3PD0A

Caspase-3 e246a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
238
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDSGIEKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATAFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic, enzymatic and structural effects of removing a salt bridge at the base of loop 4 in (pro)caspase-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
total genus 86
structure length 238
sequence length 250
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pd0A00
1NMEA 3NR2A 1NMSA 4JR1A 5IC6A 4QU0A 1SHLA 3R5KA 4JR0A 4NOJA 3H11A 1IBCA 1QDUA 4NOLA 4EHNA 1CVRA 4JJEA 1NMQA 4JQZA 4EHDA 5IBCA 4FDLA 1GFWA 4ZVUA 4FXOA 1SHJA 4NOKA 2CNLA 4IEFB 3QNWA 4NBKA 3S70A 4JR2A 4ZVPA 3R7SA 5IC4A 4DCJA 2XZDA 4NBLA 3V55A 3H1PA 4FGUA 4EHAA 5LU9A 4FEAA 4LSZA 2XZTA 3D6MA 4JJ7A 4D3ZA 4EHHA 3PD1A 2CNOA 4QU9A 4N6OA 3K7EA 3P4UA 5IASA 4QUGA 3GJTA 4I1RA 3V4LA 2QL7A 2Y0BA 4N5DA 1RHRA 2HBZA 4QUBA 3R7NA 3D6HA 4EHLA 2C2OA 1NW9B 2XYPA 2QLJA 2H48A 4HQRA 4DCPA 1GQFA 3NS7A 1RWKA 2H54A 2AR9A 4QULA 3UO8B 5IAGA 1ICEA 1RHQA 4NBNA 2Y1LA 4QUAA 4QUIA 4QU5A 4PS0A 1RE1A 5IABA 4ZVTA 4EJFA 1RWOA 2H4YA 3SIRA 3PD0A 1I4EB 3UOAB 1RHUA 1CP3A 4IYRA 2P2CA 3P45A 2XYHA 1RWNA 3R6GA 1M72A 3SIPA 4DCOA 1QX3A 2NN3C 1RHMA 1RHKA 4N6GA 2QLBA 3D6FA 3KJQA 4JB8A 4QUJA 3R7BA 5IAEA 3H0EA 2FUNB 3EDRA 2FQQA 2J32A 2C1EA 2H4WA 4PRZA 3S8EA 1I51A 3DEKA 3PCXA 1K88A 2C2KA 1PAUA 4JJ8A 2HBRA 3RJMA 3V3KA 5K20A 2QL5A 4N7JA 4EHKA 5LUAA 5I9BA 4HQ0A 1PYOA 4PRYA 2CDRA 4ZVQA 3GJSA 4JQYA 4ZVRA 1KMCA 1RWWA 2QLFA 4QU8A 1SC4A 4QUEA 3V6LA 4PS1A 4AWAA 5IANA 1JXQA 4D3YA 2H65A 3GJQA 2CJXA 3DEHA 3V4OA 2WDPA 4QUHA 1I3OA 4ZVOA 4QTXA 5IAJA 5IBRA 1RWMA 4I1PA 2CJYA 3KJNA 2H5IA 3E4CA 2K7ZA 2H5JA 2J30A 3ITNA 4HVAA 4NOMA 5H0IA 1RWPA 3OD5A 5LUBA 2J31A 2J33A 3H11B 1RWVA 3IBFA 5LU8A 2HBYA 3V6MA 1QTNA 4D3XA 4N7MA 3EDQA 4M9RA 4QUDA 1BMQA 2QL9A 1F9EA 1SC3A 3GJRA 3KJFA 4ZVSA 5IBPA 2C2MA 1F1JA 4QTYA 5JFTA 3BIJA 2CNKA 2HBQA 3DEJA 3H13A 1RWXA 3NKFA 2CNNA 4N6NA 4AW9A 4EHFA 4AWBA 2C2ZA 3IBCA 1K86A 2DKOA 2XYGA 1RHJA 3R5JA 5IARA 2H51A 3R6LA 5IAKA 2FP3A 5I9TA 1I4OA 1SC1A 3DEIA
chains in the Genus database with same CATH superfamily
2JW5A 1FFDA 2WI8A 3BRCA 5DNDA 1VP9A 5TMEA 4JENA 3GZ4A 2ZTVA 2CLDX 4Y2VA 3ANSA 1RM5A 2P9YA 3ZY2A 1B42A 1XK6A 2GERA 4BO0A 1A9XA 3CGGA 2R65A 2XA2A 3FDIA 3VC1A 5KZMB 5BSEA 2CYCA 1PK8A 3D6NB 3PGJA 1P1CA 3O9VA 3R3HA 4LKOA 1G2OA 4E22A 8GPBA 1GTSA 5CFOA 1D2CA 2HRCA 3ZEAA 1X2EA 4NVRA 2YWHA 1JWAB 2UVPB 1Z26A 3NU1A 2JLXA 4QRHA 1MAHA 4NDAA 4FN5A 4F8EA 3DFIA 2WB2A 1RYBA 2VA9A 1FFEA 4K9MA 3VYTB 2QLMA 4B5LA 5FL7A 1YB5A 4I9NA 5H3CA 3UGKA 3IDFA 1YQGA 4P80A 4PW0A 2INGX 3V8PA 2A1TS 2NPIA 1VCHA 1UJBA 4PLZA 4TUYB 4Q4CA 1YIDA 4BNIA 4LVUA 3KXIA 4C4RA 2ESRA 4KXMA 1ZICA 3HY4A 4FCWA 2GK3A 1R8YA 4XD7A 2ZS9A 1ZVJA 4U2GA 5JMTA 2GRUA 2XUQA 2IHNA 1YQDA 2WYIA 2E87A 3GNTA 1QGAA 1N2JA 4MHSA 3WRXC 1THTA 3K53A 4MVJG 4F3NA 4BS9A 5MDHA 1R0XA 2GASA 2KBFA 4LVOA 5C51B 3FCUB 2VAMA 3AR5A 1RWOA 3D8SA 4HNSA 4KQWA 4KR0A 4CKEA 3MLAA 1R5BA 1CYEA 2V65A 1K6XA 1YTLA 3C3PA 3AJ8A 3ZK7A 4DY4A 4R5MA 1PZMA 3ZDEA 4DCOA 1O77A 3EXG1 1RHMA 3SS8A 1K9SA 1DJOA 1OILA 1X2BA 2JB9A 2W93A 3GPIA 3HI6A 3M1AA 4I4TB 2QLBA 3LT2A 1UINA 5LB2A 3H6GA 4KIUA 3SU8A 3T54A 3EOZA 3FPHA 2E2WA 2YY6A 4KK3A 1G7TA 4OGLA 2CVZA 3VHXA 3GFVA 4PX3A 4PZYA 4PRZA 3ETLA 1UDAA 3B1VA 3SHVA 3WA7A 4JNKA 3SSAA 2XVMA 1FYVA 4RL6A 3V9PA 4JDPA 1CQXA 1YR8A 5AFSA 1CUSA 1CUYA 4OBWA 1WD5A 5DGCA 1DQPA 3R9XA 4KN5A 4IIEA 1EG7A 1CG6A 2HWWA 1OT5A 1OZGA 1JVBA 2ZIAA 5G02A 5FYDA 1D4AA 2KWIA 2VR1A 2MSLA 1E1YA 1X80B 4BP8A 4DY6A 1IQRA 3PPIA 5TQVA 4XVUA 2QXYA 1SO8A 4OL0A 2RBGA 5KNDD 1SUCA 3DKPA 4BC1A 2GPYA 5C3MA 1YASA 2X6QA 4C0KA 5JC8A 2PVSA 3ONEA 4IIBA 1W5AA 3VPCA 2ZQZA 5JHHB 2REXB 3RASA 1WPGA 4ZDWA 1FSZA 4HT3B 4GX0A 2C92A 1UM9A 2I6QA 5FUVA 3AEYA 3NAZA 1XP8A 1D5CA 1DEOA 1KA9H 1H65A 2ZDHA 3OFKA 1FLVA 1UCFA 3L8EA 1WV1A 4G0YA 1QQAA 4OOEA 3IBGA 2C1ZA 4PTLA 3SI7A 4FD2A 2QVCA 4CTJA 3I72A 1KR5A 3FSJX 3ZU6A 2FKNA 3NIDB 3DMTA 4BZZA 2IYLD 3JQ9A 4UNSA 3R2JA 2UUAB 1KOJA 1ECGA 3CRNA 2ZI9A 5CFLA 1T4DA 3IBCA 3O21A 4ZCQA 2H9AA 2VZ8A 1QQ6A 2C0PA 1SJ9A 3C1UA 4LV8B 3KHTA 4RTJA 3M4JA 5JR3A 1QFJA 3QVGA 4HDRA 4ASUD 2LE0A 4XFDA 2JI7A 4I14A 4YO7A 1CIJA 3PHGA 3PNLA 1SHLA 2QN3A 5L95A 4Q37A 4LJYA 3A36A 3VI3B 4WZBA 1O94A 3W2TA 1YS4A 2P9QA 1HEYA 1LTKA 1SKYB 3WQQA 4BECA 1J0DA 4F92B 3VJRA 3NHFA 1P6UA 4L74A 3LO8A 4PSUA 4FE4A 2DKFA 4MROA 4WASA 4C76A 4PXYA 5EY5B 4H6PA 4NEGA 5J5CA 1YRHA 3VA7A 1XEAA 4OFXA 1VG0B 2GN8A 4IUDS 4E15A 4YCNA 3BXOA 1RACA 3LYHA 4IDNA 4R71A 2JZOA 5CB8A 5KTSA 3KKKA 3LUHA 3M6UA 5BNWA 1WXHA 2H2IA 2W6CX 2YWDA 1WCYA 2C8KA 3WHKA 3LS2A 3LXRA 4L78A 2QW1A 5LNK1 4JBIA 3RRFA 2EKBA 4LHWA 4QBFA 4XPZA 1X7XA 1Q7BA 2GK6A 4WK2B 1KE1A 1JHDA 3WYAA 1T2AA 3IUMA 1ZDMA 1OASA 2DF8A 5D1NA 3V80A 4BMYA 4M1YA 3GT7A 1H5NA 3EMVA 1B6TA 1Y4DE 3IVAA 3WGVA 5KCZA 5FHRA 5THXA 5DW3A 1YT5A 2HWXA 2XQKA 1X19A 2C1XA 4MQFA 4R9RA 5ENZA 5G41A 3AX6A 3IQGX 4N65A 3WB0A 2IYRA 1JQJC 3NOQA 3JARB 3QYJA 2PMCA 4D43A 3PLNA 1Z5ZA 1XZDA 1NXSA 2JA1A 3K09A 4M0EA 5K8IA 1GSHA 2A9OA 4LZAA 2PH1A 1PG5A 1H2XA 4Z7JA 5IHPA 2YTZA 2QY9A 3ICWA 1YMUA 4OGFA 5K1ZA 1X3LA 2C5BA 2WD7B 2C20A 4KRGA 1Q6ZA 1T36B 3IR5A 4IINA 2GPWA 3SWWA 4TSFA 5KB3A 1GG2A 1SG0A 2KHZA 3RNLA 1DFHA 3QNMA 2YHIB 3N2GB 3OLVA 4TRMA 1EFVB 1S3SA 1COWA 3ZJ5A 3N39C 3A6DA 3HB4X 3OLZA 1D03A 4INPA 4QYSA 1A7JA 2BGLA 2DSTA 1Z36A 4PAQA 5F9HA 3EMDA 4AI6A 4RZIA 1A9TA 3QUCA 4C7BA 1Y82A 2PEYA 1W4LA 3OE1A 1YQXA 1JTFA 5SICE 2YX1A 3U3ZA 1T26A 1P1FA 2Y0PA 1Y4SA 2PSFA 4BV3A 1C2TA 1PJSA 1UFRA 2JATA 1CUVA 3OEHD 5TF4A 4BMOB 1V4VA 5EPOA 1KBZA 1XXHE 2VHCA 3RRBA 3F74A 4NYIQ 4AJ2A 1XDUA 3SICE 3JQFC 4G86A 5KMGA 1P77A 5CVUA 5AQ1A 3TIFA 1EE2A 4HDNA 1GP2A 1Q3HA 3OJCA 1LPSA 4L4YA 4EVQA 1YR2A 4PINA 3MB8A 3F49S 4FOTA 2AG8A 2HBYA 3JRXA 4F4FA 2XGOA 1AGYA 2W0MA 1XV5A 3D6AA 3GK3A 4QUDA 4EPYA 4IVPA 2DBRA 3LFHA 3T5DA 1B73A 3ZV7A 5EXPA 3OU6A 3VSCA 1X7WB 1CY4A 3WNCA 1R5OA 1UJMA 3WLEA 4BE7B 2R62A 4MARA 4AXBA 4MJ3A 3Q0TA 4OBEA 1SVUA 2OORC 1SKUA 3HLTA 2C4KA 4RYLA 4BU0A 1GYPA 1I2AA 4MGEA 4OFZA 5CM2Z 4HAVA 3ZD6A 2ZTMA 5DRYA 3JQEA 1NRJB 4EP1A 1YS9A 4RTRA 1DKUA 3AFHA 3BYZA 3HMKA 2FPWA 1BXRA 2O3TA 3CG0A 3SIWA 1T1SA 4I9HA 3W9YA 2R8PA 1A8HA 4ZHQF 1PE0A 1T9AA 4DNOA 1X9GA 2HT1A 2O5EA 2MR5A 1F06A 2Z3VA 4A8JA 1KO8A 3IEIA 4DV2B 5AI4A 3NV9A 4YJ3B 2XDQA 5DLDA 2Q5QA 4BZQA 5KOHB 4TTAA 1TTQB 3PR2B 4I1SA 4U8HA 4NXMB 1HL3A 1DC4A 2DTDA 3GLGA 2Y27A 1JB1A 3M3PA 1IM2A 1N5IA 4OJKA 4WLVA 3ZWYA 5THKA 1DWPA 2YOHA 1H5QA 1F14A 2FF5A 1H0SA 5TPZD 1WSAA 2AFRA 4M1MA 2NW6A 4BO2A 1G20B 1JSZA 1NATA 5DMXA 5J2UF 2XQIA 5CR9A 1A8QA 4OJNA 2OCAA 4MI1A 3TF5A 4OHWA 3UHFA 2PKCA 1VHDA 2KYRA 1OFVA 3ZV5A 4UC0A 3OCYA 2GFQA 2JCGA 3IKLA 5E3IA 2QM0A 3OX3A 4HS4A 3QVLA 2GZ3A 3UK7A 3DBVO 2HIMA 3JRWA 3OQNA 3Q0EA 4AKTA 4TS3A 1V8ZA 3K94A 4IQFA 1Q95A 1OYOA 2HMVA 2H4YA 4UNQA 2E1PA 4C5BA 2Q07A 1C0EA 1RCFA 2WJPA 2KLHA 2JFFA 1G21B 1Z5PA 2FX2A 5AXDA 2ZVDA 2C5AA 1HPLA 5HS6A 5GZ1A 4YMGA 2Q5JA 1U1DA 2VK1A 4L51A 3TD2A 1GG9A 3L07A 3W8FA 3I2HA 3WJ1A 4AK9A 2YZNA 4BEWA 4I19A 5FOSA 1UAGA 3QLJA 4H6WA 4IL5A 3H8JA 3TDKA 4TYYA 4UTRA 1EUYA 1V6SA 4L3OA 3TS1A 1D2MA 2GQ0A 5JW6A 2Q2OA 2P3SA 2K2QB 4OYRA 3LG2A 3VMFA 1BC5A 1JHUA 5LL6P 2XW6A 3E9DA 3OUZA 3V8MA 2NM0A 3KZKA 5AOBA 2E0IA 2GM5A 3HR7A 1RWQA 2D74A 3STVA 3I1FA 5ALNA 1W93A 3RFCA 3ZBUA 3OOEA 3V7UA 1G1MA 2CXSA 3DTTA 3MCTA 1CZRA 2BEJA 1COZA 2PSHA 2WSYB 3E7XA 4M6WB 3WL5A 4XDYA 4YRGA 5J2TB 4AG3A 2SKDA 1CR2A 4HDOB 4KR9A 3N8HA 3JVDA 1A8SA 5CTAA 3M4NA 5DNUA 4ZU6X 3JAMA 3DTYA 3AGPA 3GIDA 3KKNA 5DGTA 4IO0A 3GUVA 3KOWA 4MIOA 4PZPA 1BJKA 4KAJA 1S2MA 1S1MA 3DFZA 4NJEA 4O59O 4FIZA 3WWYA 5JJBA 1EUCB 5DYGA 4XSHA 2C57A 2PX2A 4B4WA 1LTHR 4XCXA 1RBMA 4GPZA 1QYWA 1CS0A 1MABA 2I1WA 4G8JA 1FUKA 2G5PA 4X92A 1N2BA 1ZGBA 4XTCS 1DB3A 2YRWA 4R69A 1BMQA 1XVVA 2FGJA 1E9DA 3MJFA 3NHMA 4G0OA 1NSYA 1ZWLA 4XDZA 3WSTA 4CQLA 3QELA 4RDIA 3H13A 2NUAA 3KAQA 4BY9E 1RI4A 1O0SA 4NCJA 1HTTA 4XFJA 4EHFA 3S81A 2YY7A 3MWYW 3Q3EA 5JFGA 1E2HA 1YCFA 1OREA 3TCKA 1FP1D 1X1DA 2JLQA 1QG6A 4QBGB 3G9TA 1T5TA 2ZJAA 3H2GA 2OCYC 4HBGA 4JP5A 4Y2SA 5ICFA 2NAFA 3KNZA 1T2EA 2SNIE 3MVEA 4PAWA 1YFJA 3LLMA 5SY6A 2FEPA 1JNXX 1YRQA 1ZUD1 2FPPB 3ET5A 4Z1MA 1CW2B 3A0RB 1IN7A 3NWOA 1I7DA 3QTLA 1Q7TA 1CDZA 1ZRNA 2LCFA 2ZTUA 3MUOA 1OH8A 5LD2B 1GAXA 4K40A 5GJBA 4WEQA 2RJOA 5CCXA 3U37A 5AQEA 1PIWA 2PZFA 3RH0A 1SCQA 1IEQA 2OCKA 3RUEA 3OY7A 1KETA 1EFRD 4L1KA 4E08A 4CCWA 1KAOA 3JQFA 5TMPA 1D0IA 1S01A 3CTPA 4W5QA 3CZAA 4N12A 4B3CA 2PWAA 3AK4A 2GESA 4IXWA 3N2NA 5HF9A 4H1HA 4HX9A 4YMHA 4H0FA 3W4KA 4RIHA 3WX0A 1U31A 5F3RA 2Q7OE 3IJ5A 2Z09A 1M0EA 2FY8A 4HZUA 4X94A 4YWJA 1KAHA 4O4LB 3ORFA 1P7YA 2C0QA 3K9LA 1U0RA 1ZISA 1YZKA 4TWRA 1XOIA 2JGEA 2QZ4A 1WXGA 2ZAGA 3IPLA 3P0RA 1KI6A 1TF2A 3PUHA 3AYZB 3JZIA 2PH5A 4RGBA 4V2UA 4BBPA 1K68A 4TWJA 4ENSA 4JUAA 3WLPA 3LCUA 4DHEA 2VTBB 4TMFA 5EJGA 4BNGA 4UARA 1JJIA 1ZIXA 2PKWA 3BDIA 2ZYIA 3RSHA 1ZM7A 3NBYC 4PIPA 5HM8A 4PS0A 3WFJA 1E9AA 1ODFA 5K3DA 2O0MA 2A30A 2QIPA 4MW6A 1L8OA 2IGBA 4ARAA 1PDOA 4J0IA 2A8YA 3DEAA 3M7IA 2WLTA 4JLVA 4KH0A 4Y3UA 5ALHA 3WQBA 3ZIDA 3ZWMA 1AMOA 2JCSA 2WHEA 3CN7A 3Q2OA 2ATCA 3IMGA 5FBLB 3CZ5A 3L6DA 2IZOA 4RTKA 4CMIA 4JB8A 1Y4AE 1ZD1A 1ODKA 1BX0A 5J43A 3MRXA 3GLVA 2FRDC 3ZUPA 1UEIA 3PA6A 5WRFA 5ALVA 4K0RA 5GY7A 1K2VN 2IVFA 4BWVA 2FZ5A 3DLHA 1LVHA 4UNIA 4Y6QA 2IHJA 4FZ3A 4K05A 5JJCA 3HJNA 1ESZA 2EFEB 3GYBA 3I4FA 3SQLA 3SBDA 1WZEA 2C98A 3L7BA 1DKRA 4L27A 4U7FA 1EWRA 2BM1A 4AS3A 5ICGA 2R3SA 4X7MA 4BGUA 3NUZA 1G8KA 4CHTA 3V7NA 3LUCA 2K87A 3NBKA 4KZPA 5G4KB 1VI2A 4XR4A 3WV5A 1ZGHA 4EI8A 4LOAA 3ZYCA 1KFJB 2ACEA 2J4DA 1N4DA 2YW2A 3UV6A 4H7PA 1U2DC 2FKAA 2OD7A 3FZNA 3L0PA 4JQCA 5C31A 2DJ5A 3B1KA 4YCSA 2PZAA 3KUDA 1QKIA 5B57C 3H5TA 3HR4A 1T2DA 2H3EA 4I4CA 4LPSA 1JPNA 1Y5NA 5CT8A 3VYUB 1QHSA 4UPDA 1XJ5A 2PUDA 1FB5A 2GYWA 1IWBB 1E0AA 1UPXA 1MH9A 2EG5A 3WYDA 1M0TA 4ME6A 2OFPA 1FVOA 1Z5UA 1OXXK 1T4CB 3KXDA 2QZPA 4PIVA 4IYJA 4WCDA 4C5AA 3PEYA 2Y1GA 4WT7A 1DX9A 3DFKA 4M7WA 3J81k 5CB0A 1N9KA 4KE9A 4QTYA 2E6UX 2GCNA 1XTJA 2BGWA 2EGUA 4RZ3A 3BZUA 1ZA2A 3HLKA 3P5BA 4B9EA 2YRXA 3ZE9A 2GF9A 3KFLA 4AZSA 2FPIA 3R8CA 1O6CA 1TIBA 4HH0A 4NMWA 4B6PA 4CFYA 1KYZA 1CY8A 3RLFA 5BQ3A 1SQ0A 1GQOA 4JSRA 3U39A 1LJLA 2G09A 4EY5A 6AT1A 5EJ8A 1JB9A 1EVLA 3VDMA 3NGMA 4ZU1X 3KJXA 1Q57A 4B2IA 1BS2A 1OWNA 5EUQB 1IRIA 5K0EA 1IUNA 3TLEA 2ZWPA 3LHIA 3KVRA 2GEDA 4MQEB 4CUZA 1V8BA 4HVCA 3ZQJA 4FGZA 3FYTA 3CWQA 2RHOA 3MTGA 1OY1A 5F7JA 4D5GA 5BNIA 1R0ZA 3OBIA 5T8KC 3RUIA 1CFZA 3AJAA 2GARA 4QO8A 4CEIB 2RD2A 1F4LA 4M88A 4JROA 4OJMX 1KYVA 3AESA 3W3ZB 4CMEA 1Z06A 2DEUA 2PUEA 2JJ1D 1PHRA 2QYHA 1NSTA 4JBLA 5HWSA 5ITWA 1RYFA 1JVSA 4N3AA 4RELA 3HPRA 1DDOA 1N2ZA 4OEHA 2PJDA 4DR3B 5TS2A 4LJAA 3K7EA 4N3BA 5ECGC 5EQTA 4DM3A 1VBFA 2QAGA 2WLSA 1R6UA 5EHXA 3K32A 4ALIA 2QL7A 1Z4JA 3L3BA 1RHRA 3O74A 2WZBA 2VYVA 3NCHA 3F7MA 4TVBA 4RBNA 5C7IO 2BFDA 3OOSA 5KX5F 1VG8A 1L5RA 2AQIA 2YYSA 4NENA 3TUJC 4HN2A 5DN6A 1RHQA 1N3YA 1T0HB 2AFIB 2YC4C 3DE4X 2WWTA 4LGCA 4CQMD 3R40A 2AYZA 1NVUQ 1CJTC 1P4HA 4DTIA 4ZVTA 4ZYUA 1P7CA 3O84A 5FTNA 1A9QA 3C98A 1TD9A 3AZOA 3BZWA 3RUHA 5JZOA 4Y2GA 2NV6A 3AI2A 2CFRA 1RHKA 3UAGA 2II6A 2EZ4A 5K01A 4G2NA 2G4VA 4JELA 4DLXA 4FEGA 4C0WA 4LXQA 2PUWA 3R3WA 4M36A 1XNGA 1OBVA 2UZ1A 4Q1DA 5JVDB 3B1XA 2JHGA 1M66A 3CLKA 3PEFA 3NDJA 4F72A 2GCPA 3WL7A 4HVLA 3K3PA 3T5GA 2V3WA 2HJRA 1BVHA 1HSOA 2W2PA 1Q0SA 3A4VA 3RJMA 1NF9A 4BYGA 4TTTS 5JO9A 5JSZB 1M10A 5GWXA 3UJNA 4WY5A 4FMPA 4TQAA 2R86A 3IMKA 1E7YA 2YJ3A 3OTHA 2WUVA 4MS3A 1T2UA 5I9BA 2RHGB 5JS6A 3W2GA 1KKUA 2AVNA 2B99A 2B2NA 3EWNA 5CEFA 3HU1A 1XTQA 3U5TA 3L84A 3P9XA 1FDIA 2V7UA 3QA3E 4AUKA 1PJ2A 3L8MA 4NS4A 4G37A 1YZUA 5DWVA 5LQNA 2VDWB 3KL4A 3DYBA 1QIEA 1C9JA 4U6SA 3DE1X 4BQNA 2PGOA 3CE9A 3EEBA 3OF3A 4G0MA 4MCIA 3UVEA 4DSAA 4JI8B 1PVOA 4XXHA 2PPVA 3SMQA 4BQPA 1BAPA 1Y7TA 3CEJA 3W9UA 1M2KA 4AECA 3OQVA 4ZRMA 3ETGA 1HGXA 3D6TB 3LUKA 1KWKA 5E9JA 4HJXA 1TCVA 2IHBA 2O7VA 3D1JA 3BMNA 3DO8A 3O92A 1WS6A 3RUAA 2SECE 1VL6A 2DYKA 3IBFA 4I50B 3UWOA 2BGMA 2CD9A 3RK4A 1QOZA 3DLIA 3TOZA 1L5LA 13PKA 5EIEA 4EUNA 2AHOA 2C5SA 2RARA 4NICA 4LJ6A 2C5FA 5ERYA 1Q1AA 2FZGA 2IYUA 2WM2A 2X0JA 4FCTA 4EA8A 1JKMA 1KU0A 3JAKA 5B4VA 2F8SA 4Q4LA 1K66A 4Q3OA 4WNYA 1NVKA 2IIBA 3K05A 3Q12A 1XRLA 5EERA 4BLRA 4WV3A 4AJNA 3BB1A 4MCJA 2V1XA 2XIQA 4WVFA 1Z2OX 3OZFA 3SXUB 4Z9XA 3IA2A 1DO0A 1QDEA 1U0EA 4QECA 3WQHA 3ZCRA 3H5VA 3PC8C 2P75A 3AY7A 5IJZA 5BSRA 2G1AA 3UHPA 1WVMA 3FWNA 1G7SA 5ITVA 4LTNA 5HK9A 4KV7A 4LF8B 1S5PA 3FH0A 4DQDA 2E5WA 5L51A 4Q48A 5I9LA 1U5CA 1E2LA 2WTXA 3PENA 2R47A 1M2EA 4G84A 4OHCA 3RWBA 3W5JA 4X1IA 3WIBA 3EYAA 3WGZA 3ZI0A 3LHDA 4N3NA 3LFTA 4B3DA 4N5MA 4U2BA 2PS9A 1GCIA 3HWX1 4EOGA 4R01A 4IEIA 1HNXB 1USIA 4TS4A 3T7TA 4D82A 8LDHA 4BEJA 2BMWA 1QXSA 3P94A 1SD1A 1SBZA 3MAJA 1T1EA 1CK4A 2BR3A 4PYLA 3KYBA 4D9MA 1UJ6A 2CDBA 2YZKA 3PQ5A 4A8JC 1I33A 1EXDA 2O5RA 1E1QA 1QH8A 1DFGA 2BW0A 2OM6A 1VLLA 3WMRA 4RQAA 1W30A 2PXXA 1R00A 2D59A 1U1GA 4L8WB 4PG5A 1NY6A 4FX5A 4BNDB 1ZAYA 3R44A 2VOEA 1QX3A 5A03A 3AVXA 2Q4TA 2AEEA 1RXEA 2IZZA 2W71A 4I6EA 4NCIA 4EF6A 2VT3A 2ZR0A 4F6RB 1PWEA 2FUNB 1ENOA 1BEUB 2WOOA 4Y7DA 3UJBA 4W7SA 1Y5LA 4BLOA 4X7BA 3C43A 1RRKA 2ZI4A 3GDGA 1C1XA 1MF7A 4KR3A 2YFKA 2X7JA 4JBWA 2I6FA 2OBLA 4LRTB 3RSSA 2VHUA 5A04A 5KNCA 2XVXA 1NUUA 4KXXA 3U6KA 1QIHA 2BBWA 3M6FA 1MJ5A 3IOYA 3W5HA 4XSGA 3A6EA 7MDHA 4HGPA 3ROPA 3KQPA 1NVVR 5B1HA 3MJEA 4RHEA 2PYDA 1MO3A 3DUFB 2YY5A 3QE0A 3F73A 2VRWA 3UXYA 4KWTA 4CQMA 3S1AA 3KVOA 1UQRA 1E9EA 1SURA 2WFAA 3WE7A 3ADOA 4BJ6A 2CCJA 4HLCA 1ZH4A 7REQA 3N59A 4RESA 1XD2B 3OZUA 4U7TB 1YU9A 2IWHA 4GS5A 3V48A 4C0QC 3AFMA 1QP4A 1UQUA 2HX1A 2F6RA 2GCGA 3PU6A 4AJHA 4GICA 1ONOA 2ZB4A 3TVTA 1CUCA 3DE6X 3QXCA 3RVSA 3CKKA 4R1TA 5GM1A 2V74B 3KYCB 1KEEA 1SK9A 2JLRA 3WMGA 1JR3D 2X8BA 1PGOA 2DRIA 4ARZB 2HA4A 3VTKA 2NVWA 3U7GA 1RYYA 3EIWA 1EWKA 2QQ0A 4JKOA 5GJCA 1YOVA 2XCUA 3KJFA 3QM1A 4U9HS 3REQB 1SPXA 4B7CA 1B15A 5IJWA 1JFFB 1FMLA 4J94A 2G9NA 4JUCA 4RF2A 3RJZA 3INTA 4XB1A 1HG1A 1W94A 1IXKA 2JDID 3HCAA 3I23A 2PL5A 4Q39A 4RV5A 4YVFA 3DZDA 3VR2D 3PCTA 3X1XA 1C9YA 3ZOZA 5L4LA 3B13B 1S2LA 1T9KA 2GBLC 3PT5A 2Y67A 2BZGA 3A4LA 1IOZA 1R0BA 4UTNA 2ZRBA 4P53A 2FX5A 3HRIA 3TQQA 2G0NA 3FYUC 4MGYR 4RK7A 2UYGA 5CDFA 1E3TA 3QF4A 4UNNA 2B6NA 4C88A 4BEBA 1QGOA 3KTFA 1JBKA 3OF2A 3AOEC 4QODA 3V8VA 3ZE2B 2VKTA 2EIXA 4CNQA 3K2IA 3P4YA 1UC4B 2IYOA 2P78A 5JNTA 1I6KA 1AT1A 4MPJA 1TMYA 2HREA 2CVPA 2Y4OA 2Z98A 4GYYA 4P4SA 3REGA 3JWJA 4ZCRA 2OOKA 4HAXA 1O6FA 2WHPB 1OH7A 4RIIA 5FPHA 2EARA 2V5VA 3TUIC 2AI3A 5KWSA 3GCWA 4D7AA 4LE2A 4H7DA 4Q3CA 5EJMA 1BFDA 1DHRA 2MMCA 1NE7A 4ZVKA 4OKSA 3GEDA 2VJKA 2FR8C 2H7XA 4DMFA 4HQRA 1N7HA 3U31A 3AEKA 1M76A 5IF9A 3E61A 4XX1A 1EGHA 4CVNA 5CXQA 4NE9A 1CF2O 5DTRA 1NW3A 1BCSA 2C2BA 2C8LA 4NCAA 4B3BA 3E8XA 2ZULA 2QN8A 2XMGA 5G3YA 4YWHA 1OU0A 3G6KA 4F8YA 5DISB 4EJSC 2E4YA 1QO0A 3KPJA 4NONA 1L7BA 2ZCJA 3AVYA 4MV6A 4RWZA 5IT5A 1AMUA 2BONA 2ZR9A 1C1DB 2PT5A 3T94A 1E0KA 2YHUA 3IR6A 1F38A 4GYKA 1I10A 1XALA 3KWFA 4H6VA 3WNVA 3ZJUA 4ZYTA 1MVNA 2VJLA 2VQDA 4DR6B 5H3LA 4TYWA 1MT0A 2G5TA 2BDUA 2YWXA 3PIRA 4RH0A 3ZCQA 3OEED 3NDBB 4HLUC 2G67A 3I2JA 1J2TA 1R15A 1DBIA 3WHPA 2FN4A 2CXRA 2YV4A 1XCGB 2EDCA 2HK8A 4Q02A 3K35A 2Y0EA 2H7VA 4QX6A 1NYTA 3LBHA 3VZSA 3B9QA 4UHBA 1WULS 4OQXA 3RC8A 4BRZA 2ENWA 5JTTA 2VAWA 4JL6A 2VJDA 2GYUA 4CI9A 5JTUA 3EGIA 5FV4A 4CNBA 4HLDA 3EF1A 2XD4A 3K96A 3GV0A 1ZS9A 2I8CA 4TKUA 4DMCA 1Y8RA 3JAWB 4MIKA 5IXSA 1P5FA 2Y0DA 3DAFA 4S3MA 2JBHA 4EABA 5I7UA 3ABOB 3LUBA 2NXWA 1YS7A 3Q9SA 1F6DA 2VSQA 3BMOA 3KJNA 4WFKA 4WCFA 2Z5FA 4J7UA 1ZAKA 2HHHB 1E9CA 4YA6A 3OZ7A 2EDAA 1S02A 2GGSA 3FFTA 4G1VA 1PQUA 3K16A 4NYMR 1N7JA 2QTNA 2X0DA 3WNDA 3DTNA 4A7PA 1SKAA 3F8TA 1E62A 1TI7A 4EJ2A 2JLBA 2OPHA 4K6KA 4E1BA 3HWRA 1XNRB 4KRFA 1L1EA 3F6BX 1BQEA 2W2KA 1P74A 3R8XA 3V1YA 5JD5A 4YLYA 1V16A 2RK4A 2PVPA 5A1JA 1K86A 2K4MA 4BO8A 1NXTA 2M6SA 3FJYA 4Y9UA 4JOCA 5ALQA 2EFYA 2BFPA 5EGSA 3A2KA 5IN5A 1L4MA 1XHEA 3T3IA 3AR4A 3ICQB 2Q6TA 1QC5A 2YH2A 3M70A 1C0IA 1KH3A 1RADA 5DYTA 1FSSA 4M0DA 2XV1A 1FYWA 1VLZA 2OYSA 2ZSJA 3FBGA 4RENA 1L5NA 4TKLA 2OD2A 1VKZA 2NO4A 5GJVC 1FBNA 2FZCA 6YASA 3ZE0B 2P41A 4EYSA 1EFTA 1OROA 1B1CA 3WLAA 3GHYA 1XKQA 4WZAB 1ZGAA 4BHTA 3MA0A 1LV7A 1U0NA 3OE5A 3JATA 4ZMSA 5K8TA 2PCLA 5AM1A 1PNRA 1JXMA 4YDQA 3FROA 4IF4A 3ZDRA 1N78A 4E2YA 3IKJA 2WZQA 4IDGA 4KI7A 1CVIA 2HDHA 5KYKA 3IQIX 1E6WA 2H1HA 1T6YA 3OJLA 2XT9A 1SKBA 2EHDA 4HATA 3RRYA 3UJDA 4M8IA 3EVDA 2Z95A 3RS4A 2FPXA 3ZGZA 4M4SA 2JBAB 5LQJA 1YTUA 2G76A 4ZOBA 1NXWA 1AE1A 3IVGA 3KG2A 5GIPE 3MMZA 5LQUA 3ZY3A 3HABA 4BMVA 4A6PA 4LF4B 2QT1A 4LNHA 2D2FA 5CD9A 2AJDA 3QEMA 4OQMA 4C20A 1J9GA 1N6HA 3TSYA 4KIGA 3NHZA 2J0VA 5L9AA 1QH1B 3H3FA 4XJVA 3EBPA 1GR1A 5HDBB 1KQNA 1AJEA 3S3TA 1OW3B 1E1RD 1SPBS 1T1IA 2Z1MA 3D7KA 3M81A 3I9FA 3PFGA 5EYPB 2OHGA 2QE7A 4JGBA 4MB2A 2Q0XA 1E2BA 1JJ7A 4WBNB 2M2IA 2ETXA 3GFBA 4N54A 2QJFA 1Y0BA 1XTVA 1Z33A 1N0WA 3NHRA 2BJHA 2WFZA 1SVLA 1P4AA 3B2QA 4UE2A 4EVIA 4LE1A 4MICA 1W85B 4BP9A 1OBFO 1ZNQO 1TE2A 2O06A 5IX8A 3PC7A 1WXQA 3Q11A 2B37A 4GE3A 3TB6A 1U4OA 1NQVA 3KZMA 3JWPA 5F5LA 4BQSA 2OV3A 4J4HA 5BY2A 1RC1A 5KVVA 1UR5A 2EP8A 1BTOA 2OCGA 4IOLA 4NFLA 5F7OA 4WXMA 4S0ZA 1RJGA 1T8SA 1R4NB 3AR2A 5DXJA 3M9LA 1V5GA 3WXMA 1KF0A 4PZ0A 4NEQA 2HB6A 4M0KA 3VR2A 3SNKA 3VSDA 2K7FA 2ZRFA 1ZN2A 2BR5A 1CZLA 2NQ8A 1HQKA 2J9FA 4L95C 4UMFA 5CFZA 1OVMA 1EDDA 4DHWA 1ABEA 2ZSDA 3QE2A 5JHGB 2HJGA 1GGJA 3CY6A 4DUZB 3SZMA 5ALFA 3A4NA 1E2EA 1J6UA 1M8JA 2RHMA 2J08A 5DXAA 3TLZA 4RXUA 4I1OA 4JIGA 1TM2A 4R41A 1BH2A 1I2MA 2VHWA 2E55A 4PCAA 1GPH1 2XBUA 3RFUA 2C82A 2VSXA 1E5DA 3I4LA 5D3ZA 1LBSA 1SIUA 5K51A 4CDRA 5A62A 2BFNA 4E07A 3F9IA 2W5UA 3HHEA 2O4UX 2WF5A 3R3JA 4KGXA 4UOZA 1FTYA 1KYYA 4UNPA 3G89A 3WGLA 4DDUA 4MW0A 5A5VA 4TTPA 1WXDA 2DLDA 3F1LA 3SC3A 4KN6A 2Q3LA 4JBXA 1P31A 4ZEOA 2FJPA 5EQFA 2ZYWX 4GH5A 4TZTA 1CR4A 4EGJA 1MJGM 3GJ3A 1B00A 3QVMA 4E4YA 4V2IA 3GJ4A 3MLEA 3P97A 4EB6B 4PO8A 4UBIA 3P9ZA 4XI9A 3OKAA 3BHIA 1UKYA 2VSFA 1BYUA 1U2PA 3QFCA 1XN4A 1LJ8A 4MWSA 5TDHA 3RBZA 3UMBA 2R7LA 3R7SA 5YASA 5FPKA 2J3EA 4PO9A 5DM60 4G4SO 5KO2A 2XRZA 2NUPB 3HCPA 3T7JA 3LW8A 4MWEA 1H9BA 2P1DA 4CGYA 1XQ9A 3WRVA 4GHWA 3ZWDA 2F8TA 3JVUA 3H5LA 3O3CA 3P4UA 4OXYA 3Q8MA 5CVTA 2JGNA 3E7PA 1JT9A 3GFRA 2Y6UA 5AW6A 5IN4A 4TMVA 5LYJF 3GLGE 1KJNA 5DX1A 3FGOA 2W8ZA 1FQWA 3ILYA 1L5WA 3KAKA 5A6VA 3TLGB 1WM1A 4UFOA 4EUKA 2QD1A 1Z8HA 2JFGA 4Q7EA 1ZH2A 2FPMA 5IAGA 4JZKA 1KH2A 4U5XA 2Z1NA 2HW8A 3OZSA 5KVCA 4RFSB 4MYUA 2HH9A 2OAQ1 1B4DA 1RHUA 3IVCA 4DN6A 1OLXA 3HXTA 1B16A 2IBMA 2AMYA 3E70C 4QJ5A 1WEKA 4GZ6A 5CNJA 3A9WA 5AI9A 3TRKA 4PPNA 4Q05A 5CB4A 3VKGA 1NUPA 2OLKA 5CW1A 3BCHA 4CETA 3TLBA 4Z8YA 3U0VA 4AFNA 5T3YA 3H0EA 4G1FA 3F67A 3TTWA 3UXHA 2I29A 5LP6F 3L49A 1AXRA 4JP3A 1PYGA 3OPMA 5CA0F 3C4QA 4KW7A 1T10A 3QEJA 3FTFA 3NTUA 4MMYB 4HNQA 1PD0A 1EVYA 1P61B 5FWXA 3T15A 5JSQA 5B5SA 1IFXA 2Y68A 3K6JA 1BW9A 5CAEB 2YMQA 4NZMA 4RIGA 2A9QA 5BWLA 1AA9A 5A0VA 1JE0A 2PT9A 3TOVA 3I32A 1ZPDA 2VWHA 4XM2A 1Y3AA 2PRSA 1MJNA 3I2KA 1O9GA 1TMGE 2NYRA 3PHBE 4MAAA 4DRYA 4BIMA 3AUJB 5BORA 3VAZA 3FCYA 3NBMA 1RQNA 2B7LA 1HX7A 5ERGB 4CL8A 3WOVA 3V2HA 2PZGA 4QUHA 3B1YA 1KO5A 1KZYC 5TPWA 1SZJG 1MW8X 4DB2A 2ORED 4MAFA 2CCKA 3PQDA 3ZHBA 3HC7A 5HXAA 4QOGA 3L1HA 4GP6A 1Y5RA 5CXUA 5TPZA 4O4JB 4Z4QA 3T3MB 3IUQA 2OXFA 3SYMA 3AR3A 2Z2KA 3FNEA 3YASA 3LL4A 4RH1A 4I55A 4QNRA 3UMRA 3VFDA 3R3YA 1KVQA 5EUBA 2BP7A 3LIPA 5IH3A 1TMKA 1QIJA 4YCJA 2XGSA 3TDNA 2H9IA 3ZC3A 1AZTA 1BVRA 2GA9A 4FNMA 5EOVA 5C2JB 1LQTA 1V95A 3QK7A 2ZTSA 4ZEXA 4DWOA 5EIXA 3QE4A 4HAOA 4HP8A 3TAUA 3CUSA 4PC2A 2WQ6A 5A6SA 2XF8A 1AF4A 1P2FA 2JBWA 3I5UA 2I62A 1U8AA 1VZ2A 2AW5A 4OATA 4WXYB 2WSSD 1G8PA 4YR9A 5EPEA 4JI3B 4EITA 5B7QA 3P7MA 2FWJA 1RPAA 4RIFA 1YBMA 3UMYA 5BSKA 3BDVA 3OO1A 1SA0A 2AX4A 2JK1A 4RD4A 5HCNA 3IEMA 1G8JA 3B3JA 1LK7A 4OSPA 3VTZA 1TVCA 1YJXA 2G40A 5LBTA 4RHUA 4DIUA 4Q3AA 4D8VA 4W6ZA 4AY2A 1UDBA 2JK0A 4GX2A 4KLAA 1U4SA 4MWOA 5DEIA 2MHCA 4FFBB 2WAYA 1XLWA 3EISA 2I6GA 3AWIA 1I36A 4MDYA 4KYTA 1X86B 2R5NA 3MGBA 2BH9A 5G0WA 3F90A 1GU7A 2IITA 3IP1A 3WJ2A 2D0OB 4OLJA 2D54A 2FPOA 3KZNA 4IR7A 4ZAGA 2LXNA 1E94E 1S8FA 3N6VA 1ANKA 1E2JA 5ALOA 3MRSA 3OOJA 4Z51A 3LK7A 1B8VA 4LC1A 3L02A 3O0DA 2V5UA 4WNIA 5A02A 3C45A 1XMOB 3COZA 1B6SA 1EX1A 2E4AA 2EERA 5EKTA 4BX8A 1X15A 2C2YA 3H65A 4OQPA 4JI6B 2Q1YA 4QYIA 1V11B 2QTCA 2AXNA 1VCMA 2I4RA 3CF6R 3UO8B 5GADl 1Q1NA 4P3KA 1U28C 1ZY2A 3HFSA 1N9ZA 1UL1X 1K0FA 3G9ZA 3QVOA 2VSOA 4M76B 3T7CA 3UJ6A 4Y30A 3JQAA 2WE8A 1W52X 3WLHA 4EI9A 4IVQA 3ILVA 4TYQA 5CA1F 1XWIA 3W90A 2MSNA 2X5JO 3DMHA 3N53A 1LK0A 3K0FB 3R5HA 4MUNA 4XR9A 4QBHA 1US8B 2XZOA 5T8KA 3C0KA 2GN9A 3NH9A 1KQPA 4TWAA 4E4TA 3EXHB 1AKYA 2CZQA 821PA 3WGOA 4HDKB 4QRDA 1QK3A 3HB0A 1DADA 3TJZA 4ZHQA 1XHFA 3VO9A 2PKXA 2C8JA 1IY2A 1SKQA 1UM8A 1VYUA 1CUHA 1R8JA 4JJ8A 2EC5A 4NG4A 4Y6GB 2HA7A 4K8OA 3S40A 3SLRA 1AUOA 1JQEA 1C4OA 1HRDA 1K4KA 1YKSA 3CX3A 3G23A 2REQB 2WILA 3CN9A 3FPLA 4MGZR 4X3PA 1EI9A 5GP1A 1KZGB 3U4MA 1BE8A 2C3PA 2I55A 1QTIA 3TW8B 4F2GA 1IJBA 1PJ3A 1D8AA 1P73A 1FUIA 2QUKA 2EKDA 3VDRA 3IEUA 5EXEA 4KYVA 4N18A 4Q9HA 2RGXA 4BNJA 3G6WA 5L7WA 1PDVA 1ZD3A 1Y8RB 1WSWA 3LC7O 5A7HA 1Y6JA 4JI0B 1THGA 4QYMA 3KQWA 3U48A 3TL2A 4N9QA 4A5OA 1GR0A 4HCJA 3NQ41 3ZXIA 4DIOA 3THOA 5CEEA 1JNYA 2CZGA 3AKCA 3BGDA 4U9IS 3ZX5A 4G4JA 5DNCA 3WQSB 1BX3A 1RM3A 1MQAA 3OD5A 4KGDA 5LZ7A 3V7YA 4DPMA 4ARVA 4MV1A 3PNKA 3MGCA 2JPDA 2GFHA 2FN8A 3PPVA 4TTRA 4F7DA 2QU7A 3DXZA 1UZNA 3EFEA 1NRIA 4J2TA 4M9ZA 4X6UA 5AKGA 1O95C 5JECA 1QG0A 2JJYA 4GT1A 1THZA 1V26A 4OQDA 4MRSA 2WUEA 2H1RA 2W2LA 4XGIA 3OZAA 3B20A 3IHLA 4YMVA 5AKLA 4XCVA 1M3SA 1U9IA 2ZFUA 4KX3A 4NABA 1TAHA 4OYYA 1ZMOA 2FP3A 1JDJA 3HPQA 1NIPA 3Q7EA 4C7OB 5ADWA 1E3LA 3UAXA 2QRNA 3BRQA 3DKVA 2Z0MA 3NJ8A 3DB2A 3FN4A 1C1DA 3UJHA 4C0XA 4PG6A 4LZNA 2FMFA 1T4CA 5FPSA 5I45A 3ASZA 4RMNA 4C2BA 2AS0A 2YS6A 3I1JA 1RTTA 1MEEA 4BJ5A 2VLBA 4YRMA 1FLAA 3P32A 3NWPA 3LF1A 4E46A 1O96B 1RKBA 1W0KA 3EC7A 4KLRA 4I55F 3DMNA 1DO2A 3C74A 3WL3A 3OQOA 5IT9A 3F5DA 3RS7A 4X8HA 3H1BA 1GADO 3V1KA 3DPUA 3JQBA 1MHTA 3HFJA 3P1JA 4DAEA 5CDFE 1NNSA 1ZMXA 2CFCA 3U3KA 2WKSA 4C14A 4HAUA 2DUMA 2QQ5A 2EZ9A 2O0HA 3ZXYA 5DBIA 4EIWA 4OI4A 4P9NA 5C5CA 2Y0BA 4C78A 1YK0A 2EWMA 3GFPA 1SCUA 4B4DA 2AQ8A 4B4VA 2XNDA 3GX1A 4M6WA 1M2HA 2A9JA 3E15A 4MIYA 5ARBA 3STWA 4C2UA 3WIVA 3ZHSA 1XCOA 4IJQA 4FGSA 4A8PA 4J7CA 2O05A 1KAGA 5C8VA 2QM7A 3IC5A 1HEIA 1F8YA 3CU5A 5GZ6A 3CCBA 3JD4A 1AY0A 2JFOA 1A5SB 4HWGA 4KH1A 3TMYA 3WIEA 4XEHA 4BNFA 5JCZA 1UUFA 2QBYB 1AZSC 4UCXA 4F38A 3BFKA 2QD5A 1D8TA 1HE8B 1NW6A 2BFEA 2OZLB 2V4ZA 1J00A 1PL0A 2X9QA 2X9NA 3GGGA 2OVBA 3P45A 2B1RA 3PVCA 2R5FA 4LF5B 2FXIA 2G82A 5CA0A 1F20A 2OM2A 2WVHA 3U7FB 1DEXA 1DZIA 3H9JA 2AV6A 3AV0B 4WBNA 4QJ4A 4ZPJA 4ZZ3A 5GV7A 2ST1A 4Q4HA 1XEXA 4WA7A 3WYBA 4BUJA 1D0SA 3B78A 5KSPA 5J1TB 2H00A 2R8XA 2V7TA 3PC6A 3LZCA 2QF7A 4G9BA 4M46A 2GSDA 3TIXB 3DSRA 4CTNA 4WZ6A 1KE2A 5KWEA 1GRNA 1L9XA 1T91A 3G2OA 3TGWA 1KI6B 5K8VA 1U1FA 1OZHA 1PDWA 1U9ZA 2YJZA 3DC7A 3EVCA 4CCSA 3R3VA 3L6UA 4MYSA 2YIDA 4TLDA 3ZDXB 2XCSB 2IOHA 3SJ7A 1CB7A 2Z1DA 4B4UA 3VMMA 4PSDA 4IV5A 1JPVA 5BW8A 1NQWA 3ESRA 4FFRA 5JASA 2PSDA 1C3VA 2IHYA 3GEGA 5HIIA 3LC2O 1C8BA 3WY9A 1QFYA 4PNPA 2HPVA 1G3RA 1V4NA 3QBEA 1PW7A 3PF8A 4W9RA 4ZOLF 4ETMA 2JCBA 2MYNA 4U3JB 1HTBA 5JV5A 1FFWA 1H69A 3ML1A 3KKOA 1UK6A 4CKYA 1EEHA 5K3SA 3RS3A 4UTPA 1QTNA 4KVFA 1VIDA 2IELA 1Z0DA 2VJMB 4A8JB 3B3AA 1JFLA 1WD7A 2HIAA 2OCXA 5A4MS 1EFUA 3FTEA 1UKAA 1EXVA 3K4PA 2FUEA 3M9WA 5AKEA 4A4DA 1GD1O 1N5OX 2BL4A 4HQOA 2XECA 4FPXA 1HWYA 4KXVA 2FFBA 5IJAA 5CJJA 4BWYA 4MGHA 3WLQA 3QVJA 4J43A 1OZ0A 4IDFA 1AG9A 4Q9JA 2XAUA 5M04A 4JV5B 3KPUA 1W6RA 4HN9A 1KHHA 3TXXA 4WOPA 3URMA 3NHPA 1PSDA 4CV2A 1NKTA 5L6MB 1E2IA 2EEZA 5SY9A 4EG7A 2IODA 1V0JA 3BE5A 3S5UA 3AF4A 3SZUA 3TQCA 3DT6A 3KB8A 3BWVA 4MULA 4UVGA 5AHWA 2GEJA 4FYVA 4ND3A 3KYJB 3A6PC 3SM3A 2R6FA 1C8VB 3BCRA 2GJ9A 1ZK4A 2NV0A 4FGUA 4K3VA 1PV2A 5AXBA 1HETA 2C0CA 1NVEA 2J0UB 1RLUA 3AUSA 2HQSA 3DMDA 3MAAC 3PGXA 3QUSA 2QR3A 1LLQA 2ZS8A 1CT9A 1JFTA 1QIDA 3ZV3A 2B92A 1QCYA 5TT1A 4E7PA 3L0SA 4OCZA 2JC3A 1PR1A 2ZUVA 4URVR 1OB5A 3DXXA 1Z0KA 5C7YA 3MWJA 3F71A 3E22A 4M9SA 4YI3A 5B6PA 2DLCX 3RU3A 2C2OA 1Y8ZA 4EUSA 3ZHTA 3FF4A 3WBKA 2H5EA 3NS7A 2I7CA 2J6IA 4IFEA 1YUBA 4JHLA 3SYRA 1WDKA 3UICA 3ERCA 3ZKWB 1JHRA 2HUNA 2ZBQA 2C5EA 1R1DA 3A9RA 3C3DA 4KODA 3HI4A 4EJSB 1E1QD 2HOQA 2CWWA 4DV5B 3HP1A 1GN9A 1NOIA 2YXNA 1JDZA 2QU8A 2G9RA 2XT6A 3AW9A 1V6CA 3NVMB 5HKOA 5JI3E 2A92A 4XQ9A 2D2VA 4AP9A 3RS9A 5KTTA 2R97A 2QRPA 3QWHA 3BH6A 2YN0A 5DYWA 5G3ZA 4FDAA 1T8YA 1SBQA 3DAHA 1WB4A 3CZ9A 3QJGA 4JUFA 5KQSA 1LRJA 4N6GA 5AXAA 3N2ZB 1Z63A 3N75A 4ZAZA 3LP6A 3ZH9B 2P11A 4JJZA 4D4IA 3AM5A 1AXGA 4B33A 1KK2A 2J9RA 1MTOA 5ADHA 2TMDA 4I4LA 1UOPA 3TBFA 3K4HA 3U81A 1LI4A 1YONA 3I6MA 4YROA 3DHNA 2P2YA 3AHJA 2BFCA 3CCFA 1KVTA 3MW8A 4RZXA 5J4LA 3H84A 1EP3B 2Q0QA 2YZ7A 1S2DA 3WGTA 5D3QA 5I7AA 1G9XA 2PGAA 2C2HA 2GX6A 2FI1A 1G3MA 1KPIA 5CGZA 5B7NA 4ZQHA 1CS0B 1MABB 1RJ9A 1ZHOA 1SB9A 2X1HA 3FD8A 4LHXA 4QDZA 2ZIUB 1PQWA 2VZEA 3CUWA 3VNSA 1ZUWA 4ZIRB 3CISA 4I3GA 3LTNC 2DHDA 4BBZA 3WISA 1O3YA 2PSJA 2DY1A 4D4KA 1JQ3A 4JLDA 2VUUA 3TE7A 3VJLA 3GJ6A 4INOA 3R0VA 4W1PA 4OHXA 1JYSA 2WM9B 3TPCA 3MYRA 1W36D 5ER9A 4JYCA 2D6FA 4M89A 2QZSA 2ONJA 1XD9A 1H1TA 3TGLA 3IXMA 2G1UA 3OM1A 3JASB 1LPBB 4DDWA 2Q3DA 2ZVQX 1XVTA 1EQUA 4P4SB 5CJ2A 3GVXA 1M34A 4NCXA 2WIKA 4EZIA 4LOHA 2CDNA 1C3XA 2GCOA 3O8DA 4ZVSA 3T5BA 1NXPA 5BVHA 6ABPA 3Q8LA 4B1FA 4M0PA 4CBVA 4JP2A 1AF7A 1ZM4A 1BDJA 3B5IA 1Q0HA 4G0NA 4HWRA 2M6LA 3PJRA 1MA3A 1RAIA 3PUKA 1IM5A 1VJ1A 5E6RA 1OX4B 3DP9A 3K5IA 1Y1KE 2GHQA 3P27A 4FSXA 3TZCA 2PMDA 1U0OC 3ZWNA 3ZW9A 4DR2B 4QULA 1DUIA 2AG0A 1WXWA 1D1SA 2R8ZA 3FDZB 3G8BA 3HQ4O 1F8GA 5B2ZA 1M5RA 4QU0A 2COKA 1WVIA 2PUGA 1UP4A 1RAFA 2QORA 3DF7A 3Q7IA 5CB4B 1J7KA 5IUKC 4ZVMA 5L3SA 2PH3A 3UAYA 5HJ2A 5AKJA 4EGAA 2MT9A 4LUCA 1ONBA 3TM4A 2NNLD 1X38A 2VWGA 1PGQA 2X5NA 1T8TA 5ALPA 2PBFA 2V3VA 3F46A 3L04A 5EJFA 3L40A 3LI2A 5D7NA 3BMNB 4YJHA 4FFSA 2O8VA 4H7HA 1MRSA 5CNIA 1EK2A 4GG1A 3LM8A 3ZWAA 3GT0A 3BIXA 1ZSVA 3DTVB 4O5AA 2OHIA 4QU9A 2NGRA 3BC1A 3ISJA 5IM4F 2LP4Y 3QBJA 1JILA 3OOYA 4PQRA 1VJDA 1M2JA 3W9SA 1D9ZA 5HTKA 4EKYA 3PPXA 3NGXA 3QTTA 3MTBA 2VP3A 3A8TA 3LC0A 1ESNA 4QLOA 3CS3A 3K30A 3PE3A 3AU8A 5U1PA 3Q10A 1HMYA 2IUSA 1QR6A 2X1LA 4M8NE 1DXOA 2J59A 1NNUA 1P39A 1Z18A 3CV3A 3K20A 2QTBA 4FJ1A 5EXXA 4C4SA 3SK0A 3U7IA 3QWAA 2YHIA 2PE5A 5G0VA 4ZGBA 2R6DA 2H5LA 2ZE6A 3T6KA 4PNHA 1DU4A 3D7NA 3U44B 3CF2A 5D5HA 3U4DA 3VHXB 2QRLA 3BTUA 3Q4GA 5BQXA 4MI9A 4LDNA 3L9WA 1N2CA 3COSA 4AD8A 3T1NA 1B0PA 4CHGA 2LRHA 4FJ2A 4FNOA 3ROMA 2FQQA 4YJ2B 1Z3IX 1LV8A 4ZDKA 1K6IA 3TDMA 3WK6A 4AP6A 4O2BA 4ZEWA 4L7QA 1IXSB 4CIXA 5HOQA 2NSYA 4INZA 4A0RA 3FZGA 4XGQA 3IO3A 3G5LA 5B36A 3JWIA 1VFPA 3H9CA 5LZ4A 2PSSA 1QPZA 2XT0A 5F9FA 5DDIP 1KVSA 2XCIA 4JLPA 1G6KA 3IUPA 2YOGA 1YE8A 3P2YA 4DIDA 4DMKA 3N0TA 3E9YA 1Y6ZA 1ZOSA 3K5HA 3LOQA 1F2TA 2W2XA 5B1DA 1QOQB 4JNCA 1Q74A 3EGDB 4WIAA 3OECA 2GYYA 4RZSA 3A1NA 3LDAA 2QVXX 2LGJA 4X41A 2VK2A 3QVWA 5CYGA 4MCHA 3MINA 1GPDG 3PXBA 1NUQA 4GOMD 4X93A 2C9CA 1WDWB 2QYSA 5BMOA 1EK6A 4K9LA 5IBRA 3EZYA 1H93A 4XLTA 3VTFA 2I87A 4BPBA 4PO1A 2CJWA 3L7IA 1B1AA 4JASB 1U8FO 3R9KA 1PR5A 4JKIA 1W4RA 1YDWA 4W63A 3Q87B 5CLHA 2LUOA 3UANA 5HM6A 1ECCA 3QSGA 5HBGA 5C3UA 4GL2A 4KQMA 1P2UA 3FMIA 2CXUA 4B84A 1BXRB 3LF2A 1XZ8A 2CK3D 3OU7A 4UE6A 5TQ2B 3D7SA 1CS4C 1YZQA 3DZFA 3H4VA 3KQYA 5C8YF 4BNMA 4L2IB 4YXWD 1ZCZA 3KWLA 5E4YA 2IV3A 5ULLA 3O8OB 3FG9A 1VOTA 2FQWA 2JH8A 1P2GA 3CINA 1OTHA 4AJJA 5K4GA 5AVQA 1QO0D 5GGYA 5AICA 5DM2A 1ZOLA 4LNAA 3AH8A 1L4KA 4MVJI 4HLUA 3K0FA 2NTJA 3U1TA 4ENUA 4MJXA 4A0HA 2PWPA 2XMDA 1PJ4A 2QT9A 2Z3WA 1SQGA 2EZ8A 3PYLA 4JJEA 4QBTA 1HFJA 2G9VA 4B35A 221PA 4DT1A 1SHJA 1XLUA 4ARCA 1QBGA 5IJ9A 2PMBA 5KCMA 1OBHA 4U2DA 4FFPA 3W5BA 3IELA 3NVKI 2GR9A 5K0BA 2LR0A 4CEHA 2XVAA 4MRVA 1TUBB 4U2EA 1YBFA 2C9ZA 3FGNA 1G5RA 4UPEA 3BGVA 4KPUA 1RMYA 1JVNA 4Z0NA 1B43A 1JMYA 1NJ1A 1DIHA 3FYSA 2A67A 2VNHA 3M4YA 2Z4RA 4R16A 4ZYYA 2JIZA 4BNYA 2ZM6B 5CBPA 1GRRA 5DSTA 1ZL2A 1ZLXA 2FR8A 3IO5A 2YUTA 2QMOA 3PXAA 3UOGA 4EYKA 4ADSG 1IUOA 1YI0A 3SQWA 2TS1A 1C3EA 2XXJA 2HM7A 4PG7A 2BV3A 5C8YA 1N0VC 4CF5A 1ULBA 2FW0A 3B12A 5I01A 3ROKA 1O8CA 4HB2A 2GF2A 4JLBA 3UXEA 1XMPA 3ZQ4A 5BSGA 3I61A 3N6XA 1FFCA 5HFJA 1W48A 2JL1A 3RREA 3QMVA 1RWNA 2A5LA 4A82A 3O8RA 5ALEA 4UZFA 5KYXA 1QHHA 1SWWA 4UEOA 3PI7A 4CM1A 3AIIA 4QDXA 4E33A 3X1JA 1PFQA 1WMAA 3KSDO 1GVHA 3WYCA 3TNFA 5HNKA 4OHRA 5ALMA 2C1EA 1YQUA 3A9TA 3KR2A 1RI3A 3RYFA 4ISBA 2FMIA 2A9RA 1JG1A 1KMHA 4FW8A 5JUWA 1YZ3A 4GOND 2QG9A 2YJNA 4FLEA 3SPXA 2DWCA 3THRA 4RPJA 1W5TA 1WF6A 3X1DA 4AY6A 3P9CA 2PCJA 1K6MA 1YSCA 2BGNA 2P6RA 1VB5A 3WLMA 1TUEA 4LRWA 2EX4A 2A9PA 5IJXA 3OZCA 2ZYVX 1TLLA 3QYAA 2FSSA 1VPWA 2W6NA 4UQLA 3H5AA 1OJLA 1R2QA 4LWQA 2O8DA 5EUMA 3LX8A 4JFAA 4RZQA 1MENA 1ENZA 1GFZA 2X19A 5FJJA 4N5HX 2BKXA 4C3OB 2JJ2A 1W4BA 3BJRA 3WOHA 2QENA 4GBGA 4A3SA 2DTXA 2OZVA 3LQ2A 2IC5A 4XH9B 4BFZA 1ZN9A 1RDFA 3ENZA 3ZZNA 4KI0A 3ZWWA 3L0IB 3BMQB 4DNFA 2NP6A 1WNFA 4CIYA 5B1SA 3H1AA 4OGKA 1YJBA 3UV3A 2VDPB 4LYYA 2PLNA 1G63A 3ZCTA 4J1NA 3P4XA 3AL3A 5HTOA 4Q24A 3GLIB 4PC3A 4IKOA 4YRLA 1NVGA 4CKWB 2ZJ5A 2CDCA 4JB0A 4E88A 2C2ZA 2FCRA 5K3EA 1M1XB 5DLYA 4YCLA 3ZV6A 1RXUA 4KMRA 4MZDA 3D6UA 3NBAA 4FKMA 1ZN8A 2H51A 5SZKB 3SR3A 3JV7A 5E2IA 2XUPA 1L7XA 2HQ1A 5KUTA 5CYOA 1RMTA 1NP3A 1R3UA 2FUKA 2FMKA 4ER0A 1OXKB 3KR0A 4YCMA 4RETA 5LOVA 4P0TA 4BO4A 4D45A 1NX9A 1OLXB 1PQPA 1CWUA 1LA2A 2BFBB 4FFWA 4F91B 1UFVA 5FDFA 3OAAA 2ZBDA 2PY6A 4FDLA 4A8TA 1ZHHA 2GT1A 3BMOB 1VPVA 1T0PA 2FFAA 1N1GA 4JX8A 2TSYB 3NHUA 5GONF 4H4EA 1FTNA 3S44A 2WWHA 1QYVA 1L1RA 1WMFA 5DNEA 4AT1A 1XLTC 2GRJA 1Q16A 3ROEA 4V03A 1X1QA 3HVKA 3ROXA 1VPEA 1UXJA 1RCUA 2Z4TA 3KSAC 4OUKX 3MJDA 1F2VA 3DAGA 3R3XA 4F4DA 3AIMA 1R27A 3IP7A 3HJGA 1WP9A 4FZRA 4CG0A 4EKDA 5JROA 1X13A 2Q50A 3LDGA 1Y6FA 4OGGA 1I5EA 2HWKA 5I7VA 4H3KB 3HWWA 4FR2A 1SBCA 2NVBA 3RRJA 2AUTA 4GUAA 3HCFA 4YREA 3IPXA 2BCEA 3VV2A 1T5LA 4OJQA 5DWQA 3SZRA 3CM0A 3TEFA 1PJRA 1FIUA 3PF9A 1EUDB 1DQZA 2HO4A 1GAJA 3DLPX 4AM8A 4RTNA 1U7XA 5EMKA 1JG7A 1TW2A 3C85A 4TV8A 5FBQB 1FYFA 2FZWA 3HVHA 4J03A 4EG0A 1KEVA 2EZTA 4PHTA 2FSFA 3WLFA 2XXAA 5LC1A 2AFVA 2X2OA 4BKPA 3GDHA 1YACA 3CXRA 3QU4A 4C6TA 4NMHA 2O6LA 1DAHA 4KQCA 5F21A 3I58A 3QPBA 2NVUB 2OWEA 2LIVA 5KDLA 1MXHA 2F1HA 2O2YA 1U0LA 2NX2A 3NLLA 1I14A 2WUGA 5KMGB 2BKEA 1DC3A 2P2LA 2IXDA 4R40A 4TKZA 4JT8A 1GNVA 2PGXA 3D9QX 4ALLA 4DRXA 5CFMA 1O9BA 2H7YA 1S3IA 1WEHA 2R60A 3ECAA 2YWCA 3HU3A 1W9MA 3DTVA 1HRKA 1NC3A 4HYYA 1XJ0A 3LY7A 2XYVA 3KSBC 4KDRA 1F8FA 2QGFA 1XRQA 4ZYLA 2ZK7A 1MCZA 4C4PA 3R0JA 3L8FA 4GX1A 2BGRA 3T9CA 5ITZA 4I1PA 1KP2A 3O1LA 4UASA 2X8JB 1K5DA 4MP6A 5IWAB 3OE7D 2CFSA 1KMIY 2W2QA 4ZO8A 4D9IA 1U02A 4QHSA 4DJAA 3AUTA 3ETEA 4ZAXA 4P6VF 2IH4A 1P7ZA 2ZSIA 2PX0A 4NY1A 4Q93A 2XUHA 4NE2A 4KBYA 1UMDB 2RKWA 3TVYA 2C95A 3ANMA 2DJIA 1TM1E 2QL9A 4UZEA 2HF7A 5CVJA 1W85A 3IEXA 3ANXA 4OY3A 1CUEA 1SQ6A 2JFQA 5DJ5A 1AUVA 1U3TA 2AXPA 4DJFC 1Z38A 2V3CC 1XMVA 3JZFA 1NIJA 3R0XA 1CY7A 3F3YA 2C84A 3B3FA 4AKEA 4WNAA 2C8VA 1L5SA 1T0BA 1JLHA 3B2NA 4FC6A 2VT6A 4RMJA 2RONA 1ZJ6A 2CNBA 3DMTC 3QEBZ 1OHHA 1BWPA 4FT2A 2I03A 4I08A 2ZBRA 4HPJB 3WLKX 4QHTA 1FRNA 1F7VA 5LZ5A 3GGJA 2GKSA 1VA5A 3LT4A 4DPKA 5E4JA 2KE5A 3HDGA 4ZXFA 5BWBA 3B52X 4AZ3A 3AUXA 1KMMA 4W8HA 4KRXA 1QVZA 5J2UB 1IBRA 1L5KA 3G2QA 2QYTA 5CB4F 1B6RA 1W96A 3RG2A 4NAVA 3N7UA 4R0NA 3NX4A 2IX3A 1K97A 1NF3A 3ZOKA 5K2OA 4UNRA 3QUBA 3JW8A 3OOHA 4WZAE 3C6ZA 1H6AA 1HOTA 3FF1A 4MRRA 3PGA1 3SSOA 4W5RA 1KAMA 3L7KA 2REQA 1E6CA 2Y9PB 3MMNA 3NHWA 1P4GA 1Z4MA 3FHLA 3UOWA 3ZJTA 2UUPA 3O8QA 3OCZA 1Y3CE 1TJ5A 4FFLA 4IVRA 4XYMA 4DQVA 4PNEA 2VTEA 3ZHOA 4QPPA 4KYUA 3S4YA 4NZ9A 2DOKA 2VUHB 1M0SA 4WZAA 1CX9B 1M2NA 1MVLA 2IUFA 3BEDA 4NBNA 2D1YA 4MWCA 1ZCBA 2E4UA 3I9KA 5FPYA 3VVLA 4TMZA 3K2BA 3QV1A 4EAQA 3CEMA 4FGLA 2AYXA 4JSYA 4P22A 4AULA 2NWQA 2RH8A 4AF8A 1ZVKA 1HZZA 3P8ZA 3KELA 5G0UA 3TLXA 1P9WA 1XTTA 3O4HA 1XRPA 3GRFA 4J6FA 1K4YA 4MIEA 4NV1A 4KJXA 1SAYA 4ND4A 1J5EB 3JWGA 4QJIA 4MVJE 2GWHA 3IYLW 3RRZA 3TRFA 2P30A 4AS1A 2BZ0A 3ECSA 4TQ9A 4EJSA 3H17A 2VK8A 2QPTA 1FJ2A 3L7JA 5E1MA 3VKFA 1AV6A 4M55A 2PS3A 1E5TA 2GK4A 1HKHA 3IX7A 2CSXA 2IYZA 2APJA 3ISTA 3UUGA 3MMSA 4O1HA 1PYOA 4LYAA 4P7FA 4CLRA 4K81B 3LECA 3DCNA 5GONA 2DFTA 3MSCA 3R7WA 3W4IA 3VNQA 1P7VA 2AFIE 4FKZA 3LY9A 1DAFA 1HFKA 1MORA 1R0RE 1WBBA 3WLIA 3TG8A 2YQ4A 3GVHA 4UHCA 1W581 5I3CA 4H15A 3DT8A 3CNLA 3SX2A 2GPNA 3W6OA 2V9PA 1LEHA 1U99A 1TLFA 3GCZA 2X1VA 4OXIA 2Q1SA 4YRJA 1KGDA 4WLUA 1ARZA 3BDAA 2XR1A 2VQEB 4HSEA 1ZUIA 2WA2A 3PQ7A 2N1BA 3GZJA 1NFFA 3C6KA 3QMWA 4AURA 2D5AA 4EENA 5AUPB 4ABYA 1IVNA 3LLSA 4INAA 3EUAA 1WTCA 3T7EA 1RWVA 3LH5A 4B34A 1DWUA 1FYXA 1FS4A 3KTAB 2DERA 4A27A 2ZU6A 3NYRA 4UUNA 3RFXA 3OFJA 1Y3BE 2F9LA 3B8EA 2P6MA 4COKA 2CUNA 1I7QB 1DRKA 2R87A 4XW2A 4B40A 1IEWA 3EXIB 2DXIA 5IFKA 4AW9A 3W5DA 3IVRA 3OFVA 1U0TA 1M34E 4YRIA 3EJ6A 3N74A 4IJWA 4OBBA 4P92A 1SBTA 2EIHA 3EA5A 1P75A 2QUIA 1CJMA 2RGAA 3PV0A 8MHTA 4C6RA 1RQLA 3BD8A 1Y81A 1T3SA 5FNVF 3QYPA 3EEQA 1PCXA 3NWJA 4QYXA 4RF5A 3FMFA 3H0CA 1KK0A 3UCEA 3U3XA 3BTOA 2HEGA 1X6VA 1ZITA 3PWTA 4P08A 4UM7A 4HMPA 2XVZA 2CUTA 2ZUWA 1DKNA 1HLPA 1Y7IA 4G5GA 4LAFA 4UW9A 4ZT6A 3K5PA 2GZRA 3PHHA 1ID8A 5LLSA 3CMMA 3QENA 1X7GA 3GFFA 2ZRPA 4N41A 1GLVA 1AHPA 5T64A 1Z16A 4J0EA 4D6PA 3T1VA 4PZEA 3SSNA 3W0LB 4EK9A 3QPUA 5ICMA 3FYUA 4LOLA 1IN5A 1U3FA 3R24A 5HW0A 1UXKA 1Z88A 1OQAA 4MV4A 3O1IC 5JMPA 3R5FA 4GKBA 1H1DA 2M98A 4LSGA 3G8CA 2MSKA 2CFIA 4N82A 2OGSA 5FJIA 4DILA 1MAVA 3R8FA 2C7RA 1CEEA 1EGAA 2O23A 2DKNA 4NHOA 2YDYA 3KRTA 3PL1A 4R83A 2ZTLA 3HN7A 1N36B 4LBYA 4O3MA 1P0QA 1TTTA 1ZYUA 4UHDA 2L0XA 2P91A 2G5CA 1NOJA 1ZG3A 3SFTA 4C87A 1R37A 1EG2A 3SC6A 1E6KA 1Y9DA 5DTJA 5BRAA 1O57A 4LY9A 1NVWQ 2MYPA 1E69A 1KI3A 3B36A 3FCCA 5JDCA 4W7IA 1XWWA 4WX2B 2X9LA 2ZE7A 5FLXA 1UP7A 2LKCA 1H6DA 2DPXA 1M72A 1XAJA 4G41A 4UCQA 1O03A 1ODTC 1ZNXA 3I4CA 3R9WA 2PGJA 4GOOD 2O1XA 4ETWA 3Q15C 2YWFA 1D2RA 2RAFA 4U7WA 4YAJA 2H4JA 4XJXA 3GQVA 4JUBA 4XYBA 3TQFA 3OZGA 2HK9A 5HE8A 1A96A 2DUNA 4Z53A 3OQBA 2R00C 4A2QA 2WIBA 3PQFA 5GIOE 4LJKA 1L5FA 1KRWA 2HQOA 1GTL1 5E3HA 3RWMB 4LJ9A 1UK9A 5JZ9A 4E6EA 1NQXA 4PWZA 1RWWA 3OP4A 3LZDA 2WJYA 1WDLA 1JLLB 2A78A 5BR1A 5MN6A 1DCKA 2JBAA 4CXMA 2BGKA 3I6BA 4FE7A 4YAKA 1Q0PA 5KHOC 4RZHA 1F5SA 1OF1A 4F4IA 3FHOA 3IDSA 3KQQA 4DLBA 4BGDA 4JZYA 4C0HA 5I9IA 5JDIC 1FDRA 4F8JA 3DEHA 1IZ9A 4U8GA 5J2UA 4N9WA 9LDBA 1FTQA 2C4WA 3OCXA 2VRCA 5IG2A 4QDJA 1FEZA 3E4CA 3SHWA 2YNMA 4G36A 1CRQA 1JHVA 3SLKA 1E9FA 2GDJA 3RC7A 3LVFO 1BG6A 4KUHA 1PO7A 1GPUA 4OH7A 4BNTA 1EK5A 4Q18A 5KHAA 4TV9B 1MO6A 4GR9A 3WLTA 2X5OA 2J33A 2ZVJA 3Q1LA 3KD3A 3QVKA 3SY8A 3FVWA 1N57A 4RORA 3F3MA 2AQKA 1QP0A 3EAQA 1UKZA 3FW1A 3AU9A 3W2EA 3HDVA 3COJA 3F3SA 4LECA 1PT6A 4DUPA 4RLHA 3R3ZA 4AQ7A 1DUVG 4S1WA 1NHGA 1NQAO 1ZD4A 1L6IA 3QFHA 1DIRA 3JTEA 2HC9A 5KSWB 3ANLA 3R6LA 3CTMA 4PG4A 4KQ2A 3S2FA 3PNOA 3UUWA 2O3SA 4PBTA 3KPVA 1F2UB 1II8B 3OM8A 3HA7A 3ONVA 4WDQA 2W6OA 1I30A 1G66A 2HFJA 4IIJA 1E64A 1VMDA 2AG1A 2NYAA 2P7HA 4IDHA 4KBFA 1FL9A 3H86A 5ILGA 5JCJD 4TZ6A 4K2HA 1K63A 1M6VA 3IKTA 3C1TA 4LWPA 2XMRA 2W9XA 3QW4B 2BRUC 4C4OA 3IT1A 4J0DA 4NBLA 3RKUA 2IEBA 3CRMA 3R5XA 1J2JA 1ZSNA 3EIUA 4FNAA 4R1SA 4TTQA 3WAGA 3MWFA 1WUIS 2CNOA 3O4VA 2ZROA 4JWTA 3V4FA 1PGPA 1TDJA 1O5IA 1VPDA 3A04A 3IDOA 5TS3A 2OECA 3AJDA 5E38A 3R7FA 1FS5A 5FBWB 4PFSA 4AJ9A 4BXOA 1U8UA 1ZK3A 1W34A 1FFBA 1W4CA 1XEFA 5BNTA 2HD4A 1VGRA 3B85A 3BBPA 3MYYA 4Y2UA 2OO7A 4Z9BA 3IP3A 1JWLA 4ZIRA 1RWKA 3Q40A 1PBTA 3CRRA 1N1MA 1MLDA 1DINA 5FLYA 3O9MA 5K3AA 4ND7A 4X1YB 4B3XA 1MG0A 4H3VA 4BVGA 2J3MA 5HCIA 4QFBA 3BSYA 3KJIA 2XTJA 5HHTA 2OQ2A 3AB3A 5F3DA 1MAWA 3LUDA 2KMLA 4I6GA 4NS1A 1LSOA 1MJFA 1U0JA 4DAOA 3G5AA 4MR7B 5JRJA 3TKYA 4NNJA 4QPZA 3L6BA 5D87A 2R4TA 4IIHA 3S5JA 2RGBA 2QK4A 3WVNA 1XYYA 1JIXA 2YJGA 3VU9A 1HDEA 3ANNA 2NU8A 4KQKA 2ZQ5A 4HEA1 4BFYA 2J3IA 4WD3A 4XGKA 4Z99A 4D3SA 4M1EA 2ZXFA 3EE6A 3EQ8A 4HDQB 4MA4A 2QL5A 5D7BA 3OM9A 3ZN2A 1V3UA 2I91A 5EE5B 1FVHA 1RS0A 4WCFB 4HFNA 5KSOA 1BU8A 2OHVA 4Y2RA 4B3RB 3K9NA 1WDMA 3TQOA 5BR4A 1PYDA 3HJUA 3FOEC 1RKXA 4YPFA 4HZGA 3PHLA 3WXBA 4BLWA 3RI3A 5DM0A 3H1GA 1BHSA 4YCBA 2GTIA 1CY0A 3EA4A 1LKZA 3D4PA 3HSYA 4FXPA 4KHZA 4H31A 2YQ5A 4MQBA 2HMUA 4NH0A 4Q16A 3HJCA 2ZRDA 1F48A 1KQOA 3CW8X 1FBTA 3EOAI 3FWKA 4FW9A 4MI6A 1S2OA 4L57A 2UUOA 1WO8A 2EJWA 3GZTB 4GMGA 3W7AA 2RGRA 1AKRA 1OZFA 1SBNE 2EL9A 1NTOA 3DZJA 3EGXB 3EEIA 3FYCA 4IWXA 3ZEIA 1E2KA 3AF6A 3H11B 2J48A 2YICA 4EH1A 4YXFA 3KCQA 1GKIA 3F5MA 1ZP6A 4QEDA 4RD6A 2I3AA 1ZXBA 1MV8A 1QV6A 4RNDB 4DZTA 5J4KA 5EHGA 2PKRA 4PRLA 1HDZA 5GJWC 3KT8A 2ORVA 1G17A 3H1FA 3EPLA 4TMWA 2R9VA 4QXOA 3FNHA 4Q7KA 2QAGC 3K1ZA 4DJDC 4R8SA 4F4UA 1QRDA 4ZQCB 1KDYA 4XB2A 3A6LA 1AKEA 2I3GA 3D3NA 1MV5A 1Z6TA 4YP6A 4WMLA 5H5JA 2B20A 3WLLA 1Z4LA 5IHXA 1IBCA 1WKCA 3FHCB 4KLCA 4RY9A 3CMCO 1WRBA 4KNVA 3ICOA 1UH5A 1Y34E 1K9VF 3QQ5A 3R0QA 3VNAA 1JAHA 4EMBA 1J1IA 1I0LA 5FUBA 4LMAA 1H8ED 1HTWA 1IXYA 1J0EA 4G0QA 2JAPA 4HYQA 1F51E 2C97A 1ACJA 3M2TA 5KQGA 3TL6A 5KC8A 3GVPA 1N4AA 2V6JA 4HHEA 1UM9B 2I8AA 4LHSA 1V5IA 3LXUX 2ADMA 3EBOA 2FG6C 4O25A 2GAFA 1KS2A 1NI5A 5JBNA 1B2RA 1WTAA 1XXHB 2ZITA 5HIKA 4YBZA 3K1TA 3GVCA 4KOAA 4HB0A 1HSZA 1MZVA 2WC1A 3QITA 2FWRA 5AW0A 3Q6NA 5UKDA 2C2XA 2ODBA 1AH2A 3REOA 3JQGA 3SJUA 2J7KA 1QCCA 1F8UA 2ZJZA 3GXBA 1N2CE 4P1ZA 3LD9A 5LWQA 1MAUA 2BTQA 2RH9B 1IVYA 2W6JA 4MNTA 5IZCC 2DP4E 3PD0A 3VOSA 3F98A 2ZWOA 2AWOA 1J42A 1ZIYA 2XQFA 4PR3A 3UENA 4KNWA 1FMJA 3D54D 3JQ7A 1E32A 1S8AA 3CGWA 4E4RA 5DASA 2GAJA 2H85A 5DLQC 1SCKA 5DTMA 5TT0A 2IEGA 1V96A 8AT1A 2VJBA 1NJFA 1CUZA 2B4RO 4M99A 1V41E 1C7RA 5A71A 3V4RA 3DW1X 3K2QA 1XVAA 3ZR4B 3L0DA 1YXMA 5F7ZA 3TG2A 1JIQA 4BNLA 3N7TA 3QG5A 3L7LA 2ODTX 3KE8A 3FFXA 5B12A 2HBRA 2CT8A 4EYOA 5IYZB 4KO3S 1ADBA 1N2SA 4BNZA 1Y8CA 4Y9DA 3PTZA 621PA 2NU6B 4LQCA 4HF7A 2NO0A 3TEJA 3FLBA 5JH7F 3ONDA 3EIFA 3ZKWA 4YDRA 2IHUA 3GLQA 4L8VA 4ZOQI 5BN3B 4GI1A 1RPTA 4QG7A 1JE1A 2GD2A 5CURA 3H04A 4HDMB 4UHHA 1Z83A 1MD9A 1R6DA 2QTHA 3FI9A 1JDPA 1RQPA 1E7QA 1QF7A 2XYQA 1LS1A 2XE6A 1C7JA 2NZXA 1TX4B 3C7AA 3WI7A 4DEXA 3L7OA 3ITNA 4GMDA 4C43A 4C3VA 1XYVA 5DHAA 5L7TA 1N1EA 4RVOA 3CBQA 4B8ZA 2KBEA 3BORA 1GPYA 3SYTA 3AVWA 2FSVA 3IODA 1E3QA 3HUFA 2R1UA 2TYSB 3QF4B 3M0EA 4MUFA 4O4HB 4CMBA 1DZ3A 3HRHA 4HNTA 1OYWA 2FR0A 1GHTA 3LRTA 1X87A 5CDSA 2C99A 1UBEA 1DBWA 3WKCA 5FNZA 3PYMA 2OK8A 4B7AA 4DBVO 3L6RA 2VAVA 3F6RA 3H4TA 3FPBA 4LHVA 5KTPA 4YMIA 1X1TA 4Q7JB 4QM6A 3U44A 3EDCA 3AEXA 3WTCA 5A0TA 3WDSA 5IWCA 3HH8A 3VH3A 4R6XA 3P9IA 1NBAA 5IM5A 3TJRA 2OCBA 4RK6A 1OXVA 1Z5WA 5JBQA 3GEMA 2G25A 2XGJA 1U7OA 5M29A 2O2SA 4ZPXA 3SQMA 2WY2D 2R7NA 5E2BA 1TGVA 5TXGA 2QJRA 3AM1A 1HZJA 4CKCB 5D1HA 5MGNA 2SBTA 4UTXA 2VATA 3P71T 4MOWA 2J5QA 5AJYA 4A2PA 4DS3A 1RFGE 1YBHA 3U3DA 4JQSA 3WRXA 4EY4A 1BE0A 4QGSA 4KFRA 4BKUA 3DOIA 1X80A 1EXMA 2DC1A 1RJ9B 3A4TA 4HZUB 1B8PA 4MR9A 2RH4A 4O4HF 5LDHA 3ZYZA 4RTOA 3ACCA 4HY3A 3P5SA 1W4ZA 2QD3A 5JVDA 1QB7A 3BAFA 1FP6A 3ID6C 1OD6A 2NTYC 5ECDA 4MRNA 1T24A 1XU4A 2X9VA 1Z7BA 1RQ2A 3EVBA 2P6NA 2B30A 3SFVA 4DA7A 3PQCA 4E03A 2P79A 4EL5A 1DJMA 4LRXA 5FL7D 2R11A 3RIXA 4ND8A 2B8NA 2IGTA 3HN2A 2WG2A 1CP3A 1YD7A 4DC1A 3NOXA 1TJ3A 4ROSA 1P0CA 3KKPA 4RX1A 2X0KA 5BP7A 1TFUA 3C41J 4S2EA 3KR9A 3H9UA 4I5GA 1YZLA 3ZLBA 2FPKA 2JFPA 1ZD5A 2B25A 2PK3A 4KMSA 1YQQA 3DV0B 1GAWA 2B2XA 1I7PA 1M9NA 1N6PA 2E49A 2Y9MB 3KXKA 3OTOB 1XF1A 1T35A 2N47A 3ES9A 3IV7A 3RFTA 3U1VA 4ALNA 3CVJA 4EZBA 3GLIA 4PX9A 4B44A 3T61A 3MT7A 4MS4A 4EHBA 2XCQA 3NRCA 1RPZA 4Y6SA 3MCZA 4HQKA 4KN8A 5TQ2A 2FK7A 2F90A 1NJSA 1TCCA 1VLMA 1D2GA 1UADA 1Z7YA 1YDHA 3X1KA 3SD7A 5ICEA 4O4JA 3U80A 2DQ4A 3AJRA 4HMOA 3S28A 1ZX1A 2NZ8A 2WWGA 2IIVA 3D3KA 3GLSA 3NVAA 3TOSA 5IANA 4RK5A 5E7JA 2P3QA 3CLRD 5KOYA 4GF5A 1AKTA 4B45A 2PKEA 3ANYB 3SYNA 4AKSA 2UXBB 1PS8A 5HSGA 4RZ2A 4LK3A 1AB6A 2WWRA 1IAQA 2NO9A 1RXWA 2IHKA 2EFDB 4LMRA 1NI4A 1I3CA 3AKEA 4BBJA 4E5DA 5DBHX 2OY0A 1RWPA 3HGMA 4F6LA 2BEUB 4BATA 3O2NA 1WE2A 2O57A 1M67A 2V8BA 3T3NA 1XMJA 1YQWA 4B5KA 5E9QA 4R9SA 2C96A 4QGAA 5ICCA 2G1JA 5E6SB 6ADHA 1D1PA 4XCQA 4HLQB 4KVZA 4OMUA 3NWEA 4I66A 4BLVA 3QZUA 4F3RA 3NM5A 5K6AC 1Q6YA 4NYJR 4QBIA 4I9GA 1SEPA 2XYGA 2NU7B 3DL7A 1U2SA 4YV0A 5I48A 3QU7A 4S04A 5EIFA 4XPIB 4ER3A 1G5IA 3PRHA 4GQIA 5HKLA 4ES6A 3A1TA 3H11A 5IDQA 4FFOA 2J45A 1CD5A 3Q98A 5ALIA 1CVLA 2XWJI 5JNVA 3W1EA 1Z5GA 1D4FA 1DV2A 3C7CB 3H05A 3PXCX 4GL4A 2CJWB 4LV5B 4TPKA 3P0HA 4LX0A 1JYEA 3PHIA 3T3HA 3TGPA 1WHTA 4EZEA 4MKIA 2G72A 1J0AA 3A3NA 4IIUA 3B82A 4GKVA 1KDPA 4U3JA 2EWWA 2DY0A 4DDTA 2FWMX 2O7SA 3MG9A 1NLYA 3RWOA 2O8FA 1ESDA 2JFUA 2IU4A 3CR8A 3IH5A 2OBBA 3PFFA 1SC6A 4RLQA 4DMLA 2YZ2A 1ELOA 4XDGA 3LY8A 2C07A 2E18A 2ODNA 2ECPA 3ZW7A 3B6IA 2OFXA 3FLMA 2QTTA 4G25A 3C6QA 1G55A 4QL3A 2E85A 4UAVA 3WKDA 1II0A 3WWOA