3NTLA

Crystal structure of glucose-1-phosphatase (agpe) from enterobacter cloacae
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
388
structure length
388
Chain Sequence
SPEGYQLEQVLIMSRANLRAPLANNGSVLEQSTPKQWPEWEVPGGQLTTKGGVLEVYMGHYMREWLAQQGMVKTGECPAADSVYAYANSLQRTVATAQFFITGAFPGCDVPVHHQEKMGTMDPTFNPVITDNSPEFREKALKAMETERQKMQLTESYKLLEQMTNYADSPSCKEKKVCSLADAKDTFSADYEKEPGVSGPLKVGNSLVDAFTLQYYEGFPADQVAWGEIKTDQQWRVLSKLKNGYQDSLFTSTEVAQNVAKPLVKYIDKTLVTEQAKAPKITLLVGHDSNIASLLTALDFKPYQLHDQQERTPIGGKIVFQRWHDKNANQELMKIEYVYQSSEQLRNASVLSLQSPAQRVTLELKGCPVDANGFCPVDKFNAVMNNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid glucose-1-phosphate phosphatase
publication title Crystal Structure of Glucose-1-phosphatase (AgpE) from Enterobacter cloacae
rcsb
source organism Enterobacter cloacae
molecule tags Hydrolase
total genus 128
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3ntlA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3ntlA02
2OWDA 2A6PA 1K6MA 1YFKA 2ENUA 1C81A 2P2YA 5AJWA 3LL4A 1DKMA 1SKAA 4EMBA 1E59A 1QFXA 4D4LA 3LNTA 3FJYA 2EKZA 2P30A 3D4IA 3QPVA 3LG2A 3FDZA 3GW8A 1T8PA 4EO9A 3PGMA 3ZHCA 1BQ3A 3KKKA 3F2IA 3O0TA 1DKQA 3D8HA 2A9JA 3FDZB 4IJ5A 2H0QA 1SK8A 3OI7A 2P9YA 3IT2A 2EKBA 2OWEA 2P78A 2P75A 4PGMA 1QHFA 2H52A 1DKNA 1V7QA 4PZ9A 3F3KA 4JODA 4D4KA 4FDTA 2P77A 1UJBA 4JOCA 4TSRA 2P9FA 3NFYA 5CU7A 4D4MA 5CX4A 4E3WA 1DKOA 3E9EA 2IKQA 3MBKA 1DKLA 2ENWA 1ND5A 1IHPA 3NTLA 2I1VB 2YN0A 4FDUA 3EOZA 3GP5A 3QPUA 1H2EA 4D4JA 3IT3A 3DB1A 5AJYA 3E9DA 4PZAA 1E58A 1XQ9A 3D6AA 1C7ZA 4IJ6A 2HIAA 2PA0A 3IT0A 2QNIA 4QIHA 3DCYA 2P2ZA 1SKBA 2P6OA 1BQ4A 3K4PA 4GPIB 5CDHA 1ND6A 1YJXA 1V37A 5AJVB 1C80A 2F90A 3QPWA 5AJZA 2GFIA 3IT1A 2HHJA 2RFLA 5PGMA 1TIPA 4HBZA 3R7AA 1UJCA 2BIFA 2H4XA 2WU0A 4JOBA 2YN2A 2WNIA 5AK0A 1FBTA 2DWPA 1RPAA 3GP3A 2AXNA 1H2FA 3C7TA 4MA4A 1CVIA 1QWOA 4ARVA 4GPZA 2P79A 5HTKA 4ARUA 4ARSA 4ODIA 2DWOA 2P9ZA 3E9CA 2WNHA 3HJGA 5HR5A 1DKPA 1SK9A 3EZNA 3BIFA 3MXOA 5AJXA 1NT4A 2P6MA 2EOAA 1FZTA 1BIFA 1EBBA 3K4QA 1RIIA 2H4ZA 2HPAA 1RPTA 4AROA
chains in the Genus database with same CATH superfamily
1VGVA 3NHLA 2FSVC 1MAVA 3IDQA 1E7QA 1GA6A 3L0BA 1MQ8B 4JBHA 1MO4A 1C1DB 4E5DA 1UXJA 2XUFA 5CNIA 4W9NC 3VHRA 5HBGA 1N33B 2JLCA 2RH9B 1C7JA 2VTDA 4C0SA 2WDPA 3VSCA 4L72A 4M0MA 1CFJA 3ZK9A 1I1NA 1DEXA 1H66A 4EO4A 1IIRA 3LRPA 4KEAA 4BFCA 5LKAA 4PNHA 4DADA 3LFUA 2RGDA 2IH2A 2ZB3A 3GVXA 4BDSA 1U7HA 1JG3A 1YBFA 4M1EA 1JTVA 3GCGA 4ZCPA 5FUMA 2ZRJA 1RABA 2FZKA 3DZHA 1KGSA 1UK7A 2E4UA 2Y99A 2ZB8A 2PUCA 2A9JA 1U9JA 5H3HA 1YZLA 2WF8A 1FFYA 2Z57A 5BQXA 3TJRA 5AW4A 4BO1A 5G40A 2BJVA 3RU9A 1FS4A 1U7ZA 3SXJA 3CZAA 3DC2A 4F9GA 1VPTA 2W43A 2A1TS 1ST3A 2VPZA 1VBMA 1Y4AE 5JDIA 1RWKA 4N9WA 2I80A 1OLXA 3X1XA 2CLOB 3UJDA 3R9XA 1ATIA 2P9FA 2X6TA 2G4LA 4ZOAA 1FP4B 4EYEA 3TSZA 4QYTA 3WLFA 1ABEA 2GM4A 2ET6A 3NASA 7YASA 4TRJA 1G66A 3BRWD 4Z2YA 4HLDA 4K5QA 4EY5A 4CMEC 5IFKA 3HYCA 3ZHYA 4AW9A 3DEZA 4OOEA 5IJWA 2ZW9A 2Z98A 1ULSA 4U7PB 2ZVPX 3T5BA 1Y6FA 3T5PA 2VT3A 2ADMA 1MR3F 1VBFA 1J06A 4LRQA 3UKJA 1SC1A 2WYWA 4XH9B 2I6GA 3STXA 2I6XA 3B2NA 3GRKA 1K7YA 1XDBA 4D9MA 5T4HA 2AK2A 1QG0A 4DCMA 3WGZA 1EFCA 3KKQA 1WXFA 1ZZEA 4R4JA 4S2EA 1JLHA 2Q3BA 3BMQA 5LMZA 3DWFA 2VSNA 3C6ZA 2AXQA 3MSCA 4GOXA 5CM8B 1KDYA 4D3SA 4TRRA 5KYWB 1D0VA 1G2QA 3F3SA 5DI9A 3B3QA 2GJ8A 3PR3A 1ZK2A 1PX2A 3ETGA 4PCLA 5JYEA 1O08A 2W8BB 2IDKA 1E5DA 1XPJA 2SICE 4HLUA 1QK5A 4YCLA 3FAZA 1JDZA 1TEZA 3ELYA 3D6UA 5TT1A 4ZKDA 3GEIA 3ZQUA 1G17A 1BVHA 3QXJA 3N2YA 2AFHE 3L5OA 4OQQA 4R2LA 1JS1X 1YVDA 4UAJA 3O84A 4QOIA 4CCSA 2F4VB 2BDTA 3K94A 2JH8A 2BBTA 4RA6B 4WKNA 3D8SA 5LQSA 1QH0A 2VAPA 2VJCA 3P9YA 1D2CA 3AKYA 4AVYA 4N48A 1QQAA 3PNSA 3JWPA 3U62A 2V1UA 1FDWA 3I3OA 4DKJA 3JYOA 2I76A 1QKKA 3RDPA 3VTZA 2ZCVA 4OQFA 4F72A 5C7LO 1IY2A 2WIBA 3ZVNA 2IYFA 2H5JA 4RD4A 3QVVA 3TR5A 4W7HA 1A5BB 5CGQB 5FNVB 3R3JA 1GNPA 4R0VA 2GXQA 4ZYYA 1WXWA 3FMIA 5B58C 5E9QA 3A6KA 4D26A 5GAJA 1WDKA 2VZ0A 3QKSB 5JCOA 4ZXFA 3X2FA 3WKDA 4X1OA 2JJ8A 3LZDA 2JANA 4JV5B 4FC6A 4MR9B 3UUGA 1UKEA 2EV9A 1P4RA 3UKOA 4C88A 1GZVA 3TIIA 3PFNA 2Y2VA 1G63A 1I0IA 1O3YA 1KGDA 2DRIA 4QXMA 4URYR 1CUVA 4M1SA 4K1LA 4OHFA 4DA9A 2YJ5A 2HPHA 5DBEX 2BUAA 2OO7A 3T34A 3WMEA 4YRFA 3Q12A 4HI0E 4MI3A 4BNGA 2B2NA 5FBZA 1ZNXA 2EKZA 2WJZB 2X23A 2FUG1 2BMFA 4D0RA 4X7PA 1FSSA 1BWSA 3JR3A 1QNFA 2FRXA 3L77A 2KLHA 4H7PA 3P0IA 3NBQA 4OXYA 1TO1E 2V9PA 4QRDA 2OV8A 3NHPA 3V4LA 4MA0A 1PL6A 3CGGA 3GF4A 3BHIA 4S35A 4WOPA 3R5KA 4KWEA 1TYCA 1CE8B 2ZIXB 3AU8A 1EVEA 2ZRPA 4CQMB 2XGGA 2ODNA 2PS9A 1EFHA 1JQDA 1KZGB 1TFUA 2ZRMA 4LDQA 3H2BA 2PSSA 3N3BC 3VYWA 4MRVA 1QOZA 4XSVA 1A5AB 4OU5A 1MRZA 2MIIA 1TRHA 3CE6A 4QGSA 2IHTA 5DH9A 1VJ0A 3R4VA 1Y8QA 1G6OA 3HDVA 2FSIA 2RGUA 3H1AA 5B53A 1DWQA 2MSWA 1DG1G 3CUKA 1I6MA 1IU9A 2DPHA 1CPYA 3KL2A 4FR0A 1I13A 4PANA 2GNAA 3TQFA 1ZR2A 4TYWA 5BN5B 3KZXA 2IEGA 2WSSA 3D3NA 2P4HX 1J33A 5H5JA 2PXHA 4L6CA 5HFAA 5C46F 3LBAA 2FCRA 3O8CA 4GYYA 4DBZA 3USCS 5LU8A 3LX4A 3ETLA 1ZM2A 4O4LA 1ZIPA 2B2CA 1JXAA 5I7OA 3E9MA 4KPGA 5ITWA 1XMPA 1XZHA 5A06A 2M32A 1G8AA 1KO8A 4PSKA 4JI6B 1XD8A 4XTCS 5C8YA 4GPTA 1NXQA 3EGXA 1G7SA 4DDKA 1P3DA 2A30A 4BLUA 1U0OC 1NQUA 1R4MA 2I2BA 1NP3A 1CUXA 4XCVA 2JJQA 1Z2PX 3TUJC 4RVDA 3FZQA 1W6UA 4P3NA 4YA6A 3TCKA 5D84A 1ODSA 1T4MA 1C3EA 2FX5A 4EL0A 3FFTA 2BM1A 4LF6B 2Q8NA 4CDMA 1FBTA 4HL6A 5CLHA 1T2AA 421PA 4HDNB 5EIWA 1V8FA 1VCNA 2QRVB 5HG0A 3W5IA 2GAFA 4FXOA 1VA4A 4LHZA 3SS9X 4NPCA 4Q3CA 4G4SO 3WHIA 3NDJA 7REQA 3RT7A 1E5LA 1YDEA 3ZI7A 3U49A 2GR9A 1O7JA 1Y9DA 3ZZ0A 4QX6A 1PNQA 4GFDA 1NULA 1V16B 1YOVB 2V7EA 3TLJA 1N6HA 4QDZA 3GVPA 1ADGA 2PIDA 2BC9A 2R7NA 3ESYA 1LDBA 3WRVA 5B7PA 2NO9A 4HF7A 3DW1X 2NSJA 3IDAA 2ACVA 3NHKA 2H65A 3PQEA 5LQUA 3NGMA 4HPWA 4X92A 1MC8A 2XVAA 3MT0A 5ER9A 1IZ8A 4AICA 3L7CA 2C2WA 2EJUA 2P90A 4R16A 1WB9A 4MX8A 2XODA 3JW8A 4KO4S 4BQRA 1T5OA 4JLPA 3EXHA 4IJQA 1V35A 5LQDA 4S1OA 3H17A 2PGOA 2QI9C 1L4HA 3F9RA 4RE6A 4RJTA 3U16A 4JGGA 3NAQA 3WQBA 5B7GA 4IZIA 1DTWA 1Y63A 2GRJA 1AO3A 1L8OA 2JFUA 2QMUA 3DMYA 3MWLA 4TYMA 5IKPA 5KWSA 3K70C 3DZ8A 4BMYA 4KU4A 4GXNA 5LZ8A 3LECA 4NH4A 3IILA 4PY2A 4CTOA 2OXRA 3W3AA 1H8HD 4E2XA 3OKFA 4GLLA 4JQOA 2HM7A 1N1EA 2FZ5A 2WW8A 1QYDA 1EX7A 1NPYA 3TD2A 4B6QA 3CIFA 4FDMA 1JF8A 3DMTA 5L3VA 2G88A 2Q6LA 4NAHA 4W1RA 3QYAA 2JNWA 3FDFA 4ZODA 1BXGA 3HU1A 5ARDA 4RTNA 4C0LA 5JI3E 2RGAA 2J6HA 3AINA 2PL1A 4EDFA 2O19A 1Q6ZA 2O2DA 1U2GC 4GM0A 3CLRC 1CXZA 4WJLA 1E0KA 1Z6PA 2BFBA 4QL3A 3TRHA 5HRCA 5C31A 2ZDQA 2B3TA 5JMTA 2J4FA 3HYTA 4IRMA 4XVQA 3HCPA 3KK0A 4GPBA 3A6ZA 5HBRA 3DMDA 2QYSA 1E2BA 3MBKA 1LS1A 1H2RS 3K35A 4LMBA 4UM5A 4DMCA 1B8UA 2HWKA 3DV0A 3K3PA 2WYUA 5TQ0B 4FR5A 1SUBA 3AF2A 1BWPA 4PPFA 1HK7A 5EJ9A 3GYBA 3CNOA 1DBRA 1CQXA 1GL7A 3ORYA 3KZCA 3AY3A 1JEYA 1VSUA 2NTYC 3RF6A 1EGQA 2PS3A 4LX0A 1YUBA 1G9TA 1ZH2A 2NN3C 4X93A 3AVXA 2ZJ7A 3FNBA 1ISMA 2PA0A 4Y1EA 1VL0A 2W2PA 4CKZA 1UMCA 1ZFNA 3DM5A 5CDYA 1OHHD 1G20E 2IIVA 2ORED 2WHEA 3LT0A 4E4YA 3MYYA 4EJ2A 1SXHA 3B6MA 1L3IA 3EFHA 4P08A 1G1AA 1MENA 1QX3A 4OFXA 3A4IA 2XCTB 1EK5A 3PNYA 3KCNA 1FUYB 4N82A 4RV4A 1ZISA 2A88A 3NJRA 1NV8A 1ZUIA 2C4NA 4PQYA 2FJPA 3S29A 4C6SA 4BE7B 4F9FA 1GTSA 2NZXA 2PKCA 1ODCA 4RA9A 1U2ZA 2ZTHA 1S7GA 1JFSA 3DD1A 2FDRA 2J0UA 1CJTC 5FPYA 4P5EA 5K9ZA 1TDJA 2H2GA 1SJ9A 4G3XA 3TQCA 3UOAB 3KR1A 3ST7A 1U2EA 1LDYA 1F6WA 4GBJA 1VJ5A 4DIKA 2BTQB 2O8DA 3E05A 3H05A 3DBRB 1TCCA 4OKSA 3H18A 2SHKA 2AEFA 4QECA 4DTIA 1GNSA 3ZWQA 4WLNA 3T3GA 2DVMA 4WNAB 5KC8A 4KK4A 3REQA 1OMOA 2OEPA 4GECA 2VPIA 4BZPA 1PZXA 1XCLA 1HY3A 2G6BA 4UVEA 2X41A 1Q44A 3AVYA 1ZIXA 5FP0A 2QYOA 4XRRA 2DLNA 3KQMA 4FGWA 4ZAZA 2DBRA 1FZTA 3KOOA 1C3VA 1U5CA 1CHNA 2CYBA 3ZU3A 4HB3A 4A10A 3KOMA 2G1KA 3LQFA 5K51A 5HZHA 3DJYA 3HADA 2LIVA 4JLWA 4MMYB 2PEZA 1M2OA 5LQMA 2DUUA 2QTAA 2D5BA 1TQ4A 1XTSA 4L2IB 3K6KA 2I3DA 3GO4A 1E1NA 3U3ZA 2RAPA 3DKPA 3NYQA 1XMSA 3UH1A 2GQ0A 1TMOA 2NU9A 2ZBVA 1H6DA 3K2EA 4RNDB 4DWWA 3BKXA 4CIAA 5DWDA 3WB9A 2EHDA 5ANRB 2HJHA 1HDGO 3UWDA 2FW7A 3FMGA 3QVLA 3ZNNA 3I6BA 4CM8A 4V1CA 1SUSA 1VMAA 2HBRA 2QRMA 4FFMA 3QPBA 4O4HF 2CFOA 3F6PA 4GE0A 4M83A 5JAQA 4PSAA 2BBSA 2VH2A 4FD2A 3TOVA 2ZI5A 2J3LA 1L4BA 2QVZX 3O38A 3R1IA 4LJ6A 2RJOA 4URZR 5AKGA 5M04A 2H3HA 2PKYX 1WSAA 3ITEA 1JU3A 3CB4A 2F8LA 4IIUA 4PGMA 3TNYA 4EY8A 2E0IA 4M6WA 1CRWG 1V45E 4K26A 4EDHA 2PXAA 4C4AA 2AK3A 2NNWB 4ZGGA 1IIBA 2RGEA 3FG9A 5AD1A 5CJPA 2ZR0A 3SF8A 2I2FA 4BEJA 1Z2AA 1WQ3A 4IIBA 3EEOA 2GCNA 3CH6A 4OQDA 2XCQA 1UBMS 3N05A 4P7JA 4V3CA 4PSCA 4QHTA 5COAA 4JASB 3ZWPA 2D5LA 1FRFS 1DAHA 1M6WA 5D87A 4NONA 5JD3A 1OKKD 3QBTA 2HDWA 3GP5A 3AKZA 4V24A 3VR0A 3RSSA 4JKIA 4C4TA 1U2DA 1CSEE 4QAQA 5BWBA 4J6EA 4ZHSA 4OXRA 1X7YB 1U8UA 2CLCX 4D74A 3IESA 1XG5A 4RJLA 5LDGA 2CZCA 2Q5EA 4MQ6A 2ZBRA 3R8CA 5LZ4A 3NALA 4BNZA 1GWNA 1I3MA 4FFWA 4RZ2A 2WTUA 5AR1A 4BZXA 1UXHA 5M3BA 2XNDD 2NYUA 4PLHA 1J0AA 3DDSA 3H5NA 3I9NA 4O08A 4EGCB 3D6HA 3IBTA 3QI2A 4F3NA 1EM6A 1ZSNA 2GZMA 1QF9A 1IXYA 2ZUSA 4MQBA 3EXG1 5DIZA 1OU0A 1TK9A 3EF1A 4FKBA 4LJKA 1GL6A 3UHOA 4D1YA 2Z6AA 2FEMA 1K75A 1XQVA 1LC3A 2G1PA 4Q3NA 2IFTA 3EX7C 2HWYA 3HY4A 1KMCA 3AZQA 4B3IA 4RY0A 2VYCA 1AUVA 3K6JA 3HN6A 1K88A 2HK8A 4HH3C 5AM5A 2X22A 1KPIA 4L02A 4J29A 3GGOA 4LSWA 2C9DA 4YP0A 1ISPA 3ESAA 4FI3C 4K9SA 5AKJA 2XXBA 4MGYR 1TJYA 1T2DA 4A8HA 5C32A 1T1GA 3CXUA 2X58A 2CXNA 3EUWA 4FNMA 1W5TA 2VWPA 2RGWA 1NAHA 1NYTA 1R0SA 4HGPA 5CHEA 1O58A 3K9HA 3BAZA 2ZYRA 1Q0SA 5F73A 4RGVA 4IDQA 4ME6A 1DBQA 1XZAA 2DH5A 2I1LA 4NNPA 3I53A 3FCAA 2X8AA 4WFIA 5FJIA 4BLQA 3KEMA 5DNCA 1SZPA 2NXJA 4AZ0B 4L8YA 5JXWA 3K09A 2ZVDA 4L1KA 2ILTA 3KQSA 3QA3E 1HZZC 2Q1XA 2QP4A 4P3PA 1WS6A 5CVJA 2HPZA 5KWVA 2BFMA 4IDBA 3HU3A 3HB9A 3MT8A 2GJ4A 1L4YA 3F5DA 3CG4A 5CFPA 1HE2A 4PEVA 2ZETA 3OA2A 3Q5DA 2CVHA 3PFKA 1KY5A 1DAMA 2FPGA 2YIVX 3KQPA 1RP7A 1TAQA 3O5AA 3IQZA 4G67A 4RJIA 5CVDA 2Z8ZA 4ZOCA 4JUBA 5DIFA 2I6UA 3BMOA 1NE2A 1L4UA 2ZBQA 3EEYA 3QMPA 1M74A 2JLYA 3BWCA 1YQUA 3KKKA 1UPBA 3S27A 3JYNA 2QUZA 3UMYA 2QVXX 4K6KA 1ZGBA 2ZOSA 3H3XA 4DCSA 1XLTA 4MR8B 4M4SA 1QUEA 3M9WA 4YPVA 4MPJA 4HQRA 1VMKA 4IOLA 4N4AA 4QUBA 4J0HA 3SZOA 2ZYGA 3RT1A 1RBZA 4ALLA 4AT1A 4C7KA 2CJXA 2EJBA 3PBKA 5DX8A 4N6NA 4Z9BA 1YV9A 3M6XA 2QI9F 1GGMA 1SR8A 4M0FA 4Q7MB 3RLIA 2CCJA 3VNUA 3AILA 4W8OA 2ID4A 3KYDA 2JCXA 2W2OA 4KFUA 2BFOA 3KVNA 3QW2A 4FDAA 3G6KA 4M0CA 4FMCF 1FTYA 4PWYA 4QLAA 4L4RA 5B1IA 2F8TA 1DJOA 5F98A 4JI1B 5KNDA 4QQKA 2HJWA 3EXAA 3DHEA 1GL9B 3E3OA 3LCCA 4S05A 2Q1YA 3V1KA 1IUOA 2BYTA 2HCJB 1GNTA 4C3OB 5JU6A 2O05A 5EXTA 1E4EB 2WWHA 3V6LA 3EGEA 1W581 3IKMB 4EECA 5FFFA 2Q2WA 3P0JA 2NO1A 3IVCA 3OFJA 1YL7A 4KVFA 4BFWA 1ACMA 1KVUA 1QNLA 2C5FA 1P7VA 1PLKA 1E2FA 2Z43A 3IAAA 2DXIA 3HTXA 1EUQA 4YAKA 4HNVA 1GPDG 1KFBB 1KY2A 4JUFA 4Z9AA 3MTIA 1C7EA 1A9TA 4RK4A 5AOVA 2P9EA 2O8NA 3D8NA 3OTGA 1N3BA 1NXTA 2EQAA 2N75A 4MPTA 3L7MA 2AVDA 4Z99A 1VIVA 5AK5A 2JI7A 1GILA 5CRIA 3KUDA 4XM0A 1EK0A 3R3WA 2BMEA 1PEKE 1CY8A 2RFLA 3HKCB 3L04A 5K3AA 3PNMA 3MWJA 4LCEA 3BJMA 4RPCA 1LPOA 5E1DA 1BKDR 2FFJA 3V8NA 1OWOA 2Z4SA 4OLHA 1KRWA 4LZZA 2G7ZA 5EZ5A 1NVBA 2X6QA 3P9RA 4U9UA 4X91A 1T6NA 2A8YA 2BCJQ 3IPYA 1LVGA 5FR1A 4PZCA 1E3JA 3DUWA 5J2TB 4LVNA 3EA4A 4V0OA 5CFQA 3FYDA 1I3CA 3L7JA 1V8PA 4KXLA 3BFVA 1U5AA 3FMVA 4FGJA 5JYCA 1T4BA 3IYLW 4PTYA 1NPTO 3M5PA 4EYKA 1NW4A 1RWOA 1KEEA 3MVEA 3QOFA 1L7QA 3QJ5A 3MMNA 3LRXA 4MRMB 3TQSA 1CULC 1DO0A 3NNSA 1FDVA 4JLBA 2EGUA 4TSFD 5E9AA 1C2YA 4TLMB 2GHTA 3IHKA 1COZA 5T8KA 2BKLA 1SXPA 5AJWA 2H6EA 3EWAA 1Z0SA 2COKA 2D4HA 3L7AA 2AYZA 3E9QA 4I50F 5ALIA 5JALA 2QRKA 2QZZA 1OLOA 1NBAA 3LF1A 2FOLA 3JZMA 3R6GA 3UHJA 3SFVA 2DFLA 4GYJA 2OBXA 2O8CA 1JNXX 5FQOA 3A25A 4X20B 2H16A 4EPVA 1U4OA 2AA3A 2WQZA 3JWHA 4ID9A 1Q19A 2PVSA 4HYQA 4ZICA 3RHZA 1YK1A 1A88A 2VK8A 3KOWA 4JSYA 2MSEB 3KKLA 1NBIA 1X94A 1E9DA 4XB1A 4J3JA 4DCVA 3PDIB 4P0TA 3AUFA 3V2IA 1Z73A 4OHKA 5BN4B 1O0BA 1ECLA 2JAOA 4TXHA 1N8NA 2YHBA 1PJTA 5EJFA 4L7QA 1KZHA 2P6UA 3V1MA 4KQXA 4UAUA 1M6EX 3L79A 4UFOA 4TKVB 4HDMA 2V54A 1Q20A 2HRRA 4MR7B 4P0QB 1FRQA 4WZBA 2QAJA 1ZGAA 2ZSUA 3AL3A 3QWAA 1NMZA 2GERA 2M98A 3NFYA 4OHZA 2G0AA 3HB0A 3RABA 3CR3C 4WVFA 5EJGA 4AC9A 4JJFA 3LC7O 1JHPA 4EUHA 1S3IA 2R3SA 1NRIA 1VCOA 2JH9A 1WMAA 1XAGA 1SIWA 4MVJH 1OH5A 4JITA 5JATA 5AVVA 5LA6A 1JHUA 1PJ2A 3QPUA 4GI7A 4UMDA 4ZAGA 1VCHA 1R4AA 2CWDA 1Z68A 4LSMA 4ZKEA 5P21A 4AQYB 5GJBA 1IUPA 1MEOA 4DQKA 3B3GA 1CS0A 3MUFA 1M2HA 4PX3A 1I7SB 3NAMA 2I7XA 4CR8A 1SXIA 1DRVA 3M1AA 4JX8A 4ALJA 5UKDA 3RUEA 3BWEA 4A5OA 1U7PA 4TN5A 4MO2A 2V4UA 1JTFA 1Y6ZA 1W48A 3KKEA 3HCAA 2IYYA 3HBNA 3IEIA 2OLKA 4KLZA 3WX0A 4NBTA 3OF5A 3I5XA 1O96A 4HG2A 1P6UA 2FGKA 5K3DA 4ZHQF 3OHSX 2YFQA 4JXXA 1XFDA 1RFGE 1GFZA 1JIIA 2DUWA 1IZYA 1WRBA 2WM8A 3DTVD 3I1IA 3O93A 3P9ZA 4MAMA 4XD7D 4HT3B 2XKKA 3T7TA 4TOIA 1RP1A 1SVKA 2DBZA 3WSWA 4NC9A 3OLCX 2DT8A 2Q3DA 3I5YA 4AJJA 5EMLA 5HF9A 1EIWA 2BKUA 3UT5A 4R81A 3THWA 2J6CA 3CZPA 2EJCA 4LHSA 2QLLA 2ZANA 4MW9A 1U3UA 2X2EA 4WLOA 3V80A 3G1TA 4HMQA 4P4UA 1HQCA 4G1MB 3BMNA 5LZ9A 3KJXA 4LKRA 4K9RA 2DFPA 4NENA 4NCXA 1P1CA 2G0NA 2HL6A 4PVCA 5E4FA 1AURA 3CO5A 3HDTA 2H1OA 5IJXA 2XE7A 3QPAA 1N4AA 3THSA 3TOCA 3S8MA 1XKXA 1ZXXA 3AYZB 3SYRA 3T3IA 1G8MA 3QTBA 1Q1AA 2OFWA 3FWHA 3CSSA 2BOVA 3FHLA 1O97C 2HX1A 2X15A 2GEKA 1DEHA 1JQBA 3PDCA 5JJKA 4NATA 1LX6A 1X74A 3HHPA 5LOVB 4J43A 5D00A 4D9JA 1OX6A 2FX3A 2R7LA 5IAJA 4F6LA 3FGNA 2RB4A 1XCBA 2BN4A 5DBGA 5IK2D 3DT6A 1UZNA 2QNRA 5CX1A 4ZV9A 3ZYZA 4Y9UA 3LPLA 5BMOA 5CLIA 1ENPA 1JFLA 3MT9A 4EYOA 4O4JB 4S0ZA 4RTQA 3H6KA 3VSBA 3WG9A 1KMNA 5IZCC 3TZEA 4H0NA 4KW7A 3VVLA 1FNDA 3I37X 2DP4E 1FYFA 4N47A 1BJKA 1YULA 3WRXA 1T8UA 2YZGA 4NZZA 5L9AA 4JYZA 1ZKDA 1RRGA 2QY9A 1YA6A 4UM7A 3WGNA 5JJCA 3NO4A 1NRXA 4D8WA 1Q0HA 2QPTA 3OAAA 3UHPA 4DMHA 4YXFA 3D4IA 4WBNB 4IV8A 3E5HA 4FI3F 3RFCA 4RVSA 2RI0A 4Z49A 5CK5A 5KNCA 5G02A 1TLFA 3X1YA 4L75A 4EM6A 1NVMB 3CR7A 4G89A 3E22A 3QXXA 1KYIA 4UEKA 3UAWA 5HKKA 4DR1B 1QYVA 5TJHA 1Z75A 3DCIA 3ROEA 4AMYA 2IQ5A 1CTQA 5J4VA 4DV1B 1P75A 1K5GA 1L5MA 3GFQA 3PQDA 4V1CI 5MF6A 1FX0B 4KO3S 5BNTA 4NPAA 2JJ2D 1J70A 4C07A 2G8NA 5HQ3A 4EG4A 3GMDA 2QN8A 1C9EA 1Y42X 2NV2B 3FPBA 3ZV3A 4M9SA 2AW3A 3LQQA 5LBUA 1E9FA 1T5DX 4RKFA 5I4CA 2PEYA 1I6WA 3HJCA 4D79A 4Q00A 1QHSA 2YDYA 5CCEA 3AV0B 1OXVA 1SCKA 1YDHA 2HIHA 2PT7A 2QG9A 2QVLA 3MUNA 4IHAA 5FTMA 1QQ5A 3TGWA 1XNQB 5K0NA 2E37A 5KKAA 3OQNA 1DPGA 2B9EA 1A5TA 2Y0BA 2R6FA 5KTOA 2ZIUB 2R1UA 3ESRA 1R4NB 2PUAA 5AW6A 5FL3A 1KFEB 1G2OA 9LDBA 4RD1A 1ULHA 3R9WA 2PX3A 3MIZA 1R88A 1P4AA 2XNHA 2HBZA 1ODIA 3HU5A 3PQ5A 1CUJA 3JYHA 5B3LA 3BXXA 3ADCA 2LCFA 1EHIA 2RCYA 3FVTA 1D4AA 3VNQA 3I1JA 2IYOA 2WV7A 1T25A 3L02A 1UOPA 3V8QA 3D02A 4M3NA 2CXSA 2CXTA 3ZCUA 3DFUA 5IJ9B 4D9CA 1US8A 1PTJC 1V41E 5KQLA 1AA9A 3LNCA 3NUQA 2P9GA 2OB2A 2ZS9A 3TTVA 1A27A 4BEWA 5CB6A 3FMOB 1M0EA 4DNFA 5HGXA 5F7JA 5IYZF 4AIRA 2JPDA 1UT8A 1MAHA 2ESRA 5FNVF 3PRHA 3M8KA 3OIGA 2XYHA 3OQBA 1KYVA 1QVZA 4HQKA 1JG4A 2Y67A 2DCMA 2IYPA 3H5LA 2VHYA 2F9MA 2PNJA 1SVMA 3OPYA 2IOFA 1U2QA 2JDID 3HVKA 1NBME 1G7TA 3U2QA 4R0NA 4CQJA 4B3GA 1EKXA 2BEVA 1KK0A 2HRBA 3CX4A 1CY1A 4CMHA 3GMIA 1JG1A 1N0VC 2QW8A 1U99A 4WLUA 4JYCA 4PFSA 3ROZA 1E61A 1FK8A 1BN6A 2QRZA 3VR1A 3ZE2B 3I76A 1NVUQ 1VA5A 1YR9A 1XZGA 3I32A 3KG2A 3LUHA 1TD1A 4KQ1A 1LBTA 4PSUA 4TMYA 4YP6A 3HLKA 3EH2A 3PS9A 4BLPA 2JKVA 3STVA 5J1SB 1SQ0A 2P62A 4IQGA 4BB6A 1YT5A 2IHVA 3EXG2 3HXLA 4TLEA 1VYVA 3ZE9A 1VKNA 2GSWA 4OK6A 2C92A 4UBOA 3V5NA 1E7RA 2GAIA 4FS3A 1E2JA 2IGTA 2JGLA 2VXOA 2EX4A 4BKMA 2AG0A 4KV9A 1JL3A 4EL5A 2QW1A 2QKYA 4MRNA 4RVNA 1PEAA 2FW9A 3K9QO 4E2YA 2ZTSA 4EI9A 3FYTA 1CYEA 3ZI0A 2D5CA 3U40A 2H2HA 4M38A 5J23A 3H0CA 5LD2C 4YXWA 3RVMA 1IHYA 2ZRHA 1A8HA 3T9BA 4Y3UA 3PPIA 1DKMA 4EHFA 4OU4A 1GRNA 1MHTA 1QHNA 3QFTA 1TZMA 5J9FA 4KYIB 3NBKA 3DFKA 4FFPA 1RZRA 4QEDA 2AC4A 4P5PA 3ZCRA 1RVV1 2R97A 4DDWA 4WZAA 5EFOA 1KO7A 4DEXA 4ECEA 1G8KA 1VE3A 1L5HB 2R2GA 3JU3A 2I4IA 3ZQ4A 3KSAC 4DV0B 4IX1A 1FL9A 1BCRB 1IEXA 4GSYA 2Z2KA 1IN5A 3OQVA 4LDZA 4MLDA 4AQDA 4D8UA 3SHQA 1DKQA 3HJRA 4Q05A 3WWPA 4CT4B 4V0NA 4E4TA 4CXMA 3ZCXA 1X7DA 5JWHA 5K3OA 4DZTA 4N5DA 4WDQA 2VNJA 4L9SA 4B74A 5T3YA 5JAOA 1T1IA 1H0HA 4MWGA 1U31A 1QHFA 1TEXA 1JJBA 3NWJA 2WAYA 3OZEA 3K31A 2ZS8A 4Y2UA 3JZFA 4Q24A 3LCVB 4WXEA 3UPTA 5LXTB 2BHRA 2HOQA 2DHDA 3JQ8B 2P9QA 1GZ6A 5COBA 4Q7EA 4BX9A 1I7DA 3CW2A 2C0CA 3CV3A 4CL0A 4K6GA 2JGDB 3A9SA 3LHDA 3PUHA 1V3QE 4CUJA 4W7IA 4X3OA 4ZPXA 4I8DA 2PX8A 3V9AA 1KEVA 1UM8A 3ZWAA 3ZS8A 1JA1A 4H4EA 4UHFA 4L3WA 4YAOA 3ZJVA 1M73E 2GYUA 5JH7B 2NOAA 1BGXT 3FA2A 3IP8A 3F49S 4X7MA 2GT1A 3C1OA 4QNRA 2XD4A 3ZW8A 4BV9A 1SXJA 4XYBA 1E3TA 2G1AA 1TYBE 1EWKA 1BH6A 1N9ZA 2AQHA 3CLTD 3MRSA 1VBKA 4OREX 4CG1A 2J48A 5KOJA 3GWGA 1O6ZA 2B4TO 2EW1A 1HLPA 4OCZA 1N2HA 2C95A 4U9HS 1V7PC 5FTJA 1F17A 2D1RA 4Y2QA 5FF9A 1H0KA 1UBJS 4YRNA 3OWXA 3T06B 3G89A 3EMDA 1MH1A 4MQEA 1UEXC 4L0QA 1CDZA 1RLIA 1GITA 3ED1A 3LQKA 3M6UA 4RSGA 3TVTA 2FP3A 3SICE 3EDCA 1RXSA 2QQEA 4F2WA 3WY9A 3IMGA 1SOAA 3ELDA 1W46A 1M2WA 1V0JA 1TYDE 3IV9A 3U7GA 2FRDC 3ID6C 3OZCA 3QF4B 1PQ4A 1X9HA 5EWMB 2IXTA 1P0IA 2DBVO 5HKAA 1JQJC 4UM9D 1Z36A 2O0JA 1KARA 1IVYA 1ESNA 3OC0A 2G67A 4G1CA 4D8VA 3C16C 1IM8A 4Y9TA 4RTJA 5DWVA 3PLAE 5SY4A 2HFJA 4ZI5A 4RF5A 2OXCA 3D7RA 4FHZA 3BULA 4HNSA 4NJMA 2V9CA 2HH9A 1Q0UA 2V0GA 1RHJA 2PN1A 3N07A 2EOAA 4M76B 3EZ6A 5BYBA 5IHXA 2XTAA 1JSRA 1FXWA 3MTJA 5CEJA 1BHQ1 1W0KA 2JVJA 2W6JD 2HLNA 2FF7A 1MORA 4CR6A 4DUZB 1F8XA 5E9WA 1C4KA 5L3SA 1D2RA 2GKOA 1H3FA 2P6PA 4XYLA 4FYIA 1AD2A 3PUVA 3CCBA 5B36A 1P2VA 2W11A 3DXYA 5CP8A 1GVNB 2H2DA 1E7WA 2P5TB 3QITA 3C4QA 3MFQA 3IQGX 3PNBA 1G4UR 4KR2A 3ZG6A 3M7IA 2PTGA 2V8BA 1O6GA 3L8YA 4NK4A 1HDXA 1E4VA 1V3UA 2CNDA 2QF7A 4G9BA 4GX2A 1M2JA 2BWJA 1GY8A 4KXFB 2CHQA 4CHTA 4OM8A 1C9MA 1E9BA 4D41A 3GVHA 4ZVRA 3HXPA 2EFDB 1K4KA 2ZSIA 2AZDA 1B2RA 2XGJA 1T2UA 2D8AA 1ORTA 2RSLA 3D8HA 4IO0A 4JBLA 1GPAA 2OZPA 2XWBF 4ISBA 4OHUA 5IBPA 2WJYA 4B3BA 1ZI6A 2IOQA 1BW9B 2OA0A 2J0SA 4MVJD 3K1AB 3G0HA 1TX4B 2AT1A 2JHPA 3ZHSA 1EZZA 4RS4A 4FYKA 3COZA 3HCBA 1IEWA 2HDHA 2YIDA 5KZMB 3QA9A 1Y8RB 1BDMA 3F8TA 1E99A 2PKEA 4JOCA 1EG7A 2H2IA 2IW3A 3G1UA 5JJIA 3D31A 3GAMA 6YASA 2PUFA 3R0ZA 4KQWA 5C3UA 1PGJA 1QH1A 1SC3A 2J9XB 1DAEA 5E7JA 4CFSA 4GPEA 1NVXQ 3D2CA 2ENWA 4JBWA 1JR6A 2XUQA 4CM9D 1OFGA 5BQPA 4R9SA 3ZUGA 4H27A 5KS2A 3IJRA 1T3ZA 2WWGA 1UKZA 3T3EA 2CNNA 2VP9A 4ZYLA 1NYRA 5AUOB 4PPQA 3CKKA 5AOCA 5BORA 1Z8DA 3QWHA 3ZEIA 4F86A 4Y0VA 1XALA 2JAWA 2Y6VA 3MFYA 4F91B 4D9EA 5LWHA 1Z74A 1NI4A 2A58A 2J41A 5MN4A 4KQFA 4MH0R 5E6SB 1RRVA 3GH1A 3L8ZA 4QNNA 1LRLA 1H2AS 2X5NA 4BKPA 3H9JA 1Z12A 2D0IA 4LPKA 4CMAA 1KJNA 1ZN2A 3VKFA 2RKWA 5DNUA 3LJKA 3A36A 4BC0A 2TECE 4PBSA 4WKCA 3AHDA 2FKAA 1OV4A 1NP7A 2C4TA 1CUDA 3HFGA 3NATA 1OZFA 4PQFA 5EWLB 1YJAA 5IWCA 1Y9ZA 2LCIA 3GEHA 1UBOS 3JVVA 4WK2B 2P41A 4BX0A 4J3NA 3EDOA 1AQUA 3EPLA 1EK2A 2VJMA 2C3MA 1YONA 4PC1A 2OSBA 5A1TA 3UUEA 1DRKA 4MUYA 5A5VA 1C7RA 3OM1A 3VZQA 4Y7DA 3X1JA 5LN1A 4C2BA 2AXNA 1VL2A 1I2DA 2XCLA 3I52A 1TTPB 5C37A 4PPGA 5J43A 2X7XA 1XMOB 1P1KA 2IK8A 2DFKB 2OG1A 2XXAB 4YCCA 4FHEA 2J9ZB 3HBFA 5KSPA 5MDHA 4PC6A 4TXJA 1O6CA 4CRWB 3D3WB 3FYUA 2B30A 1L5VA 4W7SA 3G2IA 3PHCA 2OPBA 4XR4A 1WWKA 4X64B 3C3BA 1Q7RA 4AS3A 3AF6A 1RXVA 3VQTA 4O3FA 3GDFA 3OEEA 4C2TA 1N2OA 2PH5A 1JPNA 3HYSA 3RHSA 1P3Y1 4MV6A 3TSOA 3OZFA 4BUJA 3THYA 3IBGA 2QE6A 1B76A 2ZE5A 1PVOA 3ZDYB 2XMBA 1LLUA 3IUNA 4C6HA 3LBIA 5H3LA 1Q7TA 1S9HA 4TM8A 2V6IA 4J1TA 3NOQA 4G0NA 3AR5A 5CYFA 1S01A 2CBZA 3EDQA 4I1PA 4G07A 5FUWA 3T1NA 4M49A 3UVEA 4LJSA 1N5DA 3H99A 3AJDA 3NVMB 4EJSC 1DUSA 3EW7A 1PV2A 4QTZA 4CGZA 2CE2X 1EFKA 3GUUA 1OGYA 3IOYA 2X1LA 1J25A 1JQAA 2QRLA 3HZRA 5DM0A 2RHHA 4Z0PA 5DCLA 1MU0A 3HP1A 1XELA 4JYPA 4EO9A 1NMXA 4KB5A 4JDUA 1MT0A 1NMEA 3WGVA 4UNNA 3E3LA 3LLMA 5CLFA 3RTCA 2DBYA 5MGBA 1YRAA 4QM6A 4FUQA 1JR3E 1X1SA 2A1UA 3LYLA 4KN8A 3UV3A 1SVWA 4JJEA 1OJLA 5FPSA 2AKYA 1R0CA 3RYFB 3DO5A 2JFQA 3E27A 3PXBA 1BYUA 3X1WA 5I7FA 1E5VA 3T5CA 1YHZA 3G7UA 3VI4B 1YE3A 2XTJA 1HEYA 2A84A 4UBIA 4EH1A 2CXQA 4YMVA 2UYOA 1B8PA 4DHEA 1I0LA 3RYIB 1L5SA 5AVJA 1N3IA 1K9VF 1ZZGA 2RH4A 1U90A 2Y1KA 3BZBA 3VKVA 3ZBPA 2JA2A 3NTXA 4GF5A 3ESCA 3GEPA 2YIJA 5B58T 3KAKA 1SN7A 3Q9LA 2RHDA 3B9RA 3O4IA 1QRDA 1M66A 1RQLA 1T8SA 2QMZA 3PEUA 4R7GA 4R2XA 4B0OA 1NQWA 1OWLA 1E1RA 4LXYA 2NM0A 3OE7D 4X94A 1CUSA 1UMKA 2WP0A 2EERA 4HN4B 4L74A 5G4KA 4F38A 4UNPA 5KTPA 2J7KA 2OBBA 1S2NA 3GRFA 1OF1A 4ZEMA 1YQWA 5FEUA 5AVKA 4I1VA 3AR7A 3TLGB 1ADBA 2GOYA 2W58A 4LECA 4MB2A 3SPXA 3KVYA 3V3TA 9ATCA 4Z86A 1N92A 2ZJYA 5T64A 1TUBA 2BMAA 3HACA 1P1RA 1PFWA 4KQHA 5ERXA 4HEA6 5CNKA 4UZEA 4DSOA 4G85A 1ND6A 1WW2A 3WA7A 1U0HC 2R8ZA 1SEVA 4HB4A 3J80A 3C48A 5ER6A 3ZEAA 5DTJA 1F4LA 1FMCA 2AMYA 3OQHA 1N8KA 2GCGA 2H57A 2W9XA 3JASA 3MPUA 2Z2XA 2PGAA 4G6ZA 2MR6A 4F3TA 5H4GA 1PWXA 3R3HA 1Z2DA 1ESZA 1EG2A 4I55A 4JIGA 1S2MA 2X6RA 3BSFA 3M83A 3FSRA 4Z6KA 3MXTA 3I28A 5HDQA 1KMQA 5SV2A 2IPNA 3RSLA 1ACLA 3QOWA 5LL6P 3L49A 2P6NA 1LBHA 3C39A 4QYIA 1GCUA 5FAKA 1Q83A 4LXHA 1JKJB 3N86A 3H04A 3W7AA 2JGJA 1F12A 2R8OA 1SQFA 2P79A 2ZUVA 4G0OA 3ZV5A 5BWLA 1RBYA 6LDHA 3FOZA 1WAMA 3DC7A 4I9GA 1NF8A 3MF4A 5BSFA 3C98A 2I7CA 4OKIA 1EVIA 1QGUB 1SK9A 4RVFA 1Q92A 4F71A 1G1MA 5J5CA 1J20A 4CTKA 2AXPA 2QM7A 2B5VA 1MX3A 4XARA 1COWD 4Z4IA 3I5MA 4IICA 1I1OA 3GQBA 4KXWA 1KRHA 5AKIA 1Y4SA 3B1ZA 3TOZA 4NJEA 2IEBA 3VHLB 2IPOA 2IYVA 1M2KA 2VPQA 2GUWA 4XIGS 2JFXA 4Q39A 4BRWA 4N12A 1N5OX 5SZHB 4C08A 4DLLA 1TKCA 4BLWA 3CSUA 2E1PA 3QE4A 5K3BA 1G2PA 3H2YA 4PX2A 4FOTA 3LT1A 5J59A 4FQ7A 2PMFA 5IAGA 4B3SB 2IYSA 4ZDWA 3KTAA 4L4YA 3JZDA 2QU7A 1QXSA 4DUYB 1XGKA 4E0BA 2PLNA 4NK5A 4MI6A 1QTIA 1M5TA 1Q57A 4GM4A 2QB5A 4LJ8A 4JH0A 4CIBA 3R8FA 2G1UA 2OGWA 5HZGA 3IDOA 3QVXA 1HT0A 1MHPA 3S2IA 3LXUX 1PJCA 2F59A 3C4JA 3BFKA 4MP6A 4E13A 1FX1A 3TX6A 5HM6A 5KSOA 3JQ9A 5A3JA 1TW2A 3AR9A 3UJPA 4KDRA 4K9MA 4EX6A 1XTRA 4P53A 2VAMA 2OMEA 3IMKA 1W4LA 2WTBA 3L8DA 5HQTA 1X42A 3FB1A 1V11A 2AFVA 4RVOA 3G2PA 3F7NA 1W1IA 1G3QA 3I12A 5DXJA 1FVFA 2WZBA 1MFPA 4LX8A 2CMKA 2WD9A 3K1ZA 3OOYA 5BSWA 2P5YA 3GLGE 3DTVB 4R1LA 1P4JA 3C41J 5DHAA 3ICVA 1T9DA 4UHCA 1P1HA 3EJWA 1L5ZA 3HKBB 1T43A 2ZSHA 2ORYA 1YAJA 2OYSA 2XOEA 1QH8A 2O2EA 1VZ2A 3C15C 3PVCA 4MPRA 3GJZA 3IH5A 4AP5A 4EW1A 3FVQA 1M2FA 2ZBFA 3D7KA 4DMMA 1KEPA 1GUDA 1KDVA 2C5EA 3TQTA 2FEKA 4EEXA 1H94A 2WD8A 3MB8A 1X9GA 3WXMA 1Q0ZA 1MJFA 4LRYA 1EDEA 1EWVA 2H4YA 3G79A 4F6RA 3VPSA 1T2VA 2EFGA 2PH7A 5CA0B 3FTCA 3KALA 4Q4HA 1DB3A 1OCEA 4NBKA 4EP1A 3CR8A 121PA 2NZ2A 3C5EA 2ZSBA 3DE6X 3HB7A 2O8FB 2GEJA 2CDBA 4PONA 4PZ0A 2O5CA 2WUEA 2ZJBA 4WD3A 1OAOA 4DG5A 5EJ5A 1DWPA 3RYTC 4MV8A 1C80A 3X1DA 1FP7A 4AF7A 2HA3A 1VIYA 2ZE7A 4XCXA 1FFEA 4J1NA 5CTJA 3WHLA 4EHIA 5IUKC 5FH9A 1MB0A 2I4TA 1PFUA 3P71T 4QO7A 1MDFA 1ZVJA 2YQZA 3TFOA 2XCIA 1XEXB 1IJFA 4JHLA 5JJ5A 4IGKA 3LLVA 1RWNA 2B94A 2ZYVX 2QLFA 3RG2A 4L57A 4B6GA 3RUCA 5JNLA 2AQKA 3BJEA 1Q0RA 1WHSA 3B3AA 4I46A 2X14A 4ZWNA 4JJKA 3BE8A 4UOEA 1SBHA 1N7GA 2OECA 2A59A 4AX8A 4RVUA 4NMLA 3IL2A 2ZZNA 4QT0A 1NSYA 1W5BA 4E12A 1NHGA 9MHTA 3H8VA 2J6BA 2NT3A 2NU8B 2ECOA 2OFFA 3CB2A 3IEKA 3V2GA 1RM3A 4RH3A 1GCAA 1R0ZA 2HTFA 3DYIA 5AJXA 4HX9A 1KMHB 3UMGA 4CLEA 2VAXA 1N77A 3EISA 5HF8A 5K20A 4BYGA 5T67A 4AZTA 5CD1A 1SUAA 2X40A 1GKUB 4JBYA 2F43B 1BD4A 1P31A 1JIJA 1NASA 1XNHA 1Y1RA 2A86A 2YV2A 3D7LA 3MBOA 4BAGA 4CMKA 4AF6A 2WQ7A 2JAHA 2PM8A 3IVRA 2OVBA 2JHGA 3VR5A 4AZ3A 1NW3A 4PHTA 4AN4A 3GZ4A 1XWIA 2PZLA 4MB0A 4WCFB 3CZ4A 4ZAVA 4YRZA 3F6CA 1AZTA 3OQ1A 2WMNB 3SEQA 2DYKA 2I33A 1ONSA 5BWNA 4JXJA 3R76A 2EZUA 4MRAA 3UF0A 2YQ4A 5L3RA 1PV4A 2E4VA 4Q0MA 5E7IA 2B1GA 4QDUA 4ZYXA 3LM8A 2XI4A 3BGSA 3SLRA 4HPJB 1A82A 3VYUB 5IXJA 10MHA 4I6GA 4W82A 1HYBA 1LTKA 1FFGA 1HORA 1Z6ZA 3PQ3A 3NHWA 1ZD5A 1CUFA 2R00C 4FGUA 4LISA 3RK0A 3DOUA 1UDBA 1WU7A 3QSYA 2HT1A 4TGLA 2DQSA 1A98A 5EPUA 3WNQA 3FUCA 4L15A 3B1VA 3BFJA 4TT3D 3NNNA 1DQSA 3Q98A 3BE5A 1KDTA 4YUXA 3NKFA 3PHHA 4P31A 4Z1MD 2FWNA 5FYDA 4NMXB 4P4SB 3NC1C 1V1JA 4U2BA 2BFEB 2GD6A 3N3AC 3UJ9A 2OYCA 4LZNA 4RPLA 2CLKB 1AKNA 2PYDA 2RCNA 3KVVA 3NONA 4DC0A 5LQCA 3IURA 4KLRA 2QMHA 2JD2A 5AKYA 1Y5MA 3U4HA 4YJHA 1ENZA 1YU9A 5AESA 3L07A 5JFGA 1U0TA 4OHXA 2H1SA 2CW5A 2B36A 4UPVA 2B2XA 1NN5A 3IQDB 5A4KA 5EWJA 4J91A 1D9XA 5G1OA 2OBMA 2HUPA 2QN1A 2VN8A 3UBTA 1L8QA 3BWYA 4RDIA 1XAJA 2JZCA 5AHRA 2TRSB 3DMPA 1S4MA 1XT6A 3LDFA 1XZEA 4Q34A 4BO8A 2YHAA 4DRYA 4WCDA 1UP6A 2DTEA 2OKCA 3R24A 3MD0A 4IM7A 3WYDA 4ERNA 1VE5A 1B41A 2Y1EA 3DCYA 3OCWA 3NIFB 2F3UA 1SBTA 2JEOA 3GGCA 5EZYF 2WD7A 2ZREA 4BB9A 2D1SA 3CURA 4YO8A 2HV9A 2GZAA 3F6RA 3FMPB 1SHLA 4LK2A 2XA9A 2FUCA 1RHUA 4HXEB 2LNDA 2QUHA 2YMMA 3WGHA 2YJZA 1ABBA 3LO8A 2Z6QA 4PZUA 1OVGA 3IT1A 4KC0A 2FB9A 3PI7A 2ILVA 1VBNA 2REQB 1GLNA 2V3WA 4LXTA 1UJCA 3ZD9A 4GKKB 4CV2A 3WIDA 2VUIB 2YS6A 3NH6A 1PEYA 2XMCA 3GG2A 3P0FA 4IQ0A 3KJGA 3MHTA 4O8CA 4DQ0A 5DNYB 4KRGA 3QLUC 2Y1WA 3FKQA 3JQCA 4XAQA 2IS1A 5FLYA 4E1VA 1CVIA 2IDMA 4WK6A 3HDYA 4WJZA 5EJIA 1ZR4A 4DUGA 2GN0A 4F8JA 3JQ7A 3WL5A 4W6QA 4XRGA 2CL5A 4OYYA 3KOXA 4CI0B 2WAOA 3TM5A 2WIDA 3KJIA 3GV0A 4P86A 2FOXA 4BCCA 2PQ6A 2FTKE 2O7RA 4IVQA 3UFBA 1IM2A 1RJFA 5NULA 3UG6A 3VR6H 1N2JA 1YUMA 4FBGA 3PFGA 1X2EA 4IXTA 1ZXBA 2MWMA 4ARZA 4JELA 5KPDA 1I7QB 4J0QA 5AKLA 1VHDA 2ZUWA 1G98A 3CFYA 3K5WA 2J08A 3AF4A 3UMCA 3UGQA 4HADA 3DNPA 2PYZA 1C3OB 3C5CA 4PS1A 4S2UA 1U8ZA 4XFDA 2RH5A 2IUFA 5HMLA 3MAJA 4CKXA 4DXDA 5IT5A 1XZ8A 1A8PA 4L0CA 5K05A 1WP9A 1T2FA 5IKEA 1II9A 4I36A 3UPDA 5K5EA 2BFNA 3DG9A 2W2TA 3DEKA 4U2FA 1JP7A 2YKGA 2PBRA 4IILA 3M9XA 1FSZA 1LRJA 3LK6A 2YUIA 2YYZA 1KZ6A 1HEUA 4QFBA 5CFNA 4ETNA 3A3PA 3E9YA 2ONYA 2IIBA 4B6FA 2Y1CA 1B0AA 3LWZA 2VP2A 3BSWA 3VVBA 5CG1A 2YXLA 5HJ7A 3O8RA 5DN6D 3Q3VA 2O59A 1W47A 5K0SA 1C30B 5KOIA 2KI5A 3BCRA 1ZRSA 2Q28A 4ZI2A 3IAM6 2BRUC 3UV6A 5JDCC 3DEIA 4WJKB 2BJHA 4KUGA 5KYXA 1YZYA 4KN5A 2NZ8A 3AH8A 2ZI3A 1ZJ6A 2QMYA 4TSRA 5HK9A 5TMEA 4CN8A 2VKTA 5H59A 1JAIA 2ZSAA 2X1HA 3DHWC 4RETA 1YDMA 5CXSA 3SQLA 2O8EA 1T5HX 4IKEA 3HVIA 3RSGA 2FXVA 1TVKB 1KEWA 4A0GA 3WKAA 2GAJA 2UZ3A 2R1TA 2ZWAA 1VYTA 2PS1A 1Q14A 2TMYA 3AEZA 3L1VA 2VDRB 3IOEA 2OG2A 5C4MA 1V26A 1E98A 3ZCSA 5JZ9A 2ZXUA 1GLVA 5C5CA 2IU4A 3DVQX 3H84A 1X38A 4JLUA 3HR8A 3LBYA 4ERXA 1KH2A 1RYEA 4UM9B 3TKAA 7MDHA 3Q6IA 2BFDA 4ETWA 4PAGA 1R66A 4RF4A 4IFEA 2DSNA 3HZOA 2FW8A 2MSDB 1MRNA 1NBMA 2QNIA 2B20A 4EFNA 1MG5A 3ISVA 4FILA 4B3TB 4OJQA 5CW1A 3IEMA 4I4CA 4JGBA 1IMJA 1OX4A 4BX3A 3LX8A 3A10A 3FRJA 5IMSA 5IT0A 4ER5A 1BWRA 4IHJA 3MC1A 1FPQA 2GZ3A 3GFFA 3WFJA 4KXMA 4MKHA 1BC5A 4LGYA 3NS7A 2J09A 3ZZUA 4LZWA 3DQPA 1SB9A 5K8JB 5EHGA 3V8BA 3GHYA 3R7AA 2BIFA 3E7PA 2WU0A 3FPCA 4QUEA 1KFKB 2ALJA 3ZWCA 4LSZA 4X44A 4IY1A 1I1HA 3E48A 3KQKA 4GO1A 4UVHA 3EWIA 3ILSA 4AXXA 3HMKA 5HMMA 2HCTA 2CLHB 4HBGA 1QWOA 4Y2SA 1AVTA 3SJ7A 3R0QA 1Y3AA 2P5UA 3A14A 4U7WA 5CTAA 3QW4B 1E9AA 1HXHA 4XQGA 4CKBA 1L4NA 1NDUA 1M3SA 2O2ZA 4CTMA 1AXGA 1HURA 3OFND 4NF2A 3I64A 5B7NA 1WXIA 3BTVA 3UW1A 1OX5A 3ADKA 3AUTA 3A6GA 3Q88A 4A3SA 1R0KA 1II0A 3R7FA 1JU4A 2W2VA 5B12A 4NV3A 1P9OA 3C3WA 3KQLA 1DWUA 1T2CA 3O8NA 4JMPA 5C8ZA 2UVQA 4PRKA 1VJRA 4QOHA 4D43A 5JI2E 3QOXA 4CL3A 1PE0A 2CEAA 2Q8PA 4FE7A 1G60A 1FC0A 1AGPA 1LJLA 1WPQA 1XLWA 3QEJA 3SQNA 4E7OA 5ADWA 1A3CA 3AIOA 4XYMA 1C0IA 4L9RA 2RHTA 2G4CA 5IKMA 2CMGA 2VJNA 3CEPB 3E84A 4MV3A 4YP1A 4CFZA 2ZM6B 1OASA 1SKAA 5FI3A 1OH8A 3ETEA 4OAOA 3O2NA 3VKHA 3DLCA 3O4FA 3P8ZA 3TJZA 4HEQA 3ZWKA 4LCJA 4C7OA 2BI7A 2GKSA 1QHGA 3MJFA 5ALTA 2CXOA 3ONFA 3RVRA 3ZDEA 5TIIA 5EXPA 4NBVA 2C8LA 1POXA 4I6JA 4UNIA 1UODA 2I78A 2OP0A 3WLEA 5JH7F 5IJ0B 1N5KA 3QG5A 4PNPA 2BEUB 2OL4A 4IF6A 1DCTA 3K7EA 4H6PA 1N9GA 2MJLA 3GXBA 2AKEA 2MSNA 1TIKA 2H52A 2VG8A 1ITZA 3E5NA 2RG1A 4GR9A 1YQDA 4ZJPA 4EHNA 1VPWA 3WL7A 4PHCA 3DLPX 2PQ2A 2D1FA 3O03A 4PAMA 1AK9A 3CZCA 3FNQA 5C8XA 4AJEA 3SIXA 1M1YE 1P44A 3K0KA 3TSAA 2CLMB 3ENZA 4PU0A 1J39A 1ZH4A 4KLNA 2CFRA 1T3LA 3GFOA 2FP4A 3SJZA 1SHKA 1X6VA 2HMAA 1L5GB 2QUAA 5JJBA 3A1WA 1AQNA 5D2CA 5CAEB 4F4FA 1M0WA 1J0BA 2CFSA 2PLWA 4FFOA 1U4NA 2F9FA 3T4EA 3HJAA 2ZP1A 1EGVB 1WKVA 2ZIZA 4ILKA 3ZKWA 4PN7A 1KQGA 1N5JA 5TEWA 4G0YA 1OB5A 1NG1A 1NHWA 2GPTA 2WJIA 1QR6A 5J4HA 2FVYA 1F0NA 5HYVA 1S7CA 3VH1A 1GVHA 1YJCA 3PNOA 3IQWA 4UZFA 3T4UA 2YV1A 3EXIA 3GFBA 1DNPA 4HUJA 4CM3A 2QT1A 5JSZB 1NVVQ 1VTKA 3S1AB 3VC2A 3W06A 1KI3A 1OC2A 2C3OA 2BGNA 4M8KA 4NEQA 4WLEA 2Z95A 4QQRA 3GMTA 2A9VA 1APBA 3NVKI 1KY3A 4MICA 3A6DA 1NFRA 2AMVA 4DG8A 3Q3JB 1HM5A 1MXFA 5DU2A 2NUTA 1T5IA 1TL7C 4GOOD 3FMFA 4NXNB 2LRHA 1H69A 1VJCA 4TUYB 1P8JA 2HWWA 3NJ8A 4TL9A 2QZJA 1PG5A 1QS0B 1XR3A 1FMTA 1F0PA 2V4ZA 4ITVA 5L4LA 4I5FA 4M55A 1Z5PA 2OOSA 1JEDA 2X8JA 2ZU6A 3FUTA 2R60A 5IKOA 1QP0A 3O82A 5HDBB 4KL8S 4TXLA 3AG5A 4ND1A 4LRXA 1GNQA 1O57A 3AVVA 3R74A 1EX9A 5JVDF 4P32A 2YICA 4R71A 3G82C 2VYVD 1CY4A 3OO1A 1NT4A 2O8VA 5KYGA 2XLCA 4YLEA 4BGIA 2YFKA 2YTZA 5L3ZA 4EY7A 1WDLA 3X1ZA 4B7CA 4MQUA 2R44A 3ABSB 2C8KA 2G17A 2C2BA 2Z5FA 1S2LA 1ZLXA 2SKDA 4HMPA 3N6VA 1T24A 4ZV4A 2WIJA 1WIWA 3AKEA 4KPUA 3EIUA 4Q3EA 1R5OA 2NADA 2GPWA 4KBFA 3OX1A 4QU8A 4YGXB 2QTMA 3R3XA 3E1GA 1RZ3A 2WF6A 2JS7A 2WPNA 4MLPA 3BS4A 4EZEA 4MK4A 1JAZA 1E59A 3LDAA 1IC6A 4HGOA 4D4LA 1OXTA 1ZCAA 4FC7A 1HKUA 3FFXA 5MHTA 1NVDA 1I2BA 2APJA 4QOGA 4CYMA 5JNUA 1G4AE 2J8ZA 4GT1A 4IJKA 4N41A 2A2ZA 1M1NB 1W2HA 3STYA 1VHQA 3QE2A 1TF5A 2SECE 3C5HA 1IFXA 4INPA 3S1LA 5BW8A 5EKTA 2PX4A 5AJHA 5KDDA 1T8WA 1KEUA 1CVLA 2OO5C 4RPGA 1U81A 1OFUA 1N1DA 1ZN9A 3EVAA 3ZZNA 1UXGA 1ZS9A 1N5IA 3I1FA 1JEQA 1J90A 4GEGA 5BW4A 3ADDA 4YHBA 2BDEA 3K9GA 2QEQA 1PUJA 1E1CA 1QQTA 3TOXA 4JODA 1XOIA 4LBWA 5U4QA 1AS3A 8GPBA 1AGXA 3S2UA 5K0LA 5CFMA 2PUDA 2YWFA 4AYTA 3NNDA 3BK1A 2GK3A 1ZGGA 3QSGA 2BZGA 3QVGB 4CKWA 5HZKA 1R8JA 3JXEA 1LI7A 4QTTB 2WOOA 2WWFA 3OE1A 2HJ9A 1ND5A 1YJQA 1XCPA 3HU2A 1M10A 1RJGA 1T1SA 3C24A 1E3SA 4Z5XA 1OIVA 4QOJA 4OY3A 3AOEA 1JU9A 3RU3A 3Q2OA 3QBEA 2GRUA 3MWDA 1V43A 4JD5A 4WCFC 1KYWA 3ZHBA 4ZC1A 2O3TA 4IIVA 4HVTA 3JQFA 6ABPA 4IYJA 5FPHA 1YVPA 2ZDHA 3W3AD 2Z30A 1H2XA 3DM9B 2OC4A 2Z4TA 4A73A 1E2DA 1LCIA 2D8MA 2VDUE 4G26A 2V45A 3K0CA 3VTAA 4C7JA 3UT0A 4UAVA 4HB2A 5AM3A 2SCUB 4BEBA 3PUXA 3Q41A 3W6OA 2PMDA 1CQPA 2EJWA 3DEAA 5H7XA 2FQQA 3GUCA 3KT0A 1KETA 3U3JA 4BFTA 3I0MA 3LXRA 3E35A 3NDRA 3W90A 3KAPA 1ZGCA 5FORA 2C03A 3TXXA 4OB6A 5EKSA 5FO0A 1U7UA 2UKDA 3RU7A 4HTFB 4AO7A 3TTYA 4IWNA 4N0QA 3VR6D 5LUBA 2O0HA 1VIDA 4HNRA 4CIWA 4PG8A 1ECGA 2JRCA 3CW8X 5F3WB 4KOAA 4HN2A 3SX4A 2ZJOA 5EYPA 4IGIA 4XX0B 2CFIA 1UBNA 3LH5A 4KAXA 5I45A 4E94A 3ENNA 3S81A 5G0VA 1J6UA 2O7SA 1TF7A 4QC2A 5EIAA 1MQAA 5TS3A 2C2GA 1MD9A 5HSGA 2WUGA 4FN5A 3GHHA 5BV0A 4OXNA 1BCSB 3B5EA 4BQNA 1NZDA 3TLCA 5DPMA 3WWYA 4H3KB 1QZ3A 3E23A 3IAXA 2FZCA 4JNKA 4HAUA 1RXUA 4YCJA 1AN0A 3EDRA 3EVNA 1TD9A 5I5EA 5SYNA 3A06A 2WT8A 3BQMB 2J4CA 4NAUA 4OJTA 3W5AA 3GVCA 1AKTA 2C61A 4GI1A 5L51A 1C9DB 4NCNA 3KV3O 3I9V6 3KD2A 3HM9A 3JTMA 1GARA 3JARB 1U3CA 3K6RA 3NYRA 4OGGA 4U7GA 5TXGA 5BWCA 4GZLA 4RV9A 5AO9A 3TLAA 1UDXA 1IQRA 4HNQA 2CJWA 3C2QA 2JVKA 5FFMA 2BM9A 1SELA 1IBMB 1RYMA 2R5FA 1I4DD 3F9CA 4HH0A 3K8YA 5CPBA 3TRKA 2IITA 3VYVA 5BNWA 3FJYA 2VSOA 3TH5A 4EW2A 2HZ7A 5MN6A 4CEJB 4OHPA 5EN4A 3GW8A 1A69A 3Q8XB 3WDSA 3BXZA 3DL4A 2GO1A 4X45A 5BRJA 3OT4A 3MNFA 3K6SA 2ZS7A 1ZHOA 1JLLB 2QJOA 5GVRA 1R5BA 3VU0A 1ZSYA 4EX7A 2IF0A 4N54A 4NBUA 4RPJA 4HFRA 4R1PA 1H3NA 4H4DA 1P4SA 3RCBA 1MLDA 1UJNA 3TQHA 4UEQA 5IN4A 3K5IA 3O47A 4EI7A 5LUAA 2HSEA 2OBNA 2ZI9A 2A1TR 4QAJA 2ZBUA 1ZWKA 2HLDA 1QGED 4JLVA 4C1NA 3NHJA 4DQUA 5CVVA 2F1HA 3O0DA 4HATA 2BZSA 4JLJA 3A37A 1I3KA 3NW9A 5CURA 4C4OA 1Q12A 1J7KA 4Q4CA 5K7SA 1VXRA 5ALZA 1EM8A 2I4NA 4QJBA 1C9KA 4RD6A 2C29D 1IWPB 2PH1A 5K4AA 3ACDA 1IDOA 3LVQE 4TMFA 3I34X 3OCCA 1KAGA 2IVZA 3CYFA 3KPJA 4QQNA 4N6OA 4QA9A 4IUCS 2F64A 1T5BA 1ATZA 3BF7A 3JRNA 3KEQA 3UWPA 4DCNA 1S6YA 3D6MA 2C2KA 1B42A 1EAMA 4G5OA 4NNOA 1GQOA 1H4TA 2JIBA 5CFRA 4O2RA 3A1UA 1R6VA 5T4FA 2YXDA 4QU9A 1RWPA 1I5EA 1LBEA 3B7WA 3EEIA 1JW9B 1S2DA 2X9LA 4AMVA 4KPEC 1N2CB 3UATA 5KTYA 4J6FA 1E3DA 1DDIA 1T2EA 3WWOA 3WMXA 2RG7A 3EQZA 3L18A 1QYIA 2NO5A 4XDYA 1F8FA 2J7PA 2JHCA 3OCVA 3IP7A 1WMFA 5ICFA 3ZWOA 2UDPA 1NFFA 4GM1A 1OLSB 4KK3A 1T4CB 3O9ZA 1EFUA 2PDAA 4QEZA 3A4NA 3K9NA 1NONA 1QV7A 1JFVA 1G8GA 1FYEA 1ML3A 2HEGA 3KP1A 4JR2A 1LDMA 2VWHA 3WK7A 5KWJA 5L7TA 4AKGA 1KJJA 1L6RA 3LC0A 1JPVA 3ZDQA 2FI1A 2NV6A 3GRVA 2XZDA 4ONEA 4FU0A 4EKEA 3A9WA 1TYEB 3F5SA 3TIFA 4A82A 2P0YA 2Q49A 2R8RA 3GP3A 3PICA 5CYOA 3KJEA 1PSZA 2ZT6A 3O95A 4J9UE 3AEUA 4AN0A 1T1EA 1AG9A 1SOUA 5J4LA 4DE5A 2I3ZA 2J9FA 4RV5A 4DLPA 3UK7A 3VSEA 1KI2A 3QH4A 3ZXYA 1SG0A 1U1DA 2GVNA 4LQDA 3LKBA 1UP7A 4LV5B 3KLMX 4PTLA 4COKA 5C5DA 3AL0C 1GO2A 3LBFA 4ZZIA 3CNEA 5CDFE 5KYUA 5BV7A 5IUNC 2OVFA 4IX9A 2IUTA 3KT8A 4ZO9A 4JLKA 5TGTA 1G5PA 3ESDA 1GTZA 3HA5A 1NQTA 2YXEA 3FTPA 3H19A 5KWEA 1A5SB 2QV0A 1PR9A 3QV2A 3N2NA 5DOZA 3N0WA 4BFUA 1MOSA 4XR9A 5JG7A 3V1NA 3KSZO 1XP5A 2IV2X 1VL6A 2BTOA 2SKEA 3KLBA 5FL7A 1OBOA 3HMQA 3ZZTA 5K6TA 3BMCA 2ORIA 2NUAA 5DRYA 3RIEA 3PYMA 4HP8A 3PXXA 1HR0B 3GDOA 1R6AA 1W35A 3DWGA 4EMBA 1Q1ZA 3D3QA 4OSOA 3BWDD 4LZPA 2HR1A 3A6EA 4HS4A 4EARA 3CHYA 6CHYA 5HOEA 3ENKA 3UAZA 1IY8A 2D62A 4JJ7A 1F8UA 2WF7A 5FCDA 3GLGA 3C3MA 3BGIA 4EHHA 2GN8A 1H85A 1K0FA 4Y98A 4BKUA 3GCDA 5IFLA 4JA0A 1QM5A 2XVMA 4QBFA 4K9KA 4DJAA 2FEWB 1H22A 1GFSA 4GMDA 5I48A 4N6GA 4YDRA 3L0CA 3WKEA 4YPOA 5CA0F 3BD8A 4LF9B 4AM8A 5FWXB 2QG6A 2ETVA 1P7CA 3B1XA 1L5KA 1XA0A 5E4YA 5K8LA 4J9VA 1TZBA 2BUBA 4M8LA 5A9TA 1Y7HA 4U7HA 3VI3B 5TPWB 5LJLA 1YZUA 4EKDA 2FSHA 3P2KA 4DDVA 2IOHA 1KP3A 4Z3DA 1IAQA 5KJCA 3PC6A 4E3WA 1KI8A 1CVRA 1ZEJA 1Z18A 1Z88A 3CRW1 3C97A 2WPDA 2RI1A 3WQHA 4D6XA 4N0EA 3B6JA 2D2FA 4ZMBA 1GPKA 3WS7A 1IK4A 1VI6A 4LGCA 4Q01A 2UYCA 1L2TA 1XJCA 3GAZA 1NLUA 1X7GA 4BTVA 3T1HB 2DERA 3K0AB 4ND5A 3WAJA 1X7WB 3W6NA 1RRPA 4O0MA 4FEEA 4ER6A 5WRFA 1JHYA 3OEWA 1PEDA 1WP4A 1DAOA 2P3QA 3S4YA 5L7WA 5KVQA 2ZRQA 3FOBA 2IHZA 1QAOA 4AZWA 5LQAA 2QHXA 1AHNA 1Z25A 3F8WA 3K5PA 1L4KA 3WAKA 4XLLA 1Q16A 3I4LA 3GLFB 3BTSA 2VATA 3O3NB 4YPFA 4OUDA 4CLOB 2G28A 4QPNA 5BN3B 3H5RA 4KQGA 1CIVA 3S2GA 3OIVA 1YIOA 2C54A 3NANA 3DZCA 2X13A 3GAFA 3FI0A 3KYIB 4MP3A 3QU4A 4OPMA 3OIYA 5KNLA 4ZTBA 5KJEA 4YRTA 2CYAA 3EZLA 2V0CA 3EBPA 3IMCA 3NIBA 1L8XA 3QMVA 2RGGA 4CIYA 4YAGA 3O2JA 4TTPA 4BPBA 4XDZA 1Q7CA 1AK1A 1RNLA 3KDAA 3VDNB 3CEMA 3ZIAA 3VR3D 1EXMA 1PR4A 4RKQA 1ZITA 4FYVA 1KRXA 4J90A 1IJEA 3ZXSA 4M8NE 4L6AA 4H16A 1NI5A 3FFWA 4XFJA 4FBMA 5GQSA 1EFVA 3AVQA 1ZGJA 4IDEA 1WXGA 4RX1A 5JAUA 3L9XA 1TM5E 4Q6WA 1X1CA 3PE3A 4IFBA 3WK8A 4KO1S 1D07A 1OSNA 4HXFB 1QO9A 1FFWA 4MWSA 4X1YA 5ELLA 3ZDCA 2C98A 3ANTA 1LNQA 1EA7A 2NQ8A 4TRNA 3NKLA 3IQEA 4BWFB 5H0IA 2ODAA 3EZ9A 4XPIB 4CDGA 1XDUA 1NQAO 3L82B 1GUBA 3M2PA 1WZIA 4LI0A 5L40A 2IXGA 1W2WB 1RKVA 3OF3A 2VDPB 1BROA 2ASVA 1ADCA 4ZEWA 4FUTA 1N4DA 1YS4A 2W6NA 1EIZA 5ALUA 4EA8A 2X3FA 4OBXA 4J94A 4TZ0A 2AJLI 3R40A 1TU0A 5DB4A 4JT2A 5K8VA 4WXMA 5CA1A 3D2LA 2NQTA 3H6HA 4L50A 4BNXA 2QX6A 3WGKA 1E2EA 3T35A 5EINA 2ZJZA 1R9JA 3NEJA 4PF1A 4K46A 3UMFA 4JEHA 3GT3A 3Q11A 3KM0A 4IO1A 2EKDA 4RD2A 3IUJA 4JLMA 1T8PA 1U7OA 1P9RA 4UXHA 5TC4A 3PENA 3GLVA 4OX9Y 1Y1QA 4G8CA 3RKUA 2O2SA 3D6TB 3T0FA 4CMEA 2ZTLA 1LDEA 4NS1A 1KWGA 3PUWA 2XJ4A 4L76A 4CG2A 1PZGA 4RWZA 2RBKA 5KU7A 1DQYA 1S0UA 3M82A 4L9AA 2FPIA 1F0KA 2FWJA 2JAUA 2Q41A 1H5UA 2DKNA 3F71A 4I6EA 4M8IA 1VFNA 3KTDA 2FZLA 4WMLA 5BV2P 4YT4A 1II8A 1XDDA 4EHBA 1K2VN 2IXDA 3KQWA 2HA7A 1VI5A 1J97A 5EQTA 3WV4A 4FGZA 1DT3A 1YNOA 3ZXUB 3FNIA 3FYCA 4B87A 4XVCA 1NKTA 4YASA 2B7BA 1UZMA 1DJPA 3CRQA 5E6UA 3E7FA 3UT6A 1OLXB 1CR4A 3RVPA 1TVMA 3R9XB 2ISCA 1H1LA 1U3FA 1P1IA 4IOMA 1NUSA 4KVGA 2HUNA 1V4VA 2WINI 3IJPA 4MUGA 1V7CA 4R2KA 5IC5A 4KFRA 2JBHA 2WKRA 2XQJA 4G0UA 3ON5A 4RKWA 4N3AA 3PZRA 3W04A 4OG2A 2JGAA 1AMUA 4KJZA 3GIWA 4X6YA 3GT4A 1F2DA 1G8FA 2F1OA 2X4DA 2Z6VA 1KH3A 3HBLA 3NBZC 4G5XA 4PZAA 2E55A 3N6RA 4BVJA 3ZLTA 3GWZA 3H13A 2PXCA 1XN1A 2QOEA 2FFRA 2Q3JA 4BNLA 1CB7A 3CH4B 4RNCA 3VBEA 3ZE0B 1CJBA 1PDOA 4YRRA 4J4TA 3WNBA 5ELXA 1F6DA 1QVVA 4M86A 3QLVC 3BMQB 4GC5A 4DA6A 1TAUA 1YCGA 4H17A 3HKDA 4QDOA 2ZSDA 4MVJG 2G09A 1USIA 4O4HA 3ZE1B 1K5PA 3GLKA 4PBRA 2FG5A 3F1KA 4XUGB 2LKDA 4I8XA 3RKRA 2WMOB 3TKYA 3KSRA 4POAA 3NXKA 1D6NA 4G5YA 1RFLA 1JI0A 4DY4A 3FHOA 2FPUA 2XRZA 4Y18A 4Y9DA 3JAMA 2A0YA 4LMRA 3ILYA 3R0IA 4RABA 3FPSA 3IODA 3WMFA 2D1QA 2ZK7A 3WMRA 5FAXA 4Q47A 4ARUA 1AE1A 2EFJA 4B3FX 2FZGA 4Q7KA 1NWCA 4H6XA 1GTJ1 2YWEA 3DO6A 4UTZA 4YRLA 3LCRA 3SZGA 1FS5A 1QE0A 5CXQA 2V58A 2CE7A 2ZLBA 1XE3A 4BVBA 1FNCA 1EBBA 3SD7A 3WNVA 4EPXA 2UAGA 5HF5A 3DVSX 2W6IA 1GTRA 3N0TA 2CYCA 3OCJA 3C3CA 4X8OA 1PUXA 1ODJA 2OILA 2VCEA 5KTTA 1NOJA 1J0EA 1JDJA 4IDDA 2YVKA 2QLMA 2IU3A 3ZHOA 4KN9S 4ES6A 1WD7A 1AB6A 1XQXA 1EPUA 5DASA 4KACA 3W6UA 3LQYA 1XPOA 1WLSA 3FNGA 1K08A 4F21A 4C9BA 3SWWA 3N8HA 4AYWA 3LG2A 1ZAKA 2C9OA 4KSYA 5L3QA 2WWYA 3CQ9A 1YMUA 3SE0A 5ADUS 1BQ3A 1KJZA 4M0UA 1FDTA 1I9GA 1QLWA 1FLNA 1GKLA 3CLUD 2JBWA 2K5UA 3R4CA 2HJVA 5I4KA 5KDLA 1EUDA 2O14A 5BOVA 4RESA 2IVFA 4QPPA 3M6VA 5DGXA 3T9EA 3V55A 4UHBA 4DLVA 4P58A 5HRAA 2GBIA 2AFIA 1T3TA 3QE3A 4X3PA 4YC7A 1I80A 5H68A 1EXVA 3BL8A 1D8TA 3BG5A 4ZREA 3DPSA 4TS1A 4BE9A 3F98A 5ABPA 4BLVA 1TECE 4K7JA 2H06A 4RD0A 5K1ZA 3OJOA 3S55A 3VU9A 4DVJA 3U44A 4BNIA 1ZGHA 3I0NA 2I4MA 3V33A 1DKOA 1J09A 1KI7A 3K9CA 1U9IC 1IYZA 2IKQA 1H6AA 2ARKA 2HHAA 1A95A 2Q6IA 3CU5A 5GZ3A 5CT4A 2YN0A 2H0RA 3B82A 3QU5A 4MIEA 3SQMA 2EYQA 3WIOA 1Y8QB 4GXQA 4XW2A 4G5GA 4YHHB 1S96A 4EB6B 4INZA 3AZOA 3EIOA 1GEEA 3CX8A 2V7QD 1PKEA 3WZLA 2DPXA 2Q2NA 1E1YA 1Y89A 4QO8A 2Z8XA 4Q7LA 5FULA 3ZIUA 5ENVA 1H65A 1YJ5A 3GEDA 1F2VA 3U1VA 3EK2A 2FPKA 4L0DA 3ZXIA 5LP1A 3KFVA 4RTMA 3LW7A 3R2JA 3UQYS 4EG5A 4HFNA 3BL5A 1XIVA 2PV7A 3OETA 4NOJA 3QHPA 4MVJF 3UMVA 4CLRB 3E4CA 2OQIA 2Q5CA 1ZSVA 3VU3A 4ZVOA 5C8YB 3B36A 3LUPA 1CEQA 3EGXB 2GVZC 1ULTA 4L07A 3M89A 4I66A 3CUTA 4NBNA 3RIYA 4EHJA 1R4MB 2VUUA 4FOLA 4JUCA 4YR7A 1B16A 4O4IB 4MKFA 1RAGA 2IX9A 2D00A 4MUJA 3OZBA 2OC9A 3FIUA 2ZWOA 4OYRA 2OK8A 1T5SA 3AZPA 1JE1A 1HKHA 1V9CA 3NEAA 1MB2A 1VL1A 4I4IA 3GVIA 1I6KA 4TMVA 3N2KA 4G8BA 1YJBA 4MTLA 2ZYTX 3SXUA 3DL7A 4HWRA 4AURA 1CJUC 1VLVA 5FPTA 5K09A 5LZ2A 3ETJA 3ETCA 7REQB 1HTTA 4F7DA 4KGVA 3TRJA 5TJ9A 4ETIA 1Q0TA 1W19A 2P27A 3GFSA 2JFHA 4OB8A 5C4GB 3W1WA 3KKNA 4J16C 4KQIA 2V7TA 3CUWA 4KXXA 3MJSA 5B3AA 4G2TA 1UM9A 2ZRKA 2WG2A 4RFLA 4WY2A 1ZW1A 3CONA 1YFKA 3WBJA 2HJGA 4EI8A 4WEOA 4I4TA 2X5XA 3EXHB 4LXUA 1MC5A 3MGCA 2R86A 3R3ZA 3DA8A 1P5ZB 4FFNA 4WAUA 4ZVPA 3RM3A 3LUDA 2HJRA 2P8JA 3O75A 2C7PA 5EIBC 1U2GA 2ZBEA 1Y5RA 4OLJA 4XVRA 4CF7A 2XVYA 2WJVA 5H82A 2VHJA 2OV6A 3RF7A 2HNKA 1QFSA 3A8TA 2R1ZA 5DNDA 3WRWA 5K0FA 4FZRA 1SVNA 3N59A 2CD9A 1WCIA 2Q6VA 3QY0A 1ZDMA 3RVJA 2EW8A 1M1YA 1IPEA 5BQ5A 3JVDA 1XJ5A 3ZLUA 3CVUA 1RLMA 5FB3A 4BFZA 1FTSA 1VL5A 3PITA 3A1TA 3DL0A 3PE4A 3FCEA 1XCOA 4XIFA 4JEUA 1DAPA 1R3UA 4X6UA 3RVDA 4YREA 1STOA 2VSYA 2J3EA 1P3JA 2YJ4A 4D3YA 1Q3KA 2EVWX 4FT2A 1RXCA 4JX9A 1YJ8A 3PDWA 1BXGB 4NEGA 1HMYA 1YDGA 3AB3A 2Q9UA 4D4KA 5A4JA 4F93B 5AIAA 5JS8A 4TKLA 3VPGA 1EA5A 2O2JA 3TW6A 3NDIA 1XZBA 4AS2A 4TLBA 1O9HA 3CNQS 2BFBB 4LWPA 1S3SA 4YXWD 3VR4A 3EMBA 1ZN7A 4KZPA 2WWVD 4MVYA 3DTTA 2B1IA 4N39A 4I9NA 2RKBA 1VIMA 5C81A 3KDSE 4GKJB 2VRWA 2BGIA 1ETHA 3KWFA 3KJNA 4TUYF 4RJKA 2YVAA 4GXTA 1N6PA 1ZY2A 3DZGA 5DCYA 1RZRD 3AF5A 5K4HA 2YW2A 4FNGA 4D4JA 1QPBA 4WPGA 5LDHA 2HF9A 4P1ZA 1QIKA 2PXXA 4I50A 1H2BA 4KHZA 4EATA 3H5IA 3GBVA 4IDAA 4UJ3A 1DTEA 5EZ6B 4ALMA 5A5GA 5JCJD 1JEYB 1DQZA 3AUXA 4ZQIA 1N7HA 1WTCA 4N3BA 2NLOA 3ONVA 2JCBA 3JQGA 3RS3A 1KOJA 1XU4A 1O89A 2IYZA 3OCZA 4KAAA 1UMCB 4CFYA 5F12A 3Q9NA 3RC7A 3HN2A 1TMGE 1HDYA 1U1IA 2MMGA 3HV0A 4ZVNA 3UENA 4OLAA 4GPD1 5BYJA 1V1RB 2WWTA 4BP9A 3SZUA 1K27A 5D3MA 2IV3A 4JXKA 1TO2E 2I7TA 4DA8A 1KYTA 2IYAA 4A8JA 3ZWNA 2WJ3A 2VTKA 2C7GA 1G8YA 1YFJA 1NU8A 1SUDA 4L8WB 3SSOA 5H1YA 3RVBA 1CZLA 5ETJA 4RA9B 1IHOA 1W85A 1Z7EA 1IN6A 1O94D 4OBBA 4Q9AA 3B9PA 1JKXA 5HE9A 4KITB 1PR6A 5HOQA 2J0UB 3BX1A 3G2KA 5C5IA 4UASA 3I92A 1X80A 1YCFA 4PICA 4LJ7A 3OHMA 1U1FA 1LNSA 1UMBA 3HCCA 1QWSA 3SFTA 4RZQA 2IS2A 3BH6A 1B6RA 3CISA 2O8DB 4AJ2A 1ZCFA 2ZJ3A 3LPMA 1SXJD 2YW9A 1ZD1A 2DQ4A 3IE1A 3REQB 1I1QB 2MT9A 4I1SA 2WG0A 2BM8A 1RRMA 4NVRA 4LHWA 1BN7A 4AZVA 1OREA 4OQXA 1I4WA 3D5EA 4MDHA 2J59A 1Y3DE 3RB8A 4MVJM 4YMLA 2XYRA 3G0GA 5AOBA 5C1IA 1BHO1 2GNOA 3OTWA 2H0AA 4Y0NA 1D04A 3L0PA 5FTLA 3GD5A 3CUYA 3AFGA 2DCUA 1TYAE 2YRFA 3K2BA 3QUAA 4GL4A 1ZN8A 3LQRA 2G9ZA 3E18A 1M2OB 3ECSA 3PB3A 1XA4A 4PYKA 4RL6A 4ZHQA 2JCGA 1NSFA 4YRSA 2W42A 4M54A 2ZB4A 2Q2QA 4FDLA 1I01A 2E3JA 4MKRA 1JG6A 1T6ZA 1ECPA 4M1YA 2FEAA 2H18A 5AK6A 4CLDA 1GP2A 1W4AA 4WK0B 4YJ2A 4TYPA 1U8FO 1QIMA 5M34A 5T6BA 5DW0A 2FA9A 2HA0A 1DC5A 1ZD8A 4MQFA 1C1DA 5GONF 1NN0A 4CM8B 4CKEA 4V1CB 1SQ6A 1M1XB 1NR5A 1NVEA 4GNRA 3ZIDA 3BILA 4V0ME 4PQGA 1YZTA 3OQPA 3ROFA 3TS1A 1RM0A 1K2WA 1U0EA 5DTMA 4YWJA 2IBTA 1YGYA 3LP6A 1KOGA 4HWTA 1W0KD 3BWBA 1ODKA 4D4MA 1W7AA 1FYVA 4M6WB 1W5EA 4H0FA 4OXIA 4DLNA 2ASEA 2WFZA 4JI0B 3MMPA 4I2NA 2H11A 4DSAA 4CF3A 2ZULA 5EE9A 4JP8A 4R84A 1EGHA 3SF8B 3VDMA 2XMGA 3U56A 3OJEA 1QIFA 3RJTA 3P4UA 1XZQA 3GZJA 4EWLA 4HNUA 2VHVA 4YUVA 5AM0A 3PC8A 3DO8A 5F4BA 4EJMA 1NUQA 1RU3A 2Z8YM 3KTOA 4MUHA 1GQYA 3JD2A 1DAFA 4HCJA 1CQWA 2IL1A 2EL9A 2UV8A 4EG3A 1ZHHA 5DVZA 2QE7A 2HXSA 2LE0A 3QELA 3IMEA 3KAJA 5A2GA 5DM70 5ARBA 2FPMA 2G76A 3F73A 1QJ4A 4ZQGA 2GZRA 1XEWY 3LFHA 5ICCA 1UKBA 1Q91A 2DFTA 3ULKA 2FDCA 5TE9A 2IWHA 2C4UA 2AN3A 2D5IA 4KDEA 1ZYUA 2UUCB 4GRDA 4JY7A 1P7PA 1E79A 5PGMA 1GQRA 2VP4A 4PVDA 3HCEA 1KSJA 4UTPA 3FBWA 5JDIC 1OTXA