3MCTA

Vaccinia methyltransferase vp39 complexed with m3cyt and s-adenosylhomocysteine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
total genus 99
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mctA00
2GPYA 1NBIA 2VDVE 2ZWVA 2PXCA 2C7RA 1Y8CA 2ORED 1P1CA 1R18A 4GC9A 2R6ZA 5FA5A 4PGGA 2YVLA 3TOSA 1RI3A 3DLIA 3KPVA 1M0EA 2YUIA 3E8SA 2AS0A 5EHIA 3PFHA 4XUDA 4XUEA 3C0KA 1AQIA 1QYRA 1RJEA 3FPHA 1JG4A 1EG2A 5P8WA 3UZUA 2AOUA 4R8SA 2R3SA 3LCVB 3QOWA 5E9JA 2HV9A 3UA4A 4YMGA 1SQGA 4RTQA 2NYUA 1SG9A 3R0QA 5KVAA 3LBFA 1M6EX 5EMLA 3BKXA 4EKGA 1B42A 2AOUB 3C3YA 3LDUA 3I9FA 4CKEA 2KW5A 3HM2A 5FHQA 1TW3A 2G72A 5ICEA 4NECA 4RTKA 2NXEA 3UJ9A 4E70A 1EJ0A 3KQPA 1JTEA 1VQ1A 1VP9A 3P8ZA 1RI2A 3LX6A 4HGYA 3HVJA 3G2QA 5CVUA 4A6DA 3HCBA 3ANXA 4HRAA 4YV0A 5GINE 3FYDA 2XVAA 3UBTA 5CVDA 3IHTA 4M37A 4DF3A 3IEIA 3P2IA 3OU2A 2I62A 4X41A 1KXZA 3PT9A 3SXJA 2V7EA 4KIFA 4ISCA 3HA3A 2BM8A 3T0IA 3P71T 3M70A 1N7JA 2ERCA 4E30A 1AF7A 3BKWA 3SM3A 3C3PA 2PVCA 3G8AA 4EMSA 2EJUA 3HCDA 1L3IA 2NP6A 3FTDA 2BH2A 2PXXA 3GIWA 4BLWA 1F38A 4E33A 5EVJA 5FUBA 2V74B 5K0EA 3CC8A 3EGIA 3TRKA 1KHHA 3AXSA 1NV9A 2QM3A 4GOMD 4LWPA 3SX0A 2PXAA 1XJ5A 4G56A 4K6MA 4BP3A 2C7OA 3GRYA 3LGAA 5FA8A 4FT4A 5DTQA 2GB4A 4IV0A 2P7IA 3H2BA 5DRYA 4LG1A 4DCMA 5EEHA 5EZSA 2P3LA 3VSEA 4P7JA 3CVOA 5DM1A 4ER0A 4EQZA 2VDWA 1KPHA 4RTSA 3OFKA 4KDRA 3ELWA 2IH5A 2YXDA 2JHAA 4QVGA 2G8NA 5KQRA 4RTNA 1JQEA 2B78A 2IFTA 3GWZA 4PGHA 5EEGA 5ICFA 3PB3A 5C1IA 1DCTA 1AQJA 4PYMA 5GP1A 3DMFA 4ATNA 3REOA 3UJAA 3FPJA 4FR0A 3BZBA 2CMGA 3FZGA 4R6WA 5GM1A 1X1BA 2P8JA 2ZSUA 3P9CA 5EIWA 1R74A 4GF5A 2VS1A 5DM4A 5KS2A 3KR9A 1R00A 3DOUA 5D1NA 3G5TA 5GOZA 3GRZA 3PTAA 2O05A 5DT2A 3KHKA 3V8VA 1FPQA 4AZSA 5GM2A 1I9GA 2ADMA 1SUSA 3EVZA 2H1RA 2AN5A 4CXMA 2ZBRA 4KWCA 2UYCA 3C6KA 4HH4A 5T6BA 3JWGA 5FULA 3KQYA 3CJQA 3BWCA 3GXOA 3LCCA 1WXXA 3KQMA 5T64A 1ORHA 3ELUA 4KW7A 4U7PB 4MHTA 3NJRA 4R05A 5FADA 3FYCA 4EVIA 2NXJA 3TKAA 2QYOA 2P35A 3R24A 2YX1A 4MQ4A 4Z2YA 3NDIA 4ER7A 1FJXA 2IBTA 1EAMA 3MERA 4GOOD 1NE2A 4POOA 2P3OA 4BP1A 2O06A 3R9XB 3SSNA 3QV2A 3OE4A 4GOND 1YF3A 4AX8A 2I7CA 3THRA 4EK9A 1YFJA 2BM9A 3C6MA 1KIAA 1RJGA 4PNEA 5K01A 1H1DA 2NP7A 4FSXA 3DMHA 1XVAA 1OR8A 3OU6A 4XUCA 3OE5A 4YMHA 3B89A 2C7PA 3M6XA 3HEMA 2PWYA 3G2OA 4X1OA 3OFJA 3GRRA 1JSZA 2Z6AA 4QQKA 3LECA 4OQDA 4PCAA 5CUQA 4AZVA 4V0QA 3HVIA 5BW5A 2IPXA 4GUAA 4E2XA 4PYOA 4PYQA 1SQFA 2FK8A 2ZULA 3EMBA 2PX2A 3FPGA 3NMUF 4LECA 3MTIA 1D2CA 1X1DA 4YUVA 4M38A 2BZGA 5EIFA 3UJBA 3PS9A 2JHPA 5EKUA 1X19A 2PLWA 4R6XA 5EG5A 3FUXA 2PGXA 3GU3A 4IWNA 2H00A 3P2EA 2NXNA 1VBFA 3EEOA 1KYZA 1G60A 1TPYA 1NKVA 4JXJA 1EIZA 3G2MA 4PINA 2DPMA 1IY9A 1O9GA 3UJCA 4OX9Y 1KYWA 2HR1A 3CBGA 5E1MA 5E8RA 2ZBPA 1YFLA 3HA5A 3O4FA 3PFGA 1U2ZA 4MIKA 3BT7A 2ESRA 4AZWA 2YXEA 4XCXA 3P2KA 3MAGA 3Q87B 4QVKA 5DLYA 2A14A 4GOLD 4RTRA 4RYLA 5M5BA 5DXAA 1EJ6A 4P7GA 2IDJA 5LQRA 2GA9A 2OB1A 2P1DA 1I4WA 1KPGA 1ZKDA 2PT9A 3JWHA 5CCBA 5FQOA 1FBNA 2ZZMA 5F2NA 3CKKA 4RX1A 1M6YA 2AOVA 3KR0A 4R8RA 2JG3A 4C03A 3DXXA 5BP7A 1G55A 1ZQ9A 2H11A 4GEKA 8MHTA 3FRIA 2GH1A 5FHRA 3KPUA 4IKPA 5FWAA 5H02A 5E9QA 1BHJA 3V97A 1YZ3A 3FTCA 3EVEA 3HCFA 3SSOA 3MB5A 3TPZA 5EC8A 5IH3A 1SKMA 2Z6UA 4DM3A 5E1BA 5DTMA 3TFWA 4E32A 3GCZA 2QY6A 3TKYA 2G71A 4RTLA 2AR0A 3UJ8A 2C7QA 2CMHA 4MWZA 2FK7A 1IXKA 4PONA 5EMKA 1XCLA 3OZRA 3PX3A 2VZ9A 2CL5A 3EGVA 1G8AA 4UOEA 2EX4A 4HTFA 5C9ZA 1BC5A 2O07A 3U81A 2JH9A 2F8LA 1VPTA 2JH8A 3G7UA 3DTNA 5DX0A 4DKJA 4WVLA 2PSSA 4QDKA 2YTZA 3GDHA 5CD1A 4X60A 2PT6A 1AV6A 4M7RA 4E2WA 4FT2A 5DM2A 4KVZA 1NW7A 2FCAA 5EPEA 5DSXA 1ORIA 1NT2A 5K0GA 5E8JA 2ONYA 2Q41A 3CJRA 1NV8A 4Y30A 2PX8A 3LHDA 4PIMA 5DX8A 3EMDA 5EQJB 4RVDA 3JWJA 1Q0TA 3HVKA 1Z3CA 2PV0A 5CVJA 3AXTA 4RVHA 3KQVA 3B7PA 5DRTA 5MHTA 3ELYA 1WG8A 5K0LA 1G6Q1 5E1OA 1L1EA 2HMYB 1HMYA 1N7IA 1ZGJA 5LSAA 5FWDA 1DUSA 2ZZKA 3HCAA 2G1PA 5EKXA 4QDJA 2PX4A 2ZVJA 2P41A 2ZIEA 5C0OE 3ER9A 3KQSA 3AY0A 2E5WA 5DWQA 2EG5A 3NVKI 1KPIA 5FQNA 2WK1A 3BGVA 1QZZA 3T7SA 3B3JA 2UZ4A 1PJZA 1YZHA 2IGTA 7MHTA 3UJ6A 1QAMA 1ZG3A 4E2ZA 5LQKA 2JJQA 3LDGA 5GIPE 4IV8A 5KYGA 4ER5A 2PY6A 1NW6A 3DXZA 3LDFA 4QPPA 2ZFUA 3OU7A 5EZQA 1RI1A 4KIGA 3G8BA 2B2CA 3F4KA 3B3FA 1ZGAA 1KR5A 2NXCA 2UYOA 3BGDA 3CCFA 2FPOA 3D2LA 3FUTA 2XYQA 3JWIA 3G89A 3KPYA 5DX1A 5DSTA 2AOWA 1O9HA 4BLVA 4RSRA 4CTJA 1R6AA 5GIOE 1XDUA 2ONZA 1P39A 3A4TA 5K0FA 5CVEA 1XTPA 3M4XA 2BR3A 5T67A 1L3BA 3VC2A 3KPJA 1X1CA 3FRHA 1QAQA 5HIIA 5LQAA 4PYKA 3LKZA 3GRVA 4GC5A 2YQZA 3LKDA 3K6RA 1G8SA 1FP2A 2ZIGA 1XDSA 5U4XA 4Y2HA 4KRGA 3HCEA 4HC4A 4O29A 4P7FA 5HIMA 4KDCA 3RODA 3EVBA 3UA3A 1JG2A 4E2YA 3GNLA 3TQSA 2HNKA 3FPFA 3ME5A 3NWBA 2ZW9A 2IBSA 3OZTA 3P9NA 2AOXA 4A6EA 4FP9A 4CWAA 3B3GA 2EJTA 2LD4A 2XVMA 4X61A 3KQQA 4CKBA 3LSTA 4QTUB 5K03A 3LBYA 2ZBQA 5CIYA 2PWPA 4PYIA 4AZTA 3SMQA 3SSMA 4OA8A 4C06A 5CCXA 3EVFA 1JG1A 3KU1A 1R8YA 1YUBA 1UFKA 4PYLA 1VL5A 4FGZA 1QAOA 2AZTA 4B17A 1O54A 4C4AA 4P58A 2QE6A 5HOQA 1BOOA 2JHCA 3KQOA 1XCJA 2AOTA 3A7EA 3E23A 4HSGA 4GQBA 3I5UA 4YV1A 5G02A 5BW4A 4YV2A 1UWVA 3HNRA 4WXHA 4M36A 1UIRA 2O57A 2OPBA 3HCCA 4C07A 5K09A 1DL5A 4RTOA 3FPEA 1JQ3A 2AOTB 2XYRA 1EQAA 2ZWAA 4ZTBA 4C05A 3O31A 4X63A 5F2KA 4PCLA 2BR5A 3P9IA 5BXYA 3NVMB 2IIPA 2PKWA 2IP2A 1G38A 2ZZNA 1VIDA 1VP3A 3MTEA 3IYLW 3M6VA 3TR6A 5K0CA 4RVFA 5K0JA 4PIPA 4PYJA 4RVGA 5CVVA 2XBMA 3ERCA 4E31A 2GLUA 4BY9E 5KQSA 5FCDA 9MHTA 1NW8A 4PYNA 2B25A 2OO3A 4RV9A 5DTRA 4OA5A 4U7TB 1XXLA 2GAFA 1JQDA 2OY0A 4OBWA 3M33A 2WA1A 5B1SA 5DM0A 1JTFA 3NWEA 4HGZA 3KR2A 1D2HA 4LWOA 5ERGB 5EMJA 2ZIFA 2N47A 2OKCA 3X0DA 3A26A 1D2GA 1N2XA 3TMAA 5JUWA 2ZCJA 1RI5A 4L7VA 3KKZA 2HTEA 5D1HA 4H0NA 5E9WA 5EHGA 2PX5A 3TM4A 3P9KA 2AVNA 3A7DA 5DXJA 5ICCA 4DMGA 3I58A 4CKCA 3UFBA 10MHA 1SUIA 3BWMA 5HFJA 3HTXA 4RTPA 1JSXA 1SVUA 5E2AA 5EMMA 1WS6A 1WXWA 5LQUA 2PBFA 3PX2A 2FHPA 3DULA 3I64A 3GRUA 3NDJA 2I9KA 2YR0A 4HTFB 3I53A 4F85A 1L3CA 4C08A 3KR1A 3DMGA 3MQ2A 2YXLA 4DA4A 3FTFA 5LQJA 4QQNA 1P91A 1RJFA 3DH0A 2FRXA 2XYVA 3HP7A 5K05A 3A25A 3L8DA 2PJDA 1I1NA 4ER6A 2OYRA 1Q0SA 5CM2Z 5EGSA 2B9EA 5HILA 4MTLA 3KQTA 4RWZA 1WZNA 3FUVA 5ICGA 1P1BA 3B5IA 2OB2A 4DZRA 4F84A 4YUYA 3THSA 3TLJA 4BLUA 3HA7A 3NW9A 2NNWB 2QRVA 3M6UA 2IH2A 3P97A 4YUZA 5EOVA 5F2OA 1JR4A 1RJDA 2P7HA 3BXOA 1T43A 3EEYA 4OQEA 2G70A 3GGDA 2B3TA 4FZVA 2UYQA 2QRVB 4YUWA 1VLMA 3AJDA 3AWIA 5K8VA 3G88A 3IV6A 1IM8A 1F3LA 4FS8A 3VC1A 3CGGA 1KP9A 2VDUE 3RIEA 3SR4A 2O0LA 3RW9A 4DCGA 2VP3A 3GO4A 3MGGA 5LQNA 1X1AA 3G2PA 5HIKA 2BR4A 3G5LA 3LCUA 3R3HA 2OXTA 3WSTA 3TM5A 1ZHFA 1JG3A 1MHTA 3BGIA 3M6WA 3VYWA 4P7KA 4YUXA 1NW5A 3DP7A 1FP1D 2Y1XA 3OPNA 3EVDA 5FTWA 4F86A 1VE3A 3QOXA 2AN3A 3E7PA 4HG2A 4C04A 3E05A 3T7TA 5IKMA 3OCJA 3KQWA 4PWYA 3T7RA 3Q7EA 3EPPA 3PLAE 3O7WA 2FYTA 1HNNA 4FSDA 3HVHA 2IDKA 2P40A 1MJFA 3GJYA 1QANA 5E2BA 4QTTB 3ER8A 1NBHA 1R8XA 1WY7A 2AN4A 3SGLA 5K0NA 3S68A 1NW3A 2ZTHA 1RI4A 2DULA 2P3QA 5HEKA 4GBED 4CTKA 4RTMA 5HIJA 2I6GA 5DPMA 4RTJA 3ORHA 2GS9A 4ER3A 2OBFA 3BWYA 3LPMA 2EFJA 3K0BA 2CKDA 3FUWA 1L9KA 3EVAA 1BKYA 3A27A 3PVCA 5GWXA 5LQCA 2CWWA 3BUSA 3CJTA 2Y1WA 3EGEA 3DR5A 2OZVA 3DXYA 3MCZA 3FUUA 2HWKA 3UWPA 3MCTA 1PRYA 2K4MA 4OBXA 4EKIA 3UJ7A 4QPNA 4V0RA 3BWBA 3FTEA 1INLA 3ID6C 2AVDA 1V39A 3LL7A 1YB2A 2WA2A 5K0BA 3EVCA 2Z6QA 3UJDA 4DQ0A 3EVGA 1XDZA 3NTVA 3KPWA 3SVZA 2IH4A 3DUWA 3DLCA 5HZMA 5LR6A 5E1DA 1TW2A 3OZSA 4AUKA 5JR3A 2ZLBA 3ELDA 2UYHA 3R6TA 3MHTA
chains in the Genus database with same CATH superfamily
1ENPA 2H9IA 1B6RA 2AMJA 3UXHA 1MCZA 3D3WA 3EASA 1IVSA 2X15A 2BYTA 3FLBA 2ORYA 2Q3HA 2QRGA 3LUBA 4ZA2A 5EHIA 5ER6A 5CB4A 3QKWA 2V7WA 4PLGA 4U6QA 1Q0PA 1G5QA 3LFHA 4M22A 5KNLA 4ZHQF 4Q03A 4BJ1A 4S04A 2BT4A 6AT1A 4D81A 3ZDCA 1HQDA 2WOOA 4B43A 3RJZA 3O7MA 3D7NA 1DJPA 1TEZA 2AZXA 2HUNA 4LOIA 4DL9A 2OGZA 2JIBA 3AV3A 4PXAA 3TZ6A 2O5CA 2R8OA 3WBBA 1PGPA 5FO1A 2NU8B 3NHRA 1L4YA 3D81A 1Q1AA 4YJDA 1UAAA 1HEIA 4Q1VA 4LDNA 2VATA 4A6DA 3GLIA 1MAVA 2H4HA 3EGOA 5AKIA 3MELA 3ENQA 2H6EA 2RH9B 3GK3A 2P2NA 2RI6A 5L3SA 1M8JA 4HGQA 2YBDA 4QPZA 3H04A 3H9BA 1Z28A 3I9JA 1FFXA 4EARA 1XCBA 5AJUA 5JAIA 4W5TA 3FPKA 4N3CA 3PD7A 1FDVA 1TLTA 1J7JA 4YP6A 4GG1A 4IEEA 2FUG6 3A1EA 2QLJA 4ZN6A 4IIHA 5LIRA 1HYEA 3BGWA 3OPYB 4CCYB 4L4RA 1TIPA 1EFDN 1EFUA 3R3ZA 5ARBA 4K81B 3IA7A 1ONPA 2JFXA 3BHJA 1GYPA 1MRZA 2CZCA 2UZ1B 2M6KA 2VQFB 1EHIA 2I7DA 3WMFA 3FFXA 2QVCA 4N7MA 2B83A 2NUAB 1GR1A 2CJYA 3HHEA 3RIGA 4G09A 3D54D 3LGAA 1F2UA 1L5ZA 4PTYA 1ORVA 1XNJA 3PQ4A 5AJXA 1I5RA 3KD2A 5DTQA 5HVNA 1KH1A 1ZD8A 3NYRA 2XXAB 1OWPA 2IV2X 1WF3A 3ZIUA 4CM6A 3BFXA 2XTMA 3ELWA 3FVWA 2I9PA 1D9ZA 2VBCA 4QWMA 4BFSA 1KE1A 1UFRA 3W06A 4PPYA 1RPAA 2P6MA 4F71A 1ZR4A 3JQQA 3NV7A 4F21A 4ZPXA 4DNQA 1QOQB 4E07A 1FVFA 4YP1A 3ZV6A 3Q9NA 5C35A 4GZ6A 1G6HA 4LVUA 2V7QD 4PY2A 3CW8X 2NWQA 1P1RA 3LM8A 1P6XA 1U8EA 1ZLXA 2B4RO 5JNVA 3OF5A 2F8MA 3OUZA 1N7HA 1PAUA 5B36A 1W73A 1V7QA 5CLJA 2QDXA 4K9DA 1UIMA 3MGKA 2RJ3A 4EG0A 3KQLA 1B0UA 2BE7A 1KJQA 3VU8A 1CY8A 3LX8A 4KWCA 4XYLA 4F9FA 2AZDA 2RGUA 2CXNA 3O82A 5L53A 3HB5X 3OEED 1KSFX 2AC2A 4X71A 3FROA 4EG7A 1NU6A 2FW7A 2WU0A 4XZ3A 2C1ZA 3DKIA 2DAPA 4MQEB 2CLCX 4ESOA 1POXA 4HUJA 3VZQA 2OM2A 3F6SA 1JSRA 3CV3A 3RSOA 4WY5A 2BP7A 2OV4A 4H7IA 5CDSA 2ZQYA 4Z4CA 1HTBA 2EJVA 3F6BX 3ODPA 3TW6A 4YFVA 3UGJA 1Q21A 1G0NA 2JIZA 5DNCA 5K8LA 3VV3A 3Q7QA 3I3OA 2HHHB 3ONVA 3LOQA 1S2MA 3LQYA 3WE7A 2QBYA 4ITUA 4ZVQA 2AI3A 2NP7A 3L8MA 3DMHA 1CS0A 4X97A 3VDXA 1SCKA 2H7VA 5DI3B 2IXTA 4LA4A 4OL9A 1RWOA 4XH9B 2ZTUA 1STOA 3G9ZA 4XGKA 2B99A 2AD5A 3C7DB 5EZ6B 3B2NA 5J4YA 2Z6AA 1PEAA 2JD0A 2ZBDA 3R7FA 3AUUA 3SF0A 1VFNA 4AZVA 2ZXUA 3T15A 1YV9A 4E2XA 2WJZB 1UFOA 2D2IA 3KUXA 3M9LA 4TPKA 1SHUX 2W11A 1NQOA 2W5UA 1WQ3A 1HXHA 4Z0HO 2R7MA 5CVTA 4LXXA 4JI8B 4RC9A 3WLLA 3BFPA 2J5KA 2CLFB 4QAQA 5EN4A 1TPYA 5K0EA 4KQ6A 1AKTA 4EBBA 1IY9A 3M1YA 5LP1A 4LRYA 2VDMB 5KYKA 1S2OA 4ZODA 2XEXA 1JWBB 1T4GA 3QEJA 4FHEA 1DKLA 4EG8A 3K5WA 3NGMA 4OJKA 4L4YA 5KB3A 3VGPA 1SC6A 2R60A 1T2CA 4MVJP 4JBHA 3ZU3A 4PQRA 1Q57A 3SQDA 4TX1A 3A2MA 1P0FA 5DKFA 1YB5A 4HGNA 1B7GO 3KZMA 4OLHA 4KQCA 1SQ6A 1CP2A 5D51S 2FXIA 2FKAA 2ZCVA 5FQOA 5ARDA 1VHLA 5F2NA 3RU3A 4K9PA 3EVTA 1O94C 3KYDA 1GUYA 1I6MA 2JG3A 3AVOA 3LWNA 1JHUA 4WNIA 1YR3A 5HE8A 4RM3A 2ZS9A 1XYYA 3JPYA 3PRJA 5BUZA 3KPUA 3SNHA 2WILA 3V97A 3T5GA 3TRDA 4M3NA 1Q1EA 5JZBA 1WKCA 3QTLA 4E5YA 4LZJA 3PQ8A 3PQEA 1UMBA 3FOWA 3LRTA 3ACCA 3OP1A 4MVJH 2FFRA 1QBKC 5ALKA 3BIXA 2VAWA 1WW3A 2VHUA 3PTLA 3VNSA 3WGJA 3RSSA 3PFKA 4G24A 4KXQA 5MDHA 1U7DA 2L17A 1BVHA 1TM1E 1DJLA 4WY2A 4G0XA 5DK6A 3WZLA 2D54A 1Z83A 1QHNA 3PGMA 3D8HA 3KXKA 3S3TA 3U26A 1AC5A 4EA6A 2QNRA 3P52A 3LC2O 4WTOA 1C81A 5JYEA 1X7XA 1IEWA 1EK2A 4E94A 1TC1A 2I54A 1S8NA 1GD1O 1SD1A 2J32A 5JSUA 4ZEMA 3I5MA 2J87A 3DTYA 3H86A 5B3KA 1U0BB 2IYXA 2VRCA 1HE3A 4Y30A 4PIMA 6GPBA 4EVRA 2H52A 5KINB 2N3ZA 4A1OA 4AJ1A 2CLOB 3M8KA 4NCIA 4MDFA 1UK9A 2NO7A 2NTNA 1GZHB 4PZLA 4WXRA 4BLQA 2PLRA 4JT4A 4U4AA 1GFSA 4HAUA 2NU6B 5DEOA 4AF6A 5DRTA 1E94E 4Y0VA 5IH7A 3H5OA 3OE1A 3UICA 2C31A 2ON6A 5K3SA 1RNLA 4HVLA 2I91A 1U11A 2BGLA 4TS3A 1PUJA 2QD4A 3EUWA 2J0QA 3I4LA 3EXFB 5L8VA 2ZIEA 2E5WA 4QTZA 4XVUA 3O4VA 4Y7CA 1KEZA 2FWJA 1YONA 3UFXB 1B23P 1PJZA 1YZHA 1NNUA 1A69A 3ISJA 4TMWA 2QVXX 1XDWA 4IDCA 4EI9A 1A71A 1FNDA 2Y2UA 3JZIA 3MTJA 3UC9A 1MZVA 2RG1A 1CUBA 4YJHA 1XXHE 3I6BA 4YP5A 3DXZA 2O2YA 3LDFA 5ITVA 5KMGA 4URWR 1Z35A 2FMXA 2ZR0A 1O89A 4KIGA 3UXEA 1GUBA 5YASA 2ZM5A 1E5TA 3L0BA 4MCJA 3D2LA 1FFEA 2FY8A 1EVYA 4P36A 1KVSA 4LJ4A 2GFIA 2V59A 4JMLA 5DX1A 4AT1A 3E3OA 5JAMA 1SC9A 3U44A 1NVXQ 1KMQA 2ONZA 2HQBA 4HNAB 4J0KA 4KQXA 4KO2S 2ENWA 3KE9A 2VP0A 3KAJA 3JD2A 2JIMA 4PYKA 1XLTA 2J9XB 4ARAA 3M82A 3MWDA 1E7YA 1QGDA 1XRSB 4Y2HA 3VX3A 3K32A 4YRMA 1P61B 3LIPA 2XI4A 1E1CB 3AR4A 1KYTA 3KEMA 4HC4A 5HIMA 3PL5A 1R1DA 1ODIA 2C1EA 4OGKA 3GT0A 3AFMA 5AHWA 4ZMSA 4ZDJA 3C6YA 3KSBC 3BJEA 2WSLA 1ODJA 2QD2A 1ZJ6A 4ZGBA 1MQ9A 5BRNA 2VYVD 3CPSA 4Z3DA 2WFLB 3L4BC 4JUCA 4RPHA 5IEBA 4CQMA 2JF0A 2BFEA 1T1SA 2DPGA 3BF8A 2G67A 4JKIA 3IDZA 3LBYA 2J0SA 3NHUA 1CUSA 4JNCA 3S40A 4CMBA 3ADDA 3HBAA 3LGSA 2FWBA 1TYDE 4G4GA 4MUXA 5DHUA 3OCYA 4AWAA 3O1LA 1PCXA 3ETNA 1SRQA 3L9WA 3SX2A 4EB8A 1B41A 1Y7PA 2I2XB 4MEJA 4FJ2A 1AKQA 2AN9A 2QD3A 1XRRA 3D4BA 3LYUA 4H7PA 1OYOA 4QTYA 4GP7A 4AIRA 1C7QA 4HSGA 4HNGA 2FW8A 1YDGA 2JD2A 1DV2A 1RQ2A 3EMVA 2ATEA 4URHA 5HZKA 3T1YB 2VJDA 3OZDA 3HXPA 3ZI4A 5K09A 2AYYA 1JKIA 1IJKA 1FLVA 2O4UX 3N86A 1A97A 2GZDA 2XPCA 4G89A 1PFVA 4S2UA 4WUVA 4YLEA 1H5NA 2B4AA 2B8NA 1HKHA 2AE1A 2EXXA 3OIFA 3FBGA 5KHAA 3IULA 4X7PA 4NNPA 1NXTA 2EHJA 2BR5A 2ZYUX 3DBRA 1ISFA 3P9IA 4WAUA 3GFPA 3ZXYA 4DLNA 4EY7A 5LDHA 1GSHA 1L2TA 1T26A 2IZZA 5E7JA 4Q4HA 3S2SA 1U2QA 1H23A 3T99A 1UT5A 3PX7A 1TO6A 3G13A 4IQ4A 2EFYA 4JP8A 4AMYA 3ZJ4A 1HDOA 4LTMA 1X1RA 4QEDA 1XZNA 3A6JA 1L5OA 4HR7A 3X1DA 4ZJYA 5CU7A 2IEYA 1ORTA 4GW3A 4FONA 4RNDB 4QD3A 3KXLA 2OY0A 4HWTA 3N74A 4I55A 4J7AA 2ZRIA 4LRXA 3TRJA 3HJUA 3IQEA 4J6EA 1JPUA 2ZYWX 2IZ1A 5DISB 3GJ3A 4RIGA 4L74A 4RK4A 1D2GA 3T7IA 1Z34A 2QRQA 1G64A 4V0KA 1AKUA 2WINI 4JBIA 1RXSA 2C83A 2WZBA 1X2BA 2HBZA 3WGKA 2HQ1A 1LFAA 1E58A 3V8RA 3A7DA 1TT7A 4Q39A 2R8EA 1XP5A 4GMXA 4IQFA 3HTXA 3DBLA 1P3DA 2I2CA 4EKEA 1I13A 1CUHA 1UJ6A 4MW6A 3ZLBA 1E1RD 1FA9A 2FKNA 3I37X 3ABZA 3GEHA 3LDAA 5BN5A 3OCVA 3I53A 2Z2XA 4KDFA 2J6HA 5I7OA 5KZMB 2JGMA 4YN3A 2QTGA 4RK6A 8LDHA 2YXLA 1BWRA 4DLVA 4WXMA 5IWCA 4L0DA 4XGQA 1PLJA 1XVTA 1Z4JA 1SHTX 2E2WA 3WRYC 2ZE5A 5EGSA 2FDXA 1P81A 3NC1C 1ZD5A 1KAGA 3WADA 4R54A 5IYZB 2IIBA 4LDJA 4RWZA 3N6VA 4OMCA 2VK8A 1R4MA 3FUVA 3P5SA 3UBMA 6REQA 3WZMA 4KIUA 4F84A 3QZUA 4NMXB 1X94A 1Z75A 4IIXA 2DG2A 3E5HA 3HE3A 2J3KA 1R4NA 3GUUA 1YRHA 4BFVA 1CZRA 1ESZA 3NRJA 2QRVB 4OMFG 2G6TA 1Z6AA 4KN6A 3KZNA 1KQNA 1ZN7A 2Z3WA 2HTFA 3LZDA 3QJGA 1B6GA 4HDSA 3PK0A 3GJQA 4IJQA 3RW9A 3GO4A 3T5PA 1FFBA 4O59O 4JD5A 4UBIA 2J08A 4W6ZA 3NLLA 1PR2A 2NZJA 3KYJB 3ICCA 4QUKA 1D1TA 3JQ8A 1AHIA 1YR1A 2IY7A 3VYWA 4ZK6A 2ZS7A 2ZYDA 4XWAA 4CHTA 4NE9A 2GT1A 1Q16A 5I51A 1H2AS 4ZYVA 1OLSB 2EDCA 5KPJA 1KTIA 1RLUA 3MW8A 3B7WA 4I46A 1DMRA 2GWRA 2FZ4A 3NIGB 5KJFA 3QTBA 2P9FA 5GONF 2JLVA 2GILA 1ISSA 4F3YA 4CUZA 3FMGA 4EWLA 4UUMA 2XQFA 5EE5B 4PN3A 3A6FA 4LGMA 4HUTA 2QLTA 3LP5A 3ER8A 4TWBA 4OSPA 2RC5A 1N1EA 3B6MA 4OHKA 1SIOA 5K0NA 4IDFA 5JH7A 1ILWA 1RI4A 1UDXA 2QX9A 1NJ2A 1OLUA 4CFZA 4Q4CA 4LF9B 4QLAA 4L8VA 2PCLA 3ENZA 2OYCA 3T35A 2OHGA 2JFQA 3BWYA 3EXG2 4FBMA 1VKOA 3WGLA 3WLIA 4BNZA 1L4KA 1ITZA 1L4UA 1LPSA 2JAHA 1L7QA 3C6XA 3ITNA 3K0BA 4URYR 2NM0A 3VTFA 4YAKA 2C3UA 3EN0A 3O8CA 2J07A 4JN6B 2OZVA 2HDHA 1JJ7A 2Y67A 3EEBA 1U65A 4HRXA 4LRWA 2DR2A 2PMBA 1Z4LA 1PRYA 2CMDA 4RL4A 4CV2A 4Q4LA 2YXNA 2OVFA 2G5TA 3ZOKA 3ZZMA 1INLA 4X6YA 2H06A 2Q5EA 5IBCA 3MJDA 3PKZA 5K0BA 1JEQA 4LDRA 4CL0A 2Z6QA 4CEJA 1GU0A 3OSZA 4Z7JA 4EYEA 3OHSX 1C3OB 4HT3B 3O8LA 1H66A 2R7LA 4UE2A 2NV6A 4PU0A 3QKRB 4PG4A 2G7ZA 5HDBB 4C6HA 5AVTA 4HDQB 4J2HA 3KC2A 4OFWA 4G1EB 3OM9A 2GN9A 4XLLA 1BHSA 1DG3A 1ZWLA 2F1RA 3CCBA 2MINA 3U3JA 1J5EB 3ESZA 4TL9A 1OJLA 4I5EA 4BVEA 1JIXA 2HIGA 3AHJA 3K6SB 1ODKA 1VB5A 4TV8B 5F3DA 4FGSA 4OCZA 2D1TA 1E1YA 5SZIA 1Z0FA 2IITA 4PZZA 3WHPA 1W36D 3GZNB 1PBNA 2W6MA 3A8TA 3ONDA 2IGBA 4FQ8A 3GA7A 1E3LA 2P9YA 2X7XA 1J49A 5A4DA 4RS4A 3QVOA 1C5KA 4IJKA 5EJFA 5KEIA 3KWLA 2CVQA 3T34A 2ZANA 4C2AA 3DE1X 4RJLA 2G72A 2FUCA 1ECFA 1VSBA 4H7FA 3Q3GE 3IB6A 2CBGA 2KBEA 4HLCA 3ZCPA 5TQVA 1P4GA 2RDMA 2BN4A 2HQOA 3OOHA 2DCMA 2Q5CA 3G2QA 3WL4A 4BBAA 1AN9A 1Q0UA 4RY8A 2K7ZA 1PO7A 1QP7A 3AUFA 3H1AA 4GXQA 5CVUA 3CF0A 4HRAA 3CLUD 2CW5A 3I34X 3PUWA 4ZXPA 5CVDA 2H1VA 4ZD6A 1DAFA 5AKEA 2Q8NA 1EA7A 3IBYA 5FFNA 5FPTA 4AQDA 1Z6YA 3WIVA 3JASA 5TMPA 1HORA 1NFFA 3OT1A 2F1OA 2P2ZA 5JQWA 4TTRA 3RRFA 1A8IA 1MORA 3P71T 2PE5A 4NHEA 1DBQA 2WOJA 3I1FA 2A0XA 5CA1B 3C3PA 3KVNA 1V4BA 3VNUA 3D31A 1MG0A 3U48A 3CF4G 4CMJA 5K3EA 1SXJE 4R69A 2O2JA 3A4VA 4BLWA 2A5YB 1EWRA 1WDKA 5SYMA 3U9TA 5I4BA 3T0GA 2XGMA 4OKNA 5ALMA 4OXYA 3IQFA 4NAUA 5BW6B 3SOZA 1KHHA 4C3ZA 1AV6A 1AB5A 3NTOA 4LWPA 4NKRA 3MPUA 4M1OA 4N40A 5KTKA 4GQIA 1WB5A 4M49A 4MV1A 1VE7A 5H3LA 5DHAA 2I2AA 3UAXA 2O2HA 5CTJA 3AUKA 1HYQA 5EEHA 1SVMA 3I2GA 1SHLA 4AY5A 2DYKA 3EQ6A 1M72A 4YCJA 4PYRA 4S24A 3GUHA 1KAEA 1SXIA 1E5XA 5B1IA 4BV8A 4L2IA 4AZ3B 1A27A 2GD2A 3S81A 5CYPA 1USIA 2Z56A 4OVKA 2O59A 4EYKA 5B55A 1J23A 2GJKA 2QD5A 3CTPA 1ZM9A 2FWMX 1IUNA 4FR0A 5F21A 4F38A 3OIUA 3BEOA 3I2KA 2YW9A 1TCBA 2PANA 1ZNYA 1WA5A 3KZXA 4KPUA 4RIEA 5CLIA 5LA6A 4AXBA 3KOYA 3DO8A 4KYTA 4P5PA 1P0MA 1W34A 5HUHA 4IMPA 4U2CA 5I7UA 3BQ9A 2ACWA 3RIHA 1TQ4A 3N2KA 3CZ4A 4CIDA 4P3YA 1CHDA 1BH6A 4JJ8A 3B6IA 4TRNA 5B1HA 4GLFA 4CDNA 1CV2A 4IF4A 2FMFA 4JFAA 2A1TS 1T25A 1EH5A 3JWGA 3K09C 1HE8B 1NR7A 4IG4A 4J94A 5AKLA 4D3FA 5I45A 2X13A 3L1KA 3ESDA 5BN4B 4MHTA 3RROA 2NXJA 3F6CA 3PXEA 1TM7E 4MLCA 1TKCA 3D7LA 2V6IA 4HDOB 5KO2A 4ZAYA 1H85A 2P3OA 2WNHA 4PTLA 2BGMA 3L0IB 4XIJA 3OE4A 1N2SA 1C4KA 4LX0A 4Q3OA 3ZXXA 4ETNA 3K70D 3U4GA 3T06B 5B7QA 3ZLJA 1MB3A 2WP8J 4D44A 1XVAA 4CODB 1U5BA 2ZU0C 3OPXA 5TS2A 5KREA 2XNKA 2GA8A 5CM9C 2RHJA 4PEVA 3D6JA 4Q1BA 1RHMA 3CMMA 1ACMA 3JCZA 1FDOA 4H08A 1LKZA 4YCCA 1DU4A 4NIMA 5JO0A 2GJ9A 3AEKB 1CJSA 2X2EA 3X1XA 1CDOA 3EA0A 2F1KA 1M6VB 3FPGA 1IHYA 1YL7A 2EFDB 3HR4A 3UJBA 1WUJS 4DPLA 1KEWA 1J33A 2W70A 4YT2A 4AMBA 2Q0SA 3PD1A 4WN3A 1ZCBA 3DJYA 4ID3A 5BN1A 3NM5A 3UN1A 1QH9A 2R11A 5JZMA 4WBNF 4YPVA 3ANLA 2XMQA 3Q3VA 3RB8A 3OZVA 4CM1A 3LC0A 1RADA 2Y93A 1A5BB 1OTHA 4RF3A 2XCIA 1TKRA 1G8FA 3O4FA 5E7IA 1U2ZA 3RVPA 3TEFA 1PD0A 1TTTA 3VHQA 3PQ3A 4MH0R 4Q1DA 1Z26A 4RABA 1GEGA 5FTJA 1M0WA 1JLHA 3GLHB 4FC7A 4KQEA 3E22A 1E5VA 1L6RA 4TV9F 3GD5A 2VHJA 5ALEA 2IDJA 5DXAA 2WKSA 1UKZA 3L2OB 2P3SA 4TWRA 5IF9A 3UT5B 1IZ9A 2AWNA 2JIDA 2R97A 1H4VB 4YMVA 3GFBA 5CCBA 1RC0A 3CKKA 1NIPA 1W4RA 4IKEA 4Q3CA 3TE6A 3DXXA 4MMXB 3GVPA 3FLAA 3BRCA 1QVAA 4WJZA 1TFRA 1Z0JA 3DM5A 8MHTA 2VH5R 3PZRA 4F3TA 2WYHA 3PUXA 2XGJA 4LF7B 2B5WA 2X0JA 3Q5GA 4OB6A 4EKDA 1BX3A 3MB5A 1FK8A 1KI6B 4NDAA 4Y6LA 5ALWA 3SAJA 1UC4B 3ZHVA 3STWA 2H1CA 3EZXA 3E3AA 1ESMA 2WWRA 2IEGA 1W29A 3QLTA 5DW0A 3OECA 1OX4A 1GZ5A 2XQKA 5MFPA 4C0HA 5F9HA 3UB4A 1K63A 1UEJA 2BGNA 3CEAA 2YINC 1KGDA 2CMHA 3HPQA 3SLKA 4AYXA 5LP6B 2HPVA 2R6GA 1FDWA 2ZPTX 2HCFA 3I9KA 4MUBA 1MOQA 3ZYZA 3FGNA 3OZRA 3FOEC 1T6XA 2PLNA 1SZPA 4G5GA 2O5RA 4I50A 3VNBA 3QELA 3VOSA 1MTOA 3LUCA 1DX4A 2EKPA 5IBQA 5U1PA 4IOKA 5AI0A 4NLLA 3G02A 4E11A 2D2EA 1MX9A 3ZY2A 3L77A 4GNKA 1P45A 4JR1A 3RTGA 4BC0A 3U61B 1DUVG 1II0A 1ZMBA 1QCZA 3D2AA 3HXMA 4UU0A 4BIMA 3I1IA 1TA4A 2VHCA 3BTOA 3S44A 4L4SA 4GSLA 4FMCB 4N5LA 4NCNA 2W6QA 5LD2B 3OC6A 4XPIB 4ZXFA 4EYSA 2GPAA 3KB6A 2I71A 4X7RA 3OQIB 3ZVRA 3GIDA 2PV0A 4MDEA 4QYIA 3HADA 5FLKA 1YS9A 3WFJA 1CZHA 3EZGA 3BVPA 2Y66A 3QXGA 2XB8A 2G5CA 5EYPA 1Z33A 4D9NA 1UBHS 1OH8A 2G1PA 2O8BB 1N5LA 2XSZD 3S2ZA 1NUSA 2GWHA 3ROTA 2ZVJA 4ZU3A 5FPKA 2VSNA 4B83A 1GV1A 5JNWA 4QA9A 4KQKA 2JK1A 2QZPA 4WCFA 3B3JA 3H3JA 4M1YA 1T8PA 2QTBA 2JBWA 4XB2A 3I61A 1D8AA 4WK0B 2QU8A 5LBIA 4BVAA 1IUPA 2PJRA 3VSDA 3ZDAA 1SCAA 4ISBA 1U63A 3D8BA 4OOFA 5TF4A 4ER5A 4CMAA 4PLZA 1HC7A 1ZC4A 1JU3A 4IO0A 2TMGA 4WOCA 4F3CA 3AZOA 3ETLA 1ZD9A 1ENOA 2WWGA 3MIIA 1GN8A 4GE3A 1P7YA 3DOIA 3OJ0A 4TRRA 3CF2A 1WETA 5DSTA 1FUKA 3JQ9A 3TGLA 3G89A 3G82C 2BTEA 1RPTA 1FDRA 1DI0A 2UZ3A 3HN6A 3PPWA 2H2WA 2Q9BA 2X14A 1JEJA 4KGDA 5CX4A 1GIAA 5FPSA 4X64B 1UF9A 1RMTA 2YWXA 3N7AA 3TH5A 1E0SA 3ZWQA 1L3BA 4FI3C 2C9ZA 3FLEA 3P7MA 3AERA 4TL6A 4BVBA 4HNVA 4EPWA 3GRVA 5JNRA 5LKAA 1SVWA 1RC1A 1GNSA 2H5LA 2BTOA 5GVRA 1FJHA 3MHPA 2PPLA 4P84A 1Y63A 1CJTC 1XG5A 3A6HA 4MKIA 4R1QA 2IWHA 3UUWA 1UQTA 4ZHQB 5F33A 3NWBA 4CLOB 1T5DX 4JQZA 4IIFA 5IN5A 1PZGA 4OYLA 1MIOB 3EXEA 2XVMA 1N92A 1PNVA 4ZCSA 4J7XA 3VMMA 3SKVA 1AGNA 3UEOA 2NGRA 3SMQA 5HJ5A 1JFFB 3DHEA 4OA8A 3V5NA 3ZG6A 2WD7B 4KXUA 1YAJA 1UBKS 5HF6A 4BAZA 4CM9D 2I4RA 1E1DA 3RC7A 5HOQA 2GF2A 3MMZA 4V39A 4P58A 5DCLA 3FETA 2H1HA 4NBWA 4WMLA 2JHCA 1H93A 3A7EA 3MTBA 2OAP1 3HU3A 3NXSA 2JANA 1V45E 2VPPA 1FLAA 2HWWA 2VPYA 4MMYB 3RI3A 2BMAA 2P79A 4QEKA 4DC9A 1RXUA 1SG0A 2PXHA 1S6YA 1UPCA 3C8ZA 3FPEA 1GUAA 3KLOA 4KLZA 5T3YA 4X24A 5AJYA 1GTRA 5AJVB 3S0JA 1I5OA 1YCHA 3TNDA 4L4UA 3CMCO 4PS1A 2DB3A 3O4IA 2BDEA 1U0HC 4UAGA 2LDXA 1C3VA 3VPDA 1X7GA 2YUTA 2ZJ1A 3EGWA 2PGLA 4D3ZA 3HDJA 5K0TA 1FFGA 1MR3F 2I65A 4PC3A 1AY0A 3T3DA 1CFJA 1JR3A 1LPAB 3NIBA 1VC2A 3E9ZA 1K7FB 1SXJD 3LYLA 2YWGA 4Q02A 2L0XA 2WD8A 4BAUA 3DQPA 3WDMA 4YCNA 4AS2A 1MV8A 3M34A 2GHTA 1EE1A 2OXFA 1KK3A 4RV9A 3IAHA 1SU4A 4OA5A 3SZRA 1XXLA 3U3RA 1JQDA 1RFLA 2FN4A 3B7GA 3NP7A 5JZ9A 4I8DA 3GFSA 1VL2A 3QNUA 3KR2A 2QTFA 5J4VA 2R1UA 3DV0B 5AKKA 5KVVA 5EMJA 2EWMA 2ZIFA 2OHOA 3MFQA 3R8XA 4GGPA 3VPBA 3Q7TA 4F7DA 4L1KA 4FN4A 1TIKA 3Q5EA 4R7ZA 4B2YA 3FDFA 4PZYA 4UAUA 2OFFA 4DUYB 1XVVA 2W2NA 3N0WA 5CH3A 2N9UA 4OSOA 2WIKA 3P9KA 1O03A 4RFSA 5G4KB 2JARA 3IQZA 4DMGA 4CKCA 1GLVA 1EG7A 4MB0A 4ZT4A 4G6ZA 5C8ZA 3UENA 2ZDQA 1R0LA 1WXWA 4ID9A 3WB1A 4HXFB 4Q4AB 4IUCS 1E60A 1T5SA 2ZR7A 5JSKA 1TMGE 3EA4A 4QQ8A 5FUWA 5BNFA 5C2JB 2JFYA 5CB4F 4FE3A 4R1NA 2PHZA 3GGPA 1BVYF 3BXPA 3PNSA 3AJ8A 1PSZA 5D7BA 2P91A 2LGJA 4BFXA 4F5WA 2PJDA 4GPZA 4Q5IA 2X6RA 3PGLA 1YE8A 3ZNQA 4B7UA 5TVGA 4QQFA 1FUIA 5SY9A 4PE5B 3NDRA 1ZO8A 1RXVA 3OJXA 4BV9A 4X8HA 3THSA 3TLJA 5B5SA 1WNTA 1Y82A 1ZK0A 1V95A 2VJLA 1DP4A 2FMHA 2ZUUA 3HA7A 2B8TA 4BNWA 1Y6FA 2IH2A 1ZD2P 2VQSA 1WULS 4C78A 4LWQA 4YRJA 4IF6A 3PENA 3N7TA 4FZVA 1K86A 2FPMA 3RVQA 4A2WA 5CAEA 2NTVA 4TVBA 1XLTC 3KOWA 1KDYA 3VC1A 1GFIA 3IOYA 2JKVA 3AF1A 1GNRA 2C4TA 3R76A 1T29A 3IHLA 1WUIS 1RLIA 2OO7A 3G2PA 1LPMA 1U2SA 5HIKA 3PL1A 5CNIA 3C1TA 4G81A 2G04A 2JD1A 3NBAA 4DYVA 3NX4A 4BX8A 2WWTA 1VE5A 1VBNA 3PPXA 3QMMA 2ZK7A 1KQOA 4C7MA 4IXWA 2MIIA 5AJTA 4L07A 4UEQA 5C5DA 4KZKA 2XUQA 4GSYA 5KJ1A 4AD8A 1GPWB 1ZUWA 2W6CX 2RHMA 3L1IA 4NENB 2KM1A 3G3EA 1E77A 4P3KA 4YMSA 1YZLA 2BFDA 4JUBA 4E5DA 1Z5PA 3RYCB 4M89A 4DA6A 3KHUA 4AKGA 4I1RA 4S35A 1UBLS 5JJIA 3Q40A 3GA5A 4UCXA 3EDMA 4FSDA 4LISA 2F7SA 2YVUA 1DC5A 1GVHA 2NUPB 3ZKWB 3S2UA 4QTTB 2NW6A 3AJEA 5EE0A 1PL6A 1KRWA 4HJXA 4O3MA 2KPOA 2IV7A 2NTYC 4HCJA 3PXBA 4CF4A 1QFXA 3KJQA 3IJPA 3RRZA 1OQAA 4LXYA 5DPMA 2O14A 5DULA 2HF7A 2OSVA 2DGDA 3ESBA 4JSTA 4JVNA 1R0YA 4ACAA 4BBJA 2DQYA 4J3NA 2ZUBA 1JSLA 4RH0A 2XZDA 3OTIA 3LPCA 1D6JA 3O8RA 1M10A 1U8ZA 2FE4A 1ESCA 1ZXLA 3A1DA 4DT1B 2B4TO 2I9KA 2HPZA 2D5CA 2I22A 2FOLA 3COJA 2PH3A 1YRWA 4YHBA 4M87A 1W9MA 3HXQA 2OCKA 2GCOB 1T2AA 4NCBA 1M2VA 3UJ7A 4FYHA 3TNLA 1YZNA 5JXWA 1BDIA 3LV8A 1F12A 3RHTA 3E9RA 1GNVA 1YZTA 3SE7A 4Q9AA 1WABA 2AKAB 1J0AA 4HQ0A 2ECKA 2ZJOA 3JQPA 2BISA 4CLRA 1QRUA 5HZMA 1XUOA 2XT0A 3D6NB 3PV0A 2V3WA 3S1AA 1S01A 2VJPA 2PO7A 3WL7A 1Z74A 4AUKA 1H69A 2Y4NA 4R41A 5B58T 4N03A 3CE6A 2GPYA 1M75A 3K2QA 4IHQA 5J9FA 4DLYA 4YK7A 4ZJZA 1A9OA 3UWOA 2Q1XA 3DNMA 5E4TA 5FA5A 4H1TA 2E55A 3VZDA 3PFHA 4REMA 4Q7EA 3H3FA 1U9IA 2XZPA 2IOYA 3FPHA 4LSWA 1Q0LA 2ZRQA 2MU1A 2R25B 3UZUA 3GLGE 1QX4A 2FRDA 4EPXA 1B16A 4R01A 5BVGB 3UMJA 3UA4A 2J9RA 4RTQA 1GAJA 3V4ZA 4JEIA 2ZBGA 4C4AA 4ODIA 4D9HA 4D4JA 1O08A 1D4FA 1YK0A 3GCDA 3TW4A 3VHRA 4YRBA 5IT4A 3S1SA 4OHYA 4IR7A 3IHWA 4C21A 3BMQA 3O1HB 4ETWA 5A4JA 3L92A 3MRVA 3GFQA 4MGIR 5AW7A 2CT8A 1RZVA 2OBMA 1EGVB 4URVR 2I29A 1AT1A 1E2NA 4GECA 2VK2A 2PKXA 1UZNA 2OXRA 1SEVA 3QYPA 1S2LA 1KYVA 1IAQA 4DMHA 4FI3F 4G36A 4RLHA 1T36B 1A82A 3VKWA 4BNUA 5FAKA 3JZDA 3HWSA 1DBSA 3D59A 4RS3A 3DOHA 3I9V1 2W2KA 3O9MA 1Y4ZA 1H8HA 2ONKA 2OV3A 4INAA 5AXCA 1GL3A 2FUNB 1BROA 3ZH2A 4E88A 3SQOA 4QOGA 3K9NA 1I33A 2CNLA 3AZPA 1T9AA 3HEBA 2ERCA 4II2A 3IKTA 1ORWA 3H1PA 1QGAA 4XSHA 2ERYA 3AEUB 3HCDA 4KYUA 4D3YA 4YJ3A 2C95A 3C3WA 4IIBA 4BKUA 4COOA 2BH2A 2NO6A 1W47A 1YA4A 2A57A 4CFSA 3IAXA 2RGYA 5B53A 7ABPA 1Y9EA 2OFOA 2PFGA 5LIPA 2WIBA 5LVAA 3M1LA 1X7WA 3SX0A 2WWFA 3NZEA 4O4IA 1VB3A 4FE4A 3PEFA 2VCEA 1WV1A 3TLBA 4GZMA 2ZB4A 1P73A 1NSYA 4IV0A 3HY3A 5CBKA 4XPZA 3T9FA 1ARZA 2OESA 2XH8A 3CVOA 2G9UA 1KEEA 1KPHA 1QG4A 1VGQA 2B37A 1KK1A 1YRQA 2OEPA 3GJSA 3TDNA 1LK5A 4N3GA 1Q83A 1V5IA 2HQRA 2V7QA 4AWBA 4MGKR 1AKEA 2B78A 2IFTA 2XCQA 5EEGA 5DGDA 2QUJA 4P8RA 4A5SA 4DNFA 1AUPA 1SOWA 7GPBA 3LT5A 4QG7A 2OCBA 1BKDR 3HCOA 1FTWA 1KVTA 1NOIA 3ADCA 5FLEX 4N1AA 4L28A 3Q3JB 2CYBA 2WKPA 3E9QA 4DIFA 1Y3CE 1Y6GA 4QPDA 1JDNA 2AJCA 2PZEA 4M9CA 4DR5B 1USVA 3FNIA 4DV6B 3KQUA 3C6ZA 5GOZA 1WPQA 4U9UA 3MLEA 5LKRA 2WTAA 4JODA 4UM9D 1NF9A 2HYDA 4UE3S 5IBPA 3RRMA 3R3VA 4X95A 2QP4A 1FSPA 1XTVA 1Y6ZA 4MS4B 2GZMA 1XCGB 3ECSA 5FUXA 1BGVA 3F46A 5LYJA 2I2FA 2WWHA 3NXKA 2AK2A 5CH5A 4BCDA 4OAPA 3LD9A 1X80B 4XWYA 2J0EA 2H54A 2HH9A 2VF5X 2AI2A 2XY4A 2WYIA 3KTOA 3Q41A 4JQYA 4PG7A 4RVUA 3TOCA 2CFIA 2J4CA 3AHIA 2ET6A 1E9AA 2LRHA 3GB9A 2OM6A 4MQ4A 1UAGA 3EFOA 3FNRA 4TS4A 5ELMA 4C43A 1W2WB 5KOJB 1Z4NA 1SVKA 4XYGA 1UJNA 3AJRA 3LBHA 3R9XB 4AF7A 1YF3A 3WL6A 3PGJA 2WF6A 4EECA 3OQMA 1CZNA 3EOAI 2PRYA 3C6MA 3NB0A 1GUFA 4GR9A 2NQ2C 3IPCA 1XVUA 1H3FA 3HMKA 2IHKA 1XA3A 2R4UA 3GMTA 4MW0A 5F98A 5BRAA 4X1OA 2Z2ZA 1JSZA 2EJBA 2ONCA 2YRXA 1U3CA 3WTBA 4GUAA 2FPPA 2YIMA 1YA6A 1KYYA 3UATA 4WK6A 3PTZA 1V9LA 4YUVA 1ECPA 4MQUA 2ZS8A 3E27A 5E9AA 2FVYA 2OAQ1 4ZAZA 1SVLA 4BMZA 1AX9A 4FPXA 4TS1A 2Q6OA 2NXNA 3R6LA 4UARA 5D8DA 5B2FA 3K92A 1MAAA 2HIHA 3R3JA 4HHEA 1TTPB 4ZCRA 4YBZA 1OMOA 4H17A 3WR5A 1YJ5A 1A2BA 3W8NA 1N1GA 4FFBB 4MMZB 3WLFA 4CM8B 4B3TB 1PQUA 3QVSA 3NAZA 4XVRA 3O5AA 3QQPA 2EFEB 7YASA 5JZSA 1HOXA 3VR1A 1TUGA 2A14A 2C3OA 1NI5A 4PHFA 3CR8A 4H7KA 4URXR 1EJ6A 4CQJA 4AJ9A 2H63A 1J24A 3I09A 4BX0A 3EEFA 1ZAYA 2OB1A 3N9IA 1CB7A 1JNXX 4ZAGA 3SIPA 1RJ9B 3TCKA 2UV8A 1R9MA 2II6A 1C9YA 1FBNA 1FRVA 3H05A 2OQVA 4D98A 5C7LO 2LNDA 1KY2A 4RENA 2XTNA 3Q8XB 4Y7DA 4F6RB 3SHOA 3QK7A 2DX7A 4Q0MA 3AKZA 3UANA 1E2DA 2XZTA 4Q19A 3AWDA 4DBLC 5FHRA 2WQ7A 5A2GA 1OX5A 3BD7A 3NS7A 1NONA 4KO8A 3IOCA 3WWOA 1RTTA 4H0CA 4JOCA 3TPZA 1H05A 3E1GA 1WMFA 3O92A 5J2TF 5FT9A 3DEAA 4TVKA 121PA 4UHCA 1QIFA 2DBRA 4JEUA 2VH1A 4PSAA 1CVLA 2WU4A 3RS7A 5B4TA 3ROPA 2G71A 1ZMOA 1X38A 1ZW6A 5K0ZA 1VYTA 2AV6A 3RS9A 3R4CA 1Z6TA 3ZCVA 3UM9A 3CRRA 4CL3A 5A3JA 4KR9A 3S8YA 2A0WA 2HHLA 5AKZA 1AA6A 1FF9A 3ND5A 4LHYA 3PJFA 1YHZA 1YZUA 4I66A 4DKJA 3OVMA 1AOXA 2RHOA 3F5MA 3PDCA 3SEAA 3C6QA 1Y81A 2RKBA 3AY3A 3Q7RA 2RGEA 1A88A 3U39A 2FG6C 1E0JA 4YRSA 4KSBA 3LOUA 5GONB 3DXFA 3C14C 4WBSA 3B1JA 3N2NA 1NV8A 4RJJA 4Z7NB 1H9CA 3JWJA 2HSZA 4EGQA 3HYRA 4I55F 2OA0A 1NF2A 3OPYI 1YO6A 2R65A 3F3SA 2ZSIA 1FCJA 2A9OA 1XTQA 4JMPA 1KJWA 2W48A 3VR6D 4EG5A 5AUNB 3MK31 3DLHA 1ID1A 2YFKA 4H77A 3RSGA 1IIRA 1MHPA 4B6SA 4TLDA 3S55A 1QDLB 5IC6A 1CCWA 2C9OA 2HZ7A 2M2IA 3IJEB 3V2IA 4DR6B 3BWDD 1Z4OA 3BGVA 4LTNA 4YRDA 3ROXA 1B26A 4CQLB 1G8PA 4D82A 1KMMA 1LGYA 2FFBA 3A1CA 3L7JA 1QRAA 1VM6A 1XCOA 5JWHA 3C5HA 3L8YA 4XDGA 1EFHA 3R7WB 1ZY2A 5JRZA 1Z38A 2MYUA 1VJRA 4U5XA 2ZFUA 3QFHA 1TQ2A 5C1PA 1U1CA 5C4GB 3ZPXA 4IOJA 2PZLA 4WZBA 1RPJA 1P4RA 3F4KA 4QDXA 3CCFA 3SJCA 4JROA 2PJUA 3QHQA 2B3DA 3U17A 4GMKA 3HFRA 3JQAD 2ODAA 3VPFA 5CVEA 1JW9B 1XTPA 2EGHA 3M4XA 5BOVA 2PRIA 4X1IB 4PSUA 4JH0A 3JTMA 4CJXA 4BCCA 2OCIA 4MI3A 2FFJA 1V9CA 2HJWA 4B3JA 3L1JA 3KKQA 2ZRHA 5CJ2A 2EFCB 1OBOA 3IS3A 1Y6RA 3CLKA 3JD4A 4KDCA 1NF8A 1A9TA 4G07A 1KO1A 4JT8A 1AZWA 1JHMA 3DZBA 2B2XA 1RRMA 3TQHA 2ZW9A 1JEOA 1VI6A 4DCSA 4DWJA 5ED0A 4N41A 4H0FA 5KTNA 2ZYRA 2I99A 4BLPA 5IVPA 3W4JA 1KEVA 2GEJA 3QKSB 3K30A 4RZ2A 5TY0A 4EL5A 5CDTA 4FOPA 4CN9A 3KJIA 1UP6A 1OHHD 2YASA 3NEAA 3PDIA 1QVZA 1TFUA 2OR3A 3KBBA 4DGSA 1AQYA 1OGIA 3AR9A 3DYIA 5I9SA 4FYMA 2VJMA 2CJPA 4H4DA 5HYVA 3T3NA 1YUBA 4B8WA 2BEWB 2F43A 1I3KA 1YB4A 3PIDA 1DZ3A 4W63A 4OHZA 1FP4B 4AUMA 2NSHA 3K4QA 2JJ1D 4ZVRA 3KQOA 4RXUA 2XMCA 2YW2A 1PGNA 1Z45A 3NBQA 1N2EA 5AM1A 4M7OA 4R71A 3OF2A 4YXFA 3NIWA 3B53X 4YO7A 5J59A 4HKTA 2JGEA 3IMEA 3OH8A 3FDXA 4ZTBA 1E3IA 4I7EA 4PXYA 1NURA 3SR3A 5ALGA 3LE8A 4P86A 3VAZA 5IF3A 4WT7A 2NXWA 2AFHA 5HMLA 2PKWA 3ND8A 4DHWA 1IXSB 1SXGA 3TCXB 3USES 1XTZA 1JIKA 1U8CB 5K0JA 1V2GA 4KMSA 2GJSA 3CH6A 3PZBA 1YZGA 3ZI7A 5E7QA 4TXHA 4DWVA 3ZW7A 1FW6A 3FVRA 3T5AA 3EQ9A 4C76A 1UUFA 4KI7A 2OZEA 4QGHA 2ZJ0A 4XQGA 3OQPA 1E7SA 1I3MA 1NLZA 3WMGA 3L7IA 1F8UA 2G4VA 4R5HA 1F06A 2OZPA 3F71A 5DM0A 3WXBA 2NSJA 1XYVA 3JQFA 4ADSG 5A7HA 1DWUA 1ADJA 2HSWA 1SCUB 2IYLD 4GX1A 3RWMB 1LUAA 3NOXA 5A5GA 2ZCJA 1IYZA 1SHZA 4GVPA 4QZVA 1ZWKA 1C1YA 1G5FA 1YS7A 4F4FA 5CBPB 3R0VA 1RD4A 2JCBA 1MH9A 3QSGA 4DUGA 5K20A 4OLBA 1VCOA 1QRRA 2VPZA 3PP8A 2DHEA 3QEOA 4FGJA 2HI0A 2XUGA 5I9NA 7MDHA 5G4LA 5ITSA 4DNOA 4P35A 1Q0QA 1UDCA 5C81A 3FCXA 1QM5A 1Z0ZA 3D3QA 1VPWA 1K7CA 1OT3A 2OILA 1L3CA 1JQJC 3ZNOA 4J1TA 3JYNA 4F85A 1F8FA 3IAFA 3KR1A 3HKCB 3L6CA 1WU8A 3LBNA 4RGVA 3EZ2A 4WCFC 1DAIA 2VBGA 3FWHA 5CRIA 3RVMA 3VHLB 3QGMA 5DYWA 1KOJA 2VJOA 3A25A 1AUXA 2AJDA 3FSEA 3HP7A 2NT4A 1MTZA 1T4MA 1D3AA 2Y1OA 3LT2A 3ND7A 1SOVA 3O95A 1P77A 4RV5A 4TN5A 5CM8B 4WQMA 1U1DA 2MDTA 2VYQA 5LDGA 4M9RA 3K05A 3I0NA 1BU8A 3DLAA 2Y1DA 5M2QA 1Z7WA 2EZ8A 4BLUA 1FTNA 4ALMA 3K5IA 3JQ9C 2BGGA 3D7MA 4PLCA 3DF9A 2O2EA 6CHYA 4FEAA 1NMSA 4UAJA 1JR4A 1L1FA 2Y1GA 1Y6QA 1EHYA 2B8EA 3EC1A 4RXMA 2NPFA 1I7NA 4ZICA 1EVIA 5AJHA 1F7UA 1SA0B 1IM8A 1WUKS 3CWCA 2R751 2C9YA 3EBPA 5ALUA 1HWYA 1KI3A 1X39A 1RE0A 4KPGA 2E4AA 5LQNA 1FU4A 3WJAA 2FPWA 1Y1SA 4C4SA 4IPTA 1QK3A 3L7OA 1QRDA 3SCZA 3JQGB 1MHTA 1Z06A 2ETVA 3WGVA 2A7XA 4QARA 4NFYA 4P7KA 4YUXA 4JI0B 4ARZA 3UCEA 3L6EA 1BQ4A 2VPIA 4RMIA 2QSUA 4RPKA 4Y1FA 4KLCA 1QC5A 3PEWA 1Z4IA 4QJ3A 5L6MB 3L0YA 1EXMA 3A9TA 3OTHA 4KN9S 3VOBA 3QVTA 1FTGA 5E7MA 1U5AA 2GN6A 3UUGA 3K53A 1Z88A 4AKTA 3NAQA 1ZBQA 1RLMA 2YCBA 3H11B 5EESA 3QBVA 4YJFA 2P9HA 3H9EO 1ZUNA 4B3BA 1HO3A 1T3HA 3DUFB 1RBQA 2YS7A 2Q5IA 3GN1A 4FZ3A 3IQGX 5G41A 4YX9A 4I1PA 5T41A 3L7YA 4QE3A 1QANA 1HDCA 5LOVA 3RYHA 3I6MA 3HUDA 3NHSA 5DJ5A 1Q1QA 3N5KA 4JXKA 1SD5A 4RGBA 3T3HA 2QQ5A 4C89A 1UBTS 5KSYA 3RAFC 2H8GA 3KJHA 4MR7B 4UUNA 1QG0A 4ZQCB 4FJ1A 4MUAA 1XZMA 3RAGA 2V9PA 3SLGA 1Z39A 1IPEA 4TVSA 5J2UF 4LJ6A 3C7AA 4ER3A 3DDSA 2OCPA 5DASA 5AW6A 1JEAA 2PZ8A 2J6CA 3HABA 2ZRLA 3PHGA 1HEYA 2BHNA 2IXEA 3AFGA 2FEKA 2GK6A 4D2IA 2HKIA 1TJNA 2Z43A 3BC1A 4TSRA 2D8AA 4DEYA 4NRDA 4QX6A 4W5JA 4ZMRA 5L3QA 1XA0A 3IE2A 2PG3A 1IFXA 4UTZA 1WR8A 1O96B 1CG6A 2ID4A 4FDVA 1DG1G 1V7PC 3G1TA 1FXWF 3J7TA 4XRGA 4B6EA 3ZXSA 1A7UA 3BWBA 4EEZA 1C8LA 1DIHA 1ZIOA 2A0YA 4IMIB 2QXUA 4DA0A 4C6RA 1W4CA 4NHOA 1YB2A 1NUHA 1UBRS 2Q28A 4M6WA 3EVGA 3ZE7A 3M2PA 3NTVA 3AESB 2ZJZA 1XU9A 1Z6QA 3U7QA 4IXDA 2C8VA 3RR2A 4A0FA 1RAAA 3FIUA 3N05A 1JS1X 5HBRA 4NCKA 3RUHA 2E0IA 4Z0PA 1JJAA 3I0ZA 4KMMA 3H9QA 4C0XA 1E99A 3OJFA 5DI9A 1Y9AA 3ACBA 5A7GA 4CKXA 2NT3A 2P65A 3U7HB 1IM2A 1Q15A 1Y5NA 1NYRA 1SRRA 3DVAB 3V42A 1K68A 4OGGA 1WCXA 1O97D 5HCIA 2Q62A 1XAHA 1T6ZA 1I2DA 4BRZA 3THXB 3LZCA 1PP4A 4HBGA 1QIJA 2NU9B 2AJ8A 1GXSB 1I2MA 1Y9ZA 1PQ4A 1CUDA 1V2HE 3HUTA 4O4LF 1N2ZA 4PTZA 4TGLA 1K5DA 4C20A 4V38A 1J70A 4NSNA 3AL0C 1TL7C 4O25A 2AF4C 2HMSA 1WIWA 2TECE 2VQDA 2Y3IA 1WPGA 2BHTA 4ZYZA 2LVBA 3ROQA 3V1YA 1KTVA 1WB9A 3LUHA 3PUVA 5J40A 1J8FA 4JGGA 3KT6A 4LZWA 5T4EA 4O2AA 3UBTA 3D4OA 2CKMA 1J25A 3IHTA 3GYGA 1XRQA 4M37A 4RK7A 2CYCA 4W7IA 5SZHB 1T1GA 1Y5MA 1IZ0A 2YHAA 5E6UB 2GCNA 3K31A 1A5SB 1A9PA 3LX5A 3VKFA 3KT8A 4B33A 1H4TA 3K1JA 2V7XA 2BSXA 2FOIA 4NJMA 4CI9A 3KRTA 3N8DA 4M0DA 4CM5A 2G9QA 4TZ6A 3AHCA 2EJUA 3QOYA 1R0KA 1CQPA 1VJCA 3COPA 5A9TA 2QKYA 4AG6A 1MO4A 1BS2A 1LDBA 1HNZB 1EK1A 2DBQA 2FZ5A 1I7PA 1COZA 2BEUB 2PWAA 5M3BA 4GOMD 1H1TA 3X1KA 1PS0A 2IQIA 1U7WA 4HDRB 2MOKA 2VP2A 5F1OA 3NWOA 1D2RA 4FT4A 5I4IA 4WNCA 2RHDA 1A9XB 1FSGA 4JELA 4QAJA 2FFQA 4LG1A 4YVFA 2BY4A 3TUJC 3HN2A 4C3UA 4RSMA 4ER0A 2DRIA 1ZVMA 2ZSKA 3OFKA 3CPJB 2YXDA 4BFUA 3SYTA 4FNMA 4DMRA 2G8NA 3UC5A 1GU1A 1MABA 2EYQA 4PGHA 5HJEA 4JWTA 1CQJA 3NBFA 3PB3A 1M34B 3OZFA 1K6XA 1R0ZA 4K03A 2E4UA 3BZBA 2CDNA 2HU5A 4UNQA 1KWGA 4X6LA 2AX3A 2BSAA 2DPXA 2V1UA 2XGOA 2WJVA 4GYJA 1VZ3A 1BXRB 1ES9A 2VHZA 3H18A 4P34A 2QF7A 5EA2A 5FOVA 3M6LA 5KS2A 3AM1A 3KR9A 4F4CA 4I50F 1GHTA 1A9ZA 1D8TA 1XF1A 1K3FA 1KO8A 1AD2A 1IY1A 2JGFA 2ORWA 3FR7A 4FEEA 4ZEOA 2UYCA 1IMOA 1QOZA 4ZC8A 4PVCA 1OLXB 1OFGA 5C37A 1WUHS 3ZTYA 1KOLA 3QPDA 3R6WA 3KQYA 1RFGE 4A73A 3BWCA 4HN4B 4LHEA 2PSJA 3B1VA 4WI1A 4XD7D 3ELUA 4HDKA 1KAHA 5HRCA 2EGGA 1OFVA 1X8LA 4IHJA 5HXAA 4DV3B 1D2NA 1G4UR 4FW9A 3SBOA 2QYOA 1M1ZA 1YE5A 1CUZA 2F1IA 1I8TA 1N9KA 4GX2A 2OLEA 4N0DA 1L8XA 8OHMA 2IRWA 4HVCA 5KWJA 4A8PA 5BYKA 4N6OA 4CIWA 1CETA 5AD1A 5DBOA 5DSZA 2GZ1A 1F2DA 2VAPA 5GJCA 3FD8A 4YR9A 1TB4A 1KIAA 3UOAB 2RKWA 1W8DA 4F9EA 1UAYA 5AIBA 3S5UA 3B89A 1B8UA 2E3JA 2QA5A 4CTOA 1ZI6A 1BMFA 4F46A 1U9IC 4ZQBA 2IX3A 2F3QA 2FRDC 2OVBA 4NZZA 5DLPA 2AG0A 3C7CB 1L1RA 2HO4A 1N0IA 4Q1CA 4RVNA 2IPXA 5ALSA 3V55A 1TO2E 2R5NA 3STYA 2NSYA 4XLZA 3BL5A 1YQQA 4EELA 2EATA 2JLYA 2PX2A 1FUYB 5F2EA 2WJIA 3QBEA 2PKEA 2I6UA 4ENTA 2BGWA 1II8B 3GNQA 3K2BA 1ATIA 1NJ1A 1IWBB 1QP8A 2C92A 2Q5HA 3N70A 4RKYA 3RNLA 4ALKA 4POAA 3BSFA 1QVWA 1X14A 3FCUB 3NTUA 4E0BA 5ADVA 5IHXA 1ZU5A 2WP0A 4K9QA 4NZ9A 3BZUA 9ABPA 1QZUA 1RWNA 3T3OA 4LJ9A 4YP9A 5BN3A 1HDEA 4FHZA 1S3IA 3Q7SA 1LZKA 3ORQA 2AW3A 4TWZA 4F5YA 3CLHA 3R0JA 4BWYA 1YVPA 2ACEA 2ZUEA 5EP2A 3WSVA 4X85A 1JLSA 2RHBA 1JI3A 3HLKA 4J29A 2P30A 2DUJA 4N0QA 1V8DA 3RUIA 2QB5A 1WDLA 4LJ7A 1GQRA 2ZYSA 3MS7A 5JZVA 4LRTB 1MXFA 4ENVA 2AFIE 4ND3A 2PT9A 4KP7A 1A8PA 1GZ6A 1REQA 1ZYUA 4BE9A 1J21A 1M6YA 4MQFA 1U28A 3B13B 1PS8A 3RQSA 4YMUA 2QSJA 1CJCA 5FBRB 3OD1A 1L7AA 4X8MA 5H02A 1Q44A 1OPXA 1JIVA 1G8KA 1AKVA 1P2FA 3I4CA 1JAXA 1N5JA 4B3GA 3TNFA 1V25A 4ECEA 2C2GA 3RSCA 2C0QA 2FN7A 4E32A 2YYAA 4LHWA 3PGXA 4XD2A 2QY6A 4N39A 3MPOA 2B21A 3EHEA 1KNXA 4UATA 2LTAA 3GMSA 3TIVA 1IMJA 2C2WA 2WFZA 3V4PB 2HYIC 5GJBA 4M9ZA 5FKJA 2VNJA 2GR9A 5H68A 4XWWA 2QORA 1FFXB 1GITA 1K8RA 2ANCA 3HVRA 4JEMA 2NUTB 1NR5A 3OKAA 1WZ2A 4PNHA 5EQTA 3BWXA 5BV1A 2YVQA 2GXSA 1ONSA 3MM4A 1TYZA 3HPRA 1GYQA 2PSSA 1ZOLA 1QB8A 5KBYA 4CU5A 2Q5LA 2WSMA 4IJVA 4WEOA 1KMIY 3WNCA 2HC9A 5KNDA 2F4NA 1LQUA 2H29A 4OXQA 4R8VA 3WAJA 3TSYA 1CP3A 4AQYB 2YCLA 5A5FA 1BS1A 1Z68A 4G5XA 2NVUA 4P31A 1F2UB 1BFUA 3I05A 4PZ9A 1SCBA 4Q4DA 3H9GA 3NHAA 1EPUA 1QQBA 2XSZA 3O83A 2C07A 3RRBA 2V7TA 4D6PA 1C1XA 3DF7A 3GMDA 1DBRA 1OGYA 1XJCA 4UQLA 1T10A 2H5EA 3AFHA 4AO6A 4IW3B 3ZUPA 3O8BA 3LP8A 1DBWA 1C1DB 3FHJA 3VJMA 1KU0A 1USUA 1U0EA 1VCIA 3N28A 3QPWA 3W5BA 1DRWA 3K35A 2MSCB 4LOJA 3W6PA 4FFMA 4A27A 4AUNA 3MSCA 3W5AA 1OAOA 4NBKA 2KX7A 3V80A 4A8TA 1E66A 2ZGVA 1LW7A 3MRSA 2F17A 4U02A 1L7PA 2N1MA 5DNAA 2ZYVX 4WE3A 2DY0A 2VWQA 3WS7A 4Q12A 3SF8B 4RA6A 2D74A 2I6FA 3BMXA 3F4LA 3P5BA 4OHWA 3SC3A 1T8WA 1E59A 1JP7A 2DFPA 2RARA 4NOLA 3U3DA 2XA2A 5HZGA 1PR3A 4RK1A 2UYOA 4US0R 5JHGB 4Q47A 2ZVPX 4TT8A 1D2AA 2WWXA 1QQ5A 3EIEA 2FPRA 4Q24A 5ALQA 2F62A 3FWNA 2SICE 4V03A 2PN1A 1S9HA 4QO8A 3DVRX 1QAQA 4LV5B 1EFKA 1NVBA 3RAEC 4GC5A 4S1TA 4HEHA 2QIOA 4X7MA 4XDZA 1QFMA 4GL4A 3C5VA 4O29A 4ZMBA 1QO7A 1NA5A 2MR5A 3ASVA 1A9QA 3ME5A 2IBSA 5C5EA 2HIMA 4ZVTA 4UAVA 2WU1A 1FRZA 4RY9A 3KQQA 3LSTA 3RS4A 1YMVA 2QIPA 5G3ZA 3REQB 4YRAA 3C45A 3UG7A 4D8TA 2PWPA 3I5YA 1LV7A 1W9HA 3ND6A 3K15A 2YV4A 4KVGA 2YZ2A 3O75A 4KSYA 4RPJA 4BWFB 5AHOA 2CDCA 4O2BF 4PYLA 2AK3A 5IBRA 5JRJA 5H4HA 2PUFA 3RS3A 1EBBA 4TWJA 1IPHA 2PD4A 5A06A 2BEJA 5HF9A 3E23A 4HQ6A 5ALFA 1OPRA 2BMJA 3BOSA 2GYVA 3LH5A 3TVTA 2QMHA 4MR9B 2J0VA 2ODBA 4IY1A 1XZLA 4UHHA 5JAUA 2BD0A 1DE0A 4FD3A 1C3EA 5KHOC 2BMVA 5KYUA 4DPKA 3GPDG 2G5PA 2C5BA 1YR7A 1P5FA 4JVLA 4F56A 4UBNA 4LK2A 5DV9A 2ODEA 5JVDF 2A0KA 3NVDA 2XOXA 4XM0A 1SXJA 2CGEA 4UM8B 4CDGA 1YR8A 2JEZA 5L3RA 4QOIA 4ZFNA 3FYUA 1GRVA 3HYLA 4HFJA 1JB9A 1I14A 3FCOA 4KIWA 4MRSA 4EUNA 3UMFA 1BGWA 1JF8A 3O8NA 4OFXA 3W6ZA 1GZ4A 5BMVF 1FMFA 2X0DA 5FIUA 1B14A 4NEGA 1M83A 3KKKA 3UXMA 2M6RA 4AMZA 2XR1A 1QG6A 4QNNA 4NYMR 1O87A 1XN1A 1Y4DE 1VCMA 4D3DA 1H2HA 1G2QA 3M33A 1ZH4A 2X42A 3SIRA 2I8CA 3QYAA 4WKGA 1WMBA 4U0KA 3DFKA 4DDHA 4FBLA 2C97A 2IYFA 2Q8PA 4QPJC 3DHWC 1XMPA 5CFQA 2HSDA 3VH3A 1WXEA 5M34A 3O8QA 2Y0PA 3H7IA 4Z54A 5BSGA 4NYMQ 3QFRA 1A9RA 1L8LA 1ZIYA 2Y1EA 2BFMA 5ALVA 3ZEIA 4TTSA 2MYNA 4RTPA 1UK8A 4TXMA 3AFOA 4EKNB 5GZ1A 1NBOA 1JQ5A 1EQUA 3PX2A 3AW9A 3I64A 2IDMA 3PI7A 1NN5A 5BQFA 2JFNA 5GZ3A 4RULA 3SX4A 1U7XA 2XT6A 5FYDA 2BKAA 4PV7A 2WNSA 2OBXA 4FDMA 3MQ2A 3DFUA 5HM8A 2FSVA 2R1VA 1AKMA 2C8JA 2RMKA 1X6VA 2OV6A 4GPIB 4OBEA 5BUQA 4WLUA 5IJ9A 4D74A 1E32A 1BEUB 1XXHB 3BRWA 4AO7A 1S3FA 1WZNA 5ITWA 4XTCS 2WVHA 3ETCA 3P0IA 3KLNA 5ALLA 2BKXA 4YUYA 3H5IA 2GVZC 1UJCA 4HZIA 4Q7KA 1CRZA 4F60A 4QEZA 4YWJA 2O8NA 4YASA 4F6LA 3EXG1 3LUKA 1P5HA 4R9RA 1Y9DA 4RK0A 2VNHA 1SQ5A 2H31A 2H7CA 3H42B 2XHEA 4JGIA 4OJYA 2B3TA 4KPFC 4A6PA 3T95A 1XZGA 3ET4A 1XRJA 2A9FA 1EVZA 2CJWA 3G88A 4FX5A 1H22A 4HYEA 3FNFA 2VSOA 4RQBA 1RKQA 3AEQB 4G1BA 4WOJA 4EPVA 3O6VA 1CRPA 1Z18A 3MQ4A 4Y67A 3PFCA 1QQ6A 2R48A 4UEWA 3G5LA 3O8OA 4Q37A 4YYEA 1YVDA 4PAMA 2CFTA 2WJWA 3OY2A 4GYWA 3LS2A 1ZGBA 4RLSA 4F8EA 1FP1D 1GT6A 2YIJA 2ZSDA 3EVDA 3OPNA 4GLOA 4WNAA 5FTWA 1FFHA 1WHTA 1PNRA 3TE7A 5ER9A 2CHUA 3NKVA 3WG9A 3E0QA 3OQ1A 1KNQA 4YRIA 4JWKA 4BDTA 2HU7A 2ZSJA 3U4MA 1SO8A 3L7DA 4O4IF 4KO1S 4DLBA 3K8YA 3ASUA 5IJ0B 5E3IA 5E2BA 4WRRA 2B69A 3I32A 4N47A 1XQ9A 3FOAA 4UFPA 3VDRA 1CIVA 3UGTA 4XWOA 2YWRA 2CXXA 3JALA 3B78A 4F0JA 4Y3UA 4P4LA 3BERA 2HJRA 3DTTA 4JJ7A 1RS0A 2ZDHA 3G17A 3LFUA 3NCTA 3W5CA 2ZROA 5IFLA 3U19A 1CEQA 4A5OA 4JLDA 4WVFA 2BL4A 3LPMA 4K9KA 2BGKA 3RV3A 2CKDA 1OA0A 2UUAB 4GFDA 1P2GA 5CJPA 3A27A 4HQOA 2WQZA 5AW0A 3MGAA 2X3UA 2Y1WA 3EGEA 2QN1A 1WNFA 3ENNA 3MCZA 4ZI5A 4AVYA 1B73A 1Q17A 1U3WA 1VHJA 3DTVD 4ZAVA 3QEAZ 4R1MA 4QODA 4URUR 2OC9A 4YDQA 1KYIA 1RXYA 3ZBTA 3IDSA 3RYCA 2HV8A 1XQXA 1EK0A 2JLBA 4WEQA 5EL0A 5J2TB 2C9CA 5AOAA 5K6AA 1B74A 4HRYA 1W76A 3MJCA 1H2YA 4NY1A 5EUMA 3TIXB 4LGYA 5LYJF 4PHCA 3RSFA 1U9CA 5DBHX 4N54A 1N6NA 2VNKA 1KP2A 3CVVA 2Q2VA 3JQFC 5E1DA 1VPEA 4HSEA 2BHLA 2DQ4A 5HF8A 1GA1A 3SKYA 2UYHA 2OQ2A 4A8HA 2ORED 3HO1A 3EAGA 2ID8A 1JHXA 1SY7A 2R96A 2X9VA 2HRRA 2WBLC 4TKMA 3OZ7A 4TYMA 3DWGA 1CULC 3T8YA 9ATCA 4D56A 2JLRA 4GLJA 1EG2A 3RE1A 3HU5A 3TRIA 4CR7A 4DMLA 3ENWA 4ML3A 1K89A 4QHYA 4Q4HB 2HV9A 1ULAA 3SK0A 2BW0A 4O4JA 4LKRA 5A3SA 1J39A 5TS3A 3TBKA 1ODCA 3LBFA 3THYA 3FFBA 4UUQA 1C7JA 4LCEA 1HSOA 2Q1SA 2ZIVB 3CNQS 2AT1A 3EG9B 2Z2YA 4MGEA 3W05A 1SKYB 1SUCA 2DQSA 2VPXA 4GI1A 4NMLA 1OZFA 1T3GA 3GNTA 1J2YA 1H3NA 4P1ZA 4P93A 4RZIA 1U80A 4DG8A 2O54A 1JTEA 1AS2A 4GR4A 2H9YA 3QKUA 1NX9A 3I5AA 4TQ9A 4RDCA 2XJ4A 4MICA 5A1TA 1ZK1A 4FNOA 5EWLB 3EOZA 3ANXA 2G08A 2LKDA 4YMTA 4TRJA 3QQ5A 3LQ2A 2BC9A 4DF3A 1BHO1 3P2IA 3DE6X 3LQFA 2W4IA 3HZRA 4OK3A 5IXYA 4HDNB 4IX9A 4MS3B 2QM7A 5IULC 3HEAA 4AC9A 3QEMA 4BPBA 1Q6YA 2QXYA 5K4AA 1B1AA 1VTKA 2A59A 3MWKA 3UUEA 1NVGA 4R98A 2H59A 1AF7A 3MRTA 4JIMA 2QDKA 1ENZA 1KI9A 3SR0A 4AZ0A 3PA8A 1CUEA 1F38A 2JC3A 1NMEA 5K3FA 1TMKA 2JA1A 3BFKA 2DBYA 3L0CA 2W8BA 5DNDA 1OROA 5CCEA 2XB2A 3TRKA 4IV5A 1QV6A 3MXOA 2BPOA 1F0YA 1KSGA 4G5RA 4BEBA 4I3GA 2IUEA 1YA8A 1SB9A 3FVVA 3FBWA 3H2BA 4ZTZB 2CHGA 1XLUA 3H1GA 3LGXA 5KJ6A 1J09A 4G0ZA 1EK5A 2VF2A 2HSJA 1YMQA 3KTAA 4NJEA 5H7XA 2OHJA 3O8DA 5KQRA 2HLNA 2G1UA 3ZGNA 2RGNA 3FUCA 3ZI0A 1DCTA 1JDJA 5AK6A 1GTSA 1Y33E 1T4CA 2X3FA 1UH5A 1J2RA 1AK9A 2VDWB 1A7KA 3RGGA 5HK9A 3FPJA 1GGKA 2X0NA 1FNSA 4ZJPA 2HLPA 1H5UA 4JT2A 4D1YA 1YVUA 5CXXA 4J91A 4LNAA 1MENA 1XZJA 5ESWA 4RZQA 4DV4B 1Y3DE 2PUBA 1EE9A 3LLUA 4HN2A 1DB3A 4B3IA 4F96A 1TGYA 3KB8A 1XJQA 3KHKA 3C8MA 1V1RA 1I9GA 1IUOA 4MP3A 1UPAA 1I4EB 5ES3A 4DCTA 4F1WA 1I2CA 1GAEO 1XTBA 4HH4A 3D2CA 2UYGA 2D7DA 1U0GA 2ZXEA 3Q85A 5FULA 2Y05A 2YMMA 2YHIA 1CQWA 2B7CA 3VU0A 4OX9B 1WXXA 4K46A 3ZU4A 1MP0A 4B79A 2GOYA 4MKGA 4ZI7A 1LLCA 1Y42X 4ROTA 3O94A 2PIAA 4KRFA 1GN9A 4A0RA 5I01A 2YX1A 5H3HA 4QXPA 1TM5E 2QL9A 4EB3A 1V48A 3OKFA 3AGQA 1C80A 1S96A 2HMUA 1RM5A 3K9LA 3OMLA 3ZDFA 4CCSA 3U09A 1ZN2A 2XOEA 4UMDA 3MT8A 2B4YA 1BN7A 2WTEA 1B4DA 4MPDA 4XOIA 1GCUA 5AK3A 4J49A 3VNVA 1OLUB 4TKLA 3WLNA 3IEVA 5UKDA 2IYNA 1FS6A 3V6MA 2QJTA 4IDDA 4ALLA 3PEVA 1FBTA 5BOSA 3CXRA 2JLXA 3V32A 2C7BA 4PO1A 1JYFA 4C2UA 2IXGA 1U7UA 4IDAA 4S1OA 5L51A 1FIUA 2HNAA 4L8GA 1T3TA 1BS9A 1Q84A 3II6X 4P82A 4G23A 1NZFA 3OHMA 4PYOA 3DDUA 1DO2A 3EE6A 1K3UB 1VPDA 3D1JA 1X1DA 3FXAA 5JAPA 4DB4A 1JHQA 2CB9A 5ADHA 3KJEA 2V65A 2PLWA 4GICA 1ZIPA 3CM0A 5LC1A 1ZJZA 1NYLA 4U2DA 1YQWA 3OOSA 3CSSA 1UJ5A 1W0JD 1O9GA 4R8KA 4XVCA 4ND6A 2EZTA 2IZ7A 3RU2A 2DTDA 2JJ2A 1P74A 3H75A 3IL2A 5E8RA 4HFMA 1U0RA 3ET5A 1Z13A 2CF6A 2FSSA 3OZBA 4FZRA 2CE7A 5HFNA 3IVXA 1QQTA 1BE1A 2BGJA 1AIPA 3CT6A 3KO8A 3PSAA 4L5IA 4WJKB 1JALA 3MINA 1IDOA 3CLTC 5FP0A 3RFFA 2J85A 1LBQA 4LDPA 1P4HA 1W94A 3QY9A 4JLUA 2A1UA 3K8ZA 1RLJA 5BURA 3RC2A 4OAQA 4R8RA 5HGJA 1BA3A 4HI0E 4LRSB 2NPIA 1LSOA 4GI5A 4EF5A 1GZ3A 2YFQA 4JFRA 4WIAA 2R86A 1BG6A 5E9QA 1IH8A 1L5LA 1YZ3A 4H35A 1A0OA 3ZQ6A 4CMKA 4MYHA 5CDGA 1HETA 5FOXA 2AHOA 2NO0A 3ED1A 4KOAA 5LZ9A 1SMKA 3WIEA 2NN3C 1FS4A 1E98A 3GCZA