2C1EA

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
b'SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c1eA00
4NBLA 5IC6A 4FEAA 1NW9B 5IABA 4N6GA 2XYPA 3V4OA 3V55A 4EHFA 2H54A 1QDUA 4M9RA 4EHNA 1GQFA 3GJTA 1KMCA 1GFWA 1M72A 2HBQA 4ZVUA 4ZVTA 2CNKA 4EHLA 2H4WA 4LSZA 4JB8A 4QTYA 3DEIA 1F1JA 2C2KA 2QLBA 3EDRA 4EHKA 1RE1A 2NN3C 4JQZA 5IBCA 1SHJA 4FGUA 1RWKA 5IAJA 2J32A 3R6GA 2H5IA 3P45A 2HBZA 1K86A 2H48A 3V3KA 3BIJA 5IASA 4DCJA 2QLJA 4D3XA 2CJXA 1BMQA 3H0EA 4NOLA 3PD0A 3PD1A 4I1RA 4PRZA 3SIRA 4I1PA 3R7NA 4QUDA 5IAKA 4IEFB 4HQRA 1RHJA 4HVAA 4QUBA 4QU5A 2XZDA 2J30A 3R5JA 1NMSA 4ZVPA 1RWMA 1F9EA 1SC4A 5IAGA 3H11B 1ICEA 4JQYA 4QU9A 3DEJA 1CP3A 5LU9A 1RHQA 4FDLA 2XYHA 4N5DA 4AWBA 2H5JA 4N7MA 3D6MA 2Y0BA 4QUAA 5IC4A 4PS1A 4HQ0A 4PRYA 3KJNA 3PCXA 5H0IA 5IBRA 2CDRA 1QX3A 3RJMA 4AWAA 1I4OA 1RWWA 4QUJA 3NS7A 3R6LA 4JR2A 1IBCA 2H4YA 1RWNA 2FQQA 2FP3A 2XYGA 1JXQA 1RHKA 1SC3A 1PAUA 3ITNA 4JR1A 3OD5A 3S70A 2DKOA 3DEHA 3S8EA 1RWVA 4D3ZA 2Y1LA 3KJQA 3GJRA 4QU0A 4N7JA 5IBPA 3D6FA 1SHLA 3KJFA 1RWXA 4NOKA 2HBYA 2C1EA 2CNOA 3DEKA 2WDPA 3R5KA 4NOMA 2HBRA 5I9BA 2P2CA 1RHMA 3IBFA 5I9TA 1CVRA 2CNNA 2QL9A 3D6HA 3H13A 3R7BA 2AR9A 4D3YA 3K7EA 2K7ZA 2QL7A 4N6NA 4ZVOA 4AW9A 4IYRA 3GJSA 5LUBA 4DCOA 3E4CA 4N6OA 3NKFA 2C2OA 3QNWA 4JJ8A 5LU8A 2J31A 4QUGA 5IARA 5JFTA 5IAEA 1K88A 1I51A 4QTXA 4QULA 3NR2A 3EDQA 4JJ7A 4NBKA 3V6LA 2CNLA 1I4EB 4JR0A 3UOAB 5LUAA 1RWOA 4EHHA 4ZVRA 1QTNA 1NMQA 2J33A 4NOJA 2C2MA 4NBNA 3GJQA 4EHAA 4ZVSA 4ZVQA 3UO8B 2FUNB 5IANA 2XZTA 4QUEA 4EHDA 1RHRA 3H11A 4QU8A 4DCPA 1NMEA 4QUHA 5K20A 3H1PA 1RHUA 2H51A 3R7SA 3V6MA 4EJFA 1SC1A 2CJYA 4QUIA 3P4UA 4PS0A 2H65A 1I3OA 2QL5A 4FXOA 1RWPA 2QLFA 3IBCA 1PYOA 3V4LA 3SIPA 2C2ZA 4JJEA
chains in the Genus database with same CATH superfamily
1FVXA 3H65A 4URWR 3OI7A 4G2TA 4NJMB 1M1YB 4C30A 5K4GA 2WIBA 2XRMA 3PGKA 4H3KB 4UEOA 4XASA 4J0HA 5FI3A 2FRVA 1CETA 1N2BA 2HRQA 2IL1A 3FWZA 3LX6A 3PG5A 4G1CA 4NZ9A 5KOYA 3T38A 3EIXA 3STWA 1RP7A 5ALWA 2V7QA 3TTXA 2IU4A 5C34B 3AFMA 3ZD9A 1ECCA 4E1AA 1EP2B 3NV7A 4TOIA 4WASA 2PL9A 3ZU6A 2C9OA 2JFOA 3UGTA 2CVFA 1U2EA 1G8KA 2Z3VA 4R0NA 3AL3A 5TT1A 1XHFA 2WG2A 4YRKA 4ZQEA 2VSNA 1ST2A 3B5IA 3M9LA 4OIFA 2BVNA 1ZUD1 3MK31 5I9LA 1ZMRA 2Z9BA 5AJTA 4BX8A 2GESA 5HQJA 4GM1A 4HLUC 3P9ZA 1T4GA 1JLKA 2QRGA 4G5YA 1JILA 2YMMA 4Q16A 3ILXA 5B3AA 3N59A 3SEZA 4IH1A 3DV0B 5AKEA 2JLZA 4NCHA 4BMYA 3WIUA 2FLWA 1G6HA 1FVOA 1GZ5A 4OATA 5EHGA 1A76A 3K6SB 1A9QA 4JMPA 4MW7A 3RSOA 1L6RA 3GLGA 2ID9A 2OV1A 3TKAA 1KH1A 1THGA 4D8WA 1JWLA 3ER9A 1M0TA 1RPNA 3WYEA 3GEMA 4ZODA 3B1FA 2M6KA 4O4HB 3SS9X 1ADCA 3PICA 2H00A 5CCEA 4ZTBA 4D3DA 2YVUA 4MPJA 3IQXA 4U4AA 2I8CA 5FUWA 1GDTA 1D03A 2PIAA 2PGXA 4GFDA 1XTQA 4QFCA 2NSJA 2PD6A 5AJYA 1PQWA 2QYSA 2JCYA 4LBWA 4LE2A 4OQPA 2G72A 5LQJA 2C42A 4ZQFA 6REQA 1NPYA 3UWMA 2Z43A 4O4HF 4BU1A 3OTQA 4DQLA 3AF2A 5FNZA 3CINA 5JMOA 3GFTA 1CBUA 3LCVB 1TCCA 2NVOA 4D9JA 1ZY2A 3TIXB 4H0CA 1JPVA 5DCUA 4Q9DA 3BSSA 1USIA 3Q3CA 4QTZA 3OJWA 4G01B 1GRNA 2OV6A 5LQRA 1G21A 3GLRA 4H7FA 4YCBA 2J31A 3TOSA 3WGUA 4PG6A 1X1QA 2ZRNA 2PL1A 2HSDA 5A5EA 1PO7A 2JEZA 3GNTA 2W2TA 5HQ3A 4H17A 3JQGA 3PE3A 4P4NA 1Z6ZA 4G5HA 4HAUA 4HH0A 4WBNA 3B1JA 3MTAA 1I33A 3OFJA 4MYRA 4WSOA 1HDXA 1TVMA 4IQ4A 4KW7A 1PS9A 2DXIA 2WHPA 2FFAA 5H83A 1RQ2A 3ZCPA 1EFVA 2VK8A 2XI4A 1WDWB 4CU2A 2A92A 2ZZNA 3DP9A 3OEYA 4RE5A 1QP0A 3UG6A 1N8SA 5AIBA 1BJTA 3PF8A 4HFRA 2EQBA 1T26A 2ZJZA 2B30A 4RPCA 2Z5LA 1TAGA 1E61A 4DIFA 4ENPA 1GG2A 1Y1TA 1ZNZA 1HNWB 4B46A 2I9KA 2F1JA 1PQPA 1VJ1A 2CNBA 1OUMA 2GM4A 3N86A 3IBCA 4O59O 1L4MA 5CB0A 3EG9A 4ZO9A 3U26A 2NZUG 4FPXA 3GGSA 1EK2A 4P81A 5EG5A 1QXSA 3RS2A 2B0CA 5BW5A 1CJTC 1QGOA 1UPUA 2QW8A 1A8IA 1AY0A 3G0CA 3RHZA 1Q1GA 4QM6A 1C9MA 3IUJA 3EVFA 2HJGA 2WTNA 4NNPA 4NV1A 1F4LA 3ECSA 5K6AA 1R9NA 1JEJA 3EC2A 1E69A 5J2UB 3IVAA 2C5BA 4BUCA 4E7OA 1VFPA 4JLVA 2BFDA 2EP8A 4D0SA 4UFPA 2DH6A 4C0QC 3JZFA 1PYDA 2E6UX 1CQPA 4A8JB 1B8PA 2OCBA 2QVYX 2RGXA 3L6DA 1U7ZA 1U3VA 1V71A 3IRUA 2IV2X 4YP6A 5JD6A 3GJ6A 4BOYA 3H0EA 1RZUA 3PD0A 4L3VA 3DDNA 5CA1B 4AJKA 5SZIA 1EM8A 2E37A 2LTAA 1F51E 2P4HX 3TPFA 1T8UA 2CDCA 4QPNA 5HM8A 2YNMC 5K0SA 3C8ZA 3L02A 1A77A 2AHOA 2H57A 2KI5A 3CRMA 2ZRGA 2HREA 3P2JA 1M6WA 2ZZMA 1XDWA 3KB1A 1R0KA 2PRZA 1QQTA 3K73O 1P7VA 3K2QA 4WBSA 1SXJD 5CA1F 1SMKA 4WZBB 3Q7SA 4G0XA 3NAGA 1E2UA 3ETLA 4R7GA 5JARA 2EZTA 7MDHA 1EFCA 3B89A 3ZDXB 3QXHA 4PRYA 2FEMA 5LR6A 2FQYA 4KSCA 1XYVA 5A6SA 5LD2C 5ECYA 1VL2A 4N65A 4PPFA 5AXCA 1XN1A 2YWGA 4M1EA 4NF2A 3E53A 4F6LA 4HNAB 1GTVA 5CXXA 4NPAA 1AN0A 1M7BA 3I9V1 1ZSNA 2J3JA 3IB6A 3IURA 3K0FA 1DU4A 3K2EA 2I4TA 5KCMA 4N12A 2FR1A 3MFQA 3DW3X 1RM3A 2XECA 2B4TO 1KDVA 3G13A 4DY4A 2HRRA 3TCXB 3VPGA 3GX1A 1Z34A 4KITB 2F17A 3DDCA 3NHAA 1BWSA 4NU0A 1RWXA 1Y82A 3C4QA 5EIOA 4GZ6A 1N7IA 1SCDA 5CK4A 1JT9A 5AFSA 3ROPA 3F97A 3DB2A 5EPEA 4AG6A 2VP3A 4C2AA 3L0IB 2Q7DA 3K7EA 3WRXC 3F9IA 5IH3A 4IYRA 4KCGA 5SICE 1K08A 3U81A 1UWCA 5C7OO 4NMMA 1FTQA 1VSTA 1A04A 1DFGA 3CVJA 2H08A 4KBFA 4NY1A 1D2MA 2X1HA 3ADDA 4Y2VA 3ZI4A 3EOZA 1ESZA 5HTOA 3VUFA 2D2FA 2HMYB 4I4TA 1WBBA 1TKAA 2V0NA 5B36A 1OXBB 1YZNA 2JHFA 4F60A 2ZT6A 3MTBA 3T9DA 1QNFA 1Q7CA 2G40A 4Y7DA 3WGNA 1N0VC 4LF5B 5LP1A 2AK2A 2WTUA 3OPMA 2GZAA 4NCXA 3I01A 5DW0A 5JG7A 2ZREA 3KZOA 2P6UA 2PIDA 621PA 4D26A 2YJ4A 4HMPA 3OWOA 1XTBA 2F7SA 3ZXSA 1T5SA 1JXOA 1MDBA 3CR8A 1V11A 4RIGA 2XIJA 2LPMA 2O5VA 3ORQA 4Q5IA 1GRVA 1U2ZA 1JFRA 3OTIA 1PFVA 2R9VA 1O08A 3C6XA 3PIRA 4K6MA 1XU7A 3Q3HA 3WWPA 4CIYA 3ZDCA 4NH4A 3B3GA 5E8RA 1FDUA 3FDXA 5F7ZA 1JTFA 1W1UA 1NUHA 3BWBA 5HUQA 3L8YA 4WOKA 1WULS 3QKSA 4BC1A 2GQ0A 1FTWA 3EISA 2WYOA 1Y8QB 2VR1A 3OPYA 4CRWB 4G84A 4XIGS 4G0WA 4B3RB 3UIEA 3HMKA 2B1RA 4QM7A 3L4BC 2AFVA 3Q6NA 4R9RA 2VPWA 5AR1A 2J45A 2AZ4A 3K5PA 4XJTA 5CH8A 3DEIA 4XUGB 1L5YA 2AEMA 1GUFA 2F6RA 2Y76A 1GDDA 2A58A 3MMPA 4EGCB 2QOEA 3OURA 5IAJA 1OVGA 4WUTA 2FWPA 5E7QA 4BYMA 2COKA 2WBLC 2JCVA 2ZUWA 3ZWOA 1KH3A 2QRVB 3MQ2A 3PNQA 2QM0A 1KERA 4UFOA 4OLFA 1KA9H 2I6FA 4HAXA 1W8DA 1TK9A 1Z0SA 2ZAYA 3GDOA 3M49A 3C3YA 3ZCVA 1ZA1A 4E7PA 2O06A 4DUGA 1UP4A 2PKRA 4PLCA 5F73A 1S01A 3T3PB 1Y9ZA 2VPYA 4LXTA 4ZV4A 1Z16A 2P5SA 3L8ZA 4Z7NB 1N3IA 4F85A 4GPBA 1PWZA 3M5CA 4NPHA 2GLUA 3N2NA 3GRUA 3WO0A 3I64A 4GUAA 1NC3A 1NP3A 3UUWA 1UK8A 2N1MA 2DSNA 1ISJA 4W8OA 2JJYA 5AKYA 1E9EA 1WUKS 1XD2A 2B4YA 4C5BA 1COWD 2D06A 2YCBA 3E9RA 4J03A 2X0EA 4WRRA 2GYUA 1LY1A 1ZRSA 2IUYA 4HB3A 3OX1A 2IEDA 3U0VA 4JB2A 2PH3A 3CE6A 4I19A 4QAQA 1IL0A 5L3RA 3RV3A 4ER0A 2IITA 2GZ2A 4B2IA 5EQDA 2QE7D 5IM4F 2Q3FA 1HL7A 2YW2A 3COPA 3GARA 4WEQA 3UJ6A 4EENA 2GNAA 4EFNA 2XHEA 4O2AA 3ICVA 5A4MS 3I9JA 1YS7A 3LXRA 3IE2A 8GPBA 3UWDA 5DI9A 3H99A 4L5CA 3MZ0A 4KZKA 3DXXA 2FPKA 1BE1A 4WADA 2H7CA 1Q0PA 5CX1B 3TVDA 3ANYB 4DQXA 3U5ZB 1C7FA 1F4PA 3RK4A 4DV1B 2RC5A 4N6OA 1Q0SA 5L9AA 3C5WP 1Z73A 3QPDA 1UFQA 1E1NA 4AZ3B 1JNXX 4BDSA 4FUTA 2A9JA 1MNAA 1I2BA 1VP3A 5EP4A 2ZRLA 3V4PB 3FPFA 4FE3A 4MS4A 5JPDA 1I6MA 2R62A 4ZT7A 1M2VA 1PX0A 1TVKB 1J7JA 3THOA 1XR3A 2DHCA 3AVTA 1N92A 2O52A 2Q07A 3FYUA 1QWOA 3JWEA 5H5JA 2IVZA 4NV0A 1RWOA 2YJTD 5KNCH 4BLWA 1ZHFA 4IRMA 1KZ7B 2H63A 3AR2A 3NIGB 4KAFA 4ZVRA 2C59A 3M9WA 4IW3B 3QU5A 1XBTA 5ALKA 3LMKA 3KXPA 4TKUA 5CT4A 3EUEA 1WTAA 3FHTA 2ZE5A 3ILYA 4HWOA 4ETNA 3B3AA 4RY9A 1UAAA 2FSUA 5EHZA 1M2WA 2DUUA 4FINA 4MV4A 4D6YA 3E5NA 4IHJB 5JSHA 2CVHA 4R1NA 4IDGA 3UV7A 3UICA 1J42A 1RXCA 1IN4A 3AZPA 3E6AA 3F3YA 3VISA 3I62A 5HRAA 4KFCA 5B1DA 3OH8A 1C8BA 1MTOA 3HA2A 1N6PA 2DQ4A 3F7NA 4FFOA 1BEEA 5BSTA 1SXQA 1IVSA 3AWDA 1A5AB 1K3UB 1V7QA 4REOA 1IMOA 1T4DA 1UKYA 3EXIB 3TRKA 1R6XA 3QVVA 4KQGA 4F2HA 3EYWA 1R00A 4IHJF 4KUEA 3O92A 4X6XA 2PUGA 1N6RA 2H2FA 3HPRA 4HNUA 2OCYC 2WTAA 1THMA 2A94A 3BWCA 3IGFA 4ND2A 3HWSA 4OK3A 1YGYA 4RMJA 1ZRNA 3RC2A 4PGFA 4BNVA 4DCCA 2V1XA 5L7YA 3AF5A 3PC2A 2KQUA 4F97A 4BP8A 1RDFA 1JLSA 2V4UA 3DT6A 5KX5F 4JV5B 1NURA 3KLPX 3OWHA 2V6IA 3RHFA 1RW4A 3WLTA 2OZVA 1PWEA 5IBCA 4PWYA 2DWPA 4KDFA 2YZKA 3B6MA 3DE2X 3EAQA 4LY3A 2X42A 1SBCA 3LNCA 2B8JA 1BMQA 3FDZA 5HEKA 3E84A 1ESNA 1H1LA 1P45A 1W0KA 2G36A 3S44A 3VR6H 3TOXA 4D4GA 4X90A 2OYCA 1J0XO 4XR9A 3OCUA 1JYEA 1EWRA 3THXB 2Q1SA 2X86A 2ZLBA 4TWJA 2VT6A 1OIWA 4LECA 3SQMA 5LMZA 1HE3A 3AVOA 3EZ7A 4LF8B 4MI9A 3TLEA 1JJIA 1OBOA 2PD4A 4RPJA 4ZAGA 1TT5B 4DDKA 2NU8B 2B3DA 4RPGA 1XJWA 2CNDA 2P2LA 4EYOA 4Q4CA 4AXXA 2I87A 3SZMA 3BGWA 5KWVA 1P2TA 3FG9A 4A2QA 5KC9A 1LUAA 4QXPA 3L8CA 4UEWA 3UJDA 3T3GA 1FPMA 3R6LA 4ND5A 4OGKA 4U3JB 3ZJTA 4ZZ3A 3RBZA 3IFSA 4FNOA 1MMFB 1WZCA 3HN2A 3L82B 1VL6A 1W47A 5DHTA 2Z56A 2AMLA 3N2GA 4XE5A 5FDFA 2FPWA 2DMRA 5IZCA 5EIHA 2QT1A 3I2GA 1MORA 4E30A 4D8UA 5ALZA 1BGWA 1W46A 3NHZA 3U3DA 3C3JA 3ZZNA 3SEQA 1K5GA 1PJAA 4CLRA 4KR7A 3QHPA 1ZL2A 3JD2A 4FTWA 4UVIA 5KJ6A 1USVA 3COSA 3E4CA 3SX0A 5C1PA 2E6KA 4XVUA 2B78A 4Z5XA 3DV2A 4CM5A 4RH3A 5IN4A 1XEFA 1Q3KA 1YE3A 1ZD2P 4KRGA 3W9BA 3X1YA 2WKQA 3IQWA 5JBNA 2JCBA 4ND8B 1U9ZA 4EGAA 1CLUA 1Y1SA 4EQ6A 4H7DA 5BP7A 3PFHA 3U7FB 1NKVA 2C4VA 2FFJA 1E9RA 2O48X 3A6PC 4CM9D 1MQAA 1JTEA 4P38A 4FNMA 4Z3KA 3BICA 1N6NA 4IJ5A 3ZK7A 3WL8A 2C04A 2NM0A 4IOMA 2GUGA 3D3NA 3QIVA 4XSHA 5IJAA 3V4SA 3BWYA 1MC5A 4ALKA 1K89A 3BPSA 3ZZMA 1I2ZA 5EJFA 2P75A 1RI1A 4LVOA 1HE4A 2FW0A 2ZTVA 2JFUA 1WM1A 2ZAIA 3DNMA 3FIUA 5DBIA 4CCWA 1J8QA 4ZO4A 1LDYA 3GYBA 3ZNOA 2XMSA 3RRNA 2D5AA 1Y34E 2KS6A 3R3XA 2EJVA 1T0IA 1M2FA 2IOFK 1NR7A 5EKSA 3TDKA 5EWLB 1CULC 5M04A 5D01A 3V97A 3THRA 1SN7A 3WYGA 1ZWLA 3GU3A 2CK3A 2YKGA 1OBCA 1U90A 4KO1S 2NQ8A 2QJFA 5CHYA 3TL2A 2B34A 1FRNA 2E4UA 3CKYA 2QLBA 1SU8A 1YASA 5B58T 4LOIA 1I6WA 2C3MA 4RVUA 3PC3A 2PH7A 2N46A 1EWKA 2Q9UA 2Z6VA 3CYFA 3P4YA 3VRHA 2PRKA 4CMIB 4NJEA 2CV0A 3CLRD 4RGBA 2NT4A 3VDNB 4RMIA 3JWJA 2XOEA 2OAGA 1FJXA 4R2LA 2I34A 2J3HA 3HI4A 4BEVA 1V6AA 1DJLA 1T6XA 4G0PA 2O6LA 3MJHA 4JHLA 4Q9HA 2JAPA 1RJEA 4UPEA 4DA9A 2F64A 2D0PB 2G7MC 5DTIA 2AS0A 2ZRBA 2XUAA 4G09A 4MUFA 1CZKA 3EXG1 4DEXA 4HPJB 1JQAA 4UTZA 1GNTA 2FR8A 4EYGA 1TCBA 3ZWCA 2ZM5A 3PHCA 5THQA 1G7RA 3ZDDA 4MGIR 3PYLA 4NATA 3U09A 2WHQA 3HUUA 3VU9B 1CDDA 1YZVA 4B79A 3B6ZA 1TQDA 3BGVA 4YECA 4KLRA 4RL4A 2PHZA 4BMOB 4DLAA 1ZLXA 5CDFE 4UBNA 2XYVA 4CCYB 3RC7A 3WL3A 4I3GA 2IH5A 3A0RB 5H0IA 1UF9A 1DARA 4JP2A 4S1VA 3WI7A 2Q3DA 2CYAA 1IEVA 1KZYC 5KNDH 4G5SA 3WX0A 1H42A 4GF5A 2VF7A 4LPKA 3QFSA 5CFZA 2PO7A 4FIZA 4RJLA 2G07A 1HZZA 2PU5A 2WJAA 4B6OA 1WEKA 2CXNA 5LNK1 1YS6A 3ITNA 1Z25A 4MS1B 3FLEA 4EKDA 1Z4JA 2Y1LA 4BRUA 5BOVA 4DPKA 1O94C 2PLNA 2NNWB 2C78A 1EDZA 3AB8A 1JN0A 4G41A 3ZW8A 3ZVMA 1A9ZA 1JG3A 4WLUA 2D74A 2NUPB 2YHBA 2OENG 4HH1A 4PM4A 4QGBA 4W6QA 2OYRA 3R7BA 2HR1A 3WWEA 2ZR7A 1NDUA 1KK3A 3O31A 4DYVA 2JF0A 2Q6VA 3D7MA 5CUQA 4DGSA 4DT1B 1GU7A 5CJ2A 5JT1A 2JFBA 2OXFA 3LOPA 3HXTA 3MJTA 3FWYA 1GZVA 5K4AA 4V24A 4OI1A 1DKQA 1ZM3A 4GGPA 5JAMA 4HK4A 3PC6A 3AFNA 4QTXA 3U16A 3VFDA 3FMGA 3W0LB 5LIPA 1AN9A 3TIIA 2GJSA 3I04M 4GIBA 4DE5A 1FPQA 1IJEA 3BMCB 4EDFA 2P2ZA 1W6RA 1W0JD 2PO5A 3ICOA 4WZBE 1R10A 4BLQA 3MS2A 1OXXK 2UZ3A 1D2NA 1IZYA 3CN7A 4FFPA 1YZFA 4MUAA 4AVYA 3GRRA 2HHHB 3FPKA 1CUHA 3RSCA 3GG9A 4K9RA 2QS9A 1E7QA 4A92A 3N6VA 1P1JA 1PJ8A 2GSWA 2HRCA 4NBRA 2QPAA 4A1OA 4TL9A 2ZWOA 2H1SA 4CV1A 3P97A 4OGWA 4UKDA 2GPSA 1XL0A 1O5TA 1QAMA 2WR8A 2VIIA 2ZIEA 5D8DA 5CA0A 3L0ZA 3R8XA 1F0NA 1J8DA 1MRSA 1XCLA 2GJAA 4XRGA 2VKQA 1GWNA 1QPBA 2ZIXA 1G2PA 3NDIA 4ODIA 4Q4HB 4XGNA 5TGDA 3GIDA 2QSJA 2O8CB 1XNRB 4MVJM 4K9OA 1AU9A 2PBZA 1GNSA 2XGMA 3RARA 1D6MA 3R0JA 3RWBA 3B9PA 1F3LA 1LBQA 3A27A 1DT5A 3P26A 2QRHA 4CQMA 1VSUA 3BAZA 3EBLA 1QB7A 2CXOA 2V54A 3ZXIA 2XWQA 3GLHA 3AFIA 4TKMA 2YBDA 3LHFA 1R6DA 3EEBA 4W1PA 1J1UA 2PPLA 3FSGA 3QVXA 3LUFA 1D5CA 1N2EA 2W22A 3R6GA 5HWSA 2Q9CA 4QG3A 1L5ZA 2OCXA 1XDGA 2AG5A 1FLDA 1GNQA 2OGTA 3BG5A 3SDZA 5CDUA 4OL9A 3DWEX 3L7IA 2JCSA 1C4OA 1GZUA 1JDJA 4HZUA 4DSZA 3HP1A 1I9GA 1Z7WA 3EH2A 1OQAA 1OWOA 4FSDA 2GTHA 3SQOA 4B48A 3MN1A 4IILA 1VKRA 4PNEA 1P39A 4MEBA 4NE2A 3AOGA 5ALIA 2ON6A 1B23P 3CF2A 5IDXA 2VNAA 2ZT7A 4MP8A 1QIIA 4PWZA 1I1QB 1E5TA 2EGGA 2L19A 2QR2A 2HPZA 2JS7A 4TMZA 4X20A 5HZHA 3NHBA 1C1YA 4JI3B 5D6NA 2WMYA 4GKAA 4IWYA 1T6ZA 1OA1A 1WZIA 1T34A 2GT1A 3AKEA 3IVGA 3K92A 4M1MA 3DOHA 3WJ2A 4X7PA 3UW1A 3LVBA 4N5HX 4PLZA 3PEWA 4TTVA 1Z3CA 4P98A 1T1GA 4DLVA 1W4ZA 3BULA 1NQVA 1REQA 3CRNA 3FVVA 2WIGA 1DXOA 3LKVA 4JSYA 3DEHA 4D3ZA 1VB5A 3MJ4A 2EG5A 1SG0A 3IQHX 4HAOA 2IYQA 4A1FA 3R3HA 4ZYXA 3CLUD 1KY4A 3O5AA 3L43A 4L4SA 5LP6A 4XFDA 2IV3A 2C4HA 4D25A 1UEIA 2B82A 2JFHA 1FNBA 1VJRA 4CL3A 3PPVA 3ANNA 4XUCA 3E0QA 3HU5A 5K8CA 1MO5A 4Q47A 3HABA 3RS0A 3CBQA 4ZQHA 2Q6KA 3A1EA 1KYTA 5D1HA 5A71A 4MWOA 1U4SA 2OB2A 3SS7X 1UBNA 1YDHA 3QITA 1NWCA 1U9JA 1VYUA 1DWQA 4RJJA 4RS4A 5FWDA 3TG2A 3MMSA 1H66A 5FULA 2JIZD 2QTVA 2V6GA 4QRIA 4TROA 1ACMA 5BSGA 5HJ5A 3AY3A 2C3UA 2ZRDA 4UUBA 2F1OA 2HJWA 2VK2A 4ME6A 2VDWA 4IKPA 1WKCA 2VATA 2XYQA 4OI2A 5I7HA 4LCBA 3CG0A 1Y6FA 1MG0A 4FYWA 4ZQGA 1Z8NA 2G4LA 3WKAA 3AP1A 1KBQA 4BFUA 1WP4A 2B1IA 2R68A 1UJ4A 3KHKA 1KAHA 3FMOB 5K5EA 1WABA 1E9VA 2G9ZA 2C9CA 3IIJA 2AE2A 1U0HC 2WJ4A 4P5EA 2VDQB 1T9DA 2I67A 2VQDA 3IT1A 3JRNA 5A9SB 4CF4A 5JC1A 2PKQP 3MBIA 5JQGA 1OV6A 4DSNA 3ZIAD 1CRQA 1D09A 3W6UA 4OM7A 1XJ5A 5K8UA 2ODBA 2R85A 3UGJA 3ESZA 4UU7A 2ODQA 4CUKA 4CTJA 4OQQA 2QYOA 2HXYA 3H5LA 4J94A 1VDMA 4S1TA 4BNDB 3R6TA 2FG5A 1I30A 4HXYA 4AUEA 5HIMA 1E2EA 2CLMB 1H2EA 1OX4B 3I5XA 4R8MA 1TA4A 3IMCA 5G4KB 3SF0A 3AKZA 1IK6A 1ZG3A 2AFHE 2G17A 3PX2A 1C3EA 1CW2B 2JAHA 4QXMA 3UJAA 4LV8B 4AI6A 4NCAA 4ETIA 1A3CA 4OOFA 5H59A 2HDNB 5LQCA 4HDMB 4QGHA 5H82A 3TNJA 1BMDA 3W2HA 1NZDA 2Q4TA 3KHUA 5KOJA 3G5UA 4MSUA 5AI4A 3IBGA 5T57A 5L4NA 4JB3A 4D3XA 5G0VA 1LF0A 2JATA 5H1YA 4QDOA 1UPAA 4A5OA 2BI8A 2RB5A 1SQFA 3N58A 4DPMA 4R3UC 5TPWB 5LZ9A 1QHEA 3LUJA 4LV5B 5KAPA 4FLMA 1Y98A 2BRUC 3CO0S 2WJ6A 3HO8A 5DVZA 3NMUF 4MVXA 2CN1A 1WW3A 4AJ2A 5JQWA 3ASZA 5DN9A 2I4NA 2FUCA 3R0IA 3MYRA 1JHXA 2N3ZA 4JQYA 5LU9A 2WSIA 4ZC8A 4P2GA 1Q14A 2W9XA 1WOYA 3LGSA 4II7A 5ARBA 2QJWA 2I99A 2ZSHA 5JSKA 3S29A 1C9JA 5DFAA 3TSAA 4QXAA 4E15A 2XDQB 4PZUA 2WHYA 1SXPA 1U4NA 1G16A 3JD1A 3K4PA 3PEEA 4IRUB 2CNWD 5JPIA 3SLRA 4I1IA 4D8TA 3SZLA 1RBQA 1QE5A 4NNJA 1Z5OA 1ZUNA 2X76A 4QLAA 5E95A 1OU0A 2IYLD 3HL0A 3PEFA 3KKNA 1EIWA 5AM4A 4LYHA 3PFCA 2O2EA 2WTEA 3L7YA 4D4IA 3N8HA 3VR5D 2PCJA 2EARA 3VUEA 1VCIA 2ADFA 3KPVA 3MRXA 4G24A 4HX9A 1CJMA 2J9GA 3WY9A 3KQHA 1TOAA 3FDFA 1SKAA 1AGXA 3L8FA 1Z5NA 2AR9A 3BHMA 4R1SA 2PUBA 3V1LA 1BYUA 4A6DA 1MVLA 4EBFA 1F3OA 1JFVA 3GT7A 1G98A 3I2KA 3T1YB 5H9VA 2UUBB 2BMWA 1NUPA 3OU7A 4MW4A 3EWAA 2XQKA 1FQOA 2KHZA 3Q7PA 1VXOA 4QOSA 5AK0A 5F1KA 2RONA 2G80A 2H9YA 3R0ZA 4YCSA 2BGJA 4L5AA 2SKDA 4I5GA 1Z7GA 2YRFA 2ZWPA 4AP6A 2XITA 2GVZC 3FOCA 5AUPB 4MRAA 3WGYA 1PCXA 2O3RA 3A37A 3KTOA 4HB2A 3L6OO 5DEIA 1CUCA 1NJ2A 5EGNA 1Q7TA 5EERA 3WNDA 5JS7A 2Q5FA 1HYBA 2MSKA 4YJFA 1WXXA 2GN2A 2EATA 3G7UA 1L4YA 3ORFA 4KGDA 2TECE 4RH0A 1KO7A 2QW1A 1SKUA 3DMTC 5T67A 1TI7A 3R9KA 1U7DA 1VL5A 3GHHA 4AJLA 5DO9A 3JTEA 5I7UA 3DBVO 1DAKA 3N7AA 3PDCA 2ZUCA 3VI3B 4BMVA 4IDQA 4QZVA 4C06A 3BB3A 4J0KA 1T8YA 4S1PA 2ZWAA 2WEKA 2DU8A 4YCAA 5C5EA 5IJ0B 1CRWG 2CF6A 3FX2A 1MO6A 1B0UA 3DC7A 1F8UA 3NTOA 2X4IA 1FJHA 3CG4A 3W6OA 4ZIRB 4HVTA 2EKDA 3I9OA 3L77A 3PSHA 3WHPA 2P4SA 5K2MA 1MDFA 3HDVA 4EB0A 2J07A 4R2IA 1E0JA 3WJ1A 5MGBA 1IN7A 1TA9A 2VTVA 1C9NA 3BRWD 3VOAA 2F9MA 5CJPA 4AMVA 4G07A 2C4KA 3HKBB 3OPQA 3GJ4A 3GBVA 1L1RA 1DAMA 1U94A 5JBIA 5AOCA 1A2BA 1JDVA 1RT9A 4MLPA 1BQ3A 4LHWA 3K30A 3IHKA 3CZ4A 4IHQA 4C7MA 5JAZA 1QG0A 3SBOA 4JC4A 3ZHRA 1I36A 4I6GA 2XVYA 5DBFA 2N75A 4YJDA 1NMXA 4GE0A 1LBEA 4P7FA 3I4CA 1V1RA 3LDFA 1IPEA 3HJHA 2V5UA 3PGMA 3SMQA 1HT0A 5ESXA 2VBGA 2EQAA 4RTOA 3ROEA 4CEJA 2FEAA 4Q9IA 4DBLE 3CQ9A 4FJ1A 4PYIA 3URMA 4M99A 3WJAA 3KOYA 1P5FA 1UWKA 3V33A 5AI9A 4M0CA 1AIPA 4YYEA 5HZGA 4OJMX 1NVEA 1LH0A 2VXYA 5I9SA 1ILEA 2XX3A 1C1XB 1QJ4A 1ML4A 3E1GA 3HXQA 3TOCA 5JFGA 3ZE8A 1TEVA 3CH7A 4JLAA 5KYWB 3GNLA 4AY2A 3BIWA 1T4MA 3O7MA 4HBGA 4A6XA 3FYDA 4LMRA 4MA0A 1O8CA 1EVKA 3T7JA 1XYGA 4L57A 4RY0A 2Q6IA 1K7FB 4C3VA 5JFOA 4G89A 4RTMA 4GVLA 1EUCA 5KSOA 2PJZA 2WMDA 4KNYA 3FW1A 1XF1A 4US1R 4BFWA 2YWDA 3TE7A 1Q7RA 4MV8A 2QL9A 2IYSA 4MA4A 3QBTA 4MUHA 4D42A 1ZIOA 2BR3A 3AEZA 5FBWB 4RA6B 5ARCA 1A8UA 2WYVA 5ABPA 6ABPA 5A5FA 3GOQA 3OUTA 4RK1A 1YE8A 3SZOA 3OQIA 4LDRA 2A1UB 3ZLJA 2Z83A 1PHRA 3LT4A 4OUDA 3G1UA 4XLLA 4BJHB 5JEEA 2PXHA 2RHLA 4Z0TA 3C3MA 4EI8A 1O96A 3FROA 1OPRA 4QOIA 3A9CA 4BBAA 4K6CA 1RZRD 4L78A 1Y8RA 2B94A 2HV8A 4PPYA 2XKKA 4BLSA 1QFMA 1DCTA 4O02B 4F2WA 2ZJ1A 3C3CA 4B32A 1GSAA 5JI3E 4KQFA 4LISA 4JQCA 5FF9A 1XEXB 5BMOA 5JNVA 1ZO8A 2IYTA 2UYQA 2PMKA 4MQMA 3T0GA 1L5MA 2RI0A 4IHAA 2YJZA 3U1VA 5EMNA 5LLSA 4MJ3A 4DR2B 5G02A 3E7XA 3DB1A 3DZFA 3M6UA 3SZGA 1HZJA 2K2WA 5GZ1A 2WPDD 5JS2A 4JKYA 3W5VA 3EGCA 1N9GB 4ZMSA 3HLKA 1OXSC 1Z2PX 5IABA 4CM6A 1B1AA 2ZKIA 1IE3A 2PR7A 4JCCA 1ZGAA 2QG6A 1CUAA 1M1UA 2WA2A 3VHXB 4GRAA 2NZ2A 3DBHB 2BOVA 5HMLA 3OZSA 1RC1A 2JD2A 3W79A 4G9BA 1WG8A 2HK7A 2Q27A 2CVQA 3I73A 1PJSA 4TQGA 5EL0A 2DHRA 2VZ8A 1ITZA 2PZLA 4C5AA 2SCUB 2IS4A 3EG5A 1ISSA 4ZXFA 5J1SB 1C8LA 1RXYA 1Z26A 2J6BA 3A1SA 1Q12A 5CBKA 4JLKA 1PBNA 3WK7A 4WK4B 1SBIA 3KXKA 1P0IA 1ORWA 1NBME 1U0NA 4KPUB 2ZSKA 3AUSA 1CDOA 3SJCA 1PV2A 2W0SA 3HCOA 3HYCA 2G67A 4RLFA 2YVKA 3H7AA 4PHCA 4Y6LA 5EEGA 5GV8A 3ZOKA 4B75A 5IDWA 5HKOA 3MIIA 4E2XA 2WW8A 3LXUX 4GRIA 2QBYB 2C31A 2C7OA 2CMHA 4M37A 4QU5A 3THYB 1FFSA 1C30A 1SOMA 3JASB 1BEZA 1RXVA 2XQIA 4GQIA 2UXBB 3QVGB 1WP9A 2VTBA 2GPBA 3C6KA 3W8EA 3LY5A 4ZU3A 3ZS9A 2C5FA 1BX3A 4DVJA 3A1UA 2VZEA 3CW9A 3O8QA 1EK1A 4Q7LA 5JH7B 3H5IA 4IG4A 2GBGA 2QMEA 4FE7A 4NEGA 1F6BA 2G0TA 1JE0A 2JZCA 2NPOA 2PUWA 4KWTA 4LXUA 1T9AA 2VNSA 4N7MA 4PG7A 3RIYA 4UNRA 2C5EA 4QEZA 5I7VA 2ZRCA 2WF5A 3GV0A 1NI5A 2CHFA 1DWOA 3ADPA 2QTMA 1WXDA 1MPXA 3KT3A 2E18A 4ARUA 1SD2A 1LSOA 2JK0A 4H6VA 4K86A 1N36B 2RGDA 4DA0A 2AMFA 3ZLBA 5JH7F 1W44A 1EJ2A 2Y27A 1VRWA 4Y1EA 3M6LA 1OB2A 4IVPA 2P62A 3IXQA 5C8ZA 3BK7A 1P5JA 1ZKMA 2ODPA 3HC7A 1ATZA 1MABA 4FBMA 4MVJH 1W5BA 4HVCA 2GUWA 1WZ2A 1Z6YA 2BFBA 3A26A 2PMFA 4BV9A 1D9XA 4KH1A 5JS1A 1P80A 2QU8A 3L8MA 2NYVA 4RDXA 2NX2A 3OFKA 1XAHA 2X5XA 4HYYA 4BVEA 3TFWA 3VX3A 1JDTA 2VYVD 1VCOA 1NVWQ 2B21A 1OKKA 4WZAE 3C3EA 3GPCA 4P83A 5AHXA 1T25A 1PW7A 4F4IA 1PFQA 1RRMA 1P0CA 4YI3A 4Z1MA 1SVLA 1T36A 1WF6A 3OBBA 2RHMA 2P27A 1JL3A 3DOOA 3KCQA 3QEOA 4R98A 3L3BA 1A7AA 3MCAA 3UV6A 1SXHA 3O4GA 2HGZA 1R64A 5FQNA 1LS1A 3ZHCA 2XUQA 3ZKAA 1Q15A 5JCXA 4PFQA 3HGTA 5AVUA 1KI6B 4KACA 5KYYB 4XKJA 1Q83A 3UKJA 2GWRA 2PZGA 4LSWA 2JGDB 1S2LA 4PZAA 5EIFA 3P1JA 2P6NA 1FS5A 4MWSA 4JB0A 1O97D 2HLDD 3RTGA 3U4QB 5DBEX 1GSIA 4DW8A 3IAEA 4FSHA 4MVWA 3HLYA 2O5EA 1SQGA 2E55A 5LJIA 2R25B 5CT8A 3MJRA 1VE9A 3S2SA 3V1NA 2PKCA 4BX0A 1AO0A 3ZVNA 3TW8A 1TLFA 4Z53A 1KYXA 4GM0A 1N2CA 3VNBA 3FTPA 3LK7A 3BVPA 4PRZA 1PGJA 4NBLA 3ZYZA 5TIIA 5IXJA 4XPZA 5K8VA 4JUFA 4KVFA 2R3SA 4GLJA 3RKSA 3ROFA 4CPDA 3CNHA 1MGOA 4NMXB 2QX9A 1GAQA 4HJRA 4JJGA 4BKOA 4P33A 4DIDA 2FI1A 4Z9AA 4PYRA 1ZLYA 2H2HA 4Y67A 2AUNA 5GQSA 3TIFA 3VJRA 3VTKA 4ZTUB 4V0MA 5I9MA 3SQWA 2ZRMA 1V8BA 3FSRA 3JZIA 1U11A 5ILQA 3MCVA 3B7PA 5ICEA 3UJHA 3VBCA 3CV3A 3LLSA 1RC8A 4E2ZA 3VNVA 1F20A 4MYTA 4K28A 5CBPB 1N5DA 3KJHA 1H5NA 2HV9A 4JK3A 3AVYA 2XT0A 3DOFA 1N32B 3QVSA 3H2GA 3HNOA 2FZ5A 3E7FA 4DBZA 2EZ8A 2QWXA 4CFZA 1TYDE 2VYND 2VWPA 2ZBEA 4UXHA 3NH6A 5AMXA 1I0ZA 4WLNA 5D3MA 1FXWA 4DJ5X 2RCYA 3BMNA 5F1YA 4PTLA 3EODA 1QZTA 2XCSB 3T5MA 1HOTA 4PSCA 5L53A 5TMBA 3KIPA 4XH9B 2RAFA 1DBVO 1BCSB 1VI2A 2ZYWX 3WMGA 1C1HA 4LJ4A 3UT6A 4R3WA 4AWBA 4AJJA 1NTRA 1SXIA 4TX1A 3HBJA 1Z47A 4K05A 3NOVA 4NQRA 3LCMA 4X64B 5AOBA 4F5YA 1QYRA 1XELA 2R6JA 4MKXA 4U2CA 5ICGA 3SWWA 2CHUA 2PU7A 5EN4A 2XDWA 2QJTA 4M88A 3V2UA 3WYCA 1LLCA 3KD3A 4NMWA 4PCVA 4XWKA 1BKSB 5SV2A 1ILWA 5MFPA 3DVSX 1WOMA 1ZP6A 3IUMA 4OH1A 3DE7X 4EUNA 4NJMA 3LBAA 1X80B 3LYLA 3WK6A 4EUSA 1K7YA 3QE4A 1OH8A 1RC0A 4NZMA 4H60A 3WGKA 5FP0A 3AI7A 2GHTA 2HBYA 1J70A 2PS3A 2ZZKA 3N7TA 5REQB 2CBXA 4NARA 4R1TA 4JZKA 4CGYA 2OD7A 4UXIA 5HJ2A 1DRWA 2FN9A 3Q2IA 3VVLA 4G26A 5BYBA 1P3DA 3CUWA 2P41A 5GJCA 5U4XA 1AK9A 2GZ1A 3VNQA 4AX4A 1L1EA 4J75A 1TW2A 3SE0A 4BMSA 1XNQB 2ODEA 1P5HA 4J0IA 3DHVA 3IPYA 1G5PA 2FRXA 2EX4A 2ZIGA 4WECA 3SYMA 3U7EB 2POQX 2QMYA 5AJHA 5KQMA 2IXAA 4KQCA 5KYNA 8ADHA 1VC2A 3KO8A 2XMZA 4EI7A 2AMJA 3N2YA 3MLAA 1KYYA 1DG3A 4GMXA 5JY1A 3NRJA 5B4VA 2PV7A 1P77A 1TRHA 4BVJA 4GLLA 2QI9C 2WF9A 5HRCA 3RS8A 4D9IA 3JARB 4C4AA 5AUOB 4RIHA 5HVNA 1VPTA 1C7JA 4NOJA 1C2TA 1E1DA 4J0QA 2OO5C 4AJ9A 1SD1A 5BOSB 3DV0A 4MB0A 1JG4A 2G3YA 2RAUA 3AQ4A 3HHPA 1YQUA 3KOOA 2PAFA 3TKYA 3K6SA 1NULA 2IU3A 3H3XA 3I2IA 1AGNA 2I4IA 5EKTA 1YI0A 3I92A 1ANKA 3L5KA 2YN0A 2Z8XA 4O4HA 2IHVA 4TN1A 5D5HA 5ELMA 3VOTA 2XCRB 4PN7A 2GF2A 1UJ6A 9ABPA 4PQYA 3UOGA 3Q8XB 4MJ7A 1S9HA 1XK6A 3NEJA 1Z68A 3SYTA 4HTFA 5AH0A 4AO6A 2W2KB 5JJ5A 1E96A 1CVLA 1XAIA 3O6VA 1Q1EA 3QKUA 2PX5A 3HB0A 4GOMD 4AKEA 2PBRA 4TYWA 1DBWA 2ENWA 2DTXA 3TKLA 3VM6A 5A4KA 3EEOA 3TS1A 2ONJA 4WY5A 4WKPA 5I51A 4R41A 3ENWA 2P69A 1YWGO 1CNMA 2FGKA 5C5DA 2HI0A 2NN3C 5KYXB 3UM9A 5HBRA 3G2PA 4URYR 3D9QX 3B6EA 3HDHA 1SVKA 2FR0A 1UADA 2ZI3A 1EFLA 3OVMA 3L8GA 2QRUA 4RSGA 2DY1A 4AULA 5JLJA 1CPYA 2EXXA 1WSDA 4UHBA 1MRZA 1A4UA 2Y4NA 3D7NA 2W2PA 4UMVA 2C98A 4W63A 2OXTA 2Q6TA 1YNOA 3PT5A 4MO9A 4Q66C 5GOZA 3TOVA 3ZR4B 4EJ6A 1SZCA 4HDQB 1T2FA 4LMPA 2QAGC 4RD3A 1JG2A 1NQAO 4WLEA 4BVAA 3W5BA 2IEBA 1ZYUA 2I33A 1MPTA 5IH7A 2XOKA 1G66A 1YL5A 3ICCA 1C0KA 3DFIA 1XMIA 3DTTA 4ZQIA 1ZISA 1GKYA 1O3YA 3KJNA 4H08A 4L07A 5ALGA 1Z0FA 1NOIA 1DELA 1A9SA 1KF0A 4R69A 1WQ1R 2AVDA 3IE1A 3DLBA 4AZSA 1Y9DA 3I01M 4C1NA 1G20A 1BZYA 2GI4A 4GZMA 4LYJA 4NEQA 4R81A 5DU2A 4B4DA 3BS4A 1L5RA 3T7RA 3TTTA 2IYXA 4X95A 1VJCA 3H5WA 4E70A 1RU3A 4OJYA 2B9EA 1N2IA 2CY0A 4H7KA 1LSSA 1P1FA 3AETB 1C4KA 4RWZA 2CZCA 3KSAC 1LQTA 1SULA 5J2UA 3IB3A 1YB7A 4TS4A 1K75A 2AFHB 5TV2A 4TM7A 3RW9A 2DERA 2P2CA 2V9ZA 3PFIA 3U3XA 3TVTA 3F5QA 2WT9A 3DS8A 4GI1A 5K03A 3SBEA 3Q5DA 2XZPA 3M6VA 1RKBA 1UR5A 4EI2A 3LQQA 4OB7A 1P4AA 3UJPA 3ELDA 4A8JA 4L85A 4OKIA 4JHXA 1BKYA 1HQCA 4INZA 3S99A 2FEWB 4D3SA 1GPYA 2GF0A 2GYWA 3PQ8A 1D6SA 4ASUD 1VECA 1CR6A 1SELA 1U9IA 1D2GA 2VP2A 5CA1A 1Z37A 3PSAA 1T43A 5SZKB 2N47A 2ODTX 4E5YA 3CZ5A 3R5FA 2OG2A 4G4SO 1P7WA 3HCBA 2Z8YA 3BIOA 1D6NA 3JYPA 1J8MF 4H0FA 2PX0A 4OHRA 3ZVLA 4D98A 1SXJA 2PJUA 5DGDA 1UOOA 5LN1A 1ZIXA 4ZOBA 4PNPA 4ZKDA 3FPHA 2P2NA 3NHLA 4QU8A 3JQQA 4DDWA 1K4YA 3P9RA 2PKWA 3B12A 2WJYA 13PKA 2LKCA 1OU4A 2VWGA 3VHQA 4BO7A 1YBAA 1XKQA 4A0RA 1I7DA 3PEYA 2WSMA 1YQGA 1NN0A 1W5FA 4R0MA 1XZQA 1ODIA 2B0JA 4ZT2A 5FBLB 4A26A 3B7GA 3A2NA 3RU3A 1S4MA 3FPBA 4ESVA 3VNUA 4HNAA 2QUAA 2BHNA 1KEEB 3UATA 3KBOA 4DLRA 3M89A 5AW6A 5J5CA 3GUHA 4PNZA 2AYYA 3HVKA 4B3DA 3ZTWA 3KZXA 4X85A 5LZ2A 1UQRA 4KI7A 4P34A 1DNPA 3DZDA 3OA2A 3H1EA 2O8DA 2NTVA 3ACCA 1P2GA 4LTDA 1Q16A 1Y4DE 4TTAA 1OT5A 4S0XA 1G291 4OM8A 1G0NA 4YRNA 3P9QA 4BMNA 5DHAA 4HEQA 2HLHA 3ETDA 4ZCMA 2BGKA 2AI2A 2BGTA 2EFGA 3PQ7A 3QLTA 1JG7A 3UPDA 3U6KA 4BZQA 1E7SA 2Q99A 3BSFA 4J1QA 4HT3B 4G4IA 1TC2A 4L0MA 3UTCA 1FTNA 4HI0E 1C3LA 1GIAA 4JH0A 3O8RA 4LRSB 4K9LA 1HYGA 4IDNA 3JQDA 1BMTA 1S9DA 2HIGA 2HU8A 1UBSB 1N4DA 2O7RA 3R3YA 1U99A 3FCUB 4WLOA 4XCXA 5DDIP 4DNOA 5HPYB 2MOKA 2ORED 2JVKA 4UUNA 3BF8A 4EKGA 1C7IA 1PIWA 1RXEA 2W6ID 2VSXA 3DDSA 4PX2A 1UMCB 4TWZA 1RS0A 2Q1YA 3TQIA 3K4QA 2JLWA 2XBMA 1UBHS 3O0TA 1EXMA 1KOFA 2R7AA 4OQFA 2D5BA 3TNFA 5C80A 2YFKA 2CD7A 1S8FA 4KVAA 3LZ6A 2VWQA 2XY4A 3C16C 4H4DA 4JROA 4C08A 1WUJS 2JHCA 4JEHA 2PG3A 3MGGA 2DAPA 4M0EA 1NV8A 3QWIA 4UZFA 4CV3A 4P4UA 1EZ4A 2Q4OA 5LJLA 5AM2A 2P7IA 3DFUA 1MX3A 1MX5A 5F1PA 3EX7C 2QX4A 5ED4A 1QHHB 1UKAA 3DZBA 4TS3A 3MPUA 4NEHB 5DX0A 5ULLA 1NV9A 5JJCA 4Z4QA 1N6OA 2WK1A 4GKBA 1M74A 1Y8QA 1DL5A 3TD2A 4BNXA 5K3BA 3UMMA 1MHTA 1H69A 1QR6A 2FN7A 2HQBA 5ELLA 1LFDB 3SC4A 3B8EA 5EE1A 3NYQA 3ZWWA 3I39X 2AEFA 1GU1A 4WLFA 2WHEA 5LBUA 1JJ7A 3OCJA 3QFRA 3RFVA 2BZGA 4CIWA 5J3JA 2E4YA 3G1TA 1C0EA 4MQEA 4TWAA 1VJDA 2IW1A 4RO0A 3IHLA 5IJWA 4RMNA 2QRVA 2EFCB 3UOAB 2HDHA 1IQUA 1R3DA 2IZ7A 3IMEA 3FWNA 2VP6A 4IV8A 4MKIA 3RVLA 5BRAA 3QSYA 5BXYA 1HNXB 4Z8YA 3CC8A 4O4LB 4OYYA 3WIDA 3KLNA 4MWGA 4MHTA 2OTCA 4CZ2A 2DUWA 2IOFA 3FPCA 1ZBDA 1T1SA 5T3UA 3TCKA 2YVQA 5EHIA 1L3CA 4QTUB 5KSYA 2ZYUX 2CLIB 1YKFA 2G5TA 1P2SA 3HSSA 3DT8A 1J0BA 4BIMA 2EWMA 5H3LA 1E2GA 4YGYA 3UFXB 1RHUA 4XUEA 1COWA 2PSFA 1UFVA 3D7SA 3HBMA 3LC2O 2BFCA 3LYUA 4O4LF 4AP5A 1ZR4A 4X8LA 1FP2A 4CTOA 4UNNA 2NUTB 1MEOA 1WW8A 3R41A 2ZUFA 2WZQA 2X2PA 1ZK0A 4NNOA 4RK6A 1L5QA 2VDJA 4MMZB 1L8LA 1NL3A 1QONA 1KH2A 2HA7A 2ZSAA 4UXJA 2VEOA 2O2GA 3FLBA 3AXTA 2BR5A 3FPLA 2X58A 4HX5A 4J9VA 1IZ8A 5ALSA 4F7WA 4FQ7A 3ZU5A 4QJ3A 4Q1DA 4R9VA 121PA 2X0JA 4KPYA 4K8OA 3S2ZA 4Q7EA 5IUJC 4BZZA 1X0XA 3MD0A 3HK2A 4GZLA 1X92A 1RIIA 5CXUA 1J21A 2RH4A 3E27A 3I72A 3ICWA 3K5HA 4UBOA 5C31A 4DLYA 3ZWKA 2E21A 3QI2A 1NBAA 5CX1A 3VJKA 1HSZA 3HR8A 3KEGA 1ATIA 1U3GA 1YR1A 2BKVA 2CHGA 4PXYA 2X6RA 2GM5A 4BO1A 3LL4A 4NBTA 3I3SR 5AW9A 3GVPA 4W5OA 1E2NA 1GKUB 1KU0A 1XTJA 1DQYA 2PUTA 2EDAA 3GBPA 3G5MA 1P1BA 2J6CA 3IV6A 4Q12A 3EGVA 4QQRA 2M1ZA 2PZ8A 4Q1FA 4RAOA 2J87A 2GOYA 2O0JA 4N8DA 4FDTA 3TXYA 4UOZA 1WMFA 1KYWA 1TVKA 3EULA 1I2AA 5JCOC 5H8WA 1VL1A 3GGDA 1EJBA 3OFSA 3AVQA 3QUBA 2IYFA 1A2OA 1B6SA 2QJOA 1GFZA 4DMRA 1IATA 3AM3A 5EMKA 1A9RA 2ACVA 2EJTA 2XTJA 5FTJA 5I4KA 3MJCA 2G0NA 1S2IA 1YJ5A 4MUEA 2GCOB 5FADA 4DREA 1NLMA 2H5JA 2FPOA 5MDHA 1MU0A 4IHJA 5EJMA 5FV7A 3LPNA 3VPBA 2VTEA 2ZUDA 5BYAA 4BO3A 2C5LA 3NALA 4HYEA 5T4BA 3RFXA 1JKFA 1XVUA 2ZTMA 5FPHA 3D3EA 3WYNA 2XGSA 4UBMA 3DOEA 3D0KA 4QDZA 2X7JA 3WK5A 1ZQ9A 3EXIA 3RC3A 1XTRA 1SKYB 4JVSB 2NUBA 3B48A 3HYLA 2MMGA 4WL0A 1FDWA 3M4YA 4KXLA 3QX7A 2IZ0A 2VHJA 4FYIA 2D0DA 1JMYA 3LUCA 4RAQA 3UH1A 2BONA 1EDDA 1LTQA 4HWKA 4L0DA 3QSGA 1GQOA 5IEJA 3COYA 1C4XA 2Z1MA 3E4DA 5EFOA 4AW9A 1SEPA 1SCAA 3EXEB 1S8AA 5IX8A 4DF3A 1JHQA 1LWOA 3A7DA 1BMFD 1U98A 4FXPA 4XWGA 4B5LA 5GIPE 3FYTA 4B17A 5MGNA 3VVMA 3KHSA 3SAJA 3EVCA 4R8RA 1N7HA 1GTMA 3VNSA 1SUFA 2X5JO 1FTSA 1LK5A 2MINA 3KZKA 4FR0A 4BWGA 5IK2D 3GLFE 1FXUA 3UKDA 4M49A 5BVHB 3P2EA 2ZG6A 5AW0A 2ZYVX 3AESB 1BJKA 1QIFA 4DAOA 2WJJA 1US8B 2XBLA 3DF7A 3PNYA 3OE5A 4PLYA 1GT91 1W4RA 1RMTA 1HDIA 3K32A 2R6ZA 1EHYA 4GXNA 4WMLA 1ZSVA 3ON5A 1FLVA 3BTVA 2NSDA 1TT5A 2NU8A 3I2FA 5JTUA 1W30A 2YHUA 4ADSG 1FCJA 1HFEL 5EZYB 3JZDA 4HC4A 4YRFA 2OQVA 3RBAA 3V3TA 1RLJA 5KHOC 3GUCA 2I29A 2BDTA 3CWCA 4GG1A 3HI6A 1DHRA 4X00A 5FKJA 5LL6P 2RGNA 3OOEA 4PU0A 1IVNA 4U3JA 3M4XA 4IYJA 3I12A 4F93B 3PI6A 2IZ1A 4M9QA 2J9ZB 2HXGA 2YOGA 3DDOA 3EIEA 3VJMA 4R54A 1I7LA 1L1FA 2IW3A 3R2JA 5KVCA 1ODCA 2OHIA 2V3WA 5EZYF 4ZXPA 5I7AA 1JSLA 1VSBA 5F5LA 2FX2A 3EEYA 1NF9A 1VHTA 5AO9A 3CZCA 2F8LA 4P0QB 3I09A 3CIFA 3LBHA 1JBKA 2WWWA 3HR7A 4J43A 3UMCA 1E1LA 5LQKA 3RRYA 3ABZA 2BT4A 1L4UA 1EAYA 1QHGA 4MP6A 3TM5A 4QGFA 4HLUA 1KTIA 3GPLA 2BBOA 4FK8A 2LCFA 1A8HA 3EGOA 2GXUA 3IVCA 4JUBA 3O83A 3S27A 4YJHB 3R4VA 1DQNA 3T5GA 1NYQA 1O0BA 3A36A 1UC8A 3OLQA 2EFJA 4G8JA 1YVPA 4NBWA 3MXOA 5JDCC 3TECE 2MSLA 1TO2E 4YUYA 2AJBA 1H1TA 4Y2UA 4G86A 1G64A 3R7NA 4P4TA 4UOQA 3K05A 3DCNA 4IIDA 4M1OA 4CM9A 3CVVA 3SC6A 2F55A 4BASA 1F7UA 3SF8A 1JHYA 2BFEB 1RYEA 1V2HE 3ZN2A 2FZWA 5FXMA 4NC9A 3ASUA 1BWRA 2B3TA 4N3NA 1VMIA 4QJ5A 3FHCB 3NKVA 3S7ZA 5K0CA 2P2GA 3GCZA 3ND9A 4HWSA 4OUKX 2R6GA 3PR1A 2XAUA 4X1KB 1O6FA 5JRDS 4LYYA 3N1UA 1U8TA 4M8SA 2X1VA 2AIRA 3PCXA 4F04A 4C14A 1E2QA 2VNKA 4C0LA 4LOHA 1DJNA 3WA6A 3OX4A 4HADA 5A3SA 3QTTA 1I6LA 1PKEA 5DKFA 2EIXA 4S1OA 1BC5A 1YBMA 4FMCB 1H1DA 3OM8A 4I9UA 3W8NA 3DPIA 5KJFA 5KZMB 4OXYA 3OQNA 5AW8A 2O3TA 2PRJA 5EWLA 4RFSA 5KB3A 2E4VA 1ZJWA 4BQIA 4BJ3A 3S68A 3D6HA 1XZCA 4K6FA 1DUIA 1NN1A 4I3HA 4AUMA 1GAJA 5JY6A 2GN6A 4MV9A 1BQEA 4QATA 2JRLA 4QBTA 4JYMA 3PIDA 4FMCF 3B9RA 4Y30A 3N28A 3PHJA 4E0BA 4INAA 4EG6A 1ONPA 2ZUEA 4A73A 1ULZA 1JU3A 1A95A 2AC7A 1QRRA 2Q6LA 3G9UA 4RZHA 3RO7A 4F8YA 4JJ7A 1I4EB 3JQ7B 3ANMA 1B16A 2LP4Y 4HCJA 4C43A 3FHOA 4POOA 5GINE 1TVEA 2JHAA 1TFRA 2NU9A 3MUNA 1NJFA 3ONEA 1L4NA 3AF1A 3SR0A 1V9SA 3UT5B 1F2TB 4HMOA 4R5MA 2VA9A 4GL4A 2QN9A 4KVZA 4LG1A 2WYHA 4ZC1A 4B4UA 2JIRA 2NZWA 3DE5X 2WM8A 5FTMA 1L7XA 2HSWA 4YPFA 1Z33A 3OX3A 3VU9A 1L4HA 1S02A 1VKNA 1FRVA 3CNOA 1Y1RA 3DHWC 3ONFA 5EVCA 1V0JA 3HXOA 2JI9A 3N8DA 2B8WA 4CCYA 2WC1A 2H2DA 2F62A 1S3IA 3GBSA 2P6OA 1WHTA 4TQUS 4EMBA 1DCMA 3HA3A 1OCEA 2RAVA 1UT5A 1W0CA 3IUPA 1R5BA 3TM4A 3ZGZA 1DTWB 1H2ZA 3KQMA 4FILA 2WVAA 2CL6X 2BM8A 3WZ2A 2XD9A 1PZEA 3L0OA 4I8IA 4B85A 1YR3A 4WW0A 4ZZ0A 4JEMA 1CVIA 4KXFB 3DQZA 1BD4A 1UXKA 2QMUA 1T3ZA 4MS1A 5F3RA 4D4JA 1G8SA 1DAHA 3U44B 4S12A 4C7VA 4I1SA 4H4CA 3HM9A 1UKVY 4U7TB 1H4QA 3HWRA 3OC0A 5HF9A 2D00A 2NUPA 2PEYA 5D84A 5FLXA 1T4BA 4O1HA 3LP6A 4YS6A 3DVRX 1TECE 3KKMA 2QMZA 4KR0A 2A59A 4DT1A 3HFSA 4E5VA 5TB5A 5ESRA 4KG7A 3ITKA 3CNLA 4OO3A 3AWIA 4JJ6A 1ORVA 3CVYA 1E1QD 2WD8A 5KSZA 2NTNA 1OH6A 4YP9A 1QG2A 3IBYA 1HDCA 3BXGA 3PXCX 2GK6A 3RH0A 5BRJA 5IKXA 5AVWA 1W0JA 1ZMTA 1VHLA 1WKVA 2FGJA 4DQDA 1NXTA 3A1VA 1J0EA 3IIIA 1WVIA 3HPQA 3BMCA 3GEBA 1DMRA 4GYWA 1WZUA 3SXUB 3T5PA 2V6JA 3ZDZB 3U56A 2WF8A 3JZAA 4G5FA 3SP1A 1G9XA 2LKDA 4Q3BA 3TD9A 3UMVA 1TMGE 1YDFA 4C2TA 3L7AA 3WNZA 4YV1A 4ZMBA 2G6TA 3TR6A 5IC4A 4AY3A 2I2XB 5DV9A 4PCAA 1XDDA 3FMIA 2RARA 1ZI9A 1KTVA 2ZIWB 3OECA 2DY0A 4HKTA 4V03A 5FCDA 3GA5A 5GONB 2NVUB 3SLGA 1OJLA 2GJ8A 3L93A 3OJFA 3ZZ0A 4EPWA 3HDGA 5HKBA 1FJGB 3VH1A 5BMVB 1B41A 4BVHA 4L0CA 4Q4HA 1H8HD 4J3NA 3M2PA 4EARA 3RRJA 2O8CA 1LF5A 1IJBA 2WKWA 5GONF 2HH9A 2R11A 2Q21A 4EJSB 3KSZO 3STUA 3PTZA 1RQXA 2YJ6A 1SRRA 3SI7A 5BMVF 1XD8A 4XRRA 3HYRA 3CWZA 3PNVA 4IJUA 5DGIA 3FDJA 3DLTA 4H7PA 4I1UA 1AS0A 2A7QA 2A9PA 1JKMA 1NW7A 3AUAA 3MHPA 4QXOA 4ND7A 2XWPA 4RX1A 5CEFA 3RGWS 6NULA 3L9XA 1V7PC 1UM8A 1XA0A 5KDLA 3AINA 4C9BA 4ZJZA 2OVBA 1NI3A 4AJOA 3AHIA 3QFTA 4B4KA 4E5KA 1LRJA 1WCWA 2QN7A 3EFHA 3ND6A 2YY5A 3KU1A 1TQ6A 5CTJA 5ADWA 1U0BB 1SFRA 1JR2A 3EGXB 1PDOA 4UVEA 4XCQA 3IT0A 3WRVA 3E0XA 5CLHA 2QYTA 1P4HA 5K8IA 1G5RA 2W6MA 4CMHA 1ABFA 1E1RD 1QVZA 4V0SA 5IM5A 3MWJA 4LQLA 4ZCLA 2YXPX 3PBKA 4JP3A 3A9SA 5K6AC 1D2RA 1SOUA 3SMVA 1BFKA 5DM4A 3LT2A 4BEWA 4JEIA 4KSBA 5EMHA 2JJ2D 3D5TA 3QVWA 3GF4A 5EMMA 3ZQ6A 1M2NA 2ZULA 3ZY2A 4E2WA 3R9XB 1BVRA 1JMVA 3RNLA 1WKBA 3NG1A 4GP9A 1OMOA 4LZPA 5DEOA 1D6JA 4HDSA 3NKLA 4RD4A 2BAGA 2YFQA 3HEBA 4ZJUA 5JAPA 1RKUA 3ETCA 1EP9A 3UAXA 2BGGA 3JYOA 1D2AA 2XUZA 4QWMA 3REOA 1I3NA 2RGAA 3WKCA 3RREA 2YY7A 4TTRA 2QZSA 5T6MA 2B1GA 3P71T 5CFMA 4QOHA 3X1JA 3U4MA 3REQB 1TJYA 1UP7A 3ESBA 2B7CA 3IAS6 1JHVA 1L5HB 4N0MA 4RNDB 4ZO7A 1CUIA 5AW5A 3RKRA 1KAQA 2BTQB 2XMPA 2BFPA 3UW3A 3S81A 2AOUB 5B7NA 2FB9A 3IEKA 2ZRJA 1QRDA 3SC2B 1U0TA 4Z4FA 2NU7B 2I76A 2I1WA 1LDGA 1QF9A 2I2CA 3G3EA 2X22A 3GRFA 3LXMA 2JIZA 4ZVNA 4D6XA 5LWQA 2FXVA 1FIUA 4AK9A 1BGVA 3WKEA 1CLEA 3BE4A 1MJFA 3K8QA 1DPGA 4L51A 3R3JA 2OL4A 4GR4A 4XUDA 2Q4RA 1XJCA 2RGBA 2PSEA 3A3NA 1MEEA 1Y5RA 3FFAA 2DBRA 3G2IA 4UM7A 5K0NA 1MCZA 4HH4A 1EUDB 4N1AA 2UUPA 3VO8A 5JAHA 1VP9A 3D2CA 4YJ2B 2IDJA 1R4ZA 1PLLA 1KQOA 4OV6B 4Y2PA 1IB0A 4FHZA 4BGIA 3ZIAA 3IJEB 5A9SA 3BDVA 1CT9A 1NIJA 3HM2A 3SR4A 5IYZF 4EMSA 5HJ7A 3ZBQA 2VHEA 5GZ3A 5CFQA 2DF8A 4O25A 4DV2B 3RUPA 3FTCA 4M38A 2YJNA 1NR5A 4YJ2F 3KHTA 3WLJA 3I6BA 3ZY6A 3KFVA 1SCBA 4KMMA 4A23A 4CTNA 1RI3A 4BNDA 4FFRA 4QQNA 2K6GA 4XW2A 1LFAA 3JRWA 2CLSA 1OX4A 2BUAA 5KWIA 4B84A 2K7FA 5G4KA 2I9PA 4ZQCB 4EX6A 1JSZA 3MT9A 4LHEA 1CVRA 4PIPA 4TXMA 3EHEA 5E1MA 1PT5A 1KPHA 2WIAA 5C8YA 1T6YA 3OZVA 4JU9A 4UMEA 5G1OA 2QQ5A 3D3WB 2A5LA 1ZCJA 2I1VB 4NCNA 5ALOA 1IBKB 4HDMA 2C7GA 2Q4BA 1RRFA 3OZEA 1J0AA 5DNEA 3SCZA 3SJZA 1SR8A 4GPZA 2RMKA 1UXOA 2GYYA 2ZE8A 3QI7A 1E3DA 1FSSA 2NV2B 4P7JA 4V02A 1LRLA 3W2IA 2C99A 4W7HA 2FOLA 3ZHBA 3DBLB 3RSLA 3U9TA 1YDMA 1LPPA 2WICA 2YR0A 1HSOA 4REQB 1Z8FA 2GWHA 2VPPA 4F9FA 2FE4A 2JIPA 3G79A 2OG1A 1S2NA 1Y3IA 3R20A 3L4SO 5TPWA 1WHSA 3V8EA 2HEGA 4WX2B 3WLQA 1MVOA 4Q9AA 1YD7A 3GN2A 4DJAA 2JBWA 3SQLA 1G3QA 1R50A 5B64A 2O59A 3AVPA 1CUYA 1CY7A 1FFAA 3EY4A 4GC5A 2XCIA 3DMGA 2AK3A 4RSMA 2ZJFA 4ZYUA 1Z7BA 1CNEA 2JASA 3A58B 3STXA 1YK1A 1TZCA 4I50B 5DHRA 1LTHR 2ORIA 4EHBA 1DIRA 3WWCA 1SUEA 2CNWA 2PE5A 4C4XA 2J4FA 2WZDA 2JK1A 2XDQA 2X8JA 3PKJA 5F12A 3I6IA 5KQRA 1I3LA 2BEKA 1PR5A 4JOCA 1PX2A 1TM2A 1RFGE 1ZFNA 2RI6A 3GXBA 3VR5A 4Z49A 4O08A 3UK7A 3MNFA 4I50F 2ECFA 4YNBA 1WB5A 1IQPA 5EKXA 5FT9A 2XH8A 3CO5A 4DLXA 1A88A 2YYZA 3DCIA 2HK6A 4OJNA 4V2UA 4AAYA 1DLJA 3KWJA 3UHPA 3KX2A 3FZQA 4LSZA 1GUDA 1AMUA 1P8JA 3IUEA 1ISGA 1D2HA 1MV5A 2ZROA 3INGA 3AVVA 4QEDA 2DVMA 4LBZA 3FYCA 3HRHA 2WSBA 3Q0TA 4FCVA 4TTTS 3TBHA 2CL0X 3LUKA 2MYTA 1ODKA 2HA3A 3HGMA 1W85B 3B85A 1E9AA 3PNBA 3ST7A 1ACJA 3Q88A 3T94A 2IPAB 3B9BA 3CRQA 4XYEA 4AIIA 5ICMA 2G7ZA 2JIMA 2MSNA 1RJFA 3K96A 2EC5A 3D8BA 1K06A 2VPIA 3E9MA 1UP6A 4S2UA 5ER6A 3UXYA 4DSOA 1H5QA 1ORHA 3OCWA 2J30A 2QTZA 3N0RA 1XE3A 2OILA 3N7UA 3S2FA 4EUHA 3C5CA 4ON9A 1N8KA 3K3PA 3I1FA 3ZHVA 3L6BA 2I1LA 3AP2A 1H9AA 1KDPA 2NSLA 2YOHA 4C87A 5F9FA 5AKHA 4L8FA 1UBUS 2XZLA 1JA1A 4YO7A 3SSOA 2HA6A 3OCXA 1CXZA 3F71A 2M2IA 1R0ZA 1ZRHA 4TMXA 4YACA 4UUMA 4BKPA 3EZGA 5JC8A 1NVBA 1MZPA 2GZHA 4OHPA 1V39A 2HNKA 1JAZA 4DSAA 2AUMA 2JGJA 5IFKA 1G1MA 3KVVA 3HMQA 3TZ6A 4B3MB 4IV0A 4IMRA 1E18A 3PHBE 3QFFA 4JBNA 4P36A 4ZN6A 1N5OX 3TPZA 3CSDA 5ALMA 4BP1A 3T3DA 4RTRA 1TMKA 3ZJYA 1AZWA 3QU7A 1PG0A 2JAOA 4AJPA 1TK2A 2QTFA 3G02A 3WIVA 5TQJA 2IZOA 2X4LA 3OKPA 5IW8A 1W581 1YRAA 2PYZA 3M4NA 4Y8VA 3FYUC 4ZIRA 1PI3A 2PMCA 1ZH0A 3R8FA 1P33A 2QUIA 5KWSA 5A1TA 2K7ZA 3BRWA 4OJQA 4G5OA 3TSOA 2E4ZA 3M6XA 2C2OA 2LUOA 2NGRA 3KPWA 4Z7JA 2R86A 4RTLA 1MA3A 5JSYA 3N8NA 4G23A 4QUGA 1D8AA 3KSMA 3HKBA 5G3YA 3TSZA 3IDOA 3MT0A 3GWGA 2JAUA 1KQNA 3EXHB 3S6JA 2ONYA 3T4UA 3UZUA 5CD1A 2Z08A 5E9WA 2QXYA 3NHJA 4J16A 4EA9A 1JIQA 5E38A 4DIKA 4TL8A 5EHQA 4WJLA 2VH2A 1YR9A 4A9AA 4DWWA 2XGGA 4MRPA 1Q2UA 1ECBA 1KAEA 5C32A 5JNWA 3E8XA 3VAZA 2YOFA 5ALTA 3PGJA 4IWNA 2J33A 3ROTA 2RBEA 5CEJA 4KQKA 4H1TA 1M6YA 4Y1RB 4KOAA 3PEVA 4MWTA 5J47A 3R5TA 4AF8A 1U1CA 3Q2KA 4KFRA 1RM5A 2W58A 5IHPA 3M6AA 1WY7A 4JLUA 1E1KA 2J4CA 4IVQA 1N57A 3PKIA 4WBXC 4PS0A 5KQSA 3JYHA 1V2GA 3ONVA 5AVJA 3NGMA 1QANA 2W6NA 4NLLA 2XWBF 3WQQA 1Q11A 4I5IA 3IODA 2FSFA 1C1XA 3DF9A 4J1TA 3FR8A 4B6QA 5KYWA 3VYRB 5KEIA 3MWEB 1L6IA 3EMBA 2C8KA 3FI0A 3K9HA 3L04A 1ZZEA 2PX3A 3KT0A 3NATA 4G85A 1ADFA 3BWEA 5DJ5A 3S4YA 2C9BA 2G5PA 4O2LA 4RELA 5KOHB 1G42A 5KVAA 2XMDA 2A30A 3RNOA 3QPWA 2PVPA 4LDQA 3WVNA 1O58A 3VDXA 4DUPA 1PNQA 4TSRA 2PXCA 2LNDA 4JP8A 2UZAA 1BXRB 3EPHA 3DXZA 3QUQA 4RA6A 3G6WA 4U02A 1I4WA 5EZ5A 3A28A 3R76A 2WWTA 1P5RA 1CR2A 1PR2A 1U0OC 2A1UA 3L0PA 2QM3A 4FMBB 5C18A 3K8ZA 3ZXYA 3KZNA 1QIJA 2B7BA 1UBFA 2I8LA 4HYQA 1QG4A 5C46F 3H9GA 3IQFA 1JLLB 4YR7A 1MR3F 1RZRA 2VTDA 1E1YA 1JI3A 3CUSA 1CJBA 3GLFB 1X8JA 1I6KA 4UUQA 1IHDA 4J90A 2ZQ5A 4FYKA 1TUBB 1GKLA 1VYHA 1DAEA 2GAOA 3U1TA 1UZLA 3B3JA 3VYUB 3C8DA 3HCFA 1E5XA 3TK1A 3JATB 5B3LA 3GDGA 3K0KA 3IE0A 3CPHA 1XEXA 1M34E 1KIFA 3E35A 4RV9A 4JYZA 4KU4A 5JWHA 2CFTA 1H2XA 2IIVA 3TLXA 3BHJA 2E0IA 4XGIA 1JB9A 2Z30A 1NUTA 3CW2A 5IZCC 1Z6PA 5JHGB 3OHPA 3T95A 2CCGA 2WPDA 3HY3A 4Q3LA 4RTQA 3IBSA 1CR4A 2YHIB 3AVUA 5HRUA 1RLTA 2QX8A 4D8YA 1NZJA 3GG2A 2ZIAA 2QY9A 4KXUA 1PNOA 1VXRA 3B2NA 4HJXA 5LA6B 1Z07A 4MCIA 3ZVKA 4A8PA 1EX6A 2QM8A 5EJ8A 5LNK6 3GRZA 3DBHA 3CZMA 3BZUA 5HCNA 1GOTA 3K1JA 1E3JA 2JVIA 3NFRA 2J9XB 4K2HA 4Q7KA 4G1UC 4F46A 1EMDA 1FFXB 3AR9A 5KHAA 4HNQA 1QKKA 2IEGA 1M2OB 4UREA 3AEKB 4C7OB 5JISA 1N5LA 4BVKA 1ISMA 5EFZA 4HDRB 2QLTA 2SCUA 3HHEA 4IDCA 5LA6F 4TXLA 2ZATA 3W3ZB 3MLEA 4AKTA 1EBUA 5DTMA 3W7BA 1YVEI 2ZBVA 3E81A 3QEMB 5F1OA 1AA6A 3D8TA 4QYMA 3WL5A 5GGYA 4S05A 4Q05A 4KPUA 3K0SA 2BHSA 3SJAA 3MG9A 1MTZA 1R5OA 2G88A 1MF7A 3GUZA 4JR0A 4Q7JB 3GNSA 2PWAA 1U0RA 3EVNA 4RD0A 1NJ5A 3SFTA 3BWMA 4BZWA 4ED9A 3ORYA 1M5RA 2VEDA 2Z04A 3CNBA 1KEVA 3D3JA 3QOFA 4L08A 4M53A 3T06B 3TQOA 4NABA 3ZC3A 4P4SA 3ZE2B 5U1PA 4NBNA 1ZOSA 4R2MA 4MUIA 4KR6A 5K0TA 2BC9A 3QVGA 4I9NA 1V5FA 2P8JA 4ZEOA 4BPRA 4KO3S 1UJMA 4Z4EA 1T8TA 4MQ5A 3AUXA 4QXQA 3ZXXA 2YWCA 3E9NA 4NG5A 3GGPA 3TBKA 6Q21A 1U5BA 4X44A 5JH7A 3ABQB 3IP9A 3P2IA 4MW2A 3UVEA 5F2KA 3N39C 3B53X 3GRAA 2VSFA 4V39A 5HTKA 2GCGA 1EVIA 3H8JA 2B2CA 1LNQA 1J2YA 3MGKA 5FYDA 4JUCA 1EA7A 1U8AA 1ZINA 5DM70 2V7WA 3AC0A 4CM3A 3UQYS 3OPVA 1QYXA 3QWHA 2FE1A 2HUNA 4L6IA 3RR2A 2FMXA 4N6GA 1E3QA 1GJRA 2IS1A 2XWJI 4YRPA 1C0LA 1II8B 1JAIA 2FMKA 5DXFA 2VNIA 3RU9A 1Y81A 2B5OA 3DL7A 2O4CA 2DPLA 3WL6A 4DIBA 4JYPA 3S1AB 5BR8B 5TC4A 3FCOA 1Q1AA 4BE4A 2QUHA 3ZE7A 1UDCA 2R5WA 2VYVA 2P77A 4W4TA 3FVTA 3DO8A 2FR8C 2HSJA 1IOWA 3T34A 1HQYE 4RCZA 4MQLA 3KTDA 1CQZA 3UYKA 2ODWA 3QELA 3ZDFA 5KNBD 3D6JA 1P2UA 4N01A 1M7HA 1X2EA 4YV2A 1YZUA 2OMKA 1W49A 3OKCA 4H7IA 3BXZA 2A78A 1BGXT 2ATVA 4EFKA 1JQ3A 2GNOA 3DFFA 7ABPA 1X7XB 2AX3A 4F5WA 1M54A 2D2VA 3JSXA 4Q9LA 1DO0A 5FEUA 1MXHA 4IWXA 3Q3VA 3KXIA 1QK3A 1RJ9A 3C7KA 3UXEA 4US0R 1OFUX 3BILA 3LFUA 3F47A 1HZZC 5CHEA 3RF7A 2JGDA 2C92A 2HLDA 2V96A 3LDGA 4JY7A 3EAFA 3QW4B 4LQCA 4GP6A 4MHOA 4QU9A 4F12A 4J7AA 4AMZA 1WIWA 4R05A 3DWFA 3T7CA 2OHXA 4DRZA 3H1AA 2I6SA 1FYXA 3KFLA 3ND5A 1R6VA 3A1NA 4IP0A 4QUAA 4WDRA 4PS1A 2CXUA 3AJAA 4RORA 5AVKA 2VRBA 4DHWA 1I8TA 1AJEA 3QE3A 4CCSA 1NASA 3L7DA 3EVEA 2P9ZA 5D00A 5HILA 2PZJA 3RODA 3L1KA 2XYGA 3ZD8A 4ZI2A 4MB6A 5KYGA 1JXQA 4Z0PA 4FFNA 1VE5A 1MQSA 5FQOA 2V5AA 4IL5A 4A7PA 5CLJA 1V35A 1B8NA 2FPIB 4YALA 2PUAA 1NRXA 2GX6A 1M9NA 2OB1A 4MVCA 4OHFA 5EZ6B 3CH4B 5TVGA 3X44A 4BXOB 1JAYA 1FA9A 5FNVF 4NOKA 5AW7A 4AMUA 1WLYA 4TSKA 4M60A 1D7OA 3HJAA 1E6LA 5EE0A 3OQPA 2EW8A 2JFXA 3WC4A 2P6PA 1LNZA 1NG1A 2BJVA 2EBUA 2H1WA 3NC0C 3PVZA 4HLCA 1SVMA 4QDXA 4QNNA 2P6MA 4BZXA 1XQ9A 4CM4A 4JJ8A 1BDIA 2GN0A 3PFWO 1YRYE 3A8TA 2HFJA 3LUAA 4UTOA 1FQWA 4NXMB 3TSYA 2YZGA 3G8YA 3RIMA 3W34A 4R1UA 3ZE1B 2GLTA 5CBPA 1JU4A 1YE5A 3WLNA 3TNLA 1SIUA 1PL0A 2VYNA 2WYUA 4O8ZA 3WO1A 3Q3JB 4HUJA 1P60A 3N2IA 3BA1A 1JA9A 1V43A 5BR1A 1LBTA 1S1CA 4L28A 3GMDA 3CURA 6LDHA 1AUVA 2BJWA 4KN5A 3JPWA 1GR0A 4GU5A 2XQFA 1V3UA 2Q3CA 3ASYA 2GETA 1Y4ZA 2NXEA 1EBBA 1CEXA 1DAOA 3BM5A 3FUWA 3LT1A 1BCSA 3MBOA 3P32A 1NMEA 2DECA 5EINA 1OYWA 3SQNA 5J58A 3BZWA 3K0EA 2GEBA 5M3BA 1IUPA 1JH8A 3OZTA 2XF2A 4I81A 1H0RA 1E4YA 3D8UA 4L5JA 4O4IB 4D9EA 2BYTA 2GN9A 5DGTA 4P92A 2HJVA 4GDFA 3M1LA 1O77A 4PV7A 3RVPA 4PFKA 3O2SB 4CMEA 1G8AA 2JZNA 1Q0RA 2M9MA 2WIFA 2WILA 2NXJA 1ZU5A 3AEQB 4J0GA 5H02A 1ZMXA 5H7XA 4DOMA 4MPRA 2ZOSA 4HBZA 3GIWA 3WNBA 4IS2A 1X80A 1X3SA 4L3OA 5ALQA 7MHTA 1HBJA 2DM6A 3DJFA 1ZMBA 2P2DA 3W9YA 3ZWXA 5A5GA 2BMDA 3KT8A 2ZXUA 3I9MA 1JB1A 3EDRA 3LK6A 1CWUA 2GRJA 1C9KA 1CUXA 1RPTA 2P3LA 4LQ4A 4LXIA 2WNSA 1O95D 3FSJX 3WQRA 4ALLA 4C5CA 1SPBS 2DE0X 3PIIA 2J5BA 4N5LA 1X0VA 2BRUA 3WTCA 2V0GA 1G9TA 2HBZA 2GPTA 4RHEA 3S55A 3ISVA 4DRXB 3PC8A 4UD2A 1Y1LA 4F86A 2P9CA 3DXFA 3V8QA 2R6HA 2VZ9A 5G41A 1HDYA 4G2NA 3O8OB 3NTQA 1MD9A 4OI4A 4D80A 3KTAB 3GFFA 1N77A 2JEOA 1R2QA 2YIJA 3ZHZA 1VG9B 4IIYA 5CRIA 5LZ8A 1TLLA 3HGQA 1YV9A 5HDQA 2OD2A 3DNPA 1SAYA 4OX9Y 1QPGA 1QOPB 3IEXA 1SH7A 4GLOA 3OOWA 4D92A 4HNRA 1G17A 5BOSA 3AL2A 4ZAWA 1RBYA 2R6R1 2PL3A 3LYAA 5CB8A 4H6WA 5FI5A 3D43A 2QUJA 1AO3A 3LCRA 1R0XA 5JNUA 5LP6C 3BE6A 3UJ7A 1L7QA 2Z8YM 1LLUA 3HY4A 2BCGY 4AWXA 5C51B 4L5YA 3OBIA 1IXZA 1VG0B 1ZK2A 3ANSA 3IS3A 4HDCA 2YFHA 1DO2A 4LYEA 1RHKA 2OSBA 4R7TA 4F9TA 1G38A 1RMQA 1B74A 3COWA 5TQVA 2X8WA 1OFTA 1RXWA 1QKIA 4ENWA 4JSTA 1PUIA 4OBBA 1S4QA 1KMMA 2RG1A 2JHPA 5AM0A 1AUPA 1GG5A 1R9MA 4KIJA 5AK6A 2COUA 2Q28A 2J5KA 4B3JA 1NVXQ 1PK7A 3UC5A 2WF6A 4ZOLA 1E32A 1SQSA 2QN8A 2V5VA 5H70A 5FD8A 3VR4H 2J5RA 4BCDA 4OMFG 5AK3A 3UJCA 2I03A 5KYXA 4QG7A 4IOJA 3KSRA 3V34A 1FFHA 4WGFA 3G2KA 4KGXA 1N5IA 4NL4H 1A5TA 3DW1X 5ITSA 1YOBA 2VJOA 3H18A 3AOEA 4A0QA 5IAEA 1JI0A 4EG1A 1KK2A 4M7RA 1VIAA 4JENA 1U81A 4IRXA 1ZIPA 4IGKA 2EZ9A 5CYFA 4I2NA 4JOQA 4YB8A 3RADC 1D0VA 4M3NA 1Y8AA 4M7OA 4BFSA 2C2MA 2ORVA 3U4GA 3WYDA 3GQBA 1IHXA 3D4IA 1U3TA 4DQUA 3KPJA 4MUBA 4XPIB 4QO7A 3ZWMA 1I7QB 1KE1A 1N6IA 2Y67A 4F96A 3TJMA 5HUJA 4KN8A 1UMBB 4LV6A 4BRZA 4GT1A 2GKOA 4LZAA 1GV1A 1GUAA 3PCTA 4OKNA 2Z5VA 4V1CB 1G2OA 2JFVA 1QF6A 2HL6A 4TKLA 1X8XA 3GAAA 1S3FA 2AD1A 2YXBA 2DFKB 3BFPA 4YEDA 2EGUA 2IOHA 1Z06A 3ZK8A 4N54A 1Q7BA 1PG5A 1MO4A 5KQPA 1KI7A 1UPBA 3RD5A 4EW1A 2WFMA 3OIYA 3MD9A 3AETA 1NR1A 2JZOA 4IXNA 4EUKA 3PLAE 3EDMA 3UGKA 4J6FA 3DZIA 2YV1A 2AFHA 5GWXA 3NFYA 4E1BA 3DEZA 4IMJB 4EA7A 4IEIA 5CCXA 2OFOA 2VDOB 1AV6A 2R6AA 3MUFA 2CLLB 1Y9JA 4EA6A 3OY7A 5FAKA 4JVLA 3ODPA 4AY5A 1XLVA 1TJ3A 2QT0A 3O9MA 4Z0NA 4ASUA 2DX7A 2IIBA 3GMIA 3C98A 3H87A 4K9MA 1W35A 3RFUA 5B3KA 2H2GA 1D4FA 4M55A 1ZX1A 2HADA 1HE1C 1EP3B 1OD6A 3ZK9A 5A02A 1E3MA 1ZCBA 4BNNA 4PYQA 2VSQA 1IU9A 3ERCA 3WGTA 2E5FA 4CHTA 1T8SA 3QF4A