2QQ5A

Crystal structure of human sdr family member 1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
238
Chain Sequence
APMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human SDR family member 1.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Dehydrogenase/reductase SDR family member 1
total genus 88
structure length 238
sequence length 260
ec nomenclature ec 1.1.-.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qq5A00
2HK7A 1U2GA 3QVWA 2Q1SA 3E9QA 4RORA 2JCYA 1LBEA 3E18A 3ENKA 4KWHA 2J5KA 4XCVA 5LDHA 2QRJA 3GH3A 4KUGA 3SJUA 4Q3NA 4F45A 2WDZA 3I5MA 3V8BA 2NUAA 2FSSA 4WCDA 1GR0A 2JD2A 1HT0A 3ROQA 5FWNA 2ZTMA 3O26A 3EC7A 4PLZA 4U0JA 1DFHA 1IUKA 1BXGB 5G2OA 2EWMA 3F47A 4R1UA 5TJ9A 3WSVA 1HZJA 4HFMA 1DHTA 3RFTA 4I1IA 3E48A 5IZCA 1YL5A 3ONDA 4PIVA 3Q9UA 4TVOA 4OOEA 3L4BC 4E31A 5TX7A 1DLJA 1TXGA 4CL3A 2JFGA 4IPTA 3ZNQA 2BFPA 4CMGA 5TRTA 3RUHA 3ZU2A 1KVSA 5A5FA 3RVDA 3ZWOA 1YKFA 2EV9A 5MGBA 3PK0A 1ISMA 3UF0A 4A10A 1CWUA 4Z9XA 2EP7A 2I67A 5I9MA 1ZKMA 4BNYA 3TN7A 1P1KA 1YQGA 3Q3CA 3ZWVA 3WNQA 3JQ7A 1WDLA 4B8ZA 2HJSA 2Y93A 4TKMA 1ONPA 4I5DA 1EE9A 5JCJD 1FDTA 2BKAA 4TMFA 1GZ4A 3VH3A 1P9LA 3BTOA 3ZHZA 5JCJA 2HMWA 4AJOA 1T4DA 3VH1A 3ZWPA 3OJ0A 3G1UA 3CINA 1B7GO 4YAJA 1E1LA 3W6ZA 2Q4BA 4WJZA 4WASA 3PJFA 1IZ0A 1GD1O 5TF4A 5L53A 2EG9A 1ZBQA 2HMVA 3K92A 2VNSA 1DPGA 2Y68A 2Z95A 3FSRA 4J6FA 4MIOA 4W4TA 3UXYA 1UJMA 2FSVA 4J1SA 1C1DA 2F1KA 4CUKA 5JO0A 1NM5A 4RF2A 1Z7EA 1P1IA 4GAEA 4KUHA 4UREA 1KVTA 4N5NA 5AVOA 4CM9D 4UVEA 1GQYA 3RUFA 4A27A 4PN3A 3U62A 3TFOA 4R3WA 4HFRA 4YCAA 1Y9AA 3ADPA 4NK5A 3BXXA 1HSOA 2JCXA 2R6JA 4U8GA 2WM3A 3CEAA 3IUSA 4E30A 1Z45A 3FPCA 3DZKA 4HP8A 3EDMA 4DIOA 2VWGA 1PGOA 1PJTA 2X9NA 3HHPA 4A03A 3JTMA 1XSEA 3C85A 3WYBA 3WX0A 3GF4A 1ZW1A 1WDKA 4BO9A 2D59A 4UVDA 4CODB 3K96A 3KV3O 2UVDA 3U4HA 2Z1NA 4BO1A 1ZFNA 1HWYA 3VC7A 5CDUA 1YE3A 2VZ8A 1TA4A 1A9YA 4I08A 4IM7A 4HY3A 4HFNA 4EEZA 2EIHA 3N58A 4NFYA 4R01A 5DNAA 4OH1A 3ASUA 1M76A 1RM5A 1H6DA 2IE0A 2LDBA 2VN8A 3ZV5A 4GX1A 3CUKA 4CL8A 2O23A 4RPHA 5G4LA 3JQ6A 2EW2A 1ZK4A 2RH8A 3I9KA 2D0IA 4RPKA 3PI7A 1XHLA 5DZSA 1GCOA 4IJWA 4YWJA 4EUEA 3CMMA 2PY6A 2HO5A 1E3WA 2D5CA 3F5QA 5ITVA 3DO5A 4CM6A 1Y5RA 1PGJA 3FNGA 2YHIB 3L77A 2NVUA 4MINA 1GL3A 4WECA 1K6IA 2J3JA 3U9LA 3OJFA 3S2IA 2NWQA 3WGQA 3ZWAA 2VQ3A 5L4SA 1U9JA 2W8ZA 2AW5A 2Q49A 1YXMA 4NU5A 4RQTA 1Z82A 1IE3A 1PQUA 4OYRA 4PLFA 4LSMA 4FS3A 1C3VA 1P44A 1XGKA 5I7EA 3H3JA 4CLEA 2QX7A 1BXKA 5JAQA 3BZUA 2ZB8A 5JDCC 1T2AA 4AL4A 2BMAA 3DTYA 1M2WA 4DREA 3CSDA 2CVQA 4FSHA 2YY7A 2CD9A 1VKOA 3DTTA 1KOLA 5JNLA 1UAYA 4CLOB 1NNUA 2X9VA 1MP0A 2EJVA 2Y1GA 3K30A 5B12A 1P0FA 3S2FA 1ZVMA 3C7CB 2GPTA 1Q7BA 4IJKA 2X23A 4UEOA 4J2OA 4P8RA 5KJEA 1ULSA 3QWBA 4BKQA 1WLYA 4YJHA 5L4LA 1EK5A 1QYVA 1DJQA 4MVJF 4AJJA 3VPHA 1UAGA 1YBAA 3JQ7B 1RJWA 3OP4A 3EVNA 2Y66A 5T64A 1PR9A 1YOVB 1MUUA 3QJ5A 2C7VA 3AU8A 2D3TA 3TPCA 1HDRA 1DB3A 1EQ2A 1LDNA 3WGZA 1DHRA 4CMIA 1D1TA 2WYUA 1T1SA 2O3RA 4NJMB 2NACA 1NAHA 3O38A 2DBZA 3PQEA 4B4OA 5B1YA 2RH4A 2BGKA 2HRZA 3OA0A 4J16A 3RC1A 3RBXA 3PHHA 3H5NA 5GZ3A 3W8EA 5H81A 3BMCB 3Q6IA 3MJSA 1ZJZA 3PJDA 4YQZA 5TC4A 1ENPA 2OMEA 3QIVA 3MCVA 4KQXA 3AJRA 5ICMA 3DFZA 3WG9A 3AFNA 3OJOA 2W4QA 2GR9A 1Z75A 2DUUA 5TT1A 4JBGA 1JWBB 2NTJA 1YB4A 3SEFA 2AG8A 1C1XA 1XKQA 3H4VA 5EN4A 1A5ZA 2GNAA 5K6AC 2JJYA 3JYQA 3HDQA 1NR1A 1CQJA 1LDGA 2NQTA 4FD3A 5JDCA 3AW9A 3VHRA 3DZHA 1ISHA 1WDMA 3DB2A 2JFHA 3ANNA 4CM4A 2H9IA 1EZ4A 4TRJA 2ZCVA 1GUZA 4M1QA 3WDSA 3HN7A 4J7CA 1DC5A 2I6TA 4MVJM 2DQ4A 5COBA 4D42A 4CLHA 2UV8A 5HS4A 5B4VA 3TOZA 4CQMD 2GYYA 4OJNA 1KYQA 1FDWA 3MJCA 2P4QA 2FZWA 3D3WA 4OXNA 1ZZEA 3IKVA 2UYYA 4YRBA 4DLAA 4XA8A 3JD0A 1E92A 2TMGA 1SMKA 3FR7A 1LNQA 4EJMA 4GKVA 4IMPA 4EJ0A 5JS6A 1HYHA 1F06A 2WJPA 2Y0CA 2YUTA 1KIFA 4XX0A 4BNMA 3KHUA 4C4OA 4IS3A 1EVYA 3H9GA 4K9DA 5AXCA 1LEHA 4AG3A 1ENYA 1U2DA 1LSSA 4FQ8A 5A9RA 1IY8A 3E82A 5EQDA 4IJVA 3O8QA 3VAZA 3PIIA 4IIVA 3LC7O 4CMCA 1SPXA 3ITDA 3I3OA 4ZRNA 1B16A 4TWRA 1O8CA 1V6AA 4UVGA 1DRUA 3EK2A 1F8FA 4XYGA 3CKYA 1ID1A 3OETA 4FW8A 4M87A 2PH5A 1QP8A 1IL0A 1UXHA 2AE1A 3C24A 1LRKA 1EE2A 3OQBA 3Q2KA 1SCUA 3JQBA 2V6BA 4XYMA 5THQA 3WFJA 1ULUA 3DHYA 2Y1EA 4Q39A 2Q99A 3H5RA 4W7IA 3DMTA 1EVIA 4BNWA 4JIGA 1EUDA 1EQUA 1FF9A 1NQAO 2C54A 5ENDA 3CZRA 2QG4A 1Q0HA 2CSUA 3BYZA 4PG8A 3RKUA 4BQPA 4MVJD 5IAAA 1A9ZA 4AICA 1U1IA 5ILOA 1I5RA 3V2HA 2R2GA 4QT0A 3DQPA 4O59O 4NK4A 3ZHXA 1LLUA 1LRLA 1M6HA 1QKIA 3D3EA 4MVJG 1U3WA 1N1GA 2VYND 1IOLA 5A5EA 1Z73A 4OSOA 4GVXA 2HK8A 2X7HA 5CAEA 5CFZA 2GGSA 4N5LA 3V1UA 1G6KA 2DTXA 3IJPA 4CQLA 1K89A 3PHGA 3RFVA 4PLVA 4RZHA 1BDBA 3I23A 3B20A 2P9EA 3TRIA 4BO4A 1UZLA 1XEAA 3KYCA 1BVRA 4BNGA 4CMAA 5IDYA 2RHRA 4E5MA 3Q2IA 4A5OA 3HG7A 1YB1A 3IKTA 1ZSVA 4CV3A 2C2XA 3H9JA 4GLLA 4D7AA 3BMCA 1BRMA 1YH3A 1SC6A 3BA1A 3KM0A 4IDAA 3S55A 2QZ9A 4QFCA 1ONOA 3ZU4A 5JLAA 1FK8A 2HAEA 1MXHA 1WZIA 2IXBA 1OAAA 3EY4A 3NJ4A 4PLPA 3A9WA 2EP5A 1DFIA 1K2WA 3W6UA 3QWAA 4AJKA 1ZMOA 3TQHA 2X4GA 4TQGA 4KZPA 3WMXA 3F1LA 4OM8A 1QV7A 4Q3AA 4E5PA 4BNKA 2ZK7A 1V3TA 4AJLA 4BL5A 1V8BA 3KYBA 4YB8A 3I4FA 3I6IA 2I3AA 3RFXA 2BFMA 1SB9A 1DC3A 2ZJ1A 4OGWA 4Y98A 1NFQA 4R54A 1BDMA 2WD8A 2X0JA 3ROPA 4E21A 1B8UA 1ZXLA 3L6OO 3GVCA 3RJ5A 3EMKA 2ZTUA 1OBFO 1ADBA 3O03A 1NHGA 2EF1A 3MJEA 1PQWA 4L4RA 4MVJI 4N18A 3DXFA 3NX4A 3TNLA 4UULA 2QZZA 5ADHA 1DAOA 1E7MA 2Y99A 3A1NA 5GMOA 3B1FA 2CVOA 1P1RA 1CDOA 4TVBA 3RAJA 2EKLA 3INRA 4R5HA 1ARZA 1JVSA 2AQIA 4EITA 2VT2A 3GEMA 3UW3A 1HDYA 3IQDB 2X22A 2AXQA 2ZATA 3K2EA 1LDMA 3GVHA 4KTTE 2FOIA 4W9NA 1PGPA 3ETGA 4II2A 4NMHA 4YJGA 3ON5A 4EGFA 1GY8A 2P91A 1E3WB 5DN9A 3FHLA 5ER6A 1ISIA 5LC1A 4DBZA 1P33A 3DEYX 4OOFA 4IY1A 2HMTA 5U1PA 4HBGA 4JX8A 1DLIA 3LLVA 3FTNA 1OZAA 1T24A 4KP7A 1J6UA 3JD4A 1WAMA 1R6DA 5L51A 5JYDA 2B37A 1TI7A 5CDSA 3QWFA 3NV9A 1GCUA 3ZU3A 2OUIA 1LX6A 3F1KA 4O0LA 1W73A 3KTDA 4RO0A 4B3JA 3VKVA 2PD3A 1NQOA 1XIVA 3GNTA 1JAYA 5DF1A 2PNFA 3VTFA 5KVSA 3BMOA 2DBRA 2G17A 2EXXA 4RL6A 4IDCA 4AJEA 5JW6A 1LDEA 1HRDA 3Q1LA 4YAGA 3EYWA 3DAGA 3LC1O 1Q2XA 3SLGA 1W8DA 2ZTVA 3SJ7A 2DKNA 5KWEA 2D5AA 4GI2A 2WTBA 3UOGA 2VWHA 1YB5A 3U4DA 1MA0A 3DAPA 3AOGA 4AJ1A 4XIJA 2OBNA 1ZEMA 1MC4A 1Z7BA 4FB5A 4QFDA 1C1DB 4CM1A 2VNAA 4HXYA 4PLCA 3MJVA 2V6MA 4AJ4A 2C20A 2I5PO 2PA3A 3VZSA 1AN9A 4W99A 5KOIA 2PZJA 3M1AA 4D0SA 1HDXA 3B1KA 4B7CA 4F6CA 3F3SA 1U3VA 2BI8A 3FR8A 5BSFA 3WS7A 5CEFA 1QMGA 1D8AA 3GDOA 2O4UX 4R1NA 2BF7A 3R1IA 2EEZA 3HFSA 3FN4A 1VJTA 3D4PA 4AJPA 1T4BA 2I99A 3W4IA 3EAGA 3H9UA 3GHHA 4ZQBA 4E13A 4D46A 1LLDA 5CEEA 3PZRA 4L9RA 1YL7A 4YBZA 3G79A 1VRWA 3PFFA 5IFLA 5KVVA 3FRJA 4FC7A 3K8ZA 4J4HA 2Q1WA 3GA0A 3I1JA 4ALIA 1NFRA 3GGGA 4CMBA 1JKIA 4D79A 5F1KA 2P9GA 2J3KA 3W4JA 4B3IA 3DR3A 3PLNA 4BGVA 4RPGA 2JD0A 4XR4A 3AM5A 4NDNE 3DBHA 5TJHA 4BO7A 4B4WA 4DRYA 3NTQA 2FP4A 5I7VA 1FXSA 2DTEA 3ZNPA 3GZNA 1ZK0A 3LF1A 2OZPA 2PZKA 2PGDA 3KLMX 3NJ8A 2DC1A 4IIUA 3F5SA 4WCFC 2LDXA 1Y6JA 4CR8A 1ADCA 4J2HA 5DP1A 4ND4A 5CPBA 3RBZA 4J9UE 2HMSA 5TLSA 5DT9A 5JXWA 3HUDA 2IDZA 3GDFA 2P5UA 1BWSA 2XXJA 4B7UA 1PS0A 5FF9A 3BHMA 3IC5A 3I9MA 5L95A 3KZVA 1DBVO 2WD7A 2WD7B 3ZH2A 2YHIA 3OM9A 3U49A 4GQAA 1R15A 1UXGA 5JC8A 1AXGA 1NWHA 4U5QA 4ZICA 2FRDA 4YPOA 4MKZA 4ZN6A 1HE5A 2UUOA 1ZEJA 4GBJA 3X2EA 4I9UA 3UVEA 2C07A 2EERA 4WLOA 5BR7A 2DU8A 5IJZA 3JQGA 2WMDA 4BKRA 4BNNA 4H15A 4DL9A 3AOEA 1GUYA 1R37A 4IGEA 3JD1A 1KETA 5HBRA 4NH4A 2F00A 4DPLA 1UZMA 3INGA 1XR3A 1HF3A 1X15A 2C5AA 3BHJA 1B8VA 1M75A 3NTRA 2Q2WA 2EGGA 4CM7A 1MXFA 1T2DA 3KSZO 1T2EA 3TSCA 3BIOA 4IDBA 2AG5A 3EZYA 3QP9A 4UUPA 1ZH8A 2DBVO 2VHYA 3E8XA 4OQYA 4HNGA 5C7IO 4A26A 4OKNA 4Z9FA 1GDHA 4LCJA 2ZKLA 4XB1A 1PZFA 4MIEA 1BGVA 4IXTA 2W2KB 2PTGA 2BLLA 1VC2A 2O3QA 3O4RA 3NKLA 2ET6A 4OSPA 4ZJUA 1K6JA 2IXAA 4Q3EA 1BMDA 3FWZA 3RI3A 4BNLA 3SX2A 3V1YA 4WLVA 3RSHA 3OF2A 2FPPA 2DBQA 1P77A 4I5GA 2Q1UA 4KWIA 4E2WA 5CDYA 4BKOA 1HL3A 4JGBA 3HDJA 4YRAA 2BRUA 5H83A 1K5HA 1GV1A 1E6UA 4HX5A 1E5QA 2UUPA 3FI9A 3SLKA 1HE3A 4P4LA 1I10A 4TZTA 2XPCA 3PWSA 3FWNA 4B7XA 2DFDA 4BGEA 1JDJA 2BELA 4I8XA 5CG1A 3WGYA 4PGFA 4NBRA 4BNTA 3DZJA 4P22A 1X7DA 1C1XB 3TFQA 4I5FA 1E5LA 2Q2VA 4CQMA 2VYVA 4YYZA 2X5OA 3PXXA 3CIFA 3PJGA 3H9EO 4LW8A 3LF2A 1XCBA 4R1TA 4CLRA 3WMWA 3VVBA 1KEVA 1YQDA 2C59A 3H9QA 3AUUA 3VZRA 3C1AA 1JAXA 3C7DB 4YEDA 4BV8A 2P4HX 1T26A 4UEJA 5BNTA 4ND3A 1D7OA 4Z0HO 1Y9EA 4NNJA 4CMEC 2VZ0A 4WK6A 3HDHA 4ZU3A 5A3JA 2FR1A 3A4VA 3AUTA 4UVHA 1B15A 2R00A 5GZ6A 1UP4A 1V3VA 2FPGA 4GWGA 1IHYA 1A72A 4K6FA 2P68A 1NPDA 3GQVA 1PWXA 2X58A 4BQRA 5A05A 4ALMA 5KJFA 1L1FA 3GN1A 5DBIA 3BHIA 1VKNA 4M86A 3QSGA 5KKAA 2FHSA 2YQ4A 1U3TA 1IB6A 1FDUA 4X54A 5G0SA 4WEOA 4XRGA 3WSWA 2Y1DA 1R4NA 1PQPA 2O48X 4MKRA 1GYRA 4D3DA 3W8DA 5FEUA 3FTPA 3O9ZA 4J1TA 3PTZA 4YJFA 3WBBA 4NBVA 4BGUA 4OKIA 2E4AA 1HYEA 4AJNA 3CMCO 3ABIA 2UDPA 1LTHR 2FR0A 1RM4A 4RLHA 5L9AA 1Y8RA 2Q46A 2EHDA 3DHNA 4E6PA 3PWZA 8ADHA 1PEDA 2PLAA 5IN4A 4XDZA 4FJ2A 3PRJA 2NSDA 3ZI0A 4CV0A 3AOEC 4WNIA 4CMIB 2B83A 1ZSYA 4E5NA 5JAZA 4LK3A 4YDRA 1E77A 1B3RA 3HJAA 3JQAB 4TZKA 2VYVD 4RDHA 1MB4A 1ZK3A 2HK9A 4G5HA 1LXCA 4GGPA 1PGNA 5COAA 5TNXA 1EVZA 4ND1A 2V6GA 4MO2A 3L4SO 4YJHB 1PX0A 2X0IA 4Q3BA 1UXIA 5EERA 1E3EA 2VTDA 4QEDA 4DQXA 2D2IA 3A06A 4L0QA 3TDKA 3PHLA 3DZFA 1MV8A 1TVEA 2PGLA 3KB6A 3UH1A 3WWYA 2PV7A 1SOVA 3LDHA 1VJ1A 1F0YA 1U4OA 1H9BA 3JQBC 1NPTO 3NTOA 4QO7A 4WCFA 1GEEA 2BGLA 4GLOA 1I01A 4NFHA 2JHFA 4IJUA 4JCOA 1MG5A 2JAPA 4F3YA 4L8VA 1W6UA 2B69A 4J49A 4BMNA 4FJ0A 1YRLA 4PRKA 3RBVA 4XQEA 5HWSA 5I7SA 1GFSA 2OXIA 3OMLA 3H3FA 4M55A 1YGYA 4WLFA 2G5CA 4XYEA 3T4EA 5IDXA 4E2XA 5KJCA 5T6BA 4E5KA 2QHXA 5HM8A 1G1AA 4YXFA 2A4KA 1WMBA 3IMFA 3N74A 3WOHA 4QUKA 4WOJA 2AEFA 4XD2A 1NVTA 5F3RA 2O7SA 3NUGA 2GASA 4RVSA 4CM5A 4CR6A 1PJSA 1DC4A 2DVMA 3D64A 2AQKA 1ZUD1 3QVOA 1BW9A 3P19A 4HV4A 2PH3A 3INTA 2BHLA 4R3NA 4JK3A 4BNFA 5DOVA 4RJTA 7ADHA 2Q4EA 2VRCA 5I9LA 2XF8A 3JQ9A 4DIFA 2RHCA 3KRTA 4ZQHA 1CERA 5ICSA 1SBYA 1CF2O 4DC1A 3CZMA 4DPMA 5JFOA 4DXHA 3KEQA 4YT5A 3BTVA 2NU8A 1T25A 1HZZA 2AHRA 4MOWA 5G0VA 1NVGA 2X86A 1H6AA 3TJRA 1QG6A 5BSHA 1GEGA 2BH9A 5B4TA 2J3HA 2YV1A 5JBIA 3JV7A 1NVMB 4RF4A 5FI5A 3NDIA 4RVDA 3UGKA 3GT0A 1O89A 3WICA 2GLXA 5IZ4A 4GL4A 2RAFA 2X6TA 1SOWA 3E03A 3KBOA 1AXEA 2X0RA 1GU7A 5TS3A 5K6AA 4B8WA 3L4BA 1DOHA 3EGOA 4MVJA 4WLEA 2GZ3A 4G81A 4XQCA 1XG5A 2Z1MA 3RQSA 4TRRA 2P9CA 2Y1FA 1PS9A 1HEUA 4NR0A 4IDDA 1C14A 1WPQA 3GVXA 4H3VA 4K6CA 3ZWMA 1BXZA 4DLLA 1S7CA 4INAA 5EJ2A 5G4KA 3ZU5A 1NBOA 5A9SA 4NIMA 3KSDO 5DCYA 2A35A 3RU9A 3UCXA 3NRCA 1KVUA 1PR3A 1HSZA 2Q50A 1HDOA 1B0AA 3WYEA 3ZNNA 4W9NC 3AWDA 2GN4A 4YJDA 3S2EA 4BO6A 1HE4A 4J43A 1YOVA 4G2NA 2VWPA 4PZDA 1VL0A 5DCWA 4PLWA 4EYEA 4B3HA 2SCUA 2IEBA 3I52A 1EDOA 3PWKA 3RUEA 3ITKA 1RKXA 4D0RA 3WNVA 3JQAA 2WSBA 3PGXA 3LLSA 1U5AA 3AI3A 3AU9A 4J9VA 1DIBA 3HZZA 3NGXA 1J49A 1E7SA 1QYDA 1GZ6A 2VHWA 1OC2A 1XQ1A 4XDYA 4XZ3A 1N7HA 4K26A 3FPLA 5AXDA 4IDFA 3DZGA 3RUCA 1PJLA 3FBGA 1GPJA 2OO5A 4A2CA 1QSGA 3VH4A 4GMFA 3IAHA 1ISGA 3IL2A 3B6ZA 1ZJYA 5JAIA 3QQPA 2ZYGA 1HDCA 2PR2A 1ZIDA 3K9QO 4BVAA 3LZ6A 3R3JA 1EFLA 4R5MA 4MP6A 1BG6A 1KVQA 1QYXA 3H7AA 1P3DA 3H65A 1HDZA 1I32A 3OIDA 4NBWA 4ZRMA 2NVUB 4ALLA 4CM9A 2QYTA 4CUZA 4GMGA 3JYNA 2Y0DA 4Q3DA 1QLJA 1UP7A 1LRJA 2GRAA 4QX6A 1MFZA 2YJZA 2NU6A 4LISA 4BMVA 3U4IA 4CLXA 2B0JA 3Q9NA 4TSKA 3KSUA 1EVJA 5FYDA 1ZK1A 4R9RA 2X8LA 4EBFA 4IDEA 1CYDA 4YACA 2CDCA 1GAEO 7MDHA 3I9LA 5A04A 2NU9A 5CDTA 3TWOA 4ALKA 1Q7CA 1VL8A 3NAQA 1FJHA 1KEUA 1ADFA 4WOKA 4FFOA 2G0TA 4KUEA 5EIOA 2A94A 2IRWA 1KC3A 3MOGA 3OQ6A 4IBOA 2E48A 5F21A 3WQSB 1H2HA 4OXKA 3V2GA 1J5PA 3CE6A 2GZ1A 3FD8A 3KO8A 1ML3A 1RM0A 3AY6A 3GUYA 3V5NA 4RPJA 1GTMA 3HWRA 5T8KC 1M6WA 4BS9A 4TKLA 4M49A 3TZ6A 1O95A 2EJWA 3MWEB 9LDTA 2O7QA 1N5DA 1VJ0A 1UDAA 1DFGA 2X5JO 3AI1A 5ES3A 4BMSA 4E4YA 4BGIA 3U09A 3R0IA 1D3AA 1P74A 3VH2A 2JFFA 4LVUA 2VT3A 4IS2A 4E32A 2NV6A 4FCCA 2EKPA 4A7PA 3VDRA 5HS6A 1KS9A 3ZWNA 5DCUA 4WEQA 3LC2O 4E0BA 3EUWA 2GN6A 4J4TA 5C3MA 4KDFA 3VZPA 1E7QA 1EDZA 3NT4A 1KEWA 2G82A 1LSJA 1IULA 4TRMA 3AI2A 1LDBA 1R0KA 2FMUA 4GSKA 4JBHA 2NU7A 2DT5A 4HADA 1YVEI 2GN8A 3VVCA 5I8WA 1QYCA 2NNLD 1B3BA 1ZO8A 3VDQA 4BO8A 5KNLA 3JQCA 3P7MA 3AY3A 3FNEA 3DMTC 1TT5B 4D43A 3GG2A 4DLBA 3NT5A 3QV1A 2IYPA 1B14A 1X0XA 4IQGA 4ZQEA 2OOSA 1XWFA 4PFJA 4BO2A 4YJGB 4L74A 3LT4A 4Y8VA 2YFHA 4O6VA 4PLTA 4XQGA 1NPYA 1ISJA 3TF5A 2B5WA 3PVZA 5L3ZA 3KYDA 3MEQA 2HUNA 3MTGA 2AQHA 4WLUA 3AK4A 1U4SA 4R1SA 3PDJA 3WR5A 3JYOA 1YDWA 1JKFA 4FFLA 1LSOA 4Y67A 4RCVA 4AFNA 1G0NA 1E3LA 2VOEA 5JE8A 3GVIA 3QWIA 3DMYA 4UUOA 5DOZA 3GZ4A 1FMCA 3QLJA 1V35A 3KYDB 5JC1A 2J3IA 4I9NA 3GGOA 3IIEA 1PZHA 5BNIA 1E7WA 1HKUA 1K3TA 5HRUA 4JJGA 2C0CA 1BVUA 3E9MA 3AUAA 3LSYA 5IZCC 4BV9A 3F46A 4JROA 4KMSA 3QY9A 3ADOA 3RKRA 3DHEA 5BSGA 2VHXA 4FOOA 5AYVA 5T67A 3WWZA 3TL3A 4EUFA 1M67A 2C5EA 1YS4A 2CY0A 3JCZA 5TIIA 5A9TA 1JVBA 1C0PA 1PZEA 1E0DA 4FFNA 5ITWA 3S2GA 2BFAA 4IZIA 3H2SA 4J91A 5FI3A 1NASA 4WLNA 5I8ZA 5T57A 4ALNA 2ZQYA 4C7JA 2I65A 4FOSA 4M54A 1I3NA 2I3GA 5EQFA 5ILGA 2J8ZA 5JDIA 1E7RA 4CM8B 4E2YA 3JQ8A 4GGOA 3GLQA 4PLGA 3PJEA 5G0TA 2P2SA 4FIZA 4RGBA 3RCBA 3ZV6A 1U5CA 4DA9A 4OAQA 3QVXA 4DGSA 1Y8QB 2R00C 2XAAA 3C1OA 1YDEA 3E5MA 4QSMA 4BNIA 4EDFA 4GPD1 4MVJE 3GOHA 3RASA 4ITUA 1NWCA 5F1PA 4YT2A 3TL2A 4BNUA 4OHUA 3GY0A 1ENOA 3GDGA 4K28A 4XEHA 4AJ2A 4CMEA 1YQXA 2O3UA 4U7WA 3Q11A 3NEPX 1K6XA 3KLPX 4JJFA 1GZ3A 1R12A 2WYWA 3VZQA 3OH8A 2CF5A 3ANLA 3TZQA 4JQCA 1I2ZA 3ZCXA 1T2CA 4B4VA 1HYGA 3ZGYA 1I2CA 4CUJA 4E12A 4JNKA 2OL4A 1Y8QA 1OC4A 2RCYA 4YTEA 3BMNA 2B35A 3GVPA 2V7PA 2NQ8A 4HWKA 1RYEA 1FDSA 1E3JA 1DAPA 3QRWA 4QTZA 1SEPA 3RJ9A 4AJIA 1QORA 3L6EA 1RWBA 2BI7A 1NQ5A 1X7GA 2HKIA 3FBTA 4J0FA 3DBHB 5I7FA 2PZMA 2Q3EA 2YZ7A 1VI2A 5BT9A 3UUWA 4L4SA 1UUFA 5JCXA 2TMDA 3U0BA 3ONFA 4CLDA 3WYCA 3H8VA 2E6UX 1PJCA 3E5RA 2BFOA 2GCGA 3MTJA 2UAGA 2C2YA 4FGSA 1I8TA 4L73A 4UEKA 2C82A 1Z74A 1TT5A 2NTVA 3UFXA 4YR9A 2WE7A 3QHAA 4Y6PA 4OMUA 4FFRA 3E9NA 4EZBA 3DC2A 1WNTA 1H6BA 2JL1A 5JDIC 3PLRA 4RLSA 2ILTA 1VL6A 3DBLA 4II3A 1EK6A 1JA9A 2PZLA 2YHUA 5BQFA 2ZTLA 1MG0A 3FF4A 2YYYA 4JLWA 4DYDA 4ND2A 4ZQFA 1H93A 2QIOA 4CMJA 5IXSA 2EW8A 3ZDFA 4AJHA 2CF6A 5IN5A 3LT1A 3T4XA 1UDBA 1H0KA 4DIBA 2NM0A 4DPKA 1EFKA 1UXKA 4MKXA 3WIDA 4IDGA 3JQ9C 3WTBA 1X14A 1E6EA 1SAYA 3G0OA 5H82A 5L7YA 1H2BA 2DAPA 1QRRA 4CQMB 1MC5A 3RU7A 4FPXA 4CMHA 1DIRA 4ZGWA 2W2KA 3JYLA 1N1EA 1T1RA 4PG6A 2VZ9A 1D4FA 1TEHA 4IQ8A 2AEJA 2CFCA 5DULA 4D45A 2HMUA 1OFGA 1E3IA 2YDYA 1QV6A 3MWDB 5GY7A 3PQFA 3ZV4A 1IPFA 2C29D 1E7YA 1U3UA 4GWKA 4Z3DA 1E1MA 3HN2A 9LDBA 3GR6A 1Y1PA 3QVSA 3SVTA 1O0SA 2QW8A 1XELA 2J5RA 2GUGA 4P4GA 5U4QA 1WZEA 3E6AA 3K73O 1ISFA 4JP3A 3W1VA 2DTDA 4LMPA 1H6CA 1E3SA 5THKA 3GAFA 4CJXA 3L0DA 3K31A 1AE1A 5AOVA 1XA0A 1WW8A 1WWKA 4XYBA 4BKPA 1QR6A 5TSDA 4PVDA 3U3XA 1LDYA 4EUHA 1CIVA 3WQQA 3GNSA 1E1KA 1PJ4A 1P1HA 4KDEA 2G1UA 1PJ3A 4A73A 1JW9B 4PG7A 2VHVA 5IF3A 5F1OA 3RUIA 4PZEA 1DRWA 4LRTB 1LUAA 5TGDA 1BTOA 4HUJA 3RUAA 4RVUA 1VSUA 3PP8A 1P1JA 1NP3A 4XGKA 2B4QA 1CRWG 4CV2A 4NHEA 1I0ZA 2HDHA 1JKJA 4DBVO 2AE2A 3PDUA 1JN0A 1XYGA 1A4IA 2IZ0A 3DBLB 3K5PA 5ER9A 4XYLA 1ORRA 1RM3A 2IZZA 3UICA 4O1MA 5JAMA 4RZIA 4L75A 3HB4X 3PPIA 2VRCD 3RUDA 4QO8A 2BD0A 3B70A 4JN6B 4BOYA 1DO8A 3PGJA 1ONNA 1YONA 5C5IA 1M66A 5DDIP 2AA3A 4EI2A 5L40A 2AEMA 3DAFA 5JPIA 1L7EA 3QA9A 1BXGA 2NVWA 3ETDA 3ZNOA 1WVGA 1LC0A 3MJTA 4MVJH 3PZBA 5C7OO 1HDGO 4GX5A 5CHEA 4WNCA 4NBUA 3D4OA 4HKTA 4I5EA 2BGMA 1X13A 3RROA 5KVQA 1EUCA 1H94A 4DVJA 4WE3A 1IYZA 3G1TA 4W7HA 2B4TO 5G4KB 4J3FA 1LU9A 4Y6RA 1I30A 1I3LA 2VOJA 5A06A 2EKQA 2JD1A 3FCOA 2VUTA 3OEYA 1V0JA 4RF3A 3GK3A 4FN4A 2GERA 3T7CA 3P2OA 4BO3A 5JYEA 4Y6SA 3RD5A 1NTOA 5KJ1A 5AXAA 1EMDA 1SZJG 1ZNQO 1PJQA 1SNYA 2EGHA 2PK3A 2O3TA 3QW2A 4FJ1A 4OXYA 4RDIA 3BAZA 4BKUA 3ZW8A 4Q3CA 4E5YA 4MJLA 1NYTA 3VPXA 2Z5LA 4WKGA 1IHXA 2H63A 4GX0A 3WIEA 1KEPA 5FFFA 3ANMA 1LC3A 1JU9A 3G49A 3D0OA 3GMSA 4M89A 4R16A 1LLQA 4FC6A 3MZ0A 3JQ8B 3I4CA 2IEDA 3UN1A 3ZWCA 1MGOA 3N7UA 4KOAA 1KERA 2OFPA 5L45A 1R16A 1YL6A 1NX6A 3NT2A 3GPIA 3PIDA 4J0EA 2NLOA 3D4NA 1DIHA 1I2BA 1L7DA 3OBBA 4LRSB 5IDQA 3GMDA 3OSUA 4O63O 5EESA 2OP0A 2H6EA 1A7KA 3ST7A 1EUZA 3C8MA 3SC6A 4BIIA 3PYXA 2DUWA 3OJEA 5A1TA 3ZW9A 1H9AA 4P4NA 2JCVA 1VSVA 3JQFC 3TZHA 3GC6A 3ICCA 1U7TA 2J6IA 5CDGA 3ULKA 3GPDG 3FNFA 5HA5A 1P0CA 3HNPA 5JY1A 1HTBA 3PQDA 4PVCA 4YAEA 5A9SB 3WJAA 1NFFA 3VPSA 3KEOA 3Q0EA 1UDCA 2I9PA 4UUMA 3WQRA 4B79A 4Z9YA 2IODA 4RVFA 4WUVA 2HQ1A 4RPLA 1LLCA 1B26A 3HDYA 3ZWWA 3I9OA 1P45A 3HE3A 2H1SA 2PGJA 4MP8A 4UAGA 2PWZA 3OFSA 3IS3A 4DWVA 5K0ZA 1P31A 2VRBA 2DLDA 1PTJA 3D5QA 3KXDA 2B5VA 2X0NA 1HLPA 4JJIA 1U8FO 4UVIA 3GEDA 1NHWA 2GZ2A 5EMHA 1CQIA 2ZYAA 1I3MA 1N8KA 2P5YA 2YW9A 1IPEA 4RVHA 4CLRB 3KETA 4H16A 1N9GB 4RF5A 4BO0A 4YAIA 3PHJA 5AXBA 1IZ9A 3P5SA 3FNHA 2FY8A 3H6KA 5BSEA 5DBGA 1UXJA 2O2SA 4LVCA 3D5TA 4J90A 2YV2A 3LQFA 5KJ6A 1Q0QA 3DFUA 4YAKA 3OIGA 4YRDA 3IP1A 2A92A 2GO1A 1DC6A 3COSA 5T5QA 3HFGA 4ROSA 4ALJA 3BTUA 4XRRA 2JHGA 1EEHA 2CMDA 1QLHA 1GV0A 3LK7A 3BMNB 4EW6A 3GNQA 3CH6A 3L9XA 1J0XO 4I9HA 4CM3A 5L4NA 4JXKA 3M1LA 4OO3A 1U28A 4YQYA 3UCFA 5BNFA 3PFWO 1U7HA 3OJLA 4NJOA 1DDOA 2YV3A 1I24A 5IDWA 4NPCA 2Q45A 2ZQZA 4XJTA 3UKOA 3JSAA 2Y1CA 1R0SA 2YFQA 4NU6A 1XU9A 3ZWXA 1U8XX 4P38A 3C3XA 3TZCA 2JAHA 3ZZNA 4UUNA 3JQDA 3S1LA 1UH5A 5G0UA 4CQLB 3JYPA 3QE3A 3I6QA 5JMPA 3C7AA 4OIMA 3NGLA 1CEQA 1Y7TA 1XLTA 3BTSA 3EW7A 5LDGA 1X1TA 2PKRA 3A28A 1K0UA 3IOYA 3T7EA 2W2LA 4PLYA 2PKQO 3QWHA 4CM8A 4NG5A 2CUKA 5KVCA 1V3UA 2CDAA 4Q9NA 4RQUA 3VPGA 4NJMA 1DIAA 3WBFA 2H5LA 4WCFB 4FBGA 4GKBA 3HQ4O 5L7TA 5IXYA 3KVOA 4R41A 2Y67A 4EJ6A 1N7GA 5AQ1A 2D1YA 4LCEA 3GFBA 5TQVA 4GVLA 6ADHA 5COQA 1OMOA 4FDAA 1SO8A 3D1LA 4KQWA 5KTKA 4BNHA 2AQ8A 4C7KA 2I76A 5ENVA 4F46A 1LQUA 4ZHSA 3WGIA 2OP1A 4D3SA 4BB5A 1DSSG 5JSFA 2NADA 4D44A 4Y9DA 1PZGA 3STHA 4E2ZA 4WGGA 3ZV3A 3ENNA 3GRPA 1ZMTA 4FFMA 4L76A 4ZVVA 3RWBA 3BMOB 3O8QB 4OL9A 1O6ZA 2OHXA 1C0KA 1GQ2A 5KKCA 1VE9A 4URFA 3PEFA 3SBOA 3OEWA 3AY7A 4FFPA 4ZQGA 4CPDA 2VTEA 1GADO 3HSKA 1KY5A 1JTVA 1TLTA 3RC7A 1G0OA 3GN2A 4MVJP 4O5OA 1KC1A 2V6FA 5KIAA 1QXSA 4NFSA 2ZYDA 3WFIA 4BB6A 1YBMA 4XB2A 1R4NB 1N92A 4ZD6A 4E3ZA 3MJ4A 2PD4A 2PFGA 3D3WB 1F14A 2CZCA 4DMLA 1YO6A 5A3VA 2DFVA 3JQFA 2E37A 1N2SA 1TB4A 3LVFO 4TRNA 1E6WA 2VUUA 4F6LA 2W98A 3NDJA 2X1HA 3F9IA 3L9WA 1VPDA 2QRKA 1C0LA 4N54A 3WJ7A 5J23A 2ZCUA 3VOSA 4ID9A 2E49A 3GHYA 3AM4A 1XU7A 1UZNA 3I83A 4PRLA 1AHIA 2GN9A 4S1VA 4BNXA 1LA2A 4N7RA 4EEXA 4TROA 3L07A 2OORA 2FPIA 4DQUA 1PS8A 1GPDG 4U0KA 4PG5A 3CTMA 1F12A 4YA6A 3OA2A 3H5AA 1YBVA 2ZIZA 3OECA 4CV1A 1W4ZA 1X7HA 1CJCA 4PG4A 3UCEA 4NQZA 4NI5A 1YWGO 2YQ5A 4N5MA 2YDXA 1F17A 4FGWA 3ORFA 1E1NA 3JD2A 4MP3A 1O5IA 4NZ9A 5DBFA 2Y0EA 2G76A 3ZHYA 1ZCJA 2OBYA 2Y05A 2O4CA 3A14A 1PJBA 4IMRA 2NTNA 4J4BA 3P2YA 2XXBA 4E33A 5JY6A 2QQ5A 3DOOA 1SEVA 1UR5A 4PCVA 3OIFA 5DP2A 3TOXA 4CMKA 3K2BA 2ZB4A 1KY4A 3GAZA 4U6QA 3DBRB 4FR5A 5TT0A 5EL0A 4QQRA 2VWQA 2GDZA 3ONEA 1RYDA 5L7WA 3OHSX 4HNHA 1HETA 1NAIA 4J1QA 1Z6ZA 1BW9B 1DRVA 4JP2A 5A03A 3B1JA 4XGIA 2O3JA 1R66A 2HU2A 4H7PA 3JQGB 5CP8A 2W2LD 2DPGA 3V2UA 4YT4A 1VM6A 1MLDA 2QRLA 3WXBA 3V1TC 4BHTA 3KUXA 1NQTA 1WXDA 1X1EA 2O2YA 5EINA 1Y81A 3VTZA 3U5TA 2D4AA 2C7GA 3C1TA 3JD3A 4D3FA 5F5NA 3SC4A 5EPOA 5A4DA 2B36A 2VHZA 3KYCB 4ND5A 3WTCA 4CLOA 4PLHA 5JMWA 4NBTA 3S8MA 1DJNA 4LSWA 3AFMA 1LSUA 1PU2A 1YJ8A 1A27A 1LQTA 4Z0TA 3IP3A 3MOIA 2ZB3A 1GQQA 1O9BA 1J4AA 2B4RO 3ETEA 4DUPA 2HCTA 1B8PA 1HLDA 8LDHA 1PJ2A 1NXQA 5LCXA 4ONEA 5F5LA 2Q1TA 4DMMA 1JLLA 2RBEA 4QECA 4DC0A 4DTIA 2IZ1A 2VUSA 1F8GA 4U6SA 5C7LO 3F6YA 1MFPA 3GZNB 3UHAA 4MPDA 1NR7A 2HLPA 4ZA2A 1TT7A 1B2LA 1Q7GA 4L4XA 1I36A 1I3KA 3LYLA 1LI4A 1EBFA 2A9FA 1WP4A 4YT8A 1PL7A 1Q0LA 2PD6A 2O50A 4MIYA 3BMQA 3BMQB 1WMAA 1KBZA 1XQ6A 2ZB7A 3GG9A 4R51A 5A02A 2HSDA 1N9GA 1EBUA 1CETA 1LJ8A 1DIGA 3H2ZA 3DDNA 3VPFA 3EVTA 3DONA 4OQZA 4YVFA 4K1LA 1Y5MA 1W0CA 3EZLA 3LT2A 4XKJA 4GX2A 2QYSA 5MDHA 3GFGA 3X2FA 2POQX 2CDBA 1Y8RB 2NVBA 2FZEA 4KTVE 1QYWA 1SB8A 5I9NA 3WLEA 3VKUA 1P1FA 1BSVA 2GF2A 2V65A 4DQVA 5IG2A 3RC2A 3GUCA 4BO5A 1R4MB 2IYOA 1RPNA 1HE2A 1O94A 3L6DA 3LU1A 4R4JA 3DOJA 3ASVA 4PZCA 1ZSNA 1ZXBA 3OQ1A 5CG2A 4D41A 3KOUA 3AM3A 3PHIA 4YJFB 3ZWBA 4J1NA 2HJRA 1T2FA 3WGTA 5B37A 2VYNA 3M2TA 4S3MA 4BUCA 4IUYA 4LMRA 2WE8A 2WEKA 3M6IA 3E1KA 3WGOA 2GD1O 4MDHA 5CPFA 4AVYA 2VCYA 4B4UA 1YJQA 4IINA 1JWAB 2Y1OA 3DZIA 3GRKA 3DBVO 1S6YA 1AGNA 3R6DA 4LGVA 4G65A 2PKQP 1PL6A 4HFJA 4XGNA 4XIYA 2XOXA 3ZWYA 4R69A 2J5QA 2I66A 1I33A 3I9NA 1ADGA 3IDSA 4ILKA 4J7XA 4LN1A 3PYMA 5T8KA 3U4CA 4GH5A 3OICA 3DL2A 1ENZA 3NDRA 1PSDA 5JO9A 3JQAD 4DYVA 1HXHA 4GSLA 3DBRA 1GUFA 2FWMX 3F4BA 3NYWA 1AHHA 4A0SA 4XWYA 5K9ZA 4M8SA 4XQ9A 3F4LA 4CM4B 3UAGA 2FN7A 1C0IA 3W4KA 5U9CA 1FDVA 1VLLA 4Z3KA 4IZHA 2CVZA 2WYVA 3HB5X 3HADA 4CR7A 3DZBA 1D1SA 3ROMA 4W82A 3M2PA 3WLFA 1DXYA 2D8AA 3G3EA 3WB9A 2DPHA 3IUPA 4BNVA 4XJSA 3GGPA 2GSDA 3R3SA 2AMFA 2RIRA 3JQEA 4W6ZA 1DEHA 1A71A 5CEJA 3G17A 4IGFA 1A4UA 3QVTA 2CNBA 2O3SA 1PGQA 4ESOA 1XDWA 4BNZA 1AUPA 3DOCA 2HRBA 3IJRA 1A7AA 1ZK2A 3ICPA 3ZN2A 1GYPA 1UP6A 4XR9A 4QXMA 4J7UA 5B4UA 1R0LA 3PYLA 5HTOA 3WGGA 2WWRA 2FR8A 4JBIA 1Q1NA 2Q2QA 2ZJ0A 4WPGA 2DM6A 4Z6KA 4R9SA 4R68A 6LDHA 3ZHBA 3DWFA 1MX3A 3LT0A 1H5QA 2E82A 1PWZA 5C37A 2X9GA 5GZ1A 1V9LA 4BNJA 3RIHA 3AUSA 3WGHA 3TZKA 4IQ0A 1KVRA 1PL8A 1OI7A 1JQBA 2JKVA 1BHSA 3RC9A 3W8FA 4RV9A 3CPSA 4IXWA 4RVGA 5G0WA 4Z0PA 2OGUA 3CXRA 2W90A 1R4MA 3GEGA 3I9JA 3SXPA 3K6JA 3EHEA 3ROKA 3D7LA 1PIWA 2X5KO 1GYQA 1OOEA 5KCZA 1X0VA
chains in the Genus database with same CATH superfamily
4ENQA 1UFVA 5ELXA 5D5QA 1TZCA 3U4GA 4H7EA 5I9IA 4DA4A 3ZE0B 4U7GA 3E9QA 2JCYA 3MUNA 4KO2S 2JLUA 2ZBVA 4PYQA 1JLLB 4OKSA 1U99A 2HK6A 3I5MA 3FYUC 1BYUA 3ITEA 5B1SA 5C4MA 2FSSA 4WCDA 1T5LA 3VGPA 2R4TA 5DN6D 4RFSA 1P72A 3O26A 1TFRA 2YZ2A 1DFHA 4HQLA 4GR5A 4QHYA 2YXLA 4AO7A 2B82A 1D2CA 1XDZA 1QHHA 2HNBA 4R1UA 4B31A 1TCCA 3EIFA 1K5GA 3QKTA 4X8OA 3WSVA 2P3QA 2QXTA 5DM60 5JLJA 2YXEA 3BWVA 1XN4A 1SIBE 3RSFA 3W2TA 5B5SA 1MH9A 3PUYA 4FI3F 2Q3JA 3A37A 3RAPR 3WWPA 5IZCA 3ONDA 1E1RD 3KS9A 1NIPA 2AZTA 3K2IA 4L8GA 3BCUA 4CL3A 5FOSA 2JLZA 1R7RA 2ZREA 3BC1A 1RXWA 1RFLA 2O1SA 3GDWA 5BSMA 1DV2A 1RAEA 5F64A 3CZAA 1DMSA 4TLBA 2IGTA 5CJ2A 5HIKA 5JZVA 3ZU2A 4DLPA 4BDSA 1QAMA 5CDFE 2BT4A 3L04A 2I29A 4QQ8A 5LQAA 2EV9A 1JJBA 2OLKA 3PK0A 5B3JC 4N8EA 5DBEX 1ISMA 1IVSA 3IB6A 2YJ5A 3ICWA 4EZEA 5AKZA 1QGUB 2JGMA 4UE6A 4BNYA 2YMMA 1M54A 1YQGA 3ZWVA 4WDRA 4FMDB 5AK5A 1WDLA 4TKMA 2CT8A 2D5BA 2P5TB 1CY4A 1DJOA 2W6ZA 2W43A 1RRPA 2O1XA 1O57A 4YUXA 4Q18A 1GZ4A 3HXLA 2XGGA 2NYRA 4UHEA 1XNQB 3IKLA 5JASA 4JEMA 2PPVA 2R4UA 3AERA 3VH1A 3WK4A 3CWQA 4P98A 1UPXA 1RLIA 4C2TA 2QTAA 4U2FA 1QJ4A 3PL1A 1GZHB 3HKCB 2CE7A 2DYKA 2WWXA 3A9SA 4P4SB 4WASA 4ER7A 5DN6A 1GD1O 5TF4A 3T5TA 4RHEA 2VSYA 2YJ6A 1EX9A 1AKEA 1ZBQA 1GDTA 4J6FA 1XDGA 3HVHA 4KH1A 2WHRA 4UW9A 5AW1A 5D1HA 3G8AA 3UXYA 1N5MA 5TR9A 2XLBA 4B6GA 1E64A 3OQJA 4CUKA 3EIWA 4GAEA 3FF1A 4KUHA 4EY3A 1LPSA 1MF7A 4CM9D 1RI4A 4LJLA 3V1NA 4DHEA 3TL6A 1Q0TA 1B4DA 4A27A 4RD6A 3V1LA 4RQAA 5EXEA 2HPAA 4R3WA 2GPAA 4F86A 1HGXA 4RGYA 2XDQA 1Q0PA 3UJCA 3UWMA 4NK5A 5BN1A 3S44A 2R6JA 1R27A 4AMBA 2KHZA 4HDRB 2XH8A 3FPCA 3DZKA 4HP8A 3EDMA 5ELLA 5AUPB 3SZLA 2ON6A 3OZSA 1DQPA 1U0HC 3LI2A 4ASUA 5J47A 2W37A 1XT6A 2P0EA 3VU9A 5IBQA 3MUOA 1JB9A 2EWWA 3R23A 3AEUB 5ALJA 5ANRB 1CFZA 1BE1A 1P4AA 4JJ7A 4DXAA 2H0AA 2D59A 2EZ4A 5CB4A 3O8NA 4QODA 4P32A 4BP8A 1G5HA 1O6FA 1OLXB 4C6HA 3C1UA 3DAOA 1ZFNA 2OQRA 3K6KA 4F4IA 2JH3A 1LK5A 3NTUA 1DBQA 3BAFA 4CF6A 5FTKA 1QGOA 1GCGA 1SY7A 1FOEB 1PR1A 2I4LA 1TA4A 2YV5A 3V4OA 1BU8A 2HRRA 1DBWA 1NP6A 4HFNA 2EIHA 3SHTA 5KQMA 4BFCA 3EJWA 1O1YA 4I2NA 2DY1A 1RM5A 3ZDBA 3U16A 1ISSA 1H6DA 4HAXA 1T9CA 4PN7A 1Y3FE 3ZV5A 4AO6A 4I4NA 5M5BA 3IUEA 1KH3A 4FIDA 4GX1A 1NOIA 4IIGA 5SYAA 3CUKA 1M8JA 3NEJA 3T0IA 3ABSB 3B2EA 3EASA 3JQ6A 4HQFA 4MWTA 2EW2A 5G4LA 4PNHA 2RH8A 5B3AA 3FCCA 2D0IA 5CTJA 3T5PA 2R7MA 3ROXA 1GNQA 2O0KA 5HIMA 4A0GA 2XEXA 3BDIA 4JT8A 5IDVA 4EUEA 3SFTA 5KDDA 3EFBA 4ZOQI 3PNMA 3NVKI 2OECA 3THRA 4CGZA 1E2QA 5IMSA 3FNGA 3JZMA 3K2QA 4I4TF 3L77A 4A82A 4DJ5X 2PFSA 2Z98A 1R8XA 2B9EA 4WI1A 4NCBA 1GL3A 1FMTA 2DQSA 3L0IB 4MV1A 3D0KA 4TYPA 3U9LA 2W6NA 4IHKA 4NMWA 2Y8EA 3IVRA 1E1DA 3BQ9A 3C3JA 3ZWAA 2DJ5A 1EFPB 3C98A 4BVHA 5EKSA 3G0IA 1NXWA 1RAAA 1S8NA 2Q49A 4UDYX 1ECPA 4YAWA 3N8NA 2YMPA 3TG8A 2IBSA 1OWNA 1E4VA 1SWVA 5JJKA 2WAAA 4OQXA 1U9YA 1VZ3A 1C3VA 1GLGA 1FQOA 4TLMB 2OV8A 1KNXA 4CLEA 3D2BA 3E7DA 1JIKA 2WTAA 1Z6GA 3FIJA 1FPQA 2NO9A 2M32A 3R77A 1JS1X 2GNPA 3ZIUA 2DWUA 1M2WA 4JSRA 1EUCB 2CVQA 2IL1A 4FSHA 4UXIA 3DTTA 3GGSA 3AG6A 4DDHA 4AQDA 4DTCA 1UAYA 1THZA 3MT7A 2VK4A 3E7WA 1POXA 4IIFA 4ZXFA 3F7NA 3H0CA 2EJVA 2HBZA 3K30A 3MD0A 1G6HA 4PRYA 3C7CB 3S2FA 2GPTA 3ROTA 4CKWA 1SA0A 4O4LF 1UJCA 1Z9BA 1M2GA 3F96A 4A6PA 3ZBTA 2X23A 4H18A 4A8HA 2ZIXA 4BCDA 2BFBA 5AHXA 4EI9A 1ULSA 4RZUA 1CFJA 2OPBA 2WSSD 5ALWA 3SGLA 1QTNA 2QLFA 3EGDA 3WMRA 4BLPA 1QYVA 5FL3A 4K3VA 4MVJF 4X6YA 3UBMA 1PR0A 2RGNC 3ND5A 1G16A 3JQ7B 1EESA 4FGKA 4DMRA 3BXPA 4WVLA 1CLUA 4Q1FA 1IONA 1C9DB 1WCIA 4A8JB 2DR0A 1OU4A 4PZ0A 4C05A 4IG4A 2C7VA 4EOGA 1YR6A 3I2YX 2CEAA 4EW3A 2Q6OA 4UNPA 4RX1A 2FW0A 1FRQA 2RGDA 3A9TA 3KOZA 1T2UA 2WUEA 3N8GA 2WYUA 2ZSBA 4KQKA 4P31A 1CUSA 3RU2A 1AUQA 3O38A 4B4OA 1YS1X 2BGKA 5A6SB 2HRZA 3OA0A 4INZA 1RJDA 4I19A 3RBXA 4JLBA 2WJ3A 2WW8A 3H5NA 5I7AA 4HLUC 3W8EA 4DIDA 2A7XA 5GZ3A 1HO3A 2AD1A 3IAUA 2H5JA 4ENUA 1MEJA 2CLKB 2Z9CA 3K5IA 3QIVA 3MCVA 5JCZA 3AJRA 3PXUA 4MRRA 4EY7A 3K8QA 3ESXA 2WF9A 1M33A 3DV2A 4RDXA 2GR9A 4EGCB 2XUQA 2V6JA 3A6FA 1R8SA 4UBMA 5TT1A 4B43A 3F3KA 2C7RA 1YVPA 2KMLA 4YQFA 3RSGA 4QRHA 1C1XA 1A5ZA 1AKWA 1E6MA 1U31A 2GNAA 1RT9A 4LC9A 2QE7A 5ECWA 2WFMA 4TWIA 4ZEOA 4EECA 2XBLA 4HEJA 1Z88A 1LDGA 5F4BA 3EFEA 5K3FA 2ABWA 4GWLA 5JDCA 1N8NA 1TTTA 3F7MA 3X1MA 3P4XA 3DZHA 1K5DA 2HREA 1YA6A 3FSEA 2WP8J 4KN5A 3ANNA 5KYXA 2W42A 3OIYA 3CPEA 3I76A 4LY6A 5BN4B 1JEAA 4DNFA 3PEUA 1PWHA 3B5JA 5LMNB 1XK7A 1W59A 1E0AA 3DMNA 5ADWA 3ADCA 5CHYA 4PFQA 3B7GA 1T34A 1GG5A 1SVLA 4X64B 1YZFA 4LOKA 1WXHA 2ILVA 4RY0A 3BFXA 3VMMA 2FJUA 5B6JA 3SS7X 2V3WA 5COBA 3NAZA 4OHZA 1QQ7A 2QLNA 4I9FA 1W52X 3VSAA 2UV8A 1GTL1 4JYPA 1AUXA 4CLHA 5B4VA 1BDJA 3E7PA 2GYYA 1BCSA 1FDWA 2FWIA 3CUYA 4N0PA 4Q03A 3EXIA 3S2GA 1NXXA 3KB1A 3IKVA 4OXNA 3OSZA 3C6BA 5H7XA 2C4TA 1SZPA 1J21A 2ZUBA 3CM0A 4A16A 5AKEA 3ZDDA 2TMGA 3IT3A 5HKAA 1BDIA 4MITA 2I8AA 3E1SA 1H2YA 4TYQA 2MDTA 2DT8A 3FFXA 4NP6A 5AW9A 3GLFB 3G6WA 4KX5A 2GH1A 3VC3A 2WJPA 2PX3A 2WJZB 3BWMA 1KIFA 2FPIB 3AP3A 3DLAA 2P40A 1XZEA 4HN4B 3KHUA 5FV4A 2CXQA 2FSUA 1EVYA 3H9GA 4LHVA 2IF2A 2JI6A 4AULA 1CQPA 2I6GA 1DTSA 4QDTA 5IK2D 4GBED 1N2CE 1PE0A 4W5JA 2WF6A 2HFKA 1A2KC 4BC1A 5L3QA 3PIIA 4J0IA 1XMJA 3TDMA 3X2SA 5IK2A 1TK2A 3I3OA 1I4DD 4IKPA 3NATA 4TX1A 4ZRNA 3S28A 3VHXB 4ARVA 3A8TA 3OD1A 3FSGD 4DKXA 2OM6A 3CKYA 3JW8A 3I62A 1PRYA 5FRDA 1IWPB 2PH5A 4TYWA 3C24A 4XYMA 3Q2KA 3R7DA 1A88A 4F3RA 3JQBA 2G04A 4ZV7A 4G0VA 3R0QA 3DHYA 4KH0A 5DSZA 5LQSA 2Q99A 3SQNA 3D8UA 3EIQA 4W7IA 4ZCTA 1EFAA 1A5TA 1J7KA 2XWQA 2DFNA 3O6VA 1GZUA 4GD3Q 3DMTA 4AZSA 5C1DA 3HV0A 3QOWA 3W7VA 2X13A 1EUDA 1EQUA 2R47A 2ZPUA 4WK2B 5EXPA 5HMMA 5BYAA 1TC1A 4IRMA 2YWCA 3ZDZB 1OQAA 2IYYA 1OLUB 3AR4A 1NMYA 3CN9A 4D9JA 3AKEA 2RI0A 5MFPA 1UBKS 1XZGA 4P7BA 4WBSA 1JDTA 1O6GA 4WKPA 4DMFA 5F51A 2ZVDA 5IAAA 4OAPA 3OZWA 3RE1A 1A9ZA 3PXAA 1XZ8A 4O4JA 2XWPA 3WBKA 4AICA 4C78A 3NYRA 3PE6A 2EEPA 1OWLA 2BUAA 4ZP1A 5LUAA 1OLSB 3IQWA 3EPPA 3RVBA 2LXNA 2R2GA 3HDTA 4KU4A 3DQPA 4O59O 2H7XA 3VKFA 3FTFA 2FSFA 4H59A 1KEZA 16PKA 1NZFA 2LNDA 3G5TA 1CQJB 4JIMA 2BZSA 4N3NA 4Y2YA 5F52A 1RVV1 3ZJTA 2F8SA 2ZWAA 4UCWA 2ZWIA 5FNVB 1M83A 1SIWA 4RFVA 3B5EA 2XQJA 1Z2DA 2GGSA 3V1UA 1C3XA 2CHEA 1K89A 4KCGA 1JJAA 3BBPA 3PPXA 4B9AA 4N3AA 2ADMA 5CBPB 1GRVA 4PHFA 1O95C 3DKRA 4TS3A 1Q1AA 2P9EA 3R9KA 3AJDA 1L7XA 3TRIA 4D4KA 2LTAA 5DWDA 1XEAA 1ESEA 4M0CA 4EENA 5BY2A 3UMSA 4KWEA 2H5EA 2JFNA 2QRUA 4L0CA 4QUAA 4HYYA 1K5PA 3GLHA 1W5FA 3AL2A 3HG7A 4C0WA 5HIAA 3IKTA 4M6WB 2AR0A 4LS3A 3WJ2A 3BS4A 2H1CA 4YLEA 3TUIC 5CDHA 5AVXA 1KPHA 1KE1A 4CV3A 4G3XA 3H9JA 1ZP6A 4GLLA 3ADKA 4DLWA 3DKKA 1J8VA 1HORA 1ZM2A 2QR5A 3ENVA 1T8SA 2NYUA 3KM0A 4PCUA 2AN3A 5EP2A 3ZU4A 3LSTA 4I1VA 4Y7DA 1P6XA 3TD6A 5BXQC 4Y2SA 1QRUA 1BX3A 2M98A 4QBTA 1TX4B 1QKJA 3NI2A 2BTQB 1ETHA 3IKMB 2DULA 3EY4A 2QB5A 2VI5A 3E9EA 4KL8S 4L4UA 4P86A 3QX7A 1Z18A 2ZYTX 3A9WA 3H9BA 1EUYA 3ZUGA 2QTFA 3K0AA 3FM9A 4I3GA 4NULA 1VLZA 3QU7A 4AJKA 1L7PA 1ZMOA 3DW1X 4FFSA 4X41A 2WFZA 1EIWA 4KO3S 1PUIA 1QIJA 3UAWA 4WK4B 4RETA 1JZSA 2V45A 1F0KA 4KE8A 1LV7A 4TQGA 4KZPA 3UMBA 3WMXA 5LXTA 1QV7A 2D54A 2QN9A 1IY1A 1NN0A 4IQ4A 1FU8A 3QKSA 4J16C 4AJLA 4BJ3A 4HDMA 1A98A 1V8BA 3MWKA 4FINA 4FYIA 2V5UA 4YB8A 2QX8A 1C50A 1ZI9A 3I6IA 2L18A 4U8HA 3RFXA 3D3KA 2FUNB 4FHZA 5EWMA 4KK4A 4YRJA 2BE7A 1E0KA 2J9FA 3EEIA 4Y98A 2F3PA 3Q7QA 3UT5A 1FQJA 2ZSIA 1A1SA 1BDMA 2Z1DA 5DHTA 1B8UA 2WOJA 2J9ZB 2IU4A 3RJ5A 3NHPA 4UHCA 3OFNA 1OBFO 1ADBA 3V1MA 1NHGA 4L4RA 2XRYA 1Q1ZA 1ZCAA 5HTKA 2P2YA 3DXFA 3KJXA 3TNLA 4DYHA 5I01A 3LXXA 2QZZA 1DAOA 3HCWA 1SC4A 3RSQA 4DAEA 4JT9A 1E7MA 4RH1A 3SS8A 4ITRC 4KX3A 7AT1A 1P80A 2F67A 3A1NA 2A9RA 4PQGA 1P1RA 1CDOA 4LXXA 4TVBA 5SICE 1ZC3A 1ZS9A 3WK9A 5L3QB 4PNZA 4YMSA 1QCCA 1U1FA 2JLSA 4L5CA 1CB0A 3EQZA 3GT7A 3KAQA 4YMHA 1U02A 2PSJA 4PX9A 1SBNE 3Q5DA 4TTQA 1KSHA 3UW3A 2FF7A 2RKWA 4HZIA 4IIBA 4YN3A 4ZK6A 5DLDA 2ZZMA 1E59A 4BVLA 1KK2A 1H4TA 3WK5A 4CCYB 4NMHA 1WZUA 2VF2A 4FOLA 1EJBA 4O2LA 3ON5A 4BJ1A 4DCUA 4G5OA 4EGFA 1GY8A 1ZD2P 1JJFA 1IVNA 1E3WB 1SCUB 2OBMA 3FHLA 3QQ5A 4LOJA 2FOXA 4PONA 4PX3A 1P33A 4MGZR 3EIUA 2GAOA 4WESA 5C53B 1PJAA 1WEKA 1Y3CE 2WYIA 1XCJA 3LLVA 4DN6A 1OZAA 3SYMA 2MMGA 4LOLA 3LWBA 1QH1A 4ETMA 2IHKA 4DDUA 1RU3A 4F4CA 3QWFA 1Y0BA 2R79A 3NV9A 2F1IA 3VXKA 1JIVA 2FCAA 3F1KA 5EI5A 4RLQA 2FEXA 4RO0A 3S81A 3GRUA 1GAJA 1LX7A 3GNTA 1A8IA 5DF1A 3W5CA 2ZWVA 1GKUB 1L6RA 4NV1A 5ETJA 4CDGA 1OE0A 2AG0A 2AOXA 2EXXA 3CNEA 3QXSA 4FT4A 3TR6A 1MB2A 2HMYB 3L06A 2HLHA 3A6JA 5EMHA 1W47A 3BCHA 4LDRA 1QANA 3UWPA 1QIDA 3EYWA 4BNDB 1LPAB 1PQYA 2B99A 1U1DA 4UATA 2FRDC 4WJKB 3HUEA 3I01A 1A96A 1Q2XA 1SHKA 1FFCA 1ST3A 3EOZA 4IZ6A 2IYSA 5DM1A 1QFYA 1X94A 2D5AA 3F5FA 2ZRNA 4RZ2A 3UOGA 2GAJA 5IC6A 5A1JA 3DAPA 3H19A 4LQCA 5D5HA 4TMXA 5ALFA 3HY6A 2PJUA 4X3OA 5DYYA 4Z7OB 3KETA 4MRMA 5JHGB 4ZVLA 4JITA 4UQLA 2H06A 2C95A 1Z8DA 4HXYA 3UWDA 1EG7A 1W46A 2JANA 2V6MA 2BISA 1K8XB 2C20A 3MJVA 5DNEA 3VZSA 4AJ4A 3KLOA 5KOIA 3H1GA 1KBQA 1SQ5A 2PZJA 5M04A 1O5OA 3AF0A 1IATA 1HDXA 2TYSB 3BDVA 1JB1A 1RCFA 2VQ6A 3VZBA 3K09C 1T1JA 2JVIA 3GRRA 4HVLA 2XD9A 3GEHA 1XDUA 3LDUA 2X2PA 5AT1A 3RUPA 3WS7A 4DUGD 3G8YA 3PQ7A 2O4UX 1RWKA 2EEZA 3R1IA 1HNXB 3HFSA 3L8FA 4KIGA 3VAYA 3DZ8A 3AHIA 4W1RA 4AJPA 2QKYA 2JDIA 2M9MA 2R7KA 1R4AA 1NVFA 2IU3A 3EAGA 1K8QA 2FTKE 3M81A 4G1UC 1NRIA 4TQ9A 4D46A 1ZXXA 1LLDA 3L7KA 5CEEA 2QR3A 5CXUA 3QVKA 2O5CA 4OI1A 1N7JA 1UJ6A 1VRWA 3G2LA 3PFFA 5IFLA 1PTKA 4GYWA 1P9NA 1T9GR 5DGXA 2YKGA 3PNQA 4FC7A 1GPMA 4J4HA 2Q1WA 1X7WA 2ORYA 2PR7A 1HMPA 2PUEA 4ODIA 5EAIA 3M9XA 4NU0A 4LPSA 3ZCQA 4D79A 4EVIA 2P9GA 4DNQA 3I04M 1T5IA 1UPAA 3D7KA 3PLNA 2JD0A 2YIVX 1COZA 3K0HA 4JB2A 3AM5A 4NDNE 4FWIB 1G4UR 1ULTA 1F3OA 3N1UA 4EL5A 5HW0A 3DBHA 5TJHA 3ZTYA 1WD5A 3R3VA 3CX7A 3UGTA 1N34B 3H16A 2KB0A 3VISA 5THXA 3VSDA 1T9BA 2EFYA 2DTEA 3ZY3A 2FK7A 4K8RB 1ZK0A 4JXZA 3KLMX 1Q5PA 1T4GA 2PGDA 4BE7B 2DC1A 2VAPA 4HDOB 1MDFA 3AFOA 4WCFC 2LDXA 3UPTA 2P1ZA 4W1SA 4CR8A 4EHBA 5ADUS 5J4HA 3K70C 1ML4A 3FTEA 4BMCA 3PF9A 2MSEB 2A9KA 2R3SA 3T3GA 4GPZA 4L02A 3RBZA 3TM5A 5CIWA 4MA0A 2P5UA 1Z6AA 1NLUA 1V7CA 4G0QA 3T0FA 4AS2A 4DRZA 4B7UA 2F8TA 3P9YA 1BX0A 1AIPA 4B6PA 5BV8A 3E58A 1DBVO 2WD7B 1L3CA 2I6UA 1K27A 4I55F 3ZH2A 3FE2A 2J9GA 1QCYA 3B51X 3DMDA 3OM9A 2WUVA 3GH1A 4PPFA 2V7XA 4GEGA 3PLAE 2FRDA 3MMZA 1OVMA 2UUOA 2OYRA 1A8HA 5H1YA 1B73A 1Z08A 1IM2A 4D4GA 4JR1A 5JJIA 4HGOA 2QTNA 4CWAA 2C07A 2N1BA 5BR7A 2DU8A 4GP6A 2DEUA 1CUCA 1CZKA 4BKRA 1IBCA 3OLVA 2FMHA 5CDFA 5LJLA 4JU9A 1GUYA 1QO9A 1CS4C 4FX2A 3T7KA 4TUYF 4ARUA 1KETA 1FRVA 1T9HA 1RXYA 3BF8A 4NQRA 3M5CA 3H99A 4DPLA 1KMIY 1OLSA 2ZJ3A 1W36C 3WRXA 3W7BA 3INGA 4TZ0A 1XR3A 1HF3A 3TBHA 3LPNA 1X15A 2C5AA 3BHJA 3FYHA 4M3NA 4M53A 4BTEA 1M75A 3PE4A 4I4TA 2WTUA 1T2DA 3KSZO 2BUCA 2WAYA 2BMEA 5TPZA 4N7JA 1G64A 2AG5A 1XRMA 3QGMA 1XTTA 1MNAA 4FTWA 4UUPA 1KZHA 1XJWA 3I05A 4DWWA 2VA9A 1A9XB 2VHYA 3II6X 3T5BA 4B6OA 2YZNA 4O08A 1SG6A 5CJPA 3ZZ1A 1TMYA 5AKLA 1YBFA 2EZ8A 4XB1A 3IV7A 5ALLA 3G0CA 3QYAA 1BS2A 5HDBB 1AKMA 2PH7A 1TM2A 4FXOA 2WUDA 2SICE 5DXFA 5E95A 5HF8A 4YRGA 5JUWA 1AV6A 4H35A 5C3UA 3KOOA 4JVNA 3KQWA 2O3QA 4L9SA 4EJSC 2P6MA 3NKLA 3DYVA 5B1HA 2WWVD 4F93B 1I7DA 1SC9A 3DQQA 3PL5A 3IRVA 4POAA 1O3YA 2FNAA 2G8LA 3EVDA 3REOA 1ZQ1A 2GX6A 2HQBA 2J32A 3V1YA 1Z5UA 5KHLB 3VU1A 1U3FA 3RSHA 1SVOA 4M7OA 3U7QA 1B23P 2DBQA 1P77A 4KWIA 5CDYA 2EFGA 1HTTA 4J3JA 1HL3A 2BFWA 5K4GA 2WUFA 3C3WA 3LIIA 3G23A 4G56A 2AWOA 3SCZA 2GXUA 3M89A 2KJQA 4HX5A 1ZAKA 3FI9A 5FO0A 2C94A 2GVZC 4RGQA 1HE3A 3AEUA 1W44A 4TZTA 4Y1FA 1T5TA 3PWSA 5EG5A 4B7XA 1RKBA 1JDJA 1O5TA 4GOND 4I8XA 5CG1A 5I51A 5IANA 4US2R 1KH1A 2QTCA 4H2DA 4UHDA 1X7DA 4P93A 3TFQA 4C7MA 1P9WA 2VYVA 5DGCA 4DDKA 1YDHA 1SR8A 1XLUA 5HFNA 5BT8A 1CUAA 4CU2A 1ZVVA 1T35A 4NDZA 3H9EO 1Q91A 2CLOB 5I8PA 3EIOA 4LW8A 4HEA1 1O9GA 3ASZA 3AUUA 2VQSA 2RSLA 3FVWA 1A9OA 3W5UA 3CF4G 3VZRA 1JAXA 3C7DB 4YEDA 4FX5A 2FJPA 2BGTA 2J0UB 2X0DA 3N8IA 1Y9EA 1VG0B 3VR6A 4NNJA 4AQ7A 3I12A 4ZU3A 5A3JA 5DT2A 4Q48A 3AUTA 4KQMA 5KEIA 3OQIB 4OL0A 1ESNA 1SH7A 5GZ6A 3BIXA 5I7WA 3IV9A 1ND5A 3M5WA 3PNVA 3J81k 4D25A 4LYAA 2G7ZA 2P68A 4MQ5A 4DR2B 2QGFA 4OHPA 2YJNA 1BXRA 1IOVA 1QO0A 3H5OA 4EA8A 1L1FA 1ZLYA 5DBIA 3WO1A 2O8CA 3BHIA 4OQLA 4E7OA 4MPJA 3VAAA 2QVGA 2ZI6A 2FHSA 3A4YA 4IF4A 1OLOA 4IWXA 4WKOA 3BJRA 5CX4A 2WU4A 4E46A 3U4QA 2ECOA 1IB6A 4X54A 5AJXA 4Z4CA 1G2IA 3WSWA 3I9V6 2RGGA 2Y1DA 1NVUQ 2QA5A 4MWDA 4MKRA 3ET5A 1MJHA 2I1VB 3W8DA 5FEUA 1LNSA 5K8TA 1TQ8A 2CYAA 3QYFA 3ZXIA 2WG1A 3O9ZA 3PTZA 4IG9A 3WBBA 4NBVA 5HJ5A 2AJDA 2OCGA 4OKIA 1Y9ZA 2E4AA 1WQ3A 4K5QA 4AJNA 1LTHR 4J0CA 3GLFE 2CMKA 2GM9A 4KNYA 1VKRA 3DHNA 3NGMA 2UYQA 3PWZA 4L1KA 1PEDA 5IN4A 2HXGA 4FJ2A 2NSDA 1CBUA 4WNIA 4CMIB 4NCHA 3D8BA 3U3DA 1EG2A 4QJBA 1ZSYA 4DG5A 3JVEA 2EATA 4YDRA 3VYVA 3O75A 1WEHA 5BR8B 3VKGA 1P39A 2J9FB 1VB3A 4RDHA 1NW8A 2YASA 4A8JA 1Q44A 1I13A 3IA7A 5IPFA 3FMOB 5M2QA 5HGXA 3BK7A 4AIRA 5COAA 4F8JA 1TTPB 1OV4A 1R0CA 1Z22A 1M73E 2REOA 1XWIA 4G24A 1IN6A 4ND1A 2GOYA 3GLUA 2FX5A 3C5CA 5JS2A 3RJMA 4YJHB 4KLNA 1ODKA 1PX0A 5DTIA 1LY1A 2UYHA 3VI4B 1CUIA 2QRHA 1LH0A 4OBXA 1FLVA 1KDRA 4CGYA 4OX9B 3SYRA 2EGUA 3A06A 4L0QA 1TU0A 2H1FA 5D2CA 3EMBA 1YR3A 4EI8A 1MV8A 2PGLA 3KOXA 4N0EA 4MUMA 4P36A 3N3BC 3OAAA 4KACA 5JAUA 1F0YA 1I51A 1U4OA 3ELWA 1H9BA 3JQBC 2PKYX 3L7CA 3UEOA 4QO7A 2XUDA 3HV2A 2BGLA 4KXQA 4J2TA 1I01A 4NYMR 4J0KA 3NANA 3P0FA 4B40A 1HY3A 1WL8A 1KJWA 2KW5A 1MG5A 1JECA 1L7QA 1ITZA 2VQEB 2F48A 1UFOA 2CWDA 1FQWA 3P4UA 2ACVA 4BMNA 3R6TA 2ZRAA 4HRVA 3L1JA 3R5XA 5DNUA 3O3OB 5I7SA 5IU6A 1ZPDA 2IK8A 1XMIA 3J80A 3OEED 3ZDCA 3OMLA 1EFDN 4Q3KA 3E1GA 4OA5A 4WLFA 1YGYA 1DU4A 1WBBA 4XYEA 1M74A 2YIDA 3T4EA 4TS4A 1GNVA 3JTEA 2QHXA 4HQ6A 2IEGA 4JCCA 1G1AA 1YAJA 2A1IA 3WOHA 2ECKA 1VMKA 4I50A 4MS1B 5BRNA 3AEQB 2H2GA 2O7SA 1B6SA 2Q29A 3L6CA 3P0EA 2NXJA 2I3DA 5KHAA 4YXWD 3I39X 1N6LA 1DC4A 1PN3A 1MHTA 1GPWB 3VV3A 3AR6A 1UZUA 2AQKA 2ATCA 3QVOA 2Y6VA 3SFVA 3SZ3A 5ITVA 5K6RA 4YCDA 3I8XA 4HV4A 2JLVA 4R3NA 1SCJA 4WX2B 5DASA 1WHSB 2DJIA 2VCEA 1L5OA 4F9TA 2XF8A 1QIEA 2WKQA 1E2DA 2HHHB 4JELA 1JDBB 3A10A 2BFEB 4PSDA 2FUKA 5LKAA 1NBIA 2BSXA 3QLEA 5ICSA 1NBME 2Z8ZA 3CZPA 5DLYA 3REQA 4FOPA 4YC7A 2IYLD 4TGLA 1H42A 1Q0RA 2RKOA 1AKQA 3COVA 3OQMA 1VCOA 2JAWA 3IX7A 2J48A 3SAJA 1T25A 2G83A 2HA0A 2GD2A 3MT0A 1NVGA 1SVWA 3AJAA 4XM0A 3ROEA 1H6AA 2ETXA 1QG6A 2Q6VA 4S1NA 3DUWA 4MROA 3FZYA 4A1FA 2WF7A 2XCRB 3ICEA 4TV9F 4BAGA 5KNBH 2VDVE 1OBHA 3VOAA 3GT0A 1O89A 1X7XA 2RGAA 4GM4A 4LYFA 4FE7A 5CMLA 2IEIA 3P52A 3MA0A 2B9VA 2PZEA 3FPFA 3UFXB 3V3TA 1SOWA 4Q4CA 3E03A 1G5IA 2XECA 1AXEA 5TS3A 5LLTA 1PJRA 3A05A 5LZ4A 3T15A 5KOJA 4MVJA 1OV6A 3DVLA 4G81A 1L5HA 1D2EA 2ZIVB 1V95A 2APJA 5EP1A 1XG5A 4HB0A 4K9SA 3UGJA 4RADA 3B6EA 2P9CA 4PAMA 2Y1FA 3A9UA 2BHRA 1HEUA 3KJNA 1J0DA 4IDDA 3U5ZB 1SVKA 2WQ6A 2QNBA 2J3EA 3F6SA 1PK8A 3GLIB 1SURA 3KCNA 1QRTA 1MN6A 1BXZA 1KNQA 4JVSB 2OHFA 3WIUA 2HSEA 2LKDA 3BSFA 5IAGA 3UO8B 1ZC4A 1CKEA 1W48A 1EFCA 4P4UA 2ONJA 5J4YA 5DW3A 4LYGA 5KQRA 1NBOA 3W90A 4HLCA 2OV2A 5DCYA 5FL7D 3WKCA 2P9ZA 5KDOA 4RMGA 4ZVRA 3RU9A 4AN4A 1QPGA 2HA3A 3ZCSA 1N5RA 1YA4A 2PT9A 4RTNA 4KPEC 3NVMB 1PR3A 3F49S 2G1AA 4NZZA 1SUWA 2V54A 4W1QA 2HIMA 3VYSB 2ANCA 3AWDA 3S2EA 1DARA 4BO6A 1M34A 1WF3A 3PQ5A 3L6RA 4NENB 3T3DA 1THTA 4PZDA 2WAMA 3BX1A 5CLJA 3UTDA 3UXMA 1QRAA 3IQGX 1T6BY 4EYEA 3B78A 5C80A 3DT9A 5HSGA 3LKDA 2SCUA 4QOIA 3I52A 1FYEA 1Z4KA 1UK6A 1TYEB 5AHOA 2C2GA 2NG1A 3BWBA 1TUGA 3NTVA 4YV2A 3RUEA 4K9LA 1E3TA 3VI3B 3ZC3A 4AY3A 3WGVA 2O8BB 3JQAA 2AVNA 5DLPA 1U5AA 2FGKA 2H1IA 4OY3A 5CK5A 3U1BA 3CGWA 2CNWA 3UT0A 1DAIA 3ZXSA 2A0YA 2WWGA 4IX9A 1FS6A 3AWIA 1MOQA 1XK6A 3EXAA 1E7SA 1G3QA 1QYDA 3M9WA 4Y1EA 1SN7A 1XQ1A 4IDNA 3IP9A 4Z4IA 4YWHA 2KWIA 4XDYA 2G5PA 1GAXA 3AI7A 1LQ2A 1N7HA 3G2KA 3IQHX 4FDLA 5DXJA 2W58A 3FPLA 5AXDA 3KSBC 1JJVA 3DZGA 3RUCA 3EGXB 3Q7PA 4YRKA 2CDNA 1C0EA 1G21E 2OO5A 1FFXA 1FQKA 2BBTA 4ZGGA 4ZYWA 3VNVA 2G08A 2JFPA 4OK6A 1EWVA 2OXEA 1XJCA 1ZGZA 3MQ4A 1RYYA 3IL2A 4LZZA 3T1VA 2XXAA 2WM9B 2ZYGA 3G9ZA 3FOCA 4I14A 3IIKA 3M4ZA 3T9EA 1PF7E 1CVLA 3A0RB 3MFQA 3R3JA 2QN3A 4TTPA 1NRJB 3DOEA 3K15A 1BG6A 1FC0A 1KZ6A 1UJBA 4D4LA 4CTMA 4QGSA 1QP7A 3AL0C 3GRCA 4OBBA 4G36A 4CM9A 2QYTA 4BQFA 2PMDA 3FDZB 3EGCA 1TZJA 3REGA 3DGEC 2IXEA 2OHHA 1LRJA 1UC5B 3QPCA 2YJZA 4QX6A 2NXCA 2PRYA 3HR7A 1E9CA 3TOCA 3UENA 1IJKA 2QU8A 2B0JA 3FGPA 4A92A 4GZ6A 2C84A 3O1HB 2YC2C 2CNKA 4IDEA 4BDTA 1BX1A 4G5FA 5C52B 1CYDA 1ZMRA 1YTLA 2J07A 3HJUA 1D5CA 4IILA 4YACA 3WWEA 4CFYA 1BC5A 1C1YA 2NU9A 5A04A 5KYUB 5KYGA 1MB0A 4Q37A 1Q7CA 1VIAA 3NAQA 3T3HA 3FAZA 1FJHA 1KEUA 3P9XA 4JC5A 3P1JA 4BE4A 2JGDA 1TQDA 4KMOA 1ACLA 5FORA 2G0TA 2Z43A 4KUEA 1E99A 5EIOA 3KKMA 1GT6A 1J07A 2ZBRA 4NECA 3MOGA 4DT1A 2V9CA 4KI7A 2VJKA 5TY0A 1J5PA 4DV1B 1G5TA 4RHFA 1DKUA 1RM0A 2GPJA 3AY6A 1DX6A 1G55A 3SN6A 4JJ6A 4BS9A 1VL2A 4MGEA 3RVJA 1A7JA 1O95A 3ER6A 1IY0A 3BQNB 2O7QA 1N5DA 1R6VA 1UEIA 4XDGA 3H75A 1DFGA 4MI1A 4RY9A 4XPIA 5ES3A 5C31A 3UK1A 3EPLA 4MDFA 4RD4A 2A9JA 1PFYA 4ZO8A 4I7EA 2ZWOA 2JFFA 3DAYA 4LVUA 4IS2A 1MT0A 2NV6A 2EKPA 3NO4A 2P9JA 4TPKA 3BICA 3VDRA 3DO8A 5LQRA 1FUYB 4W63A 2N46A 1UBUS 3QLVC 2V9PA 1EAYA 2Q2NA 2Q5LA 4JFAA 4J4TA 2GN6A 4LOHA 4ASUD 5JNWA 2G6BA 1MV5A 2I54A 4JBXA 3WLQA 1VE1A 3C5EA 4RYLA 3AV0B 4BN5A 1KY3A 2FFQA 3CBQA 4TRMA 3FJ1A 2YYZA 5IUJC 1QVWA 3OOEA 2FSVC 2YQZA 3BA6A 1I2AA 2C04A 3QVGB 2JNWA 4RQBA 2I4MA 4TLCA 2NU7A 2DT5A 1YVEI 2GN8A 1N8SA 3TMAA 1QYCA 2NNLD 3OPNA 4BO8A 5KNLA 3P7MA 3FNEA 3Q3VA 4ENWA 3GG2A 1I4EB 2F90A 1B14A 1S1MA 1X0XA 1YMUA 2OGSA 2OOSA 4FWBA 4JHXA 1TC2A 4C89A 1Z35A 1WW3A 2H2AA 3QVUA 4MR7A 4NSNA 3VSEA 4NC9A 1UMKA 5DJ5A 1ISJA 3L1UA 2B5WA 2V7EA 1B93A 4YDHB 5L3ZA 1VYUA 4EBBA 3MTGA 2HUNA 2XODA 1TGYA 4ACAA 4WLUA 4R1SA 3PDJA 3BB3A 4ER6A 3WLNA 5E1OA 4NYIR 4Q12A 3GD5A 4AP9A 2Z8XA 2P6RA 3ZLBA 1M9NA 3O7WA 1Z4MA 4FFLA 5C1OA 1Q12A 1V25A 2P7HA 4CNBA 4MVYA 3UG6A 6NULA 2NGRA 4DLXA 1Y1LA 2HLDA 4R1MA 1AT1A 3IP5A 4HPWA 4XOUA 5B3JA 5H9WA 1QCZA 1A7UA 5JV5A 1UIMA 4ZIRB 2Q9CA 2J7PA 1AXRA 1UQTA 2ZR8A 4YAOA 3SVLA 3QLJA 3CH7A 3KYDB 4NWIA 3I45A 2IPOA 1R6XA 3I61A 3IIEA 3TG2A 1PZHA 4XCXA 4DLUA 1Q3HA 2I8LA 2UVPB 3KKEA 5KYVA 5IZCC 5AVKA 4BV9A 3F46A 1S9HA 3FNRA 4ARAA 3ZK9A 4KMSA 2IUEA 4AZ0B 4HGYA 4N6NA 4Z8XA 3NVDA 2WT8A 4RIGA 5KTPA 1YS4A 1J7JA 2C5EA 2P78A 2PBFA 3DXZA 3JCZA 3UC5A 1W85A 4LF4B 4DRXB 4X44A 2Y1XA 2E85A 4PHCA 4JUCA 3ZY2A 1A8PA 4EH1A 4RU1A 2AMVA 3AHFA 2P9TA 4F85A 3IP8A 4DANA 5IWAB 2M6LA 1JDVA 1Q0ZA 4H6XA 3FYUA 1KOFA 4X65B 4RZXA 1TCUA 1O97D 1TTHA 2WTEA 3UW1A 1T0JB 2Z57A 3BE5A 3PD0A 1YQWA 3QF4B 1QONA 4HG2A 4M54A 3WWDA 1I3NA 4HXFB 5HYVA 2FKNA 5EQFA 4ZI7B 2VXBA 2OHIA 1C8LA 3LVBA 4QM7A 4KYIB 4E2YA 1J0CA 1XCMA 3DJYA 4D02A 3GLQA 3L8GA 5FTNA 2Z2IA 1E2MA 4IRUB 4UZFA 4LDAA 1VGRA 4DA9A 3ZCTA 1YJXA 4EGAA 2C3PA 3GOHA 1DG9A 1TZKA 3OVMA 1VXOA 3N0VA 1KR2A 4PY2A 1GPLA 1KO4A 3HNRA 3NUQA 4OHUA 5F1PA 4BNUA 3GY0A 3I2HA 1R10A 4AJ2A 4JT2A 1GRCA 4CMEA 4S1OA 4M2LA 1VLVA 3NEPX 1K6XA 5DTMA 3K16A 1N6OA 1NSTA 3DS8A 4BAUA 1NJFA 2CMHA 1C4XA 3HVUA 1W94A 3A04A 4NTZA 5LXTB 3ANLA 3ZCXA 1I2ZA 5ICFA 3IUMA 1NNI1 5KQPA 1BXRB 3MRTA 3MAJA 5DW0A 3ZGYA 1SBCA 2NSJA 4E12A 3OZBA 3ZE6A 3KYIB 3SOZA 3T7IA 4XB6B 4CKBB 4ZYZA 2RCYA 2JKZA 3O2SB 1KDYA 3P4YA 2LKCA 3W3AA 1YGPA 4F96A 3JATB 2A33A 3TVDA 2NQ8A 4HWKA 1RYEA 2R1ZA 1DAPA 2C3MA 3AHGA 1WVIA 3VPCA 1PQ4A 2RCNA 1MRNA 2OKGA 4JR0A 1GTZA 5CLIA 1CY6A 3NBUA 3KZNA 2WIKA 2MR5A 1IK4A 2GZHA 5AJUA 1RWQA 1UC4B 2BI7A 2GBGA 2ZS7A 3MYRA 5IYZF 1X7GA 4J0FA 4JI5B 1L6IA 2YZGA