3MCTA

Vaccinia methyltransferase vp39 complexed with m3cyt and s-adenosylhomocysteine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
297
structure length
291
Chain Sequence
b'MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
total genus 99
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mctA00
2V74B 3R0QA 2IIPA 3EGVA 1UFKA 4C03A 1RI3A 1V39A 2IPXA 3NW9A 2AVNA 1VL5A 4LWOA 5DX1A 5K01A 4OA5A 2NNWB 2AZTA 3DUWA 5C0OE 3TKAA 3E7PA 1VP9A 5FHQA 3V97A 4E2WA 4AUKA 1NV9A 2OYRA 2PWPA 1N7JA 5HIIA 5D1HA 2Z6UA 1KYZA 3GRZA 3TQSA 1B42A 2ADMA 3MCTA 1FP2A 1L3IA 5DPMA 4AZSA 2PV0A 4XUDA 4PYOA 2NXNA 2VDUE 2JHPA 3I64A 3CBGA 4RTNA 3RIEA 5HFJA 4BY9E 5P8WA 5DRYA 3MHTA 3BXOA 1ZQ9A 5CCXA 5DX0A 7MHTA 10MHA 4P7GA 1JSXA 3JWJA 3BUSA 3DP7A 4BLWA 4QQKA 1G60A 2ZW9A 4PINA 5M5BA 4P7JA 1R6AA 2BR4A 3C0KA 2PXCA 3KU1A 4GOLD 5E1DA 2V7EA 5EMLA 3KQWA 3FUTA 5GM2A 1NBHA 5E8RA 3KQMA 4YV0A 5F2NA 2H00A 1AV6A 1VQ1A 1JG3A 3OPNA 5EEGA 2OB1A 1EG2A 3HA3A 3C3PA 5EIFA 1WS6A 2O05A 2P3QA 2NP6A 1Q0SA 4RTRA 3P8ZA 5K03A 3IHTA 4RYLA 3UJAA 2FK8A 4YUZA 3PX2A 3NMUF 5CUQA 2ZIFA 3GXOA 3DLIA 2ZZNA 1EIZA 1M6EX 4EQZA 2H1RA 4RTJA 3MTEA 3KQQA 3R3HA 3Q7EA 5FQNA 2JH9A 1UWVA 2OO3A 3C6MA 1PRYA 2P1DA 3EMBA 3LKZA 5EMJA 2PJDA 4O29A 2UYHA 2HMYB 3TM4A 2O06A 2XBMA 2C7QA 2FPOA 2JJQA 2OY0A 2Y1WA 3H2BA 3ELDA 4Y2HA 4YMGA 4YV1A 4RTLA 3P9CA 1WG8A 3NVMB 4FZVA 2YXLA 4R8SA 5K0GA 1KPGA 3DXYA 2GA9A 3I9FA 2G71A 1O9GA 5HOQA 2PT6A 2N47A 4JXJA 3C6KA 4KIFA 1NW7A 1TW3A 4QVKA 5KYGA 1L3CA 3P9KA 4RVDA 2GH1A 2OXTA 3DH0A 2PVCA 2JH8A 3BGVA 5CVDA 4PYLA 3CJTA 4QPNA 3AXTA 1SQFA 1MJFA 2IDJA 1ZGAA 4FSXA 3UA4A 1M0EA 5FWDA 4C06A 5KVAA 4EKIA 3NWBA 5GOZA 1NW8A 1ORIA 2YUIA 2XVAA 4OBXA 1FJXA 4PGHA 3SM3A 2GB4A 3K0BA 2XVMA 3T0IA 1JQ3A 1DUSA 3ID6C 3WSTA 3HNRA 3KPWA 4DCGA 2CKDA 1RJDA 1N2XA 3E05A 1Z3CA 3EVGA 3GGDA 4HSGA 2WA2A 3A27A 3KPUA 4KVZA 3R24A 3EPPA 3FPGA 2PT9A 5FULA 3B3FA 2ZTHA 5ICGA 2ZIEA 5DRTA 5JUWA 1NW3A 1OR8A 2PX5A 2QRVA 2NYUA 3I5UA 3KQOA 3QOXA 4LG1A 1AQJA 3FTEA 1BHJA 4HG2A 2P3OA 3OFKA 4NECA 2P40A 4X1OA 5FTWA 3P71T 3PFHA 3OZSA 3MAGA 4K6MA 2KW5A 4GOND 4WVLA 3TOSA 3NDJA 5EHGA 3IEIA 2IBTA 4L7VA 2AVDA 5DXJA 4YUWA 2OBFA 3GNLA 2EFJA 1KR5A 3ELWA 2EJTA 3LKDA 2PX2A 4OQDA 5EZSA 3RW9A 1R74A 1QANA 4OQEA 3GRRA 5KQSA 4P7FA 3GRYA 2QM3A 3E8SA 4R05A 5EIWA 1KYWA 4GOOD 5E9QA 4HGYA 4RVGA 3VSEA 4ATNA 3UJ6A 4AX8A 2E5WA 1I1NA 2ZULA 2ZWAA 4YUVA 1FPQA 4DA4A 1XJ5A 5EMKA 3VC2A 5HZMA 4EMSA 2ZIGA 1ZGJA 2AOWA 2HR1A 2QRVB 4AZTA 5ICCA 2YXDA 5E1OA 5C1IA 5DWQA 3SMQA 1ORHA 3T7RA 4HH4A 2C7PA 3CJQA 3HVKA 3OCJA 1XCLA 1SKMA 4CKBA 2IFTA 3B3GA 2XYQA 3A7DA 3DR5A 3LDUA 5K0BA 4RTQA 1QZZA 2BR3A 2IH5A 5CVUA 2ZLBA 3L8DA 5FA8A 1X19A 2VDWA 5T67A 1X1CA 1WY7A 1IXKA 1SQGA 5LQAA 3X0DA 1AF7A 2GLUA 5LR6A 2YXEA 4PYJA 4CTKA 4MQ4A 5K8VA 4QVGA 1O9HA 1R00A 3NDIA 2PX4A 4HRAA 5DTMA 2UZ4A 4PWYA 2WK1A 2ZZMA 4E2YA 4ER3A 2CWWA 1EJ0A 3EMDA 3TR6A 5HIKA 2Z6QA 2XYRA 4E2XA 4PIPA 3S68A 1JTFA 1I4WA 4Z2YA 4GQBA 1MHTA 4AZWA 4GC9A 1XDZA 1KHHA 2GS9A 3CGGA 2WA1A 4U7PB 5GINE 2B78A 3OE5A 1YB2A 4RTMA 5K0FA 4QDKA 5LQUA 3HCBA 2OKCA 3UA3A 5FUBA 5GIOE 1XTPA 5DM2A 1F3LA 3DLCA 2ZCJA 1QAQA 3JWHA 3M70A 5BW5A 4MWZA 1EAMA 4U7TB 1O54A 2B9EA 1NT2A 2FCAA 3DTNA 5MHTA 3I53A 3PTAA 4PIMA 2P41A 4BP3A 3FPJA 5DM0A 3VC1A 3RODA 1ZG3A 5FA5A 3V8VA 5LQJA 5DXAA 3OU7A 3KPVA 3CJRA 3A26A 3D2LA 5GIPE 3PVCA 2FYTA 2QE6A 2IGTA 4R6WA 4V0QA 2BZGA 1BKYA 4CWAA 3ER9A 3EVZA 4RVFA 4YV2A 2FRXA 4P7KA 3DOUA 2FHPA 2PXXA 4DM3A 5EVJA 4OX9Y 4M36A 4EK9A 3IYLW 3BZBA 4ER7A 3G5TA 3SGLA 1P39A 3AWIA 3B5IA 5GWXA 4IKPA 3TM5A 3G2QA 5E2AA 2ZWVA 3CC8A 5BXYA 1I9GA 4LECA 3G2MA 3SSNA 5K0JA 2C7OA 5IKMA 3A25A 3AY0A 3HCDA 3G2OA 3GU3A 4QQNA 1RI5A 3OZRA 5F2KA 5GM1A 5B1SA 4FT4A 4YUYA 3ERCA 2YQZA 2GPYA 2I6GA 3AXSA 3UJ8A 3BWYA 1VIDA 1JG2A 2IP2A 4RV9A 5EPEA 3SX0A 3B3JA 3GWZA 4GEKA 5E2BA 4BLUA 2I62A 3ORHA 4GOMD 1D2HA 1R8YA 3G8BA 3QOWA 3HVJA 5EMMA 1JSZA 2R6ZA 3FPEA 3KHKA 3FZGA 3JWIA 5C9ZA 3GIWA 3FYDA 4IWNA 4KDRA 4R8RA 2IBSA 1QYRA 3FTCA 2AOTA 2ORED 3EGIA 3NVKI 2ONYA 4X61A 2EX4A 3UJ7A 1X1BA 3EGEA 3KKZA 4ER5A 3MB5A 3P9IA 5BW4A 1NE2A 3C3YA 4Y30A 5T6BA 2PX8A 4GBED 4M38A 4PGGA 1SUIA 4F84A 2B2CA 1Y8CA 4OA8A 3GDHA 2EJUA 4KIGA 1D2CA 2AN5A 3DMHA 4PNEA 4P58A 2HWKA 4DMGA 3JWGA 3IV6A 4CKEA 2DPMA 3FPHA 4BLVA 1VLMA 3LCVB 3PLAE 5GP1A 4B17A 2UYQA 8MHTA 5DM1A 2HV9A 2PBFA 1YFJA 1VP3A 1FP1D 2ZSUA 3PX3A 4QDJA 2PKWA 1JG1A 2ERCA 3KQSA 3SXJA 2G72A 3T7SA 1EQAA 3HA5A 4RX1A 1KXZA 3THRA 3SVZA 2AOUB 2QY6A 1IY9A 1L1EA 3UFBA 3K6RA 1NW6A 1RJGA 5CM2Z 3PB3A 3TRKA 2AOTB 3OU6A 1YFLA 2OPBA 4PYNA 5DTQA 2DULA 4FT2A 3EVDA 1G8AA 1YUBA 2AS0A 2CMGA 4A6DA 4E32A 1H1DA 2G8NA 2P7HA 2C7RA 2AN3A 3CKKA 2JG3A 3TKYA 5FCDA 4E31A 3ELUA 4HGZA 1HMYA 5K0LA 5E8JA 5EKUA 3CCFA 1JQEA 3NTVA 4MIKA 1VPTA 2AOXA 2VP3A 5CVEA 3FRHA 3M6VA 2UYOA 5CD1A 2Y1XA 3MGGA 5DX8A 4DKJA 3ANXA 5CVVA 2PY6A 2NXJA 3LHDA 3LL7A 3MCZA 2P3LA 3NJRA 5DLYA 5FHRA 4PCLA 3O4FA 3LDFA 5EQJB 2PGXA 4C07A 1P1BA 3LDGA 5CIYA 4GUAA 1NW5A 4A6EA 3LCUA 1G38A 3PS9A 5ICFA 2LD4A 2HNKA 2VZ9A 2FK7A 5FWAA 2IH2A 4QPPA 3B7PA 5DSXA 3TLJA 1G8SA 3BWBA 4ER6A 3O7WA 3M33A 2XYVA 4AZVA 1SG9A 3G7UA 5EEHA 3BKWA 4C4AA 4PYMA 3MQ2A 5K0CA 3M6WA 2JHAA 5EG5A 5U4XA 3SR4A 4RTOA 3BT7A 3EVFA 3P2IA 5E9JA 5FADA 3GRVA 2YVLA 4IV0A 4KDCA 2GAFA 1ZHFA 3HP7A 4FSDA 4RVHA 4XUEA 2NP7A 4HTFA 1RJEA 5LQRA 5KQRA 2O57A 3DMGA 4DQ0A 5EC8A 3SSOA 3MTIA 4YUXA 2K4MA 3OU2A 3UJDA 4KRGA 2B3TA 5HEKA 4X60A 2P8JA 2ZBPA 1P91A 1RI4A 3KQVA 5DSTA 5K0NA 4IV8A 4RWZA 4EKGA 3Q87B 4GF5A 3LBYA 3R6TA 4GC5A 5CCBA 3ER8A 2YR0A 4WXHA 2AOVA 4FS8A 3EEOA 2ONZA 4V0RA 5EOVA 3HCEA 3FUWA 1DL5A 4HC4A 2BM9A 3DXXA 3HVHA 3REOA 1P1CA 4F85A 4PYKA 2PWYA 2PXAA 2YTZA 2ZFUA 4RTPA 2G70A 3HCCA 5E1BA 5BP7A 1INLA 3OE4A 4FR0A 4DCMA 1FBNA 4XCXA 4UOEA 3A7EA 3FTFA 3EVAA 4QTUB 1BOOA 1DCTA 4HTFB 4M7RA 3BGIA 3MERA 2F8LA 4X63A 3NWEA 5EGSA 1F38A 2ZBRA 4QTTB 3UJCA 2AN4A 4ZTBA 3KQTA 4CKCA 3M6XA 1YF3A 4ER0A 3I58A 2NXCA 1QAMA 3FUVA 4PYQA 1M6YA 4FP9A 3F4KA 2YX1A 2ZVJA 3FRIA 4RSRA 2I9KA 1EJ6A 1N7IA 5DT2A 2NXEA 3R9XB 3FUUA 3BWMA 1NV8A 2OB2A 3M6UA 4KW7A 3QV2A 3KPYA 3TPZA 4CTJA 4C08A 3HCFA 2BH2A 3FUXA 3HCAA 1TPYA 3CVOA 5E9WA 1T43A 3EEYA 2I7CA 4F86A 1SUSA 2OZVA 1SVUA 3HA7A 1G6Q1 2ZBQA 3LSTA 2AOUA 3KR1A 3HEMA 3LGAA 4PONA 4KWCA 5K05A 2BM8A 1XDUA 1U2ZA 2ZZKA 5HILA 3T7TA 3O31A 1KPIA 5EHIA 1WXXA 1NBIA 2R3SA 3EVCA 3SSMA 4CXMA 3BKXA 1XVAA 3P2KA 1L9KA 4BP1A 2IH4A 1X1DA 1XCJA 5T64A 5HIJA 1XXLA 2Q41A 5DM4A 5EZQA 3THSA 4E2ZA 2CMHA 2PSSA 3A4TA 3OFJA 3LPMA 4LWPA 4RTKA 4H0NA 3E23A 1VE3A 2AR0A 1Q0TA 4FGZA 5K0EA 2Z6AA 3PFGA 1JQDA 3G88A 3BWCA 3G2PA 2IDKA 1AQIA 1KP9A 9MHTA 3GCZA 2EG5A 3FYCA 5K09A 4C05A 4POOA 3ME5A 1KIAA 1YZHA 3HVIA 1G55A 4ISCA 3EVEA 5LQCA 2PLWA 2O0LA 5KS2A 3KQYA 1PJZA 2G1PA 3HM2A 1TW2A 3DMFA 3ELYA 5ICEA 3LECA 2A14A 4EVIA 2CL5A 3DXZA 3PT9A 4DF3A 4E33A 5EKXA 1L3BA 1ZKDA 3KR2A 2O07A 1QAOA 5LSAA 1VBFA 5CVJA 3B89A 1WXWA 3M4XA 5IH3A 1WZNA 3UZUA 5HIMA 3UJBA 1YZ3A 1R8XA 2HTEA 1JTEA 4MTLA 3G8AA 3GJYA 1XDSA 2ESRA 5H02A 5F2OA 4PYIA 3P97A 5FQOA 5G02A 3P2EA 4MHTA 4YMHA 3KQPA 3FTDA 3EVBA 3LBFA 3KR0A 2P35A 1UIRA 3LCCA 1D2GA 5JR3A 3KPJA 3FPFA 3UWPA 3GRUA 1R18A 3G5LA 1RI2A 1HNNA 5DTRA 3TFWA 3U81A 3AJDA 4E70A 1NKVA 4C04A 2VDVE 4M37A 3UBTA 3DULA 4X41A 4PCAA 2B25A 2JHCA 1JG4A 4G56A 4OBWA 2QYOA 1BC5A 3LX6A 1KPHA 1X1AA 3GO4A 4R6XA 5D1NA 3G89A 3VYWA 2VS1A 4RTSA 3BGDA 1RJFA 3KR9A 4XUCA 3HTXA 4DZRA 5LQKA 2P7IA 1IM8A 3UJ9A 3P9NA 5ERGB 2UYCA 4E30A 1JR4A 5LQNA 2BR5A 3TMAA 3OZTA 5E1MA 1RI1A 2H11A
chains in the Genus database with same CATH superfamily
2ALJA 2XWSA 1KWGA 4DLLA 1UAYA 4RS3A 1X7ZA 1PR5A 3TEFA 3U48A 3Q8KA 4EG1A 4ISBA 5AI5A 3TLEA 2J6BA 4YJ3B 4WEOA 2AZTA 1FX0B 2OLJA 3LD9A 9LDTA 2Q27A 3A1CA 4HGQA 3BSWA 4H27A 1TIKA 4KTTE 3WQSB 3RC2A 1A5AB 1EVEA 2A0FA 3PYLA 3M6AA 3PKZA 4JB8A 5E0KB 5BT9A 3ND5A 4PYOA 4B0PA 2P5YA 3LQYA 4AYTA 5JQGA 5T4FA 2P1ZA 1Q5PA 2AGVA 1M1NA 4F9TA 2FSVA 4P7GA 3U4GA 1G60A 1LY1A 3PE3A 1DTEA 4JZKA 3WI7A 1W29A 1XLTA 5BOVA 4Z9XA 1RXYA 2UUBB 1SU6A 4NCJA 1JU9A 3G8CA 3GLTA 1NBHA 2V7PA 1R6TA 4KFRA 4DIEA 3C7DB 5KNDD 1O0CA 1TT7A 4ZJZA 3SYNA 1U6JA 3C5HA 3F6EX 1QOZA 1JG3A 5EEGA 3GCWA 4B4WA 3NHMA 4RKYA 1TZKA 2YIDA 3ZKWB 1ENPA 1TPZA 1DTWB 1LLFA 2H7YA 5E9AA 4P4NA 5J2TA 2FK8A 3IC5A 3TTTA 5IULC 2IY8A 3OTQA 2FWMX 4I1RA 4EYOA 2IVZA 2O4CA 4WBNA 3FOZA 2ATIA 5JU6A 5A9TA 2WY2D 2EOAA 4EQZA 1V5GA 4JELA 3GROA 4NV1A 2A5LA 3ZJYA 1NHGA 4F8EA 1J99A 1U3CA 2JH9A 1YZNA 2XMCA 3NGLA 1IHOA 4E13A 1SU7A 3TIGA 4QBTA 3V1UA 3VR6A 5D86A 4D97A 1TCAA 2P62A 4YHHB 2OUKA 4EF5A 2Y0PA 3TQRA 2HMYB 2I8LA 5DBIA 3TM4A 1H94A 2C3UA 4NBVA 3ZNQA 1K6XA 3QLEA 1QF7A 5G2OA 3R5HA 5JHHB 3A6ZA 3IJPA 4IHJA 4WIAA 2CBGA 2EZTA 2L0XA 4YRPA 2ETXA 1KE2A 2GT1A 3QKRB 1YCDA 1CR0A 4FZRA 3TZCA 2Q50A 2XZPA 4BIIA 3LF2A 2JARA 1RR6A 4M7PA 8LDHA 2WSIA 3R8XA 1W1UA 2VVTA 1DT3A 1ZSVA 5CG1A 1T9GS 1MX5A 3DEFA 3N2GB 2GH1A 3TTVA 4C7VA 1QPBA 4EW1A 1H4SA 3WMWA 2O5EA 1NXPA 2XMSA 3WAKA 2IDJA 4QREA 1QX3A 4FI3C 1F14A 1UP7A 2VLBA 3EZLA 4H0FA 4I1UA 1KC3A 2FEMA 1IJFA 2QMHA 2Y99A 1GQYA 2YUIA 3AEQA 1FTNA 5BQPA 1J2UA 3DQPA 4J9VA 2D2VA 1I6LA 4OLBA 4ZO4A 5IG2A 4L4XA 1YFKA 2W0SA 4B3DA 3I3OA 5LBTA 2GZAA 4FMCF 3L7KA 4K05A 4V24A 4AG6A 1QMPA 4CMGA 3Q3EA 5I9LA 3RAFC 3KUDA 3CT6A 4UTZA 3P2YA 3AHCA 2OENG 3REQA 2ZBEA 2YZKA 4EVSA 3G7NA 3D7RA 3W5UA 5T4HA 1DIHA 2CHUA 2FJUA 2H4JA 3B3FA 3PQFA 3OPYB 4D6YA 1J2EA 1EJBA 4RPGA 4NATA 1YJQA 1JHMA 1NNI1 2PT5A 3HCNA 1QFSA 3SE0A 1O08A 2Y0DA 4KXFB 3D0RA 1U2GA 3OFKA 1Z08A 2GDJA 5FTWA 1HT2E 3PFHA 3DDHA 5G0WA 4IMJB 1Q0HA 4AKTA 1CERA 6LDHA 3FCSB 3OTWA 1HYBA 3IT3A 5JNVA 4JLBA 4JXKA 5BSVA 5EHQA 1Z7YA 1I0ZA 2C92A 3OCUA 4IUCS 4JBHA 3L8EA 1DEHA 1ZRSA 3GVXA 4E7OA 4R54A 4FXPA 3UENA 3S5UA 2AMYA 1JHAA 1CY7A 3VM6A 5AVWA 2CDRA 3ELBA 4OSEA 3H5WA 5KQSA 2ZB3A 5CNIA 4XPIB 3E8SA 3I3SR 5LU9A 2HHCA 1AN0A 2G77B 3BDVA 3S2ZA 1Y89A 3C14C 4MUXA 3USZA 3UJ6A 3JYLA 3WGHA 3ANLA 1C7QA 2VT2A 2ZSIA 1KDTA 2FPGA 4OIFA 3ZDFA 4BV3A 4N39A 3IB3A 4Q9IA 4GLFA 4I6EA 4R5HA 4O4IF 5IYZB 3B1WA 1Q50A 3P94A 2ZUTA 1F17A 5DGTA 2SECE 4C4OA 2FE1A 2J3IA 4OP1A 2NV0A 4JUCA 1EX1A 4KGVA 2R7KA 1TYEB 2PMWB 3TQCA 4FGLA 4S04A 1G4UR 5J5CA 4NXMB 4A4DA 4EW6A 2BDEA 4D4LA 3PDCA 5TMEA 2ZLBA 4AMZA 2GBLA 1XI2A 2R751 3GP5A 2EKPA 4TXJA 4RJ2A 1Z4IA 1BHSA 1ENZA 1C4WA 3JQAD 4YAOA 4DAEA 1KBOA 2YXEA 3QEMB 2NTVA 4PQGA 2FWJA 1S1CA 1EK1A 2YFHA 4XE5A 1QHXA 2JBAA 3BHNA 4QVGA 4QYWA 1ND5A 5E4TA 5C8ZA 5AUQA 4DV3B 1TK9A 1M7BA 5EP4A 3DOIA 4GICA 3GR6A 4IO1A 5FTLA 4BU0A 4Q37A 1ZN2A 2JGMA 3OZWA 4XM1A 5MFPA 1S2LA 1YS7A 2AXNA 1KMCA 2CXSA 2J46A 2P9GA 3DBOB 1XF1A 3H11A 4KJXA 5FOSA 2ISSD 3QEOA 1Y1RA 2JI4A 3SXUA 1EVYA 3SYKA 3T7DA 4ARZA 1I4WA 1RCTE 3EXHC 1M1ZA 2R1VA 1J6UA 4RKFA 2ZRPA 4RADA 4N5HX 2CW5A 1PUIA 3QVUA 2IDZA 4JFAA 3IAM1 3UAGA 1FLNA 1K7XB 5TVKA 4HN4B 1OLUB 3E27A 4JA0A 4HWPA 3W4IA 1V4NA 3E9DA 3LBHA 4CKBB 3OY7A 3WLKX 3CVJA 4J0CA 3U13A 2XODA 2P9ZA 3L7JA 5ABPA 1QAQA 1YRBA 2YZMA 5COBA 2VYFA 3M5CA 1IE3A 3L7AA 3IAM6 4UVHA 3NP9A 4FFNA 5AKZA 3U09A 2B94A 5MHTA 4BQQA 2CHEA 4Q1AA 1TAUA 4ZAYA 1O03A 2NQTA 4L5YA 3FROA 2XCQA 1N9KA 1NP7A 2BGMA 5DGIA 3RI3A 5KJEA 3O4GA 2QL6A 2IHZA 1IDN1 3RRYA 1UBLS 4OJYA 5CNMA 3KCQA 5BQXA 3NX4A 1JIQA 1Y3CE 4B3JA 4CWAA 2RHGB 3NTUA 4UBLA 3PR2B 2V7WA 3W5SA 4AW9A 2B8WA 3D7NA 4PZDA 1BG6A 3PEVA 3SHQA 2PXXA 2ZJ3A 1F8YA 1BCRA 3AX6A 3EARA 4DKXA 2CJFA 4EK9A 2NW6A 4EUHA 1T2VA 1NSYA 5LZ7A 4I1SA 2VFAA 4K6GA 5CX1B 1DMSA 3UXMA 3A1UA 3Q9UA 4RH1A 2W58A 3EBPA 4PF1A 4ZO7A 5CURA 3WNBA 4DDTA 1XR3A 5A2QA 3O38A 5J63A 2ZUFA 1KEEB 2Z1NA 3TE7A 3UUFA 5KYWB 3FRJA 1NJ2A 1L1FA 4EFKA 1R8JA 2GPYA 5HCIA 2R68A 1DG9A 1F6BA 5F7ZA 3SX0A 4NNJA 4V38A 1SXPA 1N33B 3L8YA 3B3JA 5AVJA 2D3WA 3AV0B 4NS1A 3WV5A 1KOLA 4BLUA 2GZMA 5GPBA 3VTAA 3RSCA 4GH5A 3IP9A 4EI7A 2XKKA 1TLTA 2HI0A 1MFZA 1I14A 2GPAA 4UMFA 1J5XA 3A6KA 3FWPA 1SNYA 4UM7A 1VI6A 4M0DA 5A4JA 1QDLB 2R6JA 5IRCD 5ALJA 1SC3A 2C00A 3QUCA 5KAPA 3E1GA 3VOSA 2ZBFA 2WTEA 5TJHA 3SLKA 2FRDA 2VQ3A 5LJIA 1X1BA 2HV8A 3EGEA 4EMUA 3P9IA 4Y30A 2XKAA 3CZRA 5G4LA 2FZ4A 1VSTA 4FD3A 3S1LA 4LRQA 4GDMA 1ZJYA 1V9LA 3CLUD 2VYVA 4ZIRA 1M34B 1D2CA 3GEHA 2RGWA 3W8FA 4R2IA 1IOZA 2DAPA 1SIUA 3D6VA 3L4BC 4ZT7A 1U1CA 2Q8NA 1N3LA 4YPVA 1XOIA 5DCLA 4WDQA 2Z56A 1H0KA 4H3SA 1E92A 3G6KA 1DAGA 2Z9DA 2X5NA 1VYHA 2B8EA 4CIAA 4GI1A 2OGTA 2OFPA 4F3KA 5AHOA 1SWVA 4NCHA 1BROA 2JK1A 3NNSA 4ZYVA 5K6AA 3T7SA 4BNNA 4UJ5A 1YD7A 5JD5A 2WHQA 2B4RO 4WNAA 2JVKA 1L1EA 5A6SB 3HMKA 4CETA 1VFNA 1E60A 1WMBA 1DV1A 2NACA 3K9BA 4PYNA 4JP1A 1CS0B 1EM8A 5DW0A 2EF1A 1XAGA 1GNSA 1E1NA 3DZ8A 4TLMB 2JH3A 5E38A 1F5SA 1VMAA 1GUBA 3CKKA 5KTTA 5ED0A 4FDAA 4FFVA 4Z2AA 3ELUA 4P3XA 1DB3A 3L7NA 4RD4A 1GARA 3CCFA 1A04A 1QRDA 1XF9A 4P4TA 1C81A 2JLCA 3GDWA 5C7LO 5CD1A 1JDUA 2Z5VA 1P74A 1BVYF 1JF8A 3CH7A 3QLVC 1G3QA 1L7BA 4Y2YA 5AXCA 3LL7A 3QA3E 2P3LA 1R9GA 4WOBA 5FHRA 2OL4A 1HOXA 2LDBA 2Q6OA 3QP9A 3D64A 5BN4A 3HJAA 1TMYA 4TLLB 4B7AA 3B51X 1G38A 2PFKA 4EGJA 4J2OA 4IINA 4M89A 2AJBA 2XUOA 4PQFA 3TLGB 4LE1A 1GLNA 3O7WA 3QXJA 2HSWA 1XMSA 3TW6A 2C4TA 3EXEA 3IOCA 3DC7A 2DWOA 3ITEA 3GRVA 1GPNA 2DVMA 3CRZA 4LRUA 4YV7A 3AF0A 4HBZA 3VNSA 5LQRA 3KTAB 4HMPA 5BUCA 3F78A 4YUXA 2PXHA 1GGEA 3F3YA 4B6SA 1JU3A 1RXWA 2RSLA 2QMUA 1O58A 3ORQA 3R09A 4RWZA 4UEWA 2VTBA 1AA9A 4IRUB 2W2LD 1R0RE 4QBIA 3UOWA 4N8EA 4W5QA 5JSFA 4LHWA 3I9V1 1KZYC 2ZEJA 1OBOA 2BLLA 3CGWA 2DBVO 3VH3A 2ZTLA 5IUNC 4ZODA 1DX6A 1JFRA 1P1CA 4DNFA 1FPMA 1JDBC 3M89A 1E2NA 1QHHA 3HI6A 2P5SA 2ATVA 4OHYA 3I9V6 3WL4A 1NQWA 1OT3A 3GW8A 3P0HA 4JLUA 4RHTA 2QOEA 4UUAA 5EWMA 4ZARA 4A10A 2C20A 5KNDH 5T4EA 1GSOA 4REQA 3T9EA 1VOTA 3BRWA 3ZIDA 1AKYA 2AN4A 5BPHA 3R2JA 2GCEA 4RK0A 5EXTA 1XVUA 4AFNA 2FOXA 3TBFA 3K0KA 5C32A 4LN1A 1QAMA 1Z33A 4P22A 3OMXA 3EQ7A 2ZVJA 1K0UA 1JH9A 1N1EA 3HZZA 4Y2VA 1T8TA 1XD2A 3GNTA 3KELA 4ZAZA 4B47A 3DONA 1P18A 2FVXA 1RRFA 2O0KA 1FQJA 3CN9A 2FPIA 3N0TA 3CVOA 1MW8X 1FNSA 1N5JA 1Q6YA 4FN5A 2FKAA 4AP5A 3PC2A 4MPJA 1YMVA 1JIJA 2X4LA 2Y92A 2Z6VA 1GG5A 1PSZA 1O96A 2AOUA 4FINA 1C9MA 4U7FA 4L7QA 5DYNA 3MBIA 3SEZA 2EEZA 1XDUA 4H3HB 4LYDA 3TQFA 1LPAB 2J7PA 2VAMA 4AQDA 1PYGA 4R3WA 3ZEAA 1NBIA 2R3SA 1GN9A 3UIEA 2GJKA 1PF7E 2ZU0C 3LU1A 4C88A 4PQEA 3H5OA 1X1DA 1Z6YA 5T64A 5HIJA 5ESWA 2QLLA 3T4XA 1CJSA 5I7UA 2CMDA 3ADOA 3HADA 4UPVA 2ZYVX 3QENA 1R9JA 5JNTA 3L79A 1Q0TA 4RF3A 4NZZA 4YBRA 3IX7A 1A98A 1OCEA 3SZRA 2CXQA 1P60A 1SRQA 2BSAA 3ACBA 1FSGA 3NC4A 4AJ1A 7ABPA 3W2GA 3Q98A 1QP8A 5JASA 9MHTA 3KAJA 3FYCA 4POOA 3HVIA 1F60A 1TUGA 1R50A 4HAWA 1CUGA 1Z3IX 1P4HA 1TJ3A 2WG0A 2CHGA 2QVBA 2Y1KA 5CIWA 4ZQHA 5LQCA 1AZLA 4GP9A 1KZ1A 3D8UA 1P7VA 4IJVA 4CU5A 3WL7A 1BA2A 1O94D 1M5TA 1WHSB 4LXIA 1BFKA 2OQVA 3C3MA 4D79A 5JYBA 2L19A 5DDIP 4UU8A 5JNWA 3C3DA 3KFXA 4M55A 4PZ0A 5J4HA 2A7QA 2QTWB 5ADWA 1SC1A 1ND6A 1I94B 3OJOA 1SR8A 4L2IA 5GGYA 4XDYA 1X87A 4P0PB 4QOHA 3I28A 5H02A 4N47A 4LYJA 2VUSA 5CT5A 4DQDA 4G1CA 2VHEA 3PFWO 5KVVA 1GTSA 3WJ2A 5IN5A 5C80A 2K7FA 4DA6A 4NY1A 1ZYUA 1UIRA 2F00A 3KPJA 3Q3VA 4MHSA 1TM5E 4GLOA 4Z7QB 1UPAA 3OD5A 4PQRA 4IXDA 3J80A 2QLNA 5B5SA 1NKVA 4J1SA 3F7OA 1FFGA 3QNMA 4MMXB 4NIMA 3VO1A 4HNSA 2BHNA 2X14A 3AH8A 1YA6A 3GCGA 4MVJA 4GUDA 2YJNA 3OJLA 4G56A 2DBZA 2QYOA 1JLHA 1NVBA 4E4YA 3B7GA 3PE6A 4MA5A 5JMWA 3JAWA 1YBFA 3HL0A 3QVJA 2VS1A 3GLGA 2B8NA 4DLBA 2XKJE 4G8JA 2CDNA 3O1IC 4MSUA 1TX4B 2GPNA 4F5ZA 2QTAA 4M7OA 3GJXC 3TMAA 3VR5D 3FPLA 5JJ5A 1EK5A 3DYVA 5J5VA 1YH3A 4TWIA 1O5TA 3SWWA 4MVJI 2QUBA 5EL0A 1QYVA 1RWXA 1T3LA 4TS3A 1AA6A 1T4DA 2E37A 2XQKA 3M5DA 4P9NA 2WM2A 2J0EA 3LZ6A 4QQFA 4E2WA 2MIIA 3LYUA 4JJ4A 2OYRA 16PKA 1QQ5A 2PWPA 5HIIA 2UZ3A 5ALSA 4LWZA 3PQ8A 3OHSX 4KJZA 5AKIA 1FP2A 1KY2A 2L82A 4ZN6A 1XKXA 4H1VA 5A7HA 4C5BA 4DNQA 3CBGA 4DRZA 3SX2A 4BJ6A 4HHEA 2IELA 2EJCA 4I50F 4K6KA 3FWZA 1XNRB 1RM3A 1H5QA 1X92A 2SHKA 3HP4A 1QCZA 3QVGB 5EUMA 4GZMA 1E2HA 1PTKA 4BNDA 2JFOA 2QJOA 2XE6A 1DDOA 3R9IA 3LHFA 1N0UA 3CNOA 4C20A 4UVGA 3NIWA 3AJ8A 4CCYA 3MUNA 3CX7A 4CKYA 4UU1A 3NGXA 4F12A 3KQMA 2C2OA 2JAPA 3EC2A 3G0DA 3P0FA 3PCXA 2YVQA 5FL7A 4XB6B 5A05A 2JGAA 3GY0A 3OPNA 4EJMA 3V2HA 1EG2A 4FFSA 1CT9A 3O1JC 2XNKA 3HFSA 4LMPA 1A71A 1T8WA 3EQ2A 4QSHA 3BXXA 3C15C 1U04A 1Y1KE 1V7ZA 1KJWA 4GKKB 4GE0A 3NKFA 3UHJA 4CG3A 2IS2A 2BI7A 3LFTA 4HGNA 5K0SA 3HGQA 3MTEA 3R3HA 1KK0A 3Q7EA 2RI6A 2QZ4A 3PUWA 2CD7A 3A36A 2P1DA 1QIHA 3QMWA 3R1IA 4I6JA 2XWJI 4O29A 2FRVA 2X6RA 3AP3A 1SBNE 3AVYA 2A9QA 1BGVA 2V5VA 2Q7OE 2GSDA 5HUQA 1XPRA 5IUJC 2V6JA 2VQDA 5F1PA 4DYHA 2VUIB 5I7OA 3NATA 2N0SA 3PHIA 3PXUA 2NUPA 3S1AB 2ZJ7A 2DFKB 4S1PA 2B92A 1ULHA 1FUYB 1FA9A 1WBJB 3NBFA 4IJMA 4JOBA 5F51A 3ZPXA 2CFOA 4H15A 1L3CA 2B69A 4RVDA 4EMTA 2EW1A 2PZLA 3HYNA 2JH8A 4DLZA 4JR1A 2GEUA 4WXRA 5JO0A 1Z5ZA 2R44A 4CNBA 3E35A 2FZVA 1IATA 4IFIA 4DWWA 1S3FA 1FW8A 2CVOA 1IQ0A 2ZVDA 4OBXA 4RORA 4EWLA 5EHZA 2RHCA 3PQ4A 3WXBA 2EP5A 1DEXA 3CZMA 3MSCA 4Q48A 3VQTA 1EHCA 4HB3A 3ZWQA 4JSTA 3HL4A 1G5TA 1F2UB 1HPLA 4I8XA 4M21A 3OZIA 5HKOA 3D7MA 1H85A 1CJBA 4P33A 2X22A 1Y5RA 2IV7A 2O8FA 4Q0MA 4RJIA 3AKZA 1ZJJA 4N7MA 3KJHA 3LCRA 5BN5B 1KZ6A 3UC9A 5HX7A 1KQFA 3IQFA 3CA8A 1T4CB 4LJLA 3H04A 4X1OA 3GNQA 3U9SA 3QQPA 2PS0A 4JQSA 4XAQA 4AB1A 5B1DA 3BCHA 5KJ6A 3B6EA 3RWMB 5CR9A 2EGHA 1Y5LA 4YCSA 3R4CA 1RWOA 2F3PA 1KI7A 2GWHA 1L8OA 3AU8A 3GT0A 1J0CA 1PJ8A 1T36A 1U7PA 2FDXA 3DS8A 3GFSA 4HUJA 5TR9A 5AVOA 3VOAA 2XGGA 4MW5A 3QBTA 3TLKA 1ZA2A 3DNPA 5JD6A 3NEPX 3UMRA 1OYOA 3H19A 1UBMS 5EESA 3I23A 4AO6A 4DA8A 4P7FA 1N77A 3AUKA 1KYWA 2CJWB 4GOOD 1KDVA 1DKLA 3NHKA 1MZPA 5KSYA 1L0BA 2C98A 2LTAA 4KMOA 4Q4JA 4BMDA 4E5KA 1PL6A 3NM5A 3KVYA 4IXWA 3IMEA 2D3TA 4PRYA 4L8YA 4DNPA 4E22A 4EMSA 2ZIGA 4EPWA 1EDZA 1UK8A 1X70A 3PL5A 3OPMA 4O4JB 1HZJA 2QIOA 2HPHA 3K0CA 1JQKA 5C1IA 5JANA 4HH4A 2PIDA 2VH5R 3HVKA 4ZOEA 3FHOA 5AVKA 4XDHA 1QOQB 4PVCA 1KOFA 4MNTA 4ZI7A 1VLJA 4JP8A 5E6UA 3MK31 3KQLA 2IL1A 1SPBS 1X1CA 4KGZA 1IXKA 5LQAA 2QQEA 3G2KA 3GJ4A 1JLSA 1KAQA 1Y98A 2QDKA 2BFBB 1AKMA 4CTKA 4I5EA 1G21E 2FEPA 2QN6A 2WYOA 5LKRA 1NA5A 1NFRA 1XRNA 2XMBA 1K75A 3DAPA 4N0EA 3BTOA 1J39A 3CO0S 4YMSA 5F1OA 1XLTC 2R4UA 3RUCA 4R40A 3SBOA 2GETA 5I4BA 1JIXA 4Y2PA 2CUZA 2OVBA 3TR6A 3U40A 3URMA 2UAGA 1GTL1 3AJEA 1B00A 2XH8A 4TUYF 4KP7A 3JTEA 2PMDA 4PTZA 4OHFA 3VDNB 4AZWA 2I6XA 4BO7A 1V6CA 5LDHA 2G80A 4U7PB 2J6CA 2A0YA 4ILEA 2XXAB 1H2YA 2A7XA 2DT8A 3GJ8A 2VAWA 2X5JO 4RZ3A 5FPTA 5DNCA 1GA1A 1JFVA 4K3UA 3OF5A 2F3SA 2ZU6A 4HZGA 3RU2A 3AEXA 2X2EA 3OQ6A 1EX9A 4MGYR 4B6GA 2N3ZA 5EQFA 1SCNE 4B2IA 2GUWA 1X14A 3UF0A 5KU1A 3QWBA 4F1JA 2VH2A 1O6ZA 4ZO8A 5KSOA 1CJUC 3VC1A 4QIHA 2IYSA 1M2NA 2ZKLA 3HMQA 3QKTA 3OKPA 4YNBA 4M8SA 2EW2A 4JENA 1G5QA 1F7UA 1E3TA 4FDLA 3NFYA 2O19A 4UNIA 4F45A 2CVHA 4CLEA 1HLFA 2O2XA 4MUIA 4WESA 3RVRA 2XWBF 3WMXA 4IICA 1ETUA 3IMKA 4RVFA 1LBHA 3RNOA 3ET5A 1UK9A 4N8DA 4RZXA 5EVJA 3TG2A 4R9VA 4I46A 2PQ2A 1R64A 3DUFA 3E3NA 5JYEA 1XZMA 1EE1A 1NBOA 3CRRA 4PM4A 1PGNA 2YASA 4OXNA 4NYMQ 2PJUA 2QD4A 1DPGA 1JJAA 1TIPA 1X7WB 2WHYA 3G2MA 3BX1A 3GQBB 3SSNA 5CDYA 3EIXA 3E18A 1JFFA 3OZRA 4E5SA 2Z9BA 4BKUA 3WIOA 2YQZA 4OJMX 5EJEA 4DCOA 5AW6A 5AKEA 1E3IA 4PZYA 5KNBA 2VO1A 1U0OC 3JATB 4GOMD 2ENWA 3AR6A 4JL6A 4X92A 4GVPA 3HDYA 3CE6A 3HKCA 1YQEA 2QGNA 5EMMA 4KXYA 3DZKA 3GJ6A 4AYWA 3JWIA 2H6EA 1P2UA 1QUFA 2VJMB 3DD1A 4FX2A 4XGQA 3U49A 5GJWC 4BVBA 4CMIA 1V26A 1KEVA 2O1XA 2UZ1A 4WLOA 3W1EA 3P9RA 4AD8A 1U2GC 3T3PB 5HDQA 1Q44A 2MMCA 3L1UA 3JVDA 2NADA 3KXIA 1NE2A 3NP7A 4TL9A 3E2MA 2WKSA 3MOGA 4UHKA 1SUAA 2QGZA 4V1CI 4DLUA 2C3YA 1FIUA 3ZQKA 2HMSA 5FNVA 1SA0B 4TLDA 3RKRA 1Y5NA 2IXTA 2P2SA 1QO0D 5AVXA 5EP3A 2SCUB 1KJ9A 1MDBA 2OECA 2XNHA 3BWVA 1WW2A 1ZCZA 4NYJR 3NHWA 2P2YA 5A5GA 2W6IA 1MO5A 2P67A 1KNQA 5GP1A 4UXJA 4U7HA 4HY3A 8MHTA 3UH0A 3FWYA 3NJ4A 1KAOA 1FUIA 1CIPA 1P4JA 3R0XA 4HH1A 4L9AA 4FFOA 2GPJA 4D9NA 3PK0A 4RD1A 4F93B 1QB8A 3BFPA 1Y1LA 4I08A 4IFEA 5ALFA 4DCNA 2BFFA 1U81A 1FZQA 2ZUDA 4ZQFA 4FDUA 3KKKA 5SY4A 1IUOA 3S0JA 2WJHA 3C3JA 3T34A 4AJPA 2YXNA 1TT5B 3EODA 4BVGA 4NDAA 4DJDC 4OO3A 4NEGA 2H7XA 1B26A 1TIBA 1TOAA 1ICEA 1QKIA 1UANA 1YHYA 2CMGA 1E3EA 2CFSA 5D6NA 3IUMA 4UU0A 3K6SA 5JPCA 4D7AA 1KYVA 4XD7D 5KKAA 4PG5A 2QK4A 3IVMA 3OT1A 1JI3A 2VP3A 4A0HA 2OHXA 4ZZIA 4C29A 5LXTA 5DX8A 4MR8B 4DIFA 3RUEA 1ONOA 3NRJA 4JL5A 4XR4A 3LHDA 3Q0EA 3OUZA 1N2HA 4DV7B 1WVGA 2HQSA 1ISMA 1P1BA 2G4LA 4L95C 5FUVA 4HDNB 5ICFA 3ZDRA 1VJTA 4U3JA 4Z6KA 4MVWA 5DCUA 4RPHA 5EXDA 3VKWA 4HCJA 5IJ0A 5HRUA 2A9OA 2RONA 3L01A 3R77A 4FMPA 2PA0A 1A69A 1SG9A 4P38A 4ZT6A 2GYUA 2YV4A 3GD7A 1WSDA 3WWPA 4QULA 4R9RA 4U0JA 3ZE1B 1XZ8A 1W4ZA 5HYVA 3H3JA 2PGDA 5E9JA 1FLAA 2XF2A 4ZRDA 2BGGA 3TRDA 2NP7A 4J0GA 1AD2A 2R1TB 4FSDA 3VR5H 1G2QA 2Y1FA 5CGZA 3VPXA 1AHPA 4U6SA 5KQRA 3CMCO 1YR2A 4B9AA 4C4PA 1YRLA 3EVTA 2FMUA 1D7OA 4N0MA 4OCZA 4BPRA 2ORYA 4GT1A 1T0JB 2J30A 4MZXA 3PLRA 1E5VA 3QIAA 3X1WA 2XNCA 1GGFA 4G41A 3IRUA 2FPWA 1MH1A 4JITA 5H81A 4EKGA 3ZVLA 2JKVA 4BQRA 4J03A 1KSGA 2GOYA 2O8NA 3UKOA 2ZVPX 1LU9A 2XF8A 5EPUA 3KOMA 3TK1A 4Y6SA 5TS2A 5C4MA 1HNWB 1UP4A 3AG5A 1Q7TA 3AIIA 1NQXA 4HC4A 1EFDN 3DAHA 3DXXA 1YU9A 2C9MA 4Z49A 4PYKA 5KQGA 1A27A 2EFDB 1YOVA 2IPLA 2R65A 1EHIA 1J8DA 2G04A 1FL9A 2V6BA 1AOXA 4O6VA 3ONDA 4N0DA 3GVCA 4HFNA 2BMVA 4R98A 3B1KA 5TPZD 2Z95A 4KIUA 1U4NA 1XX6A 5EHNA 3V1LA 1HDIA 4DCMA 6ADHA 3CXUA 1QM5A 2D1FA 2VP5A 2AR9A 3FKSA 1BOOA 5CYOA 5BV1A 4MS1A 1OLXA 4AURA 4J76A 5FV7A 2JDIA 1CJKC 4CZ2A 2PMKA 3IS3A 2E49A 1NOIA 1G2PA 2GN2A 5CEEA 1IONA 3AM5A 4F72A 1ZJ5A 4O1HA 4XCVA 3WV4A 4D9EA 3EIWA 4XARA 5IT5A 3N2KB 4XYBA 5EHXA 2QR2A 1RQRA 4G0QA 2A86A 1GTMA 2H4XA 5EIHA 3M6UA 5K51A 4BHTA 2QAGC 4U2EA 1T43A 1BQ4A 3D0KA 5FWYA 2PSEA 1J7JA 4X8HA 1G6Q1 2DFLA 2I1WA 3NOXA 1VRCA 1ST2A 2YS6A 2QI9C 1OIWA 4JC4A 4QJBA 1UZNA 3SBEA 1Z07A 5DYIA 1QIEA 2D0IA 1DPFA 3TGLA 3T7TA 1A9TA 3AERB 1SY7A 1NWCA 4M8LA 5SYMA 1JU4A 4UU7A 5AVVA 4B2LA 2BPOA 3G1WA 3TLBA 3CLKA 3JVVA 5K6AC 3EXHB 3VR4D 2YRFA 2I91A 3TTSA 4FGZA 4EHFA 4E5UA 2Z6AA 1ZQ1A 1J9GA 1W0JD 3PFGA 2IHBA 4MAMA 3G88A 4G37A 1XTBA 5DCYA 4EJFA 4LHEA 4UC0A 1AQIA 1XDWA 2I3AA 4AX4A 3RRZA 2XRZA 2JZCA 1T0UA 3QELA 5BSUA 1L5VA 1RPTA 2I29A 2BKEA 3RJMA 1ZZGA 4DC0A 1C3OA 2FFHA 3DA8A 1ZOSA 3SFTA 3BIFA 3MN1A 3WZ2A 4LV6A 1RKUA 1X77A 3KQYA 5ICSA 3OQHA 4QARA 4CDNA 1EXMA 3EDOA 1GGKA 4LYFA 2Z4RA 3G68A 1PS8A 3A6FA 1WUTA 3KBBA 2NV2B 2B9VA 4QX6A 5TLSA 3QGMA 4CDRA 3NASA 1MENA 3U4HA 4B71A 2RHHA 3AOEA 3K0EA 2NAPA 2FETA 4QFCA 5H3CA 3V55A 1KFEB 4RXUA 3QMPA 1M33A 2YHAA 5F76A 3DD5A 1W5TA 1JAIA 1XE3A 2BRUC 5FO0A 1OH7A 5K2OA 4DDMA 1DC3A 4WJKB 4DLSA 5H9WA 2HCBA 4RQAA 5FQOA 3P2EA 2YC2C 3DCJA 3GUYA 4JOCA 5L3QA 1I2CA 3KWJA 4LVNA 5DM60 3BMCA 3F67A 2NU8B 3UH1A 3ABSB 3C74A 1KQ3A 3PNBA 3C6QA 4NV3A 1W2GA 4TSFD 1L1QA 1GDDA 3WGIA 1I3LA 3GUCA 4MRSA 3JS5A 1V45E 2LR0A 2ZJYA 1VCOA 5CAEA 3W5BA 1C1DB 2QTZA 1FTSA 4Q9DA 3KJGA 4TTAA 4FKMA 5B6JA 5HKKA 3GVIA 3LX6A 3F4BA 3ONNA 2IWRA 2RGXA 1ZS9A 2HUNA 2O8VA 3IJRA 4LI0A 4B74A 4BMOB 5ISMA 1NFQA 5ELXA 2WVJA 2ROQA 1G19A 3L46A 1I5OA 4CI0B 1YE5A 1DBRA 4KACA 3Q7QA 3COZA 5I47A 3BJZA 1LJLA 3CXRA 2WNSA 4AMUA 3ZYZA 4ECAA 1LVGA 2REQB 2YN2A 5HRAA 3IEVA 5DBEX 1Z7EA 5C1PA 2IIPA 3INRA 3VJMA 1QQ7A 2I8AA 1II8A 2GO7A 1JKJB 2X8JA 2YV1A 2BHLA 2V9PA 3QG1A 4WCFB 5E4JA 3R76A 4TS4A 5AM1A 5TMDA 1X7HA 2GEKA 3R3XA 2AF4C 4AUKA 4MICA 2HADA 1UQTA 3QYFA 4G8DA 4EL0A 1F8GA 3HBAA 1ILEA 1W48A 2PUGA 4NOJA 4ZVKA 2C2XA 2EDAA 4H3KB 4ZDKA 3OM1A 1M9NA 3OH8A 3WJAA 3GZNA 2WMDA 3COPA 5DRYA 5DX0A 4TWZA 3EXG2 2OBMA 5ITVA 7YASA 10MHA 3BUSA 2JD0A 3AETA 2FMXA 4PINA 4PG7A 3ZOZA 2EX1A 2WJYA 2KQUA 5GM2A 2VQFB 3I6IA 2XBLA 1E1RA 2PD4A 1P75A 3C7TA 1R4NA 2PH1A 2VWQA 5F2NA 3ZJ4A 3WQBA 4UHBA 3LUPA 2ERXA 3BA1A 3QHQA 1G59A 2G63A 4XVHA 3LY5A 5HMLA 2JGDB 2WAXA 1DBWA 3AEUA 1JX6A 2IK8A 3ECSA 3PE4A 3ROMA 3T3GA 3ZY5A 4MXDA 1NAIA 4LTDA 4DQVA 2YWXA 3LPCA 4UARA 3TX2A 4WZBA 4B8ZA 1U3TA 3R7DA 4YFYA 5BUZA 4FB5A 3A1WA 4Q7QA 2VNHA 1EK0A 1N6IA 2R1UA 1F4VA 2OO3A 3IKLA 3OQIA 2ZATA 1Y1QA 3WLFA 4LJRA 1H9AA 1XZGA 2QAJA 3IUBA 4ZOQI 2O06A 2DECA 4CV0A 2D7CA 5DZSA 2GVZC 4R8KA 1JPNA 1BCSA 1CFJA 2IXAA 3L06A 1MQ8B 4NU8X 4QGGA 5SZKB 4QTYA 4CEHB 2PGJA 4JUDX 4GKJB 4JXJA 4RW0A 4RZUA 3RVNA 5KYGA 2RHRA 1HFJA 2E3JA 4M54A 1KBQA 3WIUA 1TVMA 1EDBA 3K8QA 2BIFA 4FYIA 3U56A 1NXQA 5B1EA 3AXTA 1SQFA 1M66A 1MJFA 3HB1A 4GMDA 4PPYA 4C78A 5FWDA 3STXA 2G7ZA 2F43B 4H60A 4HWKA 2Y71A 1B8OA 5CVDA 5ENVA 1Z29A 4M8NE 1ZLYA 4TPKA 1G4HA 4MQMA 1E4EB 2XUIA 3OZUA 1YK1A 4CQMA 3TR0A 2XJ4A 3F8SA 2QVLA 4K8OA 3ZOKA 4DCGA 1THTA 1L2TA 4ACAA 1JDBB 1Z3CA 1RRKA 4HSGA 1RQ7A 2Q8QA 5IABA 2PNFA 3OOEA 1VJGA 1KKLA 2ZQYA 1Q1GA 2EZ8A 4QG7A 2ZTHA 3JY6A 2ZIUB 4IPTA 2HRDA 4GYKA 5I8ZA 1K2VN 1NW3A 3H5NA 3T5CA 3OTOB 3TECE 3IOEA 3L4KA 3FWNA 3RSGA 2NTNA 1N2CA 3M4YA 4G89A 4XFKA 1O1YA 1U80A 2PX3A 2X76A 3PRHA 5LIRA 1PR4A 4CIDA 1YFZA 1PWYE 1A4XA 3CUKA 3WGZA 3NDJA 4RHEA 1B1AA 2PBLA 4DB2A 3M4JA 2NTYC 4D6PA 5J43A 5JOQA 3VVMA 4AP9A 1KC1A 3HQ4O 5GJBA 4RZ2A 1A8SA 2DHQA 3OZCA 4DHWA 4MP3A 1HTTA 2MYTA 3PP8A 5JD3A 4C6RA 3WYDA 3ABQB 4PO8A 2QW8A 2F1JA 3AJ9A 5CTJA 3GRCA 4HS4A 5EKTA 5G0TA 1UCFA 1YDWA 4JI2B 3AUJB 4XIGS 1UT5A 2ZULA 2W2NA 3DT8A 4LV8B 4TKLA 3L7CA 3EISA 2YBDA 4DRXB 3T9DA 4UAVA 5E7QA 1NONA 4I2VA 2AOWA 5JJIA 1QP4A 1MC8A 1NDUA 2ANBA 1QCCA 5BNWA 3VH4A 4U4AA 2AN1A 4NYIQ 3UMBA 5GOTA 1YDGA 3WGUA 4Z7NB 1BXZA 1PZNA 4O08A 3TW8B 1X19A 2PH3A 4GNKA 5LOVB 4GMHA 1E6WA 4UHDA 3G0CA 2G9RA 3OKFA 5DH9A 4H1HA 1JE0A 5JATA 2XT0A 4BE4A 1BJRE 2C9OA 3NBAA 1K08A 2ID4A 2YDYA 4LZLA 4JNCA 4YJGA 3NDIA 2ZWIA 1YGYA 1U65A 1EFUA 1UKYA 1V11A 4FYVA 2GFQA 2VWHA 1K4YA 2Y1EA 4KPUA 4QD3A 3NHPA 3N8HA 3UWSA 1J33A 1ECBA 2ONCA 4TV9B 3A6JA 1SCAA 4L4ZA 2FP4B 2X6QA 5MN4A 4NCAA 2GHRA 4XJTA 3MVEA 4L1KA 1JVSA 4WH0A 4WECA 1YL5A 1OTXA 4FHDA 3BHJA 3K4HA 1MHTA 1RACA 1RWQA 4AS3A 1QX4A 2NZWA 3IUQA 1VE1A 2YHSA 4BQPA 1G5IA 1RHQA 3GBPA 4R9SA 3ROQA 3AW8A 1ZCBA 1U3FA 2PBZA 3EB9A 4UBKA 4B7CA 4ZWNA 1F3LA 1SBCA 1IN8A 3NIFB 4OJTA 5LB2A 2Q5LA 4MWZA 5FPKA 1MXFA 1T1JA 3C85A 4JQOA 4RDIA 4JXXA 3W7BA 3H7IA 1S9HA 3WQHA 1AMOA 2TMKA 4BFCA 1N25A 2OQRA 1ZG3A 1QGAA 3UUWA 1HR0B 3AHJA 3FFTA 2GKOA 3CLTC 3ONEA 4KMSA 5L9AA 4HN9A 1UPXA 1R0CA 5GIPE 1CE8B 3KYCA 1TZCA 2B30A 4HUTA 3OLCX 1RAHA 4HLUA 5C18A 4LVUA 1G7RA 2V3CC 2I55A 1R27A 2OWDA 4BAZA 1B41A 2FRXA 2Y0BA 1D04A 1T8YA 3N28A 3PUKA 3O9VA 3DE0X 4CTNA 3WKCA 4AF7A 1WPRA 4AJJA 1XL1A 1L7QA 2Q1SA 3TQHA 3OE1A 3AWIA 2WUWE 2CLSA 4G65A 4JLPA 3N58A 3UHFA 5UKDA 1YL6A 2ONKA 3H1EA 1X2EA 5TV2A 3ZD9A 3ND9A 3FVWA 3LC7O 2RD2A 1LWOA 5DHFA 2G67A 3OM9A 2OD9A 3KKOA 3OZDA 2CDCA 3STYA 5JDIA 4RV9A 5EPEA 3D5TA 1BQ3A 2ZRGA 4XIJA 5G40A 1MA3A 3R7WB 5E2BA 3WFJA 4P35A 1KE1A 2I62A 4BFUA 4ZC8A 2I8CA 3B9PA 4R9NA 1WHTB 3GCXA 2HIMA 3UOGA 4XVCA 1KQOA 3EDCA 1D6SA 4QOEA 3OOHA 4R8RA 3SNHA 1C9JA 2H1WA 5HZHA 1E0KA 1JHVA 5BWOA 5BYKA 3AJAA 3PRKE 2OHOA 3SOPA 2BZSA 4BVEA 5KCMA 3BHIA 1DUIA 4F84A 4ZC1A 3R5TA 1MOPA 3S2UA 3W77A 4IVRA 2G9NA 1ISFA 4K9QA 1GZSA 4ESHA 3EMVA 1UXKA 1V6SA 2AFIE 3FPBA 3I4FA 2BN4A 2JBHA 1TTPB 3C3BA 3I6BA 3RYHB 9GPBA 1ID8A 1X3LA 5PNTA 5TMPA 3UYKA 2C2WA 3D3JA 3LCVB 1G8GA 2W22A 2GBIA 4EZBA 2QY9A 3IUSA 2XE4A 3H5VA 2ZSUA 1AQ6A 2BZ0A 4ADSG 4R2MA 4DSAA 3I9KA 2PKWA 2Z58A 5E6SB 4KAJA 2VF4X 1PTJA 1EQAA 3QU5A 4X3OA 2JS7A 2Z2IA 4M60A 4O4IB 4X7MA 3X44A 1GQRA 4JD5A 1ZR2A 2BE7A 1RHJA 3UFBA 4F9GA 4ZXPA 5BVGB 1UXJA 4IDFA 2WSSA 4UUPA 4BQEA 3BMNA 1UJ6A 2XUPA 3IVAA 3G8YA 3K0CC 1OZHA 5I7VA 1PFVA 5DTQA 4YC7A 1UMBB 1WTCA 1LJ8A 3HE3A 4TOIA 4D46A 4Q39A 5CXUA 4MRPA 2Q7XA 2VHZA 2MSWA 3ROFA 1AXEA 2HQRA 2NQ8A 3HKDA 3TRHA 1QG0A 4YIKA 5AUOB 2QTHA 4LSGA 4H7PA 4P6VF 1IJBA 4RIFA 3UWMA 3ZE8A 1G3MA 1SG6A 3AVOA 1TNDA 1DKQA 3PYXA 3BYZA 3VYRB 1YI0A 2P4SA 4V0NA 1JE1A 4ZD6A 2I2FA 2H4YA 2XQIA 5EIOA 1DOHA 2PNJA 3CFYA 3JPYA 1JNXX 4J7CA 1VDMA 3LDFA 2J41A 1JB1A 3DEAA 4CKWA 4DR4B 1RMTA 3GGPA 2LD4A 3Q3JB 4IVNA 4QGFA 4LA4A 1YIDA 1QG2A 5JE8A 2MSDB 1CUBA 2G7MC 4QU0A 3N70A 1DGQA 4D9KA 1SHLA 1B0ZA 1Y82A 5DGDA 1MC5A 5B2FA 2FW7A 5C37A 4R2XA 5K0CA 3DEJA 4RMGA 1DC7A 1MABA 3NOVA 3NC0C 1FP6A 3N76A 4FIZA 5EE1A 2KJQA 2XD9A 3SHWA 2FN3A 3WTCA 2J87A 1WZIA 3PC8C 1R6VA 4RENA 1MQSA 1JHUA 2J32A 3QVKA 4Q4AB 2XGJA 2EARA 4IQGA 3ZV5A 5HWSA 2WAYA 2E1RA 3AZOA 1KTVA 1PZGA 2I6FA 1P91A 4ZTZB 2W2VA 3AO0B 5BOSA 4K2HA 1AGXA 4CN8A 3PXXA 3E3MA 1UPTA 3C3XA 4NMWA 3SZUA 1FVFA 2CXTA 3EWIA 3OQPA 1RYEA 3PCRB 4PC3A 4NENA 1K89A 1DO0A 4CMBA 2VUHB 3REOA 1GKYA 2C94A 2OHGA 2PUBA 5AKJA 3L1JA 3T94A 4NICA 2ZFUA 2R85A 1QIDA 3VYUB 3E58A 1TQHA 4UPEA 4TKVB 3KLBA 4N3CA 3ZBQA 3LL4A 1VB5A 3AR5A 3Q6IA 4UBNA 1TCBA 4Z3OA 2R8PA 3ZN2A 2EP8A 1LNQA 3BWXA 4FILA 1QS0B 1UAGA 2VRNA 2QQ5A 1HKHA 2WMYA 2ZBGA 3THYA 5EGNA 2OPHA 1MO3A 2V65A 3MWYW 1JGTA 5ALDA 3Q8LA 2F1OA 1XJQA 1CZHA 2P30A 1P7YA 2J3DA 1P0MA 1P29A 4YP6A 1ZR4A 3ABIA 2CNWA 4X65B 3DNMA 1CETA 1Z36A 4KXVA 3K1YA 1ZGBA 2JJYA 4B84A 1N6HA 1EZ1A 1NJ5A 4OUKX 2EFCB 2E2WA 3GCDA 3D2AA 2OXEA 4PLHA 4KAFA 3L0YA 3AR3A 4Q15A 3ZDQA 1FYFA 1JEJA 4O5AA 3CUTA 1NXSA 3EHEA 3CNHA 1ZOOA 1XMIA 2QGFA 3AKDA 1YWGO 4X1YA 2V7VA 4KXUA 3RABA 5JQGB 3R3YA 2ZBQA 4ZI2A 1JS1X 1LTQA 1Z0KA 1QJCA 2H1HA 3ESQA 1PEYA 4IOMA 1M1NB 2BM8A 2JC3A 3Q40A 3ZE7A 4CM6A 4QM7A 3K2IA 4G09A 4GE3A 4AUEA 2KBEA 2C2MA 3KK0A 1KPIA 2V55B 4WUTA 1VHLA 3TSZA 2O3SA 1Y3BE 3KAKA 4PTYA 3S99A 3TI9A 4DMLA 4IQ0A 1CUUA 4EGAA 5JWRA 1SXJA 1Y9DA 1CY6A 1E1KA 4BZPA 2ZI6A 4ALNA 4H7JA 1OFHA 3R75A 2PSSA 2Y1CA 4H0NA 3WIDA 1R9NA 4WZZA 1JAHA 1BEEA 1FZTA 1D2RA 2OZPA 3BDAA 4AJEA 4FNMA 1YRQA 2X9QA 1Z4KA 2GILA 4PXSA 5G3ZA 4M86A 4UHJA 1LDYA 4JKOA 2NN3C 3ZWCA 4WBNB 3SEAA 3L77A 4FWIB 3GDGA 4YMIA 5K09A 3ME5A 1YZHA 3A8TA 4JLDA 4N7BA 1GZ5A 2Y6UA 4AM8A 5IFKA 3N2YA 5AKHA 1AQLA 3MMPA 4ENQA 1BFDA 4LF8B 2YWRA 3E6AA 2J5KA 1FRQA 1OLSA 2O8BB 2RFLA 2WJIA 3CB2A 5F78A 3LK6A 4RVCA 5IH3A 3L6CA 3CF2A 2ASVA 2HWWA 3ENQA 4MA4A 1KZGB 3UUGA 3QIVA 5EKSA 4QO8A 3KWLA 5J23A 2B98A 1QV7A 1TB4A 3KJQA 3QK7A 3GJRA 4QYSA 1GFIA 4O2AA 4RQTA 1ZD8A 3AV3A 4X7BA 3ROKA 1U1EA 1W4RA 1SZCA 3MTQA 1BRTA 1U7TA 3PGA1 3UMJA 1U8CB 4L85A 2JLXA 3GL9A 3ZLUA 1NVTA 3I2HA 3ENKA 4WDRA 1KY3A 2PJZA 2EYUA 3O8OA 1HDEA 1M7GA 5JI3E 1H9CA 1RKVA 4HGRA 4B3IA 1R18A 1TLLA 3T1HB 4IOJA 5JFTA 3KG2A 3AJDA 3QU7A 2XYPA 4OJNA 4BUCA 4DV4B 1Y5MA 1B23P 5TB5A 4PBRA 5L53A 5JSZA 2RBGA 2HMTA 2GZSA 2VRBA 4EY7A 3WLIA 1VBNA 3H2HA 1U94A 1C1XB 1DRVA 1EWKA 1F20A 1FFCA 1FTGA 1PZXA 3QKIA 2QZSA 1U7WA 1UH5A 3ICPA 4WFKA 4KO2S 3JSAA 4TM7A 4XUCA 1QPGA 2FTKE 4DZRA 2P7IA 1GP2A 1R5OA 1TMOA 3I1FA 3KT3A 4NU5A 1ECJA 2VSOA 3LLMA 1KEUA 2OV6A 4OQYA 1EGVB 1ZN8A 4GIBA 1H2WA 4L73A 3E5RA 3ZDEA 1MH9A 1HURA 2EQBA 4LNUB 1ODKA 1TKCA 2Q0SA 4K6OA 1PLJA 5T57A 1VPVA 1WETA 5ARBA 5DX1A 5CYPA 5BQFA 3IP8A 3C8DA 1H8EA 1XL0A 4JJ7A 1WULS 3KTOA 4QWMA 1QG6A 2RGRA 1J22A 2JANA 3UXYA 3K9HA 4OFWA 4ZQIA 4CHGA 4TWRA 1OILA 4YVFA 2HCRA 3PDIA 3Q0TA 3M1YA 4UKDA 2P2LA 4AK9A 1G18A 2PSJA 2Z30A 3I64A 4EYQA 3KM0A 4MUMA 5F77A 1QWSA 2FPGB 3UTCA 1L5HB 5TF0A 1YU6A 2E87A 5CCXA 1ZUNB 2IU3A 1ORVA 3USES 3GLKA 3UUEA 3WA7A 4BP9A 1JSXA 1Z06A 1SD2A 2Z43A 3IQWA 3ZW8A 2QM0A 2YFYA 4ZAVA 1I3MA 2PXCA 4GOLD 4MS4A 1LZLA 4XA8A 5K3SA 3PUYA 2QNRA 3QKWA 3HS3A 2J0UA 3CVYA 1GRNA 3QHAA 1P2BA 5IHPA 1FK8A 1B2LA 2X0KA 3RS4A 1M0WA 2GM5A 2BMWA 1G9TA 4Y9TA 3HR8A 3V8NA 4NE2A 2X86A 1WS6A 3LIIA 4AS2A 4S3MA 1UMKA 4I4CA 1DAEA 4HOYA 3O7MA 1CY0A 5I9BA 4CGZA 1NQVA 1RXSA 2QW1A 3PX2A 3PZBA 4MRRA 5IBPA 3TJZA 4EW3A 2REOA 3TINA 1RQPA 1VE9A 1R3UA 3MMNA 3OHMA 3VZSA 1IAQA 3O8QA 4FC6A 2H1RA 1SAYA 2YRWA 5AJVB 5TE9A 1DAPA 1PAUA 3H11B 1C7JA 5U9CA 1E59A 2A35A 1N9GA 4ARZB 1NN5A 4M3NA 4OHUA 4HAIA 3TIXB 4C0HA 3JALB 1Z8FA 1E9EA 1ZSYA 3D6NB 4I81A 2XBMA 1U9YA 3CX8A 5C46F 4QRIA 1C1HA 1C9YA 1NBMA 1NUHA 4JP3A 1Z22A 4ES6A 3NHRA 1E6UA 4FZVA 1F7VA 1ACMA 2YXLA 5AKXA 2XSZD 3U1TA 1UKAA 5EJFA 3OJXA 2HT1A 2DKNA 1PS0A 5D8DA 3BFVA 4OF4A 4F5YA 3CLRC 2OV8A 3REGA 4QVKA 2BSQA 1MV5A 1VYVA 3FYUA 1QZUA 1G8FA 4HDSA 3HNOA 4YJDA 2X6TA 2ZE7A 3DLAA 1RWPA 2HYDA 2IZ7A 3UPDA 4OHCA 1TM4E 4NJOA 3RRNA 1FNNA 1I3OA 3L92A 4B82A 4LY0A 3U4QB 3WOHA 3ROPA 3WO0A 1WKVA 4IIHA 4MV7A 1OJLA 1RP7A 2OCYC 1GQFA 1AH2A 1EESA 2AYXA 4RA9B 4MPPA 4CMAA 1S9DA 2L42A 3U31A 2Y1LA 4AZ0A 1HE1C 3CW2A 2PRJA 1QVAA 4FNOA 1BN7A 5E4YA 4X66B 3N53A 1KI8A 2G0NA 3CRVA 3E05A 1OWMA 2QNBA 5DI3A 3U9LA 1T8RA 4Q3LA 5I45A 2EL7A 2VDJA 5J2TF 4B9EA 2PR2A 2XUQA 3VHXA 4EHLA 4J0KA 4QQRA 1G6HA 2FQXA 3KKLA 5KNCA 1Q16A 1GHTA 1ZIOA 3CH6A 1KDYA 4KXXA 2X5OA 4LC0A 2G4VA 2CLHB 3L1HA 3M6FA 3P71T 3R44A 3TGWA 2PGAA 3QX8A 3V1KA 1XRQA 2QYTA 2YZGA 3G2HA 4I5IA 3AESB 4BMPB 2P69A 4F4HA 3FNGA 4BBPA 1R2QA 3R8FA 3L2OB 1O6BA 1PGQA 1RPAA 4IDQA 3FOEC 2VNAA 4Q82A 4X71A 1NASA 1EVLA 3WNZA 3RYCA 3K70C 4XYEA 2QAGB 1S96A 3QVXA 4M9SA 2YZ2A 2Y1DA 2HUPA 3WL3A 5BYAA 4J0FA 1FFBA 1NKTA 3M4NA 1E5TA 2BFNA 3JQFA 5H80A 3GN2A 4M4SA 1DTSA 3IO3A 1LRLA 4LRWA 5I6DA 4OFZA 3MJRA 2P5TB 2ECPA 1DKRA 2J09A 2ONJA 4C0KA 4CNQA 3AW9A 4TLBA 3T7RA 2WBLC 1ORHA 3CJQA 1GJRA 3SDZA 1F6WA 4JIGA 4JOSA 4MUKA 4TWAA 5CXXA 1NXVA 4FK8A 2FFAA 1CQJB 4I14A 3RYIB 1KI1A 1S89A 3KJFA 3X2EA 3OUTA 1PGOA 2VDWA 5HF8A 5JAIA 2VDPB 1BW9B 4QA9A 1XTJA 3H18A 2B35A 3IEMA 3B52X 3L02A 2AG0A 1GUYA 4NMHA 4QJ4A 3K2BA 5F3RA 3UMFA 3WDLA 1IN4A 4D80A 1CQXA 4HGPA 2AG1A 3TAUA 4PAWA 5IT9A 1EM8B 4TVBA 1YK0A 3OOJA 3ZWAA 4TTTS 1J21A 1WUYA 4DDVA 3LC2O 4N0QA 2IT1A 4FYHA 5AW7A 2AX3A 4M1TA 5LUBA 4BMXA 1LVUA 3G1TA 5FPYA 4D9IA 3OVMA 2PO7A 3AVQA 2FV8A 4LEIA 4MAFA 2V4UA 3TJRA 4I8IA 2MSKA 5TX7A 3TNFA 3OE5A 1M1UA 1T1SA 4UXIA 1UKVY 2IV2X 4U0KA 2C84A 3WGKA 3LLSA 4F9EA 2Y8EA 5K0TA 4R9UC 3LUGA 1XRPA 1TMGE 4DCUA 3M70A 3DKKA 3MJTA 3RVSA 2B9EA 1I8TA 3DOHA 2C97A 2POQX 1HE5A 3VXKA 3U4CA 3AFIA 1K86A 2Q5HA 4BP3A 2NSLA 4OMUA 3M5WA 3PC4A 2A9VA 3SQNA 4BFSA 2G5CA 1LFAA 5JAUA 1N5KA 4NI5A 3HRKA 2N46A 1YBMA 1YDMA 3IPCA 3L1IA 2D5CA 5IJ9A 1APBA 2QPOA 3SVTA 2HJHA 4XDZA 3QX3A 3DO6A 1R6XA 1JJIA 1AKTA 3L6BA 4MVJP 5KOHA 4KNYA 4W7IA 4U2DA 1CRPA 1FSSA 4Q1CA 1Y3DE 1RIFA 4RDXA 1PZEA 3C98A 5CLQA 3I6MA 3UGQA 1YIOA 3VU3A 1I2MA 2RAUA 2ZBDA 4X8MA 3W90A 4JBGA 4DCJA 4IIDA 3F6CA 5KX5F 3AUFA 3L0BA 3G2QA 2VTBB 2Q62A 3HCPA 3T7AA 2JFPA 1JRLA 1H69A 2O1WA 2WI8A 2LXNA 4LECA 2C7OA 1PHRA 3A25A 4N0PA 2BEWB 1JTVA 4Q9HA 4Y1GA 1Z45A 1V1RB 1G9XA 2XDQB 3EQ8A 5B58T 2CY0A 1JG2A 2IP2A 3U17A 2EWVA 2RI1A 3GWZA 4GEKA 1TM2A 4BOYA 5F23A 1AKQA 4WINA 2MYNA 1ANKA 4TTSA 5FBZA 1OOEA 1T24A 3H2JA 4BUJA 4D98A 5CFMA 3KSBC 4E5VA 3P4YA 4ERXA 1DKNA 2QD3A 5ALXA 3TIVA 1Z17A 1HLDA 2JGIA 3FTCA 3O90A 5EWMB 3H2SA 2JIQA 4CIWA 5ARDA 2RHTA 4MQFA 3VR6D 3BJRA 1V7PC 4LBYA 4OU4A 4WZAA 5CLLA 1XHFA 5A5DA 7AT1A 2LGJA 1XEXB 4BKPA 2ZPUA 4KIGA 2FGJA 3KCNA 4W1RA 3DO8A 2WM8A 2AFHA 4PPQA 1VI2A 2CUTA 4EG6A 3CVXA 5KYXA 4C14A 4KLAA 5JH7B 1QYWA 4I3HA 3RU7A 1QQBA 2XADA 3NHLA 1LTKA 3HBMA 1Z16A 2UYQA 1NI5A 3LBAA 2HV9A 2PBFA 1HG1A 1KDRA 3MB8A 1ZMOA 5U4QA 1UDBA 3SICE 1PKXA 3HUDA 2AIRA 5HQ3B 1KY5A 1PD1A 4JU8A 1UEJA 2VCEA 1W85A 1MB9A 4ZP1A 3THRA 1PBNA 2IPOA 2AOUB 3FW1A 4ZV9A 4L3WA 3OAAA 1UT8A 2AOTB 2ODBA 1N32B 4NQRA 1YFLA 5E2IA 4AWXA 1EVZA 2NO6A 3FOCA 3KLMX 5FBHA 2C9ZA 4A0QA 2IU4A 3F9IA 1G0OA 1HG0A 4JLWA 1GILA 3NHFA 1P80A 4PRKA 3OZBA 2FGKA 4TKMA 5DLQC 4C2UA 4G0PA 4AMGA 1XMPA 3M6VA 1U02A 2UYOA 4F4DA 1C9NA 2YWJA 3G85A 2XZTA 2PY6A 2NXJA 4R84A 3KWFA 4R1MA 1UL1X 2HLDA 2GN6A 2D2FA 2VK2A 3T3EA 2JKYA 2JHGA 4E7PA 2CJXA 3ZHUA 4Z3KA 3Q85A 1NW5A 5H4GA 3LC1O 1ZGHA 2E89A 4TUYB 4OD0A 5AJXA 2BP7A 4OLHA 2HNKA 4H6VA 5HOEA 1R16A 4HWRA 4PEVA 2AK2A 1ZRHA 4QNNA 1ZM4A 4IQ4A 1C80A 4ZVNA 1YUNA 3B1ZA 3D5EA 3PEUA 2A57A 3UICA 4FOPA 3LP5A 2YJGA 5EP1A 5BWCA 2DQZA 3LBNA 4JEMA 3QJ5A 4CLOA 3HVRA 4DZZA 2OCBA 3AM1A 2PG3A 4IV0A 2XOXA 3WSVA 4CT0A 5HIAA 1ZHFA 5C2JB 4L2IB 1DQSA 1IIBA 2DMRA 4HTFA 2ISQA 3Q2IA 2EHDA 4L8WB 5H16A 3D6TB 3RPEA 1NUAA 1B8UA 2FZLA 2JAWA 3G8DA 3MTIA 1TUBB 2B4YA 3UO8B 1JAXA 4D2IA 2OHHA 2RCYA 1HSOA 3CT4A 5AOBA 1PWEA 2W6JA 2X2OA 1A4UA 3GX1A 3NU1A 1F0YA 2UVDA 2CHQA 4RM2A 1PYDA 5KWJA 3PA8A 3JQ7A 4ZPJA 1PWHA 1Z5UA 3N6VA 5AICA 4PLVA 1QRRA 4N48A 1RBQA 2C2YA 5LWHA 1L5YA 3PNOA 3U1VA 3CZPA 1GPBA 1NTRA 2HF2A 4LHSA 4CUZA 2BEKA 4X0EA 4XVRA 4W9RA 2G28A 2J31A 3QVLA 4MPDA 9ATCA 1T9GR 1LPPA 1VGVA 4LJ8A 5E1BA 1KO5A 1UDCA 3LOQA 3J7TA 1WKBA 1VSQA 1PR6A 5A4AA 2QRQA 4C4XA 4YR7A 3EVAA 4KCGA 1BE8A 3RVLA 1RSZA 4BCCA 1A8HA 4KQ9A 3UJHA 4M7RA 1K6MA 1A9QA 1PE0A 3LNCA 3NCTA 4WK2B 5AM2A 5I9NA 3MWDB 1Z2DA 4GYWA 1YF3A 4FJ1A 1Y8RA 1VGRA 5DISB 5HNKA 1ITZA 4DBZA 1KK2A 3LY9A 4N4AA 3SBDA 1QRTA 3P9YA 5AJZA 1B93A 3HU5A 3PR1A 3CY6A 1GU0A 2ZQ5A 2Q1WA 1X1TA 1YZKA 1T5DX 3A9VA 3BWMA 4KAXA 5IVIA 4EO9A 2V7BA 3QYPA 5ER6A 1U1GA 5HR5A 1FY2A 3P32A 1U2TA 3RSFA 3UAWA 4C08A 4A0RA 2FHSA 421PA 3B70A 5ELLA 5E9WA 2F8SA 4MUAA 2JJ1D 3FBTA 3C3KA 1QC5A 2VPZA 4KXMA 4HFMA 1BE0A 1EFVA 2FUCA 2GJSA 3HEMA 2Q3HA 4Q7JB 2F3RA 5KTYA 2Z2XA 1AK9A 3GH3A 1ONBA 2ZIXA 1C3XA 4ZJPA 3V8EA 3DZGA 4L07A 3ETJA 5EHIA 1LF5A 4NR0A 1RDFA 5JZMA 1H1LA 2H2HA 3SPXA 3LX5A 1JHDA 3LO8A 1D5CA 2B4AA 2WYHA 2JZNA 2WEKA 3LWBA 1XXLA 2ZE6A 3PIRA 3THSA 2DC1A 3OO1A 1PTJC 3PPYA 1SD1A 5IUKC 2LV8A 1I2BA 4CCAA 2WIKA 3JZIA 1GL6A 2EXXA 5K0EA 2J67A 4RLFA 5CGQB 1RC8A 2VDNB 2R8YA 4KZPA 2J4FA 1IEQA 5AKGA 5LPNA 1Z12A 3I1IA 3MTJA 4B2PA 1M75A 3THXB 1K7YA 4BRWA 1GZ6A 4C05A 4KUEA 1HGXA 4AY3A 3GJ3A 2H1IA 2CVZA 1D09A 1JHPA 2G09A 2IUSA 2ZBVA 1ZUD1 3R3UA 3D6FA 4FHGA 3SZ3A 1WTAA 1JJFA 2RBEA 2W70A 2BAGA 1SBQA 2KHZA 2EF0A 2ODWA 3AHFA 3EMKA 3JPWA 1Y6QA 4OQ4A 1W5BA 3PNPA 4AIIA 2WABA 2XR1A 1W36B 4AY4A 2DOKA 1ZCJA 4YDSA 4RA6A 2J6HA 3B89A 4UDNA 2ZSDA 1G2OA 2HF8A 4PV7A 2R6HA 4MQEA 5HS6A 5IJWA 4AY2A 3HCOA 1OMOA 3VPGA 3GGGA 1XDSA 2AQHA 2ETVA 2VYVD 1ZUWA 1V3QE 4DT1B 3ADDA 3OETA 4Q3AA 1Z4QA 4RDCA 2Q6VA 4R7GA 2WWWA 2QLJA 2J9ZB 1T2AA 4Q9AA 5FPQA 821PA 1V48A 1FXWA 1RQ2A 1BVUA 3NV7A 2DUJA 1V9SA 2HA5A 5CXSA 1FX0A 1EMDA 1M8KA 2KE5A 2R2AA 5B1IA 3MFYA 4YYZA 3GRUA 1LC3A 1IMJA 2FPLA 4H1UA 3B60A 2HK8A 2VBCA 1K1EA 3BL8A 1LDEA 3QBDA 1PX0A 3B2EA 2LW7A 1DC4A 2MT9A 3UGJA 2O8FB 3KUUA 4HRXA 4QZVA 5JXJA 4KXWA 1T10A 1NLZA 1BA3A 3ETCA 3PUZA 4HBGA 4RXTA 4B2YA 4KREA 3IR5A 2TECE 3EASA 1T6NA 3IHWA 5ERGB 2A9JA 1JR4A 2RKBA 2AWOA 4UDXX 3DPIA 3H8WA 4YJFA 2G3YA 3I9JA 3MZ0A 1P7CA 1TYZA 4DILA 1FTYA 3FGZA 3WNCA 1ZLXA 3L9WA 4JBLA 3EFOB 3R8CA 1EFRA 2H2DA 1N5RA 2WHPA 2FUEA 2WT9A 1VL5A 2WKWA 4Q1BA 3B9BA 3WYCA 3ZKWA 5A4MS 1N5IA 2CK3D 3BREA 3FJYA 2YHIB 3FLEA 2GFHA 3VYVA 4CR8A 1A9PA 4IIVA 3V97A 2QXYA 2QZPA 3JW8A 1GRCA 2C83A 3ZQ6A 1PL8A 1T1GA 2IZ1A 1W5FA 3HJTA 3QY9A 4DCPA 2ZIVB 4G0NA 2DLCX 4Q4JB 1L1RA 3SSAA 2CC2A 4O5OA 5HFJA 2V0NA 3V8RA 3A3PA 2X7JA 3I42A 1IFXA 3LDHA 4QXRA 5FI3A 2F64A 3QVMA 4BV9A 2ZTUA 4I1PA 2GPSA 4FEEA 2GAIA 4Z0TA 2JIMA 2PSDA 1XYVA 4BDSA 5CPFA 5M5BA 1FFYA 5THKA 4OSPA 1KI3A 3WGJA 5L3SB 4JT4A 4NH0A 1MGPA 3H5AA 3C3AA 3W5DA 3QKRA 4LJSA 1JHXA 2VXYA 4UAGA 1M8FA 4UEJA 2CMFA 4ZI7B 1PNRA 1V96A 3LUHA 3A14A 5MGNA 3KQHA 2OB1A 1CS4C 1GCUA 3W3AD 3IAUA 5E7IA 5ADHA 1VLLA 2H57A 3WS7A 3D4OA 3ND6A 5KYVA 2IGBA 4HXYA 1OVMA 4B1FA 1DIGA 1USIA 4D74A 3GXOA 3DLIA 2G40A 3GG2A 1VZ3A 3IJ5A 3TQQA 3V2GA 4CL2A 3ANYB 4URWR 2YY5A 2ZI9A 5LP6A 1MAVA 4WXEA 1SXJC 3AUTA 5FQNA 1E4YA 4FDMA 4COOA 2IHTA 5DGXA 4RHUA 2OV4A 3LVFO 5BO5A 1WW3A 2QLFA 3P9ZA 3JYNA 3TDKA 5TGTA 1UXHA 3E8XA 4O8ZA 5DO9A 1XU4A 3CKMA 1OH5A 3MT9A 1CP2A 1HORA 4ENUA 1QLWA 3OPYA 2XT6A 1U8TA 1FX1A 5EFOA 1QU3A 5CHEA 4TV8B 1EKXA 3UGTA 1F6DA 2P9QA 2XB6A 3AYXB 4HDRA 4KK4A 4MPRA 4BTVA 4D25A 3GLFB 4ASUD 1N5OX 3FDZB 2FG5A 5JT1A 2H1VA 2OCAA 4HVTA 4CFZA 3KEQA 1C9EA 2YZ7A 4PLCA 2P6NA 4XXHA 4YRCA 1QLHA 4D3XA 4PC1A 2WAOA 2VJPA 4PYLA 1G7TA 1MRSA 1Z73A 2BMEA 2AYYA 5AH0A 5GOZA 1GN8A 1OLOA 2C1XA 2W2XA 1IXRC 3KXDA 2O4UX 2VNKA 4WESB 2QP4A 3VR6H 4XPIA 1CRQA 2QRPA 3OFNA 1GVNB 1V4VA 3KPWA 4JIMA 4H08A 1T13A 5JJCA 2M1XA 1BDHA 1IPHA 4J0EA 4G5XA 2OV1A 3D6MA 3M83A 1PQPA 2B0CA 1J56A 3NT2A 4AJKA 4X6LA 4KVZA 1MOQA 3C7KA 1S3GA 2J7PD 3T5AA 1QYIA 2H8GA 1MAUA 1GZHB 1F2DA 1ESEA 2PX5A 1P73A 2BGRA 2NYUA 2V7QA 4EB8A 3QOXA 5IJZA 2WNIA 1JFFB 1X6VA 2O5RA 3VKHA 2OGWA 3LWNA 1FDWA 5LNK6 1IBMB 4XASA 3IBGA 4V1CB 4MKGA 3VNVA 2UKDA 1XUOA 2VJKA 3F7NA 5JCOC 4E5YA 2FR1A 3KB6A 1CSEE 4QUKA 2HHJA 4L7VA 1CDOA 4RL6A 2FUG6 3GNLA 3IEPA 2B5VA 2QT0A 3VUFA 1NVXQ 1KR5A 2AF3C 3QEMA 4KLZA 5DBGA 3AF6A 4JBXA 4YAJA 3HJBA 1P1IA 4B3XA 4OQEA 2CN1A 1FFAA 1J25A 3PF8A 3QKSB 5B30A 4UM5A 5EIWA 5L51A 3A2KA 1HSZA 3LE8A 4RVGA 3T1OA 5CA0F 4R16A 3R7SA 3S2FA 2IXEA 1U31A 2OLKA 3DDCA 3PHCA 4YUVA 4GRDA 4DG8A 4XWGA 2BMDA 2WFLB 2FEKA 1JFLA 1ISGA 1W8IA 4I4LA 5BNFA 4RWEA 1U8ZA 1TGYA 4K9MA 5JAZA 2FPXA 5JV5A 5KTPA 1WQ1R 3HCRA 5FI0B 4QHYA 3TBKA 5HM6A 3I61A 3ILHA 1F5NA 4F5EA 1DJLA 2ZRMA 2A4MA 2PUHA 4CKBA 3LDUA 4OTZA 2O54A 4CTMA 3OPQA 4RTQA 3JYHA 5DBFA 1P2GA 4FBLA 1FUEA 1SC6A 4RK4A 2WLTA 5CVUA 2R25B 1N8NA 1T6BY 5EAIA 4E21A 2FE4A 1C8VB 1LF0A 1PDVA 2BFFB 2XZDA 3C4QA 1KAGA 4QUEA 3VVLA 3R7NA 5TQ2B 1LGYA 5ALPA 1VDZA 2CYCA 4PWYA 5BWLA 4S1VA 5THXA 1XKLA 4E15A 2ZYHA 4E2YA 1WJGA 4V02A 5SZHB 3MTGA 1KAMA 2QUKA 4DS3A 3K6SB 5K8CA 4UFOA 3MG9A 1OXSC 4N6GA 2GYYA 3U3XA 3RKUA 2XCSB 1PWXA 5BSMA 4AJIA 5LZ4A 2GS9A 3CGGA 3D02A 2B78A 5LXTB 5CX1A 2A33A 3LYHA 4D3FA 5K0FA