3PJDA

Structure of enr g93a mutant-nad+-triclosan complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIAFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural basis of triclosan resistance
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 88
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pjdA00
2JFGA 3EC7A 3VOSA 1C1XA 1QV6A 3S2EA 1ZBQA 4KTTE 5GMOA 4DTIA 4ALJA 5L9AA 2WD8A 3TJRA 1E3EA 3PJEA 1DXYA 3D4NA 1F8FA 3OA2A 3TPCA 3AY6A 4FN4A 5G2OA 4E6PA 2QZZA 1SPXA 3HFSA 4FSHA 4XD2A 3AWDA 3MCVA 1K3TA 3W6UA 2O3QA 3E82A 2XPCA 4P8RA 1K89A 3GFGA 3ETEA 3AI2A 1ISGA 1KERA 3PHLA 3DDNA 4OH1A 3LK7A 4XB1A 1FDUA 1RKXA 1X0XA 7ADHA 1MXFA 4FB5A 1P1HA 3KSDO 2AXQA 1RM3A 4IJVA 4YJFB 3ZNQA 2BFPA 2C0CA 3FPCA 1KBZA 1DFIA 4MKZA 4U6QA 2OOSA 4YJHB 4ZJUA 3VH4A 5CEFA 1P1RA 3OM9A 1ENPA 4FGWA 4MP3A 1FXSA 3ZWYA 1MGOA 2POQX 1LLQA 1Z74A 3I9MA 3DFUA 3V1TC 4O0LA 4MKXA 4QFDA 3HUDA 4NPCA 4AJ4A 3ICCA 1QMGA 4DMMA 3LT4A 5JPIA 2X5JO 4MINA 2NNLD 1VL0A 3N74A 4DA9A 2HQ1A 1KETA 4CODB 5JMWA 1OZAA 2B83A 4MO2A 1YBMA 2B0JA 4JXKA 5DP2A 3CZRA 1YL5A 3LC1O 5JLAA 4BGIA 4PLCA 2CUKA 4BQPA 1NTOA 4E2ZA 3CMMA 1A7KA 4XCVA 2AG8A 3C8MA 1ZXBA 2XAAA 3HSKA 4DBZA 2V65A 3WYBA 4BUCA 1PQPA 1V0JA 4HFRA 4N54A 3WLFA 2C5EA 3ONEA 3ZGYA 2EGGA 4XRGA 2AQKA 3SEFA 1BSVA 2NM0A 4E0BA 3QV1A 2LDBA 1Q1NA 4TVOA 4E12A 5FEUA 1JWBB 4MP8A 3WSVA 1I8TA 1ZK2A 5U1PA 3FNGA 3AOGA 4NI5A 1HE2A 2BFOA 4BO6A 3BMNB 3T7CA 2VHVA 1L1FA 3U4CA 3QP9A 5ILGA 3WR5A 3EZYA 3WYCA 3HWRA 4O59O 3RBZA 2YYYA 3GG9A 3D1LA 1HYEA 2WD7A 3S8MA 1E7QA 1YO6A 4FOOA 1XEAA 5F5LA 2DFVA 3GF4A 2BMAA 4CUJA 4IDBA 3KETA 1FDVA 1BHSA 2W2LA 3AM4A 4PZEA 1QXSA 4DMLA 2OUIA 2JFHA 3ZZNA 4CLXA 4DYVA 1SAYA 5ILOA 4JNKA 1VL8A 1ZFNA 3D7LA 3EVNA 1J5PA 3FRJA 3LLSA 3C7AA 3RBVA 4BGUA 3K9QO 5JC1A 4CR7A 5IZCA 4KWIA 4TKMA 4MVJI 5TGDA 5H83A 3OF2A 4D0SA 1P3DA 3ICPA 4B79A 3D5TA 3G1UA 1E1NA 2PV7A 5F21A 5JY1A 5B4UA 2B5VA 3AI1A 4JROA 5TC4A 3Q6IA 5KNLA 4ID9A 4YTEA 4ZQHA 3RUFA 2XF8A 3UCXA 2QYSA 1LDYA 2WYWA 4EUFA 1ISFA 3A9WA 4E13A 2NQTA 1M66A 5IDYA 1E3WB 1ADBA 2W4QA 5JMPA 4J9UE 4D7AA 1PS0A 4JCOA 1PX0A 1H2BA 2ZQZA 1BXKA 2FN7A 2VYVA 1O0SA 3H4VA 1K6JA 2OP1A 3GGGA 3KTDA 5T8KA 1K5HA 3PXXA 4BGEA 3L4BC 2FSVA 3WLEA 2PZMA 3IIEA 2UVDA 3AK4A 1ML3A 1WDLA 1J4AA 1YXMA 2VRCD 1Y5MA 1JN0A 4HFJA 3BMCB 1NPTO 4L4RA 2P9EA 4L8VA 4LCJA 3D4OA 3AM5A 3UCFA 5IFLA 4XJSA 1LDMA 1PZFA 4RVFA 5CEJA 3KUXA 5JAZA 3K2BA 3L07A 5B37A 5KIAA 1YQGA 3GVPA 4EEXA 3NT2A 1QR6A 1UP4A 4R1SA 1PL6A 4YRDA 4B4VA 3NGXA 3ABIA 1K6IA 2EGHA 3K8ZA 4PZDA 2WEKA 2GN6A 4N5NA 4R41A 2FR1A 3CUKA 3U5TA 3DHYA 3BIOA 2BI8A 3QWFA 4JP2A 5BSHA 3GZNA 3BHJA 2DUUA 4RLSA 4Y8VA 4JX8A 4WLEA 4CM1A 3Q11A 1BWSA 2O2YA 4CM6A 1PGJA 2WYUA 3IJPA 4BV8A 2QZ9A 1E3JA 3F47A 2X86A 3ROPA 4GKVA 4EITA 5CG1A 4ITUA 5HBRA 1B14A 1EDZA 2BFAA 4IGEA 2HMVA 1UH5A 3JQ6A 5L3ZA 4D45A 3AI3A 4E2YA 4CM5A 2IXBA 3UW3A 5L45A 6ADHA 3Q9NA 1R0KA 1QRRA 3EUWA 3IMFA 4C7KA 2ZIZA 2H9IA 3HHPA 2X8LA 3SC6A 1PJQA 1BVUA 4KMSA 3N58A 3E5RA 2DBQA 7MDHA 1BVRA 1VE9A 3G49A 5HWSA 1XWFA 3EHEA 1U28A 2GGSA 4DXHA 4JP3A 1VJTA 3PYMA 1L7DA 1DRVA 3H5NA 5CDYA 2O3JA 5TRTA 3CXRA 4R51A 4WCFB 4IM7A 1DIAA 3AOEA 3DHEA 3HJAA 4MOWA 2V6BA 1NM5A 4LN1A 4LRTB 3NRCA 4NFHA 4E33A 4N5MA 1PEDA 2BH9A 4CM8B 1Q7CA 2PWZA 4JK3A 3SJUA 4BB5A 1I2ZA 5TQVA 3DB2A 3JYQA 1NFRA 4Q3CA 2NTVA 2RH8A 8LDHA 1LI4A 5TX7A 4GPD1 5JYEA 1H0KA 5GY7A 1O9BA 2YV1A 1DOHA 1EMDA 2UUPA 3L6OO 3LT0A 2PY6A 4P4GA 5A3VA 3A28A 2PFGA 3ZCXA 3KB6A 1DRUA 1NXQA 2FZEA 4FFPA 4WJZA 1UZLA 3PGXA 2X23A 2Y68A 1Z6ZA 2ZQYA 1HDYA 2H1SA 3PLNA 2RAFA 4TROA 4CL3A 4A26A 3UKOA 3GEDA 2Y67A 3ZWMA 2AW5A 4RJTA 3OJFA 5I7FA 4D43A 4R54A 5KKCA 3CMCO 1W8DA 4JJIA 1NYTA 2HMTA 3CE6A 1W4ZA 1ZUD1 1MFZA 3K31A 5G4KB 4MVJF 1V3UA 2H6EA 1HRDA 3HDQA 3NUGA 3B1FA 3QVXA 4OIMA 1F14A 1DHRA 1E77A 1XYGA 1DIGA 3WGQA 2DVMA 1C1DB 1N9GB 1WXDA 2BGLA 4Z0HO 1UUFA 2BRUA 1V9LA 1QYDA 4LRSB 5TJHA 3F1LA 1IZ9A 2C07A 3RFVA 2C29D 4E3ZA 4B3JA 1PL7A 1GL3A 4ND1A 4YBZA 4L73A 3I5MA 4XR4A 1PQUA 2I99A 1PZHA 3IKVA 4OSPA 5IXYA 5L4NA 1SO8A 2PZLA 4YJFA 1ZSVA 1PGOA 4MVJG 3A06A 5CG2A 3H8VA 1VLLA 4YJHA 5ADHA 1GQQA 1IULA 1HDCA 3DZBA 1LQTA 3D0OA 3H5RA 4P38A 1U2GA 3OJ0A 2ET6A 3QWIA 2ZYGA 5AOVA 4DGSA 3D3EA 4LCEA 1Z7BA 1GUFA 3ENKA 3WICA 4ZICA 3ORFA 1Y81A 3OP4A 3UF0A 5JO0A 3ANMA 5B12A 5FYDA 1X0VA 2P2SA 4IZHA 5BNFA 4FDAA 3FR7A 4QXMA 4R68A 4BO4A 2CF5A 4XGNA 4R9SA 3HFGA 2O23A 1KIFA 5EQFA 1A4IA 1U7TA 4NK4A 4ROSA 1M67A 1RWBA 3G0OA 3MZ0A 3IJRA 1FDWA 2GZ1A 4ND5A 3WX0A 5FWNA 2DPGA 1PR3A 4BO7A 5EINA 3INRA 2W90A 2GN4A 2DC1A 4URFA 4UEJA 3TQHA 4ZRNA 1B7GO 3ANNA 4UUOA 2DTEA 3WQRA 2HRZA 4ZGWA 3UHAA 5JAMA 3QSGA 4LMRA 1Z75A 3BMNA 3SC4A 3GDOA 4B4WA 4LVCA 5EMHA 5CFZA 1FK8A 1GYRA 2Q4BA 4NDNE 3Q1LA 3RKRA 1BTOA 1XDWA 3B1JA 3PRJA 3ZV6A 4I5DA 4IJUA 1N1EA 3JCZA 3VTFA 3RUDA 5U9CA 3P19A 5A04A 1GY8A 2ZTLA 3U0BA 3VH1A 4S3MA 5A4DA 3DBLB 2EP7A 1BDBA 3RROA 1YL7A 2I9PA 3B70A 4XQCA 2GR9A 2FR8A 4CMGA 5IN5A 1HZJA 1KC1A 3ULKA 1E7RA 3KYCA 4EJMA 1A9ZA 2RCYA 4YRAA 2YY7A 1AE1A 1CRWG 3GPIA 4BNXA 4CM4B 1K0UA 2X7HA 4GMFA 4CMEC 1L7EA 3VKVA 4HKTA 4BMVA 3CEAA 5EPOA 3QVTA 1J49A 3UAGA 3F46A 2LDXA 3QVSA 2AHRA 1ZW1A 3ONDA 4NIMA 1EVZA 3COSA 3WOHA 2QW8A 2ZTUA 1E3WA 3KM0A 5CPBA 4XJTA 3RFXA 3RJ9A 4GLLA 3OIFA 1PQWA 1EEHA 3U09A 2O4UX 1JA9A 4HBGA 1YL6A 1F12A 5C7OO 1YBAA 4H7PA 4NFYA 3ZWCA 4BHTA 1HKUA 1ZXLA 2O3UA 4C7JA 4J2OA 5CP8A 1Q2XA 1OC4A 1PS8A 3QE3A 5GZ6A 3BMCA 1KEPA 1WMBA 2D8AA 2HMWA 1KEVA 2X0IA 1OFGA 2FMUA 2P5UA 1T1RA 4GBJA 3ZI0A 5JW6A 2DQ4A 2ZJ0A 1YS4A 2NTNA 3DWFA 4EJ0A 2BD0A 3JQGB 1VJ1A 4J43A 2HMSA 4BL5A 4KUEA 1E0DA 3E6AA 3KSUA 2O3TA 4BMSA 4Z9XA 3VDQA 5EN4A 3OECA 4CQLB 1R66A 4J91A 3IQDB 3WGOA 1UAGA 4I08A 2IEDA 4UVHA 4YAJA 2ZB8A 3FSRA 1D1TA 4DUPA 2E37A 2F1KA 4BKQA 4CLOB 4GQAA 1MXHA 3W8FA 1JW9B 3K30A 3QWAA 4FFNA 1G0OA 3TL3A 4DLLA 2D3TA 4IQ8A 3CINA 3RVDA 2CNBA 4YVFA 1BGVA 1C0KA 3ONFA 1SMKA 1IB6A 4JBIA 4ZU3A 3ZWAA 4YT4A 5IDWA 5TLSA 3PVZA 1SCUA 3UVEA 2EG9A 5U4QA 3UFXA 3H2SA 4ZD6A 2TMDA 3GAFA 2EEZA 3JQDA 4EGFA 1ZZEA 4JBGA 4O5OA 2DKNA 1KVSA 2O7SA 4NQZA 3FBGA 4II3A 1ID1A 4A7PA 4EDFA 4NBTA 2X0RA 1EBUA 1XELA 3PIDA 3D5QA 3DC2A 4Z6KA 2NQ8A 2O50A 1UZMA 1BXZA 1MA0A 3I9NA 1YH3A 4GAEA 1S6YA 5MGBA 4YACA 2GCGA 3TNLA 3H65A 3JYNA 2VQ3A 4RORA 3GGOA 9LDBA 1HDOA 2O3SA 3QQPA 4KTVE 4AJ2A 5DBFA 2EHDA 2B4TO 1X7GA 2FSSA 3MJEA 1SB9A 4ESOA 3LQFA 4DIFA 1ARZA 5COAA 1HE5A 3W4JA 4WCFA 1ORRA 1N1GA 4IIVA 4TVBA 3U49A 3HZZA 1HF3A 1P9LA 1IZ0A 4NBWA 3VPHA 4TZKA 4M89A 1I24A 1KS9A 4CM8A 1H5QA 4PVCA 4G2NA 4OQZA 4U0JA 1H6BA 2ZK7A 3WDSA 3MEQA 2EW2A 4J3FA 4NJMB 4Q39A 4L4SA 1UAYA 1OC2A 4F6LA 4XQ9A 3DOOA 1KY5A 2HJSA 3WBBA 5I8WA 1YQDA 2J5KA 2D59A 4E4YA 3AU9A 4NU6A 3RUEA 2NACA 3JQBC 2EW8A 3GVHA 5CPFA 4BNGA 3NJ8A 1MG0A 5IZ4A 2J5RA 4YT2A 3LT1A 2X1HA 4Q3DA 1VL6A 3GNSA 3GMDA 4YR9A 1B2LA 4YAIA 1MB4A 1EK5A 3AW9A 2ZB4A 3I4FA 1PGQA 3F3SA 3GN1A 4CL8A 1TEHA 4HP8A 2P5YA 4J16A 3TF5A 3WGHA 1I30A 4J0FA 3BZUA 1CJCA 3EAGA 4ZRMA 5I7SA 4TZTA 1TA4A 2Q45A 1B0AA 1FJHA 2G76A 3MOGA 5G4KA 1E3LA 4OXNA 3M1LA 3ZHXA 1EQ2A 3STHA 1CERA 1B26A 1HT0A 3PFFA 4IIUA 2DM6A 5BSEA 1C1DA 1N9GA 4ZA2A 4BNUA 5KKAA 4DYDA 4DWVA 3PWSA 1M75A 5LCXA 4QO7A 2EP5A 2Y66A 1LSJA 3FR8A 1EFKA 1B8PA 5JE8A 4B3HA 5JCJD 5L7TA 3WTBA 4DRYA 2PGLA 4A03A 3JD2A 5F3RA 3PHIA 2YDYA 4Y67A 2X4GA 3LLVA 2FR0A 1BMDA 4I5FA 3ZH2A 4P4NA 9LDTA 2B5WA 1ZH8A 1PJLA 3JQAB 1NHGA 3KO8A 5JCJA 3WJAA 4PCVA 3FHLA 2GN8A 3X2FA 2G82A 4ALMA 1M6HA 1RPNA 2JHFA 3U4IA 4NK5A 3W4KA 3ZU2A 4D3FA 4F45A 4IUYA 5KTKA 2D2IA 4B4OA 2Y1CA 4RPHA 1GPDG 1BXGB 1NASA 4YAGA 4E21A 3HN2A 2X0NA 2XXBA 2X5OA 1MV8A 3JD1A 3MJTA 4OSOA 1I3NA 3LZ6A 3L0DA 3AU8A 2VT3A 2W2KA 4EI2A 2X58A 3ITDA 3RUIA 3PJFA 3GY0A 3OIGA 3VAZA 3ZHYA 4DC0A 2Q49A 1A9YA 1EZ4A 4BNYA 3TZCA 4F6CA 3WWYA 2CZCA 3S2GA 3RKUA 2QQ5A 3VH3A 3EK2A 1R0LA 4ZQGA 3AY3A 4AFNA 4D46A 4DC1A 4BKUA 4ZQEA 4G65A 4CMCA 2WM3A 5G0SA 2C2XA 4MIEA 5HTOA 1U5CA 4CLHA 1NBOA 4IGFA 4BO0A 1Q0QA 3ZWBA 3KV3O 4NFSA 4WLOA 1JU9A 4OXKA 2VHZA 2Q1WA 3DZFA 3HE3A 5ENVA 1ADCA 2GZ2A 5T57A 4PLHA 4PLZA 4YJGB 2I3GA 4E31A 3GHHA 4EBFA 1JAXA 4KQWA 3JQ9C 1DLJA 4XDZA 4OMUA 3IKTA 3D64A 1YBVA 4EEZA 5A9SB 1U2DA 1XQ1A 2GERA 5TJ9A 4U7WA 2YHIB 1WDMA 1P74A 4W9NA 4U6SA 2O48X 3BA1A 3HDHA 3ZW8A 5KJ1A 3DBLA 1GDHA 4BO3A 1DC6A 1ZSNA 1G0NA 3H2ZA 1LU9A 1H9BA 2W98A 1D1SA 5JDCA 5AYVA 1ULSA 4NR0A 3FI9A 2NWQA 4J2HA 5KJ6A 1YVEI 3OBBA 1UXJA 3GLQA 5THQA 4ALKA 1X1EA 3MTJA 5DBGA 5TF4A 1YDEA 4CM4A 4YWJA 3F4BA 4JJFA 4QECA 4J1SA 5ER6A 3KXDA 4CV3A 2P9GA 3JTMA 1NR1A 4R69A 2GN9A 3H9QA 3O4RA 2IYPA 2PKQP 2X5KO 3GGPA 3RJ5A 5BR7A 4TRMA 4IDGA 2DTXA 1JLLA 1WP4A 5K6AA 4IXWA 2IZ1A 1P0CA 4HXYA 5DCUA 4UVDA 3LC7O 1GV0A 4LISA 1I3MA 3QRWA 3D4PA 2HU2A 2HK9A 4BNVA 4HWKA 4ZQFA 2J3HA 4HUJA 3FTPA 4J7UA 4O63O 4G81A 4W7IA 5IG2A 3FNFA 1I10A 2FZWA 5JDIA 2HRBA 1ENOA 1K2WA 2XXJA 2WYVA 1IL0A 3LU1A 3PK0A 2GYYA 2NTJA 3PQEA 3KYCB 1DJNA 3JQGA 4WOKA 2ZB7A 1XU9A 4GSLA 1DEHA 1XG5A 3FBTA 4K9DA 4EZBA 4F46A 4YAKA 5AXAA 2IYOA 1U1IA 4D0RA 3DZGA 4CQLA 4H15A 5G0TA 1A4UA 3DONA 3OA0A 4ALLA 3VH2A 1ISIA 1C0IA 3FNEA 1DFHA 3IOYA 1SEVA 4J9VA 5I7VA 1NVTA 1V3TA 3PZBA 1C0PA 2CY0A 5L4SA 4UUNA 4CLOA 4J90A 2C59A 1O89A 5IDXA 3TFQA 4NJOA 1GTMA 1NAHA 2PNFA 4BNFA 1GCUA 1EQUA 4Q3BA 4IINA 3C3XA 4XWYA 4RVHA 5CDGA 2UAGA 3NDRA 3PYLA 3PWKA 3OFSA 4M54A 3AUUA 4Z0TA 5TNXA 1PIWA 4ZQBA 3SBOA 1GQYA 4EUHA 5EL0A 4FCCA 1D8AA 2VOJA 2ZATA 2G0TA 3A14A 1YQXA 2VRCA 1IYZA 3AJRA 1HSZA 1UXHA 3GN2A 4WLVA 4D3DA 4BKRA 3OH8A 4B3IA 2Q3EA 4XYGA 1T2DA 3RI3A 3RU7A 1ONOA 3WMWA 4NZ9A 4H3VA 1U9JA 1QV7A 1XQ6A 1VRWA 1BRMA 2P4HX 4FQ8A 3PPIA 3FNHA 4DPLA 5KCZA 4J7CA 1JQBA 1UXIA 3F1KA 2AEJA 4TRNA 4UULA 4CPDA 4XIYA 1E7MA 2Q1UA 3BHIA 4QUKA 4M87A 4CJXA 3DMTA 4IQ0A 4WASA 3FWZA 3BYZA 3GR6A 4XQEA 5BT9A 3VZRA 1Q0HA 4BNZA 3C24A 1RM0A 4UEOA 4IJKA 4HY3A 1ULUA 1B8UA 1LDEA 1P1IA 1DB3A 1MUUA 3PDJA 1LUAA 3ZHZA 4AJEA 4DBVO 2QG4A 4CR8A 4BV9A 4NJMA 3E03A 1H93A 1FDTA 1HDGO 2C7GA 3MTGA 1NQAO 1O5IA 3GAZA 2A94A 3VPXA 1A7AA 2EXXA 4A5OA 2VZ8A 5COBA 3TZKA 1GQ2A 3L6EA 4AJNA 2RBEA 1SOVA 2D4AA 5CHEA 4KDFA 5K9ZA 2X22A 2PKQO 4J7XA 5CAEA 2OMEA 4QTZA 2CDBA 3L9XA 4Y6RA 1B15A 3ASVA 3F4LA 5K0ZA 2Q4EA 4FBGA 4J4HA 4CV2A 4WNIA 4U8GA 1SOWA 4QQRA 5I9NA 1ZJYA 3VDRA 3P2OA 1K6XA 1EFLA 3NEPX 4I9NA 1KYQA 3E9QA 3INTA 1NWHA 2X6TA 1ZEJA 1R16A 3G79A 2VHYA 4Y98A 2CVZA 4DIBA 4DVJA 5ER9A 4MVJD 4RO0A 5AVOA 2HK8A 3M2TA 3G3EA 1ZMTA 4ND4A 3INGA 3TWOA 4XYLA 3ADOA 3H7AA 3IP1A 4Q9NA 4YRBA 2TMGA 3GDGA 4J49A 1F17A 1DO8A 1DIBA 2R00C 2FY8A 2PLAA 4PRLA 3Q3CA 1JKIA 3ST7A 4RPGA 4CMIA 4RV9A 3H3FA 3WSWA 5L4LA 4L4XA 1Y6JA 1DDOA 3W8DA 1NFQA 3JQAD 3AFMA 4OOFA 2YQ5A 1H9AA 4RF2A 2YZ7A 4YDRA 4OO3A 1W0CA 5IAAA 4FJ2A 3I9JA 4EUEA 1HETA 2NUAA 2VYND 1XKQA 4PG7A 3DEYX 4PGFA 1KEWA 2HLPA 3FN4A 4IY1A 4AG3A 4ALIA 3JQAA 3ZNNA 1R37A 4PZCA 1I2BA 1DC5A 1DJQA 2G5CA 1LC3A 4OJNA 1OOEA 4FJ0A 4DPMA 1U4SA 3JYLA 5DT9A 1DC3A 2HSDA 4FD3A 4R01A 3V2GA 3DAPA 1BXGA 2I66A 5CDUA 1XSEA 3IC5A 4FJ1A 1P1FA 4I5EA 3QA9A 3GDFA 5EIOA 3WNQA 5HA5A 1G6KA 2I6TA 1X15A 2B69A 3VVBA 3K92A 4IMPA 3NTOA 2NU8A 3TSCA 5L51A 2PH5A 3U3XA 4MDHA 1T2CA 3KYDB 4BGVA 3R3SA 2JJYA 3FCOA 4TKLA 4XYEA 4JBHA 1LRJA 5DCWA 1WMAA 1ZEMA 3JQFC 3QVOA 1KC3A 2C2YA 3QHAA 2WJPA 2X9NA 1OMOA 3WS7A 4Q3NA 3CSDA 2E6UX 3CTMA 3PQFA 1AHIA 2BHLA 1VC2A 1LEHA 3ZNOA 1X14A 3OQ1A 3BMOB 3WIDA 5GZ3A 1O94A 1XU7A 3B6ZA 1VJ0A 3GZ4A 4FOSA 1U8FO 2PR2A 3W6ZA 2V6FA 2O7QA 2SCUA 1DAPA 1ZNQO 4DPKA 2Y0CA 2BELA 1B8VA 3FD8A 1PWZA 4YJGA 1T2FA 4JIGA 5KWEA 1LX6A 2AQIA 3PP8A 1WPQA 1UR5A 1E1KA 1H6DA 3HB4X 3O8QB 1PJBA 3L4BA 1NQ5A 1ONPA 4WUVA 5A9SA 4BO5A 2W2KB 2YHIA 1VSUA 3OEYA 3V1YA 1JWAB 2IE0A 2XOXA 4KWHA 1XLTA 4DREA 4ZVVA 3NYWA 1I5RA 4LGVA 1WLYA 4AJJA 3JYOA 4A10A 5IXSA 5JS6A 2BGKA 4IBOA 4CLDA 4AJHA 1N7GA 2Z5LA 4I1IA 3RUCA 1EUCA 2R6JA 5I7EA 4D42A 4INAA 4PLWA 1F06A 4BO8A 3WQSB 1QP8A 2I76A 1DBVO 1E7WA 2HDHA 4JJGA 3BTOA 3C85A 4IDFA 2Q2QA 2FP4A 2YV2A 4OYRA 1HZZA 1QORA 1SC6A 4BNLA 1M6WA 1GZ3A 1WNTA 3AFNA 2FPPA 1QYCA 4BKPA 5BNTA 1U3VA 5IJZA 1HDRA 1S7CA 2EV9A 2NU6A 4IJWA 1R0SA 2O2SA 1DFGA 1F0YA 3HADA 5THKA 1U4OA 3ZWOA 4MVJM 5TIIA 2JD0A 2HK7A 1M2WA 1PZEA 3GVCA 4MIYA 4WEQA 4YQZA 2J8ZA 3QY9A 4W4TA 3DZHA 2YUTA 1Q7GA 3ZWVA 2YV3A 5ICSA 4DQXA 1HXHA 4K1LA 2NVUB 5JFOA 5C5IA 1H2HA 3OJEA 4QX6A 1T26A 3DZJA 3EY4A 3JQEA 5G4LA 3ZWNA 4BO1A 4XRRA 2B4RO 1YWGO 5BSGA 3QJ5A 3S2FA 1XCBA 3ZNPA 4WCDA 2YW9A 3MWDB 1V8BA 2ZJ1A 4L76A 1J0XO 5HRUA 2GPTA 5A9TA 4FFRA 3ASUA 4GWKA 1P45A 2QIOA 3T4XA 2AQHA 2V6MA 2VHWA 1AXEA 2YDXA 1YB5A 3MOIA 3I83A 5HM8A 3G17A 3LT2A 4S1VA 4GSKA 5T6BA 1R4NB 2JKVA 2Y99A 3ANLA 1KEUA 3F6YA 4PLFA 2GLXA 1U8XX 2VTDA 3KZVA 1EUZA 3IUSA 3L6DA 5B4VA 4ZN6A 3UGKA 1NAIA 3K73O 5H82A 4IQGA 3B1KA 3MJVA 5T64A 1N2SA 2PK3A 3JSAA 2IODA 2E49A 3H5AA 5C7IO 5B1YA 3R6DA 1SNYA 5KJCA 5IF3A 5JY6A 1NQOA 1EE9A 3P5SA 3MJ4A 2BLLA 2X9VA 3JQ8B 3C7DB 4OOEA 5L53A 3WGTA 2I67A 4G5HA 1T4BA 2OFPA 2G17A 5H81A 5ITWA 3ZW9A 4YPOA 3LYLA 5JO9A 1LSOA 3JQCA 3TZ6A 4XB2A 3GA0A 4GH5A 3SLKA 3DAGA 4CQMD 2ZYDA 4OXYA 1AGNA 5FFFA 4GGOA 1E1MA 4YA6A 4BNJA 3ETGA 2YFHA 3U4HA 3NKLA 2Z95A 4K6CA 4KUGA 2VWHA 1SZJG 1V6AA 1X13A 3S2IA 5DF1A 1V35A 1HTBA 2ILTA 3PDUA 3K96A 4R5MA 1E92A 1TT7A 4NBUA 3ZWWA 4EJ6A 5DZSA 2JL1A 3PZRA 1KVRA 2EIHA 3IS3A 3KHUA 1T1SA 1EVIA 1I01A 1AUPA 1ENYA 1PGPA 1RYEA 1BDMA 2QHXA 2NVBA 4W82A 3BAZA 4KP7A 4QFCA 4R1TA 2AQ8A 4E5YA 2GUGA 1AHHA 4UEKA 3RWBA 4J6FA 3O38A 1GUZA 1BW9A 3V2HA 1ZCJA 2GDZA 3HN7A 5ENDA 3WBFA 2BI7A 3JD3A 3KLPX 4E2XA 3PHHA 1GD1O 4RPLA 4GGPA 2PTGA 3X2EA 1CQIA 1NHWA 1SB8A 5T5QA 1EVYA 4LMPA 1ISHA 2D5AA 3OIDA 3PHGA 1MC5A 4MVJE 3U9LA 4PN3A 1ZK4A 3BTUA 4Y6PA 1T24A 3WJ7A 2FOIA 2VUSA 4BNKA 3VVCA 1E1LA 1JTVA 1NFFA 3H6KA 3IL2A 1R4MB 3VHRA 1Y8QB 3I52A 1HE3A 2JAPA 3KEQA 1PTJA 4U0KA 4WK6A 3ROKA 4N5LA 3TDKA 3F5QA 1UDBA 2CD9A 2EKQA 1EUDA 4LSWA 5AQ1A 2IDZA 2HCTA 1ENZA 3EVTA 3AM3A 1EBFA 2IEBA 2IRWA 3OETA 2VNAA 2QYTA 4AJLA 2JAHA 3ROMA 4LK3A 1P0FA 3ZV3A 2I65A 1LTHR 1ZIDA 3OQ6A 4NMHA 2HUNA 1W6UA 1AN9A 5C37A 4WPGA 2EKLA 2BKAA 3WFIA 1Y9EA 1YDWA 5G0WA 1PU2A 4CMJA 4XIJA 1I3KA 2J3JA 5IZCC 3NV9A 4HADA 4ND2A 2Y1FA 2DFDA 3HDJA 4OKIA 3WG9A 4AJ1A 5BSFA 2FPGA 1YOVB 3RCBA 3SLGA 4BO9A 4I9HA 3T4EA 3I9OA 5G0VA 3GRPA 1LJ8A 5KVSA 3GVIA 1EDOA 3EZLA 4O1MA 4BIIA 2VWPA 5EJ2A 4PLYA 4BNWA 1P1KA 2GD1O 3I1JA 2CSUA 3KYDA 5A06A 3QW2A 4CMIB 2A4KA 4RL6A 4QT0A 4PG6A 1Y8RB 4L9RA 1E5LA 1GEEA 2JCYA 4CMEA 5CDTA 4NBVA 4YEDA 4D41A 3DBRB 1DAOA 2WMDA 5T8KC 4CM9D 1MP0A 5JAIA 4BO2A 1LLDA 5JC8A 1AXGA 3PJDA 4IMRA 3BMOA 1A72A 1MLDA 1TXGA 2BFMA 1G1AA 4F3YA 3RD5A 2ZCUA 4GI2A 5JAQA 1NVGA 1KOLA 3VZQA 1E7YA 1LLUA 4JQCA 3V2UA 1QG6A 3O8QA 3NJ4A 5B4TA 3V1UA 2P68A 3ZU3A 4NU5A 5LC1A 1B3BA 2DPHA 4PLTA 4E5MA 5ICMA 4WNCA 4RDIA 4GX1A 1DSSG 4QEDA 3BMQA 1CIVA 2AE2A 3WTCA 1IPEA 2YHUA 4BNTA 3ZDFA 1GPJA 2C20A 2WTBA 4BNIA 3SVTA 1I2CA 1QKIA 3UOGA 3I4CA 2HKIA 2PA3A 1ADFA 3AUSA 3TRIA 1T2EA 4XZ3A 3HQ4O 4R1NA 3WWZA 4XX0A 1OI7A 2AEMA 3SXPA 3DTTA 1P44A 4JN6B 2DUWA 3LDHA 3W8EA 5IDQA 3DL2A 1A71A 3D3WA 3PJGA 4QSMA 3PWZA 3DR3A 4W99A 1P1JA 4RF4A 4WLUA 3M1AA 4FW8A 1UP7A 4RQUA 3S55A 4WLFA 1IHXA 3IUPA 1GU7A 2EJVA 2OP0A 4E5KA 5HS4A 2FRDA 1H94A 3H9GA 1JAYA 3NGLA 4R16A 2VN8A 2W8ZA 2DLDA 4XEHA 4TQGA 1GR0A 1X7HA 1XIVA 2GF2A 4CLRB 3MJCA 1PSDA 4FFOA 1NVMB 2NVUA 3GNQA 2Q1TA 3MJSA 4J1TA 2P9CA 3I6QA 4J1NA 3AOEC 3CH6A 3DXFA 4KUHA 1PJ2A 2J5QA 3OSUA 4BQRA 3RU9A 4NH4A 2E48A 4ZHSA 4M55A 5JCXA 2DAPA 3Q0EA 3JYPA 4Z0PA 4LVUA 4FS3A 2D5CA 1E5QA 3HDYA 3KRTA 3JQ7B 5ES3A 4RZIA 1KVTA 4I5GA 2X9GA 4JGBA 1I3LA 2ZB3A 1VKOA 5JSFA 2VRBA 4GX5A 1GADO 1NQTA 4WEOA 1UJMA 5T67A 2P91A 3V5NA 3KOUA 4II2A 1E6UA 3GEGA 5DULA 5KVVA 4HX5A 4DQVA 1LBEA 3VZPA 5TT0A 2IZ0A 4MPDA 3WNVA 2I5PO 1GAEO 2Z1NA 3UN1A 3O9ZA 1R4NA 3HB5X 5F1PA 3ENNA 2CVQA 3DBVO 1QSGA 4I9UA 1XGKA 3ETDA 1I0ZA 2EWMA 2V7PA 1UXGA 3WXBA 2Q2WA 2W2LD 4CLEA 5J23A 1RJWA 4A73A 1E7SA 4YAEA 3I9KA 4XYMA 4DLBA 2ZTMA 3JQBA 1IUKA 3CPSA 3FF4A 1UP6A 3L9WA 4WE3A 3RBXA 1HLDA 1JVBA 2Q2VA 1N5DA 3DZIA 3KSZO 2BGMA 3O03A 1WAMA 2OZPA 3BHMA 3AUTA 4OGWA 1U3WA 1UDAA 2UYYA 3JQ8A 4Q3EA 1PJSA 2DTDA 4R9RA 4O6VA 1W73A 2JFFA 3DBHA 4Y9DA 2FWMX 3WGZA 2VUUA 4FFLA 3TFOA 2DBRA 4OAQA 3ITKA 6LDHA 1QYVA 1Z73A 2D0IA 4BKOA 4UVEA 3LSYA 3V8BA 3WMXA 4OM8A 3EDMA 2G1UA 2B36A 2VYVD 3PIIA 4FGSA 4XGIA 5AXBA 5JXWA 3GEMA 3VKUA 1N8KA 3H9UA 3A4VA 4XQGA 2CVOA 4B4UA 3DZKA 1HSOA 1NPDA 5DOVA 1LA2A 2J6IA 2ZKLA 1NWCA 5ITVA 4M49A 1D3AA 1CQJA 2A9FA 3UXYA 4BNHA 2J3IA 3DMYA 3I23A 4UVIA 3HNPA 4PLVA 3E8XA 2C7VA 3AY7A 3LVFO 4MKRA 1Q7BA 3EW7A 2EJWA 3OJOA 2RHRA 2CDAA 2WE7A 3U4DA 2RIRA 3I9LA 5F1KA 2Y1DA 1OBFO 1GFSA 5I8ZA 5A3JA 2IXAA 3M6IA 1WW8A 5KJEA 3RC7A 4I8XA 2Z1MA 3C1TA 1HYHA 3W4IA 3E1KA 3RC9A 3RSHA 1PZGA 1ZVMA 2OGUA 3UUWA 4W6ZA 3RUHA 3ZN2A 1C0LA 2H5LA 3T7EA 3F9IA 4ONEA 3ZU4A 4R4JA 1R4MA 4CQMB 1B16A 1DRWA 1Y8QA 5IN4A 1TVEA 5A5FA 1YJ8A 3WQQA 1HWYA 3BTSA 3NX4A 5AXDA 2A35A 4QO8A 2D1YA 4AJOA 1HE4A 2E82A 1E6WA 3NAQA 4CR6A 4GVXA 1T2AA 1LRKA 4PIVA 3CZMA 4DL9A 1BW9B 4GWGA 2PH3A 1P33A 1SBYA 5CDSA 1XHLA 3UICA 1A27A 1ZKMA 2GASA 4EW6A 3GHYA 1GZ6A 5KJFA 5A1TA 4PG4A 3LF1A 4MIOA 4OL9A 4D44A 1DC4A 2UUOA 5DDIP 1Q0LA 2NU7A 1CYDA 1LQUA 4A0SA 3GQVA 4WKGA 3JQ9A 5FI3A 2HO5A 5DP1A 1TT5A 4CMAA 1YOVA 4A27A 4P4LA 2GNAA 4D79A 2UDPA 3PLRA 3LF2A 4MJLA 4RF5A 2FHSA 5EESA 1YGYA 1FMCA 1DLIA 4YYZA 2OBNA 2EERA 2JD1A 4W7HA 4KZPA 2BF7A 1Y9AA 4MVJA 3C7CB 1GYPA 3PI7A 1Y8RA 1KY4A 3E18A 4WOJA 4CM3A 1GUYA 2ZYAA 1PR9A 5F1OA 5KOIA 1IHYA 2CF6A 3DBRA 4J1QA 3VPGA 2Y1GA 3E5MA 3OHSX 3RASA 1YRLA 4N7RA 1NNUA 3AUAA 1IY8A 4J4TA 3GK3A 1JKJA 1PJ3A 3GPDG 4AL4A 1LC0A 2FPIA 4XKJA 3DTYA 3H3JA 2DBZA 1U3UA 1QYWA 3NTRA 4Q3AA 4CV0A 2VYNA 2RH4A 2QX7A 2OO5A 1D4FA 4WECA 4HNHA 3RIHA 1MC4A 4UREA 4B8ZA 3SX2A 2JHGA 8ADHA 3R1IA 2DT5A 3FTNA 3JD0A 5TS3A 5LDHA 2PGDA 3C1AA 3ADPA 1X1TA 4CMKA 3GH3A 3GNTA 4RLHA 1YONA 1PJTA 2RHCA 1YB1A 5HS6A 4OKNA 5AXCA 3P7MA 5G0UA 1ZK1A 2I3AA 3ZV5A 1EVJA 2VZ0A 1LNQA 3NT4A 1ZO8A 3OQBA 1GZ4A 2VT2A 3GFBA 3GT0A 4KOAA 2NADA 4R3WA 4R1UA 3TOZA 4E32A 4AJIA 1N7HA 1A5ZA 1H6CA 1DPGA 1RYDA 5KVCA 4RVUA 4PLGA 3KEOA 1Z82A 4HFNA 3VPFA 4DLAA 3L4SO 3CIFA 4RCVA 3LC2O 1TLTA 1NP3A 4Z3DA 1B3RA 1DHTA 4X54A 1CDOA 1P31A 3RC2A 4RVSA 2O4CA 4HFMA 5KVQA 1I36A 4A2CA 5BNIA 4FIZA 4IDAA 4XYBA 4TSKA 2YFQA 3PTZA 2YJZA 3BMQB 3PEFA 4C4OA 2EF1A 3VTZA 4CLRA 2A92A 2Y1EA 2C54A 4E2WA 3ROQA 2OL4A 2X0JA 5C7LO 3WGGA 2OORA 1MX3A 3E9MA 2QRLA 2PD6A 4WCFC 5L40A 3O26A 1C1XB 4NG5A 3IP3A 3RQSA 4BS9A 1LDGA 3PQDA 1FF9A 4YJDA 2OXIA 5GZ1A 4YXFA 2VWGA 4RZHA 3JQ7A 4IDEA 3WGIA 5EERA 1JDJA 5DOZA 4K26A 4PG5A 3D3WB 2CFCA 1P77A 4U5QA 2C82A 4IPTA 5C3MA 4UVGA 1CEQA 4BVAA 2B37A 1QYXA 2NSDA 1ISMA 4AVYA 5BQFA 1VM6A 1DIHA 3M2PA 4E5NA 3GRKA 2HJRA 4CUKA 3OICA 5MDHA 1I32A 3N7UA 3WFJA 4CMHA 2J3KA 4TMFA 1PJ4A 1WZIA 4YT5A 2QRJA 4B8WA 4BMNA 5I9LA 2ZCVA 2VNSA 5A9RA 1TI7A 4Y6SA 1CWUA 3DOJA 3G1TA 2Q50A 3ZHBA 3KLMX 2VZ9A 1MG5A 3ZWXA 2NU9A 4CMBA 2EKPA 3K2EA 4IDCA 4BNMA 2WE8A 4AJPA 1HDXA 4IDDA 2F00A 5F5NA 3BTVA 2VWQA 2OHXA 1YE3A 5A03A 4N18A 1XA0A 3ZWPA 3OJLA 4GMGA 1R6DA 1UXKA 4E5PA 1V3VA 5TT1A 1OAAA 3CKYA 5L7WA 2DU8A 4UUPA 5DN9A 3TN7A 3FWNA 3SJ7A 1LSSA 2GZ3A 3P2YA 4GLOA 4PVDA 2PZJA 2JCXA 4ND3A 4NNJA 4D3SA 3RUAA 3R0IA 4PG8A 1CETA 2R00A 3A1NA 1UDCA 3DHNA 1LDBA 1M76A 2V6GA 1GYQA 1QLJA 4GL4A 4YQYA 1WVGA 4L75A 4LW8A 1R15A 1Y1PA 4FC7A 3DOCA 1F8GA 3Q9UA 3WGYA 4NHEA 4R5HA 2Q46A 1LRLA 4GVLA 2WWRA 4CV1A 2WD7B 1NR7A 3EGOA 4OQYA 1SEPA 2HAEA 5LDGA 1WDKA 2WSBA 3IAHA 4YT8A 4RQTA 2AG5A 4K6FA 3GOHA 1JVSA 2O3RA 3DBHB 3JD4A 4EYEA 2PGJA 3H9JA 4CUZA 2VTEA 1LXCA 1ZK0A 4UAGA 4UUMA 3RFTA 4IXTA 1E6EA 4IS3A 3QIVA 2AMFA 2AA3A 1VPDA 3TOXA 1U3TA 3VZSA 3KBOA 1T25A 5COQA 3WYEA 4RVGA 4MVJH 3C1OA 5A05A 1XR3A 4XR9A 3B20A 1Z7EA 3PGJA 4M86A 4PLPA 2Y05A 4CQMA 4FC6A 2B4QA 3EYWA 3E9NA 3ON5A 4PRKA 4B7UA 1NPYA 2B35A 3MWEB 3DFZA 4YCAA 3S1LA 3H9EO 4FFMA 4J0EA 3EMKA 1T4DA 4ILKA 3JQFA 3DAFA 2NLOA 5FF9A 1ISJA 4H16A 4BOYA 3R3JA 2VHXA 3TZQA 3U62A 3VC7A 1WWKA 4RPKA 1IOLA 3KVOA 2E4AA 4TRJA 4AICA 3Q2KA 4W9NC 1Y7TA 1ZK3A 3TL2A 4GX2A 4NBRA 3NDJA 4KQXA 1O95A 5JNLA 1E3SA 2H63A 1HYGA 5JDCC 5TSDA 4CM7A 2NV6A 1MFPA 4GX0A 3WB9A 1U7HA 3NT5A 2NVWA 1EK6A 3JV7A 1HLPA 1X7DA 1HL3A 2Y0EA 2OBYA 5A5EA 3L77A 2C5AA 3QLJA 1BG6A 2R2GA 4JLWA 4P22A 4TWRA 5I9MA 3PYXA 1IPFA 5FI5A 1QLHA 4L74A 1VKNA 1CF2O 1DIRA 2GRAA 3GZNB 2ZTVA 3ZV4A 5L95A 5K6AC 3OMLA 3I3OA 4WLNA 2GSDA 1N92A 2GO1A 1YJQA 4DQUA 4HNGA 1LDNA 2QRKA 3BXXA 1Y5RA 3OEWA 1NX6A 3F5SA 1EE2A 3FPLA 2YQ4A 1R12A 3NTQA 2P4QA 3K6JA 1C14A 3IDSA 5JDIC 4GKBA 1JKFA 3QVWA 4BNNA 2PD4A 2PKRA 2AE1A 1U5AA 2PD3A 1TT5B 1VI2A 4M1QA 4DIOA 4FR5A 4RVDA 1FDSA 2JCVA 1PGNA 4IZIA 4Z9FA 4KDEA 2CDCA 3QWHA 4IS2A 5CEEA 2VCYA 4WGGA 4Z9YA 2DBVO 2Y0DA 2Q99A 3UCEA 1RM4A 4XDYA 2VUTA 4LSMA 3DQPA 1YKFA 2Q1SA 5A02A 3WIEA 4Z3KA 3GUCA 5EQDA 3GC6A 4M8SA 1ONNA 1Z45A 3Q2IA 3HG7A 1PS9A 1HEUA 1UZNA 2JD2A 2Y1OA 3K5PA 1KVQA 3VPSA 3I6IA 4HV4A 3RAJA 1J6UA 1D7OA 1LLCA 4J4BA 4ALNA 3E48A 4AJKA 1RM5A 1TB4A 4MP6A 3PHJA 1ZMOA 5JYDA 4YB8A 1HDZA 1WZEA 3GG2A 4K28A 2AEFA 4B7CA 1PWXA 3UH1A 1PL8A 5DNAA 3TZHA 1LSUA 4RF3A 1E3IA 4RGBA 5L7YA 4CM9A 2CMDA 2IZZA 3NDIA 1IE3A 4XGKA 4R3NA 1ZJZA 4MVJP 4RDHA 1H6AA 1YB4A 1KVUA 3KYBA 2PZKA 3QWBA 4RPJA 4FPXA 1I33A 3W1VA 3PFWO 2UV8A 4XA8A 2WDZA 5JBIA 4L0QA 4E30A 3RC1A 4B7XA 5DBIA 4BB6A 1O6ZA 3GUYA 1GEGA 5DCYA 4TRRA 1VSVA 1GV1A 2HMUA 1PJCA 2VOEA 2Y93A 4PFJA 1ZSYA 1ADGA 3GMSA 3DO5A 3GVXA 1GCOA 1O8CA 1C3VA 3ZU5A 3DMTC 4OHUA
chains in the Genus database with same CATH superfamily
1LTKA 1AKQA 2JFGA 4LKRA 4HATA 1QV6A 3CLHA 6YASA 1C3LA 1ZBQA 3BF8A 1N5RA 3OX4A 4KTTE 4DTIA 5JZ9A 3UJPA 1U0SY 3JQPA 1E8NA 4AB1A 2WD8A 4YK7A 1EG2A 3CLSC 2OM2A 4U7DA 4JQSA 5AI4A 4E6PA 5DH9A 4RIIA 2P0YA 4KLCA 3Q8LA 4FSHA 2Q0QA 2O2ZA 1Z18A 3AWDA 2CN1A 3MCVA 4XD2A 2HR1A 2JBAB 3GD5A 4OQLA 2XPCA 1SHLA 1XZPA 1N7JA 3I05A 1YKGA 3NBQA 3GFGA 3PHLA 1FDUA 3WLOA 3PE4A 3ZPXA 3KNZA 1MVNA 4FB5A 2P2NA 2YVQA 3D6JA 1FEZA 1P4SA 4RSHA 1AUOA 1AUXA 4IJVA 4YJFB 4UZFA 2NAPA 1WXWA 4LAFA 1LPPA 1Z16A 3FVVA 2BJWA 1Z35A 4ZJUA 1HX7A 3LHIA 3C3KA 2C3MA 4YX9A 1EX7A 1UOEA 1ZC3A 4L4ZA 1W0KA 3PC6A 3E7FA 5DIFA 4C0AC 3OM0A 4HOYA 2R1VB 2ZB2A 1GXSB 4NPCA 2AWOA 4MKGA 5AK4A 5GONA 3M81A 3X43A 2NW6A 2JZOA 2QYHA 3E9RA 1T0HB 1VGRA 5TQJA 3AR9A 4DA9A 4ARZA 5JMWA 4N3NA 4PBTA 4R9UC 5LA6F 2PU7A 2CXSA 4X45A 1OZAA 4L28A 4BMYA 1KI6A 1IOVA 2QI9C 2B83A 5JRJA 4MYRA 1YL5A 3KDAA 3PFHA 4IHJF 4GM4A 3HB0A 4P3XA 3IVMA 4PLCA 3CNEA 4R1OA 1NTOA 2RHHA 4G0XA 5DTIA 3ZIAD 4A8JB 3RYCA 4ZZ3A 5C51B 1XCPA 2GCPA 1P80A 5HJ7A 3K9BA 2XAAA 3ZJVA 4DBZA 3H13A 3WYBA 2CLIB 2QSUA 1DADA 3UW1A 5KTNA 5JS7A 2C5EA 3ONEA 3ZGYA 1DTSA 1ZJ4A 2I34A 2AQKA 1Y9DA 4F96A 1JXOA 5FEUA 1XZNA 1ZK2A 5JASA 1U63A 4DV2B 2XLBA 1FIUA 2IOFK 3T3OA 4XPZA 2Q5QA 4NZMA 1FP7A 3P97A 3BGWA 4ARAA 1CB7A 5ILGA 2YXBA 5EYPA 1G8PA 2PO5A 3NTLA 1Z6AA 4L16A 3P0EA 3G9ZA 3Q40A 4YJ3F 4Q3KA 1KDZA 3A58B 2XUOA 3HPQA 3VM6A 3D8BA 1HYEA 2D8MA 4Y7CA 2O54A 1XTJA 2GJ9A 4FOOA 2XHEA 1GAJA 2DFVA 3OZGA 4KAFA 4UUQA 4YP5A 4KXXA 1FDVA 1BHSA 3AM4A 5H4GA 3UXMA 2I87A 3RHTA 3WIVA 3HCAA 1CIPA 5JJIA 4ZFNA 1E0JA 2OUIA 2VT6A 4DYVA 1PDOA 3C3PA 2PX2A 2ATEA 3DLBA 1J5PA 4NLLA 3C7AA 4BGUA 4CETA 4LYYA 1A7UA 5I7UA 5JC1A 1P91A 1ODIA 4TS1A 4CR7A 4KWIA 4AY2A 4TKMA 4MVJI 5TGDA 3I58A 1BIFA 1WS6A 2WR8A 2XE4A 1I1HA 3ICPA 3D5TA 4QXQA 4RH3A 1M6NA 4BFXA 4A0FA 4DSTA 5JY1A 1DI0A 4LJ8A 1NVDA 3SZRA 1IM2A 2YZGA 2Q8PA 4FZVA 4ID9A 2YMQA 2XNDA 4YTEA 2JLQA 3GJTA 2WYWA 1LDYA 5LYJA 4A0RA 1Y4AE 1YQQA 2C5FA 4WKCA 1I6LA 4NV3A 4YAOA 4KWTA 4BVGA 5AVYA 1M66A 1KSGA 4WW0A 1H69A 5AM5A 4D7AA 2I3BA 3MWEA 1PS0A 1IXZA 4JCOA 5IJ0A 1PX0A 1S3GA 4NOKA 1SN7A 1P9NA 4WZAB 5G3YA 4AS2A 4FYPA 2L18A 4E88A 4RY8A 5IKEA 1XKXA 4Q48A 1GNSA 3HN6A 5JSZB 2BEUB 4LF9B 5HZMA 3CRQA 4AQ7A 5K51A 3PXXA 4IIJA 3RIGA 2FSVA 5C4GB 1L5LA 3WLEA 1WLSA 5KWJA 3H11B 3I9FA 2HU8A 5K0GA 3KP1A 4UPEA 4C0JA 4L22A 3PVCA 1J4AA 5KYUB 3GIWA 1YXMA 3DE5X 3A31A 1PF7E 2ERYA 5HZHA 2HA3A 1L5HA 3BMCB 4ZI7A 4LCJA 4L4RA 2P9EA 2LNDA 4R0NA 3S5UA 5CT4A 1DBQA 2R8PA 3KUXA 1R6AA 1WOYA 2QX9A 3L07A 1MJ5A 4ZU6X 5KIAA 5LQDA 4EEXA 2OKCA 2G4LA 4L5BA 1PL6A 4Q19A 2IYQA 4DG8A 1GNLA 3K8ZA 1R6UA 2II6A 4GRDA 3PNYA 4N5NA 5B58C 4II7A 2VDQB 3BREA 3PFIA 2XD9A 3SG0A 3ZZUA 3OY7A 4EZIA 2YV4A 4JP2A 4BQSA 5BSHA 1E2NA 4QAQA 3IEXA 3BHJA 4EMTA 5JJLA 3AZQA 4Y8VA 3CLSD 4WLEA 4CM1A 1HZZC 3Q11A 4CGZA 4XFJA 1PR0A 1PGJA 2JGAA 4L07A 2PIAA 3CURA 4QBGB 5GPBA 4CM6A 2PXHA 1KU6A 2ZU6A 2WYUA 2FSHA 2V7GA 3N2YA 4BBZA 4F9FA 1P17A 2QM8A 3X44A 5BVGB 3VO2A 1VCIA 5CK4A 3MBOA 4I4LA 4ZXFA 3F47A 3STTA 3ROPA 2JI8A 1UKYA 4N9WA 2O6HA 4KQKA 4HXEB 4EITA 3OZAA 2OGWA 1EVKA 2TSYB 1RXWA 1KMNA 4RTRA 2PUVA 1B14A 1KZ9A 1WQ3A 4RHEA 5ECDA 3JQ6A 4DMHA 3P2IA 4WXYB 5AHXA 2IXBA 2Y0BA 7ABPA 4NMLA 3CH7A 3RTBA 3HCWA 2GEBA 1N3BA 3IMFA 1MRSA 1IBLB 2V8OA 5K8CA 1G38A 5YASA 4LEIA 4CEIA 3ZQKA 3RS2A 2VTBA 1RWMA 3C5CA 4JLVA 1DDIA 1TGVA 3SE7A 3AVQA 5ADVA 3E9ZA 3T7AA 2JGNA 3P9SA 3BIXA 2FPMA 4D25A 3OKCA 5K0NA 4I46A 2Q7OE 4D2IA 3N58A 4Y18A 1R5OA 3CCBA 1CY2A 1XWFA 2YOHA 3EHEA 1U28A 4HLUC 4LGYA 2RI0A 1V4BA 4JP3A 1GPBA 1GFZA 1H8EA 1V8DA 3PYMA 1DRVA 3LG2A 3HY6A 3OWXA 5JVDB 1QIKA 3AEZA 3L0SA 4D99A 2R68A 5F23A 2Z3ZA 1JAHA 3DHEA 4F2WA 1OZGA 3OF5A 5ALVA 2V6BA 1NM5A 4LN1A 4EHAA 2FQXA 4RKQA 3RVOA 4NFHA 1C7QA 3GZJA 5FJJA 2ODWA 5KQGA 5BSWA 1PFQA 2C5GA 5DN6D 1TX4B 5TQVA 1Y98A 4TQ9A 1RLUA 4Y2XA 5D3QA 3HKDB 4A2QA 3THXB 1AKVA 1P2SA 3UAZA 3IQIX 4Q3CA 5IT0A 4YCLA 3ZDAA 5IVIA 3TMAA 3A6JA 3MM4A 5DNDA 6PFKA 1LI4A 1VA4A 4AG5A 1G2PA 1O9BA 2AZTA 3RRYA 2MU1A 2ERCA 1DOHA 1EMDA 4EG8A 2PY6A 5A3VA 1XTUA 1M5RA 2IK8A 1DRUA 1VB3A 1UZLA 3VTZA 1JJFA 1SIUA 1Z6ZA 3PLNA 3RW9A 2H1SA 1SQSA 1ZRSA 2B99A 1AK9A 1FU8A 3BD6A 4HEQA 4KN5A 4OHPA 5BWBA 5M34A 4DV4B 3O8OA 3M6UA 3SSOA 3GEDA 4UE3S 1K68A 4DKXA 4EI8A 1RTKA 1YFZA 2Y67A 2AW5A 3PVSA 3N6XA 4HLNA 4NECA 4OXXA 5ALIA 5J5AA 3V3KA 3FPFA 1NOKA 3W1WA 3KJIA 5CTJA 1NW7A 3K9FC 3CMCO 3MAGA 3TLZA 3TBHA 1NYTA 3HYLA 4NAHA 2B4YA 3H9CA 3IPYA 5REQA 3IPLA 1MO3A 3TAUA 1W4ZA 1UPXA 2QVYX 4K6HA 5FNZA 3K31A 5G4KB 4KHZA 1UK8A 3HDQA 1N5LA 1F14A 1E77A 2HL6A 4H7KA 3ND6A 3KVNA 1C1DB 4HHEA 4AP6A 4Z0HO 4BC0A 1V9LA 1UBFA 2FK7A 5TJHA 3F1LA 1HQDA 1AQNA 3B12A 4XWOA 2PKWA 2Q9CA 3BX1A 1L5NA 3RFVA 1MC8A 5DWQA 4YLYA 3G5MA 1G20E 4C7OB 2XYGA 1GL3A 2ZSBA 1QQ7A 5DMHA 1ZRHA 5DMXA 4X65B 4YBZA 3EN0A 4HX2A 3I5MA 1X39A 3TQCA 2ES4A 3PFCA 1SO8A 1UMCB 2PZLA 2MSNA 4L3WA 1H1LA 2WNIA 3TXXA 3TKLA 1K7SN 5LMUB 1PGOA 3SYKA 2UYGA 5ETJA 4OX9B 2GZSA 3H8VA 1ZICA 3X1ZA 1J90A 1GQQA 3CTPA 2H5IA 2QXYA 4GR9A 4EGCB 4Z7JA 1U2GA 3OJ0A 4R7ZA 2OA0A 4P80A 3WDLA 2FJUA 3R7NA 3RF7A 1P29A 2E6KA 1Z7BA 4DIEA 2GH1A 3ENKA 3BF7A 1W4CA 5LNK1 3HGTA 4FMDF 4K86A 3FUUA 3C8UA 1Y81A 3OP4A 2M6LA 3R75A 4B2IA 1O9GA 1A96A 2CL5A 1WMEA 1VPLA 2SICE 4G63A 2WM2A 3KQOA 4N3GA 5B12A 3IBYA 5FYDA 5EJ9A 2F4VB 4IZHA 3O95A 5BNFA 2A5GA 3RRXA 1OX4B 1K63A 3GOQA 4R68A 3OUTA 2WF5A 3O7MA 4XGNA 3OEEA 4RFSB 3HFGA 2HF8A 6REQB 2HNBA 4EHNA 2C7PA 1A4IA 1A9RA 3C45A 3ABOB 1MVOA 2L17A 4ROSA 4RHYA 2DF8A 1BDIA 1A97A 2WYIA 3KJNA 1FDWA 3BH6A 1P6UA 1GNTA 4OYLA 2PUEA 1UBTS 2DUJA 1G291 5TVGA 5M2QA 1PR3A 4G5SA 4UE2A 3I32A 3OTIA 4ABYA 3OUZA 1B6SA 3PR1A 1G17A 2W90A 2GN4A 4URFA 3UB4A 2WB4A 1B7GO 1NZJA 3ANNA 4RELA 4UUOA 5NULA 2E1RA 3HEBA 4G8CA 3AVUA 1FUIA 5K8LA 4RHFA 1AK2A 2YFKA 2P78A 4G8BA 3NHFA 3SC4A 3H5LA 4PSKA 3GDOA 3N0RA 3ENVA 4QDTA 5DBHX 3LY9A 2Z8YA 1FU7A 3KZKA 4N9QA 1FK8A 1IUNA 1AURA 1GYRA 2H4XA 2G77B 5A7HA 2VKQA 4HRXA 3QXJA 3RAPR 4UXIA 1BTOA 3C8ZA 3B1JA 5GONB 3ZV6A 1N1EA 2QXTA 2GM3A 4YCDA 1KP3A 5DU2A 2G6TA 3RUDA 2CXHA 2I7CA 2I7DA 1GY8A 2NZ8A 3N0XA 5K8UA 4V0NA 4RIFA 1AMOA 4S3MA 4CCYB 2HBRA 1XZDA 1QHIA 3T4UA 1Z29A 2BN4A 2DLCX 1G3UA 4KE8A 3RROA 1FTNA 2WDPA 3PKJA 1YL7A 4W1SA 3B70A 2CNWD 3WLJA 2APJA 2WWXA 3L82B 1QIIA 3QX7A 1K6EA 4H0CA 2CXXA 5FFNA 3KYCA 2WICA 1Q3HA 5K4HA 1CRWG 3AL2A 4BNXA 5EJ4A 1UBEA 3OFVA 4YI3A 4I3HA 3ZY3A 3VKVA 4BMVA 3TGLA 3I01A 3C6QA 5DLQC 4GWLA 4N5IX 1J49A 1FQOA 4FLEA 1FXUA 2RJOA 3BWYA 4PHHA 4PF1A 4WDRA 1L7AA 2AHRA 1E1CA 1ZW1A 3GRAA 3ONDA 2XWQA 2CKMA 2F17A 3KKEA 4L2IB 1JQKA 4DM3A 1E99A 2C00A 3W8RA 2QSYA 4EPYA 3W3ZB 4W63A 4B6SA 5M04A 4CTMA 1CNFA 1RU3A 3CA8A 3EEFA 4OLJA 1R8YA 4Y1RB 3GX1A 2V8BA 1YAHA 4PE5B 5KOYA 3FYHA 2VZLA 5C7OO 3HWWA 3AHGA 4LGCA 3VDNB 1DEKA 4BHTA 3IV6A 1WXFA 3PUIA 2ZIXA 3Q7SA 4J0CA 4ZREA 2O3UA 4TTTS 3IIIA 4NICA 4HTFA 5AH0A 1JA0A 2ONZA 2P79A 5CP8A 3INNA 4J76A 2VPYA 4U7FA 4F9GA 3QE3A 5GZ6A 1ZC4A 3PQ3A 1VKJA 2HMWA 2X0IA 1OFGA 4JVMA 1I13A 5JW6A 5CRIA 3WRYA 4DILA 1JHDA 4N0QA 3N8IA 4D9KA 2V9PA 4DCNA 4Y6LA 3EEOA 1D4ZA 2NTNA 1QAOA 2RHTA 3SGLA 2Y77A 1F51E 3CUWA 1VJ1A 1OZ0A 2FZCA 4BL5A 4LZWA 1V8OA 1E0DA 2O3TA 1EWVA 1VSBA 1Q1GA 3QITA 3ETCA 4H27A 5CFPA 1OWLA 3OECA 4CQLB 1WXXA 3IQDB 3CNLA 3KUUA 3MCUA 3RS5A 2JI4A 3OJWA 2XRZA 5IAGA 1P73A 2Z9CA 4UVHA 4YAJA 4I4TA 1XZCA 2MSKA 3S2UA 3U81A 1KYIA 5FTKA 5LVAA 4YFYA 1JW9B 1GRRA 3K30A 3F8SA 1FP6A 2F6RA 2JFYA 4KR6A 4P84A 1IQ0A 1XALA 1PWEA 5L3QA 1M7GA 3ONFA 1IB6A 4J0HA 4O2BA 1KMHA 2C8KA 2NSJA 3DOFA 3QKTA 3LL7A 3PVZA 1SCUA 3QVUA 4IILA 4KQIA 3UFXA 3GLGB 1DMRA 1I4DD 1VIDA 1X80B 1NLFA 3CUYA 3CVYA 3O8LA 4HWRA 3W5BA 2DKNA 4XGQA 4NQZA 2I22A 2CXRA 4MCIA 2I03A 3OAAD 5JAOA 4RTSA 2QUIA 2G9ZA 3FMOB 4NBNA 4A7PA 3FCEA 4NBTA 1LPOA 2J0QA 1XA3A 2RGNA 3PIDA 5T41A 4Z6KA 4P7FA 2NQ8A 1LBSA 2YJNA 1Y37A 3AJ9A 1P8JA 2O50A 2Q5CA 3IAS1 2WSYB 1BXZA 3DVQX 2JW5A 3KT3A 4LIPD 3I9NA 3SI7A 1PYDA 3KD2A 1S6YA 4MSUA 1EFRD 1ESZA 1PFKA 1RWOA 4Q7KA 4C3OB 3H65A 2BMWA 2IBMA 5D00A 4IUDS 2O3SA 1T3SA 2QMZA 5DBFA 4AAYA 3ORSA 2AFRA 2EG5A 1UC5B 1CVLA 1T8UA 3AEKB 2GMWA 3BOSA 3R5KA 2FSSA 4NCNA 1SB9A 3QBJA 3TMKA 3PX3A 5CK5A 5JG7A 4DIFA 4DWOA 1ARZA 5HCUA 2Q3FA 1Z13A 3G9XA 2ODEA 4BJ6A 4M22A 4L0CA 4BQQA 4RTMA 4IIVA 3SYTA 3DMFA 2QY6A 5JLJA 1UPUA 4YY3B 1P9LA 3PSAA 5CA0A 2GDJA 3LDGA 3P27A 2OV2A 3H2HA 2VSOA 1M34B 1XCJA 4HDCA 4M89A 2OWDA 3DGEC 3ZOZA 4Q4AA 1IAQA 4OQZA 4U0JA 2QSZA 2ZK7A 3WDSA 1C30A 1INLA 2BF4A 2ADFA 4J3FA 1T34A 4Q39A 4B6EA 3HY4A 2GBFA 2I4LA 4GEGA 4GBMA 1GNQA 3OU2A 3OZTA 4XQ9A 4H35A 4BUZA 2PMKA 1RQXA 3K6RA 2V3WA 4G0YA 1ZVJA 3A6PC 1IN8A 1QQTA 2J5KA 1NVXQ 1ZI9A 5CNIA 3RUEA 3L93A 4M6WB 2ZE6A 2WC1A 3V8NA 1JDBC 1MG0A 1BMQA 2GYVA 4KGVA 4D56A 1OTYA 2BSAA 4YT2A 1PV4A 1NIPA 2PJZA 3B82A 3EGDA 4F8YA 4KLRA 4QNNA 3RU2A 3GNSA 4Q05A 2QN8A 3F0TA 3PRHA 4LZPA 3EG9A 4CVNA 1NBMD 1PFYA 3N3BC 2ZB4A 3R7SA 2DYKA 1U5BA 3F3SA 1HOTA 1RAHA 3JAMA 4ARIA 2NUPB 2FMFA 3EARA 2CBGA 3OOJA 2I2FA 4CL8A 1YHNA 2P5YA 5FOXA 5DCLA 3O31A 4MJ7A 3ER9A 3BZUA 1CJCA 1JPJA 1ZJ6A 1T9BA 4YMUA 3HCPA 3K0CA 2MYUA 1P8AA 1FJHA 5KKNB 2IS4A 1MJGM 2G5TA 3EE6A 3NEYA 3ZHXA 4ZODA 4K8OA 3STHA 1CERA 3PFFA 2DM6A 5AJHA 3RSQA 5FL7D 4N01A 2XXAA 3K5HA 1OBCA 3PWSA 2ODPA 4IQ4A 2Z0MA 3T61A 2ODAA 1IN6A 4QO7A 5BRAA 1XZ8A 2BHNA 2FA9A 4KMOA 1BWPA 1B8PA 1GKLA 1WXQA 4XUDA 1B23P 1L5OA 1F38A 4KPUB 4PC2A 5IM4A 3I1FA 2CMGA 2J3QA 2BC9A 3JD2A 3KT8A 2IBTA 2BBWA 1XZKA 3FPHA 4Y67A 1JZSA 3HGMA 2XX3A 3KCNA 1ZD1A 1BMDA 3ZH2A 3EVCA 3KCQA 1FL9A 9LDTA 5HKOA 9MHTA 2BI4A 1IBKB 3JQAB 1NHGA 1T0BA 2HLDA 3KO8A 3LNCA 4TXLA 4X1IB 3LBFA 4XWGA 2QL6A 2J9RA 3I8XA 3X2FA 3O3CA 5BT8A 1G9SA 5MFPA 2EKDA 1N2XA 2JHFA 3ICWA 3GUVA 3L1VA 4NK5A 3S70A 3W4KA 1LV7A 3ZU2A 3RAEC 1FFDA 3JPYA 1FTGA 3E0QA 1BXGB 1IDN1 5EQTA 4E21A 1CS4C 1VHJA 1XFDA 4KVAA 2XXBA 4IDQA 3IE0A 3IODA 4J0KA 4XTRA 3WYAA 2AF4C 4IYRA 1ODFA 3OOWA 3M4JA 4FHDA 3DMDA 3KVRA 1E66A 3JYHA 3P94A 1I3NA 3NATA 3GEEA 1MO6A 1BD3A 2FPWA 2WTMA 2KSQA 3A05A 2LCIA 1VE5A 2VT3A 3D7RA 4TUYA 1QGZA 2J59A 1KK0A 3ITDA 2UZ4A 1AK1A 3RUIA 4R9NA 1NQWA 3DEAA 2FG7C 2H2GA 1PEAA 2ZRPA 2ZI5A 2ZSEA 1A9YA 1IONA 1E6CA 4ZO4A 3M70A 1PJ8A 3OKPA 3TZCA 5JNRA 1ULZA 1YCGA 3GAMA 4OG2A 1J07A 5FBQB 1U0EA 3DV0B 2X3UA 2PMWB 5HIIA 3DVLA 5LB2A 4ZQGA 2R1UA 5A3SA 3VH3A 4D46A 4DUYB 3F71A 5HF6A 5EUQB 4FFWA 3AETA 5G0SA 1N25A 2C2XA 4MIEA 1VE3A 1X3SA 4FI3F 1TFRA 4IGFA 2G07A 1ZNZA 2VSFA 3CVWA 3ZX5A 1FX1A 1RBYA 4QJ4A 4LJ5A 3QF4B 4WLOA 2JJQA 5KNCD 4MDFA 2F1JA 1ND6A 2Q1WA 2GD2A 3HE3A 1QTRA 1Q6YA 5ENVA 2SCUB 2GZ2A 3SAJA 3F6SA 3WJ1A 2VDLB 2VHQA 4PLZA 5JATA 4FDTA 4JKIA 2I3GA 2AJTA 2V97A 3AJAA 3OOSA 4YJKA 4BV3A 2EFCB 2AI2A 4PYRA 4E31A 4IVNA 1L1RA 3JQ9C 3AHIA 3RYFA 3IKTA 3D64A 4RMIA 1CXZA 5CB0A 3UT5A 3OD1A 3KKMA 5A9SB 2PWYA 2ST1A 4EOGA 1F5SA 1SUFA 1XNRB 1FRQA 2FB9A 1WDMA 2JLBA 4NAUA 2O48X 2DHRA 2VYCA 3LXRA 3QMWA 1ZM3A 5A4IS 4DLZA 3EIUA 3MRVA 3CH4B 2ZUVA 3H2ZA 3PNVA 4KQ2A 1H9BA 1COWD 2W98A 2ZVQX 4WT7A 3R7FA 4E4TA 5JDCA 3REGA 1QDEA 4NS4A 3FI9A 4WRRA 1OH7A 3NHPA 1YVEI 2A86A 5THQA 2Q4RA 2RD2A 2A5LA 3CUEF 1DP4A 2XUHA 3FFTA 5CVCA 5DBGA 1QHFA 5TF4A 2JLWA 1YDEA 4UTOA 1EUCB 1PKXA 1KO8A 4JJFA 3IBTA 3WGKA 5BUQA 3HJHA 3KXDA 1YJAA 1BFUA 2P9GA 2V55B 2YN4A 2GA8A 3ZIAA 4EY7A 2J6HA 5CT8A 2QR3A 2VDOB 2WMNB 1N32B 1GLNA 4PC6A 3GGPA 4UNRA 1QF6A 3F78A 4AKGA 5BR7A 1GCAA 3DOUA 2J4FA 4IDGA 4L72A 2DTXA 2ETVA 3K0SA 1SVOA 3A1WA 1RIFA 2HEIA 4KO1S 2IZ1A 4UVDA 3LC7O 1GV0A 1IHUA 3ZE0B 5BNZA 3RPEA 1CUEA 2A84A 2IPOA 4G1MB 3HACA 3LP8A 2GKOA 1CSEE 1SXHA 1D07A 1RLIA 4G81A 4Z53A 3TLEA 1EFAA 1V71A 4CI9A 3T5PA 4FYKA 3ZCQA 2ZKIA 3DR5A 2O59A 2HXSA 1PG5A 1K2WA 4WDQA 4QICA 4UD6A 2BKXA 1QO0A 4MR7B 2B6NA 4IJQA 3T34A 5GONF 5EWMA 4Q02A 4B4DA 3C16C 3AF0A 3KYCB 1DJNA 1WV0A 3JQGA 1YUMA 4HLDA 4DUGA 4M53A 2WUWE 4Y1FA 3KB2A 4LY0A 3SVLA 1XG5A 4C4ZA 5AXAA 1D0IA 1U1IA 5DVZA 2X42A 3DZGA 3EAFA 4K0KB 3DONA 2QRHA 2V7VA 3NM5A 3FOFC 4ALLA 1XI2A 1ISIA 1E62A 1FC0A 1KO5A 1K1EA 1ELOA 3CH5A 2JIZA 3IOYA 3TIVA 4J9VA 1JALA 1F2UA 5HIJA 2WLSA 5EIBC 5J4LA 2PUDA 1C0PA 3QXSA 1DUSA 1XYVA 1GZUA 4OQQA 3D7NA 3TLCA 2FTKE 4UARA 2B8NA 1QH8A 2CNOA 1O89A 1R4ZA 4YP1A 1VCOA 2NPIA 4H18A 5IDXA 5IEJA 4LY9A 5KYYA 3HRHA 1SIWA 3GYGA 2W83A 4PYKA 2UXCB 2I1WA 1BHQ1 4KQJA 4Q4DA 5F76A 4MLZA 4Q3BA 3G13A 3IH5A 4XWYA 2P75A 2H1IA 4KPYA 1WEKA 3VKHA 2V9ZA 4ZVUA 1KYVA 2VQDA 3G23A 3PYLA 3W79A 3PWKA 4YRQA 3AUUA 4LXYA 5TNXA 1TZMA 1X87A 1W93A 2C2KA 1W35A 3DUWA 4ZQBA 3UPDA 3HJUA 3BB4A 3MNFA 1FSPA 5EL0A 2HF2A 2H5EA 1CRQA 2ZRDA 5I3ZA 3L8FA 3VHXA 1KARA 2EZUA 3LUDA 2Q1YA 3AJRA 4DMUB 4NOMA 3S4YA 1BVHA 3PNQA 5HF5A 2Q9UA 4WLVA 3GN2A 3DF9A 3F9RA 1Q11A 1Q92A 4H17A 3TLGA 2C4UA 2VAWA 2NNWB 3FLMA 4Q7MB 3FM9A 3AL3A 3ZY4A 4QJ3A 3WMWA 3UHPA 3OU7A 4B81A 2ZTHA 3R3XA 1WCIA 1WY5A 3N8GA 5DLDA 3PCTA 2O52A 3RSZA 3I1IA 1IN1A 4YALA 3VQTA 1IUPA 4NCBA 4FQ8A 3NBMA 4YDSA 3FNHA 1T6YA 3F1KA 4D5EA 4H4EA 4LE2A 4AP9A 2R4QA 1A0OA 3HLYA 3FHOA 4Q1EA 4PZ0A 4V0RA 3BHIA 4G86A 3DG9A 4ZPXA 5BT9A 5LZ2A 3BYZA 4XQEA 4RADA 4MMYB 3VZRA 2FQYA 4A5SA 5LQNA 5L6LB 4E3WA 1D1PA 1RM0A 1TVCA 3ZI7A 2V4UA 2XBUA 1PK7A 1U3GA 2VXCA 4C0WA 1SCUB 5HSGA 5JHGB 1B8UA 4GVPA 4MGZR 2MSDB 4LQDA 5ESWA 3IEUA 5FHQA 4QBKA 8OHMA 1MUUA 1P75A 1SD2A 4EO7A 1D6JA 2GEKA 3KDSE 3B1VA 3UAOA 1SFRA 1GGVA 1QF7A 2XA1A 2YIMA 1NQAO 1O5IA 3H4IA 3GAZA 4RENA 2OV3A 3V34A 3VPXA 1ZDMA 1A7AA 1J7KA 2CUNA 4IIJF 1CZUA 5H9VA 2JA2A 3TZKA 5JD6A 5LSAA 2EZTA 4HRYA 2JIQA 5C2JB 2O8CB 2VO1A 1Z7GA 2PKQO 2OMEA 3VU1A 2CDBA 3L9XA 4ZI7F 5ITZA 5SZHB 3O2NA 3QFCA 4CV2A 1WCV1 1ZGBA 4U8GA 1SOWA 4WNIA 4QQRA 2QTVB 3T9FA 2RG7A 3WGJA 5I9NA 3VDRA 5EVJA 4E11A 1IBRA 1K6XA 1KYTA 2ZSFA 3H9BA 5DGTA 2HTFA 1N75A 3HI6A 3W34A 3DF7A 3DKKA 3HU3A 2J7PD 3R3YA 3NEPX 4Q16A 4PGGA 4I9NA 4QFMA 5FBRB 5IXJA 4HVTA 4RCZA 3CVVA 3HUEA 4L9AA 1NWHA 2P2DA 3HJNA 4W5WA 1THMA 2IYWA 1NLUA 3UKDA 2H85A 1IPHA 3I34X 4ZTBA 4G97A 4TMWA 3EOZA 4MNTA 2HK8A 5AVOA 3M2TA 3AEQB 5CA0B 5H68A 3JQRA 3DTVB 3Q3GE 4Q9NA 1Z2DA 1TMGE 4IFBA 2ZWAA 5IX8A 1SG0A 4JSTA 1OGJA 3NKVA 4JA0A 1YRAA 4X94A 4EB6B 1IXYA 1F17A 1C30B 2PLAA 1JKIA 4H08A 2UUAB 3CNBA 4QUIA 1ZD2P 3N8DA 4G8JA 4OHRA 4JLJA 2HADA 2IW3A 1G8FA 1TIBA 4L4XA 3I61A 2QV0A 3JQAD 3Q3HA 4TTRA 3LP6A 4OOFA 2X13A 2ZRGA 1H9AA 4LV5B 5HIKA 1MTZA 4F3KA 4RF2A 1SUDA 5DN6A 2Q6OA 4W8HA 2R96A 2PSFA 1HETA 4JFRA 1KMMA 1XKQA 3R44A 4PGFA 2P6MA 5J47A 2EFJA 2QRQA 1JJBA 3FN4A 3G9TA 4NATA 4AG3A 1JAZA 1XZHA 3GEPA 3NHJA 3P9KA 2W2QA 4TV9A 1JXQA 3CONA 3AP2A 2PM8A 3FFAA 3MSXA 3R41A 1ZIOA 4K9NA 5JH7A 5KOJB 3S8YA 4EVSA 4QZVA 1PVVA 2X14A 3EQ2A 4Z8YA 1ZH2A 1R9NA 4FD3A 5FWXA 3DAPA 4FYYA 2WZQA 1M2OB 1XSEA 4R1PA 2H2AA 3Q41A 6NULA 3CNOA 5I48A 2ZR8A 3CM0A 1DVRA 1CJKC 1J23A 1EM8A 2XUDA 1QQBA 2BFWA 4RH1A 4TSFD 1H23A 5HA5A 5ULLA 3WNQA 3B89A 3A36A 1O5TA 2O0MA 2ZRJA 4GC9A 3VVBA 1JQLB 2OZLB 2QBYB 3STUA 3GJRA 5ALKA 2RGGA 3TSCA 4HS9A 1SZDA 5L51A 1OT5A 1R0YA 3ONNA 4U2DA 4BGVA 4KKXB 2DFTA 3M3DA 2J45A 1NG9A 1IXRC 1KRHA 5E6RB 3H18A 5C4IA 1JQ5A 1DO0A 2B8JA 2W6JA 4JBHA 2HJVA 3BFJA 5DCWA 3L04A 2L82A 1YE8A 2BFDB 4Q3NA 2Q2OA 1KH3A 2QZJA 3CSDA 1XO1A 3NTUA 3PQFA 1AHIA 3V33A 4Z1MD 1VC2A 2VP3A 1WVMA 4C7MA 1LEHA 4HS4A 2VJBA 2YXLA 4NZNA 2X1MA 1XU7A 4QYSA 1U8FO 2AZDA 4PRYA 1DAPA 1ZNQO 2ECFA 2O7QA 2V6FA 4QGHA 4HH4A 3LYAA 4DPKA 1GPMA 3OQNA 4YJGA 2GEJA 3WE7A 2OO3A 4DGQA 4JIGA 1E69A 1CY7A 2IXFA 3TE7A 5KWEA 2OEPA 4GRIA 3PP8A 2W0SA 3R7WB 3L4KA 5BRJA 4MR8B 3C14C 3AJDA 1PJBA 2WJJA 1NQ5A 2QQ0A 1E59A 2JIMA 2YWEA 3TTYA 4WKBA 3PL1A 4G5XA 1U8TA 3LYUA 1VSUA 3LQQA 3SR0A 3V1YA 4FM9A 3F8WA 3UJ9A 3COVA 1A95A 2ZIGA 1NATA 5B7NA 4DREA 2FW1A 3A4YA 3NYWA 1I5RA 5JXGA 3U6BA 5IT9A 4H7IA 5IXSA 4D4IA 2J67A 2OK8A 2Q6KA 3KHTA 2HU7A 2OCBA 3GLIA 4AO6A 2J9ZB 4JHXA 2D1FA 4B84A 3PUZA 4WN3A 3AETB 1DT5A 3QV2A 3NLLA 4FXPA 2LBPA 1G8MA 2FPRA 3I2FA 2X8BA 2C9DA 3TBFA 1GLVA 2NYUA 2R60A 3JAWA 5CJJA 2V98A 2BGNA 2WA1A 1VA5A 5AVKA 2XUGA 4UXJA 3O1LA 2BFFB 1IK4A 1R5NA 2QZPA 2HA7A 4UDXX 2ATIA 1M72A 1NLMA 2BTOA 1ZP6A 3MMPA 4IDFA 1QIMA 2ONKA 2QUZA 3BAFA 5HILA 3O4VA 3PRYA 3R9WA 1SUCA 5EWLB 3FF1A 1JZTA 4OYRA 5EUMA 1HZZA 5LP6C 4X95A 2EBUA 1GZ7A 1QYCA 3BGOS 4JGGA 4CWAA 3KT0A 4ZANA 2MYTA 2V1XA 3JAKB 4O5AA 5EWJB 3E9YA 3ZU6A 2W42A 1A9OA 2AKYA 1HDRA 2EV9A 2NU6A 4IJWA 1NONA 3EGEA 4XAQA 3HADA 1JKMA 1OSNA 5I47A 4LRYA 4NE2A 1PZEA 2FN4A 4G5RA 1Z88A 3K4HA 4R8MA 5EIBD 4CKEB 4W4TA 5EHZA 3AFIA 2QRUA 4OB8A 3ZWVA 3RS9A 5DISB 1FSSA 4AW9A 1HXHA 4YCBA 3WK4A 4A6DA 1M6YA 2VP5A 4JLAA 3DZJA 3JQEA 3KUCA 4O2RA 5H02A 4BO1A 2D6FA 1PQYA 2BM0A 3HNRA 1DQZA 2CNWA 1ZD5A 2CJFA 2OD7A 3O3NB 1BKYA 4Q18A 4QRDA 1PP4A 1P5RA 2HWUA 5C4MA 3QOXA 3N8NA 1VKHA 1FNMA 4XVHA 1I3CA 4URXR 4ZQCB 4WCDA 4RS3A 2O7RA 1J0DA 3LLMA 4HLUA 4CL2A 4MV0A 1M1NA 3ZQJA 4L76A 2Z1DA 4EEKA 3JZIA 2N9UA 3F6RA 5A9TA 1Y3IA 5F2NA 3SOZA 1DU4A 1P45A 2YY5A 2ZWOA 3H2KA 3L2OB 5K0LA 1VHTA 5JZOA 3DTNA 4G37A 1I7PA 2V6MA 1IVSA 1YB5A 4WA8A 3TJZA 1D5CA 3SWWA 3I83A 4NMXB 5J2TA 3ORRA 5DBOA 3HXMA 4Z99A 3EQ8A 4S1VA 2QTWB 1MJGA 2FFRA 3E35A 4GMXA 1IN4A 2FEPA 1KEUA 2RGXA 1IWBB 1A2KC 4OFZA 1U8XX 2PS9A 3LFUA 1UK6A 1EUZA 1XNJA 2H65A 2ZDGA 3IUSA 4HEA6 3N2IA 4F4CA 4UBLA 3DO6A 5SY4A 1NAIA 2PA0A 2GFIA 3K73O 1TA0A 4Y9TA 2OBLA 5IK2D 1GNRA 1VXRA 3IUNA 1TCVA 3DVSX 4HO1X 1P1CA 1OVMA 3QEOA 5T64A 2IS6A 2GRUA 1GG8A 3H5AA 1BQ3A 1WBDA 2X2EA 4OHXA 3T5DA 1EE9A 4HXGA 4WX2B 3C3CA 3D7SA 5AJWA 4DA6A 3UMSA 3NIBA 1GM5A 3EFOB 5AW3A 1KFJB 3IE2A 4W1PA 3MFYA 3EDRA 3OFND 5H81A 1XZIA 5ITWA 2IIQA 3BEDA 1QGUA 2RHBA 1II0A 3OI7A 3HA3A 4C30A 4YPOA 1LSOA 1I6MA 1ECCA 1Y8CA 2WIAA 4G0UA 1RYZA 1QS0B 4OXYA 2ZYUX 1W75A 4GGOA 1GPKA 1V6SA 2IYYA 4F5WA 3ETGA 5D1NA 2YFHA 1NKSA 3U4HA 2ORED 4YRKA 1V6AA 1FFEA 3CSSA 2OMKA 1B73A 1HTBA 3ZWWA 4EJ6A 1QU3A 4NBUA 1MHPA 2FWJA 3QPCA 1NVKA 1PVDA 4HDRB 2JL1A 2N0SA 2AFIB 1KVRA 2P11A 4FS8A 4G6ZA 4MPJA 4OXRA 4ZEXA 5EE0A 3KHUA 2C0PA 4CNBA 1EVIA 2B94A 1MGPA 3QPWA 1U2PA 2PKYX 3IEIA 4A8PA 3HO8A 4QYXA 1RYEA 4US1R 4W82A 3N2NA 3NM6B 4DZZA 2DPLA 3DZCA 3NHKA 3O8CA 4E5YA 1AQ6A 3DUFA 4UFPA 3O38A 5BV0A 3ORHA 3W2HA 1K7EB 3OAAA 3V2HA 1WCIB 2DR3A 3HN7A 1OE0A 3N2KA 3O74A 2IEYA 1RJFA 5FCDA 3IT2A 3WBFA 4G01B 4MIKA 1GD1O 2RGCA 4O2AB 2XUZA 4RPLA 4N5DA 2PTGA 3WL5A 5DM1A 1TW2A 1TCCA 3X2EA 4YCNA 1YMVA 3BIWA 2IXEA 4URVR 1ZM7A 1MNQA 4BQNA 1YACA 3SC2A 5DK6A 2CV1A 3MWGA 4J6EA 2X5NA 4BCCA 1KI7A 4CFSA 3GLTA 2XT6A 2D5AA 4MB0A 3H0KA 3PHGA 4DW8A 4DR7B 3CG0A 4HR7A 2OHHA 3IJEB 5BO5A 3LPMA 1ZOLA 2WUDA 3N3AC 4MVJE 3U9LA 5I4CA 3WJ7A 1XMOB 2WWHA 1HT1E 1TRHA 2NXWA 2Q0HA 3VVCA 1Y0BA 5EJAA 1B2RA 3H1EA 4KK4A 3VHRA 2V59A 2XYQA 1AO3A 2DR0A 1MABB 2EJUA 1UJ6A 4OQMA 4WK6A 3TDKA 5HW0A 2OKGA 5FI0B 3TNDA 1M6EX 4ZJPA 2EKQA 4TL7A 1PDVA 3IRVA 3MTEA 5AQ1A 4CF6A 2IDZA 3TLYA 4DCVA 3VSEA 3EVTA 4O2BF 4BKMA 2I2DA 3KZ1E 4KK3A 4DJDC 4XWKA 5K0BA 3NI2A 1JWLA 4BQFA 2VSQA 4MQ5A 3WLLA 4F6RB 1XTPA 5TPWB 2BZ0A 3B1XA 4DSUA 3D8RA 4JYCA 1LTHR 4NMHA 4BZXA 1SU6A 2MJLA 4UBNA 1W6UA 4QGBA 5AKXA 1OFIA 2RK4A 3UMGA 2BEVA 2EKLA 4MA5A 3IIJA 3I73A 2DRIA 2GWRA 3T1NA 4WINA 1PU2A 2IKQA 4RCYA 4CMJA 5IZCC 2NU7B 4DMRA 3WZMA 721PA 4OKIA 4HADA 4LHWA 4ND2A 3HDJA 3DEKA 4IR7A 2VJKA 2GEFA 5BP7A 2FPGA 3SF8A 1USKA 4RY0A 3T8YA 3WLRA 1NBMA 1N0WA 2FSUA 2EWWA 4I9HA 1EK2A 2B2XA 1RFGE 1XZLA 3PUHA 4OI2A 3I9OA 3T3IA 1WF3A 2ZULA 2ZEJA 3GRPA 1LJ8A 1FFSA 3BORA 3D0RA 4H1UA 2A0YA 4O1MA 1VTKA 4BNWA 2VWPA 2YX1A 1Z0UA 1SCIA 3OPYA 1SUSA 3I1JA 3HJRA 4MUEA 4N40A 4NV1A 5CTAA 5A06A 4HQOA 1T9HA 2E87A 3C43A 3QW2A 5JSKA 4RL6A 4QT0A 1FLNA 1SRRA 4ABTA 1ZONA 1Y8RB 4NMWA 4WI1A 1G98A 2P8JA 1H4QA 2WZCA