2QQ5A

Crystal structure of human sdr family member 1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
238
Chain Sequence
b'APMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase/reductase SDR family member 1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal structure of human SDR family member 1.
rcsb
total genus 88
structure length 238
sequence length 260
ec nomenclature ec 1.1.-.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qq5A00
1MV8A 3GGPA 4OXKA 1H9AA 3V2HA 5EIOA 1U7TA 4HFJA 5ICMA 1BVRA 1N7GA 1BXGA 4A2CA 3ZHYA 1E3IA 2CVQA 3MJ4A 2DU8A 1B15A 1E1KA 1ISMA 4J1TA 5HTOA 4FR5A 4RDIA 5I7EA 4FC7A 2Q49A 3HN7A 9LDTA 1M76A 4KUEA 4YRAA 2PKQP 4DXHA 2VRBA 3H7AA 3ABIA 2O3JA 3D64A 2EKPA 5L95A 1E7QA 1LQUA 3O8QA 4TVOA 1OAAA 3H6KA 1ADGA 1EVYA 1TA4A 3F6YA 4PLFA 1LC0A 1WMBA 4WEOA 2VOJA 5I7SA 4GGPA 1XR3A 3HHPA 3BHIA 4BO3A 4XQCA 5IZCA 2WM3A 3VDQA 3DOJA 4FS3A 4QUKA 3PDJA 2NNLD 3C1AA 4NJOA 1NHWA 3GPIA 1JTVA 4GVXA 5BT9A 5IN5A 3RC7A 1HDZA 2AQIA 3ONFA 4KOAA 4CUJA 1EEHA 2PWZA 4OMUA 1KIFA 2TMDA 5L4NA 4JGBA 3O38A 2GN9A 1E1NA 3AUSA 4ALNA 2Y1CA 4CM6A 2VQ3A 4KP7A 4E4YA 1R15A 2R00A 4HNGA 2Z95A 2FY8A 2YDYA 3FCOA 1MFZA 1XELA 4CLXA 4Y6RA 3BXXA 4E5NA 1FJHA 4XIYA 3F4LA 1GUFA 4YRDA 3RKRA 4IS3A 4RO0A 2Y1GA 2DUUA 4D43A 4UEOA 1N8KA 3OJOA 1O95A 4ILKA 4CMIA 4CMEC 4ZRNA 1C0PA 3O03A 4Z6KA 3G1TA 1KVRA 4JROA 1GTMA 1E6UA 4KDEA 3SX2A 1NTOA 4J1SA 4OJNA 1DAPA 5KTKA 3L4BA 4D3SA 3NT5A 1QYVA 1GZ4A 1YS4A 3ITKA 3P2YA 4OGWA 5KWEA 5I7FA 3FNFA 4MP3A 1X13A 1VL8A 2HCTA 3DZIA 3WWZA 2PNFA 1G0NA 2VT3A 2P91A 5B4TA 1NWHA 3SXPA 3PLNA 3E9MA 3VH4A 1YKFA 3TQHA 5G0VA 5G0UA 4O63O 4NBRA 5BQFA 1PR3A 1V0JA 1YOVB 2X0IA 2FZEA 4MOWA 2VWGA 1WPQA 4QQRA 5I9MA 4J9VA 1UDAA 4J1QA 2P5YA 4XQEA 3KSUA 3RUEA 2VZ9A 1E77A 2OUIA 4R4JA 2NTJA 2O3RA 1M67A 4E5KA 1AHHA 4XRGA 1NASA 2WE7A 1HKUA 1I3LA 3B1JA 5T64A 4W82A 1PJTA 1GEEA 2G0TA 4BV9A 1HSOA 4RVUA 1DFIA 1SB8A 1J49A 1GY8A 3OIDA 3DFUA 1I30A 4CJXA 3TOZA 1GDHA 1DC3A 3GFGA 4MVJD 1X7HA 4XR4A 1XQ6A 1ONPA 4WCFB 5I8WA 3EC7A 3ZWMA 4BNLA 4W9NC 1VPDA 1SZJG 3GNQA 1U5AA 1HDCA 3G49A 4WPGA 1JWAB 4ZA2A 2EW8A 1TB4A 1MX3A 3TFQA 3PHHA 3S2EA 1R6DA 4QX6A 1XYGA 2WD7B 4LVCA 1IUKA 1ISGA 2QRJA 2IEDA 4YJDA 3LSYA 3PGJA 1UDBA 1Y8RB 4CM8B 1P1JA 3BMCB 3QRWA 4WUVA 1LLUA 1CYDA 3LK7A 4YT8A 2ZQYA 3OBBA 1DLJA 2O23A 3KXDA 4IQ0A 5JY6A 3GHHA 8LDHA 1PJBA 1PJLA 1MG0A 4EJ6A 3TZKA 1SEVA 2QRKA 3CEAA 2W2LA 3R3JA 1NR1A 1RM0A 5CAEA 2C2YA 5DBGA 5JE8A 2YUTA 5L51A 3RFXA 2DFVA 4ZHSA 3W6UA 4INAA 4H3VA 5T57A 3B1KA 3PP8A 1Z74A 1Q7GA 4Z3DA 2EJWA 3QP9A 4EZBA 3RJ5A 4BMNA 4CM9A 5ITWA 4MJLA 2XPCA 3ZWWA 1RM5A 1H6AA 3U4HA 1WAMA 5TIIA 1NQTA 5EESA 3KYDA 3CKYA 1EK6A 3WQRA 2VZ8A 5FWNA 2GUGA 4D46A 4WNIA 4EDFA 3C7CB 2CF6A 2X1HA 3ZWOA 3IS3A 2VUTA 2BI8A 3I9OA 1U5CA 3IIEA 4RVFA 1GUYA 3DC2A 4BQRA 1EVIA 4BNIA 3FD8A 4UVDA 3QVWA 2VUUA 2X86A 1C1DA 1PTJA 5BSHA 4PIVA 3FTPA 1NQOA 3JCZA 4MVJF 3TN7A 1VC2A 4G2NA 3U0BA 4CUKA 5IFLA 4KUGA 3V2GA 4E5YA 4LSMA 5HS6A 3ZCXA 3HDYA 1G0OA 1RPNA 3INRA 4HFRA 1I10A 1E3EA 1IHXA 2BF7A 3PVZA 5EINA 2VN8A 3OQ6A 4XJSA 5CEJA 4PG4A 3ZNNA 3ZWYA 1KERA 4PG8A 3M1LA 1N1EA 2E48A 3GF4A 4DWVA 3AUTA 3RUFA 2AA3A 3KYBA 1JKFA 3WLFA 4LN1A 1UAGA 4U7WA 3OF2A 3UW3A 2HQ1A 1HZJA 2HO5A 4OOFA 1W6UA 3DDNA 3KO8A 1HSZA 4TSKA 3VPXA 4DPKA 5IJZA 1T2DA 1DIAA 1G1AA 1E1MA 1LDNA 3D4OA 3DTTA 3KYCB 3OJEA 5A9RA 2DAPA 1PJ2A 2ZYAA 1E5QA 3L6DA 3MJSA 4PZDA 4BUCA 4TRJA 3SEFA 4DBZA 3GRKA 4URFA 3WXBA 1DC6A 2UYYA 4DQUA 1Y8QB 1LDEA 5TT0A 2Q4BA 5AXDA 4MIYA 3QVOA 2AEJA 4WCDA 1DIBA 3GDGA 4I9NA 2NSDA 2X5KO 2YHUA 3UFXA 2E4AA 5KJEA 4R3NA 5A02A 2OL4A 4AJ1A 3JQ8B 1A7AA 2G82A 4R41A 3WOHA 2D8AA 1JVSA 3KETA 3B6ZA 3R1IA 4GMFA 1PL7A 1T1RA 2P5UA 4IMPA 4JXKA 4UVHA 2Y05A 1CJCA 3WYBA 3ZHBA 3DMTA 4HX5A 5IN4A 3RVDA 2BFPA 3PDUA 1NPTO 1ISFA 4EI2A 3DZJA 3VPGA 1B8PA 1DHTA 1P1FA 2NLOA 1GEGA 1P74A 2DBQA 3I6IA 1V3UA 3QWHA 2BFOA 4PGFA 2J3KA 4U8GA 1ZNQO 4XDYA 3IC5A 4HP8A 5HWSA 4EBFA 5KCZA 5TGDA 4AJJA 4G5HA 1G6KA 4E0BA 2PZJA 3FR7A 4LMRA 1BWSA 1F14A 2Q46A 4FGSA 1KC1A 2IDZA 4XWYA 3TOXA 3KYCA 3H9GA 4UVEA 5B4UA 1W0CA 4NFHA 4DIBA 3PWSA 2Q1TA 1VL6A 2AEFA 5JW6A 4N18A 3PYMA 4GX1A 1KYQA 3JQ7A 1J0XO 2OXIA 1ZK1A 3DZFA 2YQ5A 5KJFA 4B4OA 5JCXA 5DN9A 1NNUA 5C7LO 1MFPA 1U4OA 3BTVA 4PCVA 5EPOA 3GN1A 1DRUA 4RDHA 5BSEA 4CQMB 2F00A 2Z1MA 3UCXA 1XQ1A 1ZEJA 3ZWPA 1E3JA 3DB2A 5CG2A 2C20A 2H6EA 3VTFA 5K6AA 4R9SA 2O2SA 1H93A 1I3MA 4DL9A 2FPGA 1BTOA 3FPCA 5EERA 3AY3A 3C24A 3MWDB 4PVDA 5U1PA 3JTMA 2QZ9A 4CMGA 5CEEA 4OM8A 4K1LA 2AG5A 2Q2QA 4YWJA 1Z82A 4GX5A 3SJUA 1XGKA 1YDWA 3LC2O 3CZRA 1IHYA 2P68A 4GI2A 2XXJA 3QLJA 3DBRA 4I5FA 3KZVA 2VNSA 3H9JA 1XCBA 3U62A 1H0KA 5LCXA 3AI2A 4YYZA 1AUPA 3ANMA 1BMDA 1NR7A 1WZEA 1WDMA 4KZPA 4BO8A 4JN6B 4E2YA 4QFCA 2NUAA 1DJNA 5C37A 3VKVA 3AUAA 5TF4A 2B35A 3VH3A 5IAAA 2OBYA 5TJ9A 1NX6A 5AVOA 2DLDA 4CL8A 3OIFA 5DCUA 5JC1A 1LBEA 1O9BA 4YAGA 5L53A 5ER9A 3V5NA 1IYZA 4DIFA 5KVVA 5DF1A 3DBVO 1LRJA 3G3EA 4A73A 1E5LA 4QECA 3BMNB 4Y6PA 2PTGA 3B1FA 1NFFA 3JQBC 4B4WA 2AW5A 4DIOA 3BTOA 1R66A 3IQDB 1A5ZA 1YQGA 2X9GA 3GC6A 4ZRMA 5CDUA 3QW2A 2ZB8A 3ASUA 3BMCA 4NIMA 1LRKA 3AU9A 2ZTLA 3LYLA 3PQFA 3DBHA 1ZSNA 2Y1OA 3ZV6A 1ENPA 2NWQA 3I4CA 4RZHA 2AHRA 4OSPA 2RHRA 4E2XA 4HFNA 4BO2A 1MUUA 1EVJA 4HFMA 1QORA 2NM0A 4NI5A 4OH1A 1UXGA 1KC3A 2PKRA 4GWGA 4F6LA 4WJZA 1P1IA 3NV9A 1YQXA 3ROQA 3U49A 1FDSA 3E5RA 1Q0QA 2EKQA 4B7CA 1U3WA 3EZLA 1BXZA 1WXDA 4EUFA 1D4FA 1IPEA 4E21A 3PEFA 4FOOA 3MZ0A 3KV3O 1SPXA 4CR8A 2X5JO 2O3TA 3WGQA 5GY7A 3A4VA 2QHXA 3ZV3A 4M49A 4U5QA 4CLDA 3O9ZA 4Q3AA 1RYDA 4Z9YA 3S2FA 3TPCA 2WYUA 4MIEA 4IINA 3DOCA 1HTBA 1R16A 1XWFA 3I4FA 3WNVA 1BDBA 2BGMA 4Q9NA 1RKXA 3DBRB 1HDGO 3FNHA 4K9DA 1GUZA 4XB1A 4BKPA 2PFGA 2OO5A 1HDOA 3DTYA 4NNJA 2BH9A 1KS9A 4YAEA 3ZNPA 4IGEA 4BGIA 4NHEA 1LEHA 4J90A 4IPTA 1GYQA 3QWBA 4JBGA 1Q0LA 1CRWG 1K5HA 3KOUA 1GPDG 3UUWA 2B4RO 1VJTA 5KNLA 1XHLA 4RQUA 3RQSA 4Q3BA 4D7AA 2GNAA 1I5RA 3ETDA 3GVHA 1UXJA 2BFAA 4N5LA 4H7PA 1N5DA 4YACA 4MO2A 1X0XA 3RI3A 3RWBA 2DUWA 3HDHA 1MGOA 1VJ1A 3NJ8A 3JD2A 5IDQA 1RM3A 4TKLA 4CLOA 4BKOA 3E9QA 1DLIA 3H2SA 4L9RA 4A26A 1D1SA 3BMQA 4FQ8A 1C14A 3DL2A 1M6WA 4AICA 1B0AA 1GPJA 1DHRA 3PHLA 3GZ4A 1RJWA 3EZYA 1QYDA 1VI2A 3LVFO 3QVSA 3BTSA 3STHA 4CODB 1JU9A 1ISJA 1N92A 3RUDA 1HLPA 1HETA 4M8SA 1I3NA 4B4UA 4PLTA 1QSGA 3K2EA 4LRSB 3EAGA 3PQEA 3MTJA 1KY5A 3AFMA 3IUPA 1YDEA 1DOHA 2C7VA 3D1LA 4PLVA 4D3DA 1ADFA 2X7HA 2EF1A 3PIIA 2LDBA 1FDUA 4PVCA 1NPYA 4BNJA 3PRJA 4WLFA 3S2GA 2HK7A 4ZQGA 5ENDA 3UGKA 3WR5A 4R54A 1NVMB 3NUGA 2Q3EA 3LT0A 5BNTA 4NH4A 2GDZA 2NV6A 4TQGA 3UKOA 1ZBQA 1U3UA 2ZB4A 4XCVA 3PWKA 2JKVA 1H5QA 5EN4A 1E3WB 3D5TA 2VTDA 4Q39A 2VHXA 4HV4A 3EK2A 2V6MA 4IS2A 1P44A 3C1TA 4UVIA 4CM4A 4J3FA 2QYSA 1SOVA 1OMOA 4NMHA 1P0CA 3RC9A 3UCEA 4BNMA 2PA3A 5TS3A 2PD4A 3DONA 4ND3A 1FK8A 4BKQA 3N7UA 1SBYA 5A5EA 3HQ4O 2VTEA 5IXYA 4CLRA 1WDLA 4U0KA 3JQFC 2DTXA 4GX0A 1F06A 4MKRA 1L7EA 1VL0A 3A14A 4WCFC 2DBVO 4GQAA 5B37A 4OIMA 5ENVA 4A5OA 4EITA 5IXSA 4IZHA 5F1KA 1XG5A 4FN4A 2D1YA 2OGUA 1HDYA 3C85A 1QYWA 4II2A 5CDSA 3Q9UA 3L07A 4OAQA 4R01A 5ICSA 2EHDA 3JD0A 1PWXA 2PZKA 4ND1A 1KY4A 4FCCA 3CE6A 2GN4A 5KVQA 8ADHA 5KIAA 3H4VA 3FHLA 4WK6A 4Z9XA 4DYVA 2PD3A 3JYNA 1PSDA 4OO3A 1I3KA 3B70A 2QX7A 4D79A 3IP3A 2VCYA 3ZU3A 5CDYA 3OJLA 3ZWNA 4ND5A 1ML3A 4IGFA 5DDIP 1Y5RA 3E5MA 4BNFA 3Q2IA 1M66A 3U3XA 4L8VA 4YB8A 4A27A 1ONOA 4PFJA 3JQ9A 4NBUA 4D0SA 3IUSA 4DLAA 3FRJA 4J4TA 2QZZA 3OJFA 5FEUA 4OYRA 4E33A 2FN7A 3GG9A 1U2GA 4CQMA 4BNKA 1ZJZA 1ZXBA 4XR9A 4AL4A 1ZFNA 4L0QA 1P77A 5HM8A 2GCGA 2YW9A 1PJ4A 2JD0A 3DAFA 3GPDG 3F47A 4L73A 5IG2A 1R4MB 1K3TA 1UDCA 3IMFA 4LISA 3W4IA 1PR9A 1N2SA 5JPIA 4YA6A 3ZWXA 4RL6A 1Z7EA 2D0IA 3K5PA 1GYPA 2V6GA 3F1KA 1PJQA 1MC4A 2FP4A 1PGNA 4NQZA 2DPHA 4MP8A 4BIIA 2BHLA 1UP4A 1NWCA 4LSWA 1R4MA 3O4RA 2X9VA 3OHSX 3OETA 3RJ9A 5TT1A 4KWIA 3JYOA 4PLCA 3PFWO 4I8XA 2C2XA 3JSAA 3K96A 3WDSA 3E9NA 4BHTA 4PLPA 4E2WA 3PZRA 5IF3A 2AQHA 4ALMA 4OSOA 2GYYA 4W4TA 2AQKA 3Q1LA 4IZIA 1GQYA 3AK4A 3UICA 3BTUA 2PKQO 3M6IA 1FDVA 1C1XA 1LA2A 4J7CA 4YJHA 4M54A 1MB4A 2VYVD 5DBIA 5JY1A 5DULA 2I66A 1PX0A 2HJSA 3H5AA 4CMKA 3R6DA 4PZEA 1GD1O 4P4NA 3WQSB 1YRLA 3DMTC 1DDOA 1NAIA 4QT0A 1XLTA 3JQEA 4FD3A 2NTVA 1LRLA 4RVDA 3PJDA 4ALLA 5JCJD 2B5WA 4UUNA 4YJFB 3OA0A 4PRKA 4YQZA 3GR6A 4CMAA 5HBRA 3ROMA 1X1TA 2W90A 3Q9NA 4UULA 3RASA 2WD8A 4OQYA 1HZZA 1P1RA 1EE2A 4CV0A 1LLCA 5L40A 1X15A 1Y8RA 4CM8A 1V8BA 5JBIA 4Q3NA 4RF2A 3ZH2A 3TDKA 5LDHA 2I99A 3DOOA 2VT2A 4KTVE 1PJCA 2NQ8A 2GO1A 3D3EA 3PHIA 4XRRA 1QYCA 4WEQA 4A0SA 4ZQEA 3K92A 2UAGA 3VVCA 2VWHA 1LU9A 3BMQB 1GYRA 4CLRB 5HRUA 1PJSA 3CMCO 1J5PA 3HNPA 5DNAA 4RVSA 4AJNA 3S1LA 4DPLA 2C5AA 2BI7A 4DRYA 3A1NA 1EVZA 3HFSA 3WSVA 4QXMA 4GL4A 4TMFA 1MXHA 2D5AA 4NBWA 1P33A 3QWAA 1ADBA 2OOSA 3GA0A 3ON5A 4CR6A 1P0FA 1GZ3A 3RD5A 4GSLA 1O89A 1VLLA 4KTTE 2SCUA 4CM3A 4E5MA 4IDBA 4J6FA 4M86A 3WQQA 1HEUA 1ISIA 1KEUA 4BO7A 1UP7A 1QLJA 5CFZA 3GG2A 1UXHA 1U3VA 3NTRA 5KVCA 3O8QB 4KWHA 3BMNA 3D4NA 1W8DA 3VH2A 3RFVA 1YOVA 2C7GA 3AOEA 1EBUA 2GGSA 1GCUA 3QIVA 1GQ2A 3MOIA 5GZ3A 1C3VA 2CZCA 1J6UA 1PZEA 1E3SA 3D3WB 3R0IA 4UUOA 1Y9AA 2RIRA 4E2ZA 4TRMA 2H63A 2ZTMA 1X0VA 1W73A 1ZZEA 5F21A 1BXGB 1DIHA 1E7YA 2PZLA 3FR8A 3GLQA 1I36A 4O1MA 1PWZA 3GDFA 4UREA 3TJRA 1TT5B 1IZ9A 2DVMA 3ICPA 4GLOA 4BO1A 4UUMA 3ZW9A 4GSKA 3DQPA 4M1QA 1ZO8A 4IQGA 4CV1A 1F17A 2A92A 3RUHA 3RAJA 3BZUA 2GZ2A 2J5RA 1A71A 3EVTA 4MVJA 4EEXA 5TX7A 1ZUD1 3JD3A 4B7UA 4CLEA 2JCYA 3JYPA 3SLGA 2BGLA 3MJCA 5JDCA 4Y8VA 3GZNB 4ITUA 3TL2A 1WP4A 3GUCA 2VWQA 1Q7BA 3H9EO 2Q1UA 3WIEA 1EMDA 1JA9A 1CF2O 3GNSA 3LQFA 5JFOA 5K0ZA 1B8VA 3WSWA 1F0YA 4RPGA 4D3FA 3OEWA 3OP4A 2QQ5A 3OQBA 2YHIB 1KVTA 3GN2A 1WW8A 3DHNA 4X54A 3GQVA 2DM6A 1PS9A 2YZ7A 5DOZA 3JQGB 4IDGA 4PN3A 1ULSA 2RCYA 4FFLA 5IDXA 4E32A 3I1JA 1ORRA 1SC6A 1HWYA 2ZATA 1EUCA 3IJRA 3CINA 3LC7O 3U4DA 1LSUA 3WICA 2Q4EA 1YJ8A 2GN6A 5EMHA 3GT0A 5HA5A 1UXKA 4Q3EA 1BSVA 3WYCA 2A35A 4HY3A 1GFSA 3U4IA 1I0ZA 1DJQA 1P31A 4YRBA 4J49A 3WIDA 2JAHA 1LLDA 2EEZA 4BGUA 3PTZA 2B4TO 2CDAA 4M87A 2CDCA 1PS8A 3Q2KA 2DQ4A 2A94A 5IZCC 3MTGA 1UAYA 1Y1PA 4R5HA 2PH5A 3ENNA 4ESOA 4PLHA 1A72A 3VPSA 4I5EA 4YJFA 3CMMA 4FFRA 4WE3A 1C0KA 2EG9A 4YTEA 5T8KC 1VE9A 1K2WA 3S2IA 4AJHA 1X14A 1GL3A 4HNHA 2I65A 2GLXA 2C29D 4AVYA 4ZU3A 2Q50A 2VNAA 3E6AA 3I9LA 1K6IA 4S3MA 4RVHA 3UXYA 4FDAA 2G5CA 5A1TA 3OEYA 3ZZNA 4IJVA 6ADHA 3U5TA 3A28A 5J23A 2X0RA 2G17A 2IZ1A 2OP1A 3D4PA 4NFYA 1HRDA 1PEDA 2HAEA 1NPDA 4YEDA 5AXBA 5JLAA 1MG5A 2Y68A 1ISHA 4LGVA 3ZWAA 3SVTA 1S7CA 1YL6A 3BMOB 2B5VA 3G0OA 4DREA 3E18A 1YBAA 4AJKA 2WWRA 3DZKA 4J16A 3A9WA 4Z0TA 5ADHA 3HDJA 3GMDA 3RUCA 1CETA 4Y6SA 1BHSA 1VSVA 4ZGWA 1UXIA 5B1YA 1U2DA 5G4LA 1IULA 4YAJA 3VTZA 1X1EA 5DT9A 3ZWBA 5L4SA 3UH1A 3ROPA 2WDZA 1HDRA 4RF3A 2Y1FA 1DXYA 2YV1A 2EGHA 1BW9A 2EGGA 2BELA 4E6PA 1IY8A 2ZYGA 4O6VA 3W8EA 4QSMA 4UEKA 2OHXA 4WECA 2RHCA 1R12A 3LZ6A 1LLQA 3G1UA 5A3JA 3NTQA 4IDEA 1T2FA 2WE8A 4R1NA 1DPGA 3GVPA 3INGA 3PYXA 1PIWA 2I3GA 1PGJA 4RPLA 4IBOA 5TRTA 2UVDA 3RBVA 1H2BA 3P5SA 3AU8A 1QYXA 4I9HA 3JV7A 4BB5A 4RLSA 4DPMA 3NDRA 1IL0A 3GRPA 4J4BA 5IDYA 1C1DB 5C3MA 5JC8A 3CH6A 2X9NA 1HYEA 2GPTA 2FRDA 1NP3A 3OQ1A 4LRTB 1XEAA 1K6XA 1NFQA 1KETA 1T2EA 1FDWA 2ZIZA 1GQQA 5JCJA 3VKUA 3FBTA 1U8FO 2BGKA 4BO6A 2VRCA 3KHUA 1ZXLA 1JWBB 2X4GA 2O50A 1YB1A 3ITDA 4R1UA 5CHEA 3AM4A 1LSOA 1E0DA 4CMBA 1SO8A 3I23A 3ICCA 4GPD1 2NTNA 4NDNE 2XF8A 5THQA 1U28A 5FI5A 1B8UA 2DT5A 4PRLA 3L6OO 1D3AA 4DBVO 1RYEA 3DHEA 4W7IA 4JJIA 1GR0A 4OQZA 3FF4A 4PLGA 5A9SB 4OXNA 4WLOA 1VJ0A 2GR9A 1C0LA 5JAIA 1YB4A 1SNYA 1LC3A 1ZH8A 3CUKA 4B8ZA 3KUXA 2EV9A 3ZU2A 1PU2A 4UVGA 2C07A 5A9SA 5KJCA 2GSDA 1GAEO 1SMKA 4XB2A 1LSJA 4CV2A 2DFDA 2H1SA 2AEMA 2D5CA 3NGXA 3F46A 4R1TA 2F1KA 3S8MA 2ZQZA 4Y67A 2B4QA 5L7TA 3MOGA 2CVZA 4AFNA 5C5IA 1DIRA 1Y5MA 1E7SA 3W4JA 3HG7A 2EP5A 4RVGA 3ZW8A 1YONA 4JX8A 4J43A 4FSHA 4P22A 2H5LA 3U4CA 4ALIA 1WMAA 1TLTA 1OI7A 3EGOA 3VVBA 4NJMA 2QW8A 4DYDA 5DCWA 5JMPA 1V6AA 5JDIC 4IM7A 3NDJA 1HE2A 2O7QA 3AY6A 3RC2A 3QWFA 1XIVA 3I52A 4YJHB 1ZKMA 4K28A 3ZWCA 9LDBA 4XYBA 1F8FA 4DLBA 4EYEA 3KEOA 1ZSVA 4TZTA 2VHWA 2NVUA 2ZTUA 2QRLA 4E30A 2CFCA 1AN9A 5JMWA 5B4VA 4ALKA 3M2PA 3K31A 2E37A 2D2IA 1IZ0A 5TLSA 3DZBA 3TZQA 5G0TA 3EMKA 3DBLB 3GGOA 4YT4A 4GVLA 2P4HX 1HE5A 2VOEA 3ANNA 1ENOA 3GAFA 1SEPA 2VHYA 3T7CA 2NU8A 1DBVO 1ADCA 2OBNA 3T7EA 4TWRA 2VZ0A 3VZRA 5L4LA 3AW9A 3UHAA 4FJ0A 4EUHA 2DC1A 1H9BA 1AGNA 4EEZA 2W2LD 4HKTA 2J5QA 1T24A 3BAZA 3AFNA 3HE3A 4J0FA 3NT2A 3TRIA 3GY0A 3LU1A 1EUZA 5CG1A 3L4BC 4ZD6A 5CEFA 1DRWA 5TNXA 2FPIA 3HB4X 1A4IA 3PFFA 2NACA 3W8FA 2E49A 4GH5A 4MVJH 3EUWA 1JAXA 4KQXA 4ONEA 4NBVA 3FSRA 2OMEA 4JNKA 2Y0DA 1EBFA 3VPHA 4PG7A 4WLUA 4DUPA 3WG9A 3PJEA 5KKAA 1HF3A 1EUDA 2HUNA 1OC4A 2XAAA 4ZVVA 2O4CA 3RFTA 4AJOA 3IKTA 3B20A 4YT2A 3WGYA 1QV6A 2BLLA 4G65A 3EHEA 4R68A 3LF2A 2W2KA 1JAYA 4B3HA 3MJTA 3F1LA 1DIGA 1ENYA 2CF5A 4YCAA 5GZ6A 4NG5A 4D42A 2CDBA 4NU6A 4E12A 1ZMTA 1UH5A 1JDJA 2Z5LA 3TFOA 3VH1A 2I6TA 1NYTA 3QHAA 1BG6A 2P4QA 1Y9EA 3E03A 3H3FA 3PYLA 5TQVA 3D0OA 2HLPA 1GV0A 1I24A 1B3RA 4WNCA 3WBFA 3FBGA 4I08A 5JAQA 4CM1A 5TC4A 1OZAA 2Y1EA 4DC1A 3WMXA 3FWNA 1UR5A 3JD4A 4RCVA 4XKJA 5JO9A 2Z1NA 2E6UX 3K8ZA 1PS0A 1Q0HA 4MINA 4FGWA 3EDMA 3EW7A 4W7HA 4ND4A 4MVJI 2FWMX 1VSUA 1R4NA 1WDKA 4WLVA 3H9QA 3ZDFA 3QE3A 2IYOA 1O0SA 1NBOA 2RAFA 4C7KA 1QKIA 2JCXA 4GAEA 4B3JA 2NQTA 2JFFA 3AY7A 2J6IA 1LTHR 3AI1A 4G81A 2BKAA 2Y93A 5JYEA 3NGLA 3H8VA 4WCFA 4GBJA 2P9EA 4MKZA 2HMTA 4XX0A 5T67A 4E5PA 1YXMA 4O5OA 3KM0A 3PK0A 1KEPA 4ID9A 1GU7A 5G0SA 3OECA 5TJHA 4WLEA 4CM4B 1LX6A 3RU7A 4QEDA 3RKUA 3DBHB 4AJ4A 4RLHA 4C7JA 2G76A 2A4KA 3VZQA 3KYDB 1EDOA 4LVUA 4OHUA 1SOWA 1ARZA 3KBOA 1E1LA 1YJQA 2AMFA 2YV3A 1UZMA 4NR0A 1JKJA 1YWGO 2FMUA 4GLLA 5CDTA 3BHMA 3K2BA 4WLNA 5K9ZA 3ZU5A 1FXSA 2IEBA 1QXSA 1NFRA 2GZ3A 1LDMA 3L0DA 4LCEA 4GX2A 2IRWA 4R16A 1ZK0A 2V6BA 4AG3A 4YAKA 3GAZA 1T25A 3DFZA 1YQDA 3GHYA 4ROSA 2W4QA 4XA8A 4XQ9A 2OP0A 2YV2A 5EQFA 4XYGA 2NU6A 4BB6A 3JQ9C 4PLZA 7ADHA 2O2YA 4D0RA 2OORA 5TSDA 1QG6A 3WGTA 1CDOA 1R0LA 2HJRA 4P8RA 3OA2A 2X0JA 3WYEA 1ZJYA 4BNUA 3FN4A 3BHJA 4AJ2A 4ZQHA 2GF2A 5JDCC 4AJLA 1MA0A 5DP1A 1XA0A 2FR8A 5AOVA 3AM5A 5ITVA 1ULUA 4AJIA 4R51A 3L4SO 3PGXA 2FR1A 3BYZA 3QVTA 3C8MA 1P3DA 3WGHA 3EVNA 4W9NA 1HE3A 3IP1A 4J1NA 4WOKA 3W1VA 3SC6A 3VDRA 3RBXA 4K6FA 6LDHA 2PV7A 1XDWA 1S6YA 2B0JA 4WASA 3U09A 3COSA 4R5MA 4B79A 1T2AA 4DLLA 1KEWA 2C54A 4O0LA 4BL5A 5DBFA 4IJWA 4NFSA 4W99A 3E8XA 1NHGA 2B83A 2DTEA 1TT7A 2QIOA 3DMYA 2FOIA 3CPSA 1KVQA 3GZNA 4OKNA 4UAGA 5EQDA 2X8LA 4MDHA 2EIHA 3JQBA 2WSBA 3FNGA 3ZV4A 3FWZA 2AQ8A 2IZ0A 1PGQA 4BNTA 3WFIA 5BNFA 5F3RA 4YJGB 1Z7BA 4XYLA 1Z73A 3HZZA 1O8CA 3PLRA 4U6SA 4MKXA 1P1HA 1B3BA 1QLHA 1D7OA 4ZICA 1JVBA 4F45A 1B26A 2FSVA 5CPFA 1H6CA 4BNVA 3F9IA 2C59A 2HMWA 2PGDA 4IXWA 3QWIA 5ES3A 1KVUA 2D4AA 4AJPA 2GD1O 4FFPA 2EKLA 5MGBA 4UEJA 3P19A 3MEQA 4YQYA 5JAZA 3D3WA 2HSDA 4Z0PA 2ZB3A 4XZ3A 1UZNA 4R1SA 7MDHA 4Z9FA 3HDQA 5THKA 3SJ7A 1I32A 1M6HA 4XD2A 2IODA 4D44A 4CMJA 2IXAA 4DGSA 5G2OA 1JKIA 5DCYA 2Y99A 4JK3A 5KJ1A 5A3VA 1Y8QA 4R3WA 3E82A 3HADA 2O3UA 4L75A 2BFMA 1M75A 2RBEA 1HXHA 2I67A 3I9KA 5MDHA 4MIOA 5B12A 1K89A 1IE3A 3HSKA 4XJTA 3NRCA 2CVOA 1SAYA 5BR7A 1LDBA 2GN8A 4OL9A 3KLPX 4L76A 4XDZA 2Y66A 3JQ7B 1E92A 3ZU4A 4FIZA 3DAPA 1N7HA 3T4EA 4NPCA 5CP8A 4JP3A 1R37A 4U6QA 3K6JA 5ILOA 3QY9A 3RUAA 2X58A 1ZVMA 3KTDA 3MCVA 3R3SA 1I2CA 2PY6A 3SLKA 5I9LA 4EUEA 1N1GA 1XSEA 4Y98A 4ZQBA 3RC1A 3UVEA 1NVGA 1A27A 3L9XA 1QV7A 4IJKA 2PGJA 4O59O 2B69A 4S1VA 2NVWA 2VYVA 1IOLA 3JQCA 4P4GA 2Q45A 4BS9A 2YY7A 3CXRA 4XEHA 1DAOA 1W4ZA 5A4DA 5IZ4A 4NJMB 3LT4A 3DR3A 4JBHA 2HMVA 1GZ6A 2Q1WA 3UF0A 1YB5A 3IDSA 3PI7A 5ER6A 3CZMA 4BNXA 5BSGA 4NU5A 4B3IA 2ZJ1A 1YL7A 4WGGA 3TL3A 2PR2A 4DA9A 4CR7A 1R0SA 4ZJUA 1Y7TA 4NBTA 1VM6A 5AQ1A 1YGYA 3M1AA 4BMSA 5A06A 3TSCA 4DQVA 3C1OA 2IXBA 1PL8A 3JYLA 4BO9A 2P9GA 2ZCUA 1EK5A 1PQWA 2ZJ0A 3PZBA 2ILTA 1P45A 5I7VA 5CPBA 2D59A 2I5PO 3TZHA 1MP0A 5T5QA 4YJGA 1E7MA 2Q2VA 1E6WA 3F5QA 1JLLA 1L1FA 4PZCA 4XGIA 4EGFA 2DBZA 3NYWA 1I2ZA 3DWFA 1ID1A 3VPFA 2ZKLA 4RV9A 2YDXA 4J7XA 2VYNA 3D7LA 1PL6A 4II3A 2WMDA 4F3YA 1FDTA 3KB6A 1YBVA 3BIOA 3ST7A 1EQUA 2JHGA 1GCOA 1N9GB 4RF4A 3GH3A 2B36A 2TMGA 5KKCA 1JW9B 3W6ZA 4QO8A 4CMEA 1I2BA 4Q3CA 4HBGA 3TNLA 4YAIA 1LXCA 4BKRA 2ET6A 2UDPA 3F3SA 3D5QA 3GFBA 2GRAA 5A04A 4R69A 1DC5A 1EE9A 1U7HA 2WTBA 2Y1DA 3PWZA 4WKGA 4JBIA 1BXKA 4BNGA 3QJ5A 2IYPA 1J4AA 4K6CA 2C0CA 1GADO 3PQDA 2YFQA 1K0UA 3OSUA 4FJ2A 2JL1A 1OOEA 3LT2A 3RUIA 2D3TA 4MPDA 3PJFA 4IMRA 3JD1A 3NT4A 3V1YA 1BGVA 5I9NA 5JDIA 2EP7A 1CWUA 3JQDA 3DHYA 4FW8A 1B7GO 4P38A 1Q2XA 2GERA 3LDHA 4Z0HO 1E7RA 2WYVA 3AWDA 4FC6A 1CQIA 2Q2WA 1Y81A 3I83A 4BO0A 5L7WA 4LMPA 1D1TA 1LDGA 3FNEA 1EDZA 5L45A 1EQ2A 4CQLB 1NQAO 1AHIA 3WTCA 1Z45A 2HK9A 2AG8A 3KEQA 1IPFA 1CEQA 1NAHA 2DKNA 5KOIA 5C7IO 1UZLA 4I5DA 3S55A 3F5SA 2W98A 1A9YA 3PHGA 3WNQA 3Q11A 1Z6ZA 5DP2A 3NX4A 3LLVA 4BNZA 4CM5A 2HRZA 5H81A 2VWPA 4FFMA 3DEYX 2EW2A 2W8ZA 1UUFA 3KSDO 2DBRA 4F6CA 4MP6A 1TI7A 3GOHA 4KUHA 2YHIA 1EZ4A 2CY0A 4HXYA 3V8BA 4CMIB 4A7PA 4H15A 2VUSA 1LNQA 3A06A 4LW8A 1PQPA 1U8XX 2CMDA 4DVJA 3WGIA 1JQBA 3FPLA 1I01A 3G17A 1BW9B 4IJUA 3N58A 5JO0A 3ZNOA 3Q6IA 5F1PA 1CIVA 5JNLA 4CLOB 2X5OA 4PLYA 5FI3A 4RGBA 2J8ZA 2PK3A 2JD2A 3KVOA 4JJFA 4R9RA 3KRTA 4L4RA 4GKBA 3GNTA 3JYQA 4RJTA 2AE1A 2PH3A 2YYYA 1XU7A 5G0WA 4I9UA 3PPIA 3RSHA 3I9MA 1I8TA 4P4LA 3WMWA 2WYWA 1NQ5A 2BRUA 3IJPA 3IL2A 4CQMD 4BNHA 4N54A 2VYND 4JIGA 1ONNA 2O3SA 4UUPA 2YFHA 1A7KA 1E6EA 1QP8A 3AUUA 2I9PA 1U4SA 4RF5A 1MLDA 2VHZA 3WLEA 2FR0A 1ZMOA 2HMSA 3WJAA 4J4HA 1FMCA 5A5FA 1BRMA 4I1IA 2LDXA 1P9LA 1O5IA 3DZGA 1Z75A 4CM7A 2BMAA 2Y0CA 3WWYA 4A03A 1ZCJA 3Q0EA 2A9FA 4DC0A 3NDIA 2UUOA 1DEHA 4L74A 2HDHA 1WNTA 4JLWA 3JQGA 3ASVA 4EJMA 5EL0A 3IAHA 2ZB7A 3DXFA 1WLYA 5COQA 2WD7A 4L4SA 3NJ4A 2O48X 1KBZA 1PZFA 3DO5A 3GEMA 3PHJA 4FFNA 3L77A 4D45A 3ANLA 1JN0A 2JFGA 2V6FA 4TZKA 3ZGYA 4CV3A 4YVFA 4KDFA 2IZZA 4TROA 3GK3A 4BNYA 1KEVA 1R0KA 3OMLA 5C7OO 1AXGA 4OOEA 4B4VA 5DZSA 5AXCA 4IDFA 3AOEC 4RZIA 2Y0EA 4DMLA 4RPKA 4DQXA 1TVEA 4DTIA 2NU7A 4A10A 1A9ZA 3V1TC 4HWKA 3W8DA 2WEKA 4H16A 3ETEA 1FF9A 3NAQA 3GEGA 3PIDA 1R4NB 1PJ3A 3K30A 5IDWA 4TVBA 4BNWA 1E7WA 3FTNA 1QMGA 4GMGA 1TT5A 2O3QA 5F5LA 1T4BA 1AE1A 4JJGA 3GEDA 4J9UE 3ZI0A 3HN2A 1ZW1A 5CDGA 2GASA 2FHSA 5LDGA 4W6ZA 3ADOA 1LJ8A 4XQGA 1LUAA 1HE4A 3DZHA 3MWEB 1X7DA 4PLWA 1O94A 2O4UX 2POQX 1LQTA 3DBLA 1ZK2A 2R6JA 1HDXA 3I3OA 5BNIA 3EY4A 4BOYA 1V3VA 4IY1A 1U3TA 2FSSA 3IKVA 4M89A 3WX0A 5JYDA 2CD9A 1I33A 3GVCA 3KSZO 4CLHA 2X22A 3GGGA 1BDMA 3INTA 3K73O 2OFPA 4CQLA 2UV8A 5JSFA 5JAMA 3TZCA 1T1SA 4JCOA 4XIJA 3HB5X 2X0NA 3I6QA 2W2KB 3X2FA 3H9UA 1PZGA 2E82A 1C1XB 3ZWVA 1SB9A 4OKIA 3JQAA 1B16A 1UJMA 1NXQA 3GVXA 3CIFA 1DFGA 4BQPA 3CSDA 2V65A 1WZIA 4IUYA 3NTOA 4MVJP 4N5NA 4QTZA 3C7AA 3C7DB 5LC1A 1TXGA 1PZHA 1VKNA 4TKMA 3VOSA 3GVIA 4FB5A 1HL3A 4FJ1A 3HUDA 1ZK4A 5F5NA 3VC7A 3E1KA 4FBGA 1O6ZA 1M2WA 3L9WA 4BKUA 3H5RA 4C4OA 4J7UA 2RH8A 3E48A 3KLMX 2EWMA 4WOJA 2R2GA 1B14A 3ZV5A 3T4XA 4RPJA 1PGOA 2YQ4A 1DSSG 3QV1A 4L4XA 4D41A 1UP6A 1YE3A 2HRBA 3JQFA 3QA9A 2AE2A 1P1KA 4MVJE 3RIHA 2YJZA 5FYDA 5K6AC 2CUKA 2H9IA 4B8WA 4GKVA 3WGOA 1V9LA 2G1UA 1NM5A 4IXTA 4Y9DA 3SC4A 4BGEA 5H83A 2X6TA 2X23A 1V3TA 4MVJM 4YPOA 4TRRA 4ALJA 4RORA 4YR9A 4AJEA 4CMCA 1U1IA 4BMVA 4J2OA 3ONDA 1OFGA 2R00C 2DPGA 3TF5A 5FF9A 1ZIDA 4KMSA 5AYVA 3X2EA 2PGLA 3LLSA 3UCFA 3RCBA 4CMHA 2XXBA 4BO5A 3V1UA 5L9AA 2NVUB 1VKOA 3ZN2A 3LT1A 3QQPA 3CTMA 5COBA 4CPDA 4NZ9A 4MVJG 3N74A 5COAA 1DO8A 1WVGA 4NK4A 1DB3A 3WTBA 3AI3A 3NKLA 3AM3A 1IB6A 4XGNA 2C82A 1KOLA 4B7XA 4IIUA 2J3JA 1XU9A 2QG4A 4F46A 3WB9A 4N5MA 4XGKA 3ZHZA 2JD1A 1H2HA 3UAGA 3IOYA 5FFFA 3VZPA 1MC5A 3ROKA 1LDYA 3WJ7A 4IDDA 2ZYDA 3JQ8A 1K6JA 4TRNA 2XOXA 1A4UA 5ILGA 3RBZA 4IIVA 3GMSA 3OIGA 1DRVA 1EFLA 3H5NA 3RU9A 2JHFA 5A03A 1Q1NA 5JS6A 1YO6A 1DFHA 4NK5A 2JCVA 3BA1A 1YH3A 1Y6JA 3TZ6A 1H6BA 4EW6A 1YL5A 3VZSA 3O26A 2PZMA 4ZN6A 2RH4A 4XYMA 4GWKA 3H3JA 3UN1A 3ETGA 3ZNQA 4JP2A 5T8KA 5G4KB 1LI4A 3ORFA 2IE0A 4IDAA 3WGGA 4YXFA 2P9CA 5L7YA 3OM9A 1RWBA 3OJ0A 2Q99A 3RROA 4U0JA 4RPHA 1CQJA 4JQCA 4IQ8A 1GV1A 2AXQA 2PLAA 3JQ6A 1H94A 4J2HA 2PD6A 4DMMA 2Y67A 1SCUA 4QFDA 1PGPA 2EERA 2J5KA 3P7MA 5F1OA 2JJYA 5H82A 2NU9A 2V7PA 4FPXA 5AXAA 4EJ0A 2DTDA 5JXWA 4YDRA 4E3ZA 3BMOA 1BVUA 1RM4A 3I5MA 4M55A 3VAZA 1ZEMA 4LCJA 2HKIA 1T26A 3I9JA 1OBFO 4FOSA 1F12A 5GMOA 3C3XA 4BV8A 3WBBA 2P2SA 1HT0A 4I5GA 4Q3DA 3MJEA 3K9QO 2JFHA 5T6BA 3WS7A 3QSGA 3DAGA 3NEPX 3V2UA 3EYWA 4K26A 1WWKA 5HS4A 2Q1SA 2O7SA 4OXYA 5DOVA 2UUPA 2JAPA 1U9JA 3HJAA 4BGVA 3MJVA 5KJ6A 1PQUA 1QRRA 4BO4A 2C5EA 3JQAB 3H65A 4PG6A 2ZK7A 1H6DA 2VHVA 1C0IA 3LC1O 1MXFA 4CM9D 4FFOA 3HFGA 5I8ZA 2BD0A 2NADA 4YT5A 3FI9A 3UOGA 3WGZA 5U4QA 2ZTVA 3JQAD 3ENKA 1B2LA 3M2TA 3GDOA 3QVXA 1HYHA 3OICA 4ND2A 1TEHA 2OZPA 3H2ZA 1ZK3A 4J0EA 5L3ZA 1D8AA 1YBMA 2GZ1A 2NVBA 1N9GA 4CUZA 3P2OA 1OC2A 2I3AA 2QYTA 1F8GA 3L6EA 2J3IA 3PJGA 3SBOA 1CERA 3OH8A 1QR6A 3GUYA 3LF1A 1T4DA 4E13A 5BSFA 3Q3CA 4QO7A 2HU2A 5G4KA 2EJVA 4PG5A 1L7DA 4HUJA 1ZSYA 4CL3A 1EFKA 4ZQFA 4GGOA 1X7GA 2WJPA 1YVEI 1HLDA 3OFSA 4N7RA 4XYEA 1LSSA 5KVSA 1T2CA 4BVAA 2FZWA 3F4BA 5GZ1A 4IDCA 5U9CA 1E3WA 3ZHXA 4RQTA 3ULKA 1AXEA 4YBZA 2VRCD 1V35A 3TWOA 1KVSA 2HK8A 5EJ2A 5A05A 4Z3KA 3AJRA 3HWRA 3U9LA 2FPPA 3WFJA 1ENZA 3ONEA 2EXXA 2HMUA 3VHRA 3G79A 2B37A 2I76A 4J91A 1XKQA 4LK3A 4BNNA 1VRWA 4HADA 1Q7CA 1DC4A 3AOGA 2CNBA 3W4KA 1HYGA 3I9NA 3PXXA 1E3LA 4E31A 1NVTA 2J3HA 2ZCVA 4KQWA 5A9TA 2CSUA 3ADPA
chains in the Genus database with same CATH superfamily
1L4YA 1YIOA 3MUEA 2QF7A 5D8DA 5CB4A 3EF0A 5A0VA 2FLKA 1JQAA 1RVV1 4IHJF 3QE0A 1CCWA 1G5PA 2FZCA 2IHTA 1BQ4A 4ER6A 1IIRA 2AN4A 3BB1A 1BXGA 1MIOB 4PAMA 3FPEA 3GJ8A 3TUIC 3JPWA 3VI4B 2WFLB 3H0CA 3ZDYB 4HX2A 4DJ5X 1UJCA 3MHTA 4LI0A 1G19A 2REQB 2CXQA 2VBGA 1RP7A 3OE7D 4J1TA 4O2BB 5EP1A 5C7YA 4EBBA 2J30A 4FC7A 3HYNA 1AGXA 3HB1A 9LDTA 5GJVC 1PNRA 1M76A 1H9CA 4UXJA 3NNSA 5FA5A 2C3OA 5LQJA 4MPTA 3T4PA 2VRBA 4LZLA 1EXDA 3H7AA 1MOZA 2W8BA 3O8QA 4GLJA 2N3ZA 3H6KA 4TVOA 5J2TF 4HL6A 2HJ9A 3Q6NA 4RPIA 3L5OA 3EGIA 1YFJA 3GFVA 2AFIA 2V3WA 4G5RA 1HX7A 2AOXA 2XEXA 1XR3A 2BEJA 3IEIA 4ZXPA 2FMHA 4KNVA 5BN4A 3T3DA 2ZWMA 2P5TB 4PY2A 3BC1A 5CFOA 5EHGA 3VDQA 5GPBA 4EEKA 2I6XA 4RJLA 4A91A 2B78A 1HDZA 3ONFA 1EX9A 3VYSB 4IDOA 1P2VA 4OMUA 4C6SA 1QH8B 2HTEA 3ZC3A 4F85A 2YYAA 2OWDA 3PGLA 5ALEA 5JFTA 4Z3OA 2AFIB 5LVAA 2P67A 2GN9A 2DFKB 4HQLA 2XYQA 4EG4A 3LPDA 4KP7A 4HNGA 5SYMA 3FX2A 3FCSB 3QKRA 3ZI7A 1P6QA 4EQ6A 2ZM5A 1XELA 2PUDA 3ILHA 1OBCA 5TE9A 1N6NA 3PFHA 3CH5A 3VYVA 3VR4D 1LB1B 4PWYA 3RKRA 2C2KA 4RHEA 1G9XA 3NBAA 4IS3A 4TKUA 5M29A 1XTVA 5LA6F 3SBXA 2WINI 3R0XA 4ILKA 4JJ4A 3TBHA 1C0PA 3BB3A 2C4MA 2RARA 4FCVA 1A9RA 1WL8A 1T3HA 1KVRA 3G1TA 2JFYA 1E6UA 4N39A 3O9MA 3QSYA 1QS0B 1E2JA 3FDXA 1N0HA 3IUQA 4X95A 3L4BA 5JJ5A 4RACA 5AK4A 3RVNA 1QYVA 4JC0A 1QZZA 3ITKA 4FX5A 2QLJA 3WLAA 5I7FA 3IE2A 4V0QA 1YOBA 4DT1A 4LFAB 4MV4A 4WY5A 1PG2A 2HCTA 1XDDA 1VI6A 1G0NA 2HF8A 2P91A 3M81A 5B4TA 1J22A 1J7KA 4QUJA 2O8EB 4MPRA 5G0VA 2R68A 5IASA 2QV0A 1FFCA 3OQHA 4PHTA 3DUWA 4RTOA 3ZKWA 1EJ0A 4AECA 2EOAA 4MOWA 2VWGA 1DC8A 1UBGA 1WPQA 3H5OA 4OHRA 4URYR 5FP0A 5I9MA 3F7NA 4OHFA 3KJQA 3S2SA 1Z5NA 2LIPA 4HGNA 2R8BA 1KOFA 1E77A 2FQYA 2KQUA 1O03A 1ZIYA 4PBRA 3C43A 2FEKA 1VOTA 4E5KA 3TLEA 1LJUA 2YVQA 5AKLA 2XGOA 1HKUA 4BVHA 4G0UA 2OG2A 2J48A 4QGBA 1XD9A 4RIIA 4ZJYA 2C4HA 4PXYA 2X42A 5IAJA 5F52A 1PFWA 1J49A 3IE0A 5H0IA 1I3CA 2YWCA 1H3NA 3BREA 3DFUA 5EI5A 4U00A 4Z8YA 3KL4A 1TYAE 1YQ9A 4K3VA 1ND5A 3E61A 3GFGA 2Z58A 4MVJD 1PKEA 4IHJA 4XR4A 1ONPA 4H6WA 4MUEA 3E7PA 1PR2A 3ZG6A 3EC7A 5BMVA 5I8WA 5CYOA 2B8EA 4W9NC 4DAOA 3NM4A 1KDVA 2VJDA 4KMMA 1NBMD 3AMVA 4KQMA 1ORHA 3W5UA 1Z4NA 2WP0A 3G8YA 4ZA2A 3PUYA 1MX3A 2W83A 3CN7A 4OXQA 2IUUA 2V7BA 4EF5A 1N5JA 5BW4A 4N5DA 4LVCA 1EGAA 1NF2A 3OZIA 1ISGA 3EDQA 4MV0A 3BAFA 3IIIA 4YJDA 1ZUNB 2WQ6A 3J7AC 1KR5A 1QF7A 4CM8B 4NZZA 2HA5A 2UVQA 3IPLA 1FVHA 3CH7A 2V0CA 2I7TA 3FUUA 1P19A 1CYDA 1WCIB 1YBHA 2K2QB 3HI6A 1WPGA 3CNQS 4MEAA 4R98A 3I01A 4DDHA 4YT8A 1IXKA 4EY7A 2ZZMA 4Q4JB 1JGTA 2XADA 5B58T 1W581 1PJBA 5A7HA 5KBYA 3CO0S 5LP6C 2KX7A 3TZKA 1W36D 4PYMA 4CKXA 4D02A 3R3JA 3A1SA 3IHTA 3AB8A 2BZ1A 1G17A 2C2YA 1PT9A 4IIDA 1W4AA 2D54A 2YUTA 2CV1A 2KWIA 2PAFA 4AJ9A 2WHPA 1SVMA 3FB4A 4DR6B 5J59A 4B71A 1P81A 5FPSA 1TTQB 2I2FA 3QP9A 4O2LA 5EZSA 3RJ5A 3VU8A 5CA1F 1W48A 5HFNA 1PAUA 2YXNA 5JMOA 1UCFA 3ZWWA 1RM5A 3U4HA 3K53A 5F1YA 1DMSA 1NQTA 4C88A 5ALIA 4EJSA 3IHWA 1NN3A 5TQ2A 3RTGA 4AKTA 2GHTA 3OLVA 4MW5A 2HHAA 2JAWA 2JHAA 3S27A 3L8ZA 4BRZA 4ZANA 1NOJA 2XYRA 1NY6A 1XZQA 3C7CB 2CF6A 3QPCA 4FKZA 4NYIQ 5EIHA 2VUTA 3ZS9A 2H65A 5C53B 1U5CA 3IIEA 4RVFA 1TAUA 4IYRA 1J00A 5DN6A 5LBUA 4A8JA 1Y6FA 1EVIA 4QARA 2JVKA 2ZYHA 4GPTA 3FD8A 5FYQA 4JVLA 3QVWA 3BWYA 2WT9A 1D9ZA 2VUUA 2XEDA 1GOTA 3ESRA 3P9YA 4QJBA 4AQDA 1PTJA 3VSBA 3VKWA 2VAXA 4RTQA 3FTPA 3T52A 3JCZA 5B3KA 4UPDA 2WWXA 2J5BA 1VC2A 3GJ0A 4G2NA 4RAOA 3TEMA 3TOCA 4CUKA 3NH9A 3GUHA 3UAOA 3W9UA 4LY3A 2Q6TA 3P0EA 2A4MA 5HS6A 3ZCXA 3HDYA 2WJHA 1RYMA 3TCNA 2DJIA 2ONCA 2QTFA 1MTZA 3AEKA 1XAJA 3GT4A 5M34A 1W4RA 3QPBA 1FSFA 3FCCA 3T0IA 2IPOA 2VP0A 3P2IA 4TV8F 1OBHA 3G2MA 3V97A 5LMNB 3WRXA 1KL7A 4QFBA 2J09A 2GXAA 3M1LA 5L3VA 1N1EA 2FMXA 1KI9A 3B6EA 4AZVA 5G53C 2AKAB 4U2DA 3RABA 1BMFD 1S8AA 4AMGA 3KYBA 1YS2X 2GFHA 1JKFA 1FYFA 4LN1A 4Z4HA 3EA4A 5EUBA 1JQEA 2XWJI 3KPJA 4QUIA 1F2DA 3UW3A 4KDCA 1L1RA 2ZSDA 4NEGA 3CA8A 3VFDA 1F9EA 3LIIA 2UVPB 3BF7A 3CR8A 4OOFA 3KO8A 3WLKX 4KSYA 1BH6A 2BISA 5E4JA 3SX4A 5LYJF 3KYCB 2A0FA 3D4OA 4BFSA 3VJMA 2PKYX 1EFVA 2PWPA 3HUUA 2ZR7A 2ZYAA 3NGMA 3L6DA 4TRJA 3B1VA 3GRKA 4GPEA 1AQ6A 4PYRA 2ZLBA 1DC6A 1AK9A 3PC7A 1YCDA 3BD6A 2ZWOA 4UXIA 5HE8A 4DQUA 1EHCA 2GK7A 3NV7A 1CW2B 2Q4BA 3L79A 1V1MB 1XMJA 4RULA 2X5KO 1WQ3A 2YHUA 3D1VA 2E4AA 2UYOA 4GEKA 4B3BA 4R3NA 3V4PB 5A02A 4JL6A 4CETA 4L5AA 1GZUA 1J07A 3HBFA 5C2JB 3QKIA 4YRKA 2PV0A 1FUKA 2G82A 4C20A 2AZDA 4R41A 1XL1A 1JVSA 4TWBA 3R1IA 4GMFA 3QOWA 4IGIA 2XIQA 1PL7A 4EMSA 2P5UA 1WS6A 4IMPA 4UVHA 3WYBA 1NC3A 3DEKA 3ZHBA 3DMTA 5AVSA 5IN4A 5CNJA 5KYWB 2BFPA 1BJTA 4HTAA 4BFCA 3HA2A 2FAXA 1DKOA 1FP4A 5TS2A 1P74A 1SKQA 5LDDC 1V3UA 5DLPA 3GRVA 4DM7A 1WO8A 1ZAKA 3JAWB 5EJAA 3MCUA 2J3KA 2B2XA 1ZNQO 3RIYA 1GTVA 4G67A 4U6NA 1OXSC 4G5HA 1C7IA 1E2EA 1G6KA 1XZIA 2PZJA 2MSWA 2BSXA 3CZQA 1HG0A 1Y9JA 3FPJA 3HJUA 2Q46A 4LMRA 4XWYA 3LHFA 1QIGA 1W0CA 2F67A 1YJ5A 1DT5A 1E2KA 3E22A 4LPSA 4M1ZA 3E3NA 2BDTA 3ROTA 1UPBA 2YXEA 3HU1A 3I12A 4KI0A 3RYFB 1SWVA 2ASVA 1AQJA 1ZRSA 1J0XO 3S2YA 4D9HA 4KAJA 5B1DA 2YQ5A 3ER8A 4MW9A 3CLSC 5KJFA 2FG5A 4WD3A 5HR5A 4LGMA 1BCRA 1NNUA 3SJAA 4GI7A 1U4OA 4PCVA 4JLBA 4MS1B 4F3TA 2HN9A 3Q7TA 1H69A 2QUIA 1EFAA 2D1SA 4JQZA 1ZEJA 2CBZA 3M6WA 3ZWPA 1E3JA 4BRUA 1ZIXA 2CLKB 4HK4A 1KORA 2C20A 4G5FA 1BKSB 3EA5A 1PFQA 5EXDA 3O2SB 2GFQA 1VE7A 2O2SA 1I3MA 2WUEA 3LFHA 5AM0A 3FPCA 3AEQA 2V4ZA 2CHGA 3B3AA 3HR8A 1GRNA 2D1TA 4TKVB 5EERA 3WADA 3C24A 3VC2A 1G2OA 4PVDA 4EPVA 3CLUC 3K4HA 5SICE 1W25A 2ZBUA 3KOWA 4Q7MB 1ISPA 1UPAA 1AB6A 5CJ2A 1UBMS 5IARA 2Q2QA 2PZEA 1GTZA 2WFMA 3SJUA 3DQQA 2CMKA 4IUDS 4JI6B 3C6YA 3IV9A 2LGJA 1RAIA 4IXMA 5BN1A 5IYZA 1C7RA 1P80A 2QG9A 3DBRA 2ZFUA 1CZOA 3KZVA 4KQ9A 1G6OA 2C8VA 3FZYA 3OQIB 5TQJA 3G85A 5FLEX 2CV2A 3BEOA 2BGUA 2B1QA 3F71A 4LBZA 1AUPA 5LCXA 4YYZA 3KQUA 1GNTA 1KZ1A 4PPFA 4CQJA 3RVMA 4E2YA 2QLBA 2ZBVA 2FEMA 4KV7A 4X91A 3H5VA 4REQB 4YCLA 5C37A 4YXWD 1F5SA 4AKEA 2GVNA 3GJSA 5B1EA 2Q7DA 5FTWA 5KNCH 3WOVA 4Y6LA 4P7GA 2OG1A 1T0UA 2COKA 5TJ9A 2V0NA 1WM1A 2DLDA 4PS0A 3OIFA 4Y2XA 5DCUA 4CL8A 1LBEA 4L07A 4MKHA 3ICVA 4F5EA 4TKUB 4YAGA 3C8ZA 4RMJA 4OHCA 3V5NA 1BRTA 4RPCA 2FRXA 4ZAGA 1OFUA 3G3EA 4O2AA 5DF1A 5E6UB 4A73A 1PUXA 2W6OA 4LOKA 3DLIA 3QENA 1JEYA 3M3HA 3BMNB 3CGWA 1WMDA 2PTGA 1S2GA 4TXLA 3B1FA 3D6FA 1L3BA 2AW5A 1LVHA 1T6ZA 1AKVA 1N3IA 4S1OA 5JAUA 1MV5A 1G5RA 1W35A 2IBTA 3MUFA 5DNUA 1J21A 2BI4A 2W48A 1UC8A 4CIDA 1R6TA 3GC6A 1TDJA 1X1CA 2G67A 4L3WA 3THWA 4NIMA 3ZCSA 2ZTLA 1KNQA 3LYLA 4ENSA 4NULA 2BFCB 2IYFA 2J3DA 3K1AA 3DBHA 1JFFB 3L7IA 4A6DA 4UTZA 3GLUA 4RZHA 2V55B 1NG1A 2RHRA 1J2RA 3NIFB 4OQEA 3IQEA 3LHSA 1VL2A 4HFNA 4OQNA 1UMCB 2CWDA 3I04M 1QORA 1CVRA 2JGDA 3DVQX 4I1VA 4F6LA 1L5VA 2PYDA 3EFOB 4HDSA 4MRVA 1YQXA 4WKBA 4BMZA 1FDSA 3E5RA 3HXKA 4GXQA 2PEZA 1TUBB 4QULA 4XCQA 3LDAA 3X2SA 3EZLA 1BXZA 4AWAA 5GIPE 4DJAA 2W8BB 1D2CA 3A6HA 4PR0A 4C7VA 3AUJB 3IP5A 4EUFA 5A4JA 1P2GA 4DB2A 4E5DA 1E2HA 2VJOA 1M7HA 3GP8A 4P98A 3H2KA 1CUJA 3KV3O 1F1JA 3Q7IA 2ZSKA 1U0TA 3R6GA 5GY7A 1WB6A 1RJ9A 1JZTA 5B2EA 3A4VA 2RGYA 3UAVA 1PQ4A 3E2PA 5SYAA 2IZ7A 5FFMA 1PT5A 2W6PA 2OD7A 3AEYA 1WB9A 1QLWA 4Q3AA 4A3SA 2PL5A 1Y1KE 1VBNA 3H1TA 4JVNA 3TW0A 5G41A 4ARAA 2WBLC 1E9BA 3DOCA 1R4ZA 2FSHA 1JR6A 2DHDA 1BDBA 2BGMA 4CZ2A 5E4FA 1Z6PA 5IYZF 1GPAA 4CNBA 1G7CA 5B57C 1N6KA 4LQ4A 3FNHA 4K9DA 4PCLA 1GUZA 4TTJA 2DPYA 3HJCA 3N0XA 2B4KA 3ORSA 5HJ2A 2F3UA 1MT0A 2HIGA 4CN9A 2TRSB 1RQLA 1LEHA 2ZETA 2XDQB 4F93B 4J90A 1GYQA 3QWBA 4OI2A 1STOA 1Q0LA 3RFCA 5BMOA 3OQPA 4PIMA 2UUAB 3UB3A 3KKLA 3MCAA 1LQ2A 1K5HA 5J2UB 3Q0TA 4CF3A 3P9IA 4OY3A 4JJ6A 3UUWA 2YFYA 3KYJB 3PEEA 1VJTA 4LE0A 2VJQA 2WWTA 2O20A 2QXYA 3RQSA 4M9UA 4TTRA 3URMA 2GNAA 3AUKA 5DK6A 4Z1OA 1QZTA 2I7CA 3HSYA 2QL7A 3ENVA 4PXSA 3VGPA 4K9QA 4DJFC 4EFKA 3FUVA 1UXJA 2BFAA 2D8MA 1UMDB 3LP8A 1N5DA 4H7PA 4JLNA 4N5LA 2F43B 4C4PA 1DP4A 1SUCA 1X0XA 2C58A 1U63A 3LBAA 2GHQA 3K1TA 1S2DA 1O4WA 1QPGA 4TKLA 2QSYA 1SHZA 3H2SA 1T9AA 4L9RA 4A26A 2QU8A 4G0OA 1YZKA 1A0OA 4DCMA 2W11A 3GMTA 4M1WA 5KNBD 5F12A 3RHZA 1EA5A 1YACA 3UT6A 1FY2A 1TIKA 4LXXA 5K09A 2IYAA 3MTDA 4ASUD 3EZYA 2OUKA 4AZTA 3ESYA 4R2KA 5JBNA 5LLSA 3MG9A 3GPCA 4DR2B 4PZYA 2HLDD 2UYGA 2YFKA 1HLPA 3C8UA 3RUDA 1HETA 4N1AA 4F12A 5EJ6A 3WYDA 1NVVQ 1S02A 1VRVA 5AJYA 2R6CA 4DNOA 4Y2PA 1KY5A 3QPWA 4PSVA 1TQ4A 4W5OA 3JAKA 2C7VA 4REOA 1N5IA 4Y2UA 3V3TA 1Y1QA 1E6MA 2H4YA 3PIIA 1I1NA 2PZAA 2R8EA 2LDBA 1Z83A 2W6NA 2ZUVA 1J09A 4BVLA 1F3LA 3H1PA 2C99A 2I3DA 4RSHA 1E0SA 2HK7A 3OKPA 5FNVA 3WR5A 4CCWA 4LC9A 1NVMB 4Y2VA 2D5BA 1J0AA 4FN5A 1U3UA 3EFOA 3PWKA 4XCVA 1SXJD 1EXWA 1Z4IA 3THYA 5EN4A 1M73E 1VJRA 4FYVA 1FUUA 2O8DA 3UFBA 2K7FA 1P7ZA 4A16A 1NQUA 4HGRA 2VTDA 4Q39A 1VLMA 2G04A 4HV4A 2V6MA 4MI1A 1P44A 5JMTA 1SD5A 3HM2A 1N2CB 1YNOA 2NZVG 4J3FA 1A2BA 2H1CA 2XGSA 2IXGA 1WXIA 4GXNA 4D3XA 3PJRA 1Z6TA 4BJ5A 4MS1A 3ZCPA 1FFWA 2ZBFA 3WLJA 3KOOA 2PA3A 1MW9X 4TOIA 3UMFA 1JR2A 1SBYA 2WHQA 1NUUA 1YJAA 1ZUIA 5DBHX 1OH5A 5IXYA 4GR5A 2G08A 2ABWA 4FXPA 3TLCA 2P4UA 1U0GA 3AR5A 4MKRA 3UKDA 4AZ0A 1L7EA 4MW0A 2Y71A 3F2IA 3EULA 4HTFB 4OIMA 4OQQA 4FT4A 5ENVA 4QM6A 1L7VC 5JCZA 1SKMA 3GLTA 1NLFA 3A7DA 4UNPA 1NKVA 1Z7GA 1SQGA 2JAOA 4HGZA 2Z2ZA 3L8YA 2R8PA 1VIYA 4GP6A 2L42A 3VTKA 4FK8A 5CFMA 1DEKA 3D02A 3R7WA 3NMUF 4ABTA 1QYWA 4I6EA 4C0XA 3K6KA 4QG3A 2Z5VA 2ZDGA 3Q9UA 2EZ9A 5ICSA 5IFKA 1OHHD 1E8MA 3TQOA 4PIPA 3HJGA 3JD0A 3WMEA 1KRHA 3ZGZA 1NRXA 1RE1A 1PWXA 2BCGY 1KXZA 4RD3A 4JC5A 2VTBA 2PZKA 2VPIA 4ND1A 1K08A 3ZE0B 2W42A 1I51A 2WNSA 3CE6A 4G5GA 4K9SA 4O4IF 4OU4A 3IA7A 3CWCA 1O54A 4HDAA 4NBNA 2CD7A 4WN3A 4UHCA 1CS4C 1KI4A 4RSMA 3S40A 4F4JA 2D1FA 1D2RA 1D7AA 5TQ0A 5MF6A 3SIRA 4D92A 3L82B 4M46A 1Z6YA 5BR4A 2XUPA 1ACMA 4U2BA 3ZU3A 2J9YB 1M10A 4L7QA 1E58A 3CRMA 3TQQA 3ZWNA 3UFXB 1IJFA 4ZJPA 3MWDA 4P0QB 1G4HA 1M6NA 1HNZB 3ZXYA 1T5HX 3ME5A 3U3XA 4EA7A 5PGMA 3JQ9A 1M2NA 4YP5A 2XUGA 4WXYB 4DLAA 3PC3A 3DLAA 1F8UA 3FPKA 2ZRHA 1YHNA 4OYRA 5EWLA 3OQJA 2FN7A 1U2GA 4BNKA 4GOXA 2H17A 1ZJZA 3D6MA 4G85A 4Z4IA 4Z8XA 4CIXA 4ZYLA 4B85A 1H4TA 3IAEA 4ZAYA 8OHMA 3U1BA 1T91A 3SMQA 4ZI2A 4ZVLA 4AD8A 3PD7A 1PJ4A 4BYGA 5I4CA 1Q0PA 1U0JA 3U44B 3U4QA 3GPDG 4R9VA 2JANA 3TR0A 4L73A 1UDCA 3RT1A 1MPXA 1N2SA 5KJCA 1FVOA 1D0SA 2EKDA 4LXHA 1CJSA 3IQWA 4F4CA 2CLDX 4RL6A 1H2RS 4RJJA 3H4IA 3SQMA 2PJRA 4JDPA 2BVNA 1QIKA 3GJYA 3DEIA 3K16A 5IT0A 5IM4A 4QLAA 5C31A 5AI9A 3U7QB 1Z5GA 3DKIA 1H0HA 3FGPA 4BIIA 4BQQA 3MGCA 1UP4A 4LSWA 3MMSA 4U2KA 2X9VA 3TQRA 1USKA 2PS3A 3QLTA 4KWIA 4PLCA 1GKYA 4KYTA 5CVTA 1OFHA 4R71A 3VU0A 3A9CA 3K96A 3WDSA 2CVHA 4N76A 1MVOA 5JQGF 1JEAA 1E2FA 1U81A 4G84A 3IT2A 1A8SA 4I7EA 4RZ3A 4TYQA 3PZRA 1L5HA 1DO0A 4ALMA 4BFXA 1H1LA 4W4TA 2UU9B 2ZBRA 2AQKA 5H9WA 1A9QA 2GZAA 2OCXA 2EIXA 3O84A 3ZDDA 2FE4A 5DN6D 2PJUA 1AUOA 3LLUA 4Q4HA 2VDQB 3DDOA 2PH7A 4P4UA 2QNIA 3ISTA 1DWPA 1BCSA 1SUAA 1C1XA 1XF9A 4YRGA 1MB4A 2XCTB 1WU7A 2CVFA 2Q1XA 5JY1A 3WL4A 2I66A 2CKMA 2H8KA 4BQSA 4A8PA 3R6DA 2Z2KA 3EG9B 3CB2A 1IUNA 121PA 3WQSB 3UENA 5CVDA 3V1KA 4BIMA 3DMTC 4HRXA 4KR9A 4INJA 1L8OA 3LC0A 4TX1A 4P0PB 2IEAA 4W5TA 2Y9PB 3JQEA 4FD3A 3OFND 3LYHA 4LC0A 4NLLA 4RVDA 3PJDA 5BT8A 5KX5A 2B5WA 2WTNA 3WHLA 2PVSA 4M21A 4PRKA 4FNGA 3EAFA 3TPZA 1R6UA 1IXSB 2HPZA 3RVBA 1FFBA 3DVRX 1X1TA 1FFYA 3P32A 1CT9A 5A2GA 4G0WA 3CF6R 1KARA 1HZZA 4QU9A 3ZI4A 4CV0A 5KU7A 2WOOA 1L4LA 3JWPA 5L40A 1BS1A 3DCYA 5MHTA 2XECA 4Q3NA 1R4AA 2ZIEA 2E55A 3ZH2A 5BQOA 4AWXA 5LDHA 1XBTA 2WAOA 3DOOA 4MZXA 4C03A 5D85A 1B41A 1PJCA 3PHIA 2ERCA 2FPRA 3L84A 4RKRA 3RRZA 5JANA 1QYCA 3IURA 4YIHA 3DMNA 4A0SA 3LZDA 2WWIA 4DLPA 2QM0A 3K92A 1Y3IA 2VWHA 3FZGA 4OBBA 1R18A 3CMCO 1J5PA 1TQ6A 1K98A 5DEIA 3HNPA 2EDAA 5AJXA 3QPVA 4KBFA 3F5MA 4AJNA 3W9YA 1US8A 1Z5PA 3NFRA 5ALRA 1KI1A 3O4IA 1R6VA 1OPXA 1TCUA 4TVSA 1TF7A 4J76A 3WSVA 3FHCB 2C97A 5DX1A 4GL4A 1WMEA 1M1YB 3HRHA 1QGAA 4N0MA 4BRSA 2OB2A 2XMQA 4NOLA 2C94A 1C3EA 2CL0X 4PEVA 4C08A 5K0FA 5K3EA 2VIIA 3A10A 4MQ5A 2GEBA 4X44A 2JEZA 3P71T 4B47A 1KU6A 4XUGB 4CR6A 3RD5A 4R7TA 1M2EA 4GSLA 4CU5A 3L6CA 4BYMA 4ZKDA 2Q9UA 1KWGA 1XKXA 4IDBA 3ICOA 3QV2A 4IIXA 3M4YA 4J6FA 1ISIA 2JCSA 3BRCA 1UP7A 3TAUA 4AY2A 1H1TA 2YWDA 3C5VA 1Z36A 2GJSA 1UXHA 3GG2A 2ORVA 3NTRA 3RREA 1JDVA 1UBFA 4KWHA 5KVCA 3BMNA 3D4NA 2XGJA 2VP6A 1YOVA 4UU7A 4EPTA 4PO3X 1YASA 4ZDKA 3H97A 1E18A 4DXAA 2IKSA 1F0PA 3DR5A 3MOIA 4EB6A 1XEWX 3RS8A 3U7EB 5HUHA 1KNXA 4E2ZA 1VP3A 1Y63A 2HU8A 2IIBA 3BDVA 3DVSX 1QKKA 3EY9A 3MBIA 4UUOA 5DVZA 5FKJA 1DEOA 2V7QA 2RGUA 1JF8A 4HAUA 2ZTMA 4MB0A 4Q4AA 3ACDA 3DMDA 5LZ9A 2VBFA 1AC5A 1QONA 2RONA 1ZZEA 1GJRA 2HRQA 4JMPA 4Z4FA 2PZLA 1FUYB 1JRLA 4M9ZA 1W5FA 1SHTX 4ZT7A 4LXGA 1PO7A 3WYGA 1TKCA 4RTRA 3GJXC 1V39A 1T9GR 2C84A 2B5OA 4BAGA 1N5LA 1IZ9A 4GLOA 3RRYA 4BO1A 1VE1A 4GSKA 3DQPA 1OYYA 4IQGA 1F17A 3ACCA 4FFBB 5E9JA 3RAJA 2P2ZA 1CUCA 3IALA 3T7SA 3ABQB 4OLAA 1P4SA 2VLBA 3OCJA 2QPLA 1K4MA 1Q1QA 4L2IB 1Y6ZA 1OW3B 3Q41A 3PT9A 2RHJA 3DFIA 4ZZ3A 1RMTA 4IVNA 4CLEA 3DHWC 4BVGA 2JIBA 4AO7A 4FYIA 5JDCA 1WSWA 1NV9A 1Y4ZA 1KMQA 4ITUA 4C5CA 3DDWA 4U3JA 3K70D 4WIAA 1DQZA 1V26A 4WNAB 3WIEA 5FWDA 4F4UA 1CF2O 1KK0A 3I3SR 4OJTA 2JLZA 1V11A 4MO9A 4A0FA 3AEQB 3M5WA 2GRJA 1SULA 3TG2A 2FPGB 3NOQA 1B8VA 5EG5A 3WSWA 1MX5A 2XE6A 3BCRA 2VBCA 3CU5A 3AUXA 2QQ5A 3OP4A 3Q4GA 4OQ4A 4QPDA 3I8XA 1OROA 4DIUA 1MQ9A 3SYTA 3GLIB 3OEHD 2YHIB 3E9ZA 4FM9A 1WW8A 2QUAA 4WTOA 3DHNA 4IG9A 1CUSA 5AICA 1BH2A 1U1CA 1W4BA 1Z6AA 1ULSA 4QHSA 1V2HE 2C04A 3O4GA 4FFLA 5E1MA 4F1WA 5IDXA 1KKUA 3KXKA 5CIQA 1ORRA 1SC6A 1HWYA 1PBTA 2ZATA 3KQQA 4KXXA 4DS3A 3WBKA 3AEZA 3CINA 1AO3A 4HVAA 2YIVX 1E0KA 1ZGJA 5EMHA 4H9GA 3GT0A 5HA5A 1NZDA 3PUKA 3V4FA 4HY3A 3EZNA 4F7WA 1BXRA 3ET4A 3ADBA 1SCNE 1VPLA 4NFLA 1GDTA 2H0RA 2EKZA 3WIDA 2BJHA 2JAHA 2VJLA 1JHAA 1ILEA 1JAZA 4B7AA 2G5GX 2ZPAA 5AUOB 3IV6A 4B34A 1F0NA 1I13A 4M87A 1N6LA 2CDCA 2OBXA 3C16C 4P3XA 6ABPA 1GGNA 1AQLA 3EOBI 3PFBA 2RE8A 2C4NA 1R88A 3M83A 3MTGA 1RAHA 1XCJA 4HEJA 4E1BA 5IZCC 3AHHA 1XZPA 4R5HA 3I01M 1N1MA 4GMXA 3L4EA 1HA3A 2QYOA 4I46A 4KB5A 3SZGA 4HLNA 3BSYA 4AP6A 5AKJA 3LUAA 4FFRA 3QEBZ 2EG9A 2HC9A 4CTKA 1X7ZB 1YZNA 1QP0A 3VAAA 2R1TB 3UHPA 3WLIA 2OSVA 1FRNA 4HNHA 4QJIA 2RD2A 4ARUA 1IJBA 2Q50A 3D3QA 1HO3A 3AO0B 3E6AA 4FYWA 4GZLA 4S0XA 3TIXB 3CFYA 4RVHA 2IX3A 4JXZA 4FZ3A 1ZD8A 3CLKA 5LB2A 4E15A 2Z4SA 2I2BA 4K6MA 1WUKS 3R3VA 2C5BA 6ADHA 3THOA 4B81A 5J23A 2X0RA 3LPNA 3RWOA 5JEDA 3THXB 3D4PA 3QY0A 4ITRC 3WIOA 3IQXA 2YYZA 3SEZA 2Y68A 3EXEB 4LGVA 2PSSA 3GB9A 4S2UA 4BJ3A 1USGA 3ES9A 3L6BA 5DPMA 4O4JA 2ZRKA 4RVNA 3TXXA 4GRIA 4J16A 2HTFA 4AQYB 3GMDA 2XE4A 5D1HA 1Y4SA 2RB4A 3HU5A 2M6LA 1UXIA 5B1YA 1PZMA 5LQDA 5AUPB 3U7JA 1IULA 4O4JF 421PA 2IEGA 4M8IA 4DNXA 2I6GA 1VBFA 3UH1A 3FM9A 2ISCA 4HB2A 1F51E 3ROPA 3TQFA 2WDZA 2X3UA 3QLUA 2VSYA 4DV1B 4RF3A 1FP7A 3Q3EA 2QS9A 1CE8A 2EGHA 5AVYA 3E05A 3KSRA 5LQSA 3TSWA 3TNDA 3KZ1E 1GTG1 2ZYGA 5JPDA 2RHDA 4L6AA 4WXHA 1MF7A 4BX3A 4WECA 1XWIA 3LZ6A 1HOXA 3RWMB 4A36A 3G1UA 1SCIA 2C2MA 4EI7A 2XUHA 1NR5A 3MTQA 3UTDA 3HL0A 1T2FA 2WE8A 4ED9A 1E79D 1JMKC 2F8TA 6YASA 2MJLA 4RS4A 3RF6A 3INGA 1PIWA 2PUGA 3ZHQA 1MQAA 4RPLA 3TW8B 4WZAE 4BKMA 3W5HA 1RXVA 1CUWA 1PWYE 5K3CA 4B1FA 1QIIA 5IHPA 3DOFA 1DVRA 3IHLA 3WDKA 1Y3HA 4C14A 5AESA 5HKOA 1P0IA 4PE5B 3JV7A 3Q7EA 2PIAA 2FFJA 1DKPA 4MMXB 4DPMA 1D9XA 1IL0A 1SXJE 1U5BB 2EF0A 1LLFA 4GNRA 1K2VN 4E14A 4EKNB 4ARSA 5FTJA 3VISA 5JC8A 3UQZA 4NE9A 2GPTA 5G3YA 2J3QA 3MRTA 4BBJA 1NU8A 3V3KA 4ODIA 4B6FA 1K6XA 1KETA 1RI5A 2ZIZA 5ERYA 1DOAA 3FBTA 1XNHA 1V7CA 5CCXA 4N3CA 2II6A 3AR2A 4DG5A 2ZBDA 1WB4A 4TUYF 2H06A 1ZXLA 3CUWA 4MGEA 4PSDA 5H8WA 2J33A 1RQXA 1V1MA 1Z68A 2X4GA 2WIJA 5B7GA 1YB1A 4GICA 4R1UA 5CHEA 5DRYA 2FW0A 2ZRIA 3AM4A 4UTPA 1E0DA 1EE1A 5AVTA 1GCIA 4CMBA 1T0HB 2DUNA 2ZZKA 3B53X 2NTNA 1TM2A 4RK0A 5THQA 4DA6A 1B8UA 2HYDA 4INZA 5AVXA 4P7BA 1Z7WA 2KMLA 1D3AA 3FPGA 4LTMA 1ZJWA 3DHEA 4JA0A 4W7IA 5JSZB 1KIAA 3PWTA 4NG4A 4ZOBA 5EEGA 2CHVA 1Q7TA 4QUHA 4YAWA 3GLGA 1D2GA 3HPQA 2IIVA 4JJAA 1JJFA 2HV8A 3KWJA 2XQFA 1VLJA 4FMDF 3EIOA 5JAIA 5FI1B 3QU7A 3N1UA 3TTVA 1KGDA 2AN1A 4HNTA 2GK6A 4V02A 2EV9A 1B0UA 2E4VA 3ZK7A 1PU2A 4MPJA 4X97A 3OOWA 1W44A 4K9MA 6AT1A 2Q28A 4Z7OB 2A30A 2C07A 3W1EA 5A4KA 2GSDA 2PSHA 2V98A 3DD5A 2ZEJA 1SMKA 1L9KA 2HM7A 3V8VA 3TI7A 2JK0A 2DFDA 2ZSAA 3NAZA 4MAMA 1V16B 2QTVA 1G6HA 2VLIA 3CEPB 2HD4A 4R1TA 1IRIA 1E89A 3N6XA 3HVKA 1XD2A 4F91B 2R3SA 1V5GA 2ZQZA 2ZYIA 4JI0B 3A26A 1GZVA 5L7TA 2CVZA 4A4DA 2X1VA 3I9V6 1OB5A 1BE1A 1DIRA 3NWBA 2O2HA 4LF8B 1FP1D 3CHYA 3TM4A 3W4JA 3HG7A 3BBLA 2C2WA 4YMIA 1JS1X 2P4EA 5HZMA 5FRDA 1T8TA 5JZVA 2H31A 4BX2A 1SM4A 1EA7A 4ALIA 1OI7A 5JSZA 2FZVA 3EGOA 1XZCA 4PFKA 1H05A 1JBEA 3MS4A 3LK6A 3PE3A 4HF7A 4C01A 1ZHOA 1BMQA 4K5QA 5CA0B 4NONA 1N2CA 2WHEA 3L6RA 3QUSA 4B6QA 2JFVA 2VATA 1ZRMA 3D6TB 6REQA 4IM7A 3NDJA 4L72A 3CNBA 2DFPA 2JLBA 2QVXX 3QWFA 1WULS 3I52A 1NVVR 3OBIA 3QFRA 4YJHB 1DV2A 1XCOA 2OBLA 4WSOA 1H22A 3S44A 3S99A 1K3FA 3B2EA 4ENRA 4QFMA 2HU5A 1SC9A 4AIIA 3E4DA 2JGNA 2NVUA 5EIFA 3VDXA 1X70A 3RLFA 1LPAB 1TYBE 1YUNA 2H7CA 4UBOA 1KE1A 5I48A 2H5JA 3N9IA 3KKPA 2QTCA 3DA8A 2WJAA 1LPSA 1C7FA 2WKRA 5DIZA 5KHLB 5KYUB 1RMQA 2VDWA 4OAPA 4X1KA 5CAEB 1T0JB 5LD2C 2W43A 2VEDA 3OLZA 5A5DA 1HE5A 2GK3A 1ENOA 1CQJB 1T0IA 1VYHA 2I2XB 3WL7A 1RW4A 3CKLA 4CTMA 5CA1B 1MKYA 4TWRA 2VZ0A 2YIJA 1QR2A 1PQYA 4ZT2A 5LU9A 2X4IA 3DG9A 2CHQA 2JBWA 4ARZA 4GYWA 4EUHA 2DC1A 2QXUA 4Y0AA 4EEZA 1QIDA 2MSKA 2OM2A 2W2LD 4HKTA 5T4HA 3FOEC 4DQKA 1ZD5A 1JIVA 1GL9B 2EBUA 4J0FA 4B75A 4PPQA 1T35A 5DWQA 4G5OA 4MUGA 5HYVA 5KAMA 3GY0A 3TRIA 1GTSA 3L4BC 1P9OA 4D9MA 1DRWA 4L3VA 2HIHA 3F8WA 4NEQA 4P5DA 3DEFA 2NACA 4WGFA 2RHOA 2XVZA 1M1YE 1RC0A 1XCGB 4NV3A 1NJ2A 2J6BA 2BFFA 2MHCA 3IPYA 4ONEA 5AW3A 3EIQA 1B00A 1XWWA 1ZGZA 3PCXA 3FSRA 4HH4A 4C6TA 1KA9H 1XPJA 2HCRA 2ACKA 4O25A 4P08A 1CR6A 1UBLS 4WKCA 5HIJA 2G25A 3O21A 1NY5A 2BIFA 1F8YA 2G06A 3PJEA 5KKAA 5CYGA 1RT9A 3TMYA 4B2IA 3RYIA 3OQMA 1EUDA 2QW1A 1HDIA 4HHEA 4TN5A 3RFTA 4P32A 3T3MB 3N2KB 3B20A 4Q7QA 3ZD8A 3V4ZA 3IKTA 3DSRA 3OESA 4KHZA 5HMLA 1F4VA 3EHEA 3L01A 1OAOC 2YZ2A 3LF2A 2C0PA 2W2KA 4L3OA 4PU0A 1U0OC 3MJTA 3OZFA 2D3WA 1DIGA 2H2GA 3PXEA 4B3HA 5I01A 2CXOA 1ZLYA 4YCAA 2ZRBA 1X77A 1OKKD 3L7AA 3O2NA 3WMRA 4LX8A 3NWOA 2TMYA 2X14A 1ZR4A 3PV0A 2I6TA 1DPFA 2FYTA 1Y9EA 3E03A 1OBVA 3H3FA 4LXTA 2W4IA 3PYLA 5ALMA 4C1BA 4Q3LA 2FCAA 1B3RA 1AKWA 4BQIA 3WBFA 3QX7A 4KWEA 4KQ2A 1IHPA 2JJ2D 4U7JA 1W1IA 5C1PA 5HK9A 2Y1EA 3DFFA 4UJ3A 2SHKA 5CT4A 5JFGA 3FWNA 1AGPA 3UK1A 3RARA 1AA6A 2Q5QA 3P2KA 3ZJVA 3FRIA 3ROZA 1Q0HA 3M5DA 3R5XA 1ILWA 4FGWA 2J4FA 5B6IA 4ND4A 4ZVUA 3F73A 3UO8B 4B0PA 1XMOB 2Q3HA 2IZOA 1E62A 1JPJA 4XLLA 1R4NA 1WDKA 3MERA 5EZQA 1XNGA 4LYGA 3QE3A 4KO4S 4TLDA 2RAFA 4YQFA 1UWKA 2AN5A 4OFZA 1JU4A 5KVAA 1KJ8A 5DBOA 3V33A 3ILXA 2AMLA 4DUGA 2JFFA 2NYAA 1OIXA 1XRNA 5HSGA 2DPMA 3BH7A 3AI1A 3MCZA 5C1OA 1JILA 2IUYA 4G81A 1AKUA 3WGLA 4IF6A 3NGLA 3H8VA 4J0JA 2Z57A 1UBEA 1HFWA 3MWLA 4I9FA 4OL0A 2GEJA 4YRCA 3FYUA 1YXMA 3M6VA 2ORED 4O5OA 3KM0A 1DKNA 2QXTA 3OECA 4CM4B 1CR4A 4ICIA 4UD6A 3IIKA 3IMEA 2F3RA 3OE1A 2W6MA 3OSZA 4UNQA 5FIUA 1LV7A 4RLHA 1YMUA 1WOYA 3VNUA 2CJYA 3VZQA 1BEEA 1OU0A 3RANA 3U5ZB 3RGWS 3I61A 1SOWA 2IC5A 1U7WA 2AMVA 1ARZA 4HH0A 4WNAA 3FY4A 1JKJA 1PV4A 5JAHA 1ODCA 4ZOCA 5DTRA 3EQ2A 1EWVA 3IBFA 4BFYA 2OKCA 2J4CA 4UASA 1ABEA 4WN9A 5ALFA 5B5SA 1D09A 1E32A 1XLUA 3LCVB 4B6GA 3R40A 1QXSA 3WA6A 3A2MA 4JODA 2IRWA 4R16A 4YONB 4B73A 2V6BA 3ESZA 3HFJA 3UA4A 5FUWA 4AG3A 5LU8A 2RH5A 1JDNA 3GAZA 3DE3X 1HQDA 2CNWA 2R79A 3CNEA 1EGVB 4XA8A 3WHIA 4EPXA 5JRZA