2OCGA

Crystal structure of human valacyclovir hydrolase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
254
structure length
254
Chain Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Valacyclovir hydrolase
total genus 93
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ocgA00
4PV7A 2VA9A 4DMCA 4A16A 1CUCA 3YASA 4LXHA 3FCXA 3I1YA 1VA4A 1K8QA 3LLCA 3OC0A 4DLNA 5AM2A 4KAJA 3FSGA 3CXUA 5ALKA 5AP9A 4CG1A 1NU8A 1XZEA 2WIGA 3G9XA 5AKIA 1EI9A 3RM3A 4Y2YA 5C7YA 2OAGA 4BC1A 5AK5A 4U2GA 1LZKA 2RHTA 4EBBA 3K6KA 1H2ZA 2BAGA 2O2HA 3ESAA 4RNCA 3PE6A 3D59A 1QZ3A 5AK3A 2ORYA 5FP0A 3IBTA 1EB9A 1JU4A 4Y2UA 4DIUA 2OCKA 3H1BA 1WOMA 3G0IA 4K5QA 4BZZA 1E8NA 4Y2VA 3FBWA 2RI6A 1XZLA 4EB0A 5T4HA 4HTAA 4UHEA 5AKHA 2DHCA 4BC0A 3KDAA 1UOPA 4UHDA 1XZBA 3S8YA 5ALLA 3O4JA 1A8SA 2VJBA 3CN7A 1R1DA 5K3CA 2JIDA 1GXSA 1VLQA 4IQ4A 2HA5A 5LZ7A 1PFQA 3MVEA 5HQ3B 4QA9A 3ZLTA 3PUHA 4X97A 1CUGA 2VF2A 4KE9A 4B0OA 4F21A 2B20A 1XZGA 1CV2A 3G0DA 4KE8A 1PV1A 2QJRA 1EA5A 2OGTA 2BGNA 3DEAA 2WHPB 4ZGBA 2HA0A 5HQ3A 3Q0TA 5LKAA 3IURA 2UZ0A 4OSEA 5T4FA 3DYVA 3VVLA 4IH9A 4LXGA 2JBWA 1EHYA 2HFJA 3AFIA 5A7HA 3QPDA 5CXXA 5AI6A 2Z3ZA 4J7AA 1ODSA 1ORVA 3C6XA 1AMNA 2ACKA 2RONA 1LNSA 5H3HA 3VISA 3C45A 5AKYA 4U2DA 5FDFA 5D3ZA 4B9AA 2QUBA 1XKTA 1O6GA 4Y9SA 1WB5A 4U2EA 5ALZA 2PSFA 4B81A 3M82A 3SX4A 2XUPA 4HXEB 3R3XA 5ALQA 5JAPA 4HZGA 2FJ0A 1QIIA 2QVBA 1AGYA 3I6MA 3G7NA 2QJWA 1HDEA 5JAUA 1FSSA 4EA6A 5ESRA 1R9MA 3L1IA 2YASA 2DSNA 1MX9A 1L7RA 3BXPA 3NUZA 4OCZA 4UHBA 1DT5A 4AZ0A 4FLFA 4P9NA 1XROA 2W6CX 2WTNA 2BUBA 3DL4A 2DCMA 1XZHA 5ALTA 5CT8A 1ZD3A 3WIBA 3FLAA 5AKZA 1DWQA 1QJ4A 4HXFB 3I6ZA 3WMRA 3ZI7A 3O4IA 4X90A 3V1NA 3B12A 3QMWA 2JF0A 5ALUA 5AKEA 1CUDA 3PF9A 2HL6A 3IULA 5AICA 4UUQA 3QMMA 5DLPA 1MO2A 1U65A 3EBLA 1P0QA 4DNOA 4UBKA 5K5EA 1J07A 4FTWA 5DJ5A 2IX9A 5JANA 2DHEA 3WKAA 4DMHA 1OILA 3GBSA 4C01A 3PFBA 2QZPA 2XLCA 2XQIA 2ES4A 1EX9A 5ALGA 1MTZA 3WL8A 3RK4A 1EB8A 1X2BA 1KEZA 3DKKA 1CRLA 3ESDA 4BDSA 1BCRA 4WY5A 4CI9A 3WZLA 5EIAA 4UFNA 1UK9A 3T4UA 3U0VA 3W2TA 3R0VA 4K2AA 1FFBA 1GKLA 5K3FB 4UBIA 5FPPA 1JMKC 1LPOA 2GBIA 3ZLUA 1GZ7A 1RYYA 2OPHA 4WFIA 4HXGA 2PSDA 2BUAA 1TQHA 3I1IA 5EHNA 4E46A 3F8SA 5K3EA 4KE6A 2Y2UA 2PSEA 3VVMA 3GZJA 4BAUA 2O7VA 4IH4A 1W75A 4AO8A 5DYTA 1ODCA 4UHFA 2PU5A 5AM5A 3EF3A 1ACJA 5A62A 2Z8XA 1DTEA 2XUQA 4G9EA 3W9BA 4UFPA 5JZ9A 4EUSA 3I6YA 3BWXA 5FKJA 1IZ7A 1SFRA 4MYSA 1EDBA 2PUJA 1CFJA 1K4YA 4M0EA 1JJBA 2AXEA 4LKOA 3I2FA 1Y7IA 4UHHA 2GBGA 3PFCA 4MJ3A 4J0KA 4D9JA 1UOOA 2XUIA 2WG2A 4XWGA 4J0GA 1ZOIA 5AM3A 1ETHA 1IZ8A 5BOVA 4FMPA 1W52X 4HRYA 3N2ZB 5E4JA 1R9NA 1W4LA 2I03A 3C8HA 4DNFA 5HF9A 5HFAA 1K5PA 5LZ2A 1CR6A 3LIIA 1R3DA 4QEKA 4U2CA 4B9EA 1MNAA 1XFDA 3QVMA 3HXKA 1P0MA 3ZV7A 1QO7A 1DINA 1WB6A 5FXMA 3WK7A 4X92A 4UBNA 2B9VA 5T4EA 3ZPXA 2XE4A 3WI7A 4X93A 1UXOA 2HU7A 3PDCA 3F67A 3WJ1A 2QXTA 3H17A 1YB6A 3WIOA 5AM0A 1YAJA 3C6ZA 2VEOA 4MQMA 5ALDA 1WM1A 4TGLA 2WJ3A 3V1KA 2CMFA 4YX9A 4ARBA 3WQHA 1GQRA 4WCVA 4Q3LA 5HK9A 5AOBA 3WA6A 2QT9A 3UUFA 4KE7A 5AI4A 4B0PA 5E2IA 5A2GA 1XZMA 1XZFA 2VSQA 5JADA 1VXOA 2XMSA 1XKLA 1VJ5A 2XMCA 4H35A 4NZZA 4GHWA 2H7CA 3JYHA 2EDAA 3D2CA 2WFLB 4MEAA 2WHPA 3WWCA 2XLBA 3V48A 3FWHA 2XUDA 4XIIA 4GEGA 4ARAA 4BAZA 4J0CA 4N8EA 3ZLVA 5DTJA 3JWEA 1FFAA 3B3QA 3EQ8A 4E15A 3WA7A 3VXKA 2D5LA 4DMFA 2CJPA 4AMZA 3AIOA 5IVDA 5AKJA 1QTRA 4UHCA 1CUXA 1QFMA 1HKHA 5JATA 4QDXA 4N5IX 4OU5A 2WUGA 4CFSA 3H2JA 2ROQA 4FHZA 2JGLA 2LIPA 4PQEA 4HS9A 1W76A 4C4XA 5DTIA 4BATA 2H7XA 3AZPA 4W1PA 3OM8A 1WHTA 4N8SA 4J3JA 5HF5A 4EY4A 4H7EA 1CUSA 3DKRA 4BVKA 4L72A 5E4YA 1GGVA 1ZD5A 3PICA 5D7BA 4G4IA 1QO9A 3K2IA 4ROTA 3B5EA 1THTA 1CLEA 1XQXA 2Z5GA 2B4KA 3HABA 3W9UA 1QIHA 3DL7A 2WM2A 2GYVA 3AIMA 4CIBA 1WB4A 5SYNA 3IUNA 5ALHA 3LCRA 3EQ9A 1Q84A 2PX6A 1T2NA 1JT2A 2G5TA 2WUFA 5C8VA 2WHRA 1MJ5A 2K2QB 4ZRDA 2HA3A 3AIKA 3WL6A 3STUA 5EHQA 3DJYA 5AO9A 4OU4A 3OURA 4G8DA 5JALA 2HU8A 1VZ3A 4QDOA 4Y7DA 3FNBA 1WPRA 5CT6A 5C81A 1Q0RA 4Y2RA 3MUOA 5K3FA 5JZSA 2X76A 1SCKA 2BFNA 5SYMA 2JGEA 1AKNA 1XZAA 3IB3A 1R50A 3HSSA 4B83A 2JGFA 5CH5A 4JEIA 2XQFA 3ANTA 1LPBB 1NU6A 4BTLA 3O9VA 3KOOA 1AQLA 2X5XA 2VATA 3TEJA 5JD6A 2EDCA 3ICVA 5BWCA 4EY5A 4YK7A 1ZI8A 4CCWA 4C88A 4NVRA 1ZICA 2R8BA 3WYNA 7YASA 2VJDA 3G9TA 1TCCA 3JW8A 4X91A 1DT3A 2PL5A 2WUEA 4FLEA 2ZYHA 4ZV9A 2HA7A 3HEAA 4U2FA 3DDUA 4AXBA 2HA2A 1XRQA 2JGIA 1JJIA 4DYHA 1LGYA 4W9RA 1FJ2A 1GPLA 1H2XA 4F60A 4HAIA 3A2NA 1ORWA 5EIHA 4B80A 4KJXA 5AI8A 5AJHA 2CUTA 1TIBA 5CRIA 1MAAA 5JAHA 3TJMA 5HKAA 3NOXA 5CURA 2QXUA 1AUOA 2C7BA 2BKLA 5CXUA 3ESCA 3FVTA 4OUKX 3A70A 3STWA 1C7JA 2GZRA 1S8OA 3O4HA 4KACA 2IITA 1F6WA 5ALEA 3F98A 3CN9A 3BF7A 3BIXA 5K3DA 3LS2A 4BE4A 4GECA 5D6OA 2VT7A 1LPPA 4E11A 2RAUA 1A8QA 4Y2JA 1J2EA 1W6RA 1HBJA 3EIOA 1W1IA 3WZMA 2O2GA 1HPLA 2J4FA 4Q34A 4MEBA 2J3DA 3WK4A 3G0GA 1DX6A 3STTA 3H2HA 2XMRA 5ALYA 2PM8A 2XUKA 4I4CA 2P8SA 3W05A 1PJAA 4CIAA 2WQZA 1MNQA 1U8EA 3FLBA 5DYWA 4Q05A 1J06A 1QIGA 5CTAA 5LZ8A 2E3JA 4BZWA 2WJ4A 2QOEA 1MAHA 1ZI9A 1AC5A 4LHEA 4X94A 1G66A 1ZIXA 3AILA 3F9CA 4O08A 3IA2A 3WLAA 5ALFA 4J0JA 1ISPA 4C6HA 4INZA 3GELA 2V96A 4M0FA 4X7BA 3D2AA 4YASA 2Z8ZA 1D07A 2WIDA 1HLGA 1AX9A 4XVCA 3WK5A 3D2BA 1H2YA 3E3AA 2G5PA 2WFLA 4RE6A 4LIPD 2FX5A 1DWOA 1P0PA 1HQDA 1BE0A 5IKXA 4GWLA 2V9ZA 3KXPA 1HL7A 4BB0A 2OGSA 4A5SA 4C87A 1JKMA 4Q3KA 2WIJA 1CIJA 1CUBA 3FLEA 1MU0A 1DQZA 4IO0A 2QKYA 2IIVA 1DU4A 4Y2TA 3KWFA 2GYWA 1QIEA 4PNZA 2BUCA 4QDUA 3D4LA 1YA4A 4KRYA 3QZUA 4DSZA 4BCBA 1XZKA 4RGYA 5J3JA 2WFMA 3KSRA 5LZ5A 1MN6A 1CVLA 3STVA 2QMQA 4ITVA 4G5XA 1TCAA 2ZJFA 1EVEA 5IVKA 4GI1A 2DFPA 2HA6A 4FFVA 5HF6A 3QITA 4C89A 3HZOA 1YSCA 1UKBA 1QONA 3H19A 4JYMA 5I9IA 2XUOA 2ZJ7A 2I78A 1YS2X 3MUNA 4W63A 2QR5A 3PI6A 1QGED 3Q8WA 4DTCA 2XUJA 4FFWA 3ICWA 3O0DA 4Q3OA 4TVKA 4OYLA 4J03A 4V2IA 4QDZA 3HRHA 4AO6A 4AMYA 4OB6A 1TCBA 4JUIA 2AJCA 3I2IA 3OG9A 2FJPA 1I6WA 1SCIA 5EHZA 3D5EA 2WIFA 3R3WA 4DSAA 1YS1X 1XLWA 1ZJ5A 3D3NA 2XUFA 3SC2A 1XQWA 4C4ZA 4FBLA 3PUIA 3KD2A 4EY8A 3G0BA 5AKXA 3AINA 1IMJA 2Y6UA 3OOSA 1EINA 1KU6A 4G8CA 3QYJA 1XZIA 2ZYSA 4X85A 4X3CA 1BCSA 5ALWA 2GBFA 2OAEA 4Q82A 4MWTA 3ESBA 4K6HA 2RGUA 4W1QA 3SWWA 1XZJA 3G02A 1SC9A 1TRHA 1CUHA 3F96A 4B82A 3VJMA 3BJMA 3QBJA 1CUYA 4F0JA 3H0CA 2WTMA 3HACA 3GROA 4Y2QA 1ZIYA 1J1IA 1VE7A 2D0DA 3WWDA 3DD5A 5KWJA 4UBOA 2WG1A 2QRUA 5AI5A 1ZD4A 1U2EA 4B85A 1CPYA 3H04A 3GFFA 3HJUA 4HVTA 3O4GA 1VZ2A 3NGMA 3H2GA 4DNQA 2W22A 5EFZA 3R40A 3KWJA 4P08A 3U1TA 2HU5A 1LLFA 2PPLA 4B6GA 2GZSA 5DYYA 1Z68A 4MXDA 1SCQA 1IUOA 2HADA 3ED1A 5AKLA 2Z3WA 5KREA 1UK8A 1XLUA 5KBYA 1LPSA 1E8MA 2NW6A 5ALIA 1P0IA 3VJLA 4MWSA 2XQJA 1LZLA 2QUAA 3R3VA 5AOAA 4I19A 2ZYIA 1E89A 4I3FA 3QMVA 1N5RA 3FYUA 3VJKA 4RE5A 2XUHA 5LLSA 2XQKA 2HFKA 1TAHA 1EDEA 1G4HA 1T4MA 3RLIA 1XZDA 5JAOA 1UZAA 5EIEA 3AJAA 3SK0A 2C0QA 2JEZA 1CUWA 3W04A 1LPMA 3DOIA 1BS9A 1XRPA 3STYA 4UBLA 3C70A 1QE3A 1EVQA 5C8XA 3C6YA 3C43A 1G42A 5JARA 1F0PA 4FBMA 2X8BA 5A6VA 4ZREA 3LIPA 5ALMA 4H7DA 3A2MA 1B41A 5AKGA 1FFDA 4KEAA 3D7RA 4Y2SA 4ZI5A 4YPVA 1GPKA 1Q83A 1RWQA 1CUFA 3C8DA 5A7GA 3N0TA 5IVIA 4UFOA 5AOCA 2JGKA 5FPQA 5IH7A 4IH1A 3IUJA 4H18A 4DMKA 2JGJA 5AHXA 1XQVA 2WJ6A 5BWBA 2O2IA 4OB8A 2WSLA 2AJ8A 3K9BA 4B84A 3FYTA 2Y2VA 3IIIA 3H1AA 1CUAA 3LP5A 1DX4A 4J0DA 3IDAA 3WKDA 4WDQA 1YR2A 4AB1A 1UKAA 5EGNA 5CBKA 4AO7A 4BRSA 1LBTA 4AX4A 2VT6A 5CH8A 4CG3A 5I8PA 5HF8A 2OGZA 4IHAA 3STXA 4ZXFA 4PW0A 3ZWQA 2RHWA 2CEKA 5IVHA 4L3WA 4FNMA 1JFRA 2XI4A 4S0XA 5KWIA 3FYUC 1UOQA 1Y7HA 5LP1A 2J4CA 4PO3X 3WK9A 3C6BA 3GUUA 2VAVA 4GDMA 4KR0A 2H7YA 3AUKA 3G8YA 4H7IA 1BN6A 3UUEA 1YCDA 1EK2A 1K6EA 2PSJA 2AJLI 2OG1A 2VTVA 2I3DA 2FUKA 4KAAA 1MX1A 4H7KA 3G0CA 3T52A 3V9AA 5HZGA 5E4TA 5LKRA 1K63A 2PVSA 1ZJ4A 1UKCA 1SOMA 5C8ZA 3F97A 3WKBA 5YASA 3C5VA 1CUZA 1Q0ZA 4NS4A 4WFJA 5AH0A 2XUGA 1ZD2P 1XZCA 5D3KA 1O6FA 2DQYA 3TRDA 1VOTA 5ALRA 1VA5A 4Y2XA 5EI5A 2WKWA 4QLAA 2OQVA 3O95A 5I7UA 1JJFA 1QTIA 3HLKA 1DQYA 3H2KA 1NX9A 1U4NA 2HRRA 3H18A 4FNGA 4EHBA 3D0KA 4ZV7A 5AIAA 2RIPA 4FDMA 4J0HA 2XUAA 3WYDA 2DR0A 4QLOA 4BRZA 3E0XA 1AZWA 2YXPX 2ONCA 3M81A 5CT4A 2BJHA 5A71A 1IVYA 5LYYA 3OPMA 3HI4A 5DNWA 2YYSA 3UMJA 5ALXA 4BVJA 2PKYX 4DNPA 2HIHA 1E3QA 2H1IA 1OXMA 1XRNA 2XMGA 5JASA 3I28A 1EK1A 1QIKA 2C58A 3ILSA 2VQ6A 4P92A 4OB7A 4BCDA 1FFEA 3FOBA 2C0PA 4L9AA 2HRQA 5FUMA 1MT3A 4GXNA 1IUNA 3R41A 2O7RA 1RP1A 3E4DA 4FLMA 1N8SA 5FRDA 1X70A 1ZGBA 1ODTC 4BAGA 4P93A 2HDWA 5ISMA 2G4LA 5HKBA 3TGLA 1CQZA 2OCGA 2WIKA 5JIBA 2AJDA 2XB6A 3WK8A 2GBCA 5CT5A 4GLBA 4UBMA 4EY6A 4X00A 2OQIA 2BGRA 2C5GA 3BDVA 1C4XA 1DWPA 2OCLA 1A88A 3DQZA 2Y6VA 1XRRA 2CZQA 1H23A 3V1LA 3DNMA 4BE9A 2QTBA 4PSUA 4EZIA 3WL5A 4BVLA 4C4YA 3WWOA 2HA4A 1VE6A 2ZYRA 3DOHA 1BU8A 1BN7A 4FWBA 1ZGCA 4OD0A 2WU3A 4UPDA 3BL8A 1LPAB 1UWCA 2ZSIA 1QIFA 1JMYA 4AQDA 3FAKA 3MGAA 1YAHA 5CH3A 4N5HX 3WWPA 4AN0A 4WDRA 1UFOA 2J3QA 1MX5A 3R3UA 1VKHA 3OTQA 1CUIA 5DNUA 5ALPA 4PSCA 3IUMA 1VXRA 2PSHA 2V98A 1QIMA 1JU3A 5AK4A 5HCUA 2BCEA 2R11A 3E1GA 1XLVA 1QFSA 3G9UA 3FSGD 3HYSA 4PSDA 4G4JA 4GBGA 1THGA 2HHAA 2XMQA 5T4BA 1L7QA 2WLSA 2Y1KA 4AZ3A 1WCYA 1BRTA 2C4HA 5ALVA 3IUQA 2G63A 2CKMA 5AI9A 3H2IA 2HM7A 2JEYA 4BP8A 4MQLA 2QS9A 4K6KA 3BF8A 4X6XA 1CEXA 2ECFA 4JH0A 1WPXA 3QM1A 2WFZA 1GQSA 3O9MA 4N8DA 4M0MA 4F5ZA 3PF8A 1OCEA 3BE8A 3FYUB 4MYDA 2VJCA 4BYMA 3GA7A 3WWEA 1LBSA 2V97A 1X2EA 4DGQA 3VKFA 1WHSA 2PBLA 2WU4A 3WKEA 2CBGA 3W06A 4L0CA 5EHXA 4DM7A 3DCNA 5A7FA 1YB7A 4HRXA 3VDXA 4JYPA 5K3BA 5JZBA 1BEEA 4QNNA 4WY8A 1R4ZA 2C5FA 3C87A 1H22A 4QZVA 4H7HA 5AM4A 4X95A 1CUVA 3A6ZA 1XQYA 2OLEA 1UK6A 1LPNA 3DS8A 2XMZA 3NWOA 1CUUA 5HFNA 1GT6A 1QIDA 3I2KA 2WG0A 1IUPA 2I3ZA 1CQWA 2ZSHA 2H9YA 2XMDA 5CW2A 2GYUA 1ACLA 4TPKA 4B7ZA 4WJLA 1MPXA 2OXEA 1EXWA 2WILA 1CUJA 1B6GA 1JI3A 4G9GA 5LZ9A 3X3HA 4X6UA 5AM1A 1EDDA 1YA8A 2XT0A 4OYYA 2XQGA 4G8BA 5JD5A 3P2MA 4A23A 4LXIA 4QWMA 3HC7A 1QOZA 4BCCA 3I2GA 5AK6A 1F8UA 1N5MA 5DNVA 4BBZA 2ZJ6A 4QWWA 1A7UA 4H77A 4BTVA 5LZ4A 1UK7A 4Q1VA 4X71A 2CB9A 4QE3A 1AURA 2PU7A 2XMBA 1USWA 1YASA 3G9ZA 1XRMA 4EY7A 3R3YA 2DQZA 1KU0A 5CMLA 1Y37A 4J0IA 2PUHA 3RKSA 3DLTA 2WHQA 1E8DA 4WFKA 4CG2A 4FKBA 4W1RA 4BDTA 3WL7A 4CCYA 4G4GA 3M3DA 1QIJA 5AKKA 4AN1A 4Y2PA 5FOQA 1E5TA 6YASA 4LYDA 3QPAA 5FLKA 4CCYB 1E66A 4KRXA 4U2BA 3BDIA 5DWDA 3C5WP 2DHDA 3I2HA 5ALJA 2YH2A 3BJRA 3QPCA 4G1FA 1BEZA 1TKRA 4ZWNA 1N1MA 4PF1A 1XRLA 3WK6A 2XDWA 1L7AA 3V1MA 4ETWA 4H0CA 4XX1A 1A8UA 1ZI6A 1H2WA 3R3ZA 2QM0A 5FV4A 3FCYA 2ZVDA 1CUEA 4UBJA 5JYCA 4KAFA 5K3AA 5AI0A 4FOLA 5JD4A 3CCBA 2EEPA 3I2JA 4Z49A 2VJAA 4RPCA 1BROA 1TK3A 2AJBA 2WUDA 4H7JA 3AZOA 5BV7A 2Q0XA 1EH5A 1R88A 3L1JA 3FVRA 4OPMA 3DYIA 5ALSA 5AIBA 1C7IA 4QDTA 5ALOA 5LIPA 4K6GA 4BP9A 4JNCA 5ALNA 3EQ7A 2ACEA 1G5FA 3M83A 3L1HA 4E14A 3IVMA 4XJVA 5HK8A 3A2LA 5F4ZA 1FFCA 1M33A 4W1SA 3BIWA 3QH4A 1GPNA 3AZQA 2VAXA 1UT6A 1F0NA 3ANSA 2OCIA 3WKCA 4LYEA 4KYVA 4X6YA 1GKKA 3CCCA 3S2ZA 5CT9A 3RARA 4NMWA 3WJ2A 2JGMA 2B61A 4GW3A 1QLWA 4H7FA
chains in the Genus database with same CATH superfamily
4PV7A 2CXRA 2GPSA 2HK8A 4M46A 4TZKA 5DMHA 5FTMA 3A11A 2VA9A 4J94A 2I3AA 4MJLA 3X2EA 4RTMA 1MH1A 1I1HA 3WLQA 5IYZB 2BMVA 3FTNA 3VTKA 3NT5A 2QUIA 3FCXA 5TIIA 5ELXA 1RM0A 2FPKA 2B92A 3KTAB 3Q7PA 4TXMA 3WGUA 4BXOA 1IOZA 2PGJA 3FTDA 1YJCA 4GZMA 4DLNA 5AM2A 4KAJA 5HUHA 3ADOA 3LL7A 1QZUA 3NHLA 3T3GA 3ES9A 2JRLA 3FWNA 1AKEA 1XJ0A 3NHMA 4J7XA 4U7JA 5C1BA 2AXQA 3U3ZA 4BLPA 5FX2A 4CG1A 4NEQA 5EXTA 1G8HA 4IUYA 4UJ5A 1NUHA 4PIMA 3EB9A 1G8MA 2VWPA 1WDKA 3IALA 3L2OB 3AGPA 5AKIA 2VPQA 3NAMA 3V8MA 2Z9DA 2Q2QA 5KNBH 4D3FA 2I6TA 3ZHOA 1J09A 1EI9A 3WLNA 3FFXA 2VT2A 4HWRA 1GPBA 1TC1A 1LI7A 4LDPA 3RM3A 4NCKA 3DOOA 3TO5A 3ZWBA 3CZ9A 4EB8A 1IB0A 1YIAA 1C1DA 4DJDC 2C57A 2B8EA 2D1SA 5FUQA 1VLLA 3K0AA 1IQUA 2IY7A 2W6JA 3FROA 3FUTA 3K6KA 4UZFA 3UQYS 1H2ZA 3MERA 4IJ6A 2ZYUX 3K0HA 3QHPA 3EDMA 5F3DA 4OI1A 5DGDA 3F47A 2O2HA 3ESAA 5DVZA 2EZTA 5E95A 3WHKA 5EQTA 3PE6A 4CJXA 3D59A 4CW7A 3PPWA 1X42A 4MPDA 4AAYA 3U4QB 2ZRGA 2QTNA 3DBIA 1FMTA 7MHTA 2FWNA 4YRRA 2JFFA 3FPAA 2FFQA 5J9FA 4E21A 5CDHA 3TLGB 2BJVA 1LKZA 2PBFA 3UAXA 1WBBA 2OORA 4OFBA 4M36A 1QYDA 1RFLA 1ULBA 3FI9A 4NFSA 3T0IA 5KHLB 1EB9A 1KVRA 4MV3A 4Y2UA 1HTTA 1H4VB 2OCKA 3U39A 2Q2NA 2DWQA 1LDNA 1F9EA 1OAKA 4QOHA 1NW9B 3UPDA 2A86A 3C1UA 5IASA 1XNRB 1GILA 2XQVA 4NICA 4J6FA 4Y2VA 3AETA 3PCXA 1JZTA 5BR8B 2AEFA 4IIJF 1JIVA 1RE0A 4UMEA 2AR9A 4EHDA 1SCDA 1SCUA 3ZLBA 3CVXA 2IL1A 2BMDA 4BUJA 1E69A 1JPNA 4EJFA 1WBDA 2PUFA 3CF6R 3RIMA 3W7AA 3K9FC 4OXRA 4LBYA 4UHEA 4EPRA 2A6PA 1HZZC 3A0RB 3KL4A 1DG9A 1TRKA 2GPAA 4DEVA 3ZNOA 3GUCA 5SY4A 4QPZA 1T4CB 3FLMA 1A8SA 2B98A 2G07A 2VJPA 1L5YA 1XJCA 1USKA 2UZ1A 2QR3A 1NUQA 2F1IA 1QE5A 1VIVA 1YRQA 1U3UA 4YAGA 5BV2P 1GXSA 1J2TA 1VLQA 4GGMX 4IQ4A 4RHXA 1DDIA 2ZM5A 1FNBA 1K8RA 2ZUFA 5ELLA 5AYVA 3TK1A 5J2UF 4GI3A 1COWD 3U3JA 5H16A 5LZ7A 1B76A 5EHIA 4GL4A 5IAAA 1HR0B 5JS8A 2XZLA 4TMFA 3EYAA 2DJIA 4QA9A 2C7OA 1QANA 2W2OA 4KYUA 3IOMA 2CHFA 1VRCA 3FYHA 4RD2A 4X97A 1QHIA 5LLDA 1JG6A 1Z26A 2PGAA 4HEA6 4N40A 3TR5A 5AESA 1ZESA 1DJQA 2O8NA 1XDDA 3GLQA 4DA0A 3SYMA 3RHZA 3ZS9A 1JA0A 5E1OA 4B7XA 1CV2A 3K5HA 1IBMB 5AXBA 4HUQA 4KE8A 4PFQA 2VI5A 4B4UA 2WD7A 2FZ4A 1Q0HA 2ODQA 3NEAA 2WHPB 1B3RA 3GJ0A 2HA0A 3NG1A 2YWFA 4K40A 2O3RA 4LJSA 4TX1A 3LT5A 1OWPA 5LKAA 1Q50A 3R0JA 3SZ3A 1PZHA 3L43A 4BO6A 5LJLA 1UWVA 2TMGA 3PDWA 4I50B 5TPZA 1U7TA 1WXGA 2I7CA 4HAZA 3CPSA 4OSEA 2CC2A 4RMNA 4RVSA 1RPTA 4DUZB 3C3KA 1OX6A 1MIOA 3KYCB 4IH9A 3DGEC 2GEDA 2WZCA 4N3NA 3IEMA 3F7MA 4FS8A 5IJ9B 3RFTA 2HFJA 1DAOA 1X92A 2OP1A 2XXBA 5FF9A 1QG0A 1PLKA 1EDOA 3BH0A 4MVJF 4CUKA 1ZM9A 1HE3A 3IAUA 2C5AA 1XMXA 4DQ0A 3DLPX 3GT3A 1SBYA 2IFTA 3JQRA 3KR2A 1SKYB 3O92A 2Z3ZA 5IJ0A 5LNK6 1ODSA 1PGNA 4RTQA 1T8YA 4MCAA 5C53B 5ICFA 2APJA 1R9GA 3HGTA 2HB6A 2YJZA 3I5UA 3TZQA 2VYNA 4DZTA 1LNSA 3F4BA 3C45A 1N4DA 4N6OA 1T6ZA 3DTVA 1L4HA 1RYMA 4MI6A 1EWTA 1RW4A 1RLMA 3KYJB 2ZRIA 4KXXA 4P86A 1W5SA 4LRYA 5JYEA 4I50F 1U2QA 1MQAA 3I83A 5D3ZA 2ZT6A 3K6SA 1I51A 3ON5A 4AZWA 4QUHA 1DOHA 1AKYA 4GP7A 4JR0A 3W5HA 1XKTA 1EWVA 3JD3A 4WZAA 4Y9SA 2OYCA 5BNTA 1JEOA 2EWMA 4U2EA 5DGHA 1XTIA 1DOAA 2UYHA 1EWRA 1Q44A 2YN2A 3M82A 3OOJA 2O2YA 4LTDA 3SX4A 3WDSA 2XUPA 1BQ4A 1LU9A 1S3IA 4KRGA 3UATA 4EEZA 4UULA 3SC2B 3BGSA 5IX8A 1TAGA 3BHNA 5D87A 2AOUB 3P2JA 2GJSA 4HEQA 1SCJA 2YWJA 4DJTA 2FJ0A 2QVBA 4OHWA 1C8BA 3F3KA 1O89A 1U7XA 1KL7A 3TM5A 3NOVA 2FMTA 3FRIA 4RM3A 3CH7A 4LRTB 4QOIA 1WHTB 4QGSA 3EOBI 3WNBA 1Q0PA 2ONZA 1JAZA 1M2HA 1NOIA 4RNDB 3HJBA 3W8NA 1XMJA 1VCNA 4HPJB 3DQQA 1D2GA 1JFLA 3AOEC 4FFDA 1IN8A 1DAFA 3GPLA 2W6ID 3OIDA 3L1IA 5AVOA 1SWWA 1ESMA 3GLHA 1Q7BA 5JCOC 2FKAA 3C97A 3OOEA 4OCZA 4Z53A 4UHBA 3M1LA 4BX0A 1WW8A 4FLFA 4P9NA 1JHPA 1KHTA 1L5FA 1MFPA 1NXWA 3R5TA 4JENA 4NBRA 4BVEA 3X1XA 2Q3JA 2HTEA 2VLBA 2XYHA 3DL4A 1NVTA 3SGLA 3D3EA 1KSFX 2FVXA 2D13A 3B82A 3QE0A 3VNAA 1ZD3A 4GQAA 3AKZA 1TYCA 1U28C 2W4IA 1DL5A 3JRWA 3MILA 4CTNA 3FLAA 1NQTA 3LOPA 3MF4A 4BGUA 3L8GA 2A9JA 3AEUB 3CSDA 1ZYUA 3H3FA 3P5BA 4GYYA 4EQ6A 3WMRA 4D98A 1VHLA 2IOFK 4HFNA 1KH3A 1XVTA 4YYEA 2MMCA 2Z6AA 3NONA 4RFSA 3W2GA 1T6BY 3DLIA 3RVSA 2QAGC 4ZVVA 5CYFA 2YUIA 1A2OA 4QODA 3L46A 3V80A 4KO2S 4BFVA 2BFOA 3UMCA 2RCNA 1KZ4A 2ET6A 1XAIA 4FYVA 1QC5B 2BFAA 3EZFA 4BFTA 3RI3A 3QVXA 1O7JA 4OHUA 4DSTA 5T3UA 3BIOA 2IHKA 4LVNA 1N36B 2EARA 3U7JA 1T34A 1IXRC 3HE3A 1L4YA 2F1OA 4Z9XA 4OQQA 3T12A 3UUGA 2RGAA 1C9KA 1U65A 4M0PA 3B2QA 1UPXA 1H66A 1PS8A 2P6MA 3EBLA 5JVDB 4NOLA 4ZDJA 2GHQA 1UOEA 2QLFA 4AF6A 1XTSA 3ROZA 4FTWA 2Z8YM 1Y6FA 3FDFA 2IX9A 4XD7D 3SE7A 3IDFA 1D0VA 3KR9A 2OZEA 4QAQA 1HNWB 4TQ9A 1MLDA 5CG1A 4Y8VA 4Z3OA 1DQPA 1QZZA 2PZAA 3QF7A 3ZYZA 4CMKA 5JH7B 1K08A 5JCPA 3REQA 2XQIA 3VMFA 4QBKA 5HTKA 2GYYA 2PY6A 3D8TA 2WF7A 3QTTA 3GFVA 1JZQA 4RPJA 1ZSYA 1ZY2A 1X2BA 1WF3A 2CUKA 2UAGA 4BO4A 4DBZA 2ZJBA 3DKKA 2YS6A 4PZYA 5DP1A 5DHFA 1PR2A 4OHYA 1RRVA 2X2PA 4BDSA 1AKMA 4G0XA 1M7BA 1I7NA 4YT8A 2O8VA 2XDAA 4WY5A 3OKAA 3DE3X 4CNBA 4LSGA 2ZJOA 1TT7A 3LCCA 3V1UA 3W2TA 4W5NA 4WZBA 4ENRA 2VSXA 5LMNB 3E7WA 3HGQA 1GY8A 1VPDA 2NV0A 3FMFA 1KMHA 1JXOA 5GJBA 2P30A 4X3OA 5ITZA 1DCTA 1MIHA 3BQMB 4J16C 4KSBA 1LPOA 3FSEA 4GR9A 2OCDA 2CYCA 4FE4A 5F7XA 2IJGX 5EZYA 1ZU5A 3A6GA 2C31A 1KJQA 1GZ7A 3DDSA 3KAJA 1JA1A 3DZFA 3G49A 4G0YA 5DI3B 1YS4A 4C7VA 3ACCA 4NFHA 4W8HA 4EGQA 3H4VA 1Q2UA 2PSDA 4WBNB 1N6KA 4EECA 5C7LO 5IFKA 2BUAA 3I76A 2Q5JA 1LNZA 3R6LA 5ECWA 1G55A 3K9HA 1ZK3A 4PAGA 5F1YA 4HH4A 4Y9UA 3TVDA 3QVLA 1V3VA 3M6FA 1UBLS 4MITA 4C14A 5EHNA 5KNBD 1N0UA 3T5BA 4KLNA 4QT0A 1HLDA 3ZD6A 3RTDA 1MENA 3LKBA 3VSBA 1XEWY 2I6UA 4MH0R 2C4TA 4WH0A 3RFVA 3H99A 1PLJA 3SF8A 3NFRA 2DFVA 3BTUA 4XR4A 4ZHSA 3HN6A 4NDAA 1N5KA 4KXVA 2GETA 3VI4B 2GF2A 3SEFA 2QTWB 2ZIVB 2CL0X 3AHGA 2IXDA 5EWJB 1T4GA 2O7VA 2P9CA 2Y99A 2HPZA 4FFPA 1L5KA 2BPOA 4HK4A 1G4AE 4IH4A 4RJIA 3SP1A 5LL6P 4ZU6X 4DWWA 5H70A 1QX3A 4PZAA 4Z0TA 5FWXA 5K45A 5DYTA 3KQVA 1IWBB 4ZVPA 4I8IA 1FP2A 4UHFA 4BJHB 2N0SA 3AEKA 3LHFA 4U7TB 4CN9A 3AHCA 1T8TA 2FPPB 3GEMA 1J0EA 1E2IA 3NWPA 4PZ0A 4AYXA 1M2EA 4PX9A 1ACJA 4O2RA 4BIIA 5BV1A 1E9VA 3WO1A 1TUIA 5FEUA 3KIPA 4Y9RA 1NYQA 3ADBA 2XUQA 4DRXB 1QQTA 4YEDA 2B37A 4LGYA 1F2TA 2W37A 4G9EA 1P81A 1SUDA 1ZMRA 2XH8A 4EGCB 3NR2A 4EUSA 1FEZA 3ADDA 4P4SA 4TSKA 1BJTA 4OJMX 1R0RE 3G2JA 2W2VA 3U5ZB 5KYYA 5ES3A 1CFJA 4JKIA 1K4YA 3AV0B 4ALIA 1H69A 2F43A 4JP8A 5H8WA 3EMVA 5DSXA 5KQSA 3I2FA 3WR5A 2AE2A 3W5BA 5KZMB 1DCKA 1NASA 5A4DA 4J0KA 2M1ZA 3UEOA 4M88A 2WG2A 3EVAA 2DFKB 2QEQA 2QV7A 1P1RA 4J0GA 3DYBA 2P4HX 4WKNA 1ETHA 1IZ8A 1P4SA 2EP8A 2VDJA 1P2GA 2PUWA 2ZI3A 3FCEA 3H84A 3OU7A 4ZD6A 1I2ZA 3W3ZB 4RH0A 5E4JA 2J9XB 1R9NA 5JJ5A 2GXQA 2QAGB 1W29A 3N07A 1YK0A 3C8HA 3WYBA 2WNSA 3CPEA 2O8BB 3JD1A 1R4NB 3M4ZA 4LOAA 3CLSC 4FFBA 1EWKA 3B20A 2XKAA 5GGYA 3IV6A 3R9IA 1CJTC 1S01A 3W6PA 5HFAA 3RTGA 2ZCUA 3FDIA 3KKQA 3ZWCA 5IFLA 1D2CA 3FZNA 5JYBA 3I1FA 4MVWA 4U7HA 5LZ2A 4YO7A 3INRA 2BEVA 5GOTA 1C3XA 2G6BA 2VHEA 2XTJA 1WP4A 1ZONA 2WAAA 3DWGA 2PN1A 4JEUA 3H3JA 4LZPA 3PCRB 4HWPA 4QEKA 1MPTA 4U2CA 4DABA 1J49A 2E4AA 2KM1A 3ZCUA 4XPIB 5LLTA 1VGVA 3HXKA 3O21A 3A9UA 4M9QA 2EHDA 1EP1B 1KYIA 1P0MA 3C5EA 2H4YA 4FHCA 4X62B 2W2QA 3A6DA 2WM8A 5BO5A 1DINA 2FEPA 1XI2A 1YDEA 2VP0A 2VPPA 1RJ9B 3O8DA 3SS8A 4ATNA 4F4UA 4PQRA 2B9VA 2QRPA 3W3AA 5IMSA 4OLJA 4KV7A 2NQTA 2FR0A 4MKFA 1XL1A 3ZPXA 3WYFA 1X1BA 4JSYA 3WI7A 4HX5A 1E1QA 2HU7A 5DZSA 2ZVJA 2P91A 4DLPA 5EXDA 3F67A 2GPJA 2P2GA 2E4VA 4Q47A 3G0OA 5EL0A 4LYYA 3WJ1A 1QCCA 3NKFA 2O2JA 4JOSA 1E1RA 1G6KA 2FSSA 2IUSA 4EX6A 5BN3B 1XPUA 4H1HA 3UG6A 4NBVA 4TT8A 5IDVA 2ID9A 4EJMA 5FBKA 4ANFA 1CJVC 1J99A 1VSUA 1YB6A 2W4MA 1T36A 2WWYA 5EOVA 5ICGA 1NGSA 3ADKA 3QVGA 5TNXA 1PG2A 1BKYA 3BHJA 5LR6A 5KYWB 3QOFA 1LTQA 2XTNA 5EQJB 1D5CA 1NLZA 2ATIA 2WJ3A 3LYUA 1C3EA 5BP7A 2W7TA 5LIRA 3PVCA 3MINB 4JHXA 1PL7A 1ZOOA 3KCNA 2FPLA 2PWYA 2D59A 3M6MD 4R7GA 5JNLA 4NYMQ 3K0AB 2NXWA 4G2TA 3VC3A 2AF4C 5CB4B 3IT0A 3WQHA 3FPLA 5JFGA 1SKUA 3RR2A 4FD2A 3J81k 1UT8A 2PEYA 4G25A 4P54A 3P94A 1VE5A 4O1MA 4UTZA 2QT9A 4CL8A 5C4IA 4KE7A 4RD3A 1EFVA 2C42A 4B0PA 1PLLA 1JX6A 3MWDB 1L5MA 3OC6A 1XZFA 4M2LA 1Y3FE 2BKAA 1C4KA 3M1AA 1NQVA 5IAOA 2YWDA 5BUCA 3R24A 5JADA 2WWGA 3PXDA 1U5BB 4LFAB 4KJZA 1VXOA 1BE6A 2X1VA 4URHA 4CTKA 3B2NA 2ZWAA 1IC6A 1QVAA 3PEEA 4NULA 5DDIP 4CEJA 3GCWA 1W0CA 5EPUA 5FBLB 3L4BC 3D1JA 1D4FA 3RJ5A 2JIZA 3BGIA 2QRJA 3UT0A 1FYWA 3Q41A 4BMZA 2Y1GA 4X20A 1YBMA 3DMYA 3EZNA 1VI6A 3D2CA 4MVJP 1K75A 4MEAA 5TXGA 5JC8A 4IDHA 1NRXA 5EJ7A 2W6JD 4GOXA 121PA 5TGDA 3QVWA 1QFJA 3FJYA 3KSZO 3S2YA 3RS5A 2AFRA 2MTBA 4HDSB 4ARAA 3AEXA 4EEXA 4E1VA 4E31A 3KM0A 4KQMA 1U0FA 3BICA 3ZEAA 1YE8A 3COZA 4MTCA 3DXYA 1G8AA 5EC8A 1XCBA 3GV0A 2JFPA 5I5EA 3JRNA 2EFJA 1M5RA 1R5JA 2DVMA 4ADSG 1AH2A 2BFBB 1UJ4A 1WUIS 2ZDGA 1P17A 4E1BA 5F5XA 1PQPA 5BUSA 2GR9A 4CZ2A 4GAEA 1UDCA 2CJPA 3OBIA 5DXAA 2IX3A 4KVFA 1GTSA 2P9HA 5F9HA 2HSGA 1A82A 4MWCA 3F4LA 2Z04A 5E3IA 1LNQA 3S8MA 4ZYUA 5AKJA 4F1WA 2FY8A 1DCFA 1V4VA 4UHCA 4DFDA 1CUXA 3IUBA 3SQXA 3PNKA 1KARA 1QFMA 3K2BA 3B9PA 1WPQA 2AOWA 3CHYA 1LRLA 1RZVA 5EXPA 1V8DA 3MM4A 1GZ6A 3FBGA 4C29A 3LTNC 1BDHA 4PICA 1RWKA 1OH5A 2HXGA 5DWQA 3INYA 3JWJA 3PK0A 2VHJA 3ZDQA 1N25A 2WUGA 3QV1A 5IH3A 1Y9EA 2CVPA 2JAHA 4AKIA 1T35A 1JBQA 2QGNA 4CFSA 1F6BA 2P6PA 4FZVA 3ZHYA 3GJ3A 2ZAYA 3QRWA 1MIOB 4V3BA 1C9JA 1DBSA 1VKJA 4CV2A 1TPZA 1THZA 1KYTA 1KIFA 5IJ9A 2IT1A 3RYIA 1W0JD 2O7SA 2Y3IA 2H1RA 1M75A 2XVAA 3PD7A 4WXRA 3RGGA 5JZVA 1MEJA 2FUNB 5IARA 4DBLC 3P4YA 1EUDB 1QGYA 3F5SA 4EGSA 2BRUC 3CX4A 1YOBA 3TJZA 9ATCA 2G83A 4XDHA 2J87A 1Z47A 4N9WA 3P0HA 3VFDA 4F9TA 2PX8A 3P4XA 3IEKA 3TTVA 4X1YA 2CNOA 5AMXA 4FOPA 4UDYX 4EY4A 4WZZA 2I80A 1W0KD 2R65A 3OBBA 3DBHB 4EO4A 3QKWA 2BN4A 1X8LA 2YIJA 1Z83A 2ZJ3A 3RS7A 1AU9A 4CV1A 4CDNA 1Q12A 4OATA 2NAFA 3HFGA 2J0VA 1JEQA 5D7BA 4WLEA 5F9FA 3QI7A 5DNEA 2R60A 4JYAB 4YQEA 2I7DA 1X9HA 3K2IA 4OH7A 1H4SA 2GA9A 3ZGOA 2AXNA 3RIHA 1SU4A 2QDXA 4P35A 4OV6B 2BKVA 2B4KA 3HABA 4TTIA 3V8RA 3VOTA 2WE8A 3W6NA 2A8YA 1BS1A 1CF9A 4K9OA 1UQUA 2IUYA 5J40A 4DIDA 2DH5A 2W2TA 2A0XA 1SKAA 2WM2A 2XDYA 3ESRA 1XHEA 1E1LA 1OIWA 3H5IA 1NKVA 1SXHA 1HT0A 3IAFA 1Y81A 1BRMA 2QI9C 5A4JA 3DBOB 2BM0A 1XB2A 1TZKA 4QKQA 4ZHQF 1I36A 1YACA 2FF5A 1G1AA 1G8SA 1WB4A 3N2LA 4MR7B 4QUIA 3ZY6A 4MV7A 3WLIA 4EUEA 1SM4A 2CHGA 4A9AA 1C14A 4GRAA 4JBNA 4R9SA 5KIAA 2FRDA 3PGVA 4MVJA 5EJAA 3L0CA 1JIJA 3D0QA 4RLHA 1V8PA 3E1KA 4CLOB 4JR2A 1H2HA 1U8CB 2G5TA 4FDTA 4C3UA 1RKUA 4WEQA 3N6VA 2WHRA 3P9QA 4QBGB 4UUOA 1Y3HA 1T5BA 1UFVA 3NHYA 5MHTA 1MJ5A 1TYBE 1KTVA 2K2QB 3GFRA 3R6GA 4IX9A 1ZUIA 4IGKA 3UTCA 4B3IA 4YY3B 1H6DA 2W2LA 4TKUB 1FRVA 5L3SB 3P45A 4ILKA 1E3EA 5SY6A 2NN3C 4ZQGA 4R2JA 3KEMA 3L6DA 4E2ZA 4BB9A 5EHQA 4IHQA 3EWAA 3OWXA 5I9BA 2VXBA 3WIDA 3H7AA 4KQWA 1JJVA 3UB3A 3IAS6 1GLVA 4QOGA 3OO1A 4BVBA 5TMEA 5KVVA 3E9EA 1MD9A 3N2GA 1JFTA 3OUUA 4D57A 4MP3A 3ZVRA 4KFTA 3FMOB 4REMA 1B74A 4KO4S 4FYKA 5DV9A 2FW8A 5KJ6A 1DDGA 4BN5A 1VZ3A 3ET4A 1XU7A 2PX3A 5TMDA 4HH1A 2DPGA 4UEKA 3RT7A 3TQIA 4QDOA 2D06A 1A4RA 2ZPUA 3M4JA 4KQIA 1N1GA 5JJKA 3CVWA 2J5QA 2FHSA 2JFBA 3CBGA 1GKUB 2O6LA 3M1YA 4EYSA 2FW0A 5CT6A 4UNPA 1GGFA 1UBTS 1EKXA 3HJCA 4UM8B 3OTIA 2VP4A 4NFLA 3T7KA 1MORA 3VV2A 4E2FA 1BDMA 1YRHA 1H94A 2NACA 2RI1A 2IPXA 1SMKA 4KWEA 5K3FA 2HWKA 1T26A 1FF9A 1JR2A 1YL5A 5DHQA 5FHRA 1G9SA 1C30B 3NM6B 2ASEA 3QLJA 3U56A 2J5RA 3CGWA 2BFDA 2AMYA 2QZZA 4DMMA 3V9PA 1XZAA 5CLLA 1K7EB 2I55A 3T5GA 3HSSA 3TXXA 3RAEC 4P0QB 1P44A 1EP3B 5CH5A 2GZHA 3M5CA 5FAXA 2GXUA 2XQFA 4HDNB 3AHHA 1LPBB 1M2WA 2A4KA 2CXUA 3IDZA 4BTLA 4C6TA 3S5JA 5ECYA 1G5RA 1SKBA 2BC9A 1TJYA 1VKZA 1RJFA 2J31A 4NESA 1L7EA 1QCZA 4I8DA 3TE7A 1KFCB 2HY7A 3E22A 1A5BB 1BC5A 2EDCA 4NARA 4XLZA 1UJ2A 2Q3BA 1UFRA 3KD3A 4WNAB 4XWYA 3W9YA 2NO6A 4BQEA 4EY5A 3ZV5A 5KWEA 5I7VA 3PDUA 4LBZA 2WA1A 3VZDA 1VYHA 1U04A 3CUUA 4TWIA 4BBPA 3BB3A 4ERNA 1BWQA 2JZNA 2ONKA 2V0NA 3O4FA 3LFHA 2QTCA 5LYJF 3AONB 4Y6OA 2WU0A 3G5AA 2GFIA 4KQ6A 1FMLA 1KMMA 1N0HA 1YJXA 4OJKA 4Q7KA 3ROKA 7YASA 1TCCA 4X91A 3JPWA 5KNLA 1DT3A 1XL0A 3SDSA 3ZGLA 1X7HA 3U31A 1AT1A 1JLSA 1J97A 1NWHA 4ZV9A 4AURA 3SXUA 4UUNA 2OM2A 2HH9A 3O2NA 4JA0A 2H31A 5E1DA 2B7CA 1KEKA 1DTSA 1JJIA 2WTBA 2JK0A 3MK31 5ANRB 4B4VA 1ZK2A 1DARA 1HTWA 3AU9A 3E8SA 4EKIA 5I9SA 2ZOSA 5BVGB 4E08A 1CQPA 1QQ5A 2WWIA 4IMPA 4QTUB 1FBNA 1AF7A 1R4AA 5FPSA 1IEXA 2CK3D 2Q5QA 4RZQA 2H2AA 1RYDA 4F60A 1R6BX 1WNFA 4AMGA 3I4FA 4RHYA 2XBMA 1XK6A 4BQPA 5EIHA 4B80A 1M0SA 1V39A 5L4LA 5AI8A 5CA0F 3THWA 3HFRA 4PCVA 1PO7A 2XZDA 1MC1A 1KJZA 5ECDA 4IJMA 2IXTA 3WE7A 1CEYA 1YCGA 4HR7A 2KX7A 2OO3A 2PWZA 3QU9A 4TWBA 3VPCA 1CY4A 1M1YB 1OKKD 2PV0A 1ES9A 2WTXA 4HLDA 4ZOEA 1ARZA 5DBHX 5A3JA 4QXPA 1AUOA 3GT0A 3SJZA 1B73A 1ZGGA 1BU5A 1E4OA 3LUGA 3QKSA 4FCVA 4OJYA 2DQSA 4M1KA 3UKDA 1WAMA 3WLPA 1BOFA 1LJ8A 3B60A 1V41E 3A9RA 4HPWA 1EVIA 3A4MA 4LMAA 2O2XA 1B14A 3PR3A 4MQUA 3GWGA 4O33A 4OUKX 4RDHA 3REOA 4DPKA 2H8GA 3UWOA 3AR3A 4G1CA 2VCYA 1Y4SA 4JMPA 1MJGM 2XGOA 4XCVA 8ADHA 1S8OA 1CX9B 3MJEA 8ABPA 4EO7A 4QOFA 3W78A 2WIAA 3FMVA 2IITA 4GKAA 4N4AA 3C7TA 4RPLA 5CVDA 3FFBA 3EHEA 3DMTA 3DMGA 2BW0A 3BF7A 3CN9A 3PVSA 3SX0A 3ZHBA 4YMTA 4FILA 2RG7A 3O1IC 3WLKX 3UB4A 4R81A 2A9QA 1T6YA 1UUFA 2L19A 3DTVD 1PUIA 2FF7A 3V2IA 3QQPA 4CUZA 1GM5A 2ID8A 4BFLA 3RYHB 4AJEA 2EZ4A 5JPCA 5KYYB 1VE1A 1O0SA 4BE4A 1DNPA 2A5FA 1FTGA 3GLKA 4ZC8A 2YNMC 3QKIA 2XE7A 3A3OA 3D3JA 4I4NA 4EFLA 5LP6F 2VT7A 1LPPA 2ISCA 2PA0A 3GLSA 2F43B 2RAUA 1XVLA 3RNOA 1A8QA 2AW3A 4Y2JA 4CMCA 1T2VA 3NETA 1NVUQ 1J2YA 1W1IA 3H0KA 3MCZA 4LEIA 2WJAA 2OOSA 3UC9A 5KS2A 2R6AA 3E5NA 1BGVA 2J3DA 3WK4A 2GX6A 4FNAA 5GJWC 3H2HA 1NC1A 1NBMD 5ALYA 2YV5A 2W4QA 4DSAA 4RTNA 1X1QA 2F8MA 1EVYA 2ZBUA 3GG9A 2BMEA 1GD1O 1L1EA 2ON6A 1XNJA 4MCIA 4CIAA 4OH1A 4AKGA 1PEDA 4IWYA 4CT5A 2WQZA 4KW7A 3F3YA 1JEDA 1MNQA 1U8EA 3GFBA 2QNIA 3CF2A 4PZZA 4ENQA 3KZVA 4LSMA 4OBBA 1Q92A 2VEDA 3OIFA 4YRDA 3UUWA 3VPAA 1QIGA 3TW4A 1V3QE 1XLTC 2L82A 3AR2A 3HKEA 4KH0A 4QASA 2CGEA 4LCJA 4QQFA 5LZ8A 2D00A 5LQMA 3MMZA 1Z4QA 2OXTA 2WJ4A 4LMBA 3UKJA 4AU1A 2O5EA 1SK8A 1SURA 2CLCX 4EYKA 2I1QA 1P6QA 2VT3A 4BGVA 3O8CA 1U2PA 4ED9A 5BV8A 3CG0A 4BNKA 4X94A 5H02A 3AKEA 4NMXB 3LFUA 4CLRB 1ZIXA 3O6VA 2C2ZA 5IKMA 1MJHA 2I29A 3TGWA 4UATA 4OUDB 5GP1A 3CR3C 4O08A 1QRUA 1XJ5A 2VZ8A 2JCYA 1QYXA 3ZGXA 3ABQB 2NU9B 2MR6A 4U7DA 1V5EA 2BY4A 1ISPA 4G5HA 4I81A 2O8FA 1QQAA 4WZ6A 4YB8A 1S96A 5ARDA 4AIIA 2H5LA 5BQ3A 4M0FA 4RZSA 3I73A 2H29A 4WNIA 4X7BA 1N2JA 5CX1B 1XWFA 3NANA 3T7SA 1Y89A 1U0HC 2FR8C 3MRSA 3ZV3A 3ZZ1A 1RQLA 1HNXB 2ZWPA 2JS7A 2VXCA 1UC9A 1GU7A 3CEHA 5JHHB 4F2DA 3P2EA 3R5JA 3WOVA 4E5VA 3L79A 3A3PA 4V0QA 4XVCA 1A9OA 1RNLA 1J0XO 4Y9TA 2QVGA 3OJEA 4JLMA 1GOTA 4XB2A 3MTDA 3PDIA 4DR6B 1T36B 3CUEF 4XVUA 4DDMA 4URXR 3GBPA 1MMFB 4RK4A 3EVBA 3OFVA 4KV9A 3ZW9A 1A9XA 1TQ4A 4DWOA 2JH8A 1YJ8A 2GO1A 2CBZA 4GNRA 1Z6TA 2WKPA 1BGXT 1QCDA 3G82C 3GLRA 5JXWA 1FU7A 4RE6A 3WDMA 3V4VB 2C7PA 3E23A 3C5HA 3FXAA 5TF4A 2QQGA 2CCJA 3KDSE 1RCUA 2B0JA 2YZNA 3LLSA 1P0PA 3O1JC 4UCWA 1IWPB 1HYQA 4QQNA 1IBSA 1W9MA 1FU4A 2WYWA 2H11A 3DCIA 1YULA 3OQPA 4LY0A 3NFYA 1HL7A 2GCOB 3TPFA 1JDBC 3WRVA 4BB0A 4BLOA 4ZI3A 1PR1A 1XVVA 3AP3A 2CJWA 4K2HA 4Q7JB 4GL2A 3TDMA 3DT9A 3ZNPA 4EW1A 1PGQA 1P9LA 3INTA 3EZ9A 3GYBA 5JXHA 2Z1NA 3MWDA 1CUBA 3NLLA 3FLEA 2XITA 3ZLTA 4N7MA 4EF6A 1UADA 1SKQA 1Z7BA 2IIVA 5G0TA 1U2GA 1F12A 3CR8A 3EQZA 3K1TA 4YJFB 5BSRA 4LCBA 3SZLA 5DYGA 3CEMA 3E8XA 3QX8A 4PNZA 5IKOA 2X9GA 3UK2A 4C04A 4U9IS 2JI9A 2X4DA 3CLSD 4ZZ0A 2Q7XA 4JWKA 1P4JA 3VR4D 3GHYA 2C1XA 3TQFA 4CR6A 3RBVA 4NH4A 3MBOA 1UZMA 4BNXA 4ZCMA 1GAXA 1NXXA 2CV1A 2C0CA 4BCBA 4Z1MA 4CQJA 1YS9A 3KSRA 7AT1A 4P81A 2EX4A 1NBMA 2O2CA 1VPLA 5I8WA 2V6FA 3B51X 1KAQA 1ISHA 1ID1A 1C9DB 1KY5A 3QP9A 3WSVA 4BL5A 5HX7A 4FMDB 2F17A 2JD2A 4G5XA 5IT9A 4I9HA 4AJ9A 8ATCA 1USVA 5H83A 1VSTA 4MB0A 2DY0A 5FLXA 1EVEA 2WR8A 1RRGA 4LDJA 3I0MA 2HWYA 1P9RA 4Y1FA 3F9RA 2DFPA 1XFAA 2HA6A 3X1WA 4V2UA 4YUAA 5KU1A 5AWFC 4M55A 1XDUA 5F21A 3C3MA 3B5JA 1L5ZA 4JQYA 1N2CB 2VHYA 4IDCA 3RROA 1PV4A 4LV6A 1A7KA 3GF4A 2P4UA 3LHDA 2O14A 5BUZA 5H5JA 4KWHA 1Z12A 3FUWA 4TKZA 3VR0A 4UHKA 5AW8A 3L8HA 4K86A 1YS2X 1RQGA 1SZDA 1YT5A 4HTFA 1PK9A 3CG4A 3KAPA 5AXDA 4BQRA 4EBFA 5LD2B 2V6GA 1VKNA 4AJLA 1RCFA 1H1DA 4RSMA 2EU8A 3AUTA 2C4VA 2QWXA 3LPDA 1Y5RA 4HVAA 5K7SA 3I23A 2DKFA 4MPPA 3ABOB 4QREA 4S12A 4F3NA 3CPHA 3LY5A 5AW7A 4F4DA 5E6SA 221PA 4LNAA 4Q3OA 3L7KA 3MS2A 4J03A 4OYLA 3O4RA 4TVKA 5LU8A 5LOVA 3NC0C 1D2HA 1EQUA 3C4QA 5KTYA 3OMWA 1D4OA 1FFXB 2OHHA 2QRVB 4HLCA 4BMPB 3FZGA 5BSVA 5CCBA 1Z36A 3Q8MA 4OB6A 1JQ3A 1ZIOA 1RXIA 3ZXYA 1KYYA 1Z63A 3LX8A 4WESA 3PE4A 5AR1A 1YMUA 1XUOA 4JZKA 1E0JA 5FO0A 2VUSA 3TZEA 2R44A 4ZOAA 1J1UA 1Z6ZA 3Q85A 1M6YA 3KPVA 1WETA 2EKLA 2IEGA 4XIFA 5DBIA 3RU9A 1L8XA 1GGHA 1K89A 2V4ZA 1BVYF 2P9YA 3PQ8A 2YJ3A 4R8RA 4ZAVA 4UASA 2DUJA 1M6EX 4QOJA 2H18A 2Q3EA 5EHZA 5J1TB 5K2MA 1R4MA 4IZ6A 2WIFA 3R3WA 2IZZA 2WAXA 4DBVO 2NQ2C 1V4BA 1Y8QB 1ABEA 2OHGA 3QOXA 1ZJ5A 3NT2A 2HBRA 3EX7C 1PGOA 1DAHA 2XUFA 3C4VA 5DM0A 3WIUA 3B5IA 5KTRA 3NATA 4M9UA 1ZSNA 3F7NA 1SD2A 3O31A 3WGZA 2PSSA 1JEQB 2RGNA 1EJ2A 1MB4A 2ZGVA 3PUIA 1NL3A 4FBLA 4FGKA 4XDGA 3IEUA 1KVUA 3U1VA 5J4HA 1AHPA 2RGRA 1Z8DA 3ICOA 3PWTA 5AKXA 1B15A 3KP1A 5F7ZA 4QDKA 4EKGA 4LFBB 3KJFA 1ODLA 1EINA 2GTIA 1RM3A 4JLOA 2IYRA 3AWDA 3QYJA 1XZIA 2W6PA 2ZYSA 5DNDA 2M2IA 1IBRA 3ILVA 4CQLA 3HB9A 1R12A 4RZXA 5IS2A 1D4ZA 1DQSA 4WN9A 1TJPB 3V4SA 1LRKA 4DM3A 5HOEA 5ALWA 3SBDA 1QH8B 1ZOPA 3L4EA 2DM6A 3C7DB 1YZGA 2VF4X 1TQ6A 1TM7E 3I8SA 1RKBA 3U4IA 5DX0A 3VUFA 2N3ZA 3GQBA 4V0RA 1JHRA 1XNHA 2IPOA 1U8TA 4P2GA 4BEBA 3PXXA 3EUEA 2G7ZA 4YJHB 5IAGA 2WSMA 2NPFA 3UXHA 5JRZA 3PC2A 2D0IA 3MHTA 2FAXA 3FGOA 1EEXB 2WF5A 2OFFA 5EWLA 1Q0LA 1CUHA 3CPJB 2XD9A 3DWFA 3U48A 2PANA 1NYTA 3BFKA 5F51A 3NDJA 3PA6A 1LI5A 4R2HA 3GR6A 1N78A 2D0PB 2XTZA 1L5OA 1P80A 1EE1A 4F0JA 5LMUB 2GF0A 1G5PA 4IXDA 3H0CA 1DJOA 1J4AA 2V7WA 2PYIA 5LDDC 4KFCA 2OSBA 4Y2QA 3VU3A 1ZIYA 3F3MA 3FOEC 1TUBB 4OX9B 1PN3A 1VE7A 5L3SA 2Z95A 3W34A 3R44A 3BBLA 4GSLA 1TIPA 2MT9A 2X13A 4BVGA 2DZDA 3VDRA 2VDLB 1DKLA 3CXRA 3NP7A 4L0MA 2DKOA 2C9BA 2WW8A 3ITKA 1SQSA 5G4KB 3DHYA 521PA 3I0ZA 5IM5A 3ME5A 3SZOA 4UPEA 5B12A 5LWQA 4IGFA 5EIXA 1X86B 4KPUB 1CS0B 3RQIA 3THSA 4AMUA 4ZCRA 2CXQA 2VZ0A 2WAYA 3B9BA 3GFFA 3H04A 1OZ0A 4HV4A 4KO3S 2HQSA 5CLQA 3NGMA 5ILOA 2VF8A 3UH1A 2IDMA 3HCEA 3R40A 4L50A 4Q48A 2D5IA 2JJQA 2IGBA 2O57A 1KNQA 1ZA1A 2OLKA 2MU1A 3C24A 3D1LA 3L3BA 2HU5A 1LLFA 3OE4A 4BU1A 4GH5A 2Z2ZA 3NTRA 2PPLA 2I62A 4I1SA 4J8PA 4MQ6A 4HH3C 3KJXA 5KQGA 2I66A 2FFRA 5TS3A 2XA2A 1SCQA 4Y3UA 3I3SR 1IUOA 1Y0BA 3FKSD 2EJCA 3BE5A 2VHQA 2VSFA 3PX2A 1TI7A 1ZP6A 3C3EA 3CRQA 3JQ8B 3ZDFA 4JI2B 2QA5A 3L4JA 3RWMB 1CERA 2FLVA 2VJQA 3AUSA 1SGWA 4MMZB 5ELMA 3TH5A 4Q4HA 4AF8A 3E4CA 3V4FA 4IL5A 4BKOA 1ADYA 3PNSA 2EQBA 1BNCA 1WNTA 4L2IB 3JQAA 3JU3A 5CGZA 3FGZA 1K2WA 5ALIA 4XARA 4XQ0A 3TDKA 3VJLA 1WQ3A 2XQJA 4JYBA 2ODBA 4L9SA 4Z8XA 4CLHA 3IMCA 1GG8A 4EW6A 1TA9A 3ZU4A 1P8AA 3IMEA 2ZYIA 1E89A 1W5FA 1ECPA 2HUNA 1G38A 4I3FA 4M8SA 1E63A 4I9NA 3LD9A 2P27A 2ZWMA 4QYXA 1QX4A 2DPHA 1WXIA 3DEKA 2MYPA 3QMVA 4WXMA 3E22B 3LJKA 3MCAA 2YYYA 4N5DA 4ZVUA 4Z7NB 3DOJA 1EUCB 4ISCA 2XECA 1DAIA 2BFMA 3DFUA 4QGAA 5H9WA 3KR0A 5ESDA 4X7PA 5LLSA 4HC4A 5A03A 2HFKA 2NZUG 2YHAA 4JGGA 1SD5A 3U40A 4NTZA 2FPGA 5B2FA 1UZAA 2EZUA 4RF5A 5EIEA 3DR5A 5C34B 4X66B 4MS1B 3BMQB 4HO1X 1R27A 2KBEA 4Y0NA 4G8JA 1CUWA 1BYUA 1KO1A 3GPDG 3KQPA 5HFJA 2C3OA 4MUBA 3DOIA 4D92A 5AVVA 5KHOC 1XRPA 2JLVA 2A1UA 2WF6A 1E9BA 2C4NA 3HCAA 4M1OA 2GA8A 2NUBA 3Q5GA 4YLGA 1YZYA 2QZ4A 4EGJA 1FS4A 3LFTA 5TGTA 2IYUA 1KJNA 1YRYE 5PGMA 3T7EA 4YPFA 3T1NA 4FB5A 1G42A 5JARA 3O75A 3HYNA 4I36A 5DRYA 3TTUA 2PRJA 2ATEA 3MJCA 4NE7A 2SKCA 2X8BA 5TVKA 5A6VA 9MHTA 4I3GA 3W5AA 3LIPA 3MMSA 2Q3DA 3QUSA 4H7DA 1E61A 2OQ2A 2WSSA 3JQ7A 4OAPA 5COQA 4CMIA 3UAGA 4IIFA 3P96A 1B41A 4FB4A 2B1GA 4NYIQ 5ED0A 2QT0A 2FDCA 4Y2SA 1A5AB 4URWR 4WN3A 4G65A 1E6UA 2GNAA 4YPVA 1Y3DE 2KMLA 1PW5A 3Q7QA 3UOGA 3UFXB 5GM2A 4JBIA 2BKUA 5JHGB 2PX4A 3AY3A 4JL8A 5JI2E 3BAZA 2OHJA 1I0IA 3EVFA 2R1TA 2E85A 3SJUA 1CUFA 3EIHA 3TNDA 3C8DA 4PNEA 4F8YA 4XFJA 5IVIA 4ZRMA 2H0QA 3TBHA 4AKTA 5GV7A 3QFHA 2O2EA 4AUKA 1GZDA 3LBIA 3CKYA 4E33A 4Z4CA 3IUJA 1EJ6A 2VDPB 4FCTA 4H18A 4ZOLA 2PKEA 5C8DA 3QLEA 1I3CA 1TKCA 4AS3A 3VNUA 5JVDF 2WJ6A 4KO8A 4LV8B 4O2AF 5BWBA 5LSAA 1YWGO 5IBQA 1HE8B 4EW3A 3AKYA 4YV7A 5EXSA 1HSOA 1SBNE 3K9BA 4B84A 1UXGA 3FYTA 3I92A 1E6WA 2IYSA 1DC7A 2Q5EA 3N2YA 1SVIA 2CLFB 3R9XB 4R40A 3IIIA 3H1AA 4D4HA 1ZMOA 4J0EA 1Z56C 2PLNA 2R00A 2PZMA 3V3KA 4CIVA 1SU6A 2AOXA 3ECCA 4N39A 1NR1A 3WNQA 3THXB 2FFHA 4WDQA 1Y3IA 2HPVA 3KJIA 1EE2A 3IR6A 3RYHA 2AFHB 5EGNA 1ADCA 3IPYA 1XU4A 1TXGA 3DTTA 1U5AA 2JK1A 4HAWA 4ROSA 5GTDA 1LBTA 1J39A 4B8YA 4BQSA 3K1AB 3MT0A 3P27A 3QWFA 3WIVA 1Q7GA 1KJJA 4ENUA 5KNCH 4I4TF 4CG3A 1FXWF 2RJ3A 2W6QA 3Q12A 4KFUA 3MGGA 3ZD9A 3EGXA 5BSKA 3RK1A 1CXZA 4RZUA 4IEFB 3V5NA 1QPGA 4BX3A 1KPIA 1YGPA 3NHZA 3STXA 4LQLA 2FWAA 5I8ZA 3SJBA 5CIWA 1MJNA 4CM4A 3H9UA 1KI4A 2RHWA 3TWOA 4NV1A 1JJ7A 3KVNA 1OWMA 2OPBA 3OP4A 4AY6A 4NWIA 2OCYC 4XVHA 2XI4A 3OZXA 1CNMA 2C03A 3BGWA 1KSGA 2HYIC 4FYMA 3KZCA 4EUKA 2QIPA 2CHEA 1M1YE 4Q03A 3ZWMA 2GCPA 1ZDMA 4D9BA 5KJ1A 1IHXA 1BO6A 2Q29A 4M9SA 5EMHA 5JAQA 2QE7A 3VR6A 2V1UA 4P0PB 1XAGA 3X1KA 5C1OA 4JD5A 2RHDA 3I3OA 2QPTA 3HVRA 2XCIA 2VK1A 4EITA 5ABPA 4QJBA 1RC0A 1LDGA 1L6RA 4HP8A 2LP4Y 3JALB 1K27A 4H7IA 2CXNA 4D9FA 5I48A 3RGWS 3JWPA 5KNDD 4DNXA 1K4MA 5KYUA 3M3PA 1GZHB 3WGHA 3VNVA 2Y0CA 1EAMA 4CLRA 2YZ2A 1P2SA 2LBPA 1YCDA 4AJJA 1EK2A 1K6EA 1TD1A 3ENQA 4F2GA 1Z0IA 4OUDA 1UXJA 3CTPA 2I3DA 2GEBA 1Y9JA 1GAJA 1DO8A 1YMVA 1ZW6A 4KAAA 1OFIA 2YXEA 3AY6A 4LWQA 3BVPA 3IILA 5AQEA 1AS3A 1D3AA 4KUHA 5KX5A 4RXTA 3OEED 2DBVO 4JHLA 3M3HA 2VIIA 3PWKA 2Q0QA 4W5RA 4GUDA 3JARA 4KIJA 3PWSA 1KYQA 1WXXA 3WQRA 1PYDA 2YFYA 2E4YA 3K15A 4RMJA 3GI1A 2UYCA 2XVXA 1GTL1 5C8ZA 2Q6TA 2C8LA 3C5VA 3H1PA 2ZSFA 3IT2A 1VG9B 3V8BA 2YNMA 3JQQA 4OQXA 2I6QA 1RR6A 1J6UA 2EKQA 4D45A 5CCXA 4KMMA 1RRMA 2EP7A 4ZQHA 3H2YA 3L92A 1XZCA 1HE4A 2AUTA 3CIOA 1V7ZA 1G5QA 3TRDA 1TFUA 4QL3A 4GLLA 3A26A 1SUBA 3DDOA 3GA5A 1X13A 4XYEA 5KSWB 1VA5A 4HNRA 2OV1A 1L8LA 3QENA 2QTHA 3BUSA 1G6HA 1GCIA 1GGJA 1ODFA 3AXTA 2UV8A 2RIRA 4Z86A 5I7UA 4LHSA 2O50A 1DRUA 2CFOA 2NG1A 1OOEA 1PR6A 2XEXA 2ZULA 3CLUD 2IIQA 3KEGA 3QX9A 4X9XA 1O9HA 3GGPA 3AM4A 1DQYA 2GN8A 5H7XA 5IJXA 1Y1QA 4RY2A 4R0NA 1U80A 2HLHA 5GZ3A 5EQDA 1U11A 1Q74A 3NBUA 3ADCA 3ZQ4A 1SVWA 5DM4A 2FK7A 2W6OA 1CF4A 1G7SA 4DIOA 4E03A 5AIAA 1IJKA 2RIPA 1H4QA 2ECOA 3PSAA 3X1MA 4C7BA 1P7PA 2JFZA 2H0RA 2C8VA 3MLBA 3WYDA 4RTPA 3LA6A 2B8JA 1IHDA 3HBAA 4Q93A 1A5TA 3KKMA 2PLWA 2Z08A 3ZKAA 2YXPX 3EJWA 4IHJB 4TVBA 3IB6A 2ONCA 2HF2A 4IUDS 5CT4A 2RHHA 3C3JA 4KPYA 3BMNA 4HUJA 1IVYA 1KBZA 1Z0UA 2DULA 5SZJA 1YOVB 2AT1A 2WICA 1CJCA 2CF6A 2XJ9A 4JC5A 4H3HB 1TDJA 2J41A 5BQ5A 5DNWA 2MSEB 2OAP1 2Q8NA 5ALXA 2B8TA 3BMCB 3UMJA 4DNPA 1GAWA 5L40A 4RHFA 2Q46A 1WKCA 3P2YA 3P9PA 1QK3A 1X9GA 3OSUA 2YVAA 1XRNA 3I8OA 2XMGA 5JASA 1WXQA 4A2WA 1H9BA 3I28A 3ZD7A 1C0EA 4URVR 1GNRA 1CSEE 3AERA 1W36C 3OJWA 5ILQA 4CV0A 3SYRA 1K7XB 4BQOA 1JIXA 3EIUA 4C0SA 1UBUS 2VQ6A 2Z5LA 1C7RA 1WZCA 1F8YA 2Q6VA 2R87A 4P92A 3VPBA 3ZVLA 4FE7A 1DUVG 1ENYA 1K8YB 3FOBA 4Z7OB 3O0TA 2PBRA 3S3TA 1OB5A 2BFPA 1AQJA 4L8GA 3W8RA 3L05A 1IUNA 3NJRA 3R41A 4LKRA 4MWZA 1VE3A 2GSDA 3N39C 5CLHA 1YQDA 1C0PA 1GCUA 1XDWA 4I5DA 3OCWA 2O7RA 3PZRA 4NG5A 2G9NA 2ZDHA 3MJRA 1Z9BA 2DTDA 3PD0A 4PONA 1E64A 3W8DA 1S1CA 1XZNA 3SC4A 4MVJE 4FLMA 1FYFA 2PJZA 4OGLA 4MV5A 2J9FA 1YRAA 1C41A 5CX4A 4YGYA 5FRDA 3TB4A 1ZGBA 2FRXA 3VVLA 1Q19A 2E18A 2HDWA 5IUJC 3I4CA 3SR0A 1GNLA 1DHTA 1ZVQA 3TGLA 3NI2A 4MVJG 4ZT7A 2O9JA 1ZN9A 1JKFA 4OQFA 5EPEA 2ZJZA 1TVMA 4IJWA 4YMHA 5CVJA 3TFOA 2AJDA 4EHAA 1B3BA 1WUKS 2XB6A 3BTOA 4ZARA 2N9UA 1NJ5A 5E6SB 4X8LA 5CCEA 1NRJB 2FPSA 3CRVA 4I5EA 2HPAA 2I6GA 2IIBA 3LO8A 2FFJA 4MS3A 3UV3A 2OQIA 1W4CA 2QRVA 2X3UA 3ZY3A 3OE7A 1PKXA 1PNOA 2PLFA 2BBTA 3IUSA 4DR2B 3VZCA 1JDNA 1DWPA 3ABZA 3GJRA 3ROFA 4DQKA 2CYAA 1A88A 4MS4A 4WESB 5EE3A 2FOLA 1JSRA 4M1MA 5DK4A 3BIJA 1XRRA 1T0HB 1B7GO 1X8KA 3I1JA 1H23A 1QGZA 4M54A 3IP7A 3ZXXA 5TS2A 4OFWA 3E5RA 5DLQC 3TIIA 2QTBA 5ICCA 1LBQA 1JHDA 1Z34A 4EZIA 4G1UC 1SRRA 2IKSA 1V1MA 4BVLA 4C4YA 5HVNA 3S1AB 2HA4A 3IH5A 2OHIA 2HDNB 1BU8A 2JFXA 4A10A 3DF7A 3K96A 5FOTA 1E9CA 2HW8A 4FWBA 4B87A 1S4MA 3BQNB 3OPNA 2F48A 2AYZA 2GN4A 2INGX 2I7XA 2J32A 2QB5A 3AK4A 4GR5A 1D8TA 4GZ5A 4M22A 4NK5A 4Z9FA 3W2FA 1ZD8A 8LDHA 5AVQA 5E7QA 3N5KA 2D8MA 3O9ZA 1NJ1A 4IHJF 4KQXA 4FU0A 3MGAA 1EIWA 5FR2A 5EGSA 5CU7A 3VR6H 4YRMA 4L4YA 1XXLA 2OMEA 3UPUA 4K87A 4G1VA 4WN9B 1JWAB 2JBAB 4C3OB 2H1OA 4ZAFA 3QLTA 3R7WB 4WDRA 2YXLA 3ENZA 4FP9A 4JUCA 3TLAA 3WC4A 4DLVA 2COEA 2OZKA 2VTKA 2Y71A 2EF1A 1KI7A 3TPCA 4Z3KA 1PFVA 4FDAA 4F9EA 1IAVA 1RXVA 1MC4A 4INPA 1JPVA 2Q8QA 2ZBDA 3IP6A 4NC9A 4LHVA 1HO3A 4ZYZA 2HK7A 4UXIA 3IUMA 1KO5A 1PJRA 5E9WA 3SSOA 2F3PA 1HF3A 4QPPA 1VXRA 3GA0A 4MLPA 2P3LA 1VI5A 3KR1A 3CQ9A 5DIFA 4J0QA 1L7MA 1OW3B 1QIMA 2B1RA 2PK3A 3L9WA 5CD1A 4ND5A 1DO0A 3W5JA 1JU3A 1NZFA 1B43A 3D5QA 3ZX4A 2R11A 1DEXA 4R31A 5E7IA 3G9UA 3LY7A 1JS1X 3IOYA 5EP1A 4XJXA 1IEVA 2Y1WA 4PSDA 4GBGA 4TV8F 2CKDA 2XYVA 4UEQA 1Y98A 4YMVA 3CA8A 1Y9DA 1QF9A 3PPXA 1RJWA 1WP9A 1AQ6A 1RVDA 1W93A 10MHA 4IQFA 3FWYA 3TRJA 2WYIA 2ZS7A 5CJJA 5E0KB 2DSTA 4NNJA 4BFZA 5KSZA 5L7WA 5COBA 5AJZA 4TYMA 2IW1A 4XYBA 3VSEA 2VDQB 2PX0A 4HZUB 4I1YA 4EL5A 2JI7A 5I7WA 3C7KA 1T91A 3IP3A 4FYIA 1F48A 1B8UA 1ZPDA 4W5JA 1SQ5A 5TVGA 3UK1A 1TX4B 5BN5A 3Q4GA 2YIVX 2TSYB 4XX0A 2CE2X 3DZCA 3L5OA 4DOMA 1LW7A 1KBQA 2JAUA 4M0MA 4QOSA 4DLRA 3ER8A 4TYPA 1FP4A 3GLUA 1EM8B 5CFRA 4L8VA 1OCEA 3FYUB 2ST1A 4Y30A 2Q4BA 4PZPA 2C88A 4TRJA 1YDFA 2GRJA 3CNNA 3MS7A 4A2PA 1W2HA 2GD6A 2HCJB 2VJCA 4MCHA 1FSGA 2G28A 1IZZA 2JD0A 3H9GA 4MYDA 5EUBA 1CR4A 4YJ2F 4AJOA 3O8QA 4Z9YA 1LBSA 2IYLD 2VZLA 3IXMA 1GPAA 4M49A 2J5KA 1TEHA 2P40A 3I12A 3IIMA 3OPYI 4F6RB 4FYYA 1PJTA 1KYZA 1S9DA 2VDMB 1GRNA 3D5TA 5ICMA 2XRYA 2WU4A 1UPCA 2CBGA 4RTKA 5HDQA 4MV0A 1NY5A 3HWRA 3INGA 3JVDA 1UBCA 3BTVA 1VMDA 1E3SA 4TLDA 3VHQA 3SVZA 3DCNA 1EZ4A 2PKCA 1L8AA 5E7MA 4OXXA 2YY7A 4EKYA 4HRXA 1OU0A 1G4UR 1JSZA 2MJLA 3UJ9A 5L7TA 3UN1A 2FX2A 4H1VA 4CF7A 1TQDA 5EUCA 5CDYA 4Z9BA 3QW2A 2RGXA 4WY8A 3RSFA 1GPYA 2IZOA 2ZBRA 5AJYA 2ID4A 3FY4A 4YQZA 1JYEA 4HL6A 4WKCA 1SWVA 1QYIA 1YUNA 3NAQA 1KEEA 3MJVA 1GDHA 1NR5A 5DMXA 4X95A 4PCUA 3O93A 2IYWA 4L16A 3HVKA 4QU8A 3RKRA 3BXGA 4QYWA 1E9AA 2A1IA 3EXFA 1OFUX 1P1IA 1U8ZA 3D6NB 5KDOA 5LQNA 4ZK6A 2PRYA 4RHUA 3PNPA 4MS1A 5FBHA 1Q20A 1PZFA 4UD6A 2H4XA 3EF1A 1K8XB 1IEQA 3EGDB 4O2BA 2I87A 1NMYA 4BWYA 4CM1A 3I9OA 4DPLA 5BSMA 1DBIA 2H9YA 3ENVA 4BFSA 2WJPA 1ILEA 1N0VC 3L6CA 2B4TO 2VH1A 3L0BA 4LYFA 1XRJA 2DGDA 3IQIX 1D5WA 2V5UA 4CM8A 4B7ZA 3LPMA 1EWQA 4XWKA 3OX2A 1IHYA 3D54D 3R09A 5JRJA 5EMJA 2PEZA 3ZIDA 1ATZA 2WILA 5HS6A 5JEEA 3CW2A 3TTTA 4O2AB 2FMKA 2QU7A 1S8NA 1KA9H 4IR7A 4JLJA 2ZAIA 2D1YA 3KYDB 1UBNA 3QU5A 1DRJA 1ISIA 1PR0A 4AF7A 1D7OA 2EBWA 4PXSA 4AJ1A 4OJTA 4EGAA 3GLTA 3LHSA 3WL4A 2QNBA 3GD7A 1HL3A 2Q5OA 3LPCA 4LRQA 1LVGA 4HGNA 3GL9A 1YA8A 1VRWA 2QUKA 2R7LA 3U6KA 5EHGA 5GPBA 2I33A 2W6ZA 4Q6WA 3NHAA 2XQGA 4F72A 1VDMA 4NBSA 5JD5A 3ZCXA 2VK8A 3IMFA 3NWEA 5FD8A 3THYB 3JRXA 3P0IA 4E5MA 2BGGA 1KEWA 3JZAA 3I2GA 4O4IB 4RSRA 3V7FA 1F8UA 1N5MA 3KK0A 4NZNA 5KKAA 1CT9A 1ABFA 1K5HA 3BH6A 3PDHA 4H6XA 4QWWA 1XD8A 2I4OA 4R7TA 3NKVA 1RD4A 1SH7A 4FX2A 2Z56A 2YDYA 2CW5A 1UEIA 4MR8A 4Q1VA 5LA6F 2IDJA 3H75A 1RC8A 4AKHA 3FFTA 2WWWA 3HZRA 1AB6A 2DWOA 3OZFA 2V7BA 3AY0A 2XMBA 2EATA 2OESA 1B8VA 5CDTA 4HMOA 4K9RA 3G9ZA 5DX1A 4XYGA 3RANA 2Q1YA 1Z2AA 3CEJA 4FMDF 5CMLA 1DWUA 2VJLA 1J70A 1OREA 4AG5A 1QS0B 3OU2A 5BVHA 2HK6A 1O95D 1CRPA 2ZYGA 1KDVA 3GVCA 1SUPA 3RKSA 2IHYA 3MJHA 2FI1A 2HIMA 4WFKA 4CG2A 1VSBA 4FKBA 2VYVA 1PSDA 3DAYA 1KEVA 4CCYA 4DSNA 3MTEA 5BQFA 4G4GA 2AJTA 4ENPA 1VIAA 2WDPA 1J20A 1V2GA 3ANNA 4MPJA 4BNLA 3LQKA 1CDZA 3K1YA 3PHCA 4IGEA 2VDWB 4DYVA 4EB6B 4YXFA 5LQRA 1FXWA 4OLFA 3Q9SA 3RG8A 4Y2PA 2TECE 3EXHA 3O26A 4H60A 2VP5A 5FOQA 1SU8A 2GPNA 4WK2B 2ZIEA 4RCZA 1DLIA 5AW5A 2G4VA 2P9GA 2ZRBA 4BQIA 1T25A 2E4XA 2XEDA 4LYDA 3WWDA 1SB9A 5AVJA 2OT3B 5NLLA 4FZJA 4B4KA 3UK0A 3KPYA 4MZDA 1C1XB 1E66A 1N8KA 2O1WA 3DBLB 2FGKA 3BM5A 3OECA 3QUAA 3ZZNA 2BVNA 2DHDA 4EMTA 2HGSA 1ST2A 5CYGA 1GN8A 1SXQA 3QPCA 5K01A 4BGIA 4CM3A 3WV5A 4RVNA 3VKVA 5ADUS 3LK6A 3SYLA 1AOXA 4O4HA 1XRLA 2UXBB 5IPFA 1L7AA 2HEGA 4HQRA 4PBRA 3VPSA 2BONA 4X41A 4E7OA 2ECPA 2B83A 3AEYA 3EIEA 4ETWA 5AHKA 4H0CA 3RC2A 1A71A 2R68A 3LT0A 3W5DA 4LZJA 5DEOA 3KXLA 3SXJA 2PCLA 1RAFA 3A10A 5LXTF 5LYJA 4CDRA 2QGFA 3A9SA 3STVA 2Y0DA 2WSYB 2CNNA 5IZ4A 1TT5A 4RD6A 4EOGA 1PX2A 2QUZA 2YBEA 4BFYA 2QM0A 5HJ2A 5G2OA 2IEAA 5T8KA 2A9PA 3TS1A 2W11A 3TNJA 3OKCA 3IT1A 3K0FA 3ERCA 1J7JA 1N6OA 4RIEA 2D5BA 3RRNA 3Q8LA 4P58A 1GPUA 1TYDE 3OKFA 4PGGA 1AM4D 2FFBA 1W73A 3CO5A 3OJFA 1POXA 2WVJA 4MO9A 1VL2A 1Q0SA 3A1WA 4NDNE 2VKTA 4FOLA 3OPQA 1XTKA 1J7KA 2G3YA 1WDMA 1VKOA 1KJYA 2EEPA 1P3DA 1ECLA 1X15A 3I2JA 5L3ZA 1SIUA 1G19A 1LFDB 5DIZA 3KBBA 4IWXA 3R0XA 3P52A 2Q5CA 4G1MB 4PLTA 3VZBA 3DEZA 2AJBA 4TYQA 4ZGBA 2VXYA 1QV6A 1RWMA 3AWIA 3AZOA 2DWPA 1EH5A 1L0BA 1R88A 1W85A 4GUAA 3TLEA 3FVRA 1OAAA 4REOA 5HBGA 1A98A 2RHRA 4LFCB 3FCOA 4L78A 5ALSA 4X3PA 2FHPA 1A5SB 1VCMA 1C7IA 3ACDA 3D81A 4QDTA 2OY0A 1DSSG 3ZH9B 1R6XA 4RX1A 3IAM6 1E3TA 4RF3A 5SYAA 4YONB 1JQDA 2Q6OA 2VZEA 4FK8A 4WXEA 5SY9A 1EFRD 4W6ZA 4MAFA 1MRZA 3U3MA 1G5FA 2NVUA 2QR2A 5BN4A 1BE8A 1EFHA 2PZ8A 3DUFA 3G1TA 5CR9A 4QT4A 1U0SY 3PD1A 4E14A 3TOCA 5AW6A 5HK8A 5F4ZA 1ZKDA 4Q1FA 4RK5A 4IEEA 1M33A 2F2TA 3EVDA 1BW9B 1PTJC 1KFBB 1YIOA 1Z82A 2AOTA 2BGIA 3ISJA 3BIWA 1Y6JA 2WUVA 4ABYA 4CIDA 2JPDA 4RY9A 5EPOA 3UENA 2FSFA 3Q3JB 5F23A 1RHUA 1GPNA 1PW7A 2IYPA 4YMLA 2PH7A 1AMUA 4NMMA 2DR3A 4MKZA 1F0NA 3CVVA 5G0SA 2AG6A 4FEEA 4Q4AB 4PC6A 3MT9A 3ZWXA 3WFJA 3W4JA 1IM5A 3DVAA