3NTLA

Crystal structure of glucose-1-phosphatase (agpe) from enterobacter cloacae
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
388
structure length
388
Chain Sequence
b'SPEGYQLEQVLIMSRANLRAPLANNGSVLEQSTPKQWPEWEVPGGQLTTKGGVLEVYMGHYMREWLAQQGMVKTGECPAADSVYAYANSLQRTVATAQFFITGAFPGCDVPVHHQEKMGTMDPTFNPVITDNSPEFREKALKAMETERQKMQLTESYKLLEQMTNYADSPSCKEKKVCSLADAKDTFSADYEKEPGVSGPLKVGNSLVDAFTLQYYEGFPADQVAWGEIKTDQQWRVLSKLKNGYQDSLFTSTEVAQNVAKPLVKYIDKTLVTEQAKAPKITLLVGHDSNIASLLTALDFKPYQLHDQQERTPIGGKIVFQRWHDKNANQELMKIEYVYQSSEQLRNASVLSLQSPAQRVTLELKGCPVDANGFCPVDKFNAVMNNAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid glucose-1-phosphate phosphatase
molecule tags Hydrolase
source organism Enterobacter cloacae
publication title Crystal Structure of Glucose-1-phosphatase (AgpE) from Enterobacter cloacae
rcsb
total genus 128
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3ntlA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3ntlA02
1IHPA 2WU0A 3QPVA 5AJWA 4EMBA 5CX4A 4ARVA 4D4JA 2H0QA 3MBKA 2DWOA 1NT4A 3C7TA 3E9EA 1BIFA 3LG2A 3ZHCA 4EO9A 1UJBA 4GPZA 4E3WA 3IT0A 2YN2A 4MA4A 1QFXA 1H2EA 2YN0A 1E58A 4JOCA 4D4KA 2HPAA 1RPAA 2GFIA 5HTKA 3NTLA 3F3KA 1H2FA 1FZTA 1CVIA 1TIPA 3K4QA 4ARUA 2OWDA 3GP3A 2HIAA 1EBBA 3GP5A 2P77A 1ND5A 1QWOA 2P79A 3E9CA 3FDZB 4GPIB 1V37A 3EZNA 4IJ5A 3HJGA 2RFLA 4JODA 1DKNA 4D4LA 3QPUA 2HHJA 1RIIA 3IT2A 4D4MA 1BQ3A 1E59A 1C7ZA 1YJXA 2EKBA 2QNIA 4ODIA 5HR5A 3D8HA 1SK9A 1RPTA 3NFYA 1SK8A 1C81A 2P9FA 4QIHA 1C80A 3F2IA 1DKMA 3FDZA 2P9ZA 2EOAA 1BQ4A 3QPWA 2WNHA 2ENWA 1QHFA 3KKKA 2DWPA 3IT1A 3O0TA 2P2ZA 2P9YA 3PGMA 2F90A 2P2YA 5AJYA 2ENUA 1YFKA 2H52A 5AJVB 3LNTA 3BIFA 1DKQA 3K4PA 4HBZA 3E9DA 4PZAA 1DKOA 1ND6A 4PZ9A 1K6MA 1UJCA 1XQ9A 5CU7A 3D4IA 3OI7A 1DKLA 3FJYA 2A6PA 5AK0A 1T8PA 5CDHA 4AROA 2AXNA 4JOBA 3EOZA 2P78A 5AJZA 2WNIA 3R7AA 2OWEA 4FDTA 3MXOA 2A9JA 4PGMA 5AJXA 2H4XA 2P75A 1DKPA 5PGMA 3GW8A 3D6AA 2BIFA 4FDUA 2I1VB 1SKAA 4ARSA 3LL4A 4TSRA 1FBTA 2EKZA 2H4ZA 2P30A 3DCYA 2P6MA 1SKBA 4IJ6A 2P6OA 3DB1A 1V7QA 2IKQA 3IT3A 2PA0A
chains in the Genus database with same CATH superfamily
2C7QA 4JEHA 4L4YA 1WA5A 1P5ZB 4E2ZA 5H8WA 4NBNA 4AJ2A 1QNLA 5IBPA 3TOVA 4B8WA 1QCDA 2QE7A 4Q48A 4WRRA 4JB8A 1GZUA 4AXXA 5C32A 4EO9A 5CVUA 5TB5A 1SOUA 2IS6A 3LW7A 3L7AA 1LX7A 3I73A 3QBEA 2F67A 4INJA 3UJHA 1YS1X 3X2FA 3QX3A 4MRMA 7AT1A 1TA9A 3GLIB 3A11A 1JWAB 1NKTA 3OIVA 3QUCA 2X0JA 4RSMA 2GBPA 3QVLA 3SM9A 1SFRA 4N0MA 4LCEA 2CF5A 4J0JA 4P9NA 1PNVA 1B16A 4BRWA 3ISVA 2GPNA 2XZLA 5IABA 2IUFA 3UMJA 4UBOA 4HQFA 3DBHB 4XGQA 3GFFA 4OTZA 1OX4A 5IKEA 5JNSA 1P4RA 1OFVA 4UOZA 3PJFA 3D6VA 3OZTA 4RK6A 1M1XB 2GPAA 4J29A 4OQ4A 1RRMA 1Y9AA 3ETEA 4UC0A 3V8QA 3LP6A 1RIIA 1C3OB 4JI5B 1OI2A 2J1LA 2C1ZA 3A3KA 3PNKA 3RAJA 1Z13A 4WLNA 4EG1A 3VVLA 3FWPA 2AOWA 3I6QA 4N5LA 2I62A 5DNEA 4YECA 3DVAA 3U1TA 1QLHA 3VR4D 5TMPA 3DMGA 2GXAA 1WJGA 1CT9A 4JLVA 4N3NA 2V0GA 3U9SA 4E4YA 3W77A 1T9CA 4FCWA 5HEKA 1KKMA 2XMRA 1E2BA 3QKRA 5CDSA 1OA0A 2GF2A 1LK5A 4IM7A 2LZ0A 2QRVB 4PRYA 2YRFA 1FNBA 4PC2A 2HQOA 3MPUA 2PUTA 3DLTA 3YASA 1OLUB 1N7JA 4C14A 5C51B 4BQSA 3B1VA 2I6XA 3IUQA 3QKTA 2LP4Y 3OKFA 1VYUA 1VSUA 1O94C 4JSRA 4A8TA 4XLLA 2P6NA 1KYWA 1IVYA 1JR6A 4I4NA 4AYXA 3P19A 1T4MA 1BMQA 1J4AA 3MB8A 4AY5A 1JWBB 2HNBA 1I1OA 2MSLA 2Z2JA 3ET4A 5H80A 2SNIE 3GH3A 4KOEC 3MZ0A 1I4LD 1BH2A 3HZHA 1HDZA 4Q02A 4R05A 1CY2A 2PZGA 3V1NA 1H4QA 2XMQA 4LDJA 1C7IA 1NTRA 3D6JA 3N2IA 1YS6A 2XNDA 3IAXA 1CW2B 4B17A 5A06A 2HDWA 4MR9A 3IMFA 2E6UX 3ZK8A 5J58A 4F3YA 1OWPA 4ETMA 3DXXA 4O4LF 4BVJA 2ZXFA 2Q6TA 3LC1O 1ZA2A 1A8PA 2C61A 4P4GA 3JD1A 4XZ3A 3RYTC 4KB5A 3F4BA 3R0IA 3QEMB 4ZVVA 2I4OA 3B20A 3PFWO 4I2NA 1BE0A 3JTEA 4RSGA 1MA0A 4D02A 2XLBA 1ILEA 2FN3A 1LXCA 3ZCXA 3H2HA 1MIHA 1U81A 1N5MA 2G1KA 3G7SA 4MJ7A 3SMVA 2ISCA 3E7DA 1KDZA 4DCSA 1D6SA 4KO1S 1JIIA 1RIFA 3K9WA 1N2SA 1QHYA 2GHIA 2H3HA 3K15A 1USKA 4OGGA 1V2GA 4A27A 4IW3B 2BIFA 5LDDC 1KJ8A 4KSBA 2B6NA 4ND8B 3AI3A 2Q3FA 3NAZA 2GZDA 2WHRA 3PEFA 5EUBA 3I6MA 3KKQA 4ZYXA 4RVUA 4QVIA 4ZXPA 2HBQA 4ZZ1A 3G2MA 1FXWF 2IYUA 5IEBA 1GRNA 3TSOA 4PO1A 3V8VA 2B4YA 1V11B 5BSUA 1OLUA 3HSYA 2VT2A 3NWEA 1FNSA 2J3EA 4PLYA 1CDDA 4IXWA 1Z6GA 1D2CA 3SDSA 3V48A 2OTCA 1GOTA 1M73E 1SBYA 1FXUA 2YN4A 4RTKA 3WLHA 4RS3A 1GU0A 2L0XA 3BS4A 2DPGA 2P6RA 1SVMA 2SKDA 1MDFA 4TTIA 2BH2A 3STVA 2I2WA 1M6VB 1XCJA 1RBZA 1G0NA 1H8HA 3CF2A 5KSOA 3PA6A 2FA9A 2R7LA 4HAWA 4URYR 5A9SA 1NFRA 5HFJA 1MLDA 4OSPA 4ZIRA 2DY1A 2HA3A 3IDFA 3KPYA 4L9RA 3SC6A 5LJIA 2PYDA 3FPCA 5AVZA 3LGAA 2JAXA 4FYIA 3RLFA 3F9RA 3ZX4A 1KR5A 1BX3A 4J0EA 4KVFA 2AA3A 5BR8B 2HJVA 3T5CA 1J1UA 3GDHA 4C2UA 4BQRA 4DEYA 2GZ1A 3QKSA 4IS3A 2JGMA 3KQHA 3EULA 2H2GA 2UVPA 3PVSA 3EZGA 2HHJA 4PZDA 1DV1A 3S27A 4F6LA 3IT2A 5KUTA 2XD9A 2HXGA 3FGPA 1P2SA 2IGBA 3MT9A 1IXRC 1G7TA 2GLXA 4EEZA 4H3VA 4IIYA 5IWAB 3LTEA 4Z0TA 4ERXA 1Q7BA 1DCFA 2QRHA 1N3IA 4DMLA 4CEJA 3CXRA 4MW6A 1J2TA 4ES6A 2J3QA 2EKPA 1H0HA 1TYZA 3B1JA 3KDSE 1P7VA 4LYYA 2P9FA 5M5BA 1N5IA 3S2SA 1X0VA 4FYMA 1R6VA 1JPUA 1W4ZA 4ND3A 1E7MA 2V7GA 3Q3JB 4IDDA 1GZ6A 1FNMA 1MO6A 1HXHA 1WU8A 1I13A 1PBNA 1SD2A 2QL9A 1HQKA 3P9CA 1WF3A 5JFGA 1DDIA 2OO3A 1IZZA 5CH8A 2ZJOA 2XOXA 1PR3A 1LPMA 4GWKA 4Z7OB 1QRUA 1RJWA 2I66A 3IKTA 2CE2X 4E32A 1MEJA 2DPYA 4Y1RB 1E5XA 1YBMA 2A4KA 2C4KA 4RH3A 4DR2B 1C4XA 2PBLA 2MYPA 3NC0C 3BH7A 3IA7A 2YFQA 1GQSA 3AXSA 4NBUA 2NZ2A 1K4MA 3VYWA 4DQDA 5TPWA 4QYIB 4EKDA 2EJBA 5ENVA 3BICA 2HEGA 4JBWA 2QQ0A 4ZOQI 5DE3A 3AOEA 5DKFA 1IUNA 4HDQB 4P86A 1WTAA 4RD3A 5FOTA 5CCEA 4HEA1 3G7NA 3HACA 1T2VA 1H93A 2GVNA 4YTEA 1A9SA 1XVVA 1UKAA 2ZR7A 3AF0A 3F6RA 4YNBA 4DB2A 1H8ED 4ESOA 3HKCB 3H1GA 3KHKA 3CLHA 3GLFB 3NH9A 4M1OA 4ZTBA 4YCMA 2PUDA 5KTRA 2NU9B 1TC2A 1RLTA 2I4IA 4H0CA 1UAGA 1F8XA 3AHIA 4JT2A 3UHJA 1YA4A 1H9BA 1WXHA 2GFHA 3KKZA 3V8NA 3ZWMA 2QTVB 3MFQA 4MYTA 2ZRBA 2AE1A 4EFMA 1BEEA 1E4VA 4MDFA 1SKAA 3EZ9A 1UWLA 2R3SA 3WNCA 1JAYA 1T9BA 1QOZA 3GZ4A 2GZ2A 2V0CA 5BWOA 1FMLA 2HGZA 4BLQA 5EI5A 1CJVC 4TT3D 2ISQA 2JGFA 4GX0A 1U4NA 3S1AB 3TN7A 2I7TA 3TK1A 4B79A 4BNHA 3ER8A 3EZ6A 1QH9A 1VPTA 1Y1TA 1I3NA 3H6HA 4OHVA 1IE3A 4YAWA 4KX3A 4KWEA 2AQIA 3NAMA 4I5EA 4F3RA 1BCSB 3BD7A 2RHMA 5JJIA 2Z3WA 1TJNA 3OOYA 2QUJA 4NZMA 1WZ2A 1QIDA 5G53C 4YIHA 4QYXA 4RLSA 2WD9A 2WKPA 3TB6A 3T1NA 3VAAA 2VNIA 5JSYA 2XCRB 3LTNC 1JW9B 1Z0UA 3MTEA 3T1QA 3D6FA 4JQCA 2V4MA 1QIFA 1C0KA 3WRXA 5F23A 1O6GA 1EDDA 4M60A 2DB3A 1FSFA 1N7IA 1PJAA 1DAPA 1I3CA 1Q1BA 1IMJA 2OM2A 4M98A 4OK5A 4G23A 1UBUS 3WMGA 1K3TA 1ABFA 1A9XB 1EWRA 1EZ1A 1KK1A 4CETA 2ERYA 1HTBA 1FTYA 1NLYA 1T2CA 2B5OA 2QD2A 2W6QA 5KYVA 4EW1A 2IX3A 2QLLA 3EVEA 2Q7DA 5BWLA 2P7HA 4DR6B 4CCSA 3NBUA 5DIFA 4BQPA 2XWBF 1FVHA 4MZDA 5JWOA 4LHWA 3KJXA 3GRRA 3AJ9A 5BSFA 3Q40A 1CUDA 3BF7A 4FKMA 3TDNA 3HJTA 1BD4A 3MNFA 1KFKB 4K6FA 3ABOB 3DDZX 4XWKA 1II8B 1BG6A 1FTSA 3AIMA 1DQZA 2NM0A 2QDKA 4HB0A 4IKPA 3INNA 1FSZA 2EBFX 5EUQB 1Q95A 1NXQA 5EJ8A 3LVBA 3ZVNA 4AICA 1D4AA 2A9FA 1WP4A 3K0CC 2PLFA 2VHVA 3OP4A 1AD2A 5E95A 2HR1A 5K8VA 4Y2XA 2X42A 4IXDA 1QFSA 2QP3A 2YKGA 1BDHA 3M82A 3NYIA 2RCNA 3FPAA 3THXA 3ZXSA 2E1PA 4D2IA 3KC2A 5JZ9A 4V0KA 3E6AA 3UHPA 5AM3A 1E9BA 4KVAA 5CFQA 4MKGA 1L4MA 3VOAA 3M4YA 3DAGA 3GZJA 1S3IA 1SIBE 3JXEA 4O1HA 2WY2D 2A67A 1HNZB 1I0LA 1D7AA 4DMGA 1WSDA 1U9JA 1VB5A 3JQ6A 2D8MA 5DN6A 1JKJA 2RE8A 2JEOA 5CVDA 3PUWA 3GNSA 3B9QA 3TCNA 3ADKA 5M3BA 3ZWAA 4WLUA 2FW0A 4JDPA 3TLEA 2ZR9A 4YJGA 3QELA 4QJIA 3HLTA 3MCAA 3GLKA 1XJWA 2PH7A 3IELA 3LOQA 1XD8A 3LZCA 4BZQA 3WQBA 3Q5DA 1WEKA 1Y3DE 2GZAA 2LR0A 1GU1A 3I42A 5K3EA 3HUTA 5FF9A 1F6WA 1M2FA 4B4UA 3CURA 2BJHA 1A9QA 2A0KA 1W4RA 2JH8A 2VUTA 2DECA 3PGKA 2HM7A 2BR5A 3KEFA 1LDYA 2XMCA 4Z4FA 1RPJA 3M89A 4OL0A 1LJUA 4L7VA 4PYKA 4F9GA 5T8KC 5D3KA 3B5JA 5FRDA 5FUVA 3D6AA 1ZGHA 4B2LA 2F6RA 1S02A 2P68A 5ESWA 3EAFA 4Q01A 4E11A 5I9IA 1P2DA 1W8DA 1WWKA 2HMTA 3PJDA 3OC0A 4WJZA 5BSTA 3AHJA 3DCYA 3TTUA 1W88B 3RVMA 1KH3A 3EUFA 5K0EA 3WQHA 1E6CA 4LF6B 4YV1A 4LYDA 1O94A 3S44A 4QUBA 4XCVA 3BILA 4F38A 3JSAA 2ZBGA 4KQEA 4AP5A 5LSAA 5TEVA 1AO3A 4HWPA 3NHYA 4J0QA 4YAGA 3JYQA 2LKDA 4ONEA 4BKPA 3TG8A 2BUCA 1Q0RA 1N0WA 4NYIR 4PYNA 4A8JA 4EYKA 1I3OA 4I1IA 5K3DA 5A7HA 3DHYA 2B4TO 4B8ZA 4B7ZA 1AGNA 1KERA 2B8EA 4D79A 1CZNA 5H3LA 3NV7A 1RJEA 4GGOA 5GGXA 3RF6A 3TI9A 4B40A 4DUGD 3FUVA 5DLPA 3LNCA 3PRKE 3DBLB 4H7PA 1EFRD 1A50B 2QR3A 4L16A 3UBMA 3FYCA 1RACA 3IEUA 5LQCA 5HJ7A 2RGUA 2WYUA 3KDPA 1H85A 3U3OA 1P5FA 5JC8A 1YR2A 2KQUA 2OD7A 2I7XA 1KBQA 4NU5A 1MKYA 2PN1A 3RHFA 1VL6A 2WWFA 3TLGB 3VU9B 3ZI4A 3C6MA 1NMEA 1NBAA 3PUIA 1XMPA 3SVLA 1JXOA 3S1AA 4ALKA 1KFCB 4CJXA 4B3JA 4PG8A 3RE1A 4YACA 2LGJA 2HT6A 1OZGA 3N5CA 4WZAB 3L02A 2GEBA 1SM4A 4UNNA 1JSXA 1T4BA 1ZC4A 3U3RA 4D8YA 5JXGA 2AMLA 4HX9A 1B0ZA 3QELB 3EWSA 1AK2A 3OTOB 1YE3A 4KK4A 1EXDA 2G5CA 2GWHA 3ND9A 4Q6WA 1U80A 3AQ4A 1VECA 2D1SA 1GILA 4B6SA 1X80B 2JHFA 2J5BA 2D8AA 3FMFA 2EARA 2RKOA 4PBSA 2G77B 3RYHB 4HOYA 3GGDA 6PFKA 4Q4JB 1IXKA 3VPAA 4NMMA 1W1UA 4BFYA 2NIPA 4BNMA 4ZEMA 1WUJS 4RTNA 4IXNA 4XDHA 5ALUA 2XYRA 5E9AA 1VHTA 3E9ZA 2NUAA 4WNCA 4ZOEA 4FMCF 2PKXA 4QX6A 2NAPA 1PO7A 2IJGX 1UBKS 2QX7A 4UVIA 5EJIA 3TL3A 4B85A 1XJQA 3EIWA 5CLFA 1PFGA 1DO2A 3HA5A 3SIWA 3CZ9A 4G9EA 1P39A 1V4VA 1FFAA 1Y6QA 1X1SA 3MCVA 4HB3A 4M54A 2I2FA 4M4SA 2MSCB 3AI7A 3HXPA 3OAAA 5TS3A 3V1YA 3QFFA 4EY7A 5AVWA 2O8FA 1Z0ZA 4LOHA 1CY8A 3CLKA 2RDMA 3MWYW 3ZDRA 3O47A 2JJ1A 4FEGA 1RD4A 1CEXA 1U3GA 3N3AC 3PE3A 2X14A 2BHLA 4B4WA 4YQZA 4HPWA 3WJ2A 1JHQA 3FPLA 5L3SA 2GPBA 2VF2A 5JAQA 4UTNA 4IQFA 1CF4A 2CNDA 3ZNNA 4ARSA 3ZJVA 1PF7E 1VYVA 2DYKA 1GTZA 2CHQA 3LY8A 3A36A 1QG2A 1RC1A 2OZKA 1O2DA 2W2OA 4JBNA 4JP2A 4CMHA 4PLCA 3B38A 5ALOA 5HKKA 4DV4B 4JJ6A 4U7GA 3PUJA 5NULA 4EBBA 3KVRA 2CCJA 4IBOA 1IHPA 4EMBA 1NUQA 5CX4A 3HUDA 1I36A 2PH5A 5GM2A 3OTQA 4FGZA 4GP9A 2QY9A 3RFVA 3UAYA 1NGSA 3BG5A 1IK6A 4V2IA 3F73A 3B6EA 3UK6A 3S29A 2HMSA 4QOJA 2X3YA 4Z1MA 4RNCA 2FWNA 2IWRA 5K3SA 3B9PA 2XOKD 1JIVA 5SY6A 4CIYA 5EJMA 1AUVA 1PR4A 2EBWA 1K7SN 3PQ3A 4HRYA 2GFIA 3DUFB 1M6WA 1KZGB 5AW3A 1ZW6A 1OJLA 2H7CA 5CLQA 4YH1A 2DETA 2HYIC 3IAUA 2DCMA 1TA0A 2YZNA 5AVOA 3O93A 1KOLA 4K0KB 1N9GB 5D6NA 1LBIA 3H18A 1N3LA 2QW0X 4MIKA 4Q9IA 5J63A 3BRQA 1P3JA 4CKEB 3SIPA 1E4OA 1GNPA 1QYIA 2P79A 2PL1A 1U0SY 4OUKX 3V34A 5C1OA 3OEWA 3ESBA 2OECA 3R5SA 2QTAA 1XKLA 1L7MA 3GJZA 4BO1A 5KQPA 2H2WA 3TOZA 4HGZA 4HH3C 2NPIA 3EGXA 5SICE 3PHGA 4LZAA 1KYYA 2O05A 4KIFA 3HVRA 1LWNA 5T3UA 1FE8A 4CKCA 2ILTA 1XT6A 4EHFA 3CQ9A 3WRXC 5EJ4A 1KRXA 3G2PA 3QLJA 4YCLA 3TLJA 4DXAA 5JAHA 1WDTA 1OYOA 4UUQA 2QSZA 1NY6A 2J7PD 1DUSA 3QU7A 4I55A 1TIKA 4RETA 4M1SA 4PAQA 5LB2A 5IJAA 3TOSA 4AYTA 1HQYE 4CKZA 4PX9A 1WNTA 1X80A 3IPAA 4QELA 3CLVA 4G25A 2M1ZA 4GXNA 1ODFA 1K75A 2NXNA 3QOWA 1JEEA 4B6QA 1I4EB 4B84A 1P4GA 1L5WA 2EKDA 1TAHA 4R1NA 4NV1A 4G0QA 4IJVA 4J3NA 1JT2A 4C4AA 2H1HA 2JD0A 4UTRA 1N9KA 2PSJA 1XEFA 3PHJA 3F6YA 4CIWA 1ISMA 4TVSA 5HQJA 1SCBA 5FWXB 3C3MA 4EX6A 2R4TA 2ZTLA 3VNRA 2JNWA 2JLUA 3OCVA 1RPZA 2AJDA 2HXSA 2I6TA 1SZCA 4XVRA 5D7BA 1MJHA 3TXAA 4PHHA 4GKBA 4PHTA 4WKOA 1ZEMA 2EYQA 4A6EA 3EPHA 1QZXA 1OIXA 2UYCA 1TVMA 2Z8YA 3D4IA 4PRKA 5DHQA 2JGDA 2GAFA 2V96A 3DKVA 4FIZA 1E0KA 4IL5A 4ZVKA 4NCIA 5D3MA 3K35A 1RWWA 3ESAA 4X45A 3SN6A 2N1BA 2JH9A 3JQ7B 3NRCA 4YJ2B 2RHJA 1DADA 3KKMA 2CLSA 2ODPA 4LBYA 3RC2A 2MOKA 2QTWB 2D1YA 2PUFA 1BJTA 1EP2B 2WFLB 4BQEA 2CKMA 3OY2A 2WKRA 2FZLA 2C99A 4FT4A 3I5UA 1K8RA 1U8ZA 3LY7A 1QX3A 2FZCA 1PHRA 1ULAA 3AI2A 1A5ZA 4NNPA 4F85A 5B2FA 4R9VA 4BPBA 2O06A 4UKDA 4FM9A 1JAIA 4JC5A 2OC9A 4ENPA 3DQPA 2OKGA 3EQ9A 3HU2A 1NXWA 4XJSA 5JD3A 5L4LA 2XCLA 4BPRA 4E5MA 4LOIA 4TSFA 2WQ6A 4BEBA 3ADOA 4EAAA 3W79A 1A9OA 2PGXA 3HU5A 3P5BA 3FUWA 4AUKA 4AWXA 3O73A 7REQA 4H7EA 3RC7A 1PGNA 2BVNA 2NSLA 1ULBA 2IS1A 2MYUA 3TAUA 4FZ3A 2PL5A 3WZMA 4KJZA 4BN4A 1TO6A 3CPHA 4PIMA 2ZIXA 2XADA 3L7DA 4MKXA 1PYDA 1ZK2A 1OBHA 3DHEA 2ZDQA 3E23A 4GMFA 2FWJA 3TBHA 4H7IA 2JK0A 4HADA 1Y4ZA 2G8NA 4FR0A 1COWA 1NZJA 5AMXA 4F9TA 3I6ZA 4IS2A 1Q77A 1JX6A 1WD7A 2AKYA 3QIAA 2NU8B 4HZIA 3UAGA 1F20A 4CLOB 4DPLA 3CU5A 4FOLA 5D5QA 4BNDA 4URVR 1EXNA 2FQXA 4XARA 1CJTC 5DDIP 1EQUA 1O6ZA 3L7YA 1ZMTA 1ORDA 4PICA 4PYQA 3SJZA 4YYEA 4CRWB 5BN1A 4C21A 2PMDA 1DINA 1LI5A 1VPEA 3RS9A 2J9RA 5HFAA 2ZUCA 1MV5A 3GR6A 2FPPB 4ICIA 4KDFA 1ENYA 1REQA 5HZKA 4GPIB 4W1PA 4QICA 1PWXA 2EW2A 1C9DB 1I5EA 1EE1A 1EUYA 4KTTE 1LZKA 4YJ3B 4EMTA 4G4GA 1AQYA 5K3FB 3I58A 1G9SA 1ZJ6A 3G8YA 1ZINA 4HN2A 3P0HA 4RJKA 3D1LA 5F77A 4ZK2A 5F52A 2HU5A 1H8HD 4JVSB 1EM6A 4KBGA 3T61A 1TK3A 5A9RA 1I80A 1IL0A 4H1VA 4WZ6A 4F1KA 2R6JA 2CK3A 3K31A 5AW1A 4F93B 4EA8A 4ZI7B 3JWHA 1FFHA 3PR2B 3G6WA 2OHFA 1Q3KA 3Q6IA 2APJA 3AJEA 5K8LA 5AHOA 4KQCA 3KXPA 4ZD6A 3BC1A 1PJRA 4JLMA 3OU7A 4DYVA 4IFEA 1KQ3A 4M87A 1OX5A 3DJFA 3JPWA 4P34A 4FGUA 3U6BA 1Y42X 4U7FA 5HZMA 3ZJYA 3JQFC 4MUYA 1THTA 2JLCA 3FUCA 1GYQA 4DYDA 1L7AA 3MHPA 2B1RA 1BMFA 1UANA 3NWJA 1KYVA 2HLPA 1TVKA 2KJQA 1Y4AE 5EA2A 2FI1A 4J0CA 1DC3A 5GZ3A 2G80A 4M49A 4MQUA 3HB7A 1ESMA 4RL6A 1WXDA 1O03A 2ZEJA 1XN4A 2Z98A 1O5OA 3QIVA 5J5AA 4PQYA 4TL8A 4ZAXA 4DV6B 1U94A 1ZK0A 2DZDA 1M75A 2HRZA 5JW6A 1CYDA 1XHEA 2F3QA 5E38A 3TIFA 1HE3A 3JYHA 1E6KA 3FMOB 1E2FA 1QP0A 5K6AC 4XIFA 2CDCA 1TE2A 2ZULA 2IITA 3O4JA 5FJJA 5AJZA 1WRBA 4Q9DA 3EG9A 1PD0A 2V7QA 4TMFA 2D1FA 3QLVC 2W2KB 4KH1A 2J3MA 4AZ0A 1UBMS 1WDWB 5JZSA 5B7QA 3MRTA 4L8VA 4NCHA 3O5AA 2H59A 1DHRA 1NVUQ 2M2IA 3LLCA 1CEYA 2XHEA 2VJOA 2QYTA 3NIDB 4YVFA 2FPIB 4WD3A 5CLIA 1X7WA 4JVOA 3HY6A 1NKVA 3WY9A 3CX4A 5IZ4A 2Z6QA 5CGQB 421PA 1X3LA 3GGJA 3R1IA 5KC9A 3PPIA 4NTZA 4WBNB 1A8SA 1F0YA 1Y3HA 2WUWE 5CUQA 4KXXA 3G13A 2VG8A 3PG5A 5BORA 3NKFA 1LPOA 3E2PA 3C6YA 4EJ6A 3L0ZA 4IH4A 1QMPA 3AUYA 4UATA 4PZZA 5I45A 4FHDA 3NDBB 1SIOA 3CIOA 5I8ZA 2NMVA 4F45A 3OT4A 1XUOA 2B30A 3COPA 3H9QA 1QBKC 3M7IA 4U0KA 1X9IA 1N8NA 2CL6X 2SCUA 1YBFA 4EJ2A 3OU6A 1H5NA 3BH6A 1JT9A 3U4QA 2XE8A 2BFFA 1Q1AA 3FZNA 2O2YA 3DM9B 1UPTA 3K8QA 2W90A 5AI8A 5F9FA 4LQLA 4ZICA 5J4LA 3RRBA 1TQDA 3HY4A 3SLGA 4PN7A 1Y82A 4GKVA 4OXNA 1C3EA 1KYQA 5AXDA 1TYDE 3WB9A 1P17A 2R751 4J94A 5D1NA 5IF3A 2PMWB 1R8YA 1VLVA 5C34B 4XVQA 2G4LA 3LA6A 1GPLA 2CLIB 3LSTA 3OCZA 4BO4A 3RHZA 1EE9A 1USVA 1Z0SA 3P0RA 1JAZA 4HNHA 3I34X 4KN6A 4H3KB 4QTUB 1F2VA 3IV6A 5IAAA 3AYZB 4RV9A 1DIRA 1L3IA 3NALA 3ZN2A 1SCIA 1SVKA 1Y6RA 3OPMA 3DDHA 1W2HA 3EMDA 3KOXA 4PG4A 3TYXA 1TW2A 4CM4A 1D0SA 1VI6A 3M5WA 4IMJB 3WL3A 7GPBA 2DFDA 3W8NA 1UKZA 4RVGA 2HF7A 2VP5A 3O7MA 1DBIA 1NHWA 4C2TA 1I14A 4YYZA 1RVV1 2AMVA 2AG6A 1E0AA 3ZH9B 4FR5A 2JDIA 3T5MA 2FFJA 2ORWA 4EHIA 2ENWA 1IOZA 3NIFB 2PUHA 4EKGA 3KJZA 3D0RA 5TQJA 5DT2A 1NZDA 1PK9A 4Z9FA 5JDIA 1E1LA 3A3YA 3L7IA 2XTMA 3FHLA 2W9XA 1Z6YA 2FWBA 2BMVA 3C5VA 3QA9A 4GUAA 4K0RA 4YJ3F 2I99A 2IHZA 1FDUA 4UHKA 3RU2A 3QVKA 2EV9A 3E0QA 1MF7A 4KWIA 4DIFA 5JVDA 1XCMA 1RHKA 2O2SA 4FNGA 5KOHA 1T13A 1WDLA 4ASUA 5L3QA 5ES4B 3U4GA 2OCGA 1EIWA 1ZNQO 1BA2A 1ICIA 4FQ5A 5JR3A 4J7AA 4EZBA 3BERA 2C2XA 2I7VA 5T6MA 1DFGA 4G8CA 4YMWA 5EY5B 3VH3A 1S1CA 2O54A 3QLEA 1T6ZA 3QFSA 4HJRA 1Y6JA 4NEGA 3ERCA 4DVJA 3CH7A 5IU6A 5ERYA 4QUEA 3UWPA 2VR1A 4JLKA 1BRMA 4GBGA 1BHQ1 2P78A 3R0ZA 4UCXA 2KW5A 4WW0A 5K6RA 4FJ2A 4E5YA 1PP4A 3R40A 1UZNA 4LVCA 4R3NA 3LCUA 4RABA 3REGA 1FTQA 1IUKA 4F6RB 4YRBA 2CT8A 1R18A 1EJ2A 2O0KA 2V6BA 3LH5A 4PG6A 4ZIRB 1S2IA 1TXGA 2E21A 1HL3A 2VDWB 3JRXA 1E9EA 3NATA 4V0OA 1AGYA 3HFRA 5CA1F 2PLAA 5T7BA 2GERA 2VHTA 3QJGA 1P91A 4FDUA 4FFRA 4PONA 2DXIA 2YL2A 3K2BA 3V2GA 1ATIA 1OH5A 5AW9A 1EB9A 2YYZA 2JA2A 4DLAA 6YASA 2CUNA 4CE6A 2JATA 2VSFA 3N7TA 2ODWA 1WD5A 1VGQA 2R2AA 5EZYF 2G7ZA 2CYCA 3NCTA 2I4NA 2LD4A 2Q2NA 2XMGA 4HF7A 2GVZC 1E2KA 5BN3B 2EQAA 2J0SA 3R6WA 3N59A 2IH2A 4P33A 3QENA 4A0FA 4TXJA 2B4RO 2RSLA 2BBTA 4OQFA 2ECQA 2OFFA 1TKAA 3LBHA 4IWNA 5FCDA 2JHAA 5DI3A 1IM2A 2EKLA 1KXJA 1JB9A 2ERCA 1NYLA 3AZPA 3CGGA 3A4LA 3EIEA 4M76B 3O75A 3JAWB 1USIA 3SG0A 4MQFB 4PHGA 1MORA 1GTJ1 1N6KA 1W1WA 1D2AA 1SHKA 3IMGA 4KCGA 2CV1A 3V4LA 3VO9A 3HCDA 3OQ6A 1VL1A 2C98A 1F1BA 2Y2VA 3R2JA 5B1DA 1DC4A 2P5TB 4C87A 4GX2A 1U3FA 4O4LB 3H0KA 4XDZA 5A6SB 1MTOA 1YJQA 3VVCA 5ETJA 1TM7E 2LDXA 2EFHB 2V7PA 3RJ5A 1XX6A 2QM7A 1JR3A 3CNLA 3R3WA 5JQGF 2DHDA 4MUXA 1CY1A 2PO7A 2I22A 3GHHA 1PT8A 1NN1A 3NBYC 3DGEC 2NZJA 1FQWA 1GRCA 2RK6A 5FPTA 3UB4A 1TECE 2WIKA 3ZIUA 1PVVA 4BAGA 1GUFA 1F2UA 2Q3EA 4E94A 2GILA 2WTBA 2G67A 5J2TA 2H2AA 2ZSDA 4IHKA 4QXQA 1J9GA 3A9UA 4GE3A 2Y1FA 3SS8A 4BYGA 5FLYA 3ESCA 2AHOA 3KQVA 3U60B 4DXDA 4FFBA 3EWAA 2H1FA 2VAMA 2OV8A 1YBAA 4DQVA 2AR9A 5JALA 5J47A 5JAZA 3MILA 4QPCA 3QKSB 3K0AB 3OEYA 5E4FA 5JO9A 2DEUA 4AQ7A 3Q9UA 4Q66C 1NLZA 4AZ0B 2FZEA 4B45A 2GYVA 4DA4A 3O3NB 3T34A 5ICGA 3V4PB 3I01A 2W8BB 4YR9A 4BKQA 1ZWLA 2A4MA 3TR5A 1PNQA 2YWRA 4JA2A 3L8DA 1W36B 4YRSA 1TZKA 5HS4A 1FPQA 2GCPA 1K9SA 1K7XB 1QIJA 3L7MA 4MR8B 3BMNB 2CLMB 3L7CA 4HTFB 4L4ZA 5D8DA 2TMKA 4UAUA 3WNQA 2PGOA 1U11A 1U2ZA 2BHTA 4BFLA 1SXJB 2VT3A 3E48A 1ZN8A 3R4CA 3UXYA 5AK6A 4GOJA 1S8AA 2VVTA 2D3WA 5ALTA 5K01A 5DRYA 1IN7A 3C3PA 2VT7A 1Q6ZA 4EJ0A 2HQ1A 1P45A 4K6MA 3E27A 2P2SA 3C4VA 4JBIA 3ZEIA 2C8JA 2D1QA 4R5MA 1KHTA 2ARKA 2VZLA 3FNQA 3M4XA 5I9NA 3MEQA 1M9NA 4RIGA 5BR7A 1KVSA 1ZVQA 1QYCA 2GWRA 3ECSA 3CKKA 4IDFA 1NX9A 4LQCA 5K0JA 4OYLA 3WYAA 3L7OA 1J24A 2CF6A 1SVOA 5TF0A 4DPMA 1T0UA 1PJSA 3GH1A 4M8NE 2R8ZA 3OBBA 4MROA 4OAQA 1ZHHA 1O08A 1C9EA 1DKPA 4IOLA 1ULHA 4RK0A 3UUEA 4CTKA 5IPFA 2MSKA 4NJMB 4ZI7A 1H2HA 1ZYUA 4B5LA 5I4KA 3BTSA 2QF7A 3OKAA 2R1TA 3LQ1A 3KLBA 4G56A 5AKJA 4C7JA 4EG0A 3IHTA 4ZHQB 1M7GA 4XD7D 1M74A 3ZE8A 4Z3KA 4H7KA 1JJVA 3GRCA 4IR7A 1PU2A 2M9MA 2FN4A 2J9XB 3DOUA 4IDEA 1FNDA 2XYQA 3LUHA 1ZMXA 1N78A 1PEKE 4NJMA 4QFDA 2HLHA 1JYSA 3W05A 1V95A 2Y6VA 1FRNA 1KAGA 1RAHA 3GARA 2W6NA 3AEKB 4DLPA 2E55A 4KR0A 3B3AA 3ZW8A 1URPA 2PBFA 4Q5IA 4QEKA 1QB8A 3L0PA 2IZZA 1SVIA 4TS1A 4TXNA 3H5IA 4WXHA 2NV2B 2VYVD 4C03A 5HK8A 1BROA 1NL3A 4IF4A 4KQ9A 2GAIA 3C48A 3GJ8A 4BKUA 2C95A 4IXTA 4WE3A 4OJKA 1PAUA 1NOJA 5TQ0A 5U4XA 1NVKA 3RSOA 2J4FA 3ZDFA 3ZIAD 1E2JA 4UOEA 5HOEA 4PC7A 4D8VA 3QKIA 4Y9UA 4LFAB 1QFYA 2I2DA 4G37A 1ARZA 2G83A 5KQMA 3LW8A 4DUPA 2HBZA 2NZVG 4HO1X 3NDJA 4JVNA 3LGSA 5CH3A 3RAPR 5ALKA 2GSDA 4DQ0A 1NM5C 1PR0A 2NZUG 2ZRNA 3BIOA 3W7VA 1XVAA 3QXXA 4X6LA 5JSKA 3AUUA 3NTRA 4O08A 1E2QA 2JFXA 2Z1DA 4ZHSA 1C3OA 3G2IA 3PUVA 2GJKA 3MWFA 3U7RA 4BWYA 2Y0DA 4WJLA 5JSFA 1DAMA 2F8LA 4LZZA 3DOOA 1U6JA 2Q9UA 4BE7B 2ALJA 7ABPA 2E4AA 4Y6PA 4LBVA 2Y27A 2FY8A 2ONZA 4R71A 5EKDA 1NIJA 4RLFA 2BKEA 4BVGA 1VG8A 4FFBB 4B7AA 4L95C 1GCIA 2EZ4A 1EDBA 3W1WA 2DWQA 2F8SA 4WESB 2B2CA 2CWWA 3IJPA 2RMKA 1E8MA 4QGBA 4LAFA 1X8KA 3GEEA 1XU9A 3H1TA 4JKOA 1XD9A 3DWIA 4QKQA 3FX2A 1LDGA 4I1VA 4C6TA 3VR4H 5EJAA 2VNJA 3F7OA 4HEA6 2FSVA 1N1MA 2KSQA 2NO9A 1C3XA 1DFIA 1YU9A 4MULA 4RWEA 5SY4A 5A02A 4QG3A 1T4CB 1AXGA 2IOHA 4H1UA 4P7FA 2IGTA 3SIXA 2CVHA 2ZJ1A 3VTAA 2O8EA 3ENWA 4QDJA 3MRXA 2RBKA 5FADA 1YC5A 4L27A 3DF9A 5FR1A 4EUNA 2ZLBA 3AHDA 1KYXA 2YV2A 1RYDA 3F98A 4O4LA 4NOMA 1VB3A 5AKIA 2DRIA 4ZCPA 4BAZA 2JFHA 4ED9A 5KOIA 3AL0C 1N2OA 3AERB 3GXOA 3TX2A 5F1PA 3VZPA 5LU9A 3HVIA 1Y1RA 3QUQA 3UZUA 1R50A 2BGLA 4G09A 4PE5B 4RIEA 3TE7A 5CDYA 1BMFD 3HCRA 4QXRA 2VK2A 4Q3EA 4ZAVA 3WWPA 2PSSA 2QP9X 3ZVRA 4RELA 1RLIA 2ZUDA 3N9IA 5J4HA 2FHPA 2YMQA 4X3CA 4K7JA 2DTDA 3TTYA 1HTTA 3F5QA 1ZESA 2OBMA 3FSEA 1ZLYA 2HU2A 3Q7SA 3RC3A 1GLGA 2MIIA 2FPGB 3KXIA 3G2HA 1DRWA 1M3SA 2OHGA 1L3BA 3LT1A 3C7DB 1OYWA 4XWYA 5FOXA 3SFVA 4YDRA 1IZYA 3LV8A 2BFWA 4B3CA 3A3OA 5ANRB 3X0DA 4DSAA 3COZA 2QVXX 5ALMA 3U5TA 2VYNA 3IP7A 2PX6A 3PCTA 2X2PA 4NYMR 1RI5A 2DHRA 2QL5A 5BYAA 4HLUC 5JS8A 4LJ7A 1FFSA 4AY4A 3OT1B 1R5NA 1QFXA 3UANA 1H2EA 3IUPA 4PZYA 1H94A 4BNIA 1PNTA 4GBJA 4DR4B 3R9XA 2ZIVB 1FMTA 1HFKA 4MH0R 3A1UA 1VKNA 3GJTA 1V5IA 5LM3A 2EBHX 2EGUA 2OXCA 3TG2A 1MR3F 2F1HA 4R1MA 5GP1A 3ZGLA 4LF4B 1X1DA 4WSOA 3JATB 1Q7GA 1A9RA 5AKEA 2F4NA 2VHWA 3G0CA 1G4UR 1KQPA 2XDYA 1E1DA 1F6BA 3EC7A 1W0CA 4G9BA 2XNDD 4IFTA 1MB9A 1QUFA 1P81A 3GJRA 3L01A 4I3GA 1CETA 4JBYA 4LRXA 4RYDA 3MJRA 3ORRA 1RHJA 4NU6A 3CVOA 2PGJA 2NSJA 3LUJA 5K4GA 3VXKA 4ZV9A 5FT9A 3FSGD 3HB1A 3AEXA 2AYYA 1GPJA 3CR8A 4EUFA 2QRZA 3CE9A 1YHZA 4M7OA 1KOFA 4CL8A 1JG6A 2OAP1 1T3HA 1TOAA 4H6PA 1EVYA 3KQPA 3ZZMA 2IUEA 3EWNA 2CXHA 3G5AA 1L2TA 2JL1A 2AYXA 2V9PA 5CYPA 4EH1A 3C8DA 3HRKA 3BRCA 3K16A 1KP3A 2CSUA 3D9QX 1ZMOA 4GSYA 3SZGA 4L08A 5BQ5A 2YXPX 3BXOA 1XKQA 2VPWA 1T4GA 2HF9A 4I19A 3FE2A 4UFNA 5HGJA 2JG3A 2DWPA 3H84A 4IG4A 3DF7A 2I03A 2BEKA 4LWPA 4MR7A 5FI0B 3NMUF 4O2BB 3PIRA 1UMCA 5G41A 3R3ZA 5F3RA 3QVTA 4DBVO 1E2GA 3NC1C 2D5LA 1NC3A 2X15A 3CRRA 4B47A 1J42A 4QOEA 1U7DA 1KY2A 5AVSA 1PQUA 2HHLA 5CU7A 4CFYA 1VKRA 3W90A 2DUMA 2HADA 5TGDA 1JJIA 2BSAA 4B3MB 4M7WA 4GOXA 4N82A 5JLJA 2F4VB 2PD3A 5CG2A 4V0NA 1GUAA 2AFRA 2WLSA 3HVUA 4LGYA 4JKYA 4JOBA 2F1KA 3MS7A 1CUWA 5FTJA 3M1YA 4GBMA 1OI3A 1UXIA 1QKIA 3KEOA 4II3A 2WW8A 2Q7OE 5DNCA 3TX6A 5AKXA 5ER9A 3ONFA 3NS7A 2GB4A 2BI4A 2YCBA 2HWYA 3KTFA 4CI0B 1YCDA 1YFLA 5IJWA 2J45A 2BFFB 1FVXA 3QQPA 2ZIUB 1E8DA 1GKYA 1N0UA 4CEHB 3ZZUA 4LW8A 3RD5A 4QT4A 2P35A 2OB1A 4XYEA 3GF4A 2XZDA 1TM4E 2QDXA 4MLCA 2YY5A 3EEOA 1RZRD 3PDCA 1B3BA 4JL5A 5BT8A 2QYHA 4CKYA 1QQ6A 4EATA 2IXGA 3RTEA 1H2RS 4TTAA 4WN3A 4AW9A 2P1ZA 1K97A 4RFSB 3HGQA 4ARVA 3K53A 3ICVA 4JLOA 2FF5A 4AY3A 2OP1A 2FZGA 4A2CA 3O03A 1CQWA 3RAGA 1ZIDA 3WV4A 4FHEA 1X8XA 4LHSA 5GIOE 3GELA 1Q0UA 2Y92A 4DA0A 5AJHA 4ZCMA 3F3SA 3GNTA 5HF5A 1OBCA 1H1LB 3RANA 1W7AA 2ZQYA 5THXA 4G1BA 4UVDA 2WJZB 1WZIA 4DDKA 2JEYA 3CA8A 2OVBA 3N2NA 3EISA 2IZ6A 2YZ2A 1EJBA 1V9LA 3NGXA 4IWYA 4N7MA 4PFKA 4YJKA 3RQSA 3JRWA 3CFYA 3KG2A 4Q16A 3W3ZB 4BP1A 1W5BA 4B6PA 5HIMA 1VFNA 2UKDA 1K6XA 4DAEA 4ESHA 2A5DA 2BHRA 3DUWA 3H17A 3HDVA 3I37X 4CYMA 4E3ZA 4YR7A 2B8JA 5GY7A 2D06A 3S8EA 4OI1A 1J20A 5AHRA 1X7YB 3QEBZ 1W5EA 4FSDA 3LYAA 3HR4A 2JAOA 1RP7A 3DMRA 2EZ9A 3KM0A 3OEEA 2F1RA 3K96A 3P5SA 4HPXB 5DEOA 3SS7X 3FFAA 2YWHA 4HUQA 3CXUA 4HAOA 2Q5EA 1XKXA 2ZT6A 4HFJA 2E9SA 3TKYA 1RXUA 2VJMA 2VH2A 4Z1MD 4PPYA 5KAPA 3HBFA 4JEMA 3UTDA 3NJ8A 1X74A 5DYTA 3SJCA 1ZUD1 3WGOA 3A28A 3W04A 4MV7A 3B6JA 5AQ1A 1XTVA 3PF9A 2Z08A 3BXGA 2FZ4A 4KV7A 3S5UA 1G1AA 1LQ2A 2QGFA 1X87A 2WM2A 4P7JA 3MMNA 3K70C 3AVTA 4IGAA 3VYRB 3DL4A 1AG9A 1DDGA 2NTYC 5EE3A 1JAHA 1L4NA 1SC4A 1VMEA 3BCUA 3GPBA 3W3AD 5KVSA 3Q12A 1T0PA 3ZCPA 1QO0D 3ZYZA 1UQRA 3CBGA 3K2EA 1G5RA 1QS0B 2H31A 1KZ6A 2PS3A 1RABA 1Z5PA 3MWGA 1JDNA 1DQRA 1Q92A 3AR2A 1F14A 4IH9A 1C7EA 5LJLA 1CUYA 1PG2A 1WY7A 5IANA 1FOEB 4LJSA 2G3YA 1EKXA 4KFSA 2XAAA 1P31A 1HDGO 2WOJA 4HXYA 2P9CA 3H1BA 1L1FA 1R2QA 3CR7A 3W4IA 3WLFA 2C54A 4PNZA 4NI5A 4D8XA 4GR9A 2HAEA 3L04A 3O6VA 2ASVA 3R3YA 4J1TA 3WWEA 4UPDA 3KFVA 2Q5LA 2WJGA 1NLUA 4AKSA 2RAUA 1WM1A 5A05A 1UDAA 1KE2A 1II9A 3GCWA 5F7OA 1H2ZA 4KN9S 4MKFA 2FPUA 4EI8A 5EKUA 5HRUA 3UHFA 1G8SA 4ZDJA 1IHUA 2J41A 3IVXA 2ZCJA 5FPHA 1VE5A 5H70A 4BMCA 3Q8MA 4MRAA 5EMLA 1G8YA 2WD8A 1SXJC 3RS5A 3TQRA 3UJAA 1KEZA 2O7VA 4D57A 4DILA 2YZKA 3WNBA 1N2CB 3SNKA 3W6OA 1O0CA 4PSAA 5GM1A 3U48A 3NKVA 3HU3A 1UEXC 3IAEA 4Q9HA 4CKCB 1K92A 1V96A 3HBMA 2C9YA 2I1VB 4RK5A 4M0DA 4LZWA 4XRRA 2EKZA 2JHPA 4NBTA 1UBHS 5ADWA 4IV0A 4G0ZA 4BS9A 4EM6A 1KL7A 4AXBA 4IJ6A 3I5MA 3CY6A 1MP0A 2BGTA 3OX4A 3H9CA 1J90A 3ELWA 3DYVA 4HL6A 3ZDAA 3S5JA 1WXFA 4AECA 3PGA1 1T5TA 4KE9A 3VISA 2EGGA 1TJ5A 2W58A 4FDVA 1B7GO 1AM4D 1VMAA 2PSHA 4IGEA 4WHMA 3ZHCA 3MMPA 2SECE 1M8JA 3KUUA 4N6NA 3UENA 4CT5A 4C4TA 2NP7A 5HBRA 1QHEA 1VKZA 1GDHA 1QO0A 1PVDA 1HPLA 1Y81A 3D7RA 4MI3A 4WY8A 1J0CA 4XI9A 3T06B 4ZKDA 4BN5A 3FD8A 1WQ1R 5EIEA 3NEPX 3NP9A 4DRXB 1CQXA 5JYEA 1VHLA 1SHLA 3RTGA 3MHTA 3K4QA 2HRBA 2VJPA 1B6GA 2X1HA 3AKCA 1EU1A 5K4AA 4EZIA 1ZGCA 1M6YA 2DBQA 1R3UA 2ODQA 3ZG6A 4IUCS 5FAXA 2JFNA 4N4AA 4D9CA 3WGQA 2PQ6A 1RJDA 2K2WA 1A88A 1O96A 4J4BA 1WDKA 3LQFA 4JODA 1U98A 3WXMA 5JANA 4KWHA 4BX8A 1TQ2A 3A1DA 3H3FA 3VR5H 1V6CA 1TMKA 3PNLA 4PCVA 4C43A 2FDRA 3N0XA 1I4OA 2EJUA 1PLJA 3UCEA 2JIQA 2VXOA 4GU5A 4HDSA 5DSTA 4GNKA 2VZ9A 3OLYA 2P91A 1FU4A 2PM8A 2R48A 3L8MA 4R9UC 5JADA 1ZVJA 2UUAB 1F06A 3W3AA 4ME6A 6REQB 2FX5A 2ZRLA 1BEUB 2BCGY 4KIJA 4IP0A 3TD6A 5A9SB 1OWNA 1IJBA 1QGED 1VMDA 2X1MA 4ATNA 4UM5A 1N0IA 1BQ4A 3PFCA 4F4UA 5LP6A 4W4TA 2PNFA 2CCGA 2YY7A 3OT1A 4X7BA 4YAOA 1ZJ4A 1P4SA 4S35A 5DRTA 4WVLA 4RDIA 4W5RA 3E9RA 1VA5A 5CVCA 3TTTA 2QMYA 3FWYA 4FGWA 4DNPA 4N7JA 3GRYA 4UHFA 3B6MA 1KO5A 1NBOA 4C4RA 2BUAA 2EFYA 1XP8A 3D6MA 3FCYA 2FW1A 4GBED 2HSGA 3UJ9A 1X19A 2NZ8A 4TYPA 3E22A 4KITB 4JEUA 4FD2A 2IW3A 2R85A 2XW6A 4NESA 4JIGA 2QJOA 4M8SA 5EP3A 2FPGA 4QA9A 5ARDA 1U3DA 4KDEA 1H3EA 1JU9A 1KP9A 4H1WA 4KIWA 1RZRA 1CUAA 1K8QA 4U00A 3SU8A 1CUUA 1SIUA 4KRFA 2C4HA 4AAYA 2ZVJA 4JJ7A 4O33A 3ZY4A 1NG1A 4MJLA 2OGTA 3WLJA 3BIWA 4ETIA 1RHMA 2XTAA 2YW9A 5K20A 1TEZA 1C5KA 4Q7LA 4OQEA 1Y3IA 4AIIA 3DXFA 4FS3A 4MUIA 4FYWA 5TMBA 3RVSA 1F7UA 5HJ5A 3HRHA 4JCCA 3E9NA 1ZGGA 4NAVA 1ISPA 1RWVA 1Z35A 3QPBA 4WZAA 3ZCQA 4BV8A 3KX2A 1IZ7A 3ZJUA 3DUFA 1X1TA 1KVUA 1G21E 1OU0A 3GROA 1X6VA 3PEUA 2VEOA 1I6WA 3GEMA 4NVRA 1SKYB 2OA0A 5HOQA 2UV8A 4X41A 4BBZA 5F73A 5C7OO 1M34B 2IIVA 1BKSB 5DNVA 3K0HA 3P0FA 3WG9A 4N6OA 4CQLB 3OFNA 1ZXBA 4XEHA 2PGDA 3WGKA 4MVJE 4DQUA 5CT6A 5F33A 2YHBA 4G4SO 5FUBA 1UC4B 1XSEA 1AB5A 3WWCA 4NFSA 3S99A 3ZI0A 4CUZA 1GTMA 5JCXA 3IQIX 3LG2A 2ODBA 2JRLA 2L69A 4ZT3A 1Q7RA 1ZD9A 2H07A 1WULS 3DYIA 4R98A 4TS3A 5D7NA 1YDWA 3PX3A 3QNWA 3HCOA 1JR4A 3AHCA 4HFNA 4C0QC 4OP2A 2PXAA 1K0FA 1XLUA 2CMKA 3GOHA 4KFRA 4AMYA 4F06A 2UXBB 1QF6A 1ORIA 1SC3A 4OGKA 4IJQA 2OHVA 4BVKA 4WBXC 3KSAC 4NOLA 5KVVA 1YS2X 3GP3A 4EPVA 2PUCA 4O3MA 2YWCA 5EXPA 1G21B 1WAMA 2GUGA 1MDBA 4RY8A 3FI0A 3EVFA 5K1ZA 2ZI7A 3BMCB 2ZU0C 1A2KC 1BZYA 1WPXA 3BQNB 1Z2CA 4DCNA 2AUTA 2O5CA 3WFIA 1QPGA 2I3BA 4V0LA 2W37A 3HR8A 1UJMA 4POAA 5KDDA 1VXRA 1BKDR 3HNPA 3HXTA 3B8EA 3KQTA 3F1LA 3I9LA 3AU8A 2CLKB 3TZQA 3VSAA 3WRYA 3ZTTA 2IYRA 1IPFA 1CZLA 3EXIB 2IK8A 1RKBA 4FIDA 2BHSA 4DV1B 3HPQA 5IZCC 1IWOA 5CT8A 3S2EA 4K28A 3ZCUA 3N76A 4RVOA 4RORA 1J2UA 4TZ6A 4DL9A 3L6OO 3VI4B 4I55F 1E3WB 2Q1UA 1NAIA 3F4KA 2YV1A 3GLIA 2DQSA 2FP3A 4QC2A 3HKDB 3FIJA 4FMBB 5B55A 2JZNA 3II6X 4CODB 4MUNA 3SEQA 2QD5A 1ZH4A 2P2ZA 3NB0A 2AF3C 1GCOA 3O7WA 2I87A 2IU3A 3B6ZA 4PAGA 2V9ZA 1CRLA 5CLLA 3FBGA 5AKHA 4CN9A 2WJPA 5LMCA 3UOAB 1DKQA 1UMBA 2G5PA 2VOJA 3OTIA 4ND2A 4OQZA 5LZ8A 4F2GA 2DY0A 4I4LA 3N6RA 3QX8A 3DEYX 3RYFA 9ABPA 2ORYA 1WF6A 5B4UA 1U5BB 4AJIA 3TQHA 3KQKA 1GZ5A 3MIIA 4RLQA 2UYHA 1EE2A 3FVRA 3GN2A 3Q7PA 4B3IA 2IRWA 5L6MB 2BJWA 1J8MF 2NT4A 1Q44A 1WOYA 2QM3A 4KZPA 1A7KA 4MS1B 5DTMA 1T2FA 2Q3DA 1KC1A 2B1QA 1OA1A 4Y0NA 3WSVA 2FRVA 1YQEA 1ECPA 2PRIA 2VN8A 4BFCA 2W6ZA 3KQNA 5HVNA 3DFIA 4GEGA 5HPYB 2BM0A 4GPBA 4JVMA 1PJ8A 1XELA 3LM8A 4CFZA 2R68A 4EECA 4MB6A 1NQUA 4Y2VA 5DW0A 3B1FA 4XJVA 5DX8A 1E99A 4OBEA 4JUDX 4QU9A 3RJTA 4C0AC 1QCZA 1PWHA 2Y0EA 4XWWA 1KRHA 3EMVA 5E1MA 2PX5A 4H60A 4NZ9A 3GGPA 4K9QA 4E07A 2QVCA 2WJIA 4KQ6A 2YIJA 1MB3A 2YQ4A 3SP1A 1FXSA 3NRJA 1NLFA 4A0SA 1RQGA 1TQHA 1DAOA 1E1CA 2VKTA 5ENZA 2BN4A 1WQ3A 3NBQA 5DNDA 1PRYA 2WU0A 4UEQA 2C31A 3ZBPA 4TS4A 3IP3A 2JW5A 1ZRSA 1CQZA 2F3PA 1W96A 2BMAA 3SQMA 4F6RA 4RX1A 1V43A 1XRJA 2WC1A 3BDVA 1WETA 3BULA 1BW9B 2DWCA 4G67A 1MB4A 3T7RA 3U31A 3MCWA 1WY5A 1WMSA 1JTEA 4UTVA 3R7DA 3TSCA 4RE5A 3KPVA 2M6LA 4D80A 1T5LA 1WR8A 4XA8A 4UMVA 3NHAA 3NXSA 5AKGA 4HAVA 3WE7A 5IYZB 1IJEA 3CLUD 3KB8A 2O48X 2Q46A 1JQAA 3KKEA 3MWJA 1HUQA 4Q47A 4R8LA 5A4JA 1CHDA 1V8PA 4HAUA 4G84A 2VCHA 4HEHA 4IGKA 4OJQA 1AIPA 1FDIA 2WFMA 2WJHA 3ONVA 3TLMA 1YS7A 1IHYA 3I1JA 4DLNA 4JHLA 5ALRA 1TD9A 3EZNA 4MI9A 1IUPA 2FMUA 1JVNA 2WAMA 3M2TA 3QI2A 4BTLA 4KG7A 2CLDX 1GA1A 2Y3IA 3T95A 5L4NA 1DTWB 5LZ2A 4MINA 1I9GA 3W9YA 3PQDA 1O94D 1QAQA 2Z4RA 3EHDA 1PKEA 1L5HB 4U8HA 1GSAA 2VHYA 5KNCA 1YOBA 2BKXA 4KDCA 5AFSA 2E2WA 2ERXA 1XMVA 5C46F 1QX4A 2I4LA 2IQ5A 4TGLA 4YLYA 5FYQA 1EEXB 1XNJA 2IEIA 2C5EA 3GRVA 4JQSA 1NT2A 4K9OA 3GJXC 1GQQA 2V1UA 2XUZA 3QHAA 3K0SA 2GCGA 3FRJA 3KLOA 1V1RA 1YB4A 1J9ZA 1QPBA 1A4UA 4YRDA 5AJUA 2NTJA 3G9TA 2HSZA 3A4MA 1NVGA 2C3MA 2OR3A 3LQ4A 4DCJA 1BVHA 1M33A 3I2HA 3ROFA 1M0EA 1ZL2A 4N1AA 3HE3A 3TFWA 1BHO1 5KEIA 1VZ3A 2WT8A 4IIVA 5EL0A 3T7SA 4EIWA 3HBLA 3GJSA 2XBMA 2ZXUA 5CT4A 2BZSA 2R6DA 3KYDB 4Y98A 4G5XA 4C7MA 4C20A 1SUFA 1JQLB 1NBWB 1ZW1A 2RBEA 1JIQA 2VDJA 4X61A 3OZBA 3VZQA 4MLDA 3WX0A 2Q4TA 2F43A 4ZQFA 2NXJA 5FFNA 1I5OA 2AKAB 1XQ6A 4GZ6A 2WSLA 2WT9A 4KXFB 2JAUA 5IDXA 2QTZA 2ZTMA 3PI7A 1KGDA 4PYLA 5LP6C 4DV2B 4MW5A 1OZFA 2A30A 2P4SA 3ZWPA 1N7HA 1RI1A 3KLNA 2DR0A 3QP9A 4MV1A 4WNIA 1Z56C 3H5WA 2CC2A 4LXQA 2VCEA 4YV2A 1LSOA 4GIBA 1T0IA 1V71A 2Y1CA 3CUWA 4MXDA 4B34A 3B53X 3HCCA 3CMMA 3N2GA 1CUGA 1IHXA 2CVZA 2MDTA 3I9NA 4U39A 2H4XA 2ODAA 2YJ5A 3W9BA 1XEXA 4XCXA 4B7CA 5EIHA 1DAEA 2D00A 2N0SA 5I7HA 4E1AA 4JJAA 1Z2AA 2R8YA 2J8ZA 5B6IA 1N3YA 3OZGA 5L51A 2OBBA 3SKYA 2HMAA 3LHFA 4TKLA 1R00A 2EJTA 1LNQA 3THOA 4BLPA 3SE0A 2EIHA 2CV0A 2GJAA 2CFSA 3NW9A 1E4YA 3DEAA 1O95D 2X9VA 2CZCA 1Z07A 4L2IA 4XM0A 3AKZA 4D1YA 3B12A 2RH9B 3QBDA 1VLZA 4U2GA 2QZ9A 3GLRA 4BNLA 3JS5A 1NNLA 3AFMA 2LIPA 1XZIA 4R1OA 1FVOA 1M7HA 2WSSD 1FSSA 1XJ0A 2VF5X 4I9GA 3D8NA 2CVFA 4M1QA 3F6PA 2AFIE 3E3OA 3G5TA 3COSA 1X3SA 4OHCA 1HZJA 2BFPA 4BO9A 5JS1A 4FKZA 4AK9A 1UMDA 4MO2A 1ZM3A 3C3JA 1VP3A 1P5HA 1YT5A 5HTOA 2OZEA 4M0FA 2F59A 4DIDA 1G4HA 2XDWA 3KLMX 1E5TA 1LJ8A 2IHYA 2RC5A 4GC5A 4H77A 3K0FA 4W5WA 5ILQA 3CM0A 1TRKA 3QY9A 4JQYA 1M66A 1VIVA 2G82A 5E0KB 4KGDA 5AK3A 4V1CA 2ZCVA 2DAPA 1KDOA 1OXMA 1X15A 4MS3B 3AHEA 1DBQA 2V7XA 2GEFA 2QXTA 4C0JA 4CM7A 2PU5A 5JTUA 4JNCA 3K8OE 3L1UA 2JAHA 3JQCA 4JI8B 3DAFA 4NCKA 2QE7D 2GAOA 1BTOA 1V1RB 2WU3A 5AI4A 4FK8A 3DPIA 4ARIA 4MVJP 2R96A 1KY4A 2W93A 3RC9A 5K9ZA 3G9UA 1ADJA 1JH9A 4F96A 3UQZA 1Q1EA 1A27A 2QMZA 1Z68A 1UWCA 4IQ8A 4R1TA 1V7PC 3KTOA 3TW6A 2BEWB 2WZCA 3J81k 3SYNA 4OMCA 4D9KA 5F2EA 3L1IA 3P97A 2O8BB 3ETNA 2ZUUA 2B5VA 2W6OA 4PGGA 2ON6A 1BD3A 2XTJA 3E3NA 5HKAA 1KI6A 4K9MA 1OLXB 2IQIA 4U6SA 4V1CI 3UJ6A 5T8KA 4DSOA 5B3KA 1TTTA 5DWQA 4BTVA 4DG8A 2I29A 3PDJA 3HJHA 4ENUA 3BEOA 3AETA 4MWTA 3RU9A 2QNBA 5KOJA 7MHTA 2BGMA 1AKTA 1C3JA 2VHJA 3NIGB 4P4TA 4Z86A 3RK4A 5I47A 3I5YA 3ZGZA 1CP2A 1HE1C 1T1EA 3EGOA 3K09C 4RVNA 4B48A 4CMEC 3TEMA 5K5EA 2NU8A 4FI3F 5BXYA 4OB6A 4DLXA 1AS3A 3DTVD 5BQOA 1L7VC 1W4BA 4EHHA 1HRDA 4X1KB 5CDGA 1EWVA 1GZ7A 2A1TS 2G4VA 3AEQB 3R6TA 5LN1A 4NBKA 4Z9XA 1Z0IA 3HZZA 4CCWA 2E85A 3GUZA 3PL5A 1ODJA 2JCXA 2ZRKA 2QHXA 3CUEF 3JQEA 4MQ5A 5A04A 2HA7A 3D5EA 3OM9A 5BV1A 2B0JA 3MFYA 3DEKA 3WIEA 5LD2B 3A1NA 2PZJA 2FR0A 2WMNB 3WRWA 3NOVA 4F84A 3ZE6A 4G36A 1JILA 1FJHA 1FUYB 3M0EA 2OZVA 3DL0A 1IONA 2YQ5A 4BKRA 2VA9A 4I2VA 3OWXA 5CA1A 2A5FA 4ND6A 4CZ2A 2QX9A 2YTZA 4YC7A 3AEUB 3A9SA 1U6KA 3LP5A 4MS4A 3RIYA 4RKWA 4OKSA 4DS3A 1RAFA 3IR6A 2R8EA 4QWMA 5CCXA 4GICA 3FMPB 3A25A 1XALA 1PYGA 3GJ0A 2PRYA 3D7MA 3HH8A 4C0XA 2UUOA 3OHPA 5LMZA 4Y2GA 2OYRA 3A7DA 3LUKA 4MQBA 5I5EA 2VAPA 4V0MA 1XTRA 4JJEA 1DX6A 1QGAA 4LIPD 3AEKA 3WGYA 4YJ2A 3QBVA 4CLEA 1JIXA 1N25A 2Q9CA 4F5ZA 3L6EA 4OA8A 4D8TA 1BWSA 2ZR8A 3AEUA 3PWTA 4UULA 5ALYA 5EZ6B 4MIOA 4NYIQ 3EYWA 2HRQA 2JHGA 4JC0A 1NBEA 5EJ7A 4F5EA 5KYUB 3WRVA 5MF6A 2TRSB 4RKQA 5FQNA 1NP6A 2P65A 1MQAA 1TEVA 2RG1A 1YZYA 3P52A 4J4TA 4QGSA 4RTRA 1IFXA 1YIDA 2QYOA 1M2OB 4BHTA 2FRXA 3V8BA 3LKBA 1H0SA 1Q0PA 3AKDA 3CRQA 1KJ9A 1LPSA 4MKZA 5T4HA 1QGDA 4GMDA 3IAS6 4M86A 4MGHA 3ZCTA 4Y2SA 3WQRA 2PTHA 2C88A 1LLCA 2F3TA 1HFWA 3HKDA 5EIBC 2QLBA 4Y1FA 1C7QA 2RKWA 4JYCA 1A2BA 4OHXA 4JT4A 4QO8A 5AKKA 5B57C 4BLWA 5IT4A 1SCUB 3RCBA 2O2CA 2ZJ6A 4OYHA 1E9SA 4QXPA 5LA6A 1M2VA 1QG0A 4QIHA 1UBCA 2BI7A 1Z5WA 3MTBA 2XT9A 3WGGA 5UKDA 2P2NA 2VF7A 4U4AA 1YRQA 2I67A 4NOJA 1AKRA 5THQA 1KZHA 4YIKA 1PLKA 3VZSA 5F9HA 4HSGA 3B6IA 5DM2A 2O0HA 3VC2A 4X91A 4NJEA 1SN7A 3HNOA 3PC6A 3V32A 5BT9A 4XYLA 4EI9A 3DVQX 1V4NA 1NONA 4O4IB 4RA9B 2O14A 4LX8A 3DOEA 1WXQA 2J6BA 4DNQA 4DTCA 1CUJA 2BEWA 2FWAA 3GZTB 4IDHA 1K5GA 4L9SA 5DXAA 5JY1A 1F4PA 4PPFA 1XVTA 5DP1A 5I51A 5LU8A 3GAMA 2JGJA 2E82A 3ROPA 2C29D 3OHSX 3A32A 2QLTA 5KC8A 4EB0A 3LLSA 1P29A 2NVWA 1D09A 3OFKA 4MV9A 4N7BA 1Q22A 4TMYA 3EW9A 1A96A 2ZI5A 1GPH1 4UDYX 1W34A 1I94B 2IHNA 3GY0A 4R54A 3WGLA 1KZ1A 2OGSA 1XDWA 2VL7A 2D1RA 1TT5B 2X7XA 2VJLA 3ORFA 1FBNA 4ZT5A 4EVIA 4B33A 5U1PA 4CTJA 4II7A 4MQLA 4FW8A 4X7PA 2PYZA 1P9RA 3ZHQA 2HWKA 1EVIA 1KVTA 5CIQA 3DD5A 2V3WA 1MV8A 5L8VA 4JP3A 2L2QA 3A9VA 2C4TA 2VQ6A 2W2XA 3MGAA 5FBQB 5LB4A 3WGJA 3WFJA 2XOEA 1E1MA 5BNTA 3QFRA 5LC1A 3H2KA 4D8WA 3AI1A 2QPTA 4QJ5A 1Z25A 3HA3A 5TC4A 3W5UA 2ZU6A 2ID4A 4JI6B 1FFBA 2P30A 3ET5A 3O2SB 1G16A 4RY2A 4FYHA 3RSFA 1KEVA 3SPXA 4CCAA 3E84A 5DBFA 2EEZA 2BMEA 1WLSA 3D4LA 1TCBA 4BZXA 1X7ZA 3DO6A 4UHJA 2QTFA 1T5SA 4IILA 3T3MB 5ADVA 3THWB 3KTAB 2B7LA 2ADOA 2XTZA 3P32A 4YMIA 1T24A 4TN1A 3EVCA 2RGCA 4JROA 5TR9A 4D5GA 3K2IA 4G4JA 3JVIA 3BMXA 2PT7A 4MEBA 4P93A 3RGGA 4ZTUB 4L73A 2I6UA 4M0KA 4BL5A 1JG3A 1FS4A 2YN0A 2ZG6A 3IVAA 2Q2WA 2HA4A 2GM4A 3DJYA 3GRUA 3QVVA 1J56A 3AM1A 4KHPB 2OHXA 1RZVA 2GEDA 3HSSA 2WUEA 1JNYA 3NTLA 1B93A 1YCFA 1YTLA 2Q2QA 4TV9F 5IVKA 2WFAA 4LE0A 2FCAA 4YXWA 5K0BA 3NM6B 1R0SA 2NPOA 3L06A 2C00A 1TQ8A 4UCQA 3BMQB 1YIOA 3V55A 2A84A 2JH3A 4JP1A 3SHQA 3PUKA 3I76A 1L8OA 4ZGGA 1QRSA 2AMJA 1NUAA 3L7KA 4FUTA 5GWXA 3TM5A 5BV0A 5IDWA 3OIWA 3RYIA 1OC4A 1ZM2A 2QJRA 4LPSA 5ALVA 3UK2A 1DUVG 3LT0A 1AGRA 3GD7A 1JQEA 3LQQA 5JSHA 2R66A 3DAYA 4Q19A 4HYYA 4MV3A 3K70D 5AICA 2OVFA 1X2BA 2BP7A 2C07A 3C24A 2XVMA 3LVFO 1JH8A 1DWOA 4IIGA 4KAFA 4B3DA 1GARA 4LHYA 5AUOB 1M2EA 1EFLA 1T3GA 1FY2A 4V39A 2VRBA 1X42A 2Y9MB 1C7JA 5YASA 1N4AA 2LPMA 1TDJA 2HBYA 4US2R 2EL7A 3NORA 1KK2A 2Y05A 4CG2A 1ZRMA 3FOAA 4Z0PA 3RYIB 4CDMA 3QVGA 4EQ6B 1HYHA 3UFXB 3ND6A 3N8NA 2HZBA 4DBLE 2PKCA 5F21A 3UYKA 1ZGJA 3U7IA 3VV3A 4D0NA 4DWOA 5JS7A 1Y7IA 4DUYB 2BTEA 2PJZA 2HRRA 2RHBA 1U0RA 2WP8J 3ESZA 2IHUA 5DJ5A 5T3YA 3M6AA 1VCHA 3GWGA 4YJFB 1N1GA 1QTIA 1W4AA 4R9NA 1LNSA 4MB0A 1QDUA 3DBLA 4TXMA 1DELA 5L7WA 1IZ0A 1O0SA 3KQSA 3MWEB 4N48A 2D5IA 5L53A 3GUHA 1HYBA 4LNHA 3MJTA 2WWYA 1NVWQ 4I1OA 4XWAA 4MPRA 1LTKA 4A0GA 3R3UA 4U9IS 1WHSB 4P84A 3UK1A 1XTUA 1D1QA 3T4EA 2VSOA 4KH0A 3W7AA 5CFMA 5KMGA 1OCEA 1PZEA 5FL7A 3V9AA 5B36A 1CDOA 1N6NA 2H48A 2DQ4A 2DHEA 3AB8A 3H87A 4NAUA 4O2AB 4QSMA 1JKFA 2O8EB 5MFPA 4CMBA 4F7DA 4IINA 4Y1GA 2OAQ1 2BFCB 3QSYA 1HDCA 3VNBA 2XQGA 4BCDA 1ZLXA 3MWEA 2IIPA 1TO2E 4NP6A 1ZONA 2WICA 3FAKA 5KSPA 3BT7A 1DJMA 5C7YA 3MN1A 2HPHA 3R0VA 2PUGA 4DSNA 1BXGB 3D3EA 4N3CA 1YHYA 4J8PA 3DLCA 1L1QA 2RK4A 1KPIA 3H9UA 4QHSA 1JIUA 3PDUA 5FHRA 2WHPB 5TMEA 4Z2AA 4HYTA 3MJEA 3NFRA 1RC8A 3WIDA 2A78A 2W0MA 4TSFD 3FF4A 2B3TA 5JVDF 2WPDD 3H4TA 5LIRA 1Y89A 1Q0SA 1IJFA 1QVVA 3EUWA 3G49A 1SU8A 1Q5PA 3KHTA 2A9PA 3NDRA 2GJ8A 4GDFA 1LEHA 5JHHB 2GEVA 2EJCA 4W5JA 4ZO7A 5FX2A 2YY6A 3HO1A 1YZGA 4PSDA 4QOIA 4JOCA 5ESRA 1U8TA 4KO2S 4U8GA 1E0JA 1AMUA 3KKPA 4ZCSA 2NLOA 2XUGA 3IO3A 3ND8A 4J2HA 4K6KA 5DTRA 1U5CA 1UJ2A 3FPFA 3G8CA 1U7ZA 2W5UA 5JXWA 2IV3A 4A6DA 2PYIA 3H2BA 4TKUB 1QPZA 2XGSA 4NZYA 5KO2A 2AG8A 2G0NA 3RAEC 5FJIA 1DIBA 1JIKA 1ZR2A 5K8CA 3ZGYA 1IPEA 2JHCA 2XWSA 3SQDA 1RU3A 3I0NA 1V37A 4TRMA 4U02A 1TF7A 3V46A 2P41A 3KQLA 3BE5A 3CNNA 2CNBA 4A16A 4TWJA 3PTAA 1I3LA 4YUYA 3RARA 5DGXA 2RHGB 3WHIA 4LECA 1MT0A 5CM9C 3DDSA 4ALLA 3SYLA 4PXAA 1CR4A 4OJMX 1B15A 3L8FA 2ES4A 4FFDA 2J9FB 2UAGA 1SBNE 4O4JA 5EWMA 4X66B 1BVYF 2PGIA 3TZBA 4RJ2A 4DIEA 3C2QA 1KO7A 3BYZA 4BB0A 3LO5A 1ESZA 1LW6E 3U3ZA 4ZVSA 4WXYB 2I0FA 2IXEA 2WNHA 4I1YA 2H54A 1CLUA 3NBKA 1YWGO 2VIIA 2Q4BA 1SUIA 1CY4A 3AKEA 5CFOA 5M34A 1HE8B 2F90A 1ORVA 1KGSA 2GVDC 2GSWA 3MRSA 4P4UA 4EYQA 5HXAA 2CL0X 1HE4A 4G5SA 3LFUA 4KXMA 3SOZA 3CSSA 5BV8A 3ZV4A 1FW8A 1FX0B 1ZQ9A 4FGKA 3LT4A 1MABA 1ZNWA 3LT5A 1U7OA 3Q88A 2B9EA 2YVKA 5DGHA 1H9AA 4MI1A 1XCOA 4UNIA 1T34A 2HCFA 1QO9A 2R1UA 2W2MA 3B48A 3DS8A 3O3MB 4R2KA 4UAVA 1XMIA 3SZMA 2FLVA 1XO1A 2W2LA 4BFTA 4KFCA 1LC0A 4R3UC 5ED4A 5E3JA 4PLWA 5AOBA 4H16A 1ZUHA 2P2DA 2DFKB 3O84A 1PGQA 1IEQA 2PLWA 3KOMA 4QRHA 4X92A 4TYMA 5B4VA 3ZKWA 5J2TF 4Q7MB 2A0UA 3C43A 3IBCA 3LCRA 2WFZA 2CL5A 3HABA 5E6UB 2CMHA 3L7NA 3AWIA 3FOEC 1GLVA 2XKBA 4ZYVA 3BK7A 4RD6A 2F3SA 3EXFA 1GSHA 1SXJA 2O52A 2PGAA 2R47A 2AI1A 2BSXA 2R6GA 1X70A 2RB4A 4GRIA 4J3JA 2PH1A 4LXUA 4F5YA 2QV0A 3TEFA 4AJ4A 3I61A 1DBVO 1KDVA 1YZ3A 3IUEA 3RRNA 4BMNA 3U4CA 5G4KA 1GFWA 1Q1ZA 4HBGA 3EH1A 2AHRA 3IP5A 1E2HA 4FCTA 4LHEA 1H8EA 3F3YA 2OC4A 4LI0A 1HYQA 1ZAKA 2QA5A 3HYLA 5EJ5A 1NJ2A 4UDNA 4ISBA 2DPXA 3EIXA 1U1DA 1SBIA 1QDLB 2Y8EA 1ONSA 1LQUA 3QPVA 4WOKA 3T1TA 3IURA 1QP8A 3BWXA 4QYTA 4F4IA 2JLVA 3SWWA 2H57A 1MOSA 2OMEA 1A77A 3O8OA 8ABPA 4NK5A 1T5HX 4F86A 3ZD7A 1GPMA 4M83A 5D5PA 1JGTA 2QRGA 4PCLA 2I7CA 1SZDA 3DE0X 2BLNA 1ZIYA 1X13A 3IDOA 5DYYA 2OKCA 4JP5A 5AQEA 1OWOA 1SVSA 5J2TB 2WTUA 3USES 3AILA 1ZP6A 1EP9A 2WVHA 3ILVA 4G8JA 3ITNA 2XMZA 3OCYA 3CT4A 4HRAA 2AOXA 4QUAA 3BMOA 1G2IA 1P75A 5DTJA 2OLEA 3U26A 3G9QA 2F3RA 1JU3A 1FPMA 1I24A 2P8SA 3DFKA 2HIGA 3OO1A 3SF0A 4COOA 4OKNA 4A0HA 4AYWA 4RTOA 4HDMA 3LI2A 4OU4A 5F7ZA 2YFHA 1N6HA 3EOAI 1IOWA 2O8BA 3UH1A 1ZUNB 4KKVA 3L0IB 5JU6A 2IV7A 4MQ6A 3BWYA 1QV7A 4P83A 1TPZA 2DG2A 3MOIA 3R41A 3PDHA 4Y6RA 3WQQA 5FO0A 2H63A 3OIDA 3I6IA 3R6DA 1NYTA 4R2IA 3T41A 1SJ9A 3EXHA 1MHTA 1ID1A 5GOTA 1DZIA 2XGOA 4YQFA 4DR5B 2XKAA 4QDOA 1EG7A 3I23A 5IH3A 3UYLA 5C3UA 3EEFA 1NG9A 1JEYA 4TV8F 1UIMA 1A9XA 1HOXA 5ALWA 3QWAA 5E1BA 4PO3X 1L5YA 1V8BA 1WZNA 3NR2A 1OFGA 1AQIA 4TTSA 3RIHA 3NHBA 2JJ8A 3VR5D 4DUGA 4F4FA 5HQ3A 2BWJA 3I30X 3TH5A 3TZEA 1JBKA 4UTOA 1CZUA 1LPNA 4LXIA 3VKGA 3A1VA 3ICPA 3ONDA 2QYSA 4WLOA 3KYJB 3GA5A 4Z0NA 4ZVQA 3X1DA 3M81A 4BWFB 2CNNA 4RENA 5TARA 4KREA 1V5WA 3ULKA 4B3RB 2H85A 2HDOA 2Z3VA 3HM2A 3JQBC 4CPDA 5FD8A 3S6JA 2NUTA 3OBIA 4F2DA 2WHYA 3DLAA 4B43A 4XGRA 5E7IA 3VDRA 3UT5A 1I4DD 1VHJA 4LISA 2HHAA 2HMUA 3H5LA 4GAEA 4CKWA 4YMVA 5K0TA 3X1ZA 4HBZA 4HEJA 4DLSA 1I4WA 1CZKA 1DKOA 3G82C 1UBLS 2YXEA 1N2CE 5ABPA 4ITVA 4AKIA 3KEMA 4RPKA 5EXTA 1EWYA 3ASZA 4Y30A 2YJ4A 1DP4A 3LHDA 5JC1A 2E37A 1ZKDA 3FOFC 4IOJA 3LMKA 5DBOA 4TLMB 2VJYA 1Y1LA 1QDEA 5ADUS 2C58A 2NU9A 1IDN1 2SHKA 4P0TA 1ESCA 4B3XA 4DSTA 2G17A 4WA8A 4L9WA 5JBQA 5B1IA 2J46A 1W9HA 2X0KA 3MUEA 4HXEB 5ALEA 3GN1A 1HDYA 2OCAA 5GJCA 1O96B 1ETHA 4NBWA 2BKVA 2KLBA 3UKOA 1N7GA 4Q34A 5H16A 1WUKS 4QVKA 4OQQA 1L5VA 3I64A 1VC2A 1PJZA 4ARAA 4L5JA 3U17A 2Z9BA 1HI9A 1K6IA 5JEDA 3CPSA 1JQJC 4JMLA 5G1PA 1INLA 3FA2A 4IQGA 5PNTA 2AYZA 4HHEA 4XWOA 2P6OA 3EY4A 1I1QB 2PEYA 2E4XA 4DDHA 1I5RA 1NJFA 2ILVA 3UB2A 4NARA 3U1BA 4WKBA 3F6BX 3VJRA 1DEHA 3JARA 1K6JA 3K9LA 4LZJA 4REQA 5GOZA 4GWLA 3RBXA 4BJ5A 1JEQB 3HU1A 4C89A 5KNLA 4WI1A 2BEVB 2X58A 3F3MA 3QU5A 1NVAA 2PWPA 4IHJB 1YSCA 4YRLA 2FEAA 2M98A 1JUDA 3STTA 1RHRA 1KAOA 1C30A 2TMDA 3OPYA 3AERA 1WMFA 5BWNA 1QNFA 2D0DA 4I1RA 2XNKA 1V3UA 4Q4CA 3X1YA 3KVVA 2QU8A 1ACMA 4J0DA 4C30A 4U5QA 3WL8A 5D6OA 1RKXA 1W30A 1FFYA 1ZJWA 4AKHA 1HLFA 3R5KA 4PGFA 2HH9A 1YO6A 2JGKA 1W8IA 1YR3A 4MA5A 3VU1A 2H0RA 3VA7A 1RFGE 3D8UA 3DDNA 1L5LA 2AN5A 1QVZA 1G291 4FC7A 2JKVA 1SC6A 1PW7A 4MEJA 5THKA 4GH5A 2Z2XA 3DC2A 4Q0MA 3TVDA 2VTBA 3DO8A 1IPHA 3E7WA 3GRAA 1GCAA 1X1AA 4MMXB 2D2XA 4ZMRA 4TUYF 1B1CA 3ER6A 5A71A 3WNZA 1RJ9A 1LS6A 1M7BA 3LX4A 5K6AA 2XI4A 3FZEA 3OQVA 4OHOA 2X6TA 2A1UB 3DFFA 3R74A 1UBSB 3EAGA 4KTVE 5DXFA 2C8KA 1IBMB 1BXZA 4WT7A 4LG1A 1L5HA 1E98A 3OMWA 1E2PA 4ZK6A 2IYOA 3QG1A 2W6PA 1AN0A 5LR6A 1NVVQ 3PV0A 1KMQA 1LK0A 1WMDA 1ZS9A 4JGGA 5EMHA 4EPTA 4L3OA 3KWFA 1EWQA 5JBIA 3ECCA 5TT0A 2Z5FA 4QUIA 3VC1A 3ZKAA 4ERNA 3H05A 1B6SA 1JRLA 4QFMA 2BBWA 3AVOA 4K9LA 5JH7B 1ZDMA 2CJPA 3E1GA 3INRA 4TVOA 1KMMA 3C3KA 1CE8A 1TYEB 4WKCA 3IEIA 3EY9A 4NV3A 2I76A 3UJDA 3VPCA 2O20A 1M1YB 2ZYTX 1JHRA 2ZDGA 2WOOA 1B26A 1VCMA 1P0IA 1SCNE 4OQNA 1Q50A 3FWNA 1JHPA 4URUR 1UDBA 1YRBA 2CJWB 2Y9PB 5BMVB 5JQGB 1DWQA 3INYA 4RAOA 1CWUA 4BNWA 1VCOA 5C0OE 5HJEA 4OI0A 2PWBA 4JBGA 4EENA 2OK7A 5AJTA 2GBIA 1DAFA 3TVYA 5EWJB 1T1SA 4YHBA 4CCYB 4PC1A 3T3IA 3H42B 3RQIA 3ZLVA 3AKYA 1QVAA 4MVJM 1L5RA 3ZHSA 1M8GA 3NOQA 4HUQB 3S8YA 4M2LA 4LF7B 3U62A 4P3OA 1JFSA 5AJXA 1EDEA 1MIOB 3ZV3A 4OXIA 1QUEA 1LCIA 1OTYA 2QN9A 4JUBA 2TYSB 2BMFA 4QPNA 3BDAA 1HLGA 2AOUB 1BEZA 2PS9A 4I8DA 1XDBA 4L4RA 2UYYA 5B2EA 4R84A 1C1XB 3CJTA 4ZQBA 5LBUA 3HCAA 4MR9B 2YNMD 3GFPA 5TX7A 3D4PA 1KS2A 2JIBA 3W9UA 4C3VA 1PJCA 1MUUA 1QXSA 1RBMA 1GPUA 3HNRA 3HSKA 3KOYA 2P3SA 3VUEA 1P9OA 1GG5A 5ALSA 1NN0A 2NNWB 4RZXA 2J85A 1H2YA 4XWTA 5MN4A 3BFPA 1GFSA 3MGBA 4LNUB 3O1LA 4KYIB 2HT1A 4EGFA 3ROEA 4OH1A 2G9NA 4A8HA 4ACAA 3GFQA 1SG9A 2QW1A 3BXEA 3LWNA 2NO7A 4ER3A 5BN5B 1YAJA 4G3XA 4GPZA 4JLJA 3W5JA 1BAPA 5F2NA 5TRTA 5ARBA 3QI7A 4PVCA 3PYLA 2OENG 3KTDA 5AOCA 5GMOA 3WLMA 2ECFA 3T99A 4DJAA 5CJPA 3PCRB 4IUDS 4O1MA 1Z06A 3PCXA 2RB5A 4XGIA 3CRNA 4DLRA 1R6BX 1EWTA 1TVCA 2ZAYA 3J7TA 1Y33E 1WUIS 1CCWA 1LLDA 2QRVA 2R5FA 1UFQA 2X9NA 1JXAA 1HKUA 1R1DA 1WB6A 2V58A 3K9CA 1ADYA 3KL2A 3OWHA 4M8IA 4CR7A 3KE8A 3SYRA 3GAFA 1S3FA 2C4VA 2ZRHA 3H6KA 4UM9B 5TVKA 2PKEA 1IN4A 3VC7A 1J0DA 4MQMA 3JRNA 4ETNA 1DPGA 1MC1A 4RZQA 3NP7A 4C22A 5HBGA 1W88A 2V6GA 2HCRA 1DS6A 2ZBUA 2J4CA 4ZMSA 2P6PA 3DEJA 1ILWA 4LXGA 5AK4A 3QUAA 3ZY3A 3FLAA 4JLPA 5BR4A 1QIMA 3JQDA 4RMHA 2JAWA 2IHVA 3HG7A 4S04A 2OT3B 1KOGA 2Q9BA 1J0EA 3OPVA 4OEHA 3ECAA 4Z3DA 3PXUA 4G1CA 1U2GC 3QMWA 1E9VA 2V55B 3HB9A 4J0KA 3UJ7A 4ZZ3A 5JROA 5K3OA 1R8SA 2GRJA 3OE7A 4W5TA 1FP1D 3EMBA 3RSHA 5E4YA 1V8FA 3NOOA 3TKAA 2GN8A 4WACA 5KHOC 3A2NA 1O89A 1PG0A 5DYNA 5DVZA 4GHWA 4LDAA 4QFBA 4C0HA 4ZYUA 3M83A 4IJMA 4E5VA 3C85A 1ZN9A 1RWOA 4BX3A 3MJ4A 5AWFC 3U9TA 1N6PA 2QR2A 3A9CA 3SX0A 5ISMA 1XAHA 3NZEA 1BKYA 4X7RA 4BX2A 2PZAA 4KPGA 5TMDA 2W83A 3O0TA 2EFJA 5BUCA 1LRLA