4R1OA

Crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
496
structure length
496
Chain Sequence
MLSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVFKSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAFAESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELLDEYEELYDIVPAGRQEGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPGNELILGAHMLEVCPTIAATRPRVEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-arabinose isomerase
publication title Crystal Structure of Thermophilic apo L-Arabinose Isomerase from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Isomerase
total genus 183
structure length 496
sequence length 496
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.4: L-arabinose isomerase.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r1oA01
4R1PA 2HXGA 4R1OA 4F2DA 4LQLA 2AJTA 4R1QA
chains in the Genus database with same CATH superfamily
3VU9B 2F8MA 3D6HA 3UH0A 4DQDA 4XRRA 5B12A 4HYTA 1XEWY 2ZJFA 4Z3OA 3NP7A 3ZJUA 7REQB 2CMFA 3MOIA 3BXOA 2FE4A 2PH5A 4X9XA 2PUFA 1G8AA 5EQTA 1PR3A 1S3IA 3LOUA 3VAZA 4HDNB 2B9EA 2OAP1 3D3JA 3FJOA 2E2WA 2GD1O 4Y9TA 3V42A 3NO4A 2VTBA 2ZK7A 5EZYB 2ATEA 3SBDA 3TIIA 3KSZO 2Q5HA 1E98A 4OXNA 4PLCA 1C30B 2J07A 1DBRA 2PQ6A 2QD3A 2I54A 4XIJA 3R5SA 1JLRA 1PGNA 5KJEA 2Y27A 5FPKA 1QH1A 2ECFA 3G8AA 4LI3X 5ESXA 3UT0A 4CMAA 3G5MA 2W6OA 4EELA 5BVGA 1HDZA 2HLNA 2ABWA 3AOEA 3GEPA 4AN1A 4K3VA 2Y1CA 2QQ0A 4J4BA 4Q05A 3H16A 1PWYE 1SUWA 2Q2OA 1A77A 1AKNA 1P6XA 3LT0A 3FYCA 2NYAA 2FJUA 2GPTA 4FINA 4IO0A 3G7SA 4I1VA 1JFFB 3R3ZA 2WZQA 4ZPJA 4U7DA 3FWKA 4FI3F 4WKNA 4QIHA 2QM8A 4G4GA 4UFOA 1DS6A 4FEYA 4Y2TA 4C4AA 4EVRA 4YCLA 2GILA 2JFHA 1FYDA 2ZYHA 3DOOA 3MTDA 3QE3A 2JJ1A 4UZFA 2QTAA 2WUWE 4Q9JA 1CJTC 1Y1SA 3PQEA 5BMVB 3GLRA 2Q3HA 1CIJA 3BRSA 1M0SA 4Y2YA 4UJ5A 3FIUA 1X38A 3G2JA 4IHKA 1A88A 1ZJ4A 2Y4NA 2H4XA 3LBFA 4NYIR 5KYYA 2CXOA 1EGMB 4FONA 2ZBQA 4EGJA 4N5NA 3CZRA 4K2HA 4ZDIA 5K0BA 2P90A 1ZL2A 3OZIA 3SZ3A 3CVVA 3C8ZA 3A4LA 3UHOA 3KQHA 2A14A 4KR9A 1NXVA 5LR6A 1K7SN 2BT4A 1CZNA 3NEAA 1QJCA 2YJNA 1R8XA 1UBTS 3D02A 3QG1A 1H9AA 1QORA 1F1JA 2YY5A 1JIUA 1SVKA 4KVFA 1CFZA 4HF7A 4QUGA 5TT0A 5K3OA 1SCUA 1T8SA 2UUPA 3IQIX 1VPTA 4FD2A 1PKEA 3RARA 2WYWA 4KUHA 1T0PA 5AW6A 3GRAA 4FR2A 4E3ZA 2Q5LA 3PD0A 1H2HA 1GTMA 4AK9A 3D8HA 4M0EA 1D7AA 4Z53A 1P0IA 1CZHA 3DVAB 3CNNA 2UUAB 1T91A 1KA9H 3W8FA 1MX9A 3RIMA 1BHSA 3M1LA 1J24A 2P9ZA 3D6JA 3SMQA 4EFMA 4DV1B 3I5MA 3L02A 1X94A 3ZI4A 1LQUA 3PHHA 4Z4EA 3DOCA 4QBFA 3PPIA 1WMBA 1MDFA 1RBYA 3LMKA 2A59A 3KXPA 4MVXA 4NAHA 5CEEA 5HJ5A 5K3FB 2ZYWX 4HMQA 2G25A 5EGSA 4CPDA 3W77A 2Q27A 4US1R 3OU7A 4KU4A 5DGIA 3CUEF 3IHKA 5AVOA 5CM2Z 2VHWA 2PSEA 4RPHA 4OMCA 4ALMA 4J9VA 5ER6A 1NNSA 2ZYTX 1L8AA 3IR5A 4KYTA 4DG8A 3N39C 3UBMA 4W82A 1NL3A 3FW1A 1TFRA 2DBVO 5KTMA 1MHTA 1VDMA 4AWBA 4M0LA 1HURA 3ICOA 3NWBA 4ZT3A 3H4VA 3T4PA 3EK2A 1MXHA 3ND9A 4MJLA 5D01A 5A02A 2I7CA 3Q7SA 3WL5A 4CFZA 3CZ9A 3HG7A 4MYHA 2V6GA 1M1XB 2W2NA 2GARA 4AVYA 4F4DA 1X80A 4K9QA 4R2JA 3JASA 5G53C 2QMUA 3CNEA 3TOZA 3WTCA 2Q6VA 2YICA 3P2JA 3P0JA 1QFXA 2HF7A 1Z6AA 4IQGA 4Y0NA 4B3HA 4RV4A 2CJPA 1QU3A 5IULC 3P52A 1L7RA 3TDKA 3CN9A 5AK6A 1LRJA 2W6IA 5JJLA 4J3NA 2GERA 2X8JA 4OXXA 5KDLA 2YHBA 2ZUFA 1ACMA 2UYGA 4IH4A 5ECWA 4E4RA 1K06A 4QBHA 5CPFA 5FO1A 4J75A 1WKVA 3PR2B 2JB9A 4OYHA 2EP8A 2IHVA 1CVIA 1U2EA 1UK6A 4YQYA 4HUQA 3PXBA 3F5FA 1TIPA 5HUJA 5J2UA 2PSSA 3RAJA 3GBVA 4YREA 4B4UA 4F7WA 5JMOA 2DR0A 1XWFA 2H7CA 2WILA 1KRHA 2EG5A 5I9MA 5IT5A 1BA2A 2QTZA 1SUAA 2GRUA 2R1TA 3BD9A 2XWJI 1E0DA 3CR8A 4OUDA 4KR0A 2E18A 3QKWA 1ZMTA 4WKGA 5JUWA 4BDSA 3LE8A 4L8WB 5KTKA 1NJSA 4MVJA 5IWAB 2C95A 1KOGA 5FDFA 2H08A 4JXKA 2GKOA 3JW8A 1C8BA 5AVJA 4B74A 3H11A 4CRWB 1Q7BA 1R3DA 2C94A 3WYEA 3PJRA 2SCUA 4QXPA 1NUUA 1EUDA 1ODKA 4J0KA 2WYIA 2XDWA 2IYLD 4Y6GB 1C7RA 2X0EA 2D0IA 2QE7A 3BWYA 5A4JA 2G0TA 4BE4A 4KPGA 2R6ZA 1L5HB 1GNSA 4ZQEA 3AR8A 5J9FA 1JA0A 9ATCA 1S96A 2VBIA 3L40A 1YACA 3OQPA 2R7MA 4FYJA 5EQDA 5HEKA 4E2XA 3HRHA 1NLFA 3VGJA 4FZRA 2OLEA 4V0QA 5SV2A 4BO9A 2V0GA 3OJFA 1X1BA 2PA0A 1Z29A 3CF4G 3PSAA 3TE7A 3ZWDA 4LG1A 4C30A 4D74A 2F9LA 2CGEA 1MNQA 2AUTA 2MMCA 4TTTS 1EFRD 2VJOA 1OXSC 1X3LA 3L8GA 2ZQ5A 4N3BA 1LRLA 4LC0A 4R1OA 5DASA 1VFNA 1IEXA 5ER9A 3KB2A 1Z5NA 1LK5A 3OOJA 1QBKC 4R05A 3WOHA 4R8LA 5JFGA 2P4HX 5CAEA 1F3LA 4FJ1A 2GCNA 1IY9A 1L3IA 1U80A 3KVYA 4GZMA 3X1ZA 1O9BA 3TJMA 3AM4A 4M1TA 5TNXA 2C2KA 1SQ6A 2IZOA 5HMMA 4BVGA 3VAYA 1JI0A 1KF0A 2CUNA 1DDGA 1SQ5A 1D07A 2ZIXA 2DJIA 3I1JA 3LVRE 3EY4A 4LNUA 3O91A 4TM8A 2J87A 1HTWA 3G2HA 1JLMA 1ZNWA 3NGLA 1ES9A 4ZCIA 2GLTA 1IJKA 2TRSB 2FZ4A 3O3MB 1XD2A 2HMWA 4D8VA 2XCRB 1M34A 2Q46A 4ZVOA 3VGPA 1GG8A 3HN6A 3NUGA 3QEMB 1AUQA 3MGAA 3EDCA 2E55A 2GRAA 2IHYA 4MJ3A 2FEXA 3OD1A 4QGBA 2JANA 4WZBA 4DMHA 4MSUA 4N39A 4YT4A 5CFQA 1ZR2A 4IKEA 5JPDA 2SKEA 4E32A 2OORC 1XBTA 4QHSA 3UHJA 1FOEB 1L8XA 4N12A 3WMEA 4BQQA 4Q4CA 1AM4D 4IO1A 3K4HA 4QTYA 5CH8A 2LPMA 1WTCA 1TECE 1C7ZA 1TM2A 1CYEA 5B3KA 3GP8A 4ZPXA 1SUSA 4BPRA 1Q0HA 1RYNA 3WYNA 1MFZA 3LOQA 4PQYA 2P7HA 4CL3A 2C0PA 3BGWA 1N2CE 4DWJA 5L3VA 1VL0A 3B8EA 3N6VA 5JMPA 5IJZA 1GL9B 1Q5PA 4O2BA 4N0MA 1DE0A 1W44A 4GYKA 2O8VA 4B3SB 3IX7A 4Q4AA 4EVSA 2V6FA 4KAXA 2HA5A 3L7OA 1P5HA 1IQPA 1X1DA 4ZDWA 3SYRA 2CV1A 3IQGX 4RYDA 1R8YA 2OUIA 1G6Q1 2PYZA 4RSHA 1DTWB 4YV7A 1USIA 4IUCS 4Z6KA 2QI9C 2X6RA 3EBPA 3P32A 2VYVA 1NBEA 2B3TA 2EEZA 2YW2A 3Q8LA 4OP2A 1L7MA 1GXSB 1N8TA 3K8ZA 4NVRA 4RM3A 1GZ6A 4U5XA 1R5JA 1W0CA 4C6SA 6Q21A 1SBNE 5IYZA 1AQIA 4FFPA 5KTPA 3CE6A 2D5CA 2PT5A 3A1VA 5FI5A 2CMDA 4KQFA 4UE2A 1OU4A 2IEBA 4FFDA 1E6CA 1XO1A 5AVXA 5CXUA 5A05A 8ADHA 5EZ6B 3OSZA 5E0OA 4A8HA 1VG0B 1BS9A 3QVGA 1JF8A 4MQ4A 3EA5A 1QJ4A 1SELA 3IRUA 4CMIA 3WWDA 4D2IA 2VT3A 2ZKLA 3D3EA 1YB2A 5CXSA 2R60A 3CJTA 4CG3A 4GVPA 2VTBB 1YVPA 2XB2A 5BORA 4JYZA 1A9QA 2D2FA 4YT2A 4HQ6A 3SIPA 1A9ZA 5F2OA 4YRNA 2GPJA 4F4CA 3TNDA 1QH1B 3AJDA 2I4LA 1H6DA 2FE1A 4TROA 4OJKA 1PS0A 3NDPA 4POOA 1Q0QA 3PC2A 5BVGB 2QRJA 2N46A 1OFTA 1IBSA 3B78A 4QJ4A 1E1YA 3DWIA 1M10A 2I03A 1ID1A 5TY0A 4R3UC 4YTEA 3VNUA 3PRYA 1J8VA 1ZN2A 1E89A 4MOWA 1KJWA 3ETJA 5KVSA 1PU2A 3VU8A 4TTAA 1GGHA 1RJ9A 1OFIA 2ZS9A 3U1TA 3F7OA 1OD6A 5B53A 1FS5A 2B21A 3D8TA 2E4ZA 4W8HA 1GR0A 5CNKA 1AXEA 3RK1A 1EUQA 3DO5A 3MUNA 3DBVO 1O94D 2L0XA 2WU4A 1NBIA 3PE6A 3RREA 5KYYB 3DBRA 4QWWA 1PNVA 5AOAA 4RTMA 1TC1A 3G1UA 1F2VA 2C5EA 4F4HA 4JLBA 2NXNA 2CDBA 4LXGA 3MJDA 3TOXA 4AL4A 1ZD5A 1BMFD 1PNOA 2AOTA 4OYRA 5DHFA 4CEJA 4BLPA 1MQ9A 2YV3A 1WP9A 4NBVA 3KLMX 2OCLA 1NLZA 2VJQA 1TM4E 3D8NA 4TYNA 4FWBA 1SCUB 5DYTA 3HXMA 3R5KA 1LBSA 3MMPA 2HHAA 3MS2A 4P36A 1W93A 1T1IA 1NE2A 3H83A 4B73A 5K8UA 4M54A 2R4QA 4E5KA 1M8FA 1BRMA 1GRNA 2FUCA 3B20A 4G9GA 4HH0A 2QTFA 1SVIA 2M2IA 2WNHA 1YOBA 3F5QA 3P97A 1GGFA 4KSYA 3SJCA 3UT5A 1GPLA 4PC2A 4J43A 3ZUGA 3CE9A 5AKIA 1O3YA 2QTHA 4PF1A 1P17A 1RHMA 4UUAA 3RT7A 5HK9A 1CTQA 1ND6A 4KVZA 4PYRA 3KKZA 2JGMA 6REQA 5BSFA 1HT0A 3OIYA 4LF9B 2P9GA 3WLMA 5CYFA 3QG5A 3QVMA 4EFLA 4NYMR 1J2TA 4U7PB 4YJHA 1E3LA 1EJ0A 3N0TA 4X7BA 2DR3A 1QHEA 5EIBD 1W88A 1RPTA 4CM6A 2NAFA 2BFCA 1DWUA 1PW7A 2I80A 3P0HA 2H4HA 1YB7A 3GA5A 1BGWA 1XXLA 1NJ2A 4BNMA 2CB0A 3RABA 1ZM4A 3F74A 5NLLA 5A5VA 1OLUA 4XRGA 3LP8A 2BGJA 3L4BC 1U7TA 2OSBA 1C0KA 3QY9A 2WWYA 4NBLA 1NQAO 2IXBA 4UHCA 2RCNA 5CIQA 5DHUA 1AC5A 1HSZA 1M8GA 2HWUA 1UZAA 2BF7A 3X2SA 1R6VA 1E2UA 2A3NA 1OZAA 4PGMA 1H2WA 1X80B 3OIUA 3ZKAA 3JASB 4AUMA 3LPNA 1E4YA 2W71A 1DKRA 2LE0A 5BOVA 5J58A 2I29A 4LQCA 5F1YA 4TYWA 3EVNA 2ZVDA 4YR7A 4LZAA 2NZWA 3II6X 4B3GA 4WWHA 3ZK8A 5DBEX 3JD0A 5ADVA 1I30A 3H18A 1YGPA 4Q66C 3U3RA 4Z4GA 3JD2A 1YI1A 2EXXA 1U0LA 3E9ZA 4KEAA 4OLHA 3Q72A 2VBFA 2B8WA 1NUTA 3OU2A 2XGSA 2E4VA 4IRXA 4G25A 4HUQB 3QVLA 4FCVA 2WP8J 4FMCB 4ZYYA 5J2UB 2ZRGA 3TW8A 1HZZC 2M9MA 3E5HA 1U7DA 4LHVA 4RW0A 4ZVRA 3OTWA 4KQKA 2JAWA 3SZRA 3X1WA 3KZOA 4QNMA 4OUDB 5JARA 4ND8A 2R1TB 4BGDA 2GN1A 1YI8A 3C3DA 3CB4A 5FL3A 3TSAA 3FD8A 4XWGA 2AOWA 1SVUA 1HBJA 2Q5FA 3HEMA 4MUKA 4FC6A 5KUTA 2VG8A 3W34A 3JD4A 4LE0A 3N8HA 3H11B 3Q6NA 4ZHQA 5HIAA 1LNSA 1BU5A 5TQJA 2R87A 2WKPA 4AMYA 1EUDB 1XT6A 3C6YA 1II0A 4D4IA 1MCZA 1MFPA 2EW8A 3OCCA 1P3JA 1QOZA 1Z37A 2O59A 2IK8A 3T3IA 1A5TA 1RZ3A 2PVPA 3C3KA 4RDCA 4URUR 1I3CA 2R00A 5DGTA 2GFIA 4LYAA 3C5EA 4B3XA 2E89A 4W7IA 4WXRA 1B76A 1ZWLA 2QQEA 3DYIA 4X7RA 3RJMA 5FTLA 2COUA 1KVTA 1S02A 3EFBA 4TVOA 4ZVLA 1B3BA 1LD3A 4ZV7A 5EJ4A 5HJEA 1EINA 1PG2A 1ZK4A 5LLDA 3GLGA 2QTMA 1L5VA 1U2SA 3VSBA 1EHYA 1WDKA 3T38A 3KAPA 3AERB 4LRUA 3VNVA 1U1FA 3DE7X 1RPJA 3JQFA 3BGSA 3MRTA 4PHCA 5E3JA 1ZR4A 1K7FB 2W8ZA 1JDZA 1OT3A 1WTAA 4MX8A 3X1JA 5ISMA 2OYCA 2CV2A 4F3NA 1ZUNB 4FS8A 4QT0A 3FCUB 1OKKA 3G2PA 3Q2IA 4FOSA 5CAEB 4X85A 2R68A 4HN4B 1C7IA 4B35A 1CXZA 2BKLA 2X9VA 1A5ZA 3MUOA 1GSIA 3QEJA 4OIMA 4AJ4A 4MV4A 4DCTA 4ND5A 3WO1A 3JQDA 5EE0A 1WO8A 3CPJB 1OC4A 3DZDA 4F5EA 3RFFA 5COBA 2CLKB 2PG3A 2ZIXB 4IDNA 1D0IA 4WH0A 3KQMA 5E3IA 3MEQA 4FDVA 3JWPA 2Z98A 3N2KB 4LNUB 3SI7A 2NSJA 2R47A 2CVZA 2OXFA 4GQIA 4B4WA 4YY3B 2P9FA 4GP7A 4LMAA 2DZDA 3NTOA 3MWKA 1PLKA 1XD2B 3H1AA 4TYMA 1M34B 3SC6A 5K0GA 1LPPA 5TVKA 1RKXA 2VPIA 1FYXA 4GOMD 2QN2A 3O03A 4WZBB 1YRQA 1UDAA 2OCIA 3BBLA 4WHMA 4WY2A 5HK8A 3VVCA 3TG2A 3MCVA 2PY6A 1B43A 5HKBA 4DARA 4BVHA 1GYRA 1WF3A 3CRQA 4OFBA 5FWXA 2NO4A 2XCTB 1M1ZA 1CUJA 3C3XA 3D64A 2QX8A 4JBNA 2I7VA 3DS8A 1CNEA 5AJTA 3R8FA 4V0ME 3QUTA 4N65A 5A6SA 4S1VA 1V3QE 2H1SA 3OQVA 4LY6A 1RQGA 4PCUA 4C0QC 3DUFB 2BTQB 3DT8A 3HNPA 3K09A 4LHYA 3TTWA 4FB4A 4X92A 1EQAA 3VTAA 4DSUA 2HW8A 3ESYA 1U0BB 2CVOA 3DEAA 1DAHA 1JZQA 3DW1X 3Q1LA 5A3QA 2PEYA 4KX5A 3C7CB 4Q4AB 5CT6A 1WCWA 1SUFA 1V37A 1SVWA 3GFOA 3NHZA 4CDGA 4RTRA 2QJTA 4MEAA 4PLHA 3ZLJA 4HRVA 3TDMA 1Y7LA 4PO9A 3IMCA 1RFGE 5HRAA 5LQDA 4LIPD 3PEVA 2FWPA 2Y67A 2IYAA 3T8YA 5BXYA 3BMXA 3DE0X 1L5SA 2W6ID 1WBBA 1VPWA 1CYDA 2BKXA 5H3LA 4JUFA 1KH1A 4IV0A 5IYZB 2X23A 2G7ZA 2O1WA 1RAHA 2XV1A 3NTQA 4DLYA 2OBNA 3RSZA 3B7PA 2OVBA 1R0KA 4TMTA 1K6MA 4EFNA 3E1SA 2HSWA 2HCRA 1N6IA 4W6QA 1Y6GA 3LNTA 2Q2VA 2AXPA 4U7FA 4BFTA 1H6AA 4HLQB 4H7HA 4CMIB 1MTOA 3G5TA 1LA2A 5GMOA 2ZJ7A 1NX6A 2NNLD 1X1EA 2QPTA 5DWQA 1OFUA 1D1SA 3TVDA 3D0QA 3MINA 1YCDA 3B9RA 3ED1A 2P2SA 3HDYA 4YRGA 1HRDA 3MMSA 5KOHA 5JC1A 1V4NA 2NPOA 2YDXA 1TZMA 2ZRDA 1W85A 3IVXA 3VSEA 1JFRA 2X8BA 4ZQHA 5IJ0B 1XMOB 3B1YA 5HE9A 1K2VN 3ELDA 5A5GA 2JGRA 2VLBA 3N2NA 4MUNA 5LYJF 4DR4B 3BA1A 2X8WA 2H3EA 4P5EA 4CIBA 5LP6A 1GP2A 2IYQA 3L46A 3MTAA 1PLJA 3A05A 3OT5A 1HY3A 3GRKA 4CG2A 3FPSA 5IAEA 2JLRA 3BK2A 2XD4A 3IMFA 4GUDA 4DABA 1NR1A 2X0NA 3L6RA 1K6IA 1XPOA 1MT0A 4TL7A 5C4GB 2OYSA 2EQ5A 2FEAA 3H9JA 3IP3A 5KWVA 3UJNA 3U4CA 2AQKA 5EXEA 4QQKA 5JAHA 3ZBPA 5TMEA 4G89A 3O0TA 1RJ9B 4J03A 1UQTA 2FX5A 4LPKA 5E8RA 3GG9A 5AI9A 4UQLA 2ALJA 4FM9A 2Z4TA 1U8TA 2V1XA 2WC1A 1SOVA 1AUVA 1JDPA 1UJNA 4FMCF 4PRYA 3HZZA 4KXLA 3W5VA 3ZU3A 1A76A 1B7GO 4A2WA 2E37A 5TXGA 4E31A 3DBRB 3I3OA 1E92A 4HYYA 4MULA 2GZ1A 1Z7BA 3TCKA 1WWKA 3PI7A 3RS2A 2AOTB 4BJ5A 1A0OA 4CL8A 4CEJB 4IUBS 4X6UA 1DKUA 3FUCA 2YUIA 4MVJF 2ZCUA 2P5SA 3FXAA 4BVAA 3L8FA 1EM6A 4LMPA 5A7GA 2NU8B 2CB9A 5HOQA 4I14A 4XWTA 5AI4A 2GBLC 3NEPX 3WYCA 5LNK6 3DFZA 3I9V1 3ORFA 4Y7DA 3IAAA 1YZYA 3PFFA 3M3HA 1SG0A 1WDMA 1SOWA 2DUJA 2FFRA 3BTVA 3NIWA 5K9ZA 1Q1EA 1I7NA 2EP5A 3L41A 3E35A 4HB3A 4MS1A 1E2JA 4PSAA 1NM5A 4PANA 1QPZA 3H97A 2AD5A 3QLJA 2AN4A 3FMOB 1Y89A 2AUNA 2XCOA 3UT5B 4B6PA 4HAXA 1KDYA 2QP9X 2ZUSA 3HY4A 4Y2HA 4DR3B 2VP5A 3O93A 2XVAA 2C3MA 3MTQA 1JYEA 2Z1MA 1QGYA 4MINA 1LX7A 2XZTA 6REQB 3R5TA 4WCFA 4FN4A 1RWVA 3HR7A 3MRSA 1C3EA 1UDRA 2O0HA 1D2EA 4MIOA 5EOVA 5JYEA 4EI7A 3QQPA 2NTJA 1E63A 4YJHB 4DBZA 1G7TA 3M4ZA 1W88B 4MWOA 2I67A 1CCWA 3LX5A 1HYQA 2BFCB 3CX4A 4A6DA 1HQYE 2F67A 2PSDA 3DULA 4I5IA 3R74A 1P72A 3N53A 3YASA 3JRNA 3FVQA 2VI5A 3ENNA 4MYUA 1H0KA 1X74A 3K73O 4M8SA 4MHOA 2QY6A 1OLUB 3SHFA 3V46A 1Z7EA 3IAM1 3VKVA 2YIJA 2JRLA 4TV9A 3REFA 3U7HB 3JYLA 1H0HA 3EC2A 4MGKR 3QBVA 1XZ8A 3SIRA 2CXXA 6CHYA 1XCMA 1YSCA 4INOA 2QNBA 2X8AA 4FSHA 4MUGA 4PYOA 1CDDA 2FN3A 1XRPA 2Z5LA 3PV0A 4ITRC 2JIPA 1VYVA 1GRCA 4QDXA 5J59A 4EYQA 4JIGA 2V96A 3UOWA 3M6FA 1YB6A 4AQ7A 3KIPA 3DVSX 1QTNA 3EOAI 2FRDA 2OD9A 3BIJA 4P4SA 1CZKA 9ABPA 1XZPA 1CRQA 2J46A 3R4CA 4ZCSA 2GYUA 5JW6A 4RK0A 3AJAA 3SR3A 4B45A 4DMRA 4YRSA 1OH8A 2ISSD 1JHDA 1MB2A 4EHJA 1AO0A 4MPTA 1AK1A 1CE8A 4S2UA 1RWWA 3LO8A 1AJEA 3GBPA 1R27A 4KTVE 1Y5LA 4QHTA 4ZOAA 3ZDRA 4YRMA 2GBIA 1SB8A 3WMWA 4DTCA 1KZ6A 1SRRA 1KO8A 3PYLA 4FLFA 5IT9A 2HIMA 4F2GA 1AUXA 2YVQA 3WKAA 3D4OA 3L01A 5KIAA 4D4GA 1E1DA 3NAMA 1TCVA 4YAKA 2D5IA 4A0RA 1TF7A 2BR3A 621PA 1EGHA 2V7XA 2R62A 3GUCA 4FOLA 3TW8B 2GEUA 2PKWA 2I87A 2SECE 4IW3B 2Z3ZA 3ORYA 2XLCA 1F2TB 3EXHA 3M82A 1Q7CA 4L75A 1X8JA 4ISCA 1QGED 1NRXA 3KKOA 2PL3A 3MRXA 3LBHA 4AZSA 4CMEC 2WAXA 4EG6A 4F60A 3SWWA 4Q7JB 3N0RA 5HZMA 2NXWA 1WW3A 4GRIA 4HNHA 4GAEA 2Q3MA 4B33A 1J23A 1VKZA 1ZSYA 1ZIPA 1P19A 1PUJA 4ZHQB 5JO9A 1XGKA 3LQQA 2GAJA 2L18A 3CSSA 2CF6A 5GADl 4LGVA 3DDSA 1XXHE 3FDZA 3KC2A 2C1EA 1I3KA 3K70D 2NQ8A 2CW5A 1LDYA 1GPUA 3D7RA 1S0UA 2PX0A 5JDCC 5ARBA 5LMUB 1AQNA 1NVMB 3THYB 1V7ZA 3SYNA 1OREA 1IDN1 4YX9A 4FEGA 2JFUA 4EIWA 1AF7A 3U48A 3FKJA 3V8VA 4CIXA 4HG2A 2AW5A 2QS9A 4G81A 3G0GA 4Y8VA 4N8EA 3H0EA 2DC1A 2VJDA 4EPWA 3GLGB 4M21A 5CB8A 2BGNA 2HK8A 1SZDA 4AMGA 3UAWA 3T6KA 4DC1A 3IEPA 5J4YA 1EVYA 2OECA 3MB8A 2XQVA 1HDEA 4M0PA 5IARA 3KQVA 3GY0A 5JH7A 5JROA 2Q4BA 3O3CA 1V39A 5JSUA 1BFUA 3SX0A 1HTTA 2Q5JA 2PH3A 2YW9A 2PZKA 3P9ZA 3LT1A 3O47A 3E7XA 5H02A 3ZY5A 1J20A 1HFJA 1YJAA 1YZFA 1ZIYA 4RD3A 3EXG1 3ZCVA 5IT4A 3I5UA 4P7JA 2C7VA 4WKCA 2R97A 2F59A 2IFTA 1FFWA 5ICMA 1E1NA 4AYWA 5ES4B 4HMPA 4M1QA 4HDRA 1I7PA 1WB6A 3DCYA 4LN1A 2K6GA 1R0SA 4WKOA 1IZ8A 3G5AA 4XOIA 5JT1A 3DNMA 3AYXB 4RDHA 3O5AA 2JIMA 1PZNA 2XW6A 2AFRA 2TYSB 3P2KA 3QH4A 2XCQA 3MWEA 1NDQA 3SP1A 1T13A 4HEHA 1EFHA 5GV7A 2C59A 2FFJA 3R0JA 3HCAA 3BJIC 3QOFA 1YBVA 4ZC8A 4V2UA 5GJCA 3HJUA 3LWZA 5E7JA 3W6PA 5FWXB 2IOFK 1HL7A 5ALMA 3SBXA 1CB0A 2Z30A 4HAZA 1XRQA 5FLXA 2AJDA 5A6SB 3L6EA 4CUZA 3OFNA 4KBGA 4ETMA 3AF4A 1G3MA 4PAQA 4Q4JA 5F4ZA 1DG3A 1Z26A 5B6PA 2ECPA 2Q6OA 4U8GA 4UE3S 3ZYCA 4EOGA 1G1AA 1TUBB 4Z8XA 2IH5A 2F8SA 1O0SA 3FTFA 1GZSA 1WQ4A 1A82A 2AI2A 3V6MA 1PIWA 2DT5A 1FNCA 2REXB 3DPUA 2CNDA 5JZ9A 4XVRA 3DGEC 1LPMA 2FWBA 2DWPA 1YBAA 2UVDA 1X0VA 5DI3A 4ARBA 1PNRA 3RFVA 1I8TA 3X1YA 5M2QA 4O5AA 1ORVA 4LYDA 1J42A 1WRBA 3TIGA 2RGWA 4MRAA 4PIMA 2DG2A 1G7RA 4J0EA 1WLSA 5U1PA 2ZRFA 5CFZA 3AP3A 1V6SA 4H1TA 2AUMA 1TAQA 1M2HA 3GT7A 3RG8A 4UTRA 3VR6A 2B30A 1RPNA 5SZIA 1EFVB 4R9VA 1BIFA 2XB6A 2C8VA 3G0IA 2FZGA 3I30X 2LP4Y 2VL7A 5JAOA 4RKWA 1MIOA 4RK5A 1ZIDA 3IS3A 3DFFA 3WADA 4PYQA 3R7DA 1YAJA 1XAHA 3ETEA 3N2EA 3MINB 1TKRA 3OIWA 4HR7A 4EQ6A 4INJA 5KOHB 3FHLA 4KE8A 4JT2A 4YPOA 4JSTA 4M7WA 4N0QA 4NNOA 1W85B 5H83A 1G0NA 4BAGA 2QYTA 3UAVA 3NKVA 2C54A 3GRYA 4GBGA 3JYNA 2PV7A 2WU0A 5LP6B 3WI7A 4FW8A 4G5GA 1Z0JA 5JZBA 4CJXA 2HK7A 5F35A 4NBUA 2QZPA 3IBSA 4Q7KA 3V1TC 5J63A 1GSOA 5EUMA 3CHYA 4XXHA 2Q4DA 3IAHA 3IE2A 1HFKA 5E8JA 2F2TA 4ER3A 4ND3A 1U3VA 3GELA 1R0BA 3DYVA 3IOYA 5P21A 3NHLA 3QKUA 2CWWA 2ZBFA 4L5BA 2D1YA 3KPUA 3Q11A 4G3XA 1F3OA 2DPHA 2F1KA 2ENUA 2QW0X 3HCEA 5I5GA 5E1OA 3UMVA 3BCRA 2G40A 4BB6A 2JBHA 4JY7A 2X76A 4G5HA 1MT3A 3D4NA 1XJ5A 5J40A 2JGDA 4L9AA 3RHFA 5CA1A 5DNUA 1PZEA 1F6DA 4L2IA 1DFHA 3W4KA 4RIEA 4M9CA 2QOEA 4RMIA 5CT8A 1GGNA 2FEPA 4KAAA 1K8RA 4RD2A 4P0QB 2AG6A 3OG9A 5AUNB 2MSCB 2XUDA 3I9LA 1NU6A 5KNDA 3LX8A 4KI7A 1ZOOA 4ZHQF 3GEHA 3HQ4O 1J8DA 3AEKA 3HZRA 1WB5A 4LQ4A 1OYVA 1YRLA 1JHQA 2ZROA 4W5RA 4MS1B 2AJCA 2H57A 2PD4A 4WESA 2QPAA 4UPDA 1FUYB 2C3YA 2JPDA 2ZITA 3OLZA 4K46A 3STXA 5FA8A 3CKKA 5EFZA 2Q6TA 2VP0A 3AZOA 3HB1A 3RHZA 3VVBA 3P96A 4IIEA 3MWGA 4M60A 3QVSA 2FFAA 2GDZA 1GUZA 2GFHA 3BUSA 4FZ5A 4KUEA 2FCAA 3IPLA 2YYAA 1AHHA 3P0RA 3C8UA 4WCFB 4KWTA 2ERXA 1F17A 3NBZC 3FKSA 3QQ5A 4FDAA 4YMHA 1E4VA 4HNUA 1R00A 4PC7A 2PSFA 4CF7A 2JI9A 1C3OB 1KEEA 4XYGA 1IN5A 2ZRBA 3U26A 2QVZX 2Y71A 2JCYA 4HGRA 1V3TA 3EASA 1W96A 2VZ8A 5AICA 1WW8A 2CKDA 4C0XA 3UTCA 1RYMA 1EQ2A 3AX6A 3QENA 4O4HA 3DV0A 4X65B 3MK31 5IW8A 3OMLA 1EWRA 4TV9B 2BHTA 1ARZA 2F48A 3DFUA 3GFSA 3LL4A 3R9XA 1UBSB 1IB0A 3DZJA 4YMLA 2OQRA 4G8JA 3NWEA 4FJ0A 4D3YA 1Y5IA 2NTEA 3VH2A 1NMEA 1BG6A 1UL1X 4NYJR 5DXJA 3WHKA 3CKMA 5KTSA 5ALIA 4B82A 5AESA 2ZZNA 1BN7A 3FOCA 3UJBA 1QQ6A 4ND7A 5EYPA 3STUA 3ENWA 1GA1A 2RJNA 1MKYA 1U4NA 3FRIA 3MJVA 2FSHA 1CV2A 1CNFA 1CE8B 1QH8A 3ZXXA 4AJIA 1TO1E 1WDLA 1O4WA 1N5IA 4LTNA 5CG1A 3QVKA 1EDEA 1MAVA 1TVKA 4KO3S 1JHAA 4CT4B 4D41A 1QG2A 5G4LA 3M2TA 2VKQA 2WJIA 3GMIA 6NULA 5ICCA 2QXTA 1MOSA 2IXFA 1Q92A 3IXQA 3Q3JB 4FT4A 3U1BA 2CK3A 3IV7A 2BKVA 1N7GA 1ONOA 4L9RA 3D7SA 5JXJA 4UVIA 5IN5A 2G8NA 1HL3A 2I2BA 3NG1A 4I9FA 4FWIB 3EXHB 1RKVA 2PZMA 2LKDA 4LZPA 1CRZA 4HUTA 5TEWA 2XQKA 5KCMA 3TLGA 3WGZA 3H5WA 1IHPA 3PNBA 4MKFA 5EERA 5IBCA 4UTVA 4N01A 1RQLA 4E14A 1Z6QA 2X0KA 2QT9A 3MJCA 2HYDA 3SOZA 4G23A 2O7RA 2PMFA 1RBZA 1XWIA 4P3XA 5CJPA 4WA7A 4YMWA 2WAAA 4EB8A 3FDZB 1NF9A 2Q1SA 4IPTA 3UWDA 4KMRA 2XGMA 3ZUPA 4AZVA 3UPTA 4HEA1 1JKMA 3V4ZA 3E82A 1M75A 2JATA 2PYDA 1MAAA 5H3CA 5ALWA 4GKVA 1KARA 2FQYA 3SYLA 1GRRA 3HR4A 2O8EA 5BNZA 4P3YA 2UYQA 3DGFC 3D2BA 4QOFA 4WEQA 1C4KA 3L7NA 3VDRA 5LSAA 2ZYUX 3IOMA 3A4YA 4PPNA 5KYGA 4DVJA 5JZSA 4RC9A 3CBQA 1ZJWA 2HBRA 5LBIA 2X1HA 1SVOA 1XKXA 2CLIB 5JH7B 3CMCO 1UMDA 2OK8A 2DFKB 2VDVE 2HIGA 3BSFA 3DAPA 4AO8A 5BWLA 2GTPA 2WG1A 2Y76A 4GBJA 3WY9A 1H9CA 1IBLB 1RRFA 1FJXA 4LVOA 4H7EA 1IOZA 4ZDJA 1HQCA 1YUBA 5KHLB 1QCCA 3KX2A 4TT8A 2Y0EA 2BHLA 4W7HA 3QHQA 5HVNA 3RFTA 3DMHA 2C8KA 1Q1QA 2JEZA 4M9RA 4Q34A 5SYAA 2ADOA 2Z1NA 4QBGB 2QTBA 4HDRB 2ZB7A 4ESVA 2ZWAA 1YQDA 3LDAA 4G4SP 3OJCA 4GF5A 2CDAA 4L1KA 4D9KA 4N03A 2AQIA 3GQVA 4WOBA 1PJSA 3UOAB 3MWEB 3VBCA 2BZ1A 4EBFA 1QIMA 2C4MA 2PJZA 4Z9BA 4CHTA 4LHZA 4L85A 3OZVA 4D0NA 3AEUA 1RM0A 3E48A 3PJEA 4M0MA 4TX1A 3U7GA 1G6OA 1L5FA 2GD0A 2HFKA 3EBOA 3KAJA 1DBPA 1EBBA 1NQOA 4HPXB 2X0FA 4UUOA 1RYFA 2X40A 1LV8A 4U9UA 3NLLA 4RXUA 3BD8A 4MUJA 4HGQA 2WSSD 5IK2D 2QDXA 1D2NA 2H16A 3B2NA 4R0VA 5ALHA 3WLEA 2RHMA 4NIMA 3A04A 3QVVA 4B3RB 5BQPA 1VLHA 3RRFA 1A3CA 1O97D 1BU8A 1E58A 3IOBA 4NE2A 1EE2A 2B7BA 5DM60 9MHTA 1KJ9A 4LVNA 4E7PA 3MELA 4Q4JB 3OC6A 1E3TA 1PE0A 2B37A 3KKQA 5K3SA 1ZC3A 3DR3A 5TF4A 1E6LA 1FEZA 3ANSA 3F9CA 5FADA 3ZCRA 4BUCA 4L08A 1Y7IA 1SC9A 2DPYA 2ODWA 3FUXA 5DCLA 1I51A 1ETHA 3ADPA 3FSJX 4DAOA 1N4DA 5LOVA 1X70A 1QO9A 4FIDA 2PWAA 2E3JA 5DI3B 4H31A 5HIJA 1I2MA 5HF6A 3UQZA 4YCMA 2IS4A 4TZTA 1P0QA 1TAHA 3RQSA 1LLUA 1PQYA 4ZWNA 1PZMA 2C2MA 1IQRA 2FPUA 4XCQA 4PQRA 4R83A 4HC4A 3HU3A 4QXQA 1R6BX 2BMJA 5FF9A 5SZKB 1NQXA 3WZ2A 4RPIA 1NXQA 3EQZA 5ED0A 3ZBTA 2XTNA 1I0ZA 1ADGA 2J67A 4HD8A 1ZK3A 3SSMA 3HUDA 2XTAA 4O4LB 4B3IA 3A6KA 5JSKA 1V4BA 3KVRA 4PC3A 2EL7A 4JEIA 2O1EA 4M8IA 1E2FA 3WHLA 4PPFA 2VDUE 1U4SA 2PT7A 4JK3A 1T9GS 2EAUA 1QHYA 4LA4A 4PLTA 5KQSA 1MIOB 4D3SA 4C43A 3NXKA 3UGQA 2NYVA 4TLCA 1HKUA 3A9RA 3N59A 1NXWA 4U02A 3GHYA 5F7JA 3ZIUA 4AURA 3OTGA 2O7SA 1U1IA 5HCNA 2GT1A 2FGKA 2YV4A 4AF7A 5JRJA 2NU9A 4EQ6B 4M1SA 3GZTB 1JT9A 3PZBA 4N48A 1ACJA 2CLMB 1TAGA 4UHBA 3T0GA 3VO9A 4D98A 4JI7B 1JTVA 4EY7A 1D09A 3PDUA 3RH0A 1DUIA 1B6TA 3BJRA 3LF2A 3P9SA 3QMPA 5CB0A 5IANA 3PQ7A 1TJ4A 1FRFS 4FQ7A 2GS9A 4P58A 5ETJA 1IUKA 1B8UA 4G2NA 3SAJA 2DH5A 4R9UC 2PUWA 4FFLA 2AK3A 1G38A 2K7ZA 4MICA 2IYOA 3F9RA 4D96A 3OIGA 2RAFA 4PNZA 4B6FA 1O95A 2QRLA 1A72A 2PMEA 3WGGA 4RIIA 3KUKA 4FGWA 5BN3A 1TZJA 1JXQA 3K31A 4OQFA 1TE2A 3AZQA 3LLUA 1ZEJA 3Q1KA 4HLUA 4R9SA 4FKBA 1MJNA 4KI0A 1ZCAA 1YRYE 3FMIA 5L53A 3COYA 2G9QA 1QHFA 2NZUG 2H59A 4URZR 1PGPA 3AVWA 3CG4A 1NPDA 2CXUA 2RKWA 2JASA 1NUSA 2CDCA 4IDGA 1MW9X 2C4VA 1G7CA 2JGDB 1UDBA 2C2BA 5CA1B 5DN6A 3D6UA 1U7WA 4L2IB 3T3OA 1E2GA 2JVJA 3TQCA 1VJTA 3NR2A 3PRHA 4X7MA 3N7AA 4XJSA 3ZV6A 5IAAA 2Y1GA 1Y1QA 5DWVA 3UMJA 4B84A 2O2IA 3OSUA 1G42A 5L6MB 3LPAA 3WGUA 4C4TA 3DZKA 5JCJA 2GXUA 1EFAA 2JIQA 4EVQA 4CG1A 3BKWA 3BMCA 4LZLA 3ZBUA 2C2WA 3DF9A 4KRFA 4YRTA 2B25A 1IZ0A 2GJ4A 1SCJA 1QYVA 1PFWA 2A94A 3I72A 3HABA 4WFIA 3AEKB 1E2QA 4FCWA 3VHLB 3PYMA 1RLIA 4X24A 2PRSA 4NI5A 5EMLA 1JTFA 1AQ6A 4GXNA 2YNMA 4OATA 4WESB 1T3LA 3QVWA 4RGBA 4DCCA 1X42A 2J6IA 3QKSA 3C3PA 3G9XA 3D3QA 2ZTMA 1SKQA 3QLEA 4S0ZA 3W5BA 1T4DA 2ORWA 3MTBA 1FTSA 2J5XA 5JS8A 3LDFA 3OHPA 4DNOA 2C2GA 2HRQA 2IUYA 4HNRA 4BX8A 1ICIA 4S0XA 4DNQA 1N2OA 2X14A 3VSAA 4V3CA 3JAMA 2QN7A 1FB5A 1SRQA 2B7LA 2HU2A 2C0CA 3I9OA 4RY8A 1KEEB 5JH7F 3ONFA 5AHRA 1RKBA 1XB2A 1N32B 1PQUA 2G4LA 4HVAA 3KBOA 2RI6A 13PKA 4W5WA 3GV0A 4KXNA 1Z0UA 2A9QA 3UXYA 2RONA 2JKYA 3ICWA 4FGSA 2WIFA 3NT5A 4LHXA 4Z0TA 3MM4A 5JWHA 4O4HB 1JKFA 2R6HA 5TE9A 4BNUA 2YR0A 4CKWA 4IDOA 5FEUA 3N07A 3SZGA 2AJTA 4ZV4A 1OOEA 3R9XB 2OLKA 3RVNA 4BTEA 3BZWA 3R77A 3WQSB 4GWLA 4H6XA 4MKHA 1UF9A 3WNDA 3GNLA 5HE8A 1M8KA 1M2JA 4U7HA 2BZGA 4WN9A 4DMLA 2PPLA 1T43A 2I22A 5TS2A 4GZLA 3AYZB 1B73A 4OI2A 3FTPA 3GGGA 4M53A 4II3A 4EF4A 2XZOA 1YNSA 1JLLA 2PS3A 3H75A 3QWAA 4CTMA 3ICVA 4BBZA 4JVOA 1A9OA 2GPBA 2EX0A 4KBFA 1QDLB 2Z3WA 1JIIA 1PR0A 1QH8B 1YMQA 2HOQA 3DLIA 5JG7A 1O7JA 1JUDA 1JIVA 2CL5A 2FK7A 1ZGHA 1E3JA 3BIOA 4Q9LA 4FBLA 1BHQ1 1W1IA 3L8CA 5LXTA 1TVKB 2PKQP 4OL9A 1XL0A 2J33A 4BZWA 4N8DA 1RI3A 1Z4PX 2GN9A 5B6JA 2QW1A 4Q02A 1ORIA 3V33A 1WDWB 2REBA 1MH9A 4GI7A 4GWGA 4ASUD 2H4JA 1X6VA 3HYRA 2C20A 1I3NA 4W6ZA 5I45A 5IASA 3TSYA 2IZZA 4C03A 3KD2A 2FG5A 1J56A 1L4MA 2HX1A 1PJLA 3BC1A 1UKCA 3DEKA 1Q0ZA 3LQRA 2XE4A 4KODA 4MVYA 5FI0B 1S2DA 5REQA 3TLGB 4OQDA 5JAIA 3TB6A 3AF0A 3T54A 1KK0A 2C2YA 5KQGA 1WSDA 2O8NA 1KDRA 3DE2X 3FVWA 3MTJA 8LDHA 2QT1A 4UM8B 1E7YA 1NKSA 1Y3CE 3CTMA 2VZ9A 1VJ5A 1O03A 4Y98A 1ISFA 4RMJA 5HBGA 3NOXA 4D4JA 3B6MA 5C8VA 2HHCA 2L19A 4IVPA 3QW4B 5DE3A 2B7CA 4R6WA 4O4LF 2C9ZA 4JKIA 4BO3A 2LRHA 1WX1A 3W3AH 2IJGX 4RV9A 1UPUA 1E99A 4EWLA 5TS3A 2O8EB 5B7QA 1L5LA 4FE7A 2Q45A 4WV3A 1Z6TA 2XYHA 4Q19A 2PPVA 4L4XA 1DG1G 4TVBA 3WMFA 3ZGLA 1M8JA 3DQQA 2R86A 1H4VB 4ZVVA 3T7TA 3VV3A 1WD5A 4NDAA 5H0IA 4JN6B 1WMDA 2D54A 2BIFA 3ONVA 2YV5A 5DKFA 3W9UA 4JLDA 2CY0A 1OJLA 2V9ZA 3FG9A 5CITA 1V1MA 3HXQA 5D85A 1UMDB 2O2XA 1RE1A 1VLQA 1NP3A 4P8RA 3JYHA 2RHGB 2NT3A 4UOZA 2FMXA 3W2GA 3EPLA 1OAAA 2YZKA 3E4CA 3CSUA 2HXSA 3NM4A 3RKRA 2QF7A 3LQFA 3RIXA 4P0PB 3S2YA 2BGTA 2YYYA 1DO8A 1EKXA 2C9BA 4H7JA 3GGOA 3M6XA 2F1IA 4QAQA 4F84A 1NF8A 1GITA 2VP3A 5DTEA 3RVDA 5ENDA 2OESA 2BWJA 4TXHA 3HR8A 1I0LA 2OCAA 5CD9A 4F6RB 5LDGA 4V24A 1RE0A 4AW9A 2WPDA 2C4TA 3AEUB 1ZS9A 4DHWA 2ZIGA 5A62A 1MOZA 5L3SA 2VJMA 4E5PA 3AMVA 3GJXC 3CF6R 1X7DA 4ONEA 1S3FA 3LDUA 2I3DA 3FKSD 4WMLA 4Y0AA 2IX9A 4YQEA 5CA1F 3UPUA 2VUUA 3U5TA 4OIFA 4I2NA 4J7XA 4RKEA 3S0JA 3ZE9A 1UJ2A 4LK2A 5EJAA 3T3NA 1CDZA 5FLYA 2VCYA 3PEWA 3UN1A 4BGIA 3TQQA 3B9BA 3HLYA 3P2EA 4MW2A 3KOWA 4C9BA 5IVDA 2DEUA 4B76A 1ZGBA 2YL2A 4HSEA 4UMEA 3SXPA 4FFBA 1N25A 3PQ2A 4MK4A 4M37A 4DT1B 1UJMA 4NXMB 4IX9A 2HJSA 1ESMA 4JBXA 3UMCA 2QEQA 4G8CA 4LDRA 3EG9B 5M04A 1AV7A 2EWVA 3FCAA 4V02A 5LOVB 4L16A 5JS1A 2O3SA 3FI0A 3NBFA 4JV5B 4ZAFA 5FI3A 4F5ZA 2YVUA 1DIRA 2P2LA 1VHWA 3FYTA 3LS2A 4IOMA 4MDYA 5H9WA 1K8ZB 1P6UA 3DXYA 3PHCA 4BLRA 2QRNA 5GIPE 4J8PA 2J0EA 4UEQA 2FW0A 3IYLW 3WLRA 2X1VA 4G0YA 4KFCA 1OHHA 3R8CA 5BV2P 1MP0A 4JI4B 4S1PA 1I1NA 4QYSA 4C6HA 1G21E 4OL0A 1A98A 2BM8A 4V1CA 2NMVA 4DJTA 4NRDA 4JI5B 2XR1A 1LY1A 1DBSA 1KXZA 1Y1RA 2O50A 5JNWA 1TAUA 4QOSA 1SMKA 3MJEA 1C9JA 2R5FA 3C5HA 4WN3A 2FSPA 3FOBA 3FR8A 4P4GA 1XZBA 3EDQA 4L7QA 5DLYA 3UB4A 2RHOA 4ZT6A 4Y2VA 4A36A 4EPTA 2DQKA 1OAOA 1OU0A 4O4HF 1J4AA 1V8FA 2BEWA 2P6RA 4BLWA 1EWQA 3OFKA 1OGYA 1T3TA 3VU3A 5E3HA 2FZWA 2FOIA 2NU9B 1M1UA 4AICA 3K1ZA 3SLKA 3AZPA 3H65A 2FGJA 3NKLA 4OAOA 4QTTB 4G0WA 1RPZA 3W4IA 3BXPA 1GJRA 4WNCA 1XTQA 5TSDA 2Z0MA 4EHBA 1LTHR 3QLUC 1DL5A 3E5MA 5JCOA 1RCUA 1SCBA 2PXCA 3NFRA 4GUAA 4M0CA 5DBFA 1MV5A 4C05A 1XNQB 4F2HA 1CS0A 3MS4A 2QUJA 2WJHA 3GGDA 4KXUA 3WGKA 5G2OA 4C1BA 4BNTA 5LDDC 1UWLA 4K9LA 3ZD8A 3OPMA 2LIPA 2HSEA 1O4VA 3PVCA 4HVTA 3BJMA 4ZVUA 3HN2A 1QPBA 3EVZA 3IV6A 3AF2A 2CXSA 3FWHA 4LAFA 4LQLA 1HEYA 5DYNA 5IM5A 5BN3B 5L6LB 1D2RA 1IIBA 1Y8ZA 1DC3A 2QAJA 3E0QA 4PAOA 2XNHA 2GHRA 3B1VA 3CCCA 3RSQA 2IPNA 3T5TA 3VZDA 4E51A 3WQBA 4DLBA 5AVUA 3HSYA 3WS7A 4K6FA 1DAGA 3X1XA 4I4LA 4CETA 4NKRA 1G20E 1ZQ1A 3WRYA 4JLMA 4L3WA 4ZTBA 1M2EA 3NNSA 1QFZA 2O2DA 2OQ2A 5DGXA 4EJ6A 3LFUA 5K0SA 1E7MA 1XVIA 2HFJA 3OO1A 2P9HA 5G1OA 1VSUA 4A0FA 4HBZA 3COPA 1NBMA 3BMCB 2ID7A 4YAWA 5CVUA 3VZPA 2DUNA 2R6FA 3ZV3A 2X1LA 3ZX5A 2YJ6A 4A5OA 2JAPA 3IXLA 4H3VA 1M2GA 3ZDAA 3DAGA 1H1TA 3GWZA 2HWXA 1A27A 5EQJB 4B17A 2OFWA 3AFGA 5HIKA 5K6RA 3B6ZA 1OV4A 2ZRLA 4LJLA 4UM5A 2HAEA 3MWJA 4DIKA 1XNHA 1U8YA 3RSLA 4IWYA 1THTA 4JP2A 3QKSB 3ML1A 1P62B 1FX0A 4GD3Q 5IDYA 2YQ4A 3LT4A 1UPBA 3U0VA 3CKYA 4R9RA 2FWNA 2ZSEA 1XSEA 1VIVA 3F6CA 3I4FA 5AOVA 3UXEA 2OB1A 4GPZA 3ZXSA 2JFGA 5CD1A 1GM5A 3LAWA 2MSNA 2IIVA 2DM6A 3EPRA 3G89A 2VLIA 1Z4OA 1K86A 4BGEA 3LGXA 3GUZA 4IR7A 5J5CA 1VFPA 2ZTHA 5FBLB 2A0KA 4IY1A 2O0JA 3L8YA 3NHBA 4FJ2A 3KLOA 4M99A 4AS2A 2RHJA 5F2NA 3AFMA 3NIGB 1QVVA 5B2FA 4IH9A 4H77A 2UZ1A 4JP5A 4IUDS 4CKWB 4FPXA 4UC0A 4HDMB 1MZVA 1JH8A 2Y9MB 3BAFA 2NADA 1F8UA 3E9CA 3G0DA 2CL6X 1WCYA 1A4RA 1P2TA 3HKEA 4X60A 4DWVA 3TPFA 5CDHA 1R5NA 2NO7A 3ZW8A 4WN9B 3NDIA 5AKXA 3A0RB 3WK5A 5DYYA 2XDAA 2O1XA 1DO2A 1UBCA 4HAYA 1D4FA 3GLFA 1XTPA 2CVQA 1JLLB 1ITZA 4RTSA 3FPBA 4N4AA 4PSVA 3RASA 3KZ1E 5K05A 4ZGGA 2Z2JA 1U3GA 1XAIA 1CETA 4NU0A 4KJZA 2HUNA 5HSGA 2R8EA 1E3EA 5F9MA 2H4FA 4B3CA 4HFJA 4BVBA 2UVQA 2DUWA 4D42A 2I6XA 4JLAA 1QTQA 3B13B 5GAJA 2XRYA 3D1VA 5LXTB 3LLVA 3IJRA 4XSHA 2AJLI 8OHMA 1BWQA 3EAFA 3FFAA 3X1KA 1MC4A 2IXGA 1Z4KA 2J3EA 3G6KA 1KZHA 3T7RA 3LLMA 1W25A 1N5RA 2A4MA 3PXGA 3WB2A 3FOZA 3KR0A 3KSUA 2VDQB 3IP8A 4UNSA 1X1SA 3CLHA 5JSYA 5ULLA 5FPYA 1FZTA 1Y81A 4XASA 1LVHA 1W19A 1ZD4A 4C0AC 3AINA 5CB4B 1DAKA 3OTIA 3RLFA 2QMHA 4AO7A 3FF1A 1QH9A 4NY1A 4RQBA 5FPTA 4PGAA 5REQB 2Y1KA 1J8FA 1CY2A 3FAKA 1ZMRA 4KDCA 1IY8A 2JEYA 2GF2A 1SXJE 5EHGA 3BSWA 1TMGE 3BH0A 4LC9A 3SD7A 4JT8A 3ZCSA 3DAHA 4F93B 3GNSA 3EZXA 2BR5A 4P5DA 3RUHA 2F62A 3AHIA 2JLYA 4KITB 1XRNA 2ZJ4A 4NF2A 1KFCB 3VR0A 1TUIA 3N2YA 5BV8A 3LHKA 4K6KA 2EFHB 4RZQA 4IIBA 1U81A 4PTZA 1C9KA 1O95D 5ICGA 2P9YA 4MDFA 3VQTA 1NYQA 2QMEA 2PZJA 3QXCA 4LJ5A 3ESBA 1U8EA 4AMVA 4BRWA 4RS3A 5L8VA 2D13A 1X8LA 2KW5A 4YO8A 4MHTA 2WAOA 2XX3A 4JLSA 1GPH1 3VHQA 2FWMX 2ZB3A 1GV0A 3ADOA 2PZLA 2CHVA 4QOJA 4Q3LA 1CULC 1ZQ9A 3VR4H 3HM2A 2JAOA 5E38A 5IH3A 5T4BA 3KPVA 3NJ4A 3SKYA 1IDOA 2II6A 3EVFA 1ECLA 4UVDA 1DHRA 5F9FA 3ME5A 5E7IA 4Z9XA 5E6UA 4BBJA 2BY4A 5AKKA 4A8JB 4AIIA 4BNIA 1G8GA 1PW5A 1BOOA 1ESZA 3N0VA 3WWZA 1VB5A 3L0IB 4DIEA 4DUPA 3OFVA 1QCDA 4PXSA 2H00A 3O7MA 4YDHB 2I2CA 1OTXA 2QZJA 3FFWA 3I2YX 1SOMA 3PXUA 2QN9A 1LWNA 3D7KA 1JRLA 4OHUA 3WGVA 4TS4A 1E9RA 1ESNA 1TNDA 1XX6A 5ALQA 5A7FA 1DIAA 4OSOA 2ONCA 4EG0A 3VPSA 3RTCA 3OX3A 1H2BA 1KQOA 4DQKA 5EXTA 1L7QA 2AKEA 3ZTWA 3ANTA 5L3SB 2VJMB 4M8LA 4YMVA 1NULA 3OPYI 2PUGA 4DG9A 1ZNXA 3B38A 2V58A 3COZA 4BIIA 1M0TA 1PJ3A 1S8FA 4DOMA 5HG0A 4NONA 2YMPA 1KP3A 3KFXA 3JQAD 4CQLA 5JXGA 3OQIA 5KZMB 2QZZA 5FO0A 2CFCA 4P1ZA 3PHLA 4BRUA 4XSVA 3GDWA 1D03A 3T35A 3PJDA 3EISA 3V97A 1EP1B 2WTUA 2DCUA 1V8ZA 4FFBB 4RK7A 4EUNA 4Z1OA 3KL4A 1BE1A 3W2FA 1V48A 3DDWA 3OBIA 3TLJA 1FYWA 3EN0A 4LSMA 1M5TA 4AMBA 4E88A 5C1BA 3KSAC 4EW2A 3D1JA 3S3TA 1AHNA 2QTWB 1K3TA 4U9IS 5KEIA 4K8OA 4WXHA 3C4VA 2JH8A 4CQJA 2QBYA 4PZUA 4BX9A 1A2QA 3IR6A 2VWHA 3NHFA 1ECJA 1DAIA 3ZC3A 4ZYUA 4DV7B 3PXXA 2JJ2D 3HH8A 5FUWA 4G4JA 1AY0A 2AOVA 3I8SA 4QGFA 4EDHA 2F00A 4V1CB 2IDKA 2EZ9A 1R66A 1F12A 3LTEA 4JBLA 4QUJA 4UTPA 1DJQA 3MJSA 3OCXA 3O26A 4R1UA 1WCV1 3KWLA 3B2EA 1ECBA 1T2EA 1B2RA 3ONEA 4RS4A 1UDWA 1BRTA 5JLAA 1WHTB 1GZ5A 2UDPA 3EQ6A 3B85A 3GFGA 2WHYA 2V55B 3GEDA 2BEWB 3ITNA 4NZZA 4F3TA 1I2CA 5B3JC 3UK1A 3I58A 1YZQA 2RSLA 3P5SA 3GLSA 4NV1A 1BXRA 4OY3A 5BVHA 1JR3A 4OJYA 1BDJA 3ILXA 1Z2PX 3H6HA 2WJPA 4GQBA 1Q3KA 3I6QA 4J07A 5DIZA 5EQFA 4GLLA 5F73A 3GARA 1N2XA 3BWXA 3ODPA 4E30A 4FNGA 4ALNA 1CS0B 4C3VA 3CEPB 1J8MF 5AVQA 1Y8RA 5HTOA 4S1TA 5TX7A 3ZE6A 1RYYA 2A3RA 5TGZA 1K27A 1KVUA 2VPQA 3BXZA 3CUUA 4EY3A 2D2VA 1X8KA 5F2EA 4B48A 2G1UA 4DUZB 4ICIA 2ZWPA 5KNBH 4TPKA 5LXTF 1RAGA 1DC7A 5LZ5A 3RF7A 1ZVQA 4ABYA 1BNCA 3I8OA 3NIDB 1TIBA 2VQFB 1CC1S 5IAJA 3RHTA 3FN4A 2OKCA 3DFMA 2A0YA 4FKMA 5HF8A 2GN0A 3FVRA 4ID3A 5G3ZA 1SHKA 5IF3A 3LBIA 2I3AA 1XN4A 1OB5A 2J4DA 3TCNA 2GKGA 1YNOA 2V65A 1JE1A 3GW8A 3AKCA 3RAEC 1YIDA 1EH5A 4G0MA 4OD0A 3U9TA 3FFTA 1NOKA 4YHBA 4ZI7A 4BQPA 1P9OA 3LZCA 1NHGA 5HM6A 2LBPA 4TMWA 4V0LA 3JRWA 1UT6A 5BYJA 2UV8A 1ZC4A 2P0EA 2EQAA 3FB4A 3K9CA 3MMZA 4UUPA 5FOSA 3REGA 1AU9A 1JG4A 4PSUA 4B3DA 3U7FB 4X3CA 5HILA 1RJFA 2GI4A 4HAUA 1JQJC 1N5LA 4IVRA 5DT2A 3O1JC 3LP6A 1ZKDA 3GXBA 1F0YA 5KYKA 4TZ6A 2A5GA 3IUJA 4EYEA 2ZTLA 4TYPA 1DEAA 2EF1A 3WDKA 3EULA 3QPUA 4X3PA 1G8PA 4F1KA 5HCUA 1LNZA 3V7WA 1FX0B 1JEQA 4AMZA 5BN4A 1BH2A 1BHO1 2LDBA 4FSXA 4L0CA 4O29A 3ZLBA 5B5SA 2WPDD 5JSFA 4LY9A 4IYRA 4CKZA 2FR1A 2P5YA 1JQKA 2AW3A 2P6UA 1TB4A 2PZBA 4CKEB 4NYMQ 4D3FA 5KDOA 4K88A 4O4IB 2PK3A 4RVHA 5IC4A 5B37A 1KVSA 4IGFA 2FP3A 4DXHA 4QAJA 1YVRA 4ZCLA 5B58C 1CQJA 5MN5A 3AQIA 2WT4A 4J3FA 1NSYA 2JHPA 1Y6ZA 1IUPA 3AHCA 4Z86A 1O08A 3GLHE 5G1PA 3VYSB 2IPOA 4BMCA 1JTEA 1KI6A 4JA2A 3UJ7A 3KV3O 3WDSA 5A06A 1QYCA 1T2CA 3I09A 2CHUA 1FPMA 3E18A 2JGKA 2ZWIA 3BH6A 2PUEA 3OWXA 4U9HS 4D9GA 3ICQB 3AOGA 3U3MA 4KR3A 4TGLA 2DQ4A 1Y9ZA 4KXVA 2FXVA 2WKRA 3HKEB 4J2HA 2GK3A 3VPBA 5BPFA 4RTOA 2N3ZA 2N0SA 4JB0A 1TRHA 4AD8A 2RG7A 4YCCA 5JNUA 2LW7A 2IVZA 3SX2A 4TL6A 2ASVA 2QR3A 4UBOA 4UUMA 4KFRA 3VU0A 3DOFA 4IHQA 1ZOIA 1ZONA 3EF1A 1ZBQA 2BZ0A 4GLJA 1JA9A 1G4HA 2C1XA 4U2EA 4UDYX 2RHTA 4MH0R 3U3JA 5HTKA 2J3KA 1C50A 3U2QA 3L0ZA 1IJEA 2UZIR 4I66A 4AB1A 1YR6A 3L0OA 1HWYA 1JLSA 5FUVA 4NFHA 1KR2A 5T3UA 2GO1A 1ZI9A 2YWEA 2X3FA 1C7QA 1D2HA 1EUCA 3DE5X 3K2BA 3TINA 3KUXA 4DY4A 1GQRA 1RQXA 4KJXA 5FFMA 1Z28A 2UYYA 4POAA 5FA6A 3SSOA 2YFKA 4L76A 4LKOA 5AO9A 4DV2B 4IGEA 1I13A 3HE3A 4MVCA 4OGKA 4UHFA 3IULA 3OLQA 3ZHCA 2F8TA 3QY0A 3VH3A 1YRAA 3F2IA 1U8XX 1GA6A 2Z4SA 3B5EA 3KSDO 3MB5A 3VISA 1WBDA 2IP2A 2ZI3A 3DJYA 3X1DA 2Z9CA 4YRZA 1U3DA 2IE8A 1U8CB 5ALEA 4G26A 2XYQA 5F52A 4YUXA 4DTIA 3HU5A 4HDKA 3RSCA 3M5DA 1X7ZA 1KAOA 2AWNA 3ZVMA 3QTBA 1ATIA 2EKDA 5LN1A 1UPFA 5BN1A 5ALJA 1JR2A 3ND5A 4R16A 4PIVA 3HM9A 1Z7WA 4CGYA 1FJ2A 2VAXA 2WQ6A 2BMWA 3HDTA 1GZUA 2O19A 5LD2C 1SXJD 1P39A 1RM5A 2DGDA 3AY3A 3OCWA 2NO6A 4UXIA 2LCQA 1JIJA 3W5UA 1PN3A 3N8IA 2XMDA 2I4MA 4GM1A 3VVMA 2CHGA 3PITA 2CJWA 3C87A 4PPQA 2IH4A 2Y1EA 4CL0A 2EEPA 1US8A 5ENZA 1OXVA 1RMYA 4AS1A 5KJFA 4DPLA 1G55A 1G3IA 2EWWA 2F7SA 1JE0A 3HI6A 2BM9A 2FTKE 3LF1A 5DHRA 1GT91 4KSCA 2I91A 1L7OA 3IMGA 4N3NA 1U7ZA 3K9QO 2QMYA 4AG5A 4IDCA 4WY8A 4DEVA 1QUFA 3DZIA 5DNYB 1IE3A 1THMA 2I5PO 4MKGA 2K2QB 2YBDA 4TZKA 3E3NA 3OE1A 3X3HA 1U1DA 3T1TA 3LBYA 3G0BA 5BSMA 2VJYA 3T7EA 5E6UB 1PZHA 4FFSA 3TBFA 1P0MA 1M0WA 3KT6A 3UJ8A 4B43A 2VWPA 5CCDA 1E2LA 3HVUA 1LSUA 2OV4A 4OYLA 4JAVC 4G4SO 4RHEA 2XWBF 4L4ZA 4YCAA 4PHHA 4X71A 4A6PA 1FLAA 2IHZA 4B80A 4QVIA 3FZYA 4CIWA 2YZMA 3F7NA 4JBIA 5I3ZA 5MHTA 3IUPA 4OPMA 1HDXA 1I4EB 1PJCA 1EDDA 1L5WA 4ENVA 2PJRA 2XWSA 1YK1A 3PFWO 2BD0A 2QLNA 3L8DA 3DD5A 3EVGA 3A2KA 4KRYA 3W1EA 2ZRIA 3FSGA 6PFKA 4G4IA 2QL5A 5IKOA 4OQNA 4MEBA 2VTDA 5LKRA 1VOTA 3UWOA 1X7WA 1PRYA 1QRTA 1W29A 3IGFA 4CMHA 1DNPA 2OCYC 3DB1A 4IICA 1PJ8A 3H42B 3O94A 3V2HA 4EF6A 5K8LA 4L8LA 3IR7A 1LS6A 4QU8A 4HTFA 2QUBA 4LF5B 3HKBA 3H8VA 2X8LA 5EJEA 2IUSA 3KZXA 3L2OB 4FQ8A 1ZLYA 2VNKA 5C81A 3L8EA 2E9SA 1LNQA 2B69A 3BRWA 9LDTA 4DC9A 2CUTA 4CQLB 4PBSA 4QECA 3OQIB 5L4SA 2R85A 1RXIA 4US0R 1NW9B 4WLNA 5KTYA 4BATA 4RAOA 3MWYW 4D8UA 3ED5A 2C5SA 2IPLA 1RXYA 5IJXA 4AP5A 1E9DA 4D81A 1XLUA 1ECCA 4QGAA 4JQCA 4OGGA 4DLNA 1G6HA 1DKOA 4MKZA 4F9EA 3IDFA 3M6LA 3U49A 2ZT8A 1N77A 2BGLA 2JD1A 2XNDD 2P3OA 3H3JA 3JTMA 3VHXA 1IHXA 1J0CA 2HHLA 2HREA 1Y3FE 2JRCA 5AKHA 4PG6A 1SC6A 1E3IA 5AW5A 3C4JA 1NI5A 2PUDA 4RMNA 5FPQA 1N75A 4Z4FA 1QTRA 4N6NA 1ST3A 1P2VA 3CLUC 3EOZA 5AW9A 2QBYB 1I5OA 3PXDA 4K5QA 2JLQA 3OURA 3EMKA 1PJRA 1U99A 3QVOA 3HDHA 4O4IF 3ZJ5A 2YZ2A 1HDOA 2B82A 3B89A 4ZGBA 1KEKA 4JJIA 4M9SA 5DN9A 2Y2VA 3SFVA 1WSBA 2A4KA 4PHGA 4OFWA 1YKGA 3EQ2A 2OWEA 4KL8S 1EP9A 3PCRB 2X4IA 3PNKA 5E6SA 5IBQA 3D1LA 1WVIA 3DWFA 4ZAXA 4ZV9A 2HL6A 1DG9A 1PKXA 4MA0A 4DA8A 3ZHTA 2ZB2A 5JIBA 3FY4A 1GZDA 3SE7A 2LUOA 1NJ6A 1NYLA 3T9DA 3U19A 4ZJUA 5M29A 4AXBA 4Z7OB 4QJBA 1BXRB 5BVHB 1CX9B 2A92A 4HPJB 5F5LA 3ZZNA 1EXNA 1V5WA 2BI8A 1PL7A 4XCXA 3SIXA 1Q50A 1YJ5A 3BHIA 1Z5GA 4I08A 5IKPA 3BERA 4JI8B 1K5HA 2FOLA 2IEGA 4LE2A 2Z04A 4UBJA 2DETA 1UAAA 1XNRB 3GEEA 2DFPA 1JFTA 1FDWA 1Y8RB 1ZVKA 4CMBA 2CL7X 3KFVA 3NXSA 2P6NA 5ALSA 3CY6A 1N7IA 5GJVC 2BFEB 4ETIA 2VQDA 3FDFA 5IJWA 5IRCD 1L3CA 1VBKA 2AX3A 2H2WA 3W2EA 4HRYA 3DJFA 4PN3A 4BAZA 4Z51A 3I64A 4UARA 3QU5A 4FGJA 5JSQA 3GN1A 4OHZA 3N2LA 2ZS7A 3C3WA 4DR2B 5CG2A 2BGWA 4ZK6A 1JSXA 2EZUA 3HJGA 4PPGA 4CGZA 3TQHA 4C76A 2G9ZA 2ZAIA 4IIJF 4PU0A 4X45A 4BO8A 3O1LA 4QDZA 3VC3A 4K40A 3H2ZA 4RD6A 4AJ9A 5FT9A 3OVMA 5JCZA 4TTSA 4LJ9A 1QP0A 3DH0A 2YWGA 3G79A 5JQWA 4EAAA 1GWNA 3FM9A 1WL8A 3KJZA 3PGA1 1Y5RA 4RHXA 1DAEA 3BFJA 4GOOD 3PQ8A 4L0MA 3SSNA 5FV4A 4ZI7B 5EN4A 3RSGA 1NVFA 1TO2E 3VZCA 4MV3A 1UH5A 3V9AA 3OOSA 3I6IA 1W46A 2AKAB 2QD1A 5A9RA 5HYVA 3L4KA 1A69A 1SXHA 1RFLA 1U02A 2ASEA 2QD4A 2QUIA 2V6BA 2HY7A 2VWGA 2X7HA 2V1UA 3OEHA 2R8YA 4D79A 4EA8A 4ZU3A 2BFBA 2J08A 4MB2A 4XGNA 2WJJA 3PF8A 1QV9A 2IW1A 3U13A 1MRSA 3I04M 3PUYA 1P44A 4KE7A 5I7OA 1XEXA 3ROGA 1TEZA 2O52A 5J4KA 3KDPA 2BTOA 2JHFA 5DMHA 3P2MA 4H15A 1EE9A 4NQZA 1T2VA 2ZT5A 2JGLA 1JEQB 1QZXA 1EUZA 3HN7A 4GSYA 1RRKA 4I19A 1BDMA 1DEOA 3TMYA 1B6RA 4H4CA 3DG9A 3AVOA 1QOPB 4YECA 3HYNA 2DMRA 1T6XA 1ULBA 2G9VA 2OD7A 4LV8B 2QM0A 4UTXA 1CQJB 1B3RA 1JAHA 1NW4A 1VXRA 2JGAA 2OSVA 2ZZKA 3CF0A 5EHNA 1N2GA 2WFAA 3CX8A 3OZDA 1Q0UA 4KHZA 4WBXC 1XLWA 1KI6B 3RQIA 1V2GA 5DNWA 4YI3A 2VNSA 5IVKA 2WP0A 2O6LA 2QN1A 1DOHA 4RMHA 4B1FA 1KVRA 3AY7A 4CTOA 5IX8A 1FSPA 2ZR7A 3NHWA 5KPJA 1I80A 1Q14A 3KAQA 2ZU6A 3LC0A 4MPJA 4LHSA 4NBNA 1DC5A 2WG0A 4MZDA 1XTSA 4R2IA 3DE1X 3UMFA 2JFBA 1EHIA 1WQ1R 4CG0A 4MCJA 1NASA 1OUMA 1VQ1A 1XTKA 2BFWA 3H0KA 3QA3E 4FOOA 1ZRMA 3MG9A 3GEGA 3PGVA 3DF7A 2GEDA 3PHIA 4IRMA 2Z8YM 3ISVA 5JAMA 1GL7A 2CFSA 4DB2A 2XSZA 1A50B 5SY9A 1NLMA 4C0LA 2O8FA 4ZYXA 4U2BA 3S5JA 5AM0A 1X7YA 2PKQO 4ARIA 1FDVA 2BONA 1NOJA 2W2TA 5CDFA 3ZY6A 2MIIA 5K0EA 2W37A 1NKTA 3FRJA 5CNIA 2GZHA 3AH8A 1C8LA 3KB8A 3C41J 3MBIA 3LKBA 1Z08A 3M4XA 4JKYA 4P22A 4RORA 3W2IA 1AH2A 1EUCB 2C29D 3TVTA 2J7PA 2FOXA 1JDBB 3C7TA 3MT9A 4I5EA 1LJ8A 1DOAA 4WZZA 4FHDA 3UJ6A 2G1JA 4QLOA 3CBGA 4I1OA 2DHQA 2IXTA 1AKEA 1ZPDA 3BDVA 1AGPA 1CUGA 1Q83A 3IVMA 3L8ZA 3Q4GA 4G85A 3FYHA 3U1VA 5IUNC 2MHCA 4V0KA 2IHUA 3RK0A 3HA7A 5YASA 3V4RA 1G66A 2G8LA 4NDZA 1FUEA 3AF3A 3EXIA 1CP3A 4XJTA 5ALKA 2WM3A 4R40A 4C01A 2R8BA 4ZO6A 3DV9A 2VRBA 2YUTA 2ZP1A 1X7ZB 4HDKB 3QVXA 1CUSA 5E4TA 5JSZB 1O8CA 2ET6A 1XN1A 5HXAA 1UBHS 3SJAA 4F5WA 1ISGA 4J0DA 3ZQJA 2QXYA 2VDRB 4M0FA 4RTQA 2DUMA 2OV8A 3QGMA 1RM3A 3Q85A 3KOXA 3D3WA 4HNQA 1XAGA 4KO8A 5FHQA 4DSAA 2OVFA 3I5YA 2B2XA 1NPTO 1Z6GA 2SHKA 2O2ZA 2NUTA 1QHXA 2R1ZA 3E22A 4MO9A 2CJWB 5KDDA 4S1OA 4F0JA 2YHUA 3M4NA 1DMRA 2ZJYA 4P08A 4YI5A 3CGWA 4C2AA 1K97A 3VDMA 3N05A 4YGYA 2GLUA 4RV5A 1Z5VA 2C96A 1J21A 1LFDB 4YJ3A 1EYZA 2PRJA 3ASUA 3E81A 4MQUA 3EMBA 1Y9DA 5GZ3A 2VUSA 2D8MA 2OTCA 2VCEA 3IIMA 4DLWA 1KP9A 4OXQA 5H82A 1ABFA 3BRQA 4WLVA 3OEWA 4MQLA 1BQ3A 2BC9A 4DDTA 1PD1A 3FCSB 2MOKA 3QOWA 3S6JA 2H2IA 2AR0A 3KB1A 4C0HA 4CF5A 3IVRA 4N18A 1Z7GA 3DKPA 3UEOA 2BOVA 1EVZA 4UW9A 3TCXB 3EJWA 1U31A 1S3SA 1WVMA 3ETCA 4UNNA 1XDGA 2Q1YA 1HF3A 1IUNA 1KNQA 2XXJA 4ZOCA 2D1RA 3LXUX 3M3PA 3R9WA 2XCSB 2V0CA 4MQ6A 1G8SA 3JAWA 1UK7A 2NVOA 3G6WA 1XRJA 1IBCA 3H2HA 2BKUA 1XP8A 2A67A 5A9SA 1P5ZB 1E69A 4EYOA 3VDNB 3D4IA 3T15A 2DX7A 4NG4A 2ZUWA 4RJJA 3UAOA 4NV0A 1S8AA 1IM8A 1XKQA 2JCSA 3GLIE 3E84A 2I1LA 5D3KA 3ZEAA 1X7WB 3EWSA 4GNRA 1RD4A 1GTRA 4W5QA 3LC7O 2GESA 5EIHA 4D9HA 4E4YA 2P2DA 4HTFB 3HKBB 2D4AA 4JYPA 5KHOC 1UOOA 3A6ZA 1FU4A 1U0FA 1HQDA 4KLAA 4QGHA 4IFIA 3PPWA 4F4UA 4LDQA 2BBWA 4ZI7F 4BX3A 1T36A 1SKMA 1R16A 2OZEA 2ZUTA 3ZCPA 2B61A 1SFRA 5BUQA 3MCUA 2DF8A 4URXR 1WETA 4TN5A 2OQVA 5J5AA 3V1NA 5BQ3A 4AYXA 1K7YA 1CR2A 3ANXA 5KS2A 1UWVA 5IBRA 3A9UA 2CWDA 2O3TA 3AXTA 3H5TA 1DC6A 1D9XA 1PHPA 1PL0A 2GJ8A 2NV2B 2QMQA 2V7VA 1T4CA 1G63A 2WSIA 3CUSA 3E7WA 3R6LA 2GZ2A 4KLZA 4NENA 1JGTA 4EPXA 2VUTA 1TGVA 2PZGA 2XNCA 2IU0A 1RAEA 3GRVA 3DDNA 4C08A 2O1SA 1TK9A 2ZXFA 3ROEA 1EP2B 1Y7HA 3DE4X 3CINA 4LK3A 4Z1MD 5JWOA 1MMFB 2IA5A 2RAVA 2W2PA 1OIWA 4N9WA 1JAIA 1JLKA 4OHWA 4ZOLA 5BW6B 2WA1A 5IZCC 2ZBEA 1PGOA 2OO5C 3HJBA 5HP4A 3F6SA 4B79A 1TU4A 4FOPA 2WE7A 4UBLA 5MF6A 4S2EA 3ZW9A 4EARA 5I6DA 3CVXA 2JH3A 5A4DA 4GPD1 1EFPA 4XB2A 4XPZA 3RIYA 5E6SB 2Y92A 1PDOA 1YWGO 1VC2A 4FDTA 3ZDQA 1F9AA 1LWOA 2Y6UA 4DWWA 3U6BA 3KUUA 4RZHA 4HH4A 3AM1A 2A35A 1S01A 2DQZA 4NMXB 4NHOA 4H16A 1SURA 3KQLA 3CLTD 4C87A 5A1JA 3PLNA 1XEWX 2Q07A 2JI7A 4WSOA 1KK3A 4ECAA 1BJTA 5F77A 1YDGA 3EODA 3GRRA 5JQGF 3EFHA 3DTYA 3DYBA 3KZNA 3M4YA 3N8NA 1SXGA 1UQUA 4JQZA 1Z0ZA 5EUQB 1TUEA 4PX9A 4O08A 2H7YA 2ZI9A 3DA8A 5KSWB 4H0NA 5EINA 3I9MA 5D87A 3IELA 3A14A 5DK4A 4BV2A 2PGJA 3DHEA 1GCOA 4Y6SA 3DDCA 1VZ2A 1X92A 2LNDA 1L6IA 3ANNA 3BGDA 4Y2RA 2JVKA 1G2IA 1K4YA 3HJTA 3JZDA 3P26A 4K9SA 1YK0A 4ZYZA 1P4SA 1CS4C 5B57C 5K0TA 1E8MA 1NVVR 2OY0A 2QSUA 3NHPA 4GPAA 4LYYA 4ZAVA 2XZDA 1TO6A 1UXIA 4QX6A 1ZUIA 1WUYA 2ZRJA 3BILA 4REMA 2EBWA 5DTMA 4G0QA 3SQXA 1N9ZA 4ZAYA 1VP3A 1EZ4A 2RGDA 2Q7XA 1PT5A 1QKIA 3F9IA 3P0EA 3P4YA 2GASA 4AZ3A 1BCRA 4TKZA 1X0XA 2XCUA 3BGOS 4ZT2A 3SEQA 4BTLA 4OLBA 2C7BA 4MVJP 3CT6A 3R9IA 3SU8A 5JNLA 1DARA 3G8CA 4E09A 4F85A 4E4TA 2QJFA 1Z4IA 1YC5A 1ZIXA 3K0CC 3M1AA 4J1NA 1ADYA 4OBWA 5DGDA 5JTTA 4OA8A 3CVYA 2G83A 2X7XA 3FTQA 3AKDA 1QVRA 3UMGA 2MMGA 3I2KA 2D7DA 1ZJZA 1SPBS 1W0KD 3E8MA 4P7KA 4TWRA 5WRFA 4EW6A 1YR7A 2NV0A 4PW0A 1GHTA 5ALOA 4JUIA 3KOUA 3DOHA 1CY8A 1R74A 4RU1A 1FBTA 3PXAA 4WLFA 1DC8A 4TLBA 3D5TA 2BH9A 2ZRHA 2EGHA 1LPAB 3F1LA 4B3FX 3K9WA 5B1YA 3DTTA 1XEXB 4N7BA 4WQMA 1E66A 5E9WA 3O38A 4TRMA 3VR2D 2ZI6A 5AW8A 2Q62A 1NBAA 2H1RA 4C4OA 1A8QA 3AC0A 4UHHA 3MZ0A 4YVFA 3DMFA 1QP8A 4DMUB 3T7IA 5HZHA 7MHTA 2I65A 1U65A 3ADKA 5GWXA 4BFLA 4OB6A 3TRJA 1YHZA 3DAYA 3MGGA 4F3YA 3KXDA 1DQPA 1T2NA 3ABSB 2BUAA 1GPYA 4IXDA 2RH9B 3BRWD 2DWQA 2EC5A 4KZKA 4NFLA 4LNHA 4FCCA 4Q7MB 5EMKA 3PQFA 1BEZA 2H1OA 5CUQA 3A9VA 3PFIA 1C14A 2HA4A 4D9EA 1PUXA 1X87A 3RV4A 4ESEA 1V7CA 1ZVJA 2RHBA 4ARVA 1COWA 3K53A 4GOKA 4Q24A 1UQRA 4HB4A 4QUAA 4AZWA 1BE0A 3BSYA 3GK3A 2M1ZA 1C9YA 2HM7A 2MYUA 3AUXA 3BWBA 3QEOA 3TR6A 1LVUA 3ZHSA 3IUNA 2CL0X 1XVAA 2PKEA 2XQIA 3A9WA 3USCS 1G4AE 2R6R1 2IYUA 5C35A 1RC8A 1GA4A 3IIKA 4HXYA 3ZE7A 4OSPA 1HE3A 2O8FB 4Y2SA 3AUYA 4G9BA 1B42A 1X7YB 3OBBA 1FP2A 3AEXA 2VTKA 3F3YA 2QI9F 3O92A 2C9YA 1OIVA 1ZCZA 3D3NA 3GRFA 3KOOA 3PSHA 4FFMA 5EE3A 3ZD7A 1Q16A 2RK4A 2QLMA 4DCSA 4NPCA 3IKJA 5K45A 4IG4A 4ZEVA 4R7TA 1W34A 2WF6A 2Q9BA 3H86A 4PYKA 3VUEA 4MIYA 1DOZA 1E62A 2VK1A 4DYHA 5EKSA 1RMQA 2AFIE 2WUDA 3CXUA 3Q5DA 4EY6A 2WSYB 2BE9A 4DCOA 4M98A 1M2OA 1RJWA 2AHOA 1ZCBA 4FBGA 4KO1S 5LZ4A 4BXOA 4RADA 3QWBA 1NVTA 4FI3C 4MV0A 1N2SA 1Z3IX 3VYTB 5U9CA 2ONJA 4Z9FA 1W94A 3I62A 4L7VA 3ZIAD 3VNSA 4AU1A 4D4KA 3S27A 5IXSA 3HZHA 4GNKA 4LGYA 3JQ9C 2O2HA 3AWIA 4CM8A 4EUEA 4F9GA 2F8LA 4CTJA 5JOQA 1PEDA 1PEYA 1WXHA 1K5DA 3D3WB 4R3NA 3BK1A 3V7UA 2CNBA 3OESA 4O2LA 4FYXA 3IERA 1G18A 4BNVA 2NUTB 5JECA 4MCIA 4RD1A 2O0KA 2QLFA 1V41E 4KMSA 4BQRA 4D9IA 1U5CA 2XCLA 2PBFA 4G0OA 1CZRA 3HBMA 5KCZA 1NF2A 2RJOA 4FHZA 4LGCA 1U8UA 4EECA 5FI1B 1N2JA 1YZ3A 4OJMX 1OWPA 4GRAA 4MS3A 1GNVA 2IL1A 4YJ3B 4UXJA 1KGDA 3OZEA 3A6PC 4KV9A 2AYYA 5LUBA 3SMVA 3RD5A 4EKIA 4JI2B 4MYCA 1IY1A 2FPGA 1H8EA 4R0NA 4E70A 1LW7A 1T5LA 2OK7A 3L9XA 4ZO8A 4Q39A 2OENG 1OPRA 3PCTA 5CX4A 2NAPA 4UHDA 2R1VA 2QM3A 3ORSA 4LY3A 2I2DA 4GMDA 1ZRNA 4J0JA 2I0FA 3DR5A 1A1SA 2HLHA 1H1LA 2O9JA 1XRRA 1TYAE 3GU3A 4L3OA 3AM3A 4WIAA 5G0UA 2XGOA 3BB3A 4RBNA 2VHUA 2V4ZA 4DLUA 4IRUB 3U17A 1TCUA 1T8PA 4J6FA 1P7VA 1SCKA 4BQEA 1YMVA 2WYHA 4DPMA 1BO6A 2JDIA 4RVGA 3A27A 5LBTA 2XA9A 3JAWB 1DB3A 1E3WA 4QU9A 1GNRA 1PJZA 2XAAA 4EJSC 2TECE 1DDIA 2IQIA 5C1OA 1I33A 3OKCA 4YRQA 1KPGA 2EHJA 2UXBB 3L0CA 2ARKA 4Q37A 2J3MA 1I14A 2QG4A 4L07A 4GPTA 5DM4A 3STHA 3FPHA 4G0NA 4DM3A 3H9GA 5IXJA 2OO7A 4ZZ1A 2VJLA 5G0SA 3P8ZA 5JNTA 1RXWA 4Y2XA 5HRCA 4TWZA 1YE3A 1F8YA 3AF5A 1ESCA 5DOVA 5A4FS 1TA0A 3BM5A 4KK3A 4WW0A 2PUBA 3D43A 2FPMA 1KQFA 5I7HA 4U63A 1QYDA 3IUYA 5AVYA 2FX2A 2GHQA 2B6NA 3OIDA 3D6VA 2BCEA 1P77A 4CT5A 3WK8A 5EIEA 3MSXA 5FNVA 5ALRA 1P9RA 3KHTA 4EO9A 4W5JA 4MITA 1T36B 3KJQA 4G8DA 3I32A 4JQYA 4YH1A 2MR6A 4DGQA 5CU7A 4YONB 1FTYA 2HF9A 3L0SA 5I9LA 1Z38A 1UIRA 3H84A 2PMKA 3BL8A 3PWKA 2IELA 3ZOKA 4EENA 4DJFC 3IUSA 1BXKA 2R4UA 2Z1DA 3EBLA 4ZAZA 2ZB8A 1T4CB 4QO8A 3JZFA 4JLUA 4BIMA 4NENB 3SX4A 5IP5A 2YC4C 3R3YA 3KJHA 3QE2A 3G17A 3KKKA 2XSZD 3I12A 4J2TA 1ULUA 2WQ7A 3LWNA 4XYLA 1KI4A 1PCXA 1YI0A 2EP7A 4L0QA 3SFTA 2VOJA 1N6KA 3THWB 4JVMA 4KPUA 1O57A 1KGSA 3EIUA 4ZOLB 2HV9A 5UKDA 1CQPA 1LLDA 1R4MA 3CRNA 3QJ5A 2NQ2C 3R3WA 4IGKA 4LRXA 4DZRA 4E33A 1JVSA 5DV9A 4JEMA 3UB3A 3MGKA 1RBMA 4WUTA 3GRZA 3TLEA 2PBZA 1ZHOA 3E1GA 4OBXA 1E1KA 3BEOA 4RVUA 1