3PJDA

Structure of enr g93a mutant-nad+-triclosan complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
257
structure length
257
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIAFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural basis of triclosan resistance
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 88
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pjdA00
5AYVA 4DIFA 5B12A 1O94A 3WXBA 5CP8A 4IPTA 4KTVE 4DPLA 5L3ZA 3SLGA 2C59A 3RQSA 4CR7A 4BO8A 3CZMA 1B15A 2ZB8A 3E5RA 3WYCA 1UXGA 4CMKA 4BNUA 4NDNE 1N1EA 4IUYA 3KRTA 2XF8A 2E49A 4W7HA 4BNLA 4N54A 1W8DA 5IJZA 3TPCA 3KXDA 1IHYA 2GZ3A 3LZ6A 1MXHA 1JVBA 4I08A 5T57A 1GTMA 2WD8A 3EZYA 1YBMA 2O48X 4DMLA 3NUGA 1QXSA 1I3LA 4M49A 5B4VA 1VKNA 4JX8A 1EVJA 1I2ZA 2OUIA 4JBIA 4TRJA 3LT0A 4R5MA 3DC2A 4P38A 4LMPA 4GI2A 4CM7A 4OQYA 4PRLA 1DJNA 3RUDA 3PXXA 4N18A 4R01A 3IKVA 2E4AA 1H9BA 2XXJA 4FC6A 4PIVA 5KKAA 2PFGA 1DHTA 1YL7A 5L95A 3A9WA 3LT4A 4NFYA 4D3DA 1LDYA 4MINA 1PR3A 4TRRA 1WPQA 4JP2A 4ALLA 3WB9A 1A4IA 5AOVA 4EEZA 4EZBA 1MXFA 5DP2A 2GZ1A 3DZFA 2G0TA 5C3MA 4L9RA 3NTQA 1SEVA 3GZNA 1VE9A 3DXFA 2W8ZA 4IDAA 3UVEA 4RVGA 1BDMA 1LX6A 2NLOA 2Q46A 1ISFA 1BHSA 2F1KA 2H5LA 1NQTA 2J3HA 2E37A 3IL2A 3C24A 3L07A 1EUZA 1LQTA 2QX7A 4WOKA 2OMEA 2Z5LA 4II2A 4CQMA 1JN0A 4XJTA 1RWBA 3AM5A 2AE2A 1UAYA 4J16A 3ZV5A 5JAIA 3TWOA 3SJUA 1LDNA 1FK8A 1A9YA 2DUUA 2Y1CA 1BXZA 2QZZA 3D5TA 5JFOA 1HLPA 4Q39A 3HN7A 3QVTA 1MX3A 1HXHA 5DDIP 3NKLA 3LLSA 3PK0A 2ZATA 5A5FA 3DTYA 2ZYAA 3GEGA 4YYZA 5GMOA 3GT0A 3BYZA 4UUMA 2BFOA 1BDBA 1N8KA 2Q3EA 4CQLB 4XEHA 1EVYA 1M75A 3JTMA 2VHWA 2VHYA 1MC5A 2FHSA 4OM8A 5EINA 1PS0A 3JYQA 4CM5A 1L7EA 2W4QA 1MC4A 2W2KA 3W8FA 2EGGA 2VTDA 1A72A 3DHEA 1OFGA 3PFFA 4KQWA 4XQ9A 4CMCA 3JQ6A 4DWVA 3T4EA 2VHXA 1YXMA 4AJEA 5HTOA 2Z1MA 4CPDA 4E5PA 3A14A 3I9LA 4IINA 2VWPA 4OQZA 4AG3A 4CV3A 1I8TA 1JQBA 2R6JA 4B7UA 3AOEC 3G3EA 2DUWA 4ND5A 4ZQBA 3DOJA 1DEHA 2IODA 4RVHA 1GUFA 2VUUA 5T8KA 4KOAA 3GPIA 3BIOA 2Q1WA 3TQHA 2EJWA 1N5DA 4MVJI 3ZU5A 4ZQHA 3QHAA 4ZVVA 5G0TA 4D3FA 1I32A 1QYXA 1LQUA 4IJUA 1E7YA 2VTEA 1EBFA 3OFSA 3GNSA 3L4SO 1Y5MA 2YDYA 4I9NA 3GRKA 3AK4A 2BHLA 4KUGA 3PDUA 2X0JA 3WGQA 1XGKA 2CSUA 2GSDA 2WYUA 1YQGA 2ZB4A 2VWHA 4BNIA 3ZV6A 4DC0A 1AHHA 4CM9D 2Y1DA 2QW8A 1XEAA 2DBRA 1LSOA 2OBNA 4Q3CA 5KVCA 4EDFA 1X7DA 3DBLB 4BKPA 4FOOA 5A02A 4C4OA 4EJMA 1SC6A 2GZ2A 4CM6A 5LDGA 1H0KA 4NK5A 3WR5A 1ZK4A 1EFLA 2I76A 1ZNQO 1PIWA 4D43A 1XU9A 3WFIA 1Y9AA 2AQHA 1E7MA 3QWBA 3RASA 4WASA 1EVIA 1K2WA 3JYOA 3G17A 3TZQA 1N1GA 3PHLA 2I67A 1U3WA 2O7SA 1U8FO 3V1UA 4FIZA 3QA9A 4NH4A 5EQFA 1LRKA 2HCTA 3I4CA 3G1UA 3I52A 4LRTB 2W98A 5JMPA 1ZO8A 2P9CA 3RBZA 4ND1A 3DMTC 1YO6A 4M54A 1R4MB 3ZNNA 2BI7A 4DGSA 3U4IA 3GR6A 1HEUA 4XYEA 3M2TA 1E3WB 3ZDFA 4NJOA 1IZ9A 1ZXBA 4QUKA 1RM3A 4HFRA 5I8ZA 2OP1A 4IGEA 3M1LA 4PLVA 4XIJA 2CNBA 2RHCA 5A05A 2D59A 3U0BA 2UVDA 3B70A 3FCOA 2X1HA 4RF3A 1YE3A 1Q0HA 3QLJA 4LISA 3ICCA 3VZPA 1PWXA 3JD1A 1LTHR 4NBRA 4CMAA 3ITDA 4GLLA 3H2SA 1GUYA 3EGOA 3INTA 3EDMA 1AHIA 3MJEA 1HE5A 2D5AA 2BF7A 1XWFA 4KUEA 1PJCA 1HDOA 4NHEA 1QSGA 5IFLA 2J6IA 4BNWA 1NPYA 1I3MA 3WQRA 1B16A 2FZWA 3B20A 4JJGA 4WK6A 3TNLA 4E6PA 2IRWA 3GEMA 3C7AA 4J1QA 1D1TA 2B4QA 2Y1GA 3Q0EA 3ZU3A 3VVBA 3UHAA 1U7HA 1VL0A 4K26A 5JNLA 4UVDA 2VZ0A 2V6GA 5KJEA 3F6YA 1QORA 1Z7EA 3P19A 4B8ZA 4E4YA 4XB2A 4AL4A 3MJTA 4RPLA 1IULA 1PEDA 2QYTA 4MKRA 3UFXA 4CMGA 4RDIA 2PH5A 1B0AA 5KOIA 3WGIA 3PP8A 2VZ9A 1G0NA 1X13A 2NVUB 1CDOA 5EJ2A 4OH1A 3C7DB 5JYEA 1Q0QA 1R6DA 1R0LA 4L4XA 3FHLA 5IDWA 4CMEA 1Y8QA 1NTOA 1Q7BA 5F1KA 5A06A 5IN5A 4R68A 5JSFA 3NAQA 4U6SA 3U49A 4J4BA 3WTCA 2EKPA 3QQPA 4A10A 4RL6A 3RC9A 3SJ7A 3BTOA 3GDGA 1QV6A 3TFQA 5KJ1A 2UAGA 4RF4A 4Y67A 4RCVA 2GN6A 1MA0A 4YJDA 1F14A 5CHEA 3QWHA 3ZWWA 3H7AA 3WGGA 1WZIA 4QO7A 3QWAA 2FY8A 4NBVA 2GN4A 5EIOA 5HS6A 2PKRA 4BGVA 1E7SA 1O5IA 1PJBA 3BHJA 2AEJA 2IYOA 1B14A 1DJQA 5T8KC 3OECA 4R9RA 3I1JA 4IS2A 4AJ1A 1ONPA 3GZ4A 4DBZA 2FRDA 4LVCA 1L1FA 1H2BA 2P4HX 3RIHA 1PJ4A 1X1TA 3NTRA 1VJ0A 1U28A 4F6LA 1NFQA 2PZLA 3DBLA 3F9IA 5JCJD 4IXTA 4XYMA 1Q7GA 5ES3A 1D8AA 3ROQA 4CM4B 1JAYA 1R66A 4XKJA 2NUAA 3B1JA 2EHDA 5A5EA 4J6FA 4DTIA 1HRDA 4GVLA 3OQ6A 3ITKA 3EVNA 4PZCA 3I83A 3IP3A 3ST7A 4YJHA 2RBEA 3DTTA 3IUPA 3VOSA 1PSDA 2P68A 4QECA 5IXYA 2A4KA 2EF1A 2VYVA 3GDOA 5F1PA 2Q2VA 3S2GA 3D4OA 2GGSA 4GPD1 2Y67A 5TX7A 4WCDA 2ZIZA 1R4MA 5COAA 2YV2A 3HDHA 1CWUA 4OXYA 4UVHA 2WDZA 4E31A 5L40A 1FDTA 1E3WA 4H3VA 5DP1A 5IDQA 5CFZA 4FFLA 3K8ZA 3KV3O 3TRIA 1ZMTA 1P44A 2GRAA 4DBVO 1WVGA 3DL2A 4U0KA 1KVTA 4EJ6A 1PS9A 4GX5A 2J5QA 4KUHA 4UEKA 4TKLA 2PA3A 1U8XX 1ZFNA 4YJGB 5DCYA 3ZNPA 3KZVA 4Z9FA 5G0SA 2X0RA 1XU7A 3K31A 1NQAO 4A5OA 3VDQA 5JYDA 5KWEA 4JNKA 1K89A 2CVZA 1BXKA 3BMNB 3GDFA 4PG4A 2GNAA 2PLAA 5L51A 2C07A 3KB6A 3E9NA 2Q1UA 3H9JA 1P1IA 4YVFA 5K0ZA 2C5AA 1HZZA 2BGKA 2O3RA 2UV8A 3P5SA 3GVPA 3QRWA 5CEJA 1ISGA 1CJCA 1EK5A 2FZEA 3ON5A 4E0BA 1GCUA 1CF2O 1BWSA 3LU1A 2FPGA 3RUHA 1E6WA 1Q0LA 4PGFA 1LNQA 1I2CA 1FMCA 2FN7A 5ER9A 3OA0A 4HKTA 3V2GA 1D7OA 3GVIA 2H6EA 1P1RA 2FR0A 4AJIA 1XKQA 1GU7A 2IE0A 4Z9YA 1V3UA 1WP4A 3DZBA 4AJPA 2DVMA 1LBEA 5A1TA 4QX6A 1B8UA 5L4NA 4M86A 3DBHB 4MPDA 1PGQA 3FPLA 4R51A 4ZA2A 3U62A 4I9UA 3H9QA 2JHGA 3I9NA 4PLYA 3B1KA 3EY4A 3EAGA 1JA9A 3KTDA 4BUCA 5GZ6A 3ZW9A 2J3IA 2EERA 4GGOA 4WNIA 4ZJUA 4Y8VA 4YTEA 4JGBA 1J4AA 1KVSA 4AJNA 5ER6A 5TS3A 3R1IA 2WM3A 3BA1A 1MV8A 1TLTA 2VNAA 4KDFA 4JK3A 3LT2A 3EHEA 4CODB 4W7IA 1GEEA 2AW5A 2FR1A 3CINA 4KDEA 5KTKA 1RM0A 4TWRA 1EBUA 4Z0HO 1YWGO 3EC7A 4D79A 4CLEA 3H9EO 5CDSA 2HK7A 3PFWO 3U9LA 2HRBA 3RROA 5CAEA 2HK9A 3OETA 1KY4A 3WQSB 3FNEA 3AY6A 4HBGA 3WYBA 2WE7A 4BV8A 4RLHA 1GV1A 4EEXA 4ZRMA 1ZEMA 3GY0A 1NHWA 5TF4A 3IC5A 4IM7A 4N5NA 1OOEA 1EK6A 1W6UA 3ENKA 1NM5A 3PJDA 5JS6A 4D41A 2IDZA 5C7OO 5H82A 4XQCA 4TSKA 4OAQA 2HMTA 4AJOA 1PJQA 4EUEA 4RV9A 3TDKA 4L75A 1ENZA 2I65A 5AVOA 3WBBA 1PQWA 3GK3A 4HNGA 2A94A 1U5CA 3W4JA 3VPXA 1O89A 1YQXA 3V1YA 2WSBA 4K9DA 3DZHA 4JBHA 3ENNA 4J1NA 4E5MA 4CM4A 4HFNA 2IZ1A 4JN6B 3DAPA 4K1LA 1NHGA 2AG5A 3B6ZA 4AJLA 1ADFA 4IZIA 4JJFA 5T5QA 1GZ4A 1I2BA 2EEZA 3JD0A 1U2DA 5ITVA 1KVRA 3CMMA 4NG5A 1DXYA 4URFA 4LGVA 4ESOA 1T2FA 4FFNA 2Q4BA 5L9AA 4ID9A 1XELA 4G81A 4R9SA 5BSEA 2PKQP 3Q1LA 5A03A 1GYPA 1LRLA 4J0EA 3ZNQA 4RLSA 4DMMA 1JDJA 1EDOA 2DBZA 1YRLA 1DB3A 2GN8A 2EW8A 4CR6A 2Q45A 1CYDA 4L76A 1QG6A 2PGLA 3JYPA 3FNHA 3UCFA 3GFBA 2NWQA 2YW9A 3FTPA 2C29D 1EQ2A 2X58A 4R1SA 1GZ3A 4YJGA 1P3DA 5FI5A 1TB4A 2EW2A 2QIOA 1SOWA 2EWMA 3AI2A 3OA2A 5FFFA 4WGGA 4YEDA 2PZMA 4P4NA 3ZWBA 4BIIA 1HLDA 3ZV4A 1HYHA 3LSYA 3F47A 4L73A 1C0KA 3DOCA 4OKNA 3Q6IA 5THKA 1QYCA 3DONA 4N5LA 2I9PA 2EG9A 4MKZA 3LK7A 5AXBA 1J5PA 2D5CA 1T2AA 2X6TA 1R4NA 3GGGA 2I6TA 4J4HA 5IAAA 1KVUA 3JQAD 1ZSYA 1CETA 1IOLA 3WIEA 1Z75A 3ETGA 4K6FA 3UCXA 4DYDA 1X1EA 4J91A 2POQX 4IS3A 3LF2A 5JXWA 1DIBA 1E1LA 3S55A 3DAFA 1P74A 3HSKA 1HYEA 3FBTA 3AW9A 3M2PA 3GN1A 4DRYA 4FQ8A 1U2GA 2CMDA 4LSMA 5C5IA 3AI3A 2QYSA 4AJJA 4B79A 1UDBA 5TGDA 3GAZA 3WG9A 4CMHA 3IAHA 1DC5A 1E1KA 3ZHXA 4LW8A 1L7DA 1T1SA 5T64A 1T4DA 1JU9A 3NTOA 3ZN2A 1NR1A 3LYLA 2O23A 2JD1A 5A4DA 1Y81A 2X9NA 2ILTA 4AJKA 1PQUA 5CPFA 3G1TA 2AMFA 3OM9A 1KC1A 3LQFA 5KKCA 5HA5A 4HWKA 3MTGA 3O38A 1X15A 2WEKA 5DBIA 1KEVA 4QXMA 4WE3A 2QRLA 5FYDA 3RC7A 1Y1PA 3KYDA 1EMDA 3AUUA 1YGYA 5EPOA 2QHXA 4RVUA 7ADHA 2ZYGA 4F6CA 3EW7A 3C8MA 3GF4A 3NEPX 2E6UX 4XIYA 1HZJA 1X7GA 5U4QA 4R1TA 3GVXA 2GR9A 2C5EA 3ONEA 3ZHBA 5HRUA 1N2SA 4NPCA 1VSVA 2O2SA 4Y98A 4Q9NA 5TRTA 4NNJA 3VHRA 4TZKA 1ZBQA 1WDLA 5BSFA 5I7EA 1S6YA 1ZCJA 3DMTA 1B3BA 4FN4A 3SX2A 2J5RA 2CF5A 4NIMA 3H6KA 3OP4A 2W2LA 3ZCXA 2OZPA 2ZTMA 1ML3A 2HK8A 1OI7A 4E2YA 1TT5B 5JO0A 3AU8A 3AUTA 3F5QA 5COQA 2AE1A 3ADOA 5KVQA 4XR4A 1UAGA 5U9CA 4XRRA 2EIHA 2GASA 2DBVO 3OSUA 3D4NA 5H83A 2DTXA 1HE4A 2Y66A 2ZYDA 4E5YA 3NDIA 5I7SA 2X5OA 1V6AA 2X4GA 3GGPA 1I30A 3DQPA 3K5PA 4JJIA 2VOEA 4PLGA 2PR2A 1KEUA 4J7XA 3ZHZA 5G4LA 1E1NA 4TRNA 1HWYA 1HT0A 2LDBA 4PLZA 3W6ZA 3LT1A 2B35A 3OICA 1NFRA 4BO9A 4ALIA 1S7CA 4JIGA 5I7FA 3AJRA 2ZTUA 3K2BA 2O3JA 3P2YA 1KIFA 1NAHA 1Z73A 2P9EA 2HLPA 2CFCA 2Y05A 1ONOA 3WX0A 5C7IO 2WMDA 3HDYA 1P9LA 1F0YA 2HO5A 5JAMA 2YFQA 3MTJA 1IUKA 5DBGA 3UXYA 1X7HA 1A7KA 4NK4A 1DOHA 3E82A 3H8VA 4BNMA 5JMWA 3TJRA 4OO3A 1BTOA 4IDFA 2DQ4A 3SLKA 3FSRA 4TVOA 1NWHA 3TFOA 1D1SA 3GG9A 3RKUA 1T25A 1R37A 1KETA 1ZIDA 3DO5A 2GF2A 4ALKA 1WNTA 1E5QA 1FJHA 4R3NA 4WLOA 4RGBA 1DRUA 1PGOA 4Z0PA 1T2CA 4PLHA 1P1KA 5JCJA 5MGBA 3DHYA 4I9HA 1RM5A 2QRKA 4QSMA 4R16A 1ZZEA 1SO8A 1M6HA 1ULSA 1GCOA 1AXGA 3U5TA 4D46A 4IJVA 3ZWNA 4YAKA 3DHNA 3D5QA 3OIFA 2VHZA 3GAFA 3X2EA 4AJHA 1DLIA 3CEAA 4TKMA 1YB5A 4XYLA 2GO1A 2NVWA 1Y8QB 3I9KA 2Y93A 4B3IA 3ONDA 2OP0A 4UVIA 5G4KA 2Y0EA 5JPIA 4Z3KA 2PK3A 5IZCA 5EN4A 3BXXA 4MVJA 4Q3EA 1PGNA 3PQDA 2B4RO 1E7RA 1HDGO 2RH4A 3NJ8A 4O0LA 2VWGA 4L0QA 4CM3A 1R16A 2IXBA 1K6XA 3K30A 5TC4A 3ZH2A 5ILOA 2WD7B 4KZPA 4RORA 3F4LA 4E33A 1DPGA 1RYEA 2FPPA 3I23A 3OIGA 4JROA 1BGVA 2PD4A 2ZTLA 3H3JA 1ISHA 1NFFA 1NPTO 4FJ1A 3HHPA 2H9IA 3ZWYA 3QY9A 2NU8A 4YT5A 4GX1A 5L7YA 2CUKA 4XJSA 2NSDA 2H63A 2WE8A 3A4VA 3WWZA 2BGMA 4JQCA 3WS7A 3IQDB 3WFJA 3IS3A 1EDZA 1DAOA 1NWCA 2VZ8A 4IQGA 5DN9A 4YAJA 4BKQA 4PG6A 4F3YA 4ROSA 9LDTA 4LCJA 1YB4A 2EXXA 3OH8A 3VZQA 3OHSX 2DPGA 1VM6A 4LRSB 4OHUA 4YJHB 1TT5A 1YQDA 3ETDA 4BMSA 5IG2A 1D4FA 2E48A 1PZHA 2B36A 4B8WA 4KTTE 1JKFA 1TVEA 3SC6A 2NACA 2VYNA 2G76A 1QLJA 2V65A 1P0FA 3V2HA 3DWFA 3AU9A 3IDSA 3WGOA 3ASUA 4J7UA 1T2DA 2PD3A 1VPDA 3Q2KA 4DC1A 5KJCA 5HWSA 1PS8A 4LK3A 5IN4A 1SZJG 5DOZA 3NGLA 1F06A 3KUXA 1C1XB 1KVQA 1R15A 1WXDA 3GHHA 3OMLA 3TF5A 1G6KA 2DTEA 1NVTA 1W73A 1E3EA 1NYTA 3KSZO 2Q50A 4TMFA 4FFMA 2VCYA 4CM8B 5J23A 2EGHA 5JAZA 2VRBA 2HJSA 2V6MA 3KVOA 4I8XA 2E82A 2HDHA 4WEOA 5IDYA 3BMOA 3KO8A 4FFOA 4YPOA 2VWQA 4IIUA 1PGJA 3BTVA 5CDGA 5LDHA 2BH9A 2FR8A 3HB4X 1GPJA 1NAIA 1TT7A 4BMVA 4EUHA 2JCVA 4M89A 3V1TC 1MFPA 3FF4A 1LDGA 3ANMA 4FGSA 5CPBA 1ADCA 1ZSVA 3RJ5A 4UVGA 1B3RA 4U7WA 3GC6A 3L0DA 4RVDA 3H3FA 2Y1FA 1MUUA 1IPEA 4TQGA 2X8LA 2X9VA 1O6ZA 3G0OA 4IMRA 5L4LA 1EZ4A 1P31A 3HADA 3S2FA 1OC2A 4YDRA 1HDXA 1DSSG 1GYQA 2B69A 1QYVA 1I01A 4IJWA 3DR3A 4M1QA 4CL8A 1CERA 9LDBA 4BO1A 4TZTA 1H2HA 4W4TA 5TLSA 4PLPA 3Q2IA 4EYEA 2V6FA 3ULKA 4P8RA 2P4QA 4PLTA 1H6DA 1B7GO 1C0LA 4O6VA 3M6IA 2Q1SA 3JQFA 4GSLA 1PWZA 4BO5A 4OSPA 4E2XA 2I99A 1XHLA 3GG2A 4KP7A 2C7VA 2NADA 4ZICA 1BXGB 4LMRA 2EKLA 3T7EA 1YDEA 5KVSA 2JAPA 2VRCD 3VC7A 1VJ1A 3AI1A 3ETEA 1TXGA 2C2XA 3JQ9C 3GLQA 4A0SA 4FJ2A 3Q3CA 2O4UX 3ZWOA 2QQ5A 1UZLA 3NYWA 5TT1A 4YBZA 1I3KA 3HJAA 3LC1O 4TRMA 3RUCA 3ZWCA 1NXQA 2WYVA 4R4JA 1DHRA 3JQ7A 3SEFA 2WD7A 1F8GA 5BR7A 4D3SA 3PJEA 1ISJA 2FMUA 3VTZA 1LC0A 1IB6A 3HB5X 5C7LO 1PZFA 5IZCC 4IBOA 4IDEA 2AXQA 4R5HA 4CQMD 3FR7A 2RHRA 3IJRA 1OMOA 4OGWA 3L4BC 4Q3AA 3D1LA 3WJ7A 1Y8RA 1DAPA 4AICA 1HKUA 5JW6A 1UH5A 4CLXA 4NR0A 3ABIA 3NT4A 1P45A 3ZU4A 1ZKMA 2G5CA 1ISMA 1PZEA 3C7CB 2X5KO 2H1SA 4HFJA 3TN7A 5AXCA 5DCUA 5I7VA 1PX0A 4CR8A 1HF3A 4LSWA 4E2WA 4YCAA 1IE3A 3C1TA 5K6AA 5DT9A 3ROMA 5BSHA 3FWNA 4OIMA 1EVZA 4GBJA 4AJ4A 4FB5A 1GFSA 1PJ2A 3JQAA 2C2YA 4WLEA 3MJ4A 1H6CA 3ZWAA 4WECA 2VHVA 4BNVA 1T4BA 3GA0A 4G65A 4ZRNA 5B1YA 1NX6A 2OBYA 2P5UA 4ZN6A 3ONFA 2GERA 3GRPA 4XGNA 3K96A 3VKVA 1PQPA 5L45A 3PHIA 2JHFA 3K2EA 3ZNOA 4NQZA 1LXCA 1P0CA 1XSEA 3E03A 1LLDA 2D1YA 1ZMOA 1O0SA 1RKXA 1C1XA 3LC2O 4Z0TA 1PL8A 3P7MA 3QV1A 4IZHA 4JCOA 4XQGA 3TSCA 4Z9XA 4UREA 2ZB7A 4CM8A 3ZHYA 1AGNA 3GN2A 4HX5A 3FI9A 2NTNA 1ORRA 1GUZA 1ZK1A 1UP7A 1G1AA 2VN8A 1HETA 3ZWXA 1VKOA 2NVBA 5A3JA 5TIIA 4ALMA 2BELA 2EP5A 2BLLA 2J3KA 1LSSA 2ZTVA 4FDAA 2DM6A 4YAEA 4PLWA 4BB6A 2XPCA 3RBVA 1I24A 2HUNA 3W8EA 2A92A 1HDYA 1R4NB 4WLVA 3GUYA 2BRUA 2I66A 1A5ZA 5JE8A 3QJ5A 3C1AA 2UYYA 4BNYA 3CUKA 3OQBA 3DZIA 4QEDA 4RZIA 1N92A 1PJSA 4FS3A 4JLWA 4MVJG 4RPKA 5ICSA 3HDQA 1EEHA 4GMGA 2NU9A 3C3XA 4RPHA 1PU2A 2R00A 3H2ZA 3WGZA 2DFDA 2BFPA 3O8QB 1ENOA 1UUFA 3E48A 3QWIA 1PJLA 1A71A 2OGUA 4RF2A 4JP3A 3RUIA 1J49A 3PQFA 3WICA 4A26A 5KJ6A 3WYEA 4Z6KA 4YXFA 3JYNA 3K92A 4MIYA 4PRKA 3CSDA 2I5PO 4IXWA 4BNZA 4ITUA 1EFKA 5L4SA 3FR8A 4Y9DA 1WWKA 1YB1A 1BXGA 4RZHA 1J0XO 4I5DA 4IY1A 2Q4EA 4Z3DA 3CE6A 4IDGA 4MJLA 3PIDA 2JFHA 5TJ9A 3RI3A 4CUKA 4XWYA 2FWMX 1HDZA 3PWSA 3L6OO 3H9GA 3JQFC 2I3AA 1CQJA 3KYDB 1E1MA 1YS4A 3KOUA 4BO7A 2PV7A 4CMJA 2QZ9A 2OHXA 2QG4A 3MJCA 3OBBA 1UR5A 4XYGA 1B2LA 1MG0A 1X0XA 3EUWA 4NBWA 3QP9A 5KNLA 3IJPA 4HUJA 2YHIA 4YT8A 2VUTA 3PWZA 2PGDA 4FSHA 2HMVA 4F46A 1R0KA 3L77A 3MJVA 4IJKA 2ZCUA 1H5QA 3W4IA 4B4UA 3PYLA 1KERA 5CG2A 3JV7A 1IY8A 4QQRA 4L8VA 1DBVO 2JCYA 3NX4A 3WJAA 3PPIA 4O1MA 5ENDA 2ZQYA 4GKBA 3SVTA 1E6UA 2YJZA 4HXYA 2EV9A 2ZK7A 1ZJYA 3M1AA 4XGKA 5CDUA 5BT9A 4YT2A 6ADHA 2B0JA 1YBAA 1YOVB 2Y0DA 4R69A 4EGFA 3T7CA 3KEOA 3TL2A 3OF2A 1B8PA 1V0JA 3ORFA 1I36A 2XOXA 1NR7A 3BZUA 3DMYA 3BTSA 4ZHSA 2XAAA 5K6AC 3DZKA 2P2SA 4MDHA 4S1VA 4XRGA 1ULUA 2V7PA 1BRMA 1XQ6A 5I8WA 1LA2A 2HKIA 1LLQA 3DFZA 3GFGA 4BKRA 3E9QA 4D42A 1JWBB 3DZGA 4BNJA 1ADBA 1PGPA 2CDBA 5DBFA 4CMIB 3UCEA 4QO8A 3MJSA 2HMWA 4OOFA 2OORA 1YJ8A 4H16A 4DYVA 4ZU3A 2Q2QA 4J9UE 1GR0A 2O3TA 4C7KA 3EVTA 3TZCA 1QR6A 5GY7A 1UZMA 1K5HA 1SB9A 3O9ZA 4XD2A 4CV0A 3JQGA 5F5NA 2JKVA 1KOLA 2FPIA 4W6ZA 1T2EA 4YACA 2VNSA 1I5RA 5TJHA 1GD1O 1NVGA 3MWDB 3UUWA 4YB8A 3VPGA 3E5MA 1J6UA 3CZRA 1DRVA 3QVXA 2AHRA 3D0OA 3KSDO 3TZ6A 3U4DA 4ONEA 1MP0A 1Q2XA 5A3VA 3L9WA 4CM9A 1E3JA 1LJ8A 1JKIA 1SB8A 1DO8A 2G1UA 2PY6A 1QV7A 4MP3A 4RQUA 5A9SB 3QE3A 1V3TA 1NPDA 1M6WA 3RFXA 5A9TA 4U6QA 4I5FA 1O9BA 1DIHA 5TNXA 3WGHA 2AQ8A 4N5MA 4M87A 3U09A 2B83A 1CQIA 2DBQA 1SCUA 5F3RA 4ND2A 3O8QA 4WOJA 1B8VA 3S1LA 3HDJA 1RM4A 4NBUA 4HV4A 3AFNA 2AA3A 2QRJA 4LCEA 2I3GA 4IDDA 1C14A 4UEJA 2VYVD 2D3TA 3D3WA 3CMCO 4UULA 1Y9EA 3JQBA 4YRBA 5G4KB 3L6EA 5L7WA 4Q3BA 4G2NA 4WNCA 4IIVA 4XGIA 3IMFA 4INAA 4XB1A 1ZSNA 4OSOA 2R00C 3INRA 2EKQA 4EUFA 5T6BA 2Z95A 3OEYA 4GGPA 3RWBA 4CLOB 1A27A 5JY1A 1P33A 2RCYA 4XZ3A 1HSZA 3HQ4O 1NQOA 4KWHA 1XR3A 1X14A 1YONA 3OQ1A 3DEYX 1Y7TA 4QFCA 1LDEA 4YA6A 3N74A 4R3WA 3ZGYA 4N7RA 5ITWA 3QSGA 4CV2A 5GZ3A 5G0VA 4CLDA 1C1DB 3QW2A 4YJFA 1OAAA 1R0SA 4J49A 1UXKA 5TSDA 3I9OA 4A2CA 3UH1A 2JJYA 1KY5A 1W4ZA 4RVSA 3RVDA 4B7CA 3DAGA 1YBVA 4PLFA 4PZDA 5CDYA 2WWRA 4BNXA 2FSVA 4OMUA 3WLFA 1CIVA 1KEWA 3D4PA 1SAYA 3V8BA 3GH3A 1SNYA 1YJQA 5JDIC 2X7HA 1WDKA 3PGXA 4KMSA 1H6BA 1O8CA 4B4WA 4XR9A 1LC3A 4PG7A 1EQUA 1U1IA 1UZNA 4MVJH 1JAXA 1YOVA 3ANNA 3PQEA 4U0JA 4YR9A 1ZEJA 1ARZA 1VSUA 1LSUA 1WZEA 5COBA 3IIEA 3VVCA 3AM3A 4Y6SA 3R6DA 1IL0A 4PLCA 1U4OA 2J3JA 5JC8A 5I9LA 4IQ8A 1XQ1A 1IHXA 3FD8A 2UUOA 4OXKA 5FI3A 4IQ0A 4BNTA 1AXEA 3JQCA 1T24A 2YHUA 2YYYA 1I10A 2X22A 4IMPA 2Y1EA 4IDCA 1K0UA 1K6JA 4II3A 4WEQA 4I1IA 1PJ3A 3I9MA 3MOIA 4NJMA 3H4VA 5EESA 5JY6A 4CMIA 1Z7BA 2VRCA 3BMOB 4WJZA 1HTBA 2DPHA 4BGIA 3DBVO 3H5NA 1P77A 4EITA 3W6UA 3JQDA 1FDVA 2BFAA 1GL3A 3PJFA 1I3NA 1WW8A 4CV1A 1OZAA 3HG7A 4WLNA 3QVSA 4E32A 3D7LA 1NQ5A 4R41A 2UDPA 1EUCA 3AM4A 5MDHA 1C3VA 3U3XA 2C7GA 2JCXA 3ROKA 4OXNA 7MDHA 2GUGA 4DA9A 2OFPA 1E3SA 4ALJA 2WTBA 2IZ0A 2GLXA 1D3AA 5JC1A 2P91A 1HE2A 3Q9UA 4XX0A 1HSOA 1IPFA 5C37A 2GYYA 3RD5A 3RSHA 1ZVMA 4BGUA 1GEGA 3AY3A 5DULA 4MVJP 4RVFA 3WNVA 4BO2A 4NBTA 1ZJZA 4W9NC 2D8AA 5A9SA 1B26A 3EYWA 1IZ0A 2NU6A 3ZWMA 2YQ4A 3HNPA 2NQTA 3ANLA 3K73O 3VAZA 1ZK2A 1E92A 2O2YA 3BMCB 1KC3A 4XA8A 4YAIA 5GZ1A 3JQ9A 3GNQA 2J8ZA 3NV9A 2GPTA 1V35A 1O95A 1IYZA 1C0IA 5BSGA 4I5EA 2V6BA 2Y99A 2PNFA 4ZQFA 4CUJA 4E12A 3WLEA 2O3UA 4YAGA 1HDCA 1AE1A 2OO5A 4AVYA 1VI2A 1XLTA 4O5OA 2ZQZA 4RPJA 4FPXA 4DLAA 2NTVA 3PHJA 3NGXA 2VQ3A 3F1LA 3ZI0A 4PVDA 4CLOA 3L4BA 4XDYA 4CL3A 3U4HA 4O63O 5BNFA 3JQ7B 5IXSA 1Y6JA 1DIAA 4O59O 3GNTA 3JQBC 3JQ8B 4EJ0A 4ZGWA 4BS9A 2BKAA 8LDHA 2O7QA 3ZWPA 2HU2A 1VLLA 1U7TA 2HMUA 2X0NA 3RBXA 1H6AA 4BL5A 4G5HA 1NASA 4KQXA 1C1DA 1Y8RB 4A73A 4AFNA 3WSVA 3MOGA 2O3QA 1UXJA 4YWJA 4FGWA 1U3UA 1I33A 4TVBA 3N7UA 4NU6A 4DREA 4FFPA 4RQTA 3AUAA 4QTZA 4M8SA 1GQYA 2WYWA 1BW9B 1UP6A 4GL4A 1VRWA 1E77A 1ZUD1 3E8XA 4HY3A 1M66A 1UDAA 5TQVA 3ROPA 3JQAB 1LU9A 3RC2A 5ENVA 4BNNA 1GV0A 1QYWA 5H81A 2BGLA 1PZGA 3HUDA 2X5JO 4DLLA 3W4KA 2RH8A 4E5NA 4J2HA 2A9FA 3S2EA 3WTBA 1DDOA 3H5AA 2A35A 4Y6RA 4D44A 3F1KA 3DBRB 3V5NA 4MKXA 1N7HA 3MZ0A 3PEFA 1F17A 4DIBA 3NT5A 4YRAA 2ZB3A 4BNHA 1A7AA 5JAQA 5KVVA 4OJNA 1G0OA 3RKRA 2C0CA 1Z74A 3HZZA 1ZW1A 4D7AA 4GH5A 4QT0A 4GVXA 2D4AA 1WAMA 2G82A 5KIAA 5JCXA 2DTDA 2EJVA 2AQIA 3NDJA 5JO9A 1Z45A 2VT3A 3A1NA 4MO2A 1E3LA 4PG8A 5DNAA 5KCZA 4BKOA 2Q99A 3JD3A 4M55A 3VTFA 1RPNA 4ZQEA 2NTJA 3HWRA 1XG5A 2JD2A 4NFSA 4LN1A 5L7TA 1GDHA 1LRJA 4W82A 1DC4A 4MIOA 4J43A 4XCVA 4Q3DA 1Z6ZA 1DIRA 2CVQA 1XCBA 3ZV3A 1E7WA 1CEQA 2HSDA 4HADA 1T26A 2Q1TA 3VPSA 3GMSA 1WMAA 3JYLA 3RUAA 4MOWA 2G17A 3ADPA 3DOOA 3LVFO 4S3MA 1ENPA 3VH2A 4PCVA 2HQ1A 3FPCA 5CEFA 1QYDA 1TI7A 5JBIA 1H94A 3RUEA 3AWDA 3VZRA 4FFRA 1YDWA 1CRWG 1Q1NA 4DQVA 1V3VA 3KLPX 4OL9A 4OYRA 3WNQA 2IXAA 3E9MA 5LCXA 4WCFB 1AUPA 1U4SA 5B4TA 5JDCA 1WLYA 5EL0A 3OJ0A 4MP8A 1F8FA 4J3FA 3HFSA 3TOXA 3G49A 5BNIA 3BMCA 3AUSA 4RF5A 4RPGA 2W2LD 2DFVA 2HRZA 1ISIA 2DKNA 1LDBA 5G0UA 2JFGA 3C1OA 3LDHA 1GADO 3PRJA 4E21A 3I3OA 4CQLA 4KWIA 4P22A 4DLBA 4RJTA 2Y68A 1NNUA 1OBFO 2FP4A 3UICA 1T1RA 3GEDA 3ZU2A 4A03A 2GDZA 4R1NA 1E3IA 1SEPA 2JAHA 1XDWA 4YRDA 4LVUA 5HM8A 2HAEA 2Z1NA 1E7QA 1K3TA 2X9GA 1U3TA 3IP1A 5EQDA 4J90A 1JVSA 2ZJ1A 4H7PA 2VT2A 4GSKA 3VKUA 1HE3A 1MB4A 2CDCA 3O03A 4GAEA 4L4RA 5LC1A 3PVZA 5BQFA 3AY7A 3PYMA 2ET6A 5B37A 3U4CA 1BVUA 3JSAA 1UXHA 3RU7A 1MG5A 1E0DA 1FDWA 4RO0A 4UUPA 4ZQGA 3JQ8A 1BMDA 5A9RA 1ZH8A 3GMDA 4R54A 3RFTA 2DU8A 1JLLA 5F5LA 3KLMX 1P1HA 2Q2WA 3IKTA 2YHIB 4GX2A 3TL3A 2YY7A 4CMBA 3PHGA 5THQA 4PVCA 2ZJ0A 3I9JA 3ICPA 3R0IA 4IGFA 1KEPA 3WGTA 2CZCA 3QVWA 3WDSA 3WMXA 2CY0A 4XQEA 3AFMA 1ENYA 3INGA 3QVOA 3UOGA 1A9ZA 3BHMA 2O3SA 3R3JA 2O4CA 4PZEA 4U8GA 3S8MA 4MVJM 4J4TA 1FF9A 1VL6A 3KM0A 3WBFA 4CLRB 3S2IA 2FSSA 1BW9A 2CD9A 2NNLD 3B1FA 2YFHA 4A7PA 1ONNA 1YVEI 2HMSA 2JL1A 3EMKA 4NMHA 1QMGA 3NJ4A 1KS9A 3GQVA 4IDBA 1YL5A 2NV6A 1M67A 4RDHA 2YQ5A 4ZD6A 2PGJA 3GVCA 4I5GA 4XYBA 4HNHA 1HL3A 5CDTA 4BHTA 4E2ZA 5EMHA 3H65A 1ZXLA 3UW3A 2OOSA 3X2FA 1GQ2A 1MGOA 1DFGA 5I9NA 3MEQA 3BHIA 3DBRA 2P9GA 3A06A 1HYGA 4UUOA 3OJFA 4WLUA 3Q9NA 1GY8A 1UJMA 3RUFA 3VPFA 2B5WA 3WQQA 1JW9B 2PTGA 4UAGA 3HFGA 3VPHA 1AN9A 2UUPA 3KBOA 4XDZA 2P5YA 3PIIA 4BO3A 4EW6A 3DFUA 3Q11A 2HJRA 2RAFA 1I0ZA 3BMQB 4E30A 1DRWA 1W0CA 1U5AA 2BI8A 2TMDA 2GN9A 3PJGA 2YV3A 4HFMA 2F00A 1QP8A 3PLNA 2X23A 2Y1OA 2XXBA 2JFFA 5TT0A 3JQGB 2AEMA 4MVJD 2YV1A 4GWKA 4ND3A 1JKJA 2O50A 2C20A 4CUZA 2C82A 5U1PA 1LLCA 2B5VA 5EERA 4E13A 2X0IA 3G79A 3KYCB 4J1TA 4JBGA 2RIRA 3H9UA 3NDRA 4L4SA 2DC1A 1RJWA 3IUSA 5ICMA 2BD0A 3KHUA 3KYBA 4DPKA 2DLDA 3EK2A 4BV9A 2GCGA 5AXDA 3MCVA 1F12A 1H93A 3GGOA 4P4LA 3OJLA 1DIGA 3LLVA 4UEOA 1FDUA 3JCZA 3QIVA 4WCFA 3L6DA 4FC7A 4F45A 3PWKA 2NQ8A 3R3SA 5A04A 5DF1A 4H15A 5ADHA 3TZHA 3COSA 3FN4A 4FCCA 1PR9A 1X0VA 4Q3NA 2VUSA 5BNTA 3WMWA 2SCUA 4TROA 5K9ZA 4DQUA 2LDXA 4WUVA 1NP3A 4FJ0A 2PD6A 1YKFA 1N9GB 1PJTA 1P1FA 3D3EA 1UDCA 4J2OA 3ZZNA 2D0IA 1SMKA 3FNFA 2CDAA 1WDMA 4A27A 4ND4A 2YUTA 2PKQO 3D3WB 4FBGA 4YQYA 3RJ9A 1U9JA 1TA4A 5JDCC 2VYND 4DQXA 3HN2A 1QLHA 1UP4A 4QFDA 5CEEA 3SXPA 2TMGA 3GUCA 3CTMA 4BNFA 3STHA 3SC4A 3WWYA 1N7GA 4PG5A 3VZSA 2Y0CA 5DZSA 1RYDA 3TOZA 2NVUA 3WOHA 2PZJA 4JXKA 1VL8A 3I6QA 3UAGA 4ILKA 2CVOA 3ZW8A 1YH3A 1SOVA 3NRCA 5G2OA 4PN3A 1GYRA 2AQKA 4OKIA 1GAEO 3TZKA 4B7XA 1Q7CA 3RC1A 5L53A 4GX0A 3LF1A 4J9VA 4D45A 4CM1A 1GZ6A 3WGYA 3ASVA 4NFHA 2IEBA 1M76A 2OXIA 1DFIA 4DUPA 4YJFB 4DXHA 3PDJA 4W99A 5JDIA 4NZ9A 3RCBA 1ID1A 3CPSA 2JD0A 1LEHA 1YL6A 4J1SA 3PGJA 1BG6A 1EE9A 3F46A 3OJOA 4YQZA 1P1JA 3KEQA 3PHHA 5F1OA 4CMEC 4AJ2A 1NBOA 2PZKA 3GPDG 3QWFA 1WMBA 5HS4A 2IEDA 4Y6PA 4PFJA 5KJFA 1HDRA 8ADHA 5AQ1A 4BB5A 4CJXA 4MP6A 1PL6A 5B4UA 2C54A 1JTVA 4C7JA 4CLRA 1GPDG 5IF3A 2BMAA 4NI5A 1LLUA 3VH3A 1V9LA 4UUNA 3I6IA 1M2WA 3D64A 3PTZA 1XA0A 3BAZA 3O26A 1VC2A 2NM0A 5IZ4A 1VJTA 4BQPA 1SBYA 3K9QO 4GWGA 3LC7O 3FBGA 1PTJA 4P4GA 3GHYA 1TEHA 4OOEA 4WLFA 1SPXA 3HE3A 2ZCVA 3F4BA 6LDHA 1EE2A 1ZK0A 4E5KA 1DLJA 2NU7A 3OEWA 2ZKLA 4J7CA 5ILGA 2FOIA 4BO0A 5JLAA 5HBRA 4DPMA 4GLOA 3T4XA 3KETA 1DC6A 4D0RA 1ADGA 4FOSA 4NJMB 1MLDA 5CG1A 1LSJA 3DDNA 5T67A 1QKIA 4K28A 4BNGA 3BMQA 4DL9A 1DC3A 3SBOA 2R2GA 4J0FA 3RU9A 3P2OA 2J5KA 3KSUA 2Q49A 4R1UA 3NT2A 3GZNB 1LUAA 3WSWA 3VDRA 5I9MA 5F21A 2D2IA 1PL7A 4K6CA 2IYPA 5FEUA 3PZBA 4HP8A 4B3HA 2CF6A 2IZZA 3CKYA 3DZJA 3DB2A 4W9NA 4MIEA 2DAPA 4WKGA 2AG8A 4YT4A 3BTUA 1C0PA 3PI7A 1UXIA 3RFVA 3CH6A 3UGKA 1BSVA 4CQMB 3VH4A 3JQEA 4FR5A 3KYCA 2YZ7A 3E6AA 3FWZA 3L9XA 3GOHA 3IOYA 4BVAA 1KBZA 4E3ZA 3OIDA 5DOVA 4MVJE 4BMNA 3UN1A 4BQRA 1A4UA 3PYXA 1KYQA 3UF0A 3BMNA 4EBFA 2OL4A 4BO6A 3OJEA 4GKVA 3EZLA 2PWZA 2AEFA 3W1VA 3F5SA 4B4VA 4BKUA 4BNKA 1Z82A 3O4RA 2WJPA 4CLHA 1E6EA 1XYGA 3C85A 3UKOA 4DVJA 3I5MA 2EP7A 4X54A 1QRRA 3I4FA 3FTNA 4UVEA 2DT5A 4FW8A 1XIVA 3PLRA 2YDXA 3E1KA 2X86A 3PZRA 4DIOA 5AXAA 1NVMB 1R12A 4BO4A 3RAJA 5FWNA 3E18A 4EI2A 1GQQA 1FDSA 1N9GA 1EUDA 4GMFA 2GD1O 3V2UA 3A28A 3JD2A 3W8DA 3CXRA 1BVRA 3CIFA 4ALNA 1H9AA 2PH3A 4L74A 3AOGA 3ZWVA 4BGEA 4BOYA 3K6JA 4WCFC 4FD3A 1OC4A 2VOJA 4U5QA 1U3VA 4MVJF 2W2KB 3JD4A 2B4TO 3DBHA 4B3JA 1K6IA 3AOEA 1JWAB 4NU5A 5FF9A 3VH1A 3FNGA 1Y5RA 2B37A 1DFHA 5G0WA 1MFZA 4D0SA 3N58A 3FRJA 1FXSA 1V8BA 5IDXA 4WPGA 3F3SA 3MWEB 1LI4A 3H5RA 2W90A 3WIDA 4GQAA 1E5LA 5DCWA 4B4OA 1ZK3A 1LDMA 2BFMA 3GVHA
chains in the Genus database with same CATH superfamily
1PT5A 1W6RA 4IRMA 1YQUA 3H8WA 4EAAA 1GZDA 1O94A 2AMYA 2J6HA 1SOAA 1HRKA 3FYDA 3HH8A 3RT7A 3M4ZA 1KAOA 1BDHA 3DTNA 1NVEA 4CR7A 2O2ZA 3CZMA 4G01B 2P2CA 2IP4A 2C4MA 4MV6A 4ND8B 5AVTA 5JR3A 2HW8A 5ALFA 4WX2B 2Z4RA 2K6GA 3VX3A 4DRXB 4G0XA 1M6NA 2IDJA 2NO1A 1X94A 2SECE 3IDOA 4IUYA 4KW7A 3EJ6A 2P90A 4QLBA 5ELLA 5ITZB 3UKDA 3N0WA 2W2QA 1WNFA 3GCDA 4JLKA 5K01A 1AQUA 4GBMA 5A3SA 1J99A 5IJZA 2JH8A 5EOVA 3TPCA 3BWYA 5IC5A 2XADA 4UC0A 2Y27A 2XE7A 4LNHA 4JVLA 5F12A 3RS9A 4EGJA 1YBMA 4BVBA 1FFGA 1A9OA 3DDWA 3M0EA 1QXSA 3CEJA 3D4LA 2XMBA 5ECDA 1VKNA 4JX8A 1UQUA 2J08A 3ZHQA 4PNEA 5KSYA 5I9IA 5LFAA 4KIFA 1JJBA 5DIFA 2DG2A 4TRJA 3BAFA 5B55A 3B89A 5C53B 4P38A 4P82A 4WI1A 5FI0B 3A3PA 5HYVA 4CM7A 1T5BA 3ZJ4A 1DJNA 3RVBA 2XZOA 4EFLA 2ZS9A 4ZI5A 4FHCA 1KSJA 5CYFA 2J4DA 2E4AA 4UAUA 2OUKA 4FC6A 4I9NA 3FFTA 3ER9A 2EQAA 3WZLA 1YL7A 4FKBA 5L95A 1YRYE 3A9WA 4PR3A 1SHTX 5FV4A 1RYHA 3R20A 4B43A 4U39A 1M2HA 4EUKA 4RH1A 4TRRA 1LVGA 2AD5A 4DV7B 2CKMA 3WB9A 1A4IA 3U3DA 1D1QA 2WFLA 1PLKA 4L16A 1L5FA 3AO0B 3CCCA 3OOYA 2JGFA 4UU0A 4EEZA 4EZBA 1MXFA 1RAIA 2GZ1A 1W44A 2G0TA 3UB3A 5ALHA 2D54A 5BN5B 5JXIA 2WJIA 4DMRA 4L9RA 1IXYA 1SEVA 3GZNA 1LH0A 5U4XA 2VPYA 1RRKA 4AB1A 3A3YA 5FNVF 3UVEA 4X84A 2GEBA 4Z4FA 1RHRA 2Z2ZA 3SZRA 1SKMA 4C7XA 4GR9A 1WPXA 4JBLA 1E0AA 2F64A 3IL2A 3WQHA 2PYIA 3C24A 1BA3A 1UWKA 4X90A 1TGVA 4XFJA 2F43A 1P5RA 2QTAA 3SZUA 3PNVA 2Z5LA 4II2A 4YH1A 2GEUA 2JA1A 4FYHA 3HCFA 4J16A 2AE2A 4B46A 4S1WA 3TWOA 4NFLA 3SJUA 1XJCA 1ZCFA 2DUUA 4ZPJA 1W0JA 3GJ6A 4V03A 4K6OA 5I5GA 5J47A 3WP1B 1WXGA 1XRJA 4DOMA 3HN7A 4LJ4A 4RXUA 1HXHA 4G56A 4NCKA 3EWIA 4RK5A 3NKLA 4FTWA 3LLSA 3EODA 2EARA 2ZATA 1F6WA 3LT5A 3T1TA 4GT1A 3IAUA 2V5VA 1FFSA 3GFTA 3L1VA 1J00A 3NTVA 4YHBA 3ILVA 4M9SA 2QTBA 2M1ZA 2FP3A 1C30A 1K2VN 2DT8A 4GP6A 4A15A 3HP4A 3EPHA 3WMFA 3IEKA 2P2NA 3ZHUA 5EHQA 3I5AA 2RD2A 4CQLB 1GAQA 3WO0A 3P94A 3LQKA 4MAMA 3RNLA 1Z8HA 1IMOA 3BUSA 4IHQA 3RWMB 2GFIA 5FBKA 1X1QA 4OM8A 4CGZA 2GWRA 4Y0NA 4BXOB 2QENA 3JYQA 4LGYA 5I7OA 3T06B 1DAGA 1H2RS 3UFXB 5A1JA 5JCOC 4DZZA 4EPYA 1UC4B 1B74A 4BFXA 1JSRA 1RWVA 5LPNA 1CTQA 1RBYA 1SUBA 4PANA 1YE5A 1OFGA 1N6LA 3O3CA 2YOFA 1P4SA 4FX2A 4XQ9A 4BP8A 4TV9F 4DJ5X 2VZEA 2RHDA 2JEOA 3R5KA 4JBWA 4KJXA 3LY8A 5C4GB 2H8GA 4FMPA 5HTOA 1Z63A 3AJ8A 4JR1A 3EBOA 1PWEA 3HHEA 2G9UA 1MO5A 3I9LA 3LUCA 1S01A 5EUCA 5HIKA 3L02A 4OQZA 1K63A 1PR1A 5BQOA 3N7AA 3WJ2A 4K81B 3RTEA 3TX6A 4FDMA 3HKCA 4LK2A 5K0NA 2YN0A 4ARVA 4ZJPA 1H5NA 3L40A 2ZG6A 1XTQA 3AOEC 2V7VA 3IOMA 4MYCA 2O0MA 4Q4DA 5D2CA 3DOJA 1CP2A 3FROA 2VUUA 1VFPA 1E1DA 1F2VA 2FRXA 4HI0E 3GYBA 5DSTA 3M4JA 1C3XA 3TQHA 1DGQA 4IDOA 4K8RB 2IIQA 2GK4A 1PFKA 1XALA 1US8A 2O14A 4MV7A 4PGHA 5JJ5A 3THWB 1QYXA 3A9UA 1TFUA 3GNSA 3CRNA 4PYMA 4EJ2A 4DRXA 2IP2A 1R6TA 3AK4A 2WI8A 1ZD9A 2BHLA 3OCXA 4YV0A 1KQFA 2CSUA 1NXWA 1YQGA 1Z4PX 2ZI7A 1T10A 1N2GA 3O91A 2ZB4A 4LJKA 2VWHA 4UBIA 1LY1A 3ZV6A 4DNFA 3JAKB 1C0EA 4P7JA 1KO1A 2QW8A 2FMKA 1QIMA 1YZTA 4H7HA 1X7DA 3DBLB 1RLUA 1WA5A 3F3YA 4YRTA 4R8SA 3DPUA 4Z1MA 1QHSA 2VBFA 1LJLA 1H0KA 1N8TA 1ZA1A 1CUYA 1ZK4A 3A4LA 3FOEC 1LZKA 4DEVA 1PIWA 3JYHA 4D43A 1ESZA 1XU9A 2XLBA 3NEAA 1SUCA 2HU8A 1Y9AA 2AQHA 2HEGA 3DE1X 4FFDA 4WASA 3KBBA 5DEOA 3I6YA 3TZQA 4E15A 4P84A 4P98A 5BYJA 2I67A 3LW7A 4B83A 3GO4A 4G2TA 4OGLA 3GP3A 1TFRA 3KKNA 5EQFA 3FH0A 1LRKA 2HIAA 2HCTA 1P17A 2ODBA 4RJJA 1MX9A 1QGOA 3JPWA 3DMDA 3HM9A 2BW0A 5JPCA 1THZA 4M54A 1VCMA 3O95A 4XARA 3U16A 3PDIA 3LECA 3W0LB 4ZVTA 1POXA 3GR6A 3IPLA 5BN5A 3M2TA 3ZIUA 4ZYYA 1AX9A 1ZXBA 3FFAA 3Q1KA 4LQCA 1JKJB 5AUPB 4D4GA 1P6XA 1RYNA 2IYTA 3RTAA 1U1DA 2P7IA 5F7JA 2AN5A 1ZVVA 3N8IA 1JQKA 3L7AA 3OFVA 5A0TA 2D59A 3E9RA 1Z2EA 2DUMA 1C1YA 2UVDA 3QJYA 4HEJA 4KR6A 2PWAA 1YE3A 1E9AA 4OFBA 3TE6A 3GD7A 4CMAA 3ITDA 4R9VA 3H2SA 1A2QA 3EXIB 1GM5A 3G8YA 4R05A 1AHIA 3MJEA 5IHPA 3BXPA 4UCXA 2BF7A 2G5TA 1HDOA 2AK2A 3TO5A 2OZVA 4I5IA 1W2GA 2FK8A 3L5OA 4NHEA 5LB2A 4A0QA 4Q37A 5A4IS 2XB2A 4PICA 4N7JA 2LBPA 3U3JA 4OBBA 1RKBA 4JJGA 2NZWA 2IRWA 4AQDA 4RANA 4LRYA 3CLVA 1E8MA 4J1QA 4JP8A 2G9NA 3TH5A 1GSAA 4V1CA 3VVBA 3CN7A 5F2EA 1I4WA 1H2AS 2Q07A 1RQPA 2V3WA 4LBVA 3KZ1E 1YTLA 2D1FA 4D4HA 1H2FA 1JJFA 4N47A 4MUAA 1AMOA 1RTTA 4Q93A 2AJBA 3ICOA 3V6LA 2FOLA 5K8LA 1G18A 3K4QA 4E4YA 3MJTA 2IIBA 3I2IA 3SHFA 2H7VA 1GHTA 3I01M 3UFXA 1QVAA 3X1XA 1USUA 3D8TA 3KK0A 3QFTA 5E4TA 3LOUA 2MSEB 3TYXA 3WDLA 1EUYA 1MGPA 4L22A 3FIUA 1G0NA 5KX5B 4ZI7B 2R3SA 2NVUB 2QMOA 4OH1A 1Y82A 3OEHA 3DEJA 3H1AA 4P32A 1G7CA 1R6DA 4C21A 3WWEA 2POCA 3RVJA 4L4XA 3EF0A 3FAZA 3FHLA 4I1OA 1AZSC 1IQUA 1Y8QA 2JLZA 2FUKA 2QEQA 2VSNA 3INYA 1IWBB 4JA0A 2I9KA 4G5GA 4ETMA 2PJDA 3WTCA 1K92A 4G63A 3TB6A 1HUQA 4RL6A 5A4AA 1HLFA 4HX9A 4MGHA 5JH7F 4HYYA 5D7NA 4P53A 4PS0A 3TFQA 1C7QA 4KSCA 1CB0A 2GN6A 2PS3A 1MA0A 4RCVA 2A9PA 3BZBA 3QWHA 4GPBA 1WZIA 3QWAA 2FY8A 4NBVA 4KSBA 3L4JA 3LWNA 3E7FA 3THWA 4BGVA 3M5WA 4PGAA 4FDTA 3CJQA 5H3CA 1G8MA 3D4BA 3PSHA 4ZQIA 1VHJA 4YLEA 3M7IA 2F8SA 1ZH0A 2DSTA 2AEJA 3PR3A 5EKXA 3L0BA 2IZOA 1U2EA 5T8KC 1FEZA 4Y1RA 2QBYB 2IHUA 3LL7A 5CURA 2XDQA 4TMKA 3QYJA 1EFDN 1ONPA 1SD5A 2YFYA 3GZ4A 4AY4A 3JAKA 4DBZA 1H2BA 2PFKA 3RIHA 3OJXA 4JDPA 3CKMA 4NULA 3M9XA 5LZ8A 3B3FA 1BN7A 3DBLA 4LJ9A 4IXTA 1Q7GA 1TA0A 5ES3A 1SVMA 1T6YA 3SJCA 1JAYA 1R66A 1QE0A 1UFVA 1SHUX 1AQ6A 4MUMA 4BP9A 2VP6A 4FZVA 1ZD8A 3DBOB 4HUTA 1Q44A 2YWEA 4GVLA 4LA4A 4EM6A 2GARA 2N3ZA 3FVRA 5C9ZA 2RBEA 3BCRA 2QN1A 3QFRA 4KPFC 1U8EA 4ZEMA 2P68A 4L50A 5F3WB 2ZDGA 1EHIA 1XZ8A 2ZIUB 3GDOA 2TMYA 1MO2A 2Z2IA 4PAOA 4V39A 4ZWNA 3U5ZB 5BYAA 1JHVA 1WLSA 3D4OA 2P2YA 4NECA 3PEEA 2O8CB 5HHTA 4B9EA 3WYAA 2FFHA 2WFZA 3W7VA 1XDGA 3Q12A 4O33A 3MD0A 5LWQA 2YV2A 1OLOA 3QFCA 2C9MA 2E2WA 3QKWA 4S35A 3ROXA 4E31A 2D0PB 5L40A 5DP1A 1YKGA 4ECAA 3GMTA 4FFLA 4KAJA 1KYXA 5BV1A 4MW9A 4B3FX 1Q1BA 3UPUA 1VE6A 1ZMTA 2ANBA 1P44A 2Y9MB 2FWNA 4OHZA 5FHQA 1WVGA 1W5BA 3DL2A 3V4OA 4EHNA 4EJ6A 3SQWA 1RXVA 1Z17A 1ORHA 1SG0A 4TKLA 1QS0B 2P1RA 2FN9A 1W48A 4LRWA 3M81A 1KMNA 4MYRA 4L0MA 3KPUA 2XMSA 1Y7LA 1S96A 3PV0A 3UWKA 3KJHA 2IW1A 3MWLA 3MJFA 2VBGA 4GZMA 1P39A 4K9RA 5JYDA 3D3KA 1ILWA 3FBWA 3KFVA 4MQFA 4MWOA 3PI6A 2F8TA 1S8OA 3OZSA 1TK3A 4PG4A 4W1QA 1ODSA 2PLAA 3EXIA 3Q3HA 1MO6A 4YUVA 3THSA 4C6SA 2JLWA 3KB6A 3E9NA 2OCBA 5E1BA 4K3VA 4YVFA 1P1IA 4P6VF 3BJRA 3OFND 2XUQA 4F4DA 3QITA 2BGKA 3T95A 1SY7A 1QG0A 4PZ9A 5DGHA 4D4IA 1VPTA 2O3RA 4F60A 3FOFC 2XQGA 3VVMA 3ND9A 1EK5A 1ZVKA 2NO6A 3ON5A 5AVVA 1HMYA 2R68A 4BFVA 3AERB 3NIBA 4HS9A 1P1BA 1RWWA 3K05A 2O2EA 1J8DA 4BFZA 4PC1A 1Y4ZA 1I2CA 1FMCA 2XGSA 3B5IA 4M9XA 2HCRA 1P1CA 4DM3A 4NXMB 2WQ7A 3AR9A 1GN9A 1Q84A 1X8KA 4X91A 3A26A 5DLYA 1ECCA 4ES6A 5I47A 4HYQA 4AJIA 4KSYA 4D8XA 3CF4A 2GAJA 4DBLE 1F6BA 1PEAA 4EG3A 4OUKX 1X87A 3TS1A 3WRYA 1Z5NA 1JT2A 5DM0A 4QX6A 2F9LA 4AJPA 5A1TA 5JQGF 4QFMA 1FU7A 1NXXA 3HKDB 1ZGGA 2RG7A 2ZVDA 3PL1A 4QVGA 4YDHB 4ZA2A 2E1PA 1RNLA 1N8NA 2BDUA 2IY7A 3FOBA 5EP4A 4C2AA 3JRWA 3EAGA 4GLFA 3BWEA 2A5JA 5KX5A 4QPDA 3Q6NA 2QOEA 3OE5A 4N3CA 2BMJA 1HQCA 3W7AA 5HFAA 1Z68A 3R1IA 5DNDA 4DAOA 3ORYA 4WFKA 1F5SA 3BE8A 3O1LA 4FMCB 2E0IA 1IXRC 4JK3A 1NMYA 4KDFA 4P3YA 1JU4A 3N3AC 1URPA 4W7IA 1CIJA 1GEEA 5BO5A 2HRRA 4KDEA 4HAZA 4UHKA 1DCKA 4R83A 4FOTA 4TWRA 1EBUA 2YOGA 3ZW7A 3FFWA 3KYIB 1KSFX 3H9EO 4GDFA 4PBRA 3PFWO 1F2UB 4IGIA 4FE4A 4PQRA 2KPOA 2DSNA 2HK9A 3QVKA 5K8VA 4ATNA 2EKDA 1KAMA 3HXMA 4TTRA 1AA9A 1GILA 1NYLA 1UKYA 1GV1A 3EZ2A 4ZRMA 3VR0A 1L5HB 1ZEMA 4MUNA 3GY0A 2RI1A 1UQTA 2W8BB 3H7IA 3NYIA 4TYMA 4N5NA 2PNJA 1VSTA 1SKBA 1OOEA 1EK6A 3ENKA 3O4FA 3WK7A 3ESRA 3S4YA 4ZK6A 2IDZA 3ZC3A 2HNAA 3RNOA 1QWOA 3QZUA 1ZM2A 4FONA 1GPBA 3ZQ4A 4AJOA 4F9GA 2QBYA 1PJQA 3BFVA 4HNTA 2PUDA 1TW2A 2JJ1A 3TDKA 1ENZA 2X14A 5FUXA 1S8NA 4A5SA 2H4FA 4WD3A 4I0WB 2FPOA 4GKAA 2A94A 3K09C 4L5JA 2VKTA 1F38A 2VF8A 3BWMA 4DW8A 4NOJA 3GJ3A 3ENNA 4J1NA 3TTYA 4CT0A 4FIDA 2IZ1A 4JN6B 4CG2A 2WWHA 2AG5A 3P9KA 4RD1A 3B51X 5G1PA 1XEFA 4IZIA 2VA9A 3JWHA 3HY6A 4RHUA 5ULLA 1XMJA 4PAQA 4AWAA 1G2QA 2RAVA 4BLTA 1XTTA 3C87A 1GZ4A 4GPIB 1I2BA 3JD0A 2FSFA 4CE6A 3G5TA 1PAUA 5KYXB 3VYTB 1HR0B 1KVRA 1VYTA 2ZSBA 1DXYA 4URFA 4ZZ2A 1C3OA 2JB9A 3DOFA 3KZOA 3MOSA 2EBUA 4FFNA 2B6HA 1XVTA 2WJ6A 2W2VA 3OIVA 3IBYA 1E1CB 7YASA 4BZQA 5DYIA 3MUFA 2WIAA 1KDZA 5BYKA 3DFFA 3D7NA 3HUTA 1CUGA 2C9ZA 1LRLA 4IIYA 2O5EA 4J0EA 1NBEA 3DSRA 3IBTA 3EY9A 2JKYA 4I99A 1K1EA 4WL0A 1NXPA 2CNWA 1ZIYA 2GBPA 5P8WA 1UEJA 4OG2A 4MGIR 1JV2B 1E63A 4L4ZA 3NLLA 3PENA 1Z4QA 5ES4B 1CYDA 1N6OA 4L76A 5T4BA 4I1VA 1OGIA 4B33A 2GT1A 4GUAA 3JYPA 3FNHA 1XD9A 1N2JA 3FYUC 3K1TA 4PBSA 1XP8A 4W9RA 5I9SA 1Q0PA 1QS0A 5J5AA 2HPHA 2WA2A 2K2QB 4EG0A 1EQ2A 2X58A 3G8DA 3IOEA 3G9QA 1CJBA 3IEPA 4W8GA 1P3DA 3E81A 2QIOA 5CX4A 3G0HA 2R44A 1YR3A 1ISRA 2Z2YA 4FHZA 5A5GA 4GPTA 1JBQA 1TCAA 2CNKA 2QX8A 3OA2A 3RK1A 4CL0A 2ADMA 3ZWBA 4EJSB 4DQKA 4M6WB 1NF3A 5FNZA 1RRFA 5FR2A 5IJAA 4EX6A 4CIYA 3S44A 5AVSA 1HYHA 1A50B 3SD7A 3F47A 3L46A 4LI3X 3SKVA 5IWCA 2X19A 5THKA 1QYCA 1QZ3A 2XNJA 4L7VA 5DYYA 5EIWA 4P58A 3NUZA 1J8YF 4QXOA 4X7PA 5ECYA 3WIVA 4YRKA 3AERA 2R8ZA 3MRTA 2C4WA 3D6MA 2PKWA 1ISSA 2H2DA 3D0QA 3KKEA 3QUCA 1NUAA 5HOEA 5IULC 1MV5A 2HIHA 1U7XA 1Y1SA 2H92A 3RSGA 1C4XA 5LQDA 2Y1KA 3JQAD 5BSUA 1ZSYA 3BK2A 3TRFA 3L8EA 3WAJA 3MCZA 5AKZA 1IOLA 2OQIA 2YJTD 5AM0A 4I4LA 1IEQA 3T3DA 4QYSA 1X1EA 4EY5A 4FILA 1M1UA 3LF2A 5JXWA 4GM0A 2IWHA 3HKDA 3S55A 3QVLA 3PWTA 1RXUA 3DAFA 3HSKA 4J0CA 1HYEA 1GP2A 3M2PA 1V95A 2JFZA 2Q5LA 1YQEA 4QLOA 5ALPA 5M29A 4FQ8A 4S12A 1QVZA 1RI3A 4P2BA 3ICQB 1HOXA 3AI3A 3ZDBA 3CRW1 3VNQA 4AJJA 1ZYUA 3R5XA 4OI1A 5IEJA 4HDSB 3AFHA 3W5IA 1LS6A 3IAHA 2F59A 4HYEA 3B6KA 4LW8A 1L7DA 2FN8A 4C29A 1P0IA 5T64A 1JHAA 2QZPA 2LE0A 1G5FA 1NR1A 1PJZA 1VLJA 3B5JA 3NTOA 5JS7A 2JHPA 2PH7A 4B3CA 1MOPA 4PRYA 5C4MA 3IT1A 3DA8A 1Q91A 1WUJS 1SBIA 2VP3A 2ONCA 2XSZD 4LPSA 4POAA 1EWKA 1CW2B 1GPLA 3P97A 4AJKA 1TPYA 4F92B 1OF1A 2OWDA 1QGUA 1KKLA 4NLLA 3G1TA 2IKSA 5CCXA 2BMDA 4QXAA 4DLWA 3LQFA 4HT3B 5KKCA 4LF6B 1B6SA 1CRQA 1ZESA 1I2DA 1PT9A 3B5EA 4ODIA 3HYRA 4QGBA 1F2UA 1SXJC 3O38A 4HATA 4JXJA 3VV2A 2GPJA 2FZLA 2WEKA 1J5EB 5DBIA 5C8YF 1RYZA 2VJCA 2HR1A 2QYHA 1QCYA 5M5BA 1MF7A 4WGFA 4F4UA 5EE0A 2G72A 3RC7A 1I6MA 1EMDA 2CZQA 4TMWA 4OHYA 5EPOA 1L5HA 5D5QA 2W8BA 3I45A 4F6CA 2FW7A 4XSVA 3GLFA 1MABB 2JZNA 3C3PA 4YP9A 3QEBZ 1XJ0A 4DNPA 1WD5A 3GF4A 3JTEA 3NEPX 4X3OA 1J06A 4DNXA 2PCLA 5BP7A 1GAJA 4W1PA 3LQ2A 4N40A 1GITA 2QP9X 3K1ZA 4BE7B 2GR9A 1H1LB 4TN5A 3GJTA 4QDTA 4CDMA 2VAVA 1PG5A 3AC0A 3I73A 5EIFA 4BRUA 4BIMA 1YR8A 3E9CA 4TZKA 4LBZA 2YY5A 2WP0A 2A5YB 3IUYA 2CXRA 4IWYA 1S6YA 1W4AA 1B3BA 3SX2A 3TG2A 2B82A 2J5RA 1CKEA 5AR1A 3LO8A 1G9XA 1CT9A 1P7WA 3MPOA 4NIMA 3H6KA 3OP4A 4EB0A 2W2LA 4F8EA 2UYQA 1V1JA 1ZGCA 2J09A 1W93A 2OZPA 1MOQA 1ML3A 2HSWA 4H59A 3UG7A 4F7WA 1F7UA 1TJ5A 2JLQA 1TT5B 2O2XA 4UD2A 4KO1S 1E69A 1UL1X 4ISCA 3F5QA 4PY2A 5COQA 2AE1A 3GLHB 3NBKA 5KVQA 1G59A 3LXUX 4IH9A 1P7PA 1V6CA 1Z88A 2PN1A 3L8ZA 1EJBA 3LX8A 4MGKR 5KYXA 2UXBB 4RDCA 3BMXA 3PS9A 4V02A 1KI3A 1B0UA 2GASA 4UMVA 2DBVO 5SZJA 4IVNA 3STWA 4R6XA 5JZSA 2XBMA 3CLRD 2P3SA 3WRVA 2ZU0C 3AV3A 1G8JA 3NDIA 3NNNA 1O0CA 2VIIA 5BOVA 5IUJC 3Q0TA 4V38A 4JJIA 3PHBE 5FA5A 1FUYB 1FXUA 3A2LA 1PNQA 4IIBA 3BXGA 4AUMA 5TGZA 2QL6A 2VPQA 5G4LA 4C3UA 2QY9A 3MGBA 2PVSA 2AI3A 2O20A 3COVA 2IUEA 4CZ2A 1FJ2A 4YO7A 3W6ZA 1G41A 2YZKA 3PD1A 2E89A 2OBMA 3IMCA 1CZKA 3ZU6A 4QXPA 3BH7A 4PHCA 5BRJA 2ZTUA 1C9NA 2QVYX 3NXKA 3HMKA 2WSIA 5JISA 3TNJA 3P2YA 1KIFA 3L7JA 4I55B 1NAHA 1FC0A 2I3BA 2ASEA 2J3QA 2P9EA 1II8B 2HLPA 2PZAA 1ZC4A 4KBYA 2ODEA 3VC1A 4K6MA 3UQZA 2CFCA 1ONOA 1ZVQA 5JCZA 2OM2A 1ZN8A 2OFFA 1GZHB 4EJSA 2EWWA 1Q1EA 5AW1A 1FSZA 1IBKB 1ZNZA 3R5HA 2BZSA 2OFWA 1VYUA 5JAMA 2OHGA 1RLOA 1IUKA 1R0BA 1STOA 1X7HA 3KD3A 4KWEA 3RSCA 4CIVA 5ELXA 2C94A 1CDZA 2Q4DA 4E88A 3OVMA 1V8PA 3QU2A 1RC0A 4G1FA 1LPOA 1G19A 3H8VA 4BNMA 1XK7A 1KI1A 1R0WA 1WUTA 4G67A 3NANA 3PUVA 4TT3A 2ATCA 3MLAA 4F21A 1AUQA 2PUFA 2VEOA 3B1YA 2IS6A 3HDGA 4B6RA 4PC2A 1EZ1A 1RPAA 4WA8A 4HPWA 5EJ4A 3TFOA 2NZJA 3N0VA 4WXRA 5A6SB 3C6QA 2GF2A 3O8BA 4ALKA 5C1BA 3I04A 1E5QA 3ADDA 1T9HA 1XPRA 2A0UA 3DV9A 3RT1A 5JCJA 4PC7A 1P1KA 2VNIA 2AH5A 3A9TA 1RM5A 1J39A 2ZBFA 4I9HA 4Y0VA 4EELA 1NBMD 3AP2A 1OTYA 1KSHA 9GPBA 4OBEA 1JA0A 1U7UA 1ECJA 2PX2A 4BP1A 1AXGA 1T29A 4X71A 4EL0A 3F3KA 1BDIA 4YMSA 2BMFA 3LQYA 5FUVA 1BYIA 3Q5EA 1SCIA 2Q7XA 1UPTA 3OIFA 5FOWA 3BXEA 3KR9A 1Y4SA 1E20A 2GM5A 1DLIA 1MJNA 1C29B 3AZQA 5EUMA 3RV3A 5A0VA 3JRXA 3E22B 3MN1A 1YB5A 4XYLA 2NVWA 4TZ0A 3I9KA 2Y93A 3WB0A 4MWGA 4X8MA 4LC9A 2OP0A 1NQUA 4OMFG 4UXHA 5AKXA 3GBPA 2ZDQA 5DGIA 4GEGA 1VHLA 3RB8A 2MSNA 5IZCA 4HN9A 5H8WA 1XNRB 4ZXPA 4R2XA 4Q3EA 4AMZA 1E1RD 1NDQA 2QD5A 1ACMA 1TECE 3DLTA 4FM9A 4KL8S 1MAUA 1HDGO 2G71A 5ALZA 4GDMA 3AIMA 4L0QA 4TV9B 1R16A 2IXBA 4F7DA 3OY2A 4PX3A 2A0WA 1DKPA 2XECA 5ARDA 3B3AA 2P7HA 2C9CA 1K7XB 1QZZA 3MT9A 3P9SA 4YUXA 3LRTA 2FB9A 1N3BA 4WRRA 1Y3CE 4JROA 5BQPA 1Z6TA 3D9QX 3DE0X 2ZTLA 3FNIA 1KRXA 1L1QA 4JXXA 1MABA 3Q7TA 2IYSA 3D02A 3HGMA 1CUSA 4PM4A 3BT7A 1GRQA 4UCFA 3ZWYA 4MQ4A 4FCWA 3QY9A 4LBWA 1G3MA 1QU3A 4Y2SA 2CUKA 4NNOA 1H1LA 1NURA 2NSDA 2L19A 2PKXA 3N8DA 2RGWA 4RM3A 3X1KA 1H0RA 2BGMA 5MFZA 3PGVA 3I76A 3P5BA 1EDZA 2WQZA 1TYDE 2IYYA 3WK5A 5DN9A 4KN5A 4X20A 4R2LA 5E38A 2R9VA 5LQNA 1Q7EA 4ROSA 1DBSA 3OPQA 2EXXA 4LCJA 4ZO4A 5F7OA 3UOWA 4YY3B 3T9DA 1V96A 4ZMSA 2Q0HA 2AG1A 2E1RA 2XA1A 1VM6A 2PX0A 1EAYA 4P93A 1TT5A 5CLIA 3LFHA 4MRMB 5GGXA 3TXAA 4BMSA 1UANA 2D1RA 1PZHA 4ENQA 2VDUE 3GLHA 3LDAA 1Y5NA 1JKFA 3A58B 4KTTE 3SC6A 5JVDF 3F7NA 2W6ID 2NACA 4ZYZA 2RKBA 1Z4NA 3QVJA 2IOYA 2V65A 1P0FA 1M8GA 4OLFA 4U7PB 3DCIA 1I7DA 2ODQA 3H5OA 3M34A 3VKHA 5KYTA 2N1MA 5FTMA 1ZN7A 4EMUA 3WL6A 4NICA 4OY3A 3PXGA 4JGIA 5IN4A 2ZUFA 5EHXA 2GK6A 4H0NA 3F8SA 3KUXA 4ZAYA 5JWOA 3RWOA 2RHHA 1NL3A 3H1PA 4AMBA 2C8KA 4NABA 1E3EA 4BX0A 2IZ5A 4JI2B 3HC7A 2Q50A 3H8JA 1F1BA 5J23A 1T6ZA 5JAZA 2AN9A 2HJSA 2V6MA 4I8XA 5E0KB 3TKLA 4CQNA 3BFPA 4KXWA 1QX3A 2IQ5A 1PNTA 3NHFA 3BMOA 3V33A 2IPMA 5J4KA 2XUFA 2H5EA 3SIXA 5ALNA 1E8NA 1II8A 2BFCB 3NBAA 3O8RA 1GAWA 4P3KA 1O94D 1NIPA 1ACLA 4M7WA 4AYTA 1NAIA 2BJHA 2QLMA 5K3EA 2O8FB 3MQ2A 3P4UA 1KO4A 3R3VA 1NJSA 3KQPA 2RGGA 2ZWOA 1DRJA 3MWKA 3PRKE 4I6GA 1MFPA 3IBFA 2OXEA 3QPAA 3JWIA 4RMIA 5AM2A 5HOQA 1LDGA 4FGSA 5CPBA 3M83A 1ADCA 1ZSVA 2CFOA 1XDDA 4U7WA 4JYCA 3C6KA 1UWLA 1T9CA 2EAUA 3FJYA 4Y7DA 4CFZA 4DLYA 3L8MA 4CTKA 1W49A 1ES9A 2PMKA 2R1TB 3BL8A 3CJTA 4MVYA 1CZLA 2FEOA 4RVDA 3V80A 2HJVA 4WZAB 3AKCA 4F3CA 1E1QA 1MUUA 1RHKA 4TQGA 3WLAA 3A1TA 4HLQB 5HJ5A 4WY2A 2W9XA 4TMXA 4BLOA 1SVUA 2OZLB 3HBFA 4IMRA 3WYNA 2ZUBA 1EZ4A 1P31A 5A6SA 3UK7A 5ARBA 4X7MA 1WCWA 1HDXA 5CXSA 1DSSG 2B69A 1GYQA 1ZC3A 2GJSA 4IO1A 2IHZA 3ZJUA 4IJWA 3WFZA 3DR3A 1EGHA 3E3AA 1Y3FE 4M1QA 1FFCA 1O87A 2G25A 3ELYA 3PE3A 3V4SA 5EJ9A 1XAHA 5DISB 3E7DA 3COJA 2P69A 4JL6A 5AUNB 4RKRA 3ULKA 3IOBA 2WTUA 2I78A 1ZICA 4FLFA 1SHJA 3V9PA 2FVYA 4UE6A 3WGMA 1S3SA 3QX3A 2C42A 1Q92A 3QLVC 4O8ZA 3RFUA 4YO8A 1JJAA 3E22A 3KSMA 3HLYA 4OSPA 4E2XA 4KKXB 3NWJA 1CZUA 1U65A 4KWTA 4ZCSA 1NBME 4KP7A 4CIDA 2C7VA 3UTDA 2QA5A 3LGSA 4X8HA 2QSZA 1YDEA 1DAFA 1NY6A 3HJTA 4RKYA 5K3SA 5CT8A 3ZTTA 1VJ1A 2FN4A 2XT9A 2WK1A 2NVOA 4TVSA 4OP3A 4B5KA 1UCFA 3GJSA 5ALIA 2BFEB 5E7MA 2DOKA 3EQ2A 3NS7A 2C00A 1D6JA 3IAS6 2RGBA 2ECFA 2LRHA 2YHSA 3NHLA 3WLPA 3FNRA 1DXHA 1UZLA 4I1PA 2MSCB 3NYWA 4MX8A 2Y6VA 1I0LA 3D7RA 5JANA 3HJAA 3LC1O 1CQJB 2VK8A 1NXQA 1I80A 2DY1A 4HAOA 1DKLA 1ULTA 4TV9A 1GPYA 5LLDA 2BV3A 1VI6A 4DFDA 1JHMA 2OKCA 3L0ZA 4FYVA 2I7DA 2L2QA 1QAQA 4NZMA 3TCNA 2I1VB 1ISJA 5J4HA 2VXCA 3QW4B 1EINA 1CJMA 5BVHB 4IDEA 5K2MA 1U3GA 1W9HA 2HY7A 3FM9A 1Z8DA 2RHRA 5EFZA 4GMHA 1ZRSA 3HEBA 3B13B 4OGWA 1SXGA 1W0JD 3W3AA 2HBZA 1HQDA 4Q3AA 1M83A 2JIMA 3D1LA 3DFKA 3WJ7A 4DJEC 1DAPA 5LP6F 2JW5A 3LGAA 1UH5A 3ASZA 4K6HA 4NR0A 5DHUA 1DG1G 2DQKA 4ZEVA 5GONF 2ILVA 1CBUA 2QM3A 2XWQA 2OLJA 1B93A 5FQNA 3E4CA 4AP5A 1EH5A 4B2PA 1Y89A 3AR2A 3LPMA 3NATA 2VXOA 5FOUA 4DV1B 3TN7A 2VQSA 2D62A 5DCUA 1QQ7A 4R1MA 1KKMA 4LSWA 1B42A 2AFIA 3ODGA 2C7BA 4KRYA 2PGNA 3DM9B 5DT9A 3FWNA 3RHSA 4OIMA 5BSHA 3GXBA 3SC2A 4FB5A 2WC1A 4I6EA 1YZYA 5ALSA 2CFIA 2OGZA 4F04A 1J5XA 1H6CA 4WECA 4QGSA 4BLQA 3O2JA 3KSAC 4CKEA 3GP8A 1U7OA 3IPRA 3BXFA 1J0AA 4G65A 4TQAA 5B1YA 5KAMA 3FYTA 1EJ2A 2C7QA 1WOMA 2OBYA 1GPKA 1VKZA 1MW8X 3OZTA 3ONFA 2AOXA 2GERA 5BV2P 1R00A 3G7NA 4PINA 4AMYA 1S3IA 2WOJA 2JHFA 1EFCA 2PT5A 4NQZA 1MRNA 1P0CA 1QR2A 2BFDB 1R8YA 2BY4A 1RHUA 3M3HA 3P9ZA 2D1YA 4MS3A 1VRCA 5FQOA 1O0SA 3FPFA 4FS8A 2CFRA 2PEZA 3LIIA 3QKTA 4JCCA 4ND6A 3WK8A 4F3RA 3L8CA 5JZOA 3HLTA 3P7MA 5ICGA 2BLNA 5CBKA 4JCOA 4JXZA 1YS1X 4PZYA 1L5VA 4I1UA 4PSUA 4ZRDA 3VDMA 4KPGA 2ZB7A 1KDRA 3PE4A 1LS1A 4LVNA 4WINA 5FFMA 4DT1B 3GN2A 4HX5A 3IJ5A 4TLAA 3FI9A 1J33A 2X3YA 5JV5A 3SJAA 3BOSA 1GUZA 1DX4A 1F0KA 1G1AA 2JGKA 3EDCA 2YRXA 3FPAA 3ZWXA 3FNQA 5AKLA 5BSRA 2A1TS 2BFCA 3WYDA 2JFBA 3LUDA 5IVHA 1VYHA 3LOPA 3K70C 2PWPA 4YYEA 2BELA 4KGVA 2O8FA 2BLLA 3G2JA 4F06A 1QF9A 4IILA 2XYPA 3WZMA 3PNBA 2DM6A 4F3KA 4NVRA 4EW1A 1KR2A 5FD8A 3CRZA 4BB6A 2PSJA 1I24A 2PSHA 3H2BA 4B4KA 1SK9A 2RGNA 5KUTA 2R1TA 3EB9A 2V96A 4HPJB 5FUBA 5CVCA 5EMLA 3UT5A 1OAOC 1S8FA 1ZGAA 2WJJA 3Q87B 2XUGA 3N2LA 2GVZC 3FKSD 4BWGA 4P31A 5EGNA 1QIGA 2OZLA 1RW4A 4OQFA 4WN3A 1W9MA 3CEHA 1DTSA 1NUPA 1XMVA 2QV0A 3KPWA 3A7EA 4MVJG 2P62A 4B35A 3ENQA 3D8UA 4LXGA 5CUQA 3HDQA 1L3IA 3LCVB 3A1VA 1AIPA 3ORQA 4XCQA 5J59A 3CB4A 4GEKA 3TFWA 1ODCA 5FH9A 2CKDA 4LJ7A 4L8FA 2ARKA 2DFDA 3R0JA 3VC2A 3MMXA 2XUDA 3NBUA 3ZBTA 4TMYA 3PC3A 4Y3UA 3NHKA 3K0EA 2MTBA 4PYJA 1J49A 3GEEA 3KFLA 3PQFA 3WICA 1E94E 2ORED 2DRIA 3C7KA 4DSNA 3K92A 4MIYA 4HN4B 1MR3F 1ZG3A 4X6XA 4IXWA 3V00A 5BSMA 4AXBA 5K45A 1Q0UA 4U2GA 1F8XA 5L4SA 4MJXA 3D1JA 1L3BA 2HV8A 3MGKA 1J0XO 2IXEA 4HWGA 2V74B 3TXYA 3O4IA 3WNZA 1JHOA 4MJLA 1CY8A 5E4YA 4AF7A 2WJ3A 1QBGA 2BFEA 3H19A 3TVDA 4CUKA 5KYGA 4BJHB 2JLUA 3D6AA 4N8EA 4D9BA 4N41A 3BCHA 2VA8A 2WVGA 2EZ4A 3IHKA 3JQFC 1IRIA 4MJ7A 4KFUA 5EKDA 3ZLJA 1CQJA 1GZUA 2PUHA 1CSEE 4X6YA 2FW6A 2PO7A 2PSFA 1DDIA 1MW9X 1SIBE 2RHTA 3DULA 3HMQA 3KOUA 3KYDB 3NPMA 4BO7A 4BVKA 2OR3A 2QZ9A 3I30X 1Y7IA 4L6IA 2X41A 1A2BA 1E79A 1P3Y1 1X0XA 3EUWA 3IE2A 3L43A 3L7LA 3N59A 3GJ0A 4HTAA 5BVHA 1ZX1A 2P6OA 2ZW9A 2JGRA 2XODA 4HUJA 4FBMA 3IO3A 1XWWA 3W6PA 3PWZA 3A32A 4G1BA 2PGDA 1WXWA 3E1GA 3G2QA 3Q7EA 4RABA 1ZISA 4F46A 1R0KA 4FYMA 3MJVA 2ZCUA 2FEKA 1H5QA 1YMUA 3NASA 5AIAA 5SZKB 3SGLA 3W4IA 4B4UA 5CFMA 2D0DA 5JH7A 1CEEA 3DE2X 3EZ6A 2RARA 4O4IB 3ACCA 2FSUA 2I7TA 3LBIA 5AI0A 3ZE9A 4ARZA 2HI0A 4L8VA 4QQRA 5CG2A 3REFA 5C5CA 3WJAA 3PPIA 4YLYA 3B38A 4O1MA 4P4UA 3T54A 4GKBA 3UJ7A 5A4JA 5G53C 5J2UF 1G4UR 1S7GA 4J0QA 2R7AA 5CNIA 1AN0A 2EV9A 1Y98A 2ZK7A 1SCJA 2HQSA 3DEKA 2JDIA 1A95A 4L0CA 4G07A 1GL9B 3O92A 2VCHA 5K0JA 5BT9A 1I2AA 4TUYB 4L15A 3UB4A 4K03A 1Z5VA 4MEJA 1KAQA 4TLMB 3DW1X 2ZYRA 1Z34A 5FFNA 3CX8A 4R69A 1K0FA 1PJRA 1UXOA 3HXTA 4OFZA 3T7CA 4A36A 1SXPA 3ND8A 2J87A 4O4JF 4LYEA 1GGKA 4Q1AA 4RS3A 1FFHA 2MYNA 4BBJA 1B00A 4ZHSA 4PO8A 3USCS 3BTSA 3LUFA 4KE6A 3VOAA 1IIBA 5K6AC 4S1VA 2HGZA 3STXA 2BFDA 1Z29A 3I12A 4FMDB 2V7PA 1XQ6A 1DXOA 3KKKA 2HKIA 3KZCA 3DPIA 2X8WA 5I8WA 1JR6A 2EDAA 4QTXA 3OEHD 4V3BA 2PUAA 1YDMA 3E9QA 2GEJA 3DZGA 1O03A 1ADBA 4U7GA 4BNJA 5KTKA 2DETA 1SIUA 4YRRA 4ZVQA 2VS1A 2NSHA 2J9XB 2ORWA 4DT1A 4QXRA 4CMIB 4HMPA 1T8RA 3K6SB 2Q21A 2HUPA 4DYVA 4H16A 2ORIA 2Q2QA 1GR0A 1W4BA 2O3TA 4J9UE 4RFVA 5JAHA 3EVTA 4RHXA 3OX4A 1QR6A