1VSQA

Solution nmr structure of the productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
132
Chain Sequence
TIAIVIGTGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVETGREGVKALKAKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannose-specific phosphotransferase enzyme IIA component
publication title Solution NMR Structures of Productive and Non-productive Complexes between the A and B Domains of the Cytoplasmic Subunit of the Mannose Transporter of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 43
structure length 132
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.1.191: Protein-N(pi)-phosphohistidine--D-mannose phosphotransferase.
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 1vsqA00
2JZOA 3LFHA 2JZNA 3GDWA 3CR3C 4TKZA 1VRCA 5IM4F 3B48A 1PDOA 3MTQA 3BEDA 1VSQA 3GX1A 3IPRA 5T3UA 3CT6A
chains in the Genus database with same CATH superfamily
4TLAA 2ASVA 2C78A 1QVVA 3Q7PA 3LRXA 3QJ5A 2JCVA 2J3DA 2O1SA 4CKBA 2ZI7A 4ZZ0A 2YJZA 3FFWA 4AWBA 2BFFB 2GM4A 4R7ZA 1DEAA 3AG5A 3FPAA 1P17A 3GZ4A 1ISJA 1X80B 4LYDA 3SYMA 3TLXA 1ENYA 1ZZGA 2G9NA 1C9NA 3M6MD 4LZZA 3DH0A 3KVRA 3GK3A 3TLZA 3HY3A 5GJWC 1Z36A 3BWCA 4B4KA 5CB4A 1R8JA 4Q7JB 4QQKA 2JLXA 3S1AA 2R4UA 1DCTA 3ITKA 3DVLA 1S01A 1GEGA 1TCBA 3IAFA 2C42A 4QFMA 1B93A 2PZJA 4L1KA 4DA6A 4DLTA 1BO6A 3K7EA 5E4TA 1X7XA 1Z5ZA 5JS6A 2E4AA 4CCYB 3CRMA 3LCVB 1H85A 4UREA 3ROZA 4BFWA 2FRXA 3DTYA 1ZR4A 4HH1A 3D8BA 1XDZA 1SQGA 1ZWKA 3C3AA 3HZOA 3VAZA 2C2YA 3LH5A 4N76A 4QXQA 1YOBA 1H2BA 5TMEA 2OFWA 4E7OA 2PR7A 3F1LA 3WRYC 1G8GA 1SGWA 3FKSD 4O2AF 2IEDA 3GX1A 3JYQA 4K8RB 3T4PA 3WC4A 2QXYA 3LFTA 2YFYA 4UAUA 1GTSA 2CSXA 1UEJA 1NYQA 3L7IA 4ZYXA 4TWAA 3QKSB 4EJSA 3MGCA 1YB7A 1Y82A 4RGVA 4ICIA 3ZU5A 3GLGA 2O3QA 1AUQA 1BKYA 4WY2A 3E81A 1U7PA 3PL1A 5DV9A 4F0JA 4JXZA 1X3LA 4ZAZA 1Z4IA 4JXKA 2YZ7A 4FYMA 4Y2QA 5EQTA 2WICA 3LBHA 1WHSB 5AICA 3PBKA 2QZSA 3GY0A 4B3HA 1QK4A 3T6KA 5C8XA 1A27A 2A58A 2X0JA 1A4RA 4GS5A 4EGSA 1MZVA 3QBTA 1U65A 1Z4LA 4XOIA 1BXGB 1JA1A 1ZN7A 5H4GA 3EODA 3ZW8A 1JFVA 3C8DA 2F43A 1O6CA 1QMPA 1PQPA 2YCBA 3K9LA 3HA5A 4PAMA 5TF0A 4C43A 5JY1A 1CG6A 3QLUA 1O5TA 1DT5A 2VXOA 3SXPA 2O5VA 4Q01A 1K2WA 2Y3IA 4YP9A 5JH7A 4KE8A 2DQYA 1U90A 3O8QB 4KDCA 5AVRA 2PZLA 3IPLA 1LRJA 4QM7A 1NP3A 1CUHA 1PJ2A 2W6CX 2OCPA 3I2JA 3ZCVA 2DEUA 2ZGVA 3DAFA 3PA6A 7AT1A 2R6HA 3O9ZA 4KQMA 1PUXA 5L7YA 3RV3A 2GJ9A 2IOFK 2MSWA 4MJ7A 3DR5A 3ZQUA 2AN4A 3ECSA 3RVOA 4EGQA 1R4NA 2H08A 2YN2A 3LOPA 3HXTA 3ICPA 1WO8A 4HUTA 1N3BA 1JEAA 3FCCA 4QHYA 3L8GA 4YA6A 2G28A 3TW8B 2DHDA 1RM5A 2BN4A 1QE5A 2ZIUB 1QB7A 2PRZA 5EEHA 2RKOA 5F1YA 1KTIA 4E12A 1QU3A 4S3MA 2H4YA 2Y0PA 4DJJA 1W5EA 1CJVC 2DF8A 3I32A 1H05A 3JTEA 3H1FA 2QM0A 4N0EA 3TQRA 3D2BA 1T15A 2H57A 2CLEB 3LSTA 4LJ5A 2WW8A 5EJAA 2PANA 4ERNA 2JFWA 2V1XA 4DEVA 2EJTA 3A9TA 5K0LA 2D54A 3E5MA 2GD0A 1QS0B 1HTTA 1LPSA 2IOFA 3G0DA 1YZVA 3KOUA 1VXRA 5LWHA 3R9XA 2EATA 5IUNC 2HU2A 2B3TA 3RUPA 2YIDA 2Q6KA 3COPA 2PGOA 4AQ7A 3RLIA 4Q4HA 3UWSA 3TD2A 4MI1A 2HIAA 3I8OA 4EF4A 5KKAA 3CX8A 3EHDA 3AM1A 2LKDA 4R69A 4U8GA 4EHBA 2PBRA 2FX2A 2XCQA 3RTCA 3G0OA 4JVNA 2R8XA 3DAOA 3WB0A 4IIGA 3C6KA 221PA 4IILA 4LHVA 1I80A 1Z6GA 3JAKB 3PC8A 1NXOA 4XDZA 1S7CA 3VU0A 3FHLA 3PNLA 4I36A 1K7FB 1EDDA 4NH0A 4Q9AA 4X8OA 1HOXA 4B4UA 1MDFA 1DIGA 2XZOA 1NLUA 3ZD9A 4KR6A 1FDVA 1TQDA 2FP4A 3JD1A 1HQKA 4MW7A 4PG4A 5TQ0A 1PK7A 5COAA 4TXLA 2ZYDA 4GHWA 4EYGA 1Y8ZA 1V8BA 1XRMA 2H1SA 3VUFA 1Q95A 4JZYA 4TWRA 4Q4JA 4R2JA 4BC1A 4HV4A 1W36D 4NS1A 3WIBA 3CJQA 3DTVB 5AW5A 2ZP1A 3D0QA 4Z4FA 4P35A 3IUJA 2UYQA 2ACKA 4KN8A 1ZC4A 4O59O 2YZGA 4RJJA 4C87A 1O95A 3NTXA 4EY7A 5F51A 2X5JO 5HOEA 1AMOA 4GAEA 1EX7A 5CVTA 1LI4A 2BM0A 1E4OA 3AVVA 1NFFA 1OLUA 5ARCA 3BTOA 1BGWA 2O3JA 5JJIA 3BTSA 4MZXA 2WSIA 1FRQA 2ORWA 3SHOA 4LF9B 4P86A 4FDAA 3MCVA 1BS9A 4B5KA 2X8BA 2WQZA 1RLIA 3R77A 1Y9EA 1V9CA 2GD2A 2PGJA 3STXA 1C7RA 1CT9A 3N1UA 4KVGA 2DETA 2WUWE 1IATA 1OILA 2Z2JA 1P1FA 1YZYA 5DNAA 5DNUA 1U28C 3TMKA 2VO1A 4R84A 3F3YA 1WUJS 4PHFA 1RAHA 4S1PA 4X94A 4KQXA 1ZVJA 2V9ZA 2W70A 1OXSC 4EG1A 4ESHA 1EWYA 4X6YA 4HCJA 1UZAA 1XK6A 2GEUA 1MENA 4M0FA 3EDQA 3EOBI 4GSLA 4YJFA 2IV2X 3S68A 1U4NA 3E48A 2VZLA 4MUGA 1XTSA 4X60A 2VUIB 5A0VA 2FQWA 4LJYA 3I62A 4AN0A 3ZK9A 1A9QA 2IUFA 3PSHA 3QBDA 2XMBA 4IZHA 4CQNA 3HKEA 1AHPA 3B8HA 3WIUA 3ZQ4A 1KAMA 2HC9A 2R00A 2YYAA 3BGDA 2ZS7A 2FYTA 4KQHA 5DI3B 3SSMA 1C3OA 1XKXA 5IDQA 4D4JA 1EFVB 4X1OA 3ANYB 4LYYA 4JHXA 2VSQA 2ZVDA 3EEIA 3JQDA 4BNKA 4OQMA 3C16C 4P53A 3EGEA 1WDTA 1ISGA 4N1AA 3SDSA 2CN1A 3AUUA 4QGBA 4YMTA 3W2EA 3NRJA 3S0JA 3H2JA 2H31A 4AKGA 2XMZA 4BNXA 5T64A 2CDNA 1E6WA 2GCEA 3WDLA 5I4BA 1P1HA 3GEGA 2JLAA 2PV7A 2IITA 1JYSA 5A9SA 3WZLA 1PVOA 3Q10A 1HYHA 2NAFA 3NBXX 4DT1B 4IP0A 3IMFA 4EHAA 2A9RA 2GESA 2G9RA 3CURA 4KYVA 2DWCA 2YWJA 3IEPA 2OCBA 4TWBA 1CKEA 4OAOA 4EF5A 2Q07A 5JUWA 4O2BA 3GQVA 4U5XA 1PQWA 2VC2B 2FPWA 3QW2A 2BZ0A 2YRFA 4FFSA 4N3NA 1CJMA 5E6RA 3DDCA 4C6TB 1G0NA 2VYNA 3DKPA 4KSBA 3FG9A 1QK3A 5FYDA 3QEAZ 2NNLD 1Q74A 2OBMA 5JSUA 3SWWA 3THWB 5L3SB 1K4YA 3I6IA 4GVXA 2G1JA 5E2AA 1IJFA 1PUJA 2UZ3A 5B1IA 3IMEA 2HDWA 4NESA 4QUAA 5C37A 4AECA 3Q8XB 4URVR 2NQ2C 4BB0A 4F8YA 2HJWA 3Q0TA 2XYRA 3AKZA 1H4SA 1VCNA 1GVHA 4XX0A 4A8JC 1D6JA 3AWDA 1D2GA 1P75A 1ODTC 1RLUA 1VA4A 2IIVA 3JW8A 1NW7A 1W88B 2DFKB 4MINA 4O2LA 5FTNA 2JK0A 3B1XA 4YRRA 3RT7A 5FTLA 2ODNA 1NVDA 3RIMA 2QZ4A 3PFCA 4KXFB 2FEAA 3LO8A 3MM4A 3GJQA 3NCTA 5AO9A 5D3MB 4BFLA 5CBPB 4B3RB 1R6TA 5I7OA 1JU3A 4OHRA 5ALTA 4EG8A 2WBLC 5M29A 5EJ2A 1T35A 1E9BA 1EFPB 5HKLA 4TYNA 5CBKA 2XHEA 1KMMA 1QH1A 4BEVA 4DIMA 2BI4A 2PX0A 1CVRA 4FI3C 4RFSA 4FW9A 5JCJA 3EJWA 3FIUA 1YDEA 1R0YA 2HPAA 1Q12A 1S6YA 3DA8A 4GOLD 4RPGA 3SPXA 5A9RA 5EZYF 3KUDA 4CHTA 2CJWA 5C8YF 4XCVA 3PNVA 2RGBA 4UTOA 1C81A 1S9DA 4ZVOA 3D7SA 2X0IA 1Z07A 1VC2A 4JA2A 4G1CA 5TV2A 1R64A 3EIQA 3TRHA 1V9SA 4HZGA 4B76A 3ZJVA 4HO1X 1Q19A 2X5OA 1IM2A 1VCIA 1Z4OA 1QQ5A 1TEVA 2AZDA 2PSDA 1VIDA 2J09A 1FU7A 1LX6A 1BCSA 2G80A 2B8TA 4CDNA 2Q4EA 2UVPA 3EIXA 4N0QA 3HB9A 3E6AA 1F38A 1GYRA 3JQEA 3RYFB 5C35A 1YR7A 3OHMA 4QAQA 1FSZA 3NNSA 3OIFA 3SJBA 3PNQA 4MAFA 3VTZA 1E1RD 2H5IA 1YVDA 4Q9LA 1E0SA 4BY9E 3Q5EA 4K9LA 4L8VA 5DXJA 5BMOA 1FRFS 2GXQA 2VTEA 3AZOA 4R1QA 3FLBA 3QELB 1H9AA 2WFZA 5BWOA 1ECGA 1VMDA 3ADOA 3AV0B 1EGVB 2I2CA 3QP9A 3ZU6A 4YMHA 5CURA 2GPYA 3IKJA 4OUDB 1EFUA 3NS7A 3OY2A 2IUEA 3BICA 3NIDB 1R4MB 1THGA 1TCCA 1YB6A 1TIKA 3B1WA 5JXIA 3WIDA 3HDJA 1TJ4A 2IYRA 3NP9A 2YASA 2CXNA 4UZSA 3AEUA 5F64A 5KNBA 1UXHA 4RGQA 4R8VA 3V34A 5AVQA 4OYRA 4F84A 2WY2D 1B3RA 1FFBA 1J2EA 3M8KA 4MGKR 1E6LA 2JAXA 3U3MA 2NQ8A 4CEHB 4AZ0B 4BAGA 4L72A 1RP1A 4QBIA 1G5FA 2HTEA 2RGGA 1P2TA 3KQUA 5TS3A 2YDXA 3R7AA 5L4SA 3F90A 1AOXA 4EX7A 1NMZA 3C48A 5ALEA 3PHBE 1Q3KA 2XB9A 3E53A 4NFSA 4EMBA 3BMCB 4CBVA 3DXYA 2GAOA 3D4BA 1IG3A 2DFLA 1Z4NA 4N18A 1YMUA 4UMFA 2OEPA 5FEUA 2Z2IA 3CW8X 3IP3A 1VKRA 4M0EA 1U3TA 4EG0A 1X2EA 3Q7SA 1JNXX 4Q9HA 1KEVA 1W44A 4N5DA 4ARVA 4F4CA 5ELXA 1RD4A 2GA8A 4W5JA 2BGGA 2NTJA 3CH4B 4AJEA 1JVSA 4J1SA 1XJ0A 1WY7A 2NYRA 3V6MA 2BR3A 1R5JA 3CLHA 3E4DA 3VOBA 4JYZA 4L7QA 3EH1A 3HJBA 3GGJA 1R1DA 3IJRA 2W6OA 4MQ4A 2DFVA 3BZUA 4AO7A 5LQAA 2JVKA 3HP7A 4MR8A 1FXUA 1BVYF 5U4XA 1GRVA 2F48A 3QLEA 4MB6A 2DTXA 3JZMA 4XIGS 1ZFNA 2QZ9A 4XYGA 4BWFB 2I3GA 2NGRA 2X9VA 4OLJA 3K8ZA 2NT4A 1HM5A 1XWWA 3F2VA 4YUXA 3LGXA 3FB1A 1C8VB 1P0FA 3C41J 5HIJA 2Q5CA 2V7UA 3DFMA 3LNCA 4A5SA 1Q3TA 3FYUB 1P9OA 4P6VF 5DULA 4ZCRA 4BVKA 1KRHA 1GTVA 1IH8A 3R7WB 1H5UA 1C1DB 3DT8A 4MULA 3H4VA 1JF8A 3QWBA 4V0SA 3D81A 1BE1A 3W0LB 3PPIA 1DKPA 2JFZA 1I3CA 2ZKIA 4OGWA 1Z33A 5AVOA 5T4FA 3OECA 5FUBA 4G1FA 5LPNA 4R6XA 2QS9A 5KEIA 1IXZA 3L7MA 2QPAA 2WHQA 3SQNA 2NPOA 5JJLA 3SVZA 1XRQA 4EJMA 3VR4H 3X43A 4KO8A 3HYLA 4ALIA 4EJ6A 2JCSA 4RQUA 3PX3A 4PR0A 4TVKA 1LZKA 4P1ZA 4B33A 3HYSA 3RAPR 1U8TA 1GYQA 1I30A 2ZPAA 1GM5A 1E3LA 1WEKA 4G89A 4J0GA 2BE9A 2JH8A 3HHPA 1B76A 1QIMA 2IDJA 3QU9A 3OF5A 4IJ5A 3ZXIA 4LFBB 1ABBA 3ASVA 3DQPA 2PUAA 5M2QA 4QDTA 5B4UA 1UBOS 1D1TA 4QL3A 4DA7A 1J06A 1ZEJA 3MQ2A 4DA8A 2G82A 3T5DA 4I9GA 5H1YA 1W9HA 2GCPA 1X1BA 3HYNA 2A5FA 4HDMA 4Y9UA 3T3EA 2V4MA 5HIMA 2YVLA 1MH1A 4DUPA 2OGSA 2PGXA 5FFFA 3ZLBA 1H5QA 2C5HA 3V7YA 4BBZA 4F38A 1MB3A 5D8DA 2PWAA 2WUDA 1COZA 3MZ0A 2SICE 3GMIA 3GELA 4RENA 1ZOOA 4UCWA 4DAOA 5FBLB 2J31A 2A0KA 5T6BA 5JZSA 5CA0A 2JCXA 1XGKA 1VFPA 1YF3A 4C2UA 2CJXA 1J39A 3DKKA 4TMWA 1UBCA 3TZBA 3GJXC 4X61A 2P3OA 3H6HA 3LQFA 2I34A 3NV9A 5IN4A 3BMOA 2P6MA 3LHKA 1KYQA 3CIOA 2ZBGA 1J22A 4UD2A 1ZXXA 3VOSA 5JC8A 4QATA 1DAPA 1AUXA 1CE8A 1PX0A 1TW2A 3MYYA 3NU1A 3EXIB 4QEDA 3SHWA 3TOZA 3FMPB 3VH4A 2I4OA 2PUDA 3GUVA 3R3XA 3WGKA 1JT2A 1RWNA 3QG1A 3ESBA 2ZIAA 4GM0A 3KEGA 4JIMA 4TL9A 5HJEA 1V7ZA 1H22A 1Y9ZA 1E2GA 2MTBA 3GFSA 3LV8A 1T0HB 3SFZA 3ILVA 4RPKA 1E9RA 5D6OA 4IR7A 4LOAA 3T7JA 1J2UA 1L5VA 1RT9A 4KWHA 2ANCA 2HCJB 3F46A 1H0SA 2QTBA 1E60A 3B85A 3M1LA 4QPCA 3BORA 3MOGA 1GN9A 5E3HA 2H7CA 3NANA 3RSSA 4RELA 1FK8A 2VN8A 4LJ7A 4MUNA 2K5UA 3UJ6A 3PWSA 1BAPA 3K1AB 4I4TB 5D7BA 1IULA 3AM5A 4B2LA 3W3AH 4M36A 1D8TA 3EQ9A 2BIFA 4K6FA 3O3OB 4RZ2A 5TPWA 4FFVA 2AVDA 4TMVA 3RD5A 1C0PA 4CMGA 4NJEA 3AKYA 1B15A 3PPVA 1DC3A 5TGZA 2C8KA 3FPLA 5KYUB 4KIJA 3OX2A 3TNFA 1RW4A 3IRUA 3KYCA 5TQ2A 4BBPA 2NYUA 3P2JA 1QK5A 2QRPA 4PXAA 4CQLA 5JEEA 4TQGA 4QODA 2XUZA 1GCIA 3DMFA 3FI9A 2YH2A 1W94A 3ESRA 4M1SA 2X5NA 3NORA 4IVRA 1OFUX 2RB5A 1KZ4A 3FWYA 2P77A 3F6BX 3GJ8A 1L7PA 1IOWA 2W11A 1U2GA 4G5SA 4IDFA 3RSHA 4BC0A 4URYR 4WY5A 4GZMA 3RK1A 3GUCA 2O1XA 3H9GA 4QUIA 1I6LA 1N2JA 2BKVA 5TC4A 1G6OA 1KZHA 3V8RA 1ECFA 1JT9A 1QFMA 3T54A 3JAWA 3RVMA 4ARSA 1KFJB 2JFVA 1NJSA 1UFKA 5JE8A 5BVHA 3IP8A 2YXLA 2G71A 2FXIA 3AP3A 4JJ6A 4KO4S 2QVZX 1JUDA 3EEBA 3FNHA 3GN1A 1KYZA 3M6IA 4LYHA 3H75A 2H8GA 1N78A 5HXAA 4LEIA 4GLBA 4DYVA 4MHSA 3RC2A 5C9ZA 1Y3CE 2IP2A 3KUCA 3DBRB 3WRVA 4DV3B 1KIMA 3U5TA 1VL6A 2C99A 2IRWA 3P0RA 3EGIA 1O6ZA 4FMBB 5JBNA 4N03A 5AXDA 1XD8A 2PJDA 2J9FA 3A9VA 4B46A 1XPJA 1EU1A 5ILQA 4CT0A 4PSKA 2VTDA 5COBA 1SRRA 1A76A 1B41A 1O77A 1JFFA 2G5CA 4GPIB 1JE1A 2HSZA 4LPSA 5C3UA 4FOPA 1DQYA 1GNSA 4L2IB 1GL9B 2OLJA 3LNTA 3QFSA 3U9LA 3WWCA 2BZ1A 4WBXC 4ENQA 2XV1A 1T2VA 1U3GA 2Q6LA 3T9DA 1U5BB 2D5CA 4A2QA 2W93A 1HNZB 4UQOA 3PFGA 4DCVA 1EFHA 1CZNA 4C2TA 1VPLA 1ZH6A 1QAMA 5TARA 5DSTA 5EJ7A 3EFOB 1LWOA 3PR2B 4DC0A 5ICCA 3GGOA 2AZXA 1MO2A 2D7CA 1J8QA 5C1IA 1T0UA 1IDOA 2A0FA 2PVSA 4MUIA 4AY5A 1PBTA 2B6HA 2VG8A 2WM9B 3CKLA 4DREA 2XWQA 4IFIA 3S2EA 5LNK1 4I8DA 2WYVA 1TEZA 3CKYA 1QG2A 4PLWA 2WF9A 5AM5A 2RC6A 3L4SO 4GLOA 4BB9A 1WB5A 3AFIA 1YBHA 4INOA 1R0BA 1U02A 1SB9A 1ORVA 4JZKA 5DM1A 1M7BA 3WBBA 4E5KA 1ADJA 1NAIA 4YV2A 4PQYA 3FYHA 1HE4A 3L0BA 4P9NA 4MYRA 1QMGA 2YS6A 1ZM2A 4U1RA 4D8WA 2PBFA 5GMOA 4L4RA 1AKMA 1SXJD 4QXOA 2C8JA 1CZKA 2FPIA 2ZATA 3M2PA 2CUKA 3O38A 3OQIB 3QITA 5HF9A 4CU2A 2Q28A 3MPUA 5LJLA 3SE7A 2CNWD 1GDHA 1JX6A 1OVGA 1BHSA 2MR5A 5DYYA 3QEBZ 2OL4A 1BMFD 5JC1A 3LDHA 2BI8A 4E2ZA 5LYJB 4V02A 3GAZA 2JGMA 2RHDA 4EOGA 3K0FB 2HNKA 3ERCA 4UDNA 1E2JA 4DSNA 3UJDA 3A4YA 1M7HA 2V6JA 3LHIA 1FBNA 5C3MA 1NWHA 4JCOA 3P96A 4MR7A 1G7CA 2AUMA 2HF2A 2Q5IA 4MV1A 4KSCA 1C9YA 1GYPA 1YKSA 1G21E 4YB8A 4EUNA 4UARA 5CITA 1QPGA 4J76A 4C7JA 4L8WB 1CDOA 3K4PA 3R3VA 4RV9A 2P4SA 2CBZA 4UUNA 1EXVA 4MVJF 5KJ6A 3DMYA 1XKLA 3IO3A 4FYWA 2JARA 3I9V1 4BO1A 2FR1A 3RVBA 1Q3HA 2AEEA 1GTG1 4JB0A 4EUSA 3OPXA 2IU0A 5FJJA 3WFIA 1XMVA 1UBUS 4KFCA 4BPRA 4Y2SA 1S7GA 2J9GA 2XW6A 1K1EA 2OR3A 3K20A 3BRCA 5DT2A 4ZI7A 1H65A 3W4IA 3RE1A 3X2FA 3DE4X 4EI7A 1NVVQ 5FOVA 5JANA 2DBZA 1QCDA 4AQDA 1R16A 3CR3C 3RRZA 4OF4A 4C3ZA 3FRIA 1GKUB 3OLCX 2WFLA 1DEXA 3ZK8A 1GARA 1NF3A 3HEAA 5LP6A 3RHTA 4RTMA 2HADA 1E2UA 1E9CA 1CP3A 4LK2A 1YE8A 1D5WA 4XOUA 3V2GA 4FMDF 4Q9KA 4C4RA 2VDVE 4LY6A 4RF4A 3BGSA 3IS3A 2W2VA 1CYDA 2ID7A 2D00A 1QV7A 5K3CA 4UC0A 3C5WP 5COQA 5C18A 4XRRA 3UJ9A 5ALXA 5F77A 2B34A 4KH1A 3ET4A 4MVJM 1ZEMA 1CF4A 5LIPA 1R74A 1PHPA 1QC5B 2YBEA 5A7HA 3U0BA 3GPDG 4V3BA 4A1OA 2C5AA 4H0NA 2FPSA 4HL6A 4IDHA 4TTPA 5DP2A 1W2HA 3X1YA 4PZ0A 1R6DA 1T4BA 4MQFB 4R16A 1H3NA 4GFDA 2IHYA 3B12A 5K8CA 3KZOA 1Z16A 4Q4AA 2R7MA 2UU9B 3PUZA 1GJRA 1WDKA 4A73A 2YOFA 3JSXA 2Z4TA 4OFWA 2KBEA 5FNZA 5E6UB 2DPGA 4IXNA 1L5NA 2P9CA 2OO5C 1DAIA 1IEWA 5A4MS 1UC9A 5HQ3B 5CFNA 2A1TR 2QYHA 1AMNA 2ONKA 4UKDA 3VNVA 4HBGA 3GP5A 1W85B 3ORRA 4M3NA 2PXXA 4HKTA 3A7DA 4MO2A 5HCNA 5JAQA 4L85A 1POXA 3D5QA 3UENA 2IU6A 2O0HA 3WV5A 3CVJA 2ATCA 2P1RA 1V1MA 2X42A 4XM2A 4MVJH 1OYWA 5E3IA 2FQXA 3I2FA 2XT9A 1QTIA 2DT5A 2VJDA 3RJ9A 3CVWA 2JEYA 4NU8X 5DMHA 2WQ7A 1O4VA 2FZWA 3I9NA 2CNOA 5F1KA 3U13A 3AHCA 4JLMA 3K5PA 5CYFA 1HF3A 2FSVA 3RRFA 5B6JA 3EZYA 5EA2A 4YX9A 4IF4A 2VAMA 3GFGA 4UATA 1RLMA 2O3RA 5KKCA 3FYCA 2MT9A 3HB0A 4BV2A 2D1QA 4B87A 6AT1A 1RRVA 4CGYA 5IJ0A 1EGAA 3B1JA 2QBYA 1Q0RA 1Z45A 1ZU4A 4X66B 5JWRA 1ZW1A 1X9HA 3KE9A 5DW0A 2VHJA 3IA7A 2PK3A 4M8LA 1OBVA 5CH8A 5AHWA 5E7QA 1GZUA 2BMWA 4EY5A 5JSQA 1NL3A 2V6BA 2BEUB 1W73A 1MQSA 4QU8A 2WOOA 3TW4A 4H7HA 2E5FA 2WI8A 5DX0A 2O3TA 2ZBUA 3DE1X 2YMPA 3WL6A 3KC2A 1EVQA 3FPBA 2IHZA 2ZB7A 4DCSA 3QUQA 2JRCA 4PNEA 2OZVA 3B6MA 4TRNA 4RDCA 3WKCA 5CDTA 2JLYA 1NBAA 1OMOA 2YNMA 3VNAA 1O96A 2DCUA 2W8BB 3FLAA 3JD3A 3QSGA 5F4ZA 2RCYA 4C20A 4IFEA 1GAWA 5AD1A 2W6QA 1Q14A 1TADA 4QGFA 4O4LA 1DIOB 4B3GA 3OAAA 2YZMA 4FXOA 2O0MA 4HEHA 2DH5A 2JHFA 4N7RA 4X41A 1PLKA 1QG4A 3LY8A 3O3MB 1L4GA 4JA0A 2ZSDA 2H92A 1EJBA 3TW6A 3NHWA 1CUXA 2WC1A 2E55A 4PRLA 1PT9A 1JHMA 2ADOA 1V2GA 1SCUB 2Q2VA 2NUPB 1EUCA 2ZWMA 1S4MA 2YWGA 2ZB4A 5F78A 3TTVA 4BFVA 4BNDA 2R8OA 5F21A 3WMWA 1I8TA 1TCAA 2ZCVA 1SC6A 1QYIA 2ZTMA 2DR3A 3DVQX 3ECCA 3M33A 1WM1A 4IEIA 4RA6B 5F98A 5BSWA 1HL7A 1ESCA 1K5HA 3BEDA 1GCGA 3IQHX 4IUCS 4LQLA 5B53A 4ZKDA 4S1TA 4ZVVA 2D0PB 2B1RA 2G1KA 2LIPA 3E61A 3NXSA 5GOZA 4UTRA 1G9XA 2BEVB 3BCRA 3NM6B 5ECWA 5IT9A 5KSOA 1ZP6A 5H80A 4AN4A 4BQQA 1SULA 1RABA 4O2RA 1G66A 4XIIA 4WBNB 2CXXA 3TVDA 3MTJA 5I8WA 1QFYA 3NWJA 4LF6B 5BN4B 4AUKA 1B74A 1D4AA 1DJOA 3GF4A 4YK7A 2GCOA 4ZV9A 1NMSA 3QHPA 4HK4A 2XYQA 3G7NA 2EKDA 3R5JA 1Y6JA 2XB4A 2QUHA 3GARA 3H1EA 4XAQA 3MD0A 5D84A 3VDXA 3I61A 1H66A 2OA0A 1ZLXA 1GCOA 1RQRA 2FETA 5EMLA 4I5FA 3Q72A 5CLFA 4U8HA 1NR7A 4L15A 1VYVA 1XOIA 4B44A 3NHPA 2GO1A 3QE2A 4NFHA 3FOEC 3E18A 4XTCS 1IVNA 1SC9A 1UM9B 3IUPA 3KG2A 2LGJA 4HAXA 4KXWA 4M1KA 4F72A 2ZE8A 1J9GA 3EK2A 4B7UA 1O3YA 2DUWA 3R5TA 4TQAA 1NM5A 1QLWA 1ENZA 2IHUA 1VMKA 3QU7A 3OSUA 4WK4B 3ZTWA 4CL8A 1JEQA 3F7TA 2Y4NA 3Q1KA 4TYMA 3MRTA 4DIFA 2D4AA 3SAJA 2P2SA 3LX6A 3U3DA 2HSJA 4TKMA 4S24A 4DPLA 1FJXA 2CHGA 3W2GA 4ITUA 1IPEA 1KF0A 5HZHA 3OURA 2I6GA 3MT8A 4JEMA 1EBFA 3SKYA 3PC2A 3ZTYA 4P4TA 5A4FS 3PGJA 4CR6A 1YVUA 2QTNA 1EFKA 5F7ZA 2FG5A 2OQRA 2GEVA 1PZFA 2XOKA 1Q0TA 3THXB 2ZE5A 1L5QA 1BOFA 2UUCB 4FDMA 5D7NA 1G41A 1KERA 5AK6A 2QAJA 3I6BA 2FR8A 5LP1A 1YL7A 4LUCA 4UW9A 4WXHA 4M2LA 4WNIA 2R1VA 4X00A 5SV2A 2Q0XA 3RQSA 3W7AA 3FHTA 3MWLA 1REQA 2PT9A 2QLBA 1EB8A 2P2LA 2WV7A 2Y6VA 3D3WB 2POQX 1T2DA 3RC8A 2ZUDA 4C4ZA 3W5SA 3T3MB 1J2TA 1DBSA 2BJWA 3TLJA 4IHJF 4IS3A 1L8QA 5KMGB 4NATA 3D3QA 1AKVA 1P4JA 2JLZA 4D80A 5B3AA 1WCYA 1XXHA 3EXAA 2EJBA 4EBBA 3T4UA 2C2MA 4NYJR 4E1VA 5JADA 5SZHB 2HU8A 3C7CB 4MVJI 5FH9A 2HA4A 4O1HA 3WZMA 1P33A 1PDVA 4U63A 3GR6A 1WJGA 4LAFA 3T35A 2CDRA 3GZJA 4J1QA 4Z9XA 2Z30A 2Y1KA 2Y4OA 3JSAA 1NXXA 4L9WA 4BNTA 2A67A 4OTZA 5HNKA 2IBSA 1QRDA 4D9CA 2AD5A 3D31A 4J1TA 2IYFA 5SZJA 1CJTC 4K6CA 1EJ0A 3AB7A 3DVAB 3IMCA 2FOXA 1I4EB 1OH6A 4EW6A 5EIFA 4KGXA 3TVTA 4X84A 2ZM5A 1QR2A 3DE7X 3R6GA 1ZNWA 1UPFA 2WIDA 3VAAA 2BCEA 3CW2A 4YT4A 4FWTA 1E1YA 3AF5A 2AJ8A 3KSUA 4ZQEA 4CL2A 4WCVA 3NI2A 2YHSA 1YR2A 1JPNA 4JJZA 4MWSA 1QZ3A 1XN1A 2ODEA 3WK6A 2QX6A 2ZJOA 3GFVA 4PC2A 1E3MA 1UMBA 4L4SA 4HR7A 3C74A 2PTGA 3RUHA 5AHRA 2FWRA 1DJNA 2XUPA 2WJWA 2ZSIA 1QPBA 1WSWA 3FMIA 1YHYA 3JYOA 1JFRA 1M6VA 2LD4A 3BWVA 4X1IB 2VJAA 5F5NA 1Z74A 2R4QA 3NT4A 1FMLA 4JOQA 5C4GB 1VI6A 4LJAA 2ZR8A 4LHEA 4NCHA 5AKHA 1GZHB 1E92A 4TGLA 1Y1QA 4PQFA 3TRDA 1ZCZA 8GPBA 4RY8A 2IYLD 3KAKA 3LT1A 4GWGA 1LLFA 3H11A 4H2DA 3KTDA 1ZVMA 1IZ7A 4IEFB 1RKUA 2J3KA 2QW0X 1E1CA 3DD5A 4OHFA 2GEJA 3CUWA 3KOYA 3WYCA 2AFIB 2PPLA 5DOZA 1VDZA 4X1YA 2P1DA 4Y8VA 4YT8A 1JRLA 4ZVLA 4CIXA 1PJAA 3FUWA 1EM8A 3R6LA 2VCYA 1KSHA 3ES9A 1OH7A 1D0SA 4M98A 4LMRA 1KAEA 2YYYA 3WJAA 5JCXA 4X65B 1XZHA 9ATCA 1XCMA 2V3CC 1VRVA 3QVVA 1GG2A 3L6OO 4ZAVA 2FMXA 1BJKA 4ZVPA 3SP1A 2QEQA 2VRCD 2R8YA 2YRXA 4REQA 4UU0A 4A4DA 5J2UF 4TYYA 5FL3A 1KI6B 1RXCA 3CONA 4FI3F 3EFEA 2ZK7A 1IPFA 1Y33E 2OFFA 5KQLA 2OCDA 4X5OA 1U0RA 2F3QA 4NCIA 1GGFA 3AERA 3JYLA 4E5NA 1EVJA 2VSOA 2QVBA 3HJNA 1QWOA 2NU9B 4KBGA 1J7JA 1LVGA 1OYVA 1CEQA 1Y3DE 4YAFA 3W4KA 5BW8A 1I1NA 3A9WA 1W0KA 4B17A 4C14A 4PQRA 3TIXB 3AG6A 4EI8A 4RF3A 3JYHA 4Y2VA 3R4CA 5CHYA 3B7WA 3ZWWA 5AVXA 1MNAA 2B5VA 3GL9A 3R20A 1KR5A 2A57A 4RLHA 4EGJA 3G0CA 4EYQA 1FQJA 3DTVD 4DV4B 3P8ZA 3WLMA 3FNQA 3ZLTA 2ATVA 3GA0A 4CMAA 2DKNA 1LXCA 1E5TA 1EVEA 1M1NA 1MIOA 1GPNA 2P2CA 2QX4A 3RS8A 2TS1A 3OA0A 3IPCA 5IAEA 1FX0B 3GVCA 3K2BA 2G06A 3WA7A 1RPZA 4RJ2A 3OQNA 2FW6A 4ZJPA 4FX5A 4YLEA 1NUSA 4FEAA 3TM5A 1QO0A 3TRKA 1KK1A 4R1SA 5SICE 2F1KA 2IXBA 4YRNA 2V45A 1U8EA 4U7TB 4OX9Y 1KI2A 4LFAB 3P9XA 2R6JA 5H3CA 1E63A 4MNTA 1F2VA 2XZPA 2ZIVB 1GXSA 3FGPA 4AG5A 5EIWA 3LY9A 4DC9A 1ODIA 3EVDA 5IVDA 1SVUA 3MS4A 2F3PA 5B7NA 2H4XA 3P4YA 1NASA 5AOVA 2P8SA 4I5IA 4JOCA 4WJZA 3U19A 4CM7A 1QTRA 2VNJA 5LOVB 3CT6A 4WD3A 3ZWBA 2QQGA 4LY3A 4P3KA 2EWVA 2UVDA 2ZDHA 1T6YA 3VTAA 3UJAA 2ZM6B 1XAHA 4TM8A 5ICMA 4G1MB 4ZRMA 1DQSA 2E89A 4KYIB 5LU8A 2D1TA 2ZR0A 1YZ3A 1DQRA 3PRJA 1P60A 1G2QA 1RYEA 2QTAA 5LBTA 1CNEA 1OBOA 3Q7TA 4INZA 4GO1A 2X13A 3WI7A 3LOUA 4BVAA 1S0UA 4J0CA 3TKLA 4ZK2A 1IHDA 3O94A 3IPRA 1HT2E 3QA3E 3UMVA 1LPMA 4XGIA 2IOHA 3ZWAA 5LLDA 3GROA 1IN1A 1IVYA 4MJXA 1F06A 2NO5A 2YXBA 2ONJA 1I1OA 4B6FA 2VWGA 3FETA 5CA1B 1PNOA 3WJ1A 1YCHA 4XSGA 4A6XA 3N0TA 4B2IA 3KVYA 3BZBA 4UHBA 4US0R 5CJJA 4ZT4A 4K9NA 1EBUA 1VLZA 2ZE6A 3SXUA 3FIJA 1UPTA 2I4TA 2JHPA 3ZOZA 2OORA 3QUBA 1ULSA 2QPOA 4IX9A 4K3VA 3GRYA 4MW5A 4EG6A 4YMUA 5CLJA 2Z2KA 3EARA 4K9SA 2OXIA 4RZSA 1N0WA 1YOVB 4R98A 2Z95A 2OHFA 1AHIA 4MV0A 1T36A 3IEXA 4W6QA 5CDFA 3PDWA 2HDOA 4PPFA 3UMGA 4BKRA 2RGYA 4IUYA 1X7DA 3DAHA 1XFAA 3HO6A 1NKSA 3UFXB 3H13A 3RADC 1U0BB 1ENPA 1Y1TA 1Z4JA 2HWUA 1CW2B 2IHJA 4KXYA 1JIIA 4RE6A 3VTKA 3BDVA 4HF7A 3F74A 3CWCA 3A2NA 1QH8A 2OXTA 1R9JA 3IOBA 2J30A 3IULA 3I9JA 3VJLA 1LFAA 4QOIA 2X3FA 2QE6A 2I03A 2FEMA 2XYVA 2BSXA 3EIWA 2GZ1A 4Z0HO 4ZVUA 3C1UA 2XTJA 2BHLA 2GXUA 4M1WA 3SC3A 5KTTA 1NOKA 1ZN9A 4PG6A 3LU1A 4YIKA 2QN6A 3L9WA 5FL7D 3WYBA 4LRYA 4QEKA 2E9SA 5DFAA 2JLVA 2HBZA 2WFMA 2WG0A 4PCLA 4OHZA 1P18A 3ZW9A 1OXTA 1MXFA 2J08A 1T2EA 4XB2A 3SMQA 1RBMA 1UXJA 4AKEA 3OFNA 4N40A 1Y4UA 5KKNB 5F7OA 4FM9A 1QJCA 1SZPA 4XCQA 1EFAA 4B4WA 3PS9A 1OGYA 1FFXB 4NOKA 3K92A 4Q21A 3DFIA 1RKQA 2XUJA 2QUAA 4EEZA 1ZJ4A 1I10A 4HLCA 3U1VA 4LF4B 3DDSA 1TU4A 5DNWA 2H65A 1N7GA 1E66A 1M2GA 1R2QA 4C4SA 3D7NA 4EW1A 2PEYA 3GGDA 2YXPX 2AFHA 1A96A 3COYA 4CR7A 4W5RA 1RWPA 3QI7A 4Y9SA 2WD7B 1FRZA 4ER6A 2PVPA 1E3WB 1JXMA 2ZIFA 5CXSA 5EHGA 1L7OA 2KX7A 3DE5X 4F46A 1JQ3A 1YWGO 2K4MA 2F17A 1TF5A 2C9OA 3L41A 1PGNA 4P7BA 3EVZA 4BNLA 3DOIA 5A6VA 3MIIA 2BGTA 3O8NA 3MB5A 1E64A 3LLMA 4EA6A 1V5WA 4KOEC 3HBMA 4C0KA 1XZLA 2Z58A 4ENPA 5KWJA 3AINA 6GPBA 4H08A 3P4XA 4ZC1A 1H1LA 1YI8A 2IDKA 2J6CA 3AF6A 2XDYA 3GQBB 2REQB 5GJCA 4YDHB 3SQXA 2QP9X 4GM1A 1GCAA 2J9YB 5DBOA 3DMDA 4G4GA 4YN3A 2J9RA 1PW5A 3U40A 2ZAMA 2IH2A 2G4LA 2V58A 3TQHA 2O9JA 1JEEA 2IHKA 2HOQA 2Z5FA 3R0QA 4Z3KA 5BXQC 3TSAA 3LVFO 4G1BA 4P3PA 4HNVA 1YFJA 4AKHA 3ONNA 1LVUA 3F6SA 2HL6A 3RVPA 1Y1RA 4M38A 2P3SA 3T95A 1DJMA 1A9OA 3MCUA 1EWQA 3C45A 4LQ4A 5F1PA 5IH3A 1R6UA 2WWRA 1IAQA 1IEQA 2GD1O 3V8EA 4H7DA 4PLZA 5A5FA 5AQ1A 2ZRBA 3UV3A 4J2OA 5KX5A 1QH9A 4I0WB 4PQEA 1YZKA 1G4AE 1TJ3A 2N3ZA 2XMGA 4LXUA 2HHHB 4GYWA 1N1MA 5DTRA 3WWYA 4CQMA 1QGUB 1KNXA 1VG9B 4FFMA 3EE6A 1NSFA 1CQJA 3IV7A 4QO8A 1CETA 4FBLA 1RHQA 4OJKA 3HYRA 1II0A 2RSLA 1ECCA 1W5BA 2X3YA 5E9QA 5B3KA 9GPBA 1B0ZA 4CRWB 1Z18A 2QLJA 4Y6LA 2VHEA 2Q6VA 3I0MA 3WK8A 4N5IX 2CBGA 3UO8B 5LDDC 5EGSA 1VL5A 4N49A 4QOEA 3C6QA 2FVYA 1QX4A 2RKWA 1ZLYA 4QO7A 2BTOA 4W82A 4DCGA 4B3FX 4F12A 5AVWA 1SH7A 3UAVA 4DQVA 1RACA 1XRJA 4RDIA 1KJNA 2IV7A 3RKRA 3WNCA 1D09A 5EIAA 4IIVA 5C51B 2ZB3A 5D51S 1I3OA 3INGA 1UBKS 1BRMA 2CCGA 4XEHA 1M8GA 4AY3A 4BNJA 4OQZA 3E7PA 5LQUA 2WSYB 1PVVA 4PLFA 3TIGA 3GDGA 1A1VA 1NXTA 2I2WA 4HNUA 2YN4A 1IJEA 4HX2A 2X0EA 4B3BA 3FY4A 3PNBA 1HQYE 2PMCA 1NW5A 2QX8A 3E82A 4FFRA 3H6GA 5DNCA 5LIRA 3U44B 1ORTA 4UM5A 1GILA 4W4TA 3KYJB 3VVLA 1Y8RA 3UICA 3AUKA 3SLKA 5JRDS 2WTEA 4M1ZA 5L8VA 2OAGA 4EABA 2QD1A 1WQ4A 1IVSA 4BNNA 2AMJA 5JBQA 4BGEA 3K4HA 1U4SA 2EBFX 2AEFA 3RG8A 1HLDA 5DSXA 2GN1A 2GNOA 3KLOA 2MDTA 4IVNA 3QWIA 5IVKA 2BFBB 1EK1A 4RANA 1LQUA 4NBUA 1G16A 1MN6A 1P9RA 2OM6A 4BVFA 3RVKA 1ZBQA 4V0OA 4GG1A 3F8TA 2ZBFA 3BCHA 2W6JD 3OZ7A 5DXFA 1M5RA 4OXNA 1Z7YA 1XX6A 5K2MA 3OBBA 1V3UA 4Z53A 4MKZA 3PQFA 3F6EX 3M1IA 4CM4A 1KP2A 4LQDA 1VJ5A 4OHYA 3HXLA 4XLTA 4H1HA 3K6KA 1YQGA 3HDYA 3UA4A 4BL5A 5LQRA 1PU2A 3TI9A 2HR1A 4A0GA 5L3ZA 3SEFA 4LDZA 2OP1A 3GW8A 4UBOA 1GADO 5AI8A 5I9TA 1PV2A 3TZLA 4EFNA 3PI6A 4US1R 3E4CA 5CA1F 1RZRD 2ZUVA 1F2TB 2BFMA 1ZQ9A 4I9UA 3KLPX 2FEOA 4KIFA 5EWLB 3W1VA 4CW7A 5T5QA 1QZUA 2ZTSA 3EPRA 3GEBA 3E22A 3IIMA 3M9XA 2BVNA 3X1MA 2IZZA 4AXXA 4KQKA 1YJXA 1CP2A 1QGYA 1N4AA 4RWZA 3EXHC 2VT6A 4RCVA 4LVCA 2ISSD 1VJGA 2J3IA 4ZEOA 4DA9A 2NWQA 3GO4A 1GA4A 3H0CA 4TV8A 5LCXA 2IK8A 1ZWLA 3IXLA 1YCFA 1NLMA 3CQ9A 1JI3A 1XD9A 4WKGA 3UC9A 3IIKA 3H5VA 3IQFA 1PEYA 4MVYA 1B8NA 1F2UB 1MF7A 2C2GA 2HXSA 1C0LA 1M66A 2V6IA 3TXXA 1X7WB 1YIAA 5EMKA 5J63A 3MELA 5DJ5A 1LI7A 3G6KA 4G8DA 5LP6C 3L0SA 3MPOA 4ZI2A 5FUWA 4D42A 3HB7A 3O8LA 1BA2A 1NJFA 1NUAA 5DXAA 4TN1A 3B36A 3NOOA 4RAOA 3HP1A 3OD1A 1Y9AA 2IE8A 4Z7OB 3CNHA 2ZFUA 4MGIR 4CIVA 4K3UA 3G8CA 1TO6A 1XU7A 1A9RA 4J0DA 4CKWA 3BXPA 2DBVO 1TAHA 4WCDA 4HX5A 4F3TA 4KRYA 5I8PA 1T1SA 3CLUC 2ZSFA 5CB4F 1DRUA 1DBIA 3EGXB 1G6Q1 3CBQA 4FCTA 2CVQA 4RACA 1KDTA 1ZD5A 4XB1A 2UUAB 4K88A 1Q6YA 2DPMA 2SECE 4PO9A 3K9HA 3B3QA 3MGKA 4IY1A 3WOVA 3IEVA 2MHCA 4NZPA 4OOEA 1SCDA 2RGCA 4M9UA 3HV2A 1ZM3A 2G17A 3TQSA 1SKQA 2ZIEA 3K8QA 2DBYA 4XQCA 4Q4DA 4HGRA 4B79A 5TIIA 1L8LA 3DC7A 3QEKA 1YI1A 1FW6A 4AN1A 2BMDA 2Q1WA 4RXMA 4RKEA 5FXMA 4JLKA 2Q5JA 4L3OA 3ANTA 2E4VA 3THYA 3KBOA 3SXJA 3U17A 2UVQA 3C8MA 3LRTA 3T7CA 3ZGOA 4KITB 4EHFA 1UBHS 4HS9A 3CTPA 3VVMA 2BW0A 2J4CA 3FTDA 5DCYA 4DQKA 5LD2C 3OI7A 3BKWA 2GN0A 2OG2A 4EHDA 1Q83A 4NYMQ 1WDLA 2Q8NA 3CX6A 5ICEA 4C1NA 4UMDA 3VNBA 1FDRA 3IHWA 1DKQA 1K8ZB 2EKLA 2FN4A 3NYIA 4GPD1 4K8OA 4WWHA 2V9CA 1GPJA 3LT4A 3AETB 2ZSHA 5FOUA 4FE3A 4IDOA 1MO3A 1TKCA 5MGNA 4FMCB 4J1NA 3MHTA 5KNDH 1KZ1A 3SU8A 2PG3A 5CTAA 3TQOA 4HEA6 4XD2A 4H3VA 2DHRA 1E77A 1Y7IA 4CCSA 1O94D 4URUR 5JH7F 1DP4A 1NUPA 4RETA 5KYYB 2VPPA 2WVHA 3I8XA 1J0XO 2RARA 3LM8A 3AH8A 3ZKWA 2W6IA 1E98A 1G8AA 4EECA 2ESRA 2AG6A 3FPHA 2A5LA 3T3NA 1V45E 1XFDA 4ZT2A 4BCCA 3HKBB 3HZRA 2DWUA 1LV8A 4F1JA 1WXEA 3VO1A 1EP9A 1QIKA 4AAYA 3RU9A 4GMGA 3CZ4A 2H06A 3HMQA 1ORWA 4UHCA 3AUTA 1QVRA 5JALA 1JXOA 2AXNA 2YNMC 3EXEA 4G5OA 4GD3Q 4Q9IA 4YCBA 3UIEA 4PGMA 4PZZA 4BKOA 2EFCB 1G291 1Y4ZA 3QF4B 4Z9AA 1WD5A 4JI1B 4N3AA 3ZWXA 1DHTA 3LY7A 1VJCA 1YDFA 3OQ6A 4J4TA 4MA5A 4L8GA 5JY6A 1N57A 1WAMA 1CS0B 4YMGA 4R8LA 2MSDB 5KTRA 2ZSKA 4NDAA 4FGSA 4KN9S 4OGGA 5KSYA 3WFJA 1W34A 3ETLA 4JQZA 4REOA 4ER3A 3LQ4A 3IAM1 3X1XA 1AK9A 1LC3A 1UIRA 1VLJA 4JB3A 4P82A 4MI6A 2IL1A 3AR2A 4YJDA 2FW7A 3QE3A 3V8NA 3BDAA 4CLRB 3BH7A 1P31A 1RYNA 3N8NA 2BELA 4KRGA 4P4NA 4C03A 1ZNQO 1NQOA 1PZNA 3DR3A 4PNZA 3JATB 2AUNA 4N0MA 3RAGA 2J59A 1U1IA 4JQCA 4DDWA 1IY0A 4JYBA 1E2KA 3LX8A 3F6YA 3DV9A 1T5HX 2OLKA 4ID3A 4RUKA 1ZGJA 4GRDA 3T52A 3BIWA 1D04A 3A7EA 3OEHD 4KP7A 4X1KA 3PXCX 1JPUA 1GRRA 2SKDA 4V3CA 1M72A 4ZA2A 1THTA 3P0HA 5A0FA 1DT3A 2H52A 4GE0A 1AZLA 3IE2A 3DAYA 1OH8A 1DJQA 2OB2A 2WF7A 3JQCA 1J8FA 1X7ZB 3JQGB 4HVCA 4MQEA 3F9IA 3K30A 1II9A 3PEUA 4PTYA 4O5AA 1YBMA 2WU3A 3PFNA 2V0CA 2J0UA 3MWEB 3SJUA 4ESVA 1M9NA 3NTUA 4ZVKA 3LYHA 4ZT7A 4RS3A 1HDGO 2HD4A 4BQSA 5A4AA 2P6RA 3E0XA 3ZHQA 3AFHA 3ZHOA 1M34E 2EX1A 4A8PA 2BFEA 3OOHA 4E2FA 1BXZA 3PUKA 4E2WA 1K08A 2FZCA 1C7FA 2H48A 2QAIA 3QG5A 1UBMS 2ZWPA 3LXRA 1HT0A 4IRXA 4QYIA 4WFQA 5B6IA 1KNQA 2QENA 4WK6A 5FR1A 4EDFA 1AMUA 4MP8A 3ORFA 3ISJA 4FQ8A 5TVGA 4B9EA 2BP7A 4P84A 3SX4A 1VHJA 1UMDB 3OCVA 1ZW6A 2QW8A 3ZGNA 1WTCA 2JL1A 4EUKA 3HGQA 2XB8A 1NM5C 2I2XB 4J90A 1U7XA 3DEYX 4GW3A 1EVLA 4MRPA 2UYYA 5ALOA 4JVLA 2DM6A 1CY7A 4BZPA 5B58T 1C3EA 1PSZA 1SHZA 2EWMA 2P5YA 4X8HA 3SJ7A 5LQKA 1BDMA 1BYIA 3OTQA 4TTAA 1ZMXA 2PMBA 1DKOA 3ICOA 4QTTB 1DFGA 3KPYA 3NWBA 5JVDB 4GYYA 1E2IA 3QX9A 4WESA 2Q5FA 4PPGA 1KH2A 1N2CA 5ALRA 3EF1A 1Z2DA 4C6RA 2FR8C 2AS0A 3TSWA 2PS1A 2CXQA 4NONA 3NHMA 4AF7A 5CHEA 3U0VA 1KFEB 1SELA 5A5VA 2D5AA 2WFAA 3I2IA 2WU0A 3WGYA 3OM9A 1BFDA 2JFGA 4WKNA 2EJUA 3G2HA 1EJ2A 4DLPA 4ND2A 3GLFA 3G2NA 1WPXA 2H63A 1W87A 2VVTA 3QUTA 1OTXA 2BKLA 1XU9A 4JI0B 5C1BA 3A1NA 1FVFA 1FEZA 2AIRA 4A6DA 3DMTC 4TRMA 1A72A 1VKZA 5TJHA 1YR3A 2AQHA 4R2HA 5AMXA 3ZTTA 2XXAB 4GKJB 2BFPA 3PK0A 3BA1A 2DPHA 2BFWA 3FDJA 1Y4DE 3KOMA 4AJKA 2DU8A 3DT6A 4E4RA 4N01A 1AKNA 3ZIUA 1RP7A 5AJXA 2IS1A 3EASA 4YUVA 1L7DA 1YRWA 1XCJA 2P4UA 1EXWA 2X4LA 5JECA 1MXHA 1UDXA 2AJDA 1Q0UA 2OBYA 3EG5A 1OWOA 3I3SR 4BZWA 3WWOA 1NLFA 3BRSA 3EVBA 4RK1A 4P92A 3AQ4A 2Y27A 3HUDA 4FQ5A 1F1BA 1VDMA 3AHJA 1JE0A 4OAPA 2ET6A 5H70A 2KQUA 4HRVA 5A3QA 1YR6A 2PPVA 4RQTA 5EP4A 4MDEA 1JR3D 3ZD7A 3R3SA 4LISA 2FNAA 2RC5A 4OJNA 1HO3A 5CT9A 4Q34A 5EZYB 3VDRA 1BWRA 1ZPDA 5C8YB 2VT7A 5KWSA 3L4JA 2J7KA 1HORA 1NVUQ 1EP2B 1ZCJA 2YVKA 3QY9A 3EGVA 2BOVA 5K0FA 3TMYA 3C3BA 3RVRA 1FNBA 1OZHA 3N5KA 4EFMA 1DMSA 3L43A 2G76A 4Q66C 3OH8A 4I2NA 1BNCA 2ZQYA 4NPCA 4HWOA 5L9AA 1ZHOA 2K2WA 4D4LA 3DLHA 4D92A 4F3RA 4RCYA 4BO5A 3O1JC 3HR4A 4NZNA 3EA0A 3KB1A 3O7MA 1EUDB 4KIWA 4XPIA 2UYOA 2FEPA 1PO7A 1RLOA 5I3ZA 1WZNA 4WT7A 1BXKA 4ZOLA 1L5WA 5D3ZA 5FNVA 3OKCA 3P9PA 4AUEA 4LRWA 1CY0A 4UHJA 1J7KA 2GPAA 4Y1RB 5EP2A 1G59A 3PEEA 2PM8A 1DBWA 4PAGA 3FGNA 3AVOA 5AM1A 3U37A 5HYVA 1RQNA 1D4OA 3MFYA 1Z7BA 1JDZA 3SI7A 3OZRA 1DC8A 4LZAA 1FC0A 4B6RA 4ESEA 2VRWA 1LI5A 2XOEA 5KWEA 4YCLA 4MJ3A 1YTUA 2QK4A 4YUAA 1V11A 5EZ6B 5BR7A 3R6TA 1BN6A 3ENQA 1MV8A 4FFPA 2ZSEA 1T8TA 2Y05A 1SVWA 1JHYA 1VKNA 3AUYA 2AJBA 2WAYA 3N7TA 4C88A 4EYSA 4JJ7A 3CHYA 2GHRA 3GJZA 5E7MA 4YR7A 3GVHA 2QW1A 3P2IA 2NO7A 3ZY6A 2XGJA 1ZGCA 1M75A 2WT8A 3L6RA 4N3CA 5DLPA 2VXYA 1T91A 2DFNA 2JEOA 4FR5A 1S8OA 2YC4C 4QD3A 4BLPA 4BLVA 4E6PA 3CVOA 5FLXA 3U7GA 1WCWA 4PRZA 4P5DA 3CG0A 4OFBA 3AFGA 3KVOA 3UBTA 3O4VA 3ILXA 2QM3A 4DUYB 3TCKA 2OSBA 4CI0B 4PXSA 1PYGA 3HRIA 1XZDA 3BD8A 2ZUCA 4E5MA 4YAKA 3AL2A 1RWKA 1XEWX 2WA1A 3GUZA 4D3FA 4H7FA 4M0CA 1H2AS 2PKQP 2ZYVX 3EULA 1TTPB 2JAWA 3EBPA 3PDCA 1NJGA 2AMYA 2Z5VA 5CX4A 1SZJG 1F8UA 3JX9A 2VLBA 1W4ZA 1M8KA 1PKXA 2WOJA 3PVCA 4IO0A 3ZQKA 1JG2A 2WE7A 1OV6A 2O2XA 4MWBA 4QZVA 3OQOA 2NAPA 2YZNA 3ZIAD 3EZNA 4RVDA 3PPWA 4Y98A 4RCZA 3VHLB 2OZPA 4IS2A 3T7RA 2QL5A 5GZ3A 2YWCA 1UFOA 3KT6A 2ZB2A 4EPRA 1L4FA 1SJ9A 5HF5A 1O97C 3DQQA 4JOBA 1XMOB 3M49A 1WHTA 3FNIA 5CVDA 3KSDO 3PDIB 4D57A 2Q9CA 5J40A 3PUVA 2R8BA 4MLZA 3AVUA 4M8NE 3RRNA 2D5LA 4PU0A 1ODLA 4UNSA 4EW2A 2ZRHA 1COWA 1OX4A 5IAGA 1QGED 1C2TA 3BD9A 3FVVA 1AKEA 3P0FA 2FWAA 3I73A 2Q5OA 3PYXA 4FFBA 4RV5A 4Z9YA 4P5PA 5G3ZA 3TEMA 1WMEA 3IUEA 4C4XA 3KB6A 4IIJB 3ZDCA 3HS3A 4WLUA 2PUTA 4ARCA 1GNRA 1TLTA 1PI3A 4OQ4A 4CN9A 1K8RA 1EFDN 2VDPB 3K05A 1ZESA 3L5OA 3C85A 4JJFA 4D45A 3LQKA 1BS1A 2H59A 3RPEA 1R3UA 1U3UA 3BXOA 1NVMB 3G2JA 3HJFA 5BN1A 1KBQA 3LX5A 3VA7A 1RQPA 4C0JA 2H54A 4GOND 1Z8DA 4MQMA 2OFXA 4JS0A 4LF5B 1M1YB 1NRIA 2M1XA 1DARA 3A1CA 4KACA 4KJXA 1O6GA 1P4HA 4TLMB 4DPKA 2B2NA 2YJTD 3PE6A 1U2PA 1CRQA 2D1FA 3IALA 3QPCA 5LA6F 1FDIA 4O1MA 1DCKA 4MMYB 3CLSD 2VF5X 1II8B 2OORC 3BILA 1D1PA 1FE8A 3MRSA 2JI8A 1TDJA 2QN3A 2R86A 5DGIA 3C4QA 3HNRA 4KXNA 5A03A 5H9WA 1O2DA 2XRYA 3F96A 2YICA 3OZUA 1XLUA 4C0LA 5LQJA 4JJIA 4DR3B 1KYIA 2PJZA 2YQZA 4QYSA 3D0RA 3C6MA 1CS4C 4FHZA 2PH7A 4KLZA 1DXQA 5G4KA 4FKBA 2GBFA 2PT6A 1M83A 1QCZA 3H2YA 4FS8A 4GICA 3QXSA 5I9SA 4RMNA 4DY4A 3A1VA 1IDN1 3UXHA 2X4GA 1Q16A 4JFRA 3BHIA 5AOBA 3MB8A 3PQ4A 5AJYA 1U63A 1NY6A 3ESQA 3M89A 1N1EA 4E31A 4GQIA 2GK6A 5TGDA 4RYDA 1GD1O 1CFZA 1JALA 4NE7A 5AM2A 5TE9A 5KNBH 3EG9B 1TIPA 1FYVA 5K1ZA 5L4LA 1GNQA 1TZCA 4F2HA 3U26A 5F2OA 1ILEA 1ZRSA 4KR0A 4X3CA 3C1TA 3QBVA 1ECLA 1JIVA 2PU5A 2VUHB 3BHNA 4G9BA 3OPQA 2HCBA 2P1ZA 4HSEA 2OC9A 3TSYA 4DUZB 1FF9A 1HEUA 2JFPA 1XMQB 4HSGA 4WZAB 5JS1A 1EX6A 5HUHA 2WSLA 3C3MA 2ZQZA 3RTBA 1XEXB 3TPZA 2A92A 2OD7A 1CF2O 1NBIA 1WUYA 2EFDB 3V48A 4GP9A 1E9FA 1I6MA 1ST2A 1QBGA 3A37A 3DBHB 2J8ZA 1N5RA 3PIIA 4RDHA 3BL6A 4W7SA 5AI9A 1MOZA 5ENZA 4CPDA 1V7PC 1KO5A 3K4QA 3KRTA 4RTQA 1NZFA 2JGDA 2QOEA 4C7OB 3PCTA 2P40A 5JJ5A 2C59A 4HAIA 4L73A 1V5EA 3CO5A 1L5RA 2PX6A 2XNHA 2BM9A 2RH9B 1UXKA 2IGTA 4U9UA 1OHHA 5CA0F 4I1YA 2RE8A 3B6ZA 5I9MA 3E9ZA 1V5GA 2NX2A 2BHTA 2MYPA 1ZRMA 4BAZA 3DVSX 2WPDD 2GXSA 3P52A 3QLVA 4M1MA 3T12A 1YH3A 4DRXA 5A06A 4JLPA 2GN4A 3I4CA 2ACWA 4CTJA 3VU1A 3PB3A 7REQA 4L78A 3DV0B 2YW9A 5HA5A 5BQOA 3L0PA 1VHQA 4O4HB 3IKVA 4KR2A 2WM2A 5FWAA 4DOMA 1GV0A 2XUOA 5HKKA 10MHA 3ZU4A 1FMCA 1K06A 4DG8A 1DADA 1D2EA 1MDBA 2CKMA 2JGKA 2P2GA 1IE3A 2OD9A 3P9RA 4FN5A 4GBMA 4OJTA 2O8DA 3IR6A 3PGXA 4M6WB 4ENSA 3DSRA 2BYTA 3DEKA 4JBYA 1XA3A 2ZIXB 1U2TA 4H4CA 1L7BA 1OREA 2QVYX 2FU5C 2XQFA 3ZVMA 3GJ5A 2DUJA 3IPXA 1QIEA 2IPXA 4FHGA 1OAAA 5HILA 5K2OA 4PYQA 1XMSA 3SX2A 3QX3A 1H94A 5ALKA 3PIDA 3W6NA 4IV8A 4RK4A 4RHCA 4LV6A 2LPMA 5DIFA 3SF8B 3V46A 4IZOA 4ANFA 1B42A 1HDEA 1P5JA 3KV1A 4LV5B 3DZFA 1JAIA 1G7TA 5FUMA 4PSAA 1VOTA 2L18A 1CQIA 1G3QA 4JIGA 2W2XA 4GL2A 2LUOA 5C4MA 1HX7A 1QG6A 1M2WA 1Z4QA 2R65A 5EIEA 2QD5A 3UQZA 2WUVA 2QN2A 7MHTA 1V8ZA 1LS6A 1JR3E 1PEDA 2WJ3A 2WYOA 3L1HA 4HWPA 5K4AA 4F4HA 3PUXA 4J4HA 4PLVA 4Y6PA 3SQOA 3T9CA 2WG1A 4P4SB 4JBXA 1SXJA 3IODA 3OU7A 4F6CA 1GGEA 4LDJA 3RUCA 1SBCA 2FJPA 3EIUA 2P4QA 3LRPA 2D2EA 5EIHA 1X9IA 1BMFA 4ZEMA 2QJRA 5BSFA 3KLBA 1OZGA 9LDTA 3FTFA 1ID1A 1Q50A 1M2VB 2NTNA 2HCFA 4QOHA 3VU9A 1OKKD 3DCJA 4V0MA 4IIXA 1AM4D 5CW1A 1R0SA 4DR4B 5HGXA 3PGKA 3SFTA 3FUUA 1P62B 4L76A 4GT1A 1KA9H 2PS0A 1F6WA 3NG1A 5EMNA 3MINA 1RQXA 5IKEA 1WXXA 3G9ZA 4AD8A 1U31A 4JHLA 4L5AA 1MRSA 2QLFA 3WLQA 2QU8A 3RFFA 4NENA 2AN9A 4RY9A 8ATCA 3K0KA 1CY8A 1DUSA 1RCFA 1T9ZA 5L4NA 4QU5A 3BWMA 4DCNA 1WCIA 3NWOA 3KE8A 1EWTA 5AKZA 4TLCA 3RRBA 3ID6C 3ROXA 4EAAA 2FDXA 4OKIA 5JAHA 2H1OA 2DY1A 5L6MB 3MJ4A 3WLSA 4BN0A 3FBWA 3GLVA 1B6TA 2CVHA 2VLIA 3L5KA 1XMXA 3BAZA 4Q7QA 5CFZA 1QU2A 2FHPA 4UXJA 2BEWB 1YGYA 4FFDA 4RPJA 2FFBA 2VQSA 2QMYA 5HFJA 4C4YA 3TB6A 2TECE 3EXHB 1IK4A 1HPLA 1DX6A 2A88A 1GFSA 1EVKA 1T3GA 3BE6A 3KJGA 3LI2A 5K4HA 1XF1A 3QBJA 4NJMB 2JCYA 2QR3A 3I0ZA 4MGYR 4B80A 2D3WA 2WJGA 3CZMA 4RZ3A 5ED4A 3RGWS 3VGJA 1ODKA 2ZYSA 2ZJAA 3O9VA 4F2WA 4JLVA 1V5IA 4EJ2A 3OEED 2YVAA 4DSZA 2FX5A 3COVA 2XZTA 1EMDA 1AZSC 2GETA 3DOFA 3VPDA 4AS3A 5B55A 1Q6ZA 3U16A 4JJEA 3KKMA 3P20A 4DJ5X 1AG9A 4EENA 2A59A 3ZPXA 1FYFA 4FMDB 3T1VA 2IELA 4W1PA 1CR2A 4KUHA 3NVDA 4F1WA 5BW4A 1QORA 2VDUE 2A35A 4ND8B 3UAGA 1JNYA 1F5NA 4G97A 1FNMA 2J0EA 2LNDA 4Q18A 1G1AA 3P9CA 3WYNA 2PS9A 2CMDA 1EEXB 4HDRB 5JAMA 2HLDA 4MYSA 4QPPA 1G8FA 1QP0A 4LKRA 2XIQA 2I2FA 3BK1A 2Q9BA 2ZSAA 1SCNE 3JV7A 4QOGA 1ZVVA 1NBME 1A2QA 1DJLA 3UH1A 3N5CA 4XE5A 5AKEA 3BMQA 4EDHA 5IJ9A 3P71T 4Y0AA 4KQJA 3GB9A 2FXVA 4CFSA 2XE8A 1EQAA 2JJ2D 3CU5A 3WGMA 4ZDJA 1SVKA 3LECA 5ALIA 2PGAA 2XT6A 2HA7A 1PNRA 1DOZA 4RA9A 4IH9A 4DIKA 4YLGA 2PLAA 1Y63A 3FRJA 3GAMA 4Y0VA 2GTHA 4NOLA 5FOQA 1JZQA 1MX1A 1UOPA 2NZVG 4G65A 1KJZA 3GFQA 3QVJA 1XTJA 3F3MA 2DWQA 3IE1A 4BNHA 2H2IA 4EWLA 4V38A 1ND5A 1T9BA 3D9QX 3GZNB 3N3AC 3OOEA 1K0UA 1L4NA 4MS1B 4IMRA 5TMBA 2WK1A 1Z68A 2CWWA 2NN3C 1ORHA 1Q1ZA 1ULTA 3AW9A 1L5OA 1RHUA 3MTQA 4K40A 2XQVA 3E1GA 3A6JA 1IY1A 4Y7DA 4YAOA 2AC7A 3QWFA 5LP6F 4ZI3A 4V0KA 2X0DA 3QE9Y 1AJEA 1IBSA 2CE2X 3S99A 4B4OA 2W48A 3HJHA 2VOJA 4D3DA 5L7WA 1U2QA 4YRQA 2UXDB 5MHTA 4I66A 3R0XA 4Q24A 2HJSA 3GJSA 2AQ8A 4HRAA 5B3JC 3B9BA 4TT3D 2N42A 1P2SA 2GSWA 2VRNA 5IK2A 1A71A 1LLCA 1WZ2A 4AKSA 3WA6A 4B7ZA 2EWWA 2W9XA 4BO0A 5AW9A 2ZI6A 2EXXA 5TXGA 4W5NA 4PTZA 2C00A 1IPHA 1B1AA 1YAJA 3FX2A 5ALJA 1MD9A 5FBZA 2XCSB 2WHYA 4XVCA 2I2AA 5CNJA 2IS2A 3K94A 1U04A 4S1OA 4YXWA 4GZ3A 3FPSA 2QE7D 2W43A 4K46A 1PL8A 4LOKA 4NTZA 4OY3A 3H7IA 4UUAA 4KQWA 5FBHA 5TT1A 4DMHA 3F8SA 1KZ7B 1AHHA 1JTVA 2ASEA 4WECA 2OYRA 2WTUA 4NU6A 1F8YA 3DF9A 3LS2A 4OGLA 4UNQA 1G64A 1F1JA 4Z0TA 2FSPA 1K3FA 3SJZA 3H99A 1AS2A 4DEYA 1OFIA 2C8LA 2I33A 2E7ZA 1UDWA 3L7JA 3A0UA 4YJGB 3SLGA 3DO8A 3UPUA 1EIWA 2ID8A 4E4TA 1W4AA 4P0PB 1WBBA 5CEFA 3EPJA 4Z2YA 2HY7A 1ZJYA 1DMRA 2GUGA 1DV1A 4HDCA 4QFBA 4H15A 3REQA 1V1JA 3I2GA 3WQQA 5DTQA 3RHSA 4E5UA 2QJWA 3OMLA 3J81A 2QAGB 2WMOB 1W36C 1LTKA 3M3HA 1GPLA 1GT91 2XMQA 2C2KA 4O02B 2HMUA 5DP1A 4MTCA 5LVAA 5C52B 1MX5A 4J0EA 1AUPA 1N6OA 3M6UA 1GTL1 3E3LA 3KKLA 2WZDA 5J1SB 3OPYB 5CB0A 2CJYA 2QXTA 1U9IC 1G2OA 1BEEA 2EERA 1NQTA 2AN1A 3ODPA 4JLBA 5IBRA 4EHJA 6REQB 3KJEA 1PBNA 4RK6A 3H9CA 4TSFA 4JFAA 2B6NA 2FG6C 4ZV7A 4FIZA 4OHMA 2PYDA 4U2KA 3JQAD 4WL0A 2RJOA 3GVIA 3B6JA 3LBNA 3DBOB 1PZMA 3H5NA 1C9MA 2NP6A 3WGQA 3MJVA 3EZ2A 2JIBA 4KPUA 4CM9D 5HRAA 4PO3X 1QV6A 2BFFA 2CUNA 3NNDA 4KK3A 1KO7A 3R7BA 4DWJA 4ZZIA 5IXJA 2C7QA 3KKQA 2ZJ2A 5TDHA 3RANA 1CV2A 3G1UA 2WZQA 2GNAA 4X85A 2NVUB 3AXSA 1U6KA 1GL7A 1VECA 2XNCA 3BGWA 3PJEA 3U7RA 2BF4A 3QHQA 4NBKA 1NXSA 4IDCA 3R3UA 1VE9A 2PSSA 2N75A 2WIAA 2ZUSA 4Q3KA 2C3OA 1PNTA 5E38A 1ZUD1 5CVEA 4A36A 3L1IA 4HPWA 2J32A 4TRRA 1NN0A 4URZR 5GP1A 4BTEA 1L1FA 3ENVA 5BQ3A 2VDRB 1F7UA 2DECA 4CCYA 5JJCA 2XEDA 3GGGA 3OQHA 3ROPA 1YBVA 3SCZA 3P9SA 4F1KA 4F8EA 4U7WA 3DAGA 2AK3A 2G63A 2IY9A 4ZCTA 3WDKA 4XA8A 3RRJA 1SWWA 5KQGA 5FPTA 1OPRA 5IC5A 1PD0A 1CEEA 4I1UA 2LDBA 3LG2A 5JD6A 2G9QA 2EAUA 2Q3BA 4X95A 2C4WA 1T1GA 3QKSA 1MO5A 3QIVA 3T4XA 3VO8A 3WG9A 3PTAA 3BH0A 4GBJA 4RVHA 1NBHA 1QYXA 3DE0X 4GECA 3ZR4B 2FPPB 1HZJA 1W47A 2PZEA 4WN9B 4A7PA 1YFKA 1AKQA 1Y0BA 2VPQA 3WGVA 3COWA 5AKKA 2BGNA 3A1UA 4RY0A 2JGFA 1WHSA 3A6GA 3DEIA 4NL4H 4N6OA 2VH5R 4QUJA 1V8DA 4MDYA 3IBTA 4ZU6X 5JT1A 2WILA 4JWKA 2B98A 4MCJA 2YQ4A 1GY8A 1I6KA 1U8FO 1JHVA 4NK4A 3AZPA 4X63A 2VF7A 1KAOA 3RVJA 1GQFA 4BE4A 2B0CA 1S02A 4XWTA 2SBTA 1VSUA 4ZYTA 4FNMA 2MSLA 4JR1A 3O8OB 1U9ZA 1KOGA 4FPXA 2RFLA 4WZBE 3QEMB 8ABPA 4QULA 3PKZA 1XNGA 1ZITA 1PE0A 1KQOA 3MYRA 2YWEA 2IVZA 1G8MA 1PEKE 2H9YA 4C7MA 1P7CA 1YC2A 1K6JA 3UJ7A 4OFZA 4IGFA 1VMIA 4ZZ3A 4PEVA 1LBEA 2CHVA 2E85A 2C3YA 3EZGA 4MLCA 4P3OA 3B1KA 3OLZA 3AUFA 1FP4B 1EZZA 1SXIA 3QIAA 1QFXA 2A84A 2GAAA 2MSKA 2QRLA 3B9QA 3EMBA 4W8GA 3RTDA 5M04A 4CV3A 2QORA 3WK4A 4XYLA 2NXCA 1P5RA 4RADA 1UKEA 2LTAA 4PGHA 1JR6A 2P0EA 3QOWA 3V2UA 1QGZA 2M2IA 1MNQA 1XTKA 5TMPA 1Q0HA 3F3SA 3IB6A 4BQNA 1DKRA 4QPJC 2I87A 3KQOA 1LZLA 2AX4A 3TW8A 1XQYA 5LMUB 4MARA 3JRXA 1I5RA 5KCZA 1XTQA 2XWPA 2Z09A 4D5GA 3ZIDA 3OC6A 4TS1A 4K1XA 2O7VA 4YV1A 2GHQA 1PTKA 5K3FB 2D0IA 3L1JA 3QYJA 1ZI9A 2A4KA 2RBEA 2ZJYA 1OGJA 2RB4A 1VJRA 1QGOA 5DN9A 5FFMA 2I7VA 3HUUA 4ZYLA 5A4DA 1QS0A 3WQHA 4J6EA 4DZTA 5TB5A 4D3XA 4JXXA 3NASA 4R83A 4JI6B 3OWXA 4Y30A 1NN5A 2W2LA 3H05A 1YC5A 1K92A 2ATXA 4NBLA 5CEJA 3BT7A 2KSQA 3JQQA 3MXOA 3PNYA 2IXTA 2P5TB 1YQUA 1LBHA 1Z6ZA 3L07A 5EAIA 3W3ZB 1U1DA 1J56A 4P2BA 4RTRA 1Z2AA 2LCFA 2BFOA 4O5OA 4Q6WA 4Y6QA 3OE4A 4O0MA 4NU5A 1RKBA 2EZ9A 3JR7A 4WE3A 5TPZA 5CFQA 3U61B 3WGIA 1NJ6A 3FYTA 1FFCA 4WH0A 4AO6A 3AEZA 3R8XA 4EA8A 2YX1A 1ZIPA 4NICA 5L51A 1WU7A 3UGKA 5A7FA 1QFSA 3T7DA 1MP0A 2XZDA 3DOEA 3ZE8A 3MUNA 1DIRA 3WLIA 1DLJA 1V1RB 3SZGA 3P9ZA 1KAQA 3IDSA 4GXRA 1WQ1R 3QFHA 3ML1A 4ZAXA 1IBMB 4AU1A 5J2UB 4MKRA 3L79A 1WETA 3HR7A 1E5LA 2ZRCA 4XVRA 1W1UA 1A82A 5KYKA 1E2FA 2DBRA 1WMAA 2MYNA 2WTMA 2IU3A 1FNDA 4AY2A 2Z9CA 4OYYA 4P93A 4V1CA 4DV2B 3DTVA 1HE2A 3HGTA 4MCAA 3IOMA 1FUKA 4TKUB 3VDMA 4CIDA 3SQMA 1TJNA 4GOOD 5ITSA 2X15A 1DTEA 1NZDA 1HLPA 1IZ9A 2QMEA 5A05A 4H7JA 3F9CA 4G0WA 1J1IA 1HK7A 3A04A 3L3BA 4J0JA 3RYHB 1FPMA 3L8DA 1KMQA 3BM5A 5EQDA 3T8YA 2VWHA 1UQRA 4Q48A 2HH9A 2V3VA 3HSSA 3B1ZA 5JOQA 1S2GA 2R2GA 4XZ3A 1FP6A 2R11A 3PQEA 3WAKA 4LJLA 2CB0A 2Q0SA 3V8PA 3T1YB 1DXYA 4G0QA 2X19A 5C1PA 3N28A 1PTJA 1TAUA 4JVSB 4QFCA 4TLLB 4Q12A 4RNDB 5G53C 2GFIA 4B3IA 1U0FA 3G2OA 3WP0A 2VXCA 2PRIA 1ZJZA 1KI9A 5LZ8A 2G0NA 4KKVA 1AB5A 1YZFA 1HL3A 5KC9A 5DEOA 4NXNB 3ZG6A 2IW3A 1H2WA 2JAUA 3G6WA 4YRLA 1IBRA 2RD2A 4YALA 1W6RA 3FVQA 2NVOA 5G1PA 5AJZA 3ZJUA 5D5HA 3ZS9A 5JI3E 3ILSA 2BBWA 521PA 3FSGA 1HT1E 1B3BA 1VFNA 4CODB 1P0PA 4DFDA 1I2AA 4QUBA 4M1EA 1BQEA 1I1HA 3DB2A 5DI3A 1VZ2A 1GR0A 1A9XB 1EFVA 1OUMA 4G0YA 4A10A 1B16A 3K1YA 4PHHA 1D2RA 3F8WA 4OJQA 3IQEA 2DQKA 4MP3A 5BO5A 5B1YA 5BN3B 4HNTA 2WP8J 1P0MA 5CLHA 1ZGAA 1P6UA 4ZOQI 3IP6A 2GJ8A 1ULAA 2Y76A 2WJHA 1EFRA 2G0AA 2ZI3A 1XNJA 3EQ2A 3VUEA 2I6TA 2X8WA 1I7NA 2I0FA 2OBLA 3H9BA 4DT1A 1I13A 2RGUA 1T8WA 3AKDA 3LQYA 1Z38A 4KV7A 3ZH9B 4W9MC 2F8TA 2WAXA 3ADPA 3V2HA 1CZRA 2HMWA 3ISTA 4CCWA 1I01A 4HDKB 2OXRA 4TTJA 1B14A 1UJ6A 1UK6A 3A8TA 4IQGA 1J0CA 4YROA 3ROKA 4D43A 2NSDA 2GM5A 2MSNA 3I2HA 4M54A 5AXAA 3SSAA 4C6TA 3QU4A 1UKBA 1GR1A 1X42A 3FCEA 3DZGA 3NHRA 1QYVA 1O87A 2DQSA 3THWA 3AYXB 3X2SA 4CKEA 3UW1A 5L3SA 1DXOA 3T5BA 5AW7A 2I3ZA 3A05A 4CLOB 5HE8A 5AFSA 3OKFA 4ND1A 1HFWA 5FL7A 1T9DA 2J4DA 2W2MA 1O89A 3UFBA 1O08A 3AF1A 1T3SA 4EARA 1HDZA 4XJVA 4BECA 1L5FA 1YZGA 5J23A 1MEEA 3NWPA 5C31A 4BJ6A 3DMPA 2O1EA 4U9IS 2NUAB 4XFJA 4DZZA 1KGSA 2G09A 5ELMA 4IMIB 3ONVA 1MTZA 2UZAA 1S8FA 1VYHA 4I4IA 1P1RA 1Q15A 1VIVA 1RXIA 2ZIWB 4LOLA 5D3MA 3B5EA 3PFKA 3OEWA 3CTMA 3D3EA 3TIFA 4RHYA 1JJ7A 2FWNA 1F0NA 3KWMA 3TO5A 4F3KA 3RSFA 9LDBA 1NX6A 2GCIA 3OKPA 1Q7CA 4HADA 4UOQA 2C4VA 3N87A 4M89A 5DNVA 4YH1A 2C2OA 1N36B 1WEHA 2HN9A 3EY4A 1WUIS 3L8MA 1MEJA 4X64B 5EERA 2GKOA 4M99A 4ZGBA 1Z6PA 5BP7A 1DINA 1P1BA 1SURA 2CFSA 4LBZA 1ISSA 1CR1A 1YJAA 2RHRA 3INTA 3A4IA 5FYQA 5BWNA 3ESCA 4S1WA 1QVAA 1EVIA 2CXOA 1WXIA 3HBAA 1LDBA 2QD4A 4G63A 2XR1A 3BWBA 2LVBA 4XKJA 3M0EA 3USES 2F64A 1KEZA 2WA2A 4QVKA 1U1GA 2OCYC 1E2HA 2YR0A 1R0ZA 3QKRB 4UEJA 2O7RA 3VC7A 1P4SA 3L6EA 4NBTA 1DWQA 4NYJQ 4ETIA 2IEGA 3M3DA 3P97A 1TM3E 1GHTA 1XL1A 2CL0X 4Y2JA 5DH9A 5AKGA 3RYFA 1T2NA 3VYTB 1YDHA 1MJGM 1GWNA 4BKQA 1VBMA 1LWNA 2CLKB 3MN1A 1JHAA 1JKMA 4Q1FA 1KSGA 3WK7A 3NBAA 4GDFA 4KQ2A 1MH9A 1TKAA 3M6VA 2XLBA 2N9UA 3GLHE 1W4CA 2W2NA 5CFLA 3R41A 1JDUA 3BRWD 3PNPA 4NMHA 4G0UA 3G89A 2IYOA 1AZWA 4BO6A 4AJHA 4YFYA 2VA9A 4OATA 4HLNA 1R9GA 3KL2A 4OUDA 3O9MA 1DC4A 1P4AA 1R0WA 1R4MA 3BL8A 3IR7A 1CUSA 1JFLA 3HWWA 4XQGA 5FBWB 3SJAA 5JSFA 2RAVA 3NX4A 3TQQA 5K9ZA 2DSNA 3EUFA 3N2ZB 3T1NA 3VR3D 5JYDA 4E21A 3NYWA 1BJRE 3E3MA 5TQVA 2VHTA 1YZLA 3IP1A 3DDWA 4CEHA 4AZ0A 1JKIA 2IXEA 3ZDXB 3WAGA 4CE6A 4FLFA 2JDID 2R5FA 3UGTA 4FOLA 3ZE1B 3DZCA 5C1OA 5IAAA 3P2EA 3ONFA 1MAHA 4JLJA 4PAOA 3ON5A 4XUEA 4PSUA 3VR4D 4TX1A 5KOYA 1KJIA 4V0LA 5E9WA 4CTMA 2G77B 4B3MB 4Q5IA 4JT2A 5JQGB 2C1EA 2C5LA 2NLOA 2V7GA 3GIWA 3HKCB 3PQ5A 2XCRB 9MHTA 1ISRA 1EK5A 2C7GA 3OTGA 3PR3A 1GNTA 3CNLA 4MV9A 4KHPB 3KKOA 1Z3CA 3WNVA 4OCZA 2YIVX 4YT5A 1EWRA 4RZQA 4S1VA 3VZQA 3QWHA 3H4MA 1ULBA 4UUQA 4DNXA 1XZMA 3FJ1A 1ZBDA 4ZI5A 1LPAB 2PMFA 2Z6VA 1FFEA 4IXTA 4DDKA 1V39A 3NDRA 4HOYA 2NTYC 4OHXA 5IEJA 2A5DA 5H82A 2V8OA 1YK0A 3TXYA 5A02A 2H00A 1K86A 2GQ0A 2H85A 3AR8A 3RB8A 1RXSA 3VC3A 3LP6A 2V5AA 2VYCA 4QG3A 2FZ4A 1XZKA 3AKCA 1HV8A 4RD1A 4DCPA 1T29A 6Q21A 3KBBA 4ZU1X 2O8EB 3IEMA 4ZAWA 2QNBA 3WLHA 3ZD6A 4HB3A 3A3OA 2V65A 1KVRA 3NRBA 5B7QA 1HE8B 3SGLA 1ZQ1A 4FK8A 3FYUA 4XCXA 1F8FA 2CE7A 3DMNA 3CLVA 4L75A 4ZD6A 3TLMA 3N9IA 5E4FA 1C1DA 1XTBA 2QKYA 3FFTA 5ER9A 4H6PA 4Q9JA 1FLDA 3W4JA 2WM3A 4G0VA 3TBKA 1DFHA 1EJ6A 5HKBA 1M6EX 1VMAA 5KX5F 1SXJC 2AVNA 1OJ7A 2WZBA 2W6JA 1NV9A 1RJEA 5H02A 3T9BA 4COKA 1DC6A 5EHIA 1IN5A 1WDWB 2WJZB 2YJNA 3LO5A 2HXGA 3M9LA 1PGJA 4UNIA 5G0UA 4AJJA 1KWKA 3TCXB 3ASZA 3CVYA 5BQ5A 1Y1PA 2XE4A 5GTDA 5HRCA 3ROTA 3U4GA 2XVAA 3BF8A 2JA1A 3LPAA 1SA0B 5DU2A 1YA6A 1CB7A 1HNNA 2BTEA 2IH5A 1AIPA 5H9VA 3EEYA 1KI3A 2GRUA 2OCGA 2DFDA 3ZCXA 3LXUX 4S04A 2Q1SA 3HU3A 2Y1EA 1PS9A 3LKDA 5LMZA 4F4FA 3ROEA 1SBZA 1MPTA 2XDQB 1RZRA 5IYZB 3EPLA 3QJYA 4OB6A 1BFKA 3KS9A 4LMAA 1U2EA 5H68A 1NTOA 2JJ8A 1SBYA 1XELA 3NGMA 2CGEA 1WUTA 3L93A 5JRZA 2HJGA 4LC9A 1X6VA 4KEAA 3QENA 5EXSA 2BGIA 5F1OA 4FSHA 1NT2A 4RK0A 5C5CA 1FRVA 2O4UX 2WJVA 4NLLA 1GA1A 4OXQA 5K8VA 5FD8A 2YVUA 1PJSA 1O03A 5L3QB 1OC4A 1NMXA 4EJ0A 2WUFA 3DZBA 5DISB 3ZGYA 3GGSA 2PIAA 2BUBA 1ZH4A 1P1IA 1E0JA 3O4HA 1U80A 4NJOA 4NBSA 2NSJA 4PF1A 1V3VA 1NA5A 4BX0A 2XKBA 5ALLA 5ETJA 5KTMA 2C20A 1QYWA 2BZGA 4JL8A 5I9BA 2X7XA 3EXIA 3KYIB 2QX7A 3K31A 3INYA 1UOQA 5KVAA 2QMHA 1N77A 4Q1AA 2PUGA 3BIFA 3DL7A 2NIPA 1S5PA 4C2AA 3NHFA 4LDPA 2QPLA 4Q1DA 3WO0A 5KSZA 4GBED 4Z99A 4ILKA 5J5CA 5G1NA 3GNSA 2XIJA 4QJ5A 3F5SA 3L4EA 3WLEA 3AF2A 2GTPA 4XGNA 4PG8A 4IJWA 4RVFA 1P0CA 1URPA 2ZJ4A 3ZHSA 4YP7A 4CKBB 3T34A 1QRSA 4I4TA 3K1AA 4JOSA 3VHXB 4B0OA 1P0QA 1X92A 2ZJZA 4AF6A 3L8EA 3FBGA 3OIYA 2W90A 5UKDA 2OAEA 2HRBA 4Y2TA 1R0XA 1JQKA 1V4NA 5F9HA 4JBLA 2C2ZA 2DPYA 5KYUA 2GUWA 4BB5A 1F8XA 3CX4A 3EDMA 4KWIA 4AWAA 4Q19A 4FDTA