4R1OA

Crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
496
structure length
496
Chain Sequence
MLSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVFKSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAFAESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELLDEYEELYDIVPAGRQEGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPGNELILGAHMLEVCPTIAATRPRVEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-arabinose isomerase
publication title Crystal Structure of Thermophilic apo L-Arabinose Isomerase from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus hta426
total genus 183
structure length 496
sequence length 496
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.4: L-arabinose isomerase.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r1oA01
4R1QA 4R1OA 4LQLA 2HXGA 4F2DA 4R1PA 2AJTA
chains in the Genus database with same CATH superfamily
3U16A 1MP0A 1I3LA 2GHTA 3RRYA 2ZVQX 1IPFA 1P2TA 1SKBA 4MVJE 3ZIAD 4ZVSA 4EG4A 3IVGA 3MS4A 4PPNA 3TPZA 1WDMA 2Q5LA 1WIWA 1RRKA 3M6WA 3JQRA 3KB2A 1YXMA 2EG5A 2JFYA 2XXAA 2PX4A 3TIVA 1DKQA 4JP5A 3VNVA 2JA2A 3NYWA 4YJHA 3RFFA 3OEED 1BX3A 4HCJA 4IILA 4OM7A 2PMDA 1ZU5A 1U9YA 1NUUA 2A9OA 2HNKA 4UHDA 4B46A 3GLIE 2PUFA 4R1TA 4I5DA 5AHRA 4GI2A 1XKXA 5KX5B 4JBNA 1DG1G 4UU1A 1SD2A 2G0TA 2HJVA 1B41A 4X41A 2X7XA 3PGKA 2PEZA 1ULHA 4CUKA 4ZREA 4ARZA 2P68A 3FWZA 1MTZA 3BCRA 3S8EA 4MQMA 1QRAA 1JYFA 2XGMA 2ZS8A 5BQXA 1EFPB 3EGVA 2HCBA 3ANMA 3N3AC 5J2UF 1A4RA 2EC5A 4KNYA 2FEMA 2ZJBA 4B45A 4TZ0A 1QS0A 2VT3A 4BKOA 3DDWA 1NC3A 4G4IA 1L4GA 1S1MA 3T1QA 3WZLA 2JLAA 1ND6A 3ZHYA 5BWNA 4CQMD 1YV9A 4RK5A 1FRQA 2EBUA 2G80A 3L6DA 1Q16A 1D2MA 2QD4A 1CTQA 3ZXSA 2OHHA 2P9GA 3AQ4A 1F8XA 3W7VA 4C0BA 1W4AA 1Z12A 1E0SA 1TZ2A 2LIVA 4RHUA 3FDXA 4G1MB 5IM4A 4BNYA 4RTRA 3NM6B 5ER6A 3NQ41 5BWLA 2IUFA 5CT8A 1E4YA 3DVQX 1SHLA 2C4KA 3OIVA 2EBFX 4ZV4A 1KK2A 3EQ2A 3UC9A 1VPDA 2R8BA 2A9VA 1M1YE 4EJFA 2F1IA 2G9RA 3MJVA 1KO7A 8GPBA 4DDUA 1T4BA 1Q3TA 2WINI 1FP1D 1Z7EA 3FCAA 1JSCA 2GEFA 1M5TA 1JA0A 3I28A 4LWPA 4P2BA 3TIFA 3OC0A 4IKOA 1SMKA 3PIDA 4BNTA 3ZVMA 1YMVA 5DU2A 4CDMA 5A03A 1EHCA 3D3EA 3MK31 5CHYA 1GCGA 4L28A 5B30A 1UPXA 1YQUA 1PRYA 2EZ4A 4URZR 3DCJA 4NCAA 1IBKB 2Z6UA 1X1SA 2H8GA 3BGDA 4WBSA 4EHKA 1EXDA 2CHVA 3KELA 1JBQA 3HN7A 3HP4A 1U2DA 4WX2B 1V8FA 4H7EA 4LNUB 1LCIA 2UXCB 5CA1F 4ZRMA 5KYYB 4JJFA 3RODA 3A1UA 3TLJA 4FNMA 4H6WA 4R1MA 4ROSA 2NUTA 5BORA 2PUCA 1TT5A 1TYZA 2CLMB 4HQ6A 3OTWA 4GGOA 4KN6A 4QUBA 3AETB 4JC0A 4W8OA 4D5EA 2J9FB 5E8RA 4KITB 1UP7A 4O4LB 3NBXX 5FX2A 3T1YB 2B2XA 2VF7A 2QPLA 5A0FA 4MHSA 3GIWA 4ESEA 1YHYA 1HL3A 3BK2A 2DR0A 2ZQ5A 2ZUBA 3GH1A 4KE9A 1N77A 5HJ5A 3MRSA 3PJRA 1RQNA 1QPZA 2WHRA 2P77A 1BW9A 1THTA 4BWVA 4J1NA 8ABPA 4EY7A 1KYQA 1RABA 4JZKA 4U7FA 1N9KA 1EJ6A 3COYA 1LPOA 2A94A 5IX8A 5I8WA 3GI1A 3U19A 3BF7A 1YS9A 1E2IA 3RBXA 1T8PA 2I4LA 2J5RA 3GN1A 3M1LA 4RGBA 4ZU1X 5IAGA 2BKAA 2DQSA 3KE8A 3IE1A 2IIBA 4AWXA 2CLKB 1KYZA 4TXNA 4KOEC 1RHJA 4N3CA 5CB4F 3ZNNA 2OY0A 4CR8A 3Q15C 3D0QA 3F49S 3V2GA 4I50B 1Z8HA 4M89A 4NBNA 1PFVA 5B4TA 1E9SA 1T4GA 3G49A 3I32A 1I5OA 4EUNA 5JCJD 4B17A 3SK0A 5IKOA 2NVBA 3T3EA 2O8CA 3KQOA 4OVKA 2BFEA 3FVWA 4MW0A 1WUTA 2JHFA 4PNPA 5DNVA 5AUNB 1QZXA 3O8BA 3QVLA 3VPAA 1ZVMA 1MTOA 2KYRA 4D02A 2Q6VA 4OXNA 2ODWA 4PCVA 4BE9A 5JZSA 3AF6A 4BC1A 3AKCA 3WXBA 1RXIA 4LNUA 4H60A 4QXPA 3WKDA 1NVEA 4PPGA 4YUVA 2DPGA 3H84A 5IS2A 3WGKA 1JLKA 4F5ZA 2GPJA 3FR7A 2VRNA 3SHOA 3TLXA 4C4AA 2UVDA 4EO9A 2XUIA 1P8JA 2HREA 3CH7A 4GRAA 4JOSA 1P2UA 4X1YA 1ZGJA 4PE5B 2EWWA 3CIFA 3HUDA 4LRQA 2X8BA 1VQ1A 4FYXA 2CJYA 1GZVA 5ICSA 2Y9MB 4OQLA 4XLZA 3CRZA 2BJVA 5AVTA 4RTSA 3DXZA 3CHYA 3TWOA 3Q0IA 2H06A 2Q62A 2D7JA 4RJJA 3ZG6A 4KR3A 1X3LA 3DE2X 1IXRC 3GDHA 2VNIA 5CVEA 1FF9A 3H04A 2B30A 4HP8A 4B3SB 5LXTF 2HBZA 2I76A 2ZRQA 1MO6A 2EARA 2OR3A 4ITVA 1PJSA 4P7KA 1P39A 4J6EA 4A8JB 3VR1A 4BV9A 1D1TA 2D06A 1S7CA 3IP7A 3LP6A 4UW9A 4AMZA 1HT2E 2FRDC 5HX7A 2VT2A 2QRGA 2NO5A 3SQXA 2V6IA 5BSGA 3ULKA 4EF6A 3QK7A 4GI5A 4B09A 5HPYB 3BKWA 4NOJA 2G5CA 3QUCA 3AR8A 3WJAA 4RACA 1WQ4A 2HIAA 1QWSA 1Y80A 3DMYA 3LQYA 4BFVA 2G9UA 4DDMA 1RTTA 4IYRA 2F43A 2PZAA 2GAAA 1E1QD 3PG5A 4GKAA 1Z18A 5K0LA 4QFBA 1S2LA 3WYEA 1HL7A 1QP7A 5JTUA 2VSNA 3BC1A 1TRHA 2JIOA 3WIVA 4OA5A 5HVNA 2QRPA 4O1HA 3E8XA 2J5QA 1B93A 3GGGA 3INGA 4KLZA 2W83A 3FB1A 3DB2A 3WNVA 2WAOA 3ZTTA 2CZGA 1EGVB 1RI2A 2QN1A 3VKHA 4IUYA 3QKWA 1ZM4A 3FPHA 3M82A 3VO2A 3VZPA 4PZDA 5LQSA 4EEXA 1U9ZA 2C9DA 5E38A 3W6UA 4HNQA 4J0EA 4FINA 1R9JA 4LCBA 2VFAA 1T1GA 1O5TA 1X74A 3ST7A 4AG5A 4NENA 4D8VA 3Q3IA 3O2QB 3LT2A 4PBRA 1AKQA 1A27A 2Q3CA 2X1LA 1QJ4A 4FMCF 3KXLA 3U0BA 1KE2A 1YOVB 3AJ8A 3LA8A 2ZRCA 3NC1C 3NFYA 4RVCA 4ZVKA 1FJGB 2JAWA 3QYFA 4G85A 5DHRA 1EXWA 4YPFA 1BC5A 1Z0SA 2XI4A 1KERA 2QN3A 3Q3GE 4FX5A 1T5HX 5BO5A 1E1YA 2FR0A 1U2SA 1QMGA 1Y98A 2X9LA 1VLJA 1DFIA 2L17A 4KQKA 3PT5A 4TPKA 1J90A 3EXHA 1D6NA 2RBGA 3RC1A 1H8ED 1MG5A 1NBME 1JE1A 3ZN2A 1FSZA 4Z4HA 5JJBA 3A2NA 4GICA 5K8UA 1KRHA 4K88A 1MB4A 5E2BA 5FPSA 3TW8A 3DZJA 3V97A 4A27A 1MAVA 4E07A 3KJEA 4RTLA 5K3EA 4A23A 1L7BA 4ZT6A 5BR1A 3PC7A 4OHVA 1KI3A 3D1LA 3FWKA 2ZEJA 2ZYSA 2HSEA 2MYNA 2XMPA 1AGNA 2Y0EA 5DN6A 1DHRA 1OX4A 3KD3A 4QYTA 5EA2A 5FL3A 4YMGA 2YXLA 5JECA 1R8SA 1QH1B 2ZSIA 1PNVA 3PKJA 1NASA 4C5CA 1QG4A 3D3WB 3HXOA 3ZDRA 2PPVA 4B3TB 3DOCA 1FFCA 4TS9A 5DM2A 2YMLA 4BNWA 1M76A 5JUWA 4EG0A 4QOFA 4G0UA 3OLYA 1V3VA 3MINB 3LY7A 4P0PB 3C6ZA 4CBVA 1O6BA 4EGSA 1CZRA 2C2OA 3MQ4A 4EQ6A 4S04A 2C1EA 3NUQA 3HYRA 2C98A 2BKXA 2BFWA 3RPEA 4MKGA 2BGGA 1YZGA 3P9SA 3QVGA 4BFUA 3SU8A 5CXUA 1TZCA 1ZNWA 3HMKA 4W9MC 2GRJA 2HBQA 2P8SA 5EIWA 3NLLA 2ZSFA 3KJIA 4IQ4A 1IBRA 2HA6A 2QTNA 4A3SA 3FGOA 2NZUG 3EY9A 5K7SA 2EG9A 1UAYA 1FDTA 1WMFA 1EFVB 5DIFA 3E0QA 2RGBA 2VCYA 4OI1A 1L8QA 4LOHA 4Z4EA 4AI6A 3NC4A 3VVCA 3IJ5A 5BW8A 4Y98A 3QPCA 1YB6A 1GRRA 4PV7A 5TPWB 4QA9A 5F21A 1ZMBA 2CDAA 4MI3A 1CJBA 3BSYA 3H2IA 4FQ5A 3GP5A 2Z5LA 1CUJA 3DTVB 1OR8A 3DE7X 4PXSA 3P32A 4MQFB 4ZO4A 2ZULA 2X4DA 4DJTA 5FP0A 3TOVA 2DR3A 4F4FA 4JL5A 1DNPA 4R0NA 4Q9DA 5JH7F 3N8NA 3AF2A 2WK1A 3V8QA 4OXKA 4WSOA 4X0EA 2WUEA 1TM3E 2J3HA 4YAUA 1QH1A 5K99A 1KMIY 2QAIA 4MR9A 2RKWA 1NXWA 3NONA 1SIOA 1YH3A 5C46F 4E3WA 5CFPA 2RGCA 2E87A 3K5PA 2GZMA 4D41A 2A5GA 4EHFA 5M2QA 1PBNA 2O3TA 1YIDA 5IYZA 1VBMA 1N4AA 2A0KA 2FQXA 4NDNE 1I14A 3KALA 3LPNA 4FHDA 5F1KA 4N5NA 4KXVA 4L27A 2UKDA 1C5KA 3F5QA 3NV7A 1GZ3A 3AUSA 2QVLA 4R8SA 3VOAA 4ER6A 1PDWA 1I1NA 1Z6ZA 3BBPA 4ZO7A 3OTOB 4GPEA 3RBZA 2JJ1D 2XYRA 3QEOA 4ZT5A 1YK0A 3D1JA 3H2ZA 4ZEWA 5C32A 1O4VA 5GPBA 1T36A 1STOA 3NJRA 5T41A 1YR2A 3M6AA 2M6RA 3D7RA 1YDHA 3DS8A 3AUAA 2B92A 1O87A 3ZK8A 2XUHA 3DUFB 4CGYA 3AY6A 3RVSA 4AZ0A 4ALJA 1WVIA 5FNZA 4CNBA 2WTMA 1VSVA 1BAPA 3OPXA 4UBJA 3PXEA 3DMGA 4AJOA 4H2DA 3HJTA 2BM8A 1YVDA 3JYNA 3PNYA 4PZCA 1HO3A 1WMSA 3FIJA 1SXPA 5EHNA 3SZMA 4LBWA 1B3RA 3OCZA 3PHIA 5EPOA 1N57A 1Z22A 3I9OA 4HWRA 1ZM2A 2YXDA 4MIKA 1J00A 1QZ3A 2QBYA 2JVKA 3CF0A 4RZHA 2IV2X 2PVSA 2CFSA 1W34A 1E59A 2H4ZA 1BOFA 4D4LA 3NFRA 2MJLA 3L02A 3VOSA 1XQ9A 1GO2A 2XXJA 1E7MA 2IA5A 1I3NA 2ZYAA 5DHAA 5KYUA 4DM7A 4WNCA 3FFTA 1KXZA 3LT4A 1AA9A 1A82A 4ABTA 3BE8A 3ZI4A 4OCZA 1N5DA 3JQAD 4XWAA 3B9BA 5L3RA 1V7PC 1K8YB 1SFRA 2FSSA 1DFGA 3PP8A 4YRMA 4ZZ0A 2AFIE 5ICGA 4HL6A 2JH3A 3UTCA 4X90A 4BGUA 4YTEA 1XNHA 2H92A 5CJ2A 1FDIA 1JPNA 4KMMA 3QMVA 1I9CA 4TUYA 1EUCB 2EJUA 4II2A 4C0KA 3LK6A 3EVZA 5G40A 4PW0A 4QBGB 4YRRA 4AN1A 5DCYA 5IZCA 1KRXA 1MNAA 4ND6A 1ONOA 2I1WA 1BA3A 4MS1A 4MZDA 1UZNA 4DUYB 4G0YA 3CUSA 1QGAA 2YRFA 3GG2A 2FYTA 5ENZA 3U3KA 2SECE 1XZAA 3K6JA 5HFNA 3B12A 5HJ7A 1E2GA 3EGDB 1EDOA 4K46A 4ZVQA 2JBWA 1R6BX 3BGVA 3IH5A 3DCIA 2IHKA 3ZCSA 2H7YA 5DCUA 1H1LA 3V4FA 1U2QA 2P65A 4S0XA 3Q7QA 1WTCA 1OJ7A 1Z8FA 4NXMB 4HYYA 2OV6A 3CZQA 1NNI1 4CEJB 2Y67A 4GQAA 2QX7A 2J46A 1V2GA 2X0NA 3I6BA 5DN9A 1YBAA 3NBKA 3K9NA 3QTLA 4J0CA 3ZV6A 5HZMA 5KTPA 1QOPB 3L4EA 3LECA 5KTKA 3DDHA 1X39A 4OP3A 5ALRA 5AXBA 3GLUA 1YC5A 3QUQA 1QH0A 2CLOB 1C9EA 1D0SA 2IW1A 4XE5A 3LCVB 3QBJA 1GGFA 2XGSA 3ZEAA 5JNUA 3KFLA 2NZYA 1H9AA 3FZQA 1AKMA 1C3OA 4J16A 4KIGA 4ZQGA 1V3QE 1AF4A 3FCOA 3UGKA 2BSQA 3NG1A 2PLFA 3OZFA 2H5JA 3NRBA 4KV9A 2WVAA 1LRJA 2LKDA 4BNUA 5K0EA 4Y2UA 3CUUA 5FOVA 1XL1A 2YVAA 5CLGA 4JUIA 3V6LA 3OTQA 5AVYA 3GZNB 2JS7A 2PWZA 5NULA 2RGAA 4UCWA 4AKTA 5EJIA 1O6CA 1YOBA 1TA4A 4NH4A 1SC6A 2WYWA 2AJ8A 5DI3B 1KS9A 3I09A 3FDJA 4FZJA 1DTWA 3JYQA 1Y9DA 3O3CA 1P9LA 4J3FA 4MV5A 5LZ8A 1E2UA 1YUBA 1LK0A 3QPVA 2IH5A 3E9MA 3R7DA 4BAGA 1WLYA 4GKKB 1HE5A 2LZ0A 3GRYA 1XMJA 4DCPA 4JWKA 4O4JB 1COWA 3EGDA 3TDNA 9MHTA 2XUKA 4KFTA 2HGSA 3P5SA 1MQSA 4JSTA 4L8VA 4CYMA 3B3JA 4RTOA 1ULSA 3LF2A 5EE9A 4I3HA 2A2ZA 3CX3A 4KQWA 4R7GA 1P5FA 3EJ6A 3GWGA 4ZQBA 1O9GA 3RC3A 4YMUA 3PK0A 4CEJA 2CEKA 4H31A 1V39A 2NLOA 5HR5A 4HDNB 4OXYA 1IN8A 4PPFA 3W6PA 1VA5A 2GHIA 1Y1RA 3L6RA 1E3EA 2IVZA 4YBRA 1BXGA 5EHXA 2EF0A 3ISVA 5DCLA 2IYNA 4BMYA 4ZCSA 4UUNA 1L7NA 1JLRA 1FLDA 1RI5A 2CNNA 2VVTA 1RWOA 2IHVA 3CBQA 4TV8B 2IXEA 3G59A 1DUIA 4AKEA 2H0AA 3OFVA 1SVLA 2TYSB 1OLXA 1MMFB 2I4NA 1KAEA 5UKDA 1F0NA 1Z34A 2AZTA 2X5XA 4RVUA 2WZBA 2RKBA 3GUCA 5IM5A 4EBBA 3NX4A 2NNWB 4KV7A 1JS1X 4NAUA 4E94A 4JXKA 2WDZA 1L5QA 2HA4A 3ASYA 4TT3D 1N5OX 4JNCA 1GA1A 2LXNA 2VEOA 2ZBGA 2M6KA 3UB2A 4MWTA 4RCYA 1PAUA 2IZZA 1YDMA 3KYJB 4IQ0A 2ICAA 2CXNA 1GPJA 3L05A 3QWIA 4J1QA 4MVCA 1KEVA 5JY1A 1G3UA 1VE1A 4DUGA 2JHAA 4QOHA 4UHEA 1JPUA 4F85A 5KTSA 5L7YA 1RPTA 3K2IA 3NAMA 4LKRA 1SCIA 3AIKA 1MDBA 2JFUA 5HCNA 4ZN6A 1UMCB 3TI9A 5L7WA 1QGED 4PLCA 1K5PA 5AW9A 2IYAA 4I4CA 2P2NA 3OUTA 5F3DA 2B0JA 4ND8B 5AKXA 1BA2A 2HF8A 3WGHA 1DRWA 3MQFA 2CBGA 3N2KB 4KFUA 1HE8B 3EUWA 4O2AB 3B2QA 3KAPA 3CSSA 5AVXA 4NR0A 1W87A 1XZEA 3DVSX 4IW3B 3P20A 4YR7A 4WY8A 4M1WA 5HGXA 3EPHA 4AJJA 1GY8A 3NIGB 4E09A 1Y8ZA 4ZV9A 1K6EA 1L5KA 1RJ9B 2WWXA 3S81A 2WUDA 5E7JA 3UO8B 1J49A 1EFDN 2FGJA 2JI6A 3U3DA 1W76A 1ZVVA 1ECJA 2ZZKA 4M7WA 4X97A 1V5EA 3FUWA 2YQ4A 2A1UB 3TRDA 4HYEA 2CCJA 4P36A 4I8XA 1HF3A 2JA1A 3KVVA 2J3KA 3GJQA 3NNDA 3C7AA 2ORYA 3OPMA 5EKXA 4ENPA 2J30A 4MNTA 4YRZA 2RC5A 4EYGA 1UOEA 2DTEA 2A1TS 1USUA 4B5LA 5TJHA 2Y1FA 3MIZA 4A5SA 5MDHA 3U4MA 2AGVA 4TV8A 2DERA 5FA8A 1EXNA 4NPAA 4ALMA 5JO0A 2PUGA 1W30A 2R00A 4RK4A 3MD9A 4ZJUA 3ZE1B 1HT3A 3RVPA 1OYVA 2ACWA 3DZKA 1RWNA 3K3PA 4ZC1A 4JJKA 1TOAA 2Q99A 3WLLA 1HPLA 1KSFX 5T5QA 5J47A 1ZUHA 3G5UA 2GCGA 3HKCA 1GAEO 1P7YA 4EJSA 4WH0A 4NQZA 3MWDA 4X1KB 4WZZA 4D25A 3NBFA 3ANYB 3C48A 2R62A 1F3LA 1KI2A 3M3HA 3RRZA 4CFYA 4ZCRA 3E05A 3ENNA 1FNMA 1D4OA 2G36A 2RGDA 2VNJA 4D98A 1R15A 1NUHA 3WMFA 4YUAA 2PGDA 5KHAA 1CERA 2XVZA 4DJ5X 3OLZA 2ZWPA 2VRCA 1RKVA 4KO4S 4BQIA 3EEYA 4N1AA 2OLKA 4EI2A 5E4YA 3KTAB 1EI9A 4ON9A 4ES6A 4M60A 1JMVA 2IUSA 3GLHA 2EW8A 2F1RA 3Q3CA 5F51A 4UAGA 4DV3B 5AUPB 1FC0A 2DBQA 3EZ2A 2DKNA 2SKCA 3W9UA 2CMFA 3U44B 2FZ4A 3IILA 4MULA 1TK3A 4S1WA 3CR7A 3G88A 1Q6ZA 4DWWA 2C2MA 3R44A 1VBKA 4JBGA 4U7PB 2OBBA 3F5SA 4BCCA 1GG8A 4DCOA 1X8XA 1QGYA 5K3CA 3ANTA 2RHWA 3NYIA 4BLPA 1TKCA 1X8JA 3DE0X 2ODAA 3DHVA 5JRJA 4PLZA 4ND7A 4DMHA 4MW9A 2P90A 3RSZA 1Y7LA 4Q4DA 1ZIPA 4DDTA 1OROA 2N47A 2V6JA 4I1RA 1TECE 4IH4A 3JW8A 1TEVA 3O4FA 2OXTA 2OORC 4DIBA 6LDHA 1V1RA 1GUFA 2OD9A 3O8CA 1YAJA 5FNVA 3JWPA 3ND9A 3K30A 5FI3A 4WOKA 1D4FA 2ZQZA 1A96A 4HN2A 4MLZA 4MKHA 4X1KA 5F2EA 3RVQA 4URVR 1V47A 1WY5A 1J0BA 2A30A 4WXPA 3TMKA 1JAYA 4HVTA 1IATA 2AC4A 4YP9A 4AT1A 4D9NA 1K6XA 1OBHA 3WWYA 4PO8A 4AMUA 4Z7JA 1SZJG 4E1BA 1R6TA 1QAMA 4HGZA 4OHOA 5ALZA 1T3SA 5BYJA 3WL4A 4BL5A 3GBPA 1VGQA 3NDPA 3S7TA 3EZLA 4NTZA 1LI5A 4CT5A 2WY2D 4F8EA 4HADA 4P53A 3SIXA 3OZDA 4FWTA 5A62A 4M0MA 2IHZA 3OC6A 3UKDA 4DW8A 3RADC 1EBBA 3ZHCA 4LVOA 3TVTA 2VR1A 2CV2A 2HSWA 2CL7X 1NXOA 1EJ0A 1OLUB 1P2FA 3E3NA 3H83A 4RTQA 3KDSE 1EDDA 1IG3A 3T4XA 2I66A 3TM5A 1SU8A 3EXFB 5BV7A 4EUFA 5CPBA 5B3KA 4D9JA 2A88A 2JIRA 4XQ0A 1KO4A 2VXOA 1ZJ6A 2Q1YA 4LXGA 3JQ7A 1KJIA 3GCDA 4J0QA 4BC0A 1DDGA 2FSGA 2CWDA 2JAUA 3WQBA 2J5BA 1NBEA 3UJ9A 3W2EA 2FWJA 4R98A 1NJFA 1Z5NA 3AHJA 3GLQA 5K45A 2RGGA 2I6XA 3KVOA 1O95A 1TVEA 3QP9A 4NFYA 1GGKA 2I8CA 4C20A 4JDPA 4L02A 4OQZA 4EPXA 5JAOA 2NAPA 5ECDA 1JA1A 3JD0A 4RANA 3ZKAA 4LY6A 4FMPA 4NG5A 3Q0TA 4AROA 1ABFA 2VTVA 3P9CA 3R8CA 1QTQA 1CUWA 3REQB 4I6JA 4ONEA 3P9XA 5D51S 3AI1A 1JR2A 2OXRA 4C08A 3NVAA 3BL6A 3WGJA 3R6TA 1DKMA 1JJBA 2ORWA 1WQ1R 2TMYA 4UTPA 1ZGAA 5AXAA 4EHNA 1BCSA 1E0KA 2IW3A 5DYNA 1SRRA 3QE2A 4RDIA 3BDIA 3GA7A 4EDHA 1IEXA 3M6MD 1NR5A 3L40A 3FMIA 5IFLA 4R5HA 3WAGA 5HSGA 1C81A 1G8MA 1NQTA 3DZDA 2WIFA 3WWOA 7AT1A 3TG8A 4DMRA 3CNOA 5JVDF 4IHQA 5DI9A 4CF6A 4MGHA 1U7WA 2DQ4A 3N39C 2CKMA 3SYTA 3R8FA 3BXOA 5TMDA 1KK1A 1IN6A 3DO8A 1Z0FA 3CA8A 3DHYA 3Q5GA 2BFDB 3H3FA 4JFRA 4RLQA 4YP1A 3BB4A 3QTBA 1O94A 1ZIYA 3RUFA 4L2IA 2ADFA 4EVIA 4TSRA 1L5MA 2QE7A 3OQBA 4OP1A 4Z49A 5FBZA 1NATA 4CIDA 1RI1A 4ZA2A 4ZOEA 3ROZA 1W0JD 4RWZA 3E22A 4LJ6A 3VX4A 3LIIA 1I6KA 2YHBA 3FTEA 3E81A 1MFZA 4KU4A 1E79D 1AXRA 1HEIA 1YK1A 1C4OA 2UUBB 5G02A 1XTVA 1JT2A 4L76A 3TNLA 4FB5A 3F2IA 1UC4B 1XTSA 1TB4A 3PUKA 4HAWA 4ZI3A 4QGSA 2XQFA 5ADVA 4YYZA 2Q4DA 1W85B 5DBEX 3KKNA 3IKLA 3W3AD 1NL3A 1DLIA 1ZK1A 1WOYA 5DHTA 3THYB 5C1DA 3OZIA 3TQSA 3OURA 4AS1A 1XFDA 1FW8A 2H1FA 3BCSA 3OPYI 1OWNA 4PQYA 4Q7KA 4YMWA 5A3VA 1XCLA 3LYUA 4PGFA 2VATA 2CD9A 1UBUS 1BMFD 2XITA 4W1QA 1JAXA 1Q7BA 4MWCA 1QDEA 4HGQA 1P3JA 1YCDA 4FGZA 3FMFA 2Y0PA 1V4BA 2WMYA 3MWEB 1DIOB 3FTDA 2RG7A 4G4GA 5EAIA 4EG6A 5CXQA 1G6OA 2XODA 1U99A 3WLJA 2AI1A 1WHTA 2BPOA 4M0LA 4H7KA 1CZUA 3WK7A 1O89A 1J1UA 4Z6KA 4CV0A 1HOXA 1HQKA 3Q98A 3V2HA 3CT4A 2WSIA 5BSVA 1NMZA 2C20A 3BAFA 1DRKA 4B76A 1J2TA 4DG8A 3ZV3A 2GO1A 2XOKD 3HO6A 1X7WB 4HQ0A 4KAAA 1XQYA 4N0DA 4QXAA 1QHNA 1CDZA 3I2HA 1K6IA 4CODB 5FB3A 1E3DA 1L7VC 1Y5IA 3MAGA 3R0QA 2PZ8A 4M88A 3G5LA 5F5LA 4YXFA 1XCMA 3PDCA 1AUOA 3DEIA 3ES9A 2XDAA 1JJ7A 2Y93A 4MRNA 4YECA 2RHLA 1BQ4A 1JUDA 1O54A 4KR2A 1CUZA 3GV0A 1IJKA 3KHSA 2GN4A 4INZA 2JLQA 1D7OA 1ID1A 1X7ZA 3M4XA 1GG2A 1XJQA 3CVYA 1JIKA 2CXTA 1XVAA 2P6MA 2BM9A 4MQ4A 1O6GA 3RAEC 1JZQA 3DBOB 1SKUA 4O4IA 2QYSA 5GWXA 4GI7A 3LUPA 3QOWA 3WYNA 4DEYA 1JQ3A 2SKEA 3D9QX 5E7MA 1P3DA 4GR5A 4BO3A 4DIOA 1B73A 2D3WA 3OICA 2VP0A 1GYRA 4X45A 4DR3B 3LOPA 4ZOLA 5BXQC 3THYA 3ICEA 3AZOA 1W4BA 4E4TA 1KJQA 3PUIA 1FPQA 3HB9A 2P9TA 4JR0A 3A1VA 1LXCA 3IDZA 4IR7A 1HGXA 1HTWA 2C9YA 3CNLA 4RZIA 1NNUA 2CT8A 3FUVA 2AJBA 2H3HA 2GVDC 4PTLA 1O97C 3EQ8A 2ZJFA 4QBIA 3F3MA 1SELA 4IDGA 4Y1RA 1E2LA 3RS3A 4DV4B 2V58A 3TLCA 4B73A 1XVLA 1XZIA 3J81k 4J16C 3KEFA 3QU9A 1PVVA 3EVAA 3IP3A 2V9ZA 1XRQA 3LRPA 3PWZA 4DIKA 2YV1A 2QUHA 3L6BA 1S3FA 2P9HA 3JS5A 4FUTA 5LBUA 1IHOA 2ONJA 3UMFA 1ZH8A 5LU8A 2BFBB 2YRWA 4L78A 2GVZC 5T57A 1R0XA 2O2DA 1JEAA 4MRMB 4M8IA 1LBSA 4IH9A 4LDQA 4PYLA 4DNFA 2PL3A 5LIPA 3O94A 3DYIA 2VHWA 2YMPA 5DIZA 2EL9A 5FL7D 2JCYA 3B1KA 1SVMA 4E5VA 3EYAA 2JATA 4BGIA 4EG1A 5KIAA 1UK8A 4BRUA 3U7QA 1MB2A 4WVFA 5CB6A 1PHRA 5J2TF 3HBNA 2P1DA 3S29A 4ZI7B 1C1XB 4QAJA 3TSOA 2WP8J 3GAAA 5LYJA 1J8DA 4HOYA 2IEDA 1PR5A 5FTWA 4DTIA 1FBNA 1GSAA 3T6KA 1U4SA 1PKEA 3GAZA 5A1JA 4U2FA 2XCIA 4ZQIA 2JCVA 4JJ4A 1RPNA 4GOJA 3RAJA 3WO1A 4QRIA 4WNYA 1DOHA 3KXDA 3O9ZA 4M37A 1AHIA 3O21A 3J7TA 4W6ZA 4XRGA 3KQPA 3TLZA 1JEOA 1IY1A 3BJZA 4DR5B 1B43A 1ELOA 4FHEA 2A59A 2YY5A 1BU5A 2H1SA 3AFNA 4ZT3A 4OGFA 3KPYA 4YO7A 3HJBA 5KVSA 3NMUF 2B8EA 1LPSA 3R3UA 4MJ3A 1E3JA 3FSGD 3JXEA 5ESXA 4G9EA 2MYUA 3TXAA 2OBYA 2QTAA 1W5EA 5BURA 4AJIA 2R4QA 4CQJA 2BMJA 3DF9A 3ONFA 4IX9A 4P3YA 2MCFA 8OHMA 1QB8A 4M54A 5I3ZA 3PNBA 1F2UA 1YONA 2BFBA 1SXJC 3G1TA 5C1IA 2Y0DA 2ZVPX 3FAZA 4HGNA 2IIVA 4W4TA 4Y9DA 3I01A 4G63A 2HQ1A 2J3MA 5LJLA 4MCIA 2Z6AA 2EJTA 4BNLA 2O9JA 4TYMA 2IH2A 3CX6A 4V0ME 1POXA 1P1HA 1U0LA 4HMOA 1JSZA 5DBHX 4HXYA 3V00A 4YRCA 4AF7A 4WJZA 1CR0A 3B85A 4UULA 2E1RA 1LI7A 3IJEB 4B4WA 4U7WA 1S2GA 4ZT2A 1AKEA 1SKAA 3DAFA 3RHTA 2OK7A 3UKJA 3MTJA 1BN6A 2UDPA 5TQVA 3FLBA 1TD1A 1CUAA 4NYIQ 4B84A 3R7FA 2R6ZA 4CKBA 3W4IA 4WXYB 1AZWA 1J23A 1YRAA 1UMKA 3SSNA 3QWBA 1P2SA 1TDJA 3A7EA 3NXKA 4BJ5A 3R3SA 3M3DA 2C31A 1SVSA 1K3UB 1ZG3A 2WOJA 5AXCA 1B14A 1SBTA 2ZUCA 2QR2A 3CB4A 2JANA 3LPAA 3LGXA 5DMHA 4F6LA 1YBMA 1W46A 2REQB 1PYDA 2C95A 3GFPA 1L5VA 4L8LA 1TNDA 1X8KA 3L0DA 5NLLA 3S28A 3ZY5A 1RHKA 1Q14A 1LQTA 2HSGA 4Q1EA 2XR1A 4PEVA 2P9FA 1KZ1A 2P2DA 4TMYA 6AT1A 3EASA 4DCMA 4FHZA 3DEHA 4POAA 4Q3AA 3DSRA 1NI3A 1IYZA 2FSPA 2GK4A 2HNAA 3NIWA 3QLUA 4RA6A 2Y9PB 1NJ6A 1MAWA 3EW7A 4AJKA 4JLWA 1WPRA 4E5NA 4PXYA 4IDOA 1X1RA 4ERNA 1LSOA 1PJRA 2BJWA 1ICIA 2FZEA 3I0ZA 4EJ6A 3BCUA 2FQ1A 4EJSC 3UJNA 3MNFA 2PMKA 1JYSA 3GX1A 3T7CA 3LP8A 4KXNA 3KJZA 4EGQA 2J7PA 3G79A 2XDQB 3JPYA 4UREA 4OV6B 3HZRA 4WY5A 3A9UA 2V5UA 2YXEA 5K0NA 4Z0NA 3I9KA 2GHQA 3W0LB 4DDHA 4IWXA 4AYWA 1MIOA 1KBQA 3N0WA 3AKZA 3E5RA 4QARA 4K6FA 3TTSA 3C1TA 1B23P 2YASA 1KAQA 2FH5B 3KJHA 2WTXA 3F9CA 3KDPA 3C3BA 2FE4A 3DV0B 3LHIA 3JQ9A 3WLNA 3WGQA 4QXQA 1P77A 2O3QA 4YVFA 1PUIA 1XZLA 1QU2A 4IPTA 4ZTBA 1IUKA 1Z3IX 3A4MA 1TUIA 4TV9A 3GLFB 2QJTA 3L7DA 3NTVA 4KQHA 3CZCA 3LKZA 4BX8A 3OO0A 4D4JA 4W63A 5FI0B 4Q21A 2C9MA 5EXPA 2HRBA 3BXXA 3RSGA 3RYCA 4H1TA 4FEGA 3HXPA 2DWPA 1SCUB 1A9XB 1PG0A 3A27A 3WE7A 2NYUA 2JVIA 1Y3DE 2Q0HA 2G76A 3KJQA 2JAPA 1KZGB 1TC2A 4I9UA 4LCJA 4M8NE 5EE0A 2JFOA 3QEJA 2O50A 2Y1XA 1RMTA 3G7UA 3SQDA 5DMXA 1A5AB 1M72A 1ZRSA 3PEYA 4M99A 4X1IA 1CIJA 1NVUQ 3S68A 4M0PA 4F71A 3IV7A 2SICE 5K3FB 1AURA 4EB6B 4F2WA 4Q3NA 1UJBA 3PYMA 1AKTA 4AMBA 4WD3A 1J99A 3RAGA 1I6LA 2AG1A 3RBVA 5GV7A 5THKA 2LCFA 4HY3A 1GYQA 1C7EA 4B3BA 1T3TA 4CM4A 5KINB 4N48A 1Y6JA 1V5FA 3JQQA 2IBMA 4OQNA 1EEHA 2IHNA 3UQZA 2H08A 3VNRA 3ZCTA 1XA0A 4YT5A 2BFNA 3MMSA 5CPFA 1UPAA 3L8GA 2RI0A 4MYRA 3HN6A 4W9RA 1G9XA 1Q1AA 1CZLA 3N8IA 3WKBA 4CRWB 1DAKA 2JFXA 2PJDA 2PRZA 2GT1A 3I9V1 3QENA 5CT5A 5TARA 5BT8A 3GLIA 1M34A 4KXWA 3A1TA 4RY8A 2R2GA 1ZK4A 3A14A 3AP2A 4PAQA 5F23A 2GUGA 3P2EA 2ZBEA 5ECGC 3F5DA 2HMYB 3C3CA 1SXGA 3ZWCA 4U5QA 1XJCA 2UUAB 1B0AA 3O1JC 1GQ2A 1VHWA 3IQEA 5FYQA 4G5HA 5C34B 4PLFA 4QJ5A 4MUAA 4Q3BA 4HV4A 1E6EA 2BCEA 3HM2A 1GLGA 3SEQA 2HRCA 3ZI7A 1QFYA 1S7GA 2VDMB 1VPWA 5AWFC 1QLWA 3K0SA 4RPIA 4LGVA 4ZHQA 2E49A 1TU4A 1BFKA 4NKRA 3TOXA 3AG6A 4IXDA 4B31A 3LWDA 1EG7A 2QZPA 2I3AA 3KYCB 4M1OA 4OKSA 2WKPA 2O7SA 4PG7A 1XBTA 3UJPA 4XFKA 4Q66C 4E70A 2G70A 1VB3A 1S02A 3JWEA 1O95C 5FAKA 1AKRA 3IT3A 4L8WB 4ECEA 1NQUA 2OAGA 4IJMA 1NYTA 3B9RA 1DVRA 2WFLA 3WZMA 4LCEA 4DTCA 4C5BA 1I94B 2C4VA 3QUTA 4I6EA 5CXXA 2DHDA 2PH5A 4QBKA 4BLTA 2VZ8A 4EF5A 2PAFA 3P0EA 1Y3FE 4HS4A 3NKFA 4V0QA 3LXRA 1T8YA 3ZPXA 2FPOA 5DGTA 1GKKA 3QFCA 1O97D 2JIZD 2QXTA 4ZZ3A 2GEVA 1M1YA 3KB6A 4PSUA 4PAOA 2RHOA 3NAZA 1OXUA 2EKDA 5AKZA 2D7DA 2XIJA 1I33A 3N74A 1P0MA 2XA1A 3HDGA 3PGMA 3ZHQA 4ARCA 3FROA 2RGNC 3AUKA 3CF4A 2OO7A 4X65B 1A95A 2C2ZA 5ERYA 1T2EA 4V0OA 1PCXA 1RAIA 2WM8A 5B2EA 1TM5E 2GJ4A 3LO8A 2G83A 3ZGOA 4ZOAA 3Q8LA 5C35A 3A11A 3G0CA 4YV7A 3GPDG 1ZDMA 2ZT5A 3VUEA 2I3GA 4HO1X 1UXHA 2A9RA 1S8AA 3UK0A 2H9YA 2OKGA 1GPKA 4C2AA 4JI7B 3Q7SA 2G9VA 2GLTA 4J91A 4WUVA 3GHHA 3ONVA 2JEZA 2AJDA 4IEIA 3E3OA 4G26A 4GD3Q 2ILVA 3VTKA 3TVDA 1NQWA 4L4YA 2OLEA 4WLFA 3RTBA 5K8JB 5JQWA 4KDCA 3D2CA 4OB6A 3PDHA 4P83A 4Q01A 1K2VN 3TECE 2I6QA 3A2LA 3EEIA 1P5ZB 1XLVA 4BZWA 1CUGA 3D4BA 4H7JA 3ZVKA 2ZIXA 2FTKE 2FWPA 1DAIA 2R6FA 2X86A 4NSNA 4OA8A 5LBIA 1NW3A 4R40A 2ZSKA 2O19A 3R6WA 1TZJA 4KMRA 2WE8A 4JVMA 4YRPA 2JK1A 1LQ2A 1JHPA 2W6NA 2WWYA 1P5RA 2QPAA 4C3ZA 3D6UA 4LC1A 4DEVA 2BUCA 4OXQA 4ZVVA 4XTRA 3WMXA 4CM9D 1Z38A 1LS6A 4AFNA 3LHFA 2VF4X 1I6WA 1M67A 1YNOA 2RC6A 1SHUX 1NHGA 4L5YA 4OK3A 1RS0A 1EDZA 4ND3A 3SIPA 1U0TA 1LC0A 3AEQA 1N2CB 3DM9B 1BE8A 4QOSA 4YAKA 1ZM9A 4E12A 2WMNB 5G0UA 4KKXB 2YHUA 3MCTA 2IIQA 4IRXA 1B8VA 1KQOA 2GDJA 1M2WA 3O73A 3V8NA 5BY2A 1PVOA 1PV1A 1ZUD1 4TTRA 3ZTYA 1SXJD 2GN0A 2YVLA 5I4BA 2JIPA 3D4LA 3LIPA 4KWHA 4ZCQA 3WC4A 4DUGD 3RO7A 2ZCJA 2IYZA 2FUKA 2M1ZA 5FBLB 1DARA 3EWNA 2FN3A 4AULA 4E13A 5HWSA 2XBMA 3W8RA 2V0NA 1Z88A 5ICCA 4D79A 1JIIA 1TAQA 1HYGA 3HBJA 1U0FA 3FVTA 3G2QA 4OUDB 4WLUA 4GHWA 3PPYA 5AI9A 3ROKA 5KNBD 4MQUA 3OMWA 1QRSA 1EAMA 2Q6KA 4H77A 3ZS8A 4BWFB 2FW8A 2OHIA 1XYYA 2GXSA 3IIIA 4QDXA 4AQDA 2X22A 3VJLA 3N28A 2OUKA 4LE2A 4EHIA 1JLMA 3VR4H 1W9MA 2DJ5A 2JLCA 1PGQA 2XLCA 1TUGA 3AV0B 3KRTA 3P2IA 3GMDA 3HWX1 4LRYA 4PFJA 5SV2A 3R7WA 3WLPA 1IZZA 3SYLA 4HTFB 3U9TA 2VDWB 1DMSA 2HF9A 3PDIA 4FSXA 3ELWA 3OU7A 4F06A 2BI4A 5FT9A 2R6DA 4KWTA 4D9EA 3D7SA 3B2EA 5TSDA 4BVBA 4UHBA 4MUBA 4B3HA 1TUBB 2HSDA 3MJ4A 3NTQA 3PQEA 4MZXA 4N3AA 1VE3A 1KOLA 1FPMA 1O9HA 2DWUA 3SE7A 2AMLA 1VBNA 2XX3A 3OZEA 3Q6NA 5LDDC 1GFWA 3UXHA 3TJZA 4RK7A 2WBLC 3HSKA 3AFHA 3EPLA 3OF5A 3MD0A 2GEJA 2W0MA 5IW8A 2OILA 1QYCA 3NHWA 3HPRA 5DNAA 3QI7A 1CQJA 2YICA 2FMTA 3OE7D 2QT1A 4BLRA 3ZDAA 3VBEA 1II8A 4CKCB 2HB6A 4M38A 2X2EA 4YJGB 5DXAA 4E2ZA 1ZOIA 2XTJA 1PGNA 3QJ5A 1S2NA 3FN4A 3KXPA 1L4BA 3T9EA 3W34A 3UBMA 3PI6A 1LI4A 2OC9A 4I8DA 5KX5F 4FILA 4TYYA 5CCDA 4MS3A 4X64B 4R8RA 4ER3A 4OUDA 2IOHA 4NU5A 4D4GA 2VCEA 1T1SA 1QVRA 3WGLA 4U9HS 4WT7A 3LKVA 5F77A 3E1GA 4RF5A 4AN0A 5F64A 4GQIA 1YFLA 3L41A 4QUDA 3FVQA 4YCCA 4J4HA 2VF2A 5HBRA 2O2IA 2VJNA 2HT6A 3CONA 4KUGA 1OA0A 4TVKA 3MS2A 1A8HA 4H18A 3CURA 2AEJA 3R5JA 3RB8A 1XRRA 2VDWA 3GFRA 1LBIA 4WGGA 3Q3JB 3QF4B 2OK8A 4YP5A 1F20A 1CS0B 4LXQA 1TQ4A 1HYQA 4YMTA 5AW4A 2GAIA 4LDPA 5GJBA 4OXIA 2AVDA 1NY5A 4N0EA 3RS7A 4MDYA 2ZKIA 5BOVA 1DIBA 3EPPA 1UM9A 3LLCA 2DPMA 5LQMA 4Q4HB 1HLFA 3ND6A 1ZIOA 3PGXA 3TW6A 1NW6A 3VKVA 4OU5A 5HKOA 1M1XB 3NW9A 4UEKA 1A7AA 3BWYA 4AW9A 4B85A 1NC1A 2JEOA 5IAKA 4US2R 1A1VA 4Q3LA 2C94A 4IHAA 1DXQA 1CRLA 1NBMA 3B20A 3OM8A 3HXQA 1V8DA 4NESA 4OHKA 1C3VA 1LDGA 2BJHA 3B6ZA 3U4AA 5JADA 3X43A 3VU9B 1Q2XA 1VJTA 2P9QA 3KPVA 4DT1A 5AVWA 5FWNA 4US1R 1UC5B 4G81A 1GGMA 3R3JA 1NRXA 5TQ2B 3RJ5A 4BNZA 3ZGXA 5F12A 2BHRA 5KSPA 3H5WA 4GUDA 4XUGB 3RT9A 3CB2A 4P82A 4EAQA 5CRIA 2YVKA 1AZSC 1RE0A 3IALA 4H4EA 3O7WA 1OBOA 1PYOA 1GUYA 4H16A 4PYIA 1Z5WA 3H05A 4IDHA 2D3TA 4C05A 4Z1MA 1VJRA 1R6AA 3GEGA 4CHGA 2G9NA 5EXDA 1ZC4A 1OB5A 2E82A 3TUIC 3R74A 2ZTUA 4IS2A 3O4GA 3OCWA 1B7GO 3UPTA 4TYQA 2ET6A 1FCJA 1XG5A 2L18A 2Q2NA 2W2LA 1N1DA 2FG6C 4RMHA 3VDRA 4JT4A 3VYRB 4RTJA 1ZHHA 5T8KA 3C0KA 4E6EA 4I66A 1VE5A 4XZ3A 5PNTA 1OXTA 2CC2A 3MB5A 4M7OA 3RDPA 3PQ3A 4TOIA 3RS2A 2O5EA 3KU4A 3KZ1E 2J4FA 2JFNA 4ZAGA 4RNDB 2QSZA 4KXLA 4CM3A 1J21A 3O3MB 2W2MA 2GN1A 1OV6A 4TKVA 5TIIA 2ZWVA 4G25A 3AG5A 2VLBA 1DINA 3DMDA 1SAYA 2GGSA 1NIJA 2WJGA 2C8LA 1ZR4A 4X5OA 1QP0A 4FDMA 2YYZA 1M1NA 2HA3A 3LKDA 2QR5A 3H1BA 2TSYB 3QLUC 4FYHA 4QECA 3DAOA 3JTMA 3O8LA 1CZNA 1O08A 3CH6A 4PO1A 1SVIA 1E2QA 3GR6A 4QGFA 3QKSA 5EEGA 3HXMA 2LDXA 3HK2A 2W6IA 4F6CA 3TLMA 3HVJA 1GTRA 4GL2A 1MEEA 1H1TA 3IUSA 5K0TA 1E7SA 3A3NA 3AEKB 5JSYA 3VU9A 3IAEA 1XTBA 5ALNA 3U60B 3EPJA 5I51A 2YJ6A 3DHEA 1E2BA 1N4DA 1JBKA 1VIYA 2JB9A 2P75A 2ZI7A 3BWEA 4KWCA 4N6NA 4EI8A 5LWHA 4KTTE 5A5VA 4QQRA 3CR3C 2C5EA 1FX0A 1SEPA 4Q7QA 4EX6A 4I3GA 2COEA 3RABA 2C2XA 3VH4A 1FFAA 2B1QA 4IOJA 4HRVA 4DIFA 4WFQA 3NZEA 3NWEA 3ORFA 3R9KA 1Y1QA 3LE8A 1TIBA 2JGRA 1T2DA 3JQ9C 3UQYS 3I53A 1GRVA 3DOJA 1GTVA 3R0VA 2P27A 4MB6A 4CDGA 1YNSA 2DG2A 3HKDA 2HBRA 3A6GA 3ILXA 1ISSA 1CUFA 3G68A 4RQBA 2XBUA 3F73A 1NQAO 4I9GA 1A98A 1JDUA 1W8IA 5FWDA 3QXHA 3E9CA 4FFVA 2PA0A 4NPHA 3FWPA 4K86A 5KNDH 3IGFA 1Z07A 1Z33A 1Z0ZA 3U09A 2YS7A 4ZK2A 4D4HA 1N6IA 1DAFA 2QLBA 4TVOA 3V1YA 3QUBA 1PU2A 5AM2A 1ISMA 1ZGGA 3BULA 3JATA 3EIEA 5DYGA 2DFNA 4JV5B 4FI3C 5DEOA 3VNSA 3EHEA 4Z0TA 2BEKA 2C3OA 2QVYX 4R54A 1Y33E 2WKRA 2DYKA 4L51A 4NFLA 1FDWA 3S55A 2AUTA 2B1JA 3V1MA 1UPTA 3D1VA 1Q1QA 1CRQA 3BQ9A 4X6LA 3CT6A 2O7RA 3FVRA 3OI7A 3WHKA 3U5TA 3DMNA 1Q6YA 1RXSA 1VXOA 4QYIA 3SS8A 5L3ZA 3F7MA 3RG2A 5JPDA 2HFJA 1PDVA 5CB0A 3DFIA 4BU0A 3PQDA 3UCFA 1T9HA 3UG6A 3EOBI 1U28C 4CMIA 1R8QA 1TPYA 2CUTA 3JASB 3K9LA 3TAHA 4F3YA 3L7KA 1NW9B 2J41A 4FGSA 4QBFA 1K7YA 1R10A 3IQZA 5K2MA 1IUPA 2XUFA 1JYEA 2WTEA 3KOYA 5KNCA 1TM2A 1MEOA 2ZSAA 3C7DB 4JDUA 1DXOA 2BI8A 4OB8A 3RANA 4EKDA 5J63A 4PPQA 2B1RA 4TMWA 1MJHA 4FN4A 4LDZA 1J24A 2GZAA 4LZJA 2BWJA 3ZWWA 4H35A 2EW1A 4ENVA 1GPUA 3SYNA 2I33A 1B6SA 1B0PA 3FGPA 2O2GA 3JD3A 4ASUA 2Z2IA 2QT0A 1EX7A 2AFIA 3WSVA 4ZANA 4BJ3A 1EBUA 4F3RA 3MWLA 3O31A 3SLGA 2H07A 3Q87B 4W5WA 1RQ7A 1ZQ9A 1OXBB 4L22A 2JFWA 1Y9AA 3HJRA 3PJFA 4TQ9A 3CJTA 4GMXA 4ZYLA 3NAGA 5B2FA 4L9SA 4MDEA 4CCAA 4GSYA 3HU5A 2AMYA 3NBMA 4TKVB 2J3DA 5G4KB 5HQ3A 1WM1A 4IHJA 3OQMA 4RY0A 2YJ3A 1NVMB 1OI2A 1AV6A 1WP4A 4NZOA 4RV9A 3TE6A 3DGEC 1ZSYA 2GZ1A 5BSMA 4Q1AA 4QEKA 1NQVA 3V4VB 2WLTA 4TMVA 2WMDA 3UW1A 3ZY4A 4W5RA 1PTKA 4ENTA 4YAWA 1E66A 1UP4A 2XT6A 4TQAA 1Q7CA 3OU6A 1NP3A 2CL5A 4YJ2A 1LDNA 1FFSA 1NLYA 3G6WA 4HDSB 2NXJA 4UD2A 3EIOA 1MOPA 2OM6A 4TGLA 4WGFA 2ZQYA 1ZGCA 1Z7BA 2H63A 3KYDB 1GG5A 5I7EA 3OG9A 1H0HA 1MQAA 2QQ5A 2WYOA 4GKBA 4PYJA 3K2QA 4UBNA 5A04A 4KLNA 4LYGA 1MBZA 2O8FB 2R6AA 3IOEA 5DTIA 1G20E 1E96A 2XUOA 4M0KA 4A8PA 5AQ1A 1FNDA 4NK5A 1TMKA 3EDMA 3X1ZA 1L5FA 4F91B 3WNDA 1JU4A 1KQGA 3OIDA 2FXIA 1EFAA 1C4XA 1WZNA 1Y8RB 2ZK7A 3BL5A 3CZMA 4HH0A 4LFCB 3W1VA 4ZEMA 5IZ4A 3WIUA 1N2XA 2PM8A 3CN9A 1Z63A 1QKJA 5IJ0B 3R76A 1XB2A 1P9NA 4QU5A 3RHFA 3K0EA 2I65A 3O0TA 3KKPA 4UEQA 3WYBA 2VNKA 4YUWA 4AF6A 1F4LA 1C2TA 3PR2B 4XQCA 2PO5A 3EPKA 3C2QA 2YW2A 4GIBA 3MAAC 2WIKA 3GEBA 4PZZA 1SBQA 3ZK9A 1Z28A 121PA 2F3RA 2DMRA 1JKXA 4OJNA 4P5EA 5CITA 1RRFA 4E0BA 2J0SA 2HW8A 5BRNA 1SIUA 1YDEA 1Z62A 3GDWA 4TWBA 4IQGA 3VAZA 3HVIA 3IHWA 1KRWA 3RYHB 1R64A 5JCXA 1BJRE 2BE7A 3KQVA 3U6BA 4WECA 2RGRA 3DLCA 4FFBA 1AQLA 2IYQA 4FKMA 5HTOA 3PJDA 5KCZA 2RFLA 3WWPA 1E60A 4OOEA 5HRCA 2QYHA 1BHJA 3GGDA 4R1SA 1C9KA 4B2YA 1BJTA 1GPAA 4HDSA 5ALWA 4ZKEA 4OHYA 2YOHA 1KY2A 3HB1A 4GBGA 4I1YA 1E5TA 1XDGA 2WICA 2NSLA 1T8WA 3CS3A 4X9XA 5C4GB 1IK4A 1G7TA 5K6AA 1GFZA 3KG2A 1FMLA 3GL9A 4BEVA 1XCGB 3JAKB 3BH7A 1CB0A 1M2JA 1X87A 2FPRA 2X7JA 4FYIA 4AS3A 3BHIA 1PNRA 3M6IA 3OIFA 2NN3C 4K8RB 4V1CI 4BXOB 1CLEA 1JQLB 1EH5A 1NVXQ 3N86A 4NFHA 2CLIB 3H5VA 5SYMA 1ZP6A 3S1AA 1R88A 2WC1A 4K6GA 4LDJA 2DPYA 2E4XA 3ZWDA 3VOTA 4A4DA 1Z4JA 4FD3A 4E30A 1E99A 2PJRA 1Y37A 1VL5A 4QDKA 5HJEA 5HMLA 5TF4A 1XD2A 5LUBA 4ZJZA 4JUAA 2UZ0A 4GNRA 4WLNA 4C2TA 4J43A 3OHMA 4KEAA 3HNOA 4HGYA 1CF2O 1ICEA 4H0NA 2ILTA 5GONA 3UXEA 1GILA 2QUIA 3ENKA 1CCWA 4I1UA 2RGEA 2XWQA 4ESOA 1CY1A 5JALA 1Z36A 2J08A 2ATIA 2GZDA 3QLTA 5FTMA 1QIIA 1N0VC 4AICA 5T6BA 3K9FC 1YZNA 3KHTA 2JCXA 1LF5A 3X2SA 3OVMA 2F1KA 1MC8A 2RCYA 2XWBF 3QY9A 1UDBA 3UFXB 1J5PA 1S6YA 1K08A 3DDNA 1ODIA 1RWPA 1VKHA 4HXEB 2DB3A 3C5CA 4B3RB 4WZAB 3W2FA 2XQJA 4UBIA 4RC9A 4UKDA 3CFYA 4PAGA 4Q9LA 5BV0A 4JELA 1YE5A 1NBHA 1CQIA 4J7UA 5AK6A 4BB9A 1UK7A 4C2UA 4KGXA 4CLDA 3SZ3A 1KVUA 2G17A 3EQ7A 4I0WB 1K9SA 3I8OA 5FTJA 4AN4A 1JQJC 5FFFA 4DLKA 3KZCA 1Z2CA 3B8EA 1NI5A 1EGMB 4Y67A 1VFPA 5CM9C 1UKYA 4HBGA 3LO5A 4YDRA 5TE9A 3T0FA 1H4QA 5DSTA 2EQBA 2FRVA 3I83A 3UFBA 4UAVA 1LZLA 4KB5A 1AKUA 2R6JA 3E61A 3T7KA 2Q1XA 4D96A 1AG9A 4NC9A 5BN5B 4AJ9A 1WEKA 2ZYDA 1RM3A 1H94A 1X1CA 3IAS6 1FJHA 4PN7A 2MSNA 2WJVA 2D54A 4MO2A 1I4EB 4AZ3A 1SCQA 2FFBA 3HCDA 2WEKA 4RX1A 4PG4A 1ONSA 5EXEA 1N25A 4K1XA 2BP7B 3I72A 4QOGA 3EAFA 2I6GA 4TRJA 1VPTA 4EBFA 5F3RA 3AP1A 2PLNA 2PXCA 4AKGA 1V9LA 2YC4C 3I9NA 4RJLA 4YUYA 1KDYA 1Z74A 1ZH6A 2WSSA 4QQ8A 4XR4A 1L5ZA 2BFMA 1BHO1 3PUHA 2EYQA 1P2VA 4EMBA 4XASA 3TZQA 1ADCA 2VSXA 4KNVA 2FFQA 1W48A 3DQPA 5JPIA 2H4YA 1ZICA 4MUXA 1N6RA 4QTZA 1Z6TA 3ZTWA 3G23A 1M8KA 1UAGA 3P97A 3S8MA 2I4RA 3LVRE 2Q1TA 4IL5A 3BF8A 2X4LA 3ETDA 4OLHA 5I8ZA 4TMXA 1HTTA 1SD5A 2A0WA 1UFKA 2C9OA 1O57A 2IYPA 1WSWA 2EGGA 3GEPA 2BFCB 1UBRS 1FMJA 4K28A 2VRBA 4ZPXA 3UJDA 1JFFA 3ZIUA 5CYOA 4JI1B 4AJEA 1T91A 4R41A 1JQAA 1L5HA 4D9MA 5ITZA 2HNBA 5JSKA 1DBIA 5EUBA 4XPIA 1CDOA 4GLJA 4MVJD 1CEYA 3TRFA 1EK5A 1CXZA 1BMTA 2AOUB 3GDOA 1W75A 1XXHB 1SUPA 2GN2A 1MKYA 1V71A 2PH1A 3ASVA 4FE4A 1SB8A 2H9IA 3I12A 3I4LA 2GFIA 3B53X 3L8FA 3N0RA 3SEZA 1ISPA 3QXSA 2BTQA 1TT7A 1XZKA 5G3ZA 4E21A 2J87A 4N65A 5FLKA 3VPFA 3BWCA 3KXKA 1L7DA 4DSOA 1UWLA 2ECPA 2GA8A 5BN5A 2QTMA 9LDTA 5IKXA 1AB6A 3T3PB 3ZJUA 4GOND 4DV7B 4S12A 1SEVA 1SUBA 1MFPA 4TWAA 4F86A 4MP8A 3TXYA 1JG7A 1M2NA 4B83A 3DAHA 2GBIA 2HSZA 3QFHA 5DRTA 3K94A 3THWB 1FFDA 2X0RA 3AR6A 4KBGA 4WKCA 4Y1EA 5JSUA 5F52A 2XMCA 4J2TA 3BWXA 3I6ZA 3NTOA 4FPXA 3HWSA 4B6JA 3OTHA 4LXUA 3HEAA 3WL8A 1FVFA 1N6PA 2FZVA 4RPCA 1J5XA 1NF9A 2J9XB 5LQAA 4GG1A 2QAJA 3FPAA 2HA0A 4OJTA 5C1PA 5LSAA 5GZ3A 1M83A 2J4CA 1YDGA 3H4TA 1I4WA 4OSOA 2EYUA 2QPOA 3NUGA 4QUAA 4XI9A 5AP9A 1JTVA 3IPYA 3V7NA 3G8CA 3B1FA 1Y5RA 4GPTA 5IDXA 4UEJA 5KTTA 1FQKA 3PE6A 4UBKA 2PUTA 1QRUA 4X8MA 1RWVA 1A9YA 1J07A 2DSTA 3M0EA 4ISCA 4O4JF 4UCXA 2VTBB 2O5RA 4ALKA 3OPYB 1VIAA 1N9GB 3DUWA 3AVQA 3IOMA 3K71B 1CD5A 4WZ6A 1QSGA 1UL1X 3FHJA 4KYTA 2O0HA 2ORIA 4IV0A 3OAAA 4R8KA 4X71A 3D4IA 3IQIX 3EPRA 5GGYA 4RD3A 5B1EA 2Q9AA 2TMGA 1XXHA 4JLJA 4OJMX 4BWYA 1R0KA 1W4LA 2QEQA 1MXHA 2QW0X 4KO1S 4HRAA 2H1HA 4ND4A 4P4TA 2ZAGA 2AG8A 2WYHA 1W0KA 4UXJA 1I7PA 1QG2A 5EEHA 5DX0A 5EL0A 2X15A 2B4RO 4LMRA 3ER9A 1ZXBA 5L8VA 4J7AA 5DNCA 3PFWO 2DCMA 2QQ0A 1J8FA 2PL9A 3LVBA 4TV8F 2WHPB 1CUXA 1LW6E 1N2HA 2VK4A 2Z43A 3I6IA 1AQUA 1U5BB 3IOYA 2HRDA 2XQVA 2NO4A 4I4LA 2JI8A 4OJQA 1C8KA 4K6CA 4PO3X 4YJ3A 1UT6A 3H86A 4G0PA 1HMYA 3M1YA 3IP9A 2O14A 4OL9A 2G7ZA 1JHZA 3LUHA 1BX1A 1M7GA 5CLHA 3ZGYA 5BYKA 2OQRA 1PFUA 4EFDA 5ELXA 1XELA 3CF2A 3DZBA 5DX8A 2H51A 2P69A 1GNQA 1IZ8A 1UH5A 2G3YA 3HM9A 3ESYA 3EAQA 4K26A 3HYLA 3EZ7A 3HV2A 4BP9A 1HYHA 4BVJA 3SOPA 2FDCA 1KDOA 1I6MA 4HMPA 2GDZA 2VA8A 1Q57A 1IG0A 1XCOA 3PXUA 3ZR4B 2ZOSA 5KOHA 3FXAA 2PYIA 1MAHA 4Q9KA 1XUOA 5A0TA 4Z9XA 2PMEA 4O5OA 2PMFA 4QUIA 1ZCBA 3GARA 3NHKA 3EARA 1VP3A 5KKNB 3CE6A 2J0VA 4CMBA 3U3OA 2VXBA 4AUMA 1BMDA 1R9GA 5J4LA 3JQGB 5A3RA 4IINA 2YRXA 4YLGA 3NBAA 1E8DA 2VHUA 3EDCA 1T5TA 1DE0A 2NTYC 4MWSA 4K05A 5JNLA 1TQHA 4YV1A 3AVUA 1D9XA 3M70A 2F59A 3WLFA 3ZLTA 5JD6A 3BFPA 4G01B 3LZCA 4BKQA 3CZ9A 3L8YA 4I36A 4XFJA 2FPGB 4J0JA 4C7OA 1B26A 4F2PA 4UDOA 1EFTA 1O96B 3TD9A 2X5OA 3OMLA 4RVSA 4DMMA 4HKTA 2CXHA 1I4DD 2VJBA 4MYTA 4KFSA 3SSOA 3SS9X 2VPTA 2WM2A 1XHFA 3HJAA 4RPJA 5ER9A 2RIPA 2IVFA 3IQDB 4OQYA 2PGNA 3LRTA 3CINA 1NMQA 1L7PA 2Y1KA 2YYAA 3SIRA 4Q6BA 4LWQA 3A6JA 4QUKA 3I05A 3VZDA 4YRNA 1PR1A 2YWJA 4RS4A 1NBAA 2IQ5A 3WMEA 5GMOA 1N2OA 2F3PA 2QTGA 4MEBA 4RY2A 2H1RA 3S70A 2H7VA 1ITZA 4QHSA 4AJNA 1HV8A 1ULUA 1TQDA 7MDHA 4NICA 5JI3E 1I7LA 2BGRA 1N5MA 4N4AA 3PEFA 3ZI0A 7YASA 4WESA 1SU4A 4A2QA 4C30A 1BS9A 3WK5A 4I4TA 1A9QA 1CUDA 1F8GA 1G5HA 1QV6A 1WMEA 2FN4A 2R6R1 3NPAA 4KG7A 5KNCH 1U7OA 3JYOA 1W88B 2VSQA 1L7EA 5BV1A 1NKVA 4GBED 1O4WA 1XTRA 4DA9A 3R0IA 1ESNA 1X3SA 1VHDA 4DV2B 2I7DA 5AW3A 4ZDJA 2D74A 4QWWA 3UY4A 1JSLA 3BUSA 5DT2A 2AOTA 3LHDA 1T13A 4IG9A 1CPYA 4U4AA 3WRVA 4P32A 1E3QA 1YL7A 1TEXA 4GQBA 3V9PA 5JFOA 4EMSA 2YYSA 4EHJA 1NLUA 4R1UA 4Q6WA 3Q5DA 3IPAA 2AN1A 1Q0TA 3C3YA 2NO0A 4DLZA 5I7VA 1D2NA 2A1IA 1M2VA 2O2SA 2X76A 2Q2OA 4MI6A 3H2JA 2QTLA 1JE0A 1DIRA 3BK7A 1AS3A 6CHYA 2BEWB 4TTAA 3IL2A 1X80B 3PNSA 4I46A 1XTIA 2NOAA 1SUWA 4MVJG 2OBLA 2WA1A 4ZGWA 4F6RA 2GLUA 1M6HA 2W42A 2ZIEA 4X66B 3SZUA 1NI4A 2MTBA 4Y1FA 4KLCA 2JJ8A 5BSUA 5BQ3A 5IDQA 4HBZA 3DLBA 2GCOA 1L9XA 2W4IA 1YVEI 3AJEA 3CEAA 4M36A 2OGTA 2PRYA 4REQA 1BYUA 4IF4A 5K8TA 4B7ZA 3ZGLA 4Y0NA 3OOYA 1C8BA 1E3TA 5DBOA 1KPGA 2R97A 2NVOA 4M86A 4Y6QA 1Q20A 3CUEF 3JD4A 1A04A 4RVHA 521PA 1B3BA 1A76A 2JGLA 4FYVA 1IOLA 5DK4A 3LC0A 5AKGA 2MU1A 2BGIA 2R65A 3H6KA 4IVPA 3UGTA 4M9UA 3MRXA 3K0BA 2OBNA 5COAA 4BCBA 5DCWA 4GZMA 3KR0A 1AMNA 3D3QA 4DJAA 2ROQA 1GYPA 3RVRA 1L4MA 1NVKA 2G6TA 4MKXA 3HA5A 4A8JC 4AP5A 1U7ZA 4JITA 2IF0A 4HVCA 1TO1E 2RAUA 3KX2A 4UNQA 2GXAA 4G65A 3HY4A 2I55A 4CMAA 1OXXK 1R74A 4DXAA 1BGXT 2Z5FA 5HK8A 2X6TA 5JMWA 3AVYA 2ZIFA 3U1TA 2HRRA 4IOKA 4DUPA 4RMGA 4ZC8A 2E7ZA 1SBYA 5SY4A 3I2FA 1MO3A 2HQOA 4C7VA 1QUFA 3ROGA 2QRVA 4HF7A 3CEMA 1Z6PA 3LVFO 3W5CA 1DEKA 2J6BA 3D6VA 3ER6A 5K6AC 3WSTA 4LBZA 2ZJAA 4G2NA 3RAFC 4QFDA 3KJNA 3URMA 3IUBA 1WP9A 3GJ3A 3PHBE 5EJFA 4JI6B 4A1FA 4CIWA 4LYFA 4CIBA 3GRZA 3TKYA 1NBMD 1N8TA 2B4QA 4DIUA 4B0PA 4UHCA 5IN4A 5FBRB 4JR2A 2FN9A 5J5AA 1XTUA 4UDNA 2JC3A 2YJZA 3EZXA 2A58A 4ENWA 1ZJJA 5BW4A 3IDOA 4FZ3A 1T15A 3VPSA 5K8IA 4YV2A 4YP0A 1VKJA 3PQ4A 1SO8A 2YDXA 1AXEA 3BFKA 4JENA 3CF4G 3U17A 2D1QA 1JJIA 4D9FA 3ZDZB 1OWPA 1PL7A 1UR5A 2P2GA 4UAJA 4LVUA 1H66A 3TMYA 1J8YF 2XUPA 3AUUA 4WOBA 3ILYA 1UBFA 4MAFA 5KCMA 2XKKA 4OHCA 3WXMA 4V0MA 5LDHA 2YWFA 1TMOA 3IELA 2REOA 3IBCA 1JSRA 1Z5VA 3ITEA 4PVCA 4UNSA 3X44A 3FY4A 3KKEA 2J31A 4ZVTA 4BZZA 5A5EA 1FZTA 3WA7A 1H69A 2HDNB 3GD7A 3SX0A 4FDUA 4B44A 4GC5A 2Q28A 3FH0A 3HEBA 1EINA 1HDIA 1BDMA 1BMQA 3DV9A 3GN2A 3Q3VA 4HEQA 4PGMA 4DNQA 3ELDA 3QX3A 3IYLW 3V1LA 4K9KA 1JKIA 1R4NA 4AZTA 2J67A 2BZ0A 1MABB 3BORA 5EIBC 1YR1A 2R1ZA 3CKMA 5IH3A 5HJ2A 1NUPA 4YJFB 1SBHA 3HBAA 2II6A 3RS5A 4R3WA 4GVPA 4F4DA 1GLVA 2I29A 3L6UA 1IJFA 2FWRA 3L6OO 4ZDWA 4TTPA 4ZJPA 3GQBA 1SOAA 5ARBA 1PS8A 3SAJA 3ASUA 4RK6A 2QTFA 3NTRA 4B2IA 4PZUA 1Y6GA 4Z4FA 2JFQA 1UPBA 3FHCB 3MCWA 1OF1A 2GJKA 1BGWA 5HE9A 1W1UA 2GPBA 5EZYA 3UYLA 3AR9A 4PLHA 3WRWA 1GQOA 1TQ8A 5KC8A 5LZ9A 3KLNA 3R40A 1G8PA 5F9MA 3H11A 2SCUA 4Y9TA 3RVNA 2D7CA 2V9CA 3VR5D 3QQ5A 3HVHA 3AB7A 3TN7A 4IXNA 2BTEA 3BTSA 2OV8A 2PX3A 4TZ6A 2NMVA 3NHAA 4RYDA 4U7TB 4CL3A 5BSEA 3HBMA 5F73A 1WEHA 2QUAA 1RLOA 4C6TA 5HDQA 4A5OA 1DT3A 5FD8A 3ZCRA 5JS1A 1P61B 4QE3A 5FPHA 1RACA 1M2OB 3R7AA 5IT4A 3UK6A 2JFHA 1RBZA 1UWKA 1DQYA 4CIXA 1UC9A 2IITA 3OFKA 2KX7A 2QMEA 4AO6A 4JASB 4HJRA 3T12A 3UT5B 1M2KA 4CEHA 2EDCA 2ZJ8A 3UIEA 1MQ8B 1PP4A 1ZWLA 2PS0A 3JARA 4L3OA 3VMFA 2ISCA 1PUJA 2QM8A 2FMHA 1XA4A 1HWYA 2JZNA 3TXXA 1ETUA 3VRHA 1MH1A 5K8LA 2A92A 2X3YA 1AHPA 2G1JA 4E32A 2VHQA 1PG2A 2E3JA 2JI4A 1DWPA 2DH5A 4XIJA 2ZR8A 4YMSA 2C2KA 2HU8A 4J4BA 3BIJA 4WNAB 3TTTA 2A6PA 3OZCA 1H0RA 3FFAA 2WV7A 5BN4A 1M6WA 2IYLD 3RS4A 1P62B 5EKDA 1P7CA 2XWSA 3IE2A 2VQEB 3ZGVA 4MWZA 4ARSA 2QVZX 1V6SA 3FKSA 2C96A 1ANKA 4IM7A 5K51A 1VRCA 2FSFA 5CX1B 1QZUA 4I99A 4ZT7A 1Y7TA 4A6DA 5TT1A 2KS6A 4E5YA 4IIXA 1GQQA 3U3RA 2VNAA 4XVUA 4GMGA 5KOJA 3GJRA 5JQGA 3BKXA 1MW9X 1RHUA 3EA4A 3ILHA 3OJEA 3AKYA 3BMOB 3FW1A 1V9CA 4DLXA 4BO7A 1E1LA 2WSMA 3Q11A 3D7MA 3UGQA 5A5GA 2VPQA 1VLHA 4KE7A 5A4KA 4NZYA 4PICA 4DF3A 3L6EA 1A77A 3B52X 5IDYA 4DDVA 1HX7A 4AY5A 1TZBA 3KEQA 1HFWA 3NDBB 3TKLA 4WTOA 2GF0A 1KH3A 1YHNA 1Z7YA 2QWXA 3A3PA 3HR8A 2VP6A 4GOOD 4UZEA 2P6NA 1JHXA 3O74A 3USCS 5BVGB 4QJIA 5CA1B 4YT8A 1PI3A 3PYXA 3SYKA 4AJ4A 4PRKA 2O8DB 3HTXA 3CUYA 2GN9A 3WGUA 3SI7A 1W1IA 4NE9A 4HNUA 4JUFA 5E1DA 2EGUA 3MOSA 4DDWA 4Q19A 2FLWA 1FJXA 1JQBA 2YCBA 2H59A 2IBTA 1CY0A 1NXXA 3KR9A 4DHEA 1TFUA 4ZI7F 4R7ZA 1DTEA 2CNBA 3E1SA 6REQA 1LH0A 2ZRMA 5G1NA 1Y4ZA 2BL4A 2ATVA 2CD7A 2PCLA 2VHCA 3ZY2A 2NU9A 4FN5A 2G08A 3HRHA 1MO2A 3KIPA 2Q45A 4AECA 2MSWA 2GPWA 2ORVA 3DHNA 5KNLA 4KGZA 1YWGO 4HXFB 1I32A 5ALJA 3VOBA 3WYCA 4G3XA 4XA8A 4EGCB 2H1IA 4IKPA 5IC4A 2V7TA 3O82A 2I7VA 4LFAB 1FDOA 2ZAYA 4DC0A 5CB4B 2QP3A 1FUUA 4YYEA 4ZT4A 2AEFA 1GEEA 3IXQA 1ZX1A 1THGA 4HDKB 3UYKA 1PR9A 3O8QB 1I3OA 1YQQA 3MW8A 3WWDA 1GADO 4G84A 2PSSA 2KLBA 4D8TA 3I0NA 4FEYA 3RG8A 4RPLA 4JQZA 1KVRA 2KM1A 4TKZA 1VJ5A 2O0LA 2Z2JA 2OHGA 4UQOA 1B0ZA 1IMJA 1L3IA 4J3JA 2H5LA 2PV0A 3NEAA 4IDAA 3SC2B 1KEEA 2PQ0A 4Y2PA 1XD8A 4MKRA 3VAAA 3W6NA 1L5RA 2LTAA 1CEXA 3DPUA 4HFJA 3IXLA 2ASVA 3CU5A 2W2KA 3GAMA 4UNRA 3UMYA 3F6PA 1X14A 5C0OE 3A4LA 1NR7A 2C0QA 4NJEB 3CTPA 3AERA 4MV8A 4D81A 2B1GA 3RT7A 1UOPA 1D6SA 1MOZA 4AKSA 2UYQA 4BYGA 1UJ2A 2VS1A 3QEMA 2OPHA 1V16B 3GCWA 3IAAA 3LWNA 3TL3A 4YMLA 3M5WA 4C4PA 1HFKA 4WW0A 4HK4A 1N6NA 5KYWA 4H59A 1FQJA 3GH3A 3W7AA 1GL7A 1SG6A 4HAXA 3NI2A 1W581 3PFHA 1G4HA 3T54A 4XDGA 5B58C 1W5TA 2HHCA 5BVHB 2E21A 3GD5A 1RJFA 2PRIA 2VHYA 4TTSA 2OV4A 1JKMA 1JDBB 4MDHA 4CV1A 1VYUA 3SBXA 4UJ5A 3W5BA 1Z0KA 1ARZA 4P4LA 5IDVA 4OMUA 1CK4A 5CT9A 4QBTA 2DC1A 1WXXA 2RI1A 2GETA 2PGIA 3DBHA 1HQCA 1C9DB 2W48A 3FNFA 1AF7A 3T7EA 4PXAA 2OL4A 4OH1A 1MPTA 2HR1A 2ZG6A 5C8YB 3NALA 2PKQP 3SLRA 3ZDQA 4PYRA 2WT8A 3DEAA 5C7IO 1D2EA 4UVIA 4L16A 4MS4A 4PYMA 2AOVA 1I1OA 1TO6A 3L79A 2IUEA 3ZWKA 5IUNC 2QX4A 3ICQB 1Q95A 2CEAA 2FX2A 5EWLB 3MRTA 1HDEA 1R0SA 1T5LA 3NANA 3RGGA 1P8AA 3EQ6A 3IT2A 3SDSA 3QHPA 2IDZA 1G8KA 1KEWA 4DLPA 3C43A 4CKEB 4J0KA 3L93A 1E58A 4JVOA 3UMSA 3ZWMA 5AUOB 3PEUA 2NXWA 3DZGA 4TVBA 2C88A 1R6XA 3GZ4A 4CF7A 1K4KA 2ESRA 1RBYA 3I8SA 4HNTA 4GI3A 4P5DA 2WQ7A 2HA2A 2FE1A 4G9BA 4J7CA 4IKEA 5D7NA 3MHPA 1TCVA 1ZRMA 4BFCA 2XQKA 3KQWA 3E7FA 3RIYA 3OHPA 1S2DA 4OBXA 3JD2A 1DAPA 2NU7B 2G1PA 2NO6A 2B4AA 3NCTA 4M76B 4LK3A 5EIHA 1KDZA 3MTEA 4KHPB 2YZKA 4KN9S 4FOSA 2DWQA 1LNQA 3PD7A 4QU8A 5KDDA 2Z8XA 2WB2A 2PKYX 1ODTC 5DGDA 4F5WA 3L7JA 5FR1A 2A35A 2AW3A 3LLSA 1UKCA 2IX3A 1GP2A 2Z3VA 2DBRA 3IDAA 3JAWA 4GZLA 5CHEA 3KQLA 5THQA 3RYFB 4DLLA 2FPPA 1GTJ1 1YCGA 3EGXB 3Q8WA 1QRDA 3NXSA 5DASA 1U9JA 5EQTA 3DTNA 1NBIA 5AVRA 1CR2A 1ZJZA 1AXGA 1JI0A 3R0JA 3DAYA 2D1TA 1FXWA 4OMDA 1OXSC 2FP3A 2XYGA 3JQFC 2P40A 5FUBA 3N0XA 3KSAC 3O1HB 3KCNA 5JCOC 5A4MS 2GA9A 1CS4C 1M0TA 4PG8A 3D5TA 4KBFA 1UDCA 1OH8A 4IIJB 1GVNB 1H3FA 1UMDB 3H9CA 3MS7A 1VJDA 1RI3A 3IR7A 3DLAA 5DLYA 4MWDA 1OLSB 1V3TA 4LGYA 4A1OA 1HI9A 3C7TA 3CXRA 1EP2B 3QJGA 3UJAA 4CDNA 2YYYA 4JIMA 2PZFA 2NO1A 3ITNA 4CMKA 4MVWA 4B2LA 4YRIA 5KOIA 2HHLA 4A8TA 3CVUA 2GLXA 1GFIA 1KFEB 1XGKA 3H16A 3L77A 4L9WA 4D3YA 2IV3A 3V9AA 16PKA 3GVPA 4ZGGA 4PFKA 5ERGB 1L4HA 1MX9A 4H3VA 5CNKA 1D6MA 1ZFNA 5KSZA 5M5BA 4NEHB 4NS4A 4HEJA 4KVAA 2FG5A 4HN4B 4E2WA 2J0UB 2JI7A 4L4XA 2PMWB 3DFFA 5G3YA 1P0IA 1XF1A 4XWOA 5HKAA 1KKUA 1JFLA 1K86A 4CF5A 3Q8KA 2AD5A 4KODA 5CTJA 1ADFA 3DTVD 5DX1A 3UOGA 3EXG2 2WW8A 1FTWA 1LJLA 3DMTA 3EULA 4B79A 2PS3A 3BGWA 2NSHA 1SUSA 2CDRA 5DNUA 3KLPX 1M73E 4NCXA 2UAGA 1ZY2A 5AVZA 2QAGC 4Z4GA 4U6NA 3BWBA 1CB7A 2I54A 3HB5X 3WZ2A 2GD2A 4DNXA 1LK5A 3PE4A 2W7TA 5JBIA 4MR8B 2P6PA 5KYTA 2E6KA 1CIVA 2FW7A 3N8GA 4XB1A 5A4DA 4K9SA 1JF8A 5E6UB 3N2ZB 1E8NA 1RYZA 3EYWA 4Y6PA 3A9SA 3TRHA 3DLPX 1E1DA 4M1TA 2BONA 2PZLA 1GT91 1QHYA 2ES4A 3GEDA 2G63A 4C5AA 1F2VA 1CNEA 1VJ0A 3QFTA 1FXUA 2XCTB 1LSJA 2LP4Y 4XRRA 5BMVA 5EESA 4HFNA 1EM8B 1GNSA 2V7PA 3FZYA 4MYUA 3VJMA 1JEYA 2X58A 3SVZA 2J6IA 5LM3A 2P4EA 3VPGA 4HRYA 1U5CA 1DBWA 2CF6A 3FSJX 5JLAA 2ZPAA 1Q12A 1E61A 2CGEA 2IEYA 4R01A 4O2LA 2D62A 3SFVA 4DDKA 1I2BA 2FLVA 3BDVA 1ETHA 4L1KA 1CBUA 2WF9A 3P9PA 4WUTA 3RIMA 2KMLA 1HKUA 4MQEA 2KJQA 3IKMB 1RQRA 3PCTA 5EMNA 3TL6A 1HTBA 2BKEA 4GEGA 4IV8A 5ALIA 5HILA 1KSGA 4UOZA 1XT6A 3HDVA 1CJVC 1F8YA 1Y1SA 1QYIA 1DAEA 4FNGA 3OKPA 5FLYA 3A28A 1ZOSA 4KE6A 2WWIA 3FNGA 4EECA 1E3MA 5KTRA 3FVVA 1WSAA 1EU1A 3K31A 3KQQA 1BXZA 4CMJA 5C8ZA 3IKTA 2O0KA 5E4JA 2A5LA 1CEEA 3RJMA 2ZBPA 3FYCA 2R5FA 1GHTA 1UBCA 4PSDA 4D97A 2W2QA 3TBHA 1VRWA 2BRUC 3IUMA 2OGWA 1ZBQA 4OUKX 1BJKA 1OY1A 4Q7EA 3AHDA 4P7FA 1H05A 1ORRA 1UZLA 3MUNA 1ECCA 4JP3A 1RPJA 1W0KD 3IFSA 3AB8A 1DELA 1WZCA 3NOOA 4JHLA 4B8ZA 2RB4A 2Y6VA 4DIEA 5MN4A 2EIXA 1DWQA 4QPPA 2B4KA 1VKOA 2G6BA 2CMDA 1TVKB 1C0IA 1H2HA 2QMQA 4TTIA 5KI6A 1WO8A 2CJWB 2OYRA 3ILSA 3WVNA 3O75A 2DKFA 1C3XA 1P80A 1Y1LA 4II3A 3GRVA 1X7YB 5C5CA 2F8SA 1GU0A 3AOGA 5EVJA 4UMFA 4P0QB 1DRUA 1IEWA 2NWQA 4FMBB 4XOIA 1KU6A 2ZYIA 1IQPA 5AQEA 4C0AC 4AKIA 3RUAA 4HDMA 4MQLA 4X7BA 3HLYA 1ND5A 4HAIA 4EL0A 1ISRA 1RC0A 1ZI6A 4E5MA 3JV7A 1TF7A 2RHBA 3C5VA 3WNQA 2IYUA 3SVLA 4QDOA 2WD7A 1QLHA 1D4ZA 1Z2AA 2FUG1 4DVJA 2NYRA 3Q7TA 4BAUA 3KOXA 5CH8A 5LP6A 3GGCA 4WE3A 4WCFB 2RJNA 3OQVA 2FQWA 2XYQA 3HYNA 4NE2A 5HF5A 4HMQA 2FW9A 3H4MA 4OQMA 2PX5A 5G0VA 5LL6P 2W4MA 4V3CA 4DCGA 5E3IA 3C41J 1T4CB 3ZW7A 5C8XA 2JG3A 1NJ8A 3I2IA 1KI6B 1NIPA 3DLIA 2CY0A 2ERYA 4FEEA 4OIFA 3MMZA 4B4DA 1WPGA 3VXKA 2DU8A 3U7IA 3G0GA 4RFSB 621PA 3I61A 2R6GA 5H3HA 4XAQA 1HC7A 3CPJB 5IBQA 3CG0A 3M33A 2OZLB 3OP1A 3FE2A 3GJTA 3M8KA 1G60A 1PS9A 3AO0B 3QYPA 4J3NA 4TSFD 2QTVB 4TN5A 4BS9A 3THXB 3L2OB 1UZAA 1UXOA 1Z3CA 3SZLA 3V55A 4NDZA 1P45A 3DO6A 1C9YA 3PJEA 2P9JA 4XGKA 1QR2A 4Z8XA 4TYWA 3N2GA 2CK3A 3ZHRA 3EG9A 5CGQB 4URWR 3PGVA 4KH0A 3D3JA 5BQFA 2LE0A 2PJUA 4MP6A 1DG3A 2JEYA 2R6HA 1BD3A 2EKBA 1Y5LA 3FUCA 3IV6A 4FGKA 4ROTA 4LF7B 2GAFA 4Y2HA 2E48A 2FUG6 3KSZO 4DCCA 2X0FA 2CZQA 5CCEA 1A72A 5DLDA 4B48A 1DKOA 5LOVB 3FPEA 1V41E 2NQ2C 3H5IA 1Z37A 2VDLB 2X8JB 1K89A 1QV9A 1F0YA 5J1TB 4AWAA 4TX1A 5AICA 2H2IA 1M74A 4O29A 2ODQA 4L73A 3MCAA 4FFPA 4MKZA 2WJPA 1BHSA 2XEDA 2AFHB 2PANA 5A2GA 2PUHA 4YP6A 1Z06A 3R9XB 2D2VA 3BYZA 3LVQE 1NT4A 3O4IA 4ILEA 5I9MA 5EJGA 4ENRA 1LUAA 1ZBDA 1LVHA 2OCDA 4GWLA 4W1PA 5AKIA 3TPCA 3WLTA 2Q3HA 2Q7DA 2PE5A 1Z75A 2I6FA 3CZ5A 3DOIA 3ZE0B 3J7AC 3ZHOA 1T4CA 1RC8A 4M21A 2BTOA 3NV9A 2HUPA 3GRKA 5BMOA 2EF1A 1DX6A 1QIJA 3NKLA 4AJHA 2BVNA 4N3BA 3OJWA 2Q7OE 3QLVA 2XCUA 4CM5A 5LZ2A 3T1TA 2ZANA 1VI6A 4Q37A 3ZQ4A 1RYNA 1TMYA 1JSXA 3INYA 3M6XA 4Y0VA 1MX3A 1ONNA 2A3NA 5HG0A 3WLEA 2I2AA 3MJRA 1UF9A 4XCQA 4B34A 4CQLA 3THXA 4TXHA 1Z7GA 1Y7HA 3MWYW 3UA4A 4LJ4A 4NIMA 1QX3A 2YBEA 1I24A 3SHFA 1S96A 1EQ2A 1KXJA 4OF4A 4OHBA 2QR3A 6GPBA 4LYAA 1IDN1 2X0KA 4D9CA 3E9EA 3Q72A 3K53A 1AJEA 1QK5A 1TXGA 1U0OC 5LCXA 2P3QA 1E9DA 2F8TA 1QNLA 3VZBA 2CV1A 2FQYA 2PTGA 1LPPA 1G20A 1CE8B 2CLFB 4G0QA 1A5SB 1KHTA 3S2IA 5IAOA 1CUVA 3PR3A 3F96A 3ZD7A 1LKZA 3LV8A 5FI1B 5DLPA 1XDBA 2WFMA 5AJXA 3A6PC 1IB0A 1QIGA 3JYHA 4OMFG 3PNKA 5AHXA 4CLHA 1ESCA 1YVPA 3OT1A 3UH1A 1IHUA 3INRA 2OO5A 1JEEA 1W6UA 1X9HA 2O0MA 3F78A 3VC1A 1LSSA 1Y4UA 3ETJA 4X63A 3VYTB 2R1VA 1YR7A 2ZRKA 4RF2A 1CR1A 5D5PA