2VJKA

Formyl-coa transferase with aspartyl-coa thioester intermediate derived from oxalyl-coa
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGDSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FORMYL-COENZYME A TRANSFERASE
publication title Reinvestigation of the Catalytic Mechanism of Formyl-Coa Transferase, a Class III Coa-Transferase.
pubmed doi rcsb
source organism Oxalobacter formigenes
total genus 141
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 2vjkA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 2vjkA01
1XK7A 1VGQA 2VJNA 2VJLA 1PQYA 2GCIA 1X74A 1P5HA 1VGRA 4HL6A 1XVVA 1XVTA 1P5RA 2YIMA 2GCEA 2VJKA 2VJQA 2VJPA 1Q7EA 1XK6A 2GD2A 1PT8A 1PT7A 1XVUA 1XA3A 2VJOA 1Q6YA 1PT5A 2GD6A 2VJMA 3UBMA 1T3ZA 2G04A 2VJMB 1XA4A 1T4CA 4ED9A 2GD0A 1T4CB
chains in the Genus database with same CATH superfamily
3ICOA 1E7YA 2E5LB 1N33B 2WFLA 1VMKA 1PR9A 2C9OA 1KSGA 3CE9A 5COBA 5I4IA 4EEKA 1CZUA 1DHTA 1FVOA 3A32A 2AJCA 3I1FA 4TUYF 4UOQA 5UKDA 4BFCA 1HYEA 4G36A 3PC6A 2OR3A 3HZOA 3PQ6A 2FF7A 1TMKA 1YRYE 3CKMA 3WRWA 4EAAA 4HNQA 4HNTA 1TEHA 2VJOA 1K6XA 3F5QA 3HCOA 3K94A 4FOTA 2CNKA 4JLKA 4MO9A 2Q5LA 1KDYA 1S5PA 3QYFA 1LRLA 1H9AA 4O6VA 3DONA 2NXCA 1R6DA 3F5SA 4IV0A 3WXBA 1EAMA 4EG6A 5SV2A 1O5IA 2BCJQ 4DLZA 4MW6A 2O5CA 2DH5A 4BX3A 3EVAA 4W5QA 2IX9A 3GCXA 2P90A 2GKSA 4LCEA 1YMUA 1G6HA 3FVWA 2Y9MB 2Y77A 3L0IB 4GWKA 3S2SA 1J9ZA 1ZISA 2NQ2C 3BMCB 5KYWB 2Z6AA 3EMDA 4UHEA 3CEPB 5BVHB 1CJMA 1JHZA 4ZMRA 4F56A 4CQMD 3PDHA 4NJMB 1ONPA 3UJCA 5J4YA 2XGJA 4B1FA 1NPDA 2LIVA 2R25B 1KYVA 2PKRA 2WF7A 3AUTA 3H3JA 3KR0A 3QX8A 3DLHA 4QGHA 2D1FA 4D0SA 2A8YA 3CTPA 4BO1A 3D6TB 4NYJQ 2PWAA 4PLCA 1U1DA 1E1QA 3LWDA 3SIWA 1WULS 3BE4A 2W2LD 4XW2A 3HS3A 3T3GA 2BAGA 1AY0A 1M3SA 1JHAA 2EFJA 2Y3IA 3ZOZA 5KWJA 3JQGB 3C6XA 1R3DA 3Q12A 3GI1A 2OZPA 1YBMA 3O03A 3QFHA 4O3MA 2OPBA 4PG7A 5ESDA 1D2MA 2V97A 3DV9A 4WN9A 3ZE8A 3ZKAA 3R44A 2ZJ2A 1YR9A 3OHMA 5ENDA 1VLHA 3Q8KA 3FZNA 3H9JA 4JBGA 4K9NA 1TPZA 3JAMA 1E7SA 1PLKA 2R1TB 2CC2A 2FUNB 4DQKA 5KNDA 5CT9A 2I9PA 4FEGA 4QVIA 1EFTA 1BGWA 5JH7B 5EE5B 1K3FA 1P0CA 1QFMA 1J2RA 4C7OA 3IT3A 2EW1A 5SZJA 2I91A 3AUSA 3OTGA 1IZ0A 1YXMA 3UOGA 5FBRB 1WCXA 2DPXA 1KFCB 4IO1A 3KEOA 5BSGA 1GKLA 1E0KA 1YCFA 3HYSA 1MA0A 2ON6A 1ORDA 1BO6A 3IR6A 4M6WA 3T7SA 3WLIA 3Q98A 4RH0A 3NX4A 5H02A 3RVBA 4AD8A 1Z13A 1MRSA 2GH1A 4QU5A 4WZ6A 2X4LA 3WGMA 5CB8A 1HLDA 5DNUA 5K03A 4A16A 2C4UA 4DEXA 3U81A 5DTJA 3QF4B 2XUHA 5K8JB 1Q77A 4LDNA 1PNVA 3A6GA 4Q1FA 3LQ4A 4BIIA 2N1MA 5C52B 2JGAA 2OFWA 5I9TA 3VPSA 4PYIA 1Z8HA 1CSEE 3LK7A 2ZR8A 5FUVA 2VEDA 3BWXA 3KALA 4MVJA 4BN4A 5A6SA 1Y6JA 1WV0A 3TL2A 5LNK1 5DW0A 1E2EA 1AH2A 4OQDA 5AHXA 1DO8A 3UENA 2VT7A 5B12A 4I0WB 1N9GB 3ZGZA 1KRWA 1Q14A 3RUIA 2RK4A 4YR9A 1SCJA 4UDNA 5B2FA 2PV0A 1L8LA 1NZJA 2Z58A 2ID7A 1W0CA 3L7LA 5DXJA 2P2NA 4BB6A 5M2QA 2CYAA 2K87A 1LBTA 1VIAA 2F64A 3M9WA 1HT0A 4TRNA 4B3TB 1H42A 4RH1A 5I7WA 1OXSC 4R1NA 2Y71A 4ZTBA 1ODIA 2R8ZA 1ULAA 2QAIA 1NN0A 4S05A 3H9EO 3UICA 1I30A 2GJ4A 2QLMA 1P0PA 1Q1EA 2BGTA 2DTEA 2HNKA 4G8CA 2QMOA 1X7XB 3EXHA 3D5EA 3IUNA 3QJ5A 1TFUA 4RD3A 4ER3A 1AUOA 1YA6A 3P5BA 3KQSA 4NIMA 1UDRA 4QOJA 3UJHA 1I2BA 3AETB 3H5IA 1I32A 2PT6A 5JS1A 2F8SA 3NBUA 5HF5A 3QU2A 3AVUA 4MYSA 3HKDA 2QYHA 3KLNA 4HO1X 2HLPA 2FW8A 2CBZA 3F4BA 2HZBA 3I61A 1BG6A 4PG4A 4WZAE 5A06A 1Q3HA 4W1PA 4JJ6A 4KE7A 4DARA 5DI3A 1AZWA 1FMFA 1Y1SA 2BKEA 2IHJA 1R4NA 2ZDGA 4WSOA 1K3TA 4NBRA 1NJ2A 1Y48E 4KBYA 2COUA 5L4NA 3CX8A 2I6XA 3H4IA 3ZHXA 4BQNA 3KUXA 3SS8A 3KKLA 1ZUWA 1TQHA 4DCUA 3GCWA 4F3KA 4ZCMA 1NM5A 4B33A 1LSSA 1NXPA 1O8CA 3V8BA 3ZWAA 4RK5A 5BYKA 4CLOA 2YMQA 1JG3A 1WDWB 3AEYA 4DLUA 1KQFA 4JOCA 2GBIA 1TVKB 2PZGA 1C1YA 1NVFA 2VA9A 4W8OA 1F8XA 2VAPA 1BFKA 1SHZA 1P0IA 3GWGA 1WW3A 3OIGA 3Q5EA 4O4HF 3GP3A 2G9UA 2YVQA 1OWNA 5K0NA 5JPIA 4NG5A 4F6CA 2RE8A 3OT5A 4FZVA 2NAPA 3P52A 3CZ4A 4E22A 1Y8CA 2FZ4A 3BOSA 3STHA 4UQLA 2VRCA 1BCSA 1MIOA 3N2EA 3VVMA 4BEJA 1E5QA 4XRRA 1KZ1A 5CYPA 4ESHA 5LN1A 3PRYA 4I08A 1ZAKA 2OZVA 4K87A 1COZA 3FTQA 4L75A 4CQNA 2E2WA 2B6HA 2H11A 4YRTA 3VV3A 2JFUA 2GAJA 2XVZA 3GUZA 4RMGA 3J7AC 3OZUA 3N28A 5HBGA 1TRKA 4CFSA 3EJWA 4MIOA 1DUIA 2GPBA 3NV9A 4PN7A 1NQVA 1C2YA 1T15A 4KFTA 4LDJA 4U7HA 2V3CC 1XTTA 5CBKA 2NUAA 1MABA 2E4YA 3SMQA 4LFBB 1BH6A 1WSWA 1C3LA 2KW5A 3H11B 4P4SB 4JI2B 2EFGA 4MKXA 3RUPA 4E1VA 3VOBA 5K0CA 1URPA 2EZTA 2ZWPA 4Y2YA 5JWHA 3COVA 4KLZA 2ZI9A 3UCEA 1A8UA 5HM6A 3IB3A 5ALDA 3I8SA 3F96A 2L69A 4LRUA 5HX7A 1D7OA 4Q93A 2NVBA 1JA0A 5D5QA 1U4OA 3R2JA 2G5GX 3SLRA 3GJTA 1B0AA 3DVLA 3GEEA 4GO1A 4IWNA 3VTAA 4MGIR 1BE0A 1B4DA 4G5HA 3L6CA 1JNXX 3PX7A 5KJ1A 3OH8A 3LXMA 5EN4A 4ZVVA 4IDDA 1UBCA 2AHRA 1PJLA 3LGSA 1U2DC 2IEIA 1IBCA 3PDIA 3IEVA 1A5BB 4IX9A 1CKEA 4LPKA 2ISQA 4FPXA 1IXRC 2BC9A 1XZDA 2VFAA 1SHKA 3T3NA 3G49A 5C1BA 4J0HA 1ECGA 4HI0E 4ZWNA 4MVJM 3WLTA 1FDIA 3P9CA 1HETA 2BGJA 3BBPA 3D0OA 3QEAZ 1SXQA 5BSKA 4Q1VA 4F7DA 4BZPA 1JAHA 1E4YA 3QYAA 1M76A 5ENVA 1I5RA 3NIDB 5BNTA 3L6OO 3GLIA 4LNAA 4RMNA 2H2FA 3MMPA 1N5DA 1FTGA 1SHTX 2BFFB 3IUMA 4GX2A 2GZ2A 5CFRA 4INPA 3BRCA 2P1ZA 4X97A 4ZDJA 3CLUC 1OAOA 1BKDR 3FJ1A 4PANA 2F3TA 4GKKB 1LU9A 2ZJ6A 3I9NA 1OIWA 4B3MB 5B7PA 2AXNA 3IVRA 1X8XA 5EEHA 4OGKA 2PKCA 1P77A 2PRJA 3IOMA 4KE8A 4UTZA 3WK9A 4BMVA 4PSAA 3GAFA 1TA0A 2D0IA 3TX2A 4OXQA 1T4GA 4WH0A 1V9LA 3ZWNA 2HTFA 3E7WA 4N41A 2C2YA 1XL1A 4P53A 4PYOA 4D9FA 3IV6A 4RF3A 1DC3A 1NURA 5JC8A 5LU8A 2C7RA 3OZFA 3GJQA 4JUBA 3BGVA 1ZYUA 2C7OA 4DS3A 1KI4A 3H2KA 1ML4A 2EJTA 4Z8YA 4KKVA 5DBGA 1IN5A 3ONWA 1G18A 1OKKD 1CYDA 5F7XA 4JS0A 4KGZA 4CR7A 2XAUA 1I3NA 1Q7BA 4AZ0A 3TLKA 4AY2A 3ONNA 4XGIA 2VPYA 3PITA 4Q3EA 3VV2A 2HEIA 3A4VA 3B8HA 3HY4A 4Q37A 2DQYA 5JXGA 2VJYA 3WZ2A 1SOWA 4EUFA 4CMIA 2HWKA 4EITA 1UZUA 3H1BA 5L6MB 2CLOB 4BCCA 2IH4A 5IASA 2PL1A 3W79A 3Q85A 2H48A 5IZ4A 4XZ3A 1U0SY 5DULA 4B3IA 3S5JA 1FVXA 1YE3A 2O0MA 1SVLA 4OHPA 4C4OA 4BE7B 1JALA 3RKRA 5BOSA 5K3SA 1DG1G 3SJZA 1Y1KE 3SFVA 4BO0A 4HTAA 4IILA 3QLJA 1XU4A 4HBGA 3E6AA 2VDJA 3HCPA 3LBAA 3L7KA 3VH1A 3IQEA 4RM3A 3RTDA 1JDTA 5EIBD 2I7DA 3RTCA 5T3YA 1M54A 4HAUA 1W5SA 1H4QA 3KR2A 3A0UA 3S28A 2BBOA 821PA 1D2NA 4EB0A 2WJAA 4HUQA 2WU4A 1PYDA 4HATA 5LBTA 1WY5A 3FGPA 5EWJB 1CUCA 4K9LA 4L4UA 4EI2A 2W6JA 1B3BA 4N6NA 1JAXA 4I3HA 3KWFA 1MQAA 3IAS6 5EXTA 1NXTA 3CLRC 2IHYA 3KIPA 1KMMA 4W5RA 4CIAA 4ATNA 5AW3A 2IITA 3HADA 1F2TB 4PG5A 2I78A 4IZHA 3DBLB 3P9YA 5HW0A 2IHTA 1YOVB 2QLTA 4DR7B 1T9HA 1XEXA 2YWEA 3KX2A 4MUFA 4DRYA 2REQB 3MB5A 4EZIA 4WLFA 3OE7D 3IPAA 3AR4A 2P7IA 1ZR4A 1EWVA 1PGPA 4BO8A 4YCAA 2PUFA 1S01A 3BIFA 3QVLA 5JXJA 2DKOA 1N5IA 5HZKA 2ICAA 1GLVA 4OHFA 1EFHA 3DCYA 3QXSA 4WJKB 4HLQB 1E1KA 1Z2NX 4R41A 1MZPA 3FVQA 2ONYA 3QFCA 3ANNA 1SZPA 2PUVA 4WE3A 1J9GA 5DTMA 4HN9A 3G0IA 4EB8A 1A3CA 4Z2AA 4RPJA 1VSUA 4H3KB 3RU3A 5DN6A 2WV9A 1CVIA 2XRFA 1E18A 1FK8A 1M1NB 1T8UA 2ES4A 2YJ5A 4JFRA 1Z7GA 1PRYA 4IIHA 4HH0A 4MWBA 4OK3A 4UJ3A 5DNAA 5FA8A 5H9VA 3JD2A 4YI5A 4YBZA 1ZCJA 5KI6A 1AKTA 4CETA 3AM1A 3KQMA 5HEKA 5LVAA 2IS6A 3NONA 3GJ8A 4HDQB 1IHDA 2EX0A 4EUNA 2KMLA 4Y6OA 2DERA 4TS1A 2JAHA 4HN4B 5DFAA 3AFOA 5A9TA 1Z17A 4BNHA 4N47A 1JH9A 2OTCA 4ALKA 4G1MB 2Z2ZA 1J24A 3CR8A 1W7AA 1K92A 4IGFA 3K2QA 1X87A 3PUHA 4MRNA 3FWNA 5HILA 3VR2A 1S0UA 1D9ZA 1TECE 5HCIA 4HG2A 3PICA 3CUSA 2JIDA 5J63A 2O0KA 2BTEA 5EY5B 5CA1B 2IKSA 3RAFC 1SXJC 2YUTA 3GRYA 2BMEA 2ENUA 3PFFA 1QJCA 1U5AA 4DWVA 5T8KC 5KHAA 2VJAA 4CIWA 1U2GA 1YZHA 1GQYA 3SR3A 5LYJA 3V4SA 2VN8A 1B23P 2VHWA 1RE1A 2GUGA 5FT9A 1JSCA 4Y8VA 1C7JA 5BPFA 1JYEA 4XPIA 5D5HA 3KZCA 4JC8A 3UC9A 2NWQA 1OT3A 4WADA 2KBEA 3EA5A 4YRKA 3O5AA 1GSIA 5DHTA 2OAGA 3W2EA 3KEMA 4JOQA 3L8DA 4BTLA 4YDHB 1BWQA 2Q3DA 1THTA 3AFIA 4ETNA 2QM0A 2JGFA 3BAFA 3MCVA 4OUKX 2NXNA 1KPGA 1Y7IA 4DG8A 2AV6A 4UD6A 3C7CB 1WCWA 3GMTA 5C1PA 7GPBA 4X1KB 2HGSA 1RM5A 1Z73A 1JHYA 5FULA 1PR6A 4R1PA 5LSAA 4PAGA 1H1DA 4OB6A 5DNVA 3K6JA 5AHWA 5AW9A 2P69A 2HU8A 1UKVY 2OO7A 2XUAA 1CF4A 3O8OA 1VL8A 2CXSA 2CFCA 3M4JA 3OJWA 4GMGA 1KNQA 4MI3A 5FLEX 4RF4A 1UM9B 4DOMA 3RJZA 1E2KA 4U39A 4B8YA 2G0TA 4AG3A 4JJ7A 16PKA 1AKNA 4LRWA 5AKJA 3H17A 3BBLA 5A4IS 1NC3A 5IDWA 1RJGA 1ICEA 5L7TA 3NWEA 4MB0A 4TQGA 4XTRA 3M1AA 1JHOA 2JCVA 3ZWDA 621PA 4OFZA 1OI2A 4OMUA 5L3ZA 1GSHA 3MJ4A 3NAGA 1Z62A 4L5IA 4ZAZA 1SHUX 1W2GA 4G9GA 1TB4A 3KQQA 1JECA 3CNHA 2ERXA 3D0KA 4I6EA 2VBFA 4FGKA 5K8LA 5AJXA 1GT91 3C3EA 4GE3A 5E6SA 1SWWA 5AO9A 3SS9X 3LQFA 3ZWKA 4C0WA 1UAAA 1DEXA 3IVCA 5FPKA 4MRVA 3ZDYB 5C4IA 3DEAA 1HQDA 3EF3A 2IKQA 2QZ9A 1FTWA 3I2IA 3MWEA 5IVIA 4DYHA 5AK0A 3PQ3A 5KOIA 3MUFA 5IN5A 3DCIA 3Q6IA 3OE4A 4IS3A 2BL4A 2Q49A 5B4TA 3NTLA 4QJIA 3VC2A 2CDCA 1H3EA 1W87A 4YIHA 2A5JA 1QU2A 1V11B 1OLUB 2V6IA 2AG8A 2HSDA 1KMCA 1RI5A 1XA0A 1B1CA 5K3EA 3X0DA 3UFXB 4M9ZA 3UMMA 5ALMA 1ZVKA 2C9MA 5DGDA 5FLKA 2XRYA 5CT4A 2YWHA 4JNCA 4KXXA 1XHLA 3NGMA 2VF2A 2IXBA 2PGNA 3AL2A 4NR0A 2ZB4A 3KQPA 2NUBA 2BKVA 4X7PA 3TEFA 5I7UA 1OT5A 2FJPA 1KE2A 2V7GA 1JFFB 4DB4A 4CU2A 4NF2A 1RWXA 4WEQA 1L9XA 3BPSA 4REMA 2RGWA 2R0QC 1T2NA 4I8IA 1DT3A 3NOQA 1UP4A 1QV9A 2E4VA 5TPWB 3W0LB 1T6YA 2XNSA 3EW7A 3AM3A 4GIBA 5KVVA 3D6UA 4X85A 1NRXA 1C8KA 1O6ZA 5DYYA 2HBYA 4YJ3A 1CZHA 3IOCA 5BNZA 3L8HA 2P5YA 3PEWA 3T61A 5FDFA 3ZZ1A 3P4UA 4DNQA 2XTZA 3C3CA 3DULA 3G7SA 3MSCA 3LL7A 4M1EA 2NXEA 4PM4A 5FOTA 1NGSA 2FMKA 4OKIA 4CRWB 3DDHA 2LCFA 2LCQA 3CZ5A 1Z5OA 4GI3A 3TQOA 2PL9A 3QXXA 4BLPA 4BMXA 3AJ8A 3NQ41 2PUJA 1VPVA 2ZS8A 3VX4A 5C1DA 4RY2A 4BNNA 4X7MA 3AQ4A 1M0TA 5F64A 2Q1XA 3D3NA 4A0FA 2ZE7A 2BCEA 3PC4A 1Z6GA 2QRPA 3CURA 3GX1A 4NCKA 1U8XX 2XSZD 5HG0A 3H8WA 4B6GA 2ZRIA 1MH1A 3G5UA 3O94A 5E2IA 4Q3KA 4TZKA 4DSOA 5CNJA 5JTUA 2P2DA 3FB1A 4IX1A 1J1UA 1KYQA 4M1WA 3OIDA 4NFSA 3UUFA 4UCQA 3K4QA 4K6CA 3KAPA 4NL4H 2Z57A 3NANA 1C0IA 4NAHA 5E7QA 1CS0A 1NBAA 3UEOA 3VO9A 5LQKA 4EJSC 3PHGA 4FR5A 1SU8A 1WPGA 4JFAA 2XGSA 5JEDA 1PR0A 2EVWX 3HSYA 4B35A 3NHAA 3TVDA 4FBGA 3M5PA 1HE5A 4EW1A 2WMOB 3IGFA 1F0KA 1UXOA 1H3NA 1P4RA 2YYAA 1J8VA 4PNZA 2VAXA 2IPAB 1L7RA 3WZMA 4NE2A 1JFLA 4GOJA 4WK2B 4X60A 1KVTA 1WXIA 2PFGA 3D6NB 5HGJA 3WYCA 4K6KA 2GT1A 1KE1A 3FTFA 3NBMA 2VHQA 3QH4A 5KIAA 5NLLA 1W0KA 2ATCA 3O4RA 2XMQA 3WGLA 1SC3A 4ZIRB 4KN8A 2YDXA 3OJEA 4ILEA 3OPYB 1QDUA 3O7WA 4ODIA 3GJ6A 3FJYA 3DBOB 4GOXA 4CKBA 4EJSA 4F72A 2E21A 4AY4A 4H7IA 1QGYA 2G63A 4B40A 1OIXA 1UMCA 4C1NA 2B0JA 3LX8A 2GHRA 3KOXA 2XZDA 1WP9A 5DN6D 2PCJA 6REQA 5EYPA 5AXBA 4WKPA 3FOAA 3FLBA 4D99A 4EMBA 1R5JA 2YIMA 3DAHA 4HX2A 3MMSA 4F21A 3IUQA 4EYKA 2BUBA 4J7XA 4Q9LA 1HOTA 1RWWA 2FX2A 1IJKA 3FCYA 4EPWA 3M4NA 4TKZA 4H7FA 4HB3A 3B9BA 3Q3EA 1OA1A 3MGGA 5CGQB 4HQNA 2B4TO 5TGTA 1T0PA 3NJRA 3T52A 3U3KA 1ODKA 4OBWA 3UV7A 4JI6B 5DB4A 2BVNA 4AKEA 1SVOA 1AGRA 1MAVA 1D7AA 1EFPB 4MV3A 3KJXA 4GPZA 4GP6A 2XMCA 3FLMA 4Q6WA 2ODTX 2ZULA 4XFKA 3VC7A 3ZW9A 3OX1A 4GR5A 3TTSA 1LF5A 4CDRA 1T4DA 2Y27A 4YP1A 4RW0A 3COZA 1VECA 2P30A 1D4FA 2P3QA 1HQKA 2C57A 3KCQA 4IDEA 4KLCA 1Y4SA 1BEUB 1T1JA 1YK1A 3NOXA 3B3QA 1V39A 1N2XA 5GJBA 3MCUA 3R0ZA 4JENA 2E4XA 4OXKA 4R16A 1FNCA 2JIRA 1IVSA 2CUZA 4CDMA 3EGCA 2RHLA 2ZCJA 5I7HA 3CW9A 5I9MA 4BKPA 3LDUA 1KFKB 1OY1A 3OPQA 4EHIA 3GLSA 4X64B 1MT3A 4A6DA 3ED1A 5FL3A 4MV1A 4BHTA 3BXEA 1IWOA 3WLJA 3ORRA 5LYJF 4Q5IA 3U4CA 3K35A 4JB3A 4OMFG 3UAYA 4IVNA 3VUEA 2YWBA 3GXOA 3OA2A 4M9CA 4ID3A 2UZ1A 3C98A 1SPXA 1J2YA 1EAYA 1WPQA 1ZJ6A 5D8DA 5E9QA 1X74A 3OLYA 5BQ5A 4CU5A 2FQ1A 2HIAA 2JEYA 2XJ9A 4L5JA 4X61A 3U0VA 4IGIA 4ZCPA 1G8MA 3CZAA 3VR5D 4C5AA 1SM4A 2ZYUX 1CF9A 4JDUA 1U1CA 3M81A 4Z4FA 4Q1BA 3ZCVA 2FVYA 3OIUA 1LA2A 2A9FA 3N8KA 3GC6A 1JKJA 4RKQA 5CRIA 1HDOA 2FP3A 4O1HA 1PTJC 4OMCA 5AJZA 5KVAA 4JNKA 3EF0A 1XNQB 5TJHA 5CVVA 1DO2A 3K71B 2QAGB 3ANSA 4OI1A 2BLNA 5F1PA 3O90A 3QWFA 2V3VA 1XMVA 4RKEA 2QT9A 2X8BA 3CRNA 1G20E 1XZNA 3EFHA 3ZHUA 4FYIA 1YB1A 1VKHA 3W5BA 3B89A 4FDAA 3D9QX 4PWYA 4DBLE 4LDRA 3MWDA 4MQ4A 1T2UA 5IU6A 2EX1A 3LK6A 4XYGA 1F2DA 3WHKA 1JMKC 4MWTA 3WGQA 3OMWA 2QTWB 2LXNA 4KSCA 3ZHSA 4KR6A 1EX9A 3IEUA 1PR2A 4Q66C 3N0VA 1OXBB 1OH7A 2WDPA 3QMWA 1E5VA 5FWAA 221PA 2BELA 2YW9A 1DIAA 3EULA 4IV8A 4EUKA 1PTJA 3QEKA 1YULA 3FWKA 2FDCA 3N2LA 4Y30A 1UFQA 2QJOA 4H16A 1QFSA 4BX8A 1XWWA 1NU6A 3AOEC 4AIRA 1R0WA 2A1IA 4WFKA 5FXMA 1CJVC 4DFDA 4ZCRA 5DLYA 4DDWA 4MOWA 1JT9A 1SA0A 3C7DB 3L0OA 1L7NA 1J5PA 2H9YA 5CNIA 2NU9B 2NO5A 4NPAA 1PSWA 3CRZA 5LUBA 4EYOA 5JSHA 3PXUA 1P6UA 4CG1A 3WNVA 1G8SA 1EKXA 3IJ5A 2J6BA 3U5TA 3FN4A 3FJOA 3T9EA 3EBOA 1V8FA 2IUEA 2XMGA 2LIPA 4FNOA 1DL5A 4IIJA 4Q3CA 5CT6A 3RQSA 1NW6A 4NOLA 5TQ0B 1QTIA 5ARBA 3OTIA 4YX9A 1H8HA 1Y9ZA 2ORED 5IM4F 3TTVA 3R9XB 2JIPA 1OV6A 1WU7A 2JASA 3TMYA 1QO0A 4LTNA 4U6SA 3LQRA 1KPIA 1SKBA 3A14A 5FQOA 5LOVA 4EIWA 1PNQA 1PFYA 3ORSA 3PVCA 1RM3A 2P9FA 1XC7A 4F8EA 2GCOB 2OCXA 2Q4OA 4FFBB 4G56A 2G7MC 1E1RA 1VCOA 3JX9A 4S1WA 5A3RA 3P9QA 1A9XA 1XDDA 3EY4A 4JZKA 4ENVA 2DHEA 4WBNF 1X80B 2FGKA 2QM3A 4CN8A 4F2DA 4WZZA 1PT7A 3HXQA 1HUQA 3M4YA 3HXMA 4D6PA 3ILSA 3U7HB 3KB2A 3NHMA 3ZY6A 3H9QA 1QK5A 2N0SA 3OVMA 4WQMA 1NE7A 5CDYA 1BOOA 1OLXA 1RKXA 2UZ3A 1FFXA 3WLOA 4CKWB 1JFTA 4H1WA 1EVQA 4QYIB 1YJAA 3C39A 4HBZA 3V1LA 3IXQA 4X8HA 3W1EA 3ZCRA 4KQ9A 4EABA 5JCOC 4AW9A 2BEVA 4AMUA 3MOSA 5D51S 5YASA 2M1XA 1RZRD 3KFVA 5BNFA 2Q21A 2O8DB 3BH7A 3PXXA 1AO0A 1BS2A 2F00A 2QE6A 3LE8A 3DMRA 4GS5A 3E58A 2AFRA 2VPXA 2JGRA 3FMGA 4QG7A 4XYBA 5IJZA 4CUZA 1P2SA 1XDSA 2JJ2A 2IJGX 1XXHE 2Y1GA 3BTSA 5WRFA 3ESYA 3TGLA 1A5TA 4OPMA 3N8NA 3F6CA 4FT4A 1P1RA 1B8PA 3WNDA 3DWGA 3V42A 2H7CA 1QCZA 3HB5X 1ZHFA 2ZYRA 1EGMB 2OP1A 4NDNE 1ZI8A 1GDHA 1J6UA 3CGGA 2PD3A 4KWHA 4NOKA 4XSGA 1W0KD 3SHTA 1E9RA 1ISFA 1YC5A 1JWAB 1KH2A 2B1JA 3AI7A 4MVJP 3SHQA 2F43A 2MSKA 2XX3A 4LQ4A 2H7XA 2V6MA 2AW5A 1IOZA 3N2KB 4M76B 4BYGA 3C24A 1Q84A 2F59A 2WP0A 4ZYUA 1Q1NA 4N3AA 5E3IA 5DIZA 3BHNA 1G8PA 5G4LA 4M7RA 5DSZA 4J3JA 3GEIA 1XXHB 2QGFA 5HP4A 1ZC3A 2WIJA 3GRKA 2CDNA 3L46A 2RAVA 4IIXA 2HK6A 5IVDA 3GY0A 1KDVA 1EU1A 3E8XA 1GUBA 3DE6X 2KS6A 4G25A 2GN6A 5DGCA 3LGXA 1PL0A 3H5LA 3E53A 4JQYA 3N8GA 4OJMX 2OQVA 3GH3A 1XHEA 3AHHA 1R9JA 3OOSA 4LXTA 2ASEA 2BFCB 2IBTA 4WRRA 4M1ZA 4HNUA 5HS4A 2V7PA 4U7WA 3GDHA 4OLFA 3HRIA 1P9WA 3PA8A 5I3ZA 1NQXA 4GSKA 5J9FA 4KPUB 4P7KA 2RK3A 3K16A 5JATA 3RFFA 1J07A 3RYFB 3M5DA 4JJFA 5K6AA 3WOHA 1S7CA 2Q7DA 1MHTA 3ZNPA 4MZXA 3NWOA 4BL5A 3LA6A 1XWIA 5KEIA 3D2CA 4RE5A 5EIHA 1E1CA 1FXUA 3QITA 2HRDA 5IBPA 5LMNB 3AP2A 3WBBA 2C5EA 2Z6VA 2O2IA 3A3OA 4Y2UA 4QPZA 1AQJA 2NP7A 1M5TA 4R1LA 3UAWA 3EBPA 4WTOA 5E7IA 4JJ8A 3K6KA 1E32A 3P20A 1OI7A 4QUGA 4C3ZA 1A04A 1C9NA 2HJ9A 3LVRE 3R20A 5H59A 2Y1XA 3LZCA 4GBGA 1F0NA 2RHGB 4IM7A 2AL7A 5CP8A 4DLYA 4W9MC 3K9FC 4BATA 2J3LA 3F74A 1PAUA 3NHKA 1LLCA 3T5GA 2B8NA 5I8PA 4GGPA 3TDKA 4F85A 4JWKA 5H68A 1NJ8A 3BWEA 3EIOA 1RI2A 4Q05A 5CCEA 1ZG3A 2QM8A 1IQ0A 2R6R1 2A1UA 1F8FA 2BDUA 3LT4A 4PCAA 1DIGA 2Y0BA 4RJKA 3WGHA 5DH9A 4EM6A 4MA0A 2PPLA 4P83A 4JVSB 3W06A 4BJ3A 1IZ7A 1YDGA 2PDAA 1ZNQO 3G89A 3Q7SA 4UC0A 4EW3A 1DQNA 4B4UA 2WWRA 4G1UC 1S2NA 4NULA 1Q50A 1K75A 3B78A 1YASA 1DX4A 4QGFA 4YJFB 4F4JA 1I6LA 3RU2A 5BY2A 3HSSA 5CB4B 3AB7A 3ROMA 4DLTA 3PGKA 3E3OA 1C0EA 1BIFA 3LCRA 5IBRA 2QYTA 2JF0A 3GPCA 2YYSA 4R3NA 1QRAA 2PGXA 1Y4DE 1B1AA 3GFBA 1Y5NA 2DX7A 4EA6A 3VSEA 5JJLA 4NCIA 2ZI6A 4FKMA 1PF7E 5EKSA 3WIOA 4P82A 1G19A 4W8GA 4BC0A 4BECA 3VR5H 4WCVA 4DSUA 4BX9A 3FDZA 1THGA 3ZDXB 2FCAA 4UW9A 2CZQA 1XL0A 4ZVNA 5LZ2A 1HSOA 5FUQA 3DYIA 1J8MF 1OD6A 1HZZA 4IZOA 3ZBTA 1FTSA 3V1NA 4A03A 4CT4B 1H0KA 1J0XO 1OFVA 3E05A 3ZWCA 3OTOB 4IDAA 5BYJA 4XFDA 4EHAA 2AYZA 1CRZA 1TK2A 2BFDA 5JZ9A 4A0QA 1QR6A 2F62A 1U0NA 4KRXA 2PX8A 4DC0A 4K6FA 1CHDA 3GQBB 3PR3A 3GBVA 4D2IA 3RCBA 2AUMA 2HCBA 1H2ZA 2JBHA 2O7SA 3DPSA 4HTFB 4ONEA 1ZICA 4L50A 3DWFA 4RJ2A 1FP7A 1ZK3A 4CGYA 1EVYA 3VBCA 2V55B 2JVJA 4JUDX 1G291 2CN1A 3M8KA 1IIBA 2DETA 3RLIA 2C99A 3HDJA 1U2EA 3CWCA 4X3CA 1LSOA 2ZSDA 2CMHA 2FV8A 2M98A 5EXEA 2HA6A 1P1HA 2AX3A 2DLNA 1KOJA 4J0KA 5DXFA 4YT2A 3T0IA 2NTEA 4WZBA 3TW4A 2PLAA 1GOTA 1N8SA 3L6DA 3T35A 2EHDA 2YASA 2WTEA 4CLHA 2FMFA 1HURA 1NZDA 2NO1A 1S89A 3R5SA 4G1BA 1ENYA 3F5FA 4U2DA 5K3BA 3VHXB 1QOPB 2I6QA 4MUAA 4FFWA 4BFZA 3DZBA 1YRBA 2R87A 3EFEA 4GYWA 1QO0D 2D62A 3BJRA 4P0PB 2KPOA 5E2AA 1XEWY 3NP7A 2MDTA 5DX0A 2VF4X 3JD4A 3I52A 4UVDA 2CVPA 4LIPD 3U1BA 2GD1O 4NU6A 3H75A 2APJA 2FRVA 2NUPB 4BNDA 3T3MB 4JVOA 1NL3A 1DXQA 1M6YA 1P80A 2QX4A 3FD8A 2QT1A 4MJXA 3RIEA 4EBFA 1YZFA 3G3EA 1LBSA 3L82B 4IIJF 5T41A 2XQVA 4X90A 3R3XA 4BFYA 2GQ0A 4Q12A 1I24A 4IDCA 2J48A 1ST2A 1L5RA 3CRVA 3FZEA 2UVQA 1RP1A 5FI1B 1ONSA 3HABA 2G4LA 2CNLA 2VJLA 1G5TA 2BM9A 3QU9A 1O9HA 1DCTA 4DCTA 5LUAA 3JVEA 4BBZA 2FWAA 3G88A 3R3HA 2WFLB 1LPBB 3IP9A 1MJ5A 2DY1A 3QJYA 1JSXA 5KX5F 3ZV7A 1RPNA 3T5CA 1ZRNA 4KIWA 2QIPA 3A1WA 5DO9A 3KT3A 2UUPA 5JYCA 5C46F 2X14A 4KOAA 2BMWA 3GEBA 4NE7A 1SKMA 4PYJA 1ZGBA 2D74A 1HEIA 3IAAA 4WINA 2IYAA 4LXYA 3AKCA 4YAFA 4LSGA 1DC6A 3VX3A 1IEVA 3KVYA 1EBBA 4PPYA 4QLAA 2M6LA 2I55A 3AHEA 1EFLA 3CF4A 1T0JB 4PGFA 1P44A 4RKRA 5C8VA 3UK2A 1DWQA 2X13A 4GECA 3QUQA 4NDAA 4MICA 2FPIB 3EMBA 2NLOA 2JG3A 3DV0B 1BYUA 1VOTA 1GRVA 5BWLA 2XZPA 1HV8A 4MB6A 4ND4A 5LBIA 1PE0A 3GP8A 4KC0A 4YLYA 3KB8A 1NE2A 1OV4A 1Y1PA 2JJ2D 4URUR 4HWTA 2VP5A 5EWMA 1H6CA 2R6GA 4G3XA 5HOQA 4RK6A 3D7NA 4IR7A 1J8FA 3W8NA 3KZXA 3UJ6A 3VKHA 3GDOA 3ETNA 3QTTA 4DPLA 5DXAA 1EEHA 5ES4B 1NQOA 4QNMA 4XB1A 3K9GA 1ADGA 2NU6A 3CPSA 3HH8A 2YZGA 1EUCA 1MOSA 3IA7A 5AICA 4HNVA 5G53C 1D1PA 4TSFD 2QT0A 4P0QB 2WSSA 1E6CA 1AV7A 4D56A 4R01A 4A6XA 2AXEA 2V3WA 3B2EA 2DBRA 3P0RA 4OXNA 2DB3A 3EIWA 3DOEA 4GOMD 4I1RA 4I81A 3PA6A 1BVUA 4JX8A 3EDYA 2DUUA 1C29B 1HC7A 1L4NA 3KDPA 3VSBA 3SKVA 2CXOA 2OZLA 1PX0A 3CT4A 4IFIA 1XALA 1TMYA 2ZJYA 4YP0A 1VL2A 2X3UA 3MWKA 3WGZA 2BEWA 1ILWA 4UU7A 3REOA 1IZ9A 4UM8B 3WKCA 5JY6A 1ZGAA 5K0ZA 3TSOA 2PS1A 4CCYA 1N2SA 1RVV1 4Z1OA 4FVTA 4MVJE 1JSZA 1D09A 3KKNA 2CXQA 4L8YA 4X54A 3IERA 2H51A 3ICQB 3D2BA 2K7ZA 1J0CA 1PVVA 3G02A 3R7NA 3T3DA 4EB6A 3WADA 3JAWA 1NQWA 2DU8A 4PBSA 4C7OB 3MGKA 3WX0A 5L6LB 4AQDA 1GGEA 2JGMA 3R0VA 2BD0A 1XFDA 1SUWA 4NCHA 2FR8C 2RFLA 3W8EA 3SNHA 1A77A 2Q5QA 2V45A 4LEIA 3T41A 2NP6A 1NR7A 1T35A 1VCMA 3IVAA 4M0LA 4DUGA 3KSZO 1B73A 3WSWA 4F4IA 3A3KA 3PSAA 3EAGA 4KMSA 3RIGA 3Q7TA 1G7TA 2HFJA 4KACA 1XQ6A 4QFCA 5F5XA 2CJWB 1NNEA 3DOIA 2VSNA 2YNMA 4GI1A 3AFMA 1MMFB 2SNIE 3WP1B 5J2UB 1I9GA 3H0EA 1C5KA 3B5JA 3VM6A 5DT9A 3HLKA 2AN1A 4MRAA 1CY7A 2YOFA 4AN0A 1PQPA 4BRSA 1JAZA 2WJIA 1GPNA 4HAYA 4NAVA 3VZSA 4D1YA 3C15C 1EUDB 4JCOA 4OJQA 3SQWA 2E6KA 3GHYA 2ZSIA 3NPMA 1K8ZB 4HNSA 3CZMA 1BQEA 3DAYA 3NRBA 4N3BA 1E94E 3OZBA 1XLTA 9ABPA 4ASUA 2C42A 4AO7A 3NNSA 1MPXA 4G97A 2FMTA 4M0MA 3SLKA 4INAA 1F2UA 2D06A 1TZ2A 1CW2B 1JU4A 3HWRA 1MJGA 3NJ4A 1R66A 4OG2A 3NIWA 3HCDA 5IYZB 4QEDA 4RA6B 3CX7A 3V7UA 3A04A 1C0KA 1Q6ZA 1Q1BA 1DDGA 1SRQA 1JKXA 2B25A 2X5OA 3C6ZA 4BMOB 1J5XA 2ZJ0A 3K9QO 2D8MA 3CV3A 2ODQA 1D9XA 2D2EA 4LHYA 4JITA 3NCTA 4IVRA 1WA5A 4G24A 4J94A 4NBUA 3TMAA 2E82A 3KYBA 3HGQA 1Y3HA 3GZNA 5BV7A 4MS3B 5TS2A 4F04A 3KTDA 4M21A 3ER8A 3FHTA 1IDOA 1KR2A 2V65A 1W5TA 1ZI9A 1RXIA 2O2GA 4MVWA 1E5LA 2IELA 3HKDB 1ZRSA 4QGGA 4DLKA 2PJRA 2IX3A 1PIWA 4P7BA 2IP4A 3UQZA 2H57A 5KVQA 1ZUNA 3FY4A 1D6JA 3EJ6A 4F06A 2AEEA 2WU8A 2FHPA 3FHCB 5J4KA 4RTOA 4KREA 5DHQA 4GVXA 1HDZA 4GC5A 4XM1A 1KARA 4L9SA 4YR7A 4JUAA 2B7LA 1X3SA 4IHJA 4LYAA 1YVUA 3QKSB 2PUGA 2HA2A 3RW9A 3EYAA 3ROGA 1LDEA 3CEHA 2VZ9A 4JJIA 4URFA 3W3ZB 1K06A 5C18A 5JQGB 5JZVA 4BRWA 5IBCA 3GFFA 2Z1DA 2A5DA 4UASA 3A9TA 3W6NA 1JTVA 3UHPA 2D5AA 3Q3CA 3JRNA 4FCVA 2I1QA 2QRLA 8ABPA 1S2LA 4A26A 1UADA 2PGLA 3EF1A 4W6ZA 3SYMA 3VPCA 4KWEA 1KF0A 1R27A 3JQFC 4J16C 4WW0A 5GVSA 4QTUB 5EINA 4ZOEA 3HCCA 3L1IA 3KJQA 1GLGA 3IEKA 3REFA 2E4AA 3DD5A 1CUFA 3EA0A 5HUHA 4UNIA 3NHZA 5JUWA 1NNUA 4PYMA 3RIYA 3VOTA 1HFKA 3Q8LA 4PC6A 5CW2A 3BFKA 2J9RA 1FZQA 3N2YA 3VGPA 2C07A 2Z30A 5G40A 1XA4A 3BULA 1MABB 3ZHZA 1SQFA 1U0TA 2RH4A 2QD2A 1R6BX 2NYUA 5IW8A 3MG9A 3B1JA 3OF5A 3O47A 4UEQA 1IBRA 1OX4A 4N40A 4NJEA 4ZOLA 4HGYA 1M6VA 2YYYA 4OHCA 4R84A 1VMAA 1BMFD 2J5RA 3NTOA 5FFFA 3TN7A 3IQXA 4B5KA 2WWYA 4L8LA 4TQUS 3RARA 3GDGA 2I03A 1BFDA 2ZB3A 3KPJA 4YJGA 1Z6QA 3QXJA 3EZXA 1UT6A 3ETEA 4IHKA 4EF4A 4F2PA 2W8ZA 2F6RA 1T1IA 4EF6A 4JT2A 1KQGA 3H5VA 3ICPA 1ZXLA 4K3VA 2W98A 1J21A 2J45A 5AQEA 5IG2A 2N75A 3WIUA 3TM4A 1EWYA 2G70A 3IAFA 1N4AA 4ARUA 2HRBA 4D5GA 2J32A 1NX9A 1PJAA 1YDHA 1JIJA 4BE4A 3LOPA 2EBFX 1IMJA 2A9JA 3FSJX 3UJNA 4ZVSA 2GXQA 1QONA 2IEYA 2JNWA 3W3AA 1V2HE 3ZE7A 1FRNA 1DRUA 2AWNA 5DI3B 3RTAA 3V1YA 4DCNA 2BTQA 3FRIA 3ZH9B 1SUEA 3FPSA 4FIDA 5JAIA 1AMUA 1QIIA 1YS2X 2VCEA 2ZU6A 2GCPA 2X0EA 4PCUA 2QTVB 4F9FA 5JCJA 2Z6UA 2JFWA 3K4PA 4RZQA 1VKNA 3OQVA 3PDWA 3N05A 4IQGA 1PVOA 4C0AC 3ZCXA 4UVHA 4AY5A 1YUMA 2XA1A 4DLAA 4ZYZA 2WJ3A 2NQTA 4FYHA 4F4CA 4YFVA 2BI7A 3FWHA 3K1ZA 3S2ZA 3CEMA 2F8TA 4BXOA 1YDMA 4B6FA 4DQDA 1VSQA 3D4OA 2IL1A 2PH5A 3E1KA 1Z34A 1RM4A 4QUDA 2JL1A 4WK4B 3BJMA 3UB2A 5DM60 2F9FA 3UMCA 2GTHA 2YW2A 1Y8AA 3HCNA 4BKOA 5KTRA 4ZARA 1UJ4A 1Q11A 1SURA 3A3PA 4I9NA 3F9CA 5FNVB 2ZBFA 4XVRA 4G09A 2WYUA 5BMVB 1DUVG 1QGED 2P3SA 1PQ4A 1OGYA 3P1JA 2GEJA 1K2WA 2FPXA 4OKSA 4XIYA 5ADWA 5CIYA 4LCJA 2WSSD 3DKIA 3OPNA 3OZAA 4OSEA 3FUXA 4F1JA 1BCRA 3BF7A 3KK0A 3I12A 4JP3A 4D9GA 1ZPDA 3ANTA 4BNXA 2IRWA 1UINA 5DBIA 3EODA 13PKA 2Z2JA 3F7TA 5KSWB 3PUIA 4H4EA 2EL7A 3EGXB 2TMYA 3N7AA 4HLDA 3H5OA 4FKZA 1EDEA 1UZAA 1CB7A 5DNEA 5KC9A 3KCNA 1TM2A 4LY6A 4ISCA 3FYUC 2C8VA 5JJKA 4G6ZA 4RZUA 4ZU3A 2PUWA 4YRQA 4RPLA 1X6VA 2ONCA 4MUYA 3HL4A 4B2IA 4B76A 5B3LA 3OQJA 2H5EA 1BH2A 1I3CA 2BEJA 3UHOA 5D84A 2WJWA 1FSSA 1N8TA 3LUDA 5C37A 1QRTA 1YVDA 3BE8A 5CCDA 3DUFA 4YRIA 3U3XA 4TGLA 3G0GA 5DPMA 2A86A 2VO1A 4Z9YA 3CJRA 1YMQA 4HB2A 2D00A 4GVPA 4UAGA 5JEEA 4DR3B 2Z5LA 2P2CA 5H4GA 4FC6A 2FFRA 3MC1A 5I8ZA 1O5OA 1FNNA 1UBGA 4M0EA 3RJ9A 2O1WA 1NQAO 3NEPX 4HDAA 4R83A 3GD7A 4RWEA 1G21A 3FYUA 2ZZKA 1KY3A 5CT8A 4AJEA 3GGSA 3NBAA 3ZY4A 1B14A 3IT0A 3GUYA 5FLXA 1IHPA 5E1BA 3NVDA 4LZNA 3VOSA 1O95C 1ZCBA 2BWJA 3GJ4A 1NPYA 4RFSB 4YV7A 4ZDKA 1EEXB 5E9JA 2W83A 3OCJA 3VNUA 1J7JA 1CNFA 1ZONA 3AVXA 4DLXA 1XMOB 3QY0A 5CURA 2FG5A 5DCUA 1FP4B 2E49A 3C3MA 2Y9PB 3CTMA 4Z0NA 4LC9A 4Z3KA 2VYVA 1MJFA 3QLEA 3WYFA 1A71A 2PU5A 2Y2VA 2HO5A 2O2DA 2Z2IA 1L5HA 4WBSA 3ZU5A 2AWOA 1OOEA 3P32A 3HXTA 1QM5A 1H6AA 1X86B 2A9QA 1K5DA 5E0OA 3LBNA 4E09A 1FSZA 1ZXBA 4OP1A 1KOLA 2Q3FA 2X3FA 3BGOS 3NUQA 1F5SA 1L5ZA 1N6RA 1Y34E 2GN8A 2PNFA 2VT3A 2XCUA 3MS4A 3JALA 4CUJA 4M8SA 2OHXA 2YY7A 3DMTC 3FHJA 4XX1A 3R7BA 3KC2A 2AX4A 3QFSA 4GICA 3LZDA 1OBOA 3PRHA 5EZQA 5AT1A 4B3BA 1CZRA 1RC8A 5BOVA 4AJOA 5KMGA 3GLTA 4A2PA 5DM70 2X40A 3SXUA 3Q9SA 3EX7C 1R2QA 1XP5A 1JMYA 1QNLA 1JE1A 3BIWA 1N0WA 3FG9A 3JQ9C 3U3ZA 1D0VA 3QSGA 1JL3A 3SICE 5A4AA 5AVWA 2BMAA 3IMKA 4P3OA 2CFSA 2NSYA 4A15A 4KMMA 1TW3A 4KV9A 4JQZA 3RFVA 4TL7A 2N46A 1EVJA 3RUAA 1T8RA 1PNRA 4P4TA 4QLOA 3BRQA 1HQCA 4UNRA 3CUEF 4V1CB 1SG9A 2YMPA 1A4IA 4WKBA 3UANA 4UMEA 1M2JA 3I0NA 4KQCA 1JEEA 3ZNQA 1JEQB 3F7NA 3P4XA 4KGXA 3V4RA 1E9VA 1EVIA 1CUXA 3UHFA 4DGQA 3LQ1A 1QX3A 4MCHA 3OOWA 1TM3E 4MPJA 4H7PA 4DW8A 2ZK7A 2RKBA 3H04A 4PGHA 3TB6A 2IIQA 3N2NA 4QGBA 5AD1A 5J59A 1SXJE 4FFDA 2RHHA 1ZK0A 5IEBA 1KKUA 2J0VA 2XZLA 5IJ0A 3BN3A 1OLSB 4NZMA 4OAPA 1PG2A 5E3JA 4IHJF 3QEMA 1SUPA 4F3NA 4MW2A 3K32A 5FUMA 1SC9A 4PAMA 1XZCA 4YAJA 1TC2A 1U9IC 2O19A 4A9AA 4IKPA 4JI5B 2R1VA 4YH1A 4F2GA 4BBJA 3HFSA 1SCKA 2YRFA 3K9HA 4TLLB 3IQFA 4W4TA 1EK5A 4J6FA 1H0SA 2H31A 5AJWA 4YNBA 1AOXA 1F8YA 3CUWA 2Q6LA 4A0GA 1ZK1A 2OQIA 4A82A 1Z18A 3EG5A 1RE0A 4UCWA 3ZLTA 2YRWA 3X2SA 3HYTA 3PTLA 3WC4A 2EP7A 3V7YA 5JJ5A 4XDHA 4COKA 4RZSA 1SXJB 4HEHA 3KOWA 2EFEB 2OK7A 4HAXA 3N2GB 4E3WA 2NZUG 5IAOA 2Y0DA 4NU0A 4BLSA 3RF7A 4CTKA 4J0IA 4IFBA 1PR4A 2H0RA 4KL8S 1NYQA 1YI8A 1Y5LA 3ESCA 1U9IA 2GF0A 3F7OA 5GADl 4AF8A 2HT1A 1AV6A 4NABA 3HKEA 5A04A 3E2PA 2A9OA 3FVRA 4FDVA 3Q7QA 1N77A 1BU5A 5AHOA 3TCXB 1M1YA 4BBPA 3B1XA 1NMYA 2BMJA 3MS7A 4FN4A 3N3BC 4H27A 1W9MA 4GZMA 2AZMA 1ZJYA 2F3QA 4JLAA 2IPXA 1BHQ1 2ZIEA 4LKOA 1GR1A 3G0CA 4GL4A 1YJBA 1ZKDA 2PUHA 3U1VA 3UWKA 4CLEA 2WWVD 1DAOA 5EESA 3SI7A 3UOAB 4KHPB 2G1UA 4IRUB 8OHMA 1R6XA 2IBSA 4HZUA 2ROQA 1YR2A 3P2JA 1SGWA 4YPOA 3AY3A 3AI2A 1P0MA 5LZ5A 2GPSA 1B6SA 1P60A 2YHUA 4UATA 2X5JO 4US0R 3FNGA 3RG2A 2P6NA 3U3DA 4BC1A 3L7IA 2QTHA 3K09C 1TTTA 3CG0A 4ZHQA 1ZOSA 4Z5XA 2CJXA 2O8FB 4XD7A 3NUZA 2ZREA 1HRKA 3KWJA 3F6PA 5HUJA 3BZWA 4PHGA 3UBTA 2HA7A 5EMMA 4D4MA 1SZDA 1KZ7B 1ZH6A 3PV0A 1VRWA 4ZV7A 5HDBB 4MUKA 3RVSA 2G5CA 5ED4A 3WL3A 3AUXA 1YZGA 2BGNA 2LDBA 2FJ0A 4W63A 1O7JA 1UP7A 2NU7A 4W5TA 2ZJAA 2I6TA 4WKOA 2QR5A 3B53X 4KK3A 3G8AA 1Z9BA 2MWMA 2PMCA 2DFNA 4HPWA 2EDCA 3I09A 2CNOA 4N18A 4L95C 5DYGA 1ZZGA 4BNKA 2WHPA 4X71A 5DEOA 5LXTF 4FCWA 1B00A 3QOFA 3T7DA 3TJRA 1EB9A 3BZBA 4E2YA 2F1RA 1X2BA 4NI5A 4BVGA 4REOA 1X42A 3NO4A 1KI6B 3UHJA 2OMEA 1GO2A 1TZMA 3MBIA 3E7DA 3BMNA 4U5QA 1MT0A 1B8UA 3IIEA 3VMMA 3KZKA 2G1PA 3FUTA 2DT5A 1W0JD 3MT8A 4IOLA 2PGIA 3JVVA 1H3FA 2J1LA 3D8TA 4Y0NA 3UATA 4XVUA 4K46A 4Z7NB 5HJ7A 3LUKA 2RJOA 1RXVA 1V95A 3UN1A 4JXXA 5CW1A 4IWXA 5BXQC 1TF7A 2NXJA 3N74A 3OQ1A 3QELB 3MRVA 2O05A 4ZYWA 1XNHA 2KLHA 2W6MA 4I36A 2IHNA 3NEYA 2WD9A 1GG9A 2HJSA 3U7EB 3C6MA 5JS6A 4JYBA 3HACA 5K8CA 2JPDA 3K1JA 2QK4A 1JJAA 5LM3A 1Q17A 1N2BA 2YS7A 4ZO4A 2IK8A 2HPVA 1ZD1A 1GTMA 1WJGA 5LYYA 1ZO8A 1MOPA 2QRGA 1AGYA 2X8WA 3A9VA 1U0HC 1PDOA 4L4SA 4YAUA 4CNBA 4N8EA 4WUVA 3SKXA 3GLGB 1G9XA 1ZK2A 2GETA 2ZE5A 1L5QA 2I2XB 3K96A 3RC3A 1IFXA 4HS9A 5C7LO 4HEA1 1UBMS 3H7IA 1CZNA 1E0JA 1SG6A 1LDBA 4PVDA 2XTMA 2LWIA 1SC1A 4ZK2A 5FOUA 2G9NA 3E8MA 5D3MA 1CF2O 1ZD2P 1YJQA 1AE1A 2PWPA 3AGPA 4RIFA 5ALUA 4AXXA 4BO9A 3F8SA 3LT1A 4C4SA 1J90A 4GOND 2XWBF 1JMVA 1E2NA 2XLBA 3ZI7A 2ZJOA 4J7UA 4AM8A 1TT7A 1QR2A 1QWSA 2AJBA 4HFNA 4L85A 5KKAA 3RTGA 2I9KA 1QG4A 1H8ED 2QVCA 1ZUIA 2OC4A 3FBGA 4KQKA 2CFIA 4XPZA 1J7KA 4R51A 3WOVA 3VISA 1PD1A 2VJMB 4D44A 4A10A 1JEJA 5CLJA 5ALNA 5F12A 4XWWA 3GMSA 1YS6A 5KOJB 1M6NA 3AUAA 4GDMA 4A0SA 5DV9A 4QARA 3VYTB 2B0CA 1E6UA 1NUQA 2Q41A 3F78A 4EJSB 4C2TA 2KBFA 1I01A 4NXMB 3UUEA 1T4MA 1ORHA 5IP5A 5HOEA 2VDQB 2J3DA 5A0TA 3LYHA 3MLEA 3PG5A 4EWLA 4L0DA 1LBIA 1H66A 5EYPB 3SOZA 2NYRA 3TYXA 4AMYA 2FSVA 5B57C 1QG0A 4LISA 1A7KA 3KZVA 4U9UA 2DLDA 2R7AA 3IP1A 1TKBA 3VKVA 1ZP6A 5EJMA 4I1IA 2OORC 1DXHA 3OKPA 1F6DA 2F1OA 4QUBA 1WLSA 3U3OA 3EGWA 3Q9LA 4HWSA 2P35A 2XNCA 1ACMA 1JSLA 1PZXA 4YRJA 1MAWA 4Y2SA 1LPOA 1B16A 1NBWB 1CY1A 2YXPX 2ZETA 3L7NA 3F90A 4R7TA 4ND7A 3O2JA 4QQ8A 5HE8A 4DL9A 2P6MA 2W2PA 1AIPA 2R9VA 4PLHA 1XK6A 5EL0A 1A2BA 3WGOA 3BF8A 4JEUA 2ZM6B 1W47A 2K6GA 1U28C 3GYBA 2VJBA 3U4HA 2GJKA 1R4MB 2OQ2A 4Z53A 2OORA 4WWHA 1C7ZA 3UWMA 3TSAA 4D8WA 5ECDA 4ARVA 1QE3A 1D5CA 1RTTA 2QMYA 2R48A 3QVOA 3QWBA 3R41A 2I4OA 1ZSNA 5CR9A 1YH3A 3FNRA 1OH6A 3I0MA 1QVVA 5D86A 3GGJA 2QVBA 2OV4A 1PFKA 3IH5A 2ZSUA 3NNDA 5FWYA 4JT4A 1USGA 1T36A 3CNQS 1S2OA 3QU5A 3EEIA 2I4RA 3TAUA 3TUJC 3Q7EA 3M6UA 4JQSA 3PPVA 1INLA 1Z5UA 2Q99A 4PLGA 1W4RA 1NKTA 1SULA 3DVAB 2VQFB 1AKEA 4XA8A 3SSNA 4UD2A 1U28A 4OEHA 3TCNA 3NOOA 1RLOA 1UFVA 5FPPA 2ZJ1A 4DADA 3LY9A 3KQWA 3W9UA 1AA9A 5ALHA 5JPCA 3PEUA 2BHSA 1JKJB 4K9OA 4ZC8A 3G2JA 2ZI3A 3DZIA 2EBWA 3KBOA 3QIVA 2XD9A 5I7OA 4JU8A 5CX1B 4XWKA 3EWNA 2R44A 1PQYA 2X7XA 3HJRA 4F4DA 5CDTA 2R6CA 3OICA 5HJ5A 3EN0A 4Q4JB 3RJMA 4CDNA 2X2OA 1CUWA 3MJRA 4A5OA 4ZRNA 4CKXA 5KU1A 5TVGA 2B5VA 2ZWIA 2DG2A 4RPGA 1GITA 5EERA 1L1EA 3JQDA 1S8NA 2UYOA 3F8WA 1HM5A 1BW9A 1AX9A 3BD6A 2C98A 3HRKA 3ETLA 4UE6A 4X20B 5GONA 2XY4A 1ZEJA 3E18A 4GP7A 1KJWA 4L08A 2HUNA 1MFZA 2A3NA 2FSHA 3VHRA 4DILA 5IAEA 5HIAA 5HKKA 4DV3B 4QPJC 3A37A 1HH4A 4MWCA 2WG1A 4N5LA 4EYQA 2B92A 5B55A 3NV7A 4L74A 1JFVA 4KJZA 3VSCA 5EIEA 2BFBB 3QPWA 3ACDA 3GQVA 4RD2A 1XCOA 4FGSA 4FHZA 3RK0A 1N6NA 4YP9A 3FWZA 3WB9A 2JAUA 4F4HA 1P61B 1CIVA 1RWQA 2GEVA 4H6WA 1VHWA 2ZBQA 5DSXA 3WGKA 1EK2A 2A3RA 3IR5A 3DDZX 3WRXC 4GDFA 4HAIA 4L5AA 4X1IA 3B3GA 1K8XB 1UWKA 3CRRA 4NG4A 3SC3A 4ZHQF 4L3OA 2FWPA 2CNBA 2ZB8A 2OWDA 3DDNA 2GSDA 2V0CA 1YQWA 2PTHA 4DV0B 1CR2A 3LHFA 3P71T 3FDFA 4CIXA 1XMPA 1Z4LA 2QI9F 2BKXA 3GLKA 3OKAA 4G85A 4IICA 4OQXA 2Q45A 5CG1A 5K8VA 4BY9E 4M37A 3U4MA 3OQPA 3MTIA 1D07A 1WUKS 4H1VA 5EJEA 3CPHA 1USKA 2RGRA 2NTJA 5LOVB 2WEKA 4MV4A 1T3TA 5GZ6A 5GV8A 1IN6A 2FMIA 3KVOA 4M9QA 4I1UA 4KQEA 4BX2A 3WJ2A 3DS8A 2ZYAA 4I6GA 5IVHA 1A9XB 2EGHA 5C4MA 4RIGA 3WL6A 2W6IA 4MO2A 1ORRA 2F67A 2H85A 1NN1A 3L79A 2FMUA 1QHHB 2GM3A 4Q9JA 3BRWD 3MUNA 2VP2A 3C6BA 4KQ1A 3RREA 1AK9A 1BJTA 5HQ3A 3A6KA 2Q4BA 3SQOA 4OM7A 1R88A 2PRKA 1KDZA 2VT2A 4AMBA 3HPQA 2EV9A 3QI2A 4QDTA 3DCNA 1FYFA 3E1SA 3NPAA 4KMRA 4PLVA 4G0ZA 1PJZA 2R8OA 2WKRA 4BJ6A 2W2XA 2H54A 1A9PA 3UCXA 2D1RA 1EG7A 2HCTA 3MYRA 3DFIA 5FNVF 4Z49A 4HYEA 1O6CA 1VGRA 1GZHB 2JGNA 4KN9S 3CVVA 2XTAA 1K3UB 2XUQA 4M9RA 4IJ5A 1JKMA 4KWIA 1JBQA 4PZZA 2SKEA 4M60A 1NRIA 3O8QB 2PKXA 1Z5ZA 2C5SA 3T5AA 4JP1A 1D4ZA 2OZKA 3KYJB 2Y2UA 2ZI4A 3P97A 2BE7A 4FW9A 3ORFA 3HRHA 3WGIA 1RACA 3VC3A 4BLWA 4HDKA 4DMCA 1D6NA 3FTPA 3WJ7A 4M3NA 3RR2A 2HHAA 3TH5A 3CUKA 1LY1A 1VJ5A 4YMIA 5ICGA 4ZQBA 1WF6A 1LK0A 2IPLA 4GYKA 5GIPE 2PUEA 1GPLA 3SZLA 1E9FA 3QQPA 4LA4A 1WEHA 1QLJA 4Y0AA 1M2HA 4IZ6A 1F8GA 5EWLA 3D2LA 4XUGB 4YJKA 5KNDH 2RI6A 3A8TA 3PVZA 1T4BA 3L77A 4DCOA 1Z4KA 4IDFA 1G2IA 3I8XA 3FMPB 1LNSA 2JB9A 1P29A 3S4YA 4A1FA 1X0VA 3S1AB 5ES3A 3PNKA 1NJGA 1XD9A 4CE6A 2D2FA 3UMFA 3TLEA 1G5IA 3CXRA 4H1UA 3R8FA 1KAQA 4FMDF 4ZVOA 3WLKX 4B09A 3CZQA 1BX0A 3S2UA 3WMGA 4QPNA 2Y6VA 2VWPA 1NOIA 4ABTA 1V8DA 4RMIA 1U6IA 1VGVA 5LZ9A 5LIPA 2X9GA 4QATA 4L5YA 3MCAA 3USES 1VSTA 2OPHA 1SUFA 1U9ZA 2R84A 4C88A 2PX3A 1Z16A 3M9XA 4KV7A 1OB2A 3KUCA 4DNPA 1O54A 2HRCA 5KYUA 3ZLJA 2CE7A 3D6AA 5G1NA 4RHCA 3LZ6A 1OAAA 4FS3A 4W1RA 1XVVA 1Y5RA 4MVJH 1QO7A 3PNBA 2C78A 1GVNB 1ZMXA 4AO8A 4UBJA 5KYNA 4Z7QB 5HM8A 3NC1C 3RFUA 3ZV3A 5B1HA 2TECE 2JLWA 5ELMA 2R8YA 5HFNA 2GCNA 2H4XA 4CF4A 5JIBA 1XF9A 3VU3A 3BIXA 3I8OA 4WD3A 4AMGA 1CVRA 2Q3EA 4C6TB 4NS1A 3DPIA 1P3JA 2VNJA 2FOXA 2AHOA 2ID8A 1YTUA 2PTGA 3IDFA 1A4RA 1LBHA 1QHYA 3ZXIA 2FFQA 3AERB 1RKBA 1EA7A 4QIHA 4PLYA 1OYWA 3FUCA 3EEBA 5H16A 1NATA 1QB8A 1GU7A 1FFDA 2YH2A 1KAGA 4B73A 2CUNA 4DQ0A 2FUKA 3EG9B 2Z1NA 4ZEVA 1Z68A 3PUXA 4G0QA 3D6HA 4HEJA 2H65A 2OCPA 4TX1A 2QJWA 3OLVA 2LTAA 3RTEA 2VJCA 5ULLA 3TB4A 3LCJA 4PF1A 3T7EA 3UGQA 5JYEA 3GLQA 1PJ4A 1JQBA 2PUTA 3AEKA 3LU1A 3IEPA 1PI3A 2JDID 3H2ZA 1QMPA 5H82A 4FGZA 4B2PA 2PE5A 2W43A 3HJHA 4PV7A 2NVUA 4XX0A 4E4TA 3I04A 3EDCA 2W2MA 4K86A 4N8SA 4H31A 1A9RA 3MUEA 1ISPA 1XAHA 3DBIA 4FK8A 3PJFA 4OFWA 2V7EA 3B51X 4I55B 1FYVA 4EA9A 4FD2A 1BJRE 4MR8B 4MS1A 3HYCA 3ETDA 1I7QB 5LL6P 1US8A 2WUGA 2OSVA 3PE6A 5LZ8A 3R7WA 3ZX4A 3PJRA 2CDBA 2JI4A 4O0MA 1M2OA 3B1YA 1K86A 3D4LA 4JXJA 2QGZA 3V4VB 2G77B 2C9BA 1NUAA 4D8TA 2OZEA 3F3KA 5I8WA 1GUZA 4AICA 1FNDA 3NRCA 2CB0A 3TD6A 3MXOA 4A0RA 1TUGA 1L0BA 4RHUA 1NF3A 4DRXB 3HB1A 4EI7A 6ADHA 4GX0A 4D26A 4MS4B 4M8IA 1D2HA 5I01A 3IPXA 4ZT6A 3LLSA 4PGAA 3EZ2A 2ILTA 3LHDA 1D2RA 4KBFA 1P7CA 2Z8XA 1IB0A 1SU7A 5BQPA 3U6KA 2RBEA 3MT7A 4GNKA 2C5HA 4G5QA 1V1RB 1TX4B 2QVLA 3IUPA 4D82A 1JR3D 3WHPA 2Q4TA 4QU9A 4MIKA 4YRFA 4LRSB 1ZOLA 3KWLA 3OWHA 4UNQA 2ZROA 4ZAVA 4DA8A 1JU9A 4JBYA 2SCUA 2O8CA 1YI1A 4PXAA 1QORA 2WTXA 4BVBA 4BCDA 5B3JC 3K0BA 2Y99A 3QQ5A 4U2BA 1DEOA 3DFUA 2NSHA 3LAWA 4ZREA 3PFHA 3AVYA 4L02A 1ODJA 1L5OA 2YJTD 2ZSEA 1GYPA 1YKGA 4AS2A 4D6XA 4DMHA 5IS2A 1EUQA 3P94A 4R8KA 2QRVA 4P98A 5IABA 3LP6A 4FINA 1MQ9A 3IX7A 2ECQA 1WSAA 3ND9A 1P4JA 3INGA 4TMXA 4P3XA 3WDSA 5EE9A 1AN9A 1EX7A 2FW0A 2PMWB 1X1SA 3OCVA 3GZTB 4N3CA 1KI3A 4BAZA 2DFKB 2AKEA 3GA0A 4YCNA 3L1JA 3JQBA 2ZVPX 4UUBA 5GONF 1CIPA 1HLFA 2UVPA 2XYVA 4E5DA 4EKGA 3HPRA 3I6BA 1FJXA 4QBTA 1OASA 5HNKA 2ODEA 2CLCX 2J33A 3OFVA 3P0EA 2FRDA 1M2VB 2ARKA 1HFWA 4H3VA 3SF8B 4YJ2B 4RFLA 5B3JA 3DEFA 4ZEOA 1UOOA 2ERCA 5BPHA 1N1DA 2P2ZA 3KB6A 3EIXA 4I9HA 3TR5A 4R8VA 1P19A 4TL9A 3PFIA 4Y9SA 1N1EA 1CPYA 1BXGA 1L3IA 1SOUA 2V58A 3VKFA 1IJBA 2DQKA 4IMPA 4PC3A 1MTOA 4DSZA 1C9EA 5JZMA 3F73A 4FYMA 1EFAA 1NYLA 2MYUA 2C1EA 1NIJA 1JLRA 1SRRA 2QTTA 1K4YA 1QGZA 3MRXA 4FS8A 3S3TA 3X1YA 1FYWA 1NV8A 5J5AA 3S2IA 5AW8A 3T54A 2CLFB 2VUTA 5E4YA 3T0GA 2W6ID 4Y67A 3T3EA 2W48A 2Y1KA 3QOXA 4TMYA 4KYTA 4JHLA 1KJ9A 3HVRA 4D9JA 1H0HA 2CBXA 3WLHA 2WYWA 3HUUA 1AXRA 3DP7A 5KYVA 1UM8A 2W2QA 1FC0A 3L9WA 2X0FA 3V48A 2FEWB 4E5VA 4MVJG 4ZOQI 5BQXA 5KAMA 1H2AS 1QQ6A 3W8FA 2DWCA 5JCPA 3EQ7A 1JPJA 2P79A 1E3WA 4MCIA 1KOFA 1M34A 2VVTA 3PDUA 4RD4A 4Y6QA 3LCMA 4Z0TA 3TAHA 3QPCA 4H7JA 4J4TA 4BYMA 4TYWA 1JEYB 1P7WA 4LYEA 4PGMA 2F1JA 4ZCLA 2WB2A 5KJFA 3TLZA 3ANYB 3UPDA 5EIWA 1PZGA 2C83A 2J7KA 2YR0A 3DO5A 3N1UA 3I04M 3IELA 3LUJA 5I51A 4WJZA 2NPOA 4B6EA 3CVWA 1ADFA 1T2FA 2V7TA 4B80A 4R2HA 4EW2A 4MR9A 1U0JA 3BL5A 2O7RA 4IXDA 3WWCA 4IH1A 4QECA 1CJUC 1EZZA 3A10A 3ND7A 2VP0A 2GHIA 4M36A 1FYEA 2M6SA 3R9KA 3IQZA 1YR1A 3SEQA 1DAEA 2OV1A 4PXYA 2B7BA 1A5ZA 1JXQA 1ZVQA 1DX9A 2FEKA 1V2GA 3RFXA 4DLNA 1NRWA 3CO5A 2A9KA 4WNCA 3HDGA 2RBGA 5DWQA 3SIPA 1EUCB 1JYFA 1LJ8A 1UT5A 2G4VA 3AFGA 3ELWA 3FCXA 4R7GA 4F6RB 3VAZA 5BRAA 1G9TA 1WXQA 3L05A 3OQIA 1VCHA 4JBNA 3E5NA 2AT1A 5AUNB 2C2ZA 3GBSA 5ALIA 4W5NA 1PHPA 3QBVA 1PT6A 2JGKA 5DBOA 2V74B 2HA3A 3AF1A 4UBLA 1M75A 4E2ZA 3A4LA 3EZLA 1YSCA 4I8XA 2ZSKA 1X38A 3F5MA 1CUDA 4ZALA 1RQLA 2MMGA 1VM6A 1WMFA 2BEWB 3U9TA 2CL5A 1Q0UA 1STOA 3B6JA 1UKZA 3AEZA 1IBSA 2Y1EA 1JIKA 3OF3A 3U7RA 1IM5A 1FUKA 1ICIA 1U7WA 1GM5A 1Z88A 4OBXA 3E9ZA 5A4KA 4U7JA 5LD2C 2AFHB 1VP3A 4D46A 2QMUA 3D43A 3JAWB 3V7FA 3M34A 2Z9DA 5C8YB 4Z8XA 4KAXA 1LQ2A 3CIOA 3BCSA 3ILXA 4LWOA 2I3BA 4MKFA 1WY7A 2O0JA 4MQEB 4QOGA 5TRTA 4FC7A 1A97A 3O26A 4BGDA 3RPEA 5CT5A 1LNQA 1WCYA 1SQ5A 4DLRA 1OC2A 3H3FA 2P0EA 1VSVA 3H0KA 1QTQA 4NBVA 2ODWA 5DNWA 5L7YA 1GRCA 1FJGB 3O83A 4ZQFA 1TCCA 3THRA 3WDKA 2B5OA 3E9MA 5LMUB 1ZZEA 2JGEA 4WN3A 3L8GA 4Z51A 1C30B 4FILA 4B0PA 5FPSA 2VP9A 3TEJA 3TGPA 1NUHA 3T3PB 2WMYA 4DR5B 3CH5A 4B9AA 2HNAA 4G84A 3KSBC 4LXHA 1AC5A 1AMNA 3MBOA 1A5SB 2Q5JA 1JHMA 1N6OA 1I3MA 1TA4A 1XLVA 1LW6E 3O82A 2JVIA 3N6XA 1I8TA 4KKXB 5E2BA 5LA6A 1LEHA 4F5WA 2R8XA 5BQOA 1M74A 4IWYA 1M67A 3RVOA 5K2OA 1VE3A 2OFXA 3A6LA 3HTXA 1AKYA 4HQLA 4Z9XA 1CULC 3UUWA 1ZOIA 4EO7A 3FYDA 3MILA 4RK4A 4KIJA 3OZGA 2VHUA 2DBZA 5TY0A 4OHMA 1JQ5A 1T43A 3ID6C 4LBZA 1GILA 1MVOA 3I1JA 3ZDEA 4P5EA 5IF3A 1EVLA 1EZ1A 2AI2A 5E3HA 1WUTA 2RSLA 3OX4A 3WWZA 1FSFA 2XECA 3ET5A 2WZDA 2OOKA 1OUMA 4HAZA 3WK8A 4TRRA 3QX3A 1RXCA 2VPZA 1DUSA 2UZ0A 3FPBA 4S2EA 2CV1A 1MEEA 4JV5B 3BE5A 1DJQA 4EO4A 4MWSA 1JEDA 1GEGA 3UMVA 1PEDA 1ZFNA 1GNTA 1COWD 1RS0A 1S6YA 2WE7A 3AHFA 3BC1A 1MUUA 3RS4A 4DYDA 1ZUNB 3IPRA 1N2EA 1U7XA 2Q6IA 3BSWA 3EBLA 4FFVA 3VJLA 5EE3A 3RRXA 1FX1A 4RDIA 3O3NB 3OZEA 4HFJA 1R8QA 4Y1GA 4YUWA 5JAOA 3JRXA 5SYMA 1P4GA 4H18A 3I9OA 3ER9A 1I5OA 1U94A 1VP9A 3P26A 2MR6A 3FYSA 2A92A 2PJUA 3KPWA 1LJLA 2Z56A 4RTKA 1SQ0A 2QPLA 4N7RA 4MKIA 4WXMA 1GYQA 1DLIA 1PS0A 3LUHA 3OQBA 5AUOB 1ESNA 2R7KA 1XEFA 3U6BA 2O20A 4F46A 1VIDA 2IOQA 4MI1A 1MX1A 4QU0A 2OC9A 3B20A 1GQRA 3FYCA 4PIPA 4IOJA 4U2FA 2F55A 1PS8A 4A91A 3H6KA 4OCZA 4BB0A 1Z6TA 1N0UA 1XQYA 2I1LA 4ND5A 4Y6RA 1ZAYA 3SVTA 3FSGD 3WLFA 1A2KC 1KBQA 3T7CA 3FTDA 5FOWA 2BZ1A 2Q3CA 3NRJA 4EPVA 2TYSB 3CEJA 4LJYA 2CT8A 3Q1KA 2ZM5A 2CJFA 3DNPA 1R12A 3TR0A 4I2VA 3LPDA 2Y1FA 4OUDB 1KDOA 1M2WA 1YZYA 1I33A 3AU8A 4LXGA 4MRPA 1QRUA 5BW8A 3LUGA 2IYYA 1VFNA 4FOPA 4YPFA 2QL6A 2JJMA 2OUIA 3H1EA 3HZRA 4G0YA 4UFPA 3KQUA 3Q4GA 4MAMA 1H2EA 1ESCA 4G23A 4IFEA 3FM9A 3OZWA 4RL6A 1OX4B 1T1EA 4ZOLB 3DQZA 2ZPUA 1BDMA 1RADA 2QROA 3DHEA 2HKIA 2P9BA 2VI5A 4NCJA 1UBUS 3GJZA 3QHPA 4F71A 1YFJA 1QE0A 2R47A 1XPOA 1HYGA 3HA5A 1K7FB 4HDSB 2AC2A 4YYEA 2HK7A 1Y6FA 4BVJA 5IAKA 2G7ZA 4C4ZA 1YRLA 3HWWA 4DTIA 2QL5A 4ISBA 5KNBD 1J2UA 3AUJB 4BMYA 1MLDA 1ESEA 1XZ8A 4NLLA 2WF6A 3TLGA 2X8JA 5DSTA 3BFPA 1QQ7A 3F49S 1AKMA 5U4QA 1NLZA 1NOJA 2PS3A 3L0SA 3PGA1 4HRVA 3TO5A 4BNVA 4YQZA 3PWTA 4B81A 1O94C 5AQ1A 4QDZA 3F0TA 4YAEA 1NF8A 4C05A 4ZQEA 2QTAA 4G0VA 5ICEA 2WM2A 5FOVA 4M83A 1ONBA 4N1AA 3WA7A 1B93A 5T57A 4OLBA 3KQNA 3HKBB 4TLAA 5HZMA 4A8JC 1DAGA 4NBTA 1PV4A 5IWCA 4F2WA 1L7EA 4PX3A 4IUYA 1NHWA 3U7GA 3OQNA 4JH0A 1C4XA 1A72A 3GD5A 3IUYA 5DYNA 4QGAA 4CEHB 3N59A 4MWZA 1EFUA 1NBMA 1T4CB 5L3RA 4P08A 3MT9A 4O5OA 4HLCA 3YASA 3B2NA 3MOIA 3JYOA 1O94A 5FTMA 3RYCB 2HYDA 3CW2A 2B4QA 5B30A 4D02A 2GVZC 1IRIA 2N9UA 2I8CA 3GK3A 3OZRA 1ZRHA 2QD5A 1LI7A 1WDMA 2X8AA 4DIKA 3UT0A 5BVGA 4W9NC 1XJ0A 2IU6A 2IZ5A 3D3WB 5BN5B 3I72A 3KOOA 3EVNA 4IHQA 1MDBA 2ZRLA 4B31A 2V98A 1B8NA 2O2SA 3SYLA 2XXAB 3RJTA 5AYVA 1CJTC 2HBQA 5H70A 1MB2A 2RAUA 1ZJ5A 2X5XA 2PK3A 1H1TA 3DE7X 4ADSG 3K2IA 1LDYA 3W7AA 1G21E 1BWPA 3DEIA 1GDDA 1O58A 2WVHA 3BD8A 3GJ3A 1L8OA 4LZWA 3FTEA 3GIWA 3GPIA 4QUJA 4E12A 1V7CA 1J49A 1UDCA 1Z2AA 2JLAA 3LC0A 1HE1C 3QKRA 2V6GA 1WXFA 2P27A 3ELUA 1L6RA 2OCYC 4XWTA 5HIIA 1U81A 4PS1A 3NHWA 1EMDA 1I0ZA 3H99A 3GT0A 4DJJA 4D74A 2OXEA 3TOVA 2QIOA 1LZKA 2EFDB 3MRTA 1N7HA 4GKAA 4Q4AA 3I58A 2JA1A 5DRTA 1SWVA 1NR1A 3KOMA 2ZANA 3ZHRA 4DHWA 3KLMX 4KQGA 4CR6A 5J1TB 1U7TA 2RAFA 5JNWA 1G21B 3FYUB 4LHSA 4NEHB 3OX2A 3V33A 3IP7A 1A4UA 1RWNA 4LNUA 2BEUB 1T6ZA 2NMVA 3GR6A 1NSTA 2Q3LA 2PYZA 3HP1A 5F76A 4NZPA 3UT6A 1F4VA 4UE2A 2ZITA 3ZGOA 1I5EA 4W5HA 4LRTB 3CLSC 3CM0A 4IHAA 3UG7A 4K6MA 3UYLA 3B6IA 3JWEA 1BVYF 1NN5A 3CCBA 4J0DA 3BK1A 5E4FA 2WG2A 2IC5A 2OA0A 3RS2A 2JIZA 3KR1A 2C94A 2HF9A 1GFSA 2JATA 4JC5A 3UAOA 3ZJTA 2RI0A 2GESA 4XQ9A 2E85A 1L3CA 1Q0LA 4Q7QA 3SBXA 1KY4A 2BONA 3KELA 5CAEA 1GZSA 1O87A 2EYUA 5BSHA 4FMPA 3A0RB 3EVGA 4RAOA 1FFCA 5LZ4A 2GM5A 2OV8A 3AINA 4QFDA 3OUZA 2FAXA 2YWRA 4S0XA 3GJRA 4L8FA 5A4FS 3JALB 1KQPA 4QUEA 3G2MA 3QW4B 1MXFA 3E82A 2FQQA 3UMYA 3I4FA 1RC1A 4DDVA 3L43A 1LTQA 1EFVA 3BCUA 3CLVA 5DGHA 4B3DA 1IN1A 5LA6F 3SF0A 1BDJA 1FSGA 2EKPA 1R50A 4HS4A 3WK6A 4P3YA 3H8VA 2FWRA 1Q1GA 3EB9A 1GNRA 1XRNA 4XSHA 2K2WA 5L3QA 3STTA 1WHSA 1DDIA 2VNKA 3BMQA 3MINB 1BXZA 4M1MA 1X1RA 4Y1RB 2VTKA 3FLAA 3Q1LA 4YQYA 4LZLA 3I3SR 1XG5A 3DPUA 1CUYA 5EFOA 4YRCA 2FJUA 4DWWA 1BXRB 1GEEA 3KT0A 4EHKA 5CBPB 3W9YA 2I80A 3D4NA 1CDEA 1HK7A 4CI0B 3K2EA 1DBSA 1A9OA 1U04A 5LDGA 3B12A 5D3ZA 4CIDA 3LXXA 5DGTA 4R69A 2Q27A 3TKAA 4AKIA 3DW1X 4U4AA 3ZS9A 4A7PA 2J0UB 1YJCA 1KYTA 3CB2A 3MJFA 3A9SA 5CIQA 4YRLA 3RGGA 4CDGA 4ZJYA 3NBQA 5H3CA 4GMXA 2YHIB 3WWDA 1EFKA 2DPYA 3IV9A 5AK5A 3T1OA 2WD7B 4AMZA 5AIBA 4A27A 3IUJA 1HSZA 3CONA 4FFRA 2HGZA 3A3YA 3L4SO 4MPPA 2ISSD 3SYTA 4WL0A 1K8YB 1U0FA 1CUHA 2P9CA 2Q4EA 4EW6A 4PSCA 4KGDA 2J9XB 2R8RA 4J4BA 2WU1A 1Q2XA 2R4UA 3ABIA 2FN8A 4FT2A 3RD5A 4LF5B 3CA8A 4MW1A 5C7IO 3KTFA 4YRBA 4ETIA 4OQMA 1IY2A 1E77A 3MWYW 4IXMA 1DGQA 3GHHA 3NAQA 3Q15C 2AOUA 2J9FA 2W90A 3AJRA 1FNSA 1HDIA 3B5IA 4G37A 4AFNA 4PLFA 5ITZA 2IS4A 1M83A 4INJA 5GPBA 5L40A 4FB4A 2VHTA 1Y3CE 1NDHA 1AXEA 1HPLA 2XB9A 3W2TA 3OJOA 4HQFA 1G1MA 4A5SA 1FB5A 2I0FA 2OB2A 4IIBA 1FW8A 1Z28A 3MPOA 3JZFA 4AU1A 3OWXA 3VZRA 2FUG1 1QIMA 3MXTA 3CISA 5IJXA 2GYVA 4X45A 3GDFA 4IQFA 5A9SA 4PAOA 4B9EA 5B6PA 2POCA 2FNAA 4MUJA 2XODA 4LDQA 3RSHA 3ZLUA 1CEYA 1NF9A 3E81A 3CMCO 1U9YA 3OKFA 5EJAA 2P2YA 1MO5A 2B36A 2EU8A 3HO8A 3HBLA 4IY1A 3ZQJA 2ZAYA 2ZRDA 2JARA 1VC2A 4B8ZA 5JHHB 2IYVA 1NUPA 1OBVA 1T1GA 4XWAA 2VS1A 1MFPA 2FPWA 4KO3S 5KNBH 3KU4A 1L7OA 9GPBA 3FW1A 2QD3A 1IY0A 4MW7A 3P0IA 1YJXA 1THZA 1U1EA 4ENUA 2DR2A 4F6LA 2HLHA 4EOGA 3NETA 1RCFA 4PYQA 1CUZA 3INYA 3NHUA 5CJ2A 2A6PA 5EJ2A 3I5UA 1M66A 4DXAA 1VJTA 1OJLA 2I2FA 3LGAA 4L16A 2C04A 3WV4A 4DLPA 1CQIA 1ZN2A 4EG7A 2OT3B 2XKJE 3QEBZ 5FHQA 1AZLA 3NCHA 5CLHA 3SHVA 1VMDA 3HFJA 4MWEA 3MEQA 2AMVA 2L17A 2XUZA 3MTQA 4DR2B 1LQUA 1JDUA 1ZC4A 2ACKA 3VDQA 4PHFA 2VWQA 3VYSB 1ZQ1A 4EK9A 3EFBA 2JCXA 4J29A 1U0EA 2B21A 1NQTA 1JIQA 2OQRA 3O1LA 4P93A 1L5NA 1FU8A 3GRAA 2B7CA 3DJYA 2A0FA 4D5EA 5CVEA 2DFPA 1BE6A 2D59A 4WXHA 1QCCA 3U19A 5ALSA 1Q57A 4RLSA 2H2GA 1VYUA 4TKUB 2QX9A 1R0RE 1GPMA 1KI2A 4UUOA 2Z5FA 4H08A 2E89A 4HNRA 5CEFA 1UJNA 2BF7A 2EKBA 1IXZA 2NO0A 3BUSA 4NXNB 3B38A 4RKYA 2XBLA 5T4EA 1U8AA 3LC1O 4JN6B 1U2SA 3A1NA 2WWHA 1UPAA 2LRHA 2QD1A 2UU9B 1V45E 4TTQA 5KDLA 4JROA 2QRNA 4L28A 3ES9A 2C58A 1KP9A 1RQ7A 2NOAA 1L8QA 3NG1A 3OEEA 1E59A 5EIOA 1W88A 4GFDA 4FQ5A 1CP3A 4EJ2A 4EDHA 2HJHA 4K40A 5HKBA 3DA8A 1SXHA 1YA4A 5JWOA 2GFIA 1XO1A 3QVSA 2ECOA 3GG2A 4GEKA 5ALJA 1JPNA 4URZR 2RC6A 3L02A 5CJJA 3WLNA 2C8KA 4QHSA 1P9NA 4AQ7A 1SY7A 2QLJA 1IULA 3OIFA 1NAIA 3O95A 8MHTA 1RBYA 1SQ6A 1ZCZA 2RGNC 2J85A 3NB0A 1P6XA 3GCDA 4EMTA 2ZVQX 5K4AA 3REQB 5E7JA 2ZRBA 3IAXA 1I1NA 1Z6AA 2ANBA 3LL4A 3S7ZA 2JAXA 3AKZA 4UBOA 1Y6RA 1D8TA 3VYUB 1YZNA 3DYBA 2BI4A 3PNYA 3VQTA 1B41A 2JANA 4XGKA 5EEGA 3WMFA 1IJFA 4BV3A 1E9AA 1REQA 3QHQA 4AWBA 4EQZA 5C8ZA 7ADHA 2O3JA 3HA3A 1R6AA 1L1FA 4QYWA 3E5HA 4ML3A 1E1NA 3ZEIA 3OAAD 4ARSA 3LWBA 1G7CA 2IS2A 1DFHA 1E1MA 2EFYA 5FOQA 1J0BA 1GZ3A 4MQ6A 1YL7A 4XB6B 4C0JA 3KHUA 3DL0A 3NMUF 4NPCA 1GGMA 4JLOA 4B79A 4F9EA 1DLJA 1NJSA 4GPBA 3K0AA 3KE8A 1L8XA 2BF4A 3FLEA 5DHRA 1LLFA 3DZJA 5DTQA 3W34A 3W5AA 3BCRA 4KUEA 1NW7A 2VQDA 4S3MA 4TTPA 3AW9A 3L0CA 1FXWA 3EQ8A 1W581 4RZ2A 3UXYA 1G8KA 2ZS7A 2W9XA 4R9SA 3TRJA 3IHWA 3KJIA 2VATA 3D5TA 4BNFA 3DEKA 2RGEA 4CMKA 1XPRA 2LE0A 2NZJA 2VXYA 2PKQP 4KVGA 3G1WA 3B1ZA 3B3FA 4KZKA