3PD0A

Caspase-3 e246a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
238
Chain Sequence
b'SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDSGIEKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATAFESFSFDATFHAKKQIPCIVSMLTKELYFYHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3
publication title Thermodynamic, enzymatic and structural effects of removing a salt bridge at the base of loop 4 in (pro)caspase-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 238
sequence length 250
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pd0A00
4HVAA 1PYOA 1SC4A 1ICEA 1CP3A 3V6LA 4JR0A 1SC1A 2FP3A 1RWOA 4AWBA 1QX3A 4IEFB 2H4YA 1NW9B 5LUAA 1RHJA 4HQ0A 1RWMA 1RHMA 3IBFA 3GJQA 1RWWA 4NOKA 4QUGA 1M72A 1RWPA 1RWNA 2C2OA 1I3OA 2J32A 4QUDA 2H5IA 3DEKA 4N7MA 5IABA 4ZVRA 4PS1A 3H11A 5IC4A 4M9RA 2XYGA 1RHKA 2CNKA 4ZVQA 4EHKA 1QDUA 4JJ7A 5IAEA 5IBPA 4EHFA 3V4OA 4N7JA 4QU8A 4IYRA 3P45A 2HBQA 2C1EA 2QLFA 4QUHA 2XZDA 1RE1A 1I4EB 2CNOA 2DKOA 4FDLA 2QL5A 2XYPA 2HBRA 3EDQA 3ITNA 5IAJA 1PAUA 3UOAB 3R7BA 3IBCA 3KJNA 4ZVPA 1RHUA 4DCOA 3V4LA 2H51A 2P2CA 2CNLA 4JR1A 2H65A 4QUIA 3PD0A 3BIJA 2QL9A 1RHQA 2HBYA 2XYHA 4JQZA 4EHNA 1NMQA 3DEIA 3PD1A 2K7ZA 2C2MA 4FGUA 4EJFA 3EDRA 4ZVUA 4QUJA 3QNWA 1K86A 4JQYA 3H11B 5I9BA 4I1PA 4QU9A 3R6LA 4N5DA 2HBZA 1F9EA 3SIPA 3DEHA 2J30A 2H48A 5IBCA 2CNNA 4PRZA 1RHRA 1KMCA 2CDRA 3P4UA 2J33A 4LSZA 4D3XA 4D3ZA 5K20A 3S8EA 4EHAA 2H5JA 5LU8A 2QLJA 4AWAA 4QUAA 1NMEA 5IASA 4NOJA 1I51A 2Y1LA 3KJFA 5JFTA 3H0EA 3RJMA 3NKFA 4QTXA 5I9TA 3S70A 3K7EA 3R6GA 4ZVSA 3D6MA 3R7NA 3SIRA 1K88A 3DEJA 4FEAA 4QUBA 4ZVTA 1JXQA 2AR9A 3R5KA 4JJ8A 4N6GA 3OD5A 1RWXA 3H13A 4QU0A 4HQRA 3NR2A 2C2KA 5IAKA 4PS0A 3KJQA 3D6FA 3NS7A 2WDPA 1GFWA 4AW9A 1SHJA 4FXOA 2Y0BA 4NOMA 3GJTA 1GQFA 2CJXA 2QLBA 3R7SA 3E4CA 5LUBA 2H54A 1CVRA 2QL7A 2XZTA 4I1RA 4JJEA 4JR2A 3H1PA 5IAGA 4QUEA 5IANA 3V6MA 4NBKA 4DCJA 2CJYA 3V55A 1I4OA 3GJRA 4NOLA 2H4WA 4EHLA 3GJSA 2FQQA 1F1JA 1RWKA 5IARA 3PCXA 1SC3A 3V3KA 4ZVOA 5H0IA 5LU9A 1IBCA 4QTYA 4EHHA 2FUNB 3UO8B 4QULA 5IBRA 4DCPA 1RWVA 3R5JA 1NMSA 5IC6A 4JB8A 4EHDA 4PRYA 2C2ZA 2J31A 1SHLA 3D6HA 1BMQA 2NN3C 4N6OA 4NBNA 4QU5A 4D3YA 4N6NA 1QTNA 4NBLA
chains in the Genus database with same CATH superfamily
4ZO6A 1E63A 2VHQA 1G8GA 2G7ZA 2GM3A 3KQVA 1S2NA 2PLWA 3PYLA 5D00A 2OMEA 3T94A 4Z7OB 5C8VA 1AUPA 2VTBB 2HWUA 5SV2A 1TYZA 4PGFA 3TLYA 1Z2PX 4DSNA 3ENKA 3RS9A 5C1BA 1Z25A 1YVUA 3TTYA 4Q7MB 2GN8A 4FQ5A 3NT2A 3WFIA 4U2GA 2XB4A 4DLUA 1OY1A 3SMVA 1MO3A 3E15A 4MPTA 1V8ZA 3GZTB 1L5QA 2I7XA 2JGDA 5K6RA 2CLMB 1WNTA 2X3YA 1MF7A 3FX2A 4GNRA 3ZXYA 2BH2A 1UFQA 3SQNA 1E69A 5LA6F 2ZWIA 3WYAA 1AF4A 2H8KA 2O7VA 4C0XA 1J49A 4MUMA 3KT3A 4Y9SA 3QEMA 4QSMA 4PSDA 5AJYA 3MT9A 4OM8A 4NYJQ 2RC6A 3CXUA 4GRAA 4WUVA 3SHTA 3A1CA 4FVTA 4I4IA 4NU0A 3ZVRA 4CUZA 5FTNA 3G0DA 5AHXA 2Q3HA 1DBSA 3CQ9A 5GPBA 1SUWA 2ODPA 4MUKA 1UFVA 4XUDA 3UKDA 1FP6A 3RU7A 5LOVF 3LOPA 1I2MA 1JQLB 1GCAA 4RGQA 2JVIA 4JB0A 3ZG6A 4CYMA 2VUSA 3BSSA 3KDPA 4PLHA 1TO6A 4KYTA 2VAWA 2I7VA 2YNMC 4D7AA 2Q5IA 3MGBA 1GQRA 3QIAA 5F12A 3RTCA 2CF5A 1L7OA 3DNFA 3WLRA 2Z57A 3ESQA 4XFDA 1A3CA 4OQXA 1LLCA 3K9HA 5KOIA 3EGEA 1GNLA 1Y1RA 2QM8A 3SZMA 1KWGA 2QQ5A 4HVCA 4NMHA 1IEWA 3N5CA 1MGPA 1IH8A 2ZS7A 3AJ9A 3JWHA 5JO0A 3ZVMA 1CEEA 1CUFA 5JDCC 3BD7A 2VYCA 1ZNZA 3OY2A 1DQRA 2R47A 2ZYWX 3MMPA 3WMGA 4DLTA 3NVDA 3MJTA 3FDZB 2I9KA 1DDIA 1K89A 1R16A 3WLJA 3QV2A 4IFTA 3A9WA 3TGWA 2WJGA 3C3CA 3E22A 1KDYA 4UMEA 1V8DA 3MILA 3SIRA 5EP3A 2WV9A 4UVHA 1B42A 3WRXA 1GARA 1LSSA 3NPAA 2BEUB 3AV3A 2JB9A 2NG1A 1Y8RB 2PX0A 1ILEA 4FLEA 2QX4A 3EVCA 2FHSA 3CRNA 4I6GA 5EC8A 3UJHA 4JL6A 4EYSA 1S3FA 5C8DA 1E4EB 1IBLB 1V11A 2VT6A 4IKEA 2P6NA 4BFZA 2B82A 1Q12A 3RYCB 2IW3A 4ABYA 2MSEB 4LRTB 4O5OA 2ZSDA 2CJXA 3N6VA 2QLBA 4RENA 2OWEA 4XLTA 3PIIA 4B4KA 4IW3B 1R10A 2QAGB 1T0JB 3RS2A 1FU4A 4DUGA 1JG3A 2YFKA 1C3LA 4FGSA 5EJ9A 3PPYA 1ICIA 1O6BA 1BHSA 3EASA 3SYNA 3HB9A 3VAAA 4JUBA 1GNQA 5BT8A 4Y18A 3BGVA 2WFAA 3QKIA 3GT7A 3K0AB 3KKKA 3MM4A 2OP0A 1VKRA 2OSVA 3R5JA 5H81A 4I1OA 3KVYA 4TXLA 4ZOCA 4AS3A 2I34A 1U65A 1LQ2A 3HNPA 4HGZA 2V96A 3M7IA 3ZWQA 2A1UA 3AKDA 1XLTC 2GFQA 1YAJA 4QOJA 2KLBA 3OM1A 2ASVA 1MMFB 4EPXA 2HLHA 2GARA 3UW1A 5F1KA 5L8VA 5M5BA 2CLHB 3O90A 4Q7JB 1S8AA 1IVSA 4IOLA 4FILA 3ZIAD 3PJEA 3UJPA 1SUPA 2GMWA 5ALUA 4R31A 2WR8A 1C0PA 2CCGA 2O0MA 3UKJA 3VDNB 4ZIRA 4LI3X 2YJ5A 1CF4A 1JYEA 3KTAB 4RDCA 3MG9A 3FROA 4OBWA 2O8BA 4CDMA 3PX7A 1RRPA 2BMDA 2O3JA 1I0ZA 1GTG1 3VR5D 1J21A 1QP7A 3U60B 3COWA 3OIUA 3ZHBA 4DR4B 5IAEA 2FUEA 4IIBA 2Z5GA 5CIWA 5K01A 2D5CA 4CT4B 4HB2A 3VHLB 2I8CA 2FUG6 1NBEA 3D8RA 5E4JA 5INTA 5C37A 3TE6A 5LQNA 1YRAA 1YI0A 2G1AA 4LYJA 2ODBA 3G5TA 3OPYA 3LNTA 3KZ1E 5A2GA 2F7SA 2EL9A 3E84A 4QDUA 3IDAA 3VGJA 1K0UA 3ZS9A 5FNVA 1JZTA 5IYZA 3BWDD 3DE0X 4L8YA 5FWDA 2DQSA 2OL4A 3KYIB 1ADGA 1Z4LA 2VJYA 2BFNA 5LC1A 4DTIA 3C15C 3L1VA 5FLYA 2OUIA 1RJ9B 2FX2A 3MCVA 1SQSA 3DLAA 1R0XA 1WOMA 2R1UA 3CW8X 2J0QA 1P0MA 3DV0B 3FMVA 4ZXPA 1HE4A 1JDZA 4FOPA 2MYNA 4OG2A 5IT4A 5J4LA 1V96A 1GSIA 2UXDB 5JHHB 2EIHA 4DN6A 3EULA 2FVYA 4M22A 5ALKA 4M88A 1K7CA 1SVLA 2EJCA 3X1DA 1MD9A 1FCJA 2M2IA 1VLVA 4L5IA 4LJAA 1RQNA 5GONF 2W6PA 3KPVA 4XYGA 2VXCA 4F3KA 1JH9A 2BFDA 1N2CA 3BWYA 5DGHA 5DTQA 4BZZA 3JARA 2RGCA 2I62A 2CVZA 3QW4B 2HDWA 1M3SA 4OREX 3UHAA 1QXSA 4A1FA 4BB9A 4R40A 3KE8A 2OPBA 1UODA 2HL6A 1Q74A 2PHZA 4IF6A 4NULA 5CYOA 3RH0A 1TGYA 3DEJA 1LWNA 4C6HA 1XRMA 2SECE 3PEUA 2IBTA 2R65A 3FJ1A 4JJ8A 4MLZA 2FX3A 1X1TA 2WU4A 2YWGA 3GLFE 2DMRA 4YRQA 1TIKA 4BNLA 1YR1A 2HY7A 1LI4A 2Y4NA 4EVSA 1XZNA 1U80A 2KMLA 5GINE 1EP3B 4WNCA 1V47A 4FYIA 5I4BA 3SQWA 1IUPA 2C20A 2P68A 2VPIA 3P2EA 1Q91A 3RFTA 1TYEB 3PS9A 4UM9B 4JP8A 3RT1A 3K94A 4FX5A 5IKXA 1MAUA 2QVXX 1TJ4A 3WAJA 2P9ZA 1WKVA 1QKIA 2WD7B 3T9AA 2F43A 3ZWXA 1CVRA 2BZ0A 5HK8A 1FPMA 2NU6A 1T15A 3ENWA 4EFMA 5BWLA 5JPDA 3PC6A 4FHEA 2B92A 3BIOA 3IQFA 3G7SA 5FUYA 4W8HA 1BX0A 3ONWA 2YWBA 4B3HA 3GP8A 3KU4A 1X1RA 1R5NA 1KNQA 3EZXA 2WTBA 4GBED 2GZSA 4UXHA 4LDNA 2DLCX 5KJ1A 1T10A 1YJXA 1W36B 2X4DA 2VSYA 2JIZD 5FBLB 1QM5A 1GT91 3A14A 2CV1A 2PWAA 3IOBA 2RGEA 4D9CA 2PXAA 4JUIA 4TV9B 1YMVA 4Y1RB 2GERA 4AC9A 2ECFA 4UPEA 1PQWA 2LUOA 2WD9A 5T64A 3GELA 5FORA 2IU6A 2GZDA 2P9GA 3LD9A 1NA5A 3LUKA 4W6QA 4C7MA 5AW2A 4DUYB 2H4YA 3SD7A 4ZI7A 5F7OA 1Q0QA 2I4TA 2R5NA 3M5DA 1XL1A 1CPYA 3P0HA 4PR0A 3GRPA 4QBHA 5JEEA 2G7MC 2R2GA 4Z4FA 4AZVA 3TW6A 5EUMA 4AF8A 3WGHA 4BMYA 3EIQA 4JKYA 3CPSA 3BDVA 1MABB 4B45A 4Q15A 1BCRA 3RBAA 1PU2A 3H1GA 1X7GA 1MPTA 2BRUC 2EX4A 2HIHA 2Q8NA 1KMIY 2VBIA 3AFIA 1OXVA 4KVZA 4Q37A 2F3PA 1Y1KE 2GOYA 2JGRA 2X13A 4MWOA 4E2FA 1ZMRA 5EVCA 4YXWA 4E4TA 4NG5A 4LF4B 4BRUA 5F9HA 4X1YA 4WACA 3MYYA 3WTCA 5B36A 2DPMA 1X1BA 5MFPA 1Y8CA 3KJZA 3AEQB 4S2UA 3OZEA 3KYDB 2CGEA 4PQGA 2GJ8A 5B3JC 1N5JA 3IBYA 4IWYA 3L06A 2QE7D 4MUYA 1SEPA 2W71A 3I01M 5AI6A 1UKYA 2OV2A 2PZFA 3ZK8A 1Q1EA 2X8JA 4AL4A 4DA6A 1YJCA 2YJTD 4DQKA 4I5DA 1IK4A 1HTWA 3ETHA 5HM8A 3LPCA 1RWBA 2FZVA 2ZREA 4HC4A 1PWXA 1EDDA 2A7XA 4E3ZA 4XVRA 5KOHA 2O0HA 2PD3A 2OAQ1 2HO4A 2WJPA 4XWOA 1VJCA 1WUKS 3QYPA 3SLKA 1R4AA 3M4JA 2W6QA 5L51A 4HDKA 1LUAA 1MORA 1DO2A 3W9YA 1G8KA 1UC8A 3PDHA 1APBA 2PZEA 4RBNA 3VR5A 1CETA 4D8XA 3TUJC 1YKGA 2PPLA 1J2TA 2G63A 3AHHA 1MV8A 4MO9A 3D3NA 4NYMR 5C31A 5TS2A 5SY4A 2X86A 4QGAA 4CCWA 3F5MA 4HGYA 3VR6H 4ZHSA 2C7GA 2Q1UA 3ZZ0A 1E4VA 3SWWA 1K8XB 2QF7A 4LJLA 5ESDA 1MLDA 3UAZA 3WLKX 5A4MS 5CFQA 2GCPA 3V34A 2A8YA 1FYWA 1P1FA 1NX9A 1QGAA 1ZAKA 1VKJA 2J3HA 5BWCA 1JHZA 2X9LA 2D74A 3GLFA 4RK6A 3NPMA 2AXEA 2BGLA 1LNQA 1NT4A 1USUA 5JXWA 4BFYA 3CSSA 3MJEA 4HH4A 2RG7A 3H8JA 1YK1A 4EWLA 3H1TA 4I9UA 4CETA 3TE7A 1UBUS 1Z8FA 3MAJA 4BBPA 2P2GA 5H9VA 3SEQA 2YMQA 1D2EA 2VP3A 3AUFA 3CZ9A 4ARUA 3I5UA 1O96A 4YDQA 1PUXA 2G4LA 2EOAA 1I13A 3DWEX 4BMDA 3OCCA 4HB0A 1NIPA 2ZTUA 3L7DA 1W4LA 1M66A 4C6TB 1AZTA 4B33A 3H8WA 5BNIA 2G0AA 1F3LA 1P4HA 4P38A 4BNNA 4E94A 3SC4A 2AOXA 2VQ3A 4AJEA 2G5CA 3AR8A 2NTEA 2OYCA 2VBFA 4ZC1A 1ZBQA 2IL1A 4QJ3A 4IIHA 1E2DA 5EP1A 1YZUA 4CG2A 1NURA 4E2ZA 4P35A 3P7MA 4IHKA 4UEKA 2B1IA 4V0OA 4KHZA 4A23A 1I1OA 4FONA 2A67A 1WUYA 3CEPB 4FUTA 3CA8A 4HPJB 3RVSA 4D4MA 5KO2A 1O0BA 1C4WA 2I3GA 2VPPA 3G8AA 3VAZA 3R3XA 5A3RA 1K3UB 2AOUA 4M60A 3GT4A 1CUEA 3BMCA 3MAGA 3CPJB 1GN8A 3WMFA 3QUBA 4IXWA 8LDHA 3IAXA 1JQDA 4QFCA 1VXOA 2ATIA 4EUKA 4UTZA 2NMVA 4JLAA 4ZMSA 4O25A 1YQ9A 3IAEA 4M9ZA 2QRZA 3FRIA 4MQ5A 4KMRA 4UCFA 5FNZA 3SZLA 1NZFA 4BATA 1E6KA 3ADPA 2UYGA 2UUOA 2OA0A 1M7GA 1FLNA 2BFWA 3AETA 1KAHA 3HCWA 3AVYA 4HMQA 2PZGA 4LHSA 2C78A 4LCJA 3RRNA 1ID8A 4NJEB 3UXEA 3WGQA 1XTZA 1PEAA 1DHRA 2C1EA 5CDSA 2NT4A 4FUQA 3OMLA 4HWKA 4V3CA 5AMXA 3WRXC 1XI2A 4PAGA 5EE3A 1R0BA 3FWZA 1ELOA 5HIIA 3CTPA 3ZHRA 1TB4A 3FHOA 4X62B 2QB5A 1PNVA 3PE6A 2JIZA 4WXYB 4N3BA 2PUHA 3EXHA 4LE0A 3F6BX 1ZVKA 3C39A 2FEAA 5GV7A 3PUYA 5KWJA 5DK6A 3N2KB 5B37A 2W48A 5KHOC 4TV8A 1RJGA 2VSOA 3DKPA 3PXDA 2GASA 4IMIB 4OEHA 1K86A 3HYSA 1C7EA 2Q62A 4PBTA 1L4GA 1DXQA 1JZSA 1Y82A 2XW6A 4EDFA 4YT2A 1B1CA 1NL3A 2X22A 3WLPA 1QYXA 1BE1A 4PRZA 1K06A 3BWXA 4U7WA 4XAQA 1I3LA 4D3ZA 2B2NA 1GV1A 1FBTA 1AQUA 3RKRA 1VBFA 3PICA 2EU8A 3PCTA 2UVPB 3EY9A 1QANA 4IOMA 4AYXA 3KJFA 2WHXA 1HT3A 1QGUA 3CEJA 4IIXA 5HF5A 1QH8A 1Q0SA 3WYNA 4DLZA 2L42A 3UY4A 1QLJA 4U5QA 3FTDA 2RIRA 1OB5A 2IEAA 3E3AA 4DARA 1NP3A 1UBSB 4G5GA 4DLXA 2BGRA 5AVOA 4HQOA 1O5TA 3JALB 1FTWA 3L0DA 3UYKA 3H8VA 3TAUA 1Z7BA 3T3GA 1BC5A 1FXWA 1NJ2A 3UWDA 1SCBA 1XQYA 2QE7A 1E2QA 4KSBA 3TR0A 4X8LA 5CA1A 2FG7C 1MB0A 1IBSA 1NG1A 3K0CC 3J80A 1OX4B 1U8AA 1DEKA 2C3MA 4PRLA 1A1VA 4LMPA 421PA 2Q6KA 4TLAA 1QYDA 3LQQA 4Q3AA 1OXTA 1N4DA 2C83A 4XB1A 4AMGA 3KPJA 4YPVA 3CN9A 1VE7A 3M5WA 3ZBPA 1NVXQ 5IU6A 3ZD6A 3ASVA 1PFGA 2Y9PB 5H4GA 4QO7A 4YYZA 1SUSA 5FUMA 3HI4A 5FWXA 1EDOA 1K4KA 1AZLA 4N7BA 4J0GA 4DIEA 1U7TA 3QEJA 5L4NA 1YCDA 4LFCB 2WZDA 3OICA 2EW8A 2EWVA 1C3OA 5J2UA 3G02A 3D3WB 1TUBA 3IB3A 1VE3A 1ZZEA 3GMTA 3S2SA 1ULHA 4JL8A 1G38A 1KYYA 3FDFA 1N0UA 1VRVA 2RAUA 2XB9A 5C7YA 4G0MA 2XT6A 1R0RE 1KOJA 5EINA 4XSHA 4ZAZA 4DIBA 3N0TA 4US2R 4D98A 4TMYA 2PT6A 3UB4A 2XUJA 4F71A 2H4ZA 5K2MA 5I7UA 2ZDQA 3OVMA 4ZRDA 1GU0A 2A78A 4P86A 2YV3A 3U6KA 3U7HB 1SKAA 3HWSA 4PS1A 4URHA 1GKKA 3K96A 3LP6A 1RM3A 5IYZF 2C92A 2RBEA 5MN5A 1ZRHA 1G2PA 3DDCA 4L15A 4PQFA 5AVKA 1NRIA 3VKWA 1SOUA 5GOZA 3ZEIA 2OV1A 4YRBA 3HUTA 3P9ZA 4RQBA 4BN4A 5A4FS 4OX9Y 1VYHA 5DHQA 1ADCA 2V97A 4OMFG 4CIYA 1UZNA 5B7QA 3TQCA 1U5BA 2IYPA 2HW8A 2NVUA 5FR1A 4CMEA 4QOIA 1L1QA 1I7DA 1MQAA 2GA9A 2FRVA 5DBGA 4B47A 1JHVA 3O8DA 5JUWA 4RVSA 3Q3EA 4GPAA 1IHOA 1VCIA 2FVXA 3OJCA 2QL9A 2X2FA 4CT0A 2C7PA 4YP9A 4OXIA 5JAOA 3A6EA 4J29A 1RXEA 3KR0A 1JEJA 4ITUA 2R7MA 1JDNA 4K9LA 3BD9A 4ZTBA 2G5GX 3L1UA 1G9SA 1JLKA 2KBEA 3Q5GA 5DOVA 5JPIA 1YHYA 2PRSA 3G7NA 1B16A 3OIFA 4L0CA 4MS1A 1WW3A 4LOKA 3K8OE 4NPAA 3RS5A 4CNBA 2V1UA 2OBLA 5F1YA 4QGGA 1OWNA 2O59A 1JDUA 1RHRA 2E1RA 3FMIA 2QLTA 2WIDA 5CJJA 4EYEA 5K20A 3TQFA 1BFKA 3NDRA 2XCRB 1R8SA 3PQ2A 3ROEA 2FRDC 2FAXA 3FF1A 4ND2A 2V7UA 3ANMA 2M1XA 3FCSB 3LXUX 3O7MA 4WZ6A 4TMZA 3OLYA 4KDFA 3O1HB 4XM1A 1WE2A 1QFJA 4CFSA 1QBKC 3R6DA 4DV6B 3ZDAA 1DJMA 1AE1A 4C14A 3NANA 1Q7CA 2E5FA 2KI5A 2AFHA 2XJ9A 3LCMA 4TYQA 2C3UA 3BXFA 3QXHA 1P17A 4JBNA 5F77A 2FB9A 3V8EA 4AF6A 3OZBA 3RSOA 3SKYA 1KO7A 3C14C 1M2WA 1RQLA 3GEHA 2RGRA 1QAOA 2OFWA 2I71A 1ZJJA 1C0LA 3GARA 3GJ4A 1OTYA 2BMEA 1L2TA 2KW5A 4AM8A 1W88A 3H6GA 3P8ZA 5FBZA 1GPNA 1OAOA 1XDBA 1ZN9A 3CNLA 1C1XA 4O08A 3T35A 4FKMA 3LH5A 4N40A 3R7SA 1MW8X 1A9OA 1D1QA 1SKBA 1YNSA 2YHIB 3OE1A 3W79A 4F4DA 2VG8A 5AKHA 4YRCA 2NSHA 1G42A 2E55A 4F1JA 2JLYA 3IURA 2L17A 4HQLA 4MVJG 2A30A 2WWIA 5A7FA 2ZJBA 4YEDA 1GT6A 3T95A 3TNDA 4RK0A 2IUEA 2P9CA 2AMLA 7REQB 2O2ZA 4KDEA 3WAGA 2JRLA 3BTUA 2FOLA 4FOSA 3LAWA 1ZW6A 4MGIR 1HK7A 1XA3A 3R8CA 4L02A 3SBEA 5COQA 1F5SA 4JC4A 1G0OA 1XRPA 2PMDA 3DYBA 4QXAA 1AGXA 3RFFA 3KKPA 1XK7A 4GR9A 5IYZB 3AUXA 5HWSA 1UOEA 5JPCA 2J3QA 4JYZA 4WOKA 1UPFA 3FTEA 1A5SB 3PEEA 4DJFC 2PXXA 3IEPA 1IWBB 3M6UA 4TTIA 4IIUA 3JV7A 1CYEA 2XCUA 2J4DA 3LT5A 1T4GA 4G37A 2RKWA 4IZOA 1JXMA 2P2LA 3EE6A 1C3EA 1P6XA 1U8TA 1YDGA 3X1WA 1BA3A 1S3GA 4G5HA 1JKFA 1MA3A 3GJ0A 5TGZA 5AUQA 1GY8A 1U3CA 1JFTA 2VR1A 4OAOA 1BHO1 2PM8A 4GPZA 2I7DA 3I73A 4K9KA 4WINA 3HN6A 5ALWA 2BTOA 3C41J 4HAUA 2ZJ4A 4IH9A 4MEBA 1S3IA 1EM8B 2D5BA 3KQTA 4L9RA 4WESB 1ECPA 1UT6A 3ZIDA 2MWMA 4FFWA 4D4IA 1QE5A 3O4RA 1PR5A 1ETUA 1QKJA 3B85A 9MHTA 2IXDA 5TMPA 4TZ0A 4KBGA 1TZJA 3DBLA 1J2YA 1COWD 2QX9A 1G21B 4ZJPA 1IN5A 2J9ZB 4L72A 4PC3A 1Q1ZA 4D9FA 1HOXA 4J6FA 2J9FA 4D44A 4KZKA 1D03A 3V8PA 1ZXBA 4RHYA 5I3CA 4KOAA 3TGPA 4QNRA 3BIJA 4LJ9A 3QPVA 5LA6B 3EZ2A 4CE6A 4KPFC 1EQ2A 2BR4A 2VEDA 3BQMB 3R8XA 4C08A 2RJOA 4DMRA 3W5SA 4O0MA 3F97A 3AHJA 3PFGA 3WFZA 4UATA 4MDEA 3GCXA 3OIWA 5JRZA 5ALGA 3HB0A 3BB3A 2VEOA 3B6IA 3QF4B 1JS1X 1SKMA 1U9ZA 4HS4A 2Y05A 4HZUA 4D4GA 4RFSB 3AWDA 3MJHA 4F4HA 1JEQA 3VI3B 3ZNPA 2V7XA 3OECA 1UJ5A 2GD2A 2ZWOA 2BUAA 4ZRMA 3TIGA 3WBBA 1JMKC 5KDDA 1DC6A 4P33A 2I29A 3MTQA 5IZ4A 1O3YA 2OHXA 1L5YA 2IPOA 4PIMA 1T8YA 3I61A 2PJZA 5HCIA 5LZ8A 4AY6A 1XTJA 3ZZ1A 4Y9RA 3UUEA 5JADA 2FQXA 5K05A 3KWJA 2JNWA 3HBAA 1XCOA 2VHCA 1ZU4A 2IITA 3A28A 3B2QA 4MS4B 2NADA 3PC2A 3DPIA 3F2VA 5DI3B 1ZR4A 4JBIA 4KCGA 1ZMOA 3D6FA 1N6IA 3UKOA 2XECA 4DA0A 2YRFA 1A7JA 1ZM7A 3ZU6A 1W4RA 1RXVA 3UV3A 1CZUA 4R16A 1LQTA 3R7WB 5FWAA 1NAIA 2QTWB 4TS4A 2W2KB 4YDSA 3T3MB 5HDBB 2AWOA 1QH1B 1NAHA 2PX4A 2VXOA 3F5QA 4A91A 3H1AA 1NV8A 1POWA 1JSZA 2HQOA 3COYA 1JYFA 3OM8A 3K1TA 4PWYA 2I91A 2YR0A 4GHWA 5LZ5A 1KSJA 2W2MA 2HHLA 3KZMA 4ZVOA 5ITZB 3WKEA 5AOVA 1YZFA 2A1TS 2BUCA 2VJLA 3TRDA 3S68A 2XYVA 4W1QA 3T0GA 2GETA 1RU3A 3EXHC 4H6VA 1J1IA 4TXNA 3SS7X 5A62A 3TCXB 2CL5A 2HU2A 2X5OA 3BF7A 3ILSA 5THKA 3FCUB 1Z0SA 1D7AA 4PG6A 5B1HA 5AOCA 4RK7A 4ER5A 4ZRNA 2G9VA 4LXXA 1H2EA 3ND5A 1G4UR 3NVMB 4J03A 5EYPB 1Y6FA 1JF8A 2ENWA 3LUBA 3IUPA 4E33A 4HX2A 1UK7A 4ZU6X 4IVNA 4S1NA 1N5KA 2DPGA 1AMNA 1XTIA 2PLAA 3NTXA 4B6PA 1U2GA 4LF8B 2HQSA 3T38A 4O4LA 1GG9A 1ZDMA 2XUAA 2NPFA 2XT9A 4HRYA 5CDYA 4PTZA 1IFXA 3EAQA 4KAXA 4NG4A 4BFCA 1QYIA 1GFSA 4D3FA 1OAAA 2R8PA 2Q07A 4E11A 4KLNA 2FFAA 4GT1A 4BQSA 2JARA 1GAJA 2GUGA 3TOZA 2OK7A 1R8JA 3KIPA 4TV8F 3U48A 4LRYA 3LL4A 5BOSB 5EJEA 1CJVC 3QWIA 1Z45A 2Y1WA 2MJLA 3OA2A 3CZRA 3LC2O 3GA7A 3I62A 4ZN6A 1XQ6A 1OLUA 4CFYA 2DUNA 3EW9A 4UZSA 5KTRA 5IPFA 5K0BA 2UYHA 3JW8A 2JFXA 3U61B 4KQKA 2J09A 2P77A 3JATB 3RRXA 3DL4A 1DP4A 4MCIA 4ZAYA 4CIAA 5MHTA 4LYDA 3F3SA 2VDUE 1PT5A 2Q45A 3JQEA 1GN9A 2Q3BA 1BVUA 3ANYB 4G2NA 3SYMA 4HYYA 1U0RA 2YMMA 3D3KA 3QG1A 3QP9A 2CV0A 5FFFA 1XDZA 3EFBA 1R64A 3B5EA 1WHSB 2G8NA 2BLNA 4YCNA 4XLZA 3L7CA 2JAQA 2HNBA 3VFDA 1EGVB 1B26A 4P84A 4YUZA 1IY1A 1AT1A 3N0WA 3EVEA 3ZHZA 1D9XA 1U3VA 4KIGA 3A9CA 3ANLA 5AOAA 1M1NA 1TVKB 3AEZA 2QTMA 3CCBA 2P69A 3IA2A 1W8DA 2GESA 5EWJA 3HKCA 4PPQA 2J59A 5DNVA 4FB4A 3SEZA 4PHCA 1CS0B 4Z8YA 3EPHA 4RZHA 2K4MA 1P4JA 3REGA 3VNUA 1DFGA 4WXPA 2ZJOA 3QU9A 4R2IA 2GXUA 5LCXA 3RRZA 3EYAA 2X2PA 3V9AA 2I8AA 4LBZA 4X45A 4DCNA 2CUZA 2ZYUX 4Q6WA 3RGGA 4CKBB 3KSUA 1Q0PA 3UM9A 2Q2WA 2BGNA 1DC5A 1WCIA 3HU3A 5GONB 1HDYA 4TVOA 5ALNA 2Z6VA 4MRMA 4DYVA 4HNUA 2WT8A 3WXMA 1R88A 2I4LA 1PZXA 2BKAA 4XZ3A 1N5DA 3PXAA 3EMBA 3TZBA 3VO9A 1KFEB 2ACWA 2FTKE 4EQZA 3VVLA 2GDZA 1DKUA 1HBJA 3D3JA 1WPXA 1KZYC 2BN4A 3PPXA 2ENUA 4S35A 4N0QA 4CKWB 1FFDA 4CIBA 1P81A 4C2UA 2OTCA 4O2AF 5BV8A 3VPCA 4QQRA 1D5WA 5EJ7A 3RYIB 2BEVB 2HO5A 3BZWA 2FZEA 2GCGA 4IRXA 4XSGA 3R76A 1WO8A 3H87A 1RAGA 2QY6A 1NOIA 5B4UA 1TLLA 4CMEC 4C7OA 3A9SA 1ZITA 3KLPX 4NWIA 1A9XA 3SSOA 3A3OA 3NBXX 1RYNA 3UAVA 4CRWB 3BA6A 2FPGA 3C16C 3R3WA 1UXIA 1CX9B 2FPSA 1N9ZA 1YR7A 4QTZA 3ETEA 2GCEA 4YJ3A 4P93A 5ALXA 4DZRA 2XTZA 4MMXB 3DBIA 2C57A 3F46A 2XOEA 3KT0A 3NHBA 3SLRA 5JCXA 2XUPA 1A8UA 2BHTA 4LGVA 1AD2A 1TKAA 4H15A 1U7WA 2AC4A 2HCFA 1YBAA 1QVAA 3QNMA 3W1VA 3DFFA 4R7ZA 2VQ6A 3L6UA 1L7NA 4OU4A 2EJBA 1CXZA 1EWKA 4DXDA 4E6PA 1IYZA 4ECEA 4HNTA 1JG2A 4GGMX 4IX1A 4IZ6A 3GLIB 4MITA 3OWOA 1YGYA 2O2HA 2HHAA 3DBRB 1ESZA 2E85A 2FX5A 2R5WA 5T41A 2N42A 2H1HA 5ALTA 2O52A 1PGJA 4M49A 2VHUA 4G4SP 2VWHA 1KQNA 3WWEA 2WAYA 2AZDA 4J90A 4OSEA 2BR3A 5K6AA 3B3FA 3RABA 4EUSA 1IUOA 5WRFA 3BH7A 4X66B 3BIXA 4I4CA 3O4FA 4G1CA 4E2WA 4MQMA 3I42A 1TEXA 2QJRA 2RARA 5JSQA 1MJHA 3GCDA 2AKAB 3WSVA 5IHPA 2FWPA 3SHOA 4UOEA 3QEAZ 2D0OB 4PBRA 1P1IA 3I76A 3D59A 3HY6A 1L5MA 5J5CA 4R1QA 2OMKA 5CX1A 2VKTA 2GRAA 4X97A 4ZQIA 1KJ9A 1WPGA 1OAOC 2ECQA 1I01A 1U3DA 1GDHA 3GRVA 4L9WA 4OSPA 3VSCA 2PKYX 5DX8A 2DBVO 4F46A 5F76A 2XZPA 2A0FA 4B4DA 4TYYA 2D62A 4RYLA 5G1NA 4BNTA 3ZLJA 5AIBA 2QI9C 2VJNA 3EZ7A 3ABSB 2GT1A 1IAVA 2C1XA 2NZUG 2BGJA 4Q39A 1PJAA 4IIVA 3BJIC 3I53A 4RF5A 5CP8A 3S2FA 1PSDA 2GX6A 4RJ2A 3TM5A 4LMAA 1G60A 4MEAA 1MEJA 4P0PB 2XMQA 2IYEA 4X54A 2QX7A 2Y6VA 4IRMA 1KNXA 2MCFA 2BEWA 4EJSB 2QLJA 4M7RA 3FNGA 3EH2A 3TLCA 2DG2A 1Z9BA 3O38A 1N2ZA 4B3IA 4HB4A 2GZAA 1RYHA 4K0KB 4ZT2A 3K7EA 5AW6A 2PLNA 4Y0AA 2Y71A 1YNOA 2ZYSA 1ACMA 3FNIA 4PSVA 3TB6A 2D5AA 1J8YF 1NBMD 4BCDA 5A3QA 4Q05A 3RAEC 5A5FA 2CBGA 3S2GA 3WV5A 4S05A 5FBVB 3HXLA 1RACA 2WOJA 2R44A 1SCQA 1FMTA 1G2IA 1GZUA 2PVSA 4MVJE 4PXSA 5IUKC 1SD1A 1Z0AA 3KJQA 1J2UA 1EDBA 1U28A 2H8GA 4BECA 3G23A 2HKIA 1M2GA 1XVIA 1QBGA 1WD7A 1YS6A 4CFZA 4AO6A 1YZHA 3DH0A 3KQHA 2PMCA 1JJAA 3MJCA 1EVIA 4GPEA 1BXZA 1N1GA 4EEXA 1QF9A 4CQMD 2QXYA 5A9SB 5GV8A 5CMLA 1C5KA 1O95D 2XLCA 4W99A 3GUZA 3URMA 4AY4A 1WWKA 4N54A 3BTVA 4UEOA 4HS9A 1NBWB 1N2HA 5E6UB 1RRKA 4DCVA 2QZ4A 2PR2A 3O73A 3PSHA 4PG5A 1QC5A 2WM8A 4TL9A 1UJNA 4ENQA 5LLDA 1W6UA 1QYVA 2EF0A 2R6DA 2FPLA 2DSTA 1EJ6A 1JSXA 4HUQB 4Q1EA 4RA6A 2JCSA 1BXRB 4CM7A 2Q99A 3Q0IA 4A0FA 4MVJI 4H7JA 2ZIXB 3KHKA 4H0FA 3HFRA 2Q9BA 2V65A 2P3LA 3OC0A 3UMCA 1O8BA 4J9UE 1VJRA 1T8TA 4XPZA 5CITA 2X8LA 1WY5A 1IUNA 2VZ9A 2ZBUA 4JYPA 1VBNA 5BSHA 3MHTA 3EZFA 2F2TA 4J0IA 3RUPA 3EGCA 4CV0A 1P5JA 2CCJA 4C88A 3VYTB 4RESA 2Q4TA 2HPHA 2A0WA 3K0EA 1DX9A 4PZCA 5ULLA 1PR6A 3LKVA 3PBKA 3JAWA 5IC4A 2Q4BA 3VVCA 3EBLA 1RHKA 2VQDA 4IUCS 4RVOA 1INLA 1DRWA 2YWXA 2IHVA 3M6IA 4KFRA 2MSKA 4EY7A 4QWMA 1IXRC 2GTHA 2W43A 4UBNA 4FGLA 1AUQA 3FKSD 4ONEA 5EERA 1SK8A 1F4LA 3LBHA 1GFIA 3G85A 3PNPA 1KYTA 2GAFA 4GPBA 2IVZA 1A9ZA 5IEBA 2ZJYA 2IWRA 4C0JA 3HACA 3R1IA 2G76A 3AFMA 3KSZO 1E9AA 2GO7A 3N05A 1PFVA 4WKBA 3CX7A 2AMYA 3ICVA 4JBLA 1ZGBA 1Q15A 3WRWA 3PC7A 1Q44A 3V1NA 2QZ9A 4JV5B 1KAGA 3MUEA 3TDKA 2FSHA 2I2XB 1U3TA 1Z68A 5TEVA 4K6OA 1NOJA 3MIIA 1G8FA 1R5BA 2JKVA 1KO8A 3ILXA 3GHHA 3U4IA 4DR1B 1XO1A 3FIUA 1XZHA 2A92A 5CXXA 2FN3A 4YHBA 4XR4A 4GBMA 1E0SA 3TKLA 4MDYA 5E7MA 5FPKA 5H16A 5BSGA 2NV2B 4S2EA 1Z83A 2C5EA 3KLBA 2QW8A 1FJ2A 1SPXA 1M7HA 5EHNA 1QZ3A 1J9EA 4B73A 3S5UA 4N8EA 1QG0A 3F4BA 4H7PA 3PGMA 3TJZA 1RMTA 2LTAA 5DRTA 1XRJA 2NZXA 1EA7A 3LP5A 1GKIA 1XQWA 3AY6A 1GLVA 3OUUA 4RY9A 1PUIA 1Y7LA 2IQIA 3KSRA 3QBEA 3NH6A 1T25A 3PNKA 4JYAB 4FT2A 3T7KA 2VNHA 1DJPA 3DCYA 3GXBA 3VPGA 2GK7A 2AN5A 1QHEA 2JJQA 1LBSA 5KAMA 3VDMA 2XVXA 3P20A 5EESA 4WN9A 4CM4B 5BUZA 3HYLA 4EOGA 5A71A 1U2GC 3AM4A 4DDTA 1OGIA 1GGNA 2AYYA 3D02A 4LMRA 4QWWA 4YH1A 5AT1A 3GX1A 3JWEA 1SD2A 4WERA 5IC5A 2BMWA 3QBVA 1BHQ1 5TQ0B 3JZMA 3K31A 3A4MA 1N8KA 3CLKA 4W5JA 1KOLA 2BHNA 4EFLA 4ILKA 4LMBA 2BKEA 2NQ2C 7AT1A 5G4KA 1BQEA 3AILA 1S4QA 2WM3A 2Y76A 4I2NA 2WTXA 2QOEA 3W7AA 1WJGA 2ZROA 1TCVA 2CY0A 2HCBA 2ZE7A 1R8YA 3BXEA 3L0PA 4D0SA 3OWHA 4PX2A 3IVXA 2QL6A 5LIRA 1P0QA 4MMYB 5K4GA 4MV3A 1Q22A 1E2JA 1EWVA 2QYOA 3FDJA 1C9YA 4GBJA 2VPQA 2HTEA 3HFGA 1ZM9A 3QIVA 4XQ9A 3U44B 1J00A 4HDSB 3C3EA 3PDCA 1XEAA 2A1UB 4G97A 5KMGA 1MB3A 2HQBA 4BDSA 4DZTA 1NBMA 1RMYA 1DIGA 1E9EA 1IEXA 4K9OA 3FMPB 2O5VA 3F7NA 3FGZA 3KYCB 3WOHA 1UR5A 2LBPA 4BJ6A 3I2FA 3D5QA 4DJEC 2OP1A 1JXAA 2QS9A 5TC4A 3RB8A 3CLUD 4BFUA 4CG1A 3R0QA 1Z2DA 5U9CA 2QW0X 1SK9A 1N2XA 2W6ZA 4HY3A 3KD2A 4JJGA 4YCSA 4GKKB 3DMYA 3HL4A 3PR1A 4FK8A 1Z2NX 3KSMA 3DFKA 5K3BA 4CQMA 3KOZA 3P9QA 1O95A 2REOA 1CERA 4IY1A 3K9FC 4R9SA 4N7JA 4QFMA 4KFTA 3IEUA 5AUNB 2CZGA 3FAZA 4DG9A 2QRHA 1XXHE 3BE5A 4MI1A 4OQZA 4BLRA 4YFYA 5JWRA 3IP3A 4F92B 2Z98A 1XCLA 5A6SB 2LDXA 1QHSA 3OPYB 5AVSA 3E9YA 4B83A 1DAHA 3CMCO 3QWAA 4B6EA 3C6QA 3VKHA 2YWDA 3EUFA 4YBRA 1NVVQ 3GA0A 3QEOA 3OX4A 1YE3A 1IRIA 1S1CA 1GGJA 2X0NA 1T3SA 3BK2A 3D6JA 1EFRD 1I6KA 4YT4A 1HC7A 1N5LA 3W5VA 4LISA 3GVIA 1H6DA 1EVEA 1RYMA 2RK3A 5JNVA 3VC2A 3L0ZA 3UPUA 4GX0A 2FHPA 3EISA 1U3WA 3O82A 4IGAA 4RIEA 4URZR 5I9SA 1RC8A 3RS0A 1GR1A 1T3ZA 2OAP1 3H2IA 2VQSA 4GVPA 2WSLA 2ZIUB 3ER6A 9ABPA 2D8AA 4IG9A 3KWFA 3P9SA 3AFGA 4P08A 3DMHA 3JQRA 2JFHA 3TLBA 4D42A 1F7UA 2VPWA 3BFJA 1Z0ZA 1T29A 3SJAA 1YXMA 4NC9A 4GQAA 2DWQA 1FFAA 4L27A 1N2CB 3NCHA 4B7ZA 2A9OA 2HMWA 3JARB 1WV1A 4PFQA 5FJIA 1KDRA 2AOVA 3HVKA 3VA7A 2P5SA 3V7YA 2VSXA 3FKSA 5BMOA 2PKRA 5I7FA 2IOHA 1I5EA 3L6CA 4RV9A 1B2LA 1OMOA 4C04A 1SGWA 4JYMA 4O3FA 3BULA 2ZYIA 4G56A 3ZBTA 1VMAA 3ILHA 3IHTA 2CSXA 3L7NA 5BNZA 4INPA 2UZ4A 3KUDA 4H77A 1AKUA 1ZISA 3OY7A 3A4VA 3RVOA 3D2LA 1W5SA 3BD6A 1NM5A 5L95A 1GHTA 4TYNA 1H2XA 1SQ5A 4YAWA 1HG0A 2BSXA 2ZPTX 3W2GA 4AD8A 5HQTA 4ARCA 3TS1A 2RE8A 3T3HA 2QAIA 2QL7A 4EB6A 2RKOA 1DPFA 2NU6B 5K6AC 3C98A 1LNSA 1T9GR 2RBKA 1I3NA 4JT4A 1XZPA 4GKJB 3QU5A 4I50A 1A9TA 2DUUA 1JI0A 3GBVA 4L7VA 1U8YA 2L19A 1H1DA 4M98A 3FYSA 4D0NA 4QREA 1IBCA 1RYZA 5K3DA 3LYAA 5BORA 2WJ6A 5FUWA 4DYDA 3HXOA 3H18A 3RFCA 5IC6A 1HDRA 3GLHB 4WZAB 1H5NA 1O87A 4RTKA 2CBXA 4H1HA 4N5LA 4GICA 2FA9A 4N6NA 3FOEC 3G2MA 1ZGGA 1Z4KA 3DAGA 5FLKA 5ALLA 3LUHA 3B2EA 1VTKA 3MJVA 4RV5A 1JG1A 1T1IA 2W2TA 5CT6A 3OAAD 1EJ0A 3AVOA 4U2BA 4ETMA 4MH0R 5C5DA 3FM9A 3CRQA 3UH0A 3QITA 4AIIA 5LDDC 4TS1A 1HRKA 1Z4IA 3EXEA 3GAAA 4QEKA 5EPOA 2IWHA 3MUOA 4ON9A 3PENA 2VP2A 3K0SA 3G9TA 2AG1A 1FDSA 3PIRA 4EPYA 3CV3A 4MVXA 3VH3A 2VUHB 4BX8A 4I3GA 1BO6A 1O97D 2P5UA 4QT4A 1PKXA 1UXGA 4B3MB 1BS1A 1TW2A 2DJIA 1L1FA 1R6XA 5IBPA 5LQDA 3C5WP 1YQUA 3PJRA 4YY3B 3KXDA 3ICPA 4ZEOA 3NHZA 4LE1A 1FRFS 1UEXC 1I8TA 5T6MA 1AX9A 1UDCA 5HKLA 3RNOA 3V4PB 3RVRA 1WABA 1RMQA 2HQRA 1ULSA 2PX2A 1IY8A 3B70A 4X1YB 5CAEB 1UZLA 3W0LB 3TECE 1RHUA 5TJ9A 4FFDA 4ACAA 1QH9A 3DC2A 5IDWA 3RO7A 1G2OA 4PG4A 1GAQA 1KI4A 1U28C 3W5AA 4CKCA 4DPMA 3N0XA 2C5HA 1E62A 3KO8A 1KS9A 1E96A 4G0QA 1IMJA 3AJRA 5HKOA 4FB5A 4EW2A 5E1OA 3BWVA 3OP4A 3NKLA 3AKZA 3P2YA 1QK5A 3DEYX 4TWRA 1KBOA 1NQTA 3KWLA 4XH9B 3AK4A 2R86A 3D3QA 3NRJA 2K5UA 2JFGA 4FYMA 5FADA 3WGVA 2AS0A 2J33A 4A2WA 2XB8A 3X43A 2FMIA 1JA1A 4B3DA 2XCOA 1G1AA 4CLRB 3AERA 2R6ZA 4U9HS 4XVHA 5DW3A 5EEHA 5KNLA 2HFJA 4G86A 3L1JA 3PNOA 4HRVA 1ISIA 3MQFA 1BN6A 3I64A 2G9RA 2IZZA 2JFQA 2PRIA 5E0KB 3LV8A 4P53A 4QRHA 4HAIA 2RKBA 3ME5A 4YMGA 4QDXA 5ALOA 3WMRA 4O1HA 4DUZB 1NUTA 4E88A 2XMZA 6GPBA 1XROA 2VDJA 3GFBA 2TMYA 3H05A 1T5LA 3DM9B 3IHLA 4XB6B 4D99A 1OBHA 2FSUA 2QX8A 2HA5A 2XNKA 4LV8B 4A7PA 2W2LD 1ZK0A 2ARKA 1A71A 4QAQA 1FYVA 2D6FA 4NI5A 1C3XA 4BWFB 1AO0A 2LR0A 2VPTA 4G8BA 3O0TA 1NLFA 1O96B 2W6ID 1VCOA 4LQCA 5JYBA 2BTQA 2GFIA 4RIIA 4NBVA 1BZYA 4YAOA 5D5QA 1SHZA 2FUCA 1E5TA 5ELXA 2WHQA 1ZONA 1ENZA 2IHBA 2ZAMA 3MNFA 3O92A 5K4HA 1FLAA 1ONNA 2V4UA 4R1NA 3TFQA 4A16A 4QTYA 1P0PA 1S9DA 3QHAA 3ZJ4A 3U7FB 3GP5A 3QTBA 4UMVA 1TQ4A 3I72A 4GSKA 3HGQA 3N53A 5EHXA 1XP5A 2AOUB 2OGSA 2P1DA 2OLEA 2XUHA 3BK7A 3DGEC 4G26A 4TWJA 3R4CA 4AJKA 1LB1B 4KX3A 5F78A 5AVZA 2QT1A 1Y8QB 2CC2A 2HJRA 4WNAB 5EZSA 3KXPA 4F8YA 1ND6A 1T4MA 3TXXA 4O2RA 4MWZA 4EH1A 4LJ7A 1N75A 4OQLA 1WM1A 5DVZA 3TBKA 4BNXA 3WIEA 3QLTA 2J8ZA 3G8YA 4D9IA 1WAMA 5CNKA 2F1RA 4QYMA 2HIGA 4F3YA 4Y2JA 1HLDA 1Q0HA 1AZSC 3D8TA 3HRHA 4OK5A 5G0UA 2UKDA 3AV0B 4HEJA 1LW6E 4UM8B 3VISA 4PFSA 1UPBA 3RVKA 1PEKE 3N2ZB 2AKEA 3W5JA 1IBMB 2HGSA 5ESWA 1XX6A 3LXMA 1MTOA 2D1QA 2XYPA 3GROA 1K92A 4DSUA 1DG3A 13PKA 2HCJB 4HLUA 1NF2A 2WMNB 4AXBA 1QFXA 1IMOA 5JHGB 3WB1A 2J41A 2JAPA 3MCWA 3ENQA 3OJLA 4Q3NA 4WT7A 1QK4A 1M2NA 4RD1A 2XVYA 2O8EA 1QHYA 4EVRA 4TV8B 3TSOA 4Z7NB 3NDPA 5EUCA 1H5QA 3ONNA 2K7ZA 2RH5A 1XVLA 3O8NA 1ZUIA 3GFSA 4LJ8A 1IY0A 1T2EA 2BGKA 2QRQA 3N2GA 3OAAA 3ZHSA 1S2OA 3AVPA 3VNAA 3LDFA 1LZLA 1QHHA 4DCGA 2PQ6A 5DX0A 2J7KA 2OAEA 2I2AA 1LFAA 4BQPA 1J7KA 3S8EA 2A58A 4CCYB 3FKQA 3QFCA 3L9WA 5KI6A 5B30A 1IC6A 1NFFA 1WXGA 3JTEA 1JFLA 1BOOA 2BT4A 2OYRA 1QGUB 2CFSA 2XNSA 3D4NA 4WJKB 3PLAE 4ZTUB 3CEHA 3DOCA 2YY6A 2G40A 4LY9A 5CM8B 4LK3A 4R2LA 2C97A 4FEAA 3SU8A 1VQ1A 1HDGO 1GTRA 4GLOA 1MG5A 2Z30A 3GJXC 4DIMA 5D3KA 4OHRA 4D4KA 5E3JA 4EATA 5T4BA 7YASA 3PEWA 5AW1A 4R9UC 2D06A 1KF0A 3CUUA 3KVVA 1DFIA 3MUFA 1N2EA 4FYYA 2QUIA 4NFSA 3ETNA 2QLMA 2G1PA 5EKXA 1LDMA 1T2CA 3MRVA 4K2HA 3J81A 1QLWA 3EOBI 3LCUA 4N82A 4RK4A 1SXGA 3LFUA 2BFBB 2ZT7A 1UJBA 3MF4A 4BVJA 4DEXA 1A5TA 1O95C 1ECJA 1C30B 1KI2A 4UOQA 5IG2A 1RJDA 1VG8A 4IX9A 5BT9A 1JJ7A 4A8HA 5JECA 1AQIA 1NYTA 2DPXA 5F7ZA 5KCMA 4DRXB 3NIGB 3WGNA 5C35A 1R66A 3IULA 1EGAA 4GF5A 4OQFA 2ZSKA 1IOZA 1H6AA 3VAYA 2KLHA 1QO7A 3RJTA 2NTVA 2I2CA 1Y7TA 2H1VA 3R7AA 2DZDA 3IT3A 5AVJA 1EEHA 3H6KA 1ZN8A 3KKMA 4PRYA 4YRTA 2MSCB 4FU0A 3EXFA 3OFJA 1Y3BE 4KQEA 4O2AB 1Y9JA 4U2DA 3THOA 5CD1A 1HDZA 2OCGA 3N8HA 4LJYA 3KZCA 3V9PA 2Z2IA 4BV8A 3AL0C 3GD5A 3JX9A 4GL4A 1SUCA 2CJFA 3ML1A 5HKKD 3F4KA 5A5GA 1YOVA 3EVDA 3QLVA 4TYMA 2X9VA 3C97A 4JQCA 5EJ5A 2YVKA 1KYWA 1X1CA 4AN0A 1UZAA 4ESVA 1NJ5A 2W2LA 4OO3A 4EJMA 1P19A 3DEKA 3WQRA 3TCKA 1VB3A 2NNLD 4MJ3A 3WLMA 4EMBA 3KXKA 1QFZA 3JWIA 3AUSA 2H1CA 5CHYA 4KFUA 4LWZA 5HM6A 3V7NA 1TEZA 1QO0D 1G59A 1DX6A 4XPIA 1S2IA 1FUEA 1SBNE 2VNSA 2YQ4A 4QUHA 1JGTA 1X80B 1IATA 4HH0A 2WZQA 4UXJA 4WZZA 3ZBQA 4YJ2A 1ATIA 2G28A 2RBGA 5IM4F 2ZB4A 1MO6A 3SX2A 4F6CA 3C8UA 3OO0A 3KEMA 4JEHA 4KPUB 1GUAA 4Q9HA 3HCPA 2R79A 3RARA 3GVHA 3N2LA 1EFPA 1II8B 1P7CA 2VUTA 1UFKA 3EMVA 4DC0A 4EAQA 2RI6A 1JIXA 3CH6A 3I04M 3JPYA 4YQZA 2X4GA 3H6HA 5GM1A 4DF3A 4EGAA 3COVA 5JS7A 1PNOA 3RJ5A 3EDRA 2IVFA 4ZVUA 1II9A 1ZOOA 1CF9A 1ORTA 1P8JA 3LYLA 4R2KA 4LBVA 1YIOA 1XDGA 4MP6A 3RLFA 3TL2A 2HREA 4AXXA 3TZ6A 2B36A 2X0JA 3LT2A 1ZFNA 2Y1EA 2GSWA 4MR8A 4EX7A 2O1SA 4WX2B 2DWCA 4KZPA 1DO8A 1ZNXA 2QD1A 1Z36A 4I55B 1YCGA 2WPDD 1J8VA 2CDBA 2CVQA 2H6EA 1CDZA 3HXTA 1EE1A 3N59A 3IX7A 1EU1A 1QMGA 2ZYAA 3JWPA 4FQ7A 4MWEA 4WLNA 2JKYA 3X1JA 4QQ8A 1G20E 1VRCA 4U7FA 4DHEA 5BURA 4JXKA 1U8CB 2C3OA 1TM2A 2G0NA 3OZGA 5K09A 4ZT4A 3OMWA 1XZKA 3L8FA 3SR3A 5BN4B 3UOWA 1AUVA 4PC1A 3UTDA 2HMSA 2RMKA 1DBQA 1TLTA 2PJUA 3Q7IA 1F8UA 2EYUA 1XRLA 1AY0A 1XGKA 2EKDA 1AUOA 3EOZA 3I05A 1O8CA 1LY1A 3KKNA 4W6ZA 5ELMA 1GRQA 2NP7A 3SICE 4ER6A 3EZ9A 3GEGA 1C1DB 1KO5A 2RHOA 4BLSA 4DREA 1XF1A 4I50F 4HT3B 5EWLB 1VKOA 3MPUA 1XKQA 3RFVA 4PS0A 3MMZA 1U4OA 4DYHA 1OVGA 3OZ7A 4OL9A 2WTNA 4YJGA 2BFEA 2D3TA 1SHJA 3IUNA 4RVDA 4PLFA 3SP1A 2V9ZA 1RCUA 1W8IA 2UYQA 4R41A 2HLDA 4BO5A 3DNMA 2OORA 4Q1BA 2H54A 2QMEA 3F7OA 4MQ6A 4QARA 1CF2O 2AB0A 5EXEA 5KQLA 4WASA 2ZIEA 1RLOA 1S6YA 2FN9A 3CWQA 3GJRA 3JSAA 1LTKA 3UWKA 3PI7A 4LOHA 2FMXA 3A6KA 1B2RA 4YV0A 5K0SA 5F2NA 1J06A 3PF8A 5KTSA 2QGZA 3ZS8A 5FWYA 1GDDA 3LSYA 1YRYE 1YS1X 4BU1A 5JLJA 3SCZA 2WIBA 1W5FA 5IMSA 3X1ZA 1SRQA 5IDXA 1AIPA 4WEQA 4O6VA 2IPMA 1E9CA 1QR2A 5KKNB 1G7SA 3ER9A 3IPAA 1XZCA 4BTEA 3AZPA 5AI9A 2H00A 1JTVA 4N3NA 3L18A 3QSYA 3HH8A 4M54A 4BE9A 4D92A 4E1VA 4TKVA 1TA0A 3U62A 2H9YA 3CWZA 4JOQA 3ZWOA 5KVVA 2OR3A 3TMKA 3L0YA 4D5EA 4WK4B 3UPTA 4P58A 1GUYA 1IB0A 1ORDA 2BMJA 4MIKA 1Z15A 1S3SA 3SS8A 3EZYA 2JS7A 1JYSA 2A57A 5SYAA 3HSYA 1UBGA 1E1KA 5AHKA 1P1HA 4G07A 1ZYUA 4UUNA 4GQBA 1DBWA 1J33A 4ZEMA 1X1QA 1Q11A 5IVKA 4ZV9A 1UBLS 3DR5A 1RM0A 4IILA 4AUEA 3IQGX 2BSAA 4MULA 3WIDA 5L6LB 1A4RA 2PTHA 2YJGA 2YWHA 5IEJA 5HYVA 2BP7A 2YQZA 4M7PA 4A26A 3AR2A 4FDLA 4ENWA 2QL5A 4MCHA 4GPTA 1TF2A 2ZSFA 2FWAA 1CY6A 3DZJA 4IQGA 1E2PA 3IPLA 5EXXA 1ULAA 3E1SA 4IQ0A 1FMFA 1AF7A 1JAZA 1BVYF 5EJAA 4D9MA 5C3UA 5M7EA 4RLHA 3ZE0B 2HBYA 2XODA 1N2OA 1QU2A 1JPUA 1ESMA 5K8UA 2BJWA 4XUGB 1UPXA 4BKUA 3EUWA 2G9ZA 3QQPA 3ICWA 2WBLC 5TSDA 4BLWA 3B6JA 5GOTA 4ZD6A 2ZR9A 3Q88A 5HKKA 1PJ2A 2Y4OA 4HGPA 1UM9B 1YJ8A 2ZI3A 2N46A 1BYUA 1PJ3A 3B3AA 2QNBA 3H7IA 2JI9A 3BGOS 1VE6A 4W1SA 1RAAA 2XA9A 4RVUA 3PDWA 5B12A 2IBSA 4OHYA 2UZAA 1FRNA 2XGGA 3VSEA 4Q9JA 3WJAA 4F4UA 3C8HA 5A2QA 1JEQB 1SUIA 2ZJ5A 1DKLA 3BS4A 1Y89A 4ZXFA 5A1JA 3VNVA 3U7IA 1DIOB 2ZIZA 2NYUA 1OBFO 1XCBA 2R7KA 3D5TA 1FK8A 1NXTA 3IQIX 1SHKA 1MO5A 1QO0A 2LE0A 2QQ0A 3JPWA 3NQ41 5JJIA 4Q4LA 4R7GA 1DNPA 3UC9A 1EWRA 5B1DA 2QD5A 4D25A 3I0NA 3QKRA 1L4KA 1X42A 4K9RA 5DGTA 1HKUA 1Q0LA 3B1YA 5LJLA 5B7GA 5CDUA 3VO1A 3THXB 1KI7A 3LPLA 1LV8A 4FMCF 1XZDA 2DPYA 5JFOA 1EFVB 2INGX 5PGMA 1R3DA 4FJ2A 4KIUA 1XB2A 1WXFA 2JDID 4M86A 1P91A 2C8KA 3ZC3A 1N0IA 4DL9A 1FFCA 3NHFA 3RC1A 5CT4A 3SHFA 3UANA 5JJKA 1ESDA 2ZZNA 4RVGA 1R5OA 3IVRA 2ERCA 1CY7A 2SCUA 4BX3A 4PLVA 5IH7A 1LLUA 3T9FA 3V55A 2RGDA 2DY0A 4E3WA 5K7SA 1P9OA 3GBPA 3W7VA 3F71A 1ZK2A 2WPDA 2B4AA 2DRIA 4BS9A 4MV0A 4DWJA 1QJ4A 2Y2VA 4HLUC 3PITA 4KV7A 4MKFA 4MSUA 5E4TA 4L28A 1U5CA 1EFDN 3U4MA 2XEDA 1R00A 2ZAGA 2DSNA 3U3DA 3JQQA 3L6OO 4YR7A 3D64A 3LQYA 1IPFA 3A2MA 3PUVA 4IICA 2PU5A 2IDZA 4TWIA 5G0VA 1A4IA 1ZCJA 1G41A 1PJZA 3FPGA 4KN8A 4RHTA 3ZQJA 4DOMA 1E8NA 2R8RA 5I8PA 3Q2OA 4DHWA 4A5SA 3BBPA 2QTGA 1S2DA 3AKCA 3ONEA 4HOYA 2ZRBA 1C0EA 2B25A 2VJMB 2V0NA 3CBGA 1Q5PA 4FFBA 4YTEA 3MCUA 4ZQHA 5AKIA 1FSGA 2W8BB 4MI6A 3GAFA 3WJ7A 2DLNA 1UBOS 3ZNNA 2VAXA 1I3OA 2XBMA 3G88A 4E5YA 1DARA 2EBHX 2I6QA 3L92A 3NTQA 3I6YA 4FR0A 2J7PD 1IOLA 2OENG 2XYGA 3OUZA 4ZZ3A 1U6KA 1XRSB 1Z4JA 5I8WA 1YFKA 3PXBA 4Q9AA 2B4KA 4EJ2A 4UTVA 1E60A 2P90A 3R5HA 1N77A 3RIGA 1YUNA 2AZMA 5IBQA 1G5TA 2C59A 3L04A 3D4BA 3Q8LA 2WU3A 3VTAA 3TQSA 3KB1A 1SBYA 1M6VA 2AG0A 2W4IA 2JHCA 2Z2KA 4XFJA 5CHEA 2Z6AA 3LU1A 4MVJM 3O8LA 3QBTA 1YZVA 4ALNA 4B6SA 1NONA 2VH2A 4JCCA 4ZEVA 5JROA 2PGLA 4KXVA 2HCTA 1P73A 2XD4A 2B7BA 1U7OA 1IXSB 1ORIA 1G4HA 4AKEA 4JIMA 1O89A 1K6JA 1XE3A 4R0MA 4FYXA 1Z73A 3I4CA 4PINA 2I6XA 1XYYA 1ZK4A 3B7WA 3JYOA 1LZKA 2V7BA 1NVKA 2QJOA 2OCAA 4QPCA 5HF8A 5JMTA 3NVKI 1Z6GA 3KT8A 2QN2A 1MX9A 3OG9A 2PNJA 1CBUA 1L7BA 1WMAA 4PHGA 5EP4A 3FSGA 5F7JA 4EUHA 4DPKA 5DX1A 4DR6B 1NLUA 3CPEA 4IZIA 3ESBA 4EY5A 3M1LA 3FOZA 4MIOA 4JJ4A 4D26A 4ND4A 1NX6A 2ZBPA 1WB5A 1M1NB 1JHMA 2H16A 2ID9A 4JVSB 4D9JA 2XGSA 2QVZX 4OUDA 3RADC 3WWDA 3O3OB 2VDWA 1WHTA 4LXQA 3HKCB 5EWJB 4FNMA 5A4JA 4YXFA 5CG1A 1LI7A 2VDMB 3FFBA 4HFRA 1UJ4A 5CJPA 2C0PA 4MUIA 1MW9X 1TQ8A 2CFOA 4HN2A 3L8YA 5CNIA 2F64A 1FUIA 1R6AA 2GRJA 1JAXA 2OCKA 2FSGA 3B1ZA 2WVAA 1L5HA 3USCS 1MGOA 4RZ3A 4DDMA 4JI3B 3U0BA 2PT9A 4XWAA 1DRVA 3ZJUA 1PDVA 2B8JA 2X9GA 3LQ2A 1G6HA 2YYSA 2ZJ2A 1W48A 4AMYA 1SBHA 3JYNA 1P2UA 4AUMA 2V59A 5JSHA 3VUEA 1Y33E 2CEKA 1GZDA 3AIOA 4G9EA 4TZTA 1M34E 4X92A 4ZT6A 4EB0A 1IBKB 4M76B 3OF5A 3WB9A 3R9WA 4JOCA 4WCFC 4XYLA 2YZGA 3FOFC 1B0PA 5BUQA 4K6KA 1FSPA 2C5GA 4Y6PA 3FIJA 4IHJA 4MWCA 1AKVA 1H9AA 3S8YA 2P78A 3TM4A 2IK8A 3Q8WA 2HT1A 1B14A 3NU1A 2ERYA 1SPBS 2DQKA 1YMUA 1QHFA 4TMXA 2M6KA 3PGVA 1ISPA 3SBOA 3M2PA 2X1LA 4C7OB 3S0JA 2RHRA 4R2MA 5HZKA 2Z56A 3QENA 4DRYA 3PPIA 1EJBA 2FPGB 2RG1A 4O4HF 3ZW9A 5KIAA 2QVLA 4A27A 3LW8A 2DWPA 5DW0A 2Z1NA 3RSQA 6LDHA 4IR7A 3FI0A 1I9GA 4IIGA 1TTTA 1AA9A 2EG9A 4IJ6A 4JY7A 2V0GA 3DV2A 1HE5A 3E3NA 3BM5A 3AIKA 1W85A 1DWUA 1P5ZB 3KJXA 1BJKA 1XD2B 1X7XA 3CKMA 3CG0A 3QU2A 1TRKA 2C9ZA 4OU5A 3OOSA 4IDQA 4HVTA 4ROTA 5IJ9A 2DXIA 2R751 2XE4A 1JEYA 2FDRA 3TL6A 3FRJA 3HYNA 1YS2X 4Z99A 1YZTA 4YT5A 5DWDA 2G9NA 4OGWA 2FW6A 4C1BA 3UJBA 5BYBA 1K9SA 4TVBA 4IJWA 3CT6A 3HHPA 2B69A 4G2TA 3VHQA 4Y98A 3O47A 1KVRA 2LV8A 4AULA 5IULC 3TINA 1XD9A 3PKIA 3PC4A 1DOZA 5CCBA 1NXQA 3WJ2A 2JFPA 4AQ7A 4XXHA 2Q5CA 4OVKA 1BRTA 1D4FA 1QONA 2H4HA 4RELA 4WFQA 3GEEA 1LF0A 2RI0A 2V4ZA 3ZI4A 4YMIA 5G0WA 5CX1B 3BRCA 2AJBA 1P72A 2GBLA 3PD0A 4ROSA 2R5FA 5ENVA 5G0SA 3HJFA 2O5CA 3G2IA 4HYEA 2GNAA 2ZSUA 1PR4A 3P9CA 4X94A 4FOLA 8ADHA 1AV6A 1KSHA 1ENOA 2QTVA 3LY9A 5TPWA 5H68A 1QRAA 2OORC 3OX2A 1E2GA 2QR5A 4MR9A 3VR6A 5KOJB 4I1PA 4GLBA 1XWFA 2V9PA 1M83A 1E9DA 1Y5LA 3FPEA 1ZWLA 2Q8PA 5KSZA 5J23A 5A0VA 4K9PA 1YQXA 1EKXA 1CKEA 3L6EA 5FI3A 2I1VB 2IH2A 4KPGA 4C0BA 5KC8A 4L2IA 3A32A 4WKOA 4A0HA 3QELA 1KPHA 3CRRA 3PPWA 2HNKA 1XZBA 3GLKA 3MB5A 3P71T 3EARA 1NGSA 4QT0A 5EFZA 4BO6A 2XGJA 5P8WA 4LF9B 2A2ZA 1YMQA 1SIUA 3DKIA 3DO8A 3GB9A 4X0EA 1W0KD 1GZHB 3OQ1A 4B0PA 1OPRA 5B6JA 2HV9A 1E3WB 3FPFA 3ROGA 1QHGA 5GGYA 5TEWA 1UQUA 5ALVA 2AOTA 1UXKA 3PQ4A 4C3VA 1IDOA 1SXJD 4I2VA 5IRCD 1O4WA 3AHFA 3OF2A 3GJYA 3ZX4A 3ZV5A 4JU8A 3WICA 3V8VA 3FPLA 4C01A 5BVHA 2WVJA 4US1R 2ATCA 2YIMA 1T24A 3NWJA 4FD3A 3ZHXA 1E79D 4C20A 1GCOA 3I92A 3ZVLA 2EEZA 4XCVA 3M1AA 4M9UA 1VE1A 4UEWA 5JE8A 2BYTA 4BPBA 4DR7B 4DMLA 3BPSA 2O8EB 2C99A 4RU1A 4G0OA 2NTYC 4NSNA 2WYOA 2AV6A 4LYAA 1PT6A 3TD6A 4A2QA 4EHLA 2MOKA 2JFVA 4M8KA 2DKFA 4YCJA 1E64A 2XA1A 3FCAA 4EUNA 1XZGA 4MS3B 1QC5B 1NN0A 2CHFA 4GYJA 5G41A 1U5AA 3RU3A 4D2IA 1NF3A 3H75A 3DSRA 4UTRA 4RA6B 3OJFA 1Q0ZA 4U6QA 4L8GA 5DI9A 1MP0A 3KM0A 2PXHA 1V5IA 1SCIA 4FNGA 2PAFA 1YA8A 2CHEA 1JIJA 4JI4B 3EYWA 3FPBA 3O6VA 5EA2A 1U3UA 3N9IA 4YV7A 2JW5A 3AQ4A 5TV2A 3A8TA 2UDPA 5HQJA 3C74A 1E2LA 1OT5A 5K8IA 3GRKA 1RXUA 1BH6A 5E8JA 1OGYA 2IYQA 4IKOA 5EHIA 4W7IA 2BMAA 2P3OA 2WG1A 2X9QA 2QJWA 3H8SA 3TNFA 4TTTS 5LMZA 4LOAA 4F2HA 3Q7PA 2I80A 4NS1A 1JAHA 4GOND 1KIMA 4MI3A 4QUDA 3T7AA 3TDNA 4BXOA 2W8ZA 2AYZA 2Q0XA 3HJRA 1D4ZA 5CDTA 3KUKA 1T9ZA 3L4BA 3LCCA 4Z9YA 1GITA 1SUDA 5DHUA 4MP8A 3A6LA 2PT5A 1JPNA 1R74A 1TZBA 3P2MA 3OOHA 2VK8A 4UJ3A 4URFA 4Y2SA 5DMHA 4EY8A 5KJ6A 2O3RA 3EEYA 1W25A 2YY7A 4HEA6 3AJEA 5EL0A 4QEZA 2GR9A 3TEMA 5LQAA 1EGMB 4B6JA 2M1ZA 5A02A 1HFEL 2CXPA 3G7UA 3HJGA 3VU9A 2CXRA 5FDFA 4XVCA 2AFIE 1TU4A 3IV6A 4PX5A 4QNMA 5TPZD 5B55A 5CB8A 5H9WA 1REQA 1U1DA 3SVZA 2WKWA 4E5MA 4GOMD 1CFJA 1Z26A 2G5PA 2JFNA 4H35A 3LBIA 4LOIA 1OXBB 4OJNA 3LLSA 1A7KA 3FUCA 4LTDA 4RHXA 1T8PA 4RF3A 2AI1A 1R7RA 3O93A 2OFOA 5AKZA 5AI8A 5EG5A 4ENSA 1OI7A 2OVBA 1ARZA 1I32A 2ZBGA 3C7KA 1OJLA 1UKCA 3CUSA 4MV8A 2OM2A 3T3DA 2JCVA 1HNXB 2R84A 1MXFA 4IEIA 4G1UC 1R9JA 2GTPA 2IF2A 1RAEA 1IQUA 1J0XO 3RSGA 2AF3C 1AOXA 2VNKA 1OROA 1X8KA 3LKDA 5AJTA 5CB4B 4E03A 3DMPA 4YUXA 9ATCA 4H9GA 4ERXA 4G6ZA 2FMFA 2DBZA 1PN3A 2GKOA 3R3VA 3SSNA 1JQBA 2XAAA 1CFZA 2XMDA 2XKJE 2OOSA 1OIVA 3TVYA 2PWYA 5BN1A 1HY3A 1DHTA 1QJCA 3BXOA 4X20B 3RSLA 3A3KA 1ULZA 2Q1TA 1KPIA 5IT9A 3ZWKA 1P2GA 5EZ6B 3HYTA 1WU7A 3A6FA 4BNDA 3W5DA 1PWYE 1ZI8A 4OQDA 5H3LA 3LRTA 4AK9A 1BS9A 1IZ7A 1L9KA 2GZ2A 2UYOA 3M1YA 2YHBA 3NBAA 3REOA 4BEVA 5BR1A 3U4QA 5G3YA 3QVSA 3C2QA 1OA1A 1X38A 1BAPA 1M9NA 4MZXA 4Y9DA 2WQ6A 2H3HA 3QK7A 5I7AA 5JFGA 3ZVNA 5B1SA 2XCQA 4QGFA 3I9V6 1WMSA 5L7YA 4BQQA 1AURA 3PHLA 3W1EA 3OQNA 3E70C 4Z9XA 4Z0PA 4ZT7A 3GLGA 3DM5A 4L4ZA 2G0TA 3PJDA 4N3GA 1Z5OA 5FUVA 2VDPB 3DCJA 5G4KB 3V6MA 5MF6A 1ACLA 1ISMA 4BVKA 3A7EA 3HCRA 1WF3A 4UAJA 2QBYB 2ID7A 3QMPA 4BBZA 3HYCA 2OBMA 3H2GA 3UNXA 5IZCC 2BMFA 4B46A 4W7HA 1VOTA 1Z47A 1FJGB 2SKCA 1T5SA 2GD6A 2AN1A 2YV5A 4QHYA 1JHAA 5M3BA 2E5WA 3ENVA 3WNBA 5I6DA 1JI3A 1HEUA 4NJOA 2ES4A 3A1VA 1G63A 4B4OA 5KMGB 3NTRA 1QP0A 1GTVA 3L8DA 1JLRA 2B3DA 1WF6A 4DT1A 2CHVA 5K3AA 3FYUB 2Z4RA 3CC8A 4D02A 1RI5A 3OCJA 4OI1A 1ICEA 1KMMA 1ACJA 2GEKA 1SXJA 2PV7A 3ZWWA 2R62A 2ACKA 3UAYA 4RZSA 2EP7A 3QG5A 4NCHA 2IGTA 3CINA 3OFSA 1F9AA 5DTRA 4FEYA 1E79A 2TMGA 2VVTA 3EPKA 4QPJC 1XXLA 1RWNA 4ES6A 4X84A 1Q6ZA 3IBSA 4BUCA 4OSOA 3USZA 5CYPA 5KPJA 1QX4A 4WXHA 1PYGA 4BQIA 2FJPA 3OA0A 4HMPA 4JT9A 1KGDA 4ZQEA 1PJBA 4CQMB 2C4NA 4GVXA 1IJEA 5CFMA 1CZRA 4XCXA 2JLAA 1YQWA 1LJ8A 2C0QA 1A2BA 2DY1A 2HJWA 3M6VA 4HAOA 4UCXA 4PC2A 1UT8A 3MT7A 3OQBA 4M1WA 1T6XA 1H0RA 3A3YA 2R66A 2IELA 4K87A 5DNAA 2PNFA 4G63A 2I78A 2VAMA 3OQOA 5CFZA 4LBYA 2RGNA 4BVGA 5B1YA 4KJZA 3PXCX 5IF3A 3PXXA 4MGZR 1OILA 3GLTA 3ZU4A 4CF5A 3R24A 4P3PA 1VG0B 3JVEA 3ECAA 4HEQA 3ZTYA 1KJIA 2BDUA 2QTBA 2RGUA 5L3RA 3DAFA 4X85A 4EUFA 2NXCA 1NVDA 1QDEA 4WNYA 3GU3A 3M89A 5E3HA 1J5XA 4KTVE 3T99A 2R6HA 3EVBA 1Y9DA 4FYVA 3SAJA 4URUR 4BV9A 3KFXA 5J9FA 5EIFA 5JD6A 3O94A 3K9WA 5KYUB 1L1RA 3BILA 2JZCA 3IMCA 4M0PA 2ZATA 1T0HB 1D6NA 1ZD3A 2WHPA 3L0OA 5ALHA 3GC6A 1UP7A 2DU8A 3K2BA 5GGXA 3WHIA 4QE3A 4X1IB 1W0CA 1E6WA 4EO9A 1ISFA 3AT1A 3UAGA 2OHIA 1F6WA 1TCAA 2RB5A 4LV5B 1BH2A 1MQ9A 4NONA 3V46A 4BX0A 1UKVY 1NC1A 2PIDA 3GPCA 1I2DA 4NABA 4DMCA 3I9LA 3NHAA 2YJZA 2R6R1 3DL0A 3UZUA 4MROA 4INAA 1VBKA 4LZJA 4W8GA 1OR8A 4AB1A 4PYKA 1EESA 4Q5IA 3W6ZA 3WX0A 3H2SA 2WWFA 1VE9A 4D6YA 1PWZA 3TI9A 5DGDA 4FNOA 5TPZA 2F3UA 3CXRA 4C06A 4ZGWA 4NDNE 3AI1A 3P9KA 1ZEJA 4ZANA 4CEIA 4FNAA 2PUCA 2MHCA 4DNOA 3AW8A 2AX4A 3FUXA 4FN4A 4RSHA 2VP4A 1EFHA 4GMGA 1KL7A 2JJ1D 2GAJA 2B5VA 2O20A 5J59A 2V98A 4AJNA 3Q3JB 1NLMA 4I50B 1ZMXA 2QG6A 2XUZA 1F2TA 1UDRA 3R77A 4GG1A 1KC3A 5TNXA 5KZMB 4PFJA 4CV1A 2CFCA 2ZSAA 4YCCA 2A3NA 1BW9B 2AJDA 4F0JA 3K09A 2PGAA 1AXRA 3EEFA 5DJ5A 3UJ8A 4BFTA 1XU4A 3ETCA 3ADOA 3BTOA 2OFFA 4KXNA 4FM9A 1DZ3A 1CVLA 2GBLC 2UAGA 4JB8A 4RM3A 4FLFA 2IUYA 3BH0A 2XVMA 5F5LA 3V33A 2Z3VA 4C4AA 4ZCIA 2QQFA 3U1TA 2X1MA 2ZB7A 2D1SA 2X58A 4N9QA 2GLXA 4B76A 6CHYA 3T61A 4OIFA 1B0AA 1BCSA 5I7HA 4B84A 4XGKA 1I36A 2JGKA 1FP7A 3FR7A 3L0BA 3M1IA 4K05A 4MIEA 1R4ZA 4EB3A 4L3VA 5ABPA 3EXEB 3FNBA 2ANCA 4HQ0A 1RHMA 3UT5B 2D13A 2LCIA 1XTUA 3ZHTA 3QUTA 1RWWA 4LNAA 3A1EA 3A0UA 3WJ1A 3LXRA 5IAAA 2PR7A 3T06B 3AU9A 4L74A 3ZCQA 5DGXA 1MT3A 3VYRB 5BXQC 3IQWA 3QVKA 3O4IA 1XMOB 3WLIA 2JVKA 3RROA 4KO4S 1MJFA 2DFDA 1RABA 4TKUA 1BKDR 1TTPB 5CPFA 4M1OA 4WBNA 4E5PA 5DASA 5I48A 2IH4A 4JLSA 3VZDA 3KAKA 2P9FA 1BG6A 1DL5A 2DKOA 3NM6B 4HHEA 2GLUA 5FYQA 5JYDA 2QRJA 1YJQA 1SQGA 3IAHA 3IQHX 3QVGB 5EZYA 3ZHQA 4JGGA 4O59O 4DWWA 1QHIA 4MB0A 4DV3B 2VRCD 3COPA 2VPZA 5ALFA 4OXKA 4C7VA 3HL0A 1P4RA 3U6BA 2XB2A 4UE2A 1GIAA 3LKZA 1SEVA 3TW8B 5FOXA 3HEBA 2WT4A 3DYIA 3IKJA 3HBNA 3SK0A 3KB8A 3DBHB 5LFAA 1A9YA 1PTJA 2PSEA 1GNTA 5B57C 2OO5A 4TTPA 3RRJA 1OWMA 2ACVA 2B7LA 4WY8A 2QUBA 3NHUA 4BNMA 3PHBE 4EVIA 5JNRA 1OBOA 3U7JA 3D7KA 3DOFA 1KQGA 4DNPA 1L4BA 3QXJA 4Y8VA 3LWZA 3VNRA 3MJRA 4LX0A 2DEUA 1R9NA 4W8OA 4V0RA 2JJ2D 3M8KA 1XKLA 2FFBA 3MGAA 3TR5A 2BTEA 3IIEA 3DXXA 2PH1A 3UCFA 2ATXA 4X00A 3R75A 5JCOA 1TMKA 2IYXA 4X1OA 1NVTA 4E0BA 1M1YE 4GMFA 4ZOLA 4IDCA 4B44A 1D6MA 3SBDA 4NOJA 2QR2A 4JHXA 1I33A 2AT1A 5LP6C 4KEAA 1DADA 2AMJA 4DLBA 1R0SA 5IJ0A 1NR1A 3X2FA 3R4VA 1HL3A 2A5JA 1QWSA 3O8OA 4F9TA 2WFMA 3SSAA 3PX2A 2BBOA 2DFKB 2J9XB 3GG2A 2ZDGA 2OD9A 4UJ5A 4WWHA 4IP0A 4ZVTA 3KTDA 1LF5A 4EB8A 4H7EA 1O0SA 5IX8A 3OO1A 4HDOB 3TLGA 3BE4A 3ROKA 1SKYB 2WUVA 1JR3D 2QW1A 2F1KA 4MW9A 1O6GA 2HYDA 5JAZA 4ZDIA 1CUZA 2FZWA 1MA0A 2R8OA 4IFIA 2QTZA 1WTAA 1TT7A 3E9EA 1USIA 4HDAA 4Y30A 3TH5A 3N75A 3GLSA 1I2CA 1XALA 2QP4A 5KYVA 5BWMA 2AXNA 2C5FA 3BMNA 4GZLA 5LLSA 5IKEA 3N1UA 4B3FX 4DQLA 3WZLA 4PZEA 3GNSA 4DLNA 2QRMA 4B3BA 3BIWA 1E6UA 4FDMA 1R2QA 4OFWA 4PICA 3INYA 4W5HA 4JEUA 1CUSA 2DFVA 4FMCB 4QIHA 4ZJZA 2ZR7A 3KR2A 5EUQB 1W2HA 3PUZA 2M6LA 4AWXA 4BN0A 2H85A 4LJRA 3H4VA 5HDQA 4DS3A 5KYTA 1QQ7A 4R84A 2GEJA 2ZR0A 4FFLA 3W78A 2WY2D 3CS3A 1TGVA 2VCYA 1NF8A 2YJNA 2WB4A 2ONYA 3DD5A 2QUHA 2ONJA 1FFSA 2IIVA 2PUGA 3EZNA 2XZLA 4Q7LA 3DC7A 3B60A 1W9HA 1YCHA 2FF5A 1Q7BA 2CE2X 3O3CA 5B4VA 2ONCA 3ENZA 3ZK9A 1HQKA 3ADKA 1P80A 4UM9D 1ABBA 1M72A 2CUTA 2C2OA 3O4JA 2O1EA 1MHPA 5BSMA 1Q1NA 1SXHA 3LSTA 1Q83A 2JVJA 4GI3A 4JL5A 4OBXA 1DV1A 4PYQA 5IABA 1U2EA 1LBTA 4YQEA 3E1KA 3I39X 3SC2A 3HN7A 3B3QA 2CNKA 4FMPA 2FEOA 2JJ1A 3G8CA 3M33A 3ND7A 3R0ZA 4L6CA 4UBMA 4BNVA 4JKOA 4DMMA 4EHFA 2P0EA 2Z08A 3T3IA 3B2NA 5JSZB 5L9AA 4RTMA 1NHGA 2ETVA 2I4IA 5IP5A 1DTWB 2LXNA 3UB2A 4WKPA 4G8CA 4LRQA 1SRRA 2H17A 2NT3A 3GN2A 3KJNA 2ZBQA 2QD2A 1Z6YA 1W36D 1OCEA 1QGDA 3FDZA 4UE6A 5JR3A 3DTVD 4WXRA 1L4MA 1VLQA 1L1EA 2GPAA 1ND5A 5LQSA 2J48A 5I7EA 1MCZA 4S24A 3IRUA 1QSGA 1BN7A 3GGDA 4X6LA 2BE9A 2C8VA 1HYGA 4LPKA 3ZDBA 1RXIA 2BEUA 2POQX 1ZCFA 3B1WA 1QV9A 2Z0MA 1Y8RA 3Q8XB 3FWYA 1DUIA 4P4TA 1QHHB 3V7FA 3LDHA 3TGLA 1E4EA 1JJFA 1VXRA 1N5MA 2RGYA 2P2YA 4L9SA 4Y2RA 5CFNA 3AHGA 1UAGA 2I8LA 5JCPA 2VI5A 3JQPA 5GJCA 4DLRA 5KJCA 1FYDA 1D0VA 1ZRMA 4NZ9A 2X40A 1NW5A 3O03A 5AI0A 2G82A 4X3OA 3VO8A 1HH4A 4AMBA 4Q16A 4U2EA 3EMDA 4MW4A 5KWEA 4H0CA 1B73A 5DN6A 4HRXA 4LSGA 1D8AA 5ICMA 2PRKA 5AW5A 4JFAA 2P4UA 4PSCA 1IIBA 1XSEA 2HT6A 5DTIA 5EOVA 4DV2B 2YKGA 2E7ZA 2Y1CA 1CT9A 4CL3A 2ZT6A 3IIIA 4NJMB 3K0AA 4LPSA 2KHZA 3PG5A 9LDBA 4DQUA 3H13A 1GNSA 4MKRA 2B0CA 5DNCA 4MYDA 2VRCA 1ETHA 5ERGB 2D0DA 2QPLA 2SKDA 3K72B 5JQGF 1OH6A 2P1RA 4IVPA 3B1XA 3UJDA 3M5CA 5KNDD 1T5OA 2GNOA 1ZK3A 1ZGHA 1RVV1 4RORA 3VZCA 3II6X 1PL0A 1V71A 4QYWA 5AHRA 1TJ3A 4RDXA 3GH1A 1Z38A 3H3XA 4PPGA 2VCEA 3S29A 4KVGA 4YRMA 1U2ZA 1YRHA 1KDZA 2YH2A 2I4MA 3KTAA 4RXMA 3SJBA 1DAIA 2XBUA 1JLLB 2H4WA 3KQQA 3P96A 4IJQA 4YI5A 3BGWA 2QU8A 2PZBA 3ZE8A 4IINA 1XAHA 2FFQA 3OX3A 3NGXA 3IEKA 3OF3A 4EHHA 2RGNC 3V2HA 2DR3A 3D1LA 2B1RA 3F5DA 2A7QA 4B85A 2Q2QA 2BFOA 2GF0A 1HZZA 2KJQA 2FEWB 4HWOA 1E77A 1WIWA 3F9RA 4H6PA 4J7AA 1KJZA 4WK0B 1MH1A 2VYFA 3WADA 1MPXA 4KR9A 4X7PA 3G17A 1DAEA 1TU3A 1PGOA 2I9PA 4RZIA 4RQUA 5DM0A 2XZOA 4GS5A 1H94A 3ZE7A 1CP3A 3CZAA 3OFNA 4V1CA 3ZJTA 3S2UA 3PL1A 3ZDDA 2OBXA 4Z4EA 3WLQA 3JZFA 1FLVA 3R8FA 1XG5A 1OVMA 2F00A 4M1YA 2GZ1A 5F21A 1M0TA 4NZYA 3T4EA 4GYWA 4O4HB 4Q3EA 2MSWA 1QFSA 3AEYA 1SJ9A 1KVQA 1RJ9A 1SY7A 4V0SA 5CEEA 3HUUA 3TLJA 3SQXA 5BWBA 3L0SA 3E82A 2GPWA 2J5XA