2QQ5A

Crystal structure of human sdr family member 1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
238
Chain Sequence
APMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dehydrogenase/reductase SDR family member 1
publication title Crystal structure of human SDR family member 1.
rcsb
source organism Homo sapiens
total genus 88
structure length 238
sequence length 260
ec nomenclature ec 1.1.-.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qq5A00
2O4UX 3M2PA 5EJ2A 4QFCA 3JQ9C 4QQRA 1O5IA 1WDKA 2EXXA 5A3VA 1MC5A 3P5SA 2VRBA 4YBZA 3KYDB 1VLLA 3E03A 3GHYA 1QSGA 2NTNA 5U4QA 4BNLA 1EDOA 2HO5A 5EERA 4BNFA 3OQBA 5JY6A 1GEGA 3S1LA 1T24A 3TPCA 1ONOA 3FBTA 4J2OA 3RBXA 5A4DA 1BW9A 2OBNA 1A4UA 2SCUA 3S55A 4K6FA 3M2TA 1PGPA 4TZTA 1DRVA 4CMAA 4XQGA 4CLOB 4D0SA 2D2IA 2Y0CA 1G0OA 3QWIA 3VKUA 3E6AA 2VWHA 3EVTA 3VVBA 5ICSA 4J1SA 1QV7A 2HK8A 2D5CA 4E32A 4CMGA 1PS8A 4YDRA 3INTA 3MCVA 4IXTA 5ER9A 5I7FA 3F46A 3TF5A 3H3JA 3BMNA 3Q1LA 4XEHA 2JD0A 4FC7A 1YH3A 2VZ9A 3AOEC 4FGWA 1Y8QB 3ROQA 1I33A 1LRJA 4IIVA 2WYUA 4GWGA 1YVEI 3HFGA 5AXDA 1DB3A 2BI8A 3B1KA 1X7GA 2NTJA 1E1LA 2W2KA 3BMOA 4M87A 4BGUA 1NFRA 4LRTB 4D0RA 1LLDA 2JHGA 3WFJA 4YR9A 3GC6A 3RAJA 3AI2A 4J7CA 3OEWA 2I76A 1P74A 3SEFA 1KVUA 2ZTLA 2Y67A 3PWZA 1E6WA 3ZV5A 4J16A 4R9SA 2DM6A 3GY0A 3W1VA 3RC7A 1KBZA 4E5YA 1UJMA 2W2LA 4OXKA 1HYEA 2E48A 4PG5A 4IGEA 3OSUA 4WLOA 4BV9A 2IZZA 2D1YA 3H5RA 2V6FA 2JAHA 3GHHA 1E3LA 3V2GA 1PWXA 1ZW1A 2VWQA 2FPIA 3ONFA 3F1KA 3DAFA 3OBBA 3U4IA 4EITA 1IYZA 4CLEA 3KTDA 1QR6A 5JC8A 4JP2A 3CTMA 4BNTA 3L6DA 3D1LA 1WDMA 3I9KA 4HFJA 3KB6A 4LSMA 4H16A 3MWEB 4FFMA 1ZBQA 1UXJA 4ZQFA 2D5AA 2NM0A 4K9DA 4TWRA 2A35A 4EBFA 4ND2A 1ENYA 1PGJA 4JJGA 1UDCA 2WWRA 1L7EA 3Q9NA 1JDJA 4BQRA 4ND1A 2ZTMA 2IYPA 1LSSA 1PJTA 4TRJA 1HDZA 2HMWA 1T2CA 3C1TA 1CIVA 3HSKA 2PH5A 3JD1A 3DMYA 5TJ9A 3PYLA 4ZQGA 1ZKMA 4IJUA 3R1IA 3WBBA 4W6ZA 3BMOB 3OECA 3JYNA 1D1SA 5JCJA 3GN1A 2P9CA 4N7RA 3WB9A 1G1AA 4BKRA 3CEAA 2AE1A 2D4AA 5GY7A 1A9ZA 2DTXA 3DFUA 2NVBA 4D3FA 1GCUA 3HQ4O 5COQA 2FZWA 1ZIDA 4JP3A 2J3IA 1I3NA 1XGKA 2C0CA 1KIFA 3MOGA 3JD2A 4WCFA 4FFNA 3PDJA 1QKIA 1TT5B 4JGBA 4XGKA 5L7TA 3LT1A 4ZA2A 1PL7A 1WMBA 5K9ZA 1YGYA 5CEJA 2QZZA 1YONA 3AJRA 5G0UA 1I24A 3W6ZA 3ZH2A 1Y5RA 1K3TA 4YA6A 2OL4A 4YQYA 3DZIA 4BNGA 3S2GA 3JQ9A 1U8XX 1X0VA 4WK6A 3G79A 4E31A 1C1DA 4Z0HO 5FEUA 5AXCA 4II3A 3HUDA 1IB6A 1NQTA 4HKTA 4DC0A 3ZI0A 3E48A 4KOAA 1MXHA 2P68A 3OM9A 2J8ZA 2Q2WA 3U4HA 3DBLB 4NU5A 2UUOA 3UICA 2O3TA 2W8ZA 2CMDA 1ARZA 2DPHA 2JFFA 3LT4A 5ENDA 1J5PA 2ZCUA 3WG9A 2AA3A 3X2EA 5IDWA 2NU9A 4RVSA 1KY4A 4YJGB 4D7AA 3LK7A 4HX5A 1U4OA 4K26A 4YAIA 4OL9A 3T4XA 4DA9A 3MWDB 1SOVA 4UREA 1DIAA 4XX0A 1NXQA 1K0UA 1XWFA 4IS2A 2HJSA 5LDGA 1Q7CA 2EP5A 3KYBA 1DRWA 4DYVA 3VZSA 5DCWA 4CV0A 4WLFA 2OZPA 3AOEA 3R3SA 4UUPA 3WTBA 1Z7EA 1R37A 1U28A 3MJCA 4IBOA 4DPKA 4XR9A 4S1VA 3HE3A 2V6MA 1BTOA 3IKTA 1ENPA 3QJ5A 3INRA 3KSDO 5C7LO 1Z6ZA 5HS6A 2E4AA 4IJWA 1Y9AA 1WVGA 3L0DA 3JQBC 2ZB7A 3E8XA 4KWHA 1PS9A 1CWUA 4WASA 4L4XA 4YT5A 1JVSA 1DC5A 2NVUA 3DZHA 5A02A 3GNQA 1OOEA 4FR5A 4NIMA 5IZCC 5L7WA 4HNGA 4BNYA 1NASA 1H6DA 1I30A 1I32A 3VAZA 2X4GA 4A73A 2BFPA 1MC4A 1QV6A 1WW8A 4ALIA 3IUSA 2LDBA 3S8MA 1W4ZA 1LRLA 4NFSA 3MJ4A 1M76A 2GZ1A 3AW9A 1E5QA 1HKUA 1C0KA 3NJ4A 1NPTO 1TI7A 1F8GA 3DHEA 3PJDA 4U5QA 1F0YA 5A06A 3WMXA 3WICA 3BHIA 5K0ZA 3JD3A 4OKNA 3SLKA 4DPMA 3F5SA 4Y6PA 3ANNA 1O89A 1EMDA 3HDQA 4FBGA 1MP0A 4MJLA 3D5TA 5DCUA 5IXSA 1Y8RA 1YRLA 4P4GA 4IQGA 2BF7A 3ZW9A 4MPDA 1E1NA 2YFHA 4IS3A 4RL6A 3AI1A 1S6YA 3K73O 3KSUA 2UAGA 1BRMA 4BO8A 3GEDA 1GL3A 3Q11A 3VKVA 2JL1A 3AUSA 1T4DA 4WEOA 4EUHA 2PWZA 4OGWA 3JQCA 3ZNQA 1F12A 2QHXA 1F06A 3PLNA 5JY1A 3TL3A 4CL3A 1U9JA 2C5AA 1P44A 2PGJA 4K1LA 3U49A 4BKQA 4PN3A 4BO9A 3HJAA 4JLWA 1OFGA 5L4SA 3G0OA 3B1JA 5EQFA 4XJSA 2Y1DA 4Y98A 4Z9XA 5G0VA 4BKUA 4PVCA 5DNAA 3NDJA 3IKVA 4YJDA 5CPBA 4EZBA 3UCXA 5DBIA 3HNPA 3V2HA 1KYQA 4IPTA 4B4WA 1HEUA 4K28A 4RJTA 5MGBA 2IE0A 2C7GA 4YXFA 2F1KA 4G65A 1GTMA 4O59O 3IP1A 5L4NA 1HDRA 5BNFA 1VM6A 1Q7GA 3NTQA 4NNJA 4K6CA 4A03A 3O03A 2C5EA 3ZWOA 2IODA 1PJQA 4I1IA 2FPGA 3WGZA 6ADHA 3K92A 3GVXA 1K6XA 5IN4A 1PQUA 1PL6A 3EZYA 4BL5A 4CMBA 4R1NA 1H5QA 2TMGA 3ABIA 1P1RA 1JQBA 4JBIA 3H8VA 3FD8A 1Z74A 4RPJA 4AJ4A 5KJCA 1TEHA 1PJ3A 4CQMB 1MFZA 5CG1A 3JQ6A 1SEVA 4NFYA 3EY4A 4Q3CA 5KJ6A 4AJEA 1P77A 2VTDA 1D8AA 4OOFA 4AJNA 4EYEA 1P1HA 4BO3A 3DHYA 3H5NA 3I6IA 4WEQA 4OHUA 3WYEA 3STHA 4CUZA 4CMIB 5A9SB 3VDQA 3C7CB 3O8QB 1PX0A 1PZGA 4YPOA 4CM3A 3A1NA 2FR8A 3RUEA 4J6FA 3H9QA 1NVTA 3DWFA 3OA0A 3FNFA 1PGOA 4J9VA 4E5NA 4CM4B 1AE1A 4NU6A 1ENZA 4GX1A 2VCYA 3FNGA 1H6BA 1YDWA 2CFCA 4OKIA 2NACA 4MVJH 4LN1A 3RVDA 5A5EA 4DIOA 1C3VA 1GADO 1D1TA 4L73A 4YCAA 1I0ZA 4MO2A 1WWKA 3GZ4A 4NI5A 3EK2A 2EHDA 5EPOA 1GU7A 2EF1A 3JQBA 4FOSA 3KYCB 1E3WB 4LCEA 4O6VA 4CUJA 4HUJA 3G17A 4HADA 1LSOA 3OH8A 5TQVA 3NGLA 5BSFA 2V6GA 4HFNA 1L1FA 3VOSA 5IZCA 1NNUA 4W99A 2B0JA 3D4OA 1UXHA 3LF1A 4CM9A 3I1JA 4L4RA 3D4PA 4XQEA 3RFXA 5A9RA 1IY8A 2XF8A 4L9RA 1YBVA 1UP7A 5I8WA 5GZ6A 3FWZA 4BGEA 4D45A 2P5YA 3PLRA 2CDCA 3WFIA 3AM3A 4E30A 1KVQA 1XSEA 1U2DA 4MDHA 3GNSA 4NBRA 2GN8A 1PTJA 1ZH8A 3QW2A 4B4OA 5CDUA 2DBRA 1N9GB 1X0XA 5HWSA 2EP7A 1HF3A 4J43A 3KBOA 4E0BA 4U0KA 1YS4A 1ZFNA 4QXMA 1XIVA 1TVEA 3U9LA 2YHUA 2VHYA 1E7RA 1HE4A 1QYWA 1NPDA 1Q7BA 4DRYA 3BTOA 4AJJA 2FR1A 4IDFA 4RO0A 1LUAA 4GSLA 2CDBA 2PV7A 3MTGA 4U0JA 1QYVA 4XDZA 3DBRA 2B83A 3F9IA 3UHAA 3WQSB 5B4TA 1KERA 4AJ2A 3FPCA 2EKPA 1F14A 1VJTA 3NUGA 3UN1A 4B3HA 4ZGWA 1DSSG 4E2ZA 3O38A 2WDZA 1WXDA 3AY7A 3KEQA 1DXYA 1NP3A 2HU2A 2X6TA 4J2HA 3RUIA 2GCGA 3PHHA 3F6YA 1HXHA 1WPQA 4NQZA 4PVDA 3I4CA 2B35A 2Q1TA 1EQUA 3ULKA 2AQIA 1I01A 2C59A 1HT0A 3OJLA 4YVFA 4IJKA 1XELA 2JAPA 2Q49A 4ZD6A 1KEWA 3KM0A 4URFA 3H2SA 1T1RA 2UUPA 1PSDA 2QRKA 3G1UA 4IINA 1ISGA 1HE5A 4YB8A 4B7CA 1R0SA 5CDSA 1WNTA 2OHXA 1EFLA 1PJLA 4YJFA 4CLRA 1B2LA 4FFOA 2DTEA 1DC6A 1GZ6A 1UUFA 1K5HA 3I83A 4KUHA 2GASA 1PJCA 4N54A 3LLSA 4BNIA 1TXGA 4DC1A 3SC4A 1LJ8A 3M1LA 2NQTA 1T2EA 4INAA 2RH4A 4IQ8A 1XEAA 3F3SA 3RD5A 4HXYA 5B37A 2C2YA 1ULSA 3QP9A 1YB1A 1B3BA 3NRCA 3CPSA 2X7HA 2Q1UA 4D41A 1AN9A 3CMCO 1J49A 5H82A 3E9NA 4PLHA 4UULA 4MKRA 4R3NA 1JN0A 4ITUA 4YAEA 4YYZA 2WD8A 3WSVA 2HMTA 1Z45A 2WMDA 4IMRA 1TA4A 1ZK4A 4FJ2A 3BMCB 2YW9A 2PD3A 4RQTA 3PK0A 3PQFA 4ALMA 2O2SA 4RQUA 5AVOA 3JQAA 3PGXA 3WGTA 1PL8A 2QYTA 3PHLA 1GPDG 3W8EA 2EERA 1E7QA 4FJ1A 1IHXA 4M86A 4NJOA 4BNNA 4ESOA 3AU8A 5COAA 3WIDA 1R0KA 3UFXA 2P4HX 4KMSA 1W6UA 4O0LA 1B0AA 1N1GA 1B16A 5FFFA 3DXFA 4YJFB 5EQDA 4M1QA 4BGVA 1EBFA 1HDGO 4QFDA 3S2EA 7ADHA 5IG2A 4A10A 2GN9A 4Q3BA 3UCFA 1C0IA 1C1XA 1N8KA 4AJOA 5IDXA 1UAYA 4TSKA 5AOVA 5CG2A 5F5LA 4WLVA 5G4KB 1E1MA 4CM7A 2ZK7A 4IJVA 4E13A 4PLFA 3DQPA 4YRAA 3ASVA 2C29D 1RYDA 3RSHA 2O3RA 3LF2A 4H3VA 1XCBA 3JSAA 3OJFA 1DAOA 1HDYA 1D4FA 3CIFA 3VVCA 4KZPA 4CMJA 1B7GO 4GL4A 1N5DA 5B4UA 4IDCA 2V6BA 4EGFA 3GN2A 1U7TA 2Q3EA 4CLOA 3GQVA 1QXSA 4WLNA 1VKNA 5KJEA 3PYMA 2X9NA 4OQYA 3N74A 5H83A 3QVXA 4ND5A 3VZPA 1QYXA 4GX0A 1ZXLA 2NTVA 5A03A 4E3ZA 3WNQA 1HZZA 1VSUA 5JW6A 5DOVA 1I36A 3DDNA 1U2GA 3D3WB 3SVTA 1Y8QA 4GSKA 4MVJD 2EKQA 2VUSA 5F1OA 3RBVA 3L6OO 3MZ0A 1P45A 1CERA 3N58A 1U1IA 5I7SA 4PGFA 1Q1NA 4WPGA 4UAGA 4I5DA 1EVYA 5BNTA 4FDAA 3P19A 3GOHA 1ZXBA 2DKNA 3ZV3A 5B1YA 2GUGA 2E49A 3DMTC 1YB5A 3AUTA 3EC7A 4E6PA 2QIOA 4E12A 1C1XB 2AQ8A 4PRLA 4CMHA 3HN7A 4ZICA 5G0SA 1NPYA 3R0IA 4OSOA 3DZFA 4TVBA 1P33A 4CPDA 1U3TA 2VUUA 4CM9D 3FBGA 1MLDA 4L74A 4TVOA 4CR6A 5T57A 2O23A 2BGMA 3BXXA 1OZAA 1GV1A 1UH5A 1W73A 1KEPA 1FXSA 3UW3A 4DIFA 2C82A 3VTZA 4A2CA 3U09A 1LXCA 2OP0A 2VN8A 4NMHA 4LVCA 3PHIA 1HSZA 2ZYDA 3ZHBA 2NWQA 1AXGA 1CQJA 2XAAA 3KRTA 3KOUA 3U4CA 3QY9A 4D44A 4DQVA 5L45A 4F3YA 4E2XA 1ADGA 2R2GA 4LK3A 4RDHA 2FSSA 2BI7A 1NVGA 1PJBA 2O2YA 4OIMA 2UDPA 4R51A 2PD4A 1DLIA 1W8DA 3O4RA 1DIHA 4J91A 1GPJA 2QX7A 2YYYA 3UUWA 3RC9A 2E6UX 1VL8A 2OO5A 3ZWYA 4IZHA 1ZK1A 1P1JA 4BNJA 1V9LA 3VH1A 4XB1A 3VHRA 3Q3CA 3SJUA 3BHMA 4BO0A 1SB9A 1ZNQO 4KTTE 4NFHA 3X2FA 3JQ8A 1RKXA 2HMVA 3IMFA 3OMLA 2J5QA 1JLLA 4GMGA 2DQ4A 1A72A 2J6IA 4GVXA 2Y68A 1V8BA 4BGIA 4RPLA 3RBZA 4CLXA 1NTOA 4DPLA 2BLLA 4IY1A 3RUHA 1TT5A 2O3QA 3E1KA 5EESA 5JLAA 4NBUA 1V3TA 3NT4A 4NZ9A 3RROA 1D7OA 4RPHA 1HWYA 4AJIA 2BFOA 2IRWA 3DZGA 3GFGA 3TFQA 1GUYA 3PTZA 4Z6KA 1XG5A 4J90A 4XA8A 2AHRA 3F1LA 3NYWA 2X0RA 4J1TA 4BMNA 4DWVA 2ILTA 1VL0A 4J4HA 5JXWA 4NDNE 1H2HA 3GG9A 2D59A 3A9WA 5DOZA 4HNHA 3WJ7A 2G5CA 5G0WA 4CV3A 4O5OA 4Z0TA 4YRBA 2WD7B 5JDIC 2QG4A 4W9NA 3DOCA 1ZEJA 4LGVA 5CP8A 1ISIA 1P3DA 5EINA 2LDXA 3DBLA 3JQGB 5IDYA 3FR8A 1E7WA 1LC0A 4WOJA 2B4TO 4W7IA 2Y1OA 1SEPA 2VHXA 3ZU5A 4I5EA 5JFOA 1LDGA 4B4UA 4YJGA 4R16A 1E6UA 1DJNA 3VTFA 2VYND 2HRBA 1G6KA 4CM6A 4TKMA 1CQIA 1E3JA 5TSDA 4R41A 5THQA 3F5QA 3JQ8B 1RM0A 1Q2XA 3GPIA 3MOIA 1MV8A 4YJHA 3TN7A 4FFLA 1LNQA 1X7DA 3GDOA 1DFHA 2YFQA 3F4LA 1HDOA 5DT9A 5ILGA 4ALKA 3K6JA 8LDHA 3BMQB 3WGIA 1P1FA 3IL2A 4J0FA 4AL4A 1YL7A 1T4BA 1UP6A 1WLYA 1ENOA 3FI9A 1NAHA 4DYDA 4CLDA 1J4AA 4CQLA 3JQAD 4P8RA 2CF6A 3U5TA 1A9YA 1NQ5A 1O9BA 2FR0A 1QORA 3AY3A 3PYXA 3ASUA 3W6UA 3DMTA 5DCYA 1T2AA 3OIFA 1ZZEA 2NU8A 2WSBA 2C20A 4EJ6A 3WDSA 3EW7A 5KIAA 5IJZA 2TMDA 4JBHA 4AVYA 4LRSB 4B3IA 3OQ6A 4MVJP 5FF9A 5B4VA 5T64A 4IXWA 3QWHA 2GN4A 1ZSNA 3FSRA 3GEMA 3ONDA 5CEFA 5IXYA 4B7UA 3ZU3A 2Y1CA 4HV4A 1PIWA 5HTOA 1QG6A 3MJTA 1HETA 4ZJUA 2W98A 3K5PA 2QQ5A 4MVJM 1GEEA 2FSVA 3GFBA 3AY6A 4YT4A 1LLCA 3PQEA 3QSGA 5I8ZA 5ENVA 1X13A 4ZU3A 4J4TA 5BSHA 4IDEA 3WOHA 4D42A 1CEQA 1CF2O 1DJQA 1UR5A 3FNEA 4YJHB 3ORFA 2I3AA 2EG9A 2EV9A 1BXZA 1V0JA 1JWAB 1N2SA 2I67A 3JTMA 2ZYAA 4AFNA 2B36A 5B12A 3WXBA 3MJSA 2Y05A 4WJZA 1QYCA 3NKLA 2ZIZA 4QO8A 3B20A 1NBOA 2HAEA 4CQLB 4XCVA 4IGFA 1LDYA 2RCYA 3JV7A 4KWIA 1BXGB 4E2WA 2Q46A 1CRWG 2P9GA 2VNAA 4UEKA 2D8AA 3IUPA 4II2A 5BSEA 7MDHA 1YOVB 3CKYA 4YWJA 4CV1A 2O7SA 4WNCA 3SC6A 4JN6B 4QO7A 4D3SA 2UV8A 1KS9A 5EN4A 4BVAA 2Q4BA 1TLTA 1J6UA 5CAEA 4IDGA 2WE8A 4YRDA 3PJGA 2HCTA 4RZIA 3ROMA 2C54A 3TOXA 4XRGA 4EEZA 1H9BA 2YDXA 2YUTA 4XB2A 2ZB8A 4GQAA 4HFRA 4HFMA 3AFNA 5C3MA 4FS3A 4M54A 4X54A 3QWFA 2QRLA 1GR0A 2VNSA 4RVDA 1ML3A 3P2OA 3DBVO 4Y6SA 3SX2A 1ZK0A 5JDIA 3I6QA 4BO5A 3C1OA 3H6KA 5IDQA 4P22A 5L51A 2P5UA 3QHAA 3RU9A 5L40A 4CQMA 1HTBA 2GYYA 4J4BA 2X58A 4GH5A 3JQ7B 3HDJA 4YTEA 1M6WA 2G76A 3V1UA 3ZWVA 3V2UA 1W0CA 3OHSX 3UAGA 3EUWA 3GK3A 3FCOA 1PGQA 3H2ZA 2FN7A 2NQ8A 3ICCA 2FP4A 5A9SA 4CMIA 5TT0A 3GA0A 2DPGA 1KC3A 4DGSA 3RKRA 2EGHA 2IXAA 3O8QA 4MIOA 3UGKA 1R66A 3M1AA 1HYHA 3R6DA 1M2WA 3AI3A 3OA2A 3EMKA 2ZCVA 3BZUA 4GLOA 5LDHA 4CM4A 1XU9A 2PLAA 3GMSA 3I3OA 1DOHA 1VRWA 3DAPA 3ICPA 4AJHA 5L7YA 2DFVA 2RBEA 2I65A 2NU7A 3W4JA 3C7AA 3SBOA 4HP8A 1CDOA 2H9IA 4R69A 5KVSA 3TSCA 3GGGA 5A9TA 4BMVA 3E9MA 1G0NA 3KYCA 3W4IA 1E3WA 3OJEA 2CNBA 1SPXA 1EE2A 1JAYA 4HY3A 3GVIA 3WR5A 3HHPA 2UVDA 2A92A 1IULA 4R68A 1A4IA 4ZRMA 5BT9A 3CINA 3MTJA 3I23A 5A05A 3NJ8A 4JJIA 1XU7A 2PGLA 4CM1A 3WWYA 1XR3A 3AWDA 2EJVA 4QX6A 1YL6A 2O3SA 4CM8B 5TS3A 5G2OA 3TZHA 3PWKA 5FI3A 4GX2A 5AXBA 4B7XA 4BNZA 1DFIA 1L7DA 2CVQA 1FDVA 2PD6A 4U6SA 1DFGA 5KOIA 1XQ1A 3GPDG 4JNKA 4CR7A 4RVFA 3WGOA 3GDGA 5T67A 2JJYA 5I9MA 1R12A 5KJFA 2GLXA 1ZK2A 3JYQA 2BFAA 1NVMB 1N9GA 3OIDA 4RVGA 3LQFA 4OQZA 2BGKA 1DO8A 3IOYA 3GGPA 3H9JA 3Q9UA 5IF3A 3EGOA 5AQ1A 3T7CA 3GZNB 4RVHA 4U7WA 5TIIA 4IQ0A 1A71A 3RUAA 4LCJA 1GDHA 3ADPA 5DP2A 1YQDA 4MVJA 4HWKA 2X0NA 2CD9A 1KEVA 4MP8A 3RU7A 1ZJZA 2I9PA 4GPD1 3NDRA 3D4NA 2HUNA 1E3IA 3B1FA 3AM4A 4PFJA 4A0SA 1PEDA 4ID9A 4E21A 5TLSA 1AUPA 2H1SA 3I5MA 1FJHA 3MEQA 3GAFA 3I52A 3G3EA 3UXYA 2DU8A 4XWYA 3WNVA 4PZEA 4BKPA 3D7LA 1SAYA 3ZNPA 1K6JA 1H2BA 2Y0EA 5ES3A 1EVZA 4XGNA 2GZ2A 4PZCA 2ZJ0A 5MDHA 3IP3A 3TL2A 3IIEA 1JKFA 1YJQA 4A5OA 2Q1WA 2POQX 1OC4A 5BSGA 5I9LA 1EBUA 2CF5A 4BKOA 3PZBA 2AW5A 3ZU2A 2PY6A 2IXBA 4D79A 5IFLA 4WECA 2PZKA 3WLEA 1VI2A 1Z7BA 3WMWA 3GMDA 3LDHA 1VPDA 1HLPA 1NX6A 1PR9A 1Q0LA 1N7HA 3IJRA 5DBFA 4IUYA 3E82A 3UKOA 4R1UA 3JYOA 3LC7O 3TZ6A 2HLPA 2G0TA 5A3JA 4UVDA 5DDIP 5CDYA 3L9WA 1R6DA 4J3FA 4AJLA 2PGDA 4FJ0A 3MJVA 4YAJA 1LA2A 1NHGA 1WZEA 2P4QA 3EVNA 4BMSA 2C7VA 4FW8A 4MVJE 3V5NA 1BHSA 2VZ8A 3TZQA 4CL8A 3C3XA 5GZ3A 1HLDA 4WCDA 1N7GA 1TB4A 3JQDA 4LSWA 1I2ZA 1VE9A 2BHLA 2ZTUA 3QV1A 5EMHA 3ZNNA 1JW9B 5ADHA 2WYVA 5KKAA 1NQOA 2IEBA 5C7IO 3E5MA 4TKLA 3RIHA 4DQXA 4OM8A 4EUFA 4XJTA 4EW6A 1E92A 1MG5A 1LX6A 2VOEA 4Z9FA 3U0BA 2GO1A 3KVOA 4TMFA 5DF1A 1BDMA 4R01A 4LW8A 4W82A 4BB6A 1AHHA 1OMOA 5DULA 1RWBA 4PG8A 5CDGA 1BVRA 2Z1MA 3NX4A 4JIGA 3T4EA 5JE8A 3E9QA 4KQXA 4A26A 1F8FA 1DEHA 5LC1A 1ISMA 1HL3A 4GAEA 2VZ0A 4GMFA 4DQUA 1E7YA 1GCOA 3BMCA 5KTKA 1LBEA 3FPLA 1EUDA 1WDLA 4BNKA 1XDWA 4J1NA 4UVGA 3FTPA 5CPFA 2B4QA 1E1KA 4XYEA 3JCZA 3ZWNA 5HM8A 3HG7A 2YDYA 3ZWPA 3F47A 4YEDA 2AEJA 2CSUA 1GUZA 3H4VA 1LDBA 1SBYA 1Z73A 3GVCA 4BB5A 1OI7A 4PLZA 4BNUA 1YL5A 2I99A 1T25A 2XOXA 4ZHSA 5L53A 4NBTA 4XYGA 4F46A 3OP4A 4CMKA 1GQYA 2X9GA 2PTGA 3BTSA 3Q2IA 2JFHA 4I5GA 5CHEA 1K6IA 4Q9NA 4UVIA 4RVUA 2DVMA 2RIRA 2V65A 3HB4X 2O7QA 2PR2A 5F3RA 5G4KA 1VC2A 2VTEA 5K6AC 1I2CA 5JC1A 1YWGO 3CSDA 4CQMD 2VYNA 2ZTVA 1ZSYA 2FMUA 1DHTA 3MJEA 4XYLA 1GV0A 1I3MA 1IE3A 2G17A 1E0DA 3HN2A 3EAGA 4UVEA 3RKUA 1BMDA 3WJAA 2XXBA 4DLBA 2P9EA 2QW8A 1HSOA 4RGBA 4MIEA 9LDTA 3WX0A 3KO8A 1AHIA 1ZMTA 2DT5A 3AM5A 3UH1A 3LLVA 1O0SA 5KKCA 1NAIA 3K2BA 3V8BA 3PHJA 4P4NA 3O26A 4FD3A 3ZHZA 4WGGA 1DC4A 2HJRA 3ETGA 3HDYA 2JD1A 3V1YA 4A27A 4B8WA 4WNIA 2Z95A 5L95A 4OYRA 2EW8A 1P0FA 1X1EA 4GBJA 2PKQP 1XYGA 4R5MA 3VPHA 2Y1FA 4Y8VA 3WIEA 3D3WA 4A7PA 3NTRA 1LRKA 3QVOA 3T7EA 3WSWA 2B5VA 3H9UA 1WAMA 1YKFA 4Z3KA 5C7OO 2YHIA 4TRMA 2AEFA 4L8VA 3ZDFA 1XQ6A 1BWSA 4AJKA 3D3EA 5H81A 1T26A 2AXQA 4TQGA 1WP4A 4BV8A 2X86A 3DAGA 3DZKA 2WEKA 4WOKA 4XD2A 5KJ1A 1M75A 3C1AA 4Z9YA 3CH6A 5C37A 2IEDA 5T6BA 5TF4A 2X9VA 4NJMB 3NGXA 5JMPA 4CJXA 1UAGA 4W9NC 3S2IA 3DONA 4Q3EA 3SJ7A 2ET6A 2JFGA 3L4SO 3PJFA 4NK4A 3ZW8A 5A1TA 1YE3A 1YXMA 3U4DA 5IN5A 1H6AA 3G49A 1FMCA 4QT0A 1E3EA 5EL0A 5KVQA 4BO4A 4OMUA 2Z1NA 1BVUA 1GZ4A 5F1KA 4UUNA 4N5LA 2EJWA 1BGVA 3GAZA 3RQSA 3WTCA 3VH2A 4ROSA 3AFMA 2VRCA 1JKIA 1NM5A 3GNTA 3OJOA 3VH4A 2BD0A 5JPIA 1PJSA 3WLFA 4EJMA 4Z3DA 1M67A 2GERA 4R5HA 1BG6A 3HFSA 5GZ1A 4IMPA 3OIGA 4MP6A 3WYBA 2X23A 5TJHA 1IPFA 1IOLA 5KWEA 4EDFA 2NU6A 3KHUA 1SB8A 4D3DA 4DMMA 4GGOA 2OMEA 1VL6A 1YQXA 2NLOA 1XA0A 4L0QA 3NAQA 4OSPA 1R0LA 1KETA 1SZJG 2YHIB 4MVJI 2Y0DA 3G1TA 4UVHA 2VWPA 2CDAA 5KVCA 1FDWA 4MP3A 1NR7A 2R6JA 4Z0PA 4R54A 2I6TA 5JAZA 2B69A 5L4LA 4GGPA 2QYSA 1PZHA 3NV9A 3ANLA 4NBVA 3ZWCA 5JO0A 3GVHA 5JMWA 2NADA 1ZEMA 1KVSA 3AUAA 1DIBA 4KTVE 2JCVA 1P31A 3PXXA 4RF2A 1R4MB 2VYVD 3ZNOA 2RAFA 1B8VA 1I2BA 2EIHA 1N92A 3ZWWA 2WYWA 1DHRA 3KLPX 1A5ZA 4B8ZA 1KY5A 1RYEA 4C4OA 2DBQA 2Q2QA 1MG0A 2GRAA 4ZN6A 3PP8A 1ZK3A 1B26A 1OBFO 3K2EA 3ZGYA 4U6QA 5JYDA 3GRKA 4JQCA 2NUAA 3WBFA 4PG4A 3TOZA 3OFSA 4PLPA 3LT2A 4RV9A 2WD7A 5K6AA 3BAZA 4RDIA 4GKVA 2PKQO 2RH8A 3ZWXA 2VHVA 1LQUA 3CUKA 3DHNA 2BH9A 2X8LA 2BELA 3JQGA 2ZJ1A 5T8KC 1UXIA 2Q50A 4G81A 4WKGA 3VDRA 2ZYGA 2ZQZA 3CZRA 3RUCA 1DIRA 1Y5MA 3ZHYA 5F21A 1LI4A 1XHLA 5JYEA 2YQ5A 2X0JA 4Y6RA 2A4KA 3RWBA 1EFKA 3A28A 2BKAA 2AEMA 5TT1A 1R15A 4DLAA 4R1SA 4E5KA 3L77A 1U8FO 4C7JA 3I9LA 5HA5A 5JCXA 2XPCA 3HB5X 4ND3A 1DIGA 3QVTA 3BA1A 2AQHA 2OOSA 3KETA 4XR4A 1FK8A 3DOJA 5AXAA 1ZCJA 2Q1SA 2EEZA 3BMQA 4YT8A 1B15A 3EHEA 2JCYA 3ZN2A 2F00A 4LISA 5J23A 1V6AA 1I3LA 1BXKA 4XQCA 2BMAA 5KCZA 3DBHB 1QMGA 3DEYX 4Q3AA 2WE7A 1UP4A 1NWCA 4I8XA 2VWGA 4XYMA 4QUKA 2GGSA 3UOGA 4FSHA 3FF4A 4BNXA 1LDMA 1AXEA 3BTUA 8ADHA 4I5FA 2DAPA 4DMLA 2BGLA 5FYDA 4KUEA 2W4QA 1EE9A 1XKQA 1U5AA 4TZKA 3WGYA 1EEHA 4Y9DA 1H9AA 3QWAA 4AJ1A 3V1TC 3K31A 4NG5A 4OOEA 5TC4A 3KV3O 1PQPA 1F17A 3WQQA 3ENKA 4LMPA 4W4TA 2OORA 1EK5A 2WTBA 3U62A 4M55A 3UCEA 1EZ4A 4MOWA 2BRUA 4R3WA 5JO9A 1BW9B 1B8PA 1X7HA 3WS7A 4CMEC 3F4BA 4AG3A 5IAAA 1PQWA 1Q0QA 2P2SA 3PGJA 4WUVA 4YAKA 1LLUA 2X5KO 2CY0A 2HMUA 4J7XA 4BHTA 2DLDA 5JAQA 3QQPA 1U3WA 1ADFA 5U1PA 4S3MA 4XZ3A 1R16A 3BMNB 3RUDA 1ONNA 4FN4A 2I66A 5BQFA 3Q6IA 4OXYA 1I8TA 3C8MA 4BNHA 4ZQEA 1QLJA 4EJ0A 2ZKLA 1VKOA 3BYZA 1Q0HA 3VZRA 3GF4A 4I08A 2DBZA 3PWSA 4JK3A 1FDTA 2W2KB 1BXGA 1LLQA 4BO1A 3H9GA 2H6EA 3DFZA 4NK5A 4ALJA 3TZCA 4CLHA 1ISJA 1DRUA 1I10A 1FDUA 1YOVA 4DTIA 4M89A 4OAQA 4CUKA 4BIIA 2VT3A 3ONEA 4I9HA 4CM5A 5JAIA 4RLSA 2IZ0A 3ZHXA 4BO7A 3W8DA 4B4VA 3PFWO 2D3TA 2Q99A 3NDIA 3QVSA 4NPCA 2Y66A 1GQ2A 2OP1A 1T2FA 3E5RA 3RFVA 3RJ5A 4XDYA 1OC2A 2RHRA 1BSVA 4CODB 3ZWMA 3DZJA 5CDTA 2A9FA 2C2XA 1ORRA 1UXGA 1SMKA 2J3KA 3K30A 1A7KA 4Y67A 1ID1A 1ADBA 4J0EA 2NVWA 3GR6A 4BQPA 2VOJA 3H9EO 3COSA 1ULUA 2PZMA 1UZNA 4FC6A 1GD1O 3HDHA 1ZJYA 5T8KA 2VRCD 4O63O 3JQ7A 3AK4A 1QYDA 2X5OA 4OO3A 4KUGA 2J5KA 4DBVO 3LZ6A 5DBGA 4FPXA 2DUUA 5JSFA 1IHYA 1X1TA 1MFPA 2IDZA 1XLTA 2GNAA 1UDAA 5THKA 1P9LA 2DTDA 3KXDA 4L4SA 2XXJA 5DZSA 5C5IA 3PVZA 1MXFA 5KNLA 4BS9A 4GLLA 4KP7A 5COBA 4JCOA 4R1TA 2YV2A 4AJPA 6LDHA 3VPSA 3IC5A 4YACA 4ALNA 4E2YA 3DTTA 2PA3A 2GD1O 2GN6A 2Q2VA 4CMCA 4WCFB 5HBRA 5G4LA 2R00C 1R4NA 4IDAA 3JYPA 3RCBA 2NV6A 1QRRA 1VJ0A 4IIUA 4LVUA 1IUKA 4MKZA 2YJZA 3W4KA 5JNLA 1EVIA 1ZVMA 4RF4A 1E6EA 1H6CA 2Y99A 3LSYA 3FN4A 3OQ1A 4QECA 5FI5A 3FHLA 1K89A 1H0KA 1TT7A 1A27A 4BNVA 4DL9A 3H7AA 4RPKA 4DUPA 5HS4A 4FB5A 1C1DB 1YBAA 1E5LA 3ETEA 1Z82A 3TFOA 2E82A 2DUWA 2FPPA 4N5MA 4GVLA 3OJ0A 1V3UA 3GUYA 5ILOA 4KDFA 5GMOA 3RC2A 1SO8A 1GYPA 3ANMA 4PG6A 3VC7A 4CM8A 4ZVVA 3D0OA 2QRJA 3ETDA 5ITWA 3M6IA 3L07A 1PU2A 1U4SA 3CZMA 2I3GA 3ZV6A 4KDEA 4CMEA 4L75A 1YB4A 4XKJA 3C7DB 4RORA 4UEJA 1PR3A 5TX7A 2I5PO 3Q2KA 3LU1A 2Q45A 1GQQA 1HRDA 4WE3A 2X5JO 1E7SA 1NWHA 4D46A 2AE2A 5CEEA 4XGIA 2PFGA 3NEPX 3ZV4A 4ND4A 4EUEA 2ZATA 4H7PA 5TRTA 3L4BC 3GZNA 3IS3A 4PLWA 2J3HA 4ZQHA 3ZWBA 2CVZA 4I9NA 1JAXA 2AQKA 1Y1PA 3ADOA 1P1IA 3RI3A 4OXNA 5BR7A 3WQRA 1KVTA 5U9CA 2JD2A 1R4NB 3FTNA 2OUIA 1DBVO 1M6HA 3QA9A 1CJCA 4XIJA 3IQDB 2A94A 3RFTA 4XIYA 5TGDA 3OF2A 1YBMA 2IZ1A 4BO2A 3PDUA 4N18A 3QE3A 4MVJG 1MX3A 3LT0A 4NBWA 3EZLA 3TWOA 1O95A 2JCXA 2G1UA 1HE2A 2NVUB 1E77A 4D43A 1EK6A 2E37A 4PLCA 1GYRA 4FFPA 1FF9A 5HRUA 3H3FA 1PJ4A 1ZMOA 5ER6A 3DO5A 3K96A 2UYYA 1NR1A 4XRRA 5I7VA 2Y93A 1LSJA 3VPGA 3VZQA 3PEFA 3PQDA 2RHCA 4TRNA 3ZWAA 3TJRA 3OETA 3CE6A 4JJFA 4AICA 2CZCA 2W2LD 3QRWA 3QWBA 4RF3A 3INGA 4L76A 1YQGA 4DLLA 2NNLD 2AMFA 3FWNA 4TRRA 2EW2A 1JWBB 5ICMA 4TROA 2GPTA 4RZHA 5I7EA 1LDNA 1ZSVA 3E18A 3CMMA 3GEGA 1Y8RB 2J5RA 3IJPA 1U5CA 4BNMA 1Y7TA 1IL0A 1MA0A 4YT2A 1ISFA 2B5WA 1D3AA 4Q3NA 3HADA 1E3SA 1JU9A 4M49A 2JHFA 1U3UA 3DC2A 2HK7A 3I9JA 2ZQYA 4PIVA 1LC3A 4MVJF 4WLUA 3JQEA 5A5FA 1SNYA 3ROPA 3TZKA 3UVEA 4XYBA 4Q3DA 1JVBA 1U7HA 2HRZA 1GY8A 4Q39A 3PFFA 5L9AA 2B37A 3NT5A 2QZ9A 4FFRA 2OBYA 3PJEA 5JCJD 1MGOA 3PIIA 4NH4A 4NHEA 5JDCC 4J1QA 4GKBA 2VYVA 2R00A 1PJ2A 1C0PA 4OH1A 3Q0EA 1HYGA 3DB2A 2GR9A 3GLQA 4QEDA 4O1MA 3WGQA 4FCCA 1UZMA 4GX5A 3PI7A 3GGOA 3TNLA 2HMSA 2O50A 2AG5A 1QP8A 1HZJA 4FIZA 4IM7A 4N5NA 3NTOA 3B70A 1LEHA 3ROKA 3L9XA 2AG8A 3PZRA 4M8SA 4E5PA 4PLVA 3BTVA 2FRDA 4J49A 4JXKA 3BHJA 1Z75A 3EDMA 4MIYA 3SLGA 4J7UA 3BIOA 1O8CA 3S2FA 4J9UE 2OFPA 3U3XA 5LCXA 5CFZA 1NYTA 1SCUA 2V7PA 4ZRNA 3I9NA 3GDFA 2PNFA 3A4VA 4R4JA 1DC3A 3C24A 3UF0A 2YV3A 1RM5A 1CETA 2NSDA 1EVJA 4ONEA 3JD4A 1KEUA 1LSUA 3EYWA 3JQFC 3TDKA 1DDOA 2HDHA 3OEYA 1M66A 5JBIA 4MKXA 3P2YA 4EEXA 3IDSA 2VQ3A 2G82A 2Y1GA 2OGUA 2ZB3A 3L4BA 4B79A 4BUCA 3GG2A 3QVWA 3FR7A 4YQZA 5T5QA 1GFSA 4PCVA 3KUXA 1FDSA 2EGGA 4PLYA 2Q4EA 2DC1A 5AYVA 3K8ZA 4G5HA 1K2WA 2FWMX 1NFFA 1RM4A 1Y9EA 3QIVA 4FOOA 4NR0A 2EWMA 4W7HA 3ZZNA 5L3ZA 4MINA 3GVPA 3NT2A 4P4LA 1H94A 2Y1EA 3ON5A 4U8GA 1A7AA 3DTYA 3PIDA 3N7UA 2VHWA 4BOYA 1VJ1A 4E33A 2OXIA 5DN9A 1GZ3A 1JTVA 1PS0A 1C14A 4ZQBA 1LDEA 1E7MA 1H93A 2FOIA 3GUCA 3LYLA 3DZBA 1EDZA 1LQTA 1UZLA 3CXRA 3PHGA 3H5AA 2IYOA 2PH3A 4JX8A 4ILKA 3SXPA 2YZ7A 3DOOA 1QLHA 2HKIA 4NJMA 3ENNA 2FZEA 2C07A 1O6ZA 2PKRA 1WZIA 4OJNA 1YJ8A 1EQ2A 3A06A 3GRPA 1HDCA 2X22A 3FNHA 2O3UA 2DBVO 3VPXA 3WGGA 4FQ8A 4RLHA 2FY8A 1IZ9A 2X0IA 3KLMX 2WM3A 1RM3A 4P38A 3JD0A 3RC1A 2J3JA 3VPFA 2P91A 1LU9A 3GH3A 4DXHA 4E5MA 1I3KA 5IZ4A 1LTHR 1DPGA 4F6CA 2HSDA 5TNXA 1IPEA 1T2DA 4DREA 3ITDA 1PWZA 3W8FA 4GWKA 4HBGA 3DBRB 2JKVA 2HQ1A 2Z5LA 3TQHA 4UUMA 1NHWA 4RF5A 2GF2A 3ITKA 1SOWA 2DFDA 4H15A 2O4CA 1N1EA 1DAPA 1T1SA 1PZEA 1Y81A 2X1HA 3I9MA 4EI2A 2PZJA 2PZLA 4BO6A 4IDBA 4XQ9A 1B14A 1ZUD1 4JROA 1Y6JA 3OICA 1SC6A 1X14A 5ITVA 1GUFA 5JDCA 3A14A 3AUUA 2CUKA 2GDZA 1U3VA 1B8UA 1ONPA 2HK9A 4PLTA 2GSDA 3LC1O 1MB4A 1MUUA 3DL2A 3L6EA 4DIBA 1J0XO 4YAGA 1V3VA 3TRIA 3PPIA 2CVOA 4KQWA 4CV2A 1PGNA 1JKJA 1R4MA 4WLEA 4F6LA 1HE3A 2O3JA 4FGSA 3JYLA 1WMAA 2GZ3A 2VUTA 1IZ0A 2FHSA 4GI2A 1EUZA 3HWRA 3RASA 2ZB4A 5A04A 1ADCA 3QLJA 3B6ZA 1KC1A 1OAAA 3WYCA 1P1KA 3HZZA 4CLRB 4UEOA 1YDEA 1ISHA 2WJPA 4E4YA 2O48X 4CR8A 1I5RA 3O9ZA 5G0TA 1GYQA 3GT0A 3RUFA 4LMRA 1DLJA 3VH3A 5I9NA 4JBGA 3C85A 1PZFA 1KVRA 1CYDA 4PZDA 3LVFO 1RJWA 5F5NA 3KYDA 3R3JA 4G2NA 5F1PA 4RCVA 3DR3A 3AU9A 2YV1A 1BDBA 4PG7A 1UDBA 3AOGA 2H63A 3D5QA 3ST7A 4B3JA 1C0LA 1RPNA 2PK3A 5BNIA 2EKLA 3LC2O 3JQFA 1P0CA 1X15A 2B4RO 5DP1A 2D0IA 1AGNA 1O94A 5KVVA 4PLGA 4IZIA 3KZVA 9LDBA 1YO6A 2YY7A 3I9OA 4DVJA 3D64A 4I9UA 5EIOA 2VT2A 4RPGA 4UUOA 3I4FA 3RJ9A 4R9RA 3ZU4A 2H5LA 1GAEO 1ZO8A 1VSVA 4QTZA 1NFQA 5FWNA 5JS6A 3JQAB 1S7CA 2VHZA 2BFMA 4C7KA 5JAMA 4WCFC 4BNWA 3IAHA 4DBZA 4IDDA 1HDXA 1V35A 1EUCA 4ALLA 3H65A 3WWZA 1B3RA 1JA9A 3PRJA 3DBHA 3K9QO 3ZCXA 4F45A 2W90A 3WGHA 3KSZO 1KOLA 3P7MA 3FRJA 1UXKA 4QSMA 4PRKA 3KEOA 2YQ4A 1NQAO
chains in the Genus database with same CATH superfamily
3M2PA 3KL4A 1IAQA 5EJ2A 1HMPA 3SEQA 5J63A 4E11A 3EEOA 2G9VA 3B8HA 1IEXA 2EXXA 2NPIA 4M22A 1YU6A 3LQRA 1OYYA 4YBZA 3S28A 3KYDB 1I7DA 1NW7A 1VLLA 3E03A 2QPOA 2ZI5A 4NCHA 3BM5A 3A6ZA 4G1BA 2NTNA 5DLYA 5U4QA 3TLAA 1QP0A 1E9EA 1EDOA 2HO5A 1VPEA 3OQBA 4TL6A 4PGMA 1UK9A 3GFRA 5DTJA 4FHEA 1ONOA 3RBXA 4J2OA 5A4DA 2OBNA 821PA 3S55A 1W0JA 4TZTA 1DRVA 3VSBA 4CMAA 1V7QA 5J1TB 4FI3C 2OCIA 4Q48A 3JRXA 2D2IA 4CZ2A 1QNFA 2ZEJA 5CLIA 5CXXA 3EVTA 3SX0A 4J1SA 1EJBA 4LOAA 3KL2A 3SJCA 1P2DA 5I6DA 2ZXFA 4XE5A 2VYQA 1QOPB 2YWXA 1SCJA 1D2HA 3MCVA 4IXTA 1OAKA 3F46A 5I7FA 3TF5A 4ZK2A 2ECKA 3CZ9A 2REOA 5AKKA 1SHKA 4NBNA 2JD0A 3WK9A 4D5EA 1JDPA 2NXEA 3BEDA 3MGKA 4Z4CA 4Q1BA 1VMAA 3ELDA 3F6RA 1DBRA 3ISTA 4FGWA 1Y8QB 4RBNA 3V6MA 4PSVA 4IIVA 4BLTA 4GWGA 2OFXA 3HI4A 1JLSA 1G8GA 1U28C 3IUBA 5JUWA 3HBNA 1DB3A 2W6MA 4N0QA 3WFZA 4DCMA 1CKEA 2O2XA 3LUKA 1KS2A 4BRWA 1RXYA 3BMOA 3HO6A 4M87A 3RT1A 2R84A 4LRTB 4PO3X 1P61B 3Q8WA 3Q3EA 3W1EA 4P33A 2IVZA 3EDOA 3H75A 2C3YA 2LKDA 4HX9A 4BC1A 5DWQA 4ZZ2A 4CEIA 2QT9A 1FSSA 1REQB 4UDYX 1E6WA 2GZMA 3CVYA 4OUDA 4S1NA 1SOMA 1MQSA 2F67A 4J16A 4R9SA 5CYFA 1S9HA 5KX5A 2PUEA 5ALPA 4RVOA 2W2LA 5HIJA 4A23A 2E48A 3RYCA 4QGBA 3SP1A 3T3NA 4C04A 5BQOA 1XZFA 2V6FA 2JAHA 2Z2ZA 4INOA 3GHHA 1E3LA 2C03A 3VPAA 1TF2A 1ZW1A 2P6MA 3GBVA 2R1ZA 3ONFA 4JH0A 1IM2A 1E6MA 4RADA 3FKQA 3U4IA 4X6XA 5EP3A 1N2JA 2I22A 1HT1E 3FVRA 4EWLA 4MUXA 1LF5A 1HFEL 1JNYA 1L3BA 1M10A 1WDMA 1Y3DE 3D1LA 4JKIA 3SS8A 4H16A 1AUOA 1Z0KA 1Z7YA 3MWEB 5LXTA 3X43A 2YY5A 3MMSA 2XE4A 2QTLA 4QIHA 2AX4A 1V1JA 3P2KA 1PBTA 2NVOA 4W63A 3B9PA 1CUWA 1ENYA 4XOIA 3ZVRA 2G5TA 4M0MA 3C70A 1J5XA 5IJ0A 2E5LB 1DQPA 2G6BA 4G5SA 4QL3A 1JDJA 4BEJA 1GNQA 1EGAA 2Y9PB 3P0JA 4TRJA 1YV9A 2OD2A 2QSYA 4UD2A 4R7GA 3T5BA 4N7JA 3PQ8A 4YJKA 1CIVA 1AM4D 3AG5A 3HSKA 2AJBA 3B85A 3DMYA 3MFYA 2YUIA 1ZKMA 4IJUA 4DANA 3WBBA 3MWDA 5BR1A 2YYZA 3I5UA 1L5GB 2ILVA 2K87A 3HCOA 4Y1EA 4A1OA 4BJ6A 1D1SA 2WM2A 3FLBA 2BEUA 1X2BA 3HSYA 1U6JA 2G7ZA 4ZMBA 2OZLA 1A9ZA 3VPCA 1BXRA 1PEYA 3OPYA 2BFEA 2HJHA 2O1WA 3DFUA 3M49A 4K9SA 1CD5A 2FZWA 1ZIDA 4PBRA 1TM7E 1O9HA 1O95C 2J3IA 4H7HA 5DSTA 1NN3A 4C3ZA 4DADA 2TMKA 4IV5A 4DGQA 1KIFA 3EQ9A 3ZG6A 2BHTA 3AP3A 3OEEA 1PG5A 1TT5B 3ITEA 5L7TA 3IOBA 1AF7A 3FTEA 3LT1A 3ZCRA 1N2CA 2VBIA 3REFA 2O8FB 1YFLA 2QX4A 1PL7A 1WMBA 2XE7A 4AWBA 1PN3A 1WXXA 5CEJA 3NM5A 3CWQA 3MXOA 5EXEA 5HRAA 3KVNA 4DLKA 4B2LA 4H1VA 1JIVA 2NW6A 1F51E 1K6EA 2W58A 3HP4A 1SCKA 4FYWA 4MIKA 3DWEX 3H0KA 2I87A 721PA 4YA6A 2OL4A 4YQYA 5H59A 3S2GA 4UXHA 1U8XX 3QXCA 1R74A 3N1UA 4E31A 1N1MA 1WMEA 2P9QA 3MCWA 4Z0HO 3P9QA 3L7KA 3RSFA 4I6EA 4II3A 3TOSA 1NQTA 1QAMA 1J56A 3RNOA 3I8XA 4DC0A 1W4RA 2A84A 5C5EA 5IX8A 1Z6AA 2BJHA 1RLIA 1E2BA 3H2YA 3NM6B 4MHOA 3U4HA 1RAEA 2WI8A 1YDMA 2YXNA 2C0PA 2O3TA 5C1PA 3K35A 3OG9A 4JVOA 2RMKA 2W8ZA 2CMDA 3W0LB 1K3FA 2FYTA 3BN3A 1HFWA 2NAFA 1CBUA 5ENDA 1J5PA 3WG9A 2AA3A 2FMHA 4WFQA 1KY4A 3VO1A 2ODPA 2NUBA 4C30A 5C8YB 1P39A 3GJ8A 1XRMA 2PWYA 1G8FA 2RKWA 3EGXA 4E5UA 5KQGA 3TLBA 3GLIE 4GPAA 3DVQX 4O29A 5J9FA 2A5YB 2QS9A 1DIAA 1HC7A 1TOAA 2HR1A 1NXQA 2CLOB 1GQOA 2GJKA 4NV1A 1VJRA 3FUXA 3VOTA 2WNIA 3QFRA 4HAXA 3SYKA 4DOMA 2A86A 2EQAA 1KWGA 1UPUA 5F77A 3WLMA 4DABA 2F3SA 1LBQA 1VMEA 4FR2A 3O74A 4UBJA 4DSZA 3AOEA 3ZDCA 3BIXA 3UYKA 1FMTA 4A15A 3UQYS 3ROGA 1TTQB 1R37A 3AQ4A 5DK6A 2UUAB 4DPKA 3ND6A 1IONA 4S1VA 5B7QA 1BTOA 5DASA 3ZCVA 2WKQA 3MW8A 1DVRA 1Z6ZA 5HS6A 3P0IA 5FR1A 1WY7A 3TAUA 4P3YA 1A1SA 1OU0A 3WYAA 4GPEA 4TMXA 2IOHA 2XEXA 1IXRC 1E9DA 2P9ZA 2ZREA 4KWHA 5FTLA 3NHWA 3MBKA 1P5RA 4ZT3A 3IUNA 5K3OA 4L4XA 5KYTA 5LJIA 2G6TA 2WWFA 4IG9A 1DRKA 4Z49A 4M8LA 1G38A 1DINA 4FR5A 2EDCA 2Z5GA 3RYHA 5IZCC 4HNGA 1IBLB 3GA7A 4TMWA 4PINA 1EA7A 3X0DA 4G86A 4KPUB 1I32A 1G5QA 4CIAA 4A73A 7GPBA 1ZUNB 3JAWA 4BXOA 1J00A 1WW8A 2HWWA 4UQPA 5JRDS 3B2EA 2YTZA 3JATB 2HQBA 1ZUIA 1PW7A 4J0DA 4LCBA 1ESDA 3MGGA 1KH1A 1EFRA 4L9AA 4NFSA 3REQB 5NULA 5I47A 2GHRA 4TLCA 1C0KA 2QMYA 3LIPA 4BRZA 3SIRA 1CTQA 2JFZA 3KV1A 2FQWA 3N2ZB 2H07A 4NICA 3F6CA 4JT2A 3LPAA 3O1JC 4IIJB 4IOMA 3CY6A 3S27A 4U5QA 1XPJA 3NVDA 4HNUA 3MCZA 4IKPA 4IIEA 4CQJA 3JD3A 2Z30A 3ABZA 4OKNA 3SLKA 4AXBA 5K0ZA 4UCQA 3ANNA 2ZQ5A 4UEQA 2QAGC 3LW8A 5EJ8A 1E59A 4MJLA 4O0MA 1RJEA 2BTOA 2ZJZA 1GQRA 4UHBA 1CR0A 1G9TA 1HBJA 3G9UA 1CUHA 4P4GA 2BF7A 3ZW9A 2QLLA 3SQWA 4O8CA 3KCQA 4GVPA 2YFHA 1F4LA 3KJEA 4HB2A 3KSUA 3B6KA 2GVDC 2TRSB 4IS3A 2C5BA 4RL6A 1BRMA 1EI9A 2AFHE 3M5CA 4YMIA 4BO8A 3OKPA 3NR2A 4NZPA 3GLGA 1YK1A 3Q11A 1J97A 3DNPA 2WA1A 1EXDA 1ILWA 4EUHA 4WEOA 2FG5A 2PS3A 5A2QA 4X62B 5ALGA 2XIJA 3JQCA 4GMHA 2NO0A 1CZNA 1QDEA 3QVLA 3ZNQA 2M32A 3QMMA 4UATA 1U0BB 3M34A 2GCIA 5KO2A 2VSQA 4BO9A 3BH0A 3HJAA 4UTXA 2JKZA 2PT6A 3HXMA 4HSEA 5HSGA 1H5UA 2OXEA 3O4JA 3B1JA 4A0QA 4JBWA 4LVOA 1JYEA 2Y1DA 3VZCA 3NDJA 2GJSA 1V5IA 1E18A 3DTVA 4E15A 3OZWA 1DJLA 1DS6A 3O2QB 5IASA 5JZ9A 1SQ6A 3L4JA 4X1KA 4V02A 4ZVMA 4IHJB 4NFLA 2IQIA 4O4LF 4B4WA 2JC3A 4EEKA 2JLZA 1IXKA 1F38A 1Q11A 2QYOA 4NYMQ 1MA3A 3I58A 2MWMA 3IB6A 5AVSA 5FA8A 1E2JA 3VRHA 3O8OA 4O59O 1DNPA 5KYVA 1C3JA 4RKEA 3GJQA 1J70A 2Z2KA 1GR1A 1VM6A 3HUUA 3TBHA 4NNJA 3QUBA 3U7QB 3FCXA 3RS4A 3D4LA 2FUNB 4HR7A 3K92A 3TLGA 6ADHA 2F1HA 3VNRA 1O8BA 2ZOSA 2ZAGA 4C20A 1K6XA 5IN4A 2WTAA 4JBLA 2GCEA 5HNKA 1PG0A 4QUGA 2P8SA 4GSYA 4B3GA 3HYLA 2YWBA 5J47A 2CK3A 1P1RA 4MNTA 5GVSA 2VIIA 2BZSA 2XWBF 5K4AA 3V8MA 1Z4IA 5ALDA 5K8LA 2ZZKA 1U0OC 2BKUA 3DP7A 1XJ5A 4GBGA 1NLMA 5REQB 3H17A 1AKVA 1AZWA 1JU4A 1O6GA 1XFAA 3JQ6A 3JQQA 1OFTA 4FZVA 4LIPD 4G97A 4NFYA 4Q3CA 3SDSA 5C0OE 4GOXA 4DMFA 5KJ6A 2GM4A 1GG5A 5DISB 1N6OA 2Z09A 4GZ5A 4I9GA 4QFMA 5EWJA 4Q21A 3KJFA 2WU1A 3N2KB 1KKUA 3A3NA 4X1IB 2XNSA 3STHA 5A9SB 5T3UA 3KUDA 3SAJA 4KAFA 1MJGA 2Y1XA 1ZJ6A 4JB2A 1ZINA 3KWJA 1PX0A 4OI2A 2VTBB 1YR6A 4GRAA 1PZGA 2PKYX 4AKTA 1IEQA 1MF7A 1NXWA 3OEHA 5LBTA 2FR8A 1ICEA 3RRMA 3RUEA 1KI2A 3FKSA 3H9QA 3OZGA 1UZUA 5M34A 2PZEA 1PEKE 4YROA 4ZTUB 4RD3A 3A3PA 4E5NA 3OPXA 4HQOA 4DDHA 3TTWA 3HB7A 4JVMA 3V1NA 2TMYA 3OOJA 2QNIA 5J4VA 3ER9A 2WVHA 2XE8A 1J42A 2Y1WA 3I5AA 3QA3E 4MVJH 4M9XA 4Y2YA 2HQRA 3N53A 1CHDA 2DWCA 4WVFA 4OMFG 3DFKA 5DHPA 2FVXA 2OG2A 1D1TA 3EBLA 4YCAA 3OPYI 5E7MA 5FUVA 1AKQA 4D0LB 4BMYA 3HB1A 1PKXA 3PNSA 5EPOA 5FI1B 3THWA 1SXJC 5CGZA 4F97A 2AV6A 3KYCB 1B2RA 4CUJA 4HUJA 5DRTA 3G17A 2PEZA 4HADA 2HA0A 3OH8A 2PBRA 4B7AA 1LD3A 4MWZA 1L1FA 1I4TD 4PYJA 3VOSA 2D0DA 3S81A 3FCSB 4W99A 4KWTA 1GCIA 4R98A 4KXNA 3ZWQA 1W8IA 4CM9A 1FE8A 4MW0A 1L7RA 4L02A 5A4FS 4ZCIA 1IY8A 4JD5A 4REQB 4ZO6A 2ACEA 2YJGA 1Q44A 4L9RA 1UP7A 4UC0A 2BY4A 3AZOA 1QR2A 4X20A 5CTJA 3KQKA 2O5EA 3CUYA 3FWZA 4BGEA 5I5GA 4D45A 3DMNA 3UJBA 1OLXB 1SBTA 2J4FA 3PLRA 5K03A 2CDCA 3CNOA 1QQBA 3MRSA 3EW9A 3UMVA 4JBYA 2QTNA 1II8A 1TKCA 3GNSA 4E3WA 1PTJA 2DHRA 1ZH8A 5H9WA 4B4OA 2V7QA 4FONA 1N9GB 1T9ZA 3JVIA 3KT8A 1X0XA 1X1QA 1XNHA 4YMLA 3DR5A 4L8FA 3EHDA 4L16A 1H8EA 4CW7A 5L3RA 1HQKA 2GM9A 4K9OA 3F5DA 2GAFA 1YS4A 1ZFNA 1GAJA 1W85A 3K0CC 2W0SA 1MX1A 1GGKA 2X4IA 2ZWIA 2YHUA 1AD2A 2AK2A 1E7RA 1J0DA 1HE4A 2VHYA 1KO8A 3DBIA 3MA0A 3ZCSA 3GJ6A 4DRYA 3GP8A 2PQ2A 2ZWAA 3MTEA 4J0IA 4RO0A 3REGA 5JZBA 3I0MA 4IOKA 4PCAA 1QYVA 1RTTA 2QLMA 1KAGA 1Y63A 2OOKA 3DBRA 4HAYA 2FX5A 4K46A 3TW8A 3MTQA 4F3NA 4QNNA 5DI3A 3UHAA 1G20B 4AJ2A 3AESB 2I2AA 5GJCA 2I80A 5JQGA 1F14A 1GG9A 5CCDA 2RHOA 3IHLA 4ZYZA 1JECA 1PJ8A 3FMIA 4LX0A 2FWBA 3LWDA 4L3OA 4XIGS 5FUYA 1GGHA 4EKIA 2X1VA 5BV8A 2Z6UA 2CXNA 2B34A 4OU5A 2WDZA 4RETA 1XTUA 2WFZA 4G5OA 1A5AB 4L6CA 1GNSA 1ODJA 2BL4A 2WUGA 1M2VB 4HOYA 1L5KA 2GYUA 3ZLVA 4W5JA 1VB5A 3EA0A 2JGKA 3RSCA 1HXHA 1EQUA 4HGOA 3ULKA 3ND9A 2C59A 1EINA 5IJAA 4XVQA 3WOVA 2ZRLA 4YPVA 2G7MC 4IJKA 1XELA 5CB4A 1YZKA 2JAPA 5JFGA 4JUFA 2Q49A 3DO8A 3R8FA 1LTKA 4N0MA 3OX3A 4BX0A 3AVPA 2OSVA 4DE5A 1MKYA 3EFOB 1HE5A 1QPGA 5AHOA 3VU9B 1EP1B 2R60A 4TS1A 3A0RB 1R0SA 3F7OA 4N6NA 2KM1A 1CRZA 2YRXA 4H4EA 3V8VA 1QDLB 2OY0A 5ECGC 5AW1A 1L7OA 3EWNA 4KAXA 4UARA 4DAOA 1PJLA 3QLVA 1ORIA 2QL6A 2PUFA 2H7VA 4YJFA 4HYYA 5TPZA 2GK3A 4TLDA 4LC1A 4N47A 4HBZA 1E9VA 3MT8A 4FB4A 5KU1A 2FFBA 1KI6A 2NPOA 1BEZA 4EF6A 1GZ6A 2FFAA 3GFOA 3V9AA 4C76A 1E64A 3MUOA 1E61A 4U7PB 1UFQA 4KUHA 4EKDA 5LYJB 3DDOA 5ICGA 2WHEA 1EDEA 2A88A 4ZAYA 3KQPA 3O4GA 2M6LA 4K05A 1SJ9A 4O33A 5DW3A 3VR5A 3CUSA 2RH4A 1K6MA 1PFWA 3UJHA 3RD5A 2W48A 3HUFA 5FOQA 3WLNA 4NQRA 2PL9A 5PNTA 4B44A 5DNYB 3F8SA 1QQ6A 2EJTA 1TZMA 4GD3Q 4D41A 4Q4DA 1WKCA 1J49A 4YRJA 3E9NA 3K7EA 4HJRA 5LWQA 4HD8A 4K9LA 2FZCA 1ISPA 2IEYA 1U9CA 4B34A 4F4JA 3FETA 3ILXA 1Z28A 1AOXA 1KZ1A 2C4VA 4OFBA 2MCFA 3R0VA 4ZOQI 4YAEA 5AHWA 3BILA 4BWFB 3WSVA 2EFYA 4Z8XA 5FJIA 2LXNA 5I8PA 1TA4A 1FSZA 3BMCB 4FJ2A 4KO1S 5CD9A 1GUAA 4BMDA 1L7PA 4MW9A 5JH7B 4ALMA 2O2SA 1KU0A 2HHHB 4AKHA 2L17A 3VJLA 1F8YA 2WIBA 4ND8B 4LFAB 3ZLJA 2XQKA 4XFKA 3GO4A 1MRZA 1V1MA 3HNOA 4LRYA 4B6QA 2HLHA 1Y8AA 3Q3HA 5F4ZA 5LKAA 3WIDA 3HTXA 2P4HX 1ONBA 1SA0A 1YTLA 1BQ4A 2I7TA 5DJ5A 2PXCA 1B0AA 4OJKA 4X7BA 3HKDA 3P20A 5BN3B 3IR6A 2ATIA 4Q4AA 5EQDA 5DBHX 2ZI4A 1XTSA 5IABA 1L5HB 5DBEX 4EY3A 2ZE6A 3D2AA 1XZIA 5AOVA 3ESQA 2G3YA 2W6QA 3LNTA 1MO6A 3OE7D 1V11B 2HC9A 2J3DA 1IHPA 1EP2B 5BR4A 3AUFA 1PQYA 4DV5B 1MX5A 3T1YB 5K01A 1E6KA 3ILYA 1RLMA 3DM5A 1SVSA 4YRAA 2ERCA 3BG5A 3ASVA 3MCTA 2I6UA 4UBOA 1V43A 4CKWA 2HRCA 4RK5A 1RYDA 3RSHA 2O3RA 2NZYA 2R2AA 1QH0A 1CV2A 1EFPA 1ST2A 2RFLA 3BX1A 4V24A 1ZH0A 3BC1A 4ZAWA 1QIDA 3CIFA 4GL4A 1N5DA 2J0UB 1AK2A 3G2LA 3L7JA 4Z0NA 5JXJA 2V6BA 3D8BA 3KSMA 3QKTA 4JLVA 1LBTA 2GXAA 1U9IA 5LA6F 3ZD7A 1M9NA 1MZPA 5AM3A 1P5FA 4QVGA 4UCFA 1VKNA 3ZWKA 2PUVA 1Q0TA 2XKBA 2X9NA 4D8XA 4OQYA 3ZQ6A 1OKKD 3B6MA 4JT8A 3QVXA 2Q2NA 4ND5A 5C31A 4U2CA 4GX0A 4MQ5A 5JRJA 1F5SA 2QLBA 4E3ZA 3J7AC 5DOVA 3DDNA 1KXJA 4NZOA 3L4KA 1IN7A 1RYZA 2LKCA 1UQTA 3D3WB 2HTEA 3C3PA 3QXXA 4ITRC 4K6GA 5HQ3A 4FCWA 2W00A 2JDID 1FBTA 4E1AA 3QPCA 2DE0X 1V5WA 1MENA 3P97A 3OJCA 3L6OO 1P45A 4FCTA 4JU8A 4H0NA 4Q7MB 3SK0A 5I7SA 1MO4A 1Y7IA 4JZKA 4WPGA 3IMEA 2G36A 1GXSA 1FDIA 1EVYA 1GHTA 1SHLA 4X91A 3P19A 3BGOS 3O4HA 4HQ0A 1ZXBA 2FMXA 4ZQIA 4K9QA 4LHEA 5E3JA 3ZV3A 1Q6YA 4D9MA 2GUGA 4F6RB 3LY9A 2IS4A 2NTEA 1RBMA 1YB5A 2FFRA 2AVDA 3AUTA 3GEEA 2OECA 3KQOA 4IIXA 3QMWA 1MH1A 5FBRB 1T8WA 1XUOA 5KC8A 2QIOA 2M1XA 4V0QA 1L7VC 4PRLA 1NMZA 4ZICA 3O5AA 3WRVA 4MKHA 3R0IA 4OSOA 3VR3D 4DQKA 1PK8A 1YU9A 1KI4A 2O7VA 3FB1A 3HXKA 2RCNA 3RTDA 1JWLA 2WSIA 5B7PA 2I1VB 3KPUA 3SYMA 4CR6A 4G23A 3SZGA 5JS1A 3N8GA 5B2FA 2BE7A 1W73A 2JVIA 1G9SA 4PF1A 3UW3A 1LBSA 3KVYA 4MGYR 3S8YA 4A2CA 1LS1A 3VTZA 4N1AA 2BI4A 4G0XA 1AQUA 2OP0A 4LVCA 1MT0A 1XXHA 2PQ6A 3PHIA 1GZVA 2WOJA 3SGLA 2VP4A 3B51X 4IJ5A 3I1YA 2GYVA 2ZBDA 4KK3A 3VAAA 3KRTA 4O2LA 1QOZA 3KOUA 3QY9A 5AOAA 1B41A 4F3YA 1KJ9A 1T5DX 3QITA 5LB2A 4KXVA 3FCCA 3DQZA 4ECEA 2RGEA 4LK3A 3RGWS 3ZZMA 2QNRA 2V8OA 4ZI2A 4M6WB 2DETA 1XMJA 1PNOA 3DM9B 1W8DA 2UZ1B 4J91A 3ELBA 1ZITA 4GOOD 2ABWA 1XZLA 4NC9A 1MVLA 2AN3A 4QLAA 2FN8A 4WY5A 4HDKB 2NU6B 1VL8A 1QJCA 2OO5A 1ZK1A 2C1XA 2I4TA 2GJ9A 2PHZA 4M7WA 3PX3A 3CVJA 1M1YB 1RP7A 3BHMA 1GKUB 3AV3A 4BJ3A 3AIOA 4KFCA 1ESCA 4B76A 3D6HA 5HE9A 3M1IA 4RU1A 4QEKA 1QYIA 1RKXA 4FU0A 4YRCA 3A9TA 4B3CA 3IMFA 5I01A 1USVA 4NARA 3INNA 3L0PA 4EW2A 3HJRA 3I9V6 1JLLA 3N3AC 1EX9A 4GMGA 4QYMA 1C8LA 4OK3A 3T1TA 2HH9A 2ZIEA 1DZIA 3BJEA 4RHUA 2LP4Y 3QHQA 5L3QB 3K20A 1V8BA 3EGCA 1H1TA 4M9UA 4W9MC 3MWJA 3EQZA 3FLMA 1C7ZA 2ZDGA 3RRXA 7REQB 1E62A 1V8ZA 1TQHA 3LBIA 3WL4A 2FTKE 2O3QA 3O9VA 3OWHA 4GR9A 5FPSA 3V3TA 2GZSA 4IJ6A 5KX5F 4NBUA 1V3TA 3FHCB 3AIIA 3C0KA 4V0NA 4EHKA 2F4VB 4NF2A 4NZ9A 3NEAA 2WINI 2J3QA 4RPHA 1Z4KA 2Z6QA 5AMXA 4Q1FA 3LDAA 1SVUA 3LHKA 1GUYA 4RENA 5GWXA 4XA8A 1EIWA 3C3MA 3NYWA 1R5BA 4D1YA 2P0YA 2CNLA 1VL0A 1MT3A 3HI6A 4NDNE 3AHJA 3OU2A 1CU1A 2PUWA 5KYUA 4EMTA 1JIUA 1NX9A 3WJ7A 4GP9A 2D2VA 1DBSA 2OAGA 3ZE7A 4UUAA 1ZEJA 3U44A 4CU5A 2QTHA 2HZ7A 3F6EX 1VJGA 3V9PA 4QUEA 3R7WA 1PWEA 2P1ZA 3M6WA 4BDSA 3VHLB 2LDXA 1GGFA 2APJA 3E8MA 3UTDA 2MTBA 3H1TA 2ID4A 3L0YA 3FGPA 5LXTF 4LHYA 2LPMA 3UG7A 1PQ4A 3M4XA 3WK6A 1C7QA 2Y1OA 1XCJA 4WX2B 4AZWA 5JS7A 3ZU5A 2QT1A 5EUQB 1QG4A 4B4UA 1JG4A 4R16A 4YJGA 3HCAA 1YB7A 1NRXA 3NBUA 3KT6A 1CQIA 5TSDA 4RWEA 4F9GA 4PC2A 2XRZA 3F5QA 5TQJA 4GUDA 1RM0A 1LLFA 2E0IA 2NXNA 3GPIA 3TVDA 1LX7A 4EFKA 1MV8A 2D2EA 4M60A 3ER8A 1LNQA 4D6PA 3W3AD 4QREA 2CLMB 2ONKA 1YQUA 1KZ6A 5JCOA 1GPH1 1J2RA 2YFQA 4EJSA 5E1OA 2KWIA 1YDGA 5ILGA 4RTNA 4DQDA 3BXPA 2VBGA 4IKEA 8LDHA 3BMQB 3RK1A 1MTOA 1F7UA 1EHYA 3DV0A 1T4BA 5CB8A 3CG4A 1XEWX 4LWOA 3JQAD 3PQCA 2CF6A 1KKMA 4P8RA 4WJKB 4OI0A 4P4TA 1JLMA 2W71A 3G7NA 3FBWA 4PR3A 5DMHA 3RHFA 3KXLA 3TAHA 4C7XA 3D8NA 4I19A 2ZJ2A 2R1UA 3EW7A 4NP6A 1QHYA 2TMDA 4AVYA 3NBAA 4B3IA 2GD2A 5B4VA 2AIRA 3I05A 5T64A 4IXWA 3S1AA 2GN4A 3GEMA 2VF5X 2QTAA 3EJ6A 3Q4GA 2IEIA 3OLYA 5JWHA 1NVAA 4PAOA 2Z9BA 3RRZA 1E2MA 4B7UA 4DYHA 5IXYA 4MV7A 4EA9A 3TBKA 1QG6A 3HJBA 3GI1A 4AECA 1ZQ1A 4AZ0A 4E5SA 1WKBA 4PPFA 2WJVA 2GLUA 2QR5A 4FFVA 2CKMA 4I1OA 2A1UA 1GEEA 4PAMA 3R7FA 2AJCA 3U0VA 3OQIB 4ZU3A 4A82A 1AV6A 4NYIQ 1QLWA 5AR1A 1GSAA 4EB8A 3RADC 1AKYA 1CG6A 3K9NA 3M82A 4UAVA 2Q0SA 4ZOLA 3WOHA 3FTCA 1DJQA 3O75A 1YI1A 3ORFA 1CJMA 2OQRA 4PX2A 1RQRA 1T29A 4WXPA 3OUTA 5FPHA 1BXZA 1NP7A 1U6IA 2OHFA 3L40A 4LDAA 3JTMA 5E1BA 3L8EA 1K2VN 3LCCA 1V96A 3MT7A 3GJSA 2X8JA 1Y0BA 3A6DA 3U19A 1SKUA 2PBZA 3WXBA 1JNXX 1XRJA 1JF8A 3OY2A 3VGPA 1YHZA 1JIXA 2JLRA 2Y77A 3WO0A 4RTPA 3B20A 1NBOA 1Z38A 5DXFA 2Z3WA 4U6NA 3ZHRA 4XCVA 2WA2A 2FE4A 4OEHA 1VZ2A 1BXGB 2M6RA 4TMYA 3TINA 4E2WA 4UEKA 1ODSA 3T9DA 3I42A 1BX0A 2RK6A 3IUPA 2O2CA 2UZ3A 2WYIA 3GXBA 5KHLB 4AZSA 1DI0A 3OLWA 1I7LA 3DE2X 3HPRA 2JJ2D 1QTNA 3UB2A 2VA9A 4DJDC 2JBAA 1E3QA 5LZ5A 3STWA 4D3SA 3NMUF 5M29A 1D4OA 2HF9A 3IVXA 4M0UA 3R75A 3RQIA 1KXZA 2FKNA 3IRUA 1ZH4A 2CJYA 3AUKA 5ALHA 4C4ZA 5CAEA 2WE8A 4FMCF 5FBQB 4LWPA 4HYTA 3M4JA 4X1OA 3OQOA 5HUHA 2PRSA 3B52X 2G9RA 3M6AA 1K7YA 2H2GA 3M4YA 2RKBA 5CRIA 4YRDA 5DYNA 5LUAA 3RVLA 2P9BA 1Q77A 4ZRDA 1W6RA 3BE8A 2UZIR 3JAKA 4XB2A 1JR4A 1YQTA 2ZB8A 3HNRA 4HPXB 1I3CA 1H2RS 3N5KA 4GQAA 4HFMA 5JSKA 1QWSA 1PAUA 5D01A 5C3MA 1J8DA 1OASA 4M54A 3Q9LA 4X54A 5JPDA 3E5HA 3EGDA 1TU0A 4FDTA 8ATCA 3C7TA 2BCJQ 5EXXA 3MQFA 3DBVO 4YAUA 5JDIA 2DQYA 1G1MA 3C1OA 5ALTA 2C77A 3IPCA 2CYAA 4OH7A 7YASA 1VHTA 2WILA 4DT1A 5IHPA 1M34E 4J4BA 2EBFX 2X58A 1XDSA 4RJLA 4Y9UA 4YTEA 2L0XA 2Q3FA 1IK6A 2G76A 1G8YA 1N0IA 1W0CA 3OHSX 1AU9A 4NWIA 3BDAA 4YBRA 2GEVA 3VR6D 1M1NA 3OX2A 3VPGA 4ER3A 3UGJA 4MQBA 4QKQA 4GM1A 2NQ8A 1SXIA 3GPCA 1K8YB 2FP4A 2PUDA 1TZKA 3GA0A 1QFSA 1KC3A 4JEIA 4ENVA 3WNCA 3O8QA 2FGJA 1U7PA 2QX8A 4G0MA 4TYQA 3IIMA 3UGKA 4W8HA 1X8KA 2IH4A 1CR6A 3H9CA 3BQNB 2O05A 4TTTS 4B32A 3E22A 1NJSA 5LSAA 3I30X 5LQKA 2Q29A 3DFMA 4RQBA 4R1MA 2ZCVA 3BZUA 3R74A 5AK0A 5KAMA 1A77A 2J7KA 4I4TB 2FA9A 3TJZA 3PNQA 2Q7XA 4CM4A 1XU9A 2PLAA 3TXYA 3I3OA 1SIBE 2D1SA 4Q1EA 3ICPA 2YWGA 4AJHA 1AUQA 1VYTA 1Z0SA 2JFBA 2P1DA 3DKVA 3MS4A 4HUQB 4TV9B 5FUBA 2RBEA 1WHSA 4MQFA 3EMDA 3VYTB 5SZHB 1T9KA 2NU7A 1Q1ZA 4XAQA 4HP8A 3RHZA 3LRXA 4KYVA 2FU5C 2CJPA 4ZV4A 3WC4A 4RA9A 1LPBB 1ZRNA 2EAUA 3LC0A 4BMVA 4BQSA 5JNUA 3E9MA 2P6RA 1XMPA 1E3WA 3ZD9A 2CNBA 3A3KA 2IDMA 4BE7B 1JHVA 1FMLA 4HY3A 2V9CA 5F9FA 3HHPA 4IUCS 3THRA 1QRUA 1TUGA 2A92A 4NOLA 2NZUG 1IULA 1NU8A 4R68A 5IARA 3BT7A 3PUWA 1RWPA 3CINA 2RI6A 1JLHA 5HZMA 4PZ0A 3E53A 1XU7A 4RMNA 2JH3A 3P9RA 1FYEA 1W59A 3WWYA 1ZXXA 5ADUS 3DMRA 3HYRA 4CCYB 2BFBB 4F8JA 1PG2A 4HWOA 2ZCJA 3TZHA 4UBMA 4NEQA 1KTVA 3PWKA 4OY3A 3RPEA 4B7XA 4BNZA 2I6FA 1L7DA 4MI3A 1WSBA 4U6SA 4YYEA 3IEUA 1DFGA 3C8DA 1RZRD 5KOIA 3GPDG 1YRBA 4LK2A 3WGOA 4M1KA 4DARA 2YL2A 3A1CA 2VCEA 1VKJA 1CE8A 3EZNA 2H06A 2I2WA 1MHPA 4LE0A 3KKNA 1Q83A 5TDHA 4WFIA 2FZKA 3HCCA 1COWA 3K1AA 5AW4A 1N2HA 4ZJZA 2GPJA 4Y7DA 4U7WA 4RH3A 4D0GA 2LNDA 2N42A 3LPCA 3RUAA 1OLOA 5EE1A 4G0VA 1FX0A 3A6KA 3GRVA 4GDFA 2A1TS 4I4LA 4KH1A 2EOAA 3CV3A 3A4TA 1NG9A 4LDZA 1G5RA 1EM8B 1KEVA 1UADA 1JQDA 1I2AA 1YZFA 2GAJA 3NDRA 1OBOA 1WPRA 3B1FA 1E1QA 4MV4A 4PFJA 3ZBPA 2KYRA 4A0SA 4JHLA 4URWR 1N0UA 3VOBA 4D8TA 1SZCA 3BH7A 3HJTA 2O1XA 5CM8B 1FJHA 4IGAA 3RWMB 3KK0A 3UHPA 3UMRA 3W77A 1DAFA 2ZRIA 1E3TA 3GAFA 3FFBA 3IV9A 3NC4A 1UKVY 4Q15A 3QVJA 2BM8A 1O08A 1T4GA 1IY9A 2J7PD 2OBBA 3BIFA 3IO5A 5E9WA 4A0GA 1H2BA 1NSTA 2XZOA 3KCNA 3P71T 5ES3A 1EVZA 4XGNA 2ZJ0A 2R8BA 2AN5A 3DS8A 2E9SA 5K3FB 3FOEC 1DKLA 3G2HA 1RNLA 1ZUWA 2QMHA 1BFKA 4X71A 1PNVA 4WCVA 3AUXA 1R0XA 3PE3A 2I8AA 1U81A 4FIDA 4YH1A 4CDGA 2F3PA 5I9LA 5F2NA 4IV0A 4R6XA 1EBUA 1ZHHA 1AURA 2IF0A 2OFWA 1HV8A 3ZU2A 4L0CA 1YRYE 3EZ9A 1YI0A 2IXBA 5A71A 4D79A 4WECA 1Z7BA 3GMDA 3LDHA 1HLPA 1Q0LA 1DWUA 2F6RA 2AMYA 5DBFA 1Z4NA 4IUYA 3BGWA 2O5VA 1O96B 3PEUA 4R1UA 4EHFA 5JSUA 4HAVA 1Q20A 1CB7A 1ODLA 1VLVA 3AJEA 3D3QA 3M6VA 4UVDA 1TEZA 3AZQA 2ECOA 1UXOA 1ULZA 3OHPA 1KJYA 1Y42X 4FJ0A 4Q6WA 4YAJA 5FNVA 4E4TA 1XAGA 3L2OB 2X6RA 4YV2A 1PD1A 1EVLA 2PXAA 4IIFA 1BHSA 2WJYA 2IXEA 1LKZA 2P69A 2RH9B 4A6EA 2IHNA 3GLRA 3R20A 4L27A 2PLRA 1TB4A 1TMOA 3AP2A 3ANTA 3OAAD 3T9FA 3S2SA 1VE9A 2BHLA 4OM7A 1GNLA 1PP4A 3N0TA 5EJ9A 4EBBA 1QHEA 4NE2A 1AZTA 4NCKA 1NQOA 2IEBA 3HXTA 3ILSA 4EQ6A 1KE1A 3RIHA 5K3EA 2JASA 3EAQA 5IH3A 1E1YA 1P9OA 1UMKA 4TOIA 3F8TA 1M8KA 3L02A 1VCIA 2XV1A 3QX9A 4GOND 1JUDA 3JW8A 3SR3A 3R3ZA 1BDMA 1NJ5A 5C32A 4LW8A 1Z4QA 4AULA 5IG2A 4BB6A 4ZOEA 3RK4A 3A7EA 1FP4A 1OMOA 3UHJA 5B3JC 4LNAA 5I3CA 5JQGF 5BXYA 3NX4A 1AT1A 3UK0A 1XEWY 4FQ7A 2QR3A 4H6WA 2XH8A 2UVPA 5TGZA 1ISMA 1RBQA 4HYQA 5ENZA 1U0EA 5G3ZA 1DV2A 4GMFA 4DQUA 1E7YA 1GCOA 1SBNE 1R27A 2JAXA 3RYIA 5FWYA 3AX6A 5A0FA 1DELA 1EUDA 5TMPA 4R1PA 4HL6A 5E8JA 4INZA 1XDWA 2C4NA 2G80A 3AGPA 1T3LA 2ZG6A 3A7DA 4OIFA 4ZVUA 4JI4B 2RJOA 1N2XA 2VI5A 4S1TA 3JCZA 3ZWNA 3T7JA 4QSHA 3HG7A 4YAOA 4B09A 4B2IA 5CB4F 5AVQA 4YEDA 2KPOA 5FUWA 4NVRA 5JS8A 1TADA 4R1LA 2BMWA 1PRYA 2PZFA 3LZDA 3TSWA 1EEXB 1YJBA 3FM9A 3KJQA 1SD5A 1YL5A 4MI1A 4PBSA 2WQ7A 2I99A 2XOXA 1YR9A 1GSOA 4JT4A 4LG1A 4TN1A 1NSYA 3HCPA 1BQ3A 3G02A 3OP4A 4XYGA 1PFVA 1QM5A 1SFRA 4ND6A 1GQYA 3ETNA 1CY1A 1IRXA 1UBMS 2C00A 2W6CX 3Q2IA 4LXTA 5CHEA 4QT4A 1CF4A 3I3SR 3MCUA 3N2GB 1THGA 2RIRA 2XUJA 3G2KA 4FOTA 2PR2A 4HX2A 3MPOA 3PCXA 4OB7A 2DYKA 1WXEA 2VTEA 5DYIA 5BXQC 3RSLA 2J87A 3BBLA 3IE2A 4QYXA 3HVUA 2ZPTX 4BVHA 1FTGA 1ULAA 4CYMA 4GI7A 1ZSYA 1ML4A 1HNNA 2JFYA 1GV0A 1I3MA 4OHYA 1UBCA 5AW2A 3EAGA 2VZLA 3TNYA 4DLBA 3RTAA 4EL0A 2C8KA 2P9EA 3ELWA 2ZDHA 2A2ZA 1ZR2A 1SVLA 4RGBA 4YR7A 2HA5A 1Z0IA 4ZIRB 1SPBS 2R5NA 1QIIA 3HMKA 1FFDA 1M2OB 4J29A 3WGJA 3LLVA 1O0SA 5KKCA 4AQYB 1NAIA 3PHJA 2M1ZA 3EF0A 5AKYA 1H1DA 2E4YA 6YASA 4WGGA 1VPVA 2HJRA 3ETGA 3HDYA 2JD1A 3PL5A 5T6MA 4B8WA 3FAKA 2H92A 1W0KA 2DERA 3HBAA 1LZLA 4F2HA 2EW8A 3GEBA 2W9XA 3HB0A 3ME5A 1P0FA 3ZXSA 5KWJA 2PKQP 2JCGA 3NDBB 4R5MA 3O8LA 4Y8VA 2X41A 5DGIA 1QGDA 1LRKA 3IVCA 2Q6TA 3R3WA 4K6KA 1A9PA 4OL0A 1FNSA 4K86A 4X44A 4Z5XA 5BMVB 6GPBA 2FQ1A 1WAMA 5CCEA 4FFSA 1PJRA 5HK8A 1HLGA 4O08A 1BRTA 2YHIA 2C3PA 4DMUB 1EAYA 2B5OA 2FEKA 1EFAA 5B6IA 1CUUA 4EG7A 2P78A 2EC5A 1DGQA 1N6HA 1TU4A 2AXQA 5EIWA 2W4IA 2X86A 2XQFA 3A70A 3DZKA 3Q7RA 4C78A 4EVIA 1X7WB 5THXA 4G4GA 5BMOA 3AKDA 5CVDA 3R7SA 2A6PA 2FV8A 2IEDA 1G6Q1 2VJMB 2WJ3A 3GGCA 3OT4A 1AQIA 5T6BA 3I28A 5TF4A 1L5LA 5A1JA 3FZQA 4XWAA 2FWIA 1J39A 1I1QB 1LVGA 1T6ZA 2Y2VA 3MT0A 4LJ6A 5KYXA 1UK6A 1OZGA 3HCRA 4Q3EA 1QFXA 3R3HA 4L6AA 3SJ7A 2ET6A 3NHAA 3L4SO 5A1TA 4JJ4A 1JKXA 2AFIB 1YE3A 5IT9A 2HSEA 5IN5A 2HA4A 1JEOA 3B12A 4QT0A 3IBCA 4OMUA 2WAOA 5D1HA 1BVUA 3U61B 3ENQA 3L79A 4LJAA 5F1KA 4N5LA 2VH5R 4YWHA