3NTLA

Crystal structure of glucose-1-phosphatase (agpe) from enterobacter cloacae
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
388
structure length
388
Chain Sequence
SPEGYQLEQVLIMSRANLRAPLANNGSVLEQSTPKQWPEWEVPGGQLTTKGGVLEVYMGHYMREWLAQQGMVKTGECPAADSVYAYANSLQRTVATAQFFITGAFPGCDVPVHHQEKMGTMDPTFNPVITDNSPEFREKALKAMETERQKMQLTESYKLLEQMTNYADSPSCKEKKVCSLADAKDTFSADYEKEPGVSGPLKVGNSLVDAFTLQYYEGFPADQVAWGEIKTDQQWRVLSKLKNGYQDSLFTSTEVAQNVAKPLVKYIDKTLVTEQAKAPKITLLVGHDSNIASLLTALDFKPYQLHDQQERTPIGGKIVFQRWHDKNANQELMKIEYVYQSSEQLRNASVLSLQSPAQRVTLELKGCPVDANGFCPVDKFNAVMNNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acid glucose-1-phosphate phosphatase
publication title Crystal Structure of Glucose-1-phosphatase (AgpE) from Enterobacter cloacae
rcsb
source organism Enterobacter cloacae
total genus 128
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3ntlA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3ntlA02
4JOBA 2P30A 1DKLA 3R7AA 3QPUA 4E3WA 1SKBA 3IT1A 4QIHA 3FDZB 4D4MA 3PGMA 1SKAA 1C7ZA 4PGMA 2P9YA 3DCYA 2OWEA 3MBKA 3K4PA 3IT0A 1BIFA 1ND6A 1BQ3A 4ARSA 1DKQA 2P75A 3F2IA 3FJYA 2P6MA 3MXOA 1DKMA 5CX4A 2PA0A 1QWOA 1T8PA 3LL4A 3EOZA 1H2FA 2H52A 3NFYA 4JODA 2P2YA 1FZTA 1SK8A 2WNIA 2A9JA 2EKZA 2ENUA 3LNTA 5AJZA 1QHFA 2ENWA 1V7QA 2YN0A 1C80A 1SK9A 3D8HA 4PZAA 5AJWA 5CDHA 5AJXA 2HHJA 3LG2A 2OWDA 4EO9A 2BIFA 2P2ZA 2RFLA 3E9CA 4GPZA 2P6OA 3EZNA 4ODIA 2GFIA 1TIPA 5AK0A 4JOCA 4MA4A 1EBBA 4IJ6A 2P78A 2WNHA 1FBTA 2EKBA 1E59A 1DKNA 3F3KA 2P9ZA 3D6AA 3KKKA 2DWPA 5HTKA 5AJYA 4AROA 2EOAA 3E9EA 1DKOA 2DWOA 1QFXA 2HIAA 3DB1A 2H0QA 3QPWA 3GW8A 2WU0A 2HPAA 4FDUA 3C7TA 1BQ4A 2A6PA 4IJ5A 1C81A 4D4LA 1UJBA 1NT4A 1RPTA 4TSRA 3OI7A 2F90A 4FDTA 2IKQA 2H4XA 1UJCA 2I1VB 1YFKA 3GP3A 3ZHCA 1V37A 3NTLA 3D4IA 1IHPA 4ARUA 1YJXA 1DKPA 2H4ZA 1H2EA 4HBZA 4D4JA 5PGMA 1RIIA 1K6MA 3O0TA 5HR5A 2P9FA 2QNIA 4GPIB 2AXNA 3BIFA 1XQ9A 1CVIA 4EMBA 1ND5A 3IT3A 5CU7A 1E58A 3GP5A 4ARVA 3HJGA 4PZ9A 4D4KA 3IT2A 1RPAA 3E9DA 2P77A 3QPVA 3K4QA 2YN2A 2P79A 5AJVB 3FDZA
chains in the Genus database with same CATH superfamily
3U44A 3B85A 1I94B 3PFFA 3O6VA 5LP6C 5CG1A 4GMFA 3PYMA 1V2GA 1AM4D 1R4ZA 2A58A 1N0VC 4KSYA 1YIAA 4OGWA 1BFKA 3RGGA 3OM1A 3VU9A 1DTEA 1EFLA 3B6ZA 2BCJQ 1HQKA 1O9HA 1OX4B 3DFIA 2XVXA 4OQYA 5DW0A 2PGNA 1N92A 2HF8A 3DVRX 3G2KA 2R62A 3KJXA 1V4VA 1KEEA 3IVCA 1T25A 4K6MA 5ESDA 4AKIA 3H5TA 3EOZA 1WO8A 5FI5A 4BX3A 2AFHE 1NIPA 1P4RA 2VNSA 2V74B 2ZWMA 2JNWA 3ICWA 1V5WA 4PLWA 4ROSA 3EIHA 1F51E 2XVZA 3BZUA 4Y8VA 5DK6A 3DB2A 4TKMA 1BU8A 4OLHA 2OCPA 4CEIA 5DH9A 1QOQB 1AGXA 2E37A 3FG9A 1PFGA 3W1VA 3V7NA 2ESRA 4FUTA 4DILA 1J39A 3FWZA 1MABB 2ZAYA 3A4VA 2RK3A 3KOZA 4OGKA 2GBFA 1ONPA 4G86A 4R3WA 2YQZA 4WL0A 1Q57A 2HHJA 3NAZA 1P7CA 4ILEA 4UOQA 4QGHA 5CLQA 3WLFA 1EUQA 3EMDA 4WNAA 1ABEA 4WJKB 5DWDA 2HDNB 3I92A 4Y6RA 3VUFA 3K70C 4ODIA 2BBOA 1CUYA 1Z4OA 4WBXC 2D5LA 3JRNA 3V1MA 2HA2A 1H94A 5DN6A 2UZ3A 5EZ6B 1ICEA 5LD2C 1XMOB 2PV0A 4JKYA 1P8AA 3UHOA 3NIGB 4DNFA 5BV2P 5LOVF 1QONA 1M7GA 2HU8A 4B3IA 4E4RA 2PFKA 1HZZC 1VCIA 4DR2B 2YYAA 1DI0A 1ZFNA 2C5AA 1VL2A 3ZBTA 4EATA 5H7XA 1BE1A 1LVGA 4HCJA 2AJ8A 2ZYTX 1FDWA 2DY1A 5ITWA 2XIQA 3GARA 2GXUA 4GX0A 2Q0SA 4AQYB 2FG5A 5HW0A 2DCMA 3KXDA 1TT5B 1TUGA 3JCZA 1QPGA 2JARA 3A1FA 3FH0A 4TL7A 5JMPA 2ZI6A 1G0OA 5CJ2A 4CNQA 3QPBA 1U2EA 2V7XA 3OOJA 3IAS6 2R2GA 3PUJA 4LBVA 4MI9A 5L51A 4G5FA 1YQXA 3VYRB 2CT8A 3OOHA 5FTLA 3CVXA 3NYWA 1RAEA 1KDRA 3DNMA 3CF0A 4MUIA 3LRXA 4ZYWA 1J5EB 1TMGE 3DCNA 1F60A 4FOPA 4EB3A 4ECAA 4ZI2A 1SXHA 1PKEA 1VA5A 3EGDA 4RDIA 3SX0A 4O6VA 4B4OA 5LP6F 4GNKA 5A5EA 4JSRA 4FQ5A 3A3NA 3PZBA 2FLVA 5KNDD 4MGEA 4TV8F 1XALA 1LK0A 4IS2A 1M6YA 3H9EO 3Q7SA 2QTFA 3EIWA 3V8MA 4HYQA 1LPOA 2AFHB 1T4CA 2TMGA 2BGIA 3DQQA 4JT9A 4O4JA 3ADDA 1UKEA 1HOXA 3E2PA 1OLXA 1JXQA 1XF1A 3GL9A 1KWKA 2QL9A 4LV8B 1FC0A 1NPDA 1O97D 4B45A 1JSRA 1TFRA 2G04A 3IKTA 1I4EB 4ARVA 4XJXA 3ZHSA 1VE3A 3LS2A 1ACMA 4JJAA 3RKSA 5F5NA 2ZI3A 1UJMA 1D2RA 2MYNA 3ACBA 3CZ9A 3N6RA 2QT9A 3V48A 1XPOA 3KKEA 1VE1A 3C3WA 4O2BB 5EZQA 1NNSA 3I0NA 3V4VB 2XKKA 4HMPA 2C7BA 3MWFA 1HTBA 3SEFA 5DYTA 5AFSA 2PXAA 4XFDA 4D8XA 1US8A 1DWOA 3KQOA 4CIXA 3QEBZ 1JW9B 1XRLA 2CDBA 1EZ1A 2FCRA 4PLYA 1HFWA 1R3DA 4OYYA 2ODAA 3X1WA 4D43A 1VHWA 2EKLA 2F9FA 4N8SA 5L4SA 2XAUA 1KMNA 1ORTA 4NZ9A 3AEUB 2PD6A 2JJ2A 1OWOA 4RV4A 5HCUA 4Q21A 3GG2A 2XVAA 1EG7A 2H63A 3AKYA 4LJ5A 3AVOA 2VDUE 3F96A 1IVNA 3EQZA 3HRHA 1I6LA 2Y1EA 4I4TB 4RHYA 5JCJA 3SBOA 2V7PA 1BU5A 4JBXA 5IARA 3UJ7A 5D3QA 4C88A 5BPHA 3MSXA 1KYVA 4GZ6A 1M1UA 1V3VA 5EHZA 4US1R 4K28A 2WF9A 2QK4A 2NU7B 4FU0A 1ZH8A 4LK3A 3UTCA 3ZV6A 2ANCA 4B3BA 4L3OA 1S4MA 2X7HA 1ORIA 5TS3A 4KQ1A 1WOMA 3BD7A 1Y9ZA 5C9ZA 4KKXB 4F46A 3ORSA 4JP1A 4URYR 1PZNA 3FOAA 3OETA 3BX1A 2XCQA 5L8VA 1QP7A 3FKJA 3RRXA 2Z08A 3VJRA 5GONB 4HDKB 2CY0A 2AXQA 5CAEB 3UJBA 4Y7CA 3GBVA 3V80A 2ZZMA 3U3RA 5BNIA 2WHEA 1IOLA 3L4BC 3LGXA 1VFNA 2NZYA 1DBPA 2FX5A 1Y4ZA 1IULA 1XBTA 3HVKA 3M7IA 4IMRA 4Q7KA 2Y2VA 1Z4IA 2QYHA 4BPRA 1DQRA 4K3VA 3ENVA 2BTEA 4WCFC 1RRPA 5A5GA 1S8FA 2AV6A 2ZQ5A 1QJCA 4YUZA 2MCFA 3K9WA 3I0MA 1D2MA 5G4KB 3HFRA 3PWTA 5ARDA 2WKSA 1KDOA 2E4YA 3BZBA 4XPZA 5EE9A 3AVPA 2JJ1A 4UFNA 5CXQA 4KL8S 3C8DA 4L7QA 1I3MA 5BW8A 2R7AA 2Z4RA 4B79A 5ECYA 5A5FA 2B4YA 5G1OA 4JLMA 3AHFA 4NBWA 1OC4A 2CFOA 4Q1FA 3T12A 4JXXA 1TO6A 4C6SA 1HV8A 3N8IA 5KJFA 3JD0A 5BSEA 2QJTA 2BP7B 1H6DA 4QYIB 4YCAA 3HK2A 2V6BA 2KB0A 2QLFA 4XA8A 4RYLA 1QFZA 4X1OA 3DZJA 3O4VA 1ZN9A 3X44A 2PLAA 4GOND 2V59A 4MX8A 2CHFA 3R6GA 2P6UA 5FOUA 1WB9A 3DP7A 5B30A 2ZZNA 2CXUA 3ANYB 1AH2A 2QNBA 2QL6A 2UZIR 3PLRA 4BWVA 4EO7A 1WM1A 4TKUB 3TXYA 2RARA 4BV8A 3U7QB 3PI6A 1WXGA 2JAUA 5DX8A 1VHJA 4ZO8A 1T4BA 1LC0A 2VT7A 3SIXA 5TGZA 1K5DA 4CRWB 3S2GA 2DPYA 4RIFA 1N5KA 3UAYA 2V3VA 2KBFA 3SJBA 3C3CA 3LA8A 5FBLB 4HZUA 1WZUA 3TLCA 4HG2A 5JI2E 1C2YA 3CT6A 2KM1A 3ADOA 3DS8A 2HHCA 4F71A 5F7OA 2IYOA 1QXSA 3DO8A 3DO6A 3UA3A 1CLUA 3CVJA 5KNCH 4IHJA 5SYAA 1R4MB 4ZAZA 4MV4A 3PDCA 1GD1O 1MZPA 1JXOA 5LDGA 1D8AA 5BUCA 5UKDA 1JPUA 3IQIX 1R8JA 3MCWA 4JFRA 4OFXA 3DDNA 2WWGA 4YMSA 4CMKA 1E5XA 5HUHA 5TVGA 1YBVA 2EEPA 1DINA 1ODIA 5ALOA 4C5CA 4BP3A 4BAUA 2C20A 1ELOA 2C4WA 3E53A 1KNXA 2J45A 2VBCA 1QWOA 3E5RA 1MF7A 2ATIA 2GERA 4BFXA 2XE6A 1BWPA 3ZYZA 4ICIA 3ER6A 4B6OA 4R2XA 2J41A 4IO1A 4P82A 4NBTA 3SDZA 3IPCA 5K0SA 2WD7A 3W5UA 3W2TA 2YRWA 2ZAGA 1MP0A 3PT5A 4RA6A 2YQ4A 3FCAA 5IKMA 2C7PA 1TTQB 1J06A 1NT2A 3PD7A 3BWYA 1E1MA 4HPXB 4HOYA 1P9LA 2N1BA 1MPTA 4R1LA 1Y80A 3NXKA 4V3BA 4AF7A 1A88A 5KC8A 4UTXA 5HZMA 4R5MA 1E3WB 1NYTA 2AG1A 1E8MA 4HP8A 4RDHA 4B31A 2JIBA 1NATA 1T2FA 1XAGA 3EBOA 3BRCA 3H9QA 1G1AA 1T91A 1GT6A 3CRZA 2MMGA 4OVKA 3A6FA 3BMNB 4JLNA 1H4QA 4CEJB 5JARA 2GDJA 4RH1A 1B6RA 1N5IA 2HDOA 4YQEA 3MTIA 3KT6A 3R3YA 4JEMA 3SXUB 2WAMA 3Q8KA 4NENA 2IEBA 2C5BA 2QMUA 4DMRA 5LP1A 3MBOA 1EB9A 3V4LA 2XB8A 1W47A 3AUSA 4V0SA 1DO8A 2QRHA 4BLRA 3D6AA 4X1YA 1JFRA 1LJLA 1N3LA 4JU8A 2WVHA 4CM1A 3BXGA 1SHUX 3DE6X 1GU0A 2BKAA 4YDSA 2WA1A 1RRVA 5LBTA 3VR3D 5BWNA 3IAS1 3LLMA 4PAGA 4ALNA 1MJFA 4V0MA 4KK4A 3H8SA 3WLTA 4ZVPA 4O8ZA 5CURA 3NPMA 2GQ0A 3BRQA 3IEUA 4NK4A 5CD1A 1L7EA 2IHYA 1W7AA 1GRCA 4UBNA 2FDCA 2GKOA 3KFXA 4LRWA 3D31A 4Q1VA 4HWOA 3L7IA 4PANA 1AUOA 4HAOA 4OAPA 4XE5A 4EJFA 4RGYA 2V4ZA 5CCXA 3FHOA 1L4HA 1U3FA 4OX9Y 4K87A 4WK0B 5AVOA 1MV8A 5BRAA 1A9QA 4E0BA 2H2AA 2QIPA 2Y0BA 4GXTA 1VL6A 3INYA 1IYZA 3QV2A 4H1VA 3HZZA 2EIXA 3I58A 3FVVA 4FFLA 4IKOA 4B6EA 4F1KA 3O47A 2YKGA 1NUQA 3O90A 3B1FA 3KKPA 4HTAA 3IBTA 4N39A 4L4UA 1OWMA 3GT0A 1OAOA 5HJ7A 1OXXK 2I22A 4B33A 2WSYB 3ECCA 3GMSA 4N9QA 4OEHA 4B73A 4LYFA 2I2AA 4MO2A 2IFTA 4RZQA 4J0GA 4TMTA 4NYJR 5J40A 3TZEA 3NONA 1N0HA 2HHLA 3OZGA 1K66A 5JSYA 3ZBUA 4JHXA 1ZVJA 2I6TA 2VLIA 4ZC1A 1TU4A 2VDOB 1U31A 1SUEA 3KLNA 2XA1A 2NV2B 4RA9A 4CV0A 4XVUA 5TXGA 1Z56C 2AN9A 5AJVB 3G0GA 4G1MB 1FW8A 1ZK3A 2E4UA 2WY2D 2WFLB 3DV0A 4BE9A 3WAGA 2E48A 3BERA 1DCTA 4KR3A 2QRJA 4G3XA 1KMIY 4E3WA 3KV3O 2QPLA 4HNAB 3R0VA 1WXQA 3I6MA 3QOWA 4J7CA 1OBCA 2GSDA 4IDBA 4TTAA 5HKAA 3HVHA 1B2LA 1PQYA 2QM7A 4LXYA 4LBWA 4GICA 3SR0A 4KYIB 1KI6A 4OXYA 4E2WA 3KR1A 3RLFA 1LNQA 2QTRA 2OB1A 2FN9A 4TLEA 2V5VA 3HSKA 3UMBA 4AIIA 4BFTA 3L1JA 4BRUA 4ZOQI 4GUAA 4N0DA 4YS6A 1TL7C 1O1YA 4MIYA 3GT3A 4RMHA 3TM5A 4IKPA 4V3CA 4AXXA 3BULA 4FMDB 2JLRA 2I71A 4ZXPA 5JJBA 2C2WA 5JPIA 1DIAA 4IGEA 3IKLA 2IYYA 4F7WA 5H16A 1UK6A 4ZK6A 5FV4A 1GG9A 3HCPA 1VBFA 3TDNA 2W6QA 2DTEA 3GUHA 2VH1A 5DIFA 5FKJA 4A0RA 5JOQA 4K1LA 1XAHA 2OWDA 2OXCA 2G17A 3QEAZ 1TVKA 4AG3A 2CWDA 4AECA 1YTLA 3NEPX 4J0EA 4BRZA 2RCYA 1QQBA 1YKGA 4H7PA 2LCIA 3G9UA 5DGDA 4KXMA 4M60A 1DBWA 1VMEA 2NUPA 1F9EA 3PDJA 4C3OB 4QG3A 1TM7E 3A0UA 3WHLA 4RF2A 3OQJA 1NN5A 3AUYA 1TQ4A 5K4GA 4ZEVA 4J0JA 5BN4B 4LRQA 1Y4SA 2GCEA 4RVGA 4G0ZA 4NF2A 3PCTA 4C0XA 1R4NA 1PBNA 1JEQA 1OGYA 1EA5A 2IVFA 4KVZA 2HWXA 4QXOA 1NI5A 3WGYA 2IEZA 5JDCC 1JPNA 1X77A 2QE6A 1Y9JA 2XSZD 4L8WB 1EB8A 4XX1A 4YP0A 5TV2A 1XZCA 2E5WA 3HE3A 3QPCA 3NV9A 4KODA 3FETA 4RIHA 3GVHA 3WISA 3QPWA 4ZARA 4J49A 3C39A 2OXTA 2LWIA 2XGSA 3RC1A 1RKXA 3EYWA 2CNDA 5BWOA 1VL1A 3PD0A 1XMIA 4MQEA 4B09A 3P2IA 2X0JA 3QFFA 4EX6A 5ARCA 2HLPA 3NAMA 1COZA 4MAAA 4NCIA 3M2PA 3BQMB 4FNOA 4BLQA 1YBHA 3IXMA 1JAIA 3QF4A 4URXR 2ID9A 1JMVA 4EEZA 1RZVA 3HB0A 2VC2B 4AY2A 3GLRA 5IM5A 4PS1A 5I4KA 3KQUA 4MHSA 3MTJA 2YV3A 4OLJA 1A1VA 4ZVUA 1AKQA 1O6CA 2VL7A 4O2AA 1CK4A 2JHCA 3JASA 1Z0IA 3MINA 4RGBA 4DRYA 1RRKA 4D3ZA 3EQ6A 5J2UB 2AXNA 1J2EA 3BMCA 1ISIA 1VBNA 2FB9A 3S2YA 4C4XA 4X20B 2WNSA 2VQ3A 4GAEA 4TN1A 1F0KA 3A4LA 2X0IA 4PX9A 2GBLC 3A1VA 1XVAA 3NT2A 3LWDA 2RJOA 4ZGWA 1ZM7A 2PZJA 4CV2A 4HB4A 1FU7A 5FEMA 3DFUA 2WJGA 1N2IA 1K0UA 4P1ZA 4EGAA 4PBSA 1ZUHA 5A7FA 3I83A 3H9UA 1DCMA 1DJLA 3RIGA 4V1CA 3D6JA 3P9RA 1GYQA 1RWPA 1TO1E 13PKA 2Q1XA 1FVOA 3II6X 1QFSA 1JG7A 1X15A 3HU5A 4OH1A 4QDOA 5ALSA 5I4CA 1JZTA 1QGAA 2CNWA 3GH3A 5KHAA 3JQ8A 1YNOA 1MA3A 4JLBA 1W94A 3KXLA 4QEKA 4RE5A 1NI4B 3MBKA 4C2AA 2JZNA 2IV7A 4S1VA 3DQPA 3IR7A 4RC9A 4PN7A 5FULA 4DB4A 1VKHA 5HIMA 2VHEA 1DOZA 1XI2A 4Q3KA 2Q3FA 2O6LA 4KXQA 2Y0PA 1JHDA 3RVNA 3BJIC 2Q0QA 2PG3A 3SC3A 4CF5A 2FPIB 4Q82A 3UTDA 4BUCA 3HBJA 2VPYA 2PGOA 1NQUA 3HCDA 1F06A 1ZD1A 1ZNWA 4FKZA 5DI3B 4FM9A 3AY7A 4MKZA 4JDUA 2OBNA 3EN0A 1E3TA 1GL9B 3H5IA 5FHQA 4EUEA 3Q98A 1KBOA 1ZH4A 4G25A 4S1WA 4UVIA 4BLSA 1GTSA 3DLIA 3GAFA 4BEVA 5BSKA 1MB3A 2ATEA 2CXPA 4MV6A 4ND1A 2HA7A 4U39A 4M83A 3IE0A 3KD2A 2P6OA 1R0XA 3CGGA 3G1UA 3AESB 2XBMA 4DT1A 2H8GA 1H9CA 3SMVA 3VZDA 5KC9A 3DMFA 3G49A 4UUOA 1WCIB 2CLEB 1YZYA 3ICOA 1EXMA 3BPSA 2BGWA 4JB2A 3I1IA 4XWKA 2Q1YA 2G6BA 2YVAA 2RHHA 1R00A 4LZNA 4MQFB 4NG5A 3A6KA 2PBZA 1PE0A 4D44A 2IHBA 2YV5A 3WL7A 1DQNA 4OSEA 4Q12A 5LQSA 3JATB 3PE3A 4JAVC 2ZRKA 4KQKA 4MQMA 5JVDA 1HQYE 1T8SA 1ODSA 2YCLA 3EK2A 1B8OA 1L6IA 4KYUA 2O8DB 1C1XB 2GO7A 1SUAA 2CL6X 2X6QA 3TKLA 3L0CA 3T3EA 3KALA 3ZIDA 4E1AA 2IU0A 4BTLA 4NFHA 3ER8A 2D2VA 1W5TA 2V5UA 3RUEA 5HK9A 3ZHZA 3D4OA 1U0NA 3LXRA 3KU1A 3L7AA 5FNVA 4UCQA 4BZPA 1XQWA 4EKGA 1GM5A 4XX0B 2R6JA 1KE1A 5IUJC 4OREX 5LA6B 1D6NA 4G2NA 4Q1DA 4XOIA 3HI6A 3DEKA 1FVFA 3PGKA 1A2OA 3D3WA 3O92A 4R4JA 1ZC3A 3NAQA 4M9RA 5JSZB 1B7GO 1XPRA 1VYHA 4IQ0A 1CUWA 3GEGA 4NAVA 3TLGA 4AJ2A 2H31A 1R6DA 1KMHA 4BKQA 3NBKA 3K1AB 4ZI7F 2WZCA 4NLLA 1AE1A 4FYPA 4OBWA 2QDXA 1I5RA 4I8XA 4AICA 4DN6A 2ZSUA 1XKLA 5AK6A 3ZNNA 3SHQA 1WUKS 4GI7A 3CB2A 1OXUA 3M6AA 4H6VA 4RZSA 3A1WA 4FHZA 4WXRA 4YJKA 1AGPA 1ZRNA 1ST3A 2FSHA 4V2UA 3T3MB 4RWZA 1EE2A 3DSRA 4MYHA 4HXYA 5ICFA 4DA7A 3HZRA 4FCWA 1CR4A 2BEKA 3IBYA 2XF8A 3ZOKA 3C5VA 3GHYA 2PJDA 4EB6A 4MQBA 1PNQA 3U19A 1YCHA 2XMSA 1E1RA 1JXMA 2J9FB 2X8JA 4YWHA 3VTZA 3U37A 3QWFA 1OWNA 3NI2A 4B2IA 3DOJA 4TLCA 3KZOA 1ILWA 4RAQA 3D9QX 1N7JA 3RF7A 4A7PA 3JQAB 3R5JA 5C7IO 1VYTA 2HV9A 4EYGA 1D0IA 5KYUB 1U7ZA 1SBQA 1XU4A 2HPVA 5HRAA 2NLOA 3V8RA 2R96A 2VHYA 3OF2A 4A03A 4HB0A 4CCYA 2QN1A 3PJRA 3MW8A 3FA2A 1CUJA 4L2IA 2W70A 4EGCB 1C2TA 3O74A 4LZLA 1IOWA 5K0EA 2VJMA 3OZSA 2IF0A 3A4YA 4HJRA 4I19A 3RRJA 4E31A 4UFOA 3OCYA 2COUA 2EC5A 3QYJA 5TR9A 4AJEA 4WOPA 2ZSIA 4NPCA 1MENA 3NHBA 6PFKA 2AFVA 3VH2A 2YWDA 2ZBQA 4G1CA 1PG0A 3IULA 4RFLA 3KBOA 3K0SA 1BH2A 4DDHA 2R6FA 4DA0A 3DEJA 2FWNA 3KOMA 4INAA 5HQ3A 4F12A 1NP7A 1NYRA 5EQJB 5FPTA 3AHHA 4CLDA 1RJDA 4E14A 4ZCSA 1RC8A 1EK5A 1NJ8A 4LWOA 3WMEA 3FYDA 3C1UA 2I7CA 1RPZA 1DX9A 4BQPA 3ZXIA 1JJIA 2NYRA 3AR8A 1Z2OX 1V6AA 1YRAA 1W4RA 1X38A 4OXRA 2JGDB 5FNZA 2F3TA 2O0LA 3SVTA 1UC5B 2I4IA 3ABQB 3B9PA 4G0VA 4NSNA 2A5FA 1Y3IA 4F2HA 4JI3B 1K7YA 4L6IA 1T6XA 3KT0A 3E3LA 3LQQA 3FLBA 1ZBQA 4WZBA 3FHCB 1X3SA 4A91A 3OF5A 4Q16A 4ZEOA 4QELA 1TUBB 1TPYA 3MZ0A 3JQRA 4GYYA 4QM7A 1ZQ1A 4KQ6A 1HE2A 3GCWA 1RRGA 1GAEO 1U3VA 2V6FA 3MYYA 4N6GA 2AX4A 1RYDA 1U0SY 2EEZA 4WLUA 4PNEA 4X97A 3UT6A 4ZO7A 4OXIA 2A5YB 5AKZA 3ACCA 4IHKA 4R83A 3W8DA 3A3PA 2QVZX 1ZOPA 3PKJA 3H1EA 5ITZA 4PPQA 5EUMA 2CFRA 1TF5A 2QTVA 4XEHA 5HDQA 1OREA 3G8BA 4X1IB 4F06A 3TTVA 2GD2A 2RHJA 2CL7X 4JROA 2X1LA 3GA5A 2HCBA 1ONOA 1ZD5A 3AY0A 1KORA 3BFKA 4IOLA 3C97A 3BWMA 4DLLA 4E11A 1BMTA 3UK2A 4MW7A 1MB9A 1A97A 1P39A 2OV1A 1TYEB 1HEUA 1Z12A 1IM8A 4PICA 4I5DA 3GA0A 4GE3A 1KEZA 3NCHA 4QU5A 3DVSX 3IDSA 1CSEE 4EQ6A 4GFDA 5JBQA 2CSXA 2ZZKA 4RDXA 3G2JA 2BGTA 4NKRA 1ZL2A 5T3YA 2FMUA 3ZX5A 1VSTA 3LO5A 5C1BA 2IYLD 1HE8B 4D4JA 2AIRA 2PKQP 1E79D 2PWZA 3LV8A 3NHWA 4EARA 1EUDB 4FYVA 3JYPA 2XEDA 2LIVA 3QUQA 2A86A 2ZPUA 1LPPA 4NECA 4Q19A 3ENZA 5H9VA 3AEYA 5JJCA 2GILA 3DBRB 3DBHB 3LUGA 2PZEA 2ZTUA 1WHSA 3IPLA 3R6DA 4MGYR 1KC3A 3TI7A 3UBMA 4J8PA 2B1RA 5BQFA 3AEZA 3VX3A 5KDOA 1DLIA 3V4RA 1W9MA 3CCCA 3OZUA 2QD2A 1B8VA 2JANA 4IVPA 1STOA 3H5AA 4JC5A 5C46F 9GPBA 1YHYA 2P5UA 2V97A 1U28C 4PO3X 3KWFA 3RRFA 1PW7A 3L5OA 4LYEA 1MQ9A 3L8DA 2PO7A 4FCTA 1GIAA 5SY4A 5I7WA 1DGQA 4MJ7A 5AKIA 1RQ2A 3QVMA 2RAFA 1E2NA 4G41A 4YLYA 4WERA 3LCJA 4YCBA 3PHBE 3REFA 4BCCA 2AJLI 3SFZA 3FCSB 5CVTA 5DFAA 4D02A 3IUMA 2O07A 2AVNA 3ETLA 3K1JA 3OZFA 4L9SA 2BR3A 5BQPA 3IR6A 5AKJA 3LSTA 4U0KA 1WU7A 3TNFA 3IOCA 1FFHA 4IEIA 1KP2A 2ZU0C 4LYHA 4KRFA 5FWYB 1OI2A 1Z06A 4NARA 4OQFA 1B00A 1Y5MA 4NS1A 1QQTA 3H65A 5KKCA 4DDVA 4YV2A 3QKSB 2O2XA 2YINC 5KX5A 2AEMA 2VZ9A 2XTJA 3LKVA 3O7WA 4CF3A 2I66A 1E8NA 1JWBB 3EG9A 2XUQA 2R7MA 5E4YA 1YBFA 1L4BA 4FWIB 1U9IA 5LXTF 4WFQA 3BG5A 4RJKA 3ZV3A 4CT5A 2HY7A 2XT0A 2JZCA 4BO5A 3KYCA 1LTQA 1XXLA 3S8MA 4N76A 3NHJA 2AW5A 5AICA 3R0ZA 4HFNA 1E6KA 5EMNA 1RQXA 3UGKA 1I7LA 4N5NA 3IAHA 3OSUA 4PRKA 1LF5A 2IU6A 2UXCB 1U2TA 4C0KA 2NO5A 2BKVA 1DBSA 2FSIA 3DBOB 5LFAA 1I30A 2I6GA 1C50A 3G2NA 2PKWA 2Q5EA 2G76A 1UBGA 2GPWA 3RQIA 5FOQA 5G0VA 4C0BA 4RU1A 3UCEA 1QHIA 1RYNA 2Z5FA 1CCWA 1FRVA 1OAAA 1OJLA 1LFDB 2P4QA 2REBA 1BEEA 1X1AA 4I9UA 3PQ3A 2OESA 3CLSD 3JAWA 1TUIA 1X8LA 5IJWA 3F5MA 3DMHA 1KRWA 2FY8A 4TRMA 4RSMA 2MSCB 4DPMA 1MJ5A 3P2MA 2JGAA 2IXDA 3JSAA 2FN4A 3AR3A 4QC2A 3R7WB 3M4NA 4XXHA 2PZBA 4WZAE 1VRVA 5AJTA 1FE8A 5DM1A 2JL1A 3ERCA 1F9AA 1UFKA 4LGYA 4WUTA 4F4UA 2GDZA 2XLBA 4GZLA 1EAMA 4LJ9A 4WAUA 3GELA 3NJ4A 4HWKA 5A6SA 2PLFA 2YWGA 2Z2IA 3OPQA 3E9YA 4Y2HA 2PRKA 2WYOA 1QORA 1QO0A 3H97A 3U39A 4D79A 4P5DA 3UN1A 3L6OO 3V5NA 4XTRA 4CR8A 4FFBA 1TZMA 4R68A 2HBYA 4JI8B 1IPFA 1WB5A 5K0CA 2OYCA 1SXQA 1LZLA 3I9MA 4NICA 3EEQA 1N8NA 2AJCA 3O03A 4EITA 4EVQA 5F1PA 1E2IA 3IBCA 2WWXA 1IAQA 1I0IA 1L1QA 2VSQA 2JD0A 1JP7A 1AUXA 3LWZA 1Y7PA 2G0NA 3ZTWA 4Z2AA 3TD2A 4UNRA 2XYRA 4MWEA 3PC7A 3R8XA 3IXLA 1GZ4A 1TAQA 5EHNA 4N5LA 3V7WA 3OOYA 4J1SA 1ADBA 2Y1GA 5G3ZA 1FSGA 3TLEA 2FWAA 4WESB 2OMKA 5C8YB 3FFXA 2WQ6A 4GRAA 4JQOA 5GZ6A 1JJBA 4W7IA 3W1WA 2QUKA 2RHRA 1O9BA 1XA3A 1DKLA 5MFPA 5EPUA 1ANKA 1MDBA 3VU3A 1IVSA 3PDIB 1I9GA 4R98A 2Q8QA 3RARA 3LHIA 2P5SA 4FDAA 2OVFA 3CE9A 3LP6A 2F43B 3AU9A 3U3JA 4ZYYA 1JIIA 2OORC 2YBEA 2YIDA 1YDGA 4G89A 4ZFNA 1DDOA 1JDZA 4RAOA 1C8LA 3CH5A 1H5QA 3ISTA 3M6IA 5CITA 2IBTA 5IDWA 1SXJA 2WFZA 3CXUA 4UXHA 3RIMA 1DARA 4XWGA 5CB4A 5HPYB 2ZDGA 4JNKA 4KIGA 2Y66A 4LOKA 2HCJB 2P62A 4HDAA 4YJFB 3QX3A 4N3AA 3KPVA 2P1RA 1SRRA 2WHPB 1DBRA 4BLTA 2A57A 4PGAA 1QRUA 1MFPA 1S7GA 2R79A 1KEPA 2OOSA 4WZAB 3FBGA 4AKTA 4JA2A 2WPDD 5J4YA 1X1DA 1WHTB 1EMDA 1SVSA 4MROA 1PUIA 2P5YA 4OK3A 4Y6SA 4R9SA 3G0HA 3IMGA 2NSDA 5JAZA 1DDIA 3DEHA 5HZHA 4PF1A 2OO3A 2B4QA 4D9JA 4EL0A 8AT1A 9LDTA 1H5UA 3NKFA 2FG6C 3RUCA 3THSA 3VR4H 4N03A 5IVPA 5MF6A 4M99A 1H85A 1YB6A 2HJVA 2V55B 4KO1S 1VJRA 1KH3A 3ZHBA 4HQFA 4YMLA 1DG9A 4RVCA 3GPLA 3C5EA 1VE6A 2VHJA 3U3XA 3BMQA 2XI4A 1A5AB 5IRCD 3G9XA 4Q1BA 4ZI3A 1QHHB 1R74A 1NVAA 2NTEA 1R0LA 3MWYW 3ZV4A 4CCAA 3PITA 1CHNA 1KHTA 4I4LA 4GI3A 3ZY4A 5DRTA 3I09A 4M88A 2X0FA 3V1TC 2OCBA 3A9TA 1G3QA 2XBLA 2D0DA 4UFPA 4ZHQF 4BBAA 4KP7A 3A2NA 4OBBA 4PVDA 4YUVA 4OJMX 4J0HA 4U7WA 1A4IA 4X64B 5LZ9A 1ZR2A 3IRVA 2BT4A 3GUZA 1HT3A 1AY0A 3LOPA 5ALDA 5B36A 1IJKA 1FFDA 1U5BB 3JVIA 4P7GA 3ZVMA 1TEVA 4Q24A 4K9DA 1TCAA 4FBMA 1I6WA 5AVRA 5E9QA 3OJCA 1GN9A 4IWYA 3HHPA 1UBNA 2EKQA 3OZWA 4OP1A 4EL5A 3WJ1A 1K2WA 2HRCA 4LMRA 3WV5A 3I73A 3SDBA 3B7PA 3K9QO 3IAXA 3CKMA 3ZUPA 4XSVA 5BR7A 1SQSA 2GVDC 1OTYA 3R75A 4LI3X 5DTMA 1N2ZA 3S2ZA 3CJQA 2LP4Y 3DLAA 2Y6VA 3HJRA 1VLZA 1QZXA 5JYDA 1PS9A 4FHFA 1SKQA 3DKRA 3EZ6A 4R01A 3AIOA 1QBGA 2QMQA 1Z5UA 3AP2A 3VO8A 2CKMA 3RSCA 4H4DA 4D3XA 4DXHA 1IK4A 2VS1A 2GH1A 3QMWA 1YZ3A 1FU4A 3TINA 2Z1NA 1GSHA 4PWYA 1KEKA 3KOWA 2R8EA 4AUKA 2FMIA 3L07A 2FP4A 3F8SA 1Q16A 3JTEA 3UK0A 1N5MA 1RS0A 4URVR 4NDAA 5BT8A 3QFHA 4PZYA 3CT4A 2ZE6A 3ZW9A 1JH9A 3O75A 4TSFA 2XUGA 3T3OA 2NO7A 2YHIA 1V6SA 3A25A 4P33A 4U1RA 4I1IA 4B34A 1GAWA 2QTHA 3IEVA 3ZU5A 1UK9A 3CIOA 1NBIA 3EQ8A 4GHWA 3CEJA 4N40A 2LDBA 5CK5A 2P9JA 5AKKA 4KPFC 4TKZA 3F3SA 2F8TA 1P72A 2I4OA 4CLRB 3AVVA 3LWNA 3I9JA 4TWZA 1PK8A 1KH2A 1P1BA 4DWVA 2IYXA 4GL4A 4LOIA 3SIWA 4IGIA 1Y48E 2HC9A 2W6CX 3UFBA 3NHMA 1F2UA 1X7WB 4N12A 2BE7A 3STUA 4YXFA 4MR7A 4X95A 5TMEA 2GF9A 1N1MA 1WDMA 1XNHA 4DIOA 3T52A 3WLPA 4EEKA 1CY6A 1SOVA 4FE4A 4DVJA 2VHWA 4HDNB 4DM4A 1QZ3A 4ONEA 1Z17A 3VKUA 3WIEA 4JQZA 4JGBA 1NVFA 4E12A 1Z5GA 3IJRA 5DEIA 1HRDA 2CK3D 3LKZA 4H3VA 4D6YA 3ZD7A 1KEVA 1R0BA 4UPEA 1FLAA 2RH5A 4MINA 2QTLA 2BMEA 2YY7A 5CDHA 2DFKB 1ZM4A 3CPJB 4FK8A 4DLTA 4WLVA 3KX2A 5IC5A 3HI4A 5DXJA 2IUFA 2D5AA 3IKMB 3STXA 1Y8AA 4BBJA 4LDJA 3VAYA 4Q0MA 5FR2A 1JN0A 1X7YB 1Z68A 1EWKA 4R2JA 1GKYA 2GB4A 2P7IA 2C8VA 5IDVA 5BVGB 2OK8A 4M0DA 1PL0A 4M9SA 1M1YB 5CW1A 5CYOA 4QD3A 3W4IA 3B1VA 5AM3A 3M82A 2PS3A 4Q6WA 5IHPA 2P0AA 3AOGA 3DQZA 1OC2A 1T24A 3FI9A 1UINA 1N7GA 2XRYA 3NNNA 1DEXA 4Q5IA 3WZ2A 3ZBQA 2HW8A 3TJRA 4KAFA 1ZA1A 3HCEA 1Z47A 3O1JC 5ILGA 5LIPA 2RC5A 3GLVA 4FC6A 1BXRA 2XCIA 1K6XA 1Q83A 3NHUA 3Q9UA 2LD4A 2C58A 4LG1A 4W1SA 3T5PA 1QF9A 1MW8X 3RAPR 4FFMA 5KTPA 4FXOA 1K0FA 2QGZA 3OD1A 3JQEA 5AM2A 2VPTA 4HEJA 4KXFB 4EDFA 1L5FA 4ZOLA 1E6UA 4IIVA 5AXBA 2Z6QA 1FIUA 1L5VA 1RZ3A 2OAQ1 4TYQA 4A1FA 1DT3A 2C5FA 2CLFB 2LIPA 3A36A 3CH6A 4MYSA 4LHEA 3WRXC 1QU2A 3B1WA 3S7ZA 5IJXA 3LVFO 3ESDA 1BAPA 2I1VB 4G9BA 4HZUB 4DA9A 3MA0A 4YMHA 3EWIA 1R0CA 4P84A 2XECA 3FYUA 2CN1A 4MYDA 4M0MA 1JR6A 2GAFA 2WIAA 3OIUA 8LDHA 4DMMA 5DYGA 2F9MA 3RPEA 4FGJA 3WB9A 4UQPA 1G2IA 5HR5A 5E6SB 4P3XA 1DG1G 3VVLA 1V5GA 1Z5WA 3MGCA 1ZDMA 4IRUB 3KLPX 1KK0A 3IT3A 4RYDA 1D07A 1YZTA 4JHLA 1IEXA 4BJ6A 3IELA 1TYAE 1GPWB 1VGVA 3AM4A 4DCGA 1SB9A 4YUYA 5ENVA 3KPWA 4MWGA 3RK1A 5I4IA 3P9YA 4JVSB 1JZSA 4QBTA 2EJCA 5JTTA 2A30A 2YFYA 4JFAA 3L0YA 5EHGA 3ZLBA 3WSWA 2RMKA 3WMFA 2RGBA 1O94C 4MW5A 4W5WA 1SQ5A 2WDZA 3TSYA 3KB2A 1QVAA 3BHIA 3NIDB 4M89A 2O5VA 3H8JA 2D0IA 3R0QA 1KJNA 2XUHA 2R25B 3IT1A 1DJNA 3DZCA 3WYEA 4PM4A 3K0CA 4M49A 1W59A 3K09C 3I62A 5F76A 5LBUA 2PIDA 4D92A 2XUFA 1CW2B 1W49A 1TTPB 3BH0A 3CU5A 3B7GA 1K3UB 1TT7A 1CFZA 5A4KA 1VIMA 1E6WA 2N47A 2PMFA 1NI3A 1G21A 3WLQA 3CRRA 1KZ9A 4BECA 4EP1A 1MB2A 6NULA 2YMLA 3PIIA 4LC0A 5CYFA 4EKDA 4O2BF 2CNNA 4F7DA 1P62B 1FZTA 2GCIA 4RKYA 3RIEA 4YMTA 1ULBA 3HR4A 5IXSA 3SI7A 1JLLA 1A2QA 3FROA 2BEUA 2CVQA 2BFPA 2MIIA 4Z7NB 4Y98A 2IIPA 2LCFA 1WUYA 2QTAA 2QY9A 3WG9A 2RB4A 1K6IA 2PVCA 2BGMA 1TJ5A 4Q18A 1DTWA 1AV6A 1H8ED 4MI6A 2E82A 4BVGA 2NXJA 2OCDA 2H18A 2CF6A 3CNOA 3F74A 1ZNZA 1AO0A 3MHTA 1SHKA 1EK1A 3N2YA 4C4YA 2R11A 4I4TF 4F84A 2GZRA 1BHJA 1GL6A 2VNJA 2NU8B 3AR2A 5JJ5A 3S2SA 1IIRA 1Y8QB 3Q7PA 2EWMA 3AETA 1CQXA 4WLEA 1ZMOA 1AHHA 1JDVA 1XB2A 1GDDA 1XMVA 4NV0A 3R9WA 3LQRA 3V3KA 1JT2A 3BF8A 4RORA 1EWTA 3M3HA 1PK7A 3SEAA 3PVCA 2WZBA 2GKSA 5FWXA 521PA 4F5WA 1S2DA 2ZJ2A 5DTQA 4MTCA 3HP1A 1X92A 2QPOA 1B74A 3ECAA 3MB5A 3DZIA 4F4FA 5GONF 2GEDA 4JJZA 4YJHB 2J9ZB 3WNQA 1THGA 5THXA 3U61B 2CNKA 3P19A 4R2MA 2ZJ6A 2APJA 4D4LA 1AS3A 1HH4A 1NT4A 3ID6C 3ND5A 4MMXB 4MUYA 1Q0TA 1TJPB 2ZR0A 1XTJA 4D2IA 5JJIA 5HJEA 4ZQHA 5DCLA 3BTSA 4MV7A 2H65A 3RFUA 4HVAA 2R7LA 1QV6A 4HN2A 1N5LA 1AKNA 4XYBA 4NTZA 2IPAB 4RZUA 5KJ1A 5CVEA 3ZWOA 3GU3A 2PS0A 1GTJ1 2NPOA 1WWKA 2WABA 4KH1A 4M1KA 4O33A 3YASA 2YS7A 3SR3A 3PR1A 5JJLA 4JI1B 1T34A 1UBHS 2XPCA 5D00A 3A7DA 1T3ZA 2UUOA 2C0CA 2FW9A 4XVHA 5ERYA 3AERB 3SYLA 4I66A 1NFQA 4I4CA 4LTNA 4MDFA 3ANNA 5K0BA 3GEEA 3GOHA 4FONA 1A8PA 3T1HB 5EN4A 3AEKB 4Z53A 3WXMA 1GQYA 1J4AA 1VSQA 4F96A 1MHTA 2ZB7A 3EGVA 1LWNA 3I8OA 1PJZA 4DCUA 1YMQA 3BC1A 3VOTA 1Y7IA 2OFXA 3UMMA 1U8ZA 1FCJA 1GAQA 1CDEA 1MMFB 1MOSA 1M0TA 1P29A 3QVOA 4ZZ2A 4ZAGA 4RVUA 2VDJA 4HLQB 5DHQA 2PN1A 1EVQA 1SKBA 3LFHA 3N3AC 3DWFA 4KE7A 1FDRA 1JU9A 1ZSNA 3AZPA 2EX1A 4GNRA 3NJ8A 4ASUA 1R10A 5E6UA 5KMGB 4D26A 1JAHA 1R0RE 1XQ6A 1Z26A 2FOLA 4CXMA 2QJOA 2X6RA 3FUTA 1P5HA 3JQ9A 1C1YA 5EIEA 3T5AA 1VCOA 2OKCA 2QLMA 3F90A 2D2XA 4C5BA 3VKHA 4IL5A 3DTVB 2UYGA 2X0RA 4EUSA 3M49A 4RTKA 3ANXA 3GT4A 4FGLA 1ZUNB 2Q4EA 2XTZA 4IX9A 4FWBA 3WA6A 3HXMA 1NRXA 1CNEA 3DC7A 4KN8A 1T3HA 4OQDA 1RMYA 1UCFA 1IRIA 2FW1A 4LY0A 2BFBB 3W9UA 1V7QA 4FPXA 3NVDA 2YWEA 3F7OA 3JQBA 1EX1A 1ZP6A 2H07A 4RFVA 1KDVA 4I55A 3R5SA 2DQKA 1I51A 3RFTA 2XQIA 4P4TA 4EFLA 2N0SA 4QPNA 2AT1A 1IEWA 5E9AA 3V4PB 1N1DA 4A8PA 4YUWA 6LDHA 3UW1A 3U3ZA 1NBME 3GJZA 4MR8B 2I67A 4MV3A 1FFXA 4CDMA 2PT6A 4LOAA 1NW5A 1QLWA 3H8WA 1U0TA 3HVIA 1XVTA 1ZWLA 3OWHA 3QYFA 4ZU3A 4I6JA 1E20A 3EYAA 3ZDAA 2W0SA 4KLNA 5ILQA 2E4VA 3GRCA 5DNAA 2GAIA 3CH4B 1C3LA 1KFKB 3OA0A 3M6VA 1CUAA 1G8GA 4DNXA 3K8OE 1MT3A 3U7RA 4DLAA 1G4HA 4RL6A 4B7ZA 3EZ7A 3FNHA 1JIVA 4JVNA 3QVXA 3G1TA 4YRGA 1A8SA 1FDIA 4OM7A 4MLCA 2RHDA 2ZUCA 1CEYA 2XDQA 2BF4A 1CTQA 3E1GA 2X7JA 4HFJA 4KHPB 1FSSA 1GLVA 1JJFA 1U5CA 3KEFA 4TS9A 2PCJA 2BMWA 3K31A 5TQ0B 3FOCA 4F4JA 3BQNB 4DV5B 1T9GR 2ECQA 3KP1A 3BK7A 3U7FB 4MVJA 1OH7A 4Q7QA 4BIIA 3LT4A 2FX2A 4QGSA 3AV0B 2ZYRA 5BSRA 2YJGA 3LRPA 1UBTS 4IZ6A 4R3UC 4O08A 1M2GA 2M98A 1AMOA 4FTWA 4IM7A 2HOQA 1QIGA 1KZGB 1IHPA 1L6RA 2D1YA 2OO5C 2Q62A 3ELWA 3IR5A 5K5EA 3TDKA 2H9IA 1VL0A 3EPPA 1R5NA 2C5HA 2XNCA 2PVPA 3BL8A 3WB2A 4ERNA 3U4QA 2HK7A 1G5TA 3FWNA 1IJFA 5HEKA 3T38A 5JCPA 1RKUA 3WDLA 1BRTA 2C2HA 2JGEA 1NJ1A 4GWLA 4O4LB 1JF8A 2ZE5A 3OFND 4MUHA 4QQRA 2P65A 5IMSA 4EWLA 3MM4A 2R6AA 1P7YA 4KPUB 4FLMA 3DGEC 4ZT7A 1FP4B 3SYRA 4BO9A 1AMNA 3NM4A 2ONKA 4MRMB 2NXNA 3PC8C 4KPYA 2Q2OA 3F5DA 4JXKA 4ZRNA 4XPIB 4PSKA 4DLBA 1LJUA 2H3EA 3A4IA 5GGXA 1W581 3WI7A 2ZUDA 3L6BA 5AW6A 2IELA 5TGDA 3KSUA 1UFQA 1OU0A 5INTA 1Q19A 5F1YA 3RT7A 2UUAB 2JIRA 2E4XA 2O2CA 4NV3A 3W3AD 4UU8A 5DLDA 3OE7A 3V1KA 2ZYAA 3SWWA 4MS1B 3T41A 5HJ2A 4XIFA 1VI6A 4YPOA 1WCXA 1PDWA 3CRW1 1ND6A 2Y9PB 4OCZA 5JD3A 5SYNA 1SCJA 1W44A 2VJYA 2VHQA 2B5OA 2V7BA 3ILSA 2Z4SA 1LRLA 4UUNA 1A0OA 1JS1X 4CWAA 2BFNA 2X8BA 3FB4A 5JS8A 4HDRA 1CDZA 1T9KA 3RM3A 4BATA 4C05A 3I2KA 2FA9A 3QE4A 3VR2A 1JEYA 1T1GA 3JVVA 5L3QA 4M1WA 2DUWA 2AQ8A 2VPWA 1GR0A 4KDCA 3QVJA 2PRYA 3MGGA 2HJSA 5FBWB 1VG9B 3V2IA 3ND8A 4S0ZA 3ZEIA 5FPKA 3NO4A 3SKYA 3WKEA 1CUVA 1V8BA 4D3DA 4Z3OA 3NDIA 1TK3A 3AVWA 7REQA 5DO9A 1UMCB 2CFCA 2HEIA 4QAJA 1VTKA 5CFPA 5EIFA 1FTQA 2PQ6A 5FV7A 1VZ2A 5B58C 1OBVA 3GLIE 4EX7A 2B78A 1GQQA 1GZ3A 4QULA 5G3YA 1DRKA 4FMDF 3SHOA 1A4XA 1OU4A 2OD2A 1FTWA 4P83A 5E4TA 2DY0A 1N5OX 3CBQA 1SFRA 3V2HA 2XTAA 1YU6A 4TTJA 3W5VA 3CPHA 3GI1A 5DTJA 5GJWC 1MOZA 4F6RB 3NALA 4KSBA 5MHTA 4LV5B 5FPYA 5K8CA 3B6EA 4OSPA 2PZAA 3AY3A 1QQ7A 5DM2A 2DJIA 4WY8A 1G42A 5H68A 3VAZA 5LYJB 1J9EA 1UBUS 3K5IA 1T8RA 1RVDA 1QR2A 4YRFA 3E58A 3LBAA 4S12A 4WLOA 2PEYA 4RQTA 3ZXYA 3HUFA 3VNRA 1P4JA 4C2BA 4WD3A 1F2TA 1QDLB 4MNTA 3ZN2A 2YIMA 1G41A 3RSSA 4R8KA 3T5GA 1U8AA 1RAFA 2QGFA 1QG2A 3OLCX 4LGCA 2PRSA 3CLHA 5G0SA 4GOOD 3OT4A 2MSEB 3A9VA 5JO9A 4KITB 3ZDCA 4X94A 4ZRMA 4LFAB 3GMDA 4PAQA 3PX2A 4ARAA 1C3OA 1TAHA 4Y1RA 4GECA 4HQLA 3ZGVA 4D81A 3VR0A 2NU6B 5HRUA 5ALJA 5EXDA 2XCUA 4YJGB 3UB3A 4DIKA 1M72A 1N36B 1TGYA 1U1FA 5HKLA 4D4GA 4Q9IA 1Y1PA 3RB8A 1M7BA 4L8VA 5EAIA 4ARUA 1HLGA 4DLXA 4RK5A 4ZEXA 4YRKA 1UM9A 4UHBA 5TQ2A 3JALB 2BBWA 3K0KA 1TMKA 1IZ7A 4QPCA 4WKNA 5CIYA 4G0QA 3AJEA 2ZSEA 1GQOA 1T9GS 4RSHA 2GK6A 3COJA 5BQXA 1T2AA 3RVSA 4DUGA 3FE2A 4F4IA 1TTHA 3MVEA 2ZRFA 2QM0A 3D7RA 4Z9FA 1M0WA 2OVBA 2ZIAA 4MH0R 2IYEA 1F3OA 5C35A 2O8CB 1JIQA 1MQ8B 4YXWA 3IT2A 3KQHA 1B6GA 1VGRA 1ZG3A 1NW3A 1OROA 3DH0A 3F1LA 2YN2A 3N3BC 4M8NE 4O02B 4TQ9A 1N6PA 3X2EA 4C87A 4I4IA 4U6QA 3E81A 5DEOA 3JAKB 4XYLA 2EWVA 2I29A 4JX9A 4L6CA 3CW9A 4J1TA 5J2UF 3EG5A 3UJCA 3I1FA 1RQ7A 3LDGA 4AC9A 3EULA 3JD2A 2CBGA 3NKVA 3L0ZA 3MWEA 4JKOA 5E0OA 5F1OA 4Z2YA 5TC4A 1CUIA 4PC1A 1NL3A 5AM5A 5I45A 4FZ3A 5TQVA 3UC9A 3VGJA 221PA 5BOSB 1CY0A 1T5SA 4Q7EA 3ZE8A 4C01A 1FZQA 1RKBA 3K5HA 4ZVQA 3KVRA 2XADA 1WAMA 4P36A 1XLUA 2I6UA 1Z73A 1K27A 4GOKA 4WUVA 3L1HA 4JODA 1XD2B 1W6UA 2H52A 1Z4NA 2WVJA 1FW6A 3FVQA 5HZKA 2HIGA 4TMFA 5D86A 4JLUA 3U1VA 5K7SA 2ENUA 3K8QA 3MJDA 4RELA 3TOCA 1G8HA 2WT8A 1UK8A 1YUBA 1JKMA 1NX6A 4GXNA 2CJPA 4DR4B 1VA4A 2CMHA 3OO0A 2R00C 3CR7A 3PU6A 4BFVA 4CIVA 1ZX1A 3DMTC 3Q8WA 1NF8A 4MR9B 1WBDA 1BDIA 3HKBA 1XZAA 3L7YA 5CRIA 3DR5A 3RRYA 4WASA 1WMEA 1ZMXA 3G59A 2VJLA 1E4EB 2JJ8A 1R16A 5BYBA 2WTUA 2CZGA 1WCYA 1KOJA 1NIJA 1NKVA 4NX2A 4BVBA 4W5NA 5HMMA 5CDFE 1RXIA 1ZN2A 3OQ6A 3U9SA 5L7WA 5CCDA 4TS1A 3FGZA 3WYGA 3ZWVA 5LP6A 2H5IA 2W8ZA 1P0CA 3HJNA 3PQ8A 4BMVA 1XTBA 3K73O 2ZVPX 2SCUA 2ZJBA 2WUEA 4OI2A 2G40A 5A3SA 3LRTA 4TV8A 4CLHA 1PNTA 3VOSA 5KTOA 3FD8A 1GJRA 1CVLA 5KCMA 3VSEA 3T4XA 5JNRA 4J4HA 3CN9A 3T5MA 1AKTA 3JZFA 2BMVA 3K8YA 1RXCA 4AJPA 4EJ2A 2FRVA 2P9EA 3O8QB 1KYXA 3AF3A 5JNUA 3P9ZA 2HEGA 1YMUA 5EVCA 5HIKA 3A04A 3E7WA 3ZJ4A 4OIMA 4A92A 2W6ID 5J5VA 621PA 3EB9A 2OK7A 5G4LA 4P4SB 3VR5A 1MJGM 3QE3A 1CY1A 3D7NA 3UBTA 2F3QA 3WGUA 4HT3B 3Q8MA 1NONA 4EY7A 2X4LA 2BGLA 2C9OA 3QLEA 4GX1A 3I04M 4J2OA 4XQ0A 4M21A 1BXGB 2OZPA 3IMKA 1VBMA 2PGIA 2TS1A 2G77B 4BNGA 1SM4A 1Z2PX 2L42A 1SUWA 3VR5H 4CQNA 3O4GA 1E2FA 2P90A 2W7TA 2PXCA 3FTNA 1SKUA 3RUIA 1NV8A 5JAMA 1OOEA 3H84A 1ESMA 1QCZA 2WAAA 2WFMA 2XV1A 3CEAA 3J7AC 3EZGA 1LPSA 2K7ZA 3JR3A 1EVEA 1XTQA 2Q46A 4QRHA 2WE7A 3ZWKA 5LA6F 1R4AA 1ULTA 1I4LD 4R8VA 3O2SB 1NJSA 5HSGA 2YXBA 1E1CB 1FQWA 2EFGA 2F00A 3A10A 5EWJA 4C7XA 1SXPA 1QH1B 1L7DA 2DT5A 3WGGA 2EU8A 1JHYA 1NXQA 1YZFA 2QYOA 3GGDA 3MQFA 5JS2A 3TH5A 1FUEA 1W88A 2CF5A 3JYQA 3CNNA 3S70A 3VPXA 5DYYA 4ETNA 1ORVA 4IXDA 3JX9A 2YC4C 3NATA 3NC0C 4P22A 5EMMA 4MWBA 1RWWA 4CKYA 1Z7GA 3A9CA 5TNXA 3U5TA 1OLUB 5IEJA 3RKRA 1PR9A 2ZT5A 3NH9A 4F1WA 2HJHA 4MV9A 4QODA 5I48A 2KW5A 2Y92A 4I1YA 4LY9A 1C14A 1K8QA 4H35A 3KVOA 1LNZA 1XWFA 1ZVKA 2PMWB 3ZWDA 2ZR8A 3IBFA 2GEVA 4QWWA 5LZ8A 1E1YA 1WDTA 2NAPA 4X6UA 3ZKAA 3HB1A 3LECA 3W6PA 3ZU2A 2QA5A 1X70A 1MBZA 2H2WA 4GI5A 2ZIZA 3LP8A 3GB9A 1E6LA 1TF7A 2H2FA 3R44A 2DUMA 3VHXB 2VQDA 4E13A 1SIOA 3DWEX 1MIOA 1QS0B 2Q4DA 1HR0B 3TF5A 4TL6A 2QT1A 4YMGA 4P3KA 3A1SA 2EATA 4ZQIA 3H2KA 1IL0A 3HKDB 3FJOA 4TYPA 1CJUC 3QFCA 4YBRA 4YJ3B 4Y9UA 3NIBA 1EWYA 1L5ZA 5LWHA 3LIIA 1KJYA 1XCPA 4X84A 4F5EA 3NUGA 3ZXXA 1Y6ZA 4GL2A 2WSBA 4IFTA 4CMEC 2Y4OA 2BKXA 4KGXA 3ZEAA 1G291 3M4ZA 5ALYA 4D0SA 1PQ4A 1TO2E 4UBOA 2BM1A 2ZI5A 2IK8A 3UK1A 5AI8A 2GCNA 1NVVR 1GPBA 3WWZA 2QSJA 2H2DA 3SVZA 1K6JA 1HKHA 1TRKA 2B6NA 2OAEA 1HRKA 1RADA 2YQ5A 2ZJOA 3QSYA 4QDTA 4URHA 4DYDA 2YDXA 3ND9A 1CR2A 1TA4A 2HKIA 2M6SA 2R8ZA 4OP3A 1P0IA 3O94A 4POAA 3TOZA 4F92B 3I6QA 4XM0A 3GZNA 5CFMA 5KTYA 3KKKA 2PUAA 1MVLA 4G37A 2XDWA 3ODPA 1ZIXA 4RCYA 1YOVA 3IB6A 4CEHA 3ZDFA 2CCKA 1UFOA 2WG1A 3AKEA 4W5JA 4GOLD 4X66B 2A9KA 3CFYA 1X7GA 1UFVA 2ZVQX 4X7RA 5DBHX 3H1PA 2DR3A 4RJLA 5DRYA 1FYFA 1QU3A 5A0VA 1UF9A 2Q4TA 3EVEA 4FR5A 4QNRA 4OU4A 4F3YA 3HDQA 5ADUS 1ZJ5A 4NOLA 2FGJA 1LLQA 4UHHA 1QRTA 3AFIA 3JQCA 2OXFA 2NTNA 4OHBA 1L4EA 4OYRA 2QV7A 2VXYA 2NOAA 1CUBA 1FMJA 2IXBA 3K5WA 1W0JD 1HDIA 3QELA 4KE9A 5DM70 4HWRA 4ZOBA 4U63A 2B8JA 3TIVA 2HXGA 2AJTA 4ZVNA 5SV2A 3D02A 3RR2A 3D4NA 4B44A 1A5TA 3DE0X 3EA0A 3EGWA 3CUUA 5CB6A 4RF5A 5AUNB 4F4CA 3QG1A 1AXRA 1IBSA 3H16A 2QG9A 5FB3A 3BJEA 2ODTX 3TTTA 4C0HA 4HWSA 1O6BA 3UFXA 3MJTA 1DC4A 1T3LA 2WYIA 3AFMA 3QP9A 4E2YA 1WXDA 3L4BA 4PSVA 4MO9A 1VYUA 3SZMA 4B6PA 2CWWA 3MCUA 1GCGA 1P2GA 2UAGA 2BE9A 3NHAA 4INJA 3SZ3A 3FY4A 3AYXB 4R1PA 1JT9A 1SCUB 5E4JA 1GT91 3WQQA 3RYIA 4WVFA 4NI5A 1NJ5A 1F38A 4FMPA 4JJIA 3GUUA 3C6XA 3OEWA 4HDSA 1HURA 2DHRA 1CF4A 1VIAA 2DPLA 3F98A 4H77A 3RVQA 3UMVA 2X8LA 1N1EA 3FDZB 3DXFA 4DE5A 2YRFA 1UPTA 3A9RA 3OPXA 5K4AA 2QX4A 4M8LA 1Q44A 3TJZA 1MRSA 5EFZA 4I1VA 1NOJA 5FD8A 5SZIA 4GMKA 3GJXC 4ADSG 5LQAA 3V8NA 2H4YA 1GPH1 2FWRA 3NHRA 5K3EA 3TE6A 3KYBA 4D9KA 5KQSA 1Y7HA 3IESA 4ILKA 5GJVC 1UIRA 3BSWA 4DDMA 4EJSB 3NASA 4LNHA 4R3NA 1LB1B 4WBSA 1CC1S 2A9FA 1O2DA 2Z8YA 3SS8A 3V8VA 4BKOA 5BUQA 3H4VA 3ADBA 2WNIA 3G02A 2CJXA 2D0PB 3AI1A 1WU8A 1MAHA 3WP0A 3BKXA 5LDHA 3HVJA 4WLNA 1PZXA 4BJ3A 1OBHA 4K9LA 4DOMA 1EFRA 3GLFB 2D6FA 1BVYF 2QRNA 3O8OB 4BFLA 3KC2A 1PUJA 2HRZA 4TVOA 4PAOA 1T1JA 3A0RB 4Y2VA 5BWMA 2PPVA 5EIBC 4D9IA 2OKGA 4C6TB 2P5TB 3QU9A 3SDSA 1OHHA 1TRHA 5BMVB 4DZRA 1DU4A 3OY2A 4IEFB 2R4UA 1OX6A 2N75A 4S2EA 4E7PA 3DG9A 4BUZA 3HXOA 4GKBA 5COBA 2FPWA 1RU3A 1EVYA 1GFWA 3NYQA 4HYYA 2QL5A 3EGXA 4XJVA 3F8WA 3U0VA 2ECKA 2CUTA 5U9CA 4JR2A 4LF5B 4TMWA 2VH5R 4L3VA 1AF7A 1JSZA 1SNYA 4DG8A 1IN7A 3I2GA 1KVQA 1O8CA 4A1OA 2O5CA 2DWPA 3MCTA 5T4BA 4F6LA 1V3TA 1JDTA 3GCGA 3DV9A 2O0JA 2H1FA 3TW8B 1E9EA 3KG2A 2WWWA 4TT3D 3H19A 3X1YA 5EUQB 5M7EA 1Z4MA 5C1DA 5F51A 1BHQ1 2E7ZA 3KOYA 3N7AA 4B76A 4ETIA 1JVBA 1WNTA 1CZRA 4JS0A 1NVXQ 4R7ZA 5LLSA 5JZMA 4AMYA 2PUGA 1G5RA 2VSFA 1CUXA 3WGIA 4I9NA 4D9MA 3OUUA 2P2SA 1SVWA 1IMOA 1VLJA 4YRZA 2H4XA 1K3FA 1VPDA 3GP3A 3MCAA 2YV1A 3K2BA 4Z8YA 2JEZA 2IH2A 2HCTA 3AIKA 4ML3A 2JFBA 3KQTA 3HO8A 2OB2A 4QOEA 2P9FA 3ER9A 1Y82A 2K4MA 4A27A 5KSWB 1PL8A 3FYSA 3F7TA 1WETA 4ARZA 3NUQA 1AS0A 3AHDA 4OD0A 2KLBA 4TROA 5PNTA 5BSFA 2B7LA 3IV6A 1JLSA 1MAAA 4K0KB 4O5OA 1ISGA 1GR1A 3AK4A 1W85A 3NM6B 3H87A 4WLFA 3I6BA 3PQ6A 4YRTA 3U13A 4U2DA 3UT5A 1V8PA 4IINA 2H06A 4DL9A 5IABA 2F62A 3SLRA 2X9NA 1QYXA 1RXEA 2BI4A 4UUAA 3F6BX 3ZD6A 1AJEA 2GVNA 3S1AB 5ERXA 1C7QA 3W4KA 2L69A 3DHVA 4NMXB 3Q3CA 1DADA 3TCNA 2J6CA 1C7ZA 1RJEA 4HDMA 3IXQA 3T1OA 5CLJA 4UPVA 2TYSB 1QIHA 2ZRMA 3AKDA 2G9UA 1LI5A 3W3ZB 1UIMA 2QW1A 3MOIA 3IURA 4F8EA 1UQRA 1O95C 2H11A 1DV1A 1CUHA 4YDHB 1LV8A 4RWEA 5C8YF 4OXKA 1U1EA 2ZTSA 1UC4B 1G8JA 1MAVA 1Y0BA 2W93A 3HBFA 3WIDA 3Q3JB 4KFCA 2LKCA 2HHHB 4BGDA 2WSIA 1UKYA 4PLPA 1UWKA 3P1JA 1PW5A 1KVUA 3BWCA 3CEPB 1X7HA 5EMJA 1E5TA 3NDPA 4RX1A 4L02A 4PCVA 4CF6A 1O08A 1WV1A 1J1IA 1XCBA 2FRDC 3ESBA 1Z0DA 1D0SA 3C3YA 3KVVA 5ALWA 3RTEA 5F78A 4LMPA 4BC1A 1J23A 3F4BA 4TOIA 2QQFA 1C9YA 3Q3HA 2ERCA 4W6ZA 3TVDA 5JC1A 1DOAA 3HWSA 4YV1A 4B87A 2VNIA 3L93A 2JI8A 4RD1A 5A5VA 2ZRPA 4MDEA 4MQ6A 4TMXA 1JHZA 1NYLA 5LWQA 3N2KB 3KL4A 2AKAB 4BJ5A 2ZJ5A 4GBED 3HCNA 1BO6A 1NSTA 2VJOA 2Y76A 2VPXA 4FX5A 2O3QA 5FA8A 1Q91A 2CHEA 1DJMA 3THYA 3TOXA 4YQZA 3SLGA 1E9BA 2O23A 4D0GA 4BVJA 5DHFA 5IT0A 1RBZA 4CKXA 1IDOA 2JIMA 2XF2A 1VRWA 1SG9A 3IDFA 3JWIA 3K9CA 2LXNA 2B2XA 4Q4LA 3VNQA 1U9ZA 1KSGA 1RLUA 2JFXA 4OAOA 1T1IA 2QLBA 2NVOA 1R9JA 2BEVB 3SHVA 2QJWA 3DDHA 4L8LA 1YBAA 5DHAA 1YB2A 2EZUA 3N5KA 1P77A 1UAYA 5IJ0B 3QOFA 4LSMA 3U4GA 4OMUA 1XZ8A 2C95A 1RR6A 2B7BA 1E6MA 1XZQA 2ZYGA 3CF2A 1BCRA 2PX0A 2ZAMA 3JARA 2CB9A 3JQ7B 4FI3C 4ZGBA 5BSMA 3WIVA 2C7RA 5EWMB 4D6PA 3WDMA 2HNBA 3MS7A 3TSWA 5IK2D 2IEYA 4RZ3A 3N8DA 1HTWA 2F1OA 2R9VA 2VUHB 4M1ZA 4G5XA 1Q0SA 4D8TA 1NMQA 2ZUBA 1I33A 2AMYA 4J07A 5ALRA 3PNQA 4LJ8A 2CLCX 2FPKA 4PC6A 3BFVA 5ALTA 2VYNA 1QG6A 2NV0A 3J7TA 3TSCA 1XVVA 3U4AA 1A8IA 4IUYA 4IXNA 2W6OA 3WL4A 2RGRA 1U2QA 2R8RA 3M6XA 2GWRA 2P27A 4RXUA 3W2FA 3LBYA 4JYAB 2DKFA 4DBZA 2JDID 2C8LA 1V9LA 2RONA 4KE8A 2JD2A 4OA8A 3D3EA 3QMPA 5D01A 3WWDA 2WC1A 2WTBA 2FNAA 3SM9A 4MCHA 2RIPA 3IHWA 3OLYA 1ULZA 721PA 4L9WA 3GLGE 5BW4A 3CMMA 2FWBA 2IZ6A 2C42A 2REOA 1M2KA 1KDZA 1JJ7A 1LLDA 1QSGA 2X76A 5H0IA 1IPEA 4EY5A 5ELMA 1LDBA 5K3FA 1JVNA 4KOEC 1M3SA 1ZWKA 4AZ0B 4YWJA 3IV9A 4BNMA 5JDCA 2W2KB 5EIOA 3CWCA 4CMIB 4CM9A 1T0PA 4OBEA 3PUKA 1FSFA 1T6NA 4OI0A 3VYVA 2OGUA 4P8RA 3RUHA 1CRQA 2C57A 4G8DA 1OAKA 5KYTA 1IXYA 4QOJA 1CFJA 2EDCA 3CG4A 4WFKA 4RS3A 4RLFA 2HDWA 3AM1A 2RGGA 4JBNA 3KKQA 4LQCA 1G6HA 1NN3A 3AI2A 5GP1A 2JA2A 2BFDA 3DF7A 4ARSA 3WK6A 2VYVD 1BWRA 2H7YA 4XIIA 1LKZA 1XD8A 3OMWA 4GG1A 1SWWA 4FYKA 1L5KA 2FEOA 5EP4A 3VKFA 3N2EA 4D1YA 5CBPB 4UBIA 5A0FA 1YD7A 2PQ2A 3UPUA 3EXEA 4RTRA 1NXWA 3GFFA 5CFLA 4QYTA 3MTBA 3OLZA 1X14A 4JLOA 4XYEA 1WP9A 1H93A 2PYDA 3WB1A 5M5BA 4UHFA 4UM5A 2IGBA 4P38A 4EB0A 4JJ4A 4ZREA 2F4NA 5DVZA 1H1LB 3UIEA 5IXJA 1H9BA 4FC7A 1N2CA 3TLKA 2RAUA 1Z5ZA 1A9PA 1VJ0A 3LG2A 2GBLA 4RANA 5CLFA 4FI3F 3TMAA 2Z8XA 1FXUA 4BV9A 4F2PA 5K8LA 1JTFA 2GCOB 2Y1WA 1PQPA 1U02A 5AHRA 4DLUA 5CX1A 2FEWB 4F2WA 5IS2A 4CQMA 3A11A 4F3RA 4UTNA 5HOEA 3DOOA 2VZ8A 3LU1A 2I6SA 3L49A 5ANRB 3S6JA 1GUAA 9ABPA 3E7XA 2JBAB 3O3OB 4R5HA 4CKEA 4DY6A 1EFPB 4H7FA 1G7TA 3B3GA 4GC5A 2JFVA 2ZTVA 3F3KA 1EJBA 2B99A 3QWHA 4HDQB 3IOEA 3WK9A 1T9AA 4Q4AB 3GLGB 4DBVO 1CPYA 1EUCA 1Q3KA 4Z1MA 1Q7TA 4XJTA 5IEBA 4JELA 1B0UA 3P2JA 4MWOA 4A2CA 3FMPB 4EOGA 3T9EA 1R6TA 5AVQA 1E7RA 3EZ2A 2ZANA 3NUZA 5A3RA 1XQYA 1EM8B 3R3VA 4LQ4A 3WO1A 1FB5A 2HIAA 3FLAA 4KQWA 4ZI7A 1UMDB 3TL3A 2WWFA 2HX1A 3DTNA 1H8HD 4H27A 4I81A 2OV8A 3NBQA 3T7SA 3W5JA 1C3XA 5GM1A 3H9JA 2NXCA 1HFKA 1X9GA 1ZCZA 2XVYA 3LVBA 3QJGA 5DNEA 5CD9A 2FWMX 3JYNA 4HQRA 4RSGA 3V33A 4GS5A 4CUKA 1MH9A 2OXIA 4H1WA 2QMOA 4HJXA 3HDGA 1S9DA 3HFSA 3L6DA 1LBIA 4AVYA 4BJ1A 1SEVA 4YUAA 1JDNA 4ARBA 3PQ7A 5KIAA 4MPRA 3CVUA 1JYSA 1U8XX 3WADA 4H3HB 1ZEJA 3PJGA 3WNZA 2FZ4A 4L8YA 1LK5A 4HPJB 4RCVA 2DBRA 4AZ3A 4C5AA 4B46A 4EI8A 4ENQA 3I45A 3A8TA 5IKPA 4LQDA 3THXB 4EH1A 1HT1E 2G08A 1SIWA 2FJPA 2X5KO 2VRNA 3IUPA 5C34B 3C85A 6ABPA 4AZTA 1QHSA 3O0TA 2J7PA 5K0GA 3C1AA 3HBNA 2FPLA 2ZIFA 4HVTA 1IRXA 1BHO1 3SXPA 3VFDA 5CFOA 1WXHA 1JSLA 4U5QA 5E95A 2I2CA 4F21A 2H2IA 4L3WA 5DSZA 4UMEA 2WUGA 4PYOA 2ZSBA 4J0DA 4Z7JA 2O20A 3VC3A 2OL4A 3VVMA 3WFIA 3FPCA 4RFSA 1ZPDA 1V8FA 4PZZA 2IP1A 3W7BA 2D74A 1E9RA 5IAJA 1WJGA 5KDLA 5KYXB 5I47A 2VXOA 4DUZB 1OXBB 5EP3A 2PKXA 3BF7A 4I5GA 1YB7A 3KYJB 2R1TA 4WV3A 5M2QA 3TR5A 1W46A 2XTNA 3I23A 4AG6A 1XXHE 4YR7A 5JQWA 1M8GA 2W98A 3L4SO 1XKTA 1S2MA 3FDIA 1P74A 3I4CA 3OX3A 3IHLA 1PWZA 2RHBA 2XZOA 2NUTB 3Q15C 4E6PA 3VR6D 4HB2A 2RKWA 3WJ2A 3R9XA 3FTCA 3KHUA 4CCSA 4DLYA 3HA3A 1PVOA 1N9KA 3M9WA 3TFQA 1Z62A 3ILVA 4BGEA 1IBRA 3FVWA 1R3UA 1YVUA 1W5AA 2QIOA 4G07A 4A6PA 3U16A 4V02A 2UV8A 1BW9B 3ZGLA 1FFXB 4RZHA 4XKJA 2C0QA 4GKVA 4OQMA 2CXNA 2QE7A 3W9YA 1QK4A 4G1FA 1G8FA 2JCYA 3MRXA 3ACDA 4CQJA 5ECDA 5JHHB 1CF2O 1LW6E 1P2VA 1NUTA 1PWXA 4QEZA 4W82A 1FRNA 4KHZA 4LXUA 1USKA 4IXTA 3L41A 1EE1A 2VWHA 1V3QE 1ZOOA 1SIUA 1P1CA 3SF8A 3EDMA 1IN4A 4LBZA 1AZWA 3I01M 1J5XA 1UC9A 2CXTA 4NAHA 4QYWA 1NPYA 3WB0A 2CUZA 4UJ5A 3MD9A 1JHQA 3PSAA 3UJ6A 3QVSA 2W8BA 5ED4A 3NC1C 3EGEA 3FOWA 4AB1A 1RJFA 4IEEA 1FVHA 2GN8A 2RI1A 2Q29A 4NBLA 3UUFA 4FDVA 2X4GA 3FOBA 2PUHA 1JE1A 1HE1C 3VZSA 1REQB 1F14A 4RKQA 3L0OA 4AROA 4JLDA 1XE3A 5EJ8A 4LZOA 5EJIA 3KPJA 4PE5B 4B8YA 2FX3A 1U90A 5KPJA 1WXWA 4I5FA 1MLDA 1S1MA 5L53A 2YW2A 5CPFA 5JC8A 1GNLA 1IM5A 3RYHB 1L4NA 1GGJA 1C81A 2QRZA 2UVQA 2SICE 1WE2A 4TZKA 1Y5NA 1XXHB 1HL7A 1L7NA 1UZLA 4S1TA 1QE5A 4FEAA 1RPTA 2FPGB 1YV9A 4R1NA 4ND8B 4TWJA 5B37A 4XI9A 3PQCA 5ICCA 1CIVA 5JO0A 1NVBA 4A6DA 3GDWA 3JU3A 3ZK9A 2C78A 3P9QA 3CKYA 4HS4A 3M70A 3S3TA 2A84A 4DMUB 5JAHA 1II0A 4FW8A 3ZWPA 1D1PA 2YXNA 1B23P 4FDLA 3R3ZA 1JB9A 3K92A 3R6TA 4M9QA 4EUFA 5B55A 5FOTA 2ZYDA 3AJDA 2EERA 1E6CA 3L92A 5TIIA 4CL3A 1C0KA 2OBMA 3TQFA 1AF4A 3CX3A 1LSJA 1UKZA 2A0XA 4G5QA 2ZWPA 5DYWA 3KXIA 1J8DA 2FRXA 1NMXA 4OJYA 1YS4A 2WJ4A 3ETCA 1AKRA 4LXXA 1JEJA 1UODA 1MKYA 5TPZD 1M73E 1SHLA 2IXEA 2OQ2A 3CW2A 2IS2A 5E1MA 1NUUA 4FD3A 4DRXA 4Y2PA 4BLUA 3B9BA 4RLQA 4M7RA 3I6IA 4EMSA 3G5UA 3IPXA 2DLDA 1GZUA 1EDDA 1GRRA 3H4MA 2POCA 3HLTA 3L7OA 4JVLA 5AQEA 2LCQA 1AB5A 1UBFA 1NBEA 5B58T 4RTOA 3O8CA 4IVNA 5LXTA 2P9HA 3PXBA 3ZR4B 3C5WP 4DLPA 1XKQA 4BEJA 4JJKA 4A9AA 1K6EA 1BDBA 2B6HA 1YCDA 3ZGNA 1P17A 1I7SB 2W83A 3BB3A 4DVGA 3F2IA 4KVFA 2EQBA 5JXJA 2IDMA 3ZWQA 3L6UA 3FBWA 4A10A 2XT6A 4KLZA 1F12A 2PJZA 5CB0A 4FHCA 1J8MF 2Q9CA 3QQPA 1RYYA 3IDQA 4MCIA 1EXWA 3U4HA 2V7QA 1VC2A 3VJLA 2X77A 1MO6A 2O8FB 4R31A 1L7BA 3S27A 3OC0A 3FUWA 3KAPA 4C07A 1ISMA 3K72B 3N8HA 5KOHB 4HNGA 4RBNA 1HDYA 4YB8A 2IE0A 2PUTA 3A6DA 3MUEA 1V1JA 5FLEX 4BX0A 5JCOA 1RWBA 3EUAA 2OPBA 4Y3UA 4RD4A 4PQGA 2O7NA 3RBVA 2R8OA 2FUKA 4Q4JB 4BNTA 4EG8A 3DXZA 3L8ZA 2I55A 4RKFA 5L95A 5DT2A 1N78A 3GNLA 1AC5A 2ONCA 3BMOB 3M3DA 5A1TA 1MRZA 4W5HA 3VPGA 4PXSA 5KQMA 3QUCA 1L5HA 2F6RA 3L2OB 4LWPA 2XYVA 3THOA 3ZCSA 5FADA 3SS7X 1Y1TA 2PMCA 4L72A 4Y7DA 5HF6A 5BRNA 4LYAA 5CM2Z 4DEVA 2C4UA 3MNFA 2DG2A 3HGQA 3NLLA 5T64A 3UGQA 2W71A 3KQYA 2H51A 4UVHA 2I78A 1A5BB 3HDVA 1U2ZA 3IHTA 2H1IA 3IILA 4HSGA 1SJ9A 2FGKA 5TT0A 1EAYA 4JJEA 2YIJA 4G01B 1NMYA 4UZFA 4A16A 2ZSJA 4NU0A 2KSQA 4JKIA 5MN5A 1KC1A 2VJCA 3GFOA 3K0FA 3KQMA 3IAAA 4LVUA 3LJKA 5CXXA 5IDQA 1BVRA 3VV3A 5HG0A 4F2GA 1G3RA 3EVCA 1J00A 4FDUA 4PG6A 5JPCA 3O84A 3M0EA 3RT9A 3OCVA 1NJ2A 4N8EA 4DC9A 4BKPA 3HSYA 3VPFA 1LQTA 4UCFA 4R81A 4NJEA 2E9SA 5HGXA 5JT1A 2NTYC 4NR0A 2EJWA 3GC6A 2WAOA 3LFUA 2BZ0A 2DZDA 4QDXA 1M7HA 3TX2A 2X58A 2W22A 4XUCA 3REQA 4G23A 3ZHCA 4TZ0A 1V2HE 1FFYA 1E77A 4KN6A 2VWGA 4HV4A 1XMSA 2W2MA 3D1VA 3GWGA 2R6HA 2QE7D 1DUIA 2Z2JA 3Q9LA 3EPLA 3BH7A 3RUFA 4LA4A 4BNUA 1Z4QA 1OI4A 2R87A 3HBMA 4M8SA 3JQGA 1M34A 2D4HA 2G1KA 1SCBA 5COQA 2OBLA 3I9LA 3WK8A 4WOBA 3C6ZA 2OGZA 3E2MA 1YS2X 2D5BA 1QC5A 2UZAA 2BFEB 5KVQA 3RYFA 3U3KA 4DDKA 2Z56A 1YAHA 3FOZA 1PKXA 4UBMA 4C0SA 3MQ2A 3BTUA 1ISHA 1E2EA 4M6WA 2R4TA 3DE3X 4U3JB 4KUHA 5AJHA 5J59A 5HWSA 2ADMA 3QEMA 3ZY5A 3OEHD 4LHYA 5KJEA 3ZU6A 4HRXA 3UCFA 4YI3A 4RVNA 1NQ5A 2Z57A 1SPBS 3DV2A 3HEMA 4X44A 3PR3A 3GIWA 1ZUIA 2VBGA 4DSNA 4QO7A 3MRSA 4O4LF 1KP3A 1TNDA 1C4WA 1POXA 1GZSA 2Y8EA 2XYPA 3CG0A 3TQCA 3ZBPA 1WZCA 3NGLA 5K8JB 3MT9A 1LPNA 2IYNA 4Q1EA 3QTTA 1T13A 3DOIA 4ZICA 2PKQO 1JDBB 4K6FA 2DQZA 1DNPA 3TTSA 3ONFA 821PA 5ADWA 3K71B 3CUEF 1E2HA 3FKSD 3N39C 4JR1A 5HFJA 4YX9A 1WKBA 3MWJA 4IILA 1U2SA 3M81A 3VSBA 3CPEA 1XAJA 5CMLA 5EXSA 5IF9A 1T3SA 1VE5A 1GOTA 2XY4A 3EIOA 4BE4A 2EBFX 3LNTA 4Q15A 4WBNB 1GNTA 3E48A 1B0ZA 4ND5A 2JLXA 4L1KA 4QLOA 4K9MA 1N2GA 3A6GA 3D8HA 1DAPA 4M1SA 3OZXA 1MORA 2COEA 2GASA 4NE2A 1N8KA 4IAOA 4V0ME 4OHZA 4ZHQA 3OX4A 5K8TA 3HB5X 4IZHA 5ALNA 5CDTA 1EFAA 1Q1EA 4LJ4A 1RT9A 3DDUA 3WLRA 1LCIA 4KV9A 4WNYA 2XMCA 4WN3A 2G71A 1H05A 1UPCA 4GWKA 1QK3A 1O4WA 2KWIA 2VDWA 1PU2A 2FQ1A 2O0HA 4LJYA 4ZYUA 4YO8A 2D5CA 3B52X 2RKOA 3TAUA 1G98A 2GM9A 3ZY6A 1AOXA 4OQ4A 4CMHA 4DCMA 1CV2A 1QPBA 4UHDA 1I4OA 3KZXA 3BWVA 3BBPA 1RXUA 3CNBA 3MRVA 3U09A 2VCHA 2XRMA 3DCIA 1H2RS 3LPCA 3M5WA 1VI5A 2HUPA 3BE6A 4PRZA 1PFUA 2Q99A 2W2LD 3EGCA 4JH0A 2GTHA 1Y5LA 3BTVA 3VISA 5A71A 3UMFA 5JV5A 3ZDBA 4RMIA 1SA0A 3IIEA 3L4EA 5F1KA 5AK5A 3EA5A 2DWOA 2OORA 1II8B 1JI3A 2CLSA 3FX2A 4I6EA 3R76A 2V98A 4M38A 4LYGA 5JALA 2YRXA 3EXHA 4YH1A 3FHJA 4HGNA 1GQFA 2IZ7A 3PLNA 4U2CA 3RADC 5G2OA 5ADHA 2AN1A 1BJKA 2B8NA 3SZGA 2B0CA 5B2ZA 4A6XA 3LP5A 1Z8DA 2WUFA 2YWCA 2ZYIA 5LLDA 2IXTA 4OHVA 2WG0A 5LYJF 2AOUA 4L75A 1X7XB 3ETJA 4RTNA 5JHGB 2YC2C 4O4HB 1YACA 5GWXA 4K9SA 1NOKA 1T9DA 1L1FA 2X3FA 5CNKA 5C7OO 1NJGA 2D2FA 1P3JA 2WSLA 1Z2EA 4JYZA 1M1NA 3B89A 3MS2A 2HBQA 4L95C 1T9BA 2YZNA 2H17A 3QNWA 4MW4A 3VZCA 4ALIA 4CN8A 1YL7A 3P0RA 2NU8A 1WBBA 1ODKA 4EO4A 4Z9AA 3IFSA 4Z51A 5K8UA 4ME6A 2QNIA 4QVGA 4FLEA 4L07A 1HFEL 2Q3BA 5KTNA 4EMBA 3BHNA 4KDFA 5BNWA 3EPJA 5AIAA 4IGAA 4LGMA 5F7ZA 1LTKA 1GUFA 1Y1LA 2YH2A 3JZDA 4HN9A 3TBHA 5J43A 5C51B 4B82A 4KLAA 4XWYA 4AYTA 3BK1A 3QIVA 4ZOAA 4PLHA 4YPVA 3H86A 2H2GA 3BXPA 1IWOA 1Z4KA 2I99A 5I3ZA 3PHLA 2JVJA 4Y2TA 2PZ8A 4FZVA 3Q1LA 4YAIA 4B3RB 2MHCA 4W8OA 1SKMA 1ZJZA 1OX4A 2XCOA 5AW4A 4XUGB 4XUDA 1M10A 3G3EA 3LE8A 1PN3A 1T1SA 2HA4A 4I6GA 4WPGA 5K05A 3IALA 1B76A 3ABZA 4F8YA 4ZCMA 3IAM1 1BIFA 3Q72A 4MLDA 3CLTC 3NV7A 3SBEA 3HYNA 1CR1A 5BYKA 1MX3A 3AFGA 1DKMA 3UV3A 1C4OA 2CLDX 3HV2A 3JY6A 3EXAA 3V4ZA 3E3NA 5JISA 2QN3A 1NZJA 2VWPA 3R0JA 3K9HA 2FMXA 4FQ8A 2EG9A 1NM5C 2QSUA 2TMYA 1WW3A 3DKVA 1MABA 4IZIA 2BHSA 4P98A 3NHFA 1FK8A 5L7TA 4D9NA 2W6NA 4EABA 1F2VA 5KYVA 4KQJA 5BV1A 5GIPE 4IIUA 3OSZA 1TPZA 2P68A 3W1EA 3LT1A 4G5RA 4DQUA 4H0CA 4CQLB 3C4QA 4E33A 4ZCRA 1RI5A 3HFJA 1S5PA 2H1CA 1NY5A 2C2KA 2IY7A 2RAVA 2WU8A 3ESAA 2XX3A 4GPEA 3NWEA 3SXJA 5K0JA 2GJ8A 1Z75A 2NTJA 1TIPA 3IDOA 4FUQA 3HSSA 2OTCA 1KZ6A 3OZEA 3AEXA 1YZQA 3L8YA 3M83A 4JLPA 1JL3A 4YJDA 4CUZA 4DCJA 2IZ1A 5BXQC 3AZOA 2WNHA 4V38A 3ZV5A 4RTJA 2B20A 4RHFA 2X5JO 1TT5A 1U7XA 2P4SA 2IUYA 3IIMA 4JJFA 1I3KA 5TJ9A 1XRQA 4BS9A 1HDXA 2F3RA 4RK0A 3EVFA 2QRVB 4QQ8A 1CUCA 1O5OA 4DSOA 4FYXA 5AESA 2HV8A 2DWQA 4RE6A 5B6PA 1FSPA 2EVWX 3U9TA 5DYIA 2C5LA 4HAZA 3EDOA 3KM0A