3MCTA

Vaccinia methyltransferase vp39 complexed with m3cyt and s-adenosylhomocysteine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Methyltransferase
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
total genus 99
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mctA00
3GWZA 2XYRA 3HCAA 3NW9A 5BW5A 5GOZA 2NXJA 5K03A 1AV6A 5HIKA 5ICEA 4BLUA 3SX0A 2F8LA 3M6WA 4LG1A 3DTNA 2AN5A 5K0LA 2ZBPA 1EIZA 3KPJA 1G55A 3KQTA 3O7WA 2XBMA 3ID6C 4KVZA 4Y30A 2BM9A 1KHHA 3FYCA 3FPHA 3QV2A 5LQAA 3AXTA 4YMGA 3AXSA 5EOVA 4E33A 5FQNA 3EMBA 1VQ1A 3LL7A 3FRIA 2N47A 3FUVA 2ZCJA 5EVJA 2FRXA 3A4TA 4RTJA 4U7TB 3LBFA 2PT6A 3NJRA 3PFHA 1L3IA 3CGGA 4R05A 1JTFA 2GAFA 1NBHA 5DTMA 2ZW9A 4PYNA 2PSSA 3LCVB 2BR5A 3NDIA 5E9QA 3ME5A 3HM2A 3P97A 2I62A 1ZGAA 5CVUA 5K01A 5DRYA 5FWDA 5LQKA 4PCLA 5CUQA 4GOMD 5GM2A 2NNWB 2PLWA 4BY9E 4X60A 2E5WA 1ZKDA 5EZSA 1N7IA 2UYQA 2VP3A 3GJYA 4QQKA 5LSAA 4PCAA 1WY7A 1IXKA 3CCFA 2B3TA 4G56A 1TW3A 4RTMA 4R6XA 2P40A 3DMFA 3KQYA 3PTAA 1RJFA 2C7PA 3OFKA 3G2QA 3IYLW 5DTRA 2PVCA 2G8NA 4RV9A 4RTLA 2BM8A 3B3GA 3R3HA 1R18A 4KDCA 4OA8A 4GC5A 4V0RA 5EMKA 2O06A 2O05A 2AOVA 3KPVA 3LCUA 4AZSA 3GU3A 1JG3A 2DULA 2ZIGA 3GRUA 3UJCA 2JJQA 4PYIA 4HGZA 3VC1A 3NWEA 1DUSA 5FHQA 3K0BA 1NV8A 3DUWA 3IHTA 3C3PA 2GPYA 2CL5A 3DMHA 3CKKA 4OQEA 1D2GA 4DCMA 1YB2A 4PIPA 4PYJA 1KR5A 4KW7A 5EMMA 3DLCA 2BR3A 3BZBA 3KPYA 3OPNA 5ICGA 1KP9A 2H1RA 4CTKA 3GIWA 3DULA 4YUWA 5DTQA 3EVBA 4FGZA 2ZZMA 3LECA 3BT7A 1KXZA 2CKDA 2HTEA 2UYOA 3G7UA 4LECA 3EVEA 4BLVA 4CKCA 1JQDA 5HZMA 3ER9A 5E8JA 1UFKA 1X1BA 2I6GA 4PINA 3CC8A 4YUYA 3PB3A 5K0JA 3LDFA 2I9KA 5FQOA 3D2LA 3C6KA 2V7EA 4CTJA 1V39A 1F3LA 3FRHA 1XDZA 2AS0A 3G88A 1XCJA 4FT2A 3REOA 3EEYA 1KPHA 3M33A 4IV0A 3A27A 2PXAA 2P1DA 2EJUA 4RX1A 3UJ9A 4E30A 4UOEA 2IH5A 2EG5A 3I9FA 5GM1A 3SSMA 3M6VA 3M6UA 4RVFA 1SKMA 1X1CA 2NYUA 3LGAA 3SVZA 5LQUA 1FPQA 1I4WA 5HFJA 3G5LA 4DQ0A 3X0DA 3MERA 5P8WA 2OO3A 3A25A 5K05A 4R6WA 1FJXA 1QZZA 3GXOA 3WSTA 10MHA 5CVJA 2IH2A 4RTQA 5FADA 4PGHA 4MIKA 1XTPA 1RJEA 3LKZA 1M0EA 4RWZA 4PYKA 2ZULA 5EMLA 1D2HA 3E23A 5DSTA 3P2EA 5CVVA 5DWQA 4YUXA 1EAMA 1JSXA 3HA3A 2GB4A 3OE4A 3UJ7A 4BP3A 5EHGA 5EIWA 4EQZA 1NW6A 2AR0A 3BWMA 4E2WA 3G2OA 3SM3A 3TLJA 3GRRA 1ZG3A 4AZVA 3B89A 4U7PB 5C9ZA 5KYGA 1QANA 4PYOA 3Q7EA 3EEOA 2WA2A 5K0GA 3GNLA 2GLUA 3R6TA 5EIFA 3C3YA 5MHTA 2P35A 2HWKA 5D1HA 2UYHA 5DPMA 1YF3A 5HIMA 3UJAA 3G8BA 5D1NA 3SXJA 3ELUA 2EX4A 3UBTA 1VBFA 3FTFA 2PWPA 3E8SA 2AOTA 5E8RA 4DKJA 1QAQA 2B9EA 4OBWA 3VC2A 3EVCA 4FR0A 2ZBQA 4QDJA 4RTNA 3RIEA 3GRVA 3FTCA 2OB1A 4GOOD 1L9KA 1XDSA 3TFWA 4E31A 4FT4A 4HH4A 3FTEA 1RI2A 2PWYA 2ZWAA 3R0QA 3JWGA 5E2AA 3UJBA 1NW5A 4RTKA 1QYRA 2FHPA 3G2MA 3PLAE 2Y1XA 2FK7A 3AWIA 1VE3A 3V97A 2O57A 4C07A 4RTPA 3MCTA 3KQSA 3CBGA 2LD4A 4PYQA 3K6RA 2Z6UA 3EVAA 4GC9A 1N7JA 5E1DA 1I1NA 3FPGA 5EEGA 4EMSA 2ZTHA 3PX2A 3GCZA 3QOXA 3HCCA 1Y8CA 4X63A 3EGVA 5FWAA 3LBYA 5HIIA 4EVIA 2JG3A 5EPEA 2FCAA 1ORHA 2FYTA 4ER5A 2ZBRA 4H0NA 1JG1A 5DT2A 3GGDA 3BKWA 5K0FA 3CJQA 4RVGA 1G8AA 1SVUA 2WK1A 2AOTB 3P9KA 5JR3A 2ZZNA 2P8JA 3GRZA 4PYLA 3ELWA 2YUIA 3BGDA 3PS9A 1RI5A 1OR8A 5DXJA 3JWHA 4OBXA 3FPFA 3TR6A 2GA9A 5U4XA 4C05A 5EEHA 4RTOA 2HNKA 3UZUA 1SG9A 2IBTA 2B2CA 2AZTA 3H2BA 3MAGA 1KYZA 1QAMA 3LKDA 4MTLA 4XUCA 5ERGB 2ZWVA 3R24A 1L3BA 2ORED 4KDRA 4XUEA 3LPMA 5DSXA 5LR6A 4YUZA 2G72A 1DCTA 4F85A 1R00A 2ZZKA 2QRVA 3GO4A 3P9NA 3QOWA 2AOUA 4R8SA 4C08A 5K09A 5KQSA 1JR4A 2K4MA 3CVOA 4NECA 1R8YA 5EZQA 5EMJA 2P3OA 3T0IA 4YV2A 5LQCA 3OZRA 5F2KA 4PNEA 1G8SA 5IKMA 3ER8A 1M6YA 3FTDA 3SGLA 4IKPA 1WS6A 3G8AA 2ZIEA 1RI3A 3BWYA 5GIPE 3HTXA 3OZTA 3KU1A 4M38A 5EC8A 3HVKA 3G5TA 4E2YA 5BW4A 1BHJA 1IM8A 2QY6A 1FP1D 5DXAA 4HTFB 2NXEA 5B1SA 3HCEA 2OBFA 1R8XA 2BR4A 1YZ3A 4MQ4A 1KYWA 1R74A 2IGTA 3HP7A 3EVZA 8MHTA 2G70A 2P3LA 3BUSA 3E7PA 2G71A 1NE2A 2QM3A 3TOSA 5K0EA 9MHTA 1ZQ9A 4HSGA 3FUXA 5FHRA 4X41A 2EJTA 1ZHFA 3P9IA 2G1PA 4AZTA 1EJ0A 4GUAA 1WXWA 4Y2HA 5EG5A 5HIJA 3LDUA 2B25A 4GQBA 5E1MA 3TMAA 2ZFUA 4DMGA 2B78A 3FPJA 3R9XB 2QRVB 1DL5A 2AOUB 3JWIA 3C0KA 3NMUF 2PY6A 2CWWA 3OFJA 5BXYA 3OZSA 1XJ5A 1FP2A 5EGSA 3KPWA 4RTRA 3MQ2A 3P71T 3S68A 4E2ZA 4YV1A 1X1DA 3SMQA 3DLIA 3UA4A 3UA3A 4F86A 1RI4A 3KQPA 2IBSA 2DPMA 1RI1A 4FS8A 2ONZA 5JUWA 3BWCA 2PJDA 5T64A 1N2XA 1P1BA 3LCCA 2IDKA 3Q87B 4M37A 2A14A 2OKCA 4LWPA 5LQRA 2IIPA 1JTEA 1AQIA 3NVMB 5DM2A 3NVKI 3PX3A 3I5UA 3SR4A 4ER6A 1XVAA 2QE6A 1NV9A 3IV6A 4P7JA 3DH0A 1T43A 3FPEA 4B17A 3DP7A 5LQJA 3BXOA 3HEMA 4A6EA 2XVMA 4WVLA 4KWCA 3KQOA 2PBFA 3DR5A 4GBED 5K0BA 3KR1A 2JHCA 4C06A 5GINE 2V74B 3B3JA 2P41A 5CD1A 3KR9A 1G38A 3SSOA 1KPGA 1ZGJA 3TPZA 3MB5A 3FZGA 3LHDA 4X61A 5FA5A 3HA7A 4ER0A 4R8RA 3KKZA 2PX2A 1JG4A 3ANXA 3BKXA 3BGIA 2C7RA 2JHPA 3BGVA 4PYMA 3EPPA 2P7IA 2IH4A 1WZNA 4RVDA 2FPOA 3PVCA 2IP2A 4FSXA 4WXHA 1TPYA 3HVJA 4AUKA 5C1IA 3G2PA 1TW2A 4GF5A 2C7QA 4BP1A 1P1CA 4RVHA 1IY9A 2NXNA 5FA8A 5T6BA 3KPUA 4LWOA 4CKEA 3NDJA 2YXLA 2Y1WA 3PFGA 1XDUA 2R3SA 3B3FA 2CMGA 3T7TA 2Z6QA 3IEIA 3EGEA 3KHKA 4C03A 4RYLA 2GH1A 3KR2A 2UYCA 4M36A 3LX6A 4CWAA 1G6Q1 3JWJA 1BOOA 4HC4A 4L7VA 3KQWA 3EVDA 2P7HA 1I9GA 3P8ZA 2PX4A 4QPPA 4ZTBA 3MTIA 5FCDA 4PWYA 4PONA 1NT2A 2XVAA 2FK8A 3I64A 3KQQA 2VZ9A 4HGYA 4XCXA 5EHIA 5E1BA 5GP1A 3RODA 3B5IA 3VSEA 1O9HA 4QQNA 5DX8A 2VDVE 2YX1A 1HNNA 2O0LA 3AJDA 1BC5A 4FP9A 5E2BA 1P39A 3AY0A 3V8VA 1NW7A 3OU2A 2ERCA 3HVHA 4HTFA 2HR1A 3M70A 4BLWA 1G60A 2PXXA 2PX8A 3CJRA 5CVDA 2PKWA 2YVLA 1VP3A 2IFTA 3M4XA 2GS9A 2IPXA 2EFJA 2ESRA 5EQJB 5GIOE 5FULA 3I53A 1FBNA 1MJFA 2ZVJA 4PGGA 1INLA 4GOLD 4YV0A 4Z2YA 2ZLBA 2AN4A 3GRYA 4IWNA 5ICFA 3TQSA 3A26A 2HMYB 2VS1A 5HILA 4DM3A 4ATNA 2YR0A 3MTEA 3MCZA 3OU7A 4K6MA 1YUBA 4C4AA 2KW5A 4F84A 4X1OA 1D2CA 4QPNA 2WA1A 1KIAA 3EMDA 1F38A 2AVNA 4JXJA 1X1AA 3TKYA 2OZVA 4DF3A 2AVDA 5E1OA 2OYRA 1VLMA 4ER7A 2UZ4A 3I58A 1H1DA 1VIDA 4AX8A 1UIRA 3ORHA 3C6MA 5LQNA 3UJ8A 3FYDA 3SSNA 1YFLA 1UWVA 2AOWA 2PGXA 2H00A 3FUWA 3UWPA 4EKGA 2ZSUA 3EGIA 5HEKA 4MHTA 4FZVA 7MHTA 5BP7A 3ERCA 3TM5A 1JG2A 4IV8A 1SQFA 5K8VA 1WXXA 3RW9A 5CVEA 1NW3A 1SUSA 3MGGA 3O31A 4P7GA 4DCGA 4GEKA 3T7SA 3UFBA 2Z6AA 3NWBA 3O4FA 2H11A 3DXYA 5DLYA 1B42A 2I7CA 3KQVA 1NBIA 3B7PA 4M7RA 2OB2A 3CJTA 4MWZA 1SUIA 1Z3CA 3GDHA 3KR0A 3P9CA 5T67A 1L3CA 4ISCA 5F2OA 4CXMA 4KIGA 1Q0SA 2Q41A 4QVKA 3P2IA 4FSDA 4OQDA 5DX0A 4O29A 1BKYA 1MHTA 5DX1A 1XCLA 2HV9A 2ZIFA 2ADMA 3FUTA 5DM1A 3DOUA 1X19A 3HVIA 3ELDA 2PV0A 3LSTA 4P7KA 2JHAA 1XXLA 2IDJA 4P58A 3U81A 4E32A 3A7DA 4QDKA 1NW8A 2XYVA 5DM4A 5E9WA 5KVAA 3EVGA 1VL5A 2QYOA 2NP6A 2OPBA 4QTUB 3P2KA 2C7OA 1ORIA 5H02A 2BZGA 1VPTA 5FTWA 4C04A 4DA4A 2O07A 5DRTA 3OCJA 4YMHA 4EK9A 1JSZA 2VDWA 2XYQA 3PT9A 4KIFA 5CM2Z 2YXEA 4QTTB 4AZWA 1Q0TA 3M6XA 4CKBA 1L1EA 5FUBA 1HMYA 2PT9A 1EG2A 3ELYA 4GOND 1JQ3A 5G02A 5M5BA 5E9JA 4E70A 3EVFA 2AN3A 2OXTA 3A7EA 3TRKA 3MHTA 3E05A 3HCFA 1U2ZA 4EKIA 3NTVA 2VDUE 5EKUA 4KRGA 5CIYA 4POOA 5CCXA 2P3QA 4A6DA 3UJ6A 1AQJA 1NKVA 5GWXA 1M6EX 2PX5A 1YFJA 2R6ZA 4OX9Y 4V0QA 3KQMA 1RJDA 1PRYA 2JH9A 5C0OE 2CMHA 4HG2A 3G89A 3LDGA 2ONYA 1PJZA 5K0NA 1O54A 3F4KA 1YZHA 1O9GA 1JQEA 2JH8A 1P91A 4PIMA 1QAOA 1R6AA 2PXCA 4OA5A 3DXXA 5KQRA 3HNRA 4DZRA 1WG8A 3T7RA 5F2NA 5EKXA 1EJ6A 3L8DA 3OU6A 4ER3A 1EQAA 3HA5A 3THRA 1VP9A 2YTZA 2AOXA 3FUUA 4RTSA 2BH2A 2NXCA 3BWBA 5DM0A 3TKAA 5KS2A 4P7FA 3UJDA 1SQGA 3DXZA 4QVGA 5IH3A 5K0CA 1RJGA 3TM4A 3OE5A 3HCBA 1KPIA 3HCDA 4HRAA 5ICCA 2YQZA 2OY0A 2YXDA 4XUDA 3THSA 5CCBA 4E2XA 3VYWA 2NP7A 3DMGA 1AF7A 5HOQA 4RSRA 4YUVA
chains in the Genus database with same CATH superfamily
2CD9A 2XDQB 1WXHA 5KVCA 2PVPA 3W2TA 3GEDA 1N1DA 3CTMA 1RQ2A 1QFYA 3EF1A 4N0QA 1B0ZA 4XSHA 3D8UA 4ZOLA 4O2AF 2NLOA 4DW8A 2MSNA 3G9XA 1T9DA 2GVDC 1T0BA 2QZSA 1LTKA 2YDYA 3AVXA 1EGAA 1HXHA 3OIUA 2HJSA 2Z5GA 3OLWA 4FPXA 4KVZA 1ZI6A 2H4WA 3QV2A 4X84A 5LM3A 5T5QA 1RXYA 5DHTA 3EG9A 3LD9A 3N28A 5EOVA 2Q9CA 4UDNA 1JWLA 2J9GA 2C5GA 3RU9A 3ZVNA 1KBZA 1T25A 2H7VA 2WINI 2ZCJA 1ZICA 1K86A 4J0HA 3LQ2A 5CW2A 1L5KA 4GKVA 1PYOA 2QGFA 3PR1A 3MJTA 2VDPB 1PJ4A 4ZXFA 4H6XA 3AZQA 5DEOA 1N2CE 2CHEA 2YZNA 1JTFA 4YIHA 4WD3A 2ZW9A 2ODEA 5AVYA 5AW2A 3LCVB 4WW0A 3G2IA 3JVUA 3WQBA 5HM6A 2J32A 4TVSA 5EE9A 2B34A 2Z2IA 4OV6B 4XYGA 3WWEA 4BBAA 1TT5B 3KLPX 3WWDA 2R85A 4ARBA 4L4SA 4LF6B 3LP6A 2ZREA 1Z37A 4QQKA 1UZMA 3D6NB 1SCIA 3RYIA 5HVNA 2IXDA 4RJLA 3REQA 1ZUD1 2B3TA 4O4HB 2I1VB 2VF2A 2J9YB 3AKDA 3ZDFA 5TE9A 2W6QA 5FWNA 1TUIA 5ED4A 3A4IA 3IYLW 5KAPA 2DTDA 1NIJA 3FOEC 2PVCA 1UPTA 2JFZA 1L5RA 3H5AA 1YKSA 2NO6A 4RF5A 4FNMA 3B51X 3ACDA 4WY8A 3VQTA 2AOVA 4H0FA 1E0DA 1RYMA 4NZZA 3HKBB 2ODTX 1T2EA 3LCJA 3DEFA 3E2IA 4CIWA 3FOFC 4HGZA 4KXWA 3VC1A 3NO4A 3NWEA 5FPTA 4Q01A 4DV0B 2ZRCA 5BUCA 3A6LA 4P82A 2R4QA 1G2QA 2J3HA 2R62A 1JRLA 2BLLA 1YE3A 2C4HA 4MUAA 3JYNA 4ZDIA 4X5OA 3BZBA 1Z4OA 4DDMA 1MH1A 3IPLA 3OVMA 4ZGWA 1GT6A 4QELA 1CQIA 1WUJS 3PJFA 1YASA 4XYBA 1NXVA 3BHNA 4OFBA 2VH5R 3RGGA 4R0VA 1WCXA 1JHZA 2GM4A 1CUGA 1FLVA 5AM0A 4BLVA 4WESA 3A9TA 5LYJA 4CMEA 2P6MA 4PINA 4C7OB 2C77A 5JO0A 2J41A 4CEHB 3A3KA 4C3VA 4QBIA 4F92B 3FR7A 2D0PB 3AQIA 3RSHA 5KNCA 3ER6A 3SHWA 5JSHA 3M33A 1QVWA 3WV4A 4P54A 2GKGA 3MAAC 4JT4A 3C8ZA 1H6AA 3ZDAA 2FWAA 3SVZA 4AKIA 1SAYA 3IQFA 1ODJA 1XWFA 5H80A 2H1VA 3MS4A 3GLFB 4CQLA 1SN7A 3PSHA 1XZHA 4N4AA 4HDAA 4X20A 4YLGA 5P8WA 4K03A 3PFCA 1RYHA 2B1QA 4LJ7A 4KQHA 2OPHA 3KZOA 1N1EA 2FLKA 1P31A 1P7CA 3IO3A 1Z0JA 5ALPA 5KVSA 2PCLA 4PZDA 4Z1MD 3L1JA 1IEVA 4RWZA 4Y6LA 4B81A 2NV2B 4NENB 3KTFA 5COBA 3W2GA 5EJ9A 4QOJA 2IF0A 5DWQA 1NBWB 2E3JA 4YUXA 1AM4D 1NR1A 1ML4A 1OU0A 5BR8B 4X1IA 2PT7A 3OFSA 1W73A 2PNFA 2P5UA 2R6JA 1ZNXA 4MW9A 1HOTA 3ROZA 3R5XA 1LFDB 1Z28A 2W2OA 4RYDA 1QXSA 3EEOA 4JQOA 3DV0B 1XE3A 1E9CA 3ECSA 3H5LA 4QXPA 1V96A 5EIFA 4ZU3A 3II6X 1US8B 3QBVA 2WVHA 1YSCA 1HYGA 1RC1A 3PICA 4IX1A 1V35A 4RHYA 1NBEA 3LX5A 4WHMA 3TQIA 3N3AC 1IBKB 3WYNA 3AVYA 3EXG1 1AQYA 3BTOA 1L4LA 4QRIA 1E1NA 1YL6A 4W1QA 4GZ5A 4M55A 4WZ6A 4YRKA 1R4MA 2AZXA 4D98A 3U4HA 4PN7A 5ENZA 4ZVRA 1QC5A 4UBOA 5KDLA 2BEVA 1OYOA 2DUMA 2XUFA 3QV1A 4MR9B 1L4UA 3NOVA 4B48A 3Q7PA 4QUKA 4AS1A 4JQCA 2W2VA 3W6OA 4QDJA 4RTNA 3IKTA 2V5VA 3EA5A 3W6UA 4JI8B 1IJFA 2G17A 3UAOA 1QO7A 2BFFB 5TT0A 3BRQA 1O0CA 5KNLA 1V47A 2W6JD 2D4AA 1C0IA 3N2GA 3PVSA 1P19A 1VMIA 5BSWA 3E2MA 1YZUA 2PX6A 1QFXA 1JHOA 1RT9A 1PIWA 2WIJA 1FMLA 1O0SA 5T8KA 1SXIA 5BW6B 3I1YA 4F7WA 4ZYUA 3HWWA 5DK4A 4BRWA 3AY7A 3V8EA 2J9FB 2Z9DA 4RESA 1OXVA 1I1NA 3UXYA 2QAJA 1FDVA 3ZTWA 3ZHQA 1K97A 1KE1A 4ZJZA 2QSJA 1ZCJA 1OQAA 4EIWA 1DE0A 2XY4A 3L7LA 4UREA 3TCXB 4IRXA 4YCSA 1XKXA 4BO8A 4Q9IA 2VJQA 3OIVA 4D56A 4E6PA 3EBLA 5SZIA 1A7JA 1ECPA 1CRLA 3SZMA 4GQAA 2ZS9A 1SQ5A 2CHFA 3BAZA 2WHRA 3O90A 2Q6IA 3JTEA 1ZD4A 1RWXA 5DYNA 5I9MA 3VX3A 2BMDA 4LTDA 2ZUBA 5EZ6B 2H2DA 1HKHA 1RFLA 1E8NA 1U1IA 3OF5A 1Z6AA 2VHQA 3ROKA 2HMWA 2A2ZA 3EW7A 1VHQA 3QG1A 5FFMA 1BDBA 1TCVA 3KOUA 1XVLA 5DEIA 1AKTA 3BK2A 2QVLA 4RFLA 2ORED 1VLLA 5KOIA 2UVDA 3KCNA 2FOXA 3K8OE 1KDRA 4YASA 5KQSA 3CLRC 1V1RB 2AV6A 3BCHA 3F49S 3IP1A 3QUQA 2Z5VA 5ALSA 3JQEA 2JIOA 5FTMA 3UPDA 4R7ZA 4A1FA 1BE0A 2QMUA 1A8IA 4X1YB 1ZK3A 4BMDA 1G21A 4BO9A 3CNHA 1PNOA 2C00A 1QYXA 2C59A 2EL7A 1WS6A 4TL9A 4ARAA 5IF9A 5KOHA 1G8JA 3TGLA 3BILA 4G5RA 2VL7A 3OM9A 3HTXA 4CG2A 3LY7A 3T7AA 2WLTA 4L72A 4CZ2A 4IDPA 5JLAA 5JHGB 2G25A 3RBAA 4XM2A 2NG1A 4WLEA 2I2CA 4KR7A 1KYWA 1B8VA 2QN3A 3PNMA 3PPXA 1S3GA 4JYCA 2Y0CA 4TKUB 1F48A 3BXZA 3H4TA 1G1AA 1I9CA 3GLUA 4CDMA 3U9SA 3AEQA 4R84A 5C7OO 2V1UA 3HSSA 3O47A 3OSUA 1JEQB 2B9VA 4JJIA 4MK4A 5A9TA 3R6GA 1HDOA 3LDUA 1XZQA 1YAJA 3P4YA 2B78A 3CB4A 3WNBA 5I48A 4QE3A 3V7YA 1PW5A 2EHJA 3PQDA 1V6SA 3R7WB 5JROA 2PUEA 2W70A 3TTSA 1XNGA 1G3UA 2B4RO 2IXGA 2GYVA 2YJGA 3T9EA 5G2OA 3UGTA 1T6BY 1CQXA 4RDIA 2GCIA 3AV0B 1K63A 1GZ7A 4WKBA 1P9RA 2V55B 4L57A 1HT1E 2I4IA 2PH1A 4WDQA 4YJFA 3EODA 3I0NA 4W5NA 2XTZA 1W85B 5IHXA 3PRKE 2XD9A 1ZVQA 2L69A 1P1BA 4AP5A 4N0DA 4QFDA 1IN8A 4WCFA 1FNDA 2VPIA 2FUEA 4EMTA 1GTRA 4KN9S 2VLBA 2PFKA 1MIHA 4XPIA 3V1TC 4EPVA 1EGHA 3B1YA 4ER6A 3NB0A 1GM5A 1JFRA 1TZJA 4LXXA 5FBKA 5AM4A 3OESA 3AC0A 3L7NA 1Q12A 1N8NA 1T9AA 1PK7A 1Q19A 2LGJA 3H42B 4IO0A 2YZ2A 1HSZA 2GVNA 4LRXA 1L5ZA 4DR2B 3R2JA 3FMVA 4KIUA 2V74B 3G1TA 3KR9A 4O1HA 1NLMA 4WVFA 2F64A 4KRYA 2FRDA 4PLZA 3ZGYA 1ZGJA 3ZLVA 4P36A 1S3FA 4X61A 3SNKA 3GZNA 4G8BA 3SF8B 5CJPA 2ZT5A 4BP8A 2J7PA 3G2JA 1MU0A 1ZOOA 1J7JA 2AEEA 4ZQFA 1E3EA 3WYGA 2C96A 2IH4A 1X87A 1J0AA 1DO2A 2FPOA 1F4PA 3F9RA 3GIDA 4FSXA 4PZCA 4QTXA 5CCDA 1QRTA 4JP5A 1DQRA 3L7BA 2PR2A 4GLFA 4NBUA 4E7PA 2C7QA 1JLHA 1GKKA 2NUPB 3VOSA 3WJ7A 3ZE9A 4OCZA 621PA 1EUDB 4HLQB 4IJ6A 4RVOA 1B23P 1QLWA 4U2EA 4RLFA 4P4GA 5JAZA 3KVVA 3B1FA 3KQKA 3S29A 1J4AA 2AD1A 2DQKA 1RZRA 5KSPA 4HUQA 1FUEA 5J4VA 3JWJA 3LXMA 3USCS 1KAEA 4HQRA 4O6VA 3X2SA 1X80A 2WM3A 3NP9A 4MRVA 1A1VA 4AWXA 3FDIA 3CKLA 3FKJA 1NRWA 1P1IA 4MO2A 5G0TA 4YVFA 3STWA 3K31A 2E9SA 4MKRA 1GYRA 1PK9A 1QK3A 3LKVA 5JNWA 3THYA 2I7VA 2Z57A 4K2HA 1E2BA 5DX8A 1NHWA 2ECFA 4FP9A 3C3KA 3AY0A 3L1HA 4H7HA 3LW8A 1DAPA 1YRBA 2E87A 3KHTA 3UNXA 1H2HA 5AW4A 4D4GA 5K99A 1FNSA 1WKVA 1XX6A 2I1LA 2NZUG 2PXXA 2YVLA 3DSRA 5EUBA 5ULLA 2PUCA 1UK8A 3DHNA 1B3RA 2XGOA 1NIPA 2Y27A 2HSDA 1IE3A 1J2YA 2JGDA 2V7VA 4MW6A 1IHDA 1SBIA 3FNEA 3GRYA 2V7XA 3GVCA 1VJDA 2EATA 2NVWA 2JD1A 3D7NA 3H05A 3LRPA 4J0QA 1M33A 2EKPA 2X58A 4A1OA 4ATNA 4G3XA 4R3WA 1XYVA 5CTAA 4W8OA 3PUYA 4ZEWA 3PLNA 2AVNA 2I6FA 3AHFA 3FZYA 1ZMRA 3R41A 3WE7A 1QX3A 2G1KA 1O58A 1SUAA 1OLSA 1USIA 1AO3A 2OWEA 3HFGA 3VSCA 4ARCA 1MUUA 3K1AB 2GX6A 2QTBA 4RHUA 2GXAA 4OGWA 1T9GS 2VK4A 4DNQA 5A4JA 2AMYA 4FZVA 3BRWA 3K1YA 2AWOA 4KAFA 4CNQA 3O8CA 2ES4A 4O33A 1D2NA 3LQYA 4G4SO 2OCYC 4L3WA 3WMXA 4DWOA 2F43A 4FYXA 3INYA 1JSCA 4TQ9A 1GZUA 1AKYA 2H5JA 3DTTA 2PUHA 3H18A 1E7MA 3V4VB 3K96A 4KIWA 2ZRHA 4U00A 1HR0B 1EPUA 2WPDD 3HB9A 2ZB3A 3L43A 5EE3A 3MM4A 5EINA 4MWEA 1Z7BA 4UMFA 1N75A 1NFFA 4XD7D 1Q74A 3ABSB 4KIGA 2QUIA 2VYVA 1VA5A 1XD9A 4HRVA 4R1PA 4FSDA 1YMUA 5DX0A 3RSZA 3LFUA 2NU8B 1XMJA 4RENA 2IYPA 3D64A 4NS1A 5CDFA 4TSFA 6YASA 4DLVA 2VZ8A 3IB6A 4TRNA 1VG0B 1CB7A 1MAWA 3GB9A 2UZ3A 4LYFA 4OMFG 1E6UA 4E32A 5HYVA 1YGPA 5KVAA 3JATA 3GGSA 4M6WA 4BFTA 3D31A 2ATCA 1MA0A 2O3TA 3VV2A 1U8YA 1YU9A 1DJQA 4BGUA 5BSRA 2JA1A 2VP0A 4JWKA 4BZZA 3QFSA 2I87A 2BL4A 2O5CA 3V6MA 4NTZA 2CXPA 4YT5A 4B85A 2DFPA 5A5EA 1KK0A 1JXQA 1GPKA 3GJ0A 3HJUA 3UGKA 4F38A 2QR2A 3GUVA 5ALJA 2Y4NA 4CL3A 1C7ZA 1RLUA 1K5HA 3U48A 1RQNA 1L7AA 2QRHA 3Q11A 4LIPD 3UK1A 3L05A 4B31A 4TZ0A 5E9JA 2W6MA 3BJEA 3OQBA 5EZYB 2CLHB 3GDGA 1IAVA 3VGPA 3QFRA 3LT1A 1U0OC 3ZV4A 1BD3A 1Z56C 2RHGB 3Q41A 3QUAA 4A6DA 2GDZA 4GM1A 3ND7A 3HE3A 4GGOA 3ROGA 1YFJA 2RAUA 1CFJA 1V9SA 2CMHA 3UAXA 2IODA 4RIFA 1YQTA 2C9CA 5H16A 3PK0A 3R44A 4TTJA 4B83A 3TZCA 1A04A 1X7DA 4B3DA 3PT5A 1L6IA 2PCJA 1O9GA 2A5DA 1KOLA 1R37A 5JQGB 1JDNA 1II8A 3VZCA 2D7CA 3NKVA 4OA5A 5TPWA 1DQYA 1XQYA 1AQLA 1UADA 3Q7IA 4PCVA 4RPCA 2HHJA 3DBIA 1YAHA 2WJGA 3HWX1 5D2CA 5K3BA 4CM9D 1F14A 5EP1A 1S2OA 5AO9A 3RSFA 2POQX 3B60A 3FUUA 3QSGA 4PC7A 5DM0A 3U7RA 4JA2A 4ZIRB 2GCEA 2Y1LA 2SKCA 2OGWA 4D4KA 4DANA 3WK4A 1WVGA 5F33A 5M3BA 1E60A 2KHZA 2XNDA 3IBSA 4Y7DA 4V3CA 1KPIA 1R66A 2AHOA 4M4SA 4PLWA 5IT9A 2EEPA 3UM9A 1YIOA 2PQ6A 4W1PA 3F6CA 3K5WA 1L8OA 1EHCA 5CLJA 1QIHA 2OD9A 4RSRA 1L7QA 1D1TA 4NOMA 3AR6A 3I83A 3WJAA 2D4HA 1UKAA 5ICEA 1PGNA 1D2RA 5H9VA 1KETA 1B73A 4CQJA 4EZEA 2XBMA 1I2DA 5JSFA 1IQ0A 1O94D 3W34A 3VFDA 1YBMA 2VIIA 3SE7A 1CX9B 4IXWA 1XRQA 1HFJA 3P4XA 2VSFA 4I4LA 2X0IA 1B8OA 1GNQA 1OXKB 2F7SA 4PEVA 3W9SA 3FUVA 4TWRA 1S2LA 1QU2A 1VKJA 1JZSA 3K5IA 5JVDA 3UC9A 1AUQA 3GCXA 4JZKA 1GUFA 5DISB 1V16A 5I7FA 2ZI3A 4WK0B 2JFHA 4EI7A 1KDOA 1IG0A 1KNXA 3ZTYA 4LYHA 1NQWA 4IGAA 4EFDA 5B1YA 3CZ4A 3EUEA 3PR3A 3REFA 4BYGA 1RU3A 2D3WA 1CBUA 2IUYA 4QG7A 5DRYA 3OEEA 2GZMA 4GKJB 4DIDA 2HOQA 3O8DA 4MV5A 4XD2A 2A0FA 5I4KA 3RRXA 1T10A 4MQ5A 1NNSA 4XA8A 2Y76A 1G4UR 4IG4A 3BD9A 2PRSA 1VJ5A 1C0LA 4MYTA 3LA6A 3OOHA 3C3DA 1PJSA 1EDOA 4JDPA 4A6XA 1MW9X 2VDQB 5GZ6A 4RTMA 3RYFA 3Q2OA 4FFBB 2ZM5A 2P9HA 4WZAB 1AKQA 1DCMA 2CLIB 1E62A 3G0CA 2O8FA 3KKQA 3U44B 3E61A 4PAWA 5EIBD 1XYGA 4I2NA 5A5FA 3RHTA 5DNUA 3ZPXA 5FD8A 1QOPB 1ZINA 5DNDA 4BNWA 2UUCB 2VAXA 2Q7OE 4DR1B 4PSKA 1XLWA 4N8DA 2I2WA 1ENYA 1K89A 4NEQA 1KDVA 4B6PA 3LHFA 4DVJA 3MC1A 1ACLA 3ASZA 2CD7A 2H06A 5CJJA 1A9TA 2AQ8A 3EYAA 1UOPA 5CFNA 3HKEB 1Q1GA 2AJDA 2QENA 4DCMA 1WXIA 1E2HA 4WN9A 4TTTS 4Z86A 1B8UA 2YVUA 4MP3A 4ZPXA 5FX2A 3R77A 1ZC4A 3PITA 3TPFA 4UTRA 1TA0A 3H2HA 3LWNA 5DTQA 4Q66C 1QFJA 2EFHB 1FTYA 4WOJA 3NYRA 3MEQA 3RSSA 3I3SR 2WJYA 2CNBA 1Z5WA 3EC2A 2AJTA 4KGXA 5SYNA 1EFRD 1L5QA 1QH8B 2IELA 2Y66A 3A6GA 3H3FA 3H83A 4BTEA 3DB2A 2ZBVA 2Y68A 5KYXB 3RRNA 2IX3A 1S9HA 4FINA 3JARA 3QWBA 4IXMA 4ZEMA 4RX1A 5F9HA 4R3NA 2OO7A 3ON5A 3TSWA 3DMNA 1JXMA 3IVCA 5GM1A 4TZTA 2HDOA 4EFNA 4V1CA 4GPAA 5DF1A 5LQUA 2RFLA 3HACA 4FYVA 1NI5A 1OBHA 4GMKA 3H1PA 3D3JA 4J76A 3SEFA 1FPQA 4C0KA 4F2PA 1DAHA 3O92A 1FFWA 4WK4B 4KAJA 2AXEA 3UV3A 4K9PA 4RLHA 1P7YA 4IYRA 4F7DA 1RHQA 5BV7A 1QZZA 1ZU5A 4BV2A 4PLHA 1Z15A 4RTQA 4YACA 4F4JA 1WZIA 3FDZA 3DDCA 2VKTA 3T1OA 1ZPDA 4HDSA 1QCYA 3RK4A 2GF9A 3O1JC 1V25A 2W58A 4IIHA 5DSTA 4DMCA 3IDOA 5KO2A 3L49A 3K53A 1TQ4A 2GHQA 3PQ7A 3SM3A 3N74A 1XTJA 3CLTC 3SX2A 1IM5A 1E66A 1GWNA 3GQVA 2YHAA 3BYZA 3DFFA 3NANA 3Q5EA 4FMDF 3Q5GA 4MV0A 1SIOA 4DSOA 3JQ7B 4ZOAA 2F1OA 1U2GC 3W77A 3LOPA 3CG4A 4A92A 5D1HA 3N2YA 4DT1B 1AZWA 2HLHA 4EELA 4HUJA 4IXDA 1MXHA 2IHUA 5HIMA 1QCZA 2VDKB 5D1NA 3SXJA 4DG8A 1P2SA 5I6DA 5DGHA 3HRKA 1BYUA 1YDHA 2QT1A 1QIJA 4QQRA 5K4HA 2VP5A 3QOYA 1WBDA 4PFKA 3TL6A 3WHPA 1IDOA 1DTEA 5E8RA 3M9LA 1SBHA 4HYYA 2NO1A 3LXUX 1EUCA 3AHEA 3EGXB 3KOZA 3UIEA 3PNQA 1OHHD 4QJ4A 1CQPA 1SFRA 3ASUA 4IM7A 7ADHA 1RMQA 3VR4H 4C4SA 2FHPA 1QV7A 4PC1A 4OL0A 2R6GA 2D2EA 1BU5A 1CDZA 1JEEA 1GILA 2WP8J 3CB2A 4FMCB 2GETA 2FKAA 3K6RA 3I9LA 4NJEA 3EVAA 1YQ9A 2BVNA 3HB0A 3JAWA 2HT6A 3L1UA 4ND3A 2PD6A 2V54A 1KAHA 1ZN8A 5CT4A 4Q7MB 5DGIA 3UH1A 3VJRA 1A4UA 3K05A 2OKGA 4NBNA 2LBPA 2R9VA 2ZE7A 4TYNA 1ZH6A 1W36C 1E3MA 3BX1A 3E48A 1JG6A 1EHYA 2GK3A 2OUIA 3WZMA 1CD5A 2V8BA 3MG9A 2QD3A 5I5GA 3I9NA 5D5PA 3KWFA 3SDSA 3UCEA 2YUTA 3B2NA 2GOYA 5CW1A 2GF0A 2YXNA 1CIPA 2VJMB 3D6MA 4Q02A 5HE8A 2IX9A 5HIAA 2FW0A 3OWOA 3MQ4A 3MWFA 4FNAA 4QRHA 2HWWA 1EK0A 2MU1A 3UZUA 3ZWDA 4BE9A 4XGIA 2RC5A 5HZKA 4G5GA 3S8EA 4Q4JB 2D8AA 2B83A 4OI1A 1DRWA 4I4TF 1WQ1R 2VXCA 4HEHA 1P8AA 4AYWA 4BL5A 5JMWA 2GFHA 1ESEA 3UPTA 2ZB8A 3P9NA 4J49A 4L8VA 4RVNA 2C1EA 3HVUA 5EIEA 1IN4A 1VBNA 4J9VA 1KH2A 4DLLA 1TF5A 2H18A 3GT0A 1JV2B 3GMDA 3L1IA 4KMOA 3QXSA 3BAFA 4BKOA 5JC1A 3HJNA 2IOHA 3G68A 3LY8A 3PDWA 4EO4A 4A03A 1I3LA 4TV9B 5CX1A 1V4BA 3IEXA 3SY8A 6NULA 3U4MA 1L2TA 1P2UA 1QH1A 3E4CA 4M1QA 4O4IF 3OIYA 3TBKA 5JH7A 5G41A 3L4BC 2IEGA 5K3OA 4H3HB 4ND7A 2OBFA 3WLOA 2XMCA 3UT5A 2C4VA 2JLCA 4RVSA 4MMXB 1FIUA 3GLGE 4N76A 1DWOA 5BRJA 3N07A 1VLVA 1M2NA 5K0EA 3ZHUA 1U7ZA 3NTUA 4FGWA 1E2MA 1XZJA 4ZOEA 1JKIA 3OO0A 5CU7A 2PPLA 1ADGA 2HDNB 1RYNA 5IYZA 4FWIB 1F6DA 1W2GA 4YFYA 1FVFA 2FKNA 1Q44A 1MZVA 2O5VA 4B6OA 5CLFA 1AZSC 2CNWD 3EMKA 4AXBA 1BCRB 2R0QC 3K2EA 4MKGA 4PLVA 4K28A 4MQ6A 1DIGA 1ZYUA 3AEXA 3D9QX 4XIGS 2C8LA 4AO8A 3U60B 4ZTUB 3O94A 4NK4A 2BRUC 4NFHA 1DEOA 1G5RA 1ZK1A 3L0YA 5TMPA 3BSWA 1TO6A 5HA5A 1SCJA 3SC2B 3HDQA 3EIFA 3SZRA 4E13A 2AUNA 3KOWA 3QKSB 2LKCA 2HAEA 4GP7A 5EN4A 1BEZA 2R1VA 3W0LB 3PC8C 4LWPA 1TTQB 4ZAYA 3N2KB 4LZAA 5C5IA 3JQGB 1WMEA 4B6FA 3SR4A 4EG5A 3F47A 1NV9A 2V3VA 3D43A 4H15A 3S27A 5I9LA 4ZAVA 1P72A 2P75A 4Q47A 2ZRAA 1XFDA 3DR5A 4WADA 2YJ3A 3VH2A 1BN7A 5AVKA 1WNFA 1LBSA 2CVHA 1Z68A 4KGZA 1WMFA 4ESHA 721PA 1Q2XA 2H29A 2VDMB 4B3XA 2F1IA 2ZR7A 4IQ0A 2RSLA 4QBTA 1OX4A 1N2IA 4YRLA 2MSEB 1X7YA 3U7GA 2KLBA 5JRDS 3F96A 4GMGA 3OCVA 4R98A 3UQZA 3BGIA 2OV4A 1IQRA 3IXQA 3NONA 3HN6A 1MORA 3QJ5A 4DSAA 1VKNA 1Q3TA 4GT1A 2P7IA 4ZYZA 5DHFA 4WBXC 1HYEA 1TPYA 4GGPA 1GTZA 2HDWA 5C1IA 4P4SA 2C3UA 4M0CA 3ZCSA 1PWHA 2GZSA 3KBOA 1NNLA 2WT9A 1IY9A 4LBWA 3SP1A 2CY0A 1IFXA 3I4LA 2BSXA 3K4PA 4UTPA 2BEWA 3R3YA 1ZCBA 2WVGA 4L8YA 4LRYA 4N7BA 4OXNA 4HH0A 2I71A 4IP0A 2WLSA 2RGUA 5TEVA 3TMYA 3Q2KA 4BJ1A 3C3EA 4HHEA 4C0WA 3BMCA 3LHKA 2HWUA 5SZJA 4CWAA 2BTQA 3KVOA 3L84A 4GOKA 1K4MA 5G0WA 3ST7A 3BREA 1XQXA 1FS6A 3E8MA 1MRZA 4BGEA 2FJUA 5TPZA 4GWKA 3UOGA 4ENPA 3K6SA 3DHEA 1LRJA 4G0VA 1E77A 4PWYA 3KQQA 3NHFA 2V6JA 2UXDB 4WL0A 1ZM9A 2C2GA 4G24A 2ZJZA 4ZPJA 3UWDA 1C4OA 3LFTA 5FTNA 2A7QA 2YJ4A 3LIPA 4UU0A 3G5UA 5FNZA 5CK5A 1V11A 1JH9A 3F71A 1E5LA 1T8TA 3NHKA 3EOAI 4GWGA 2ZAMA 2FVXA 2WFZA 1AX9A 3LBNA 3NFYA 1POWA 1NKTA 4M0DA 1WUHS 2XITA 2YICA 2I2BA 5A0VA 1B00A 4OOEA 3AU8A 5FULA 2ODNA 4RVCA 4PGGA 4DCSA 3GLSA 4LXQA 2XF8A 3TSAA 2AN4A 3K5HA 2WWRA 5JADA 5J4LA 5HBGA 4B5LA 3KEFA 4CVNA 4WBNB 2QVYX 4XEUA 2VVTA 1M83A 4K3UA 4CIXA 4OLAA 4TSRA 1YUBA 2JASA 4LSWA 3T52A 5IDWA 1A5TA 3R9XA 3GG2A 1C8KA 2E89A 2W6ID 4KAAA 5FL3A 4KVAA 2DUWA 1GDDA 1Q0ZA 2GZRA 3FYSA 5E1OA 3KDAA 1JHYA 3BXPA 1WABA 2R6CA 4US2R 4LI0A 1D1QA 5THQA 1MQ8B 5HJ5A 3VAZA 5ED0A 1EDDA 1UWVA 3FNGA 1XMPA 4O2BB 4QYIA 5EXEA 3WP0A 4EYEA 7MHTA 2IS6A 1TCBA 4YGXB 3K20A 4IDGA 5K8VA 4G0OA 1BDJA 3E9ZA 2FZGA 2BKUA 3RREA 1P0CA 2REBA 4LY0A 5FLYA 3EISA 1U2QA 1RW4A 2DMRA 3CLHA 4CEIA 3R23A 3AF0A 1E4EA 3EGWA 3ICOA 4UNSA 3OTQA 4M7WA 2JCSA 1EVLA 2PS1A 1X39A 4ZHSA 5BQXA 5F2OA 1MX5A 3WGMA 3VU9B 3AF4A 3WYCA 4DJFC 2HSJA 1E2PA 4QIHA 3WNZA 4EW6A 1WZCA 5BOSA 2IZ1A 3LKBA 1MOQA 3A70A 4BNYA 5JLJA 3SJCA 1JDBC 1ZUHA 2CNNA 2GWHA 1XELA 2Q5EA 2K5UA 1DX4A 1JR3E 2JHAA 1JJBA 1I2AA 2MR5A 2A94A 2O3UA 2NZ2A 2RAFA 4I1YA 1T8UA 4EQ6B 4FR5A 2VA8A 3FGOA 3SIXA 2COEA 1J70A 1T3SA 1XLUA 1SJ9A 1CP2A 3F6YA 4DNFA 2J3LA 1VXRA 1ZM3A 2FWRA 1FXWF 2J7KA 1WF3A 4LHSA 5AKIA 3IHWA 5K5EA 5IDYA 4YYZA 4II2A 4HAOA 4LHXA 3R8CA 5CM2Z 1M2JA 3IOYA 1C3EA 4AZWA 5PNTA 2YRXA 1E3DA 1XZEA 3M1LA 1NP3A 1AK2A 2PNJA 3WIVA 4TZ6A 1QKJA 1SUDA 3D7KA 1I4DD 3PFKA 4O08A 4RJ2A 1E94E 1HMYA 4Q37A 1NLFA 5EIOA 4EW3A 3IL2A 1GARA 3JWPA 5DSZA 1JQ3A 2BM0A 2QXUA 5LUBA 4PG8A 4HK4A 5M5BA 5DNYB 1IOVA 2GAJA 3R3JA 4DV7B 4ZZIA 1V41E 3PIRA 3BTUA 1BHSA 3ROXA 5EKUA 4A10A 2C99A 5CIYA 3A9VA 1G2IA 2I7DA 2OO5A 1BVUA 1M6EX 5GWXA 5SZHB 4TYWA 4L16A 1Q50A 4U0JA 4AN0A 1TZCA 2ERYA 1U28C 2AMJA 1JALA 3NM6B 1S7CA 3PDIB 4NEGA 4DMFA 1SHZA 4DYHA 2KE5A 1PVVA 1RZVA 5K0NA 2Y0PA 3C70A 5DTJA 2HMAA 5L40A 3H65A 2YJ5A 1ZESA 2OMEA 5K3FA 4CIYA 1GR1A 2GRAA 2QV7A 3PNSA 2IHTA 1T4GA 1WG8A 2B82A 2G0TA 1A9RA 1EJ6A 4K88A 1L4EA 4UBLA 5DNAA 1UT8A 4DEYA 3LYLA 1T3TA 5KYWA 4AWBA 5A3RA 5AJXA 1FDIA 3MWJA 4ZZ0A 3C4VA 2EXXA 1MD9A 2CK3D 3D1VA 4FI3F 2D2IA 2YTZA 5CX4A 3RK0A 4LZNA 3UK0A 4TMZA 5AXDA 4YP0A 4F45A 1GQFA 2HJWA 8ABPA 4O2RA 1ICIA 3AL2A 3LUCA 2CGEA 3FE2A 4Q3EA 1KTIA 2PBLA 2WKWA 1HMPA 1TMYA 2XQGA 2P1ZA 3CRRA 3HCDA 3NAMA 3P52A 4XQEA 1ZNQO 2EIHA 2G09A 5MDHA 4UJ3A 2W4IA 4BWVA 1U0SY 3CT6A 5E3IA 1YVPA 3D4BA 4YUVA 3N2NA 2V7WA 3NT2A 4YHBA 1XJ0A 4DB4A 1XRNA 3GJ6A 1IWPB 3QFHA 1T2UA 4N3BA 3PTZA 1FU7A 1UDCA 1S8NA 1UKZA 2ZSDA 2P9ZA 2A3NA 3H6HA 3NBYC 1ZXBA 4QYTA 5IUNC 3IQDB 4ZGGA 2OBNA 1NLYA 2OHFA 5BWLA 1W19A 1WP9A 4LJAA 4OYRA 3WKCA 2CUTA 3OE7D 8OHMA 3QKIA 3LVQE 2FU5C 1L3IA 1CLEA 3T7IA 4M21A 2QE7D 3F6PA 5AJUA 3CLRD 1DIOB 4DLPA 4J6EA 2DCUA 2Q62A 2YY7A 3FCAA 2WFLB 2V0GA 2B20A 2G76A 2GD6A 1KI2A 2DT5A 3BMNB 1U9IC 4FZJA 4PCLA 5DI3A 5E4FA 1OI7A 4QPDA 3IAM1 3R6DA 1M2VB 4OPMA 2A57A 1OZHA 1PT9A 2F3RA 2VBCA 2IF2A 5FYDA 1X42A 2FWPA 4YXFA 1DXHA 2CSXA 3O9MA 4DUYB 3ZWWA 4TL7A 2VC2B 2ZT8A 4TYQA 5AVWA 3JQ9C 3D4PA 4ZOLB 1H94A 3DE1X 4Z6KA 3U7JA 1XF1A 2JCYA 1FF9A 4K1XA 3HXQA 3DMFA 1OJ7A 1CDEA 2QTZA 2YMLA 1LNZA 1RJFA 4NPAA 3G2QA 2ZRNA 1L7XA 2W8BA 3OIGA 5IANA 5AKHA 3COVA 1IVNA 3ZIAD 4JVSB 2SECE 3EG9B 3R3UA 5G1PA 3V8QA 4X8OA 5LZ7A 4INJA 3LXRA 4P83A 4QUEA 2O05A 1RC8A 4HDCA 2ZJOA 3LPAA 4HCJA 5LIRA 1M2GA 3ABRB 2UZAA 2XMGA 3KXIA 3M83A 4FQ7A 3HLTA 4MVJM 5BURA 3FPCA 4RW0A 4EHHA 1YKGA 1U2DC 3DUWA 1FP4A 4L9SA 1TZBA 5J58A 1KQPA 4RIGA 1D2GA 2CEAA 1W34A 2P8SA 3BK7A 3LO8A 2ZWIA 4OHMA 1CQZA 1KR5A 1X6VA 3RC2A 3RRZA 4D3SA 5LWHA 2OXEA 1GVHA 2I6QA 3IV9A 5C32A 2C5BA 5SYMA 1UBRS 3IQIX 1TAUA 4L7QA 1SBTA 3MUFA 2PL9A 4BASA 3RYIB 4BVAA 1TFUA 4BMSA 2X15A 5DYWA 2J5KA 2ONCA 5K45A 4NV3A 4G67A 4ZV9A 1WLSA 5EUMA 1WUKS 2XVXA 4MYDA 4YS6A 3UMSA 1R5OA 4Z4CA 4O59O 1PJ3A 5G4LA 3ZJ5A 5E3HA 1JR3D 3FWPA 5ECWA 4ZGBA 3COJA 5CEFA 2IZZA 5ITZA 1XK6A 1U0BB 4C7XA 2AL7A 4KK4A 2A9JA 5J2TA 3DFUA 4MUKA 3IAXA 3O7MA 1RHRA 1BHQ1 4P22A 5LNK1 1I4WA 4OHUA 4BAZA 3CO5A 5FO1A 2I4NA 1OU4A 1QIEA 4TWZA 4KOEC 2PUDA 5TNXA 1EHIA 2HF8A 3U56A 4L4RA 5D00A 1XR3A 1Y1TA 1OW3B 2OSVA 3G2KA 4LYYA 3VPDA 4HWOA 3QP9A 2SNIE 1DDOA 1MB0A 1RM3A 2H7CA 2IU4A 5IVIA 1D2HA 4XYEA 2Z2XA 3E22A 1Q0RA 2C4NA 4V02A 4DA0A 1SOAA 1RKBA 1UP7A 3L8ZA 4ZEVA 1JSXA 1V6CA 3JYPA 2HJHA 5DM60 2R8YA 1ENZA 1NW6A 4E2WA 1DMSA 3IPRA 5PGMA 3DNFA 4FWBA 4WESB 4YJGB 3TLJA 1YS4A 5LYJB 4Q21A 4F8JA 3M4YA 3Q7EA 3R76A 1JHRA 5C8XA 4OQFA 3CX6A 3GBPA 5CEJA 2GLUA 2JAUA 3EH1A 1DV2A 5CYPA 4B74A 1XGKA 3CEMA 3B6MA 3TTUA 1I80A 4G23A 1BU8A 2KI5A 4B9AA 3ZJUA 4LX0A 1NI4A 2RCYA 4C4TA 1APBA 1X7WA 3EIQA 3G8BA 2XGMA 4XASA 1Z6ZA 3P2JA 1GEEA 2NM0A 3PQEA 2XODA 4U7GA 1Z38A 1RIIA 4YO8A 4KB5A 3O8BA 3KE8A 4UULA 1GO2A 1JIQA 2OFOA 2QI9F 3QK7A 3SNHA 4D9KA 3P27A 3PQ2A 3D0OA 5AI8A 5C2JB 3DBLB 3H8WA 3U19A 2GEDA 1A8SA 2YHIB 1UMBB 2ZJAA 4QOEA 4DLBA 2O8NA 1Q3KA 2JFNA 1XDSA 1L9XA 3WBBA 1ULTA 2H0AA 4EUHA 2ZWAA 4B76A 1O0BA 3G0OA 1XQWA 4AXXA 2QJTA 3V7WA 4H1TA 2Y1XA 3TTYA 4IZHA 4UBNA 3GBVA 1GRRA 1NW4A 1R5JA 1UEIA 2OHGA 4I6EA 3KQSA 4U7DA 3KZCA 1KMQA 2NADA 4TTRA 3LPLA 3WLEA 3I4FA 1NDUA 1X9HA 2VT2A 4WUVA 1PS8A 1N2EA 5DBGA 5EEGA 4RE5A 4UOQA 3L4SO 4X95A 3IBFA 3IGFA 4MUIA 1KZ7B 4ZYXA 3SIPA 4JSTA 5CG2A 5TY0A 3ETLA 3DG9A 4I1SA 2B69A 3V2HA 5KX5F 3I1JA 4PAGA 2YWHA 1TVCA 2CXNA 1R4MB 1SKYE 1Z6PA 4X97A 4PO8A 1VYUA 4QA9A 4AWAA 1QC5B 4TLAA 3I8XA 2BEVB 1H3FA 3CRMA 1SCQA 3JQAB 5AW6A 4IIUA 2R751 4DBZA 2IYQA 4KUEA 2HGSA 2GEVA 4N8EA 1UBGA 2JBHA 3BDAA 1CR2A 1VKHA 4ZVVA 3V8MA 3ZGVA 4YQFA 3UMYA 5BSTA 1E1QA 1KZ1A 2JVKA 1YJBA 3ECAA 3ZQUA 3NAGA 1UZAA 1R6VA 3BIWA 3JWHA 1MAVA 2PSDA 2XE8A 1SD2A 1ZLXA 3HU5A 4NDNE 2XT9A 3KKLA 3RBZA 2CL6X 3T61A 4DLTA 5IAAA 3C3WA 3ZXIA 4CEJB 1MRNA 2YMQA 3N2GB 3N2LA 4CMIA 4OIMA 3R24A 4IH4A 1PUXA 1CZLA 1RWBA 1MG0A 2REXB 3C48A 2EQ5A 3D6FA 5B3JC 1YA4A 1DWQA 2AOUA 4XVHA 4YBRA 5I7HA 1NX6A 3WK6A 1E9EA 2A78A 3EAFA 4FCCA 3MIIA 5EFZA 2OXRA 4RANA 5FOQA 5AKXA 1BA2A 3DWEX 5ALUA 3WG9A 1QPZA 4RPIA 2OQRA 3AI3A 3DFMA 4IKPA 1SVIA 2FN3A 3CWZA 3G8AA 4XPZA 4HAIA 3EOBI 2VPZA 5G3ZA 5F7JA 4RJTA 1YCDA 1BXRA 4OJQA 4OBBA 3G5TA 4RDCA 1D9XA 2GYUA 3SF0A 5FA6A 5A1JA 5C4IA 4KK3A 1SVMA 1YI1A 3KDPA 4I5DA 3VR6D 3T3IA 5L3SA 1KMCA 1OFIA 2C9ZA 1A5ZA 4DGSA 3U49A 4WNCA 3AEKA 3MCAA 4EF4A 3E7PA 4ALMA 3JQAD 5EP2A 1ORRA 2H1LA 3KWMA 5HRUA 5KNCH 3TG2A 3RV3A 4M0PA 1TO1E 2EJTA 3ICWA 4C7JA 3PEWA 4ASUA 1EJ0A 3LNTA 1GQ2A 1L4BA 2ZXEA 3DZ8A 5GONB 2GNAA 5KSOA 4HRXA 5JJIA 2ZRMA 3KG2A 1Z0AA 1D7OA 4UZEA 2OGZA 3EFHA 3V1UA 3VU1A 1FP2A 2QAGA 1YUMA 2XMSA 2MWMA 4RC9A 1LPSA 2IIBA 3OJFA 1O97D 3G7NA 4RK7A 4PXYA 5HZGA 5KOHB 2EJCA 4PQRA 2ZJ6A 3DLIA 1Y7PA 2WZCA 2QN6A 2QZ4A 2Q49A 2GASA 2GT1A 2VJBA 1H8HA 3N2IA 2QTVA 4J4BA 5AOCA 5JUWA 4DLNA 1QFMA 4BRUA 3FPAA 4EFLA 1BIFA 2WQ6A 1QG6A 4IHKA 2GCPA 1RPZA 3IVRA 2W0MA 3LUJA 3Q9UA 4MIEA 3ED1A 3A9CA 4KPUA 2HWYA 4KQEA 2QE6A 4MX8A 4EHLA 4BLQA 2DJ5A 3OBBA 3NC1C 4BVGA 2H1HA 3BXOA 4BFYA 3LU1A 3W4JA 1DINA 3BD8A 1L7NA 3ETNA 5K3AA 5KMGA 2FSSA 2GXSA 4MGIR 2Y1CA 2O8BA 2XTJA 2O48X 3LCRA 4WASA 5FRDA 4C06A 2QYTA 4ECAA 1I94B 3PE4A 3GCGA 4H77A 1Y98A 1XMXA 2PKQO 5ALMA 4HLUA 1H3EA 5DCLA 4FILA 1IPHA 4FZRA 3I92A 3SHOA 4ARSA 3R09A 1HDGO 3ONVA 4YWJA 2J0UA 2IU6A 1XU9A 3DD5A 1BE6A 1EK6A 4LY6A 4MJ7A 4Y67A 1RVV1 3IUNA 1SKYB 2I33A 3EQ7A 1QHSA 4ZT4A 3VA7A 1YDFA 4JXXA 4CKWA 2ZPAA 3PPWA 4CKEA 4LWOA 5L4LA 2V4UA 5C9ZA 1ULAA 3N0TA 3RC1A 4KFRA 2HXSA 3OCCA 4KXNA 4E1VA 1R9NA 1OV4A 4DR3B 2JD0A 2VRCA 4CLRA 2VH2A 3QKRA 1A88A 2E4VA 3KR2A 4DMKA 1KL7A 4C21A 3A6FA 4FDMA 4EG0A 4LTMA 4D44A 4LW8A 1BSVA 1NE7A 2YYYA 3W05A 3PQ6A 5IPFA 2BGGA 1TAHA 2HLDD 4PONA 1NT2A 2CZCA 2GJ8A 4G0MA 4B6EA 3RODA 1XWIA 2P5SA 1HNXB 1MO5A 1P4SA 3B5IA 3GZNB 2YX1A 3LM8A 4RL4A 3F7NA 4RQAA 5BMVA 3NTQA 1G7RA 1AMUA 2C83A 2JRCA 4TMTA 1ZBQA 1DKMA 3K0EA 4Q5IA 1BGWA 3SXPA 3ZD7A 1VLQA 5FPKA 1T6YA 3UUFA 4EB0A 3TSYA 1PT8A 1YO6A 1AUVA 4M0MA 4W8GA 3WYEA 4CBVA 2IFTA 4PPNA 3JVIA 1NXPA 3NRJA 1L8AA 1FBNA 4X00A 3CNNA 1FW6A 2P0EA 4F9FA 4MGZR 2PK3A 3RJZA 1R0YA 4FE4A 5AKEA 4Q6BA 3MTEA 2YNMA 4GE0A 3PPIA 1XDDA 2O2XA 4C4AA 3PF9A 4M54A 2IPNA 3C14C 3C7TA 4FW9A 3U61B 4RSHA 4HUQB 5F5NA 2OYRA 4AP6A 1SC1A 2BMVA 5AKLA 3ESCA 1WV0A 2GFQA 4A27A 4AX8A 1RYYA 3EHDA 3LL4A 4Z7QB 1X80B 4QNMA 3UJ8A 1VYTA 3FPLA 3FYDA 1PJAA 3N0RA 5BQ5A 2V9ZA 2ZSUA 3AMVA 4A2CA 2PL5A 2J3IA 1PJLA 5E7JA 1T15A 5KCMA 2CFCA 1JG2A 3FVQA 4PPFA 3THYB 4Q7LA 5C5DA 3RW9A 1SD1A 4A0SA 3UC5A 1YVUA 4C43A 5ELLA 1DQPA 5U9CA 4DUGA 2HQ1A 3JD2A 3EVTA 1Z5NA 3QVGA 3QX7A 4EJSA 5H82A 3VNRA 4AJEA 5KJ6A 1I0LA 4W5OA 1E0AA 2HB6A 1M66A 3I1IA 1A97A 1JYEA 3SZ3A 3D2BA 2JGDB 4L6AA 1WO8A 3WV5A 2XVZA 1JKFA 1V1JA 3I6QA 4B80A 1WLYA 2VOEA 3GPDG 4EB6B 4J2TA 1QK4A 1RWWA 4DXAA 4HGOA 5MN5A 3W5JA 3GC6A 1CY8A 2LP4Y 1O8CA 2J1LA 1X1SA 1HL3A 3SLRA 2A30A 4B40A 3HY4A 1TAQA 3QHQA 1QQBA 3ZD9A 1NONA 3LDHA 3WGYA 1NVUQ 3ET5A 1T91A 2EHDA 2UZ0A 5LP6C 1JYFA 4XVCA 4MRNA 5B4TA 6LDHA 3F3KA 1N2GA 4S05A 1CJTC 4ND2A 1DELA 1NJ5A 2C7GA 2VLIA 3OCXA 5BYAA 2JDIA 1LLQA 2EEZA 2DGDA 2WF6A 3W7BA 1JAIA 1TCAA 1CUYA 3PT9A 2F43B 1NN0A 2WM2A 1HX7A 3CLTD 5TX7A 4EKDA 4UHBA 1NURA 2EYUA 2F4NA 2ZVDA 1VJGA 3HY3A 4YAFA 1KEVA 2YV5A 3QQPA 2WSSD 2WD8A 3OM8A 3VDQA 3DJFA 2ILVA 3K9HA 4S0ZA 1V3QE 3PNLA 2Z43A 5ALDA 3MT9A 5AFSA 2JLVA 2H92A 3EVFA 3OKPA 3TRKA 2Z04A 3HQ4O 4GS5A 1PHPA 3WX0A 1H1LA 3GYGA 3P0JA 4URUR 4WV3A 1GGMA 5FWXA 1KXJA 3RAPR 2H9AA 3HY6A 2CDAA 1XMQB 3TD9A 4BB0A 1VLJA 4C30A 2PMKA 1F17A 4B3IA 3O73A 1YDEA 1PGJA 2FMIA 3VKGA 2PAAA 1O54A 3F97A 3QW4B 3GHYA 3JATB 1XQ1A 1PZXA 2GEFA 1NYLA 3E9NA 1XU7A 4M6WB 5IT5A 3GDOA 1S1MA 5EJEA 2UVPA 2MJLA 1G19A 1CZUA 2PXCA 2XZDA 3GLHA 3HNRA 3O9ZA 3NHSA 3OWHA 2EGGA 3BRSA 4KTTE 3D54D 5CT9A 4HEA6 2INGX 4JNKA 4BNKA 3S28A 3VO8A 1TTTA 3DW3X 3H04A 1KS9A 5HP4A 1CPYA 4HS4A 3UATA 1OX5A 2GJSA 2YZGA 4GIBA 2RJNA 3ZV5A 2MINA 4O63O 1P80A 3EZYA 1CRQA 4Z54A 1QRRA 3E9MA 4L0DA 5K0CA 3H2JA 1I3CA 2VXOA 4JT9A 4H08A 1YE8A 2C3OA 4R1LA 1R6BX 2XXBA 5CCBA 1KJ9A 2YZ7A 2ALJA 1KYQA 2NP7A 1AF7A 2I76A 4FFSA 2JIQA 4LMRA 2QTRA 2XYRA 2YMPA 5H70A 1T2AA 1E6WA 1K1EA 3OLCX 2F8MA 1OWLA 2NXJA 4M9RA 4MIOA 4WX2B 4F4HA 3CW2A 3M6WA 3JQ8A 3DTNA 3LWBA 4AY6A 1S89A 5LYYA 4TWIA 1EIZA 5CXXA 3KPJA 3O7WA 4DIBA 1XZCA 3GUYA 5BSEA 3GVXA 2HCTA 3AJRA 3DPUA 3SBXA 3VU3A 2BM9A 5KU7A 3FPHA 3C3MA 3MWEA 1KC3A 1II8B 1ZGGA 1EP2B 3PUKA 1A82A 3A8TA 3AIMA 1G18A 3SJAA 3GLVA 3V32A 3I62A 3FRIA 5SY4A 2YJTD 2BKLA 4MJXA 5C3MA 4MEJA 3O3CA 4D9BA 2E7ZA 3WZLA 3DT6A 1PLJA 1C2TA 1ZIOA 2FNAA 4ZEOA 2XWPA 1JVSA 3I2JA 4RZIA 4ZVLA 3H8SA 1WW2A 2HQRA 1E5TA 3FHOA 2HJRA 2BR5A 3DO5A 3FWKA 3L6DA 3SC3A 4KXQA 2ZYIA 1XEWX 4Z9YA 4ZI7F 4NCAA 2B6HA 2I62A 4ZARA 5FWDA 1CRWG 5EXXA 1LK5A 5JI2E 1ETHA 3IOBA 4EMUA 4BY9E 1SVLA 4CLDA 5FI5A 1MQAA 4MUXA 4OLBA 1QHYA 2ZAOA 1LDYA 1VGVA 4OP2A 1HDRA 1OUMA 1WY7A 5ALXA 4BE4A 1ITZA 4E09A 1N6NA 2ZROA 3ZH9B 4Z4HA 3DHYA 4R6XA 2H17A 2VSYA 2JIZA 1H9BA 4UM8B 2JFXA 4JKYA 1LWOA 1RLJA 2EKBA 3O1IC 5E6RB 5GM2A 3O4GA 4ESOA 1C3LA 3S6JA 4V1CI 1LK0A 4ZRMA 4UFOA 5EUCA 2FZ4A 3GQBA 5CB8A 4LDNA 2CUKA 1QO9A 4MWTA 3IXMA 3GJ3A 5HF6A 1PLKA 2A0WA 1BO6A 2QTAA 5JVDB 3QLTA 4A2WA 4CV1A 2F8TA 4KWIA 1KMMA 5HCUA 2H6EA 4OHPA 5DVZA 1N34B 3CR7A 3I01A 3S2UA 3GD7A 4IFTA 4J1TA 4QKQA 3IHTA 4ITRC 3U4IA 2O8DA 2BFCA 4KQXA 5HQ3A 4MP6A 3L6EA 4I55A 2F1HA 2DWCA 4NARA 1O95A 5F21A 3CSDA 1GITA 3WB0A 4AJ1A 1JQAA 1P4JA 1N5OX 1J24A 3LG2A 1T5DX 1AIPA 1ODKA 2DPHA 1ZRMA 3IESA 3NEAA 4I6JA 5NLLA 3UAWA 4BQOA 3PIIA 2X19A 2XNDD 4BJHB 2TMGA 2HTEA 1FS5A 2HL6A 3C45A 2PGDA 1NUSA 4NVRA 3O2JA 1XO1A 1FK8A 3N7UA 1JQDA 2GYYA 3HR8A 4NBSA 3KBBA 3PDHA 4OHFA 4HWRA 3U3DA 3W6NA 2XBUA 3WLJA 4DB2A 3TOCA 3R0XA 2J6BA 2LCQA 5DKFA 2BM1A 4LXIA 9LDBA 2O8FB 3OY7A 2VNSA 3GW8A 5B12A 3QKTA 1J1ZA 4IDHA 1OBOA 1COWD 1SIWA 1QH9A 3ZI0A 1E2QA 1LFAA 1XAGA 1P2GA 2QPLA 3FOCA 3ILSA 4RVFA 5I9IA 4WZBA 3C8HA 3KALA 5ANRB 1R7RA 4OY3A 3IKMB 4KR3A 1U81A 4DQ0A 4LC0A 4XQ9A 4BX3A 3LGSA 4TXLA 2I3ZA 3GGPA 3QNUA 4MOWA 3F9IA 4RSMA 4MWCA 1BWRA 5KWEA 1JX6A 3GGOA 3T38A 1HG0A 2JKVA 4YJ2A 3BSYA 1T9HA 1W0KA 3KJQA 4YAUA 3O3OB 4OUDB 3R3WA 2G07A 1F06A 1LPNA 1GL9B 1YZVA 4QAQA 1ZQ1A 2C0CA 2HUNA 1F0PA 3BCRA 4ZEXA 4R31A 2NT3A 3GROA 3VDRA 1FDTA 5IBQA 3WK9A 1YE5A 2F9FA 2QL6A 3W2EA 5IJ9B 3OEWA 1SZPA 3R5TA 5ALOA 2FCRA 4I8XA 4V2UA 1ZJWA 5CYGA 5ITVA 3R9WA 5KYGA 2PE5A 4ZQIA 4UAGA 4H3KB 2DTEA 3H9UA 2NX2A 3FKSD 2NXWA 2IV3A 1PD1A 1ZSVA 4B2YA 2I3BA 3JARB 4MPRA 5CDUA 1KOJA 2Q9AA 3O83A 1OXSC 5AKKA 1Z5OA 2RD2A 4FOLA 1G20A 3UWOA 4V1CB 4C5BA 1E59A 2Q3CA 4Y18A 3TR5A 5H1YA 3UMGA 3WB9A 5JFGA 3R40A 1XF9A 5EHXA 1OI4A 4P32A 1D3AA 4Z9FA 3PXUA 3H0EA 5LCXA 1EP1B 1EYZA 2M32A 5KOJA 5AJTA 2H0QA 3HLKA 4BQQA 1SC4A 4HRYA 5AXAA 5A2GA 3Q15C 4OBWA 3K70B 3W2HA 3I73A 2CNKA 4MUHA 3N58A 3RIEA 4I4CA 2P9JA 3KS9A 4P3KA 2AW5A 4WCVA 3KD3A 2R7LA 3EGOA 3D5EA 4HQOA 2ZCVA 1RRCA 1JDBB 2ZDHA 2XPCA 1I6MA 1CEQA 3O91A 2REOA 2FK7A 3FJOA 4RTPA 5IN4A 2V7QA 3KLNA 1BW9A 4BBZA 1QO0D 3NHPA 5F5XA 1EDBA 3RWOA 4D8UA 4F4FA 3GZJA 1RRPA 3KAQA 1V5GA 3HYNA 2QKYA 4D8TA 3M6MD 3CVWA 3ONNA 3LBYA 4DRXA 1P0IA 4Z53A 5DFAA 3X1KA 1X1EA 1ZD2P 3CZ9A 4EMBA 2QQFA 4H0NA 1Q16A 2JIRA 5HR5A 2ZIZA 4FHDA 4KDEA 2E21A 3AIKA 4PO1A 5FPPA 3EWAA 2CFSA 2W00A 2ZXFA 3I34X 3KTOA 4XH9B 5MFZA 1CRPA 4M0EA 3FCXA 3FVVA 2G4VA 2H48A 2J59A 3FHCB 4NICA 1Z4KA 4GBMA 2ZZNA 1CZNA 4PLFA 1Z2OX 3TIGA 3VVCA 2JZOA 2PS0A 3NRBA 4PYLA 5DBEX 3T4EA 1EUCB 4Q93A 4E1AA 5I3CA 5A02A 2CEKA 4CI9A 1J9ZA 4RPHA 4TSKA 1HYHA 5DXJA 4EFMA 3ADBA 2O2JA 2D5LA 2BJHA 5U4XA 3ROPA 4F4IA 2VTBA 1NXWA 1S8FA 3PEVA 3PIDA 3H2BA 4IDBA 1FP6A 1G41A 4M1YA 5JS8A 2Z2JA 3LKDA 1N5IA 2P9EA 4RSGA 1JF8A 4X85A 1L3BA 3UHOA 3CZCA 1P44A 3VKWA 2I6UA 5JBIA 4UXJA 2HHCA 2ZZKA 3IBTA 4R8SA 1PF7E 1TF2A 4XSGA 1EGVB 4NJEB 2AB0A 2ON6A 4OXKA 4ZDWA 2JJ1A 4EB3A 1Q0UA 2FFRA 2ZS7A 3EQZA 1R8YA 4PNEA 5DHQA 2D7DA 1RR6A 4JDUA 4YQZA 4XVQA 4BIMA 3UMCA 1KKLA 3O3MB 1YRWA 2E4XA 1E1CB 2OTCA 2ZIEA 3C6ZA 4UHJA 5H68A 4JLDA 5ECDA 4QUGA 4E94A 3CH7A 1Q6ZA 3V4FA 2RGXA 4YMVA 3I0ZA 3QBTA 4FHFA 4TRMA 4UNQA 4UARA 1KGSA 5JXWA 1LXCA 1N3BA 2AFRA 4XIIA 5JPIA 1W87A 3FF4A 2EOAA 3Q1KA 3V7FA 4ZP1A 3EVZA 8MHTA 1H4SA 4J7UA 3F8SA 2FR0A 2ZUEA 1U0HC 3GFSA 5BUSA 2O1XA 1UR5A 3HGTA 3HB7A 3ZWQA 4KX3A 4GI1A 3CH4B 1OH6A 3K09A 1ZHFA 2XHZA 1G7SA 3F6RA 4WQMA 1GDHA 2L82A 4F2WA 4OBEA 2X9NA 4LF5B 3IEPA 1CUXA 2EFYA 4R1OA 1P7PA 4YP1A 1P61B 2EJVA 2C42A 4JA0A 2CWWA 3TAUA 1O03A 3V4OA 2RJ3A 3UB3A 1B16A 2GDJA 1W4RA 4WLFA 1RHMA 2P5YA 4FBMA 3AINA 1Z39A 3Q5DA 4DV6B 3KYCA 2VAMA 3U9LA 4UVHA 3EWSA 1LX7A 5LL6P 4N40A 1ECJA 3FF1A 4E5PA 1QH1B 2IHJA 4R16A 4BLSA 2P0YA 1GCIA 2NU7B 3ADPA 5JH7B 3U4QB 2X4DA 1OIVA 2B2XA 2F3QA 2XMBA 4Y0NA 3A3PA 1ONOA 3H2YA 5KB3A 2V03A 4R9NA 4JMLA 1AQIA 3NVKI 3VPBA 1JMYA 1QB7A 2IUEA 1X8XA 4DN6A 5LXTF 3IRUA 3FA2A 1Z18A 2OCGA 2QVGA 4L6IA 5IDXA 1SXJA 1JFSA 3MK31 4LCJA 4KSBA 4J75A 4CDNA 4YAOA 4JC5A 3VC3A 3E81A 3VPAA 3H8VA 4GBED 3AUAA 5KHLB 1NQUA 3HO8A 3B3JA 1YACA 1ZD9A 3ZYCA 2H4FA 5T6MA 2BCGY 1ZH0A 4O4LA 1YR7A 2PGLA 1GL3A 1P2VA 1YZFA 4O4JF 1KYYA 3E82A 3BKXA 2H8GA 3BQMB 4JSYA 2WVAA 5T7BA 4TUYB 3WZ2A 4ZCPA 4BPBA 4PYMA 4AJLA 4DQXA 4H4EA 1OZAA 2Q3BA 3WIDA 3M8KA 3PNKA 2ONJA 2D5IA 4G1EB 1FNNA 4QWWA 2QUKA 3QW2A 4H3SA 4L50A 3FYUA 3G0DA 4MDYA 4N0PA 3U1VA 4C9BA 1E64A 4CM1A 1N33B 3CUSA 3HADA 4Q82A 2NXNA 5HSGA 5FOSA 2R1VB 2JEYA 1T8YA 3H3XA 1WSDA 3QF7A 3T7TA 4IZIA 2WE8A 3NEJA 4S0XA 2ZWMA 4HQFA 3WGUA 4XKJA 3EZXA 3VSDA 3B48A 1HRKA 1I2CA 3EGDA 3NJ4A 4Q1AA 3TWOA 5JXHA 4B6SA 4LHVA 3E9DA 3FJYA 4OEHA 4ZC1A 2C9MA 4GE3A 2GN0A 1CUSA 2RBKA 3CEPB 1EA7A 1H2YA 3RE1A 5HX7A 2VZ9A 4BDTA 3S44A 1ZKMA 3DFIA 5AMXA 1OX4B 3T5CA 1X7YB 3CN9A 4ZRNA 1CF2O 1E9BA 1IHUA 2XECA 4LJ6A 1FLDA 3GNSA 1WP4A 4CUKA 2WU1A 2RK6A 3DEYX 3MA0A 5EWMA 3SI7A 3ZKWA 1G60A 2Q1XA 1PD0A 1NN3A 2IW3A 2PKWA 3HSKA 1N5LA 5E9AA 1WUIS 1W5TA 3FVTA 3P9RA 4D82A 3TTXA 4NG4A 4B3RB 4J2HA 4Z2YA 3I04M 1IHOA 4L4XA 4IWNA 1Z5GA 3GY0A 4Z0NA 5ICFA 5KTYA 1YGYA 3H5TA 1U5BB 3ZS8A 2HIGA 3RBXA 4UUOA 4AZ0A 4DM3A 4I46A 5AW8A 3ASYA 1OWOA 2KW5A 1G9XA 3EASA 4TWBA 1Y63A 1F38A 1Y3FE 2II6A 2YYZA 3BMCB 3BSFA 5DIFA 1UKBA 4GP9A 2HEIA 3I58A 5JAPA 5L4SA 2ONKA 3CZRA 3C6MA 3STYA 2EFEB 1AQUA 3D81A 3ZDEA 3OCUA 3C5EA 1TYEB 1PWEA 2JRLA 2AFHE 4W9NC 4Z9BA 3U3XA 1GZVA 2ZTMA 1KU0A 2HLPA 1DC3A 1SBNE 1TEVA 2OC4A 4IIYA 5BP7A 1RRFA 4Y9UA 3ERCA 1OGJA 3TK1A 1RAIA 1N9ZA 4OH7A 1DC7A 3OQMA 4QODA 5K20A 4GEKA 2CFRA 1Y7IA 3PHJA 3Q3VA 1W75A 3SEQA 3ZIDA 3ZCQA 3SPXA 1Y6QA 2ZTLA 4YAEA 1USVA 3B7PA 3DB1A 1U0EA 3F8TA 4PAOA 2FN8A 4IV5A 5T67A 1L3CA 2TRSB 3RG2A 1WQ3A 2J3KA 1MH9A 1QHXA 3CVJA 1G5QA 1V9LA 2JVIA 2GM5A 4J91A 1QGAA 1DX9A 4UE2A 4P0PB 2FWBA 2XBLA 2YWDA 3Q6IA 4RXMA 4WBSA 1PYDA 4R41A 3S2FA 2O23A 3DOUA 4X44A 5CB0A 4AQ7A 4BJ6A 3LTEA 3BOSA 2WR8A 1F8GA 1Y1RA 4CCWA 1EXDA 1RS0A 3EDQA 2W6NA 3JRXA 5G1NA 3ZH2A 3LUPA 4WCDA 4B8WA 1G66A 2B3DA 2IL1A 2DECA 2PMCA 4YJ3F 3RUEA 1Z8FA 4RJKA 4B4WA 2FXIA 1RIFA 2RHRA 3I6IA 1ZZEA 4FIDA 2VUUA 4QYIB 2H2GA 3TOZA 4C88A 4LDQA 2Q7DA 2HX1A 3OOYA 1PV2A 4M0LA 4EAQA 4EJ2A 1H22A 2Y77A 4ZVMA 3SXUA 3GP5A 3LQRA 1JB9A 4REOA 4XYLA 5B7GA 1YV9A 1A4IA 3W06A 5BQPA 2CWDA 2V58A 1QQ6A 4NYMR 5T4FA 5BORA 1QGDA 5JZMA 2EC5A 2PU5A 4GQIA 4IEEA 2OORA 2MSDB 4ILEA 2H1OA 2QQGA 3M4JA 1U2ZA 3HFJA 4RZUA 4F4CA 3TS1A 1JG7A 5BOSB 4QYMA 2CF5A 1ZXXA 2PX5A 4X9XA 3DZFA 3ZJTA 2MMGA 3IIJA 4V0QA 2ZUFA 2JH9A 2J6IA 3CNLA 5EUQB 3QFFA 1F8YA 3OLVA 5DGTA 2Y1FA 2C31A 3WLAA 4MVJE 4B45A 4ZJUA 3WLSA 2CFOA 4HGRA 1J0DA 4RY0A 2J87A 4EEZA 3Q8KA 1YWGO 2JGRA 4KWEA 3UH0A 4B1FA 1E8DA 2I4LA 4E14A 5DN6D 1TM2A 5FTLA 4GKBA 1V1MA 1DX6A 2YXPX 3FETA 4U0KA 4ZT6A 4LDZA 3NNDA 3HJGA 3KX2A 4B87A 5AUPB 3MUNA 3OZUA 3DPSA 4WBNF 3DTVD 4WFIA 5K51A 4IOLA 1Y5MA 4CMGA 4MV1A 2YRWA 2BH2A 3IH5A 3DE6X 3QTLA 3AF1A 3WRYA 3FOWA 3O8NA 3PD7A 1VPDA 3H97A 1YDGA 2J5XA 4KGVA 5TARA 3DT9A 4ZTZB 1PJCA 4R5HA 2VT6A 3VVMA 2P90A 3OEHA 5ES4B 3DVAB 1PKXA 5GZ1A 4KVGA 3GEBA 4RK5A 1Z13A 3EBOA 2JNWA 3B13B 2HA4A 2R66A 4O2BF 2IYLD 4MVJI 4CM6A 5JI3E 4KPYA 2ZRFA 2WSIA 4EJ0A 3S1SA 2LV8A 3CKYA 1FRQA 3ABQB 2V3WA 2XWSA 2GKSA 3M49A 2AN5A 2J3DA 1GFZA 2PRYA 3DYVA 2H2HA 1RHJA 3I5AA 4RK4A 1IUNA 2JLQA 3ID6C 3IP8A 3TI9A 4I19A 2VJYA 1JEAA 1LBTA 3KQHA 3MXTA 4YMTA 4EA6A 4AU1A 5K3FB 1TUBB 3AXSA 2VDJA 2WAMA 4QDXA 1FSPA 3EMBA 1H05A 5LB4A 1OH5A 4L4YA 2WJJA 3QPUA 5G0UA 5DM70 5H4GA 3EXFA 3FKQA 1BWPA 3L0SA 3O4JA 4UPVA 5DP1A 5KYWB 2DR2A 3VZBA 3ZHYA 5F35A 4BX2A 1IPFA 5FKJA 5F4BA 3HBJA 2WTEA 3NCHA 4IVNA 1OVGA 5MN6A 4JVOA 2BCEA 4CM4A 4FDTA 1NPTO 3CF0A 3OM0A 5IZCA 1GZ4A 4CIVA 1Y6RA 4HB2A 4MV8A 4TRJA 3ZHBA 4NY1A 1PG5A 3GLIA 4ZDJA 1DTSA 1X77A 1ZFNA 2J9XB 2IXFA 3HDYA 1QGUB 2UYQA 2VP3A 3HU1A 4I8IA 5ARBA 2IZOA 2QD5A 2XUJA 2DM6A 3KWLA 4K9MA 3U3ZA 3W9YA 4KDFA 5FBHA 1OH8A 2O7RA 4P86A 3SZGA 5KPDA 1BOFA 1QCDA 5IAJA 2FZKA 2OP0A 2CLCX 1TM5E 2ATXA 5M04A 3PTAA 4E51A 5B64A 3E2PA 4M8SA 3GFGA 1H6CA 1YBAA 3FYTA 4FWTA 5JJKA 3SQLA 2ENUA 4MUFA 3PZRA 4OLJA 3W8DA 3NNSA 1E69A 4IDNA 2BBSA 2WIBA 4QGHA 3RSLA 3S2GA 4OHYA 3QU7A 4E7OA 2H7YA 3UJCA 4C2AA 5KC8A 3QEBZ 1V8OA 4U3JA 3T54A 4JUFA 3CF4G 3M1IA 3TZBA 1XWWA 4PQEA 4PRLA 5IM4A 2BFMA 2FFBA 5BVHA 1NL3A 1YIAA 1K3UB 1X0XA 4H7IA 4LX8A 2YY5A 1PX2A 1T0JB 4CM3A 5DI3B 4M99A 4X71A 1ISSA 5ERYA 3O4HA 4CLXA 2C20A 1M75A 1D6NA 2N46A 3LECA 1H8EA 2OHVA 1Q7GA 2VNHA 3ZNOA 3C8UA 4W8HA 3R20A 2VHVA 1DVRA 3RADC 1M1XB 4NMXB 5E8JA 4K9QA 1JXOA 4QJBA 4HJXA 1N3IA 1IB0A 3CC8A 1UDRA 3IAS1 3TNLA 3MZ0A 2WSLA 3C6KA 4MHSA 4HDNA 1BEUB 3PFNA 3A27A 5TQ2A 2OGTA 4E30A 3RVSA 2Y2VA 4DLSA 1DOZA 2H4YA 1MTOA 1J22A 1G6KA 4Q1CA 5DOVA 2JFVA 2CXUA 1R9GA 3B12A 3QI7A 3RVQA 3OTOB 3ONDA 4HDKA 1H66A 3G0HA 1F5NA 3IEVA 1JIJA 5FI1B 2QRMA 3ODPA 4IJ5A 5HRCA 3PL1A 3REGA 1XTBA 4RA6A 1E2JA 1T9KA 3AUSA 3K9CA 3WSTA 3H86A 1AMNA 2QVZX 2HF7A 4JJZA 3ANNA 3JRNA 4BGIA 4QWMA 2IVFA 3C7DB 4PX2A 4IMJB 5K9ZA 1S5PA 1Q1ZA 2ZBUA 1KP2A 1ZN9A 2NTYC 4Y6RA 3FLAA 2PZEA 1O6BA 1IZYA 2W2LA 1UBUS 3DT8A 4MUBA 2DPYA 3W2IA 4C20A 4EPXA 3ZJVA 4OU4A 5CT6A 4N5MA 3K3PA 3C15C 3P94A 4Q3NA 4TTAA 3RNLA 3OURA 2Z56A 2NPFA 1FSSA 2NUBA 2G80A 1JMVA 1GUZA 2NOAA 4KQMA 4P38A 1ND5A 1M7HA 1SCDA 3DMYA 3R6TA 4PZAA 2DBZA 3N75A 1U8UA 3C3YA 1T2NA 2NPOA 3TUZC 1U2TA 3IJEB 1YQGA 4MVJD 5G4KB 3MJSA 1H2RS 1KH3A 4HDMA 3UTCA 3VTZA 1I7NA 5BN5A 5C37A 5DPMA 1ZY2A 2DHCA 2IEBA 4WGFA 1Q1BA 2HO5A 2IEAA 3W7AA 3L8EA 4YP6A 1GG2A 2GD0A 2QD2A 4B32A 4F3NA 4GLLA 3OG9A 3ZQ4A 1Q77A 1N8TA 4K46A 4LJLA 1AUPA 2OR3A 3P9SA 2YXBA 1TYZA 1K92A 1UEXC 1V7ZA 4NI5A 2AJLI 4KE9A 4C89A 4TTIA 3HYLA 3SFZA 4GR9A 1JVNA 2WV7A 3E22B 4D0SA