2VJKA

Formyl-coa transferase with aspartyl-coa thioester intermediate derived from oxalyl-coa
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGDSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMYL-COENZYME A TRANSFERASE
publication title Reinvestigation of the Catalytic Mechanism of Formyl-Coa Transferase, a Class III Coa-Transferase.
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
total genus 141
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 2vjkA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 2vjkA01
2VJPA 1PQYA 3UBMA 2VJMB 2VJLA 4HL6A 1Q6YA 2GCEA 1PT7A 2G04A 1X74A 1XA4A 1Q7EA 1T4CA 1VGRA 2VJOA 4ED9A 1T4CB 2GD0A 1XK6A 1XVUA 1VGQA 2VJNA 1P5HA 2YIMA 1T3ZA 2GD6A 1XVVA 1PT8A 2VJMA 2GD2A 1XVTA 1XA3A 1XK7A 2GCIA 2VJQA 2VJKA 1PT5A 1P5RA
chains in the Genus database with same CATH superfamily
3UH0A 1PS8A 4J49A 3CKLA 1BWPA 4OUDA 3S44A 1W581 3UMMA 1S9HA 3F73A 2PMBA 4X60A 1HPLA 3RJ9A 1GV0A 3DAFA 4Y1RB 1JI3A 1D9XA 2ZRHA 4G85A 4M6WA 2J4DA 3G17A 1ORDA 3Q7TA 2JL1A 2Q6VA 2QN1A 4IV8A 4FW9A 1AKVA 2TMYA 3EGDB 3RUAA 4E03A 1HDCA 2OM6A 2RHGB 3LT2A 4ABYA 3JQ7B 1CV2A 1C7EA 1FYVA 1SKYB 3OQPA 3P9QA 4QUJA 2IKSA 4EY5A 2ZUTA 1KFEB 1QR2A 4YT8A 5KYYB 1HNXB 4Q3AA 4JUFA 3K9GA 5GIPE 1D2AA 3EIWA 1UOQA 2CLSA 1CE8A 1U3GA 1N0VC 4TWAA 4PW0A 2YRXA 3GZNB 3QLVC 3G0DA 3QITA 1LBIA 4AXBA 1Y3DE 4EATA 4PLPA 4Q3OA 1JEOA 1F4VA 2LV8A 3PUIA 5EINA 4TKVA 2JJ2D 4R1TA 4DYDA 2ZVDA 5FBWB 1IN6A 2J5QA 2O2DA 2BV3A 2R751 2GLUA 2R8ZA 4RHXA 2P3OA 5G1PA 1UK6A 1ECPA 2C9DA 3JYHA 3TB6A 4KRYA 2PS3A 2AX4A 1L5ZA 1JH9A 3L1JA 4K05A 1K9SA 1EP1B 2WF6A 3IUEA 4QU5A 2I65A 1QS0A 1Z4MA 2G07A 3G0OA 2FFQA 4EAAA 2C42A 1HLPA 2CXPA 2G67A 2HA7A 3IP8A 3NIBA 2VRBA 3I2YX 3NM6B 1RHUA 3IERA 3WNBA 2BGIA 3ODGA 1RNLA 3ZD7A 4PRLA 1Z56C 1C9JA 2PGNA 1GCUA 2O2ZA 3IMKA 3R1IA 4GHWA 2H06A 4N6OA 4Y1RA 1Z15A 16PKA 1GZDA 2IIBA 2ZJ1A 4TRNA 3B9QA 1HFEL 1ECGA 2IVFA 1GRRA 3EGDA 2F64A 1Y7HA 4AJ9A 1X74A 4AMUA 3IVRA 2B25A 3FUWA 3HO8A 3JQ7A 2EAUA 2G5GX 1I7DA 2BRUC 4O02B 1QOPB 1OXUA 1FLAA 3GLFB 4CGZA 1JLLB 3OETA 1USUA 2BH9A 3W1EA 3OD1A 5JZMA 2ZREA 3SZUA 1X94A 2QD5A 3GZNA 3IR6A 2Q7OE 2J0UB 2WWGA 5NULA 1GO2A 1E62A 1NP7A 3FNIA 2CB0A 3O0DA 4NK4A 3EYWA 4KKXB 5E7IA 1DBIA 3OLQA 1J99A 5COQA 1E5XA 1RWXA 1NZDA 2ERXA 3HCNA 4PHGA 1JVNA 2AHOA 2ZQ5A 4FHDA 4K6HA 5G0SA 4DFDA 1YF3A 2PV7A 1XYGA 1DX9A 1UBTS 4GXRA 1RKQA 3PFWO 4B3RB 4NAVA 2J31A 3QXGA 5KSOA 2ERYA 4J4HA 4RPLA 4TT3A 5DTQA 3U7JA 3RNLA 3SC6A 3TQCA 3PWTA 1CEEA 3Q41A 1RR6A 1JSZA 1CVRA 4XYLA 1U9JA 2P69A 2Z5VA 3E22B 2ZKLA 4MLZA 3TBKA 1Z4QA 1XB2A 1U0JA 3CHYA 1ZC4A 1W85B 4KUEA 5THQA 3ZY5A 4QKQA 3AMVA 4UBMA 4ZJZA 5JI2E 1MG0A 2JHFA 2W6ZA 3SZMA 2WU8A 2E5LB 1TVEA 3LUHA 1JEDA 2NZ2A 1C0IA 4DM4A 2WJWA 3QVLA 3ZXSA 2EX4A 4DN6A 1HURA 3TSOA 1XK7A 1MVOA 3OKCA 2AQHA 4M7OA 4PG7A 4R16A 1GFZA 1Y3FE 5HIAA 2Q4TA 5HCUA 1C9KA 3UXHA 3OX1A 1YQ9A 1VLMA 1WKVA 3T3PB 1WW3A 2AJBA 1JLLA 3TD6A 2RD2A 3UPUA 1C1YA 1IN4A 1U1CA 4S35A 4WK2B 2F8SA 3RIGA 4KEAA 5BQ5A 4R3WA 1HQCA 1P4HA 3GVIA 4AKIA 2YW9A 1O6BA 1G21E 4ZEVA 3OIGA 4IIFA 5CT6A 5HVNA 2FFBA 1YKFA 4J91A 4CIBA 2ZZMA 2QZSA 1G4HA 3H2SA 1TYDE 1IEXA 3A1FA 3C3WA 3OQMA 1EFAA 4NEQA 5LBUA 4GLBA 4IRUB 5TPZD 1SB9A 3SYMA 2C5FA 1VB3A 2NYRA 2OFXA 2ZYAA 3OO0A 4KPUB 2PX0A 2OHGA 4A15A 3IV7A 1KMCA 1V41E 1E69A 3WFZA 4AWXA 2HMUA 4J0GA 4ZRNA 4NZOA 4DJDC 6PFKA 1BVYF 1N2CB 1SRRA 4FDVA 1U04A 3CC8A 3EQ9A 4FFLA 1XTTA 4V24A 5DYYA 5EQFA 5I4KA 3E22A 4UBKA 4RMHA 3Q3EA 4ARBA 1TRKA 2QP4A 3H5AA 2NUAA 3AV0B 3TTTA 4TGLA 2G5PA 4A0GA 4B3DA 1W85A 1U8EA 1V8PA 3EZFA 1K4MA 4R8SA 1NF2A 2FUG6 1AZLA 2BE9A 2QY6A 3PBKA 4FJ0A 4J1NA 3R76A 4UZSA 4F91B 1FDOA 2IH4A 1HQDA 1FDUA 2WYWA 3K0FA 1G9XA 3IQDB 1LSUA 3LDHA 4A2QA 4D4HA 3AEYA 1HOTA 2RG1A 4G0UA 4TZ0A 3QPBA 5KWIA 1MVNA 2WJ4A 2JRLA 2JIZD 1GFWA 1G21A 2EGUA 5GV7A 2BAGA 2GD2A 3JQFA 1EA7A 2I2DA 3LZCA 3QJGA 2V6MA 4D45A 5KYNA 2Q6LA 1ZXLA 2Y1KA 4JEMA 4YAKA 3T3EA 1KMHA 1XAIA 3WGTA 4WKCA 1DBRA 1S3SA 4FMDB 4TXMA 3TIIA 4TV8F 4EJ2A 1J20A 3KEGA 2E85A 5CA1B 1X77A 4W5TA 4GLLA 5ESDA 3BGSA 1PV4A 4L8LA 5IH7A 3T4PA 3EG5A 4I8IA 3IP1A 3SC2B 1N6LA 1MORA 2P0AA 5AOCA 2C2MA 2PUVA 3KOMA 5HE8A 5FFMA 5T6BA 1R5BA 2DFDA 4KPUA 3SZOA 2QYSA 3RWBA 4DJ5X 2GFQA 3OIFA 4RSMA 4A92A 1G5IA 4BKPA 1E3JA 3QGMA 2XYQA 4GI3A 2XIQA 4BX2A 1RXCA 5ILOA 1FYEA 3HB7A 3IMCA 1N2CA 2ODAA 4MWSA 4MA5A 4MRNA 3VDQA 2FUG1 1JLHA 3HL4A 1UF9A 4GVLA 3RVJA 4ZGBA 1MU0A 2BEVB 5DBHX 1JLRA 2GZSA 4S1PA 4KZKA 4OA8A 2GF2A 3D8HA 4FI3C 2FX5A 3WJAA 4B84A 1R6UA 4ZK6A 2CDAA 3C1UA 3MM4A 4CIDA 2ZUCA 3WWEA 3LUPA 2MYUA 4I4TA 2G9UA 4MUYA 4DWVA 3RRMA 4D6XA 1QP7A 4B35A 3MT9A 1DLIA 4J4TA 4ITUA 4NU5A 1YQEA 3DMDA 1CHNA 3UGKA 5J2TF 4KO2S 1RKVA 4S12A 2PZJA 4EGCB 4I19A 2WLTA 1MNQA 3WHLA 4BX8A 1QP0A 1CIVA 1BMFA 1DO8A 4PO1A 2ANCA 2KJQA 1U2TA 4CM1A 4M1QA 4TYMA 1VPVA 5CG1A 4LSMA 3PDHA 5KYVA 2DFVA 4JROA 4E5MA 5KNBD 3SGLA 4J6EA 4I1PA 1NUQA 1GPJA 1Y5NA 3UHJA 1UKAA 3KUDA 4PZAA 5TGDA 2NO1A 3A1SA 4H6PA 1JEAA 2ZTSA 4JC0A 1R6DA 3SC2A 1K86A 4CFSA 2Z2ZA 4C06A 3PTAA 2O7SA 1YDWA 4E7OA 2Z43A 3MQFA 3U13A 1USIA 2IUTA 1SCKA 4JB0A 4Q0MA 1RDFA 2ERCA 3HHEA 3BHIA 3Q3JB 4ZOLB 1CLUA 4EZEA 4LC9A 3PPXA 4M1YA 4B6QA 2VZ0A 3JQEA 1ND6A 2O1EA 2DTDA 1HE8B 1X0VA 2A78A 2N1BA 1JFLA 2NUTB 2XAAA 5KJ6A 1WRBA 3TLBA 2R65A 2J33A 5EHXA 1LCIA 2PSJA 3WXMA 1Z26A 1QKKA 2R4TA 3KKEA 4JDPA 4X64B 4DCTA 1VYHA 2DFPA 4EF4A 1KEPA 3N2YA 3R9XA 2BR4A 3A31A 1A50B 5EVJA 2A5LA 3CX6A 1KQOA 4PLYA 1F20A 2YWJA 4Z8XA 2ZJ2A 2ORVA 3PFKA 1B16A 2IPXA 2ZYTX 3NDJA 1KI8A 4MYRA 2D74A 4TM8A 4RTOA 2B98A 2QUAA 1MC1A 2FVYA 1OD6A 4ERNA 2IPNA 1T3ZA 2OV6A 3I6YA 1QMGA 2QTLA 3A70A 3EVCA 4JD5A 1Q1GA 3PVSA 4GL4A 4WXPA 1MJHA 1OWOA 4BFYA 3UYLA 4C87A 1DZIA 1AA9A 1K0UA 2D2XA 2OGWA 1XU4A 2ZJ0A 4DSTA 1OHHA 1XZEA 2EJCA 5CFLA 1KMMA 2J32A 5IYZF 1H65A 1L7OA 3FMFA 2BGGA 1QU3A 4PZ0A 3DLTA 1CEYA 3TCXB 2QT9A 2JATA 3NFYA 1OFHA 4GD3Q 4KV9A 4U7TB 1P39A 1V1RA 5H3CA 2QQEA 1WD7A 3DFZA 4JQOA 2JFZA 5EP2A 1KXZA 4L76A 3NBZC 1NLUA 2MU1A 4PN7A 3GD7A 2NUTA 3T3DA 2A4KA 3TMYA 1TUIA 2I4OA 1PVVA 4EKDA 2GN4A 1GWNA 3DAGA 5B1SA 5A04A 3RR2A 1T4BA 2B5VA 4MOWA 2JI7A 2VJKA 4L3OA 4YA6A 5C53B 3KC2A 2IELA 3NG1A 2HA3A 3EDOA 4PVDA 1P77A 3SYNA 4B75A 3K2QA 2FPIB 2IZZA 1RLMA 3L46A 4OQQA 3L4KA 3DE5X 1V37A 3GZ4A 4C30A 1V4VA 5FNZA 4XGKA 3LNCA 5I5GA 1K6IA 4ZHQA 3DE7X 2LGJA 3C6XA 1EVKA 1UFKA 4ZQFA 2E2WA 2IOHA 4CM9A 1S7GA 4D9EA 2FPUA 4PYRA 4BIMA 1YK0A 2PPVA 3RS9A 1W4RA 3ZPXA 2WJAA 4BV8A 3N9IA 3FKSD 3F3YA 3KKPA 3P45A 1AK2A 1S6YA 3CZPA 3G9XA 3K8OE 4ZEMA 1KY4A 1OCEA 3KV1A 4HXFB 4K8OA 1WOMA 4L9SA 1C8KA 1SXJD 2L82A 2NZWA 2WOOA 4HNAB 4BV9A 3LO5A 3GLGE 3QI2A 1P61B 4AJ4A 3ITNA 3LWDA 4PRKA 1GG9A 4LTDA 4DLYA 5JAZA 2OOSA 2EQAA 1P9NA 4QPJC 1DXYA 2REXB 3KSZO 4V0KA 4OLBA 4KSCA 3H2GA 2IV7A 2B5WA 4L4UA 4IHJB 1BH2A 4X0EA 1Z47A 4JWTA 1LDBA 4G37A 5IFKA 3S55A 1D03A 1EUZA 1XMIA 4P34A 4ZDKA 1ML4A 3VAYA 1T0JB 5H70A 3RWOA 4XSVA 4Q05A 5F2KA 1T2AA 3H5OA 4ZCMA 2DFTA 1K88A 3KFLA 4YN3A 3D6TB 1W47A 4MTLA 4OYHA 3W6ZA 1JBEA 1WP9A 3K6KA 3G2LA 2F1OA 1S02A 2C4NA 4NONA 3ZWAA 2ZANA 3HABA 3ICPA 4INZA 2FPIA 1IHXA 3C6ZA 1P1BA 4JDUA 4K9NA 4WX2B 1VCMA 5T3UA 1QTIA 5FTLA 5KVVA 1U8YA 2WPDD 2BGWA 1T8YA 1SHTX 2NTEA 1SEPA 1NGSA 1SD5A 3OD5A 4IFTA 4ZC8A 5KMGB 4RLHA 2B8TA 4K5QA 1F8YA 1VCIA 4W1PA 3JYPA 3O2JA 2X8AA 1T43A 4LOLA 4YYZA 1MDBA 4Y6RA 2B7LA 1RYYA 3ZIAD 4JJFA 3MJ4A 2VKTA 1P0CA 4YB8A 3TNJA 2VPIA 3R9XB 1BW9B 2MSNA 1XHFA 2X8WA 4QZVA 4JUAA 4HNAA 1SO8A 3VPGA 3HCBA 1YJAA 3WMEA 4AG3A 4EDHA 5I5EA 4KR3A 4DLPA 3R3VA 2XTNA 5CT9A 5LOVF 1E6CA 4FN5A 4Y0AA 1CF9A 1M2JA 2O1XA 2RHWA 4BZXA 2QVLA 3TW8B 3LY9A 3I9MA 3THSA 2ZFUA 1PW5A 4IHJA 4ZVTA 4DA0A 4EARA 1JA0A 1LTKA 3CUYA 2H1VA 4FE3A 5ISMA 1IN1A 2NP6A 4JY7A 4OHUA 1PFQA 3L1HA 2F8TA 2FJPA 4G63A 3U7IA 5F76A 2VP5A 1ULTA 2WT9A 4G4JA 4RJJA 4GXTA 3LA8A 4TSRA 3LZDA 1J9GA 1U1EA 2NZUG 1ACJA 3EMDA 4IUYA 3KZMA 3W2EA 1DI0A 3HB0A 4I6JA 4RY8A 4W8OA 1ZU4A 3WLKX 5BUCA 2A0KA 4RU1A 2XNSA 2N9UA 4M0KA 5A3JA 2XNCA 3OZRA 1JEYA 3K92A 3O83A 4LYHA 4UEQA 1HDIA 4GEKA 1JHVA 3P1JA 1FU8A 3WGOA 4U0JA 2F9LA 3HYLA 4R1NA 1ORRA 2PZLA 3ZDAA 4NBUA 5IKEA 2EV9A 1QPGA 1BWRA 2P9CA 2MSDB 5KMGA 1KQGA 1S2GA 3PC3A 2CFSA 2GR9A 2HPAA 2Z3ZA 3IUSA 3PPVA 3QHQA 4QUGA 5CVJA 3ZXIA 4XJVA 4JLJA 1QRUA 1GR1A 2Q4RA 2ZBFA 1E77A 3DPUA 5E3HA 1AGYA 1BW9A 2NVWA 3STYA 3WNQA 3I8SA 3AG5A 3P0EA 4DPLA 1CT9A 2Y0PA 3DEFA 1RT9A 2NTNA 2O6HA 3GW8A 2ODWA 4FOLA 1PJ3A 4M0DA 4QHSA 3S2FA 4JP3A 3VOBA 2BJVA 1UP4A 3M4XA 4KLCA 3SOPA 3CO5A 4DXHA 4CTMA 1HDYA 3N74A 3SF8B 3TW8A 1IHPA 1HA3A 2B78A 4FEYA 2PMKA 4R8VA 1H1TA 3VFDA 2OFOA 3AVXA 2IGBA 1MC8A 1KMIY 2BTOA 2AOTA 1V16B 4MQEB 4EDFA 5EUMA 1P6XA 3I0ZA 4ZALA 2I6TA 3RS8A 4MQMA 1CRWG 3IURA 4RNDB 4XOIA 3VAZA 1N9KA 4O4HB 1A4UA 1C3EA 1FC0A 4C20A 2HL6A 3D6UA 3SHWA 3W5IA 2Q0XA 3K0AB 5TB5A 3IXLA 3ITDA 2HCTA 3IKTA 3M6MD 3MAGA 3VKVA 5AW8A 3BWVA 3LQ4A 1F9AA 3ZDRA 4UEWA 1H0SA 3O4RA 4NDZA 3KPUA 2LR0A 2R6FA 4XOUA 3WL3A 2HCBA 4ZMBA 4OGKA 4YAJA 1R0ZA 3UT6A 1KP3A 4B43A 1O08A 1IDOA 4BO5A 2G1KA 2G1PA 2YOGA 3BKWA 2ZPUA 4TL9A 5ESXA 2B1RA 1SCQA 4MUXA 4IXDA 4OQYA 1CUEA 2BWJA 3JVUA 2ASEA 2QPAA 3DMPA 3Q7SA 5DULA 1YA6A 1CERA 3M9XA 1XDBA 3TQIA 4CIYA 5AFSA 4JYAB 4J0EA 2F43A 5A03A 2TECE 1Z7EA 2V74B 2VJYA 4EENA 5HKLA 3HB1A 1REQB 2HO5A 3TLEA 5IBCA 2D3TA 4IIGA 4L3WA 3UHAA 3VHLB 1NFFA 4EQ6B 1OAOA 3SF8A 3AIMA 3KEFA 2JANA 3ZLUA 4XXHA 3VNVA 2PS9A 4MS4B 4NULA 3GGDA 4U7DA 1OQAA 3VR0A 1XDDA 3V8QA 1E1QA 2PWBA 2CV1A 1RM3A 1DEAA 1X87A 3BVPA 1DRKA 2PWYA 2JA1A 4R9NA 4OLHA 1IQRA 2RGXA 2OPHA 1PJLA 3NHAA 1V16A 3UMBA 1UBJS 2FOLA 1DUSA 2OCGA 2X7XA 3CNQS 5DIFA 1B3BA 1FYWA 3NKLA 3AY0A 4ATNA 2D06A 3QV1A 1YB7A 5EWLB 3ZDCA 1NUHA 1EFVB 4YUWA 3B5JA 2EHDA 3LT1A 4KU4A 4KXYA 4LYEA 4U1RA 3SM9A 4DA7A 5JNUA 3U44B 1Z88A 4DC0A 1FNDA 1PGNA 3K0AA 3BMNB 4HCJA 1ZBQA 4YR7A 4IDGA 3IJRA 1FBNA 1A8PA 3E9MA 1GA4A 3D4BA 3NC0C 1LRLA 4P7BA 5D6NA 3WJ1A 4E4RA 4WZAE 1NW7A 2AG6A 3U1VA 5LR6A 3EAGA 3KB2A 3K9HA 4DGQA 4BNJA 1SU8A 3FGZA 4CDNA 3UMCA 5BR8B 2P9YA 2JFQA 3Q5GA 4RD2A 3L6CA 1HE2A 1NF3A 4R2IA 4A8JC 1SBYA 2AWOA 1FLNA 2FR0A 3QIAA 5B64A 5BUZA 2JLCA 1AY0A 4R5MA 3HXQA 2JH9A 1QIMA 1UUFA 2VDQB 2FVXA 3ZDQA 1SB8A 5KNCA 3DVAA 4KHZA 4RE5A 4RXTA 1REQA 3WL6A 3JAWB 4O1MA 3PGJA 5FPKA 1FMFA 1C0KA 2WICA 4FHZA 5DX0A 2I34A 2ZBPA 4LPKA 5AXBA 5B3LA 1WXWA 1G64A 1Z36A 3COPA 3VR5A 1QP8A 1U8FO 2XZPA 3VOTA 2OXRA 3QU2A 5CVTA 1RM5A 3G5LA 5B55A 4J90A 4JFRA 5ESRA 1RKUA 1SURA 2AN4A 2P7IA 5DTRA 4IV5A 4KITB 1GQ2A 5IANA 3FYCA 4H60A 2XMSA 3WYNA 1BHJA 5BQXA 1OH6A 5EWLA 1QYCA 1PN3A 1EFVA 1E89A 4I0WB 4U3JB 1PJZA 1WDKA 1L9XA 3O75A 4IIVA 3UK1A 3U44A 3BL5A 5FOXA 5DT9A 2HHHB 1M8GA 1NKVA 3BMNA 2OO5A 1XD2A 3MHTA 4QE3A 3GCWA 5BSKA 1A5ZA 2XDQB 4HDNA 1VJDA 4UQOA 4US1R 1KZ9A 1SQ5A 2B3DA 3AR4A 4LHZA 3E2IA 3PJGA 5DK4A 1N4DA 4Q9DA 4ZXPA 4B31A 3IEPA 3SYTA 4HSGA 3QV2A 4TUYB 2D1SA 5AM4A 2YFHA 1YJQA 3GEIA 3PEUA 5AT1A 3Q5EA 1MV5A 3T41A 1WIWA 2ZT5A 4NV1A 3F6PA 4IRXA 3R7AA 3ZG6A 3N8GA 1JG4A 3GEDA 1WPGA 4NBRA 1ZGJA 4NENB 5EHZA 2FMIA 1M2GA 5A5EA 1IULA 2G6TA 5I7RA 3GJTA 1SXIA 1M10A 2WW8A 5CDYA 4OJMX 2IXBA 1H93A 2WYHA 3JAWA 3MTEA 1JDTA 2CF6A 4GSYA 2FWPA 3PC4A 2ONZA 4GBED 1H1LB 2ORED 1G17A 1V5FA 4ZO9A 4IDOA 1OR8A 2FB9A 3IT3A 1NTRA 1SHUX 5IT0A 2HOQA 1W25A 3DOFA 4R4JA 1WHTB 2AFHB 1ISHA 4ER0A 5MN5A 2QX7A 4LISA 1VHQA 3EXAA 4NNJA 1I0LA 4QODA 4BNYA 5CIQA 4CVNA 1CYDA 4R69A 5ARBA 1YRWA 4U3JA 1VECA 4AJKA 2XEDA 3ESRA 1MQ8B 3LQRA 2AW3A 4BFCA 1Z7GA 1Q7CA 4PGGA 4ZAFA 2AFHE 1SHJA 2JH3A 1FFSA 1T1SA 2AA3A 2XDQA 1F06A 4XYBA 3MCWA 5EXSA 5T8KA 5CXXA 4BGEA 2G7ZA 4ZAGA 4YRMA 1XDSA 1T5IA 4B4KA 3MNFA 3I92A 3ODPA 4WH0A 1CXZA 2JK0A 5A71A 4TUYA 1TL7C 1X7ZB 4KOAA 2BEWB 2NUBA 1V71A 4N5HX 4UBOA 1U1GA 3DJFA 2ZSKA 3D5QA 3ELYA 3BA6A 1XZKA 1HOXA 5IJWA 3LHDA 1JE1A 3W7VA 1ADGA 4NENA 3G0HA 3LG2A 2VQ3A 3JQAD 5KTOA 4ISCA 1PGJA 3A1EA 1GA1A 2OM2A 3I52A 5EIBD 4EX7A 4B6SA 3KKQA 1NUPA 1Z5OA 2QRZA 1ABEA 3C14C 3MF4A 4LCBA 5ALEA 2XOKA 5M34A 1ETHA 3TPFA 1N0UA 4W4TA 3T9FA 2JC3A 4OL0A 4CMHA 3R8XA 3T1TA 1H1LA 1NI4B 3Q85A 4WXMA 4ARZB 2QK4A 2XUZA 2CEAA 1LKZA 3IDZA 2R85A 4UMDA 3RCBA 4MQ5A 4LMBA 4YRDA 1QH8B 2XR1A 5AW2A 4GR9A 3A6ZA 2OLKA 3Q7IA 4XD7A 1KYZA 1WHTA 2H5IA 2AFHA 2PH7A 2DLDA 4UXJA 3STXA 4UUPA 4JLBA 3A6HA 5CYFA 5CBPB 2H1IA 3MSCA 4AJHA 4YJKA 1BDHA 4JT2A 1SIUA 1DEHA 2BGLA 2C83A 2NO7A 1AN0A 3QA3E 3VH3A 2GFHA 3KNZA 4RGBA 3ZEIA 4DDMA 4F2WA 2EFCB 2FSVC 2GRUA 3JQGB 4R98A 1E60A 1LJ8A 2J3QA 2JCXA 1O95D 2XUJA 1JHQA 3CX4A 4MB0A 4J6FA 1Y33E 2VUSA 2XMBA 4Q24A 4CI9A 3NB0A 2ADOA 3B1JA 4BX9A 5DM70 4QUKA 2RJNA 1GAEO 1IQ0A 3L7NA 3TUIC 3TECE 5HK9A 1O2DA 3AEUA 5JISA 2C88A 2UVQA 3QW2A 3BZUA 2XE6A 2FQ1A 4JJGA 4M21A 4MYHA 3BTOA 3B5IA 1X7ZA 3K3PA 2YIMA 2NT3A 3ZNNA 5BV1A 4NEGA 1OBFO 2BFAA 2PSHA 4KFRA 3AL0C 1DIOB 4MHTA 4FYPA 1J0CA 4IDBA 3CCFA 1YT5A 3OQ1A 1QONA 4K9OA 1O03A 3FNEA 1MQSA 4F8EA 4FBGA 2J0SA 3EGCA 2VT7A 2LKCA 3P7MA 3QSGA 4UD6A 1E0DA 2OAP1 3NHRA 3V9AA 3K9LA 5KTRA 4YRCA 5E9QA 2O2CA 4I6EA 1O0SA 2H31A 2YJTD 3PCRB 1SVLA 4F8JA 3HPQA 2XE7A 1IY0A 3GDGA 3I76A 4MW5A 5CVEA 1NI4A 4L51A 4MW1A 4RH1A 3FNQA 3FCAA 4HZUA 4JJZA 2V7WA 2B4YA 5AKGA 3VISA 3CBGA 4H17A 3BD6A 5BR7A 1XXHE 1QH8A 1YKGA 2W5UA 1S2MA 4YK7A 5EPOA 2V6GA 1RVDA 4QUBA 2RDMA 4OJQA 2NAFA 3E58A 3LX8A 4P33A 1AGXA 3PT9A 2QPLA 3KLBA 1LX7A 1POXA 2W93A 4M83A 3ZE6A 4KUHA 5CBPA 4NG4A 5LIRA 1ZNQO 3MXTA 4ENSA 1DUVG 3P0RA 5CH3A 2G3YA 3OJCA 2G08A 3MWYW 3WBKA 4GBGA 4MQ6A 4UAUA 5B3JC 3NM5A 4RTRA 2EIXA 3QKIA 3D2BA 2O8EA 3HJTA 1EM8B 1J42A 3LP5A 1TJ3A 1M9NA 1P2VA 1M34E 5BN5B 4KODA 1EB8A 3GA0A 4P84A 1KFJB 5BW4A 1A9XA 3DVQX 4DKJA 1AK1A 2X0JA 5E6UB 3NTXA 1TMGE 4G86A 2A0FA 3EYAA 1F6WA 2X2PA 4JZYA 3TTYA 3E9NA 6YASA 4KH1A 2IUEA 4UM7A 1P74A 5DN6D 1P31A 2HBQA 1EX7A 1R5JA 3PUKA 1Q2UA 1Q1EA 4I1YA 3GWZA 1GU7A 4KE8A 4Y2XA 3UMJA 3EQZA 4II3A 4NFYA 4MDHA 1C3VA 1G5TA 1AVTA 2Y3IA 2YVKA 2Q5FA 5FBVB 1M6HA 1XXHA 2QROA 3GVXA 3HUUA 4X90A 4ZKDA 4R8RA 3W04A 4J1SA 4BOYA 4CWAA 4TLLB 3VPBA 5JALA 3DD1A 3QNUA 4BTEA 2HRBA 3PNMA 4PXSA 3PXXA 4LBWA 4J76A 4GXNA 3A9CA 2PNJA 1AO0A 3Q72A 2ZUEA 3U16A 4AVYA 4GECA 2HGZA 3ET4A 4O1HA 2VHVA 2AK2A 4ER3A 5I9NA 3J80A 3QE9Y 5A4KA 4ZQHA 3K1AA 1XP8A 4OGWA 2QJRA 2XD4A 3WGKA 5KJCA 1M34A 2DQSA 2IEGA 1FU7A 3DBLA 3RARA 4GPBA 2V7BA 1MOZA 4RK1A 5HRUA 3ZJ5A 1XPJA 2JAXA 3RS7A 1JQEA 3VGPA 1L5MA 4YO7A 5K7SA 3OFJA 1YS6A 1T1RA 1EM8A 5BORA 2W6JA 3O1JC 3K9BA 5BN5A 3ZK8A 3N2LA 1CVLA 2ZDQA 4Z86A 1XQXA 4V0NA 1CF2O 3HWRA 3INTA 5E6UA 2H2FA 4LS3A 3VI3B 5CX1A 3RRFA 1K7FB 1WU7A 4BQEA 4X66B 3H2KA 5DM4A 5AJUA 1Q7GA 1W36D 1M6NA 4D42A 2C9OA 1CUWA 3OBBA 5CBKA 4TZ6A 4WLUA 3KG2A 5CNMA 5I7EA 1INLA 1XTVA 2DFNA 3DZIA 4FGLA 1SZPA 3EGIA 2XTAA 4IOMA 1MX1A 4AZ0A 5FL3A 1QX4A 3T54A 4HNHA 5IARA 1JHPA 1NVWQ 2R1TA 3HFRA 3F2IA 1UR5A 2QRGA 3WLPA 3OLYA 1YRAA 4KH0A 2GYUA 3HHPA 3V4PB 5IG2A 3UTDA 4BNHA 4H7KA 5AUPB 2WZBA 3M4YA 5K0FA 1Y3IA 1DBQA 4IXMA 4ZT2A 3R3ZA 3NI2A 3VMFA 2OV2A 2O57A 4ZYTA 1ZK1A 3KOXA 1JNYA 5CW2A 1XZAA 1GRVA 1UT5A 2Q1YA 1GKIA 1BQEA 3QG1A 1Z16A 3IDFA 4NZNA 4PCUA 4FZRA 4H3VA 4BC0A 4BQFA 1W49A 3EULA 3JZDA 5DLYA 4CLDA 1BOFA 1E32A 1M83A 1UMCB 4ROTA 3IALA 4QQKA 3ETNA 4YRGA 1SAYA 1PGPA 1Z4NA 2VJDA 1R18A 4HNSA 2VJNA 1XQ6A 4I9FA 1PYDA 1RXEA 4TTVA 3RS4A 3PIRA 1PFUA 1ZH0A 3RNOA 5TJHA 4POOA 3TL6A 2H11A 3L7BA 1WY7A 1K6EA 3BWEA 3O3CA 3BT7A 4PTLA 3AC0A 1MTOA 2NN3C 4P58A 2A5GA 3WLIA 4Q16A 3FYUB 3VUEA 4OCZA 4LUCA 1AS0A 5BSHA 1NLMA 5JJIA 3T9DA 2IJGX 5H02A 2CKMA 3UAWA 2FQXA 2ZUUA 2QR2A 2A0YA 3A27A 1E2LA 3FJYA 2AJ8A 4LGCA 1FTQA 2J3HA 2PUBA 5K99A 1GTVA 2H3EA 4LSZA 1LBQA 3OOYA 3TQTA 4AECA 4E6PA 5A6SB 1IBRA 1NBMD 1NV8A 1N1MA 5DEIA 1CYEA 1HMYA 4JJ4A 2G63A 3P0IA 4UUMA 3V1NA 3WAKA 1WXDA 4YJ2F 1HTBA 5DHSA 3VYWA 1YH3A 4FFDA 5CD1A 3DDCA 3WZLA 1QYWA 1TECE 1MLDA 4UU8A 1QF6A 2AG8A 5CRIA 3FWKA 4RACA 4UMEA 4EJSB 1KETA 4OK5A 4QQRA 3X0DA 5EE5B 1UK8A 2WRZA 5DX1A 3SIRA 3NONA 3CH7A 1XLWA 1FJGB 2G06A 5CJJA 1PT7A 2DFKB 4XB1A 1NPTO 3HDQA 4M9RA 4X41A 2WSYB 1UMCA 3G6KA 1Y8AA 4EBFA 4BNZA 3U80A 4ESVA 3NBFA 1EDBA 3WJ2A 1WQ3A 4QECA 4JGIA 4E5DA 1ADCA 2GEJA 2GHQA 3COVA 5C1BA 4L6IA 2VPXA 1W19A 3MSXA 4M4SA 1P0PA 2DQKA 2YMLA 3E18A 3SLGA 9LDTA 3DAYA 3R6WA 3VC1A 5JNRA 3EPLA 3NNSA 3A6DA 3O8CA 4ZPXA 1GTRA 2R79A 4F92B 1BKSB 2R84A 1UZNA 1TO6A 3FYUA 2NLOA 1VTKA 5EHQA 5EESA 2ID9A 2O3RA 3JZMA 4RYLA 4CKZA 1YULA 3G6WA 3NXKA 4UBLA 1I32A 1A4XA 5L3ZA 1O5OA 3I83A 4KXNA 4A6DA 1K5HA 3NC1C 3OG9A 3WSVA 4FMBB 1YFLA 2FSUA 1R00A 4F2DA 5A6SA 4C03A 3ORQA 1UZMA 3NHLA 1CY8A 2X6TA 2FG5A 2H1SA 4ZCSA 1N78A 4LF7B 1Y4UA 3A05A 3TK1A 3A4TA 3COWA 1FB5A 3HA5A 2DY1A 1A5BB 3ROGA 5F2EA 1E3LA 4GXQA 1ODTC 2PRKA 1YJXA 4EJSA 3PHIA 2SKCA 1KJQA 3RYIB 5IZCC 1YRYE 3GGCA 4ALKA 1Z4JA 2ZBGA 1KPIA 2CCJA 3GA7A 3TD2A 4OQPA 2FF7A 3U9LA 4BJ6A 2C9ZA 5F5LA 5K0ZA 5IM4A 3N2KB 3MUNA 4QBFA 2Z09A 2BR3A 4MPTA 1QO9A 2EKBA 2JD2A 2QBYA 3LUAA 4KXFB 5EIXA 1R0SA 1TUGA 2OGSA 4F5YA 4XWWA 2XZLA 1WSBA 4LXTA 1O7JA 3SJUA 1B8NA 2VDOB 3QVXA 4GFDA 3MINB 2JJ1D 2QMHA 3NU1A 3PIIA 4M1ZA 2MSWA 1W5EA 4KQGA 1W4LA 3VPFA 3V6LA 1U0RA 1Z5GA 2G76A 2XMRA 3F1KA 1P9RA 3U19A 4W6ZA 4M9SA 1N57A 1TF7A 2D4AA 4GMXA 3K2BA 4QL3A 4ACAA 1AUOA 2FW8A 3WQHA 3VBEA 1IBMB 2JH8A 1Y98A 1R7RA 4ZV4A 1KDZA 5B1EA 2ZRIA 2OO3A 1JI0A 4KFCA 4ND2A 4YT4A 4JQZA 2FUCA 4M0EA 3AI2A 5JAMA 4URZR 1KAGA 3BWMA 5J40A 1N6RA 4NC9A 3TRJA 1WSDA 2QRJA 1E9DA 5U4QA 2OORA 4YT5A 2QD3A 5F4BA 3CG0A 3PE3A 3I58A 1EVLA 3JD3A 3LUDA 4B8WA 5FB3A 5ARDA 2O2HA 4G26A 3T1VA 1CPYA 2A1IA 2IEZA 3U48A 1E3SA 3UJBA 1YE3A 1FFDA 5D51S 3ZVNA 3LSTA 5JQWA 4DC1A 4Z5XA 1ISSA 1EE1A 3KXIA 4PQGA 5E1OA 5AKXA 3RYIA 5DNUA 1GCGA 1CY6A 3Q6IA 1X70A 3O9ZA 1RXUA 3TNDA 1SBCA 2OHIA 1E92A 4KQKA 4KQ6A 2I29A 4HQRA 5CM2Z 2I6QA 3ZV4A 4D3XA 5AUQA 4O2BF 2QTNA 2HZ7A 4MCIA 3N2KA 1DKLA 4AG5A 3M6WA 2C8KA 1I2ZA 4Z0NA 4TWIA 1UXHA 1K8XB 3SKXA 2Y0EA 4D8TA 3W6UA 1PR1A 4CR8A 2OXFA 5AK4A 1F8UA 1LVHA 3AF2A 4YEDA 2JZCA 4B32A 1Q0SA 3KQYA 3LU1A 4JS0A 4PNZA 2IHJA 5JFTA 4CJXA 4LXUA 2ZTLA 1BIFA 2ZSUA 3L8FA 4OVKA 4ZYUA 3IUNA 1M2KA 2CSXA 3OPYI 4MLDA 3W06A 2AOWA 1DC4A 2CXQA 4PO9A 4GOND 4TS3A 4YH1A 1RKBA 3COYA 2P2GA 2ZGVA 4YCCA 3CVUA 1B2LA 2HBYA 3O2SB 3OE5A 4N12A 2YJNA 2AS0A 1XO1A 3OCXA 2C8VA 2HPHA 1T6BY 2MSKA 2Q6IA 3NPAA 2XGJA 2FN3A 4ND7A 3TFWA 2L2QA 4UXIA 1HTWA 2W8ZA 1QE0A 5EMNA 1P7CA 1KMNA 4E0BA 1J21A 1QFXA 5MN4A 1H94A 4JLPA 1JA1A 1LS1A 2UAGA 1NQTA 4BQQA 5EA2A 4ZVLA 3PS9A 4QOEA 3ZV7A 3BFJA 1XA4A 3HJUA 2LCQA 1QP4A 1G8KA 1ZMRA 2C4HA 2A0WA 3M6AA 1PUXA 4ITVA 3VJMA 4A5OA 2X6RA 1A71A 2VRNA 3MWDB 3TDNA 1FU4A 3FYDA 3Q2IA 3BMOA 3DAHA 4D1YA 3RG2A 4P8RA 1EAMA 1Z74A 3WLLA 2XVMA 1WVMA 4PSVA 5ALIA 2WR8A 3G49A 5C3MA 2A9FA 2H2AA 3NJRA 4GDFA 5A7GA 3RVQA 2M1XA 3FSGA 3WZ2A 1VJRA 4H4DA 3AERB 3T7DA 3T4EA 1DKQA 3T9BA 3IR5A 4H4CA 4UU7A 2IHKA 2QW8A 1M33A 4UREA 2IOFA 3IXMA 4I3HA 3ZHZA 1WMFA 4LWOA 5CEEA 4M0MA 1T1EA 2QDKA 3L6EA 4IDHA 4RA9A 3UZUA 1JSXA 1ZD4A 3KSMA 3UAVA 1NT2A 3VJLA 4BHTA 4YXWD 1BH6A 1L7XA 1QDUA 2R4QA 3OCVA 2P62A 4WEQA 3UMVA 4N5DA 1OYOA 2F90A 3WMWA 1T35A 3IBCA 1AHNA 3UCXA 1PT8A 2E5FA 3X1YA 2DM6A 3FPKA 2WWRA 3H4TA 4R2WA 1UDRA 4YAUA 3KU4A 3SHOA 4RV5A 2Q3DA 1GU0A 5JOQA 4KLAA 3SDZA 4ID3A 3U4DA 2PSEA 3E9CA 3MA0A 1MO2A 1V43A 3FZEA 3IKVA 3PENA 3FUXA 4DDKA 2RJOA 3AFHA 3H2ZA 4K8RB 4FBMA 3WICA 3BWBA 2XHEA 1USVA 3HXKA 4C3UA 1OKKD 3PHLA 3LIIA 4QX6A 1RS0A 1X8LA 1OAAA 4JJIA 3FVRA 1Q7RA 1SUWA 3OU7A 2JFWA 2BD0A 4G1FA 3JRXA 1P72A 1EK6A 4GNKA 1OVGA 4BNWA 3L4JA 3GQVA 2A9JA 2QJWA 3N8HA 1R0XA 1ONSA 4F1JA 5BSMA 5JAQA 4UU0A 1OV4A 1PG5A 1QF9A 1TNDA 2P40A 1YBMA 4CLEA 3S8EA 4MRVA 3H99A 1UJ5A 2X0RA 1UDBA 2GNPA 3L0CA 3OE7A 4XEUA 4CUZA 3CJTA 3MB8A 3CPJB 5IHPA 2XVZA 4EI9A 2PIDA 3OFVA 4WFKA 2JCSA 3F98A 4I9GA 2BHLA 3GVPA 3RJZA 1SKMA 1PBTA 4BO8A 4P3YA 2N0SA 5JHHB 3AZOA 4DADA 3P4UA 3EDQA 4KKVA 1C29B 4W8HA 2CZGA 3TSCA 2P2LA 1CDDA 4BB6A 3GB9A 1BFUA 3LLCA 3GOQA 1TD9A 1BGXT 4FZ5A 3MD9A 3GYGA 4C4PA 1E94E 3CMMA 4EG6A 1DT5A 2OFWA 4YX9A 3VHQA 1ZH8A 2C4KA 2NSHA 2PHZA 4YUXA 1GNTA 2QU8A 4D97A 2I76A 1E9RA 5J2UF 2HF7A 5LM3A 4MEAA 3LHKA 1Q7TA 3COJA 1H8EA 1VE3A 4M8SA 1JLKA 1US8B 2J46A 4TLAA 5DRYA 1QVZA 1YUMA 5LD2B 3DOJA 3CVYA 2EEZA 2D7JA 4BDSA 2FRDC 3E3LA 4AIIA 2YJZA 4MIEA 1MKYA 2X0IA 1NUSA 2Z8ZA 2BUAA 5FO1A 2P67A 4G56A 5G53C 2JFGA 1A27A 1UXKA 4MUFA 4FONA 5AOAA 1DQYA 4ZICA 4OXQA 3PX7A 4PPQA 1UPUA 4IH1A 4WNAB 1F4PA 3A3YA 2GFIA 4NQRA 1O3YA 3I2HA 2HH9A 1E5DA 4WKGA 3TLKA 1UC9A 4ROSA 4DPKA 1AS2A 3CEPB 5DHUA 2WTUA 3W4JA 1ZVJA 5KKNB 1C5KA 4DA9A 2D00A 1AURA 2VXBA 3E5RA 1J33A 4AY3A 3SEFA 1P73A 3PK0A 4FILA 3ABRB 2A58A 3ZGVA 5AM2A 3O4VA 5F9HA 1OXMA 1EZ4A 4U2BA 3WP0A 3JWJA 5JS2A 2QVGA 1F14A 5FWXB 4YI5A 2HPVA 4OL9A 1NFQA 2HW8A 2HRZA 2RSLA 1JG3A 3EFHA 3ESQA 3LCMA 2CGEA 3PNVA 3WLTA 1QVWA 4IUCS 3EQ6A 3CE6A 2OV1A 3OOWA 1OUMA 1IXKA 2PN1A 3PITA 2BPOA 3FGOA 2DWPA 1ZWKA 3T5MA 5EEGA 3TTWA 1TQ4A 3QXJA 3SR0A 3DLHA 4Z9FA 1XTSA 1GN8A 1J90A 3H3XA 4ILKA 4AKEA 2F7SA 4JQSA 5SYNA 3SK0A 3QJYA 1R66A 1US8A 2OZVA 4HYTA 4OFXA 3W5UA 2EJTA 4PZPA 4YAIA 2QI9F 3EXHB 1HZZA 3UBMA 2X13A 2RH9B 4KVZA 2KLBA 5DM0A 3RLFA 2UUCB 2WNSA 3I42A 4NHEA 2IHVA 3DDOA 4TKZA 4F9TA 4HRYA 3NJ4A 2IYRA 5I9SA 1M54A 3NV9A 4CEJB 2QTCA 2QW0X 4B83A 4XDGA 4ZTBA 3AUYA 3W8NA 2OVFA 3S5UA 4UAGA 3WG9A 3F7TA 1MX3A 4YRKA 1G6OA 3IAUA 5KVQA 4HB3A 1LGYA 1H3EA 4HGNA 1RSZA 5FORA 4MPJA 1V1MB 3KLPX 4YACA 3IP5A 3SQLA 1MPTA 3BK7A 1BN6A 3NHMA 4ZCRA 4Z8YA 3NTVA 5LQRA 1NYRA 2RONA 5DMHA 3K96A 1KBOA 2QI9C 3L92A 4RETA 2D62A 4IZOA 2JFHA 3CN7A 2ZYHA 4OSOA 4UHJA 5FWXA 5HIJA 3CLRC 2R87A 2B2NA 4R6XA 4BRSA 4JQYA 3HUFA 5KWSA 3LVFO 4R9SA 1A5SB 3UMFA 4ERXA 4MCAA 4MYUA 2R25B 4MICA 4AS1A 1EIWA 3LC7O 5FTKA 4MINA 4OQDA 4KQ2A 3BTSA 3KHUA 2GZMA 3TX6A 4XLZA 4PZCA 4BKOA 1E7SA 2V0NA 3GDWA 5H3HA 2YNMA 1VPWA 2A9QA 4Z2YA 4Y2YA 1CZNA 3HA2A 5GWXA 3JR7A 3WQSB 4F3CA 1SCIA 3EXHA 4NJEB 3L2OB 1W5BA 2E87A 4MQUA 3DTVD 3W7AA 4DJJA 1H6CA 2YWEA 1PL0A 2A1TS 4W5QA 2VL7A 4BUJA 4F97A 5JD6A 3H3JA 4FC6A 1DRJA 1TXGA 1UPAA 4LOIA 3OQNA 4CEJA 5B58T 2C20A 4H1UA 4AWAA 5FA5A 1BVUA 1Q0HA 1L5FA 1SNYA 1Y6RA 4NBSA 3VJRA 4C4TA 2IA5A 3GU3A 4Y9DA 5TMDA 4D4KA 5HZHA 4BQOA 5ICCA 4EMSA 3SJAA 1V1MA 4WACA 3ZQ6A 4PLTA 5ELXA 2HBRA 4G5QA 1MABA 3HKBB 2CWDA 4IVNA 4XJXA 5TNXA 5AESA 4M60A 1NRWA 3LBAA 3SVZA 4HBGA 3ZXYA 3E9RA 1U7DA 2VUUA 2EBWA 3OEEA 3KO8A 4MV1A 4X7MA 5ALRA 3D9QX 4LMPA 3TPCA 2GPJA 4BO0A 2WDZA 2LZ0A 3II6X 1QHSA 1MGPA 1AKNA 3S1SA 1N8NA 3DVRX 4FDTA 1JIKA 2XNDD 1G42A 2BHSA 5CEJA 2ZJ5A 1A88A 2WWXA 1IHDA 4LYYA 2XDAA 3THOA 4P81A 2GRJA 1E6WA 2XYHA 1FX0A 4MQBA 1DAGA 4IDFA 1JFVA 5CLQA 1CC1S 2FMFA 4TVBA 4DR3B 1U9CA 5L51A 2YHAA 1Y42X 3IS3A 4LDAA 1TD1A 2ZSIA 4LRSB 4MI3A 4ZARA 2HCFA 4HWTA 4K81B 4IMPA 2ATXA 2X9NA 5LMZA 3R7NA 3VDRA 1V8ZA 2OAGA 3PUYA 1VJ5A 1EEHA 1FSFA 2EU8A 3HDGA 4FKBA 4LIPD 3QSYA 1E4YA 4DJEC 4XYEA 2P5UA 2P9EA 4GYYA 2DC1A 3R3HA 5FO0A 4CPDA 2HWXA 4ER5A 4IY1A 2CDBA 3E3MA 1S5PA 1NJ1A 2VF5X 3RSHA 4QNNA 4P4NA 3TS1A 3ILYA 2VJQA 1V9SA 4EWLA 3HGMA 1H69A 4E22A 4H31A 4EY3A 3JQFC 3BSFA 2H2HA 3K0BA 4I66A 3M7IA 1Z12A 4RGQA 3TLMA 2EL9A 1EBFA 4URYR 1AD2A 2TMKA 2QLJA 4KACA 2JFUA 4WEOA 2ZRLA 1K06A 3HKBA 4F5ZA 1T6ZA 2B4QA 1DV2A 3B1VA 4LJAA 5CB8A 2AG0A 3BD8A 5KIAA 3SSOA 1UFOA 2QVZX 4O2AB 3UV3A 1G8GA 4W1SA 2M32A 5HNKA 1FS4A 1KGDA 2C3YA 2W0SA 4I4TF 3ZGXA 4FUTA 4OEHA 4P3OA 1WU8A 4F3YA 3FUCA 5BV2P 4AROA 5CDUA 3FFTA 1U8AA 3AR5A 1ZM2A 1MRZA 5B12A 4NTZA 1IOZA 2BM1A 1SKQA 2BKXA 2N1MA 4FMDF 4TV9B 2Q0QA 3ZV3A 4UKDA 3CCBA 1MJGA 2ORYA 3PSHA 4GH5A 4KPFC 2XMDA 5KNDA 4B7ZA 3TZKA 4E4TA 5KNLA 1UFVA 3WSTA 4NE7A 1EUCB 1LPSA 1D1QA 2CE7A 1GPKA 2EFYA 3K15A 1AQLA 4IGFA 4C1NA 1HV8A 5B6IA 4NE2A 4WOCA 1NC3A 1CFZA 2O3SA 2PX4A 3KL4A 4Q34A 5GVSA 5I48A 5LZ4A 4COKA 1V5IA 1VGVA 3W8DA 3PWSA 2Q8NA 1CFJA 4Y2JA 5FOQA 4AI6A 4M8LA 5LBTA 1GSIA 1UKEA 4OKIA 3SQNA 4WADA 4X54A 4F4JA 2C54A 1MW8X 4LWZA 3N6VA 3DO8A 3K0SA 2VQEB 3TI9A 2GAAA 1JR3E 4HFJA 4RDIA 4B1FA 3E7PA 4EI2A 4OXYA 1ZVKA 1VLQA 4KK4A 3QEBZ 1R8SA 4HQLA 3AJEA 3BAFA 4JV5B 3LO8A 4IF4A 4JH0A 1H2ZA 2JFPA 2Y77A 1TCCA 1Z7BA 3H4IA 3QQPA 5K51A 4B6RA 4BXOB 2GPSA 4W5RA 1DDGA 1Z2AA 2BFEA 3FDJA 4ND1A 4REQB 3GRUA 1JWLA 3GT7A 4FXOA 4TWBA 1PD0A 3KL2A 3V2IA 2ZI3A 3E7XA 3E8SA 5AM0A 2P1RA 1WDTA 2AMFA 4FZ3A 4GNRA 5HIMA 3GJ4A 2Q8PA 3OZBA 3MVEA 3WWPA 5C7OO 2V7QA 4NARA 4G9GA 4CCWA 5B4VA 3FHTA 2X5KO 1E9CA 1FQWA 2XHZA 2WG2A 2Y1LA 1JG2A 1EUCA 2VK8A 3NNDA 3PQ2A 4UTXA 1RYBA 3EGXB 5D6OA 4ENRA 3TQOA 5TT0A 3FTNA 3BWDD 3RBVA 4MWCA 3C3MA 3OCCA 3UQYS 4UUOA 4DV6B 3ENKA 3H7AA 3GNQA 3LPMA 4LBYA 4O4JB 3DOCA 1P7VA 4V0OA 4ZOLF 5HK8A 2MINA 1F8XA 4LJKA 3UK0A 2JASA 2X19A 2YBDA 3IVMA 5AJHA 2WUDA 2UUOA 3F4BA 4LJYA 4XYGA 5KNCH 2OAEA 3H1EA 4B5KA 1Z5ZA 4DLLA 4MO9A 4P3PA 5FWNA 2O3QA 2HXYA 1PV1A 4K28A 3VYRB 3QFHA 5L9AA 5ECDA 1PQPA 1X8KA 1NA5A 2OCBA 4MVJP 4UJ5A 4LRTB 5HG0A 3RYFB 5B3KA 2X40A 3VR5H 5KEIA 3R2JA 2B4KA 721PA 1YB5A 4DXAA 4RSGA 1JYFA 4BXOA 1AKTA 1X92A 2PV0A 3U5ZB 2NT4A 4REQA 2V0CA 1EFKA 1DE0A 3IDOA 2A33A 4ZREA 1LPNA 3PC2A 3VVCA 1G6HA 4TMXA 5EJ6A 1JDUA 2EXXA 3PXUA 4BLTA 4L7VA 2ZXFA 4PZLA 1O8CA 4ZHQF 2GEDA 1W4ZA 5H16A 3SJCA 3NHWA 4EABA 1N5JA 2FX3A 1QV9A 1YCHA 4KWHA 3VGJA 3EUAA 3M1IA 1JKJB 4GI1A 3EGXA 1FP7A 2A4MA 4BEVA 5JW6A 2VZLA 3B6JA 3TO5A 3ZDXB 1ZWLA 4B33A 4L8WB 3GGOA 3FCCA 4TL8A 1PWXA 4HDQB 1EJ2A 3SJBA 3QUQA 1H2EA 3VA7A 3GJ7A 4O4JA 1E0AA 4N8DA 1WUIS 4LY0A 3ESYA 3LQKA 3K0KA 1FJHA 4YQZA 1N75A 1QM5A 4M99A 4HFRA 1TYBE 1K1EA 3OQBA 1ZRMA 2ZAGA 1IE3A 5CDSA 3O4GA 4YP1A 3ENZA 3VR3A 4BIIA 4JT9A 3GNLA 3F9RA 4X97A 4D9BA 3AEXA 4AF8A 1F6BA 1RAGA 1ZJWA 1YV9A 3DH0A 1I2MA 2EKZA 1UFRA 2BZ1A 4X94A 1WTCA 3RYFA 2AF3C 4BBAA 3HWSA 4IZ6A 4UVDA 5CX4A 2HHJA 5JXIA 3PEEA 4YHHB 1C4WA 1JP7A 4LJSA 4CF6A 2CDRA 1GT6A 3MMXA 2D2EA 1XL1A 2VYND 2XODA 5F5NA 3A6JA 3OESA 3U31A 3VZDA 3IFSA 1MBZA 3OSUA 2OCKA 2RGGA 3VNSA 3B3GA 3KD3A 4MITA 4IGEA 2JD0A 2OD9A 3RFXA 3SU8A 1KS9A 4EHDA 2VHXA 1K66A 2AOVA 2FMUA 4PC7A 4EHAA 3EVAA 4ZJPA 1WL8A 1GP2A 1G1AA 4JP2A 4MRPA 5EZ6B 3NTUA 5FFNA 3W2GA 2CLCX 1OH5A 1U63A 1LI4A 3RIHA 1I10A 1G7RA 3E84A 1NMQA 1JKJA 3BB4A 3V8MA 3FZNA 3VC2A 4ZAYA 1B15A 4BMCA 4CL8A 2OHJA 4C9BA 1I1QB 2Z9CA 3ZU6A 2FPGB 3GIDA 3F6CA 4G01B 3Q40A 4HLQB 4XUEA 5EJ2A 5H0IA 1PJTA 2GK4A 4QIHA 3GEHA 5CB0A 5K01A 4MH0R 2QL9A 3EA4A 3WLEA 3ILHA 3TNFA 1OIXA 1P9LA 2Q9BA 4IHJF 3AIOA 3FUVA 4Q7EA 5JSHA 2WQ6A 1I3KA 5HCNA 3C39A 5F7OA 2XCRB 4AU1A 2H08A 4L9WA 2XYGA 4JBYA 2P11A 3HE3A 4Y3UA 4WBNB 5K2MA 5GJCA 5JRDS 1IH8A 2WM8A 4JJ6A 4OSPA 1UIRA 3N05A 3SSAA 1SG9A 3N1UA 1PNOA 4ID9A 5JSYA 1NHGA 3S1LA 1EXDA 1JFRA 4BN0A 2R00A 3PNSA 4QPZA 3CURA 3GJ5A 3GA5A 3UJHA 2EFEB 2GBLA 3H0KA 1L5QA 2P0YA 1E64A 2P4SA 2VNKA 3DULA 2ZAMA 2NVOA 3RABA 4AB1A 3C3BA 1KFKB 1TX4B 1TYAE 2WFMA 1NPYA 3FNHA 3JATB 1QGZA 4RV4A 4X95A 4UTNA 2JIPA 3ORRA 4ZCQA 2FZGA 1K4YA 2Z1MA 4ISBA 5E38A 4C5CA 1M1XB 2JAWA 2FEMA 2EERA 3MGBA 4O5OA 5DI3B 4GX1A 1IM8A 3CYFA 5FPHA 1KNQA 3OU2A 2R8RA 3ERCA 4JVSB 1K97A 2O9JA 3QFRA 4HTAA 1YVEI 2FW1A 3L41A 5EIFA 4ZI3A 5GJBA 2W2QA 1J22A 3UXMA 2FPGA 1YI8A 2PFKA 4C7KA 4KQEA 4KGZA 1ONBA 3AVTA 1RZRD 3OCJA 4EYSA 3I23A 4IS2A 4LBZA 1H8HA 1R8XA 1F2TB 1KFCB 4MW2A 3D02A 4D9JA 1L3CA 1RHJA 3JZIA 4B71A 4HAUA 5JPDA 1WXXA 4JLDA 3GGSA 2PAFA 4AZWA 1RWMA 4JXXA 3QVWA 5A5GA 1HR0B 3KZNA 1A8UA 1M8JA 3BPSA 3IHLA 4JEUA 4D98A 3JQ9A 1JWAB 1S7CA 3K9QO 3UOWA 2QVBA 1VL0A 1QCZA 1R3DA 2M9MA 5K0EA 2Y1OA 4YRQA 1M73E 5IEJA 4QJ4A 2JRCA 1U7PA 2O2GA 3DMTA 3HP4A 5DHRA 3R74A 3NXSA 4FGUA 4EF5A 2EKQA 4XJSA 2B1IA 4L72A 3V2UA 5JXGA 1FDVA 1AM4D 2XI4A 5TMPA 2C1EA 4PTZA 5JVDA 3JATA 1XPUA 3QF7A 3AIKA 3SKVA 1D1PA 2GCGA 2QM8A 3KR0A 4XIIA 1NAHA 1LPMA 2VNHA 1A2OA 2G5CA 1PQYA 2GJ4A 3AWIA 1R2QA 2WP0A 3I73A 3ND5A 3O8QB 1B8VA 2JGKA 4V2IA 1I7QB 5DI3A 2WAXA 4OHCA 2FDRA 2UUAB 4FCCA 2DLNA 1Y5IA 2A94A 1ZM3A 2GVDC 5DBFA 3IHKA 3I32A 5F2NA 3LUGA 3KT3A 4CEHB 2WU4A 4ZCLA 1BCRB 2Q1SA 3SIXA 2QMQA 4DREA 5BNIA 3S2EA 2X1LA 1UQTA 5FLYA 3GN1A 2AXPA 5HP4A 1V7PC 1G3IA 2PGLA 4E2YA 4NBTA 4NYJR 4XEHA 1IBKB 2KSQA 2IBTA 3RIEA 3ONFA 2Y9PB 2I67A 3DNFA 2ZWAA 1A2KC 2CB9A 1NATA 1UCFA 2PMFA 3NT5A 4J75A 2BMVA 2FEXA 5MDHA 5JAUA 1VB5A 1Y3BE 3NKVA 3U3RA 4MJ3A 2GARA 3VC7A 4D41A 5JNVA 3TF5A 1Z5WA 1GT91 2QTVB 3HXLA 4FYWA 4A8HA 4KN5A 4YT2A 1T3TA 2HWUA 4O6VA 4IXNA 1Z2OX 5E7JA 5BW5A 4LOJA 5J63A 3ZV6A 4ZCPA 4MIKA 2E21A 3ER6A 3IC5A 3ZW9A 4Q3LA 1LLFA 4WECA 1VYTA 4YCBA 4Z9XA 3SJZA 4AMGA 3L7IA 1OAOC 3ZCSA 4BGDA 1U2PA 2ORWA 2N47A 4LHXA 4AQDA 3TG2A 1KDVA 2PRSA 1JWBB 3ME5A 4HXGA 5EUCA 4A0HA 3V34A 3EPRA 1PSDA 1AQIA 1TJ4A 2EWWA 2QT0A 3R20A 5CMLA 3PEFA 1WZEA 3WWYA 4ARUA 5F98A 1LQUA 2DQ4A 3RK1A 5EKXA 1ZI8A 2WU3A 4M76B 3RQIA 3UAZA 1UP7A 3TH5A 1YBHA 3OF5A 5JRZA 3EEOA 1HDZA 2FWMX 1L4GA 5BV8A 2SCUB 4TS1A 2D1QA 1KOLA 4A2CA 4OMFG 4BJHB 1NU8A 2R6R1 1V7QA 2VTKA 4DZRA 1E2GA 1PJAA 2HLDA 4E3ZA 3DWEX 1UM8A 3CVXA 2XF2A 4BO2A 1KC3A 5J5AA 2VCHA 2CJFA 4QNMA 2HR1A 2V1UA 4BJ5A 4E5UA 5DBOA 1H2WA 4AMZA 3B8HA 2ZTVA 4N8EA 3U4MA 5EYPB 1R6VA 1WEHA 2FR8A 4D3ZA 4QGSA 4PYNA 3V4VB 3BHNA 2YWHA 3GJRA 1ODFA 3U4IA 1IUKA 1N6HA 3BSWA 5K0JA 1E61A 3LDUA 1ZCJA 1DKOA 4BO9A 3NDBB 5KWJA 5B7GA 3NBYC 7GPBA 3NIDB 4X63A 5L7WA 2CFTA 1T2EA 3I6BA 2DKOA 3JASB 3LY7A 1Z7YA 4BZQA 4TYNA 1RI2A 5JD3A 3PF8A 4ZTZB 4ZDWA 3AHGA 1HI9A 2R8EA 4HAZA 5AO9A 2NPIA 3LPLA 5CW1A 5F1OA 3T5GA 2I0FA 1PJQA 3GLRA 4W82A 4D8UA 4PM4A 2VA9A 1RBZA 3LD9A 2OV8A 2ATCA 3GX1A 4OLJA 4CLHA 3T3HA 5AVJA 2BT4A 9MHTA 4N48A 4O33A 1GG2A 3HY4A 4MARA 4Z1MD 1AQJA 1R0KA 2MYNA 1IY2A 1XWIA 1F9EA 2X4LA 3FOBA 3CF6R 3HZZA 3L6OO 4RMNA 3OT4A 3TW0A 5K1ZA 4ZI7B 2Q62A 1ADYA 3REFA 2JLVA 2IFTA 1TRHA 1H4TA 1P81A 4FYVA 2ZT6A 4XIJA 4NMHA 2ZIVB 2SCUA 5EIOA 4IIEA 1KZ1A 1L7VC 3FPAA 3BYZA 5J4LA 2OO5C 3LW7A 3VPHA 2O8FB 1CNFA 1JIUA 3KQMA 4KGXA 3PL5A 2GEKA 3I28A 4M38A 3HNOA 5GONB 4J0DA 3TQRA 3S40A 7AT1A 5A4FS 1YHZA 1RQNA 2QLFA 3L0PA 3UFBA 5A5DA 5EYPA 1JPUA 2XQFA 1UPXA 4UUNA 4AWBA 1OF1A 2FK8A 3I2FA 3CZQA 3WIUA 1CF4A 1QRTA 1XP5A 2H29A 4JT4A 4TSFA 4IHAA 2RGEA 1F3LA 1FMTA 1WE2A 2JZNA 4L0DA 5E7MA 3RVPA 3S7TA 3ZTYA 1SH7A 2WJJA 1YVRA 2RGCA 4R54A 4CG0A 2GOYA 1FSGA 3WL5A 3JASA 3WV5A 2O6LA 3OCWA 4BP8A 4NMMA 2LCIA 4B4OA 3MAAC 5EE9A 3PG5A 121PA 4ZQEA 3W2IA 3LI2A 1RP1A 1J2UA 3GLQA 2NNLD 5DWQA 1KQNA 4WXYB 1C41A 4QASA 2PGIA 5B4UA 4JI8B 2Q5CA 3IPLA 4LHEA 4U7WA 1HLDA 3BE5A 3JX9A 5KVAA 2PUEA 1EG2A 3LUBA 1GSAA 2ENUA 2YV4A 4TUYF 5C81A 1ENZA 1AT1A 3L0OA 5ADUS 4QG7A 5CDGA 3SY8A 3Q7PA 5BOVA 1T8TA 2I6FA 1U2SA 3HUTA 2NX2A 1OFUA 2H1OA 4HB2A 4ZI7A 1L2TA 4IOJA 3PQCA 1QFJA 2XBLA 1J39A 4URHA 5L4NA 1JQ3A 1E98A 1U3CA 1GD1O 5CXUA 3F67A 4E2FA 2Z6AA 1XKQA 2IHTA 4DLRA 3O26A 5AHWA 3RU9A 2O8FA 1MJ5A 1YDGA 1E3WB 1Q44A 2CE2X 4FWIB 5T8KC 5L3VA 2ZYVX 4ZRDA 5L3QB 5HE9A 5GONA 5JH7B 1A7KA 2HA2A 3PJFA 4GUAA 4QFBA 4WFIA 5HZKA 2QOEA 1DTEA 1H0RA 2W6IA 3LXUX 2D0OB 3HUDA 4B09A 2OP1A 4C01A 1X8JA 2VYCA 3IQXA 1UPBA 3KT8A 1YTLA 2X14A 1PDOA 3BSYA 1NIPA 1MO3A 4XFJA 3U3ZA 5IT4A 4KPGA 2GCNA 1VBKA 2AUNA 4RGVA 1SXQA 1XFDA 4EG3A 1UEJA 4E31A 2P2NA 1ZD9A 2WIKA 2YXDA 4JR1A 3V2GA 1UAGA 4M86A 3GFOA 4WZBE 1KOGA 1IZ9A 3U17A 1SG6A 3BBPA 3EDYA 4F0JA 5AJXA 5L4SA 4J0IA 5C18A 1L4KA 1E2MA 1TJ5A 1P6UA 2WM9B 1P91A 2CKDA 3V8BA 1ZEMA 3TZQA 2YDYA 5H59A 4XCVA 4P5PA 3WNZA 5FTMA 2EP7A 5LA6B 3NBKA 1AXRA 1AOXA 3LCRA 4GE3A 1N7HA 1NRJB 2B1QA 4OBWA 1KYYA 2OTCA 1BVHA 3PZRA 2ZI5A 1L7RA 1U4SA 3T7CA 1CS4C 2HJ9A 2QN6A 5H68A 4HGZA 3PXGA 5BRNA 1DNPA 3UKJA 3VTZA 5EFZA 1OLXB 1IZ7A 1VA4A 4EMTA 2WSLA 1DAIA 1VLJA 1E3WA 2C4WA 3NDRA 3NFRA 4MZDA 3G85A 4ZIRB 4OP3A 1W46A 4IWYA 5JH7A 1WMBA 4RULA 2O3UA 3DE2X 3R5TA 4PLFA 5FX2A 4BNUA 5L3QA 3D8SA 3ZCPA 5L7TA 1X39A 2Q50A 3RYTC 3QE0A 1SK9A 2VBIA 1ETUA 3BA1A 2GVNA 4AN1A 4LMAA 1FRZA 3WGUA 4DNFA 3TN7A 3VR2D 3BHMA 3N8KA 2ISCA 3UTCA 2AFVA 5HA5A 1DRUA 3FRHA 5JAIA 3D7LA 1Q3KA 1XROA 3NKFA 3MJTA 4W63A 2ZULA 2EJVA 1QNLA 3B53X 4RIHA 2BGNA 5AUNB 4WW0A 1KI6B 1DO0A 5CYOA 1KFBB 1W4CA 1XJQA 3V2HA 3LQFA 3IP9A 4HDRB 4YCMA 1SC6A 3QU7A 3L0SA 3ILVA 1CEXA 3TM5A 3ZKAA 1ZCAA 1ZS9A 2Q3HA 3A11A 4QEKA 3C8HA 3MOGA 4Q18A 3MPUA 1FE8A 5EGSA 3CZCA 3E1GA 4ZVQA 4C4OA 2GZRA 2JGRA 3QEOA 5LA6A 5FYQA 4V03A 4X00A 3AM1A 1T34A 1W93A 4G23A 3G7NA 4BFUA 2O7QA 1EAYA 1W30A 1HRDA 2ZAIA 2ZTMA 3HNRA 4LHSA 5DX8A 1A5TA 2OPBA 5F33A 2PA3A 3JWHA 1J8FA 4EPRA 2LPMA 2VNIA 2C9YA 1NVXQ 4K6KA 3I61A 3K4HA 3QYJA 2Z4TA 4H4EA 1VDMA 4FXPA 4TRJA 4DEYA 1ADFA 1C3LA 1HYGA 1VOTA 1OLXA 1X7WB 4LF5B 1Q92A 2XH8A 5AKZA 3EZ6A 1LDGA 3MLBA 5FL7A 5C8YB 2HNBA 4ZIRA 4KN9S 5KU7A 4P7GA 5IN5A 5EIEA 5FPYA 4HAVA 2WWYA 3GRFA 4PS0A 1A3CA 2DBRA 1W36B 2YJ4A 1MFPA 3GC6A 3LGAA 1Z4IA 3QOFA 4LA4A 4QTTB 3K2IA 1IAVA 2OZKA 2Y93A 4XUCA 1U1FA 1JHXA 4G84A 1WZUA 5AR1A 4BEBA 3S8YA 2XNJA 4HDMB 1EVZA 2N3ZA 2PWPA 3MTJA 1T3HA 3WHKA 2A8YA 2DFLA 4CCYB 1JAIA 1E6UA 2PPLA 3KB1A 1C4XA 4PVCA 2A5DA 2Q07A 2X22A 4LFBB 2HRRA 4HDRA 4R0NA 4X85A 1WZIA 2ZRGA 1TM3E 4Y98A 4E94A 4R0MA 1T1IA 4G8DA 5KDOA 2DRIA 3EVGA 5EHIA 4LJLA 2Q28A 3TYXA 3IAM6 1TT7A 1XTUA 4G41A 3WIBA 4ENUA 4IUBS 2VTVA 5KYWB 1IVSA 2CVZA 2VATA 3LLSA 4U2EA 4YI3A 1LX6A 2CCGA 3AJRA 3B6EA 5BNZA 2MHCA 1XRMA 3A0RB 1L4FA 3BOSA 3DP7A 1HORA 3E61A 2V03A 3H4MA 4ZVPA 4FGZA 1EQAA 5FRDA 3SN6A 3ZE1B 4ESEA 5IULC 2A0XA 4IQ4A 4LMRA 4K9DA 4R05A 4FSXA 3OQVA 1SUFA 1Y8RB 5DNEA 3RAGA 1M6EX 1RFLA 3IOBA 5DNYB 4LDRA 4RKYA 3ZU3A 2Y1WA 3IELA 2EG5A 5C8YA 4R1QA 1KZ7B 4TXHA 5IDQA 4IOKA 3N7TA 1ESMA 2G09A 4MA4A 1YE5A 3HVJA 2HLNA 2ECOA 2BGKA 3RU3A 1U7UA 3DA8A 4RTJA 1VLHA 3HK2A 2C4UA 2NO5A 3MHPA 4KMRA 2ZEJA 4W9MC 3MWLA 1XTRA 1TZKA 2P2SA 1XU9A 4I1UA 5LP1A 2NSJA 1WHSA 4UBIA 1LTQA 1Z06A 4L08A 3OC6A 4EO7A 3F90A 5JROA 2ECPA 1OYYA 4HDMA 2B5OA 2JPDA 4UULA 1ZNZA 3KQKA 1OZAA 1PZMA 3PUZA 1EP2B 4TPKA 4RC9A 5EKUA 2P9BA 1FXWA 3KEOA 2FEPA 4GR4A 2VA8A 5SZKB 3IEMA 1X8XA 5F51A 3LLVA 1VKZA 5E9WA 1FCJA 4E5SA 4JI0B 3KVRA 4M2LA 2OFFA 2GZ1A 1KAQA 1IM2A 4HQ6A 1UMBA 1Y3HA 2HNAA 2QSUA 3PDCA 1HT2E 4IV0A 3SJ7A 4RVFA 3T34A 4AX8A 1JXQA 1PT9A 1Q84A 3S68A 1R0YA 2ZIGA 5K8CA 4DXDA 4CIXA 3TL3A 1SULA 3B36A 5ER6A 3MJEA 5CDTA 5AVWA 4ZC1A 4C4AA 4QVIA 3G2MA 1GCOA 3FFAA 4NH0A 5B1DA 2PMWB 4RK7A 1Y8RA 1HNZB 2QPOA 3OCUA 1E5QA 1RU3A 4BFTA 1WTAA 4QJIA 3WWCA 3G0GA 3O1IC 3MPOA 1GYRA 1QIKA 2KI5A 4GC5A 3HBNA 5EMHA 3OWHA 3QZUA 3SEAA 1GM5A 1TTHA 3H6HA 1DWPA 4UE6A 1K75A 1U6KA 2F17A 4X71A 4QSMA 4ZO7A 3ID6C 5HX7A 4WFJA 3VX4A 1ULUA 1P7PA 2Z4SA 4G6ZA 2H59A 1X9GA 4I50B 3TKLA 2X3FA 4QOFA 1KVUA 4ARCA 2DCMA 3ENWA 1NVAA 1RYEA 1ZGHA 2D1FA 4DSNA 4FR0A 2IIQA 5GV8A 3N6RA 2QQFA 4GKBA 4G0QA 1I3OA 3T5TA 5DP1A 1BCSB 5G41A 3OECA 4OB8A 3KQPA 2E89A 4MUEA 4OHZA 4DCGA 3KYCB 3WADA 5I01A 2QL5A 3L04A 4JX8A 1WQ4A 5T64A 3W3ZB 4Q1VA 1Z0UA 2MYPA 4G0ZA 1UP6A 3QXSA 2R1ZA 3TQFA 1E2PA 2R48A 3SQDA 4RQUA 4URFA 3RSLA 4B2PA 2FW6A 3EG9A 1UOOA 3EXEB 3HSKA 4PG6A 2E3JA 4RF3A 3W5VA 2XCSB 1HDEA 3E53A 4XVUA 2JG3A 3LC0A 3CZAA 2YL2A 3NAQA 4G07A 4HGYA 1R8QA 1LC3A 1NOJA 2WZCA 4QEZA 1EGAA 2REQA 3WS7A 1TUBB 5A02A 3PPYA 1NQWA 4HLUA 4OHVA 4ES6A 4QELA 1JIIA 1JDPA 2ODEA 1SA0A 3O94A 3PI6A 2PKWA 3S5JA 4BLWA 4BNGA 1E5VA 4OHRA 2O5VA 4X1KA 1DDIA 4BATA 4DR2B 4OP2A 5BNFA 1KWGA 2FNAA 5GZ6A 3H1GA 5LZ8A 3EARA 3CTMA 4CMJA 1BU5A 3KB8A 3M2PA 4FX2A 2RI0A 3R4VA 4I50A 3DBVO 3FYUC 4HF7A 5CVDA 2A57A 2BP7A 3C3PA 4AY2A 3B3JA 3WQQA 1V3QE 5C4IA 4OM7A 5EXPA 2GETA 1ISJA 1WUYA 4C4RA 5IM4F 2WFLB 4HNTA 2YHSA 2I62A 2YYAA 3D8TA 1MOSA 2DHEA 4YMWA 4NFHA 3RGGA 1IXSB 3COZA 4JAVC 3SMQA 2VAXA 2C98A 3FNGA 2JFBA 4S0XA 1XCJA 2QNRA 2D0PB 4WOBA 3GFBA 2QRVB 4BQRA 3EXG2 1C0EA 1W2GA 2PUTA 4BNKA 4QDKA 1P60A 2RHLA 1Z6XA 1E58A 2HU8A 3EXEA 2PWZA 3P2YA 4BQNA 2G9RA 4EJSC 3BAZA 2DVMA 1K3TA 4F21A 2GNAA 1LNZA 1ZCFA 4YCJA 4LYFA 3RUEA 4JB2A 4QGBA 3KXLA 1BJRE 1U6IA 1VL1A 3BZWA 5IH3A 3CLRD 3A7DA 4BKRA 1OILA 2R1VB 4B4DA 3NH6A 3H2BA 3NASA 4JBXA 5CAEB 3TXXA 2C92A 1AKWA 2HB6A 2W90A 3WTBA 4UEJA 1R10A 3R41A 5BR1A 4KXVA 2CK3D 3ANMA 4W7HA 5EJ4A 1YVUA 5EE0A 4D0GA 4W7SA 3ZQKA 5LQNA 1N77A 2CBXA 2O07A 1NBEA 2WWWA 1AHIA 3PA6A 4MMYB 3NGLA 3TLCA 4D92A 1HYQA 1DBVO 1I1HA 1TO2E 1LW6E 1CB0A 1SZJG 4NAUA 4KRFA 2DXIA 1ZR2A 4IDEA 5CK4A 3D0OA 4B3MB 3LSYA 2YZ7A 4M1MA 1QIJA 2GN9A 2VJPA 2WFLA 3DHYA 3CLKA 4ZEXA 5JPCA 4GDMA 1ZL0A 1LPOA 3RSFA 1W76A 2E48A 4Q7KA 4A0QA 1E1DA 1NVVR 4C2BA 4CM4B 4DCNA 1SC3A 1CCWA 2H3HA 5CDHA 2RB4A 3BXOA 2JCVA 4B3XA 2KW5A 4L4SA 5L3SB 2A3RA 2QRVA 1OZFA 1Z0DA 2R6GA 3RRBA 1DO2A 5HOEA 4UCWA 1FZTA 2C9CA 2Y71A 3I5UA 2II6A 3C3KA 3K09A 2QLTA 3EA5A 4QLAA 5IF3A 1C81A 4JMLA 4CMBA 2FSFA 5FR1A 2B4TO 3H5TA 4HNVA 1J06A 4XRRA 3HKCA 1SFRA 4TN1A 1T5TA 4F7DA 3O7MA 2OSBA 3ZY6A 2D1YA 1RXVA 2JBHA 2R1VA 1RPZA 1ZKDA 2GTHA 2I66A 2Y68A 2L17A 4G5FA 4L73A 4DL9A 1NUTA 1PL6A 3TTVA 2HSJA 5HBGA 4N0PA 4HNGA 3F8SA 3BCUA 3PFIA 2DBZA 4TV8B 1FQJA 2QE6A 4HN9A 2NU6B 4ZI2A 3HADA 3OM1A 2VYQA 4AT1A 3FTEA 3PWZA 2GERA 4UFOA 3LFTA 3LKZA 4Z3OA 3QEAZ 3VDXA 5ALGA 4V2UA 4IYRA 3SS8A 2O3JA 2QB5A 2I3AA 3QE2A 3QNMA 4EVIA 4OYYA 3CX8A 1GGFA 3JALA 3BK2A 2RCNA 3L1UA 5EKSA 4RV9A 1Z0JA 1D2CA 3T7IA 1Y6ZA 1T9KA 3ZWCA 2JLWA 5EXDA 2J85A 4BMYA 1DJNA 4N7RA 5E7QA 5TQ0B 3ICOA 4DMHA 1B0PA 1UOEA 4TLEA 1U7ZA 5DXAA 5FUVA 1TPYA 1VYVA 1BWSA 3MFQA 2G0NA 4KB5A 4CM4A 5JPIA 3VAAA 1GNLA 1AUQA 1NN1A 1NL3A 2YXEA 3LK6A 4LKOA 2X2OA 3BXZA 4FVTA 3ZZTA 3HKDB 3IAEA 4FGSA 5L3SA 2NZYA 3GBVA 3V4ZA 3HB5X 3IHTA 3AQ4A 5HS6A 4UM5A 3DKVA 4OYLA 4LRWA 4M88A 5TSDA 3REGA 1I9CA 1IUOA 1OTHA 1OV6A 3FPGA 3RJMA 4IHKA 3IAS6 5G4KA 4KAXA 3DV0A 1AUVA 3KUUA 3GDFA 2IPLA 1XD8A 1SHKA 2BDUA 5DBEX 1DKRA 5FUBA 1FL9A 3J81k 2BBSA 4OHYA 3BXEA 3PJRA 4RCZA 3IESA 2V9CA 3UIEA 4PAOA 1BA3A 3VKUA 3ZYZA 5HKBA 1NW8A 3O93A 3LDFA 3ZHXA 3C74A 2JIMA 4PNEA 3UB3A 4LRXA 3UHFA 3W8FA 1JMYA 3SSNA 4DUPA 1YIOA 3T7AA 4GOOD 5KYUB 2FHSA 4E1AA 1GTJ1 4AF7A 1VKHA 4DEXA 3CR3C 1JU9A 4L28A 4FGWA 1UH5A 2GD1O 4BWFB 4DG5A 1JAZA 2XUQA 2IY8A 4UVEA 2PKRA 1NUAA 5ED0A 3NRJA 5TR9A 621PA 1N5MA 2XGOA 1PL7A 2ZXEA 1V0JA 3H18A 2RK4A 3QVGB 4GPAA 4A8TA 5TQ0A 2CXHA 1R4MB 1LC0A 4TTTS 3ZI7A 4EVSA 3ZN2A 3IEUA 5HKKA 4MDEA 1VJ0A 2J9GA 3IBYA 3QM1A 4RK5A 3M4ZA 2NU9A 3JWGA 3KPYA 4FGKA 5IDVA 1BMFD 3A8TA 5B6JA 2HIHA 2W70A 2DLCX 1GQRA 2J6CA 4X8OA 3THXB 1GITA 3H86A 1Z4PX 4MV0A 1IWPB 1PJ8A 4U2DA 2IXGA 3WGMA 2HJVA 4Q7MB 4BN4A 5KNDH 3ZGNA 3Q8MA 2R6HA 1F0YA 3I64A 2XSZA 2TRSB 4IJVA 1PSWA 3OEHA 4IEIA 1MX9A 1X1EA 4KO1S 5GVRA 4A9AA 4P0PB 2OQRA 3H0EA 4V0SA 1QQBA 5CT5A 2G4CA 2PGAA 4HR7A 1MAAA 2QZ9A 1S4QA 4RO0A 3P2KA 4KQHA 3HBAA 4U2GA 2XA9A 4MIOA 4MQLA 4QSHA 3TFQA 4HQNA 4CR6A 5A9SB 3FHLA 3A4VA 2XWPA 3IOEA 3IYLW 2H92A 1KHHA 1NR5A 5EIWA 4JI6B 2DHQA 1AKRA 3VMMA 2PO7A 1KGSA 4CG2A 5KYUA 1PHPA 2Z2YA 3DE6X 2MWMA 1HSZA 5ALHA 2O5CA 2ODBA 4XE5A 4IIUA 2IS1A 4DCSA 1MMFB 4ZEWA 2FQWA 2D2IA 3W5BA 2IYEA 2HMSA 4OHFA 1NVFA 2GNOA 4KQJA 5FAXA 4BQSA 1V6AA 2O0KA 2DR0A 4CKEB 1XZMA 1ZRNA 2COUA 3QVGA 4KWEA 2P5YA 2EW1A 3UCFA 4DIMA 1Z82A 4EBBA 5JJLA 1ZW6A 5KQPA 2IY7A 4FE4A 4NPCA 5C2JB 2AUTA 3ZQJA 1I7NA 3HM2A 1SUSA 4D5GA 3N0WA 3CUVA 4PCLA 4MS1B 5D84A 1CQXA 2AV6A 4ZOQI 2C8JA 3FNRA 1MA3A 3ZWYA 3P94A 5BNWA 5AW6A 3THXA 1ZHOA 1QRSA 3C7TA 1SU7A 1Q1ZA 4KBYA 3QEMB 4GP7A 1JHUA 3ITEA 3JARA 1YS9A 2AYXA 3LPCA 1KO1A 3NVAA 1XVTA 2V6JA 1U28A 3N2EA 4NG5A 2AJDA 2A14A 3K30A 1ACMA 3SLRA 3DGFC 1K63A 1MG5A 3H9CA 4JA2A 5BSRA 1OHHD 1U5CA 2CNBA 1RHQA 3CMCO 2XUHA 2J07A 2WTMA 4Z9BA 2D1RA 1BS9A 3AKYA 2H9YA 4L5IA 3UW1A 5ICMA 2V98A 1VE7A 3WTCA 5A9SA 1CLEA 4CE6A 2AD1A 1E1YA 3KKKA 5HPYB 4BLVA 1KWKA 2K87A 1LDYA 3LMKA 9LDBA 3QX7A 3G02A 3MD0A 3DP9A 1OIWA 5C32A 4J7AA 3CN9A 4J43A 4X6YA 5EXEA 4ZU3A 1A72A 1UZAA 4WWHA 5FBHA 1NVMB 2ROQA 4EA8A 1IB0A 1G60A 2E18A 2VG8A 2H1RA 3LX5A 4AS3A 5BV7A 4AJ2A 3ZWNA 1SCJA 2CHUA 3MWKA 3QA9A 3L6DA 1NXOA 1LBEA 4JR2A 1RKXA 1EX1A 3QF4B 1E3TA 1S3IA 4EG1A 2O8DB 3GOHA 5CCEA 3KSBC 1GGNA 2F48A 1VSTA 3AR9A 1TOAA 1ORHA 2CLDX 4M9XA 1IMOA 4BFVA 4DCUA 2B8EA 2C82A 1XQWA 5E9AA 3CNHA 5L8VA 2H54A 3IQGX 3EVZA 4I1RA 3TNLA 1GYQA 1KI9A 2ECQA 4L4ZA 2YHIB 3QEMA 3ZU2A 2VJAA 4BLUA 4CM9D 4ER7A 4CTNA 2ZLBA 2QZ4A 1SVWA 5EZYB 4LCJA 4PYMA 3DWFA 4RF4A 2V97A 5EAIA 3RHSA 2ZT7A 1EU1A 2HX1A 4YBZA 5GM2A 5AKJA 3WLRA 1T9BA 1HXHA 3QKRB 4MWDA 5CD9A 3QXXA 3O1LA 1M66A 1L5GB 2QEQA 1U98A 2VI5A 5LD2C 3KQHA 2DSTA 3ZCRA 2GH1A 1GKKA 1YBVA 4H7DA 5JWOA 1HZZC 3TR6A 2GF9A 4F3TA 2QJOA 2IUSA 3EVDA 2HT1A 1ANKA 3ZBTA 1GGJA 2JLXA 1QDEA 3MLEA 1W94A 3JQRA 5EZSA 1NN0A 2HUNA 2P75A 2VLIA 3B1KA 2YQZA 2PS0A 2Q4BA 3NWJA 6GPBA 4C2UA 1O0BA 3EVBA 2FKNA 1G16A 1YE8A 5EZQA 2CZCA 3PDUA 5AM3A 2X7JA 3WBFA 1DC5A 5CFZA 2HWKA 3UPDA 2WVJA 3QF4A 4ETWA 2WAAA 1QGDA 2VUHB 1IOLA 2VTDA 3G2IA 3K94A 4GWLA 4KRGA 3HPRA 5FA8A 2YV2A 2FEKA 3BB3A 3MRVA 1Z07A 4BMVA 4TWJA 1QLJA 4DOMA 4DAEA 1YS7A 4Q3NA 1KO8A 2FAXA 1P19A 4HN4B 3TUJC 3V8PA 2IU6A 3X1KA 1YR6A 3N86A 1U2EA 5JY6A 3LCUA 2YHIA 1OGJA 1G1MA 1Y0BA 2CLIB 3FAKA 4KLRA 2C9MA 1ODLA 4RFLA 3Q2KA 3QWAA 2OT3B 5HQTA 5EZYA 1TLTA 1TT5B 3KEQA 4JLOA 3EZ7A 1YJ8A 3R0ZA 5IUNC 4PGAA 2B8WA 1T6NA 3GLFE 4ZO4A 4LE1A 1XR3A 4PPGA 4UM9D 1CQWA 1LRJA 5DHTA 3QKRA 5E2BA 2YNMC 2J3LA 3GMDA 3KWMA 5DBGA 4CKXA 4UQPA 1A76A 2EVWX 3HCFA 1U3TA 3EXHC 2OCPA 1AK9A 1GPH1 3EGVA 3QW4B 2PUHA 1SXPA 1ULSA 2CJPA 3FIUA 1KR2A 5D7NA 3D7KA 3GF4A 4NATA 1GEGA 1OA0A 1N25A 2BDTA 2BBTA 1C7FA 2JKZA 4IDAA 4MR8B 3URMA 3OQIB 4CUJA 4CIVA 5GZ1A 4Y6QA 3DT6A 5LZ2A 2YUTA 2VHTA 1KORA 4K9QA 4MLCA 3SXPA 2OG2A 3U4HA 5JS1A 2XBUA 1APBA 2ZM6B 2VXOA 1FA9A 4F4FA 3S70A 3CW8X