2QQ5A

Crystal structure of human sdr family member 1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
238
Chain Sequence
APMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase/reductase SDR family member 1
publication title Crystal structure of human SDR family member 1.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 88
structure length 238
sequence length 260
ec nomenclature ec 1.1.-.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qq5A00
1P0CA 4NJMB 4PZEA 3LT2A 2GN4A 5HS6A 2HSDA 5I9MA 1KEVA 1M66A 2Y99A 1IL0A 4JIGA 3WTCA 1W6UA 5KJ1A 5KCZA 3KETA 3D64A 5EQFA 5JBIA 1BXZA 2WD7B 4BMNA 5A3VA 4M86A 1G0NA 1GEGA 4YAJA 4YRDA 4NU5A 3QVWA 3D7LA 3U4CA 1PL6A 3PYXA 3EUWA 1MV8A 3ST7A 3BMNB 3DBLB 4GX1A 1U8XX 3OF2A 5TX7A 1U3VA 4E5KA 1QV6A 5DCUA 3A9WA 1CETA 3CINA 4XQEA 1EUDA 1NX6A 2ZJ0A 1R16A 4KZPA 2E48A 4EJ6A 3Q2KA 1SOVA 2QZZA 4CLRA 3WIEA 5IN4A 1ZJYA 4HFRA 1E77A 3ZHXA 4NBRA 4NK5A 3ZGYA 4DGSA 3UVEA 5GZ1A 4AJNA 1PJ4A 2YQ4A 4GSKA 3BHIA 5JSFA 2FR0A 4IMRA 3X2EA 3NGLA 4BIIA 1ZK3A 5K0ZA 2B36A 1N8KA 1AHHA 1LDEA 2GZ1A 3NDRA 4R51A 5A9TA 2WM3A 3WGYA 4MIEA 3M2TA 4EZBA 3NAQA 3GAZA 1Z82A 2JAHA 5TT1A 4O59O 4B4OA 5IAAA 3VH1A 5A9RA 4ZQGA 3WLFA 1PTJA 3E9QA 4FC7A 2IXBA 3UGKA 4DTIA 5T67A 1SZJG 4LCEA 1F14A 1R15A 3PP8A 3RU7A 4AICA 4XYBA 4FFRA 9LDTA 1YE3A 2BHLA 4GH5A 4NQZA 1CQJA 1KVUA 4O63O 3FR8A 4F6CA 1Y8QA 2IZ1A 3V1UA 3SBOA 4E2YA 1GV0A 1OC2A 1H9AA 1AHIA 1NVMB 4CLXA 3UXYA 5JDCA 3G79A 3K92A 3B1JA 4E5YA 2NTJA 5L4LA 1P45A 5JC1A 3KXDA 3M2PA 4CMIB 5F1PA 4AG3A 1TEHA 3WWYA 1N7HA 1B8UA 2VZ9A 3AFNA 4E2ZA 3ETEA 4IS3A 4D46A 4IM7A 4XD2A 2EP7A 4RF4A 1PX0A 5JLAA 4ND1A 5LCXA 2UYYA 5C3MA 3ANMA 5L45A 3OEYA 3UAGA 1LEHA 4DVJA 1XYGA 3O03A 3NGXA 2FMUA 4Z9FA 4YAGA 3GGOA 5JDCC 2CVOA 3GVIA 3GF4A 5B12A 3C1OA 5DULA 3ZU2A 3OQ1A 3L4BA 4I9NA 3GDFA 4DREA 3H6KA 3WG9A 4A73A 4XYLA 2IODA 3DEYX 1P1JA 3CXRA 1MG5A 4AJOA 2NLOA 4M54A 2Y1FA 4E0BA 4GMFA 1IY8A 4H16A 1P1KA 3RUAA 2IDZA 2PD3A 1GZ3A 3D3WB 1T2EA 3EY4A 5DT9A 3VDRA 3N7UA 3ZV6A 3Q11A 3NKLA 4H7PA 4NFSA 1NQOA 1EBFA 2EKQA 3PEFA 1FMCA 3ZDFA 1Y5RA 4YJGB 4XEHA 3WIDA 5L95A 3L4BC 4LW8A 3PIIA 1H6BA 4PLHA 1I5RA 2E6UX 3F4LA 3GFGA 4CV2A 4CR6A 1XQ6A 3WFJA 3ZHYA 2I76A 2D8AA 3E1KA 2HJRA 3PFFA 1PJLA 3PYMA 2VUSA 3ZU4A 4AJPA 5COQA 3WR5A 4NFHA 4GLLA 1N1GA 2O3UA 3QW2A 2G1UA 1LUAA 2O48X 4CMEA 5ES3A 5BNFA 5ENDA 4CLOB 5TC4A 2DAPA 3LLVA 5DCWA 3HDJA 4DBVO 5B4TA 5A06A 3OA2A 1T1SA 2CY0A 4URFA 4QXMA 4ND5A 2R2GA 2YHIA 4ESOA 1BDBA 1B3RA 2ZIZA 3DZKA 4CJXA 5BNTA 1D8AA 2GRAA 3RBVA 1ZEJA 3Q6IA 4M49A 3PZBA 3K31A 3VVBA 4CR7A 3JQGB 4OIMA 2CDCA 1LSUA 3QJ5A 3TN7A 4GL4A 3LK7A 4B8WA 1XG5A 4CMEC 1J5PA 1E6EA 4R41A 1A9ZA 2C29D 3MJTA 4TWRA 1A4UA 1LX6A 1LDBA 2AE2A 4JXKA 1SO8A 3JD4A 3SX2A 2FP4A 1YB1A 1E3WA 4FCCA 1PGOA 4RQUA 3GG2A 1R0SA 4JX8A 1KVSA 1DC6A 5JFOA 4MDHA 4MVJI 3GC6A 2X4GA 4XWYA 5DOZA 3ZV5A 2VHZA 4O1MA 1LLCA 2B5VA 3H2ZA 3IJRA 1O94A 3ICCA 5DBGA 4Z3DA 1NR7A 5CEJA 2CF5A 4BO5A 1H94A 2UUPA 1FDSA 5HM8A 2D5CA 2E37A 1VM6A 1LLQA 3B6ZA 4HBGA 4IPTA 4RGBA 4A10A 4KP7A 2RCYA 3ANNA 4MJLA 1NNUA 4J49A 5HS4A 1P9LA 5T57A 1Y6JA 2PR2A 4W4TA 5FEUA 2X7HA 3ZHZA 5CG1A 2I65A 1ZW1A 1C0KA 2A9FA 4J3FA 4PLCA 4MIYA 1YOVB 2GASA 4UUOA 3QWFA 4DLBA 3CMCO 1PL7A 4R4JA 1BW9A 2GDZA 3KV3O 3ZWNA 4B8ZA 3ZWPA 1PJTA 3I3OA 3IKTA 2DKNA 3MOGA 1C3VA 2HUNA 1QKIA 1YS4A 3EAGA 3K96A 2PNFA 1QR6A 1LQUA 1OFGA 2DT5A 1FDWA 1UXIA 5AVOA 4FJ1A 1T24A 4NG5A 1ZUD1 4ALIA 1N92A 5L3ZA 4I5EA 1YQGA 2VUUA 3DOCA 2X0IA 2JHFA 4PG4A 4DIBA 2IEBA 3ROPA 4GGPA 4I5FA 1AXEA 2W8ZA 2W2KA 3PGXA 3WNQA 4DL9A 4IZHA 3RUIA 3MJVA 4HNHA 4YXFA 1DIRA 1UR5A 5KJCA 2Q1SA 1ORRA 3B20A 3HHPA 5ILOA 3A14A 1E92A 4I8XA 3PLRA 1PJQA 3B1KA 2CF6A 1W8DA 1AXGA 5J23A 1LJ8A 3EVTA 2PZMA 4DMMA 1HE4A 1LTHR 5TT0A 5ILGA 3OJLA 4B4VA 1F06A 3AUTA 3PQDA 4GKVA 3AU9A 3LC7O 4OQYA 4AVYA 1N2SA 1BXGA 4KMSA 3KRTA 1GZ6A 5DP2A 3FPCA 2H5LA 2VN8A 3S1LA 3BMQA 3GN2A 5B4UA 4MVJA 3WYEA 4G65A 5A05A 1X7DA 1NR1A 4OOEA 4CM6A 2DTXA 3Q1LA 5A5FA 3ONDA 4QQRA 4ALMA 1XQ1A 1F17A 1R4NB 4XYMA 1M2WA 4R54A 1E3JA 3DC2A 4CUKA 4D3DA 1ZIDA 3GOHA 4QO7A 1EBUA 4MOWA 5JCJD 1H6AA 1ENPA 1W0CA 2HRZA 4CV1A 5B4VA 1X7HA 4JLWA 1Y8RA 1JKFA 2I3GA 4U6SA 4UVHA 1NAHA 1U9JA 1E1MA 1VI2A 3R6DA 2C7VA 2VRCD 2P9EA 5CFZA 4BO9A 1P77A 3WGTA 1T4BA 3O4RA 1EVYA 5LC1A 2QQ5A 3H9QA 3L07A 1BDMA 4RLSA 2CDBA 4KUGA 1AGNA 1E1LA 3D4PA 4L0QA 1E1KA 4NBWA 5EL0A 1ONPA 2AG8A 2GYYA 3D4NA 3RAJA 4TQGA 1B3BA 1EK6A 4RPJA 5IDYA 1M6WA 1B8VA 4NNJA 5I9NA 1U5CA 4GX2A 5A03A 2Z95A 1ULUA 2J5RA 3EVNA 4IS2A 4Q39A 4WCFA 1RYDA 4K6CA 4RF5A 5U4QA 1UXKA 2VHYA 3GMDA 3HDHA 2I99A 5JYEA 3V2HA 3ITKA 1OC4A 3GHYA 1T2AA 1X1EA 1GADO 2EJWA 4YTEA 4IJUA 1K6XA 2AEFA 2BD0A 3KYDA 1T25A 3E8XA 2ZJ1A 1Q0HA 3VTZA 1DEHA 1PQUA 2GR9A 3G1TA 4GMGA 1VPDA 1NPTO 4CM7A 4LSWA 4BHTA 2J3JA 3E9MA 4HKTA 6ADHA 4TRMA 3CKYA 4DLLA 3TDKA 3BMOB 2P2SA 4HFNA 5TGDA 5KVCA 2PH3A 4TRJA 1R0KA 5JXWA 2D59A 3PFWO 4WCFC 4RPGA 5FFFA 4WLEA 3D4OA 2Y66A 3E6AA 4YACA 8LDHA 3L6DA 3ZW8A 3AOEA 4AJ4A 3TRIA 3DBHB 1D7OA 1WW8A 1SB9A 4YWJA 4AJIA 2DUWA 2J3HA 3ADOA 3F3SA 3EW7A 3OFSA 2H1SA 4F45A 2Y1OA 4E3ZA 4JP2A 4EYEA 3EMKA 5ADHA 1IHYA 4J7UA 3I83A 3C8MA 1J4AA 5A9SB 4A5OA 1KEUA 1E0DA 2PKQP 3AW9A 1HZJA 4NPCA 3ZNQA 1TT5B 2O2SA 1ZFNA 1NHGA 3JV7A 3I9OA 3WTBA 1A7KA 1XEAA 3AOEC 4ONEA 2D4AA 3COSA 2YZ7A 3ZHBA 3HJAA 4L73A 4Q3BA 2OXIA 5KTKA 4IXTA 4BO2A 1R12A 1PGQA 5DBIA 4L76A 4YR9A 4MKXA 1WPQA 3QSGA 3PQEA 1ZVMA 1RJWA 4HV4A 2P4QA 4GWKA 4J0EA 1W4ZA 3VH2A 2CVQA 5H83A 2EF1A 3LYLA 1VJTA 2IYPA 2JKVA 1NWCA 5A4DA 4A27A 4YAKA 1KYQA 4K28A 5TF4A 4YJFB 4HXYA 5DZSA 4BOYA 1HZZA 1ISGA 1GYQA 3KTDA 2CVZA 3NX4A 3JQDA 3D1LA 2GSDA 2FPPA 3JD3A 4ZA2A 3PHHA 3VOSA 5EERA 1NFFA 4FJ0A 4J2OA 5CEEA 5DBFA 3UN1A 2ZATA 3R0IA 1HE2A 3TZ6A 4JJIA 2VCYA 3ZV4A 1VSVA 1FF9A 1A71A 2WYVA 2B35A 2P5YA 4IIUA 4PVCA 4XDYA 2J6IA 4BGUA 5JMWA 1ISMA 3ENNA 4CUJA 4OO3A 4WLNA 4Z9YA 4AFNA 1JKIA 1U3WA 4RDHA 4OGWA 4D7AA 4AJKA 5KVSA 1H93A 4M89A 3VPXA 2X86A 2ZB7A 1B14A 2G76A 4TKLA 1EE9A 4CQLA 3IP3A 1LLUA 2H6EA 1EQ2A 1FXSA 3U0BA 5MGBA 5JAMA 1U7TA 1YDEA 3A06A 3RASA 3S2EA 4C4OA 2DU8A 3KSZO 4XYEA 4NJOA 3I52A 5HWSA 3DTTA 4C7KA 1RM0A 2IXAA 3DB2A 1TI7A 4DXHA 4RF2A 4PLZA 3ZWBA 2JD0A 5KJFA 1M76A 1SC6A 4UAGA 2CDAA 3LLSA 3KEQA 4WLVA 3NUGA 1H6DA 3BZUA 3I6IA 4DPMA 4PG6A 5KOIA 4J1NA 3GNSA 4HP8A 4L8VA 3UCXA 3WBBA 1YH3A 1IZ9A 4CMBA 4Q3EA 4J43A 5I8ZA 2CFCA 4XR4A 2BRUA 5EMHA 2RHCA 1J0XO 4N7RA 4QECA 4UEKA 2SCUA 2XAAA 3ZV3A 5AOVA 3UF0A 3VKUA 2IZZA 3PWSA 3AWDA 2F00A 2BELA 4CLRB 1ZXLA 4WPGA 3RWBA 4QEDA 2HMUA 1BRMA 3VPGA 3GEMA 4YRAA 2W98A 2Q49A 3L4SO 4HWKA 2HK8A 2DPHA 3F5SA 2O23A 1P44A 2WDZA 3U9LA 3KBOA 4ND4A 1E3IA 1CRWG 4YBZA 4LGVA 1MXFA 3OETA 4J9VA 4IDBA 5IN5A 3L9WA 4GBJA 3RU9A 5BSGA 2VT3A 2DLDA 4Y6PA 5BSFA 1JAXA 3GUCA 1PR9A 1XLTA 2UDPA 4OSOA 3RUEA 1EUZA 4JQCA 2GGSA 4RVDA 4PLTA 2Y0EA 1EVZA 3NTRA 1IB6A 3ZWVA 4E2WA 4NDNE 2ZK7A 4PG5A 2VRCA 1KVRA 5THKA 4N5LA 1Y8QB 2AA3A 3GR6A 5IDXA 4BO3A 4KWHA 4ND2A 2JCVA 1B15A 3GN1A 1O9BA 1E3SA 4N5MA 3MJEA 1KEPA 1RM4A 1DAPA 5IFLA 3L6OO 1SCUA 3KO8A 4Q3AA 2GNAA 5FI3A 1I33A 3RBZA 5TLSA 3FI9A 4I5GA 3ONFA 4OM8A 2HMSA 4BNWA 1IHXA 1R6DA 3DZHA 3V2UA 3W1VA 1ADCA 2ZKLA 1QLJA 4EW6A 1QG6A 2Q1WA 2AQKA 2UVDA 4OAQA 4YQZA 3JQ7A 3DMTA 4W6ZA 3TFQA 2EIHA 1C0IA 1UP4A 2A92A 1HDRA 4L74A 2Q45A 1KIFA 2WE8A 2QHXA 1LNQA 4F46A 3VVCA 3D5TA 3R3JA 1HE5A 1HEUA 3FR7A 4B4UA 1C1XA 3JQEA 4YQYA 1ISJA 3UCEA 3WXBA 4KQWA 5EINA 4PRLA 5GY7A 1QSGA 4IGEA 1ZCJA 2DFDA 4WLUA 3ETGA 1K6IA 1RKXA 1GY8A 3DMTC 2YV1A 4RQTA 4XDZA 4OOFA 1MUUA 3FSRA 1E1NA 2RAFA 2JJYA 2PWZA 4DQVA 4TROA 2FRDA 2WYWA 3DAPA 1IUKA 3KSUA 3GPDG 3I9KA 4FN4A 1WMAA 3HDYA 2NADA 3JYNA 3ZWYA 1DFIA 2EV9A 4YB8A 4CM4A 3CIFA 2G5CA 3LVFO 4ZRNA 5F3RA 2ZQZA 1VL8A 2BGLA 2A94A 4INAA 5T8KA 3TOXA 4YAEA 3RUFA 1X13A 2P68A 3WS7A 3IP1A 4IUYA 1I2CA 3KYCA 4R1TA 1H6CA 3INRA 3GZNA 3NYWA 1HSZA 1WMBA 3JYLA 3OEWA 3I9LA 3O38A 1HL3A 3C7CB 3TQHA 1PL8A 3GG9A 3JYQA 2I66A 1DRUA 3QV1A 4PG7A 1ZH8A 3W6UA 3GGGA 3EDMA 4FSHA 1E7MA 4JCOA 1GPDG 1B8PA 4IDGA 2ZTMA 2NNLD 1P1IA 2YHIB 3HB5X 3FBTA 2NWQA 1P3DA 1OAAA 3NT5A 4BUCA 1JU9A 5TSDA 4DIFA 3AY3A 4XCVA 2BFOA 4QTZA 4RDIA 5DOVA 4TZKA 5DDIP 5T8KC 2PK3A 4BMVA 1EZ4A 4IDAA 1UJMA 2ILTA 4WGGA 4EUFA 1UZNA 1GPJA 1GZ4A 2ZYGA 2GLXA 2D3TA 3AI2A 2HAEA 4J16A 3PHLA 2NU8A 2FR8A 5T6BA 4E5NA 1WDKA 3DZIA 4CPDA 1ENYA 1WLYA 2AHRA 3C85A 1B7GO 1U1IA 1VJ1A 1E3WB 1WZEA 1Z74A 4Z9XA 1PS0A 1V0JA 2HJSA 2FOIA 3B70A 3RVDA 4J4HA 1VL6A 5K6AA 3VZQA 2I67A 1T2CA 4YVFA 4E12A 2FWMX 1UUFA 3PHJA 3KZVA 2EWMA 4KUEA 1Q7GA 4TZTA 3UCFA 4QUKA 1DFHA 4R9SA 3OICA 2X9NA 4PVDA 4BV9A 1DSSG 5ICSA 1DPGA 2E82A 4R68A 2HK7A 2VHWA 1K2WA 3W6ZA 2C54A 4QFDA 1KC3A 2VYVD 3AM4A 3TL3A 2LDBA 4R01A 1DHTA 3QIVA 4KUHA 4MKRA 1E7RA 3PRJA 1UZLA 3E48A 3ZI0A 4BNNA 5K6AC 3EGOA 4WEOA 3QP9A 4EEXA 2C82A 3QWIA 5C7LO 2CNBA 1O95A 3DBVO 1BW9B 2EGGA 2GUGA 4R16A 4A03A 1GEEA 1GQQA 5JCXA 4M87A 5G0WA 5H81A 3VC7A 1GTMA 4RPKA 3H5RA 2X9VA 1VE9A 3F47A 1Q2XA 2RH8A 2JL1A 3MZ0A 4JBGA 4XKJA 1XCBA 4ZGWA 1GDHA 1YDWA 3WQRA 2B4RO 3JTMA 5G0UA 4JROA 5L7YA 2BF7A 4MINA 3C1TA 2JAPA 1MB4A 4OQZA 2W2KB 1K0UA 1K89A 1R66A 3JQ6A 3WX0A 1I30A 3WMWA 1U8FO 4B7XA 3FRJA 1X0VA 2CZCA 2NTVA 2PZLA 3RFTA 2H63A 5F1OA 4BGEA 1PIWA 3PJDA 4XQCA 1NQ5A 2VZ0A 1N9GA 1QP8A 5AYVA 2DBRA 4JN6B 4ZRMA 3FD8A 2C2XA 2P9GA 1EK5A 5L53A 1HDZA 1PWXA 3GVPA 1VRWA 2C07A 3S2FA 2RH4A 3I1JA 3TFOA 1BXGB 2CUKA 2BI8A 3QQPA 3LT1A 5T64A 1GFSA 3FF4A 1PQWA 2VWHA 1R4MA 5HBRA 1JTVA 1X7GA 3MTGA 3SXPA 3BMQB 5ICMA 4J4TA 1U3UA 1LQTA 1ZSYA 1BSVA 5BR7A 3QRWA 4II2A 3GRKA 3FHLA 2P5UA 1PQPA 2B69A 3RC9A 4LRTB 3E5RA 4MVJH 1EDOA 2EKPA 1M67A 3DFUA 5DF1A 1OI7A 2X5OA 4GQAA 2VQ3A 1HXHA 8ADHA 1LU9A 4RVSA 2PKQO 1Y8RB 1BMDA 3FPLA 4O6VA 2NU9A 2R00A 3I5MA 5G0VA 1PZEA 4ALLA 1T2DA 3I4CA 1NASA 4NR0A 1HDOA 4LK3A 3W4JA 2AG5A 1Z75A 1EEHA 3PYLA 4WK6A 2DM6A 3P2OA 4Z0PA 2VWQA 2V6FA 4OH1A 1PJBA 5IJZA 5BQFA 4UVIA 2D0IA 2NQTA 1YB5A 1FK8A 1XDWA 5KKAA 1N5DA 4TMFA 2WWRA 2FPGA 5CP8A 3WGIA 4NFYA 2IEDA 4R9RA 1BGVA 3MJ4A 3N58A 2HRBA 1YWGO 4P4GA 4GGOA 4BKQA 2NVBA 2OBYA 5A02A 1X0XA 2PH5A 4BKUA 1OZAA 1C1DA 4JBIA 3KB6A 4DC1A 2R00C 2NVUA 4JBHA 3BYZA 4WCFB 3SJUA 4BO7A 1ZBQA 3JSAA 4HX5A 4AJ1A 4HADA 4EITA 1A72A 3RFVA 5G4KA 2W90A 3D3EA 2Y67A 3KYDB 2O3QA 4Y8VA 4YT8A 1SNYA 1EMDA 4E32A 2VOEA 4J1SA 4KDEA 4BO1A 2FHSA 4FC6A 1QYCA 4RV9A 3K8ZA 4BB5A 1NPDA 2DBVO 4OXKA 1ONNA 1C0PA 2Y0CA 4PLVA 3QA9A 4C7JA 3PK0A 3ZNPA 2DUUA 3QVXA 2PLAA 1E3EA 3RJ9A 4XRGA 3RKUA 2DQ4A 3RIHA 1Y5MA 4XIYA 3DOOA 2BFMA 4PLFA 3RC2A 1PZGA 1WP4A 2PD6A 4OKNA 4RVFA 2FR1A 2O7QA 4Z3KA 4OKIA 4EJMA 3TL2A 4Z0TA 2R6JA 1ARZA 1PZFA 1DB3A 3GNTA 4NH4A 4NMHA 5JAZA 2RBEA 6LDHA 5KVVA 1ENZA 3BHMA 5HA5A 1DIHA 4P22A 1HF3A 2NU7A 3AUAA 5KWEA 4G5HA 2C5EA 3IKVA 3WGHA 4L9RA 4HUJA 2O4CA 3IL2A 3ROMA 1ADBA 2UAGA 5G0TA 3CPSA 2EW2A 3GVCA 1TLTA 4NBVA 4LSMA 1HDGO 1MC5A 2DC1A 4PIVA 4NBUA 4QO8A 2XPCA 2W4QA 4MKZA 1I24A 3ZWAA 4BQPA 3GFBA 3PVZA 1BTOA 1IE3A 2GZ3A 2RIRA 3HN7A 4NIMA 1FDTA 3UOGA 4XQ9A 1XR3A 2WTBA 4DIOA 5G4LA 3I23A 3DO5A 4R69A 4XX0A 3LF2A 3U62A 4QX6A 1Q1NA 1J49A 3D5QA 4ZQEA 1ID1A 1SEPA 4IY1A 3ROQA 1XU9A 1KBZA 2X5KO 3FN4A 1ZSVA 3RQSA 2VYVA 3FNGA 3TZCA 1LBEA 2V65A 1L1FA 3S2GA 2OFPA 2JFFA 4KTTE 5TNXA 2JD1A 4FQ8A 1VKOA 3ZCXA 5JDIA 1YL5A 3WLEA 2BH9A 1GV1A 3NTQA 3QVTA 4UVEA 2FSVA 4DRYA 4CQMD 2V6GA 1C0LA 3HFGA 1PSDA 4G81A 4JJGA 2VNAA 1NWHA 1RYEA 3BMCA 4LMPA 5L7TA 1KY4A 3EK2A 2OBNA 4CQLB 1QYWA 4GX0A 4WOJA 3H9EO 1DIGA 2J3IA 4YJHA 1U2DA 4JP3A 3C7AA 4RVGA 4BO6A 2Q2WA 5TS3A 4DQXA 2NU6A 3RROA 1EE2A 3JQAD 1RM3A 3DR3A 1T2FA 4IDFA 5ITWA 5JDIC 1U7HA 1PJ2A 1ONOA 2ZTVA 3F5QA 4CM9D 1V6AA 1W73A 3K5PA 2WEKA 3GEGA 2DBZA 4WUVA 4OHUA 3OQ6A 4II3A 1U5AA 2CSUA 3QE3A 5H82A 4LVCA 4ZVVA 1ULSA 1CDOA 2J5QA 3R1IA 1DJNA 2Q4BA 2Y1EA 3HDQA 3T4XA 2JD2A 2O4UX 4UVDA 4YA6A 2Q2VA 3A4VA 3ITDA 4CMGA 2F1KA 1DIAA 4ZQBA 1BG6A 3IOYA 3O9ZA 2O50A 4BNJA 4BNFA 2G0TA 4DPLA 5FI5A 3KHUA 4KWIA 4GAEA 1WZIA 5AXCA 1JA9A 2VWGA 3K2EA 4MP6A 1B0AA 2EKLA 3FCOA 3WNVA 2O3SA 3JQ8A 3FBGA 3JD0A 2HMWA 3WQSB 3C24A 4EUEA 1CJCA 1NPYA 5DCYA 1JDJA 4AL4A 3V8BA 2B83A 1PWZA 1QYDA 4RLHA 1HDCA 2VWPA 3ONEA 5I9LA 3NJ8A 4BVAA 4BKPA 2OL4A 4AJEA 1SB8A 1XKQA 2JCXA 3AJRA 2GD1O 3PJEA 3BAZA 4XJSA 2X5JO 4RF3A 4BNXA 4R3NA 3WFIA 1F12A 1OBFO 1O6ZA 3ETDA 1I3NA 5L4SA 2VRBA 2G82A 4CL3A 3SC4A 2I3AA 2Z1NA 2B4QA 1KVQA 5ER6A 4JGBA 4BKRA 2ET6A 3JQFA 4ZN6A 5A1TA 1K3TA 1EQUA 2AQ8A 2EHDA 2VHVA 3JQ9A 3ON5A 3PHIA 4FOOA 4CLDA 4YYZA 2C2YA 3IJPA 4GI2A 1A5ZA 3PWZA 3BIOA 4TRNA 3S2IA 1H2HA 1X15A 4MVJF 2ZQYA 1HT0A 4HFJA 1UH5A 3OIFA 3JQCA 4DBZA 4UVGA 1Y7TA 2DVMA 4WCDA 2PGJA 2BLLA 3MEQA 1KVTA 4BB6A 4L4RA 4RO0A 3HE3A 3HN2A 1ZEMA 2J5KA 3JQ7B 3B1FA 1X14A 3KLPX 3U4IA 4DPKA 3JQFC 4WEQA 1IULA 3QVSA 2PFGA 3PHGA 3HFSA 3JQ9C 3OECA 4BL5A 4IQGA 1GQYA 3DHEA 5EN4A 4MO2A 4WNIA 4CM3A 3GLQA 2FN7A 2QZ9A 3Q9UA 1N1EA 1DRWA 1ZK4A 2IZ0A 1I36A 1C1XB 4U6QA 1P1FA 4MVJG 2AXQA 2QRJA 1I3LA 4ALNA 3K73O 1UAYA 5IDWA 4JJFA 1K6JA 4FOSA 4IQ0A 1MG0A 2VNSA 4EI2A 3PIDA 3T7EA 4FJ2A 2GPTA 3OQBA 3DQPA 3TZQA 2FY8A 5G2OA 4EBFA 3HNPA 2VUTA 1YO6A 4CL8A 3DFZA 1N7GA 1V35A 1G6KA 4LN1A 4A7PA 1DJQA 1VSUA 4DA9A 3VH3A 1GUYA 3RD5A 2QG4A 2QX7A 4CM4B 1DHRA 3DONA 3IS3A 3C7DB 4N5NA 2OGUA 3BXXA 4M8SA 4RPLA 5L4NA 3OMLA 5BSHA 4K9DA 2YW9A 5MDHA 3RUCA 3K2BA 2CMDA 4FFOA 1M75A 3ZH2A 3VHRA 3KYCB 4YT4A 3IUPA 1T4DA 3GZNB 1PGJA 3U49A 1KETA 1Y81A 1O5IA 4YRBA 4AJLA 1WXDA 3GDGA 1V3UA 3K9QO 5ER9A 5I7SA 2PV7A 1LDGA 2Q4EA 3NJ4A 1H0KA 2J8ZA 4W7IA 3G49A 4LVUA 4QSMA 5B37A 1PGPA 1GCOA 1Q7BA 3DBRA 2NSDA 3GNQA 4E2XA 1YQXA 1ZK0A 1QYXA 4LISA 2A4KA 3TZKA 1JVSA 3OBBA 1ENOA 1HLDA 2AE1A 4L75A 1A9YA 2Q50A 1M6HA 4O0LA 5JY1A 4D3FA 1CIVA 3P19A 5JCJA 4I9UA 3ZWMA 2HMVA 1R37A 4B7UA 4BO8A 4DC0A 3QHAA 4GVXA 1CQIA 2NVWA 1B16A 5ITVA 4WJZA 2X1HA 1F0YA 4Y67A 3ZWCA 2O3TA 4CQMA 3DHNA 3UKOA 3WQQA 4E31A 3IQDB 1Q0QA 3W8EA 3GUYA 5EIOA 2X22A 3G0OA 3EHEA 4GVLA 4XGIA 1RM5A 3RKRA 4PCVA 1DO8A 1I0ZA 4EDFA 1GAEO 4B3HA 1KERA 3MJSA 2LDXA 2O3RA 3VDQA 1DC4A 4BNTA 1ADGA 1VKNA 2PGDA 3GRPA 3JQAA 4K1LA 1ZKMA 4D41A 5KKCA 4MVJP 3Q0EA 3VPFA 1CWUA 2Q1UA 1A27A 1NFQA 4J0FA 4OJNA 4CM9A 4IZIA 4RL6A 4B4WA 4TSKA 3LU1A 4TRRA 1S6YA 4DWVA 3F9IA 4RPHA 4UUPA 4J9UE 4ZJUA 4XB2A 3P5SA 1Z7EA 4CUZA 5CG2A 4U8GA 1QRRA 3W4KA 5K9ZA 2PKRA 3N74A 4WECA 3TF5A 3LSYA 1QLHA 3VPSA 1SMKA 2NM0A 4PFJA 3GDOA 2YFHA 1XHLA 4FFPA 3KEOA 3GH3A 3G1UA 3QVOA 5COBA 3SC6A 5JO0A 1U28A 2Q2QA 4P8RA 3M1AA 2OHXA 3ANLA 3SJ7A 3O8QA 3V1YA 5C5IA 1JN0A 3FNFA 4CM8A 1YL6A 1E7SA 2AEJA 3QWHA 3OJOA 3WJ7A 3DZGA 2CD9A 1P74A 1GCUA 1CEQA 1PZHA 1UZMA 5F5LA 3IAHA 2BMAA 2D2IA 3TOZA 1LLDA 2Y1CA 2Q1TA 4PLGA 4XB1A 5C7IO 1O89A 2Y0DA 1E5QA 2ZCVA 1HWYA 1C14A 1Q7CA 3P7MA 4W9NA 4UUMA 3NDIA 4D43A 2WSBA 1N9GB 3C1AA 3PTZA 5JE8A 4M1QA 1I3MA 3FNHA 4BS9A 1NTOA 4IDDA 2AQHA 3VPHA 1EVIA 4BGVA 3L6EA 2HMTA 2NV6A 2ZB8A 1ZO8A 4R3WA 1R4MB 5KVQA 1WVGA 1U3TA 4PLYA 3WDSA 4GLOA 4I1IA 1DDOA 1O8CA 2C20A 4XJTA 4ZQFA 3W4IA 3GGPA 3DOJA 5AXAA 5I7EA 3LF1A 5IF3A 4XGKA 3TPCA 4RZHA 1NAIA 4I9HA 4W9NC 1JVBA 3JYOA 5GMOA 2DPGA 4HFMA 5JYDA 1DLJA 3WYCA 4GPD1 4D45A 3W8DA 4YT5A 4N18A 5CHEA 3VZSA 1D1TA 3MWEB 1HETA 4R5HA 2Y05A 5JAQA 3T7CA 3WOHA 3G3EA 3CH6A 3V5NA 1CERA 2NACA 3RUHA 4I5DA 4NBTA 1UP7A 3CEAA 4GWGA 1H5QA 4D0SA 4MIOA 3CTMA 2X58A 2WD8A 4Q3DA 2GN6A 5CDSA 2I5PO 1RWBA 4Q9NA 2BKAA 1IOLA 1G0OA 4D79A 3W8FA 2RHRA 1DBVO 3PXXA 2PZJA 3QY9A 1UP6A 3H9GA 5A5EA 3U3XA 4XYGA 3NRCA 4Y9DA 3BA1A 3DXFA 4QFCA 1C1DB 1PJ3A 2NVUB 3ZW9A 4KDFA 3LT4A 4LRSB 1DOHA 3X2FA 2QYTA 1UDAA 1E6UA 1X1TA 2BFAA 5G4KB 4CMAA 4WLOA 1P1HA 1I3KA 3FTNA 2I6TA 2YFQA 3MCVA 3TSCA 3AUUA 5TJ9A 4L4XA 1RPNA 5EQDA 1VC2A 4MVJD 3ULKA 4GKBA 4ID9A 1OMOA 3LZ6A 4FD3A 2WMDA 3OHSX 1EFLA 4U0KA 3H5AA 3SEFA 1Y9AA 4ZHSA 3GMSA 4NZ9A 3AI3A 4RZIA 2PA3A 2OP0A 3KYBA 2BI7A 3WMXA 4E33A 4A0SA 2X6TA 1AE1A 5DP1A 2EEZA 3HWRA 5KJ6A 4K26A 2VZ8A 1YBVA 5JW6A 3ZWXA 2BGMA 3VH4A 2Q3EA 4R1NA 3OP4A 1D1SA 4BNGA 4K6FA 2X0RA 3AY7A 1HRDA 4UEOA 3WWZA 4D42A 3OIDA 3PLNA 1F8GA 4IDCA 4WOKA 4B3JA 9LDBA 4BNVA 3V2GA 1A4IA 1UXJA 5T5QA 1BWSA 1QYVA 1HKUA 1LDNA 4H15A 2HDHA 4BO0A 4RJTA 3OA0A 2V7PA 5I7FA 1CF2O 3I4FA 5HRUA 1JAYA 5F21A 1B26A 1PJCA 3F1KA 4W99A 4CMCA 3M6IA 1SEVA 4RORA 5EESA 4NJMA 2VOJA 1NHWA 1S7CA 4WLFA 4DYDA 5IXYA 3ROKA 1ZJZA 5L9AA 1MP0A 5EPOA 1LDMA 3DDNA 3U4DA 4CMKA 3CZRA 2Q46A 3BTVA 2HU2A 3NTOA 2WD7A 1JLLA 3JQBA 2HK9A 3FWZA 4E13A 1WDLA 3DZBA 4Y98A 1WAMA 2OZPA 1HYGA 3BMNA 3DBLA 3INTA 3F6YA 2Y93A 2EW8A 4HNGA 1PR3A 4XRRA 3JD1A 1FDVA 3EZLA 5C7OO 5GZ6A 3KOUA 3NV9A 1GUFA 1Z6ZA 1F8FA 4PN3A 4Y6RA 1ZMOA 1A7AA 4W82A 2QRKA 5FWNA 4Q3NA 3RI3A 4XQGA 2UV8A 4FPXA 3EYWA 2YY7A 3SLKA 4U5QA 5JC8A 3DHYA 3PPIA 5EJ2A 3JQBC 3PJGA 3JYPA 5IZCA 3ASVA 4IQ8A 3IMFA 2GERA 1EFKA 3HZZA 2AW5A 4YJDA 1OOEA 5G0SA 4XZ3A 3DAFA 2JFHA 3BMCB 4D3SA 5A04A 1GL3A 4ZICA 1GD1O 3K6JA 4R5MA 2EP5A 3PGJA 3PWKA 1P0FA 4H3VA 3BTUA 3MJCA 5BSEA 3H3FA 4YJHB 1DC3A 4BNIA 3MWDB 3NT2A 4A26A 3PDJA 3C3XA 1ISIA 2GO1A 4U7WA 1U4SA 3FTPA 3ZWWA 3I9JA 1GR0A 2QYSA 4FFLA 4IJWA 5IZCC 1ML3A 2B0JA 4J4BA 4DQUA 1HSOA 4X54A 3O26A 1CYDA 4PRKA 2W2LD 1HE3A 2I9PA 3DTYA 3STHA 1NVGA 2VYND 4IIVA 4CMHA 2OUIA 4NHEA 2C5AA 1PEDA 5I8WA 3H65A 4CMIA 3HSKA 1HYEA 2IYOA 3AU8A 4IGFA 5GZ3A 1IPFA 3WGQA 4OSPA 1KOLA 3QWAA 3TJRA 5TQVA 2YHUA 3V1TC 4Y6SA 2EERA 1LXCA 1P1RA 1UDCA 4S1VA 3H9UA 3G17A 4OL9A 3JQ8B 1SPXA 4PLWA 1XU7A 3ZU3A 4YDRA 3GVXA 4FW8A 5FYDA 4B79A 1DIBA 4UREA 4BO4A 5L51A 3GAFA 1YBMA 3F46A 3SLGA 1D3AA 3I6QA 2VHXA 1YL7A 5BNIA 4J1QA 1V3VA 5KNLA 3AY6A 4EEZA 3H2SA 2Z1MA 4G2NA 2H9IA 5AXBA 3NEPX 3SVTA 1IPEA 2FZWA 1I32A 1K5HA 4IMPA 1ZNQO 3AM5A 3I9NA 4BNMA 4D0RA 3DMYA 3HB4X 1NM5A 5A3JA 3D3WA 1I2ZA 2TMDA 2BGKA 5TRTA 1MA0A 5U9CA 4WNCA 3FWNA 4PZCA 2YYYA 2IE0A 4YJGA 1GYRA 2XF8A 3QLJA 2EXXA 4XR9A 1QV7A 4DLAA 3AUSA 1LC3A 1TA4A 3MTJA 3A28A 1EDZA 5BT9A 1MFZA 1NBOA 2ZB3A 3A1NA 1NYTA 4J90A 4BQRA 1YXMA 4CLHA 1XIVA 5ENVA 4ALJA 1I8TA 1Z7BA 4GSLA 4CLOA 2ZCUA 4PZDA 1YRLA 1JKJA 3IIEA 3JD2A 3OH8A 3RCBA 3ZN2A 4XGNA 3KLMX 5F1KA 2NTNA 2OORA 2C59A 3JCZA 3NT4A 1MLDA 1YKFA 5JS6A 1PGNA 2V6MA 4RVUA 1HTBA 2Z5LA 3P2YA 2WJPA 5L7WA 2B5WA 4BMSA 1B2LA 1KY5A 1NP3A 4YEDA 5CAEA 4PGFA 1NFRA 4CV3A 1MX3A 2AQIA 4IDEA 3WYBA 1ZXBA 3JQGA 4IJVA 3VTFA 2E4AA 4XIJA 4P4LA 3INGA 2WYUA 4KOAA 2VTDA 1G1AA 4Z0HO 3PJFA 2WE7A 1DRVA 2ZTLA 5JAIA 3WGZA 2POQX 4LMRA 7MDHA 1QXSA 1Z45A 4S3MA 2JFGA 1P31A 3IUSA 2E49A 5JNLA 3GHHA 1D4FA 3L9XA 5AXDA 4CR8A 3H5NA 2QRLA 4TVOA 4EUHA 1DLIA 3GA0A 3ZNOA 4HY3A 1GQ2A 2OMEA 2D1YA 2PGLA 3GQVA 1JQBA 4PG8A 4FFMA 1VL0A 3HUDA 3AI1A 4OYRA 5FF9A 3WSWA 5C37A 1E3LA 1YQDA 1HLPA 2DTDA 4FDAA 2G17A 3QWBA 3AK4A 1WWKA 4L4SA 4LCJA 4J7XA 3RC1A 5IZ4A 4Z6KA 5L40A 2GCGA 3GK3A 4FS3A 4EJ0A 3ZWOA 4J1TA 1IZ0A 4OXNA 1LA2A 2NQ8A 5JPIA 3E9NA 4YAIA 3DBRB 1YGYA 1O0SA 3LQFA 1KC1A 2B37A 1YONA 2J3KA 2PY6A 3GEDA 5F5NA 1IYZA 4E5PA 1UAGA 3LC1O 3OJFA 3UHAA 1E7WA 1BVUA 3UFXA 3ASUA 4MVJE 1YOVA 4TVBA 2ZYDA 3ABIA 1SAYA 1WDMA 1HDYA 1YVEI 3GVHA 3IDSA 5CDUA 2V6BA 1JWBB 4BGIA 2C7GA 1DC5A 3U09A 4ZD6A 3BTOA 4BNYA 3D0OA 1LI4A 3ICPA 1E7QA 4ZU3A 3WBFA 7ADHA 1FDUA 4ND3A 2GZ2A 4ITUA 2YV2A 4ILKA 4NK4A 2NUAA 4FBGA 3NDJA 1L7DA 1LRJA 4UEJA 1XA0A 1LDYA 5LDGA 4BV8A 1QMGA 5AQ1A 2XXJA 4CQMB 1DXYA 1ADFA 3BTSA 4XA8A 2GF2A 3DL2A 1XGKA 3DZJA 5HTOA 1DAOA 4U0JA 1YJ8A 4P38A 1BXKA 1ZZEA 3H3JA 3OM9A 2DBQA 5DNAA 2YDXA 3S55A 4NU6A 4YCAA 3RUDA 4B3IA 4OXYA 4M55A 3CSDA 4DUPA 3TWOA 2ZYAA 1E6WA 3WGOA 3WICA 3WJAA 2YJZA 1P33A 3H9JA 3JQAB 3ORFA 3GZ4A 1AN9A 2AMFA 4FB5A 3T4EA 4B7CA 1UXGA 1TB4A 1T1RA 3CMMA 5CEFA 1MFPA 3S8MA 3RSHA 1LSSA 2X0JA 5TJHA 3RBXA 4ROSA 4BNLA 4KTVE 4IJKA 3ENKA 1GU7A 4J7CA 3UICA 1UXHA 2W2LA 1LSOA 5CDYA 2VYNA 1SOWA 4E6PA 3H7AA 3UH1A 1LSJA 3LT0A 1R4NA 4CM5A 5IG2A 2GN9A 1V9LA 4BNZA 1GUZA 2YUTA 1BVRA 4DYVA 1ZK2A 1GYPA 2Y68A 4D44A 1TVEA 2HCTA 5IXSA 4P4NA 2AEMA 3LDHA 2HLPA 3O8QB 2QIOA 2ZTUA 1Z73A 3E03A 4CM8B 4MPDA 5U1PA 2C0CA 1U2GA 2VT2A 3Q3CA 3FNEA 2B4TO 4CLEA 1HDXA 4IINA 2PD4A 3GPIA 2PZKA 2JHGA 4MP3A 5KJEA 4CMJA 5JO9A 1T26A 4Q3CA 4WE3A 3Q2IA 1MGOA 3DWFA 3EC7A 4BNHA 3K30A 5JMPA 2XXBA 4J6FA 4YPOA 4RCVA 4RVHA 1Y9EA 1ZSNA 2DTEA 4BNUA 3M1LA 4O5OA 4W7HA 3BHJA 4UUNA 1H9BA 4AJJA 3U5TA 4KQXA 4TKMA 1PS8A 1NXQA 5COAA 1KS9A 5IDQA 2X23A 1QORA 3U4HA 3WB9A 4F6LA 3VZRA 4EGFA 3PZRA 3ZNNA 3VKVA 1MC4A 1NQTA 2YV3A 2P4HX 4N54A 1LRLA 1TXGA 3KVOA 2JCYA 4FGWA 4WKGA 1SBYA 1DFGA 4IXWA 1NQAO 3HQ4O 3KSDO 3PI7A 3MOIA 3BMOA 4J2HA 4FIZA 3HG7A 4BKOA 4MP8A 3OIGA 1YJQA 1EVJA 3CUKA 4F3YA 4GX5A 4CODB 2X9GA 1KEWA 1LC0A 1JWAB 2GN8A 4CM1A 3AM3A 1MXHA 2YQ5A 4BNKA 1XELA 2OP1A 2OO5A 5DN9A 4R1SA 1BHSA 1ZK1A 3DBHA 4JNKA 1I2BA 1PU2A 3ADPA 2HKIA 3DZFA 3IC5A 4IBOA 4ZQHA 4FR5A 2BFPA 3VZPA 1ISFA 2PTGA 3PQFA 2D5AA 4ALKA 1ZMTA 3E5MA 1Y1PA 5JY6A 3CZMA 2X8LA 3UUWA 4E21A 5B1YA 3HADA 3I9MA 5A9SA 2HQ1A 2X0NA 3GY0A 4YT2A 4R1UA 1HYHA 1J6UA 2YDYA 3RJ5A 3VAZA 1TT7A 4E30A 1TT5A 2P91A 2EGHA 3RFXA 1YBAA 1VLLA 2FPIA 2FSSA 1Q0LA 3F4BA 1VJ0A 4QT0A 3OJEA 1R0LA 4I08A 2QW8A 1E5LA 1I01A 4AJHA 5KIAA 4FFNA 2EJVA 2HO5A 2O3JA 3EZYA 3KUXA 2TMGA 3GT0A 1V3TA 3LC2O 2Q99A 4PLPA 3E82A 4OMUA 2UUOA 4JK3A 3ZU5A 2P9CA 1NVTA 1XWFA 5LDHA 3RC7A 3R3SA 3AFMA 3WGGA 3H8VA 4NI5A 4YJFA 2DFVA 4FGSA 2FZEA 1ISHA 1AUPA 5CDTA 4DMLA 1PJSA 3OJ0A 5TIIA 1E7YA 1EUCA 4UULA 1LRKA 3TNLA 3UW3A 2VTEA 3L77A 2XOXA 1V8BA 1XSEA 1WNTA 3F1LA 3ZZNA 4E4YA 5CPBA 3L0DA 1L7EA 4AJ2A 5THQA 4J91A 4MVJM 5CPFA 4WASA 3H4VA 2Y1GA 3E18A 5I7VA 2ZB4A 3PDUA 3Q9NA 1FJHA 1PS9A 2A35A 2Y1DA 3OSUA 1I10A 3DAGA 1UDBA 4CV0A 3KM0A 4A2CA 3CE6A 2O2YA 4E5MA 2EG9A 2O7SA 1YB4A 3WSVA 1JW9B 5CDGA 2IRWA 3TZHA 1U4OA 1H2BA 2OOSA 3AOGA
chains in the Genus database with same CATH superfamily
2P9JA 2E18A 3GLFE 4PZEA 2IW3A 5HS6A 1U90A 4BLWA 3GCZA 1YAHA 1KEVA 2ETVA 3BWDD 3EA0A 3N7AA 3RYCB 2M1ZA 4YLEA 5LDDC 3B6IA 2R1TA 3KETA 3D64A 5CX4A 2XIJA 3EFHA 1JLLB 1DPFA 1YE5A 4UDOA 5DJ5A 4BMNA 3L49A 2XZOA 1G0NA 3H86A 1H8HA 3HKEA 4BU1A 2XMPA 4ZU1X 3IAFA 1PL6A 2MMGA 1VL1A 3BMNB 5AVVA 4GX1A 4DF3A 2PA0A 4W5OA 1YS9A 4FDMA 1JXOA 2A5FA 4R7ZA 1OYYA 4PNEA 1H2WA 1ZIXA 2ISCA 2QTFA 5G40A 5BXQC 2PYDA 4K88A 3UAWA 4IDPA 4E5KA 4RTJA 4FBMA 5LP6B 2A2ZA 1G4HA 4WIAA 3E7XA 4XQEA 5C0OE 4G89A 1E99A 4YHBA 2E48A 4UFPA 3OLZA 1UK9A 4EJ6A 3K6SA 3SFZA 2QZZA 4CLRA 4Q9HA 3WIEA 1Z7YA 3EEFA 4HFRA 4YYEA 2GEVA 4QYWA 1CY2A 2QTZA 1W5EA 3PNYA 3IHKA 5HTKA 3ZHXA 1OGYA 2V7QA 1WTCA 4J0DA 2DWOA 3SDSA 1UBNA 2EFHB 2HRDA 1YA8A 4HNQA 3KZOA 1PJ4A 4RSGA 2GJ9A 2XECA 1OXBB 3KXIA 4PCUA 3WWOA 1ZK3A 4BIIA 5CB0A 1XMQB 4ATNA 4CG3A 2XUQA 3D3QA 1WIWA 3DC7A 3MA0A 3NDRA 1T6ZA 2WM3A 1X8KA 2XF2A 1SOMA 4L4UA 1FSGA 2I1VB 1GGKA 3VH1A 5HOQA 3O2NA 1OTXA 2VLBA 4FGKA 3AZQA 4WJKB 2C3YA 4IQFA 3CF4G 1U65A 3KKOA 3FVQA 4LCEA 3QI7A 4LXIA 4DTIA 2JDIA 3MRTA 2V9PA 4O2AA 3U2QA 4JKYA 4MV3A 3QU5A 1N2CE 4MYTA 4JB0A 1QCYA 1YE3A 1XU4A 2X8AA 4NCAA 5ADWA 4IHQA 2WIKA 3EGIA 4O63O 2E3JA 2DCUA 1U1CA 2VYQA 3CUUA 3SBOA 4CKXA 1M2VB 2EZ9A 4OB6A 2JANA 4CKBA 1W94A 5JXGA 4OHMA 5DX0A 4URXR 1YR8A 4E5YA 3GX1A 4URHA 3CX3A 3Q15C 2C3MA 3V7YA 2P4SA 1K8ZB 1M72A 2OCXA 1LQ2A 1DT5A 3M2PA 3WYAA 4C4PA 2JLQA 4I0WB 1YB7A 1Z5GA 2RB4A 2X41A 2D1FA 1OU0A 2QL5A 1XCOA 1KWKA 4W5QA 3TTSA 2WPNA 1MBZA 4WT7A 1FL9A 4RF4A 2F8SA 3EWNA 1IAVA 5BN5A 3ESYA 4U2EA 4I3GA 4LS3A 3ANMA 4TLBA 3HXOA 2ZXUA 1Z5OA 4ICIA 1V1RB 2F4NA 1LEHA 1GCGA 4MCJA 2A84A 3GLIE 1XYGA 2CK3A 1FDOA 2OQIA 3HVUA 2FMUA 2YV4A 3NGXA 3GGOA 5D5PA 4BEBA 1Z07A 4HJXA 5A71A 1XVUA 4GXNA 3GVIA 5JS2A 3GCDA 1OZ0A 3M6AA 1KMNA 2QNIA 1O9HA 3HRIA 3EXEA 4RVCA 4ZAYA 1Q77A 4DREA 4XYLA 3C3MA 2RGGA 3LZCA 1N4AA 1EM8B 2NXEA 3CXRA 3IR6A 2CLMB 2NLOA 3AF5A 5C18A 4WY5A 2YNMC 3AHDA 2OA0A 4M54A 3RODA 4DIDA 1SG6A 3WNDA 4GMFA 3ZXYA 1IY8A 5AJTA 4H16A 1N77A 2BFBA 3ROEA 3A1VA 1XTPA 3VX4A 5F73A 3EY4A 2XNCA 4L2IB 3RVMA 3ZV6A 4F96A 1KKMA 3NKLA 4KFSA 4BDSA 1NQOA 3FNBA 2QSUA 2BUCA 3IELA 2IYYA 1T8SA 4WN9B 1OU4A 1Y5RA 3B2NA 3CPJB 3KYJB 1PUJA 2IUTA 5FFMA 5M04A 1TZCA 3L4BC 4LW8A 2V8OA 3CLKA 1DVRA 1XVIA 5CLHA 3VR3D 2QD3A 3TR5A 1Q20A 2HHCA 5JANA 1RYBA 3N2YA 2KW5A 2APJA 1XQ6A 3CY6A 1E9CA 3ZGLA 3E1KA 2HJRA 3PFFA 4QC2A 2VUSA 3PCXA 1TKAA 3RNLA 2ZT7A 1XXHB 3PHCA 3C3JA 4CMEA 2KI5A 4Z86A 2PRJA 5ENDA 121PA 4CLOB 3ETNA 1JKJB 3R4VA 4E4RA 1MRSA 1N5MA 4DBVO 1IRXA 5HKOA 4NMXB 4PR0A 5A06A 3S2YA 3VU8A 4US2R 3LXRA 2QXTA 2VS1A 5A0VA 5JALA 1QP4A 5H7XA 1HBJA 1BDBA 4CJXA 3REQA 4ZIRB 3K8QA 2R85A 1D8AA 2OILA 2MYUA 2XV1A 3RBVA 5PNTA 1ZEJA 3KTAB 3A31A 4GFDA 3UNXA 2DPLA 1GRQA 4WFKA 3PZBA 3HKCB 4LYJA 4NAHA 1QFMA 4FYJA 5AWFC 4BPRA 5SY9A 4CR7A 5EWJB 3T3OA 4EKYA 3HB9A 4I7EA 3AQIA 4J29A 1R3DA 4OIMA 3ERCA 4F6RB 3LTNC 1PD0A 5I45A 1SGWA 2I8CA 4LY9A 3CEMA 3GEHA 3WGKA 2YYAA 4B8WA 1XG5A 3OTQA 3EC1A 3FROA 3IJ5A 1XZBA 3IMGA 4IIGA 3DPIA 2IZ6A 4X1YB 5DLYA 5FPTA 5LKAA 4NMMA 3R3WA 5FNVB 1A9ZA 1Z9BA 3UUEA 4FYXA 1CX9B 1SRRA 1Z37A 1A4UA 3C3BA 4TWRA 4RGYA 5FKJA 3CKLA 5JVDB 3L4KA 5HKAA 4P08A 4IG9A 4IEFB 4MV0A 1YB1A 3PUZA 1E3WA 3IO5A 4FCCA 4RQUA 4D4GA 4U8HA 3DLHA 3GG2A 3AVXA 2RK3A 1KZHA 3MF4A 3ZLVA 5JFOA 4F8YA 2B8JA 5F2KA 2JKYA 2JJ2A 1T5LA 1J07A 3DFFA 1XZHA 4JL6A 4BMYA 3BEOA 4O1MA 2BHRA 1IG3A 2BSXA 3WKEA 5JCZA 3ICCA 3FPFA 2VJMB 3LQ4A 3G9QA 4UATA 1AQYA 5KTOA 1YNSA 2UUPA 1FDSA 4AUMA 3UKJA 1E62A 1LLQA 1FXWA 2WWFA 3UJ3X 3B6ZA 1F6BA 3B48A 2HX1A 3V55A 4KP7A 1C41A 2RCYA 4ERXA 3IBSA 1WL8A 1P9LA 1VKZA 1ESNA 4LKOA 2PR2A 2I9KA 1EB9A 4NNOA 4MAFA 2AI1A 5EXDA 1DX9A 1Z8HA 3TG2A 5I7UA 2I65A 3WLHA 1B2RA 4TVKA 3OZIA 2A9FA 4NS1A 3CA8A 5FBQB 1C8BA 2WJIA 2ARKA 4K9QA 2H3EA 2Z58A 2DG2A 4PAOA 5KQGA 3HACA 1FZTA 3PFGA 2WAMA 2PX4A 1LW6E 1Y89A 3KC2A 2R4QA 5DASA 3COPA 4FWIB 4K2HA 3TTYA 1PL7A 3W7BA 1U0LA 2QAGC 2GDZA 1SY7A 3KV3O 4V0QA 3UGJA 4IDNA 3MOGA 4YP7A 1OBHA 3WB1A 1F4VA 1U2RA 2XA9A 3AB3A 3QUSA 1UPBA 4O3FA 1MJFA 4Y6OA 3EAGA 3HPQA 1HNZB 1O5TA 3N2EA 3K96A 1DC7A 1QR6A 1FDWA 3AERB 5AVOA 1T6XA 2LNDA 4M38A 4D9JA 3L7YA 1ZUD1 1XD9A 3EEIA 1XQVA 3LKZA 4I5EA 1YQGA 2PXHA 3DOCA 2C83A 4X3CA 3C43A 1CK4A 4HEQA 4TV8F 1MQ8B 4RTRA 5DSXA 3V80A 3WLNA 3AZPA 4UNPA 4WINA 2W2KA 2FFRA 2PT6A 3KKNA 5LOVA 4DZTA 1AM4D 1XQXA 4WESB 2GJAA 4AI6A 1QHYA 3O90A 2DBYA 4IZHA 3TCNA 3TL6A 4HNHA 4YXFA 4KR9A 1DIRA 2FEXA 3SJCA 2QB5A 3FB1A 3HHPA 3B20A 3N3AC 4G5OA 5DYGA 4BP3A 1N9KA 1E92A 4AZWA 1U2TA 4XVUA 2Y1KA 1IUOA 3B1KA 2RKOA 3I5AA 3SHVA 2Z3VA 5GONA 1S1MA 4B2IA 2XNSA 1AXGA 5MGNA 2IYEA 3GT7A 5T4HA 3OT1A 4DMMA 4E5UA 1JJVA 3B36A 1RKBA 1VFPA 3D5EA 3K9NA 4JI8B 1AF7A 3AXSA 1FVXA 1YQTA 1CR2A 1N2SA 1BXGA 4JMLA 2CLSA 3FJOA 3OIWA 2QBYA 1XYVA 3B1VA 4CF7A 5K7SA 3FNRA 1VGRA 1GPNA 4BATA 3EZFA 5CB4F 2DQYA 1NR1A 4LRYA 4CM6A 1U1FA 1T43A 2B1RA 4QQRA 4U7TB 4EF6A 1F17A 5IWAB 2Q9CA 4FYYA 3C3PA 3LX6A 2PEZA 4QGAA 1E3JA 1NW8A 4ZVSA 3PFBA 2FEPA 3E5NA 4D3DA 3T3DA 1UXOA 1R6UA 1AO3A 2P2NA 2ZSDA 4FXOA 4MLPA 4YRJA 3JAKA 1U3DA 4MOWA 3NEAA 1DMSA 1ENPA 1E59A 1NXWA 3LUGA 5B4VA 2QG6A 2XWJI 2ZPAA 4PNPA 3X1KA 4YHHB 4JLWA 3IT2A 4D25A 4KQCA 3F97A 2R8PA 3QHQA 3EBPA 2FWPA 2ZJ4A 2INGX 4QDTA 1RRCA 2P7IA 2QMUA 1U9JA 3MMXA 2G6BA 4UD2A 1JG6A 1GUAA 4ISBA 3FUWA 3ZW7A 2AC2A 2B1JA 3ONVA 1AQJA 2AYYA 4BO9A 1Q1BA 1C9DB 1XNRB 2PT9A 2AYXA 1ICEA 1R3UA 3WGTA 2YN4A 3E9CA 1MPTA 3O4RA 1T9KA 3ILHA 4B46A 5LC1A 3VO9A 3GRYA 4G9EA 2DLCX 4IHJA 3SYNA 5JCOC 3CKKA 3NNNA 3ELBA 1DZIA 1E1KA 2AG8A 2DE0X 1J56A 4DMKA 1B3BA 3FWHA 3P2IA 4LZWA 1HOTA 1UMBA 4G8JA 4YJ2F 4YROA 5EXSA 4D4MA 3FHTA 2HO4A 2P62A 3PDIA 1Q3TA 2PEYA 2CJWA 4P80A 1O0CA 3PQ2A 2XNKA 3FPAA 4WCFA 3VI3B 4Q39A 3PQ3A 3IQHX 4BE7B 5A03A 1Z0UA 2R6HA 2GZAA 2VHYA 3ORQA 3KVYA 1IM5A 1Q17A 3ITKA 2XNJA 1RCFA 1FSFA 2A0YA 1J9GA 3QSYA 2YWCA 4IJUA 1K6XA 2AEFA 3KYDA 3LWZA 4MW4A 1MDBA 1T25A 3C45A 2J3LA 4MYSA 4QM6A 1MB2A 3O8OA 4JJ4A 1FA9A 3VTZA 4BFVA 1PQUA 2GR9A 4RS4A 2Y2UA 2IYAA 1D8TA 2XUJA 4FINA 2GXQA 1UFQA 5A5GA 3VR3A 4ZARA 4LSWA 2J3JA 3D0KA 4HKTA 1JAZA 5ES4B 1CEEA 4EGJA 5EZYB 5IK2D 1KMQA 2OXEA 1E32A 2P69A 1E1RD 2WKPA 1IZ8A 3OT5A 4DCTA 3I5XA 1H5NA 5IANA 4OSEA 5JNSA 4AMVA 1N5IA 4OFWA 2MSNA 4TTSA 1JFVA 1KS2A 2B7LA 1RJGA 3CVOA 1G2QA 2ZAIA 1PW5A 3Q6MA 1V2HE 3L6DA 2HA3A 2YXBA 1PSZA 3C39A 3NTXA 1D7OA 1OW3B 1QX4A 3EGWA 3GT4A 1WW8A 3HU5A 4NRDA 3OFSA 1JAIA 3A11A 2H07A 4JJ8A 1OXMA 1P4AA 2WWTA 3EASA 2QYOA 5TB5A 2V3CC 2XADA 1GN9A 4IIJB 1JFLA 1ODSA 4KXUA 3VHXA 3I4LA 4E3ZA 1AA6A 4C87A 1ECBA 1IHYA 5ADHA 3EJWA 4I3HA 4DVGA 1J4AA 1MRZA 1F9AA 4F3RA 4BC0A 2EHJA 1E0DA 4E11A 3BRQA 3KJHA 4EHFA 1Z18A 2O2ZA 3L8DA 1LV7A 4DQ0A 4LZLA 2GBFA 1PV2A 1TT5B 2IK8A 3LLUA 1TCCA 3WTBA 3AFOA 1A7KA 1WUIS 4B3XA 3PL5A 2G5TA 3R5FA 1J8QA 1Y6RA 2X2FA 4M9SA 2R86A 2FWAA 4K3VA 2HI0A 1MJGA 5ELMA 2CDNA 1N6KA 2PJRA 3KLNA 2J30A 5FO0A 2Q3FA 1Z26A 3WY9A 5KTKA 4IXTA 5B58C 1C8KA 1CJUC 1V1MA 4IUDS 4IW3B 3QSGA 3LFHA 3PQEA 2GCPA 1IY2A 1RJWA 2VQ6A 5REQB 4DDMA 4HV4A 5BMVA 3KQHA 4J0EA 1W4ZA 4WJLA 4HYYA 4PSDA 4ZEMA 1P5FA 1Y5IA 1XTSA 2IYPA 5I3CA 3E15A 2VH2A 3EQ8A 3WADA 5BYKA 2G70A 2IF2A 3AEKB 4KYVA 3K5WA 1RJDA 2ZBGA 3H7IA 2QV0A 1NMQA 2DHCA 5TF4A 4BOYA 2GM4A 2WVAA 2CHGA 2V3VA 3BPSA 5K2MA 3K16A 1NUQA 2ID8A 2CVZA 1XZLA 3KTDA 1K6EA 1SJ9A 3JQDA 3WGNA 2FPPA 2NO4A 4FUQA 2VDWA 3KP1A 5HP4A 1HE1C 3V1KA 1NFFA 4FJ0A 5KSOA 2Z2IA 2DPXA 5CEEA 2ZATA 1WG8A 2QR2A 3TZ6A 3VSEA 4BUZA 3G82C 4JJIA 2ZULA 1VSVA 5HQ3B 5JW6A 5IT0A 2DY0A 4PVCA 3THXB 2WHPA 2J6IA 1UC8A 2R60A 3FDZB 3CF2A 3DPUA 3ZDXB 3UBMA 2OXFA 3DYIA 1K97A 3BJRA 4JKIA 4MYUA 1KAGA 5KNBD 2G4CA 1U3WA 2BDUA 4X85A 4D7AA 5KVSA 4K7JA 1BJRE 2GESA 3KZNA 3RF6A 1Q50A 3TKAA 1KJIA 1KOGA 4M89A 2ZB7A 1EIZA 4OYHA 3MMPA 5HZMA 1T0UA 4M0UA 2GPWA 3D8SA 3HXQA 3KLOA 5I5GA 5A6SB 4G24A 3ZY4A 3BZWA 4JI4B 1QTRA 5FUWA 3RASA 4C4OA 3KSZO 4WBNB 2ZJBA 5JRDS 1KKUA 5GJVC 3OZXA 2XWPA 5DTRA 3G2MA 2IITA 4KN5A 3U31A 5ELLA 3N2GA 3A2KA 4RF2A 3QE9Y 2V1UA 1M76A 5K3BA 3U4QB 1EU1A 5SYNA 4YRKA 4L3VA 4IMIB 1R0WA 5C2JB 4WLVA 1JR2A 8ABPA 4RULA 3I6IA 5A7GA 2CFTA 3EIXA 2VJLA 3HXTA 1NP6A 2FETA 3MFYA 4P7BA 1VDMA 2PNJA 3WRXC 1USWA 4HO1X 2PLFA 5FUYA 2VKTA 4NMLA 4ZANA 2VP4A 2Q5IA 4KLCA 1MN6A 5FRDA 3OPXA 2VXBA 5K3CA 5BN3B 5HKLA 4AKGA 1MB0A 2PBFA 3DTNA 3JY6A 4ZCTA 3DFIA 4I4TA 3CKMA 1ATIA 3ZHUA 1Z36A 3W9UA 3ORYA 4IJQA 4P5PA 2SCUA 3OPYA 5ALIA 1THTA 5F3WB 5AOVA 4X92A 4COKA 1ZXLA 1CT9A 1U6IA 2X4LA 2XVAA 3ZTWA 3AESA 4QBTA 3VO1A 1BRMA 3CGWA 4U3JB 2J4DA 3VPGA 1WBBA 4JB2A 3BIXA 3GEMA 1T5OA 2JGLA 4COOA 4YRAA 1QF9A 1JR3D 3FKQA 4HZUA 3ZXXA 4F9TA 5KPJA 1VG8A 2ZIXA 1TIKA 3V7NA 4C4TA 2PZ8A 4PO1A 1LPBB 5T41A 1B6RA 3R5KA 2JFZA 4R1OA 3HM9A 5DPMA 3PUWA 4FKBA 4N0DA 5DBEX 3U9LA 1C9YA 3E81A 2JBAA 1UMDA 3CF4A 3T5MA 2CLKB 4Y1RA 3KELA 3ELWA 2HSJA 5IN5A 3RYTC 1GJRA 4QOSA 4GBJA 2EFDB 3NKFA 3V7UA 3F7OA 2HQRA 4Y6PA 1YB6A 3GJRA 1JAXA 2RHMA 1K7SN 4QLAA 2UDPA 4JCCA 4QU9A 1A8QA 1R8QA 3FMVA 4JQCA 2GB4A 1GGHA 4RSHA 5M3BA 4EJSA 4ZGBA 5EJEA 1J2RA 4PYOA 5JXIA 5K4HA 3HJFA 4PG5A 1UOEA 3OZVA 3RVKA 1TW3A 2XXAA 1T8WA 1KVRA 2EBHX 1QJCA 3DDSA 3RRJA 1CQJB 4QTUB 3MS2A 5JH7F 1PNRA 1Y8QB 2G5PA 1T8RA 3GR6A 3E23A 2IT1A 1NY6A 2B3TA 3T41A 4BLPA 4BO3A 3W5DA 4ND2A 1ZHFA 3NALA 5JNUA 3DAYA 1H2AS 1O9BA 2VDQB 4N5MA 5CTJA 1GG5A 1L5FA 3M4YA 3PPYA 3U4MA 3CX8A 1HH4A 2YINC 3KO8A 4Q3AA 2QTMA 1JTEA 5LXTA 4O8CA 1RVDA 1XTBA 3SZLA 4HNAB 1UBLS 2O6HA 1NDQA 1NJFA 2K5UA 1EJ2A 1M0TA 3BL6A 4JYZA 1SKAA 3P0FA 3Q8KA 4OBXA 3FI9A 1SQ5A 3ONFA 1VDZA 2PO5A 1EX9A 3ROXA 3UOWA 1IHXA 4R9NA 3V2UA 3ASYA 1ADCA 1BEUB 3E58A 4DNXA 1N3IA 1IFXA 1QG6A 4E4TA 2BMDA 2UVDA 1U8YA 3KT6A 5DIZA 2AFIE 3DCIA 4EY8A 3DMTA 3TFQA 3JR7A 3RVPA 2PUFA 5E2BA 1HM5A 1UP4A 4ER0A 2A92A 2IZ5A 4QOJA 1L5ZA 1YDMA 5D3MA 4BVJA 1OHHD 1HDRA 2GWHA 4YNBA 3FGPA 1U0TA 4L74A 1RE1A 2YOGA 1T8UA 3OO0A 4KODA 5EHGA 2XUKA 2WA1A 3FLBA 5IK2A 3E9RA 3VVCA 1CUDA 1W76A 2ZPUA 3GJ5A 3Q3VA 2VPYA 3AHJA 1HEUA 4UJ5A 1E1RA 1QZXA 3NXSA 2SBTA 3HA3A 1SQFA 3MMSA 1YZQA 3JQEA 5ECYA 4ZJPA 1C7EA 3G68A 4O4LB 3WXBA 3VJKA 6AT1A 1PFQA 5GY7A 3IOMA 5EJ4A 1UBOS 1XUOA 2F8MA 3UJ6A 1YZHA 4R0NA 1YJAA 2DFDA 5CA0A 1TFRA 3LUCA 1K6IA 1JHPA 4G2TA 4U2CA 5KOJA 3DUWA 2YV1A 4Q1VA 4UAVA 2YJGA 5F78A 2WTEA 1E1NA 2RAFA 2JJYA 4BCDA 3QVLA 1NIPA 4DQVA 5MFPA 2P8JA 2QOEA 4CIBA 2FRDA 4BVLA 3U16A 1SHJA 2FZ5A 2JNWA 4HQ6A 3WLLA 5H68A 5I7OA 1KY3A 5ITZB 3FW1A 4L6IA 1Q0UA 3JYNA 1DKNA 1UC5B 1VKJA 2NADA 4ILEA 3IQGX 1RFGE 2I22A 1DFIA 2EV9A 3AR5A 3UK0A 4CM4A 1FX1A 4C43A 1D4OA 4ODIA 5BQ3A 1YRHA 1UQTA 4HCJA 4TKUB 1DG9A 2KBFA 2WC1A 2RHTA 3W77A 4Q9LA 1I2CA 3KYCA 3INRA 3GZNA 1WMBA 1WNFA 3C6XA 3JYLA 3O38A 2IY7A 4G09A 4PC3A 3U1BA 2ZUTA 4LDNA 2O6LA 2JFPA 3PQ5A 5I3ZA 1PL8A 2WJVA 3JYQA 2D0DA 3H1EA 3IHLA 4N8DA 5E7QA 4W5RA 2C9BA 1DRUA 1YR3A 2C4MA 4PG7A 2Q5LA 3S2SA 2AF3C 1IJKA 1JT9A 1O08A 1SHLA 3DE3X 4FDTA 5JWRA 1E7MA 4OI2A 1GPDG 3O74A 3SHOA 2YHIB 1N0IA 3T52A 2BYTA 1EFHA 1FS5A 2CXHA 3OOYA 2IQ5A 1KEEB 3FMFA 2GK3A 3V8EA 4P5EA 3AY3A 1YA4A 4XCVA 3TD6A 5DOVA 3ZI7A 2YVLA 3B3FA 4KN6A 3TRDA 2VDJA 5DDIP 3DWIA 1XCGB 1G8PA 3A05A 1UJMA 2Y1XA 4EUFA 5LQSA 2YW2A 4WK0B 1GZ4A 1I0LA 3LRTA 4WA8A 4XPZA 2RFLA 1EP9A 1XDZA 1M1YE 2FR8A 3EGCA 1PLJA 3GPCA 1ZWLA 2Y1WA 5T6BA 1KI9A 2HFKA 4FNOA 4E5NA 2ZBDA 3FHJA 5TQ0A 4AWAA 1RPTA 1DADA 2VSYA 2X0DA 3SG0A 2R6GA 3KT8A 4LOKA 4Z9XA 3QQ5A 5JRJA 3B70A 2QWXA 3GJZA 3E4DA 4CFSA 5KNBA 3TNFA 1JALA 3MTAA 5K6AA 2BEWB 4WW0A 4M0KA 3U7IA 2YC2C 3VZQA 1PT7A 1MAAA 2YUIA 4YRTA 1OUMA 1WPXA 2ACKA 4E12A 1HKHA 2H1CA 4CTMA 3UB3A 3K0CC 1F38A 2Q6LA 3S8EA 3RIYA 3KZVA 4HGQA 3L7AA 4GXTA 3AT1A 4BKMA 2IKSA 2DUNA 2W7TA 1QQ7A 4EYGA 2VNIA 5DHAA 1IM8A 2FWJA 1TM2A 2X9NA 3SBDA 1SD5A 4OU5A 5FULA 5ICSA 1TKBA 2E82A 2Q5CA 1SXJE 2HK7A 3LT5A 2I4NA 4HWRA 3KPVA 2QLJA 5AUOB 2JFWA 3TL3A 3IVAA 3LPDA 4R01A 6GPBA 3I37X 4MA0A 3KL4A 4KUHA 4YONB 4MKRA 3HCBA 1PNTA 1XCJA 1D04A 2AFHB 4BNNA 2G8LA 2XQVA 1GSOA 3PC4A 3EGOA 3SDBA 3NVMB 4J0JA 2B3DA 2YCBA 1K3UB 3LUDA 5K0BA 3AXTA 2JCGA 4GLBA 4RMNA 3KJQA 4YGXB 1EEXB 1DCTA 1N78A 5BYAA 2A33A 3R5JA 4LF5B 1YUMA 5G1NA 5KINB 4XFJA 5JCXA 1BXRA 4EFLA 5K0SA 1T1IA 5FWDA 3IX7A 4D56A 2X9VA 3VU1A 4GLFA 1DI0A 4B35A 5D86A 1Z33A 2V98A 3KOWA 5DH9A 5KOHA 3HCAA 4M76B 1E2IA 5DNDA 4ZGWA 1GDHA 1YDWA 2WV9A 4BP8A 3WQRA 1N5OX 2B4RO 2IBMA 3JTMA 4JROA 1NULA 5G0UA 5DK4A 2VZEA 1JR3A 5B1HA 3GELA 4MINA 2EX4A 3ZIAD 2RGUA 3ZQKA 3I04A 1P29A 3LO5A 1UKVY 3SIRA 2CMFA 3FDJA 4B0OA 1PVVA 2GH1A 4MLCA 3WX0A 1X0VA 2QRGA 1KU6A 2NTVA 3RFTA 4JJEA 1VB5A 1PDOA 1VJCA 1JLKA 2H63A 2JB9A 2PFKA 3JARB 2G9UA 4IF4A 5F1OA 4MYDA 1KDVA 3VPCA 4LXQA 4XQCA 1ZN9A 2UVPB 2VZ0A 1L2TA 4OLJA 1Y80A 3MLBA 3ENQA 4TV8A 2I2XB 4JN6B 1PYOA 2Z5VA 2C2XA 4KOEC 1HDZA 2WVGA 4PRYA 1VRWA 3LXUX 1L5GB 4DEYA 9GPBA 3TLGA 1Z4IA 3SICE 2HRQA 5SYMA 1GFSA 4ZDWA 1AZWA 1SXIA 5DNVA 1X7GA 4MR9B 3RS9A 2H5IA 2DR2A 4OK6A 2HJVA 1KZ7B 1U3UA 3R77A 3COJA 4LV5B 4RDXA 1RT9A 4RD6A 2QTVB 1G7CA 5BR7A 3EGXB 3FHLA 2EFEB 2B69A 3RC9A 4L57A 2L42A 2DHQA 2WMOB 3E5RA 4L9AA 4DJFC 5A4IS 3FCEA 2FRVA 3I9V1 4BZWA 1J21A 1RP7A 1I9CA 4GQAA 1RKVA 3BMXA 3ACCA 4YK7A 8ADHA 3GRZA 1NVEA 4RVSA 4DDWA 2GLUA 2BE9A 3MWKA 4G6ZA 4HWOA 1PKXA 1U6JA 4KQJA 4F4FA 1BMDA 4KEAA 1PZEA 5ALWA 3I4CA 5AOAA 1D9XA 5CB4A 4NR0A 3KUDA 1BVYF 2AG5A 1Z75A 4NKRA 4TMWA 5J2TB 2DM6A 3GD7A 2VWQA 2V6FA 4TYMA 4QG3A 1DG1G 2XOEA 1ZONA 1P4RA 1OHHA 1QIHA 2YASA 1I1HA 3E3OA 3OD5A 2J4CA 2GK6A 2LKDA 2CJPA 1RXSA 3GGJA 3QENA 5KKAA 1JKMA 4NFYA 3WGIA 1U2ZA 4PWZA 1AKVA 7REQA 3OVMA 1J90A 4IH9A 4IIFA 1BGVA 2YY6A 3TCKA 1PR2A 1Q22A 2HRBA 3R75A 2IYFA 2Z83A 1K66A 3M3PA 3GFSA 4DMHA 3KQKA 1E2KA 3GFRA 2HH9A 4X6UA 1O77A 5K0GA 2OBYA 3L5KA 3PL1A 3I28A 4FOLA 3GJ7A 2ZBFA 1OZAA 3NOQA 3QPVA 2VC2B 4OQQA 3WMEA 2JEOA 2MYPA 2A4MA 2NVUA 4JBHA 1QQ6A 5SZJA 2FOLA 2VP5A 2Z8YA 1N0UA 4DMFA 1PUXA 1ZBQA 5E2IA 4YUZA 3C6YA 4FNAA 4ZV9A 3JSAA 4N3BA 4AJ1A 3EDRA 1YULA 1RFLA 1NN0A 1FTGA 1ZESA 3AR8A 3RFVA 4F1WA 3D3EA 3UJCA 1U5BB 1G21E 2JK1A 2RH5A 3Q8XB 4Y9TA 4YT8A 1KSGA 3L8ZA 4D2IA 2IXGA 3HO6A 2ILVA 4RV9A 4ISCA 5TMPA 1NBMD 1OCEA 2K6GA 3ZX5A 1ACMA 2DBVO 3FZQA 3IKMB 4OXKA 2QVGA 1C0PA 3CR8A 3C5WP 4YJ2A 3K70C 2XMGA 1GTVA 4PLVA 1R50A 3QA9A 1W96A 1S8OA 1WXFA 3CJTA 2B2NA 3PK0A 1SZPA 5ULLA 4ZFNA 2EF0A 1SUDA 1WU8A 4YR7A 3WGLA 3MTIA 3VJLA 5B1SA 4QUBA 3QEMB 3IBGA 1GILA 4Q9JA 2CFOA 1P9RA 4F91B 4LDPA 3DOOA 3U5ZB 1SVUA 3RC2A 3OTWA 1PZGA 3GLTA 2ERXA 2XD4A 1FQKA 4OKNA 3NW9A 4EL0A 1KZ4A 1QIFA 1XKXA 2XCLA 4DQLA 3KD3A 4OKIA 3HCOA 5C31A 3QTLA 1M7HA 1PZFA 3GH1A 3NASA 1M1NB 3GNTA 4NMHA 5JAZA 3KKPA 2EJTA 2RBEA 5ALMA 1WKCA 4MQBA 5LM3A 3ITEA 4L8GA 1M8JA 4DUYB 3BH6A 1DC8A 1BWPA 3H0KA 1UK7A 1UMKA 2XUHA 1H3FA 5KWEA 2NYUA 2AVDA 3HJTA 2II6A 4G5HA 2BGRA 3BF8A 4MR8A 5CFMA 3RV4A 3WGHA 3FZGA 3K6RA 5CDFA 3WLOA 2O4CA 1DUSA 2BE7A 3TE6A 2VJQA 4RK4A 2J0EA 2QTHA 1KYYA 2EFYA 2IP2A 4B6GA 3T3GA 3CPSA 3HTXA 4X1KA 1TLTA 2IS1A 2BGNA 5JZ9A 3LUJA 5KWSA 4LSMA 4F8EA 4J0GA 1XRLA 1KFJB 4NU0A 3T7IA 1MC5A 1JG3A 2Y0BA 3Q5GA 3L8EA 1GRVA 2XPCA 4HMQA 3I61A 1B6SA 1I24A 2HWXA 4BQPA 5GM2A 3NV7A 1E6MA 1IE3A 2UUAB 4EYQA 3H1BA 1FDTA 1ONSA 1ILEA 3GLGA 3GUHA 1BHQ1 1XR3A 3MIZA 5B1IA 3ADKA 3I23A 4R69A 5JPCA 1E5TA 2BDTA 4RCZA 3RVRA 3RT9A 4KO1S 3VDNB 4AMGA 1JHMA 3UMJA 2ZU6A 3D5QA 3E0XA 3FFXA 4EM6A 1AO0A 5IT9A 2HT1A 4M4SA 3I1IA 4NENB 1OVMA 4BAUA 1SEPA 4RBNA 2V74B 3ESQA 3G2QA 3ROQA 3T38A 2EOAA 2HA6A 4F3CA 1KO7A 1KBZA 1P3JA 1V26A 4X00A 4WZAA 1AIPA 4IF6A 1ULZA 2ZIAA 4HG2A 1LBEA 4KTTE 5FPSA 1RZRD 2GJSA 2W0MA 4FQ8A 2RHHA 4KG7A 4LJAA 5JDIA 4PGMA 1OFUX 3ENWA 1NJ8A 2QT0A 1I5OA 1GA1A 4G85A 5F9FA 1P0PA 2BN4A 4QEZA 4C7BA 3QVTA 4UVEA 1NBHA 2HBZA 3DAHA 3HFGA 3DKPA 4U9UA 2HLHA 4JJGA 3LSTA 2M9MA 2ZAYA 2CV0A 2A86A 2BEVA 5L7TA 4FYMA 1WETA 1PK8A 2HSGA 2RHWA 4RIIA 3I0MA 1WHTB 3OCYA 4GT1A 4CQLB 4GX0A 2XMBA 4WZBE 1JZQA 1ZUIA 1ZM2A 2YS6A 2VPPA 1PDWA 5GV7A 4UASA 4XEUA 3TTTA 2N0SA 2J3IA 4QL3A 4GS5A 3ANYB 5HJ7A 5J47A 4JP3A 3G59A 1AUOA 3MAJA 3DLBA 2MSDB 3MWDA 1TJ5A 3OQMA 4OHZA 1NVAA 3JQAD 3I72A 1QKJA 1TTQB 1M0WA 3A3YA 3OQVA 3C98A 4HQNA 4BFYA 3ZIAA 2DRIA 2CE7A 5E4FA 3QUTA 3TUIC 4D96A 2WHYA 2BUBA 1G6Q1 4WUVA 3EF3A 2J9FB 4MPRA 3STUA 1U5AA 2CSUA 4R1QA 3HCFA 1PTKA 2PL1A 4H7EA 3HUEA 3FPJA 1RBZA 2XKJE 2DWUA 1TECE 3VQTA 1CDOA 3R1IA 3PE4A 2Q4BA 3K35A 1L5OA 3B5EA 3BK7A 2JD2A 4UVDA 5J5AA 4C0LA 5L3SA 3L6BA 1UT5A 1Y4AE 2F1KA 3EY9A 3P20A 4GZ6A 1H69A 4BFXA 4WNAB 3WYGA 3BJEA 1P6XA 4HDNB 3T1NA 4DPLA 4MWTA 1CYEA 4ECAA 1N25A 4ZVQA 3HP7A 5A3SA 4GAEA 1CR4A 5DM1A 3QX3A 1M2OA 2GYVA 5AXCA 3ZGNA 2B99A 3A8TA 4TS9A 4WZAE 2BCEA 2EKLA 4KR7A 3FCOA 4DABA 1RACA 3T9DA 2XRZA 1M5RA 2O3SA 3ZPXA 2X8JA 2XB4A 3FBGA 4YRQA 3TLZA 1QF6A 4AG6A 5FUBA 4KXMA 2WWWA 1YBHA 4ON9A 3HBFA 1NPYA 2GEDA 4JJ6A 4HR7A 3RYFB 1ETUA 1QYDA 1WXXA 4RLHA 5JTUA 2VWPA 5I9LA 4Y2GA 4M8KA 1JQDA 4BVAA 4BKPA 2JCXA 2FPXA 3HEAA 1DKLA 3BAZA 5IJ0A 1LV8A 1C7FA 3HCPA 3WFIA 1VBFA 3MWLA 4Q7LA 3VC2A 4B84A 3GLFB 5J9FA 1Z4NA 2FG5A 1E58A 5GQSA 2Z98A 1ULTA 3PC2A 4TSFD 1QOZA 1TU4A 4EHDA 2AOVA 4F4UA 1GSAA 1KOFA 3VR5D 3WZLA 1ZN8A 5AM2A 5JHHB 2PZAA 1TYDE 1G20A 4ETIA 1T9HA 3IKJA 3JQFA 1ZOLA 1CTQA 4Z4IA 1NMSA 3PEWA 1EQUA 1K7YA 4C4XA 4AS3A 3FTEA 4V0RA 3N6RA 1BMFD 4YCJA 4ZZ3A 5K6RA 3ZJVA 3CRNA 5FV4A 1I4DD 2CNWD 3SKXA 4HNVA 1NNEA 1YRBA 4EJ2A 3LLCA 4C7VA 2ZQYA 4D9GA 4Q12A 2X4DA 2XR1A 4XASA 3CB2A 1HT0A 2PX6A 2CEAA 5A4AA 4AZ3B 4NTZA 5K8UA 2VJNA 5HIMA 4DBZA 1NRJB 1VZ3A 2QA5A 4C30A 3VJRA 3O92A 2PBRA 2PGJA 4D6PA 2BLLA 3O0DA 5JH7A 4BB6A 1PYDA 3UAOA 3HCEA 1S9HA 2CXUA 1ZEMA 1XZDA 2CXOA 3JQ7B 5CIYA 1EXDA 2JH8A 4PINA 2OV1A 1P0MA 221PA 3JVVA 2OYRA 3V4ZA 2BC9A 3AWIA 1NBMA 1ZI6A 4DCJA 1A8PA 3HLKA 5EN4A 1SBTA 4M3NA 2QORA 4XM0A 3W5HA 3L1UA 2YY5A 1SU8A 3GLQA 2FN7A 4BEVA 4C07A 1VJDA 2IYUA 1P61B 1OAOC 2BW0A 2C4VA 4MULA 2BM1A 1S5PA 2WG1A 1Z62A 5EAIA 4K86A 5FLKA 1DRWA 4P54A 1G291 2VJDA 1C1XB 1U7PA 3LJKA 4LHSA 4U6QA 1KBQA 1RYZA 1ZVKA 2AXQA 1X1QA 1P2SA 2FWIA 2QRJA 3T0GA 3K73O 4ALNA 3QEOA 4JJFA 1WD5A 1E66A 1I3OA 3OPNA 4FOSA 4ZKEA 4OQEA 4A1FA 2ZRGA 3NPMA 1N2CB 1OXVA 2EAUA 3LIIA 1L5VA 1ODKA 3PC8A 4LX0A 4PAWA 3H2JA 1FSZA 3HNPA 4RANA 4WADA 5K8IA 3U26A 1E6LA 2QRMA 5AW2A 1M5TA 3DFZA 4I46A 2CFIA 5HUJA 1JMYA 5M2QA 1SCQA 4OTZA 4A7PA 4DT1A 2EX0A 3FIJA 3QLEA 1KPIA 1GUYA 4X20B 1NMYA 1U0SY 2NQ2C 2PU7A 1VBKA 6PFKA 4D80A 3GFQA 3C7DB 4FYPA 4RPLA 4OQNA 3OSZA 2XE8A 5MDHA 4MQFA 2WOOA 1WOMA 3CXUA 1IXZA 4HAUA 4JR0A 4TLCA 5FHRA 1M74A 2XQIA 4MUMA 1AKTA 1OGJA 2V7BA 4P92A 3HGMA 1LD3A 3WISA 3D8NA 2J0SA 4AJLA 1GQSA 1WXDA 3GDGA 3N0VA 5GGXA 1XPOA 1ZINA 2WNHA 3PXDA 3EFOA 3NUZA 4G26A 1PFYA 3WWPA 4AZSA 1TD9A 1H0KA 2J8ZA 4W7IA 4YRNA 1YRAA 1BGWA 4EHAA 3GLIB 5AW8A 1JSLA 4KNWA 3GNQA 2Z57A 3B82A 1E8NA 1TMOA 1YQXA 1ZK0A 3I09A 5DMHA 4M6WA 1QYXA 1PK9A 3EJ6A 4GBMA 2A4KA 2NUBA 4UBNA 3TZKA 4BX3A 2WICA 3TEFA 4Z2YA 1FU8A 5EJ6A 2C5HA 1EXNA 5ARBA 1RVV1 3L8GA 1A9YA 3RS3A 2GK4A 1QGAA 1D0VA 3PDCA 2QJFA 4QIHA 1FTQA 4C6RA 1Y4UA 3BSWA 3L5OA 1E89A 1OLOA 3DEFA 1LLFA 1PT6A 3HBMA 3LY5A 4UHKA 5JCJA 4RZ3A 1K98A 1VRCA 1C3OA 2OKGA 4I9UA 4L22A 3ZWMA 4JUIA 2R751 4HZGA 4R8RA 3QHAA 5AK6A 4YPVA 1AY0A 1DINA 1F4PA 3GMIA 3RARA 4DAOA 1RZRA 1SR8A 4QUEA 5J40A 2NVWA 4CTKA 1TZBA 4KKXB 4KBGA 3PFHA 1B16A 3BFVA 1KI6B 2JASA 4YRRA 5IC5A 3W5BA 2GMWA 3FTDA 3FPBA 3W2EA 4Y67A 4UHCA 1X7WA 5JG7A 4ZZ1A 1HK7A 2BFFB 3WQQA 5M5BA 3W8EA 4OK3A 3PXAA 3AINA 2F17A 3D8RA 3NH9A 4FK8A 1GNPA 5EIOA 3G0OA 4D4IA 2YXEA 2PX3A 4BTEA 5KNBH 4QGBA 1J99A 2O1XA 4AQDA 4O2BF 1J24A 2CNKA 3X1DA 4EDFA 1PX2A 3G2LA 4NYJR 3RFCA 4WFIA 3F6RA 4B3HA 3K8OE 4XWAA 5B2ZA 3MJSA 4EG1A 2HPVA