4R1OA

Crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
496
structure length
496
Chain Sequence
MLSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVFKSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAFAESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELLDEYEELYDIVPAGRQEGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPGNELILGAHMLEVCPTIAATRPRVEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-arabinose isomerase
publication title Crystal Structure of Thermophilic apo L-Arabinose Isomerase from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Isomerase
total genus 183
structure length 496
sequence length 496
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.4: L-arabinose isomerase.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r1oA01
4R1PA 4R1OA 4R1QA 4F2DA 2HXGA 2AJTA 4LQLA
chains in the Genus database with same CATH superfamily
5KOJA 2P69A 3PDIB 3H5AA 3L0PA 3GLKA 3RBZA 5BW5A 1Y9DA 4RELA 2ZZMA 2HLNA 3BHNA 3A1UA 3TTWA 1U0FA 1DV2A 3M9LA 3TZCA 1T8WA 1AM4D 4G5HA 4G4SP 4TMKA 3I52A 3TW0A 4JLVA 1XTIA 1PNVA 1JNXX 2QJOA 3AVYA 3B9PA 2XQKA 2WJ6A 3GNSA 5DBFA 3M33A 1G98A 1SN7A 1UMKA 4MCAA 4WXRA 4XSHA 5BN3A 2E1RA 3NEAA 3KQVA 5JNRA 3F7TA 4CDGA 4YCLA 4IJVA 4UTPA 3GZTB 1WW8A 3HYCA 2VP2A 2AEMA 4K9SA 3RU3A 5ALWA 4CL8A 3UJ6A 2VSFA 1G41A 3IMKA 1DJPA 2QLBA 4OAOA 4L6CA 2QN3A 2NOAA 3U3DA 3G7NA 2GZ1A 1F2TA 4IFIA 1X7DA 4U02A 3SG0A 3DOOA 3IOYA 1K3UB 4CKXA 2P9YA 2WWYA 3T0FA 1WB4A 5EEHA 4YRFA 2HHLA 3EGDB 4QPDA 5ESDA 5GM1A 1MF7A 4J16C 3FFWA 2BAGA 1IY0A 1IWPB 2O8VA 2QRUA 1YQDA 3BHJA 3LUKA 4QUBA 3QNWA 3TR6A 4AWXA 2YXBA 4DPKA 1J39A 3FOFC 4C0LA 1B6SA 2BI7A 2JLQA 3RS3A 3RYHA 1ONNA 1YDEA 5K0NA 5KU7A 4KXNA 4MGKR 2RAVA 1JHUA 1LDEA 1QQBA 4IXWA 5FLKA 5BVGA 2F1JA 3DMHA 3WWPA 1DKPA 4JXKA 4LYGA 3U4CA 4CMHA 5HM8A 3A32A 1HETA 1NSTA 3D1LA 3DB1A 3JAKB 1NZFA 1H2AS 1N2JA 1O94D 2EX1A 4PZDA 3WL3A 4URVR 3O2JA 3PGMA 4OQXA 4PSVA 2ZITA 1EAMA 1IZ0A 1SM4A 1JS1X 5JO0A 4EA7A 2QQEA 2I76A 3IP5A 3N8NA 4QASA 3NHWA 4F4IA 2B94A 3U5TA 4BXOA 4YRLA 4OQDA 3JTEA 2HJWA 3L1VA 1U3WA 1S8OA 4X97A 5AVUA 1YB1A 1HL7A 2H7XA 2YC2C 1YZFA 3DBRB 4LOHA 3AUTA 1N78A 3A9SA 3I8XA 3TEFA 4D25A 3BZWA 1Z7WA 3AUSA 3D4LA 1HWYA 2J8ZA 3TS1A 3ORFA 4G89A 1PWEA 1GTRA 1G1AA 3SZGA 4Q9KA 1OZAA 5PGMA 5KYYB 3JVIA 3FPCA 3U4DA 1E0DA 5I4CA 4A10A 3LO8A 1WKBA 3NM5A 1YBVA 1B6RA 4P4SA 1IIBA 2YWJA 2COUA 2BMDA 2MMGA 3FTPA 4KRYA 2HSEA 3HKDA 2W0MA 4BNJA 3M70A 3ON5A 2O8DB 2PS3A 2JGAA 3BKXA 4QICA 2IK8A 4NCJA 3C5CA 1U0JA 3J81A 1RC1A 1UMCB 2BD0A 5A1JA 1Y4SA 3AEUA 5C0OE 1JG3A 3Q11A 2WM3A 3QQPA 4PSKA 3NMUF 3A3NA 1DWOA 2F1KA 2NU7B 1ZOLA 1RACA 2MYTA 4ZDJA 5ALQA 3QPWA 5TMEA 2W22A 1QYCA 1AURA 1EFTA 3CRQA 1XMVA 4E2ZA 4EUKA 1BXKA 2A57A 4BVEA 3L8MA 4ZCIA 1M0TA 4UTVA 2Z4SA 3CC8A 3DHYA 3G0GA 1S6YA 4AJLA 3EY9A 1Q16A 3TH5A 4U7JA 3A58B 1QRDA 3DOIA 1ZMTA 2Q9BA 1GPJA 1N5IA 1YMVA 1W5EA 2HA5A 2IDMA 1OYYA 2GVZC 3CRNA 1LC3A 1DQRA 4JI7B 3EF1A 4JSYA 1QDEA 1OFUA 2AZDA 4B80A 3VYWA 4BUZA 5H5JA 5JQGA 3HRHA 4Y0AA 3SE0A 2DUJA 3ZS8A 2R8ZA 3QLVA 3SXUA 1O77A 1A72A 4F46A 3I9V6 3REQA 4EYQA 1PFKA 2ZATA 3QVUA 4Q3CA 1GGKA 4L78A 4U9IS 3VNAA 5DYYA 4B84A 1G4AE 4YR9A 1U8ZA 4K2HA 4QOJA 1EK1A 3UK2A 2JGIA 1E7WA 4G84A 2PZBA 2IPNA 1DBWA 3K6SA 1O1YA 3T9EA 5GQSA 1H23A 2I6UA 4JX9A 3FETA 2BFBB 4MB6A 4F8EA 5FAKA 5GVSA 4R51A 1Q6ZA 4IZIA 5LQCA 2JCXA 1MFPA 2P75A 2VXBA 3F5MA 5DNAA 3UV3A 2Q7DA 2QN7A 3TDNA 1SU8A 3ZQUA 4MRPA 4TL6A 4WUVA 2IXDA 2GN1A 2XXJA 4U5QA 4O2BB 2IHKA 1V8BA 2G1UA 2O1EA 3F5SA 3WE7A 4ZEVA 4PTZA 1IQ0A 4FC7A 4FZJA 3ND9A 2LBPA 1Q1ZA 4S05A 2XQIA 3L02A 2DH6A 3WLRA 1N36B 1V7QA 3IUSA 3CMCO 3KXPA 1QIJA 3HFRA 1MBZA 2HJ9A 5AK5A 5EMKA 4NCAA 1KHTA 1YUBA 2FZVA 4BNZA 1CIVA 1HDEA 2GZSA 4KO2S 4CR6A 5JRDS 4REQB 3SHQA 4I81A 3KSRA 4IS2A 1T24A 3K30A 1NN0A 4TTVA 5EVCA 3FIJA 3DYBA 3TNDA 1FQJA 1SHJA 2CC2A 2WWTA 3ED5A 4ENSA 4W6QA 1W36D 5H9VA 1P7ZA 3M9XA 1O96B 2XWJI 3UXMA 1YF3A 3RUFA 2A0FA 3B6KA 1G8AA 1T6BY 1KHHA 4BGUA 1PR3A 1AKVA 2MINB 1GLGA 1Z5NA 1PJCA 2HO4A 1NLZA 2D0IA 4M55A 5CUQA 3ICQB 4L5AA 3A14A 5I7VA 4TL7A 4YRQA 3VPDA 1DCMA 4HDOB 4HR7A 1F8YA 3QWBA 2GN0A 2H2FA 1PR5A 2COEA 4LOLA 2PXAA 1VHQA 1DC6A 2QZPA 2QT0A 3MIZA 3OQBA 3A28A 1B15A 1JQ3A 3WTBA 2JLWA 3Q8WA 3U4AA 3E0XA 2PKQO 3H04A 2Q2QA 5DHQA 2B4TO 5ALFA 5DLPA 1EXWA 3OIYA 3H6KA 1MO5A 5JVDB 3TJZA 2VR1A 3VZBA 2IH2A 1IQUA 2I1LA 1H65A 2UVDA 1RAEA 3B8EA 3WSWA 1O5TA 3L1KA 3P9NA 4E4RA 7REQA 2QV7A 1CVLA 5FUBA 4F71A 3OOHA 1N7GA 4EB6A 2AD1A 3MCZA 3N0WA 3RSFA 4ER6A 1ILEA 3WYAA 4OKNA 2PR2A 2H18A 2FQ1A 5C8YB 3T1YB 3C7AA 3FPKA 2VNAA 1N5JA 1R10A 2RGXA 4S0XA 1NV8A 5EYPA 1JAXA 5IN5A 2EIXA 1H94A 2P1DA 5I9BA 2VQFB 8MHTA 3GAFA 4ERXA 2AVDA 2CZQA 2I8LA 4UMEA 1VJDA 4YV0A 3E22B 3OKAA 1NR5A 3F9CA 1ZOIA 2G7MC 3RWMB 5ED4A 3EF0A 1V0JA 3WNVA 2IXGA 4I9HA 4IV8A 2Z3ZA 3MWKA 4U2CA 2C5GA 1XMIA 3F78A 2WJ3A 2QRVA 4FDUA 4UUAA 1SVKA 2G4CA 5AUPB 5L40A 1H05A 1PTJA 2OG1A 4BKOA 4E0BA 1XJQA 2BM1A 4HQ6A 3PRYA 4PBTA 1JL3A 3F74A 3VR5D 5FNVA 5EJ4A 2DLCX 4YLEA 5M2QA 2IBTA 1R3UA 3BFPA 3ESYA 4ZPXA 3W4IA 2QUZA 4Y6LA 4HI0E 2B35A 4OXNA 1C30B 2QTFA 1TM3E 5FUMA 2ZJ7A 2XGOA 1DWPA 3KKNA 4MKXA 1K0FA 4NJEB 5M34A 3O8OA 1UJ4A 2G5PA 1N6NA 4R81A 2GF2A 1DEXA 4R2KA 3VQTA 4BNHA 3I2GA 4P92A 3IL2A 4XFDA 1GAXA 3P9QA 2BEJA 1T9HA 2WMDA 1X2EA 4EABA 1A7KA 4W8OA 4WFKA 1HOXA 3T1VA 1C1DA 2PS0A 5IAGA 3NBYC 1YOVA 1HC7A 2BJHA 1XZHA 2OCAA 4MWOA 4WOKA 4I1VA 3VNUA 1XDDA 1UJNA 4ND1A 5AI0A 5F23A 5MHTA 4DPLA 3OHMA 3ZX4A 3JZDA 1CVIA 2FN3A 1JR4A 1KP9A 4IDAA 3MFQA 2ZUBA 1T1IA 2QTCA 3O47A 1Z6PA 2Q4EA 4YK7A 2ZU6A 1G20E 3VVCA 4NH0A 2VJQA 5IDYA 1PQYA 3ZKWB 1VJ1A 1QDUA 3NHRA 4ZXPA 1R4MB 3FB1A 2B6NA 2WF5A 3BAFA 4J75A 4LA4A 1VJTA 1Z4NA 2FA9A 2QN9A 1WX1A 3A3OA 4W8GA 1JG4A 5KMGA 1SNYA 2IEZA 1LCIA 3DMPA 4KNWA 5EJ5A 3OURA 1GPDG 3PQ3A 2BZSA 3FCAA 2WSLA 1A5BB 1SPXA 3IJRA 4I50B 1PN3A 2DULA 5D6NA 4CL3A 1ZU5A 2C9DA 4XD2A 2GARA 5U1PA 3UUFA 3THOA 2D1SA 2M32A 4MJLA 4RZSA 2ATEA 2FG5A 2ZBRA 3IPYA 2PD3A 3O4GA 2JPDA 3UMJA 2H54A 1CRPA 1SCBA 2V6JA 5L3VA 3RAFC 4O6VA 2JJYA 5DSZA 1M2OA 4QYIA 4PYRA 4RF2A 4KOEC 1YRWA 3IA7A 3RLIA 3B6EA 1IYZA 1NDQA 5JIBA 1DIBA 2WD7A 2B6HA 1WQ1R 4PG6A 4F06A 4ACBA 1QFSA 5BMOA 2ZDHA 3F5QA 1KJ8A 4FFVA 4V1CA 4ARAA 3GFBA 1G8SA 3KEQA 1NYRA 2APJA 2VRCD 3F6EX 3JWPA 3IKVA 3OETA 5A4MS 1MNQA 1NRWA 1NVVQ 3ZXSA 4NXMB 1RAIA 2AX3A 1TUBA 2W37A 4NESA 3M8KA 3WICA 3ZE0B 4FK8A 4B74A 4QXMA 3Q7RA 1KY4A 3LT4A 1WZIA 3L6UA 4MGZR 1FDWA 1AZWA 1WXQA 2ZB7A 4HXEB 1E9SA 1V6AA 1XEWY 2VDLB 3A4VA 4R41A 5LQRA 2H92A 4Y9SA 4B45A 3DLPX 4C5BA 2MSDB 1QNLA 5AOVA 2BUAA 2OC4A 1R9NA 3BB4A 1FSGA 5AJTA 4GOKA 4N0QA 2QYSA 4URUR 3STVA 5IM4A 1RXVA 1SUPA 3EGCA 2W42A 3H17A 2D13A 1RFLA 3KZKA 3KD3A 1PF7E 2XMPA 3BXXA 4AJHA 4E5YA 2DGDA 1RYBA 5JDCC 2WT4A 1BROA 4RGVA 3DBLB 2QTZA 4CR7A 1J90A 3ZVKA 3FI9A 3IJPA 1L5VA 2C5FA 5J4LA 4V03A 4KI7A 1POWA 2X15A 3DMRA 1IY1A 1WNFA 1XC7A 1AV7A 2JCBA 4HF7A 5GONA 1FXWA 3LKZA 2A1IA 3PWSA 1FTSA 3T3OA 1TGYA 4R4JA 3ZZNA 4BB9A 4DLRA 4EMUA 5CK5A 1L5FA 2BRUA 2FUEA 2OV1A 3HA7A 3PHIA 3UB2A 1LSJA 1NHWA 3GK3A 3NHSA 3O83A 1RC8A 1XVIA 4K87A 3U80A 1YZGA 2IYLD 3BFKA 4FEAA 5KYXB 1L7EA 4Z4IA 2FK8A 4H31A 3O4JA 3ZIAD 2PUCA 1DPFA 2ZT8A 4P7KA 3SU8A 4F6RA 1RDFA 3CO0S 3QPVA 4I9UA 1NQOA 5AM4A 4I5GA 3FSJX 4PAQA 1IZ7A 4RAQA 3L0YA 2ECKA 1S3FA 3IB6A 3LE8A 4ZHQB 1Z15A 3DTVD 2WJGA 421PA 4CM9A 1RQ7A 1T9CA 1X1EA 4RD1A 5CXXA 5J2TF 1PLLA 5J40A 2WP0A 4JJIA 1N34B 1C8KA 2H4ZA 2YMMA 3N86A 5FBQB 2AFIB 3HCWA 3MAGA 5C81A 1RXWA 3AZQA 4YASA 1KBOA 2OOKA 4N7RA 2V0NA 3HA2A 1MXHA 3K9GA 4MMYB 1EFCA 4NV0A 5KOHB 5LU9A 4F4CA 3PC2A 2BIFA 3IKTA 3AJAA 2I91A 2ZJFA 1T0UA 4QRHA 4DCOA 1IHYA 4RPJA 1M7GA 3C1OA 1W93A 3LOPA 3BHIA 4R9UC 3V7UA 5DN6A 5JQWA 4XQ9A 3VDQA 2VPIA 3ZNPA 3A1TA 3HADA 3B2QA 1YE8A 4RK0A 5E6SB 3HUDA 2HIAA 1T2AA 2JG3A 3NJ4A 2IV2X 5K3FB 4JUBA 5DTMA 3NKLA 1I7NA 1QCDA 3BGSA 1BCSA 1U7UA 3R3UA 4Z4EA 1KH2A 2R8PA 1Y3BE 2VCHA 3NYQA 4LJ5A 3R24A 3G2PA 5A5DA 1NF9A 2V7XA 2O5EA 3OQMA 2Q3HA 1N9ZA 5IN4A 2CUZA 1U7OA 1ND6A 1A82A 1VLJA 1QAQA 3CW2A 4PFJA 4JGIA 5DLEA 3ZS9A 3O8RA 3P19A 1T5OA 5BSEA 5KNCH 1JZQA 4NY1A 2GF9A 4S1PA 3D7KA 4E3WA 1IN6A 1CY4A 4WZAB 3RASA 2RJ3A 3SQNA 1FPMA 4R16A 5JPCA 5MDHA 1GAJA 4LHXA 4C88A 5E4FA 1DE0A 3L0ZA 4YJKA 1Z2NX 2R1ZA 3CRW1 4GWKA 2LPMA 4MWTA 5TS3A 4G01B 5AHXA 4BZXA 3H3JA 5CB0A 3TSOA 2CNBA 2RHTA 4GLJA 4DMRA 1S1MA 2WDPA 3VO8A 5E4JA 1EQUA 4NENB 2JK0A 4JYZA 1SHZA 2CVQA 2WMNB 3NTVA 5GV7A 1FP1D 5EQJB 4YRTA 3SZUA 4EW2A 5KYKA 4MKFA 1WETA 3MTGA 3SIRA 1ZAYA 3A9RA 2JAOA 2O8NA 3DZKA 5G1PA 3ROKA 3W3AH 1XPOA 3GRRA 1N33B 4QLOA 3AMVA 5C18A 3OO0A 4TQGA 1L5MA 2P9HA 2RHOA 3JQBC 3TIIA 1JTVA 1TZ2A 4WGFA 1XF9A 1YNOA 4F6LA 4RCZA 2FMHA 1SVNA 3T3NA 3AKCA 4JJEA 5FAXA 3K0SA 2JJ8A 1JWAB 4KBGA 5KVAA 1DJNA 5AI6A 3S3TA 4JLAA 3PVSA 1IM2A 2Y0DA 1FFAA 4W5QA 1AMUA 3O31A 4Z7QB 5BOSA 3W8DA 2VTBB 2VL7A 2ZYUX 4LE0A 4ZODA 4DCMA 3AF6A 3WX0A 1C8VB 4J76A 2QBYB 4G0VA 4A3SA 4ZYTA 4WJLA 1E1CA 1XRRA 5C46F 2AG1A 2PUDA 1EXNA 1PBTA 3SX2A 3A6HA 2C31A 1TMKA 1PD1A 2FX2A 2IBMA 4CEIB 1LLFA 1ZICA 3FD8A 3O9MA 3P2OA 2KLHA 1N2SA 1ORVA 1CJVC 2GKGA 4AF8A 1TI7A 5D7BA 1F8FA 1K7EB 2AI2A 5U4QA 2OZKA 3MBOA 2VP9A 2DFPA 2LGJA 3QNMA 1IBSA 3ZCTA 4FJ1A 2PLNA 3HI6A 4K88A 4DWJA 4NYIQ 2ZT6A 1CEEA 4UMVA 1U8CB 1ZAKA 1T3SA 2PK3A 4RD6A 2OCPA 3CF0A 3TWOA 3A2NA 4C0KA 3KV1A 1ARZA 1L4EA 4K8OA 1N9GB 2WVJA 3TLGB 1F3OA 1R37A 2R7MA 4KHZA 1VL0A 5AP9A 2J5RA 2V74B 3EEBA 3C6ZA 4LRTB 3D6NB 3HKBA 4YXWD 3MTQA 5HQ3B 1B0PA 4DR7B 2VH2A 3NETA 1A3CA 4JENA 4S24A 2EDCA 3SSOA 3BWVA 3CKKA 4TOIA 5EGSA 3X1DA 4DBVO 5K9ZA 2HNKA 1MPTA 1OH8A 1SU4A 3VJMA 2YJNA 4A5OA 3FG9A 3OVMA 1Q1NA 4MLZA 2CMKA 4TYMA 1JHXA 5DX1A 3QVSA 1VPEA 2G9UA 2E55A 3ENVA 4I4TA 3RS0A 4F3NA 4L5BA 4HEQA 1ML4A 4OK6A 1SBZA 4WN9B 2CB9A 3FR8A 3IPCA 1RWVA 4PSAA 3V8RA 3FTEA 1Z07A 4JT4A 4IIGA 3F3YA 5KWVA 1RZUA 1B8PA 2SKDA 1D8TA 5A5FA 5IM5A 1PQPA 4BNKA 5CDFA 4O4JA 4ZGBA 5CA1F 5J5CA 1KY5A 2J9RA 2WBLC 3N6XA 4H77A 3CYFA 3RBVA 1JAYA 4NZYA 1VHDA 2OXFA 1SH7A 1UZUA 2QB5A 4Q7JB 2Z83A 4GL4A 2OGTA 1N5RA 2AA3A 2HU5A 1UJ5A 1G42A 2Q6IA 3H2ZA 3WGNA 2AOWA 2P5TB 1H66A 1HT0A 1JQDA 1KO4A 3GIWA 5CHEA 1JG6A 1XALA 4WEQA 1KE2A 2PT7A 3IURA 5EIWA 2W6OA 4MTLA 5ARBA 4A8JA 4HGNA 3IQXA 3I04A 3OFJA 5A0VA 4QDUA 3L04A 1IY8A 3E9EA 4HNAB 1PJ4A 2RGRA 2J45A 3AYZB 3GAZA 4O4IA 4X20A 1KARA 5IANA 2YV5A 1NFFA 4FCWA 4GC5A 3IRVA 2FFQA 2VO1A 1W73A 2CZCA 4Z3DA 1B1AA 3GJQA 4QDOA 4LFBB 4X00A 4BECA 4IH9A 2AFIE 3QPAA 2CSXA 4P1ZA 5IYZA 1TQDA 3I4FA 4NZPA 3EGXB 3UWSA 1QF9A 3WKAA 1E5XA 2C42A 3WGJA 4Q3BA 2DTEA 1AKTA 1PHPA 1FMFA 3QU5A 4ESEA 1AS0A 4D9CA 5LOVA 3JQGB 4Z7JA 4A5SA 5JD6A 5KWIA 1BN6A 4P38A 2NSDA 2BR5A 5B1YA 4OEHA 2PWZA 1P6XA 3KKMA 3ZQ4A 4FSXA 3HUFA 4QU8A 4LOAA 1EX1A 2Q4DA 2BGRA 1L3BA 3C74A 3JD4A 2VDJA 3PFGA 4POAA 4Y6QA 1I30A 1VBMA 1S8FA 2ZAYA 1QVAA 3OM1A 4KXWA 2JD0A 3IR7A 4O2AF 1QOZA 4OLJA 4HZGA 4QUAA 2C0CA 2CVHA 2IOQA 3R4VA 2G0AA 3UJ3X 2JA1A 2PL1A 6AT1A 2JH8A 1V7ZA 3SPXA 1L5RA 1DXQA 4IQ0A 3D7RA 4KXYA 4BCBA 4KR6A 3H1GA 4OHXA 5T3YA 1R6BX 3U2QA 5KHOC 3R9XB 4WCDA 1JTEA 1JSZA 4BQSA 3BMNB 3U0BA 4TVOA 1QYVA 3N9IA 1O97C 3CUVA 4EF6A 4J1NA 1EXVA 1TA4A 1I14A 2FFJA 4E5NA 4LHZA 2XNKA 3A0UA 4I3FA 4QBTA 2EC5A 3Q8LA 4YAFA 4E33A 4UCFA 1YQTA 2CJYA 5AM0A 1KK3A 1Z0UA 3DE6X 3OD1A 4G1UC 4KNYA 4KG7A 2XY4A 2I4IA 2Q6VA 3RD5A 2W2TA 3O93A 4R8LA 5BWMA 3H18A 2AFHE 3T4PA 3ZX5A 1SBYA 2H52A 4W5OA 2X1LA 4EHNA 5M5BA 3BT7A 2LNDA 1LTHR 4EUEA 3JALB 2VEDA 5EQTA 3FTFA 1C4WA 1TC1A 4P3OA 1JGTA 2IYWA 1XEXB 2YFHA 4Q4AA 5LP6A 2BFDB 1Y1SA 5ECYA 1A7UA 4O33A 2FMUA 3D8RA 4JJ8A 1SUCA 2DH5A 3GEEA 4X7MA 1EXMA 4EECA 4EPWA 3CIOA 3RAJA 2NMVA 5KQGA 2ZWPA 3OLCX 4EZBA 5BRNA 3H5NA 1V7PC 3GPIA 4X0EA 2PRSA 4PC3A 5JMWA 4BV9A 1RMTA 1CUGA 4RHEA 4XCVA 3MJ4A 3WLLA 3GMDA 4MS1B 1SBCA 3IQZA 5FYQA 3V9PA 4DUGA 4QRIA 4XTCS 5ESWA 1A4IA 2JNWA 2UUCB 4RQAA 1T2NA 2HRCA 2ZSIA 2XDQA 1KAQA 3LG2A 5JNTA 1LBTA 3DD1A 1J1IA 2P3OA 3JXEA 1QAOA 3MYRA 1XNRB 1CXZA 3PFNA 3DPSA 4Z54A 2QLTA 2PT9A 3U9SA 2DHCA 3F8TA 2FN8A 4F9GA 1P9RA 3TB6A 4EBBA 5JEEA 5EKTA 4H0FA 3MQ4A 3OZTA 3S2ZA 4QOIA 2AVNA 3I2IA 1T35A 2G36A 1Y9EA 4LY9A 1WHTA 2GK4A 3D1VA 1K8ZB 3F1KA 4LZOA 3O95A 4C43A 5JXGA 2X4GA 4L28A 3V46A 1XPRA 3L84A 4FUQA 1FMCA 1YB7A 1C3OB 2JB9A 2O50A 4H60A 5DF1A 1DQNA 2Z5FA 2RGBA 3A1NA 4E31A 5IDWA 4EPYA 3FDXA 1SU7A 1QK3A 5M3BA 2FZ5A 4TGLA 4V2IA 3UQYS 1R6VA 1W1IA 3KLPX 4M7RA 1XF1A 1PZHA 2VDWA 3HMKA 3KSMA 4RJKA 3UCFA 2R7KA 2G77B 2QF7A 3IDOA 3CUWA 3GD5A 3T4EA 1VIAA 2PMEA 1M1XB 1QO9A 4LSZA 5SYNA 4RIGA 4N3CA 3MK31 1EGVB 5CVEA 5ALYA 2IS1A 4R0VA 4BYMA 4MA4A 1N5OX 4TYWA 1K0UA 5CFQA 2G71A 1BEEA 3BZBA 3JQDA 4JEUA 1S2OA 1S2GA 4ZMRA 2I5PO 4HSGA 1ZM7A 3P9ZA 1N8NA 4DA8A 3HFGA 4EIWA 1HO3A 4KJXA 4JYBA 1H2FA 1LW7A 1BMFD 3ZU5A 5KB3A 5DT2A 1DZIA 3FDZB 1NBOA 1UBEA 1VB5A 4LWZA 1P29A 1UWVA 2IYNA 3W9UA 2NX2A 2MSNA 3W6UA 3WGQA 5A1TA 4HMOA 2C7GA 3B48A 4TXNA 2EG5A 2ZIFA 4ENWA 4PYNA 4OHYA 1ULTA 4QBFA 3DDOA 3VKFA 1IMJA 2HDNB 2GOYA 4P31A 1XYVA 3PRJA 3OLXA 2HMYB 4GO1A 3TAUA 3T3MB 3ZXIA 1DCTA 3VGPA 3EAFA 1LEHA 3MFYA 4OKIA 3RK1A 2CHUA 1Z13A 2FFHA 5MN6A 1FDTA 4LCJA 3ORRA 5FOUA 4M1TA 3S8EA 4UNRA 4FGKA 4B47A 4LZAA 4FB4A 1XZKA 1LBEA 2X77A 4QULA 4D9JA 1OIXA 1JVNA 2O2CA 5COBA 5BNFA 2DT5A 4HLDA 1KC1A 2BGTA 3FWYA 4O63O 1UPAA 4QNNA 5J59A 2O4CA 2C8JA 4E5SA 5JCJA 3QVGB 2XUJA 1EJ2A 1GITA 3CE6A 4BCCA 2B1RA 2GCEA 4EUHA 1VKJA 1K97A 3BOSA 4U3JA 5JR3A 1E2JA 1SCUB 2CT8A 4DOMA 1V1RA 4DEXA 4TQ9A 4BE9A 1D9ZA 4XDZA 1DDGA 4J03A 4BP9A 2VRBA 3N0XA 1I01A 2WJWA 4GRAA 3RV3A 1QYRA 1HNZB 4IQ4A 5AM1A 4HGOA 3WGTA 4OM7A 4ZJPA 3QK7A 3H1PA 3WDLA 1U6KA 1XR3A 3A06A 3FVQA 4IDNA 1E20A 3DCYA 1KI9A 2WB2A 1C9MA 3CG4A 3H5OA 2ZSDA 4YJFB 5T5QA 1F8GA 3ZUPA 1JFRA 5DW3A 2BKVA 2W2LA 3GPBA 3HDTA 4N8SA 1EGHA 3A1SA 3MT0A 4WLUA 1R16A 3DHWC 3SYLA 3VU0A 5C1IA 1XMOB 5DEOA 1MC8A 4JUDX 2IEDA 5HP4A 3CUUA 5BMVB 2PX4A 4KYIB 1CD5A 4L57A 5A0FA 3VTAA 4B09A 1BGWA 1KVUA 2X8BA 4BJ5A 4RULA 4B32A 3ZWYA 2NSJA 5DCLA 3ZW7A 1Y33E 1KNXA 3FX2A 4MITA 1RSZA 5AHKA 4ND8B 3SIPA 2O8EA 2C3MA 4NLLA 1U2ZA 4XB1A 4YXFA 3FWPA 1F3LA 2J07A 4D3XA 1OI2A 1UL1X 5FTMA 2ZS9A 1CUDA 1ULSA 3OZDA 4BO2A 1USKA 4I8DA 1QLWA 3I9JA 4P3YA 5GVRA 4C76A 4FDTA 3F90A 3KKKA 3E2PA 4G0MA 3IS3A 3WAKA 3GARA 3WYBA 4OYLA 2YHIB 3JD0A 4URHA 1EGMB 1JILA 2HXGA 3WMEA 2P8JA 5FHQA 1PZNA 2XVXA 2ZYSA 2EKLA 3KVYA 4EATA 1B8NA 5F2EA 4J1TA 3TW8B 3CVVA 2C2ZA 3NW9A 4GYWA 2CBGA 4WH0A 3BJZA 3RC1A 3OEHD 3R6GA 3WGVA 4D9HA 5B3JC 3GZNA 1VG9B 4P4LA 1TU4A 2FZWA 2Z1MA 3AUFA 2V3WA 3L8CA 4BAZA 4LF6B 1Q0PA 4LF8B 3LRPA 1H2XA 1NMQA 4EK9A 4A0SA 4K8RB 3RF7A 1W52X 2FRDA 3ONWA 1U2DA 3L7OA 3HXMA 4FLEA 5TMPA 1N32B 2D5CA 4UW9A 1A0OA 3ESRA 3ILXA 4CGZA 3WWZA 1S4MA 4I36A 1KO5A 1E4YA 1UXKA 4DIUA 1CEXA 2FOIA 2JF0A 4FSDA 2H65A 1GTL1 3OQNA 2P65A 4OQFA 3V2GA 4I5EA 1QIKA 1UOQA 3E27A 4JYMA 5B4VA 1IUNA 2FMXA 1OD6A 4WW0A 5HF6A 3T7DA 1CQIA 3FA2A 1RLIA 2LIVA 1VSVA 1LWOA 3OZAA 2E6UX 2GFQA 4FFSA 5CJ2A 1Z7EA 3SNHA 4JUCA 3QVTA 1H3FA 3EISA 4CMEA 1E9EA 2HCFA 1T0BA 1YVDA 2R6GA 3C85A 2H63A 4MRSA 3C3DA 2E6KA 3VZQA 1XU7A 3ORSA 4RL4A 2VWHA 1HDYA 2XZTA 3RRYA 3VU1A 3UW3A 1HSZA 5HF9A 2KB0A 3RVJA 1N2GA 4LI0A 3QKIA 2YWBA 4GSLA 4XJSA 2C7RA 1VHWA 3PCRB 5IH3A 4CRWB 1CUJA 1R00A 1RJWA 4FONA 5E3JA 2ZJ6A 1QO7A 3E4CA 4X64B 1JHOA 1FNNA 2MT9A 1ZOOA 2NGRA 4RVDA 4JDUA 5K1ZA 4XGKA 4C2UA 1HH4A 1SCKA 1KAGA 4B7ZA 4BLUA 4E21A 3C0KA 4DREA 3ADKA 3TRKA 5H9WA 2E0IA 1YOBA 3K0AA 5H59A 4JUIA 3WGMA 4ZEMA 4M8NE 4U7GA 3NFRA 4QODA 3D3WB 4P82A 4IWXA 3NTOA 4O08A 4DYVA 2O05A 5EWLA 1QPZA 3U3OA 1U1IA 2WF9A 5KNCD 4PSCA 3C3WA 1B6TA 1WY5A 3BA6A 3QGMA 5EERA 4ENTA 2JS7A 4IVRA 5AK3A 1XU4A 3LK6A 3E15A 2BMFA 2D8AA 2XKKA 4Y67A 3WDSA 4C9BA 3HJCA 3SICE 1GG2A 4NBWA 5ENZA 3UQZA 1TM7E 5FTKA 3E3NA 4G41A 3GLIA 1YZYA 4ZI7A 2ZZNA 2K87A 4GR5A 3ZE8A 2JHAA 4HYYA 4BMNA 2BMAA 2Q5EA 4LIPD 5BSWA 3LCCA 4GBJA 4OI1A 4CN8A 4FEGA 2R84A 5A03A 4Z6KA 1KEKA 1DADA 1UMBA 3FFXA 4GICA 3FGOA 4HDRB 1AQNA 2Z6UA 1HDCA 5I4KA 2I6FA 3EVFA 3G2KA 2HCRA 3W3AD 9ABPA 5AKEA 4UDYX 4QDXA 2ZB4A 2GRAA 3CW9A 2PBRA 3IULA 1U0LA 3MS2A 1Q15A 2PBFA 3DE2X 4YC7A 1FTYA 3QI7A 5HJ2A 2POCA 1ENYA 2Z4RA 5T8KA 5DGXA 2JIQA 3LL7A 2CFSA 3D8NA 1IZ8A 1KI4A 3LMKA 1BS2A 1M9NA 2EEZA 1UBJS 2JZCA 4QTXA 3R7AA 4KFUA 2IJGX 4L7VA 1WUIS 3FBGA 1O4VA 4ZU3A 1SVSA 4JC8A 5FR1A 4A8HA 1PR6A 1BS9A 1EYZA 1JJIA 1H2WA 3MGGA 3OEEA 4GKAA 1Y89A 2I2FA 1CDDA 3TKAA 2G6TA 2RBKA 1XDGA 4E5KA 2OC9A 5AVYA 4LRWA 4CM4A 2PWAA 2ZCVA 3ETCA 4P3NA 1ZQ9A 4EZIA 1N2EA 5E95A 4HMPA 1O95D 1FP7A 2D4HA 4HH4A 4WFJA 3WLNA 4B3BA 1QHFA 3CUEF 1NXPA 1P6UA 1MB4A 5KTTA 1IJEA 4EJMA 1DQPA 1DT5A 5HKBA 5GAJA 2B98A 3VR4A 2YZ7A 2XB9A 3NHPA 1EWKA 2R4QA 4NZNA 2QDKA 1TFUA 4NG5A 2QTTA 2XQJA 4MUHA 4WEOA 3ZVMA 1XYGA 1KORA 1T3ZA 2FFBA 3LRTA 1Z5PA 3GMIA 3MINA 3NEPX 4NFSA 5FKJA 1YH3A 4ND7A 1IPFA 5EZYA 1E7MA 4EH1A 1PDVA 4JQYA 5DM60 1RZVA 1A9YA 1DEKA 2JIBA 3TCKA 1EEXB 1BHJA 1KDPA 4L08A 3SR0A 2ZI5A 5J4YA 2OCDA 2QXTA 4MV5A 4BO5A 3BH0A 5TJ9A 1GSHA 4CFYA 1KSJA 3DAGA 1AXGA 4WZBA 3FIUA 2DLNA 3R3SA 5F2KA 2J7PA 2OMKA 2VXOA 3HCAA 4PV7A 4XRGA 3KSBC 2JATA 1G21A 1CJSA 3KB8A 3DG9A 3HB1A 3H86A 1A69A 2MOKA 2CXHA 2PX3A 4ZANA 1T9DA 2WB4A 4PVCA 1XXHB 4DMUB 4UD2A 4DDVA 3U4HA 5LMUB 3T3IA 2Q5IA 4KODA 3CB2A 3CUYA 3TRDA 3DOCA 1FYEA 5K45A 4BBZA 3KO8A 3ROEA 3LM8A 1HNXB 3CBQA 1M0WA 3SFZA 1P62B 3SM9A 3DV0A 3H4IA 4QSHA 5LQMA 2PUFA 3IAUA 1U80A 1A9TA 1EX7A 2DWUA 1ISJA 4OGFA 4S1TA 2P1ZA 1OMOA 5EJ9A 1Q7RA 5T57A 1UK6A 4LYHA 4OUKX 5KQPA 1JT2A 1LJLA 5DEIA 2EP5A 4GYYA 3DS8A 1B2RA 1QE0A 2HSZA 1SHUX 3Q3HA 4X54A 5FBWB 5DBIA 4EHBA 2C4TA 3ANXA 3MOGA 2H9IA 3QF4B 2C5EA 3UMYA 1XD2A 4HDSA 4GGOA 4GXRA 1PX0A 3MGAA 3F7OA 4C4ZA 2CNNA 4KAXA 3KFVA 1WB5A 1FVHA 1UP4A 3BSFA 3K9HA 3F96A 3UKJA 1EDOA 5THQA 2Y99A 2V6IA 2JAWA 5JJKA 1QHGA 2VK2A 3QEJA 5D1NA 1MU0A 4X1YA 1P7WA 2Y1KA 1CRZA 1BKYA 1GYQA 2QW0X 3JVUA 2AMJA 3OLQA 3SN6A 3U7IA 1EUDB 2ZIZA 3IBCA 1UWCA 4HO1X 4C4AA 5EHZA 2FR0A 5CCXA 3IPRA 4WK0B 3QY0A 4GKJB 3L7BA 4NE9A 3GLUA 1YMUA 2G83A 3HB4X 1QTQA 1T2EA 2JIMA 3WJ1A 3S27A 2GJ4A 3ESXA 4UOZA 3G0HA 5ESRA 1NXOA 4ZEXA 1N2BA 2PNFA 3AHHA 1NW3A 3HNOA 3W1EA 4DRXB 1CR2A 4QYSA 2JIZA 3IEVA 4LUCA 1RWXA 5ICFA 3LYLA 2AW5A 3W79A 1UPXA 5BPFA 2CLCX 1IN7A 1BNCA 5GZ1A 2OHIA 2AG0A 1DINA 3U44A 3FBTA 3MELA 5C34B 3T9AA 1T4CA 3VHLB 4JNCA 4BX9A 3VVLA 1ZHFA 1SULA 2DFTA 5CBKA 1W25A 4ZIRB 3ZZTA 3N2IA 4NHEA 1FFHA 2F43A 2R4UA 2R65A 3MN1A 1E0JA 4PX2A 4AM8A 1SBQA 4Y6GB 4BCDA 5CXQA 5HUJA 3ZK7A 1N0VC 5DT9A 4N82A 5EZQA 4AUNA 1SIWA 4BGIA 1GTG1 1HNNA 2J0UB 2C57A 4RVHA 1D7AA 1QC5B 1OGIA 4JI4B 1GR1A 3G9QA 4Q47A 5IVPA 4XM2A 1AZSC 1T34A 3LFTA 2OCKA 3A6ZA 1E2IA 5DM4A 3KOWA 3K96A 3P0HA 3QKSB 1VSUA 4HEA1 2AE2A 3R6TA 5CA0F 2NVWA 3U19A 1JSLA 4P98A 4HPWA 4NCNA 4PX5A 1YA8A 1YS2X 2VHEA 1X7WB 1OX5A 2PO7A 4LCBA 4ZVKA 3TGPA 3VSAA 2QQFA 5AVOA 5TEWA 4TKVA 2A4MA 2XLCA 3HSKA 4YHBA 1TKAA 3BAZA 1Q0UA 5G02A 3TPZA 3PD0A 5AESA 4XWGA 1MT3A 4Q7EA 2CV1A 1BA2A 1Q11A 4JLOA 2ZSBA 3O9ZA 1NMSA 5FV7A 1XWWA 1OHHD 1PT9A 1ZI9A 1E2LA 4FCCA 1R15A 4IH1A 4ITVA 3TZHA 3SBXA 4HTFB 4Q4JA 1B4DA 1Y9AA 2XVZA 1F4LA 1JU4A 5D5PA 3HXQA 2EVWX 4XYBA 1K7YA 5LQJA 4BDTA 2ZAMA 4IOMA 2BH2A 3THYB 4DQKA 1MQSA 5G0VA 3KDSE 1N5LA 1U02A 2QP4A 3BJEA 4C3ZA 4CLOA 3RRNA 3RYIA 2JRCA 2G4LA 2HLDA 2IYSA 1PUIA 3FCOA 4XWAA 3ZVNA 4XIYA 3FHLA 5FOWA 3BJRA 4A7PA 4KLRA 1GFSA 5TRTA 4H7EA 2JFBA 2FW8A 4O2RA 3FNQA 3LCRA 4P35A 3JARB 3UVEA 5KJ6A 1WZCA 2RGUA 4NJMA 1XZBA 3PS9A 1YI0A 1QP4A 1B8UA 1OSNA 1JSCA 4MV6A 3IXQA 5KU1A 3FR7A 1E98A 3TBFA 2WUEA 4KYTA 2X5KO 4TTRA 1ZK2A 1E9CA 2QMHA 1SB9A 3R3JA 1BH6A 4H3VA 3N87A 2EHJA 4CDNA 1F60A 1C1XA 5AR1A 5TLSA 1DC4A 1XCMA 5JH7A 2AKYA 1QKJA 5KJCA 3FUVA 1N9KA 5HBRA 4JCOA 3ZV7A 4I6EA 2NO5A 4M37A 2P35A 4ALMA 3AJ9A 4UFPA 2RG1A 3B51X 2QRQA 4WKCA 2NPOA 3JR7A 4Y3UA 1XSEA 2DBQA 4C3OB 3PV0A 4BLRA 4JLKA 4ZCPA 5B3KA 3FCXA 4MWZA 5DCUA 1QS0A 1W30A 1YKFA 2FJUA 2E4UA 3QBDA 1EP1B 2VUTA 3V1KA 2CJXA 1AO0A 1VYUA 3C97A 3L6DA 4NDAA 1KETA 1F38A 1RM5A 1VIYA 2HMVA 2FDXA 4H08A 4NRDA 3RSZA 1QFZA 3OQJA 5F12A 2HZ7A 4UEQA 4IW3B 1M2NA 2QUIA 1L4LA 3D9QX 3VR6D 1U7TA 4MYUA 1DZ3A 3I9MA 4RCVA 5HMMA 2A0KA 2XMDA 4F7DA 3GEIA 3Q15C 4I9FA 1G7TA 4L6AA 2BGGA 4Q18A 3NONA 4ZOLF 4MMZB 3VNQA 5G40A 2IH4A 1LLUA 2JJ2D 4RHXA 3H5IA 2VATA 3U09A 3UW1A 4CYMA 2OKCA 1PX2A 3DWFA 2X1HA 4TTSA 4X1KA 2Q28A 1G8KA 1WE2A 2CD7A 3O2SB 4G37A 2X5NA 4KEAA 2DM6A 3UNXA 5BSHA 3PG5A 3GP5A 4OFXA 5FOTA 2IKQA 5G0TA 5FA8A 4ENUA 4DSNA 2JH9A 3N8IA 4KIFA 1VCMA 3AIOA 5EL0A 4E12A 3A6LA 1F8XA 5CFNA 1O87A 3P0JA 5FTWA 1PZXA 8ATCA 1C3LA 2B9VA 1BQ4A 4E46A 3FZGA 2IY8A 4H17A 1WRBA 4QQ8A 3EFOB 4XCXA 2NUAB 1W94A 3WB2A 2JCVA 4WKGA 1GHTA 3PFIA 1IWOA 2QR3A 3GGSA 1TGVA 1GY8A 3KDAA 4BP8A 4DB2A 3VU8A 4IEEA 3BWEA 5FL7A 3H75A 4MI1A 4HXGA 1QZTA 2NVBA 2FW0A 1O7JA 4J3FA 1CY2A 4Y0NA 1SHKA 3ZU4A 2OBBA 4MVJA 4FX5A 3DXXA 2AT1A 1M76A 4RFSA 1W4AA 4Z4QA 4NONA 3NCTA 3BSSA 3F6BX 3PNMA 3MWEA 3PE3A 2Z09A 3VHXA 4ARUA 1G9XA 1EM8A 4OBXA 5G4KA 1JALA 1PSZA 5JRJA 5GIPE 3NGXA 2C7PA 1Z33A 5C4GB 1N7HA 4R9RA 2IHYA 1WXDA 1OFTA 1JKJA 3TVTA 3ZD6A 2O2XA 4FLFA 1SVWA 3QI2A 4YIHA 1GAEO 2Q4TA 1MO3A 1CJBA 3IAFA 2LVBA 3PKJA 4IJQA 2DETA 4UXIA 3IQHX 2CHGA 1WOYA 3UPDA 1GM5A 2RHHA 3BB1A 1CUUA 2ORVA 2FAXA 3AKYA 3HYSA 4WJZA 5B58T 1QYDA 2JCYA 2IODA 2Q2OA 1WCIA 1OPXA 3H9JA 1EHCA 1Z8FA 3CTPA 3TZ6A 2RONA 4FOPA 1I5EA 2QDXA 3DNMA 2WPDD 4HLUC 4MRNA 4G86A 1TYEB 1W2WB 1ZN2A 4CQLB 1UJ2A 4G81A 5JZ9A 3AVWA 3OLWA 4JBLA 2BEWA 2JHPA 2QW8A 3FCYA 5JV5A 4A2WA 2XCRB 1ZGBA 4EUSA 3NHYA 4R6WA 5CB4F 4C22A 4LVOA 4FN5A 4Q9AA 2OQVA 3EDQA 1XNJA 1PT6A 4QDJA 5CCBA 2RAFA 4NZMA 1KJNA 1R5JA 3LHIA 1GGFA 1JPVA 2X0DA 5JI2E 3G85A 2YL2A 5DI3B 1E4EB 4UUOA 5K8JB 4RK5A 2HX1A 2YWEA 3PQ4A 2EBFX 1DLIA 2J3HA 3BERA 3WO0A 4M86A 4HWKA 4D5GA 1QMGA 3P27A 2YICA 1G18A 2PQMA 3D4OA 3F6PA 3H6HA 5FQOA 4DZTA 2A9VA 4KKXB 4JXXA 3DMDA 1EBUA 1FSFA 3NGMA 4ZKDA 3K5HA 5C7IO 3PHBE 1L5GB 3A2LA 4G4GA 4M4SA 2FGKA 4RTJA 3EVGA 1MENA 1G6HA 1UFRA 3MSXA 4OG2A 3EQ2A 4MDEA 4JLWA 2HK7A 2C9OA 1ZG3A 1WW3A 1RQNA 4FOSA 2W6ZA 2ZWVA 4U7FA 5DO9A 2PAAA 4AJ4A 5DXAA 2N3ZA 2X4IA 4E2XA 2AI3A 3F7MA 3KFLA 3RDPA 1R27A 2IHUA 2P30A 1T9ZA 3A70A 4PO8A 3I9LA 1RXEA 2Q1TA 4EHHA 1UOOA 1E18A 1P1JA 3BDIA 3F5FA 3GEDA 1E58A 1LX6A 1ZGCA 4HH1A 5B53A 4E5PA 1NG1A 4HS9A 2NO9A 2OYCA 1WMDA 2B69A 1SR8A 2YNMD 2G82A 3P0EA 5FO1A 1E96A 4UTNA 2AQIA 1T9KA 3PU6A 2CSUA 1S5PA 2I34A 3CO5A 3UPUA 1NBIA 1LRJA 3EWNA 1U11A 4WIAA 4XJXA 4D9GA 1ZIXA 1E5LA 1E4OA 4HNTA 1XQ1A 2PS9A 4JJFA 1TQ2A 4J2OA 4AZVA 5JD3A 4P6VF 2ZYTX 3IP1A 2P3QA 1V5EA 2A5GA 1IDOA 1WUYA 3AT1A 3LQRA 4HQFA 4B6GA 4CM3A 3T1QA 2FE1A 4A1FA 2QRJA 3RF6A 3KJNA 4D6YA 1M8PA 3X0DA 2R3SA 4GC9A 4Q5IA 4UU7A 2OG2A 3ROFA 4LN1A 4C29A 1U7DA 4UJ5A 3C7KA 3IQEA 3WL7A 1OWLA 1E1NA 2R68A 2G1AA 1SKYB 1ZSVA 1SEVA 4HQRA 1CR0A 1WDLA 4UPVA 4X6LA 4Q82A 2I67A 2R6R1 2A9PA 3ABQB 4QTZA 1LV8A 2F4NA 2DTXA 3F71A 3VZDA 1EFRD 3CZRA 2DQKA 3H9EO 4IIJA 1HDRA 2B7BA 3PGA1 3G0DA 5AJZA 4DV6B 1UBRS 4F2DA 1RAAA 2NM0A 3ETGA 2VNJA 5ESXA 1BRMA 3AR3A 3ESBA 1XAIA 1W59A 3JAWB 1PS8A 2CEKA 5KIAA 5B12A 3WKDA 4ADSG 1OWNA 2HBZA 1K4YA 2YJ4A 4GPZA 1NPYA 2NG1A 5HTOA 2C82A 1MW8X 3T4UA 3VR3A 4NBRA 4JLMA 3LW7A 1XZNA 3MCTA 3N05A 5L51A 1IK4A 1LTQA 2FSSA 4GW3A 3VPSA 5L8VA 1WKVA 3N39C 4U6NA 4NPHA 1FX0A 4YT2A 4PLCA 4QZVA 5CW2A 4RIIA 1Y1PA 4B43A 2RG7A 2OILA 4XVQA 4IYJA 1KMNA 1A77A 4FOOA 3GUVA 5E3IA 1ECJA 3QY9A 3DXFA 4L2IB 1MKYA 4LYAA 4WCFB 3W06A 1NFQA 2XCIA 3ELUA 2V5AA 4EY8A 2GLXA 3O3OB 3SF8B 1DJMA 1UIMA 2BY4A 4IVPA 2H1WA 4HDKB 2CXPA 3UMBA 1A2BA 1DIRA 3LIPA 3P2KA 4LV6A 1VP3A 3KSZO 3LUHA 3AIMA 3AFGA 2YNMC 1BWQA 3K1YA 4G36A 4JMLA 3LNCA 4REOA 1INLA 1CR1A 1G3IA 1O3YA 1U0GA 3K5IA 2WG1A 4FFPA 3AF3A 4IIEA 5ALGA 1RYEA 5FPQA 2DXIA 1W5BA 4TX1A 3TOXA 3GC6A 1DGQA 1GUZA 3FKSA 4TVSA 2YDYA 5TNXA 2GPSA 2W2XA 3OCXA 1E69A 4GX2A 2W43A 4P81A 1N2XA 4W7SA 4NBLA 3TRFA 5JNSA 1NUTA 1YU9A 2DJ5A 4WBSA 1CZKA 2AV6A 2WC1A 4R1NA 2PLWA 4UNPA 1QGUB 2Q0HA 4D97A 2OBNA 4E3ZA 4EITA 5K3EA 2QJFA 2VHVA 3HXKA 2F67A 2WFMA 3ZEAA 2UZ0A 4EOGA 3DQPA 3FHTA 2NU6A 4MKIA 4A82A 3LSTA 2FEXA 3DBHB 4M22A 2ZR8A 1WOMA 2LIPA 5DDIP 3TF5A 1E7QA 3OF5A 5D01A 4PYMA 1UBOS 2C92A 2WHEA 2C3UA 2JI8A 4FR5A 5KX5B 4RJIA 5C37A 1W0CA 3BMOA 3C15C 3M4JA 2NP6A 5DHRA 2HA7A 5LIRA 1WJGA 1J24A 2J6CA 2FQXA 4FGSA 2TS1A 3DZHA 2XUFA 1EWVA 5HILA 1ODJA 1UM9B 1XL0A 4JJ7A 4LX0A 5EHXA 1KEZA 1GNQA 2VLBA 4E94A 4PLFA 5JHGB 1U5AA 2JVJA 4FI3C 1JB9A 4UEWA 2PT6A 1Z8DA 2VSOA 2BTOA 2FU5C 2O2HA 4BMZA 2ZQZA 4E11A 2YXEA 3M89A 1PUJA 3FDIA 1KDOA 1ZGJA 3I05A 2R2AA 2RHBA 4BV3A 1EHIA 4XKJA 3BRWD 1EE1A 4RHUA 1FFDA 3ZY2A 3K8ZA 1Y0BA 4MUKA 4RJTA 1HRKA 1ZCAA 5B5SA 3MUFA 1QWSA 2HIMA 2IOFK 4I08A 3TTYA 4YAUA 2BFFA 4HN9A 4KLNA 3MWGA 4HDNB 5D5HA 4M1QA 3V1UA 5IJ9B 3WWEA 2PXXA 4M0LA 5FP0A 5IK2D 1SRRA 1X15A 1LBHA 1MIOB 4A23A 3A9WA 4RZIA 4Q6BA 4I4CA 5GZ6A 3IAXA 2IV7A 2ID7A 3TKYA 4GDMA 1YC2A 3EG5A 1OT5A 2PN1A 3ZHCA 2CMFA 1CJUC 3HB9A 1XKTA 3C45A 3MRVA 4HFRA 1SCQA 1U98A 4ZPJA 4Q16A 3HFJA 5F1OA 1ACMA 1NOKA 3SZLA 3L8GA 1S7CA 1QKIA 1T9BA 3IQGX 4J3JA 5L3ZA 4Z53A 4GP6A 3D31A 5KTPA 4MRMB 1AS3A 1TJ3A 3N2GB 4EGQA 3WMFA 3JRNA 1W49A 3TGLA 5J5VA 2HCJB 1M74A 4A6PA 1E1QD 4BX3A 4DLKA 3KZOA 1DVRA 5KTNA 4YRZA 2QGZA 2NUPB 5LSAA 3NYIA 3BGDA 3G79A 4QUJA 4D8VA 4MVXA 3HU1A 3HU2A 4KDRA 1P1CA 5FWXA 1XE3A 2I33A 5A4DA 1JX6A 4IV0A 4WL0A 4YRPA 4DXDA 2RK4A 5CM8B 5DM70 5BUCA 4YJGA 1ECGA 3TEMA 3B1VA 4EG1A 1SZJG 3OZUA 1II8B 4RY8A 1BXZA 1KI1A 2JC3A 2AYZA 2O20A 3L92A 4ZVQA 5L95A 2GVDC 3KSUA 4FMDF 3GO4A 1KYZA 1FW8A 4OB6A 2XUZA 1BX1A 1SHTX 3SOPA 4K9NA 4LGMA 4S3MA 3OCJA 3TIFA 3WL5A 1PG0A 4BVAA 4LE1A 3WHPA 1JIVA 3AKZA 3RFFA 5HDBB 1OOEA 4BMSA 1QF7A 3QYFA 3UAGA 4X6YA 3KE8A 3UK0A 1MAVA 2ETXA 2WAAA 3EVAA 2IYZA 3EVDA 5TPWB 3UC5A 3I5MA 4BN5A 3GLHB 1TX4B 3RS4A 4DBLE 5BV2P 2Q5CA 2K6GA 1BFDA 2HBQA 4OIMA 3RT9A 3PXGA 3EIWA 4CQMD 5KWSA 1OI7A 4EKEA 4JXJA 4Z1OA 5CAEA 3H2SA 1GU0A 4V3BA 5EIAA 5CLJA 3KT6A 4GKKB 2YZNA 5H68A 1Z5UA 2HCBA 2GCOB 4AFNA 3QW2A 4HEA6 5I7OA 3FPHA 1MXFA 3R20A 4D8WA 3VPFA 2RMKA 1X6VA 1SKYE 3GELA 2E5WA 3H9GA 2C96A 2GD0A 3NM6B 4KNVA 5IBQA 3TL3A 2JH3A 4MXDA 4M1MA 4ZGWA 4HD8A 5F9MA 5EJMA 3RARA 3HJRA 3RFUA 1MUUA 2XH8A 1P77A 4IJKA 3E58A 2NVUB 3STWA 2YMPA 4CMCA 4ZQEA 3N6RA 4R0MA 1PW5A 3WLJA 1D2GA 5EHNA 2CL6X 3UKOA 1FRVA 4YAKA 1L5OA 3ZQKA 4J8PA 2GHIA 1I94B 4ZI5A 3TRHA 1JLLB 4EL0A 3A9CA 3Q0IA 4MO9A 1XN1A 4QQRA 4X5OA 1X3LA 3EIXA 3OBIA 2IRWA 2O0JA 5AKHA 2NXJA 3AEZA 2Q99A 3ADCA 1K8RA 3OEWA 2X0NA 3HDJA 3F49S 4JROA 1VE9A 3EB9A 1KSHA 2DCUA 3MUOA 3ZD8A 4LNUB 2ZI4A 2RHWA 4I5IA 2QVGA 3LUCA 1SAYA 1VKNA 3WRWA 4HGRA 1EX9A 3V2IA 1E2DA 3F3SA 2ZUCA 1ABBA 4PLGA 1BE1A 4Z7NB 2QJTA 5JSFA 3FI0A 4P2GA 1KDZA 1UAAA 4CEJB 2DZDA 4RNDB 3WB1A 1Q7EA 1JNYA 5LWHA 1K86A 3VOBA 2YTZA 3MVEA 3P8ZA 1H3EA 2VC2B 5IJWA 4E7OA 3GT0A 4AY2A 4Q34A 3AEQA 1VDMA 1Y42X 2GTHA 2H4XA 2Z9CA 3D7NA 1FDRA 3UJ9A 4RPHA 4QVKA 3KQMA 4X1OA 4DIOA 2PH7A 5T4BA 2O2JA 4IEFB 1AGXA 3PC6A 3OQHA 4EO4A 1PFUA 2F9FA 2EFCB 3KB2A 4X71A 1M5UA 4B3XA 1E9DA 3L18A 4N0PA 3ZZ1A 4B3GA 5U4XA 3DW3X 1ORIA 3ZY6A 3FNGA 4HFNA 3DVAB 1PCXA 4TTAA 1L5KA 5EMMA 2A59A 4LK2A 5JUWA 1JKIA 3UYKA 2BR3A 2JRLA 2WT8A 3GJXC 2XMRA 2JLZA 1P9NA 1SZPA 2WU8A 1QZZA 4NV1A 3OA2A 4MGEA 4GOJA 3W9BA 4BKRA 5C5IA 2AMFA 4RGBA 3AG6A 1MB9A 1GV1A 2IXEA 4LV5B 4CKCA 4IHKA 4YDHB 5FCDA 5A3QA 1Z36A 2LTAA 1N5DA 1SXJE 2WIBA 3WK5A 4OB8A 3FNHA 2P8SA 5KI6A 3TFOA 1ODFA 4MKHA 3D7SA 1E2KA 3DOUA 2ZJOA 3KVRA 4JUAA 3KYIB 3RVQA 3UH1A 1X7GA 1Z9BA 1QH1A 1OJLA 3GQBB 3CLSC 5IMSA 4NAUA 2EOAA 3U4QA 2C1ZA 4KTTE 1N4AA 2X7JA 3WV4A 3Q88A 3GMSA 2X41A 3OZWA 1VL2A 4YCDA 1O0SA 1XA0A 2QVXX 3ETEA 4K40A 1XB2A 2FP3A 3EC2A 1OA1A 3Q3VA 3NP9A 1K6JA 4BTLA 4TLCA 2NN3C 2GN9A 2X8AA 3FVVA 3KTFA 2KS6A 1DS6A 3L46A 3JQ9A 3V55A 3NUGA 4B76A 1G5QA 1T4DA 1H42A 3H7AA 4QHYA 2JIOA 3QTTA 3ZE1B 3K09A 5LQAA 1KSFX 2ROQA 3I4LA 1Z6TA 2G25A 1NM5A 4WVLA 1QHEA 2P3LA 5I3CA 3RRBA 4G5RA 1OAAA 3ZV4A 4MR8A 1OUMA 4LI3X 2IHJA 3CVXA 2DFNA 1JYEA 3U3KA 3IR5A 3HJFA 1GXSB 1BEUB 1W0JD 2YZMA 4Y98A 1P1HA 2VYFA 2FLKA 3DPUA 3FYUC 3DEFA 2Q5OA 2PKQP 4GMGA 1QZXA 1B1CA 1Y5IA 1UOPA 3M5PA 4FHCA 3K4PA 2HNBA 4GP9A 4LYEA 2ZUFA 4OGGA 3WZ2A 3K6RA 4I55B 3O4FA 5E7MA 1IIRA 1KMHB 3IV7A 1L2TA 2ZVDA 3KVVA 1SOUA 5K0LA 2ACEA 4QHTA 4L73A 4ZCLA 5HUHA 2HN9A 4B3RB 3R44A 3AZPA 1YQUA 3TD6A 1ZUHA 5IKOA 1XCGB 1GA4A 1P0QA 1RI5A 2WAYA 3ZWBA 4Z5XA 1FJ2A 1P5HA 1E79A 1NMZA 3QJGA 1WDTA 3I30X 2HBRA 3DVLA 3DDWA 4GZ3A 2GYUA 2HIHA 4QJ5A 4TV8F 4DR2B 1OBVA 1LK7A 1GQOA 3OX3A 4R5HA 4AW9A 4YMWA 2VH1A 5BT9A 2QL5A 4HWPA 1L9KA 1D0VA 3IDAA 1SA0B 4JS0A 4AWAA 3E23A 5AKZA 5JQGF 1TIKA 3QIAA 2LZ0A 3ULKA 2VF4X 1F12A 2XMBA 1EAYA 4O1HA 2V7EA 1SWWA 5J47A 2W4IA 3QPUA 2C84A 4PSDA 1RD4A 2D1TA 4MRVA 1O54A 3O3CA 3QEBZ 4LDAA 3RVBA 1J1UA 5IKPA 4BVFA 6REQB 3L07A 3U3RA 3K70D 3UTCA 4D80A 1N0UA 3FTQA 3C4VA 4A73A 4GR9A 1VYTA 1M2EA 2E3JA 1R9GA 4Z99A 4Z9FA 4O1MA 1NLFA 3FGZA 3ZJUA 5DX8A 1UJBA 1MVOA 1E5DA 2M6RA 2JBAB 4OHRA 1NXWA 1KPHA 4XFJA 3KQNA 1LKZA 3DOEA 3KYDA 1X42A 2IZ0A 1P5JA 3L9XA 2IYRA 2P2GA 3HVIA 3PNLA 3L0BA 1XAGA 4J4BA 3R41A 1LD3A 1CPYA 1HE1C 4PQGA 2QS9A 1G4UR 3RO7A 1T5SA 3ZH9B 1MC1A 2VYVD 4Q1VA 4CLEA 4RETA 8LDHA 5KYGA 3DEYX 4DIKA 3NQ41 4EL5A 1F5SA 2WFLB 3A25A 3DKPA 2H07A 5GIOE 4G5QA 1YTUA 4HCJA 4AL4A 2JZNA 1NPDA 3E9CA 3OZRA 4UJ3A 1IZZA 1BU5A 2F3RA 1ZYUA 1ZQ1A 3ASUA 4I0WB 1MRZA 4FMCB 1GGNA 4LJ7A 4M6WA 1IBLB 2EQBA 2QM0A 2ZW9A 2V5UA 1P8JA 1XTJA 4G9EA 4L4UA 4LJ4A 4ZO7A 1TD1A 2ZIGA 2BCEA 3JQ7B 1GCAA 2BISA 2H29A 2VKTA 3LTNC 2VZ0A 3G0IA 1JU3A 3EQ6A 1RPJA 1GZ6A 4BZWA 1HNWB 3CEHA 4PY2A 1M1YB 2HRDA 1U2SA 2NZXA 4GQBA 1UZAA 1RBMA 4AMZA 3C8ZA 1WCWA 1K2WA 1Z4MA 5FF9A 4A16A 1UKEA 1AMOA 3UAWA 3VSDA 1EBBA 1KI2A 4N3AA 4QLAA 1FTQA 1ZNZA 1T5TA 2DR3A 3LGAA 1I9GA 4L75A 1ATZA 4WDQA 4RKYA 1MJNA 2H1HA 2JFNA 5E9AA 3HJUA 3UAYA 1L4BA 2HV9A 3B1KA 3UZUA 1A9OA 1ECLA 1XLWA 2QL6A 3L7IA 5EXDA 4IRUB 3DLHA 2HUNA 4CBVA 2Y1EA 3M3HA 4IDQA 3SDSA 3THWB 1XLVA 4OQZA 3I6BA 2BH9A 5A7HA 4QA9A 4O4LB 2P9CA 2ANCA 2I29A 4OHMA 3CH5A 3K70C 4DCGA 3D8TA 4M0CA 3FPAA 2RAPA 2IE0A 3NALA 4QDKA 3AVTA 4UHKA 2Q4OA 4WBNB 4AICA 3JQ8A 3QXHA 3LUGA 4PNZA 1J25A 2A35A 1CY0A 1L8AA 4KQXA 2BSQA 3R7DA 3L6BA 3PYMA 2V6GA 1M1NA 3ECCA 2CYCA 3WZMA 4K0KB 2GD1O 4B82A 5IUNC 2V03A 3QKRB 3R9WA 3R0VA 4QAQA 4GECA 1Z0ZA 4X90A 1F0PA 2DFLA 1KO8A 1X39A 2AWNA 4GGMX 4L5CA 3G2QA 5CDYA 3ZDQA 3E5HA 3D2BA 4S1OA 1J8QA 1N2CB 4F9FA 1NULA 3RKRA 2GAJA 4PCUA 4M2LA 5F4BA 2Z30A 2I2WA 3EW7A 3AUXA 3JD3A 1JE1A 1K5HA 5E7QA 2O54A 3ZGVA 4GGPA 5IXJA 4UU1A 1E6UA 4R3WA 3P2IA 2DC1A 2RBGA 1PLJA 2XT6A 4ILEA 3V3TA 4HMQA 5FV4A 2AH5A 4OLFA 1R12A 4RWZA 1D2MA 1C9NA 3E9NA 2ZE5A 2G8NA 3CHYA 5LN1A 1EVIA 3GRZA 3H65A 4QO7A 2OBYA 1BFKA 5FI5A 5I9MA 3PPWA 4ARVA 4ZQHA 2BI8A 4XI9A 2JEOA 3VFDA 1NRXA 3RVPA 1TOAA 5JDCA 1F48A 2NZYA 4KP7A 1AB6A 1PEAA 3A6EA 4RHFA 4PZZA 5H70A 1ODKA 2Z8YA 2JFZA 3LC7O 2GA9A 3DCNA 2B4QA 4RXMA 4U2GA 3FROA 2HKIA 1Q0TA 3CZAA 2X3FA 1EG2A 4TL9A 3RJMA 4U2KA 1TIBA 4DB4A 4YCSA 1LVGA 2WV9A 1B93A 1N0WA 4JBNA 3BE4A 2BGLA 3ACBA 1CUVA 4Y2JA 4LDNA 4L50A 1LPPA 4CT5A 1SIBE 4JIMA 5EFOA 4AF7A 4DIBA 3Q6NA 2GAAA 3OPYB 4LVCA 4RPIA 3Q8MA 3KAPA 3HU3A 1LRLA 3DE5X 1EK6A 3L8EA 3LP5A 3V42A 6PFKA 3WAJA 3UK1A 4LFAB 2V4UA 3K94A 4B4KA 1NQAO 3QOYA 2JFPA 3TL6A 3KR1A 2N1BA 1YVUA 3DTNA 1JEAA 5D8DA 3FPBA 2GHTA 5THXA 4BNYA 1XDWA 4CCYB 2WIGA 2Q5LA 1MORA 3L7JA 3W77A 2RARA 3IPLA 1I36A 3K0BA 4QKQA 4Z49A 1ISPA 2EFEB 2O8CA 1Z5ZA 1A8UA 4JK3A 4NOJA 1X8XA 1H1LA 3MAAC 4QARA 1I3OA 3VAYA 4UOEA 3LQ2A 5JYBA 2FDCA 1NW6A 5J5AA 1LPSA 3NXSA 1P5RA 5DOZA 2GZHA 2V7UA 4ZAWA 1ZJWA 4IGEA 3CJRA 2JAPA 3EE6A 2BE7A 3HYLA 5EUQB 5AQEA 3GOHA 1U3VA 1GRNA 3M1LA 3NU1A 4OMCA 4EGFA 4D3ZA 4F1WA 3HKEA 1L1RA 3QLJA 4EFLA 3U7QA 1DHRA 3QEMA 2QSYA 3QELA 4KFTA 4BLPA 5ALNA 1EFDN 3QH4A 5IJZA 2NP7A 4MA0A 5T4EA 3GF4A 3JCZA 4F1JA 3K73O 4B8YA 4FFBA 3IXMA 1R5BA 4MUGA 5A71A 1B23P 4ZTBA 1TVMA 3QHPA 1B73A 4RD4A 1OLUB 3ZLBA 4RENA 2EATA 2QG4A 1I80A 3CMMA 4HFMA 2DTDA 1BMTA 1RHRA 2PU5A 2OQIA 2O9JA 2GXQA 1DCKA 2QQGA 2R1TA 4G4JA 4XWYA 1U7PA 2I62A 4J91A 3SD7A 2B99A 4Y6RA 1XK6A 1E3LA 5UKDA 1BTOA 2P2YA 4K6CA 4RSGA 2X2OA 4QATA 2YH2A 3K3PA 1NP3A 4BLOA 2PKRA 3QTBA 3HR8A 1AK9A 4IIHA 1ZMBA 1Q0RA 2M6SA 1MOPA 4X3OA 5EKDA 3FHJA 1SQGA 1VDZA 1GQQA 1VI5A 3GZJA 1DAPA 5J2UF 2C7OA 3NBAA 3QFHA 1UZMA 5IAOA 1FVXA 1M2KA 3ES9A 3A9VA 4ITRC 3ZXUB 3ZIAA 4C7XA 5LYJF 5B2ZA 2R9VA 2RH4A 3I6MA 4AZ3A 4LHSA 4Y6SA 1K1EA 1XD9A 2H2IA 2J9GA 3LU1A 1HYHA 1T5BA 4J0EA 4YS6A 1M1YE 4HNHA 3IOMA 3DTVA 3JQQA 5IEBA 1ZN8A 4A2PA 2YJ3A 1NBME 3ZWXA 3T5GA 4PS1A 2XYVA 4P0PB 3JQBA 1RPAA 4LXTA 1Q20A 3THXB 2ZGVA 3G2NA 1QFMA 1RQRA 4EG0A 3OESA 1RADA 1N2OA 3OPQA 4XR9A 5FYDA 4HWGA 4OGLA 2XD4A 1GPWB 4L07A 1G59A 3FVRA 2I4RA 2RGGA 3L49A 4NF2A 4J7XA 4EELA 1VPWA 4OI0A 1EMDA 3NWPA 1HFWA 4XH9B 1T5HX 3A1EA 3EODA 5K6TA 1JPUA 3E9RA 4EY5A 1MDFA 2C7VA 4PYKA 3TAXA 5J2TA 2DQ4A 2RE8A 3WYDA 1UADA 5TT0A 2D8MA 3RNLA 3UOAB 2PQ0A 3KJEA 4RTOA 5E1DA 2GMWA 2X9LA 2YVAA 3C3KA 1TK9A 4DBLC 3OM0A 1YS7A 4YIKA 5TIIA 1YZTA 4Q02A 1PVOA 2AF4C 2CBXA 1S8NA 4GM0A 4KL8S 5FBVB 2X58A 4K1LA 4C7MA 2Y0EA 4G26A 3IT1A 5HRAA 1X9IA 4WFIA 4LNAA 5FTNA 2A9QA 4DC0A 1PT7A 5KQSA 4DTCA 3KLNA 3AUAA 1PGOA 4KK3A 1NJ8A 1X1RA 4C2BA 1D5CA 1LFAA 4MW6A 2FMIA 4MGIR 1MQ8B 4CLXA 3PUHA 3OQIB 5ED0A 3QW4B 4J6EA 4PRKA 4ANFA 2PSDA 4JLUA 1XTRA 3KR9A 1G3QA 3NBXX 2W4MA 3O4IA 5IS2A 4MV7A 4ZYYA 2VRWA 2QA5A 2XE4A 1H6CA 2R5NA 4WESA 1V3UA 1YL6A 1JA1A 3E2IA 3VNSA 2FPUA 1YHNA 4C4XA 1F1BA 4BX2A 3AHGA 2JI6A 2GBIA 4FMPA 5ERYA 1SXPA 1PV4A 4ZK6A 3N07A 2V96A 3WXMA 3WQRA 1NLMA 1XA3A 5ALMA 4CG0A 3HSYA 2AC7A 2Q3CA 4UAVA 4O1IA 1GG8A 3TW6A 4DR6B 2P9EA 3CBGA 3TW4A 1JEYB 4X92A 1DU4A 4ZRMA 1T26A 2EL9A 2WHXA 1UXIA 3ZI0A 4FR0A 1L7MA 2Q2WA 3K9BA 4DTIA 3IYLW 4QFCA 3RIGA 1UDWA 1VRVA 5BWBA 4M0MA 5F3WB 1W4BA 1QYWA 4GMDA 4NZ9A 2MWMA 2ONZA 3BGIA 3QKTA 2QZZA 1CNEA 3HVHA 5CBPB 1WQ3A 2GM3A 5DNVA 4LE2A 2Q7XA 4QYTA 1TQHA 1UEIA 2CLSA 4MSUA 1FS4A 1V37A 1U2PA 1PQWA 1ECFA 3PJEA 3U5ZB 3RYCB 1PVVA 4INPA 3IILA 4FGZA 1BDBA 3KWJA 5B2FA 2OV6A 1R1DA 2E4YA 4HUQA 4A27A 2PRIA 1W4RA 4N6NA 4KPUB 2FG7C 3OO1A 4BO6A 1JFTA 1DTWA 4FHEA 4ZA2A 3PCXA 5DTQA 2NU8B 2UYCA 1V4VA 2O1XA 3RJTA 2W6JA 3GVXA 3B1JA 3CSDA 4EPRA 1Y7PA 3WC4A 4BNIA 1JIXA 3SR4A 5DN9A 3UHFA 2FXIA 3QM1A 2A67A 1V39A 2JJQA 3JQFC 3VU9A 3DO8A 5FWNA 2DR2A 2OBFA 3BFJA 4AQ7A 3LVQE 3TLXA 3NAZA 1SXJC 1Y80A 2WYVA 4NZOA 5DK6A 1H4QA 3LXRA 3GY0A 3V8VA 3OMLA 2VJAA 4JU8A 4EO7A 1LDYA 3DE0X 3ND5A 5SZHB 1HZJA 3DT9A 4UQOA 4YXWA 5AVSA 2BFEB 3B5IA 4F56A 2QY6A 1Z63A 5G53C 1FDSA 5ER6A 4GZ6A 1RT9A 2YXNA 3N2KA 5SZIA 4MTCA 2QN2A 3BG5A 1NXXA 3NFYA 3SWWA 3RCBA 3QX3A 2I8CA 1SHLA 1PWZA 1ZVMA 3KNZA 3L40A 1D1SA 4YYEA 3SC3A 2PLFA 4XUCA 4KXQA 2FFAA 1OFUX 2GYYA 2PH3A 4P5DA 3TI9A 4P58A 2M1XA 4UEOA 1QX3A 1U31A 3H4TA 3T15A 1CJTC 2GAIA 1SQ0A 3PDIA 1B3BA 1NW5A 2ZDGA 4IJWA 1JKFA 1A27A 4JJ4A 1QPBA 1WHSB 3CX3A 3JV7A 3BL6A 4L5YA 4C0WA 3L5KA 3HK2A 4II7A 4OLAA 2ZRJA 1G60A 2BHTA 2F48A 2CMHA 4WNAA 3EBOA 3H8SA 3D2LA 4HC4A 4WACA 4ZARA 1QH9A 2PNJA 3T3HA 4ZZIA 5IHPA 3I83A 1E9FA 1JI0A 4BNTA 3EDOA 3ELDA 1HYGA 1PLKA 1N1MA 5AI8A 1THMA 1IXRC 2IEAA 5D7NA 1RM3A 3EIQA 3SXJA 3WR5A 1X38A 3L7MA 3R5SA 2ZSFA 5HCNA 2HNAA 4QYMA 4KR7A 4I4TF 4GXTA 2D2EA 1FVFA 3C14C 1C50A 5EZ5A 2QVYX 3SX4A 5CA1A 3MWFA 1RR6A 2AQHA 2EGGA 4HYQA 4MQ5A 4B6PA 4YT4A 3RRZA 3PEYA 3TQRA 1A2KC 1N0IA 2C03A 1P0IA 1P1FA 2YVQA 4E30A 5C3UA 2BTQB 5ITWA 1AHPA 4D6XA 1GARA 1YO6A 1I33A 3KYCB 3FZYA 1MJGA 4X85A 3W9YA 4AJ9A 4ZAYA 4IHJB 1OV4A 2WLTA 1NNUA 3EGDA 5KPDA 1E3SA 2A9FA 4F9EA 1I2ZA 3BTOA 2ZRNA 3KZXA 4FHFA 4NPCA 4RY9A 2BPOA 2R85A 3RSLA 3URMA 4H35A 2FPOA 1AXRA 1YQQA 5FWYB 1ZPDA 3LRXA 2CNLA 3DO6A 3SVZA 2CUNA 4LZZA 1X7XA 1L7VC 2FCAA 3LOUA 4OD0A 1I24A 1YJCA 3UAXA 3UXHA 3ZHXA 2O8BB 1M5RA 2XQGA 1OWOA 4GI2A 3OG9A 1N4DA 3SC2A 3TYXA 5F52A 1Y1TA 5A6SA 4DLBA 2BF4A 2P9ZA 4PWZA 2FOLA 3FAZA 1EK5A 4XASA 4AY4A 4BAUA 1NNEA 1EB8A 3FOZA 3ZWDA 1HURA 2OOSA 1I0LA 3TOZA 4LK3A 5KTSA 3PQ2A 3N8DA 3WL4A 1Q14A 4M36A 5K0TA 1WUHS 2G70A 4Q66C 2Y1GA 3Q3JB 3LUBA 2WKSA 4M3NA 2P27A 1CS0B 4DDUA 4JLJA 3SX0A 1M7HA 1HDZA 3VMMA 3GDWA 3R0JA 5D87A 2PPLA 3KKQA 3HVUA 1U2QA 3JQ6A 3AG5A 3N0TA 1XZPA 1TM4E 4YMSA 3TQTA 1UIRA 2FRXA 4P3XA 5LOVF 2J48A 1TMOA 4WLEA 3RYFA 4BRZA 3M4NA 4YHHB 3RYTC 1R8JA 1REQB 2HJRA 3EQ7A 3PLNA 3NX4A 1QG0A 3SS9X 4ZVVA 1ZIOA 5TQJA 4UE2A 2L17A 3GX1A 3Q7EA 3FMVA 2Y1CA 5E6RB 1RCFA 3GA0A 4NMWA 3TQHA 1TQ4A 3FF1A 1Z62A 3LY9A 2I6QA 1WV1A 3K9QO 4ZVRA 3U7HB 2D1QA 3CKLA 1VXOA 4ISBA 2FPGB 4UAGA 1UMCA 1PTKA 2FKNA 3LPNA 2CL5A 3NHLA 1SQSA 2QZSA 1EESA 8AT1A 3V1MA 3SCZA 2NU7A 2HADA 4KE6A 2LCFA 3UT6A 4W99A 4ITUA 1D04A 4G9GA 5D3MB 2R11A 1R0CA 2W2KB 4MV0A 4ZCRA 4S35A 3EVEA 4FZVA 4OBBA 1QHIA 4JYCA 3DWGA 1ADCA 2ZRGA 1KMQA 1DDOA 1MJFA 4KBFA 1W6UA 3SBEA 3V4PB 5HJEA 4KUEA 4ATNA 3O1HB 1FJXA 1IK6A 1RYDA 1DBIA 2WM2A 3ABZA 1G20A 4AP5A 3LUAA 4P4NA 2I4OA 3P9XA 4FZRA 1R3DA 5C4IA 4BNVA 4MV9A 4ZZ1A 3H9UA 3GLTA 1G2QA 2DHDA 3RVOA 5IAEA 4ZV4A 3EIFA 1DKOA 4WE3A 1M6NA 5HIJA 3INTA 1XZMA 3KTAA 2OESA 2WD8A 4KE8A 4M49A 3CGGA 4AB1A 3B2NA 1E6CA 1U8AA 4F2WA 4TUYF 3TCNA 3V48A 1VMDA 1Y6JA 2I1VB 3R7NA 4EW3A 1UFQA 1WG8A 4EJSA 3EXFB 4BBPA 3ESDA 1CE8B 1V96A 4PNPA 3IMGA 5CVCA 5IAKA 3TINA 3WNQA 4KWTA 2IX3A 4PGGA 4JD5A 1AQYA 3MPOA 5TS2A 4M54A 5DIFA 3PFHA 4GD3Q 4D02A 2J9XB 3JVDA 1P4AA 1L8QA 5CM2Z 3SSAA 4BQPA 3U7FB 3QFRA 5ARDA 5KWJA 5JDIC 1KEEA 1RTTA 1EDDA 3EWSA 3I62A 1Z06A 1XFAA 4ZC8A 5JNWA 1OFHA 4ZQGA 5EQDA 5KYNA 4Z9YA 4FDAA 4EQ6A 1O2DA 4RK1A 4C4OA 3KR2A 4IIVA 4WZZA 1ZUIA 3CSSA 3E35A 3IP6A 3QIVA 5D3QA 3S5UA 4KKVA 2HWKA 4UXHA 3L7YA 1R6UA 1XUOA 3AR4A 1SJ9A 5NLLA 2IPOA 1JDBC 1VP9A 3DR5A 1FEZA 2PMKA 3CSUA 4KZKA 3HB0A 1FLNA 2CCGA 4BVLA 5BYKA 2B4YA 5LZ4A 4TWBA 4A15A 3D0OA 4ND5A 4Z0HO 3DZJA 3Q1LA 4B3IA 3NWEA 3T94A 4LZJA 5K7SA 1N77A 5JNUA 5KOJB 4E5DA 2WAXA 5FT9A 1WMFA 1R4AA 3GUZA 3BGOS 3LECA 4NOMA 4EZEA 1ZSYA 2IYVA 2W70A 5AI4A 1JPNA 3NHZA 3ZCPA 2PIAA 3COJA 1XROA 1KQ3A 3PHHA 3VKWA 1OKKA 3MTIA 1K6XA 2X0FA 4NXNB 2H7VA 1HTBA 4R84A 5HSGA 2ADOA 2DPLA 3PFFA 2I03A 2CXNA 5BN3B 5LQDA 4IR7A 1QU2A 4FKBA 1A2OA 4FWIB 5P8WA 2Z6QA 4OXKA 2ZXUA 5KZMB 3OE7A 3Q0TA 1RRPA 5JMTA 4M9XA 3AERA 4K9RA 2VHUA 4QNRA 1Y6ZA 4LRSB 3TXAA 1GFIA 4NSNA 5G1OA 3ISTA 3K7EA 3V8PA 4IF4A 3FVTA 3UY4A 3KUDA 1F2TB 4C7KA 1NLYA 1G17A 3CXUA 3SZ3A 4FC6A 1TW2A 3DKIA 3FB4A 5EP3A 3MAJA 4TS4A 2CUTA 2YW9A 5B3JA 2P67A 1MAHA 1E3DA 4ZT7A 3ZNOA 5LVAA 2XNDD 1QGYA 3CN9A 4GXQA 4DV3B 3ER6A 5KDLA 4UOQA 2V7GA 4ZK2A 3EZ2A 5IFKA 3MMNA 1KFCB 3HUUA 4E6PA 2O0KA 2VDQB 2Z8ZA 4HP8A 2KMLA 4V0KA 5DTRA 3ZLUA 1KJQA 5B6PA 1EVKA 3RYHB 2AOUA 4NQZA 3AM5A 3GDHA 3RSGA 3C1AA 1MOQA 2LP4Y 2XE8A 4ARBA 3NVAA 1F8UA 3GJ4A 1ZW1A 2BM0A 5BVGB 4JGGA 4JB2A 3LQKA 3ZCSA 2VPTA 3IDZA 1QQ6A 5B7NA 3A27A 3GAAA 4LWPA 2B5VA 3U7RA 5F7JA 5HK8A 2XUGA 1HT3A 1NJSA 1XZCA 4AJNA 1ZR4A 1WP9A 3NHFA 4QUGA 2IGBA 4XPZA 3P32A 1A5TA 1DARA 1UEXC 2D4AA 1P91A 2RSLA 2X2EA 4YAJA 2BDEA 3NJRA 4QDZA 5JCZA 1JXMA 4MYDA 5G3YA 1BC5A 2IEYA 1UKVY 1A8SA 2WSSA 3VMFA 3VAZA 1JIUA 3MB8A 3IKLA 3CJTA 1UBLS 4KO4S 2M98A 4QJIA 3T3DA 1UM8A 3PE6A 5IT5A 4LEIA 2PZFA 2XKAA 2BFCA 4MUYA 3O26A 3QOWA 2FWPA 4UARA 2I66A 4JBGA 4OQLA 4D8YA 1VE7A 2JGFA 4GAEA 1T6NA 2PRYA 3ESCA 2CKDA 3M81A 1SGWA 2G9ZA 3GGPA 2IIPA 4URZR 1TUEA 1D1PA 1OX4A 3DQZA 3BF8A 1FDIA 2CWDA 4P4SB 4B2LA 3Q72A 4DJTA 4I66A 3HKDB 2ODEA 3SQDA 4UDXX 2H16A 3D3NA 4OOFA 1NW9B 1GL7A 2X4DA 2OD9A 3MYYA 1GQYA 5SZKB 3JYNA 1XRNA 2F9LA 1M0SA 4JUFA 3TRJA 3FUWA 3PR3A 2HWYA 1MAUA 1XWFA 1XTUA 3DDNA 1J5EB 3IMFA 3WSTA 1QQ7A 2J87A 4U2DA 2CNWD 4ZQCB 1SKUA 4I3GA 1A7AA 1OXVA 4RS3A 5J1SB 1E8MA 1ECBA 2IY9A 4HGPA 1ELOA 3BCUA 2SHKA 2BSAA 3GMTA 2V7PA 2VDKB 1CULC 3P7MA 1W75A 4DT1A 1CFZA 1OXXK 3BORA 3M5CA 2J3KA 4MMXB 4OA5A 4AURA 1O8BA 5B7PA 1CIPA 4PFSA 5BNWA 2VZ9A 3G8AA 3KEGA 4RQBA 5HUQA 4B85A 2EZ4A 1H5QA 1I2MA 5DXFA 3ZKWA 1JLMA 5C1BA 1DKMA 4WLVA 3U3MA 4ID9A 1I4LD 1YB5A 3H9CA 1I7DA 3E8MA 1E5TA 4EY6A 4GPIB 2GDZA 4OLHA 1CHNA 1OGYA 1M8FA 2Y2VA 1G64A 4DZZA 1EIZA 3BN3A 1X1AA 3FUCA 4XZ3A 1U3UA 2PGXA 2P6NA 4PYOA 3I28A 2ZM6B 2H7YA 3L8DA 2PYDA 4QGGA 1RBYA 5CNIA 3SXUB 4TXJA 4BQRA 1QNFA 3REQB 4I1OA 3Q9LA 2A3NA 1MQAA 2AQKA 2G88A 2K5UA 3G9XA 3BKWA 4CUKA 1Z4IA 5LLTA 1BX3A 2OVBA 2XXAA 2C78A 5JD5A 2HRQA 3QMVA 1LC0A 2X23A 4PCAA 3C16C 2O0MA 2DSTA 3M2TA 3K6SB 5M04A 1M34E 3OT4A 3OZFA 4MVJM 1AK1A 5BN5A 3ZGYA 4S04A 5JZBA 3AHFA 4P08A 1Z74A 4WUTA 4V0OA 1KH3A 1BG6A 2GRJA 3PDJA 4LYDA 4QXPA 5GM2A 5SICE 2OHFA 2B78A 3AXSA 4INJA 4AYWA 3VV2A 4X41A 4OM8A 1KDVA 1X87A 2E89A 2XODA 4HGZA 4XGRA 1HQYE 1E2GA 4ZT6A 1MHTA 3P9CA 1KS9A 1G5RA 4IZHA 1L7DA 1UXOA 4IMIB 4X3PA 5F4ZA 4O25A 3CLKA 2QSZA 2OGWA 4WERA 3D3QA 2H1CA 4B4UA 5ALHA 3N74A 2E48A 4WOJA 4FS3A 4EHAA 1YU6A 1X80A 1R0RE 1FQWA 2I2XB 2WG0A 3F4LA 4MV3A 5LUAA 5ETJA 2BKXA 2QAGC 4IMPA 1WLSA 3D6JA 3HR4A 1YDWA 4L4YA 4QTUB 1JQ5A 5FULA 4JVLA 5B58C 4TS3A 2DBZA 4W7IA 3GWGA 1P3JA 2VP6A 4MYSA 5DH9A 4ZJUA 1WW2A 4I46A 4L85A 4QLBA 4QYXA 4YJHA 1V9SA 5BSUA 3FPFA 5LBTA 1RNLA 1D2RA 2QIPA 2X5OA 1JR3E 3EVTA 4G63A 4YBRA 2EARA 5H02A 4BN0A 2JEZA 5EXEA 4C0QC 1W48A 1VZ2A 2D3WA 2GQ0A 4MRAA 1NFRA 3I5UA 4MV4A 2A9KA 5B2EA 4KWHA 4O59O 1Y6RA 1IZYA 1OY1A 1DIAA 2QSJA 3HJNA 1PL7A 3HMQA 4BJ1A 4C5AA 4GX1A 4Z4HA 6ADHA 2PUEA 3L1UA 1POXA 3BJMA 2A78A 1R2QA 1C3VA 4RLSA 4FKMA 3S99A 3IMCA 2E82A 4GKVA 1MV8A 1F4PA 1MFZA 4MEJA 4AG5A 3MGCA 4Z3KA 4MUFA 1JLKA 2AS0A 4TXLA 4ALNA 4YT8A 2HQRA 4C21A 5F2NA 3W3AA 3CNNA 2LWIA 4TZTA 3T7EA 3U62A 4ECAA 3LXUX 4HNGA 3L1HA 1K7SN 1FFCA 2AUNA 4MWSA 3W5SA 1R4ZA 3