3PJDA

Structure of enr g93a mutant-nad+-triclosan complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIAFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural basis of triclosan resistance
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pjdA00
4GVXA 3PDJA 1MFPA 1PIWA 4GKBA 1O0SA 4CLXA 2C2XA 1DC3A 1BWSA 4WE3A 2PWZA 4BS9A 1IUKA 2DBZA 3PQFA 5AVOA 5KJEA 2X0RA 4BKQA 1YQXA 5IZCC 5H81A 3Q9NA 5A05A 2GZ2A 4EEXA 1I5RA 2GN9A 1EMDA 3GUYA 3KEOA 1HT0A 3A28A 3BMNB 1LDYA 5MGBA 2X23A 2NTVA 2PZJA 4RPKA 2EXXA 4NPCA 4RGBA 4BMNA 2X0JA 4R3NA 4HFJA 3T7CA 2Y1CA 4KQXA 4D42A 3RVDA 2HQ1A 3BTVA 1C0LA 2JKVA 4NBVA 3OBBA 1DB3A 1Q7BA 3R0IA 3ZZNA 4J4BA 4BB6A 4IQ0A 3S2IA 4DGSA 2GD1O 5CFZA 2DC1A 3R3JA 5L3ZA 2FMUA 3KXDA 4CV0A 3RC2A 3I6QA 3MJVA 2NACA 7ADHA 3BYZA 5LC1A 3M1LA 3D5TA 2DPHA 1DJNA 2QQ5A 4QO7A 4W82A 3W4JA 4CQMB 1QYVA 3DAFA 2AW5A 4FFOA 1GCOA 4PLZA 5G4KA 5I9LA 1B7GO 1Z75A 3EW7A 5DF1A 1TT7A 5U9CA 5C37A 3OA2A 5FYDA 2CD9A 3H7AA 2C59A 4HKTA 3EZYA 3VZRA 3VH3A 4FIZA 2WM3A 1WMAA 3SBOA 2W2LD 1OI7A 1MA0A 1MG0A 4CM6A 1E7WA 3IP3A 3O38A 4AICA 4EBFA 1H9BA 4NHEA 3QJ5A 1T1SA 5A9SA 4YEDA 2Q1WA 4BNHA 1R15A 3IC5A 4JIGA 4QFDA 3QP9A 5JXWA 3UICA 3AU8A 5G0SA 1V3VA 2E48A 3WNQA 3D3WA 3WB9A 1D1SA 4LVUA 2F00A 1BXKA 3NGXA 4E21A 4E3ZA 3D4NA 2IYOA 1E1LA 4NG5A 3D5QA 4J9VA 2FOIA 4F3YA 3GHHA 4BKRA 5CEEA 1Y7TA 3PQDA 5IFLA 3F3SA 3FNGA 3Q6IA 1UXGA 2Q2WA 3GR6A 3RFVA 2BGLA 3QY9A 3I6IA 3RD5A 5JE8A 3WXBA 5DBIA 4XKJA 1Z74A 4M89A 4BMSA 1Y9AA 4CV1A 5IAAA 3HN7A 4LCEA 2UUPA 1MXFA 3WGHA 4AJEA 1B15A 2B5VA 5JFOA 5LDHA 1ZO8A 1GY8A 5JNLA 1U28A 4ZHSA 3EVNA 1T26A 5JDIC 3EC7A 4E5KA 2GN8A 4GX2A 2HDHA 1N2SA 2V65A 1PJCA 3DBVO 1ZSNA 3AM3A 3DR3A 3ZWPA 4E4YA 2X9VA 1I0ZA 2X5OA 3INGA 3LC7O 3ASUA 5DCYA 1WAMA 4ZRMA 1CEQA 3KBOA 1I3MA 1GYPA 4UUMA 4J0FA 3ZH2A 5TJHA 5KNLA 1DXYA 2BHLA 5COQA 5DP2A 4TRRA 3RUAA 2W2LA 4UVDA 5F1KA 3KSUA 4EUEA 1E3JA 1K6JA 1RJWA 4F45A 4WCFA 2I67A 3IOYA 3VVBA 4DWVA 1YJ8A 2PGLA 3UAGA 4CUKA 3OJLA 2G1UA 4GBJA 4L8VA 4DLBA 3HDJA 3SX2A 4Q3CA 4GGOA 4YBZA 3GLQA 3WX0A 3ROKA 3HJAA 4TRJA 2OUIA 1I2ZA 1DLJA 3CEAA 4CM3A 3FPCA 5DDIP 1DIRA 3UXYA 2XXBA 2IXBA 3BZUA 1QLHA 1YE3A 1GPDG 5GZ6A 3MEQA 4XRRA 3ZNQA 3C3XA 4CL3A 4Z9XA 2HRBA 4G81A 3K6JA 3WLEA 5JY6A 1K89A 4PN3A 1C0PA 4FB5A 4RJTA 1GYQA 1LA2A 3OF2A 3PFFA 3TFOA 2FPGA 1DFGA 5CDYA 2UDPA 3NJ4A 2A35A 1ZK0A 1WP4A 4CM9D 1KS9A 5G4KB 3ZHBA 1VKNA 1DAOA 3C85A 1UAYA 3DOOA 3I83A 3INTA 4CMEA 4FFLA 2FP4A 1T2DA 4J91A 4BNNA 4ND1A 1G6KA 3DOCA 2YHIB 4DBZA 3O4RA 1PS0A 5T67A 1NXQA 1P1HA 4FW8A 1PSDA 3IUSA 4HWKA 2BLLA 5FWNA 2J5RA 4HBGA 4A27A 1MX3A 1GTMA 5JO0A 1J6UA 2Y0CA 2H63A 2GERA 4EJMA 3PWSA 4XYLA 2HMWA 3MTGA 3P19A 5DBGA 3Q9UA 3D3WB 3DMYA 3LSYA 1BXGA 1YO6A 3PTZA 4H16A 3DZIA 4DVJA 5L40A 1CQIA 4FOOA 3RQSA 4RPHA 2WTBA 3P7MA 4R3WA 5H82A 5T64A 4Z0HO 2QYTA 4ALKA 1UH5A 1P1FA 1EBFA 3IP1A 1OOEA 3Q2IA 3V1YA 4BIIA 3B20A 4LMPA 2OGUA 4HNGA 4JP3A 1XLTA 4W7HA 4EZBA 2Y0DA 3RUEA 1SMKA 4CMIA 5A3JA 3V8BA 3DDNA 1E7QA 1ENYA 4RPJA 1D3AA 5ILGA 4XA8A 4IDBA 2XF8A 2DUUA 1TVEA 3LT0A 3LYLA 3U4CA 4EW6A 3GDOA 4WNCA 3KYDA 1I2CA 4NR0A 4KZPA 2AQIA 2AE2A 4DXHA 3K2EA 1EBUA 3ZV3A 2WEKA 2YHUA 4Y8VA 3WTCA 2O7SA 1JN0A 5DULA 4G2NA 2Q99A 4CM9A 5TSDA 1LEHA 1IYZA 2GF2A 3OQBA 3VHRA 3RC1A 2A94A 1EZ4A 4G65A 4I08A 4J4TA 3TZ6A 4A2CA 3GVPA 3D0OA 1JKJA 3C1OA 4UEJA 4PVDA 2YFHA 1EQ2A 4JBHA 1HXHA 2YDXA 2C07A 4WCFB 4A0SA 4FQ8A 1B8VA 4CLOB 1OAAA 4EJ0A 2HLPA 3JD3A 2C0CA 3ETDA 4PLGA 2GRAA 5JS6A 1R66A 4OQZA 4CM1A 2RHRA 2EWMA 2FWMX 1PJ2A 3IDSA 2C5EA 2OOSA 3GY0A 2R6JA 4WNIA 1I2BA 2C82A 3ZWAA 4AJKA 3GEDA 2B37A 5BSGA 3GVHA 4NQZA 4UUPA 2PNFA 5T5QA 1EEHA 3JCZA 5FF9A 4IJUA 3OICA 4WLOA 1X7GA 4I9UA 4R5MA 3I9OA 4GSLA 5IDXA 5U4QA 2GGSA 4XQEA 1PL8A 1O89A 4XYMA 4LK3A 3I3OA 3TNLA 3GG9A 5I8WA 2H1SA 4JROA 4JN6B 1P3DA 3G3EA 4B3JA 4FGSA 3KLMX 4L9RA 1YL7A 2X5JO 4FR5A 3AI2A 1SBYA 3PVZA 4RQTA 5A03A 4K6FA 3S55A 1UJMA 2FZEA 2HMUA 2A4KA 3DMTC 4B4VA 4BQPA 5TF4A 4K26A 3ZV4A 2JAPA 2YW9A 4P22A 3KSZO 5IDQA 1RPNA 1KY5A 4J1QA 3C1TA 4YYZA 1ZSYA 1VJ1A 3WQQA 3DXFA 4XDYA 3FNEA 3UFXA 1ZNQO 1BXGB 1H6DA 1NQAO 2LDXA 4R41A 2ZTUA 1JDJA 3LLVA 2ZIZA 2OZPA 3D64A 5JDCA 1ENZA 1TB4A 1CQJA 2CF5A 2GUGA 2O3SA 5F21A 1QXSA 5JMWA 1Q1NA 3QVWA 3TJRA 3BHIA 4NZ9A 4B79A 1KC3A 4J1SA 1XHLA 2Q4EA 5K6AA 3F5QA 5TGDA 4CMIB 4IXWA 4ZVVA 3B1KA 5MDHA 2VQ3A 1DFHA 5L9AA 6LDHA 4CV2A 4CM5A 3RUIA 3H2SA 2Y1FA 1WNTA 1H9AA 2XPCA 3KYDB 3U4DA 3CE6A 4NFSA 3RSHA 5CEJA 2DQ4A 1SZJG 3TOXA 3I9NA 3W8EA 3IQDB 3KETA 1AXGA 2PH3A 1HTBA 4BNVA 3DZGA 2GZ3A 2ZTVA 1UP4A 4ZA2A 1LDNA 4RQUA 1SPXA 5JAZA 1U2GA 2BGKA 4EJ6A 5ADHA 5I8ZA 3F9IA 2BH9A 2VWQA 4BO1A 4F6CA 4YAKA 4TZTA 7MDHA 3SC6A 3JYPA 3ITDA 1UP7A 2EKLA 1ZH8A 3AUSA 4BO9A 1Y6JA 3Q2KA 3SJ7A 4BHTA 2EJVA 2Q4BA 3IUPA 1HDOA 5F5NA 2NM0A 2Q1UA 2UUOA 2G17A 1XEAA 1Y1PA 3VKVA 2WSBA 4PG8A 2HSDA 4BNLA 1KEUA 1T4BA 3A9WA 3E5MA 2I6TA 1SB9A 1V0JA 3ETGA 5JY1A 1B8PA 1AGNA 3HFGA 1NHGA 2WYWA 2Z5LA 1YOVA 4NJOA 3WSWA 1ARZA 4D44A 1KVSA 3ZWXA 4E5MA 1ONNA 3BA1A 2EIHA 3ZV6A 3FHLA 3ICCA 1FDTA 4TRMA 3GNQA 4XWYA 4BO6A 3PLRA 3ANMA 3PJFA 2NUAA 4Q3NA 4XYBA 2O4UX 1NNUA 1DO8A 3BMOA 2GDZA 2HMTA 2G5CA 4NJMA 1L1FA 1FDUA 1T2AA 4NU5A 2ZTLA 5BSEA 3VZPA 5L45A 5IDYA 4BB5A 4L73A 2AE1A 4PLYA 4R01A 5BNFA 4R51A 4M8SA 3D4PA 3R3SA 3RJ9A 3E9QA 2DTXA 5HM8A 4NBWA 1B26A 1ZSVA 4KWHA 1Y5RA 1IPFA 3GPIA 3NDJA 4U8GA 4GGPA 3ZNOA 5JCJD 1NPYA 3FBTA 1C3VA 4CV3A 2ZB4A 3QWHA 3ONFA 1VJ0A 4FOSA 3H9EO 1EVJA 5COBA 1Y5MA 4JNKA 3H6KA 1OFGA 4IDCA 1V6AA 1RM5A 1K6IA 3IKVA 3QVTA 3E82A 4U6QA 3FR7A 1NTOA 2DT5A 4XR9A 3O8QA 4R9SA 3JYOA 4DL9A 3FWZA 1WPQA 1UP6A 1VPDA 3FNFA 2BELA 2O4CA 3VPGA 1IHXA 2WWRA 2EGHA 3BMQA 4CJXA 1PEDA 1DIGA 3K73O 1G0OA 2D2IA 2BFAA 4EUHA 5H83A 1E0DA 1UZLA 3HDQA 1ADCA 3WGTA 1HYGA 1U5AA 3WYEA 1VC2A 4EYEA 1ZK3A 3AJRA 2PLAA 3WGGA 4H3VA 3JYQA 4W9NA 4J49A 3E8XA 1VLLA 2B4RO 4FN4A 1NHWA 3PHLA 2EKPA 5B12A 1P44A 3ENNA 4WCFC 2JL1A 3WIEA 4BGUA 4MP8A 2PD6A 3BTSA 5L53A 2QYSA 3CTMA 3AW9A 3K96A 5L7WA 3ABIA 2P5UA 2WDZA 2Q49A 5B1YA 2D0IA 1NQTA 3BHMA 4HFRA 1NVMB 1UZMA 1HF3A 1KY4A 3OFSA 4K9DA 4Q3EA 3JQ7A 1LRKA 3MJSA 2AHRA 5K0ZA 4BGEA 3OJFA 1T24A 4WOJA 5A02A 1LSSA 1I3LA 4XB1A 4WPGA 5JCJA 2NSDA 5ICMA 3NT2A 4WK6A 5JPIA 1MG5A 4D3SA 2Z1MA 2J3KA 2WYVA 3HUDA 4IIUA 2J8ZA 1M2WA 3ZHZA 3PK0A 4OO3A 3ONDA 2E4AA 3JQBA 4J1TA 2O7QA 5CG1A 1TEHA 5IN5A 3CINA 1HZZA 1K3TA 1XKQA 1XGKA 5JLAA 1LLQA 2QX7A 3AY7A 1YOVB 4Y67A 1HE4A 2WJPA 2PGDA 5IZ4A 2J3HA 4CMEC 3QQPA 5JW6A 5HA5A 3GRKA 4BNKA 4PCVA 2GNAA 1HYHA 1ZIDA 3WICA 3FD8A 4UUOA 1YB4A 1PL6A 3DHNA 4A26A 1ORRA 1E6UA 1E7SA 1I3NA 2VNAA 3JQDA 3NGLA 5BQFA 4RV9A 4U7WA 1B2LA 1PJSA 5CHEA 1XIVA 2VUUA 4ESOA 1ZCJA 1KOLA 5JAMA 1PGQA 4D0SA 4XGIA 4OIMA 2UV8A 1B3BA 3U4IA 5HWSA 2VHZA 1VJTA 4TROA 5GZ3A 1KERA 4L74A 1I32A 5JAQA 2NWQA 4E0BA 5B4TA 2Q3EA 2P9EA 5KVCA 1BXZA 2POQX 3RUFA 3KVOA 4CR6A 5G4LA 5I7SA 3ZU5A 4RZHA 3JD0A 4NK5A 1WVGA 2I65A 5FI5A 4NBTA 3O9ZA 3ADOA 3MJCA 2B5WA 3ULKA 3ZHXA 2WMDA 2YJZA 1EQUA 1LRLA 4LRSB 5DNAA 8LDHA 3UOGA 1DIBA 4OXYA 3STHA 4R1TA 1JQBA 5JO9A 2FHSA 1ISJA 2EP7A 3MWDB 3BMQB 3OECA 1ZBQA 4BO7A 2HK9A 3W8FA 1EVYA 3LDHA 2J3JA 3V5NA 1Q0QA 3R6DA 1YBMA 4B7XA 1JKFA 1LDEA 1E1KA 3PWZA 1ZMOA 5AXAA 1EE9A 1U7HA 2XOXA 3FPLA 3GAFA 3U5TA 1U3WA 4O1MA 5T6BA 4MIOA 2ZQYA 3DAPA 1RM4A 3CZRA 4GI2A 3L4BA 1HDCA 3U4HA 2W90A 1ISGA 3HNPA 3NT5A 4MKXA 2PKQP 3PGJA 4MIYA 4DA9A 1E7YA 4IGEA 1HKUA 4HXYA 5GZ1A 2G82A 4CR7A 1XQ1A 3GK3A 3H65A 1YL6A 1H6BA 3OIDA 4QTZA 2I76A 2P2SA 1ISHA 1F0YA 4HFNA 1PWZA 4RDHA 4RORA 3JQ7B 4E31A 3NTQA 5DCUA 1BGVA 3VPSA 4I9HA 5HS6A 1PGOA 3BMCB 4B7UA 3QWFA 1RWBA 3E9NA 2PK3A 5A9TA 1LBEA 4A7PA 1Z82A 3DZFA 1ZJZA 5JYDA 1E77A 3DBLB 3DQPA 3L07A 5CDGA 1O95A 4O6VA 3VDQA 4WJZA 2Y68A 4CQLB 1DDOA 1H0KA 5ENDA 4HX5A 3LQFA 2YZ7A 5EERA 3FI9A 2O48X 4KDEA 3TDKA 1X13A 4DMLA 4XQ9A 1EVZA 2PKRA 3WJAA 1HWYA 3TWOA 4E32A 2IXAA 1EDZA 1P33A 1UXHA 3UKOA 4YCAA 1SOVA 2VZ0A 3PFWO 1U4SA 2OFPA 2VOEA 2TMGA 1P1JA 4Q3BA 4XEHA 3ZU4A 3AM5A 4IM7A 1XDWA 1O94A 3QHAA 4JP2A 1R37A 5TS3A 2DBQA 2GZ1A 4J1NA 3QRWA 4BNTA 1F14A 4KUEA 5EL0A 3PJGA 3RBXA 3UVEA 3H2ZA 4IGFA 3SC4A 3LF2A 3JQ8A 2FPPA 1PGPA 2D4AA 1V3UA 3CZMA 2B69A 3PI7A 3RU7A 3LC2O 2BF7A 4IDGA 3NDRA 5BNIA 1NP3A 3B1FA 2VYND 4AJ1A 2X9NA 2I3GA 4OMUA 1L7EA 1NQ5A 2FN7A 3DZBA 3JD4A 5KVSA 3E03A 3IAHA 5IG2A 3DBHA 1C1DB 1GU7A 1E1NA 1YDWA 3G79A 2RH8A 4FSHA 1CETA 3JSAA 3ST7A 4PVCA 4MP6A 4YR9A 4C4OA 4B4WA 3K2BA 3RROA 4R68A 4O59O 1HL3A 2ZK7A 2NVUA 1MB4A 4GX1A 4ND3A 2QG4A 2H9IA 1GV1A 2CVQA 1DPGA 2Q2QA 1DOHA 4XIYA 4RVFA 3NDIA 1QORA 1WZEA 3OQ6A 4FBGA 3F1LA 3OEYA 3PYXA 5B4VA 3L6EA 2OBNA 4GSKA 4J7XA 1E6EA 3DZHA 2NTJA 3KZVA 4GLOA 4JBGA 5ITWA 5G0UA 2OP0A 3GDGA 3GFBA 3DBRA 1HDXA 4PG7A 4WASA 4A73A 2J5KA 1ISIA 2EP5A 2P9GA 3C7AA 1YDEA 1E3SA 2AG5A 3NRCA 3VTZA 1G0NA 2NVBA 4BVAA 3RAJA 3PJDA 2QIOA 4WCDA 5JC8A 4I5DA 5A04A 1CIVA 1M6WA 1R0LA 2PA3A 4IDFA 3TZQA 1H94A 1R4MA 4CL8A 3ROPA 4KP7A 5A3VA 5BSFA 3WGIA 1N9GA 3KM0A 3QWAA 4WGGA 3IS3A 4YJFA 5DBFA 2PV7A 3GG2A 1I24A 4MVJM 2PD3A 2VYNA 3H3FA 3BTUA 1WZIA 4RLHA 2CVZA 4OGWA 4LN1A 1DFIA 5TQVA 4GQAA 2O2SA 1U8XX 1GEEA 2JCVA 4CMJA 4DQUA 4MVJD 5CEFA 3UW3A 3DTTA 4CM8A 1R6DA 2A92A 1E3WA 2PY6A 5LDGA 3SJUA 1EDOA 2EF1A 4F46A 4PLWA 2PTGA 2DKNA 2ZB7A 3JV7A 3GOHA 2R00A 2VHVA 1J4AA 3ZW9A 1U9JA 4AJNA 3T4EA 1UXJA 4Y6PA 5ICSA 3TPCA 3ORFA 2C7VA 2NU6A 1WDLA 3HFSA 3QVOA 4BKUA 4QFCA 3V1UA 3A14A 3UUWA 4AL4A 3GFGA 4II3A 4XGKA 5A9SB 3K92A 1BVUA 3PHHA 4LGVA 1LLUA 1ONPA 2D5CA 2IYPA 2C7GA 3UH1A 3CSDA 3MJEA 1JA9A 2QHXA 3N58A 4RF3A 1IZ9A 3VTFA 3GA0A 1MXHA 1HE5A 2IDZA 2IEBA 1ZXBA 1RYEA 2AXQA 3A06A 3JQ8B 4FJ1A 4FPXA 4HP8A 5DT9A 1A9ZA 1DRWA 3HB4X 3AM4A 1YQDA 4BQRA 1FDSA 3G17A 3OSUA 3GNTA 5TC4A 5ER9A 3UGKA 4XCVA 1R4NA 3RASA 4CMGA 5F5LA 3QV1A 4CUJA 2H5LA 2DUWA 5I9MA 3OH8A 4K6CA 4DPMA 3DBHB 3UHAA 3WGOA 1RM3A 2QZ9A 1ZW1A 4E5PA 3KYBA 1FK8A 3K5PA 3ZWWA 3E48A 1QYDA 1IOLA 1SO8A 1HE2A 1YGYA 1V35A 2DM6A 3E5RA 3IIEA 1PJ4A 4NMHA 5CPBA 4ALIA 1NFRA 4R1NA 4BO8A 3OIFA 4Y98A 2XAAA 1X0VA 2NVUB 5DOZA 3DC2A 3GVXA 1TI7A 4KUHA 4DIOA 1AUPA 4HV4A 4FDAA 4W9NC 4GWGA 4J3FA 4MVJA 3RU9A 3T7EA 1HEUA 4TKMA 2IRWA 2R2GA 1A7KA 4I5EA 4RVHA 4DC0A 1B8UA 4I1IA 2DBRA 4RO0A 8ADHA 1J0XO 4JX8A 3DZKA 1YRLA 4DBVO 1DC6A 2ZCUA 4DPLA 1PZHA 1S7CA 1P77A 5CPFA 2ZJ1A 4PZCA 1WMBA 3ZU3A 4E13A 5COAA 3DBRB 1IB6A 4S3MA 4PIVA 5AXBA 4ND2A 3R1IA 1KEWA 5K9ZA 5KKCA 4Q3AA 5EIOA 4BO5A 1Q7CA 3LF1A 5FEUA 1D1TA 4IZIA 5A5FA 4RVUA 3ZDFA 4AJHA 4EDFA 4YRDA 2RCYA 2P68A 1Z6ZA 4TRNA 3F5SA 4BNXA 2VCYA 3N74A 1HLPA 2VRCD 2DTDA 1XU9A 1N9GB 4FFMA 4DC1A 3TL3A 3AFNA 4BV8A 4B7CA 3KOUA 3FNHA 3GRPA 4M86A 4UAGA 1U5CA 4FCCA 4MKRA 4IIVA 3COSA 1ZKMA 4Z9YA 1KVQA 2Z1NA 3Q3CA 5A9RA 5I9NA 3JYLA 1GUZA 1XYGA 1V3TA 3H3JA 3QLJA 4CLRA 3LT4A 4B4OA 2PKQO 2VWPA 4EUFA 3U0BA 4ZN6A 1E3WB 2AQHA 3PHJA 1GR0A 2P91A 3KYCA 3ZWOA 1E7MA 1H93A 3U9LA 2C29D 3PXXA 1NBOA 1R0SA 1ZZEA 1BG6A 4OHUA 2B36A 3H5AA 1RKXA 4MVJI 2NADA 5A06A 4IBOA 5IXYA 5KTKA 2Y1GA 3HWRA 2AA3A 2IZZA 4Q3DA 2VTDA 4RVSA 3UCXA 2IZ1A 1NAHA 1GCUA 1JVSA 1EVIA 1PZEA 1ZK1A 1NWHA 3KHUA 4MJLA 5FI3A 3P2OA 3WFJA 1GYRA 3RUCA 1BVRA 1Z7EA 2BFPA 4GPD1 1ZFNA 3WLFA 3KO8A 3CPSA 2FZWA 4YT8A 5TIIA 2PR2A 3L9XA 1BSVA 4PLCA 3HADA 3OQ1A 4RL6A 3W4IA 5T8KA 2PZKA 1R4NB 1DLIA 1FMCA 2NTNA 4CLEA 1GL3A 3BAZA 1P74A 4ID9A 4L75A 4JCOA 3S1LA 2GO1A 2Y1DA 1DSSG 2BFOA 4J6FA 1UR5A 4PRKA 2VRCA 5CP8A 5ITVA 2Q46A 1O6ZA 4J9UE 4E30A 3AFMA 3JQGA 1QR6A 2JD1A 1J49A 1E6WA 1DIAA 2VZ9A 3PZBA 2UVDA 4RVDA 3GT0A 1PWXA 1ZK2A 3GF4A 5KVVA 1ISMA 1MV8A 1MP0A 4BNIA 1MC4A 3L4BC 1XR3A 2YUTA 1AXEA 4M54A 4YQYA 1U4OA 4D41A 1H6CA 1GZ6A 4U0KA 2EGGA 1GZ3A 3QE3A 4ZQHA 1LNQA 3FR8A 3C7CB 3F4BA 3M6IA 3PJEA 4LW8A 4PGFA 1JLLA 4HUJA 1Y8RA 3HE3A 3B6ZA 4CMBA 3BTOA 1NPDA 2VRBA 1ZEJA 1VL0A 2ZCVA 1PU2A 4LISA 4NBRA 3NV9A 4H7PA 4YB8A 5THQA 1O5IA 4IDEA 4HNHA 5ENVA 5EQDA 3FRJA 1SB8A 4KMSA 3L0DA 4YACA 5TT1A 5I7EA 4QUKA 3I4FA 3DFZA 3K8ZA 4UVIA 1N5DA 1I3KA 2BMAA 4EEZA 1LDGA 2J6IA 2JFGA 3BHJA 4IJKA 4RLSA 4GAEA 3QVXA 3L6OO 1ENPA 4XB2A 1W73A 3ITKA 4R4JA 3D3EA 4J90A 4L0QA 2PZLA 3WS7A 4ZQFA 1LTHR 4MVJG 1PGNA 5G0VA 4E2YA 3SEFA 6ADHA 1JVBA 4Z3DA 2D5AA 2HU2A 1PR3A 3VAZA 3KYCB 2OMEA 1UXKA 2QW8A 3ASVA 4P4NA 4YWJA 1NPTO 2JJYA 2A9FA 3E18A 5CG2A 1LUAA 1M66A 2BI7A 4EITA 1P0CA 3LC1O 4BMVA 2AEMA 3KTDA 2XXJA 2GYYA 4E6PA 1GUYA 5ES3A 4Q9NA 3A1NA 4JJIA 2DFVA 5LCXA 4G5HA 1F06A 3AOEA 4K28A 3OIGA 1NR1A 4IQ8A 4P38A 1XELA 3KV3O 2CF6A 3P2YA 1IHYA 4N5MA 5JBIA 1SCUA 2IZ0A 3F6YA 3F1KA 1N8KA 3ONEA 1ZXLA 3VH2A 1N92A 4YPOA 5A5EA 1X7HA 3HZZA 4IINA 5KJ1A 3PDUA 1JWAB 1B3RA 3HQ4O 3JD1A 3DO5A 1LC0A 4OM8A 1A7AA 2YQ5A 4PRLA 4QEDA 3JQEA 3P5SA 3PEFA 3LT1A 3MOGA 4TSKA 3S8MA 4IPTA 4RDIA 3L77A 4IS2A 1ISFA 2P9CA 1R16A 3WYBA 3UCEA 2O3JA 4I9NA 5BT9A 5JAIA 3GQVA 4AJ2A 2NVWA 3FTNA 1NFFA 2CDBA 3JQGB 4ITUA 1AHHA 4NFHA 1ONOA 2PFGA 4RF5A 3JTMA 3CKYA 4J2HA 3OP4A 2CZCA 3WSVA 4MINA 2FSSA 4Z0PA 1C0IA 3H9JA 3ZCXA 5ER6A 4Z3KA 3KB6A 3GVIA 1M76A 3C7DB 1PQWA 1P9LA 3HG7A 1Q2XA 2CVOA 1JW9B 2AQKA 4I5FA 4ALMA 3MCVA 4CMKA 1QLJA 2JHFA 3RFXA 3LU1A 4R54A 1E3EA 3GAZA 4YT5A 1PX0A 5J23A 3AWDA 3PP8A 3JD2A 4GL4A 3ZWNA 1LXCA 2BFMA 2HK8A 3MOIA 4QT0A 4YT4A 4OQYA 3NKLA 1MLDA 4WKGA 2I9PA 4NH4A 3K9QO 4ZJUA 3QA9A 4K1LA 5BR7A 4R69A 4IXTA 1P45A 3VC7A 5A4DA 2JCXA 3I23A 3WDSA 1A4UA 4IDAA 5C7LO 1A71A 4XGNA 1EFLA 1WW8A 1NFQA 3UN1A 1NASA 3CH6A 4OSPA 2VHYA 2H6EA 3DZJA 3PPIA 4U0JA 1PS9A 1JWBB 2YV1A 3SLGA 1E5QA 1DHTA 3IMFA 5G0TA 4BNMA 5CDUA 4RCVA 4DLLA 3PHIA 4R1SA 3BMOB 4BUCA 3Q11A 4XD2A 3OETA 4NJMB 3NTRA 2I99A 3ZI0A 9LDTA 2Q2VA 3PGXA 5KVQA 1FXSA 2I3AA 1S6YA 4II2A 1CDOA 4KDFA 4KUGA 2CSUA 4Y9DA 3INRA 2LDBA 2CFCA 4WUVA 1KVTA 1CJCA 4OOEA 3TZCA 3JQAD 4AFNA 3JQCA 1FDWA 1IE3A 4B8ZA 2C54A 2X86A 3W6ZA 1GD1O 2O3TA 1SOWA 2CUKA 2CY0A 1GAEO 5CAEA 4WEOA 3DONA 3DMTA 1KEVA 4IZHA 1PGJA 4BKOA 4Q39A 3G49A 3WBFA 2EW8A 3AUAA 4RPLA 4BNZA 4YRBA 1VSVA 1NR7A 4XJTA 1VI2A 1YB5A 1BMDA 4TMFA 4QSMA 3O8QB 2Q1SA 4E2ZA 4N18A 2JCYA 3MZ0A 2X4GA 2VT2A 2ZKLA 4KQWA 3M1AA 3WR5A 4NFYA 4BNGA 5KCZA 4OSOA 4TWRA 1GQQA 2B4QA 1K6XA 2VNSA 4L76A 5F3RA 4LMRA 4OKNA 4XQCA 1YB1A 3E1KA 4PG6A 3I9JA 4UVEA 2OBYA 3TZHA 3WOHA 1SC6A 4BKPA 3GUCA 3AUUA 3VZSA 3DTYA 3NT4A 2G76A 3C1AA 4PZDA 3V2GA 2ILTA 1WLYA 3H9UA 3ZU2A 1C0KA 3KSDO 4GMGA 3V2HA 4X54A 1F17A 3K30A 1IPEA 1F8FA 4FFPA 4N7RA 5G2OA 3VPHA 4C7KA 4EI2A 2VWGA 5C3MA 2O2YA 4O0LA 3D7LA 4W99A 4WLEA 4L4SA 3PLNA 1R0KA 3DEYX 4PG4A 3TF5A 4IQGA 4GH5A 4DLAA 2BI8A 4J0EA 4R9RA 1K0UA 4H15A 2VHWA 4YXFA 2X7HA 5HRUA 4BGVA 3JQAA 1X1EA 5F1PA 4ROSA 1ML3A 2CDCA 4MP3A 3EZLA 3EUWA 4N5NA 2EERA 2V6BA 5I7VA 3LLSA 5KJCA 1I10A 3TL2A 3KUXA 2EW2A 1NQOA 2D8AA 4IDDA 4ZRNA 4YJGA 2O50A 3TOZA 2O3RA 4JLWA 3W6UA 2CNBA 3ICPA 5ILOA 4J4HA 4BOYA 4XQGA 3GGOA 4CMHA 4GWKA 4QECA 4OJNA 4CR8A 2P4QA 3D1LA 4CMCA 1GUFA 2SCUA 4CM4A 3B70A 2FR1A 3F46A 5IXSA 2UYYA 5HBRA 1X7DA 4AJLA 4ZICA 2HJSA 5C7OO 2E82A 1HETA 2RBEA 2NU9A 2Z95A 4JXKA 4WLNA 2EEZA 4RZIA 1GEGA 1KIFA 4E5YA 2YHIA 1C14A 4YAEA 3UCFA 1TA4A 5JSFA 1YBAA 5CDSA 2HO5A 2RHCA 1Q7GA 2G0TA 3RIHA 1V9LA 3DWFA 3NEPX 4TKLA 3QW2A 1EUDA 5JDCC 1I01A 1JAXA 3SVTA 1Z45A 2W2KA 3LT2A 1FF9A 4DQXA 1LU9A 2P5YA 1WWKA 1C1XA 2OP1A 1FJHA 1KBZA 4CPDA 4U5QA 2DU8A 5T8KC 1D8AA 1LSOA 3I1JA 4B3IA 5K6AC 1NWCA 3RCBA 4AJOA 1BW9A 4OYRA 2EG9A 1B16A 1SNYA 1NM5A 4WECA 4BL5A 1V8BA 4MKZA 2HUNA 1PJLA 4FJ2A 1F8GA 5CDTA 2FY8A 2W98A 5T57A 1J5PA 4OH1A 1DAPA 1GFSA 4P8RA 4WEQA 2Y1OA 4CMAA 1CRWG 2HMSA 2PD4A 1PZGA 2ZTMA 4MVJF 3KLPX 1U8FO 1L7DA 1M6HA 3WNVA 3GGGA 3OMLA 1QMGA 2ZYGA 4D46A 5FFFA 5AXDA 3TN7A 4IJVA 3ZWVA 5AXCA 5L7YA 5HS4A 3GDFA 2D3TA 1A9YA 3OJEA 3JQ9A 1P0FA 4OAQA 1GDHA 1X15A 4E5NA 4AJIA 4IMPA 4JGBA 4UVHA 2NQTA 3G1TA 3T4XA 4KTTE 3V1TC 1U3VA 3L9WA 2ZJ0A 3KEQA 3N7UA 4GKVA 4WOKA 1MUUA 4E2XA 4E33A 1E5LA 1LSJA 3B1JA 3LVFO 3GZ4A 1Z73A 1HDRA 3DHYA 4NK4A 4MO2A 4YDRA 1X0XA 2GPTA 4FJ0A 4LVCA 2GR9A 4TQGA 4OOFA 5U1PA 4XYGA 1T25A 3CMCO 2X1HA 1HYEA 1LDBA 5EPOA 2Y99A 2ZYDA 1QV6A 3JQAB 4CLOA 2X6TA 1PQPA 5DCWA 4M87A 3VPFA 3ADPA 4W7IA 5EN4A 3VKUA 5C7IO 4JQCA 4PLTA 4HADA 5B37A 1YBVA 2BD0A 2PH5A 3HN2A 1BDBA 1KETA 1TT5A 1U1IA 1T2CA 3AK4A 1N1EA 3NUGA 3AOGA 4ILKA 4BO4A 4YJGB 3I9LA 4UEOA 1ADBA 1LJ8A 1EUZA 2ZB8A 3GEMA 5DN9A 4ZQEA 5KJ6A 2WE8A 2JD0A 4KTVE 3RBVA 1ZEMA 1O8CA 4MVJP 1E3LA 2DPGA 4ZQBA 1PJTA 4CM4B 1BDMA 5B4UA 1PJBA 1E3IA 3EYWA 4GX5A 1VL6A 4B4UA 3S2GA 3ZWYA 3IL2A 1CWUA 1M67A 1Z7BA 3WWZA 3RJ5A 1X1TA 1WXDA 1MC5A 1QYCA 4I8XA 2GN6A 4DYVA 3CXRA 2VZ8A 4R5HA 2IEDA 3EMKA 2VOJA 1A72A 1UXIA 4RVGA 3AOEC 1AN9A 4WLUA 1OC4A 3WFIA 4N54A 1MGOA 3GH3A 2HJRA 1GQ2A 1E1MA 3GN2A 3U09A 3ANLA 5GMOA 4M49A 5IJZA 2IE0A 1P1IA 3JYNA 1JTVA 4FFNA 4XX0A 4YAJA 4FS3A 2W2KB 4IY1A 4R1UA 2CDAA 3ZNPA 2HKIA 4DYDA 2OORA 2JHGA 1C1XB 3LK7A 2V6GA 3ZV5A 4FD3A 1O9BA 3NYWA 4J16A 3H5RA 1YH3A 4ND5A 1D7OA 2V7PA 4D45A 1N7HA 1LLDA 5L51A 4PLHA 5KOIA 3I9KA 3AY3A 1PJQA 1BW9B 4BV9A 1ZMTA 4J2OA 1IY8A 4BNFA 4OXKA 1NVTA 2X0IA 5KKAA 4LCJA 5DOVA 1G1AA 2X22A 1NVGA 2X58A 1T2FA 1QYXA 2X9GA 2QZZA 1PJ3A 3MJ4A 4D3FA 4FC7A 1BTOA 2VUTA 5EESA 2BKAA 2VWHA 2BRUA 2GASA 2AQ8A 1A27A 3HDYA 1KC1A 4OKIA 5JCXA 3WWYA 2X0NA 3RI3A 4YT2A 3WYCA 3IJRA 1SEPA 2JAHA 1UDAA 2NQ8A 3GNSA 3JQFA 4P4GA 1PS8A 3VH1A 5F1OA 3I5MA 1Q0LA 2ZQZA 4QX6A 4ALNA 3ROQA 4TZKA 3DHEA 1IZ0A 1NX6A 4ZU3A 5IF3A 3EVTA 1LSUA 4TVBA 2YDYA 3VH4A 2DBVO 3VPXA 3A4VA 4AG3A 1LC3A 3TRIA 3PYMA 3U49A 4ND4A 4YA6A 3WBBA 2JFFA 1P1KA 2DFDA 3TQHA 1VL8A 4UEKA 1QRRA 3SLKA 2YFQA 4PG5A 2NV6A 4CUZA 5AQ1A 2E37A 2BGMA 3PIIA 2J5QA 2Y66A 5IZCA 1R4MB 4XIJA 1PQUA 3JQBC 4DTIA 1ZJYA 4GX0A 2Q50A 4YJFB 2HAEA 4YTEA 5KJFA 3C24A 1SAYA 5L4LA 1VM6A 2YQ4A 1YQGA 1DC5A 4LSWA 5IDWA 4BNWA 4BO2A 1TLTA 2B4TO 4L4XA 4UVGA 4YAGA 2VT3A 1P1RA 1BRMA 1H2HA 4O63O 4MIEA 4PLPA 5JC1A 1E92A 4GVLA 3PWKA 3HSKA 5DZSA 1EUCA 1UZNA 1TT5B 1AE1A 3DL2A 4CM8B 2ZB3A 1Y9EA 4I5GA 2WD7A 4R16A 4D0RA 2OHXA 5A1TA 1EK6A 1QSGA 1YJQA 2GLXA 3W4KA 4NNJA 3WJ7A 4BO0A 4E12A 5L4NA 3PIDA 1HLDA 1FDVA 5THKA 3WMWA 4D3DA 2HK7A 3QWIA 3VOSA 3RC9A 9LDBA 3AI1A 1IL0A 3D4OA 4O5OA 3DAGA 3EHEA 3NJ8A 4NIMA 1VKOA 3W8DA 4YVFA 1W4ZA 4AJ4A 4JJFA 3ZWMA 1RYDA 4ONEA 1YS4A 1U7TA 5EINA 2AMFA 3CUKA 5KWEA 4B3HA 2O3UA 5IN4A 2I66A 4Z0TA 1NAIA 4M55A 4A03A 4OXNA 3RBZA 3WGZA 3GZNA 1H5QA 4PLVA 1IULA 3WGYA 2YYYA 2NU7A 1XCBA 3E6AA 4TVOA 4XDZA 4DREA 1DRVA 1B0AA 5G0WA 2FRDA 2C2YA 3W1VA 4S1VA 2AEJA 1LRJA 1HE3A 1GPJA 4Z9FA 3WQSB 3AUTA 4ALLA 3G0OA 4CM7A 3GPDG 3DFUA 2ET6A 3OJ0A 4ZQGA 1QP8A 4DIFA 1ZUD1 5KIAA 4DQVA 1GQYA 3I52A 3FCOA 1JU9A 4HY3A 3FN4A 4YAIA 5AYVA 1EE2A 1DC4A 3JQ6A 3S2EA 1LQTA 3ZHYA 1GADO 3RUHA 1KYQA 3GGPA 4INAA 2TMDA 1BHSA 2DTEA 4J43A 3H9QA 3M2PA 4N5LA 3RKRA 5EQFA 3WTBA 4ZD6A 1LQUA 5TX7A 3GN1A 2OO5A 5JMPA 4BNJA 4BNUA 4DPKA 4CODB 4P4LA 1CF2O 1TXGA 2B35A 5JDIA 1ENOA 2VUSA 3EDMA 3WQRA 1JAYA 3QIVA 1DIHA 3RKUA 2ZATA 3VDRA 2PZMA 1JKIA 2JFHA 4XJSA 4PFJA 1LI4A 1D4FA 2VN8A 4AVYA 1OC2A 3ZWCA 2VYVD 1HSZA 2WD8A 3TZKA 4QO8A 5L4SA 1DJQA 4MVJE 4Y6SA 2C20A 4D43A 2E49A 2Q1TA 2EHDA 2Y67A 3OJOA 1WDMA 5TNXA 1YWGO 3FF4A 4DIBA 1YVEI 1KEPA 3EAGA 2FSVA 1X14A 3CIFA 3PRJA 1A4IA 3UF0A 4UUNA 1W8DA 4XYEA 2YV2A 4WLFA 4BO3A 3GMSA 4HFMA 1DHRA 1UDBA 1AHIA 4B8WA 2AEFA 3O03A 3I9MA 5EMHA 1HSOA 1OZAA 3K31A 4CLRB 1PZFA 2WYUA 4IUYA 4NBUA 2Y0EA 4MVJH 4W4TA 2OL4A 1HDYA 2GSDA 2WD7B 3FBGA 5AOVA 5TLSA 4NDNE 3ZGYA 1YXMA 1W6UA 3TSCA 3QSGA 5L7TA 2JD2A 3L4SO 3VZQA 1HRDA 4Z6KA 5I7FA 3H5NA 1Y81A 3KRTA 4DUPA 4J7CA 3IKTA 3OEWA 1R12A 5DP1A 2NU8A 3E9MA 4AJJA 4A10A 1OMOA 4YJHA 3ZN2A 4JBIA 3AU9A 3G1UA 1PL7A 1EK5A 3L6DA 3AI3A 4OL9A 5BSHA 3WGQA 3HHPA 5TJ9A 1EFKA 1CYDA 1WDKA 3H9GA 3O26A 1VSUA 2VYVA 1VE9A 5C5IA 2B0JA 1UDCA 3GZNB 3BXXA 4C7JA 2NNLD 4M1QA 1I30A 4L4RA 4PZEA 4UREA 5BNTA 1UAGA 3PQEA 3WMXA 1W0CA 2YV3A 4CQMD 1U3TA 3WG9A 1CERA 3VVCA 1XU7A 4XRGA 4QQRA 1Y8QA 4GLLA 2GN4A 5L95A 3Q0EA 3FSRA 3FWNA 3PZRA 2C5AA 2CMDA 4W6ZA 1QKIA 5HTOA 2RH4A 4PLFA 3ETEA 4ZGWA 1ADGA 1HZJA 3IJPA 3H4VA 1N7GA 3RUDA 3HB5X 4BNYA 1UUFA 1YONA 1T4DA 3JQ9C 4YJDA 3U3XA 4XZ3A 2FR8A 2OXIA 2Q45A 1LX6A 2FPIA 2W8ZA 3H8VA 4URFA 3NX4A 3AY6A 2Y05A 2WE7A 1KVUA 3OM9A 4QXMA 1T2EA 2GCGA 4UULA 3ZWBA 4YRAA 1XG5A 1A5ZA 2ZYAA 2FR0A 1YL5A 4IS3A 3X2FA 1GV0A 2W4QA 3PHGA 3SXPA 1ZK4A 1HDGO 3EGOA 1Y8RB 3EK2A 3TFQA 3Q1LA 4NU6A 2RAFA 2NLOA 1MFZA 1N1GA 2EKQA 3F4LA 1OBFO 2HMVA 3BMNA 1E7RA 4Y6RA 1K2WA 1KVRA 1T1RA 2HCTA 4RPGA 4ALJA 3NTOA 1YKFA 4J7UA 3LZ6A 5EJ2A 1HDZA 2F1KA 2O23A 1DRUA 2RIRA 1SEVA 1NYTA 4BGIA 2AG8A 1U3UA 3X2EA 2P4HX 3F47A 3GVCA 4WLVA 4RF2A 4D7AA 1QYWA 1Q0HA 4FFRA 3GHYA 1K5HA 3BMCA 3EY4A 4MPDA 2Y93A 1U2DA 1QG6A 4U6SA 3V2UA 4E2WA 2X5KO 3HDHA 1ULUA 2DLDA 2R00C 2D1YA 3DBLA 4CLDA 1H2BA 3CMMA 1XWFA 4AJPA 4CQMA 3MWEB 4XR4A 4CQLA 4LRTB 1ULSA 5JYEA 2HRZA 1I33A 1P31A 3WIDA 3RWBA 1PTJA 3GEGA 3C8MA 3ENKA 1I36A 4IJWA 4MDHA 3GMDA 3BIOA 2VHXA 2EJWA 3QVSA 1XSEA 1ZVMA 2QRJA 1ADFA 2B83A 1ID1A 2J3IA 3S2FA 1LLCA 5TRTA 3OA0A 3I4CA 3MTJA 3QWBA 1M75A 4FC6A 1B14A 3U62A 4JJGA 3RFTA 4CLHA 4NI5A 4JK3A 4YJHB 2E6UX 3OHSX 4EGFA 2PGJA 1GZ4A 1RM0A 2YY7A 2QRKA 3PYLA 1LDMA 4KWIA 2VTEA 3RC7A 2O3QA 4FGWA 2V6FA 2QRLA 4IMRA 3ANNA 2DAPA 4DMMA 1XA0A 1F12A 2UAGA 2V6MA 1I8TA 4MOWA 3GC6A 2EV9A 3ON5A 1C1DA 1DEHA 5GY7A 5TT0A 4RF4A 1VRWA 1H6AA 3NAQA 2DVMA 3FTPA 1PR9A 1DBVO 3ZW8A 1XQ6A 4GMFA 3ROMA 1Y8QB 4F6LA 2I5PO 2Y1EA 3JQFC 4KOAA 2IODA 2D59A 2X8LA 3M2TA 3MJTA 4LSMA 3ZNNA 4A5OA 4DRYA 3DB2A 4YQZA 4D79A 1QV7A 3DOJA
chains in the Genus database with same CATH superfamily
1HURA 1OGIA 1UOPA 4GVXA 3PB3A 3PDJA 1MIHA 5IPFA 1RJGA 2OR3A 4I5IA 5LQDA 1PIWA 1QE5A 2O2DA 3IALA 1E3TA 4GKBA 2JZCA 4CLXA 4EVIA 1RAIA 1COZA 3EX7C 1BWSA 2B34A 2PYZA 3KQNA 3BILA 2SNIE 2Q9CA 4LK2A 5BXQC 5D5PA 3M5CA 6REQB 2PUEA 3QLEA 3NHSA 1RZVA 3I4LA 4JZYA 4CDRA 1KE2A 3ORYA 4YHBA 3FFXA 1L7MA 3Q5GA 2XNCA 4Q4DA 5ELLA 4AXBA 5LQKA 5A05A 5B1EA 4ENTA 3THYA 1Y1QA 4FMCF 1EMDA 3PC4A 3AVTA 3R76A 3CKKA 1GZDA 2X23A 3ODPA 3HZHA 1G5TA 1G2PA 1E32A 1Z6PA 4BMNA 4C1BA 3CUYA 3T7CA 2K2WA 1A9OA 2G5GX 1R6BX 1SELA 3EGDA 4KQXA 4D42A 3RVDA 3QU4A 2A59A 2LCIA 3R0IA 1DB3A 3NONA 2GO7A 1WCWA 3ZLVA 2OFWA 1ESDA 3O73A 2JB9A 2Y0PA 3GEHA 2V7VA 2LUOA 4FDTA 2RONA 3Q4GA 4YFVA 2GTIA 2ZS9A 3R3JA 5L3ZA 3Q3JB 3WLNA 4F1WA 4HK4A 3I6QA 4TLCA 2NACA 1QQTA 1ZA1A 1WCIB 3LOQA 4HMOA 3HC7A 1H4QA 4ESHA 5F3WB 4W82A 2AJLI 3P2IA 5FR2A 2C1XA 3HK2A 3DAFA 3SHFA 2AW5A 1W1WA 3OF3A 3DDHA 5JSYA 2D54A 3HCFA 1Z75A 3T35A 3KPVA 4GEGA 2GXQA 1MJGM 4IWXA 4X1YA 4YMWA 2VHTA 2TS1A 2XCLA 2CD9A 1R9NA 4KAXA 4HKTA 3BZWA 2VTBB 1T36B 3EZYA 1E2MA 5FD8A 2LIVA 2G06A 2Z3WA 3O8CA 2W2LD 2PX8A 1M54A 3AUXA 4KAFA 4HYEA 1FLNA 2CXSA 4IGIA 5DT2A 3UQYS 2QQFA 3BCUA 4MROA 2O06A 4JLJA 3ML1A 3DD1A 1R15A 2WJ4A 3IC5A 2B25A 2CXXA 3A1TA 4QFDA 3AU8A 3JPWA 1KO1A 1RWXA 4D9MA 5ERGB 1A76A 3X1MA 4LVUA 1O77A 2W48A 2WMNB 3WJ2A 3DM9B 1D09A 3GUZA 3FCUB 4M0UA 5FLXA 1KZ6A 3OPYI 3D4NA 4EHJA 2V6IA 3C74A 3ORHA 2HZBA 3O74A 1G21B 4PZ9A 4J9VA 2FOIA 3P9ZA 3UV7A 4RMJA 2ZREA 3PQDA 3KKNA 4JLAA 1YHNA 2R79A 3F3SA 4JQYA 1G64A 4GVPA 2LD4A 3P9IA 1TTHA 1W5SA 3QY9A 3I6IA 1KZYC 3BXPA 4XTCS 4ZVTA 1VECA 2Q0XA 1P3JA 4V02A 4D57A 2EF0A 1TU3A 3TTXA 2HBRA 4BP9A 4Y6LA 2O8BB 5DBIA 1UQRA 3NFYA 1CLEA 4MQEB 1ZUNB 3C3AA 3OMWA 4NYJR 4U9HS 3ZG6A 3R5SA 3TCNA 4KXXA 2PQ0A 4C43A 2IBSA 2PDAA 2Z8ZA 3GJTA 2WVHA 3BJIC 1L9KA 5EIBD 3RGGA 4B33A 4EHIA 4YLGA 4B76A 4XX1A 3DBVO 4D6XA 3DR3A 4E4YA 1DKQA 3INGA 1I0ZA 5E6RA 5AM1A 1R8SA 3LC7O 3ZKAA 3IQEA 2OA0A 4IMJB 4KXLA 5JS2A 5E8RA 1PNOA 1WULS 4K9SA 3CUUA 5AKEA 1PFVA 4UUMA 5KO2A 2P2LA 3WNZA 2OHGA 4R6WA 5IM5A 1DXYA 1JT9A 1Q21A 5COQA 5DHQA 1N5RA 4RESA 2GPSA 3DT9A 1ECJA 4I7EA 4IQ4A 4TKZA 2W2LA 4TRRA 4Q9HA 5F1KA 3KSUA 1GNQA 1E3JA 4WBXC 1K6JA 4UDYX 1YUNA 2ZZKA 3HI6A 4F45A 1T0IA 2PUWA 5FXMA 3FMFA 4BRUA 2P35A 3THYB 4QULA 4MR9B 4ISCA 1PWYE 3VDXA 1YJ8A 3N0WA 3VVBA 4DWVA 1U7ZA 5FAKA 1K8ZB 2ADFA 2PGLA 1S3GA 2XTAA 3OJLA 2G1UA 1UK7A 3KJGA 2QOEA 2A5FA 4E88A 4RHYA 2Y6VA 4O3FA 3DNFA 2HA6A 3G7NA 3AESA 4Q3CA 1IUNA 3CY6A 4ZCQA 3EGDB 3LQ1A 3HJAA 4A92A 1ZR4A 1FZQA 3ADDA 2IYNA 3AZPA 4WERA 1MU0A 2Q6KA 2F17A 5DDIP 2ZVDA 2IZ5A 3OFVA 3R74A 3ZBTA 3N3BC 3ENVA 1SXGA 3TIXB 1FFEA 2AIRA 1I7LA 2QD3A 1E2BA 3UAXA 2WYOA 4CL3A 3N3AC 3HABA 4Y2RA 2VCEA 1C7IA 3K6JA 2IYWA 5KSZA 3UKDA 4RJTA 1GYQA 1P9RA 5JANA 4ZDKA 3O4GA 2GAOA 3DSRA 3ZZ0A 4LOHA 2G36A 2A35A 3J81k 4QM7A 4CM9D 3LLUA 3NPAA 2ZWPA 5KU1A 1U1GA 1ZICA 1KQFA 4ER0A 2F7SA 1UAYA 3H2GA 2BM8A 3GCWA 1NMYA 1NSFA 4ND1A 4X1YB 4REMA 1I6LA 3AVQA 2R4UA 3C8HA 1KH1A 2BLLA 4WRRA 5FWNA 1N8TA 1V1JA 2ZJFA 1KI6B 1AUOA 2DP4E 2QUZA 4ZPXA 5JO0A 1BS2A 2QX4A 2Y0CA 2H63A 2ZPAA 2ZXEA 4FYKA 3QOYA 4S1OA 2XYRA 2VA9A 4NCJA 4EJMA 1M34A 4EFDA 4XYLA 1P5RA 3K94A 4LZWA 4U6NA 2IU6A 3MTGA 1RRPA 5K0FA 4BQFA 1L5OA 3E61A 5HCNA 3SYKA 3ND9A 4PN7A 5B7GA 1BXGA 3F6EX 4Y2TA 4DVJA 1S9HA 1IBMB 5I9TA 2XXAB 5H82A 4JH0A 5KC8A 3FFWA 4Z0HO 1XQWA 4RHEA 2HBZA 1D2NA 1P1FA 4FKBA 3IP1A 1JKXA 3W77A 1TA0A 1MX1A 2I33A 5KNDD 2IUYA 3C15C 3PEWA 1UWLA 1VI6A 2GM3A 1FLDA 2OKCA 2B61A 1SMKA 5A3JA 4OBXA 3B6IA 1J2TA 4AZ0A 5A0VA 4WZAA 3V8RA 5C1PA 1ENYA 1EM8A 3VR6H 1QTNA 4QQKA 1D3AA 1T6ZA 5ILGA 3CUSA 4IDBA 1YFLA 2HJWA 1IXKA 1WUYA 2D00A 3LYLA 1Z0IA 3FYCA 2AN5A 3DQZA 3ETJA 2IVFA 3IR6A 3GDOA 1JFLA 2BGRA 1TCBA 3IAUA 2L82A 2OCGA 2QN6A 1ODTC 4WA7A 2PRZA 1CJSA 4RNCA 1SD5A 3NR2A 1HM5A 3ZV3A 1V16B 3QU9A 3WTCA 1R50A 2O7SA 3L93A 4M0FA 1JN0A 1WUJS 5E6RB 5I47A 4EI7A 2WTNA 1J0DA 1H3FA 1B6RA 4KG7A 5JXIA 4CM9A 1ZI6A 1TE2A 4PZYA 4KVGA 4ZQCB 1VZ3A 4A2QA 1CR0A 5DRYA 2FEMA 1PN3A 1TF7A 3VHRA 2H1IA 2H92A 4O29A 2BKLA 5AM5A 1WX1A 2GH1A 4ZAZA 3RC1A 3SZRA 4EELA 4A2CA 2V8BA 3AL2A 1EFUA 2WJWA 3AEXA 5C2JB 1XAJA 1NVWQ 3GJ0A 1WB5A 5EUBA 2C07A 4QXAA 2HLNA 4FQ8A 4GZ6A 1GNPA 1R8JA 3NHBA 4JVMA 4K7JA 3AIIA 1PO7A 3ETDA 7AT1A 2QVGA 4RMHA 1NNSA 5DI9A 3B6KA 3I8SA 5LZ4A 1CJBA 3TIGA 1ZGBA 4CM1A 2RHRA 4HS4A 4MWGA 2GT1A 4I4TF 1G8SA 4JEHA 2EWMA 2ZRQA 2C5EA 5CD9A 4OI4A 1I4EB 3EZXA 4RL4A 4AJKA 4C4TA 3KXPA 2V7TA 2FEWB 5D5HA 2YXDA 2M6SA 1EHCA 4EF6A 1EEHA 2JCGA 3GRFA 5KNDA 5FF9A 3IE1A 4IJUA 3OICA 2ZBEA 1JLKA 2PX0A 4ZCPA 1X7GA 1YR7A 3LUCA 1QHGA 4OHWA 1FJXA 2O2XA 4EJSA 5U4QA 1C4WA 1ML4A 1TU0A 4QDXA 1P6UA 1QX4A 1Z5GA 4MYHA 5KYTA 4LK3A 5HFAA 2ZSDA 2A0KA 3TNLA 1F0KA 4K05A 2PRSA 2QORA 1W9MA 4JN6B 4YLEA 2DQSA 3NHLA 3UJ3X 3VU1A 1ZI9A 3DMRA 2SICE 3NZEA 1YL7A 1VOTA 4GPIB 3T0IA 3VM6A 5EVCA 3RM3A 2AX3A 2XDYA 4Y2UA 3A10A 5JI3E 2R97A 3NIFB 3WK4A 4BU0A 3ER8A 2I91A 1YS9A 3W5HA 2C96A 4K26A 2V7EA 3ZV4A 4D0GA 1T5DX 3UNXA 5JSZA 1B2RA 1KY5A 4OGKA 4J1QA 3FG9A 3C1TA 5BR4A 1M34B 4DA4A 4UHEA 3HU2A 2J4DA 4L5BA 4YYZA 3PTAA 2O2CA 3RRFA 2Q3FA 1Z56C 3T4UA 1Z0ZA 4PZUA 5DXAA 3ZOZA 1NE2A 1XZGA 3RLFA 4XDYA 1JDVA 1R9GA 4C0HA 3EBPA 1BXGB 1RAEA 2E89A 3AFOA 4R41A 5KOHA 2ZTUA 4MYUA 5JDCA 1L5YA 4FWTA 4Y2QA 4KQ6A 4M8KA 2CF5A 4GKKB 3D2AA 3IA7A 4KYIB 5AHWA 3DL0A 1TYEB 2A67A 3KJNA 4JC5A 5JMWA 5KDOA 1QFXA 4IHJA 3ZU6A 4FFWA 2DFKB 1G4HA 2GK6A 4B09A 2F4VB 1LI7A 1WOMA 3SG0A 1QQ6A 2CCGA 1JRLA 4HAWA 5REQA 4DLWA 4AZ0B 1PFQA 3HCWA 1WSDA 2B6NA 3H2SA 3H4IA 1K75A 1YASA 3AFGA 5LDDC 2QXYA 1WNTA 3F7NA 4GI1A 1H9AA 1B8NA 5CGQB 1B76A 3U4DA 2ZJ3A 2CNLA 2HW8A 3TOXA 1B1AA 1GPUA 3T7AA 3TCKA 2GD6A 3TIFA 1GVNB 4PRZA 5C4IA 1AXGA 2CKDA 1HTBA 2PH3A 3D31A 1WVIA 2PL9A 5A4KA 1UP4A 4WFKA 2ORED 3CH5A 4GPEA 3RVNA 1M1UA 1U2GA 2Y2UA 3AILA 3HKEB 2WWVD 5M34A 1X92A 3NHWA 3F5DA 4FWBA 2PN1A 3I2HA 3FMPB 4BJ5A 2XUZA 3DA8A 2VWQA 4BO1A 4F6CA 5C0OE 1NRJB 4BQOA 3FUTA 1YQ9A 4JIMA 3A6GA 2FWBA 2FDXA 4QGGA 2GEDA 3SC6A 4MV5A 3IT1A 4I2NA 1HOXA 4PX3A 1CU1A 3CLVA 3UPDA 1JIXA 1ZH8A 2FF5A 4F72A 1QOPB 1C30A 3Q2KA 1MTZA 2FNAA 1NI3A 2Q4BA 5F5NA 2NM0A 3C5HA 1EINA 2G17A 4FMDF 1QH8B 3EE6A 1NYLA 2IHJA 4FMPA 3GARA 3DAHA 1OZFA 1N6IA 1R18A 2WSBA 3EFOA 5FFMA 2HSDA 2I4TA 3EIHA 1KEUA 3A9WA 5T3UA 1KH3A 4BEWA 5ALUA 5E2IA 2I6TA 2IYZA 2PEYA 3HKCB 1AKWA 1FFWA 1UDWA 1MOZA 2JLCA 3TD6A 1CUIA 2GWRA 1U0LA 1CY4A 2BTOA 3NHFA 3TZBA 1K3UB 1RYNA 3ETGA 5JY1A 1AGNA 1W59A 3HFGA 3GLFA 2OCYC 4NJOA 1YOVA 2JFPA 4D44A 1VQ1A 3K32A 4RDXA 4E5MA 1ONNA 2RI1A 4Q9JA 3QPAA 2AG6A 3N6VA 2CN1A 1FDTA 4FXOA 4HGYA 4ZXFA 1ZC4A 3T5BA 1HA3A 4EJSB 3IO5A 4C01A 2NG1A 3G5LA 2BUBA 4EB3A 4QQ8A 2BUCA 2NUAA 1QTQA 5C34B 3AG5A 3JQQA 4LE1A 4RD4A 5K3AA 1KWGA 1LD3A 2JJQA 2O4UX 1NNUA 1DO8A 3N2GB 4NP6A 4L3WA 2CT8A 3ZDCA 1F48A 3OWOA 4DADA 2G5CA 3IBGA 4MA0A 2Q1XA 2DB3A 1FDUA 1RWKA 4P92A 2ZTLA 1K06A 4V38A 5LR6A 3G2NA 3CA8A 4UNNA 5L45A 4BB5A 5EZYA 3BH7A 4PLYA 4R01A 5BNFA 2WHXA 5E0KB 3D4PA 3Q10A 3NHRA 4QBGB 1VBFA 4BVHA 4DQ0A 3LGXA 2YXEA 2AXEA 3EWAA 1IPFA 3P71T 3GFSA 3QXHA 5JQGF 1C3VA 1C7FA 3VYWA 3DLTA 2PSEA 4FOSA 4LF9B 2IE8A 5COBA 1DP4A 5SICE 4V0OA 2Z4RA 3EG9A 4XUGB 1OFVA 1G2IA 4DARA 1RM5A 1VXRA 1LBHA 2LE0A 3T0FA 5KOHB 4HDMA 1GZ7A 3E82A 3U3DA 3A6JA 1XRPA 1JPJA 1NTOA 4AN1A 2ZBPA 4XR9A 3E22B 1N8SA 5AHOA 4S0ZA 4G4IA 4NYIQ 1ZGJA 1SXJC 1YC5A 3JYOA 2BJHA 4IHJB 1VPDA 1BZYA 2I2BA 2LCFA 3EFHA 3FNFA 3VR4H 4CJXA 1G5HA 1CUXA 1KDRA 1PEDA 1DIGA 2EZUA 3BMQA 4FLFA 2WU0A 4IHAA 4KI7A 2IX3A 3O47A 2D2IA 1RQXA 5REQB 4ML3A 2A8YA 2P2NA 3GOQA 1UDXA 4BCCA 1JIIA 2X8JA 4JFAA 4ZOBA 5K6AC 1VYVA 2WTUA 1UZLA 2WIDA 3HDQA 5DFAA 4JWTA 2ZVPX 3RTEA 2K7ZA 1U5AA 3IJEB 2RHJA 3LBHA 821PA 2RGUA 3IULA 3MIIA 3AHIA 3NIDB 1QOZA 4FYJA 5BQPA 2VQFB 3KZMA 2BGUA 4TQ9A 3OCWA 4W9NA 1HMYA 3C0KA 2BM9A 2VK8A 5T7BA 2OHVA 2A0YA 5KINB 5B12A 2EKPA 5HP4A 4D82A 1VIVA 2BFDA 2ACEA 2FUEA 1G5QA 2FRVA 4JJKA 4I6GA 2GTHA 4EP1A 3WIEA 3WLIA 4CWAA 3OE4A 2O2EA 1QK5A 1XMQB 3TBFA 2QVCA 2EU8A 2JI4A 2QYSA 2WKSA 1RLTA 4MDFA 3K96A 5BMOA 5L7WA 4HAIA 2RH9B 1THMA 1SGWA 2P5UA 4GR4A 3EA0A 1NQTA 4M38A 4F3KA 1OH7A 1NVMB 1A88A 1FQKA 4LVNA 3JQ7A 5EMNA 2GARA 1GQSA 4KL8S 5HE9A 1GCGA 4HQFA 2BZSA 1T24A 3B12A 4DLZA 3P0EA 2HHHB 2OQRA 1C30B 2YICA 1KJIA 1LSSA 1ZN2A 1U1EA 2XRZA 1VJGA 4N5HX 4WPGA 5ICMA 2FN8A 2J0VA 3IQIX 5JPIA 3ZGXA 5IT5A 1UPTA 1K8RA 4F85A 5JR3A 3CX7A 2Q8PA 3GA5A 2ZBUA 3EFOB 1YUMA 3ONDA 1VHTA 2X3UA 5KNBD 1PW5A 2IUTA 3STXA 3AIKA 5CT4A 3CINA 2V1UA 3B2EA 5JFGA 4RTOA 3M4JA 1PV1A 3KE8A 3NHUA 1XCGB 3W7BA 3GLFB 2BY4A 3AY7A 4R2HA 1YOVB 4QVIA 4GI3A 3WXMA 1INLA 1DAGA 4JX9A 4N82A 5M2QA 3QFTA 1A1SA 5HA5A 3HBJA 3GRKA 1JQAA 1SUPA 2GNAA 4IJMA 3AR5A 1HYHA 4GOKA 4LAFA 2Q3MA 2IXFA 1PK7A 4PIMA 4UUOA 4UZFA 3QLVC 3PUZA 3DHNA 4MV7A 3SC3A 2XMSA 1I3NA 4JXJA 3PF8A 2H8GA 4JI4B 4U7WA 1AU9A 1E3DA 1E96A 1XF9A 3N70A 5CHEA 4ZHQA 1XIVA 3KXLA 2EKZA 1NMZA 4H0CA 4XB6B 3A6HA 5K2MA 4OI2A 4EB0A 3LGSA 6YASA 1SG9A 4E22A 1B3BA 5HWSA 5EZYB 1BCSA 1VJTA 4N49A 1KERA 4L74A 2OHFA 5KC9A 1HE1C 1W0JD 3CFYA 5AICA 2FSIA 5AUQA 1XVIA 2YJGA 4MKGA 1T8YA 2Q3EA 3Q7RA 4Q12A 5KVCA 3OF5A 1BE1A 4WVFA 1DWUA 4EMUA 3KVOA 1PFKA 2ZXFA 3F6PA 2EIXA 4RZHA 4UARA 4CG0A 2ZYSA 4D4MA 1O95D 1VE5A 4OHRA 4K6GA 3LVRE 4V0NA 1XI2A 4NBTA 1N5KA 4AS2A 1ZS9A 3MJCA 3LYHA 1GXSB 2IYXA 5IVIA 2YJZA 4LRSB 4DMGA 8LDHA 3CR7A 4O4JF 1H9CA 4FYMA 1ICEA 1GRVA 3NAMA 4LF8B 2WM2A 3R3YA 3PC7A 4R1TA 2JH8A 4CDMA 3INYA 4DMCA 5LNK6 1D2AA 3NNSA 2EP7A 4M60A 3BMQB 1ZBQA 2CXOA 3ZLBA 1Z5PA 3JASA 3R7AA 2XW6A 4ZT2A 5KWVA 6AT1A 1LDEA 4ZYZA 1E1KA 3K9HA 2X8JB 3L7IA 4Q9KA 1K66A 4Y2JA 1TF2A 3B38A 4BJ1A 4TV8B 4X3CA 5EGNA 4F3RA 3BK1A 1EE9A 2XOXA 2O6HA 3FPLA 4HZIA 4YRSA 4NCKA 1U3WA 3ADBA 5E7MA 4QGFA 4JKYA 2N3ZA 2ATEA 3LRXA 4Y6GB 4EF5A 2P2ZA 4KWCA 3T5PA 2C4NA 2X1LA 1IG0A 4AN0A 3L4BA 4BVGA 1OFTA 3U4HA 2W90A 1ISGA 2PWAA 4EFMA 4MUEA 2BFDB 1M2KA 2D5IA 1AS2A 2QQEA 4JUIA 1UBCA 4KODA 4A4DA 4E1BA 3KR2A 3USES 5GZ1A 4D96A 1KI3A 1NRXA 1VMDA 3UUGA 2E87A 3TEJA 4G0UA 4N1AA 2QGNA 1X3SA 5FA8A 1KSJA 4YDQA 1KTVA 2DWCA 2IH4A 3F71A 2H18A 5IAEA 2XTMA 1CV2A 4BDTA 2OLEA 3C3MA 1F0YA 4H6WA 5C80A 4IQFA 2IU0A 3R5FA 1UOEA 1W0JA 3JQ7B 3Q5DA 3NTQA 1KORA 3VU3A 4E31A 5HVNA 3MHTA 3MCZA 3VR5D 5JJLA 1J2UA 1GU1A 3BMCB 2NGRA 5DHSA 4Z2YA 4BX2A 1Z4NA 2G1JA 1RWBA 1HFEL 5A9TA 2F6RA 5SZKB 4A7PA 3DZFA 3KUCA 3KZNA 4WWHA 2V58A 1NMEA 2XV1A 4RJIA 5DLQC 1O95A 3ISTA 2PJZA 4M46A 4L15A 1XL1A 3IKMB 2ZUVA 2AF4C 1A0OA 1H0KA 2KM1A 1M83A 5ENDA 2GKGA 3VI3B 4CQLB 4D9NA 4COKA 1GGJA 1N34B 1FC0A 1VYHA 2BGJA 2O48X 4KDEA 3L1JA 2HPAA 2RK4A 4PIPA 3QXCA 2PRKA 1HWYA 4GM0A 4RY2A 2ORYA 1LTQA 2J3QA 4NZZA 5JBNA 5AIAA 4HAZA 1UXHA 4AYXA 2FPWA 1AA6A 4PM4A 2H4FA 3PFWO 2P6PA 1NA5A 2HM7A 2OFPA 4OV6B 1F9AA 4WY5A 4WZBE 1RYFA 1RBMA 2CD7A 3GU3A 3ZLTA 1QCCA 3F74A 3ROZA 2X0EA 5HGJA 3TLGA 2UZ1B 3FY4A 5TS3A 4KO1S 4TKVB 2DBQA 2FMFA 5JT1A 2YX1A 1V2GA 4ZHQB 2ZDHA 4KUEA 4NQRA 4P5EA 1AG9A 1F8YA 2VHEA 3OJCA 1LH0A 3ZHQA 4F12A 4AI6A 4IGFA 2C0PA 4C30A 3EISA 1YZHA 1BCSB 1IHDA 1Z2PX 2VDQB 3HYLA 5B3LA 3CZMA 4DNFA 4KIUA 1WE2A 3M4ZA 1J90A 4BQNA 2GFIA 1E4EA 1V1MA 2G9VA 1NP3A 3B1FA 1VHQA 3CBGA 4GMHA 4TZ0A 2EARA 2YJNA 4TTAA 1AVTA 1N6LA 3JD4A 2BBSA 3CLUD 1QRAA 5IG2A 5A3SA 2BWJA 3VNBA 2R1ZA 3BRQA 3L6BA 2FMIA 4KQ1A 2RH8A 2EX0A 2ZPUA 3JSAA 1UJ4A 1IMOA 2W2OA 3KSRA 1TRKA 1N1DA 3DV2A 4C4OA 4M0EA 3LNTA 4Z4QA 3VR5A 4EY6A 1KI7A 3CRW1 4EQ6A 3RROA 4R68A 4EW1A 1U2QA 3P45A 1I1NA 10MHA 4DNPA 1XRLA 1KO8A 2FP3A 1L5SA 2GX6A 3F8TA 4K86A 3UWSA 2NVUA 4JC8A 3QBJA 4EIWA 5JWOA 3ESZA 2F8LA 3V1MA 4EARA 5AVQA 1TPZA 3P9NA 4XDGA 4ND3A 4P6VF 5FUYA 1GV1A 3GLSA 2CVQA 1DPGA 2Q2QA 4W5QA 1AV7A 3IERA 3L1KA 4RVFA 5FEMA 3SOPA 3JASB 3NDIA 1QORA 1WZEA 2IHYA 4K6KA 4TXMA 1DDIA 5AM2A 1Z18A 1WR8A 4G01B 2ZBGA 2BMFA 3F1LA 4L5YA 5B3AA 4LDZA 3STVA 3L6EA 4HNTA 3H11A 4OI1A 3AJAA 3LQYA 3B5IA 1NC1A 3JWEA 2AUTA 3DZHA 2V03A 2ZU6A 4PEVA 4IOMA 2ZTHA 5G0UA 3W8RA 1NI4A 4J75A 1XTKA 5DLYA 2QRZA 1XD2A 2RGNC 4JI6B 4B2PA 1DX6A 2QVXX 3MCUA 3CVJA 3NH6A 4WASA 5ICFA 2ABWA 2J5KA 3P1JA 3QE2A 1ISIA 4GOJA 1IUOA 3R9WA 2I7XA 3FZYA 4E13A 4K46A 1YA8A 4MJ3A 4OHYA 3C7AA 2G09A 5EC8A 1YDEA 3V1LA 3TE7A 1T6BY 3TI9A 1IZ8A 2VJPA 2DR3A 3NRCA 3WHIA 1VP3A 2COUA 4BVAA 4TYNA 1N5MA 2ZR8A 2B2NA 3R20A 1DWPA 2G1KA 2QIOA 4UBNA 5H4HA 5A04A 4V03A 2PA3A 5ALNA 1QOQB 5DGTA 1SVSA 1T0HB 2GZRA 1U2SA 3KKEA 3FJYA 4P7GA 5I3CA 5BSFA 1E2LA 3RARA 2OY0A 4B80A 4RJJA 1D5WA 1CUCA 4L4UA 3IS3A 2VQEB 5DGIA 2C7RA 4OB8A 2QQGA 5J43A 4RPCA 3KZCA 1OH8A 3PITA 4NPAA 1VMKA 3LNCA 3DWIA 3TSYA 3RV4A 3NPMA 4LN1A 5C52B 4QJIA 1QFMA 1SKAA 1Y4SA 1HUQA 2DOKA 4I1RA 5DV9A 1GEEA 1TVCA 2IS2A 2WKQA 3QYAA 3VNSA 4KXFB 2C5BA 4B87A 2JFOA 4WW0A 1R6DA 1SUAA 2A92A 1E3WA 1TTPB 1HNNA 1AX9A 4G0WA 4F46A 3VO8A 2PX3A 2R1UA 4LOIA 3PV0A 1PQYA 2VXBA 4C7OA 1ECFA 5DM70 3ABRB 3T4EA 1UXJA 3NHAA 5ICSA 4MV6A 2C7VA 2BONA 4BKUA 4MB2A 1EU1A 1OROA 4HH0A 3GFGA 2ZE8A 4XGKA 5CK4A 2ZUCA 5CDFA 4LGVA 3ROEA 1OGYA 1LLUA 3Q9SA 5CM9C 3TLGB 2J9GA 2C7GA 1PHPA 3QFSA 4NOKA 1L7XA 3WHPA 2QHXA 4RF3A 1Z68A 4N5DA 3VTFA 2IP2A 4G56A 3WMFA 4C5CA 3LBNA 2D2XA 2IDZA 4RWEA 4DMHA 4EYKA 3IEVA 3FETA 2QMEA 3EIOA 2AXQA 3HB1A 2CVPA 5F76A 1F7UA 3MUEA 5FPTA 4FPXA 4HP8A 4MVYA 1KBOA 4ZYXA 1A5AB 1YRBA 1Z16A 4KNWA 5DH9A 3RRZA 3OSUA 4RANA 1YSCA 3BWEA 4MUFA 2QGZA 4MUBA 2ZYWX 3I5UA 4MVXA 1DARA 5TC4A 3WLTA 1R4NA 5K99A 3K15A 1GFWA 4HDQB 1EA7A 2M1ZA 2XJ9A 3AUYA 3QPBA 1PD1A 2IYRA 3N8GA 5K4HA 1Q16A 1KI9A 3SSAA 4QUGA 3NWOA 1OYWA 1Z83A 3QSYA 3PXGA 3ZE8A 2I7TA 4OAPA 1FK8A 4FD2A 2XZDA 2OK8A 1SO8A 1VA4A 1YGYA 3FB4A 1BQ3A 3E5RA 3O2QB 2E3JA 2OV4A 4NMHA 5KCMA 3SZGA 4EQ6B 3E3AA 3GRUA 4F8EA 1AF7A 3WB1A 3DP9A 4NV0A 4Y98A 4BN4A 1Z0SA 3LHFA 2NVUB 5KYXB 1TI7A 3EQ2A 4OYHA 1VIYA 3FYHA 1BH6A 4ZARA 2A1UA 2OK7A 5DNCA 1EUYA 4RZ2A 4IL5A 5D7NA 3RU9A 1JF8A 1W75A 2IRWA 4I46A 3QKIA 4LDQA 1B8UA 3KR0A 2DBRA 3QUTA 5F5XA 8ADHA 4Y6QA 2QUAA 1GUAA 1YRLA 2I7CA 3H11B 1RXWA 2CMHA 1XEWX 4MI3A 1T6YA 1KZ7B 3VHXA 1P77A 4YC7A 2ZJ1A 3GFOA 4UM9D 1NI4B 3SSOA 2CLHB 1IB6A 4Q24A 1XD2B 4UCWA 4ZVNA 1BA3A 3SWWA 3PWTA 4QDOA 3BC1A 3R1IA 2C9DA 5K5EA 3V34A 2G40A 2FPOA 3U7FB 16PKA 2WUFA 3LO5A 2JI7A 2WINI 5A5FA 1LPOA 4RVUA 1NULA 4U2BA 3T7DA 3ZDFA 3W2IA 1T15A 4YRDA 2ERXA 2QG6A 1GTRA 2ES4A 4MB6A 3R7FA 4BZZA 1XLVA 2IOHA 3CJQA 4GDMA 1EFAA 5GIOE 1C3EA 3UKJA 2D7DA 4GMKA 4BNXA 2HRCA 2VCYA 1IQUA 3UMBA 3MUFA 5M04A 1V41E 3ZTYA 2DTDA 1QG2A 3SZOA 5C8YA 4DC1A 5LMNB 4KMOA 1CDEA 3KOUA 3PSAA 4YRCA 3WQHA 3MT0A 3GRPA 3OEED 1KYVA 1VL5A 1U5CA 4JLSA 1WKBA 3COSA 1JXQA 4FMCB 2RGCA 4IIVA 3EXHC 1RPZA 3QENA 2P3QA 2WIGA 2XX3A 3BZBA 1KVQA 2Z1NA 3GEBA 4Z9YA 1GUZA 3QLJA 2FPGB 2O0LA 4CLRA 4LQLA 3GO4A 1FXWF 3D9QX 3LT4A 4TYQA 5ALXA 2YWGA 4CF5A 4EYSA 3B89A 5K51A 3R7DA 2CMGA 4KDRA 1E3WB 2O1WA 5CT5A 3DOEA 1NMQA 1GR0A 5CHYA 2D3WA 1E7MA 4DN6A 1NBOA 4J29A 3TKYA 1Z6GA 4OHUA 2WHYA 4DLKA 3IPLA 4JBLA 2JHPA 3OOEA 1GGMA 4D4LA 4KO4S 1BVYF 1G5FA 2AMLA 2AA3A 4KRFA 2XUJA 1ZRHA 3SVZA 1ZMXA 3LG2A 2Q4OA 3IP7A 4IDHA 2E4YA 2PUFA 1PZEA 1NDQA 2XE8A 5E4JA 4MJLA 1VJCA 1XPUA 4Q3OA 1QHIA 2DPYA 2C2MA 2ZUBA 3P2OA 3A0RB 1GYRA 1R0YA 3RUCA 3ZCPA 2WV7A 1U0EA 1BVRA 4YMIA 3V48A 4EATA 3RSCA 2BFPA 3MHPA 3HM9A 2P69A 1NKSA 1T9AA 3QG5A 1JSXA 1RRFA 4KPGA 4RGVA 4BV2A 3BEDA 3L9XA 2EJUA 2A78A 1HFJA 1DZIA 3HADA 4YRIA 1FQWA 1OLXB 1D4AA 5BWNA 4ICIA 3BWXA 4MKIA 1LK0A 4K1XA 5T8KA 1R4NB 1XXLA 1DLIA 1FMCA 2XA9A 2Y9PB 3ETHA 4WY8A 5DM4A 5FYQA 2HWWA 4CLEA 3PXCX 4GOXA 2JRCA 1RI4A 3CNBA 4L75A 5D00A 3S1LA 5I7WA 5HX7A 5HXAA 1OBCA 3BORA 2ISCA 2Q6TA 2R8ZA 2Y1DA 4J6FA 1DT5A 3LPNA 4IYRA 4YRJA 4BRWA 4R0MA 5JMOA 5ITVA 1X94A 2Q46A 4HDRB 2YJ5A 3F4KA 3H1BA 1CCWA 3OEEA 5FI0B 1J06A 1IY0A 2NUBA 3GZTB 2BKEA 3UJAA 5JVDB 3ZS9A 3ZYZA 2IF2A 3BH0A 2PS9A 2DHCA 1OH6A 4KLZA 1KEEA 3KALA 3PZBA 2UVDA 5IBCA 2ODBA 1G2OA 2QI9F 5KVVA 3TUZC 3G5TA 1ZGAA 2A1UB 4FGUA 2XD9A 5K8UA 3VZCA 1F8UA 2IYTA 2ZSIA 1SQSA 1HEYA 2GVNA 4MK4A 4DCMA 2D0PB 4HWSA 4LGMA 1SUWA 3R3WA 2YMPA 1Q15A 1UBNA 5CM2Z 4D41A 1H6CA 2BFBB 2EGGA 2DCUA 3EDQA 4D56A 1BKSB 5LYJF 1GZHB 2XEDA 3FR8A 3A4NA 3C7CB 3M6IA 3TUIC 1JA1A 3DFIA 2EAUA 1JLLA 2CLFB 4B2IA 1Y8RA 3HE3A 3B6ZA 4CMBA 2MYTA 2L0XA 1XD9A 1K4MA 2X0KA 1ZEJA 1VL0A 3BTOA 3DGEC 3IUEA 3KKPA 3MBKA 4FEEA 4HXGA 1KK2A 4NBRA 3J81A 5JFTA 3LLMA 3M34A 2IPMA 3OLZA 4CQJA 3CN7A 4IDEA 1ULHA 5JZMA 3M6FA 3U80A 4DCPA 2R62A 1GPKA 3CXUA 3EXIA 3JTEA 4FT4A 1SB8A 3E1SA 4KMSA 2J09A 3TTYA 4P0TA 5JXJA 2AN3A 3DFZA 2H2HA 1YTUA 4DS3A 2W8BB 3PCXA 1RI3A 1TEZA 5DNYB 3QVXA 5IXJA 1QVVA 1LCIA 1C1HA 3MN1A 3K4PA 5AKLA 1L7NA 4B6PA 2QTWB 1T9GR 2V3WA 3D3EA 4L0QA 2PMBA 5IJ0A 2P77A 3W5JA 2WWHA 1JG7A 2C3PA 2ODTX 1VCOA 3QA3E 1LTHR 3U44A 4MVJG 5AO9A 1RU3A 2WNSA 3SEFA 1OXVA 2OILA 5AVTA 1TM2A 2A58A 3MWEA 1JVBA 1B8OA 1PLLA 4ITVA 1PFWA 5AW0A 1KKMA 3ECAA 2NAPA 1RQLA 2D5AA 3JX9A 5HR5A 2BFFA 2RC6A 3VAZA 5A2QA 1OHHD 1XZHA 4WZZA 1Y4UA 1TUBA 4FEAA 3TZLA 4F9GA 1ZG3A 4KGZA 4PR3A 4QU8A 2FW1A 4Z9AA 4QSHA 3OPVA 2BKXA 3TB6A 2PAAA 5H16A 4YGXB 4EY3A 3OZAA 3BRCA 3LC1O 2AEMA 5KWSA 2XXJA 4E6PA 3FTQA 4LNHA 1GRCA 1X7YA 2DFVA 4IKPA 3ANYB 5ADUS 2RHDA 1RADA 4G5HA 4K28A 3GRAA 1SK9A 3OIGA 4FFBA 4P38A 4D5EA 4IYJA 5IC5A 2UZ3A 4UM9B 1JHPA 1G18A 1Y33E 1QHNA 2VXOA 4LC0A 1ZHHA 4N7BA 1SCUA 4CL0A 5FB3A 9ABPA 5JBIA 3UPTA 5CW1A 1CQJB 4WN3A 5IYZF 1I3OA 3EIWA 4NCXA 3QPVA 3HZZA 1I3CA 4YCLA 5AOAA 5LXTF 2HT1A 4KFUA 1B3RA 3FOCA 5ERXA 3I5XA 2ODEA 3DO5A 4OM8A 3T7RA 3DWEX 2YQ5A 1CR4A 1NLYA 5EJFA 3CM0A 3ZX4A 4M4SA 3EJWA 3PEFA 1IIBA 1JQ3A 3MOGA 1T9GS 3S8MA 1AHPA 3Q8XB 1N4AA 4Z53A 2JW5A 1XROA 2YXBA 1GG2A 4EH1A 4HQNA 3L77A 1ISFA 1S89A 2P9CA 1V8DA 3UCEA 2C3OA 5BT9A 4DIEA 2VTKA 1QZTA 5JAIA 1V5IA 3GQVA 5A0TA 4OMCA 3O8LA 4XLLA 4DXDA 2CDBA 1QLWA 1ZNXA 4WXYB 4ITUA 1AHHA 3NG1A 3BBLA 3FKQA 2VF4X 3PEVA 4LOLA 5KDLA 2JGNA 5HCUA 3B7GA 3ILSA 5C32A 2QTTA 4PPGA 1X8LA 1TGYA 1EJ6A 2C8JA 2CZCA 3CKYA 4TTJA 3T1OA 4BATA 4MINA 2FSSA 3V4ZA 1C0IA 1BDHA 1PT7A 4YONB 4YCMA 1TZJA 5ER6A 3GP5A 1IH8A 4RDCA 5IJ9A 1K3FA 3E1GA 4GICA 3HO1A 3T1TA 3QYJA 1S8FA 3ZWQA 1OHHA 1H22A 4HMQA 1ULAA 2J4FA 2OO7A 4I5FA 2B1GA 5FBRB 2O2JA 3AHFA 1USVA 5ARBA 2C97A 2GPNA 3ZBQA 4LFCB 5C8ZA 1W44A 2Q7XA 4H0FA 4IFEA 2G9ZA 4WAUA 1JLLB 5F9HA 1PSWA 1P5FA 3BD8A 2FEKA 2R6AA 3A3PA 1S8NA 3CQ9A 3JD2A 5TS2A 3GMIA 4B47A 4E5UA 1SOMA 4KXMA 1KJNA 2FQWA 2MSEB 2IEAA 2HK8A 1CIPA 3ROTA 3NVMB 2HB6A 1RQ7A 1MNAA 2OUKA 4F4UA 4Z5XA 4LE2A 3NKLA 1YFZA 3FI0A 5HK8A 3KZ1E 2VTVA 2J3DA 2XQKA 4R8MA 4E7OA 2QUHA 4PZAA 4R69A 3HJBA 4M99A 4PGMA 4RSGA 5FWYA 4PSDA 3SI7A 4Q21A 5IWAB 3I5YA 2POCA 2JCXA 3D8HA 4P36A 5JWHA 1K9SA 3FFTA 4G97A 3WDSA 5C7LO 4M1SA 1EFLA 4W7SA 4KN5A 2HFJA 4AJ9A 2CBZA 2VHYA 2H06A 3DZJA 4U0JA 1O0CA 2JLBA 1JHOA 1MHPA 2YV1A 4IRMA 3SLGA 2XMCA 1GFIA 4KEAA 3WA6A 4DV2B 1GZ5A 3LVBA 2NW6A 1UZAA 1RRVA 1CF9A 1JIVA 3OUUA 2HO4A 4MWEA 4RCVA 3PHIA 4M37A 3EVAA 4RA6A 4DAEA 4GO1A 4ER5A 1Q57A 2VJNA 3ROXA 2BFFB 2BM0A 2I99A 3IAEA 4Q34A 5DSZA 4EG8A 2Z5GA 1I4OA 1MJFA 3SBXA 4MW1A 4DMFA 3ZK9A 4JYMA 4KDFA 4BFTA 4KUGA 2CSUA 1ZMBA 3HDTA 4IXMA 1XDGA 2JFWA 5K3EA 1KVTA 1CJCA 1VG9B 3TZEA 5KNCH 2J0SA 4YXWD 3MFYA 4DDTA 2ORIA 3P97A 5BW4A 3HKBB 1JEDA 4DUZB 2VYFA 1X7YB 4D6PA 2M32A 2PSJA 1GAEO 4KYUA 4RIGA 4TL7A 2XEXA 3HCRA 4FFBB 4WEOA 2P67A 5DNDA 4KSBA 1PFUA 4BKOA 4Q39A 5FPSA 3U6BA 3T9CA 2CXUA 3AUAA 3DP7A 4LKRA 5CCEA 4FILA 1AT1A 4YRBA 3E2PA 3A04A 3WO0A 4BLTA 1GZUA 2GZHA 4TTTS 1VIAA 3NKFA 2CLEB 3GZJA 2H7XA 4UCQA 3TLAA 1BMDA 4DWJA 5K03A 4QSMA 4V0ME 4OX9Y 4V24A 1L9XA 2AG1A 4F84A 1JXAA 1XQ9A 3AF5A 3PR2B 3PTLA 3SS9X 3CKLA 2RJOA 2ERYA 5KCZ