3PD0A

Caspase-3 e246a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
238
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDSGIEKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATAFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
publication title Thermodynamic, enzymatic and structural effects of removing a salt bridge at the base of loop 4 in (pro)caspase-3.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 238
sequence length 250
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pd0A00
3R5JA 4ZVTA 3H0EA 4QUHA 4PRZA 2NN3C 5IAJA 3UO8B 2H48A 3V4OA 2QL5A 3KJFA 5IANA 3E4CA 2H4WA 4IEFB 4HVAA 1CP3A 4HQRA 1K88A 4PS1A 1CVRA 1SHJA 1RHKA 3R6LA 2HBYA 3P4UA 2XYHA 4JR0A 2FP3A 2C2KA 4EHAA 4QU0A 1QDUA 4N7MA 3S70A 4D3XA 4ZVOA 5IAKA 4PRYA 3H1PA 2HBZA 5LU9A 4JB8A 3PCXA 1SC3A 2Y1LA 4JR2A 1SHLA 3PD1A 4EHHA 1I51A 2QL7A 3SIRA 4JJEA 4DCJA 5JFTA 1NMEA 4JR1A 2CNKA 4D3YA 3V4LA 3SIPA 2CJXA 2H5IA 3P45A 4AWAA 1RWOA 3EDQA 4N6OA 1RWWA 1I3OA 4EHNA 4EHKA 1JXQA 2H51A 4N6GA 2C2ZA 2H5JA 2XYPA 4FXOA 4EHDA 3V6MA 4QU5A 2C1EA 3GJQA 4NOLA 1RWXA 2CNOA 3D6FA 1I4OA 1NMQA 2J33A 3D6MA 1RHMA 5IABA 4LSZA 5IASA 2HBRA 4HQ0A 5IBRA 4NBKA 5LUAA 4ZVPA 4NBNA 4QULA 4M9RA 3V3KA 2CDRA 3H11A 3R6GA 4JQZA 4DCOA 3OD5A 5IC6A 3NR2A 1PYOA 3R5KA 4NOKA 4EHFA 3DEJA 4AW9A 4DCPA 1NMSA 4D3ZA 4EJFA 3GJTA 2H4YA 4I1RA 1I4EB 1IBCA 2FUNB 2J30A 4IYRA 2WDPA 4JQYA 3V6LA 1QX3A 4ZVRA 1GFWA 1KMCA 4N7JA 4I1PA 1RE1A 3NKFA 5IC4A 4QUJA 4NBLA 5IAGA 4FEAA 3UOAB 4ZVQA 3NS7A 4QUEA 2CNNA 4QUIA 2J32A 3R7BA 2Y0BA 4QU8A 5H0IA 3K7EA 1RHQA 3KJNA 3R7NA 2P2CA 4EHLA 3DEIA 4JJ7A 3H11B 4QU9A 3V55A 2C2MA 4QUGA 2C2OA 1F9EA 1QTNA 2AR9A 1BMQA 1RWKA 2QLJA 4PS0A 4AWBA 2XZDA 3H13A 4JJ8A 2QLFA 3R7SA 2QL9A 5IAEA 2XZTA 2H65A 1RHRA 4N6NA 3IBCA 5LUBA 5IBCA 3DEKA 3KJQA 1ICEA 2FQQA 4FDLA 4FGUA 4N5DA 3QNWA 4QUAA 1F1JA 1RWVA 1GQFA 3EDRA 2HBQA 3GJSA 4QUDA 1K86A 5I9TA 1RWNA 3IBFA 1RHUA 5K20A 1RWMA 3BIJA 3GJRA 3DEHA 2H54A 3PD0A 2XYGA 5IARA 5I9BA 5LU8A 1RWPA 1SC1A 4ZVUA 4NOJA 2DKOA 4QTXA 2QLBA 2J31A 1SC4A 3D6HA 2CJYA 1M72A 5IBPA 4NOMA 1RHJA 3ITNA 4ZVSA 4QUBA 3RJMA 1NW9B 2CNLA 1PAUA 2K7ZA 4QTYA 3S8EA
chains in the Genus database with same CATH superfamily
1CEYA 4TT3A 3R0ZA 1GL9B 5LD2B 3ZQKA 4IRMA 4KXMA 4D4GA 4GSKA 3FE2A 2JIZD 4JBNA 1EWYA 1SU8A 2GZHA 2FKNA 2LDBA 2XUJA 2YDYA 2YYAA 3DMFA 1LSSA 4V1CI 2HHHB 3LO8A 4XASA 1BWPA 1YQUA 1X7XA 2BM9A 2E0IA 2G8NA 3QWIA 4MV9A 4OA8A 4NENA 4QOSA 1EEHA 1GEEA 1BX0A 1I5RA 1HDIA 1MNQA 1P4GA 3QF4A 4J0GA 5GQSA 4RYLA 2IHNA 1E1YA 1P1FA 4DE5A 1QHSA 1JSCA 3IEIA 4I4TA 1YIDA 3B5IA 4IIDA 4TKVB 4Y9DA 5J59A 4KNVA 4PG8A 3CRNA 5IJ9B 1JIXA 4GSYA 1OC4A 4BX2A 4YUXA 4RE6A 2NZ8A 1D2AA 1JJVA 2HAEA 5IUJC 4P3NA 2I91A 4RVUA 4QPPA 2JI4A 2FSFA 3KDPA 5LYJB 2IPOA 2O0HA 2P6MA 3IMGA 3LDHA 1Y4SA 2AE2A 2BHLA 3DC2A 2A7QA 2BM0A 3EVNA 1ZIPA 3NALA 4L85A 4X9XA 4YRDA 3S3TA 2FPRA 1K6XA 2WM3A 2Z5VA 1RYZA 3MRTA 3PFIA 4GX1A 4Y2RA 1IHDA 1R5JA 2V6FA 1HQCA 4RZ3A 4X54A 1IN6A 1OF1A 4XYGA 3SQDA 2EHDA 4RTMA 4G8CA 3E27A 3A3NA 4Q93A 5EKSA 3H2YA 4BCCA 3GR6A 5K0FA 4AXXA 4UXJA 2I55A 3HSKA 1IVSA 2WU4A 1QTQA 3ETLA 5IBQA 4AMGA 3UWKA 4GPZA 3R6GA 1C0LA 4MAFA 4R40A 4IRXA 1B8OA 2ZI9A 4IG9A 3L5KA 3M5DA 4XZ3A 4L27A 2GBGA 1O5IA 2YTZA 4XWAA 1ZOIA 3DR5A 3MJ4A 3QYFA 2XQIA 1SHUX 1FU8A 4X8MA 4C7XA 2QX8A 3JQ8A 1S7CA 1XDDA 1GFWA 2Z98A 1B73A 3VDQA 1A50B 1T6NA 1P19A 3T1HB 5IG2A 1X74A 3HO6A 1Z4IA 5L7YA 3VVLA 4MGZR 4WNCA 3AUUA 5E6UB 2Y1KA 4DRXA 4KNYA 4PLWA 4PLCA 4FZ3A 3ORQA 2C3PA 4MV7A 1II9A 5COAA 3MELA 3ZJTA 1J25A 2L0XA 3S1AB 1A5ZA 1ZOLA 3PX7A 1KY5A 5GP1A 4JLUA 1IM2A 5IVHA 5T3UA 3I2YX 4JFAA 5DCLA 1EXWA 4KHZA 1VIAA 3E9RA 3K8ZA 1YI1A 5IVDA 4X64B 3UJHA 4TX1A 4ZYYA 5KIAA 4II7A 3OZDA 2ZULA 1M8GA 4MVJD 4ZAXA 3H9UA 3R4VA 1GPNA 4ND6A 5A9SB 3WY9A 2M1ZA 3RRXA 3U4QB 2Q3DA 2QROA 4C4YA 4IQGA 5KYKA 2UZ1B 3TQQA 1EE9A 3THYB 3AM3A 5ESRA 2TMGA 1QV7A 4OH1A 3T3PB 3THWA 2ID4A 4G4IA 4HWGA 4RFLA 1NLZA 4YCBA 4AF6A 1FTNA 3BIJA 2A1UA 2GZ1A 3GJRA 1CG6A 4RAQA 4H08A 4LWQA 2QXYA 2WVAA 1O77A 5AVWA 3HCOA 1YUMA 3DHNA 2J48A 1W0JD 2I2XB 1AS2A 3MIIA 4G25A 4MQLA 3A4IA 2PZGA 3DYIA 4W8GA 4CM9A 4EKNB 2IZ1A 7GPBA 4HNVA 1Y7HA 4INAA 1EA7A 1SZJG 4LF9B 1SK8A 2AF4C 4KDRA 3U7IA 3ETJA 4EF6A 4FZJA 3SF8A 1I3NA 1KBQA 1EHIA 4ZVTA 4BMDA 3EA5A 4R41A 1R74A 2NU6A 3E7PA 1NONA 1N2BA 4Z1MA 3C97A 2P3LA 4HDNA 4TYWA 4IMPA 2IBMA 4GNRA 2ANCA 3D3EA 4BOYA 3BVPA 4KC0A 2VYCA 3ZCQA 2XUQA 2QX9A 3OQJA 2PUEA 1LB1B 2QU7A 1BJRE 2ZJ4A 3F47A 2QRLA 3TL6A 1W5AA 3IMCA 4H27A 5NULA 4F56A 1GA6A 1BW9A 1YRBA 3MTGA 2JJQA 5C8YA 5TXGA 2RMKA 4Y6QA 1C7JA 3HV2A 3LQKA 5JI2E 8ATCA 4TKUA 4YGYA 3DDCA 4WZBB 3VR6D 2FEAA 1JKJB 1ZRMA 2YZKA 1USVA 1GUZA 3D8SA 2H08A 4O4JB 4WAUA 2PZKA 2CLHB 2O3SA 1O7JA 3N8IA 1P39A 3JWEA 4R1SA 4X0EA 5LP6C 2ODBA 2Y92A 6LDHA 1QE3A 2ZU0C 3L0IB 4MPDA 3KZMA 4B43A 1UKZA 3I09A 1F6BA 5AJXA 1W87A 3LBHA 4EHDA 2IP4A 2AC7A 3F7TA 4NAVA 2PRKA 3L0ZA 4R1UA 1ZMRA 4RZXA 3WWPA 5JY1A 3D6FA 4HMOA 1P18A 4HXGA 2FZKA 2VUUA 5AKXA 2W2MA 1RKVA 2PRIA 2Z8YA 1DKUA 3S2IA 3HFRA 3R6DA 4D0GA 3Q8KA 4C76A 1KHTA 1DG1G 3RT9A 5JDCC 3TRKA 3WNBA 1BH6A 4X45A 4DA8A 1PI3A 1XXHA 1JA1A 2G70A 5JE8A 3I0MA 4EELA 5EC8A 2XITA 4R81A 3T3HA 3NVKI 4OI4A 1VL1A 3FNBA 3MLEA 4IGKA 5I4BA 5IJAA 2P1RA 3UWMA 1PJTA 5AKKA 1LI4A 3A37A 1T2EA 4GPIB 5ESDA 4HFMA 5MN6A 1CJBA 3G9UA 3ANXA 3OFNA 4G86A 4H16A 2HSEA 1IZ8A 1XBTA 1CJCA 4UBOA 1MT3A 5EXEA 3DMTC 4QBGB 3P32A 2HV9A 3P9XA 1K8RA 2E37A 3B3AA 4XVHA 1IHUA 1T3GA 4Z3DA 5A9TA 3BAFA 3PUVA 2NU9B 4F38A 1U7ZA 2C2OA 4PX2A 3GP8A 3WGMA 3CLSD 3DDUA 4G0QA 4O1HA 4RVSA 2VJMA 1I24A 4F4CA 3KYCB 5FKJA 3KSMA 3TOZA 3LNTA 2CV1A 4YACA 4A10A 221PA 3RTEA 1ZEMA 3T9AA 1DTWA 1K68A 5JDIA 2JFPA 5F1PA 1ZJ4A 2E1RA 3R4CA 4P4NA 1XZEA 4ITVA 3ZDXB 3ZDBA 3E48A 4KAJA 2NX2A 1FQJA 2JFFA 3RIEA 2R0QC 3UKDA 1TQ2A 4YMWA 4BO2A 2BFCA 1OH8A 4FOPA 1ZD9A 4CM4A 1WPXA 3H7IA 3PFCA 5AOCA 3WNVA 2F1JA 1FS4A 2PS1A 2R751 3S2GA 1TI7A 1EFUA 3I1JA 4ABYA 1ZUHA 2Y76A 4QE3A 4BTLA 2CL0X 4DJEC 4OP1A 5HGJA 3AY0A 4B40A 1U8XX 3TFOA 2CCGA 4KQGA 5AM0A 5BT8A 2OV6A 5TT0A 3MSXA 3OZSA 1R0CA 1WZUA 2F1HA 3ZE8A 4OLAA 2C5EA 1VG0B 1Z4QA 3L6RA 1Q1EA 1S1MA 3AFIA 2HWWA 2C7BA 2ZIZA 3OLXA 4DA0A 2EF1A 3QUSA 1XC7A 1J90A 3CHYA 3EWSA 1A8IA 1JZTA 3GOHA 2I22A 4Q15A 1I9GA 1P7CA 4GYJA 5DK4A 4KP7A 3V7UA 5I7VA 1W48A 2WF6A 2CF5A 2CD9A 3MCUA 3KEMA 5K3CA 1LPMA 2OL4A 3G5TA 2ASVA 2NGRA 2O57A 1TUEA 5KQRA 1P2FA 3L1IA 3CKKA 2C31A 1OZ0A 2LTAA 2ZB4A 3O9VA 1DU4A 4ND8A 1FVXA 1FDOA 2J85A 4HNRA 4CQMD 3AIKA 3HVUA 4PVCA 3CNLA 1YHNA 3DF7A 4KJXA 5EKTA 4Y2JA 5A2GA 3I2FA 1EMDA 2AUMA 3CCBA 2AJDA 4A0SA 3FNRA 3V9AA 2YFQA 2EIXA 3GW8A 3HV0A 4X94A 1Z5GA 4AZ0B 1H5UA 4RPGA 3DBIA 3DT6A 2HCBA 1PS0A 1TM2A 2HPZA 1EK1A 3L05A 3IT1A 4FXOA 4O5OA 1VA5A 2XTZA 3E9ZA 4DMLA 5I8PA 4EB8A 3BYZA 1KPIA 4NFYA 5F76A 5BXQC 4PSKA 1Z4NA 2O3UA 1OFVA 2BMDA 4JYBA 1H2EA 4WY8A 2ORWA 2XWJI 2J0EA 3W1EA 3U4IA 3TBKA 4D92A 4MOWA 4N8EA 4QGAA 2W6MA 2WYHA 1V2GA 1QO9A 4FGZA 3U40A 2BE7A 1VDMA 3OX1A 4WSOA 3UYKA 2ZT5A 3C3MA 1GNQA 1EBUA 1NT4A 2EJBA 2DLNA 4I9HA 4TMXA 3U4AA 3F7NA 2MMCA 2P2ZA 1QK5A 2VOJA 5U4QA 2V4ZA 4I46A 3ZW7A 5ESWA 2PQ2A 2VNAA 2GTPA 2JH9A 2XQVA 3Q5GA 1HNWB 3E84A 2B36A 3R7WB 3FGNA 2W8ZA 3GFBA 2CUNA 2CHUA 2IHUA 3A06A 4XGKA 3NHUA 4PC6A 2QUZA 3PNKA 1R4NA 5TPWB 4HFJA 4U7PB 2M6KA 5FDFA 5G0SA 5KX5B 5GM2A 4RIEA 3SIXA 4WIAA 3I72A 3FF4A 1MO6A 2EOAA 3IDOA 2QMHA 4HZUB 5IH7A 1A9OA 3UAGA 4Y6OA 1YWGO 4AM8A 4J0DA 3H9CA 3WRYC 2JA1A 3K9QO 1U3WA 5C37A 5B7GA 4EY5A 2GFIA 2I8LA 4TTAA 4EHJA 1PNVA 1SNYA 4IVRA 4Q3KA 4C0AC 1KDVA 5BOVA 1PQPA 3TS1A 2DEUA 3BILA 3BXXA 4MGYR 3AZOA 3MWEA 1WMFA 5CLJA 4FOSA 5HKKD 4OM8A 2DECA 4BAZA 1JSRA 3AJRA 2QN8A 1Y9EA 4KYVA 2BELA 2H54A 2RI0A 3VHXA 1ZGGA 2JLQA 2J3IA 3CO5A 4GOOD 3H0CA 3IUNA 4MEJA 1SC1A 4MV0A 1Q0PA 4DIBA 2AG8A 4WXHA 5ITVA 4DTIA 3OTOB 4KK3A 3HRIA 1I0LA 2QN3A 4M0PA 3JYPA 5ELMA 5H3LA 4CLDA 3U44A 2JS7A 3NDPA 1J23A 3VM6A 1PNRA 2R6R1 3K9LA 3WSWA 2ZIXA 4UBKA 4BVEA 1PIWA 2Q1WA 1FTWA 3K8YA 2ISQA 2DBZA 5G0WA 3U31A 4QYXA 5KMGB 2XOEA 4Q47A 1DAGA 2C0PA 1A2KC 2WTEA 4TT3D 3WL6A 5D5PA 3ZZMA 3PGKA 4BCBA 3IJPA 1L7BA 2FPUA 3AB3A 3Q85A 5JG7A 3UIEA 4W6QA 4L8YA 1XTTA 1BX1A 3FUXA 1U2TA 2I6TA 4CZ2A 5HP4A 1EFKA 3SBOA 1R1DA 3SQWA 4U0JA 3WADA 2HDWA 1CRQA 3S70A 4PZUA 2P5SA 5AXBA 3O38A 3BD7A 5IAKA 2BFDB 5E3HA 3TX6A 1RLUA 4GLLA 1OUMA 2QB5A 1UWKA 2QYOA 2FW0A 3UANA 1TADA 4BYGA 2PWAA 2GILA 2Q5LA 3T5GA 1YZYA 3FPJA 4IXNA 4CW7A 1BDJA 4L51A 4W99A 2EFCB 3QJGA 4LZZA 4ZV9A 5KX5F 3ZD8A 1NUQA 2YOGA 5TQ2A 5DI3A 2XUDA 4IWNA 1NKTA 2C2ZA 4J1NA 5IUKC 4F4JA 1PV4A 4C0XA 4B2PA 2I87A 4P3OA 3IESA 1N2SA 3MJRA 1PQUA 2EIHA 2WJ3A 3KYBA 4MKFA 4FT2A 2HBRA 4ATNA 4DYVA 2XCSB 1T9GR 4IX9A 5AKGA 4CF5A 2VRCD 1VYHA 1Y1QA 4LRXA 3G79A 4HC4A 3L3BA 4Q3AA 4Z7QB 5B4TA 3LXRA 2YQZA 3PR1A 1C1XB 3MOIA 4PNHA 1KO4A 2P9YA 3DE6X 4ZC1A 2FP4B 2D7CA 5AYVA 3VR4A 1PR6A 3HE3A 2BMJA 3NHJA 3D9QX 1K63A 4HLNA 5A04A 3KC2A 4FGWA 4ETIA 3GEHA 3M2TA 1ULAA 5FA8A 5HJEA 2HQRA 4ZHSA 4LOHA 3EXG2 2XQFA 1DBSA 1ESEA 4LSMA 3B9PA 1NULA 2IBTA 2EW1A 3VJRA 3W05A 1WCXA 1Z68A 3WOHA 5LCXA 4L5IA 3G5LA 1B42A 5HOQA 5H82A 3RF7A 2X58A 4PAMA 5EWJB 2J46A 4QC2A 1M1NA 3KQPA 1U8FO 5IZCC 2VJPA 1PT9A 5JS8A 1RE0A 1Z4PX 1V5FA 4HNAA 5KPJA 8MHTA 1NW3A 1YE3A 5JMPA 4XD7A 4W5NA 3I62A 2HFKA 4W7SA 1EGAA 2QX7A 3H04A 4ZU1X 3K92A 5BN5A 2Q2VA 1ZWLA 4IFBA 1GXSB 4U3JA 5KOIA 3JQGA 2D6FA 3A6PC 4PICA 2Q7DA 1ZIDA 1BXGB 1UMCA 4BX9A 4PEVA 5L4NA 1Q7EA 3CZ5A 3EHDA 3I52A 4DQ0A 1SCUA 1UPAA 3LLVA 4EEKA 1P0QA 3W5BA 1E1NA 2HSGA 4GRIA 2C7OA 1KMIY 1GT91 4F21A 2RGYA 3I5UA 3Q41A 3ENZA 2ECQA 3B1FA 5CIQA 4AQ7A 1AGYA 1U1CA 2HA6A 5F2OA 4UKDA 4CMGA 4HX2A 1EGHA 4OATA 1RRPA 1R5NA 5FD8A 2EKPA 2ZIVB 3HJAA 3EQ7A 4HQNA 4A1OA 1XRMA 5EGSA 5JQWA 2YVKA 4YCNA 3GH1A 3UCXA 1Z25A 3KEGA 3Q0EA 4NQZA 2OGUA 4QUBA 1S0UA 3ZHTA 1U31A 1T2CA 1UPXA 3A4YA 1E5XA 1TEXA 3ME5A 3PQ8A 2YZ7A 1SKUA 4OAOA 4UARA 1G8YA 4XPZA 5EMJA 1KQNA 2HLDA 2BTQB 2PG3A 4C6RA 1FQOA 1NF9A 3ZI7A 2O2SA 4TQGA 3JQ6A 3EH2A 2XYQA 2N1BA 3IAM1 4IFIA 5IMBA 2Z08A 3LIIA 5FBWB 3W8RA 4X24A 3ZXUB 4EW2A 5FAKA 3VOSA 4ZRDA 1RCFA 4QICA 5L4LA 3CPSA 3KB6A 2CXHA 3DB2A 2ONKA 1NW5A 4TMTA 2B34A 2F90A 2WU1A 3L4BA 5JH7A 4PRYA 1CEEA 1TM3E 2NQ8A 5AOAA 2MSNA 4LY0A 5DZSA 3OSUA 1Z82A 2VP6A 1NRJB 5CVJA 2DRIA 2H7VA 2PUWA 1H94A 2W6ZA 4Q9NA 3CEHA 4U9UA 3QHQA 3WTBA 4INJA 1X15A 5ALYA 1ZUNA 1X6VA 4TUYA 3UV6A 2WHRA 2Q46A 3QE9Y 3UFXB 4N0PA 3DO5A 4LX0A 1EHCA 3EY4A 2HRDA 4Q4JA 2Q5QA 2YWBA 1DX9A 3IDSA 3KSRA 4HDOB 4UHDA 2QT0A 3W9BA 1ZOOA 2ZRGA 3L4JA 4JBIA 3COSA 3UV3A 1JDJA 1RWXA 1XVVA 4X63A 3NBZC 5DLDA 1C1YA 3CO0S 5KC9A 4WL0A 1OLXB 1KARA 4BNJA 3KHUA 4URYR 2CDAA 4MR9B 1G8AA 2O2YA 4HDRA 4ZTUB 2GFHA 2OBXA 4LSWA 3RVNA 2FW1A 1AHIA 1AZLA 4BVKA 1LDEA 2B5WA 3D2BA 3H9EO 4QEKA 3U6KA 3R5FA 4IM7A 3I01M 3TBHA 2ZJZA 2IF2A 4YP0A 4HG2A 1DI0A 5ECYA 1E1CB 2IZOA 3MD9A 3FKQA 3QG5A 2FWJA 4I50F 1FUEA 1AXEA 2GPYA 1DX4A 4ZXFA 4PGFA 1KPGA 3W8FA 4W1PA 1SCNE 1KETA 1R8QA 1WB5A 4BBAA 3WFIA 1HG0A 3FVRA 2R6GA 1B16A 2HA2A 4Z8XA 5F3DA 3F97A 1YVDA 4GGPA 2COEA 2ZUFA 1TF7A 4NNJA 1YHYA 3OFND 4F8EA 3CUEF 5LLTA 3WTCA 3S0JA 1CJTC 1UK7A 3ZNQA 1G55A 1N7GA 2FPGA 3EZNA 2FN4A 4KXFB 4BNHA 4XIJA 1XDWA 2IOYA 1WZ2A 2VH2A 2PJZA 4KAXA 3RGGA 1Y89A 4HGPA 2H65A 1RHRA 4NARA 4G8BA 1SBTA 2IYUA 1EP3B 4NMXB 2X0KA 1GSOA 1ICEA 1EP1B 5EP1A 4DADA 2Q2OA 4L0QA 3I6ZA 4EG6A 1MJGA 4YHBA 1X1BA 4YUAA 3AVYA 4HAZA 1A8UA 2GAJA 3A1WA 3DKKA 2QM7A 2FFHA 1WKCA 1AXGA 4E46A 3IV6A 3KHSA 1RXWA 2H4HA 5ALWA 5KWSA 3GY0A 2HI0A 3EQ9A 3Q6IA 1X80A 4RF3A 5FX2A 2EG9A 2C4NA 4ZVUA 1W59A 3HDJA 2IQ5A 3E9YA 3NYWA 4OFBA 2MTBA 3UJPA 1BEEA 1RJ9A 2Z09A 3EGXB 3NAMA 1N1EA 4NMHA 1X7DA 1ZCJA 4K1LA 4KB5A 2ZE7A 2XAUA 3F67A 3NO4A 1PZGA 4LJLA 4X3OA 3AFMA 1Q95A 3GDGA 3IOBA 2QQEA 3R5SA 4XIIA 4C6TB 3BCRA 4Y2PA 5JVDA 1O95A 3PZRA 3DVAA 4XW2A 4ZCSA 3JQDA 5KVCA 4DMHA 1Q0LA 2FN7A 2W2NA 3SXJA 1Y4UA 3KTFA 4TV8F 2XVZA 1RD4A 2YJTD 3ZE7A 1XVTA 1MJNA 3PEFA 4P80A 2V4UA 4MEBA 4YP1A 5F2EA 1QHGA 3UMFA 2IJGX 5L3SB 2OUIA 3PLRA 1GCOA 1Y8CA 2Q45A 2YZMA 1IHXA 4YJFB 2PKRA 2RGEA 4FS8A 4NBSA 2BSXA 5HKLA 3LDGA 3DPSA 3NDBB 1TKRA 1XWIA 2ZTMA 4O5AA 1DHTA 4D98A 1TQDA 1WMBA 3VVBA 3AEXA 3NTLA 5H8WA 3LYHA 5BR7A 3B7WA 3RC8A 3QLVA 4CG2A 1NASA 3F7OA 4ODIA 1E7MA 3FLMA 3ZXIA 1ABEA 2Q0HA 3KAJA 2NSHA 3X1XA 2YBEA 1QUFA 4TYQA 5G02A 3EUWA 2I7VA 4FFDA 1HWYA 2GRAA 3JQBA 1UXHA 2DU8A 1M75A 3NH6A 4M8NE 3PFKA 5DBFA 4E14A 1RPJA 3LGAA 2HIGA 4BASA 4DZRA 3K1ZA 1O9HA 1SUWA 1ZHFA 4DT1A 3RADC 2GZMA 1T6XA 1A9ZA 3CRRA 4AQDA 4F1WA 3I04A 5LZ7A 4UHKA 2WOOA 2DHQA 1URPA 4HGQA 2QLMA 1TAQA 2WZDA 1HDYA 5TR9A 5LUAA 3AIMA 1U5BB 3NBXX 3QVGB 4Y9UA 3V3KA 4YT4A 2WQ6A 1C1DA 1SUBA 4MIYA 1EG7A 3U61B 1VIYA 3FHLA 4Q1CA 1KFBB 1BDHA 1SVSA 1OXMA 4MRRA 4K6KA 1PR9A 3ERCA 5BOSA 2PUBA 1SUSA 3QKIA 4RQUA 1NZJA 1S96A 1PR2A 3DBRA 1JT9A 1WO8A 2ZRHA 5AW8A 3QM1A 1SOUA 1W581 3ONNA 4DMCA 3ZCUA 3GLSA 1UZLA 4WQMA 3WVNA 4F2WA 4KPUA 3DFUA 5DYTA 2VHZA 2VSYA 3RS9A 4AYXA 1M1ZA 1E1RA 3WYGA 1WTAA 4MB6A 4BX3A 4C01A 3EUAA 1Y37A 2XX3A 3AW9A 3HCBA 3KTAB 3LC1O 4QBTA 5F7ZA 1B8UA 1JJ7A 3FPHA 2BV3A 3VO8A 4QLAA 1AKQA 1WRBA 4YV1A 5IN4A 4NYJR 2ZCVA 4DJ5X 4FZVA 4OHOA 1DC5A 1XCJA 1XJQA 2V6IA 3BRWD 1R88A 4J0CA 3LLUA 4I3HA 1FDUA 1T91A 1DO2A 1KYYA 3DMRA 5JMOA 5GONA 2R86A 2ZBEA 4MW6A 2BGRA 4FEYA 3TQRA 4EB3A 1M0WA 3A2KA 3DVSX 3T99A 2AGVA 5KDDA 3TUZC 1FPQA 4UMVA 2H2AA 2OXFA 3QNWA 3U7GA 2W22A 1ORWA 2HA4A 1GQFA 1II8B 4W5JA 4Q4CA 4E3ZA 5DISB 1V3VA 3JALB 2BMVA 3IAHA 4IJMA 5HE8A 1A4UA 4WBXC 3T41A 1U3DA 2CUTA 1K5PA 3UT5A 4G0NA 3D64A 3C3KA 4KO1S 1FNMA 1W88B 2G9RA 3FKJA 4IIBA 3SR0A 4ZCQA 1A5BB 1GPJA 2QRPA 5E4FA 1DE0A 1VCMA 4RWEA 3ZWVA 1QVRA 4V0SA 4EM6A 3AHIA 4L2IB 4EZBA 3K4PA 4LGYA 3R5JA 4LXHA 1Z2AA 3DFIA 1WF3A 1VE3A 3HI6A 3WK7A 3FRIA 3C7CB 2QZZA 4MRVA 5KHLB 2JKZA 1N3BA 4M9XA 5KTOA 5DHPA 1UBCA 1EZ4A 1FDIA 1UPTA 2R25B 3REOA 4BFUA 3A0UA 4EGAA 3U1VA 3DW3X 1K8XB 2ODEA 1G21B 4G65A 3HADA 2OHXA 2P9CA 3UJCA 4RMGA 3RSGA 4WJLA 4M87A 1WXWA 1KNQA 2ECPA 3S7ZA 3SG0A 4B80A 2GX6A 4BUCA 1AMUA 3KKZA 3SC4A 2PZJA 2GR9A 4JQCA 3IERA 4QIHA 1GR1A 3TRDA 3HDHA 3WMWA 5IXSA 2REQA 1ZNWA 1XFAA 4G0YA 2OORA 4ZCIA 4DV1B 1GLVA 4KH1A 5EFOA 1G2OA 1AKYA 1PQWA 5M04A 1SVLA 2HK9A 1ESCA 4NK5A 4YRKA 2X13A 2ZE5A 3TW8A 4R1MA 4G1UC 1N3IA 1UEJA 3O21A 4EPRA 5HQJA 5FUXA 4IUYA 1XAGA 5JNUA 1QZXA 4FFWA 3DKIA 4C0WA 1NOIA 4C4OA 2P6NA 1P1CA 1UXKA 2NT3A 2QG9A 2IEGA 3OQIA 2QOEA 2B0CA 4ARZA 3BJEA 1CP2A 4TSRA 5BR4A 1SCIA 2Z9CA 3IVCA 3V2UA 1NPYA 2HA3A 2NZYA 4TM7A 2QMOA 2C4HA 1KAOA 4M9RA 2V7GA 2FPLA 4AUKA 3HKBA 4MUIA 3F5SA 2PX6A 5ALUA 5E4TA 5D3ZA 4M8SA 1JR4A 3QLUA 1CFJA 4UUNA 4FHEA 2PH3A 2C20A 3DAOA 3GFSA 1MHPA 2ZXEA 4UASA 4Y2QA 5AHKA 4C30A 4EO4A 5MHTA 4H7PA 4R8KA 4D79A 5DVZA 1ZJWA 2XMRA 3EDYA 1OWLA 4CFYA 2NPIA 3IR6A 3ER8A 1YZGA 2FUCA 3MINA 5F1OA 4BGDA 4RVFA 2P3SA 2PSDA 1OSNA 2FW8A 1W0KA 2N0SA 4YDHB 3ENNA 4ACAA 4BMZA 1K6MA 4CG0A 2DT8A 3EOZA 2PBZA 4CN8A 3KOMA 3BGDA 4KI0A 1WCIB 2O3JA 2C95A 1J9GA 3GEIA 5EEHA 1FRNA 5SZKB 2B4KA 1BHSA 2B1JA 2DM6A 3DTVA 1P9NA 3JQ7A 4PYOA 3B5JA 4E15A 5JSQA 5KDOA 2QZ9A 3SLGA 2XOKA 4XD7D 1ECLA 3HBMA 3PCTA 4JJZA 5FPPA 1YVRA 2DUUA 2M1XA 1NJ8A 3RYHA 3TQSA 5LFAA 2IYWA 4MGIR 4K9KA 4MHTA 1GNPA 2J0VA 3K0CC 4UM7A 3RJZA 2FMKA 5KTRA 2IC5A 4PSVA 4V0ME 1BS2A 2AOXA 2Q4TA 3ROPA 3MBOA 4MRNA 5KKAA 2JL1A 4RPCA 2BFBA 1IHYA 2YJ5A 3GZJA 4YJGA 4IIHA 4IXMA 1GQYA 2JJ8A 4DN6A 5FH9A 4XX1A 4YI5A 5ED4A 2JEZA 1R16A 2OB1A 2DP4E 3LG2A 3MG9A 5G0TA 4EKGA 3V4RA 2JDIA 3LQ2A 4RXUA 4EG1A 2IOHA 5J5VA 1GZ3A 3HXPA 2R5NA 1XDSA 3LDUA 1EZZA 2WUEA 4FGSA 4PO8A 3RYFA 1SC4A 3ZW9A 2AG0A 1V9LA 3CLKA 5L51A 2V7XA 1ZUWA 4K46A 4KIUA 2RHJA 2CNLA 2B8NA 4BNVA 4FFMA 4Z54A 1ZH6A 4CYMA 3L0CA 5FUYA 3DCNA 1M74A 3HYNA 3PHIA 3PV0A 5D86A 4H1VA 4GI2A 4B46A 2WHEA 3HXLA 3EZFA 3KJFA 1E2UA 3LKDA 3O8DA 3BL5A 2Y0DA 2Z3ZA 3DBHB 3WRWA 1Z0KA 2HLDD 5EJ7A 4X3PA 4RV5A 1KO5A 4R1TA 2GCNA 1CVRA 2XLCA 4KL8S 3B7PA 2X0FA 3VPFA 1L8OA 3VNSA 3HU1A 3LH5A 3DEFA 4COKA 2AOVA 2DHEA 3HJRA 3HTXA 1NVFA 3UK1A 4A8JB 4BO1A 3GCGA 1V1RB 3CW2A 4I1OA 2V5VA 1MAWA 5AO9A 2WAYA 2VO1A 1J8DA 1BYIA 1GZ6A 3NI2A 4HH1A 1M1XB 2ZATA 1L7AA 5DNWA 1D03A 2LIVA 1DV1A 3HABA 4U2FA 1JHQA 2IPAB 1N6KA 5KSYA 5ELLA 2QY6A 1HDOA 1F4PA 5IKMA 1C4WA 2VJQA 2VRWA 1XL0A 5EYPB 4EMSA 3LT4A 2DWQA 5MDHA 3KQNA 2GESA 4RX1A 3RREA 3K6SB 4P6VF 4N5MA 4OJKA 4JASB 4DB2A 1OTYA 4IIGA 5GINE 4MLZA 5F77A 3ECAA 1ZK1A 2CFCA 2VQDA 4TLLB 5CLFA 3TVTA 1N2CE 4J6FA 4ENQA 5ALQA 3HZHA 2XA2A 3F6EX 3FGOA 1JU3A 1YHZA 3LHDA 5ECWA 2B20A 1P75A 4N03A 3ZW8A 2C57A 3QVSA 5K1ZA 2CMHA 5THQA 3RIXA 2Z2YA 2CHGA 3F73A 4ESVA 3I5MA 1T9HA 4MAAA 2ONJA 4DCTA 1TMGE 5EUCA 5A1TA 3IQEA 2P27A 3IA2A 3Q7PA 2P6OA 3INGA 3VKVA 5AQEA 1JP7A 2OV4A 2YIVX 3BA1A 4M0FA 3INNA 1TZCA 4R8MA 3AK4A 4G56A 3S7TA 3V00A 4OU5A 2QMEA 3TLAA 1XU9A 5D01A 1XMJA 4CRWB 1G8JA 3VSEA 2JIMA 3RYCB 1EXVA 4B6GA 1CYEA 4B6PA 4FMBB 3W04A 4TWJA 2BF7A 4PZYA 1GTZA 3PKJA 3RBXA 3OZUA 3LBNA 2WSLA 2IU3A 1XZNA 2EEZA 4LS3A 1BMQA 4B31A 4KHPB 1BH2A 3T7SA 1YCFA 1BVRA 2BZ0A 2JZOA 3DMNA 3GEMA 1N2XA 4FGLA 2UUCB 2VHYA 4B7ZA 2YWJA 4ZYVA 5THKA 3QMWA 4CF7A 5JWOA 1MVOA 5K4GA 1RLTA 2GM3A 2X86A 4M1MA 2QIOA 1ZC3A 2XJ9A 3TVDA 3CMCO 1D07A 4KR6A 4H2DA 1BS1A 4BUZA 2FPMA 2P0YA 1TFUA 1XD2A 2IYTA 3M4XA 4XIFA 3ZH2A 2FK7A 3ZWWA 1A9QA 3JAKA 1ZUD1 3I92A 3OM8A 5BN4B 4E13A 3AHCA 3LUAA 1CUDA 2Q3CA 3BXPA 5K8UA 3DLBA 2FZ5A 5MGBA 3PDHA 3ELYA 3RUDA 2XDQA 4Q24A 1M72A 3DUWA 1AKTA 1S7GA 4ETNA 3O4VA 4YRPA 2EX1A 2C03A 3P8ZA 4IF4A 1EE1A 1GHTA 4DLUA 3CUVA 2P62A 4RNCA 4YMIA 1KDPA 1ONNA 2G36A 4FLEA 1L7VC 4J0JA 3V4OA 1O95D 2JIPA 3ONFA 3YASA 3PNYA 3P27A 5CPBA 3PJEA 2PWPA 2R6DA 1AKVA 5DGTA 5AW5A 3CV3A 4BV2A 3OQPA 4YNBA 1XCGB 5K9ZA 3RWMB 2X9VA 5ERGB 1IXZA 3N86A 5ED0A 5BYBA 4OFZA 3K9CA 3WS7A 4B79A 3N70A 1KYWA 2WJGA 3IO3A 3OCJA 4RWZA 3SE0A 1Y6FA 4JI8B 1JDBC 4P4SA 5FV7A 3D02A 3CLTC 3K1YA 1NGSA 1RPTA 2CLSA 1VCOA 3AIOA 3IVGA 1F9AA 1ADFA 1WY7A 1VHDA 3HXKA 1CF2O 1JSLA 4A82A 1G291 5AKHA 3CG0A 1CUSA 4DBVO 1E18A 1T0IA 3GQBB 3ESBA 3RFXA 2XWSA 1UANA 4CIBA 3LU1A 4UOQA 2AG1A 1RW4A 5K8LA 3OQMA 1Q7RA 4GBMA 3CY6A 4WI1A 5CW1A 4UVDA 1BEUB 4IFEA 2Z2JA 3RUEA 1QYVA 4DKXA 4JI6B 4PZ9A 2QTVB 5DNAA 5LB2A 3MERA 1AF4A 2W8BA 4LRTB 2X0DA 3S2UA 2E4WA 3FB4A 4FWTA 1VJTA 5JRDS 1BD3A 5EP4A 4IHJB 4DQXA 1GAEO 5DULA 3UAYA 4ENUA 3L1HA 1VHJA 1X3LA 4I3FA 2OO3A 3G0DA 4HQLA 4L50A 3ZQUA 2XA9A 1ECFA 2CBXA 2C84A 2XEXA 3DLIA 3UV7A 1Z7GA 1TB4A 3A05A 2BEUA 4BKQA 3JATB 3UC9A 2AOUA 3QXCA 1Y8QB 3C14C 4YP6A 3UJDA 4WWHA 3IEXA 5EFZA 4C4AA 4MWGA 3LVRE 3TZEA 4DNFA 5C1DA 3BTVA 3A6GA 4XUEA 5FPKA 4LXIA 3O1HB 1YOBA 2Z3WA 3H19A 3W6OA 3R7AA 1SVKA 2I6FA 1ZGBA 2JHPA 2PXCA 3OETA 5BNWA 2XZOA 1KDOA 4B82A 3GLUA 5BRAA 3QENA 2XF2A 1B0AA 5TNXA 3L84A 3QX9A 1F2TA 4AWBA 2BEVB 2GI4A 1E1RD 4QYTA 2KMLA 1KSJA 1TL7C 2LXNA 2J9FB 2XVYA 1UK9A 3LCJA 1Z06A 4JI1B 4URUR 4JNCA 4UHHA 3H9JA 3EHEA 1QYRA 2B2XA 2IHVA 3E22A 1REQA 4CUKA 4N6NA 1SIUA 4M1KA 4ND2A 3UN1A 1QV9A 1MIOA 5JWRA 4HZGA 1J22A 1UWVA 5KYTA 2OLJA 2W2OA 5B57C 1XTUA 5K0JA 1FXUA 4N3CA 5CXSA 3L07A 5BSMA 1W9MA 4PXAA 2HEIA 4MQ4A 2O19A 3T5DA 3PP8A 2CDCA 5TIIA 5K0TA 5CD1A 2VBIA 1SHZA 1J5PA 3EIWA 5LXTA 2IP2A 1N75A 3CGWA 1MTOA 2Z58A 5FYQA 4AKHA 4LI3X 1QFSA 2F64A 5GGYA 2BZGA 1I3KA 2HXSA 2TS1A 4K6HA 5CK4A 4CNBA 5I7UA 1V8OA 4FFOA 5ALJA 3DH0A 2OR3A 3PKIA 4YMTA 1Z26A 3PIDA 4M7WA 5CDSA 3V1LA 5AVTA 4DJDC 3T7IA 1YVPA 1C9JA 1FVHA 4NS4A 1BE6A 5CG2A 5CA1B 5KVQA 4ZODA 1PLLA 2YWHA 4PYJA 4PBSA 5HM6A 4OB8A 1MZPA 2ZSAA 4MVJE 4R2MA 1G6OA 1A9YA 4J3JA 3S6JA 4CMAA 3MFQA 4MB2A 2HC9A 4RD6A 3UYLA 3IURA 4EMBA 1WL8A 4QDKA 3NVAA 4KRYA 2JZNA 4BXOB 2GK4A 3TFWA 1N2IA 4X44A 3GP5A 3R1IA 1SG6A 2Q5JA 1LRLA 4TGLA 3DQQA 3HCPA 3UICA 4QREA 4EHIA 3BC1A 5JU6A 3IUPA 2FEXA 3MWLA 1JYSA 5EHQA 4G9EA 1B4DA 1H22A 4X20A 1TCBA 2EJWA 1T1SA 3KPYA 4U6NA 2X5JO 4YQZA 3LW8A 2Z04A 2F3SA 1KERA 1QRRA 4FN4A 2MYTA 1JHAA 5AW1A 2UYOA 3OLWA 1D2HA 4MQEB 4N5NA 4R83A 3ZGZA 1DFIA 2XB2A 4D8WA 2X1VA 3RVDA 3RAFC 4BC0A 1W76A 1DFHA 1BG6A 1C50A 1TVMA 4WN9A 2C7QA 1W73A 5CJPA 3H99A 4NFHA 3HEBA 4C0JA 5BMVA 4FONA 4P81A 1YZKA 3VAZA 3HM2A 2P2SA 2OO5A 3ZZTA 1FUKA 4UBLA 4NOLA 1FQKA 5FBQB 2VNSA 3LWDA 3WC4A 5BUSA 3T9EA 1VLZA 2GN1A 3ZQ4A 2YY5A 4J8PA 3I8XA 1E3WB 4ANFA 2FPIA 5KWIA 3VBEA 2HWKA 1CY8A 4DWOA 2R44A 1BA3A 4GR5A 3AVVA 4EA6A 3JYNA 2GBFA 3PJGA 1YZQA 3DKRA 1RNLA 1NPTO 5KNDA 3HKDB 1DO0A 2GEJA 1JQLB 1NXQA 3TDNA 2HQ1A 5JRZA 2E18A 5B58T 1FLDA 2D1SA 2QN7A 4X93A 4QZVA 4YA6A 1XZCA 2WD7A 5L9AA 1SUCA 1WZEA 1LCIA 2V6MA 4RM2A 3MB5A 4C7OB 3KT8A 3VBCA 2O8EB 2PQ6A 3FKSA 3AJAA 1N2EA 3ELBA 2H9AA 1SN7A 2OHHA 3T7TA 2PPVA 2MSKA 4GOLD 4Y6LA 4HTFB 5DYWA 5GV7A 2FK8A 3Q4GA 5MFPA 1AVTA 1GGKA 5C8VA 3AFNA 2R65A 5CA1F 3IUQA 5MGNA 1F0KA 4NZMA 1EUDB 2VRBA 2WHPB 3H3FA 4UU1A 2AR9A 3ROKA 3VPSA 3CVJA 4FX5A 2YOHA 3ZDDA 3DTVD 3MTJA 2PH1A 1ADJA 2JFWA 3MOGA 4WVFA 3UAXA 2XZTA 1GRCA 2YYYA 3NNNA 4ZZIA 2QAGB 1MXFA 1DWPA 2XOKD 2GHIA 2PRJA 3EEIA 1HG1A 2I0FA 5CM2Z 3GLQA 5E0OA 4MUYA 1Q5PA 3RNLA 1RAFA 4IV8A 4LYYA 4AN1A 3MUEA 2ENWA 4KIWA 4AY2A 3MCVA 2FJ0A 3FROA 1X94A 3EK2A 3OM9A 4O2BB 2R2AA 1ZI8A 3B1ZA 1JRLA 1ML4A 4I99A 4DA6A 3ZLTA 3UWDA 4E94A 1FXWA 5EIFA 3I2JA 1XJ0A 1M2KA 5HUQA 3GEDA 2A0UA 4HBZA 3S27A 5IS2A 1P1IA 2JDID 3NQ41 4PGGA 4QDOA 4XCXA 1NP6A 5CR9A 5CXXA 2OQVA 5JJBA 1GPDG 1CHDA 4G1VA 1GRQA 1B8NA 1RQXA 4ITUA 5CDTA 4HJXA 2MSWA 3ZWDA 2OOSA 4GOKA 4H6WA 1GCIA 3ZLUA 2FPPA 1MENA 3N75A 3OZIA 1L5ZA 4P98A 4F7DA 1M5RA 4ZI5A 1SIWA 2JI7A 3CU5A 4BL5A 1V48A 3QTTA 2AFIB 1VKRA 2EJVA 1L8QA 2HA0A 1LPOA 1ZD1A 1MQ8B 2HNAA 2BEWB 5K09A 4N7MA 1DHRA 1LJ8A 3AR3A 4A2PA 3Q0IA 2GDJA 4LE1A 1LRKA 1EH5A 1Y9JA 1TIPA 4PV7A 4BWVA 2XIQA 4LSGA 2DPXA 2P4UA 3SKVA 1M34A 3KXKA 4IQFA 4FQ5A 4XJSA 1VIMA 1YASA 1W1UA 2RI1A 3ZWMA 1V1MA 2IYRA 1JHOA 3VZRA 4M9CA 4XM0A 2TECE 2RH8A 1NL3A 1G20E 1GZ4A 3S40A 4KLCA 3VYSB 1NNLA 1P44A 4CT0A 5FV4A 1QJ4A 4LTMA 3PDCA 1U3UA 2EV9A 2NZWA 4M83A 4QTUB 5FLKA 5KZMB 4YJHB 4X65B 1I4OA 5I8ZA 5AK0A 1UZUA 1MIHA 1V43A 2Q99A 4KIJA 2DSNA 2CNDA 2J9GA 1CUWA 3T9FA 1YQXA 2RH9B 1ENOA 4ZO6A 2BYTA 2CZQA 3R3HA 3SHQA 3I45A 4E4TA 5DNYB 1Z37A 4FFSA 2I3BA 2OV8A 2OPBA 2OHOA 3BRCA 3I5AA 2WTNA 1JQEA 1NMYA 4RMIA 1KH1A 2IUTA 2WNIA 2C5LA 2B7CA 4CMHA 5AK4A 1K1EA 2GAFA 3OPYI 2MSCB 3AKDA 1XPRA 3ZJUA 4CCYB 2XD4A 4B4VA 2QGNA 1SIOA 1DDIA 2HT1A 5T57A 2LWIA 1TC1A 4EPXA 1ZLYA 3SVTA 3BEOA 3UGQA 1VI2A 3D3QA 1L8AA 2DPLA 2G80A 2AN4A 2VF7A 3TNDA 1ANKA 3F6SA 2C9ZA 3LRPA 4QU9A 3PNLA 4KVZA 2PZ8A 3FFXA 3EE6A 2VDMB 4EKIA 4A4DA 3NPMA 5MN5A 3DM5A 2QTZA 1VTKA 4IJ5A 2ZM5A 2WFLA 1K4MA 1HZJA 2WMDA 3PB3A 4ISBA 1GQSA 3GL9A 4A3SA 2C92A 4YQEA 1E94E 1K3FA 2X41A 4KO2S 1WP9A 3A6KA 3OP1A 1MTZA 4DLLA 4IKOA 2DYKA 1S4MA 3OT5A 3D7LA 1H2FA 3WNDA 2O8FB 2DX7A 2IOFK 1K92A 2I33A 1B6GA 3HA7A 1CDEA 1B6RA 3HEAA 4FD2A 3AF4A 3RRZA 5JUWA 3PNPA 3KZKA 1GCAA 3QVKA 1T25A 1ORDA 1HF3A 3B1KA 2YX1A 3EEFA 4NP6A 4PBRA 3LK6A 3UHOA 4YCLA 4YYZA 3NVMB 4EKEA 1XMPA 4K88A 1YQQA 3VPBA 4QOJA 3VMMA 4EB0A 4TKVA 5IJ9A 3JASB 3COYA 2EDAA 3VH3A 1TD1A 1IXRC 2JBAB 2WIFA 4EG3A 4BLWA 1IBSA 4BKUA 5M7EA 1X87A 6AT1A 5LYJA 1JG7A 1VHQA 5G3YA 1A0OA 1Z29A 2O1XA 5C31A 1K66A 5EY5B 1X92A 5FBZA 4TS4A 2M98A 2VPIA 3DKVA 3KZ1E 3BDIA 4FFRA 4HPWA 4K6CA 4LJ9A 6ADHA 2PQ0A 3P2KA 1NAHA 3IMEA 4LQLA 1HXHA 4ERNA 2A86A 5LQRA 3OH8A 1YQTA 3CKMA 1QQ7A 4IMRA 2QENA 3WGVA 4JLJA 2NTJA 4U5QA 4JAVC 1CQXA 3AHHA 4G85A 1TVKB 1GUYA 3QWHA 1ZNQO 2G5PA 3OPQA 5CX4A 5I9IA 1E5VA 3JWHA 5JRJA 1IQ0A 1UKEA 2R66A 4U63A 4DCJA 4ZCTA 4XSVA 2WILA 4YRTA 1EX6A 2EC5A 1AZTA 4ZHQB 4LTNA 4XJVA 1IQRA 1XD8A 2J59A 4KR3A 1U2SA 2B98A 4E09A 4WXEA 3M6VA 3LECA 4YHHB 1WMEA 1D09A 2LW7A 2AZMA 3N2KB 1EB9A 1XALA 1YR9A 1TYBE 1VIDA 3UOWA 3HGQA 1JI3A 2G28A 5DLEA 3ZGYA 2VDPB 4RV4A 4TSFA 4NBVA 5NLLA 1UMDB 2BBTA 2D8AA 3GLKA 4F1KA 4MDFA 5LIPA 2IW1A 4KVAA 2WIDA 2RGUA 3E82A 2ZWIA 4C4PA 3GLHB 4O02B 4PYQA 2NXEA 1J0AA 1XAJA 5T4EA 2QN6A 4H17A 4C20A 3OTIA 5BV7A 3S1AA 3AG6A 4B2YA 4UQOA 1COZA 3FTPA 1JLKA 3GJ8A 3ICQB 1EVZA 2NV0A 3H97A 5IDVA 3SHTA 3EFEA 1T0BA 4M0EA 3F6BX 3L93A 2HQOA 1IYZA 3BXFA 1IBCA 3BKWA 2Y1WA 3ND7A 5A9SA 4LGVA 3U4QA 2OXCA 2I34A 3LV8A 1VSUA 2UZ1A 4EATA 5JROA 3THYA 3ZS8A 3GA5A 1HDCA 2GYWA 1YB4A 2H9YA 3R7BA 1TK2A 2GRJA 3WK8A 3BD8A 5C8DA 1NQWA 4GIBA 1GFIA 5KO2A 4KYTA 2A1TS 3CRZA 2J6CA 4WKCA 1M33A 1F0YA 2CC2A 1UP4A 4PLGA 4PS0A 1DEHA 1HEYA 1OXKB 5E3IA 5BSGA 3PLNA 1Z2EA 4TWBA 1GDTA 1QIFA 4KTVE 2KLHA 1DXYA 1ZIOA 1H2XA 2W2LA 1D1QA 4M54A 1MPXA 1NYQA 1G7CA 1LX7A 3OU7A 3P4YA 4IOKA 4JEIA 1C3LA 1OC2A 4ZOAA 4A92A 1JILA 2VK1A 1USWA 3KHKA 3KQYA 4QPDA 5AM1A 3KJHA 4K9QA 2JD1A 5ESXA 4ZYWA 4JYMA 1MX9A 4RIFA 4LKOA 2AA3A 3NRJA 3QW4B 4WY5A 4Y9SA 3EEQA 5I9LA 5K3BA 5BQPA 1GU1A 4XUDA 2LGJA 3TKAA 1Y1TA 1WBDA 2AZ4A 4IXTA 3ZDZB 2ORIA 4OKNA 5L53A 3OCZA 1ST3A 4M36A 5J1TB 5KNCH 1RXVA 4NYJQ 1KRWA 2QYSA 3NHZA 1T43A 2R00C 3HJNA 2L42A 3RK0A 3E2PA 2FSIA 4EJSB 2W7TA 1HQYE 3VYVA 3GOQA 4WZBA 4RESA 1JKJA 2CLLB 4YJKA 1EFAA 5KOJA 3ICEA 4F8YA 2GTIA 4WOBA 1Q14A 4O4JA 4AUNA 1IJBA 1RLJA 1YQGA 4QYIA 4DYDA 4EGQA 5A2QA 1B1CA 2JG3A 2WYWA 5A3JA 1N2CB 4PZDA 1ZXLA 3E5HA 4MZXA 1EWRA 1QHNA 4OQDA 4TYPA 3F9RA 5FFNA 1LFDB 3UXHA 4UMDA 3W6NA 4ALLA 2AN5A 2W6JA 4E30A 3IQHX 3WP1B 1QP8A 3O93A 4UQLA 1ORHA 1KEPA 3LLMA 4JMLA 4OGGA 4WESB 2XVXA 4D0NA 4ZIRB 1YCDA 3B2QA 2XT6A 3B12A 2OFWA 3TLKA 4G9GA 3K0FB 3Q1LA 4ZVVA 5JSFA 1GUFA 2ZEJA 5AJHA 4KFUA 4MYDA 2PN1A 1PR3A 3B1WA 4FE4A 2FPSA 3CWQA 4Q21A 1L3BA 1A8HA 3LZ6A 1MP0A 3WRXC 1JALA 5F4BA 1LU9A 4XFJA 5HDQA 4M98A 4G07A 3HVIA 3BSWA 3GLTA 4YXWA 2H16A 4BNWA 4G4JA 2EATA 3K2IA 4EAQA 4KMSA 2C8KA 2HDHA 7REQB 2GXQA 2WM2A 3JV7A 3F0TA 2OVBA 3PC7A 4MS4B 2DTDA 2N9UA 4RY9A 3I73A 5TGZA 3KU1A 2CXNA 6GPBA 5I7EA 2GVDC 3HGMA 3STWA 3FAKA 2FW6A 2CLOB 3LKZA 4AJ1A 1A97A 3TIVA 1SH7A 1XNRB 1Q1NA 5DNCA 3O8BA 3IXMA 1YI8A 5DBEX 2W2TA 1N7IA 1OX4B 4NCNA 2IHBA 1UDAA 1YB6A 2B4QA 3QVLA 4FTWA 4QYWA 2E4ZA 2ZSHA 2NU9A 2DPHA 4G67A 2B92A 2ZBRA 1EVEA 4NBWA 1OY1A 4QRDA 3KYCA 1FFHA 5EKDA 2G71A 1ZVVA 3WLSA 2EHJA 1I6KA 3BCHA 4D56A 2W98A 3ZHRA 2RSLA 1KNXA 2NO5A 1T1RA 1M6YA 1QBKC 2OFFA 4BO8A 2A5JA 4Z9BA 1A7AA 1FP4B 2VUHB 4X7BA 5H0IA 5CURA 3AVXA 1QQBA 3FKSD 3AESB 4OLBA 2I4MA 4DPLA 1Y3IA 1WDTA 1YCGA 3L6BA 4EAAA 3S8YA 4ZQCB 3B8HA 4ZVLA 3D0OA 4P4LA 4D3SA 4FHGA 2AF3C 4HB3A 4Y6GB 3FZNA 4Q05A 1BWSA 2VP5A 5EE0A 5JXWA 1X13A 3IPCA 1K8QA 4LCEA 2FHSA 3AB7A 4NCJA 4NK4A 3WHPA 3L7DA 4WD3A 1J9ZA 1Y3FE 1GG8A 1P0FA 1UADA 1C1HA 2YV3A 2ZR7A 3PEVA 2QE7A 2C5SA 5G40A 3TSAA 1U7HA 3DW1X 3F4KA 1BMTA 2YCBA 2FPOA 2Q0XA 3NYRA 3RT7A 3ZV6A 2V7WA 3KSBC 1JE0A 2BFMA 4GM4A 1XA3A 4MTCA 4PPQA 4PZLA 4KN9S 2H63A 4A27A 5E8JA 3T5TA 4J90A 3EG5A 3EGIA 4JLAA 1U3GA 4RO0A 4ENRA 1N2GA 1N6HA 4V3BA 1ZXBA 3B1JA 1KK3A 4BLTA 2FQYA 4LV5B 5C1IA 1LBTA 1NW7A 4AZSA 1U9JA 2C0CA 2PL1A 3I5YA 2I7XA 3DZFA 3CPJB 1ZU4A 3GRVA 4U7DA 1UMBB 1MC5A 3H87A 4IUCS 2LNDA 4AN4A 2XD9A 2JASA 3GCDA 4B71A 3KP1A 1ZK3A 4WLOA 3X0DA 5BUZA 5I7SA 3Q88A 1U3VA 1L6IA 3DNFA 4JL5A 3PWKA 3AKCA 4HWPA 2ATIA 1UMKA 1KMNA 3R8XA 1JG1A 2Q5EA 1OTHA 3ETNA 1ID8A 3MS4A 1X1SA 3MRVA 3R6TA 2I65A 3W5AA 4DY4A 3DOIA 3E05A 1EINA 4KQJA 3L8ZA 4NMMA 1GGEA 4B83A 1F0NA 3DHWC 3W6ZA 4D46A 3L7MA 1QIGA 5I5GA 4F6LA 1JH9A 4AKIA 2ZVPX 4JJEA 3G7NA 1Z34A 2YV4A 5CB4B 1PWHA 1ZA1A 2QN9A 4XVRA 3LHKA 5EJ2A 4W5RA 1KL7A 4MNTA 1TRHA 2MU1A 4Q4HB 5GJCA 4LC9A 3T0FA 1TVCA 3B53X 4EY6A 5KYGA 2HYIC 2B7BA 4L3OA 2ECKA 4ZWNA 4A2WA 3EMVA 1BYUA 4Z9AA 5JXGA 4MUFA 1T8WA 4ZQBA 3RG8A 4AMYA 1M6WA 3GRUA 3SSMA 5JZVA 4FHCA 2L82A 1R3DA 1MB3A 1MX1A 4JI2B 2J9XB 3R7WA 5H1YA 3NIDB 4NZZA 1F4VA 5J2UB 4DDMA 1IZ7A 2OCBA 5AUPB 2NNLD 1ZIXA 3RIYA 7ADHA 1KVQA 3QVOA 3ICOA 4M1EA 1PJ4A 2NZ2A 3DWFA 2GEVA 2WJZB 1Y5NA 3FVTA 3HUEA 3L4BC 4I4IA 1HT1E 2Z3VA 3G88A 3ND8A 5KX5A 2AIRA 4W5OA 1VBFA 1O03A 2Q62A 3PL1A 4TS9A 3P2JA 4HZUA 4EW6A 1BDBA 3VMFA 4K3VA 4M37A 1PDVA 4ASUA 3R41A 4KMOA 2B25A 2C88A 5D3QA 3ZTTA 4P7KA 5LQMA 3NCHA 1IK4A 1WQ1R 1M2HA 3HR7A 4LOIA 4PHFA 5AVKA 1L5LA 4MTLA 5FULA 3ZE9A 2CNWA 3RD5A 3ECCA 1E32A 2V8OA 3QMVA 1ISPA 1OMOA 4RKEA 1PR0A 2G9VA 5TY0A 2H1WA 3N1UA 3V4VB 3DLHA 1JDTA 3VI3B 4RVDA 3ZLVA 3I01A 1E1QA 3THSA 3L9WA 3X43A 1NXTA 2GAIA 3HYRA 5CRIA 2VEOA 3AP1A 3L8EA 5BSHA 3QPAA 1GZ5A 1MNAA 2OVFA 5LZ4A 2W42A 2O9JA 1V7PC 3GUYA 5DGCA 1ZW6A 1JBQA 1R6XA 3ZC3A 1E4EB 4EENA 5ALMA 4LNUA 1L4FA 2IELA 4X1IB 3W7AA 1W5TA 4YMHA 4QO7A 1R4ZA 5REQB 2FPKA 3AVTA 2CEKA 3G8AA 3WGTA 4RY2A 4DMFA 4MW5A 2PLNA 3ZE6A 3D8TA 4QXAA 3O7MA 2ADMA 3UAVA 5KMGA 1GFSA 1K86A 1PLKA 2AYZA 2AXQA 1NLUA 2RGNA 2QN1A 4IDCA 4MYUA 1Y3CE 4BLOA 1L5SA 5AIBA 2VHVA 3B1XA 3KZXA 5DBGA 4PZPA 3BEDA 3EIHA 3TSYA 1E5TA 3UMMA 3RHZA 2I66A 3ENQA 3BTSA 1DKQA 2ZBDA 3TD2A 1KP3A 1N6IA 4B6EA 1WCV1 2BFDA 2FR8A 2I3GA 2V55B 1T3ZA 4OMCA 2DHDA 4GMHA 3UUEA 2X5NA 3T3OA 2WMYA 4ZQEA 3V8MA 3PUHA 3FNEA 3GB9A 4EO7A 1MOQA 3TE7A 2D2EA 2AD1A 1BAPA 3AU9A 3EXHB 4H35A 2P2GA 4DMUB 2JCBA 4CV1A 3BJZA 3M9WA 3NOQA 4G5QA 4YDSA 4U2DA 2FMFA 3OAAA 4PG5A 1PGPA 3SEQA 2GN8A 4TTPA 3GRCA 3PPIA 1RRGA 4NV0A 2X15A 3AL3A 3IE0A 1DBVO 3VTAA 1L7RA 1XCMA 4MQ5A 1E3QA 5FFMA 2XNDA 5DK6A 5LZ5A 1RXUA 1UJ6A 3AOEC 3SEFA 5CFNA 3OCVA 521PA 5L3ZA 3T4XA 2GLXA 2JIBA 5IVPA 4JB0A 3TAXA 1PE0A 2ZJ7A 2CMFA 3VR3A 2OE2A 2VQ3A 2G0AA 2FEPA 5ALKA 1X2BA 5EUMA 4F0JA 4UJ3A 1JAIA 4Y2YA 2ZSEA 3C45A 4TVKA 5C3MA 3IA7A 4V0LA 6ABPA 4MW4A 5EE1A 4CM6A 1C1XA 1P4AA 2QL6A 3Q10A 1O95C 5G1OA 4ZDWA 3D8UA 4ZN6A 2FP4A 4L8VA 1I7LA 4GRDA 4WZ6A 2EQAA 3G0OA 1N4DA 4MVWA 3VAYA 4YXFA 1AMOA 2ZZMA 1J1IA 1ZEJA 5JECA 1LLUA 2BFOA 4MVJF 1JHUA 3EAQA 3TTWA 2HJRA 3AEYA 2XTJA 3E81A 3PS9A 1PS8A 4P83A 1Z6YA 4AKGA 4D96A 4Q82A 2AS0A 2FHPA 3E3NA 3N6RA 4RABA 4Z9YA 4BIMA 5EWJA 3A11A 2GF9A 1ECJA 4QATA 1BFDA 4TSFD 3D3WA 3SMVA 4EBBA 5I3CA 1APBA 3N0WA 2OG1A 2RH4A 3UTDA 1NR1A 4FYXA 1W2WB 4XQEA 2JGAA 2CLFB 1NJ1A 3VHRA 3L6DA 3QLEA 5G1NA 1T10A 1ZOPA 2SCUB 3H2GA 3MUNA 1GXSA 1VJCA 3P4XA 4FK8A 5FBVB 5JCPA 3NATA 1U3FA 4D3ZA 4F11A 1BXGA 4BQPA 5CNJA 3Q9LA 5BVGB 3K1AB 1CUGA 1FP7A 2ZRDA 3CQ9A 1TTTA 1L4YA 1W4BA 4KREA 4E11A 2OXEA 3MAAC 5L7WA 2ZLBA 5K0CA 4OU4A 1OXBB 2ZUEA 3RWOA 4ZVQA 1NI4B 1JKIA 4IJKA 1VL2A 1OVGA 3E7XA 1YB1A 1IZ9A 4CKXA 9GPBA 2FCRA 1PZXA 3FNQA 2E89A 4WXRA 1L7PA 4LZLA 2Q9CA 3HGTA 4MCIA 2P2CA 1JE1A 4I50A 2ADOA 4P3XA 4EYEA 5JCZA 5T7BA 3IPXA 3E35A 4H60A 3VAAA 2ZROA 5T67A 3DAYA 4JB2A 1A27A 1A9TA 3JZDA 3KCQA 8ABPA 4B3TB 1HDGO 4XLTA 1YACA 4D8YA 5A6VA 2ZYTX 1XZLA 3MGBA 1TPYA 5JMTA 4EB6B 1DPFA 3IXLA 5LUBA 3MTIA 3ENKA 1O57A 1WS6A 2XB4A 4CF4A 4FDLA 4A15A 2BTQA 2LBPA 1NR7A 2W2LD 3Q9UA 4YO8A 3DWEX 2FQWA 1YF3A 3KM0A 5K20A 1N32B 1TYAE 1NE2A 3P5SA 4MWOA 4EW1A 2ZRMA 1QO0A 3KFVA 4KLNA 5HSGA 1I14A 1V4BA 1DIHA 3NORA 1G20B 1O9GA 1M9NA 1M76A 5FR2A 1U80A 2ENUA 4CFSA 4LKRA 3FETA 4CVNA 2ZS9A 3RAGA 3KUCA 5LA6B 3ZX5A 5LPNA 2ZYHA 3FYUB 3H4VA 1KZGB 3R8FA 1E3JA 3VGJA 1P8AA 3G0HA 1ARZA 1AKNA 3GFPA 2JIOA 3VZQA 3X2EA 1KIAA 1PUXA 4G1BA 4HVAA 1HSOA 3FZQA 1IHOA 5TVKA 4AVYA 1A9PA 3EB9A 5HQ3B 4QG7A 3WDSA 1WCWA 3PQFA 3MS7A 3UAZA 4PGHA 5HZHA 2W6JD 4HX5A 4DJFC 2QWXA 2J4CA 2JGLA 3I9OA 2BWJA 3N74A 2DWCA 2VPYA 1XEFA 3KEOA 1OLXA 1FFGA 4CI9A 1TLFA 1EJBA 1T8YA 5ENZA 4MR9A 5KHAA 2YUTA 3T06B 4EI8A 2QDXA 4KIGA 2OHFA 2VNIA 4I14A 4WGGA 4DRZA 4D97A 3BGIA 3WIOA 3ER6A 2IUEA 4RIGA 5ILOA 2O6LA 4S1WA 1RM4A 3GFRA 5EQJB 4BB6A 4BNUA 2CJXA 3I6IA 4D81A 2HR1A 1ISIA 1AKRA 3G59A 1ZR4A 1H0KA 1X1QA 4MVJM 5HFNA 1YUNA 1KYVA 4YXWD 2HT6A 5KNDH 4OI2A 2WJYA 4B5KA 3ICCA 1BGXT 1HO3A 3I9FA 3PG5A 2B30A 1MD9A 1PJAA 2I2BA 2J9YB 2W58A 3N39C 3PA6A 5B7QA 4KKXB 1H42A 1WSBA 2QXTA 3AF0A 1XSEA 5BYAA 4G0UA 2EKDA 2PKQO 3Q15C 2WUGA 3TYXA 5BW4A 1WETA 3UK6A 2FG6C 3FVQA 3LDFA 4RANA 4R1OA 2YV2A 2X2FA 5C8XA 3RS5A 4XGRA 4NS1A 5CM8B 4RUKA 3C3PA 4LF5B 3EZ2A 4KR9A 5JAIA 2GXAA 4IKEA 1SIBE 2ZRQA 3ILVA 1X86B 3QG1A 4RTPA 3DV9A 3N53A 1GVNB 4I7EA 1G6Q1 4HADA 4ROTA 1V0JA 2VOEA 4KWIA 2QRNA 3TJMA 4AJEA 1JIVA 1V5GA 2I9KA 1ZCAA 4CQLB 2GO1A 4OYLA 5KSWB 4TZKA 2RHCA 2RGXA 1E7SA 3C48A 1SVWA 2C78A 2X7HA 1MF7A 4UBIA 3RS3A 3EOAI 1SOAA 5JWHA 1YK0A 4F9EA 1J9EA 1UFQA 1DDOA 2JAUA 3CVWA 1AC5A 3H65A 4AP5A 3EGXA 2W0SA 1VRCA 5EPEA 1RLIA 5CLQA 3NM5A 2OCLA 3PKZA 4JODA 4P38A 5TF4A 3H1FA 4C6TA 4E2XA 4EYQA 2I6UA 3A9RA 3DKPA 4RHCA 4OSEA 5FTNA 1L4NA 2AX4A 4ZEOA 3SJ7A 1T9BA 2D2IA 2CFRA 3KLOA 2OKCA 3TNYA 4I5FA 3W1VA 1ZHOA 2OY0A 1E9AA 1IN7A 1KU6A 1G42A 2V74B 4Y9RA 1WUYA 3IBFA 3NJ4A 4KMRA 4AJ2A 2QE7D 4K8OA 4NV3A 4BYMA 2XCOA 4L74A 1XX6A 4UULA 5L3SA 2HU7A 3UBMA 1RIIA 5B6IA 2HWUA 2R11A 1JYEA 4OXXA 4ZRNA 1JW9B 1RZ3A 1V7CA 2QLBA 3STUA 2C5FA 3ZIDA 4IX1A 4Q3NA 2VSXA 3NVDA 4DQKA 5JALA 3WSVA 4OF4A 1ZJJA 3I1FA 5I7AA 5LNK6 1FNNA 4EFLA 4XUCA 1Y80A 4KR7A 2FV8A 4RORA 3H0EA 5B37A 3PU6A 2PT9A 1SUPA 1KFCB 1TKAA 3DZIA 5H4HA 3EQ8A 1P7VA 3Q7EA 1K2VN 4L0DA 5AI6A 5AKEA 4YPVA 5KJFA 5B2EA 4KXQA 3FWYA 3WMEA 1HL3A 1MRNA 1SU4A 4NR0A 1SXIA 2H1SA 3QF7A 3OEWA 1T4BA 1N78A 4UFNA 1TF2A 3ZCSA 3KALA 1THZA 2X1HA 4C05A 3C39A 3MCTA 1XTRA 4EHAA 1OU0A 2JGJA 3AI3A 4RF2A 4D3XA 3UMYA 3WK6A 1W7AA 2W2KB 4LY6A 3WWCA 2A84A 5CBPB 3EEOA 3VNUA 2UKDA 4GMDA 2PUHA 3QVGA 1U5BA 4K9OA 3T7AA 2A58A 4PY2A 3PPYA 1E9SA 1YJ5A 3BPSA 3GPCA 4RQBA 4M86A 4M1OA 3ASZA 4QASA 4UEWA 4URVR 1QBGA 1Z8NA 2BUBA 3WL5A 2YFYA 3FSGD 4GZMA 4L8LA 1KEKA 3DXFA 3BMQB 2ATXA 4AS2A 1Y34E 4PWZA 4HXYA 3UWOA 2QYHA 1V16B 2ID9A 2R68A 3UM9A 2OP0A 5HCNA 3V6MA 1I6WA 3T94A 5DSTA 4E2FA 3NBUA 4YMGA 4JT2A 4RETA 1IQUA 5LWQA 1YL5A 4JXXA 1R0RE 1L4KA 1SPBS 4PCVA 4KN8A 4N65A 4NBKA 3PVCA 1WX1A 3KD2A 3KTAA 4CMJA 3O91A 2JLYA 2WJPA 4HGYA 3TB4A 3BF7A 1H9AA 3G1WA 4IDNA 3EIUA 1SBCA 3L8CA 1E79A 1NVUQ 1RR6A 3IQZA 3PHGA 4YONB 1QP7A 1E8MA 1R0YA 4BHTA 3GVPA 5M3BA 4CCWA 3KWJA 4NZPA 1EI9A 1KS2A 4BP8A 1IE3A 3SN6A 5ALHA 4C1BA 2IY9A 4ER0A 4JYZA 1GO2A 4ASUD 2IDKA 3H4IA 1ZI6A 4QAQA 1JFTA 3CVYA 1Z5WA 3G5UA 1OXSC 1WBJB 4ZKDA 3QKRB 2QVXX 2GS9A 3KUDA 1II8A 5THXA 2GYYA 1S2MA 2CNWD 1ODKA 1QIHA 3JALA 3T9CA 2CLKB 3OE7A 2FTKE 1XCLA 3GU3A 1M3SA 3L6UA 3IR7A 2NZUG 2IDJA 2O07A 2RC5A 5DP2A 4EF5A 4EUKA 1RJFA 2JCVA 1VLMA 3G0BA 2BKXA 3TJZA 2LPMA 3TO5A 3V55A 4F2DA 3W4KA 1W88A 4KFRA 2QLJA 4ISCA 2VYVA 5T4FA 1YJBA 4C88A 1XF1A 1AMNA 1T4MA 1KJWA 2NACA 4DC0A 5BP7A 4IZ6A 5G0VA 3X3HA 4IO0A 5IAAA 2FWPA 5AJUA 1W36C 2Q0SA 3FYSA 4TV9B 2NU8B 3L0SA 4L2IA 1AGXA 2R87A 4V0NA 1PO7A 5JAUA 4FOOA 3TCNA 2GASA 2XCTB 2GPJA 3H5TA 4J03A 3ETHA 3RS4A 1C4KA 1GTJ1 1U8ZA 3FPCA 4WFQA 4UREA 3SD7A 3K4QA 3GCWA 3OMLA 2IUFA 4JBLA 5DDIP 8AT1A 4IPTA 1ABFA 1FOEB 3JY6A 3ZZ0A 2HFJA 4BV3A 4UTVA 2LE0A 1NE7A 2EAUA 3BXGA 1A04A 1Q0QA 2ZPAA 3H5NA 4NULA 5IC5A 3VH2A 1I2ZA 4TRMA 1KPHA 2Q5IA 4MYCA 4X6UA 4IS2A 2H4ZA 4TSKA 4UFPA 4C7MA 3S8EA 2ZUVA 3F90A 2H0QA 2P9JA 4UDOA 2CV2A 3AV3A 3JD2A 1J39A 3UB2A 4RK4A 4MYSA 2BFFB 3V7YA 4BVAA 1BVUA 4G6ZA 2P1DA 3IJ5A 4D0LB 5IT0A 1M6HA 2PFKA 3V8PA 1KZ7B 1L6RA 3OAAD 4K6OA 4GMFA 4BN0A 1OW3B 5DM2A 4BVFA 1GN9A 3SS7X 1P81A 1XTKA 1TKBA 3DVLA 4D9IA 4Q1FA 2VP0A 5DMXA 1TAGA 4ENWA 1JNXX 1O1YA 4FU0A 1DEOA 1RMYA 2XNDD 1J70A 2AN9A 3FPLA 4KE7A 4O8CA 5B4VA 1Z6ZA 2VTVA 3OFJA 5AKIA 2IK8A 3K31A 3MGAA 2AVNA 2D7JA 2RCYA 5DTMA 2EFGA 2XSZA 3RV3A 3VR3D 1E9CA 5FIUA 1T2NA 2BRUA 4MYTA 2Y0CA 1I6MA 4FYKA 2HMVA 2FB9A 4JC0A 5KUTA 1ULZA 3LS2A 3RSFA 3G89A 3NIGB 2DFDA 4I9FA 4R1LA 1NSTA 5CAEB 3W1WA 3X1WA 5KTMA 2H51A 4M0DA 1XAHA 1AOXA 2XQKA 3GQVA 1AKEA 3CN9A 2QHXA 4YP7A 2R4TA 3G8DA 4CCSA 3NKVA 2DFNA 3T4EA 4BLSA 4O1MA 1KJZA 3EA4A 5HFAA 2P91A 3OE1A 4UD2A 3A1NA 3QKSB 4EKDA 3AW8A 4QDUA 4TV9F 4Z4GA 2DXIA 1BFKA 4Z0TA 1VLJA 2QQGA 1AUVA 3W34A 3ISTA 4RZIA 4UBNA 3V1UA 4CFZA 3S8MA 3TG2A 3D54D 3FIUA 4FSDA 4C6SA 2QRGA 1NJSA 4WNAB 3SJCA 5BORA 4KBFA 4DLKA 1QZ3A 4FT4A 2VJCA 4R5HA 3I39X 4QNRA 1VSVA 1Y1RA 1MQSA 1HLDA 4OHKA 5IVKA 3FBGA 3KSUA 3WK5A 1LBEA 3NIFB 3DWGA 3VJMA 3BGOS 3D6VA 4IYJA 3PEWA 5FLXA 4FDTA 3DMHA 1NKVA 5KVVA 2RHTA 3ED1A 3RVSA 1GFZA 3RYIB 4BVJA 3G82C 1TCUA 1YC5A 3OZBA 5JYDA 3O4FA 1KGSA 2D5LA 4QQKA 4ZARA 2H1HA 1RKUA 4ZPJA 3H4MA 2BLLA 3ADBA 2YIJA 1P0CA 3TXAA 3F96A 3WOVA 4KX3A 2CXSA 1OBVA 3MYYA 2CXXA 2O5VA 2IEIA 5BT9A 1KI6B 1KKUA 1TU4A 1T0JB 2JLAA 5C8YF 2I3AA 5C51B 1S3FA 4FSHA 4ZYXA 3I64A 1A2BA 3GIDA 4BTVA 4H9GA 4GNKA 3C6KA 2NUPB 2DY0A 3LY8A 4HEQA 5FNVF 4WHMA 4C9BA 1YE5A 1Z8DA 2AUTA 3MHTA 1B23P 3DBHA 3FCAA 2J5XA 1TECE 4GGOA 5T4BA 1U6IA 1TFRA 3QZUA 3OOYA 3QX3A 2XWPA 2FLWA 3WE7A 3ZHOA 4JI0B 5C5CA 5H4GA 4MUBA 1C7QA 1QO0D 2GBCA 1EVYA 3T15A 2EFJA 5EMKA 4DNXA 3S2YA 4A8JA 4ZZ0A 2CCJA 3LWZA 1KQPA 1D1PA 1V1RA 4RHEA 1ML3A 2DJIA 2FMIA 3PXXA 2EWMA 5EZSA 4DA4A 2X1MA 4FX2A 4J76A 1DCKA 3B38A 1SCBA 3PHJA 4QFCA 4WOPA 5LKAA 3T7KA 4Y2VA 1M1UA 3GNLA 4JX9A 3BGVA 2W83A 4JLKA 3T1TA 2XLBA 3E18A 4PGMA 5T8KC 3INRA 5JZMA 1SVIA 2AWNA 4HDAA 1XVIA 5EYPA 1I4LD 4X90A 5M2QA 2ODNA 3K6SA 4J0IA 8OHMA 3N2IA 2C2KA 1RZRA 5K8TA 3QJ5A 1G3QA 3N5KA 2ILVA 1GZUA 3GUZA 5JAZA 4WEOA 4N0DA 5HBGA 1RQ7A 2XKAA 2ZWVA 1V41E 4QEDA 3NNSA 4DR5B 3PXGA 1PFYA 5BN1A 3C3YA 4IXDA 2AV6A 3V2HA 3EMBA 4GPBA 2GNAA 1FUIA 2KQUA 4U2CA 3U3RA 1Z0JA 2CVZA 1J8MF 3VHQA 4GYWA 3D0RA 1PW7A 4O3FA 4HH0A 2DLCX 3VA7A 3VKHA 3GJ3A 3H6GA 5DXFA 4FYMA 4UU8A 3WWOA 5E6SB 3PA8A 4JGGA 4KZKA 1SELA 4EGFA 1TIKA 1AO3A 1EXNA 2BHTA 4OD0A 4JBYA 1ISHA 1GDHA 4JT9A 4L3VA 4DCNA 1EVLA 4IIVA 2APJA 3KZCA 3V1KA 3CJRA 3RYCA 1ETHA 4RPJA 2JFXA 2FUG6 3ILYA 3NIWA 1V39A 4N8SA 4UBMA 2XMGA 4EDHA 1EVJA 5LP6B 2NTVA 2GZDA 1MDFA 1KQ3A 2ISCA 1PBNA 3PF8A 4JLPA 1FU7A 4CLHA 1E3DA 1EDZA 4RACA 3WLRA 2XGMA 5C53B 3VR4H 2VPXA 1OQAA 1CZHA 2OFXA 5TQVA 3AGPA 3P2MA 4QM6A 2X77A 2OFOA 1GLNA 3Q3EA 2VT2A 1RWBA 3DM9B 1IPEA 3DUFA 4XR4A 1ZH0A 2X0RA 4NU8X 1U81A 5EHXA 3DE4X 2F1RA 4ML3A 1XZPA 1RC0A 2JA2A 1L5RA 3CF4G 3K7EA 3BKXA 3WNCA 4IEIA 3H1GA 1IK6A 2VDRB 3JS5A 5BN4A 3DV0B 4FUQA 4IQ4A 5BN3B 2G25A 1TNDA 1WXFA 4MR7B 1ZH2A 4OI1A 4BJ6A 3K5WA 3I0ZA 4US2R 2IL1A 3DZJA 2EZ4A 3NEJA 4C6HA 4URWR 2H7XA 2DBRA 3R3YA 3WR5A 3RUIA 2G1JA 2IS1A 1ISRA 4XWOA 5AXAA 1KC3A 5EJ8A 3RUHA 2GFQA 1CZLA 4MJLA 2HCJB 4YQYA 3OOWA 5ISMA 3GP3A 5CFLA 2A0YA 5H5JA 3HP1A 4K3UA 3EZXA 4M4SA 4BFYA 1YQWA 2XR1A 1VCIA 4UE3S 5LLSA 2VWHA 3IDQA 3JQQA 1B14A 4NC9A 5BYJA 1CULC 3AI7A 5LQNA 4AUMA 2H31A 2B3DA 2R1TB 4X61A 2ZS7A 2F8MA 1QRAA 1N6PA 3BXEA 2P9QA 3QVMA 4RVOA 4RTLA 3HXTA 4BLQA 5AW4A 5F9HA 1YRHA 2NXWA 1ONSA 2ZK7A 3EUFA 3KVRA 3M6FA 3S1LA 2WLTA 3TNJA 3UXEA 5I7OA 2PYIA 4IINA 4FSXA 2Z8YM 3CYFA 5EIOA 3NHRA 3DHEA 1PTKA 2CXTA 4OJMX 3UO8B 4LDJA 2GXSA 3GQBA 3VVMA 2I3DA 2QP9X 1U04A 1ESZA 2X40A 2Y1CA 4FCCA 4OXNA 3K71B 1K88A 1Z0IA 3VPDA 2ODTX 2A9PA 3BK2A 4B3XA 1Q0ZA 2WK1A 4CKWB 4K03A 1X1TA 2AXEA 4PR0A 4F06A 1XTPA 1ZGJA 1V4VA 2QTVA 1KO8A 3IRVA 1R6DA 1XIVA 3HB9A 3Q3IA 3MWKA 5HZMA 1U2RA 1P7ZA 3NWBA 2FZGA 4IUDS 4PW0A 4LYDA 4F96A 1GJRA 3CCCA 4IHJA 1PWEA 1J24A 2BEJA 1E2MA 1LJUA 1S8AA 1VZ3A 1F8UA 1S8NA 2G83A 4DR1B 3FAZA 4HLUA 2AQ8A 1KF0A 3LJKA 3OD1A 2B1QA 3C24A 4NX2A 3U4GA 3JATA 1F2DA 1Q15A 1FLVA 1QPBA 1Y8QA 4WCVA 3W5JA 3U37A 1XP8A 4G97A 3SFTA 4LPKA 4FJ0A 1Y8RB 3WDKA 3H8SA 1R8JA 2ZPUA 3IOCA 4NH0A 2WP0A 1G3RA 4QQFA 3AVOA 4WA8A 3E3AA 1PSWA 3F6CA 1TT5B 1NI5A 3GF4A 4UVEA 3RVRA 5HJ5A 3NWPA 5SV2A 2O8BA 4HWTA 3L1KA 1V4NA 2VVTA 2Y1DA 2BEVA 5KINB 4TPKA 4ZEMA 4PANA 1UC4B 3F4LA 4FYYA 2J9FA 1TZBA 5EUBA 4YJ2B 4KFSA 2QLTA 1K3TA 3M70A 3PL5A 4IGEA 1YCHA 3RLFA 3TZCA 4GEGA 3WWYA 3BRQA 3ZWQA 2W4IA 2Z9BA 1J8QA 4YP5A 5E7JA 3Q87B 4QGSA 1E79D 1WZNA 1EK0A 3AF6A 2F9LA 1I36A 1D7AA 3H5OA 2PXHA 2WA2A 3FUCA 2O7RA 3HR4A 4E5KA 1NTOA 4YRMA 1J2TA 2NYAA 1CY4A 2J4FA 3TCXB 3IAUA 1HNXB 1NP3A 2GPWA 4PO1A 2X7JA 2B8EA 3TLGB 4FINA 3ZNPA 4BV8A 3T4PA 4JLBA 4EPWA 1NJ6A 4N9WA 4B48A 4L73A 3GLRA 3TEMA 4K9NA 4Q7QA 3M89A 3OPMA 3MCAA 4P32A 4RJKA 1I1NA 3NX4A 4HRVA 3TUIC 1FJGB 3ACCA 3R5TA 1EIWA 2VSOA 2FG7C 2VYVD 4ZGGA 2HK6A 1R9NA 4JCOA 4S1VA 1DCTA 4NRDA 4BP1A 3ANLA 2PGNA 5CA1A 1KTIA 1N8TA 3QE3A 3FPGA 3WZ2A 2Y71A 3WDLA 4PF1A 1R9JA 1BWRA 1HORA 1QHXA 2P77A 2PO5A 2QUIA 2IFTA 2WBLC 2IOFA 4NJEB 5ALFA 1QPZA 3ADDA 3T1VA 1KO1A 1MQAA 1UBKS 2XYGA 3A6DA 3IALA 1FL9A 4N5IX 3KL4A 1W4AA 3EGCA 3G6WA 1R8SA 3SHVA 4BXOA 2ATCA 2AMVA 2A3RA 2I6XA 2W0MA 4YMVA 5LWHA 1KTVA 2OZVA 3WL4A 1BE8A 4B4WA 1WVIA 5HR5A 1H1DA 4OQMA 3EWNA 3OEEA 4ZJPA 4V1CB 2B3TA 2VC2B 3RLIA 3G85A 4L5CA 4ZVSA 3PLAE 5FB3A 4WLEA 2FEWB 2C4UA 2PX3A 3DNPA 4MQEA 4DMRA 5HM8A 2CSXA 4MRMB 1BWQA 1UFOA 2EYQA 1EX7A 2H2FA 2NU7B 2WJWA 4QUHA 3WL7A 4ALKA 1E2GA 2JVKA 1J2YA 1AB6A 1F48A 1KXZA 2X4DA 5IKPA 3EPPA 4I55B 2NAFA 4FP9A 2Q4DA 5KYVA 4GPEA 1GRRA 3R24A 3AUAA 2JARA 3VYRB 1SBHA 2W2PA 3UMJA 4DV0B 5JZSA 5AUNB 4JI4B 5T4HA 3CRQA 3D3JA 1E3WA 3NM4A 3R3XA 1ZD5A 4V24A 2P40A 1C7IA 3G68A 4QFDA 1KAQA 3BXHA 2J67A 4LQCA 3T5BA 1JPUA 4PHCA 5EIAA 1JG2A 5JPIA 1J97A 1W4RA 2P9GA 2X0NA 3BMNB 3KZVA 5FL7D 1V6SA 1JEYB 4A2CA 1JA9A 4UCFA 2WT9A 2XSZD 3PCRB 3ZKWB 2QJFA 1BGWA 1DBWA 5BWMA 4EO9A 3PIRA 3D43A 3WI7A 1JEJA 3JPYA 1QE0A 2ZSBA 4C7OA 2ZM6B 1JIIA 1Q7BA 2FUG1 2YMPA 1P33A 3QBDA 2E49A 4X97A 5DTIA 4Y7DA 1H65A 1KKLA 1HTWA 1U3CA 2CJPA 2PMBA 1QHHB 3EISA 3IJEB 3R76A 4HTFA 5DW3A 1QH8B 3GJ4A 2JIQA 1EP9A 4DG8A 4MHSA 5EVCA 4IH9A 1MORA 5CA0B 2W4QA 1HSZA 1EUDA 1V7QA 4QVIA 2WHPA 4EVRA 5K6AA 1NVKA 3HUDA 5K03A 2AFRA 3FFWA 4ZZ2A 2C2GA 1UIMA 3RS0A 5CJ2A 1LY1A 3USES 1MAAA 2EU8A 5A6SB 4D8XA 4DDVA 1DAHA 4NE2A 4RKYA 4TTQA 2CMGA 1CSEE 1QQTA 2QAGA 2G4CA 4FC7A 3FTEA 5IRCD 2XAAA 3IE1A 3LI2A 4XPIB 1LUAA 2PWBA 2TMDA 4HWRA 5KAPA 3VX4A 1KK1A 2OHVA 4CEIB 1XKLA 4KVFA