HA3A 5E4JA 1AMNA 1ZD2P 4F0JA 3R40A 1K5PA 1Q0ZA 5FOQA 1K6EA 2X76A 2BUAA 5HK8A 1JJFA 3G8YA 2WIKA 1MAAA 4D9JA 4QWWA 2B9VA 1GPLA 2XMCA 5CT8A 1WHSA 5IVKA 1SCKA 2WG0A 2XUKA 1ZI9A 5ALGA 5AKHA 1U65A 2OG1A 4X85A 4DMFA 2WUGA 3G0IA 4FLMA 4PV7A 3D3NA 2ZSHA 2WIFA 3WWEA 4DMKA 4Y2PA 5E2IA 3TJMA 5ALNA 4L0CA 3H2GA 5I8PA 4EHBA 5AOAA 1CUDA 3UUEA 2XQGA 2XQKA 3NUZA 2AJLI 2QJRA 2W22A 5EI5A 3DL4A 4G4GA 2Y6VA 4Y2YA 4B0OA 3GZJA 1WB4A 4HXEB 3D2BA 3AIOA 5CBKA 4QNNA 1VXOA 2WM2A 4H7JA 4EY6A 2VJAA 4BTVA 1HBJA 1VE7A 3BDVA 4AB1A 3ZI7A 2XI4A 3WZLA 1N5RA 1XRMA 5KREA 4U2EA 1HPLA 5A7GA 4W1SA 2K2QB 5K3FB 3TEJA 5IVHA 1PV1A 5I7UA 4ITVA 4I3FA 4B7ZA 4L3WA 4X6YA 1TRHA 1UKCA 1YAHA 2WG2A 1USWA 3BIWA 1VA5A 5IH7A 1O6GA 2JBWA 4BB0A 3KDAA 2W6CX 3WL8A 3C87A 5HF6A 4Y2RA 3G0CA 1F6WA 4XVCA 1EA5A 4Y2UA 2BUCA 4BC0A 4QLOA 2XUFA 4QLAA 3L1JA 1ZD4A 3EQ8A 3G9ZA 3I6ZA 2PX6A 4XX1A 3F67A 2XUDA 4DGQA 4Q1VA 4UHHA 3UUFA 5KWJA 2V9ZA 2WTNA 3QMVA 4Y2XA 2PVSA 4U2CA 4MEAA 2QZPA 5AM4A 2J4FA 4DNPA 4FLEA 2O7RA 1WPXA 1EDBA 3FYUB 3O95A 4QE3A 4X97A 2PUJA 4OB6A 3V48A 1MT3A 2VJBA 5DLPA 3L1IA 4B6GA 5AICA 4QDZA 2PSFA 5EFZA 2VEOA 4J0KA 2RHWA 4FBMA 4F5ZA 4Y9SA 1IUNA 5LKAA 1QIEA 4Q82A 3HXKA 4QDTA 3FLAA 1EVEA 1IUPA 4ETWA 2NW6A 2QR5A 4W1RA 2E3JA 1O6FA 2BFNA 5T4BA 4FLFA 5ALXA 1VZ3A 2C4HA 5AO9A 5FPQA 3R41A 5BOVA 4AXBA 1E8NA 4O08A 2WFMA 5AI0A 2O7VA 3WJ2A 3NOXA 1P0MA 1CQWA 2H7XA 2HA7A 3D5EA 3DS8A 4GWLA 4B84A 1WOMA 3ZWQA 4Y2JA 4YPVA 4UHFA 1Q83A 1ORWA 3O9VA 4H35A 4IH4A 2QUAA 1LGYA 5T4EA 3OPMA 2ONCA 3I2FA 5LIPA 3E0XA 5IVDA 1CUEA 2RHTA 4B85A 4NZZA 3WK6A 2CB9A 5LYYA 3STUA 1K8QA 1EB8A 5EHQA 2JGJA 1SC9A 2YASA 2CJPA 1W75A 5AH0A 1W52X 3IB3A 4PQEA 2I78A 4RNCA 1YB6A 5CMLA 2EDAA 1LZKA 3EBLA 2PKYX 3EQ7A 1AQLA 4J0DA 1G5FA 4TPKA 3M83A 4JEIA 3C6ZA 3G0GA 1ZGCA 1CFJA 5JATA 3QITA 1W76A 5JAPA 1E8DA 2XMSA 5ALWA 2VSQA 1GQRA 1C7JA 1WCYA 5JAHA 4C4YA 1ISPA 5AM2A 2V98A 2ZJ7A 4H0CA 2HDWA 5DYYA 5HQ3A 4BAUA 2WFZA 3FNBA 5JALA 4ZV9A 3HYSA 4UBOA 4KJXA 2RONA 3YASA 4AO7A 1GGVA 1D07A 5HF5A 1ZD3A 1UK9A 4N8DA 5AKLA 1BN6A 1EK1A 5K3BA 5HKBA 1H2WA 3BIXA 2Y6UA 4S0XA 3WK7A 3O4JA 4J3JA 5FP0A 1JJBA 5JADA 1AZWA 4ZI5A 2CEKA 2QTBA 3QPDA 3PUHA 1J1IA 1TKRA 3HC7A 3Q8WA 3PDCA 1R9NA 1U8EA 4UHEA 4KE9A 2XE4A 4FKBA 2WJ3A 1GPNA 4V2IA 2HFJA 3WL7A 1L7AA 3NGMA 1DQYA 5ALZA 4CI9A 2WTMA 3R3XA 4X7BA 2H1IA 2QMQA 5LZ9A 4K2AA 4X71A 3P2MA 4NS4A 3R3YA 4DIUA 4DYHA 3C6YA 1NX9A 1EX9A 1WHTA 4EY5A 5AIBA 1QFSA 4JUIA 4UBJA 1MX5A 4BBZA 4Q3LA 4IHAA 1UFOA 1YR2A 5T4FA 5LP1A 4CG3A 5JZSA 2D0DA 1FFDA 1VZ2A 2HFKA 1QZ3A 1XZJA 5AIAA 1BE0A 1MNQA 4GECA 3WL5A 2ZJFA 2Y2UA 3DKRA 4UHDA 4C6HA 4KEAA 2ZJ6A 1SCQA 1CUHA 1UOQA 2WILA 4BATA 3WJ1A 4MYSA 1MN6A 3FSGD 5AOCA 4UHBA 1DWQA 2C5GA 2CZQA 2HU8A 1J07A 3I6MA 1CUUA 1ACLA 3E3AA 3KXPA 1LZLA 3HLKA 4CIAA 1XZKA 1QIHA 4UBIA 4LKOA 3O4GA 1BEZA 3ESAA 1UOOA 4IO0A 4HTAA 3WWCA 3FLBA 5C8VA 3D59A 1VA4A 2IITA 4WFJA 1XRLA 2QT9A 5ALRA 1TIBA 3JYHA 1F8UA 4B9EA 4Z49A 1CUBA 5T4HA 4M0EA 4Y2TA 4GDMA 1U4NA 3VJMA 3DYIA 2Y2VA 2QS9A 2OCKA 3O0DA 1XZCA 3A2MA 4CFSA 4ARAA 4L72A 3DNMA 5AM5A 5FUMA 4TVKA 2R8BA 2WQZA 3WKAA 1EB9A 3BF8A 2PU5A 3SC2A 3WKDA 1E5TA 3VVLA 1U2EA 4RPCA 5DNWA 3H04A 3VJLA 1TAHA 2XB6A 4JYPA 1A7UA 1OCEA 5BWBA 1LPSA 1QLWA 1XKLA 3I2HA 1R3DA 2CKMA 3WK8A 3G9XA 2BUBA 4X92A 1YAJA 4BAZA 1VOTA 1P0PA 4EB0A 3TRDA 1SFRA 4G4IA 5AKIA 3B3QA 3PF8A 4GLBA 1EDDA 5I9IA 3LLCA 4B80A 2JGLA 4X91A 1OILA 4WY5A 4JH0A 3KSRA 5AI8A 1PJAA 1F0PA 5CXXA 4Y2SA 2ES4A 5IVIA 3W06A 4FFWA 1YCDA 4UBNA 5AP9A 2XMDA 1FFBA 2WHQA 2ROQA 3D2CA 1W6RA 2ACEA 2QRUA 3DYVA 1NU6A 3CXUA 3E4DA 3ANSA 1CR6A 4DSZA 2BKLA 4EA6A 3HSSA 1QIDA 4U2FA 2OGSA 4MWSA 2FX5A 4KAFA 1XZHA 4KE7A 4CIBA 2WJ6A 4N5HX 2DQZA 2GBFA 3BE8A 1GQSA 5FLKA 3C70A 1CUCA 5F4ZA 3VKFA 4LIPD 3AIMA 4G1FA 4AN1A 1ZICA 1JT2A 1ZD5A 2G4LA 2UZ0A 4OU5A 4DLNA 2XT0A 4KR0A 4G5XA 3WL6A 5HQ3B 5JAOA 2DHEA 5A71A 3C45A 3LP5A 3OC0A 2JEZA 1ODTC 2YH2A 3GUUA 5EHNA 4LHEA 4OCZA 2C0PA 3WYDA 5AKJA 5AKZA 4W63A 5JASA 1WPRA 1CUJA 2VT7A 4BCBA 1QE3A 2Q0XA 5SYNA 3V1KA 2WUDA 1YA8A 1XFDA 2XUJA 4DTCA 4C4XA 3WQHA 3RK4A 1T2NA 4NVRA 5AI6A 2IX9A 3QH4A 2Z5GA 3LS2A 1EXWA 4B0PA 1GKKA 2HA4A 2GZSA 3WKBA 3WK4A 3PI6A 1XQWA 4AMYA 2FUKA 2HRQA 2XUHA 5E4TA 2HHAA 2WSLA 2RIPA 1ORVA 3DCNA 1IUOA 4JNCA 3GBSA 5ALLA 4BTLA 2EDCA 5HZGA 3IBTA 2OCIA 4MXDA 4UHCA 1QTRA 2JEYA 4G9GA 1QO7A 5ALJA 4G4JA 1GXSA 3ESCA 5AKKA 2VATA 3Q0TA 3H2HA 4PF1A 1GZ7A 2X5XA 1UOPA 2DR0A 1HLGA 4X90A 4XIIA 3TGLA 1XKTA 3H0CA 3N2ZB 2WHPA 2XQIA 4QZVA 2ZYSA 4UBLA 4X94A 4W1PA 3QPAA 3FAKA 1JFRA 3ZPXA 3FBWA 4RE6A 5ALDA 4B9AA 5JZBA 1B6GA 2AJCA 5ALQA 3KD2A 1LPBB 5FPPA 4BC1A 3ZV7A 1EDEA 3G9TA 4J0GA 2HA0A 3W9BA 5CTAA 3BDIA 3F9CA 2B61A 2XUGA 1C4XA 4F21A 1BRTA 4A23A 2JGMA 1WB6A 6YASA 1TCCA 4KAJA 4WDQA 1N5MA 3STWA 4BRZA 2GBIA 3H18A 5IKXA 3C5VA 1J06A 1CUXA 5C8ZA 2XMGA 4Q05A 4WCVA 3H19A 5YASA 5EHZA 1ZI6A 2OGZA 3L1HA 3MGAA 2OPHA 3WWPA 5C7YA 1I6WA 3RLIA 2WIJA 5ESRA 3WA7A 2VAXA 1SCIA 3IUNA 1RYYA 2VAVA 5A2GA 3C43A 4WDRA 5ALMA 5CT5A 1JJIA 2PSEA 4L9AA 7YASA 1DU4A 4YASA 2XUPA 3QMMA 1CUGA 3SWWA 4K5QA 2WUEA 3AZQA 3DEAA 4RE5A 5AM1A 5JD4A 5EIHA 1UK8A 4OPMA 4PSCA 5EGNA 4XJVA 2JGIA 1S8OA 3ZLVA 5ALUA 2ZYRA 5AKXA 1Y7IA 4X95A 3FVTA 4FNMA 1XZIA 4MJ3A 1ZIXA 3FLEA 1H23A 1H2XA 3F96A 4H7DA 1CIJA 2HA5A 3G7NA 2AJ8A 5DTJA 3G02A 4OB7A 2GYVA 3OOSA 3C8DA 2AJDA 1DQZA 4OYYA 1JMYA 4B81A 1X2EA 3ANTA 3STTA 5D3KA 3FOBA 4GW3A 3R3WA 5KBYA 4U2GA 5AKGA 1IZ7A 4N8SA 1GPKA 1N8SA 1DINA 5AK6A 1M33A 3MVEA 3PFCA 2WLSA 1OXMA 5CH5A 2QM0A 5AKYA 3S8YA 1XLVA 1DWPA 1HDEA 4DNFA 2BJHA 1XQYA 4YK7A 3MUOA 1L7QA 5AK3A 5ALPA 1XZMA 5LLSA 5AK5A 1LPAB 5DTIA 4OYLA 4BZZA 3V9AA 3VISA 4QDUA 3WWDA 3HI4A 1K4YA 1YASA 4KE8A 1AURA 4CG2A 4KE6A 4H77A 3JWEA 2PSJA 3E1GA 1MJ5A 4BCDA 4UFOA 3U1TA 4FNGA 4ZGBA 1TCAA 1XZFA 2QVBA 2V96A 4J0HA 4OB8A 3I2KA 4WJLA 4Q3OA 3IDAA 1MPXA 2XUOA 4YX9A 2XMZA 2CBGA 2JIDA 3FWHA 5AKEA 4C01A 2G63A 1XQVA 2Y1KA 1CLEA 3EF3A 1PFQA 4Y2VA 1CEXA 3JW8A 4MYDA 3H2KA 4BDTA 1BCRA 1A8UA 1C7IA 1XRNA 4FTWA 4DM7A 1TQHA 1GT6A 1MNAA 4QA9A 1DT3A 1XLWA 3I2GA 5LZ7A 4WY8A 4AQDA 3K2IA 3LIIA 5K3FA 1CRLA 3B12A 1EINA 1JI3A 3GA7A 4GI1A 5D6OA 4HAIA 4BAGA 1XRQA 4GEGA 2WIDA 1FFCA 4E11A 1J2EA 2QOEA 4FHZA 3AZOA 4J03A 1THGA 1VJ5A 1QIFA 4BRSA 2WHPB 4EBBA 4OUKX 4F60A 3FCYA 5LZ4A 2BCEA 3U0VA 3ZLUA 4BVKA 1LPMA 4FOLA 3V1NA 3VXKA 1E66A 2PPLA 2OCLA 5ALYA 3FCXA 1IVYA 2G5TA 4QEKA 3IA2A 3EIOA 2OAEA 4UFPA 2JGFA 4PSUA 1KEZA 1F0NA 4AX4A 3VDXA 2X8BA 1DTEA 4Q34A 2ECFA 1LPNA 3AJAA 2XLBA 1THTA 2DCMA 1AUOA 3GFFA 4AN0A 5FDFA 4G8BA 5LZ2A 2DFPA 2YYSA 2XQFA 4UPDA 4H7KA 1XQXA 3D0KA 1ACJA 5FV4A 3QVMA 2QXTA 4OSEA 2XMQA 2QUBA 1R1DA 5CH8A 3H2JA 4G9EA 1K63A 1N1MA 5EHXA 2ZYHA 2ACKA 3AILA 2RI6A 3F97A 1RP1A 3WI7A 3WIOA 4BE4A 2HM7A 3CCCA 3HJUA 4K6GA 1ZJ5A 1EH5A 3IUJA 5DJ5A 3PICA 1LBSA 5SYMA 4H7FA 4P93A 3G0BA 1LPOA 1CUSA 2VT6A 5DNVA 3KOOA 2GYUA 2Z8XA 1AKNA 1UKAA 2WJ4A 3PF9A 5AHXA 5BWCA 2QXUA 2WHRA 1R88A 1EVQA 3F8SA 1DX6A 1BEEA 3OTQA 2HA6A 3X3HA 5C81A 1Q0RA 1KU0A 2G5PA 3VVMA 3M3DA 4RGYA 4N5IX 4CG1A 4A16A 3BF7A 3ILSA 4X6UA 5FXMA 1JU3A 4PNZA 4AZ0A 3SX4A 3G0DA 1QIGA 4G8DA 4Q3KA 2PSHA 3AZPA 2XMRA 4AMZA 1QIIA 3G9UA 2ORYA 3PFBA 3BJRA 1R9MA 4DSAA 1A88A 4ZXFA 4IQ4A 4EUSA 4EY4A 3STXA 1CUZA 4AO6A 4DMHA 5AI4A 4H7HA 1EHYA 1X2BA 3BJMA 4HXFB 3NWOA 5HF9A 1XZEA 3DOHA 5JANA 3C6XA 4MQLA 2V97A 2XMBA 4GHWA 1XZDA 2I03A 5A7HA 2XLCA 4E14A 3D4LA 1Y37A 2Z8ZA 3T4UA 2XUIA 2ZSIA 4KYVA 4IH1A 1CUYA 2D5LA 2HL6A 4UBKA 5CRIA 2R11A 3KWFA 1TK3A 2C7BA 4MEBA 3C5WP 4HS9A 3T52A 3IIIA 4C4ZA 1ODSA 1DWOA 3WMRA 1BU8A 3H1AA 1EK2A 4KRXA 2OLEA 3ED1A 1HQDA 2DHCA 4J0JA 5C8XA 3QMWA 2P8SA 4J0CA 3A70A 4H7EA 1FJ2A 2WFLA 3HZOA 1LLFA 3BWXA 4CCYA 4BP9A 4OD0A 5ALEA 5LKRA 5BV7A 4A5SA 1QTIA 1XRPA 4J0IA 3RARA 3ESBA 4ZWNA 5K3AA 2JGEA 1QJ4A 3DLTA 1CQZA 3O4HA 3H2IA 1BROA 1LBTA 4X3CA 3V1MA 2BGRA 3IULA 3FVRA 4Y2QA 3OG9A 3LIPA 2WUFA 4KACA 1XROA 2Z3WA 5JAUA 5JARA 3W04A 1WM1A 2C58A 1FFEA 2OCGA 2JF0A 2GBGA 3HACA 1RWQA 3HABA 2WG1A 4HXGA 4AZ3A 4BDSA 3PE6A 1XZAA 5HF8A 2C0QA 1IMJA 3R3UA 5CURA 1ODCA 5HK9A 2HRRA 1JMKC 1W4LA 1P0QA 1G66A 2YXPX 4P08A 1Y7HA 2OQIA 5EIAA 3KWJA 1MX1A 4I19A 4J7AA 3ICVA 4N8EA 2WIGA 1WB5A 1AX9A 4MQMA 1CPYA 1CUWA 1R50A 2HU7A 1VKHA 1ZGBA 2XDWA 2ZYIA 4U2DA 1DT5A 3DDUA 5AM0A 3DL7A 5HFNA 4LYDA 4LXHA 2VF2A 4EZIA 1Q84A 4BVJA 4FMPA 1H2YA 4FFVA 5CT4A 1YA4A 4NMWA 1YSCA 5CT6A 5ALFA 3STYA 1GKLA 3O4IA 5JD6A 3QM1A 3I1IA 1CUFA 1CV2A 4W1QA 3DD5A 1CUVA 2Z3ZA 1VLQA 3ZLTA 1KU6A 3GELA 4P9NA 4LXGA 2PM8A 1SOMA 4G8CA 4ZREA 5AK4A 1UXOA 1XZBA 2WKWA 3WWOA 3R3VA 3O9MA 2J3DA 2PBLA 1VE6A 4FDMA 4W9RA 1XLUA 4UFNA 3M82A 5ALIA 3F98A 1UT6A 1QIMA 5FKJA 1QIKA 3DJYA 5A7FA 5AI9A 3DOIA 4KAAA 1MX9A 2CMFA 3OURA 4IH9A 2HADA 4U2BA 3HRHA 4MWTA 3R3ZA 1YS1X 3AUKA 4QWMA 3LCRA 2OXEA 2H9YA 4ZV7A 3OM8A 2IIVA 3WKCA 1A8QA 3QPCA 3H1BA 2VJCA 1DX4A 1Z68A 3DKKA 1XRRA 2FJPA 4BCCA 1G42A 1XZGA 1T4MA 3CCBA 2XUQA 4FWBA 4H7IA 5DWDA 1L7RA 4P92A 5JIBA 3A6ZA 4GXNA 2ZVDA 2CUTA 4CCWA 1AC5A 3D7RA 3FYTA 5ALHA 4C88A 1UKBA 4Y7DA 3WA6A 4UUQA 1HKHA 3I2IA 1LNSA 5JD5A
chains in the Genus database with same CATH superfamily
1IHDA 3K70B 3WYNA 4ZZ1A 2JFUA 2AG0A 3GJ6A 1J2YA 4ROTA 4US0R 5LMCA 3K6KA 4TTIA 3A6JA 4AS1A 4YGYA 1U1GA 3UAWA 1TJYA 4MB0A 4MUJA 4GMHA 2GH1A 2JL1A 4CEIA 1O03A 1OH5A 2VRBA 1ULSA 2NADA 3O84A 3OIDA 3PUZA 1X1BA 1S1CA 2OGUA 4DV2B 1ETHA 3QF7A 1ITZA 1X80A 3K16A 4BP8A 3VX3A 5K0SA 4DWWA 3WBFA 4R71A 1NW4A 2HZBA 3FYCA 3QYJA 3NBXX 2EV9A 3CH5A 3TH5A 2D4AA 1ZM9A 2PZFA 5CHYA 3AIKA 4P98A 1E0AA 1WDLA 1KI7A 4MV5A 3S27A 5KU7A 1KVTA 2AKYA 3P2IA 5JAQA 4D9FA 1V8ZA 1ES9A 2GBPA 1N2CE 5C34B 3K9BA 3HKEB 5ECGC 2JLAA 2HTFA 2P6UA 2G82A 3FYUC 1SVWA 4HVAA 4BS9A 2BYTA 1T9AA 1WVMA 4J2OA 4KSCA 3IBCA 4P0QB 3E9NA 3EZFA 2J0EA 1ZEJA 3RS4A 3AF6A 3IP8A 1ZO8A 4TGLA 4LYFA 1V37A 4F7WA 1XZLA 4DNOA 4M38A 1E3QA 1RI3A 4CQLA 2VH5R 4GBJA 4CCSA 5CVTA 3VU0A 1NLMA 1FZQA 2NUTB 4E0BA 4ESEA 4A5SA 2HZ7A 1TM1E 3GROA 3H17A 1P1JA 3LUPA 3LUBA 1ISRA 2WWGA 4CCYB 4QEZA 5GOTA 3RM3A 1CHNA 3HNRA 1BDJA 1TQDA 5I8WA 1MO2A 1EVYA 1SKBA 1JP7A 1JAYA 4B09A 3CN7A 3NWJA 4V0SA 3NPAA 4FZ3A 4EW3A 3IEVA 1ECCA 1ZXXA 2B5WA 3WSTA 1CJVC 4KQGA 3QUTA 3H11A 3VYWA 2QVXX 1QV6A 3UJBA 4P4SA 1V3VA 3ROXA 3A9SA 4DLBA 2XTAA 1ZK1A 1R3UA 4GBGA 4IVPA 3UJ8A 2YZMA 4E88A 1SA0B 4F38A 2ST1A 3SDBA 5BV1A 3K9QO 3WYBA 1KEEA 5JSHA 3ZHCA 4HRXA 1OXBB 2C97A 4WLUA 4OUDA 4L02A 3RRJA 3F4LA 1DAFA 1FFAA 4PO1A 3HDJA 3FSGA 4A8PA 1JKXA 1T8PA 4MWBA 4E5NA 2XCRB 1FDWA 2ZJ2A 3C15C 4C0WA 4JYZA 3B1ZA 3GFOA 2YMQA 3HDHA 3S1SA 1U0EA 5DYGA 2ODQA 2WU8A 2B2CA 2Y66A 1OTXA 2QX6A 2RGUA 3FJ1A 5A9SB 1W1IA 1E0JA 1R8XA 3FNFA 5CXUA 3IO3A 3OJEA 3OLZA 1MBZA 4IF6A 4NPAA 4B71A 4EY7A 2PK3A 1YS2X 1EVLA 1DFIA 4BZWA 3RJMA 1JU4A 4LBWA 2GILA 3AINA 3SK0A 3V8VA 1LVHA 4IL5A 3OKPA 4P58A 4RLFA 3UV3A 5KQPA 3RTCA 5DNUA 1OT3A 2TYSB 2FEXA 3S99A 1QZUA 4FR0A 4S12A 5H4HA 3DCIA 4G01B 3X1WA 1M9NA 1Y3FE 4H18A 4DBVO 1BWQA 3I32A 1XLTA 3UGJA 4EKGA 2JAOA 1HTWA 3KL4A 1GNVA 3I73A 2AYXA 4IIBA 3HHPA 4MW4A 1ZJJA 2ZS8A 1SQFA 3AJDA 3ISJA 5T6BA 1D5CA 3HN6A 1NSFA 1JEQB 2P5YA 1Y3CE 3TTYA 1QMGA 2PMDA 1N75A 2RGWA 3FPBA 2BKUA 4YRGA 1OAOC 4IDOA 4M83A 2WJHA 4FCVA 4MVJA 5EPEA 3JWJA 2PIDA 4ACBA 5EKXA 2CLCX 2EFGA 2FMIA 3FYUA 2IW1A 3RSSA 4D9NA 4LF6B 3D0OA 2A5YB 3BMNA 3GAFA 2BC9A 2HDHA 2QORA 3QWBA 4QDJA 1MGPA 5KX5B 1DJOA 1R18A 1DKNA 1T3HA 5UKDA 4O4LF 3I39X 4G07A 1QB8A 3P32A 2XA2A 4XCVA 3R0XA 1P9RA 5DOVA 3V2UA 5BPHA 3DDCA 3LT4A 1E89A 4KWCA 5I4CA 2XF8A 4B2IA 2JFYA 4DNQA 1MXHA 3WNCA 2BGNA 4O4JB 1G4AE 4ZALA 4BVLA 4KXYA 5IC6A 1ZJ4A 1IDN1 1ZESA 1AKMA 1QCDA 2OAQ1 421PA 1E1LA 1ESCA 3WK9A 1OD6A 5K20A 3BQMB 2CLMB 3ITEA 4XQGA 1T4CB 2IUFA 1NXPA 5KWIA 1SHZA 4QYTA 1XEAA 3DOUA 3LMKA 1AF4A 3E5MA 3L5KA 5DASA 3LQFA 5EG5A 3N3BC 2VQ3A 1X1TA 1C1XB 2PR7A 3TNDA 4R8MA 5DYWA 2I2XB 1ABEA 1IOLA 2H4ZA 2Z04A 2FZWA 4TX1A 4PAWA 5E8RA 5F2KA 4A2WA 3ZE7A 5TVKA 4F04A 2FY8A 1IPHA 2VJQA 2XGMA 2IUEA 3BL6A 3GC6A 1DRWA 3GR6A 1M0WA 3CT6A 4LZZA 4MS1B 4O29A 4DCVA 2YUTA 4YWHA 3A2NA 2OGTA 1RBYA 4MV3A 5MN5A 2PJRA 2EFYA 2EKPA 4FOPA 2NXNA 1VE3A 4IHJF 3X1YA 2XB2A 1NFQA 4MITA 4GAEA 5FBVB 1O97D 1KAHA 1G2PA 1JNYA 2QL9A 2YIDA 3BXFA 3KD3A 3P2OA 4JYCA 1C0PA 4WJZA 4WNIA 5D7BA 1FDTA 1Z08A 3RASA 2GCEA 4C5BA 2ZTMA 1R6TA 3ZTTA 2FLWA 4PW0A 2Q8QA 2P75A 5EL0A 1PFYA 4TKLA 4EW2A 3J81A 3DQPA 1G3IA 3FFTA 1EI9A 4JC5A 3FOEC 1KYIA 1ZN7A 1BS2A 4CMCA 5BN3B 3QUAA 1VXRA 4PR3A 1V8PA 2FSSA 2PTHA 3BMXA 1P60A 2J0VA 2ZJ8A 3GT4A 4RTOA 3ZG6A 1I10A 4K9SA 1MJGA 2JIOA 1KRXA 1GN9A 3ET4A 5IJ9B 3RE1A 5U4QA 4WCFC 3DHWC 4AJKA 4I1SA 3KUUA 5DHFA 4WNAB 4CMAA 5CB4B 5DB4A 1AVTA 1H2ZA 1HEYA 1FNNA 1KYQA 2PMBA 1OFUX 4TL6A 2SCUB 4RQBA 5JH7A 4AY6A 2WIBA 1RPNA 3QOFA 4S2UA 4YS6A 3SE0A 4ZYVA 1YUMA 1OA0A 2QTWB 5ALOA 1LK0A 2XHEA 1ECFA 4P2GA 4M99A 3H1GA 3OI7A 1L9XA 2EP5A 1RQLA 1DV1A 2H9AA 3R5JA 2DBRA 5KTYA 2RHGB 2JK1A 4I4CA 5AJXA 1T5SA 2ZAMA 5DKFA 3VC7A 3DV0B 4CR6A 1R0XA 5A62A 2R48A 2AXQA 3H9EO 3UK1A 5H70A 4FX2A 3G2IA 4X1IB 1UJCA 2XWQA 4PVCA 5F21A 5GM2A 2P35A 4W7SA 5KYXA 3L8EA 4MR8B 3QG1A 4HQKA 4WBSA 5A04A 2PMKA 3L3BA 1RI4A 3I9V1 2VQ6A 3Q87B 2JATA 4A8HA 3CUKA 4IG9A 5LSAA 2DPLA 3IAEA 1BNCA 1RE0A 2E5LB 1GAXA 4L5AA 3R0VA 1LBIA 2IY8A 2B25A 1Y1SA 2YNMD 2C5FA 3LOPA 4QOHA 1NAHA 4JD5A 4NYIR 1EEHA 3B38A 2X4IA 5LBTA 2GBCA 1R4ZA 2G25A 3DUWA 2UYHA 3ELUA 1UXJA 1O1YA 5D85A 3D3KA 3WK5A 2GZRA 4RVOA 1P3Y1 3RR2A 4EKYA 5TS2A 1QDEA 2P2NA 4MLCA 3OQVA 2VJDA 2QJWA 2RDMA 1OSNA 3CSUA 3I64A 4FDAA 4D4JA 1KSGA 3IP1A 1ISGA 2P4UA 3MMNA 1SXGA 3AV3A 3GH1A 5DSZA 1PV2A 4TYWA 4QTYA 1BG6A 1Z63A 4II7A 4TTVA 1NUQA 4EB8A 2PSDA 2CMGA 4LZPA 3SZLA 1A9XB 1IBKB 4JOBA 3A1NA 3KBOA 4CYMA 4TXMA 2PKXA 5E4JA 1AMNA 2VDVE 1Y8QA 4AZSA 1XRSB 1Z4OA 4YUXA 5H83A 1AV6A 1K5PA 1Y6FA 1Q0ZA 4G1BA 1Z6XA 1W8IA 3RBZA 2FPIB 3SDSA 4EYSA 1JDPA 1K6EA 4R0MA 1DBWA 1C14A 4YRJA 3QNMA 1AUQA 3I0MA 1PJBA 4U39A 4A0SA 4Z4GA 1EFVB 1ATZA 3MT7A 3ZJYA 4BGVA 3HMKA 1JJFA 4FNOA 4C08A 2JLQA 1ZBDA 3FSJX 2WIKA 5CGZA 2JZNA 3TS1A 1EUCA 2BEUA 4HGZA 1L4HA 3CF4G 1DEKA 2O6HA 4L5IA 1DCFA 5G53C 1RZRA 3OEWA 3U39A 2I91A 3BE5A 5C18A 3DFKA 3ZN2A 4OSOA 2JRCA 3QQ5A 1QAQA 3URKA 1F8FA 4MIYA 3I8XA 2YJNA 5DBGA 3AB3A 3K0KA 5D2CA 3EGDA 5AKHA 2QRHA 4RKQA 4F4CA 5KEIA 1K7EB 2PNJA 1V8FA 4V1CI 3RYHA 3E23A 1U65A 2OG1A 4DMFA 1Q7GA 1H9AA 1Q3KA 1SUFA 4YMLA 4JI0B 5F9FA 1GFSA 1SRQA 1G6KA 4FLMA 1JG7A 1Y4DE 4Q9HA 2FW6A 2WIFA 2ZI9A 1CT9A 1D1TA 3FUCA 3GCWA 3QKIA 4TT3D 1KVQA 4Y2PA 3RSCA 4BMOB 4N0DA 4V03A 3RIEA 4BMSA 4K9QA 4QICA 1NJSA 1LTHR 1NJGA 2VDRB 3EC1A 1WXHA 3QLVC 1GQFA 1KMHB 1LX7A 2RIRA 5TJHA 1ST3A 1BOFA 1LLUA 1GDHA 2J45A 3SBDA 1GLVA 3G2MA 1RSZA 3OIWA 1P4GA 4J91A 5F1OA 6REQA 4HMQA 5AOAA 1U2ZA 4ZVPA 3MJCA 5CVEA 3D54D 5F7XA 2BF4A 4U8GA 2HRBA 1HURA 3TFOA 1Z9BA 4Y2UA 2QJRA 4HDSB 1LVGA 1RIFA 2HNBA 5EI5A 1F14A 2O52A 5DNCA 4MS3A 4G4GA 1XXLA 1SWWA 3PC8A 3FIJA 3PE3A 5HQJA 4E1AA 4V0MA 1E1KA 5KSPA 4Y2YA 4RA6B 3ABQB 2OO5A 2F4NA 2I22A 2Q2WA 4WBXC 2EC5A 2CVFA 2QUZA 4DQDA 5J63A 1V8DA 4D43A 3ERCA 4ZAGA 1QP7A 3TI7A 4MGKR 1E1NA 3OA2A 2NSLA 4ZOLA 2J9XB 2V3VA 1S4MA 3NXSA 1ESDA 4XQ9A 4C2BA 4EY6A 1VPDA 1TYBE 2F48A 3B82A 3H8WA 3N5KA 4H7JA 4I2NA 1Y98A 1H5UA 2QG4A 3GFGA 1C3LA 3VTKA 4BTVA 2VJMA 3PRKE 1OXUA 3NIBA 2IYFA 2WWIA 2ZRBA 3QLTA 5F1KA 2NPFA 3BD6A 2QTAA 3O9ZA 2YWRA 3AF2A 3F1LA 1L3CA 2WZBA 3GGGA 1NF2A 3PFKA 5CPBA 4XDYA 1ZSNA 4LBZA 1P1HA 2GCNA 3NWBA 3Q7TA 1HPLA 4MI1A 4QUJA 4U2EA 3WL3A 9ATCA 5EGSA 2NZWA 2UYCA 2IXAA 2WRZA 1NW7A 1P7WA 2EIXA 1IVNA 2Y1EA 3BORA 1JIKA 3PXBA 3NYWA 4U7HA 2YZGA 4RDCA 4ITVA 4EELA 4I3FA 4DQUA 1J5XA 2AL7A 1UKCA 2XODA 3IAFA 4GOMD 1YAHA 2WG2A 1USWA 3P52A 4HRAA 4YO8A 3DD1A 4ZANA 3HLTA 5LQJA 2AI2A 2Q27A 4C6RA 1G6HA 2RI1A 3L7JA 4HLQB 3CF6R 4G0OA 4Q4HB 2R7AA 3T3IA 1L4MA 2VJLA 1MENA 4LYJA 5DP2A 2NQ2C 4OF4A 5IH7A 1V48A 3R5SA 5I48A 1O6GA 5B7QA 5HRCA 1NXXA 3D3WB 4EHLA 2ZJOA 4Y6SA 4ZT6A 3I9FA 3TE6A 1K3FA 1ZUD1 5BSFA 2W6CX 4QAQA 1IXRC 3LLSA 1ZC3A 3QSGA 4OXQA 1R5JA 4BXOB 1F60A 3TLGA 4O4LB 1E1CB 1W87A 1F6WA 1H8ED 1WW2A 1I6LA 4XVCA 5FX2A 5K2OA 1EA5A 1WNTA 4A1FA 2A1UA 2BUCA 3ZWOA 4BC0A 4UAVA 4ASUA 5L3SB 3FBGA 3CG4A 5HJ5A 4BO3A 1YL6A 3AI7A 1KZHA 3L1JA 4UNIA 4IWXA 3EQ8A 1LSUA 4RMHA 2IH2A 3G9ZA 2PV0A 2EP8A 3QLVA 1U8UA 4XX1A 4DCMA 3OPXA 1GZDA 4WN9B 2KYRA 2HK6A 4FJ2A 1Z12A 2XUDA 4FR5A 4XYMA 4XZ3A 1HDXA 3LYHA 4UHHA 5ELMA 3UUFA 2NZUG 3MK31 4DGQA 5KWJA 1Z45A 2Q9CA 3ACCA 3QMVA 4F4FA 2ZPAA 5GM1A 4YMTA 2QTRA 2QE6A 4QNRA 4FNAA 1G17A 1YS6A 2QZPA 1QYWA 2X8AA 3I0NA 6ABPA 2GSWA 1X7XB 4LYGA 1FTQA 1JNXX 3KXIA 4OHXA 4LQCA 5DYNA 2PZLA 4DZRA 5B3JC 3NVMB 1RKVA 3PI7A 5BYJA 3F3YA 4KQ6A 2ZZKA 2ZVPX 3AW9A 4IHJB 4RHUA 4X97A 5HGXA 4DLZA 3Q8MA 2PUJA 3V48A 4TT8A 3OMXA 4IFIA 2C8VA 4R1MA 1BKYA 2IVFA 4ZD6A 4I4IA 5E6UB 3FYSA 2GFQA 2J6BA 3O7MA 5EMJA 3RS2A 4AJ2A 4B6GA 3O75A 3R4VA 3P9XA 5M04A 2H1RA 4J0KA 4ZARA 4MI6A 5DM60 2EZ9A 1B76A 2OBFA 3SOZA 1IVSA 2ET6A 1PQPA 4CLRB 4RVFA 1SZDA 1M66A 3IKVA 3SFVA 1IUNA 4QO7A 1IEQA 2AW3A 4HQLA 1QIEA 1B3RA 4GMKA 2RHDA 1L5NA 3L0BA 1TZBA 3DTVB 3P8ZA 5KOJB 2YBEA 2JFVA 3HXKA 1BFDA 2OD2A 4J7UA 1C3OA 1EVEA 1UM8A 2GKOA 4C5AA 5FH9A 2OV2A 2CE2X 1OZHA 5ITZB 4P4LA 1N2HA 3RAGA 1ADBA 5LQNA 4RV9A 3P9QA 3UXMA 2AGVA 1WEHA 1IH8A 4EL5A 4DYDA 1K27A 2C4HA 2O8VA 5AO9A 1KEWA 3UMFA 1BHQ1 4RMJA 3MQ4A 4UM7A 3TDMA 2WNHA 4WT7A 5BOVA 4R1SA 1BA2A 3OBIA 2WOOA 4RY0A 1P2FA 2OKGA 3R75A 3SXJA 1AB5A 3VZDA 1KQGA 3FTQA 3UXHA 5D6NA 4F1JA 3WB1A 3H6GA 1J9GA 2GRJA 1E2MA 1ZM2A 2LD4A 3OF2A 4L3OA 1J0BA 3HY4A 4XVQA 5CX1A 1G5PA 1BX3A 3N8HA 2R2AA 3GO4A 5DYIA 3S1AB 4LXQA 3FZNA 1YO6A 2M6SA 3EFOA 4EJ2A 1PR9A 3LE8A 4FJ1A 5J4YA 4UHFA 1OJLA 4LMRA 1LI4A 1OROA 2IXGA 1PW5A 2XITA 3L6DA 1LGYA 4H16A 3O8NA 5T4EA 4JLBA 2VT3A 2QJOA 4YQEA 2GPAA 4JITA 2X0FA 2NZ8A 3IQXA 2ZB7A 3CJTA 3I2FA 5DM70 2AFHE 3S40A 3RYIA 5IVDA 3ZWCA 1CUEA 1TPZA 1CF2O 4B85A 5MN4A 2FEOA 4MW9A 1OV6A 4NZZA 2GWRA 1DC7A 3DVAB 4YLGA 3WK6A 2W6ID 4DUPA 2B3DA 2NX2A 4HADA 1W36D 2IYUA 3UK0A 5LYYA 1PJQA 3KOZA 3LA8A 4RS3A 3M8KA 5KC8A 1R8JA 1V6AA 2X0EA 3W7BA 2Z5VA 3QHAA 5EHQA 5BW5A 1VFNA 1ZN8A 1LWNA 4ZQBA 2AOUB 3RNLA 2AC2A 4WACA 4PYNA 3SBOA 3IEXA 3ESYA 2WK1A 2H5JA 3AR8A 4MA4A 2WABA 1W52X 4IS2A 2WY2D 3ZCUA 2ZT8A 5L3QB 2AQ8A 1D2EA 1XAHA 2NUPA 4X54A 5IHXA 2ZDHA 5JTTA 3KT3A 2EDAA 1LZKA 3KZKA 3LXMA 1FIUA 5I8ZA 2QT0A 2WTXA 3EQ7A 1H0KA 1JG4A 1AQLA 2ANBA 1DRKA 4FU0A 2D0OB 3LWNA 4J49A 1UQTA 2SNIE 3M83A 1GAJA 4JEIA 1BHSA 3D3EA 4LOLA 3C6ZA 2IEGA 2HCFA 3I4CA 5DI9A 5DLEA 3DHYA 5E2AA 3R6TA 4RZHA 3EIWA 3IEIA 3TJZA 5JATA 3CX3A 3RBXA 4TV8A 4EGQA 1C0LA 4QJBA 1AS0A 3KALA 2QN6A 4MGZR 2RAFA 2FVYA 3VYVA 1NL3A 5AVQA 1H2FA 4EF5A 4FFNA 1E8DA 2LDBA 2O0MA 1O95C 4K7JA 3U7QB 3OOHA 2GERA 5G0TA 1NSTA 4P82A 2IYPA 3RAEC 1U0NA 3MUFA 2BFBB 3A26A 5CT5A 3CLSD 2IZ0A 3SSOA 1KH1A 1FSZA 3GPLA 1NLUA 4EA9A 2DECA 2Z56A 3F7MA 2B8NA 3Q12A 4NCHA 4XB1A 1VMAA 3MCZA 4MMZB 4PHHA 2DWPA 1OUMA 2Q5LA 3JAKA 1PGJA 2Z09A 3RTDA 1JR3D 3GZ4A 5HQ3A 1H66A 4KXWA 2ECPA 4CT5A 1Z5GA 3TMAA 4CDGA 1B4DA 2VL7A 5KTOA 1CZLA 4F45A 3EIEA 1C9KA 2ODBA 2P3QA 1CZUA 1HRDA 2E4YA 4GNRA 3PWTA 4UZFA 3LUAA 2ZI7A 4LDNA 1Y6RA 4RZSA 2HCJB 1ZD3A 5FWDA 3NHWA 2FMTA 2FPXA 3COZA 4QXAA 1I80A 1TYEB 4BN4A 1IQRA 5AKLA 4BV3A 4Z86A 4B5LA 2NLOA 2V5VA 1UOEA 2YV1A 2I2WA 5CB0A 1MQ9A 1PT8A 4EPWA 4E3ZA 1NP3A 1SEPA 2PG3A 1ZLYA 3JSAA 5F5XA 3DC7A 4J6EA 4BNFA 5L4NA 1B2LA 1QG4A 1E9AA 2Z95A 5JLAA 4EKIA 1C4KA 2BVNA 3CH7A 2C20A 3H1PA 2HF9A 3EXEA 2WWVD 3RYCA 1TYCA 5HCIA 3BXEA 1E77A 1I9GA 3LBFA 4MEJA 3GRAA 1FMCA 1T3GA 1H6CA 3DDZX 3AWDA 4ZI5A 3H4TA 4RV5A 2UDPA 3OEED 4EO9A 1FX1A 2CEKA 5BRAA 2ZWAA 1L0BA 1TVKA 1XQ1A 1T43A 4G0QA 5I7FA 4HK4A 1J1IA 2Q29A 2YJZA 4DLWA 3HC7A 3L4BA 1GCOA 1W5FA 4JMLA 2WJAA 4X64B 4UHEA 3ILVA 1BE8A 3OE7A 1U8XX 2MR5A 4FGZA 3ZVKA 5E0OA 1WD5A 2ZATA 2WJ3A 4FKBA 5J47A 1G7CA 3OQIB 3OQPA 1KEVA 3I4LA 3OZTA 2UZAA 2VJNA 1P91A 3VPHA 3RK1A 4W99A 3PFIA 1O4VA 3QK7A 3VR4D 5AWFC 4EECA 2GEKA 3NGMA 2RKWA 4RD2A 3GOQA 1SNYA 2IDZA 2B21A 1XCGB 2VEDA 3PU6A 5ALZA 4D8VA 3IMGA 3VHQA 3IDQA 2H1IA 4HAOA 1YQTA 2Q1TA 1VLMA 1U7OA 3IXLA 1PR3A 2QNIA 2ONKA 4ED9A 5M29A 4HB4A 4CGZA 4LW8A 2YHBA 4P3NA 4NF2A 3LFUA 1DHRA 4K2AA 3JPWA 5DHRA 3V8QA 2R6ZA 2CXSA 3K7EA 2QIPA 3SIXA 1PWEA 3DAPA 3R3YA 4DIUA 1L4EA 3RIYA 5BWMA 2JPDA 4EAQA 1QTNA 3C6YA 1NX9A 2ZXFA 1WHTA 2W0SA 4DYVA 1O95A 2O8FA 5K7SA 1FRZA 3GRPA 4CLEA 2JW5A 2FX3A 2JJ1A 5IANA 4DCOA 1X19A 5T5QA 4EY5A 5AIBA 1WZEA 1QFSA 2Z2XA 3LVQE 3OO0A 4M1MA 7AT1A 5IDYA 3GLFE 2QTFA 5FPYA 1M76A 4HQ0A 3QX8A 2JIRA 4DTIA 3LGXA 1OPRA 5L95A 1W4ZA 3LUKA 2PVCA 4EVRA 2FGKA 4YRAA 3CA8A 3RTBA 2YJ6A 2GZHA 3UNXA 4RHYA 4D3YA 4YCCA 3AETA 4P22A 2CKDA 4JJ7A 5JU6A 1XNQB 1ID8A 4BFYA 3HI6A 4CEHA 1DI0A 2GKSA 4Y9RA 1WXFA 4Z3KA 4CG3A 5BN4A 3P9PA 3LX6A 3PFGA 1VZ2A 4C6TB 5BNIA 4R8SA 1H69A 3F78A 2EFCB 4JLOA 1W19A 4KIFA 3VKWA 3GLHA 4FEYA 4CIVA 3IL2A 2H5LA 1OAKA 1BE0A 1MNQA 2ZRDA 1NUUA 4GECA 3H5NA 3G59A 5KVSA 3OF5A 3UWKA 4G4SO 1DQPA 1Q15A 2ZW9A 4PTZA 2I6QA 2MSNA 2WZCA 1KI9A 5EMNA 1PS8A 4B44A 4BUZA 1WWKA 4C3ZA 2H2WA 2IP1A 1WKBA 3AVTA 1PE0A 2P11A 3TEFA 4MI3A 4CGYA 2WILA 1KSJA 4BATA 2VG8A 3D7KA 3EISA 1SCUA 2UVPA 2XGGA 3K8OE 2KS6A 3RUPA 4ZJUA 4MYSA 1YQ9A 2ZAOA 3FSGD 4P84A 4KGZA 1HZJA 1C8VB 5AOCA 1P72A 3VO8A 4QQFA 1K08A 4IM7A 4RYLA 4UHBA 4A26A 4EJSA 1KJWA 1TCVA 2D00A 1DWQA 1PD0A 2CZQA 2PBZA 1HE4A 2HU8A 2Q07A 3FNRA 3NUGA 4FMDF 1K1EA 3IQZA 4L0MA 3I6MA 4ZZ3A 3ZY5A 3BWDD 1QDUA 1YNSA 2WHEA 3F9IA 1ACLA 4PYJA 2AG5A 4FFSA 1OI7A 1XEFA 3E3AA 1X0VA 2XOXA 4EHNA 3HY3A 3D7SA 5TEVA 2O3SA 1TECE 3HLKA 1GYQA 2H52A 2PGJA 1UMKA 3B1XA 2OBXA 1Y81A 4V0LA 4YAUA 3B5IA 3BFXA 1M0EA 1GP2A 4BNLA 3U4IA 1N0IA 1YB1A 1NBIA 1QVRA 2YIJA 1DL5A 2BGUA 4HQRA 1L5GB 3D59A 1BRMA 1XV5A 4N3BA 1REQA 1VA4A 3GRCA 4E6PA 4UMFA 5EMMA 3OTWA 5CNMA 2QT9A 3G9QA 1KO8A 2OXRA 5ALRA 3JYHA 3VR2D 1U8AA 3VQTA 1KO7A 3VU9B 2BDTA 3OVMA 5B3AA 1U28A 4NP6A 3KEGA 3IEMA 4GBMA 2C3PA 1QQ6A 2AOVA 2FN9A 4HF7A 4AP9A 1KTIA 4PTLA 2B1GA 2BTQB 2D5BA 3UPDA 1Q44A 4LWQA 4LHYA 1DPGA 3DYIA 4IIVA 4QO8A 2GNPA 2Q1SA 2H1WA 4R0NA 4XLLA 5G0WA 2AW5A 5GONF 2CXUA 3DE7X 5I9LA 1DKUA 1JX6A 4TYPA 2IWHA 1KO1A 3O0DA 5L40A 3WBKA 3IUBA 4R1UA 2RH8A 3UKDA 4JLDA 4DBLE 3MCUA 1YFZA 4CFSA 4ARAA 2Z0MA 5HPYB 1PR6A 3DV2A 2WE8A 3E8MA 3BDAA 3K0BA 5AVVA 5FLXA 2V1XA 1O96A 2FDRA 3DNMA 5AM5A 1GUZA 4ZC1A 4DANA 2ADMA 4TVKA 5C9ZA 3NBZC 3B1KA 1KI6B 1FXSA 1JSRA 2QR2A 3E9CA 3IMCA 4U9IS 2AD5A 3VPXA 5EWMB 4A27A 2ZVJA 5LD2C 2R6GA 1RM4A 2ZRIA 4CI0B 5BN5A 1E5TA 3VVLA 4QULA 1T4GA 4EFKA 1CQJB 1U2EA 4QOIA 4QM7A 5DNWA 5HKKA 3JQGA 3JQ8B 4QBKA 4LI0A 3H04A 4MWCA 2H3EA 4TTQA 5F73A 1TAHA 2VDPB 3UBMA 2ODTX 2XB6A 3AFNA 2FP4A 4LS3A 2VNJA 4JYPA 3K05A 4ENUA 1A7UA 3L0IB 2R97A 4EG5A 1LPSA 3LGSA 1PHRA 1WSDA 1EWTA 1WW3A 2QYTA 1SVOA 5BRNA 2ZB3A 4HY3A 2W2QA 4Y1RA 3BKWA 4HDNA 3L9XA 1ZONA 2X86A 1KJJA 3G9XA 2P0YA 1JKJB 2YRWA 3QFHA 3NANA 4JJIA 5ANRB 4QQRA 2GHQA 1W5TA 2IHYA 1S5PA 4G0NA 4MJXA 2ATVA 4URFA 3FMPB 3WLMA 1NW5A 3DWEX 1F2VA 2UYOA 3H9GA 3WO0A 2HT1A 1MEOA 3N2KA 1RQNA 2WU1A 5I9IA 4XB2A 2EARA 1U2GC 3BX1A 3L6RA 3PJDA 1WABA 5D5QA 2E85A 4RLSA 4BKOA 4FW8A 4NS1A 3ZD9A 2EFDB 3L92A 1LI5A 3K53A 4DA8A 3TL6A 1KS9A 2QJTA 2F1RA 5DCWA 1ZUNA 1J90A 2XTMA 4RSHA 2GASA 3RODA 3PFHA 3ZJVA 3OQ6A 2ZUTA 4ZT7A 5C5DA 2JHAA 1TX4B 4Y2SA 4OXNA 3REOA 3MSCA 2YZNA 3AOEC 3JD4A 4FFWA 3R7LA 5AP9A 3UG7A 3VR0A 2XMDA 4F5YA 5JNSA 1E3WB 4B2PA 3IVGA 5EINA 2FPPA 2ILTA 1C4WA 4E21A 1XD2A 1ZOOA 4ZO7A 3E22A 3R5FA 5SY6A 2ROQA 1N2XA 2AH5A 1JPNA 1PNRA 3HUTA 2GBLA 2ODPA 4KGVA 2L82A 5F2EA 2R3SA 2QVGA 3PCTA 4QBFA 1QH9A 1CU1A 2I6UA 1U0JA 2KHZA 3JYQA 1A9ZA 1UJMA 1DIBA 5JJ5A 3REQA 1ZD1A 3B6IA 4PXYA 2J0QA 3ANSA 1KVSA 4CM9D 4CMIA 3THWA 1UKYA 4QQNA 4EA6A 1MPTA 4RABA 1U2PA 3H86A 5IJ0A 5CJ2A 4U2FA 2A4KA 3W8NA 1QK3A 4X84A 1O7JA 1RCFA 2FX5A 2VHJA 4KAFA 1XZHA 4CMJA 1KTVA 1MAWA 1SUIA 2WNIA 4UJ3A 3WGVA 4CIBA 3U4GA 3AVWA 3GPCA 4BVGA 3TCKA 3A36A 1IN4A 3M6WA 2NNLD 3JQQA 2X6RA 4MVJE 5SY4A 1ILEA 1L5YA 2OV3A 2JFQA 3B1YA 1ZH2A 3GHHA 5KTMA 1MRZA 2G1KA 4I2VA 1G8JA 5FLKA 1VKRA 1P80A 3JVEA 3QOYA 4QU5A 2IU0A 3L8FA 4PNHA 5F4ZA 3TLZA 3M6VA 1OX4B 4GI5A 4LIPD 1ZK2A 1ZXBA 2MMGA 3VKFA 1JT2A 4M6WA 3ZOZA 4DABA 1ISHA 1TO2E 2EZ4A 2G4LA 2DY0A 3W0LB 4YRSA 1JN0A 1O6CA 2AF3C 4RHFA 1PN3A 3DXFA 4TV9F 5LXTF 3WL6A 3GRZA 3ZD7A 1C0KA 2F8LA 3T3DA 4GLJA 5A3QA 1B23P 1J1ZA 4DG5A 2OO7A 4ZVOA 1LTKA 2D0IA 3OH8A 3RC1A 1RHRA 3ICCA 3WSWA 2RHOA 3MCTA 1T9ZA 1I1HA 2O8DA 1OLXA 3PZRA 4KREA 4UEJA 5TQ2A 4X45A 5EHNA 2UU9B 3T9AA 1YR8A 4JI1B 1U8FO 2PANA 1YBMA 2IFTA 2R25B 4P7GA 4W63A 4MQ6A 3CRZA 4A0GA 1Z2EA 1WPRA 4BNDA 2F90A 1VJRA 1JE0A 3JD1A 2WA1A 3S2UA 3PNSA 1CUJA 2O4CA 3TTWA 1QU3A 2HU2A 2Q0XA 4MULA 4I5GA 4N3CA 4JI5B 3RS7A 2H1HA 4DLPA 3RVRA 2XEXA 1TM5E 2ZAGA 3KQLA 4GVPA 3PE4A 3IV9A 2JLUA 1SXPA 1T0BA 1WZNA 2M1XA 2XUJA 3T3MB 1E6EA 1C9JA 3KZOA 1GTZA 4E7PA 4G5GA 1UM9B 1NIPA 3CNEA 1AIPA 4NVRA 1XCLA 5AI6A 3RABA 3D8BA 2Z5GA 3LS2A 4GM0A 5CA1A 5J43A 3BOSA 3K2QA 4FGKA 4B0PA 4CKBA 5IS2A 4BFUA 4TZTA 1RZRD 4JU8A 1SVLA 2H1OA 1KFEB 2H92A 3WKBA 1EBUA 1P4JA 2DFKB 3CZRA 1DJLA 3ORQA 3TYXA 3PQFA 1XO1A 2XYHA 3JWPA 2I9PA 3ZNOA 1TC2A 3QIAA 2P9EA 4AMYA 1RAIA 2RG1A 3E2PA 5HDQA 3N0VA 2I4MA 3KQYA 3Q72A 4DFDA 2IOFK 2WAAA 2ZIGA 1PJSA 2B1JA 2QVYX 2HHAA 2ZROA 1ZGHA 5DN6A 2WSLA 5C8YA 4D46A 1FZTA 2QHXA 1UWLA 2QRVA 4HGYA 2CFCA 2RIPA 4ESOA 4QUIA 1M6EX 1OYOA 2OQRA 1IUOA 3TQFA 1YS4A 3WXBA 3GBSA 5ALLA 3CQ9A 4Z3DA 4Q93A 5BWLA 1GUDA 2RJNA 4LAFA 3C4JA 4OJKA 3IBTA 1CS0A 4MXDA 1QDLB 5BO5A 2KB0A 4IGFA 2JEYA 4MDYA 3WV5A 3ZZ1A 1ZMOA 5ALJA 4PLYA 4ALMA 1E32A 1GXSA 2IWRA 1RHJA 1LC0A 2OBYA 4NSNA 4JXXA 1RVDA 2B2NA 3PXDA 1IN6A 1PX2A 2Z1MA 3SSNA 3GLUA 4M0KA 3ZOKA 3J7AC 5CCEA 4MPRA 1UMCB 1YHNA 1KK1A 3SF8A 3O2NA 3OE1A 2X9VA 4LISA 1TUGA 2VC2B 4PYQA 2X5XA 3KJQA 3PQ7A 5KJFA 1BHO1 1HLGA 1WMEA 4FMDB 1QRDA 4X90A 1YZNA 2ZBFA 1R64A 1SELA 1XKTA 1ZL0A 1P2GA 4NAHA 4EYOA 3C14C 3H0CA 4WINA 4URHA 3WBBA 4JASB 3OETA 1J1UA 4A10A 1RC1A 1BAPA 4JDUA 1YR1A 1Y3HA 1F3LA 3N2ZB 4UAUA 1EFPA 1JG1A 2ORVA 3A04A 3AB8A 4G2NA 3GN2A 5FADA 4QVIA 4QZVA 4S04A 3ADDA 2ZYSA 2AN3A 3A37A 3MS4A 2HX1A 3TD6A 1HR0B 5K09A 3K3PA 4RCZA 1USUA 4UBLA 2C03A 3TM5A 1JKFA 2MYTA 4CU2A 4D0NA 4CKZA 5LQAA 1OX6A 2VUHB 2W6JA 2OSBA 3O93A 4MVJI 2QEQA 2VCYA 3FMOB 3FAKA 2PJZA 4R2KA 1SVIA 2OFPA 4DF3A 4JBXA 2IH4A 1DLIA 5ALDA 2QXYA 1IULA 5JZBA 1YK0A 2NSDA 2QVCA 3IUYA 3ND5A 4PZEA 1JAHA 3LQ4A 3ZU2A 8GPBA 2CNNA 2CCJA 4JLAA 4IXMA 1HETA 4ZYXA 4WOCA 3CNLA 3E61A 3NYIA 3MCWA 1THZA 3WJ7A 4PICA 5CEJA 1EDEA 2VNHA 3FGNA 3H16A 4TTAA 3L06A 4Q9KA 5HIAA 1E2DA 3WVNA 3FA2A 1GRVA 3QX7A 3PLAE 3N6XA 2IGBA 2XCUA 1POXA 3BDIA 2F64A 1HOXA 1STOA 3SQOA 1IMOA 1XN4A 3TIIA 3TN7A 1CZKA 2FSUA 3MELA 5GONB 1UP7A 3WS7A 3SHFA 5FUWA 1G1AA 2DU8A 2H06A 2QM8A 3I12A 3ZY4A 4D3XA 1HNNA 5CJJA 3PCRB 5HIIA 5IXSA 2LPMA 1C4XA 2BFFB 2QW0X 3L9WA 4M4SA 4TN1A 1BRTA 3ELDA 2XGJA 1VG0B 3EIFA 3PUXA 4NR0A 4IDGA 4BQQA 4TQUS 4COOA 2IIPA 4X60A 4ASUD 3K0EA 4KDRA 4L0DA 1WB6A 3K8QA 2ZSUA 4WCDA 1JAIA 4Z4QA 1GL9B 4XTCS 1AK9A 3L7AA 3P9YA 3UHFA 1FX0A 3BGWA 1N4DA 5KSOA 5ADVA 4BRZA 1UMDA 4YO7A 2PQ6A 4BX3A 1BVRA 3Q8XB 2P7IA 4X5OA 1CHDA 3EXHC 3ZZMA 1CUXA 2G04A 1IAVA 5COBA 4B45A 5BVGB 1Z56C 3M6AA 5JS8A 1C1YA 2XMGA 2WHXA 4YMSA 2ZYTX 3G7SA 3H19A 2MYPA 3MWEB 4IGKA 2VNIA 4L8GA 4UMVA 2RBEA 3WQRA 1ZI6A 3KKKA 1BIFA 1EJ6A 3MGBA 1Y1QA 2RC5A 1R6DA 1XTVA 2OTCA 3KQVA 3MGAA 4ER7A 4KV9A 1XFAA 4N3GA 2AG1A 3M1LA 2VHXA 3R7WB 3WWPA 5EQDA 2JI8A 1N9GA 3CLVA 4UD6A 2XVZA 3SEQA 2WQ6A 3EPPA 4DA9A 1UJ2A 2G06A 3N74A 4YACA 5ESRA 5IAKA 4B3HA 1K97A 2I2BA 3KTFA 3AL2A 3Q85A 2HR1A 2HK9A 3ODPA 4EPXA 5ETJA 3WLSA 1RYYA 3RO7A 5LDHA 2HBYA 5BNZA 1TQ2A 2QTTA 3C43A 4TLCA 2CL5A 4WDRA 5ALMA 3UB3A 4DJTA 2XCTB 2PSEA 4WKGA 3A2KA 2B5VA 4F5WA 4L9AA 4N0EA 1XOIA 3MWLA 2FG6C 4REQB 2IKQA 3QXSA 3UGQA 1P74A 2PH3A 1IN8A 5T67A 1JILA 5DHTA 2OXTA 4ZAFA 2WUEA 3OUUA 4OHOA 3SICE 5HJ7A 3CG0A 5HVNA 2PKCA 1DO0A 1K98A 2PCJA 1TMGE 4PC7A 3WV4A 4B31A 2R8YA 4D5EA 4MRVA 4OPMA 3IIKA 4PSCA 4Y8VA 4TUYF 5EGNA 1NATA 4M9ZA 2VH1A 4YJ3A 4AIRA 3PIIA 4D0GA 4DV3B 2JGIA 5EXEA 4BP3A 4BLRA 3WMEA 1HE1C 1NP6A 3U4QB 5JSKA 1FFSA 4ARSA 3FBTA 4E1BA 1JWBB 3FVQA 5HRUA 1URPA 3IQDB 4Q66C 1BWRA 2ZTVA 1PQ4A 1S3GA 1CB7A 1QBKC 2YX1A 3E9MA 1Z6ZA 1P3JA 4L2IA 4LA4A 5F33A 3VR4A 2YN4A 1TNDA 3BHMA 3SEZA 2R68A 2OHJA 3R1IA 2BZ0A 4ZV4A 4F1WA 1U80A 1UMBA 3JRNA 3R7FA 2I33A 3INNA 4FFMA 3H9JA 3PSAA 1GAEO 4R51A 3LCUA 2OB2A 3FF1A 2G1JA 4B33A 1DBPA 3AUAA 3HVJA 3T9FA 4NC9A 1GGHA 2CNBA 1U3CA 3H9CA 2WSIA 3M3HA 2R62A 3NT5A 3N70A 2AK2A 1II8A 3JX9A 4M89A 4KXMA 2IHTA 2EKQA 4PYLA 5AYVA 4LSWA 2R5NA 5I7RA 5JNRA 4XIFA 3DMHA 4IWNA 3G7NA 1XNGA 1QRAA 2I62A 3IQEA 3R0ZA 4YXWD 2V7GA 2FUEA 2XF2A 1USGA 2B1RA 4FT2A 1VE1A 2GLTA 4Z8YA 5EJ4A 5F52A 3EXHA 1DBIA 3G02A 4R98A 4TV9B 4Z1OA 4MWZA 5LXTB 1QWSA 3WR5A 2WB2A 3P9ZA 3WB2A 3OZGA 5LOVA 1DQZA 1Y6JA 3KUDA 3MWFA 4JLWA 4OYYA 1TU4A 3KBBA 5F1PA 3IMFA 3GG9A 3ZX4A 3STTA 3U61B 3HXPA 1ZD9A 1QRTA 5KJ1A 2O2YA 4W82A 3SQXA 1X8XA 2PGXA 3UCXA 2HY7A 3FH0A 3U80A 4PYRA 5D1HA 5FOTA 3WADA 1CFZA 3UMCA 3UB2A 3DP7A 1ZH4A 3PB3A 4MCJA 4AUKA 4BU0A 1DINA 1ENOA 1OFIA 3D1JA 4U9HS 1J0CA 2H85A 3I5UA 3KELA 2PGIA 2ZJ1A 4NENA 1KK0A 1EWKA 1OXMA 4EF6A 3ZCQA 5A1TA 2QM0A 4IDBA 4YCLA 5AKYA 1O8BA 4IYRA 5FJIA 4OK5A 1DNPA 4EEKA 4JQCA 1JLRA 1TL7C 3VMFA 4OHYA 1UODA 3EQZA 2GTHA 2O0JA 5BYBA 2X58A 4ES6A 5B6PA 2MSDB 5HS4A 3EZGA 3CH6A 2VXBA 5DW3A 2R66A 1BXGA 3K1AA 4XYGA 1X1SA 1TF2A 3AUTA 4X61A 4YK7A 1QHXA 3SFTA 2JI6A 2V03A 5IJXA 4ZVLA 5BVHA 4PWZA 1UXGA 2M98A 4UE3S 1AHNA 3KZVA 1L7QA 3BGOS 4G25A 3U62A 1I3MA 5LLSA 3S70A 1SHKA 4BQIA 4TL9A 3X1KA 4BN5A 4HXYA 1JFTA 3E1KA 3VISA 5JWHA 2RH5A 2CLFB 3IJ5A 3PQCA 2QX9A 5LQUA 3EWSA 4F85A 4NDAA 2Y3IA 1LV7A 4QRHA 3HI4A 1V5EA 4UNQA 2PR2A 3VH1A 3TKLA 1AURA 2HK7A 4H77A 4KE6A 4JI7B 2PSJA 2XNCA 3K0FA 4YP1A 3SS7X 1TI7A 3EA0A 4GPIB 4GPTA 4X7PA 1UKEA 3TQCA 3U1TA 1JZSA 3V4LA 3WOHA 3TECE 3AVYA 2FEMA 5CK4A 5K6AC 1U9ZA 2QVBA 2OYCA 2D4HA 1VIAA 4QYWA 2PS0A 3GP3A 2I6GA 2VDNB 4J0HA 4OB8A 2DGDA 1RHMA 3JZFA 4WJLA 1IOVA 4W5NA 4YTEA 1W4CA 4FWTA 4IZOA 2QRPA 3QXHA 4KNWA 4PZ0A 4XQ0A 4DPMA 3BREA 3U0BA 3LYAA 4WERA 2P7HA 2HNKA 3DE4X 2X3FA 3BGDA 3NBYC 3RVPA 2B7BA 2AX3A 4NCIA 2VPPA 4E94A 4ZCIA 1X1EA 4M1EA 4ZAWA 3S2IA 2IBMA 1UPUA 2PH7A 3I5AA 4UEKA 3SJBA 1QR2A 2BKEA 3U1VA 1Q0TA 3HS3A 2ZBUA 3BZWA 2RGDA 5B1SA 1XQVA 1Z4MA 1U4OA 3BEOA 1U7TA 1E9EA 2QLMA 2XZPA 4JY7A 4OFWA 2CCGA 4ABTA 3EF3A 1TM3E 2C2GA 3V3KA 4F2PA 1Z16A 1NMXA 3S2GA 4I3GA 1ZDMA 2PWZA 5GV7A 1BCRA 4BDTA 4E4TA 1A8UA 4GMGA 1Z22A 3ZCXA 2QPOA 1C7IA 4QXMA 1X8KA 3AIIA 3TKAA 1H0SA 2P0EA 4D0LB 2NXEA 1J33A 3ZK8A 3O94A 1Z7GA 2VYND 5LM3A 2QP9X 4IJ6A 1G63A 3KFXA 1LS1A 1WX1A 3D31A 5SZIA 1AH2A 5FA8A 5JXJA 3UMRA 2B4QA 1MZVA 1XLWA 1W1WA 5LZ7A 1Y9AA 1Z8NA 4G5HA 2YWBA 4OK6A 1QKIA 3K5IA 2FH5B 3C0KA 1M1YA 3M1IA 2ZRHA 4UMEA 1BVYF 4WBNF 1YUBA 1Z0UA 3R44A 3T5DA 3PUKA 1K6IA 1SB9A 3B9QA 4N18A 2OD7A 4ZT3A 4EUNA 3KR1A 3TSAA 3GFPA 3IHTA 1JIQA 1K7FB 4XSVA 2AHRA 4YRPA 2NTNA 3FN4A 4FDLA 4YP6A 3I45A 1N78A 4GEGA 4GLLA 5G3ZA 4AZVA 4P0PB 1OBFO 3IQIX 3EBPA 4RAQA 1M7GA 2O23A 3L07A 2RJOA 3E53A 1V26A 1CQIB 1QK5A 4JGGA 4MGYR 1V2HE 4YMIA 2VJYA 1NN3A 3KVOA 4J03A 2Q5QA 4RJJA 4F9TA 2YIMA 4WKCA 2GEDA 4LQ4A 4YJHB 5SYAA 1THGA 3LVRE 4N40A 3BXXA 4WJKB 1KI1A 1WUYA 3B78A 4V0QA 1DG9A 2WHPB 3UFBA 3F4KA 3ACDA 4EBBA 5L45A 3HBNA 5D3MA 3ISVA 1NDHA 1ADCA 2R8RA 3N87A 4IMPA 4OXIA 2WA2A 1LPMA 2W2PA 1J70A 3BKXA 2QT1A 4LJKA 3VXKA 5HZMA 2V9PA 3DMYA 3FCXA 2XCOA 4BE7B 5KSZA 4TL8A 4JX9A 3DTYA 1GNSA 1P31A 1ZH6A 2UZ1A 3QEMA 4MVWA 4KO8A 4NU6A 3MWJA 4Q7MB 3F5DA 3O6VA 5MDHA 2OXFA 1SQ6A 2F3RA 4NBTA 1QS0B 1CP3A 3EIOA 1YL7A 5A02A 4QOJA 2JGFA 3QYAA 2O3TA 4NV1A 4JI2B 1KEZA 3ROQA 3GWGA 2F1KA 3INYA 2H57A 3UOGA 5L8VA 2WJIA 4QC2A 4YRTA 1BZYA 4Q34A 5B53A 3VGPA 4CTNA 4D4HA 2C5AA 2JZOA 1N34B 2IHBA 4Q7EA 3UH0A 3ZE0B 2YOFA 2KPOA 2O0LA 4QD3A 1TGYA 5IAGA 2XLBA 1THTA 3L2OB 4AM8A 4F06A 3E5RA 4AN0A 1E7MA 4LTNA 3P9IA 3CIFA 1EIZA 3PL1A 4N5DA 3CT4A 4O33A 3GJXC 2KE5A 2VYQA 5BP7A 2OHVA 3TX2A 1ODIA 3B53X 1D6NA 2DQKA 1T8UA 4KO4S 4FKZA 4H7KA 1MO4A 4PG4A 1SCJA 3SKVA 5B7NA 1IU9A 2VXYA 1H2BA 3EDQA 4F9FA 4YV1A 2QVZX 1OA1A 4RJTA 1P19A 1XQXA 4RH3A 3D0KA 4M9QA 4AROA 1NG9A 3IELA 2A5DA 3MIIA 2CD9A 4JJKA 4LXXA 4PM4A 4UOQA 4TZKA 3U40A 5JQGF 2XMQA 2QUBA 1VKZA 1U0SY 2VN8A 3CLUD 2PYDA 2RK3A 4IHQA 4MQEB 1K63A 4ND3A 4QKQA 1N1MA 3Q6IA 2ODAA 3O2SB 4D4KA 1I01A 2E89A 1S9DA 1SXJA 2ACKA 3AILA 1XDSA 2BD0A 2I4TA 2RI6A 3D9QX 5AW1A 4M22A 3K73O 3KB6A 2H4HA 4TS3A 5I7WA 3ZVNA 3WIOA 2Q1UA 5DF1A 2BLNA 3OJWA 1L5KA 2XB4A 3ZH9B 1BYUA 2OD9A 4TUYB 4BE4A 3IE2A 4I4TF 2BFDA 3F7NA 5THQA 4JSTA 1IQPA 2RMKA 3FDIA 3IUJA 4BO8A 4BUCA 3EZNA 1B15A 3PICA 3L5OA 2V6MA 4OBBA 2XKKA 4HZUA 1PW7A 1WMSA 4KQKA 4R9UC 2OBBA 4RO0A 5EYPA 4BFTA 1VTKA 4P93A 5EJ7A 1NN1A 4HI0E 1Y1LA 1COWA 4M86A 4RUKA 1DAEA 3GL9A 5E1MA 2J85A 4XE5A 2VT6A 5CBPA 4XGQA 5AW9A 2YMPA 4CQMB 3P9NA 5BORA 3MA0A 1O5IA 3KOOA 1OIWA 3NI2A 5KYTA 1VLZA 4PHGA 2G1UA 2XYQA 1V25A 1RW4A 3EG9B 3MLAA 2GYUA 3VR6H 2DTXA 3W6NA 2FZKA 4YFYA 4DT1A 1FJHA 1RRKA 1YJ5A 5K0BA 1E9RA 2H4WA 4PTYA 2C1EA 1B8VA 1L7PA 1M5TA 2WHRA 3A4VA 4MICA 1KMQA 3K70C 2RBKA 3EZ2A 2H7VA 2MHCA 1GCAA 2VUSA 3JQ7A 1S7GA 3KJHA 3JQFC 1WBJB 3X1XA 1F0KA 3OTQA 1NR7A 4PBSA 1KH2A 3LYLA 2HA6A 3GGPA 4LC1A 3X3HA 5EZ6B 1JU9A 3MMSA 3LYUA 3VVMA 3T9CA 4M0UA 4RGYA 1F8GA 4GE3A 4N5IX 4DJDC 3BFKA 1JDJA 3HHEA 2YWDA 1T5TA 1J09A 1KIAA 3RUCA 3ZDRA 4URXR 3BF7A 4C4AA 4OQNA 2CUKA 4QTUB 4C88A 2Q7OE 1U5CA 2Q3CA 3AUJB 4XVRA 1Y8CA 1Y9DA 3R6LA 5C7IO 1D2CA 4H3SA 3SQWA 5K0ZA 4RF2A 3PRHA 5BPFA 1JU3A 1YI8A 3DBRB 2O1WA 1E9SA 4LJ9A 2G6TA 4YRFA 4PNZA 1CVRA 4RHCA 1EE2A 4CEJA 1OXTA 1D8TA 3A1TA 4NABA 2PGNA 4MROA 3AP2A 3ZK9A 1X3LA 4G0WA 1PVDA 5FWAA 1TM7E 3E9QA 4PXSA 3C85A 3IQHX 3BMQA 3DEFA 3SX0A 4G0XA 3SVTA 4LRXA 1W4BA 2Q5FA 2GHRA 2WAOA 2JBAA 4QGSA 5B7PA 3QVVA 3A6GA 2FOLA 4HQFA 5IU6A 1XPRA 1PJTA 2IYRA 2YWFA 4ZO9A 2G1PA 4KLZA 2Z6QA 4MQFB 2MOKA 3WL4A 4J76A 3V00A 2DUWA 4CQJA 2CHEA 3KHUA 3S3TA 3UJ9A 1IK6A 2G70A 3QE0A 3AEUA 4DSAA 1OWNA 4XDZA 4G5YA 1ISMA 4YAJA 1HFKA 2D13A 4EY4A 1FMTA 3V7NA 4RENA 2R1ZA 3K9NA 2EW8A 1Q2XA 3H7AA 1CUZA 1AMOA 4FGLA 1NSYA 4C2UA 3JQ9A 4MIEA 4B3DA 1MB9A 2ASVA 1XI2A 2Y1FA 1K88A 5BW8A 4O0MA 4OXXA 5B4VA 4S0ZA 4KIUA 1EHYA 4CF7A 2X42A 1ODKA 2W90A 2YCBA 3UWMA 1X2BA 2FW9A 3N0XA 8ADHA 1K4MA 4LXTA 1XZEA 1B93A 1Z7YA 1Q19A 2VPQA 5H02A 1DAOA 1DOHA 2J6IA 4MDFA 2WV9A 2PRJA 3C6XA 2CYAA 2ZOSA 1NMZA 1MO3A 2ZT5A 4M21A 2JANA 2XMBA 3G1WA 4R2LA 4Q01A 2I03A 3GPDG 2XLCA 4JA0A 4IVRA 1FXWF 5CVJA 3V4OA 3IHKA 4LQDA 4F3NA 3AL0C 1H2RS 1WXXA 1Y37A 2NU6A 5SZKB 4Y6RA 2Y0BA 2FVXA 4Q1DA 1VPLA 2OFWA 2XUIA 3N2EA 5F77A 4BFVA 4DPLA 5HOEA 3EHEA 2AYYA 3FOZA 1A76A 2ZXEA 1AKWA 3QV1A 4XUCA 3KVNA 4XUGB 4AIIA 1RPAA 1JLLA 1E60A 3QVSA 3W1EA 1M74A 1UBMS 4IXWA 1JALA 1MG5A 4IH1A 1USIA 1J00A 2OBMA 5KYWB 1UT8A 3JWGA 4HPXB 3S4YA 1Q0PA 3JQFA 2A86A 1SKQA 2R11A 4KLAA 2CVZA 4W7HA 4PLHA 3WIUA 4YALA 2XYRA 4BECA 3SZOA 1Z47A 1TK3A 4L08A 3UAXA 4HOYA 1ULZA 3C5WP 5FULA 3E05A 1IUKA 1YQDA 2IZ1A 3OTIA 4R9RA 5FFMA 3DO6A 3T52A 2DVMA 2ZE7A 3WMXA 5JNLA 4NDNE 1T29A 3H2ZA 5CLHA 1LC3A 1YKSA 3OMWA 2JVJA 2RGEA 5CLFA 4LRTB 1KJZA 1SHLA 3BRQA 3N2IA 4LZWA 4O1IA 3EODA 5IT9A 2G72A 1JQBA 4J1QA 1RLTA 1EK2A 3CNBA 4I5DA 1EFLA 1G8MA 3HJTA 3P0IA 2Z6VA 3DFFA 4KRXA 3RNOA 1UAAA 3LKVA 4FYVA 2OLEA 3MLEA 3QE4A 1IRXA 3NYRA 4LKRA 3ZV6A 1GPUA 5AMXA 5C8XA 2CSXA 2PD6A 3QMWA 1F2TB 5CLIA 3PVZA 1YVUA 2AFRA 4J3NA 3V2GA 5A5EA 1PAUA 4WBNB 4HJRA 2H11A 3FPCA 3M3PA 3TD9A 1FJ2A 2DYKA 5FV7A 2PQMA 1HO3A 4K2HA 3JTEA 3HZOA 2O2CA 3SC3A 3UJNA 2YQZA 2OV6A 4OHCA 2NUTA 1LLFA 3SJCA 1EGMB 3GT0A 3O83A 1KMNA 1NBMA 1VM6A 4JL8A 3T7SA 4BP9A 4CCYA 5ALEA 5KOHB 5BV7A 3A58B 1GPAA 1KRHA 4Q19A 4JSYA 1K9VF 5BYAA 5MFZA 1LJ8A 1ORIA 3OWHA 2LNDA 2PZAA 4QDKA 5DBEX 2XBLA 1KXJA 3SAJA 1QGOA 1E69A 4L4XA 3ESBA 4QVGA 1L2TA 2OCPA 3X0DA 3HPRA 1XYVA 3ZGZA 5K0LA 1QJ4A 1JEEA 1DADA 2IHZA 4Q00A 1XHFA 3H2IA 5DE3A 3FRHA 3ZHQA 3PGJA 5EJ2A 4ZK2A 2Q3HA 2X9NA 4QYIB 4AUEA 4C0SA 2O3UA 4EZBA 3THXB 2BEVA 3QIVA 3A1DA 3RC8A 3C3WA 2VAMA 3PHCA 1QGYA 1EX1A 2W2LA 5K1ZA 1YVPA 4YJFB 2SBTA 2EBUA 2OESA 4OQXA 5ILOA 5PNTA 3AW8A 3U56A 4O3FA 2CF6A 4PRZA 5EPOA 1XMOB 1ZCJA 2ZIFA 1T13A 3D6TB 3ETLA 3ND8A 4RPHA 4Y2QA 4Y98A 1T34A 4OQZA 4UU8A 5KVQA 4AKEA 1GZSA 5A9SA 4PG7A 3DYBA 1F4PA 2HCRA 3RRZA 1W85B 2Z3WA 1M2WA 1CY1A 5CEEA 1YRLA 5JARA 4F3TA 2AEMA 4WXHA 4OL9A 1KDPA 1S3FA 1F6DA 1XD8A 1SBQA 3D43A 1RLOA 2GSDA 2YHUA 3O8QA 3F9RA 1Y82A 3KLNA 2WKQA 3G6WA 1WM1A 3PUYA 7REQA 2FFQA 1ZKDA 1FFEA 3WGNA 2REBA 3DLHA 1SUBA 1FL9A 1L4YA 2PD3A 3HO6A 3ZXUB 3DVLA 2QNRA 3DMFA 1C3XA 5HJ2A 3CLHA 2MU1A 2P6PA 2Z4RA 4R1LA 4R3NA 2GBGA 3NBUA 1QGZA 3RVQA 4C0KA 1RWQA 1XDDA 2B36A 1EM8B 1RKXA 2ZRCA 3GJ0A 3HABA 4I8IA 5TMDA 3GARA 2NYVA 2QE7A 3L1UA 1F3OA 5C5EA 2O59A 3PE6A 1KDOA 1JEQA 2Y9MB 2B78A 1LRJA 4JK3A 4RIEA 3ZK7A 3CF0A 1TYDE 1IMJA 4BJ3A 1K6JA 1VYUA 3NV7A 3QFCA 1CSEE 2FQYA 4XR9A 1TUBB 3VR3D 1DQRA 1GADO 4C4TA 4C20A 4X8OA 2LVBA 5KYYB 3EEOA 1A04A 4P7BA 3K9FC 2Q1YA 2YXPX 5JQGB 1Y7HA 2OQIA 1R0LA 2P4HX 2C5SA 3S44A 2YWGA 5KX5A 3AR5A 2NOAA 4IIJF 2YRFA 5HJEA 2YBDA 1NXSA 3NDBB 2FZ5A 4O02B 4ZIRA 1BVHA 3BJEA 2A6PA 1WB5A 5FTMA 2ZRLA 3DJFA 4XWOA 1P7CA 4O2LA 2NYAA 2PUGA 1X15A 2QZ4A 3NH6A 1EE9A 1CPYA 1RACA 1UBRS 1MG0A 1DVRA 4I4TB 4IV5A 1SHUX 1Z2DA 4O4JA 1YRHA 2OLJA 1JSLA 1QGDA 3AY7A 5H80A 4Q7QA 8AT1A 3IJPA 2IIQA 1VKHA 3I76A 4NCBA 3E58A 4DZZA 4OV6B 1CNFA 4U2DA 5J4VA 5LMNB 1KDYA 5AM0A 1W59A 1JEDA 3A3YA 1T4CA 5FUYA 1QC5B 4LVNA 2PH1A 4MSUA 1Y1PA 1Q1NA 1RNLA 3ORSA 1NP7A 1BC5A 1E9BA 3MM4A 5E1OA 4OIMA 3MTDA 1PBTA 4Z1MA 3R7AA 3VRHA 4IV8A 1C1XA 4A36A 4X9XA 4AW9A 4MIKA 1IB0A 2O7NA 1VECA 3ETHA 1JVBA 3ORRA 4GE0A 3TIXB 4UPEA 4BVJA 5KKCA 2PH5A 4FMPA 5AR1A 1H2YA 4MPJA 3HJNA 5CT4A 1UR5A 2ZRPA 4MS1A 4ZVSA 1RQ7A 2GPTA 1O89A 4OI2A 5CAEA 4N0PA 3P27A 1WP9A 3GGJA 2IODA 4ODIA 5ALFA 3KE9A 1GRCA 3VYRB 1Z0AA 2PX0A 1KHHA 4MPDA 2HHCA 2JG3A 2M32A 3I1IA 4I1RA 3A31A 1CV2A 3HJGA 1LW6E 3LXUX 1VBFA 3DXZA 4DUGA 4L22A 10MHA 1XL1A 2DY1A 1CUVA 4CE6A 1E1RD 2VRCA 1DCKA 1P1BA 1PZXA 4G5RA 3TFWA 1ST2A 1HDCA 3TRIA 4DG9A 2OB1A 2X0KA 2WAXA 2Z3ZA 5BN3A 4GVLA 1NVBA 3TXAA 3ZLTA 3X1ZA 1RJFA 4CFYA 3GLSA 3Q5EA 4LXGA 4IGAA 2VF5X 3ZU3A 3RKRA 4H0NA 3BWCA 4M3NA 4XKJA 2AR0A 2DR3A 3UKOA 2BE7A 2Q9UA 2BHNA 3CW2A 5IF3A 5I7SA 4DPKA 2OUIA 4OA8A 1GILA 2NT3A 4BLSA 4D80A 2B8TA 4NE2A 1MR3F 1G1MA 4WNAA 2DETA 4PZAA 3F6EX 4F4DA 5KNCH 1Z0IA 5KHAA 4YMHA 2CL6X 1VE6A 5CB4A 2BMAA 2SCUA 1DRUA 4YA6A 1EWRA 3DAOA 3HFRA 4FDMA 4XLTA 2Y68A 2C98A 1V5WA 4AN4A 5JPIA 3DMDA 4UFNA 2COUA 2KQUA 1U1EA 3LCVB 3UM9A 1GV1A 2H18A 4FXPA 3ANXA 2XAAA 4GMXA 5ALIA 1QYRA 1JDUA 1UC5B 5KWEA 2JIPA 1T0IA 1TVCA 3ABSB 1UT6A 1CY0A 4TRJA 4X1IA 4XIYA 1QIMA 3BICA 4RXUA 3PTZA 4MR8A 5KKAA 2CXQA 3PJEA 5AXBA 5AI9A 4KAAA 4QTTB 3AR2A 4TKZA 1XDWA 1N0WA 3DVQX 3C3DA 3HBLA 3MT8A 1I14A 2HADA 5EJIA 2P5TB 4DC1A 3GN1A 3JQRA 2OWDA 1XAJA 1YS1X 3CSSA 1PSZA 3H6KA 5AJWA 3AUKA 4QWMA 3T9EA 1N5KA 2JA1A 2GEJA 2ZYDA 4AZ0B 2ETXA 3G82C 2H0RA 4KKXB 1G6Q1 1HK7A 2GPSA 5EFOA 3AYXB 3AEQB 4U0JA 1O4WA 1WKVA 2C2BA 2DT8A 3KU4A 3AXSA 3LKZA 4ZVNA 4EEZA 4EMSA 2ZR7A