3NTLA

Crystal structure of glucose-1-phosphatase (agpe) from enterobacter cloacae
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
388
structure length
388
Chain Sequence
SPEGYQLEQVLIMSRANLRAPLANNGSVLEQSTPKQWPEWEVPGGQLTTKGGVLEVYMGHYMREWLAQQGMVKTGECPAADSVYAYANSLQRTVATAQFFITGAFPGCDVPVHHQEKMGTMDPTFNPVITDNSPEFREKALKAMETERQKMQLTESYKLLEQMTNYADSPSCKEKKVCSLADAKDTFSADYEKEPGVSGPLKVGNSLVDAFTLQYYEGFPADQVAWGEIKTDQQWRVLSKLKNGYQDSLFTSTEVAQNVAKPLVKYIDKTLVTEQAKAPKITLLVGHDSNIASLLTALDFKPYQLHDQQERTPIGGKIVFQRWHDKNANQELMKIEYVYQSSEQLRNASVLSLQSPAQRVTLELKGCPVDANGFCPVDKFNAVMNNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Glucose-1-phosphatase (AgpE) from Enterobacter cloacae
rcsb
source organism Enterobacter cloacae
molecule tags Hydrolase
molecule keywords Acid glucose-1-phosphate phosphatase
total genus 128
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3ntlA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3ntlA02
3DCYA 3NTLA 1DKQA 1E59A 2P30A 3DB1A 4E3WA 2P78A 4D4JA 5AJYA 1H2FA 2PA0A 2H52A 4FDUA 4JODA 5AK0A 3K4PA 3OI7A 4PZAA 2HHJA 1FBTA 2P2ZA 1BIFA 2P77A 2WNHA 4GPZA 1H2EA 4IJ6A 2F90A 2P6MA 1C81A 5HTKA 5PGMA 4TSRA 3GP5A 4JOCA 3D8HA 3E9CA 1XQ9A 3C7TA 3FDZA 2OWDA 1SK8A 1YJXA 1SKAA 4ODIA 5AJWA 4ARUA 2DWPA 1CVIA 1DKLA 3MXOA 2P9YA 4D4LA 3QPVA 4FDTA 1DKMA 3D4IA 3F2IA 2QNIA 4MA4A 4ARVA 1BQ4A 4PZ9A 1E58A 2H0QA 3GW8A 3E9EA 1RIIA 1DKNA 5CX4A 4QIHA 4EO9A 3D6AA 1ND5A 5AJZA 3IT1A 2ENUA 2P9FA 1FZTA 3LG2A 4AROA 2A6PA 3QPUA 1V7QA 2AXNA 4PGMA 3HJGA 5CU7A 5AJVB 3KKKA 1RPTA 2P6OA 2P9ZA 2WNIA 2P2YA 2RFLA 2EKBA 4JOBA 3MBKA 2YN2A 3K4QA 1IHPA 2DWOA 4D4MA 5AJXA 2H4ZA 1NT4A 3R7AA 2OWEA 1BQ3A 3LL4A 2HPAA 2EKZA 3IT0A 3FDZB 2HIAA 2IKQA 4GPIB 2BIFA 3O0TA 1C7ZA 3ZHCA 3F3KA 1QFXA 2I1VB 1UJCA 5CDHA 1SK9A 1RPAA 1SKBA 2EOAA 2ENWA 3GP3A 4D4KA 5HR5A 4ARSA 1UJBA 3EOZA 2P79A 2H4XA 3E9DA 3IT2A 1YFKA 2A9JA 3IT3A 3EZNA 2YN0A 1K6MA 1QHFA 1V37A 2P75A 3QPWA 4EMBA 1C80A 3BIFA 4HBZA 4IJ5A 1QWOA 1DKOA 2WU0A 3FJYA 1EBBA 2GFIA 3PGMA 1DKPA 3LNTA 1ND6A 1T8PA 1TIPA 3NFYA
chains in the Genus database with same CATH superfamily
4A2QA 1KDZA 1RYYA 2XMSA 1G8JA 2DKOA 3MBIA 2GSWA 5E6RA 4A0QA 3ZOKA 2QP4A 2XEXA 3OQ6A 3V46A 4E4RA 2JBHA 1IEWA 2PGXA 4DLYA 4F2GA 3M4YA 1ZH0A 1LVHA 2QVGA 1N6PA 2G07A 4CQLB 4Q47A 1U7XA 5TMDA 3UG7A 2IXTA 4PONA 3B53X 2Q6KA 3O21A 5BNFA 2OO7A 3PYLA 3KFXA 2VK1A 3NPMA 5FTKA 1EH5A 5CK5A 2JVKA 4V1CB 1FW6A 3ITEA 1HK7A 4ZT3A 4UU1A 1MENA 4ZOAA 4CU2A 1LTHR 4MWCA 2QVXX 3D7NA 3TRDA 2VDKB 2O5RA 3E9RA 4IDNA 3SHVA 4IJ6A 5CJ2A 1C3OB 4U7PB 4CQMB 5TQ0B 4EKGA 1VRCA 2WVGA 4C7MA 4IZOA 2XYVA 3LO8A 1KXJA 1TMKA 2Q6VA 3LRTA 2HHAA 2PMWB 1N1EA 1UT5A 3MJTA 2QLBA 3GDGA 4NU5A 3PXGA 2LPMA 4ZZ1A 3NHBA 3C6MA 1CY4A 5IVDA 5GM1A 3SEZA 3OP1A 4HNGA 5LB2A 1XCOA 3DTVB 1A8SA 1GV1A 2AEMA 4N3GA 4F60A 1BMDA 2JFNA 2QRVA 1P77A 2BMAA 5AVQA 1MF7A 3C5CA 2H5IA 1MPXA 1WULS 2J4CA 3UC9A 1TMYA 3LO5A 4OBXA 4TL7A 4Y67A 1L4LA 3L0BA 4I1VA 2DQZA 4JS0A 3BJMA 3V1TC 3W1WA 4JUDX 2Q4DA 2VP0A 5AHRA 1F8FA 2POCA 1XAGA 2H11A 1CJUC 4LOKA 1BQ4A 2P9CA 1SXHA 4P3YA 1KFKB 2FEMA 5TS2A 2HWXA 5SYAA 4LIPD 1KDTA 2EZ4A 4UU7A 3R3UA 2AFIA 4QYXA 3ZD7A 2PZ8A 4DBLC 3AP3A 4X6UA 2ZTSA 3CHYA 2P4SA 3HYLA 5A9RA 2A5LA 3ZEIA 3LUHA 1N9GA 3HGMA 1I7SB 2H16A 4FS3A 4YT8A 4PINA 4P3NA 4P4SB 4TRRA 3AJEA 3P2YA 5KYWA 3GCWA 1BE1A 4XM1A 2NM0A 4LZOA 4OATA 1ADFA 4V3CA 3EFEA 3IBTA 3L49A 3MWLA 1GCUA 4I5EA 3D1VA 4XSHA 4DIEA 4BWGA 3DCNA 3QNUA 4JNKA 3N0XA 1ENYA 3KUUA 3MYYA 4MRSA 3WLHA 4DLVA 1EMDA 1V11A 3GMDA 1EP2B 3FN4A 5ES4B 4MWTA 3PXUA 4G89A 4GZ6A 3WY9A 1GPAA 3WLRA 2Q6OA 3O8DA 4UNQA 3WNBA 3OX2A 2WSSA 5HR5A 1UJBA 3GFFA 3ZE2B 3X2SA 2PTHA 5H9WA 1CJBA 2YN0A 4Z4HA 3HN7A 4H6VA 4RAQA 1P2DA 2GEKA 1IJEA 2ZR9A 3BTOA 3G8AA 3IPAA 2MT9A 2NQ8A 2WIAA 4H60A 3A3NA 3ESZA 2GRUA 4OH7A 3UOAB 5HIAA 4TZ0A 2WJZB 3QE2A 1TFRA 2WD9A 3KWMA 6ABPA 3MTEA 1SHKA 3OX3A 3DL4A 5JC1A 2BKAA 1GXSA 3FZEA 4O4HF 5C1BA 4FQ8A 1HTBA 2LUOA 1LPBB 2YHIB 3TNYA 4CQLA 1TEVA 2R47A 2ZPAA 4RHUA 1AZWA 5EE3A 3T12A 1J1ZA 1L4FA 3LXUX 4K3UA 3CB2A 1TD9A 4X45A 3ENWA 1JQDA 2WFLB 3N6XA 1E32A 4DGSA 3U40A 5HKBA 2C7BA 1B0UA 4EQ6A 1CF9A 3MRSA 1OJLA 4BLRA 3PLRA 2FHPA 3D1LA 5KHLB 1HEUA 1DCTA 3R5SA 2O8BA 2W58A 4JIGA 2IV2X 1YE3A 1E3EA 3ZK7A 2GETA 3DG9A 3ZHBA 3P8ZA 3EGEA 3HM2A 1E6EA 1VLHA 5JADA 1PFWA 4DNPA 5G4LA 1SOAA 3C8HA 3NEYA 5G2OA 5ALDA 4MA5A 2WU1A 1VL0A 1IPEA 1KF0A 1QMPA 1C7EA 2WYUA 2YWXA 1JYEA 1ZM2A 4OHFA 1OX5A 4LMPA 4WGGA 2UUCB 1CF2O 4RE5A 5EQJB 521PA 4A82A 2H4JA 1T0IA 1O95D 2I0FA 1QH1A 3PC7A 4MJ7A 4XQEA 3VSAA 2OEPA 2OE2A 2PGOA 4ENPA 3DO6A 4IVRA 5H1YA 1HI9A 2J3QA 3MQ2A 1FYVA 3TXXA 1OIXA 7REQB 1PZEA 3DONA 5GJWC 5A5FA 3TTUA 3HB1A 3KV1A 3OLXA 2C9DA 3ZQKA 1OI4A 3O8RA 3IXQA 4RADA 1XMIA 2I7TA 2Y8EA 2JZNA 3CEMA 1L5KA 4LPKA 4B46A 3AEXA 4AKSA 3V33A 1DWUA 4YAEA 5CBPB 3X0DA 2BBSA 2G0TA 3I6ZA 4JLPA 3I9V6 5E1MA 1SBHA 4ZAWA 5LFAA 2JIMA 1AUQA 4DQLA 1UMDB 5FBKA 1SD1A 2CJWA 1L4MA 2DFKB 2V55B 3IGFA 2Q1TA 5HG0A 4MR8A 3SEQA 3ZUPA 1L7BA 3NOQA 3RV3A 5IDYA 2YFQA 3E3AA 4G1CA 3T35A 2GAJA 3RRYA 1QMGA 5A1TA 4QDKA 4UDYX 4E30A 2QSUA 2LRHA 1RYBA 1VSUA 1ADCA 4I4TF 2XTNA 4UAGA 1ZFNA 3O4RA 1RR6A 2WWTA 4DNQA 4EL5A 3K9GA 2OCXA 3QUCA 3UCEA 4ALJA 1OH8A 4EGAA 3B78A 3B5EA 3A1CA 5BW5A 4FEGA 3WFZA 2DWOA 4O4JB 4X94A 1BHO1 4Y2XA 3DKKA 4FSXA 5A0VA 2RHMA 3MD0A 5A9TA 3LDFA 1YIDA 3JQQA 5CT8A 3FB1A 1PR3A 2EBUA 3LQKA 5FD8A 1W0JD 4C0BA 3IILA 2CNWA 4CNBA 3W5BA 2HJRA 3OQPA 1P60A 4A27A 4F96A 1U6KA 1KJNA 2N75A 2OORC 2A9FA 4B6SA 5LLTA 3BQ9A 1OW3B 3WC4A 1ZK2A 2R2AA 1G7RA 3FPGA 4N3NA 2VI5A 1VE1A 2HMAA 2YRXA 3CEPB 1JJVA 4CQJA 4M9CA 3K70D 4HNQA 2WA1A 1UR5A 1E61A 1K6EA 1XYYA 2VPIA 3L7DA 5EKXA 3GLGB 5HUJA 3LIPA 4HQNA 1UXIA 4WESB 1DQNA 4NMLA 5AUOB 1IXRC 1GEGA 3TQTA 1RRMA 2C5FA 2H51A 1MX3A 4M7RA 4ETMA 4EA8A 5TT1A 4P2GA 5HRUA 4EECA 1DIGA 2GK7A 4FFVA 3ZNNA 2A9VA 2ZYDA 3DB1A 1SVLA 1Z0KA 3IP5A 4G84A 4GMGA 2XJ9A 4RS4A 1E98A 1SRQA 4D99A 3U9TA 4FOSA 1QVVA 2XBUA 5AMXA 3ZWYA 2FFHA 5CLIA 5G4KB 1RKUA 4N54A 5AJYA 3VDNB 1YK1A 5LZ4A 4Z8XA 3PQFA 1GILA 2DYKA 5F2EA 1Z82A 4BQOA 1NFFA 2AG6A 5TIIA 1BIFA 1P39A 1MG0A 2EW2A 2XVMA 4HDKB 4UVDA 2WP0A 1DAHA 3X1XA 2WFMA 3B8EA 4JB0A 1RVDA 4ZT2A 2HYDA 1P7PA 4QO7A 3JASB 3KDPA 2RGWA 1L3IA 1GUBA 4WFJA 1WSDA 2BMJA 2C4HA 2P35A 4Y2UA 4ZMBA 4LOHA 1JDNA 2MYTA 1M3SA 2QXTA 1ZVKA 2Q5EA 3SHWA 4B6EA 4OJQA 5SYNA 1XPUA 4L73A 2G40A 4RK5A 4EHAA 1ORVA 2C9CA 1T1GA 4YXFA 2I6QA 3I04A 3ZWDA 4EP1A 2P6PA 2QTTA 3DC7A 4YMUA 5L4SA 1EK5A 3ODGA 5K3CA 1QKKA 1KJJA 2QE6A 3I64A 3I6YA 1W7AA 4UNIA 1EX1A 4LUCA 2YKGA 4CWAA 5EXSA 1SXJA 2JFPA 4OQLA 4QDTA 1BX0A 1QH8A 3D5TA 3E2PA 3A6FA 3FOBA 3HJRA 2PBRA 3B6JA 3NASA 1QLWA 1ZOLA 2ZGVA 4PC1A 5IJ0A 1FYFA 2HREA 3ZNQA 1JEQA 3KPUA 2QLTA 1AF4A 2DVMA 1WKCA 2WJIA 1MFPA 4ZODA 4WNAB 4MROA 4WKNA 5DTRA 5IEBA 3GLRA 3THXA 1BDJA 4HYEA 5F4ZA 5FOWA 4Y9TA 1WXHA 1EEXB 2DFNA 3ZHZA 4CT0A 3ROXA 4EENA 2OECA 1FRQA 2I8AA 2J5KA 3FFBA 3NBKA 1CQXA 5EWMB 4XWKA 3FG9A 2GN1A 5AHXA 4ZFNA 3B1WA 3KQNA 3R6LA 4QM6A 4MS4B 3TEJA 2WWFA 2JHFA 3T5PA 3C39A 3O95A 4IDHA 1RKXA 3HBMA 3RHSA 1EFPA 4LAFA 2B3DA 4ESEA 2JIQA 1USGA 4WXMA 4XR9A 1B8VA 4O29A 3I76A 3WADA 4C0LA 4NCXA 3FDFA 3MWYW 2O19A 4C76A 3LGXA 3OCWA 2PUAA 4NZ9A 2OP1A 3HN6A 5DT9A 2OPHA 1XRRA 2QP9X 3CW9A 3L8FA 2PXCA 4UAJA 1Q7EA 5C1IA 4C87A 3HJTA 5HE9A 3FOEC 2P3OA 2GN6A 3JQBA 3A4NA 4RJ2A 2F48A 1HA3A 5HE8A 3RC9A 4KH0A 1GYQA 1VRWA 1NXQA 4RPIA 1SBIA 3QHQA 3O2NA 3DHYA 1YH3A 4AW9A 4LKOA 3ZCPA 2HO5A 2JJ8A 3C7AA 3N2LA 1RWWA 3EE6A 1BROA 4DLXA 5EWJA 1FFBA 2QTGA 3HVHA 3U4QB 3LA8A 4C78A 2QT1A 2YJ6A 1C0PA 3EH1A 3KYCB 3WIOA 4PZ0A 3UATA 4AZVA 4F7DA 2CVQA 2PS0A 3FI9A 4V0QA 2D8AA 4I4LA 3COSA 5GV7A 1DAMA 1WU8A 1YOVA 3K30A 2GDJA 2AEFA 2BZ1A 2ZP1A 4KNWA 4M22A 3D8NA 2E9SA 2VLIA 3BM5A 2AOXA 1Z75A 1SA0A 2GPJA 4OJMX 2CCJA 4L7VA 4LXQA 3T5BA 3VHXA 1QV6A 1Y5IA 1VMAA 3L18A 5K8TA 2GJ9A 3OCCA 5AKKA 3A4TA 1SB8A 1OXUA 1AQNA 1BJTA 2A9QA 3QFSA 3VO1A 2FZWA 3E3MA 2AT1A 2JGRA 4R3NA 3UMJA 3IDQA 3JY6A 3KZMA 3ONFA 3I6IA 5BQ5A 2VF4X 3II6X 1M0WA 4YRZA 3OZVA 4JC5A 4MW9A 3AIMA 3K0CC 3O8QB 2P6MA 2JG3A 1CNEA 4AN4A 2FGJA 4PO8A 3RUDA 4BDTA 1H4TA 2XNDA 5I7SA 4CMCA 5ELLA 2J32A 1F14A 1ULZA 1X7ZA 2D4HA 4YRQA 1SKUA 5KVCA 1SCQA 1TVMA 4UPEA 3PUWA 3RBVA 5JFOA 4GPD1 4EYEA 1XT6A 5E7QA 3BD8A 3SM3A 4MUYA 1POWA 4HZUB 4V1CI 5FBWB 2X9NA 2BFBB 2IL1A 3FYUB 1RBZA 1V8FA 4LY0A 4W6ZA 2AFHE 1X0VA 2WV7A 4DQ0A 1ZOIA 3K96A 2PMEA 3VXKA 3FI0A 2WDZA 3GWGA 2I91A 3O94A 4IAOA 3H9UA 4L6AA 4IEEA 5KREA 3FY4A 1KZ7B 5EL0A 1FLVA 4G0UA 5TR9A 3D64A 2J09A 3H6GA 1ECCA 2CD7A 1PL7A 1DARA 2NACA 5ALJA 3RJTA 3S3TA 4A0RA 2Y93A 4MUKA 1MPTA 4KXWA 4OJNA 1ZM9A 4XWOA 1YF3A 1ND5A 1B15A 1Y8CA 4M7WA 4FX5A 4TS1A 2ZI5A 4BNUA 2C2MA 2JCBA 1R5OA 5ALHA 4Z9AA 1F12A 1EWRA 2UUPA 2NU8A 3V4RA 5ULLA 2DEUA 3AB7A 4M1TA 4F5DA 5JAUA 1WDWB 1LH0A 3BIOA 3DOCA 5DHFA 3I2YX 5JV5A 3DUFA 4PSCA 5P21A 1K9SA 2I99A 2CLSA 1OFUX 2NYUA 2BY4A 2WSMA 5CXUA 3JVEA 1E2MA 2XUHA 3QQ5A 4DIBA 5SZIA 4CLDA 3TSWA 3OZAA 2P2CA 3UWPA 1EFVA 2JEYA 1F2VA 1AXEA 2HLPA 5FOTA 4B4UA 2HJVA 3ILSA 3TSYA 4IDFA 2G0NA 2OHGA 4TT3D 1Z4JA 1W35A 2FH5B 1WXGA 2B20A 2CNOA 1IZYA 2YIDA 1LSJA 2QN6A 2FWNA 3H11B 1AMUA 4WK6A 1SPBS 3OUZA 1A9ZA 2QV0A 3F6YA 5HMLA 1ETHA 1XAJA 2WYWA 4XRGA 1XVIA 4Q12A 2Z2ZA 1JA9A 1H2WA 1LC0A 4ER5A 3RYHB 3R75A 4BL5A 1GR0A 2F9FA 5FI1B 2O2ZA 1UM9A 2XRYA 4P0TA 3D2AA 1Z6XA 2FMXA 3LUGA 2BCEA 4L2IA 1KZGB 3JAKB 3FOWA 4HDRB 1SFRA 4FZVA 4WV3A 3MWEA 5DU2A 5FUQA 2P90A 4GKJB 1DFIA 1JIUA 1UJ6A 5AI5A 3KJEA 3IKVA 5DWQA 1NN3A 1G21B 2V7VA 4TVSA 4UHKA 2HV8A 1N0UA 1JHUA 4US0R 4KPFC 5JRJA 4DJFC 2B7LA 1F5NA 1PLJA 1PR4A 3D3EA 4DCPA 4F38A 4JI8B 1G6KA 5E8RA 4CM4A 1AK9A 4Y2RA 3COJA 3HKCA 1WABA 1PNRA 4IIDA 1JR3E 3GRVA 4ISCA 1P4JA 2IYEA 2P68A 1C3EA 1U31A 4NBUA 1DBIA 1C3LA 1U02A 1MT0A 5KOYA 1AKRA 1SVKA 2OBMA 2ZRPA 4J1TA 1D0IA 4JAVC 5CVJA 3AONB 2GEDA 3CISA 3VNAA 5LQKA 4HLCA 3VOBA 1PUXA 1DAOA 3OPXA 3JX9A 2WJWA 5A4JA 2I65A 2YICA 4W7IA 2G76A 2Z08A 3JQGB 1FSPA 1AS0A 3Q2IA 4OFXA 5NULA 3SEAA 3LOPA 3NR2A 3FMFA 1TJ3A 3F6EX 1R8JA 1E1RD 4WCDA 5GTDA 2IW3A 1E4VA 3C7CB 2FVXA 3TW6A 2RGCA 5DOVA 4JITA 3FHJA 3SY8A 2XB9A 3WGTA 4CTNA 3WQBA 2UDPA 3GNQA 5F2OA 1YZTA 4CGYA 3PLNA 3IUEA 2FG6C 3BL5A 1KEPA 4JQOA 2WTBA 4PZYA 3IEKA 4Q4HB 4GQBA 3HYTA 8MHTA 1Z0JA 3BTVA 3CU5A 1Q1QA 2NU7B 1E6WA 5E2AA 4W82A 3T0IA 2Y1LA 2EFGA 1BXZA 3GAZA 5AP9A 3WMWA 1FMFA 4F7WA 5BRJA 3IVGA 4XQGA 1PWHA 3P1JA 2EFCB 1FDWA 4M49A 4F84A 3OZFA 4OKNA 3WK6A 3KKOA 4LWPA 4NENA 1E2FA 2Q3DA 3BAZA 4QGHA 3GT3A 5AM1A 5C8YF 2Y1GA 3GUZA 1YJ8A 4PM4A 5IP5A 2Q27A 1WBDA 4AIRA 5KCZA 3ENKA 1PVDA 5ARBA 2Y99A 2CXSA 3B8HA 4F3RA 1BXKA 1FFXB 2RHHA 3HGTA 4IXTA 1G9SA 4WRRA 1UPUA 3UK1A 5LB4A 2DQYA 1OREA 2R6AA 4P31A 1J8FA 1OPRA 3EIUA 4XWGA 3P5BA 2VH2A 3QUQA 2Q9CA 4IM7A 4X8MA 5FUVA 2VSOA 4G26A 3ZIAD 1IHPA 1YD7A 1AKUA 4FFBA 3K2EA 2GVDC 3RC3A 4WBNB 4BVKA 4RIFA 1LRLA 1N77A 3K8ZA 3EVCA 3JQ7A 4EBFA 4MMXB 3KT3A 4MVCA 3TTXA 3WO1A 4YMGA 4K05A 3MS2A 3TE6A 4EY8A 3PC4A 4HMPA 3RIGA 1JFFB 3IAUA 3CRQA 3VPBA 4FFOA 1AHHA 2QRNA 4TSKA 3BRWD 3NI2A 4BVFA 4DWJA 5BVGA 1EU1A 1Q0SA 3DV0A 5A3JA 2IUFA 1ODJA 3B9RA 4MUXA 5IDWA 4QPPA 1H94A 2C9YA 3AESB 1KHTA 3CRW1 1VB5A 3FMOB 1MC8A 4JEMA 1FSGA 4B3CA 3VZDA 3NGXA 4Z3OA 2B35A 3TTVA 3UJNA 1IYZA 5A5VA 1UXKA 2IYSA 3TSCA 1OKKA 2WPNA 2YV5A 3RBAA 1JBKA 1A8QA 4MO2A 1HKHA 3K1TA 5EZQA 5BRNA 3O9MA 3R7FA 3WHKA 2IITA 2B2NA 4QATA 4B8WA 5KNDH 1G2QA 1MQSA 4OQNA 1I0IA 3CEHA 5JYEA 1IHUA 3T9AA 2VP6A 1HETA 5AVZA 3NOOA 1ZXLA 3X1JA 3TSAA 1GGJA 3NTVA 2PUDA 1B2LA 5HBGA 1NNI1 2Q3CA 1BEEA 2B8JA 1DNPA 4WD3A 5KHOC 4E88A 4F46A 5JRZA 3BK7A 4LV6A 4M1ZA 1TEHA 4DV5B 1CEYA 1J20A 3ISJA 3Q1LA 1DG3A 1DUVG 2C7VA 3CX7A 4GBJA 4P6VF 2VHCA 4K6HA 5EIHA 1I5EA 4AAYA 4QGSA 5EJ8A 2MINA 4WCFC 3F3SA 3OE4A 4QWWA 1K06A 4LJ5A 3OG9A 4OG2A 5FWYB 5AVXA 5IYZA 4DB2A 4R1OA 1U5CA 4X91A 3TIXB 1HLFA 3U3ZA 2BBWA 1MT3A 1Q0TA 3A7EA 1H1LB 1B1AA 4Y6RA 4DXAA 1R4NB 1IY0A 1LDMA 4ETWA 4CKCB 2WIJA 5EJAA 4RUKA 1NN5A 2CXUA 2P4EA 1K4KA 4IQ4A 3OQMA 4IHQA 3CZRA 4K9KA 3LCUA 2ZVQX 4UCXA 2BI4A 1U98A 1UAGA 1LBSA 1L5GB 3H2IA 3RRMA 2Y0BA 3T7SA 2C7RA 3Q98A 4JX8A 2D2VA 2JANA 5B3KA 1P1KA 2DE0X 3LQ1A 5HNKA 4XJXA 3GJ3A 4QBIA 2CT8A 3H8WA 1O5OA 3EMKA 4P3XA 1LVGA 3I32A 5AW9A 3O90A 1R0YA 1XVVA 2Z8XA 2C4NA 3GT4A 3LX5A 2L0XA 2GYWA 4BP1A 2G36A 4LHVA 2BFEA 3D4OA 3A26A 2XWQA 2XUKA 4G85A 4WZBB 5K1ZA 2QGZA 4Y7CA 5T5QA 4MVJP 2BHNA 4I4TA 3EXEA 3RM3A 1N75A 2DX7A 4OHYA 4BMDA 1IOWA 1D9XA 2IEBA 2NZUG 3GGPA 5F7XA 4GC5A 2QUHA 1T91A 1RZRA 3GJXC 3E9ZA 3MHTA 2FW8A 2PL3A 5KJ6A 1E7SA 2HHLA 4WQMA 4KQCA 4I8DA 5F12A 3EIXA 2QSZA 4N9QA 1U63A 5K2OA 4DR6B 3G3EA 2VF5X 2J4FA 3SS7X 4MS1B 1JF8A 4X20B 1OHHD 4HH0A 4B3RB 1C9EA 3PXCX 3VSBA 4OOEA 2Z8YM 1OLSB 1G21A 2EBWA 1GZ3A 2EL7A 3I0NA 4HNAB 1PQ4A 1EFRD 2VWQA 2QJWA 3PHJA 1DV2A 4HO1X 4CG2A 1RYEA 1M54A 2FZCA 1J9ZA 4S1WA 3G68A 4J2HA 1YIOA 3IMCA 4LJKA 1QS0B 4L27A 5I9TA 4ENRA 2IKSA 4HSEA 4X00A 1YKGA 4BO4A 4QNMA 1KKUA 2OYRA 3LECA 4EHBA 1E2IA 4NK4A 4PTYA 4LXYA 1U9ZA 3UJ3X 3N7UA 2ZM6B 3EEYA 4WASA 3HADA 5F2KA 2VIIA 1VPTA 2GGSA 1GPKA 3QU7A 4FTWA 3TBHA 1NVFA 3ORRA 3VFDA 2ACVA 3NHPA 4IDEA 5COQA 2FWIA 2B1RA 3LE8A 5J2TB 3EWAA 1ZICA 3Q87B 1N1DA 3GFOA 1X42A 4D44A 3ICPA 1CHDA 4M0LA 8OHMA 1BTOA 5IJWA 2F6RA 1LDNA 4UUAA 1JHDA 2YWRA 3E5NA 2V7EA 5TE9A 3IELA 4PQYA 3DLHA 5LQRA 1MORA 2VA9A 2CNWD 2WABA 4ZXFA 2NUTA 1YFLA 3VJMA 1ZVVA 3BHMA 1MNAA 1RYHA 2IE0A 2VXYA 2CD9A 3LYHA 4KSBA 2GK3A 5GJCA 5IBPA 4F12A 5BSKA 4HQ6A 1GAJA 3WIBA 3P71T 4E5VA 4O2AA 4ZANA 3NTXA 3FTFA 3LC2O 3WB2A 5T4HA 2JARA 3L6OO 1E2PA 1RAAA 4CTMA 2M6RA 2X58A 1JSRA 3F4KA 5CA1A 3BL8A 4RDCA 4RY9A 1GYPA 2ICAA 4L5YA 2H06A 4U6QA 3AEZA 1K66A 4I36A 5B2ZA 5I7AA 5HQ3A 3OAAD 3EC1A 3FF4A 3ER9A 4RMIA 5CIWA 3F9RA 1TMOA 3PFKA 1P33A 3FVTA 1I30A 3PRHA 1C1XB 4NR0A 4PGHA 3UV3A 4FILA 3KKQA 2JAXA 2QQEA 3AERB 3AGQA 1JJFA 2HHHB 4QTTB 2FMIA 2PZLA 5CIYA 4MDFA 3FZGA 3E53A 4H3SA 4L8FA 1U28A 3FCYA 5AHKA 2C5GA 1WUIS 2YWJA 2JASA 5H70A 3BX1A 3RVOA 5ALWA 2WT4A 1ZSNA 2FU5C 1NWCA 3RRJA 2B6HA 1YZNA 1PGQA 2HBRA 4MRAA 5F9HA 1RM4A 1XN1A 2WU3A 1JSCA 1ORHA 1PK8A 5DGIA 2QXYA 1U2QA 2WVAA 2D1SA 2X2OA 1R6AA 1TFUA 1KYYA 2NV0A 3DTNA 1N1MA 5MFZA 1U3FA 1PJSA 2HCRA 4DCOA 1UKAA 4MSUA 3HLYA 3GGGA 4C6HA 3QLUA 2DY1A 1ZIOA 4X1YA 4ACAA 3IQFA 3U44A 1FJHA 1ZD1A 3TI9A 1G59A 1L5HB 2OZPA 2I55A 5ALIA 2DPLA 1BRTA 3BMNA 4ZU3A 2F3TA 4DEVA 2CF6A 2HQSA 2Q1XA 4DG8A 1YQUA 3KLBA 4M55A 3HGQA 5KZMB 2D3TA 2FFAA 4RSMA 1DTWA 3T52A 4L8YA 4L57A 4XDGA 2C29D 1AD2A 3L9WA 2O2EA 5LZ7A 2R8OA 1J39A 3VVCA 3WRYC 5A5GA 5BV1A 3BXZA 5LQMA 1GCGA 1U0OC 4GOJA 1JPVA 1GY8A 3PR3A 1WPGA 2QUZA 3GLKA 2G77B 1A95A 5HFJA 1DJPA 3U17A 3CVJA 1ECPA 3LYLA 1NMYA 2BM0A 5DNAA 3W34A 1R64A 4C1BA 1PCXA 5IKOA 1TM1E 3EA0A 1IE3A 3KOUA 1FB5A 1HOXA 1XZIA 2PEZA 2X1VA 4ZYVA 3DR5A 2XMPA 4OF4A 1AXRA 2NUAA 3CF6R 3KUCA 4MV3A 3SF0A 2K2WA 2WWXA 1ZOSA 1SIBE 4Q19A 4J91A 4UTXA 5TY0A 3TQRA 4EVSA 3IT0A 4IOKA 3N28A 4XCVA 4W1PA 2PYDA 2PZJA 1NDQA 3PFGA 3PNOA 4URUR 2BIFA 1A50B 3H18A 1FDSA 1HZZA 2PS3A 2VN8A 1H3NA 3KS9A 3TLMA 2VG8A 3TX2A 1FU7A 1HDZA 1W73A 1ECGA 1WBJB 1T9AA 2HGZA 5ENDA 3RVDA 5A1JA 1M9NA 5IHPA 1GFIA 3P9CA 4JL6A 5ADWA 5JSUA 3BORA 1OASA 3LBNA 3VZRA 1W88B 2HZBA 1F17A 1UDXA 1O87A 4HQKA 4TLMB 4M0KA 3NAGA 5JNSA 2X77A 3PGMA 1I3OA 2OV6A 1VZ2A 3G5LA 3EG9B 4KUHA 2XCLA 3PR1A 3URMA 5L6MB 1E79D 1U7PA 2YVKA 4AB1A 5FOUA 5CEEA 1O0BA 3WRVA 4U1RA 1GZ7A 2WOJA 5BSUA 3QK7A 3OQBA 1XLTC 2PPVA 5K03A 1DC3A 2J4DA 1XZMA 3KEFA 3O82A 3QKUA 3RE1A 4MWGA 1LPOA 3L7YA 1HH4A 1U7TA 4IMPA 2QMOA 4O2AF 1T29A 4PS0A 2RBGA 5K0LA 5HOQA 3ZU6A 1O54A 3PIDA 4NHEA 3ICVA 3H99A 3JPYA 4CIXA 4DFDA 1EG7A 3E0QA 3OZTA 4RA6B 1IJFA 4G97A 2BAGA 1TM4E 1N5KA 4WNAA 1WG8A 1ZCBA 2WMYA 3FUVA 3OEYA 2R11A 1ZIYA 2QX6A 2GVZC 1QR6A 4N5NA 1JSZA 3RSOA 1GG9A 3WQSB 1DWQA 4JOCA 1ZK1A 5FQNA 2TMGA 2CBXA 3RUEA 3UGTA 4G0WA 2IYRA 5HVNA 2XA9A 5IXSA 4AY6A 1P4SA 1W48A 1ZMTA 2B4KA 3HB4X 3KJNA 1TYZA 2EV9A 1X3LA 5FR2A 3ZD8A 4BTEA 5CB8A 5IS2A 2ZUTA 3MRXA 5JZ9A 1SUAA 3ZIDA 4H18A 2XRFA 3B70A 3I6QA 5JD4A 1XCPA 1WPXA 2EX4A 2R85A 3CCBA 3CS3A 1U1EA 1Y3DE 1P2TA 2Z2IA 2VF8A 3DLCA 3BQNB 3ZV7A 5HKKA 4IX1A 1A7AA 2FP3A 2NYVA 4RD3A 4W5HA 2WFLA 1Q11A 1JU3A 4KRGA 4OHRA 3K1AA 1ADGA 3HI4A 3HWWA 3WGHA 3UBTA 2XNDD 4ARAA 3HM9A 1Z3CA 3S2GA 1KORA 1SG6A 4MVJH 2Z3WA 2A78A 1V25A 2C5HA 3GJ7A 5FOVA 5CEJA 1JFFA 3LSYA 4BB6A 1HZZC 1L4HA 3ED1A 9LDBA 2LD4A 5HMMA 3AYXB 1U94A 2QAIA 4UAUA 2IYFA 4X93A 5K3EA 4YP1A 4W1QA 4DT1A 1N2HA 4DQUA 3OZWA 3D0QA 1A1VA 1C0KA 1MIOB 1MGOA 1WKBA 2ZULA 2ES4A 3NYRA 3OQOA 2C5EA 3G8BA 1QBKC 4PGMA 4E2YA 4HUTA 3PFFA 5JD6A 3CIOA 1ZJ5A 4J7CA 2EDAA 1E5LA 1GUYA 2TYSB 3NWOA 4KQMA 1PT5A 4YPOA 1OXTA 3UTCA 2QI9C 4Q6WA 3KOZA 1ONNA 3V80A 1PNOA 3K8QA 4GLBA 1NNLA 4GOKA 3DL7A 2C78A 1T4CA 3P9YA 4G25A 2I7CA 5JMWA 2NPOA 5C31A 2FSIA 3EFOB 5CLQA 3K1JA 4P08A 1A0OA 5EESA 1HR0B 1Y8QA 2CFSA 2XJ4A 4IJVA 4BVJA 2PY6A 4LJ7A 4C7OB 2YFHA 1I10A 4NZZA 4PYMA 4KN6A 3CWCA 2IH5A 1FDOA 2NSHA 4CKWB 4EPYA 3A2KA 3EWSA 5SICE 1PQYA 3PRYA 1ZI6A 4OIMA 2M32A 2QJTA 4DSOA 1JR6A 3QW2A 2DCMA 2ONZA 4OSOA 1DV1A 4UHJA 2XITA 3SNKA 4JYZA 3O1IC 1PR1A 1DCMA 3DV9A 1IUPA 4QXPA 3ZDDA 1NBEA 1S9HA 2GCPA 2Q28A 3TNJA 2NWQA 4FFNA 3DUWA 4RYDA 4Q05A 1VBFA 3SE0A 5HIKA 2ZCJA 2MR5A 1FYWA 3VKUA 3T54A 3ZWPA 3KPVA 2GFIA 4K88A 3B5JA 2CBGA 1CP3A 1OX4B 4LTDA 3UBMA 3P32A 4OXQA 3U7IA 4P7KA 4YJKA 1PQWA 1XXLA 1N5OX 2EQAA 1ZUIA 4RIEA 1NU6A 5JANA 5I4IA 1QK4A 4E7OA 4LF9B 4MHOA 2HMYB 3A3OA 4GYYA 3W3AA 5B1DA 2AC7A 4Y8VA 1A27A 3TKAA 3QQPA 1XWFA 3X1KA 1PJLA 4JT2A 4MVJI 3ZX4A 5C5CA 4X1IA 3L8YA 1DQZA 2IHBA 3PKZA 3SSAA 4TTVA 3TGPA 1GSOA 1M2OA 4L9WA 1QCYA 2P2ZA 3H5LA 4MUNA 4N5IX 4ZYLA 2UYCA 4R5HA 5EJ4A 4JIMA 1WSAA 1TZCA 4LVCA 2VT2A 3EC7A 2ZSFA 1C81A 3PFNA 2W2KA 3O8LA 1N2CA 4AJEA 3ZWWA 1A9OA 4Z3KA 4EHKA 1UT6A 2VYFA 4LV5B 4YUWA 1ENPA 2W6IA 4RD1A 3TD6A 3I28A 5AW3A 1OFGA 4INOA 4L5CA 4DYHA 2YW9A 3LHIA 3MINA 4LBZA 4GG1A 3C7DB 3BDAA 1PYDA 2XGGA 1OLSA 3E61A 5IJXA 3CVUA 4Q00A 4WUVA 1SUIA 5DWVA 1WXXA 5A7HA 4DEYA 5DNEA 1U3GA 3AV0B 2X19A 2P9YA 1CUFA 1NUUA 1RYZA 2AZTA 3QPVA 2BE9A 3VPHA 4JQZA 5TPWB 3UPTA 4LJYA 5EAIA 4NBSA 1VYUA 3NGMA 1U7ZA 2ZRQA 4YDRA 3F5FA 1M1UA 4MV6A 2JCYA 3DZBA 5CX4A 4ZYWA 4J0QA 3ORYA 3L77A 1T13A 3FX2A 3GFRA 2YXLA 3FFXA 4RAOA 2P9FA 3QEBZ 2ZYTX 1P1RA 3I09A 2ZE6A 3MCAA 3DMNA 4KODA 1AQIA 1D1PA 2R7AA 2DFTA 2RI6A 2DG2A 3M1IA 3W5VA 4DTCA 1WZ2A 4GKKB 2ANCA 2Q21A 4M36A 4OX9Y 4L0MA 1EVJA 3C1AA 4KW7A 1PK9A 4XCXA 1DELA 2M98A 2EFHB 1KSFX 1G16A 3FF1A 3CIFA 3P9ZA 3V00A 4CEHA 3WGYA 1GN8A 1L7QA 2P6UA 4J1SA 3FAZA 4QPNA 2OLKA 1FNNA 1FUEA 1QWSA 2ODPA 3O4VA 2IDMA 3TLYA 4UBIA 4H7DA 2XMGA 1C14A 2PVPA 4H1UA 1Z0DA 2F9MA 1K0UA 2CYBA 1ZBDA 2D0PB 5TXGA 3JCZA 2JGKA 1SXJB 2QZSA 5AJXA 1Z4NA 1T1EA 1T25A 3FB4A 5EVCA 5KINB 1EX7A 4P7JA 3B1JA 3BD6A 4J4TA 2EEZA 4NL4H 3G9TA 4FMCB 5CYPA 1X1CA 3IJRA 3JXEA 4N40A 3ECAA 2VSXA 3NDJA 4ZI7A 3THYB 3T7TA 1QPGA 1L5NA 4ND3A 1K5HA 1JXOA 1E6LA 1R8XA 2ZRBA 3AWIA 3M8KA 2IS1A 2HM7A 4W5JA 4A6DA 1OGIA 5DBGA 5ARCA 1IAVA 3NWPA 1KMHA 3I62A 4FR0A 4MNTA 4TKVA 6REQA 1JJAA 1Z6PA 1UOEA 2ACWA 1SG0A 2BR3A 3C48A 3Q7RA 4PX9A 2PUEA 1UEXC 4LC9A 5JXWA 2EKDA 2CZGA 2ASEA 2O2YA 2BFFB 2Q5QA 4AZSA 4DMUB 2BFBA 4E31A 4YK7A 3CN9A 4ZA2A 2K6GA 3GVIA 2GEFA 3B3QA 4Y0VA 2GB4A 1C3VA 1ZWLA 4MUEA 2PMDA 3W1EA 4BIMA 1OI3A 2XYPA 1Y5LA 4XYEA 5FO0A 3VGPA 4RETA 2QW1A 3NEAA 4MDYA 3ZN2A 1DCKA 4HF7A 3SX4A 4B2YA 2ESRA 3Q0TA 5TSDA 1DFGA 1GN9A 4WNCA 4ZYZA 1A5SB 3DZHA 3SKVA 1AMNA 3QUBA 4G5RA 2IZ6A 3DQQA 3G6WA 4XTRA 5AUNB 1HYQA 5TQVA 2BGGA 4U39A 5JTUA 2BZSA 2IOYA 2K5UA 1M1YB 2WTMA 5IUJC 1J33A 2FWJA 3TLGB 1FRFS 4ZOEA 4INZA 4O1IA 1P74A 2FZEA 3OIWA 3QKRA 2ZJAA 4MVJG 2ZSEA 4YC7A 3VR3A 4B6QA 1XROA 5B6PA 1LTKA 4CIYA 5B55A 1VTKA 1XSEA 1JI3A 4C03A 1HBJA 2H57A 5AJUA 3E15A 3DMPA 4OPMA 3CR7A 3LTEA 1MTZA 4CM3A 3X43A 4BP3A 1XAIA 5HF6A 2M6LA 4DLBA 2XODA 3L06A 1HSOA 5I45A 4B2PA 2PZGA 4I1OA 3IJ5A 3PI7A 1KBZA 3UFXB 4Q3BA 4NMXB 3L6EA 3TTTA 4E5YA 4DF3A 1NX6A 3AUJB 2ISCA 3ZKAA 2XT9A 5GPBA 3UUEA 3CM0A 2VQ6A 2PX4A 4CLXA 5TJHA 2PGLA 4DM3A 1BKDR 1PHPA 3RYFB 1QRAA 3WDMA 3ZI0A 3VHRA 2A33A 4X41A 2RIPA 1NLMA 1W44A 2F3QA 2YXEA 4EB3A 5HX7A 4Q5IA 1OI7A 1G98A 1Z4OA 1WAMA 5E6UA 3E9MA 3IBGA 4XVUA 4BBAA 3OZUA 2TRSB 1UPAA 2R00C 3E18A 4MPRA 2ZYGA 4NVRA 2C5AA 1RWVA 2GUWA 3DEYX 3IOEA 4M83A 4U63A 1LK5A 4GL2A 4ARBA 3NCTA 3AVVA 3OUTA 2VJKA 1JHQA 2XD4A 3A70A 4Y2TA 4O4IF 3MOIA 3ZY2A 1K7FB 1KK0A 3VKWA 2OENG 3QJYA 1V4NA 1YZFA 2B0CA 2WF9A 1YQ9A 4ZICA 3W5SA 2QP3A 1BMQA 2JRLA 3PXXA 4QASA 1KDOA 1JEQB 1VGRA 1IK4A 2VEDA 1FPQA 3I0MA 1LV7A 3KALA 5DLYA 3DAPA 3SN6A 2O3TA 5KBYA 4Y2YA 2G63A 1P4AA 2PDAA 2FA9A 5ITZA 3JW8A 5CT6A 4YRGA 2YZ7A 3PUJA 3HJCA 4MIEA 4XIFA 1KYXA 2FLKA 5B64A 4NEHB 2G83A 2NZ8A 4TTJA 2FP4A 3EPRA 4CCYB 2IOFA 4J76A 1SG9A 4TVBA 1KO4A 1UKBA 1II8B 2IF0A 2AI3A 1T2FA 1VIVA 2ONCA 3AJAA 1YO6A 4REQA 5JCXA 5CA0B 1LXCA 1UXGA 3JQAA 2ECKA 2BGLA 2GD0A 5EEHA 1EUZA 1E3JA 1E2UA 2IF2A 2PRZA 2Q1UA 3AU8A 4LHEA 4OQEA 5HQJA 1CZRA 5JJLA 3RS3A 1SCBA 2CEAA 4CEIA 1E2LA 1J5EB 2H92A 4DJ5X 1YS6A 4CI0B 3B9BA 1PTKA 1QOPB 3VBCA 4ESHA 4CEIB 2R9VA 2CLIB 2JGDB 1AXGA 2OOKA 1OYOA 2VHYA 3CMMA 5BOSB 1FE8A 2NLOA 3IP6A 4EZIA 1EBBA 4FHFA 3L7LA 2G1UA 3QUTA 4Y6PA 2ID4A 1O94D 3UCFA 4DLKA 2QIPA 2CV1A 3MUNA 2PUGA 2YVAA 3WLNA 2VYQA 1Z25A 2GDZA 4P84A 3SBEA 4KR3A 2XIJA 3IP8A 3F7MA 1WDKA 4E3WA 3WK5A 1KQFA 2L42A 2IZ0A 4CJXA 3L6UA 1TK9A 1RRVA 3IQWA 1JZQA 1R9GA 1H5QA 1QTNA 5E9JA 3MJHA 4CHTA 2BHSA 1K8YB 2YV1A 2VWPA 1VJ1A 2I4LA 3L0DA 4J9UE 4HGZA 4XX0B 4BO5A 5JD5A 4Y1RA 4PZAA 4UHCA 3S40A 3VPGA 5ALFA 1V4VA 2WVHA 2NSJA 4IXNA 2XECA 1VCOA 3BXFA 4MR7B 1TK3A 1OYYA 4JLBA 1KQGA 2F90A 2I6GA 1QVWA 1DRJA 4F97A 5B4UA 4OGGA 1U7DA 1Y98A 2JGJA 3L7IA 2WTXA 3C8ZA 4AK9A 1OB5A 2VQ3A 3HH8A 3C5EA 4E03A 1ETUA 4GX1A 2PL5A 4UHDA 5DEOA 3ZKWB 4AN1A 5JQGF 4X6XA 5KQPA 1NJFA 3QVTA 2BD0A 3CSSA 3MJDA 4WDRA 2VHVA 4NPHA 5T64A 5JPCA 1N8TA 4HLDA 4YCJA 4RTKA 2NP6A 13PKA 1SK8A 4MDHA 1TC2A 2ZKIA 2B1QA 3LQQA 2Q9UA 1LQ2A 4NOMA 2O52A 2WY2D 1XPOA 3Q7IA 4IWYA 3VYSB 4F6CA 3X1MA 2CNKA 2I34A 2XRZA 1FXUA 4DNXA 2Z56A 3HYCA 4LYDA 3FJOA 3KZXA 1NBME 2O20A 1ZSVA 2C5BA 4FSHA 2JGFA 4O02B 1H6CA 4I2NA 1FXSA 1T0JB 1KZHA 1CUCA 1OFUA 2XKAA 1NRJB 1JVNA 4KV7A 4W8OA 2MSNA 3NWJA 3OE1A 1XTKA 1Y5NA 5E0OA 1YL7A 3T5CA 1GGNA 4C0SA 4Q1DA 3S5UA 4CKWA 1NVGA 2GI4A 1GUFA 1ZK4A 2QVYX 2ZW9A 3FPJA 3RU7A 4B45A 4BKRA 2ZAMA 3TR0A 4TL6A 2RHJA 4D2IA 4DWOA 1QIJA 1SUDA 2VLBA 2VUIB 1YOVB 1OXVA 2WSIA 2XOKD 4YN3A 4ZV9A 4KXNA 2QOEA 3LQFA 4TROA 1D4FA 4HDNB 1FRZA 1Z0ZA 1TYBE 1SXQA 3VNUA 1NVMB 2WG2A 3H2KA 3LX4A 2V7QA 1VSTA 4EW1A 2BSXA 2GTHA 1LNSA 1YAHA 3HA3A 4WY2A 4X54A 3QM1A 1N57A 4RH0A 2QD4A 5HPYB 4XRRA 3KFLA 1M2FA 4KB5A 5IF3A 1HEYA 1XB2A 2XMQA 2R66A 1JA1A 2JLAA 1NRIA 2G25A 3IR7A 4ATNA 4UTNA 3ZGYA 1CNMA 4YJHB 1TUEA 1DX4A 2C96A 3P0IA 1TTQB 2SCUB 4HWGA 5A3RA 1ZS9A 4EELA 2WIFA 1K8XB 3U4IA 2WT8A 3L40A 4HLUA 5E4YA 1T15A 3AM3A 3ZS9A 1N6KA 3RSZA 1XXHB 4F91B 3WDKA 3DBRB 4BVHA 5DBHX 3U7RA 4MRMB 1L4BA 5KS2A 1PYGA 2VT3A 4ZU6X 1R12A 4R7GA 1GRQA 3F7TA 3T9FA 4G37A 1D2MA 2D13A 2HV9A 5G1NA 4EBBA 2QGFA 4B31A 1Y1TA 4MS3B 3CVYA 2WWIA 2RC6A 5AICA 2H07A 5DE3A 4UD2A 5IVKA 1VI6A 3AEQA 5A3VA 1VQ1A 1XG5A 1E1CB 1VBKA 2JIZA 1L5FA 2GESA 3IVMA 4RWEA 4ZVSA 3VDQA 5JISA 3HP4A 3HO1A 3C15C 2KBEA 3DR3A 2QW0X 4HN9A 3EXHC 1XCLA 5K0TA 1F06A 2QSJA 2FZLA 4PO3X 1WCV1 1K9VF 3GLTA 4RK7A 4IGEA 1EFVB 1SIWA 1ZK3A 2G71A 2G80A 2RH9B 2XYRA 2YJ5A 1ZYUA 3KXPA 3TW8B 3UFBA 3HFGA 4MUGA 4YONB 4K1XA 3T9EA 3HJFA 1UXJA 1KVQA 3LCMA 4QUAA 4URVR 3WNQA 3VAAA 5H3CA 3UTDA 2GN2A 4PRKA 4E2ZA 2I78A 5J58A 4C29A 3FGNA 3EQZA 1UBHS 1KEEA 1WTAA 2WILA 1E9FA 1XZDA 2Y68A 2YWCA 2FEWB 5LMNB 4DMCA 4IQ8A 1N6LA 2EQBA 4JR1A 3ZE9A 3M82A 4OFWA 2GILA 1JJBA 3V1NA 1R4ZA 3L0CA 1SU6A 4JUAA 3QNMA 1QRDA 5B58C 4LWZA 3MCVA 4OA5A 3L5KA 1G3RA 2WF6A 5IMBA 3LHDA 2O8VA 3N74A 3G9ZA 3WAKA 3TFQA 3DOFA 2A4KA 2IP4A 4ZK6A 3FBWA 5IAGA 4P36A 4A2PA 1JEJA 1KA9H 3GLSA 3TJRA 1QB7A 2OO5A 2C84A 5AWFC 4CG3A 4E6PA 3W04A 3M6MD 1RVV1 4JELA 2Y4NA 3MT7A 5EYPB 3V97A 2HK9A 2VSQA 3FHCB 3R6GA 1DQPA 3QE9Y 4BB0A 3BWXA 5HILA 3U37A 2XB2A 1EX9A 4MUHA 1DQYA 4ODIA 4ZO6A 1OWMA 2PCLA 2MSWA 4CL3A 3CGGA 1ZY2A 4P5EA 1RFGE 4V24A 3PA6A 1K97A 4ZYTA 5I9LA 1W9HA 1X1QA 1WUKS 4YS6A 3QXHA 1DKMA 4D0LB 4TX1A 1AV7A 3AIOA 4CLRB 2W22A 3IQHX 1Z2NX 1QHIA 4L08A 1MAAA 5B1SA 4ZIRA 4L2IB 5AUQA 1E2DA 2OBXA 3LYAA 4U2DA 5D85A 1L7XA 4PCUA 4DDVA 2YQ5A 4NMHA 2H2IA 4UE2A 3HMQA 4XLTA 4RTRA 1RJDA 3EGXA 3N0WA 2D00A 3ET4A 5AJZA 1BS1A 4BFWA 5IWCA 2X3UA 3BB4A 1P5FA 3JVIA 3KAPA 2P1RA 5U4XA 4BB9A 1IAQA 3D4NA 2QTHA 4RQUA 1MEEA 1HTTA 5CFNA 2VNJA 1RJWA 3Q5DA 4PHTA 2H85A 5JAPA 1GZSA 4OXNA 3UV6A 4XYMA 3C3KA 5AVSA 1J2UA 2QHXA 3GK3A 2X5NA 5KJCA 5AI6A 1V7ZA 3AB8A 1UANA 3ZJ5A 4CCSA 1MH1A 1N2JA 2R62A 2O2HA 1UJNA 3BGWA 1RLOA 3PNQA 4JP5A 3STUA 4BKPA 2V6GA 5HQ3B 1NUPA 3OA2A 1TGYA 5I3CA 3WI7A 5DVZA 3FR8A 4MPTA 2BJVA 3A0UA 4LRQA 3LM8A 1VPWA 4HDOB 2JAWA 3WE7A 2PD4A 3B7PA 5K2MA 1DC7A 2PK3A 3FOCA 3DOHA 3EZLA 4JZKA 4P86A 5DF1A 4IGAA 4KQJA 3UMRA 1M1YA 2M6SA 1A76A 1D5CA 2WTAA 3GH1A 2BLNA 1KWKA 5B3LA 4O25A 2XZLA 3SDZA 4U9HS 1U5BB 1U9IA 1GQYA 3MG9A 2RIRA 1THZA 2G9VA 3G5TA 4O1HA 2X0IA 2YC2C 1GKLA 5THQA 3COYA 3RW9A 5IDXA 2OXIA 2C98A 2HRCA 2V3VA 2DFPA 1U80A 2CHUA 3PP8A 3UT0A 3ZGOA 5HJEA 2BGJA 4JUFA 4JJZA 1FXWF 3ASZA 2Q3LA 3G17A 3LFHA 3MTDA 4LRTB 3VZSA 4LBWA 5DGXA 4DLSA 4JI2B 3NYQA 3LPAA 4Z1OA 2JCGA 1FNCA 3OT1A 1NIPA 3R0VA 3OEWA 4P4UA 4OL9A 2O2XA 3R7WB 3GVCA 5KSYA 4DWWA 4MWOA 2AX3A 1H0KA 1WZUA 4DV0B 1DKQA 1DUSA 1NW7A 2RHTA 4L6CA 2JLZA 5FUWA 2D5CA 4J0IA 5KJEA 1W94A 4G41A 1BE8A 4PPFA 2CE2X 2Z8YA 1EUCA 3BB1A 1NV9A 3QVUA 3KZKA 1SUWA 1QV9A 2ZWMA 5ALLA 2HF9A 1ODSA 2O8FA 2QUAA 2XCUA 1P4GA 4MEAA 4WCFB 5INTA 3I2KA 3SC2B 1MVOA 1XRSB 1XZHA 4PQGA 5K8JB 5EQFA 2BP7A 2L19A 1XRQA 9GPBA 1K6JA 3JARB 4NQZA 1QGAA 5CDTA 2HLHA 1PU2A 1II9A 1H6BA 2ZBGA 2XZDA 5KNCH 1QQ5A 3S1LA 1IN6A 4U6NA 1BKYA 1NASA 2ECQA 1OROA 1VL6A 3EDMA 4K9OA 3JD4A 2VK8A 1QG6A 1TCVA 2EC5A 2H4WA 1YRHA 5C3UA 4I6EA 4C5CA 1I2BA 4G8BA 1NPTO 4U9UA 1FVFA 2QM3A 4BWFB 4TTSA 2H3HA 2ZBEA 1MZPA 4MUMA 1TAQA 4N7BA 1C5KA 1RU3A 2B94A 3CLRC 4QWMA 1FLDA 2IQIA 3EIWA 3KDAA 1WQ4A 4MKGA 4KIWA 4CMEA 2PSJA 4KQWA 5DHRA 4CLRA 4EB0A 2VTKA 3VNRA 1S2NA 1NW9B 4W7HA 3BCRA 1SQ0A 5FEMA 3DDOA 1LLQA 3TPCA 3W9BA 5J23A 1N0IA 2F1KA 2PRJA 1G7TA 4Y2JA 4MIYA 4NY1A 3DXZA 1ZEMA 3JQEA 3QOFA 3X1YA 1W52X 1FX1A 2VRCA 3NFRA 5ES3A 2W6ID 4D9GA 4BGDA 1I3KA 5EG5A 2HSGA 1XEXA 4DCMA 5B36A 1CUEA 2R8EA 3R20A 3S1AA 1WBBA 1J8YF 3NTQA 4ILKA 4WAUA 1UMCB 4EPWA 3BDIA 2IELA 3QBDA 4CKCA 2BMWA 1DRUA 2JJYA 2UZ0A 3BOSA 2O1SA 1WMBA 4P7FA 4IQFA 4UOEA 1W19A 2GCEA 5IBCA 4A92A 1A2QA 2J5XA 2HI0A 2L2QA 3ABQB 3QFRA 2JHAA 3V1MA 5EPOA 1NFRA 2FSSA 2H2HA 3WNVA 5IULC 5E0KB 5LNK1 4B7CA 3QY9A 5PNTA 2JDID 1SQ5A 1QYCA 2KI5A 1G5HA 2JI6A 3EGOA 3DDWA 1MA3A 3EW9A 3GMIA 1RZRD 3K0HA 4D57A 2LR0A 3O1HB 1E5VA 4RMHA 5IJ0B 1EXDA 2GS9A 3PHCA 3CTPA 4JT8A 1BA3A 1P18A 4MS4A 1GAEO 2BTQA 1F4PA 2A7XA 2QUKA 4QVKA 4ZWNA 3EJWA 3FVRA 4LZLA 5B1IA 1EVKA 5IUKC 4ZCMA 3I01A 5DKFA 1Q7BA 1TVKA 2FKAA 1C3XA 2FN7A 1RZ3A 1DMRA 3LBHA 3TNLA 4AWAA 3NJ4A 1NJSA 3TAXA 2FZ4A 4FOPA 1NPYA 4U2KA 4PYRA 4YNBA 3F4BA 3JRNA 3KVYA 1MOQA 2PUCA 1Z2EA 1KWGA 4YI5A 3PE4A 3SHOA 4JJ8A 3EAFA 3TBKA 1M66A 3EA4A 3PKJA 3QPBA 4F9FA 5G0WA 4YPVA 2QRZA 3LK7A 3W9UA 1P1FA 3H5IA 2V6BA 5LNK6 1I4DD 2PR2A 2FF7A 3P9SA 3QHAA 4ZJYA 3HDVA 2FRVA 4UEOA 2BGMA 2RB4A 1FNBA 4PXYA 1OTHA 4GSKA 5I7WA 2ATIA 3SJBA 3ZPXA 3RS8A 3KQKA 4Z99A 5DBFA 5JJCA 4HUQA 4MMYB 1QIGA 1FP7A 1YBAA 2JI7A 2ORIA 3FYHA 3E7XA 4YWJA 3GAAA 1Y9DA 1N3YA 3STXA 5JS1A 4BWYA 4NHOA 2LV8A 1FS4A 2A0UA 4N7MA 2DR3A 5BSTA 1CKEA 3MJEA 4J49A 2GHQA 5EZYB 3C5WP 1NXTA 2E4WA 2P4QA 2I3BA 5HRCA 4ZALA 5CAEB 1QFJA 4AMZA 4FWBA 1XZGA 4W1SA 5U1PA 3HBLA 3EPKA 5SZJA 2E4ZA 3IAS6 4C14A 1PNQA 4R1QA 2WUWE 4KC0A 3OIGA 3O91A 4LN1A 2PPLA 4UM9D 5CNKA 1C0EA 4CQMD 4LY3A 2QTNA 4UTZA 1RPZA 2VH5R 4P4GA 3FNIA 3ZWXA 4EFKA 5JSHA 1YFJA 3W77A 3B82A 1HYHA 3DWGA 3FLEA 2PX5A 3NQ41 3V1UA 2IYAA 4BGUA 4C6RA 3F90A 2VZ9A 3GNTA 3QW4B 1GRNA 4N0EA 4E5MA 4IGKA 2A9RA 3I04M 4IIBA 1HDEA 4BMCA 2E6UX 4UQLA 1ZP6A 4QJ3A 2N9UA 3FDJA 2G1AA 3BE6A 4RVGA 2I7DA 3K6KA 5KYWB 3FZYA 2FXIA 5DFAA 2UXDB 4IS2A 3RRNA 1OLXA 3MW8A 4EJSA 4EVQA 2UZ1B 4JCOA 4OYHA 2WYIA 4XXHA 4W8GA 2ZB2A 4R98A 4I5GA 3THSA 2ZYIA 5KU1A 1ILEA 2C20A 4R40A 2XUIA 1H9BA 3QU5A 2WHRA 4QPCA 1JDVA 4O3FA 2BFAA 2BF4A 2DFLA 2JJMA 2XE8A 4W9NC 4E5UA 5KTKA 1RABA 1JZTA 3GYBA 3Q5EA 4QBFA 1HC7A 1S8NA 1G8HA 2IPNA 3VZQA 4K5QA 4MQ6A 2DBQA 5C5DA 2YW2A 2RKWA 3NIWA 5TPWA 2FV8A 4IDOA 3K1YA 2JZOA 5ESXA 3TXYA 3N9IA 3WICA 1W2GA 4ZN6A 2QMZA 4XQ0A 5DP1A 3V2UA 2R68A 3MUFA 1U9YA 1XLVA 3M3DA 3A9WA 3ZJVA 2X9VA 1ONPA 1TM2A 4COOA 2G5CA 1NBAA 2A3NA 4DY4A 1DOAA 4AI6A 3CCCA 1PV4A 3GJ6A 2IHJA 4LCJA 1RI3A 3EF1A 2HIAA 1DG9A 3RK1A 4CN9A 2HRBA 2QI9F 3E8SA 2C07A 5AFSA 3EB9A 3FRHA 5THXA 2CHVA 4FMPA 3K9FC 3PNMA 1VJDA 4LY9A 1CY0A 4BNDA 1V8DA 3HBAA 3PC2A 3VSEA 3N7AA 3GQVA 2WPDA 1Q1AA 1OV4A 3ND7A 4U0KA 1DIOB 3GOQA 3IT3A 4B3FX 2B8TA 4JJFA 3MWEB 4NSNA 1Q1BA 4R2WA 3SQLA 4Q4AB 1V26A 5F98A 2Z0MA 2ZB3A 1TUBB 3IAXA 4RFVA 2HZ7A 1GG8A 1R8YA 2J3LA 3K9CA 2F59A 1KC1A 5KDDA 1RQXA 4TWAA 4WFQA 2E4XA 1T8PA 4M1EA 4YMIA 3N2GB 2HYIC 1N7HA 2V7PA 5AKJA 3V4LA 4DLNA 1ST2A 1WL8A 2BKVA 1JS1X 2DULA 2AJLI 1YQWA 4ZVOA 4M1QA 5I5GA 1AE1A 1T4BA 3MWGA 4JBYA 1NMEA 3G7SA 3MPUA 5ECYA 4QUDA 2O4UX 3WLMA 3B1ZA 1AQLA 4KH1A 3JQCA 4TV8B 3M70A 1V7PC 4MAAA 1W4LA 5C1OA 3D43A 4IP0A 2YQZA 2AOWA 1A8HA 2F67A 1L5VA 3M81A 5BORA 4D74A 5JSKA 5JH7A 3ABRB 3WAGA 4AY4A 5K5EA 2AEEA 2BEKA 3AV3A 4PR3A 4CZ2A 4EHLA 1E9CA 3QFFA 1KS2A 2AB0A 4F9GA 3BMOB 2Q46A 1YC2A 2F2TA 2H2AA 4QU5A 4CL2A 3PGJA 4KJZA 2ZSAA 3KU1A 1G0OA 2WR8A 4TYYA 2Y0DA 1MW8X 3G9QA 5HIJA 2Q2NA 3KPWA 1V6AA 4PYLA 3QEMA 3GLGE 3TDMA 4ZHQA 3NXSA 1T2VA 3VX3A 1KQOA 1WX1A 4PC3A 4E6EA 2PQ0A 2W4MA 1ZOOA 1E2JA 3S8MA 2BUBA 3MMZA 1PWYE 4N76A 1PBTA 4RBNA 2GHIA 2VPZA 3BVPA 4GM4A 2AK3A 3NB0A 4MRNA 3SQDA 4KXVA 1NKVA 2R0QC 1XTQA 1GFWA 5HKOA 5JSZA 3JD1A 1DDOA 4GKBA 4H2DA 2ZTVA 1ECJA 2AOTA 2HA6A 4IH9A 5GJVC 3EEFA 1L1FA 2HA0A 4N6NA 3KWLA 4CKBB 4OB7A 2OILA 3ANYB 3IKJA 1REQA 4M0PA 3BDVA 4EABA 1JHMA 1NXPA 4KYTA 4BNGA 3IJEB 2P9JA 2WEKA 2XE7A 3WLOA 4D3DA 1FYDA 4RVCA 3AI7A 2EX0A 4JWTA 3NHSA 5EZ6B 3FUWA 2B25A 3NOVA 3QKWA 3QTBA 4YCLA 2F43B 1Y34E 3UKJA 2JRCA 1KI8A 2DCUA 1GP2A 3LV8A 4DCVA 4ZU1X 3JSAA 4ER3A 1G8AA 1HE4A 3K1ZA 5MHTA 5FV4A 2P1DA 5KO2A 3H0CA 4RQAA 3VYWA 1M7HA 4H0NA 2YINC 2I29A 1QOZA 1LFDB 1JH8A 2JAPA 1D4ZA 1YRWA 3F5QA 1JXMA 4DCJA 2JKVA 4DTIA 1JR3D 3KUXA 1KXZA 3BT7A 4FC6A 4Z4IA 1E18A 4G1MB 3M4ZA 2BP7B 5AKGA 2ZUFA 4Q66C 1MO2A 4NC9A 4RKRA 3MT9A 1IHXA 2FLVA 2CSUA 4FP9A 3EX7C 4G0MA 2RHDA 4FBMA 2WHQA 5DPMA 2G9ZA 1VI2A 3UH0A 4C1NA 3ZU5A 2H31A 4LJ4A 4YR9A 3ADDA 3N8NA 4GNRA 1GAXA 2ZBPA 4X66B 2GCIA 3C7KA 3F9IA 2XNKA 4TVKA 5K05A 2R48A 5G3ZA 2BR4A 2NQTA 3GP8A 1MJGA 4ID3A 3GFTA 3LOUA 2K87A 4IEFB 4D3FA 4H59A 4C7XA 2GPNA 3KO8A 4W5NA 2CXRA 3AUAA 3L7AA 2OHIA 3DDCA 3ND9A 2ZUEA 1PN3A 1CUBA 4K9QA 4QQRA 4KN8A 4LGYA 4GZ5A 4QXRA 4EUHA 3HDYA 2SECE 4DSZA 1AKEA 5JS6A 1QRSA 1T4CB 1VIYA 5EIXA 3NC1C 3V8NA 1V48A 1QS0A 3VO8A 4WZAA 4GFDA 1HPLA 2XXBA 3LY5A 3QNWA 3DPUA 1UJ4A 4OYLA 1F60A 1PKEA 3BBPA 4KSYA 4CM7A 5EJ5A 4NJOA 4REOA 1J7JA 2AR9A 3OO1A 1IB6A 1D1TA 1MIOA 3KJZA 3VO2A 3D4PA 1KAMA 3GXBA 4JLKA 4PO1A 4YP6A 5LYJB 4PWYA 5SY9A 1LD3A 1T2UA 2YYYA 3EYWA 4O1MA 2M9MA 1QNLA 1CSEE 4QDUA 5HFAA 2IIPA 3PPWA 3I5YA 5JDCC 4HVCA 1J06A 1SC1A 1W4BA 1JE0A 4WVFA 2FQQA 2JLSA 3WIDA 1B16A 3WRXA 4LE0A 4V0RA 3ZY4A 4BPBA 2XW6A 2RGEA 4N6OA 5KWVA 1IUKA 1TQ6A 4YGXB 2VYCA 1RDFA 4DRXA 2ZZKA 1XCBA 2UAGA 2V4UA 4MJXA 4YO7A 3EXAA 3WL4A 5CB6A 1CR1A 4N49A 4XUDA 1ZWKA 3IUQA 4QOFA 1IPHA 3ROZA 3H3FA 3BS4A 1R0XA 2VUTA 2G09A 2FG7C 4ARUA 5CB4F 1KVRA 2WAOA 3FRJA 2X7JA 2F9LA 4MWZA 2WIBA 4KK3A 4PRYA 4X7RA 1KDYA 2AC4A 2IUUA 4EUSA 4TTQA 3T3OA 4B33A 1C1DB 4KE8A 4B5LA 5JMTA 3SKXA 1M2WA 4M89A 1KC3A 1JQEA 4CLHA 3EXEB 1RP1A 2J3MA 4TVOA 1ZJYA 3L0ZA 5JZVA 2O05A 2HY7A 5DHSA 4ARZA 1UPFA 2O8CA 1ZU5A 2HEIA 4FT4A 5LUAA 5C53B 2YN4A 3MT0A 1WVIA 1QX3A 3LRXA 4B3JA 3H5OA 4M54A 4CTKA 3HKBA 5JO9A 4AZWA 2OVFA 3EXHA 3M34A 2FF5A 3SYLA 3U4GA 1QGUA 2JD1A 1T9KA 2HIMA 4MVJD 2E5FA 3D7SA 3UB4A 1KY2A 2ZJ3A 1I94B 1Q0ZA 1EE2A 3C6KA 2H9YA 4PG8A 4HB0A 3HDHA 3NH6A 2DWUA 4F2HA 4UUOA 4M9SA 4R3UC 4G2NA 3BXGA 1UM9B 2XUQA 1EWTA 3DFMA 4PCVA 3R3XA 3ONDA 4S04A 3C0KA 1QH0A 3IV6A 3NTOA 5AW8A 1ZJWA 2RI0A 3TOVA 1E1NA 5G40A 3BWYA 1W2HA 5CCEA 1L4GA 3C3AA 1OF1A 3BJZA 5MN4A 1J0EA 1M6YA 3DGFC 2H1RA 3EGDA 1KQ3A 3O0TA 1PDVA 1G5IA 2ORED 2JEOA 4TTRA 4Y9DA 5JS8A 1E79A 2W2TA 2FK7A 4FXPA 4G4SP 2EOAA 2ENWA 3V4PB 3EMBA 4ZZIA 4D80A 2FB9A 1O4WA 5L4LA 5BV0A 3R41A 1BH6A 2IHKA 1VBMA 2V6FA 1LUAA 2FN4A 3NUZA 3AVXA 1Y4UA 4JMPA 4QBKA 3PXAA 3RS7A 4EVIA 4YECA 3D3WB 4HDSB 3OQJA 4F8YA 2ECPA 1NONA 2OM2A 2XUGA 1TT5A 1SCDA 4H7EA 4PTLA 2HXGA 5KWEA 4ABTA 1ZLXA 3GMSA 2CZCA 1OBFO 4U8HA 4CFYA 4HDMB 1NXOA 2DTEA 4C6TA 4OLBA 1T5DX 4ZDIA 2MDTA 2HNAA 5EGSA 2XGOA 3AHEA 1NNSA 1M0TA 1S5PA 1JSXA 4LJ6A 1E6MA 2CMDA 4DYVA 1U3VA 2D62A 4C6TB 3O0DA 4YXWA 4BZXA 4F6LA 1W0KA 1YB4A 1E1RA 1ORTA 4Q9LA 2Q8QA 1NUHA 3KD3A 2ILTA 3NEJA 4HWRA 2C8VA 1CYDA 4QGGA 1TW3A 1VCIA 4JASB 2OAQ1 4LYJA 5I9MA 2BKEA 4RVDA 2Z2YA 3VSDA 2I54A 2UVPA 1T3ZA 5ALZA 3UUWA 2AE1A 3RSQA 1J56A 3YASA 3BULA 5DLQC 2NG1A 1RAIA 1PT6A 4RHYA 4B85A 4YAWA 4LGMA 2CUNA 2JIOA 1FQWA 4UHHA 1ODLA 1NHWA 1UFQA 4C08A 1KFCB 1L1EA 1F1BA 2LCIA 4FYHA 3SZMA 5DLDA 2UYHA 1DIBA 4UMFA 3LX8A 3N2KA 1P1CA 1COZA 4JROA 3NAQA 4O2BA 2G9RA 5DTEA 5B3JA 1KEKA 4KR6A 1UMDA 3EZYA 5FBVB 1SU8A 1DC6A 3HJBA 5LPNA 2IEYA 4Q21A 1AS3A 1DEXA 4WZ6A 1UQUA 1C7QA 1SCNE 2VBGA 3FYUC 3LT1A 3OWHA 2X22A 1I32A 4I14A 4CLOB 5L9AA 4UUBA 1NR7A 1JFVA 3B6IA 1F48A 3OQHA 4WN9A 1HQKA 1KQPA 2R8BA 4ZV7A 2XQGA 1T5LA 3N5KA 2BJWA 3KHKA 4B3DA 3EULA 2B4YA 3O2SB 5B7PA 1HE3A 3CBGA 1RLJA 3H6KA 4NAHA 2X42A 1WW3A 2C3OA 2G4CA 3LPMA 5K3FA 3W2FA 4DLRA 4E2XA 1LW6E 3H8VA 2CLKB 6Q21A 1N2GA 1R00A 3MMPA 2I2CA 3VR5H 2GA9A 3A1SA 1S2LA 3K8YA 2O5VA 2OBYA 4BFXA 5DBIA 5FUYA 3RK0A 4BDSA 3PC6A 3N0TA 2GHTA 4CRWB 4TZ6A 1CY6A 5H3LA 2C9OA 3H16A 4FDMA 1A2OA 1JHAA 3QKTA 4U4AA 4HGQA 5T4FA 3SP1A 4JH0A 2QTVA 3W5JA 4C0WA 1GGVA 2WD7A 3A3PA 1N4DA 3AUFA 3K70C 1YAJA 4D9MA 1WV0A 3MTIA 1T0PA 3H9QA 1S89A 2YVQA 1Y4DE 4RLSA 4UNNA 2AYYA 1I6WA 4BBJA 4EIWA 2VRCD 3PQCA 3TX6A 2I2XB 1E6CA 1W96A 4BQEA 4LX8A 1A88A 2ZJ5A 4HPXB 4D4MA 2IUSA 3KK0A 2I1LA 4OMDA 5ALMA 3VBEA 5CITA 1OKKD 3E6AA 1AH2A 5HFNA 5LQJA 2J48A 3D8BA 1D6NA 1XTSA 2BUAA 1YNOA 2KWIA 3WJ7A 4CF4A 1JDBB 2P27A 3CF4G 3FCXA 4IWNA 1M2KA 1BFDA 1V1JA 5AOVA 4A7PA 5B1YA 3GZNA 1FMLA 4OQFA 4Q9JA 4B2IA 1VSVA 3HCAA 1VE9A 1EUDA 3VPSA 1SK9A 4KGXA 1RBQA 1UM8A 4OI1A 4ARSA 3PF8A 4LEIA 2CVPA 2CDNA 3BE8A 1E1LA 3GZNB 1ZEJA 1EVEA 1P7VA 2DBRA 1XV5A 1FFGA 3IIMA 4LF6B 1RWNA 4ZVNA 1WUYA 3ZHYA 3HCCA 4M9UA 2D0OB 1ZONA 1R27A 3SX0A 1NVWQ 4EKYA 5J4HA 2VUUA 3L8ZA 3PNVA 2CK3A 1V95A 4P38A 3ZUGA 4D41A 4U7DA 4ZAFA 3ZDXB 1QWOA 1V2HE 4GL4A 4IY1A 1CDDA 4PX5A 3U3JA 3DVQX 3WTBA 5BW8A 2H9IA 4FGJA 5L95A 3LWDA 2C9MA 4XD7A 3T1OA 3WB0A 1SUBA 3VA7A 2ZJFA 3N05A 2CV2A 2HW8A 1KEUA 3N2NA 1SEVA 3ZCQA 3KSBC 2HU8A 3D7LA 4RFSB 1K63A 4JXJA 3TZLA 1CZNA 3JVDA 3CH4B 3GJTA 3NHJA 3R5JA 1UUFA 4B79A 4XWWA 3OIDA 3AF1A 4YLEA 1NNEA 2SKDA 5KOHB 3MMSA 1H2FA 1NXSA 1RXYA 3W8EA 3KR2A 5E6RB 3U5ZB 3HS3A 5BN4B 3W06A 5KQRA 3VYVA 1J0XO 1YASA 4TLBA 4CFSA 3NHFA 1GA6A 5CA0A 2YQ4A 3I8XA 3E22A 3L82B 3QV1A 1XA0A 2WF8A 2ZYAA 4OGLA 3WL7A 1E0AA 3F2VA 5AXBA 5HP4A 1BWQA 1LZLA 1XUOA 2VNIA 4XPIA 2VT6A 3SSOA 3THRA 5KYVA 1VIDA 2FNAA 1R16A 3F47A 1SVWA 1LI4A 4G0NA 4KBGA 1UWLA 4X95A 3SXUB 2RKOA 4BE4A 3RVPA 2HRQA 4YASA 1CY1A 3DV0B 1JJIA 3HYRA 2Q0QA 4OJTA 3IP9A 1E7QA 5ICSA 1J5XA 1Q3KA 2ZYSA 4LJSA 4JB2A 1T26A 4PY2A 3EVAA 3VKVA 1Z5OA 1XQ1A 2Y76A 5KHAA 3ZCSA 4PNHA 2XTAA 1UEJA 3QVGB 4LDPA 4L0DA 4O33A 5FBRB 5K7SA 1E9SA 4E4YA 2EWWA 4OQQA 5ALSA 3NJ8A 1X19A 2C59A 7AT1A 1C9MA 2JCVA 3R0IA 1JAHA 4XB1A 3VR5A 1QHXA 3CPEA 4DSTA 3AC0A 1YVUA 4BEWA 2ZRIA 2W71A 2C2YA 2WJGA 4W1RA 4PLHA 1DKNA 3QIAA 1KVSA 3L8DA 3PTAA 2HA3A 2ZJBA 3PNPA 2HDHA 4FFBB 4DMKA 3GEBA 1N2CB 3QOWA 2FG5A 3MCTA 4LXIA 1J2RA 1DGQA 3HRKA 4LJ8A 5HRAA 1LFAA 3N5CA 1Y8QB 3QF4A 4K0RA 3CUSA 1N5DA 3B9PA 3S2FA 3VPXA 1LCIA 2YMQA 1U6IA 2RI1A 1E7WA 5LQNA 4FW8A 1NQTA 1Z16A 2D1YA 2HSEA 2PSEA 4R8SA 2ZFUA 4TOIA 4RGBA 3T9BA 1W76A 3RT1A 4EKIA 1YB6A 3RTDA 4BFLA 1OY1A 3I01M 4D8VA 1T1JA 3RYCA 1DZ3A 1OZFA 1V1MB 4L07A 1P6XA 3O9ZA 2HU5A 4OSPA 1EGQA 4OSEA 2I6UA 2JGEA 2ETXA 4ALIA 3R8XA 4UBNA 2ANBA 1XL1A 3QIVA 4LPSA 1YUMA 5F1KA 4ZI3A 3AVWA 4YHHB 1ESNA 4L4ZA 1BDMA 2CC2A 3IMKA 4MQ5A 5MGNA 5GJBA 3K9WA 4HNSA 1LSOA 5KEIA 4JU9A 2Q5IA 2GZAA 4CIWA 4QUGA 1JKMA 1GSAA 5FQOA 1JMVA 2GTIA 3IDSA 3UA4A 4WBNF 1BH2A 4OB8A 3LNCA 4L16A 2R6DA 3TLEA 4BAGA 4G4GA 5LJIA 2OAGA 2DHCA 2A9JA 3M1LA 5J2UA 1PTJC 1Q74A 1UBEA 1DPFA 1GAQA 1H2ZA 1HMYA 1K6MA 1WB6A 2HMSA 2RH8A 4EM6A 4C4AA 2WMOB 1XTBA 2XKKA 3D8UA 2RONA 1BW9A 3U1BA 2FSVA 1ONOA 1ZH6A 2ACKA 2BDUA 4HEQA 5B53A 3H9JA 1P9WA 2Y0CA 3ESBA 4ZCRA 2RHOA 2O50A 4M6WA 4EZEA 1UBNA 4F2DA 2ERXA 1ZGBA 4J9VA 2P3LA 4Z0PA 5LDHA 3KQUA 5KOHA 2H5EA 2OB2A 5LDGA 4OUKX 2P78A 2HUPA 2HFKA 2YIMA 3VH1A 1RAFA 4G5QA 3GY0A 2F3SA 1J6UA 1VL8A 1WOYA 2CUZA 3HO6A 2H52A 3T9DA 2BR5A 3L2OB 1VL2A 2DPGA 1GADO 3G0DA 4KPGA 2HA7A 4L4YA 3LCCA 1M0SA 1ATZA 4W99A 2R1ZA 1WP4A 3A2NA 5LXTF 2P7IA 3MT8A 4C21A 1SIUA 4DHEA 2A4MA 3MINB 2P9HA 2FEXA 3C6YA 1CC1S 3FWHA 3TDKA 4F3NA 5AOBA 5BQ3A 4DOMA 1VG9B 4QQNA 5CVUA 5ALKA 2FPKA 3J7TA 4FYYA 4HY3A 5ERGB 4ZKDA 3LU1A 3GGDA 4NE7A 5I7FA 3B1VA 3CKYA 3BE5A 3BSFA 1G0NA 4RKFA 1U8EA 1B3BA 2MYNA 3G79A 4G2TA 2GLXA 1FMTA 1T9HA 3K5HA 3H4VA 4FHZA 1XCMA 3IEIA 3N2EA 1PSZA 4YACA 3ZGZA 3FKSD 5GV8A 1KS9A 2O07A 4FEAA 5AW0A 4KR0A 3H05A 3QBJA 1QLJA 3SYTA 4NU0A 1CX9B 1R18A 1JDTA 2ZPUA 4CDGA 4GOLD 5KQMA 4CBVA 2YWFA 1WO8A 1CETA 1T8YA 3PFIA 4W6QA 4KE9A 3BSWA 4ENTA 1CR2A 4G1BA 4D1YA 4ZREA 1QH1B 1PHRA 1EUYA 4IIHA 2FPMA 1O6CA 3CC8A 1KEEB 3AQ4A 3PQ5A 1DOZA 2AA3A 3HJAA 3PZRA 4WLFA 5EJ6A 1SB9A 4NDZA 4R83A 4CV0A 4NPCA 2QM8A 1JW9B 3AXTA 1KP3A 1BGXT 1T2CA 5CYOA 2NU8B 1RNLA 1KZ1A 1V35A 2RK3A 2ENUA 4L3VA 1G5TA 4YJ3F 2IYLD 4KI0A 2LCQA 4BFSA 3QWHA 2VPTA 1GNVA 2WI8A 5HCIA 1OZHA 4GVPA 3I39X 3Q6IA 3U0BA 4DVGA 4MH0R 4PIPA 1ZD4A 3PEVA 5JNLA 1L7DA 4Q6BA 2XPCA 3O38A 4F2PA 4NCNA 4NJMB 3OLZA 4M1SA 2XF2A 1RQLA 2IV7A 5H3HA 4DSAA 4B35A 1F8GA 2WDPA 4EHDA 4PFJA 4GGMX 1ZD2P 3EGVA 3A1TA 3PL5A 3U1TA 5KWJA 2H65A 1NY5A 2I3DA 2IHUA 1ZD5A 2QTBA 3BWVA 3EZGA 5AVJA 4JBWA 1GQ2A 2YJZA 4UTVA 3AZQA 3TTWA 4YRNA 1KYIA 1LRKA 2HNKA 1FUYB 3LBFA 3ZWBA 3KSMA 5AI0A 2Q3HA 4D8XA 2HWYA 1Z88A 4Q3DA 3TSZA 5JIBA 3S8EA 2VTBB 2DKFA 1JIJA 4JVSB 4I8IA 7REQA 4B6JA 3DE3X 4DIFA 4G24A 2PRSA 2ZJ7A 5DBOA 3EOZA 3T1NA 4BNVA 2WWYA 4YAFA 2O23A 5GIOE 2NX2A 1MAUA 2XIQA 4KLRA 4N4AA 4RM2A 4MRVA 2A9OA 4FDVA 4BO3A 5CHEA 3TG8A 2PZBA 3CX8A 4MQBA 3OKCA 5CR9A 1JHXA 3VDXA 5CB4B 3VH2A 3CZAA 5DN6A 3MWDB 4ENSA 3KSAC 2NADA 5IWAB 3LWBA 3NNSA 1QXSA 3ELWA 4DGQA 4OCZA 1OUMA 1PJRA 2CKDA 4KR2A 5E8JA 4NABA 2BEJA 1VSQA 4LI0A 5HYVA 2C04A 3ETHA 1XN4A 3HVIA 3OTGA 2BHLA 2OD7A 4D5GA 3S2ZA 3RI3A 4KXUA 1CFJA 4C0AC 4R71A 3EDOA 1P73A 1WU7A 2EWVA 4TMZA 4IFIA 5JDIA 1JHYA 3NETA 5F7ZA 1OD6A 4L74A 3BERA 1IY9A 1JEEA 1H3FA 1Z13A 3PGVA 1FMJA 2VP5A 5EHGA 1AKVA 1L5OA 2FOLA 2VCYA 3D3QA 3N2GA 4KQIA 1PJZA 3RJ9A 2RGYA 4TSRA 3OOYA 1RW4A 4KWHA 2IEGA 2Q50A 1XMOB 4Q7MB 2F43A 3LVRE 2IODA 3TZKA 1SWVA 2FETA 3HHPA 2R25B 3DMTC 2GAIA 3RIEA 3PVSA 5IC6A 2IUYA 3ZHSA 3PHLA 5I9SA 3TOSA 3PNKA 3ZY6A 3C7TA 1GM5A 3D9QX 1ORIA 2PKQP 2CV0A 1WD5A 3G8CA 1W30A 1WE2A 3JYHA 3K2IA 4JNCA 4F92B 3UJ7A 1XQYA 2LCFA 1T8UA 3KUKA 2C92A 2GLUA 1ESEA 5EHQA 4HFJA 2FXVA 2EZUA 2P69A 2ZIFA 1RXVA 3GFPA 2NTEA 3V4SA 3QTTA 4KN9S 4Y1RB 2JF0A 3NU1A 3WYCA 2YCBA 1CWUA 3LBAA 3ZLJA 2G88A 3KEOA 4OQPA 5F1YA 2H2FA 1JB1A 3VC1A 1FDIA 1C2YA 3K0EA 3ZE0B 2DHEA 4F3YA 4U2BA 3A8TA 5BURA 3L7CA 1Z4MA 3DEKA 3QA9A 4ZT5A 5C8VA 3OLVA 1O1YA 4LXHA 1V71A 2EYQA 3GLUA 3H86A 2PNFA 3KUDA 4FBGA 4ZYYA 2ZAOA 2IX9A 3WGIA 4U2GA 1L7EA 4MW6A 3UOGA 2V6JA 4D42A 4KN5A 2HIGA 1Q12A 3K6JA 2P9ZA 3V1KA 5EWMA 5A7FA 3PUZA 3IIEA 2WWWA 4HPWA 5EERA 4BO1A 4Q15A 3DZIA 1MB0A 1WVMA 2NUPA 3G82C 3ZYZA 5F5NA 2J0SA 3RTAA 5C46F 1H0RA 4RHCA 3AW9A 2BEWB 3GRKA 4W8HA 5KSOA 5LQDA 3FCUB 5AM4A 1P2BA 1DAIA 3P7MA 4C4PA 1I0LA 1E66A 2KSQA 4EJSB 2ZTHA 4KITB 3QXSA 2JIZD 2R60A 3R3JA 5JCOA 1GLNA 2P67A 3GT0A 5TS3A 1KK3A 4UHFA 5G1OA 3FSEA 3NALA 2CHEA 1U0JA 2WOOA 4YMLA 1DO2A 3ZU4A 2I9KA 4G1UC 2PJZA 2ZWPA 1KI2A 4I1UA 2DWQA 3F5SA 4BLVA 3VR2A 1Z29A 3FSGD 2BFEB 3PIRA 3W3AD 3H4TA 2QZ9A 2ATEA 4RJIA 5CW2A 5IVPA 1AN0A 3KKPA 4JV5B 1SZJG 1NX9A 3ORQA 1RQ2A 2YDYA 3EG9A 2BCGY 1CY2A 4IFEA 5EVJA 3NDBB 3K2BA 4WLNA 1G4AE 1S02A 1CJCA 1ZGAA 2J3EA 2Q2QA 3F78A 4GPEA 4INPA 5ENZA 5JPDA 2ZR0A 4K6MA 4P5DA 5F35A 1Z5WA 3PBKA 4ZQHA 1ZRHA 1ADJA 3VR6D 4GAEA 2A3RA 4QQKA 1KEVA 5C3MA 1MGPA 5EUBA 5AT1A 3NCHA 6CHYA 1I7LA 1UKZA 4V0KA 4B47A 1AG9A 2I5PO 4N03A 4JU8A 3RLFA 3WWZA 1RPNA 2PA0A 4FMDF 4WKBA 1IQ0A 4EGJA 5BSHA 1Z45A 4BNTA 3ANXA 3SF8A 1N2IA 2EZTA 1F6DA 1AGNA 5IBRA 5I9BA 2FPIA 5I01A 1R8SA 2WF7A 4AXBA 2UZ4A 1SOMA 2L18A 4QOSA 2EW8A 3Q8LA 2PWAA 4YDQA 1XNRB 3IC5A 1KVTA 1S8FA 2IBMA 1TZKA 4MCJA 4ZRMA 2W8BA 3OKFA 4MDEA 3K4HA 2CUKA 5EXEA 1LKZA 3N70A 2B7BA 4KIFA 3KE9A 1V16A 3KJXA 3P9IA 4JVLA 4O5AA 4D9KA 1RRCA 1E1CA 5LMZA 3HU1A 4DV1B 2HT1A 3G85A 1UFOA 4GVLA 4HR7A 4DA4A 1NL3A 2Y77A 4IV8A 3JWHA 4PAOA 4LJ9A 3MGGA 1JLLA 1QYWA 2X0RA 2CNDA 4EG7A 4CKEA 1GV0A 2YOHA 3AL2A 2CL5A 3IEXA 1YE8A 4DABA 2O8FB 2QF7A 2FUEA 4MVXA 5LC1A 4UJ3A