1VSQA

Solution nmr structure of the productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
132
Chain Sequence
b'TIAIVIGTGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVETGREGVKALKAKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannose-specific phosphotransferase enzyme IIA component
publication title Solution NMR Structures of Productive and Non-productive Complexes between the A and B Domains of the Cytoplasmic Subunit of the Mannose Transporter of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 43
structure length 132
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.1.191: Protein-N(pi)-phosphohistidine--D-mannose phosphotransferase.
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 1vsqA00
2JZOA 3BEDA 1VRCA 3GDWA 3CT6A 3LFHA 3MTQA 3B48A 1VSQA 3IPRA 3CR3C 5T3UA 1PDOA 3GX1A 4TKZA 2JZNA 5IM4F
chains in the Genus database with same CATH superfamily
3NUGA 1FQOA 1UFRA 5FNVA 2YWXA 5CYFA 4MYRA 3UMBA 1O58A 1K3UB 3QITA 3GAZA 3NDRA 4F7DA 4WLOA 5FTKA 4MR8B 4UE2A 2BTEA 2XKAA 2J4FA 1Q0TA 2Q3BA 3X1WA 5B57C 3OEEA 2BFMA 3B1YA 3ESCA 4LNHA 5LMUB 1RBYA 4KDRA 2GD6A 2YHUA 4WHMA 4L5IA 5KBYA 2J3MA 2YOGA 4NSNA 2Z04A 4QYWA 2RBKA 1TM2A 2QW0X 1RHQA 4MGHA 4Q7EA 5BYBA 1G8GA 4YP5A 1W0CA 3RH0A 1P33A 2IUYA 1W4AA 2R1TA 3X1ZA 3W2EA 4K8OA 3V42A 1FX0A 4QUEA 3VGJA 1O97C 4BV3A 2LDXA 3ZY5A 1NP3A 2D7DA 5A2GA 5ERYA 3ZGNA 1LNQA 1VSQA 3Q7SA 1LZLA 1ZJ4A 2BD0A 2XRFA 4MW0A 4R0NA 1IVSA 4BMCA 3ZJ4A 4RY2A 5U4QA 5IJ9A 3PXBA 1TAQA 3GZNB 4C0BA 1Y1LA 1HKUA 2WG0A 1QE5A 1SUCA 1PZEA 2XVMA 2JJYA 1RRPA 2OD7A 3V1TC 2VBGA 3QBDA 3M4YA 2A1UA 3GLTA 4UNIA 2V6BA 4DVGA 5JC1A 2VXOA 2NU9A 3QMVA 1MX5A 4UULA 2ZYAA 3IUQA 2AMVA 4YJHB 3VZQA 4B3IA 4JT4A 3L4JA 3U61B 1X42A 3BZWA 4AJ1A 2Z08A 3O9ZA 4CM9D 4K6FA 5LKAA 5ICMA 3Q8MA 3S8YA 3DDHA 1E7QA 1G21A 2B21A 3C45A 3O6VA 3H2HA 3MGKA 1GYRA 2FW7A 3HVHA 4K1LA 4LKRA 1PNQA 1VBNA 1ZOPA 2ZS7A 3NTUA 4KBFA 2YY5A 3KBBA 1N6OA 1SBTA 2ZT8A 1P0PA 1AXEA 1M1YE 4CN8A 4A8JC 2MYNA 1CF4A 2VT6A 3V8NA 3OQVA 3K96A 4IHJF 5C8XA 4YCNA 3DLCA 1UXGA 2H8GA 1BDBA 1ZOSA 3OCVA 1VPVA 4GP6A 4E7PA 2C2ZA 1E60A 2RHMA 2RG7A 4LPKA 1AV6A 4O33A 3D6MA 2ZI4A 1CJVC 2JLBA 5EXPA 4N3NA 3I6BA 1CUHA 1QHYA 2QJFA 3EY9A 5HR5A 2P62A 3DE7X 1QUEA 1T1GA 4LE2A 3VRHA 5CFOA 6NULA 4LF4B 1GUZA 1SUIA 3MS7A 1Y6FA 1Q50A 3KYDA 5E7JA 1BA3A 1XZHA 2GN2A 3KJHA 2P5SA 1HE4A 3ZHOA 1J2EA 3KXDA 1I10A 1TI7A 2F3QA 3I0MA 1WULS 3BEDA 4H7PA 3I1IA 1FNCA 3NRBA 4RPJA 1PTJA 5A6SB 3L7IA 3CR3C 4B6PA 2NZWA 3IEVA 1NG1A 1XR3A 3L04A 4GSKA 3MCAA 2VRWA 3QXSA 3CF0A 3PV0A 2YFKA 1RWBA 8OHMA 4EPRA 3AF5A 1GDTA 5EE1A 5HOQA 4MP6A 5DFAA 2BGNA 4GSLA 3AY7A 3SVZA 2J6CA 2E5WA 3CCBA 4I8XA 5AOVA 1QIFA 5DYTA 3WGVA 2AL7A 2C7QA 2HRCA 3K9BA 3WNZA 1MJ5A 3KQHA 4MQUA 3ZKWB 1JPJA 4G07A 4CVNA 3UJHA 1DC7A 4ZOEA 3U4GA 2J6IA 4WERA 1UK9A 2YZMA 1MT0A 5AM5A 1XLVA 2ZYUX 2P9EA 4AMZA 3NP9A 5D00A 3SWWA 5F4ZA 1P0CA 3RIXA 2IXFA 1FZTA 4M83A 2ODNA 5EWMB 2EJBA 5KUTA 4XOUA 1WBBA 2RDMA 4Q1FA 2Z56A 1OI3A 1EXDA 1CPYA 3V4ZA 3NHZA 1DCKA 3VHQA 2FF5A 3WWCA 3IP1A 5JZBA 2JJ2A 3DYVA 1RRVA 4BS9A 3HL4A 4OIFA 2IEGA 1PUXA 4I9FA 2WQZA 4ALJA 2OQRA 2B4QA 1YI8A 2GKSA 2PX3A 1E63A 3R5JA 3WGOA 2YFYA 1TT5B 3U3KA 3RBVA 1TUEA 1M2HA 3ENWA 3NUZA 2CHUA 3L93A 4BMYA 2CMDA 6YASA 1C5KA 1L4LA 1RM5A 4TXMA 1UKBA 5CGQB 3RYFA 4Y9DA 4HUJA 1ZNYA 3CPHA 3TOZA 4XGIA 2H5EA 1IHDA 4IDQA 1EB9A 4O63O 2HT6A 3HXPA 4UVIA 4WKGA 5GMOA 3UMJA 1OI4A 2IP2A 2ORIA 4PAOA 4IHQA 3EIXA 1TK3A 2IKQA 1JQBA 4BCCA 5TEWA 1DX6A 4BQIA 4JENA 2XZOA 2HQ1A 1NXTA 2GPTA 1EVYA 2CB9A 2IFTA 2JEYA 2ONYA 2OQIA 1UWCA 4YHBA 5G0VA 4E21A 3ETNA 3QE9Y 1G8KA 2DG2A 1C4KA 3EDQA 3FBTA 4QO7A 3T5DA 2IOFK 4G2NA 1I13A 1KI8A 1N6NA 4MGIR 5F2EA 1C0KA 4R2MA 3V7UA 2GRUA 3W3ZB 1A95A 2ZB8A 3FE2A 2ZTSA 4NWIA 3ZHTA 3WLIA 1L3IA 4HB2A 2D8AA 1DKRA 3I04M 1MRZA 2HREA 4HQOA 5JYEA 3PC8C 4WNAA 2JLCA 3DH0A 2Q3JA 3DXZA 2ODTX 5BMVB 5CDGA 1VKZA 1EWKA 4X6YA 2XECA 4YCBA 1ZUIA 2ECPA 4TTTS 4EATA 2QW1A 1HLPA 1CEEA 3NDIA 1WF6A 1GA6A 4YCLA 2D1QA 2IOHA 1GQYA 5EIAA 2GJKA 4HWOA 4P3KA 1ZUWA 5CMLA 3CLRD 1JQJC 3PXDA 3IUYA 5FI5A 1OFUA 5CEFA 2G06A 3HXOA 2O6HA 3G79A 3FA2A 4DM3A 3GPBA 2XUFA 4KQ6A 2PT9A 4DXHA 1DIRA 4P84A 2ACKA 4QULA 4XUGB 4BO5A 2ZRNA 3JD1A 4NZPA 2XZTA 1M0SA 2QM8A 4J4HA 4AIIA 4BO4A 1PHPA 3DF9A 2CXRA 2P3OA 1TX4B 1UMDB 1Y5MA 2YXLA 2YYSA 1N9GA 1RMYA 1HETA 1XAHA 3QMWA 5M34A 3WRYC 3OIYA 4XWTA 2HJ9A 1AA6A 1DQRA 4B4KA 5ALVA 2V96A 4M1WA 4GLOA 2V7QA 2WF9A 4MVCA 3EPLA 4N47A 4D43A 1KVUA 1TA4A 1DBPA 1VMKA 5F4BA 1MV5A 1IHYA 2ECOA 3GUYA 4IKOA 1GKKA 2EL9A 3O92A 4JB3A 4K9KA 4S1TA 5G4LA 2P8SA 3HGTA 3ELYA 3ZUPA 2J8ZA 4JZYA 3D0OA 2Z83A 4NMWA 2FFBA 4Q18A 4V0KA 1ABBA 2ZBUA 1NBME 5CTJA 1SHKA 1JZQA 4M1ZA 4D9EA 2BJWA 1G66A 2QP9X 4G5GA 1VL0A 2I22A 1DRJA 1OLXA 1FP4B 3ZHUA 3D0QA 3NH9A 3WGHA 1B6GA 1N5DA 4XTCS 5CVCA 4DNQA 4X66B 1L3BA 4JQOA 4W5TA 1ZY2A 3EISA 3P9RA 1JIUA 2XUOA 1WMDA 2ZOSA 4IJWA 4I36A 2QL6A 3TOSA 2XCUA 2PNJA 5ED4A 1W87A 3RS0A 5KYYB 3ILSA 1WHTA 3G5LA 3HS3A 1LV7A 2AOUB 2O50A 3S1AA 1DAMA 1CK4A 1CS4C 1XXLA 2QTVA 3NBAA 2E1PA 5AJTA 4UAJA 5FNZA 4F5EA 1V39A 2C4WA 2ZIVB 1Z9BA 2HDNB 1SMKA 2F43B 4O4HF 2DFLA 3BUSA 5I4KA 1RPJA 5B6IA 3QVWA 1OV4A 7MHTA 3IHLA 5A03A 3T7CA 4L27A 3L0IB 2EERA 3RLIA 3HYSA 3EXAA 4RIIA 3H5VA 4FE7A 1D6JA 4HQKA 4JR2A 3MT9A 4O4LB 4BZXA 1WSWA 3W5CA 4ZRNA 1WY7A 4XFKA 1Q11A 2RHWA 3HYNA 4CKEA 4DIUA 5NLLA 3QWAA 3BQMB 3OU7A 5B2ZA 3FW1A 4AC9A 4ZP1A 2E0IA 3GBPA 5BSKA 5IVKA 2FRDC 3OZDA 1KO8A 3HKDB 3S29A 3V1UA 4JYCA 4ZYZA 1YHYA 1UC5B 5FTWA 1BN6A 3QFCA 4PWYA 5THKA 3P2YA 1LWNA 4QGAA 3OP1A 3W06A 5JQGF 1JA9A 1W5EA 2I6GA 4JI6B 3FTCA 2RHGB 3C7CB 3ZWPA 5TPZA 4D41A 3PJEA 2DR3A 4QEKA 1KPHA 3GEBA 8ADHA 1S3FA 1USKA 1HLDA 5AQEA 4CLEA 2ISQA 3RFFA 4UUQA 1NURA 1PEAA 3OQHA 4FD3A 2IXDA 2ZYSA 4W5HA 3BXPA 4MDYA 4TN1A 4X3PA 2OE2A 5IYZF 3EAFA 2XV1A 2VHTA 3BG5A 4BQOA 4E5YA 3ZD8A 4MIYA 4XLTA 5BWOA 1A2QA 2WAMA 1XHLA 2EKBA 2I8AA 1ORVA 1YQGA 4DCUA 3C15C 3HJTA 3ORRA 1KOJA 1NLMA 2H17A 4Q3EA 1AQIA 5IN5A 1J70A 4XM1A 1RHJA 3CWCA 5GZ6A 1L7QA 1JHXA 1ZMOA 4ZV9A 2JFWA 1T3ZA 2W2TA 3PGLA 3HFJA 5IKXA 2PZLA 2WJ6A 1Q20A 3A4LA 3HL0A 1QVVA 2Q0XA 3F47A 3QU2A 4WFIA 1XJWA 2Z9BA 1EBFA 1U94A 2QTMA 3F4BA 1MRNA 3IVMA 3OP4A 5A6VA 1WUTA 2VWHA 4IO1A 1B2LA 3UIEA 4G0ZA 4L9WA 5IBQA 3TZHA 4AG6A 5BR8B 4GC5A 5L6LB 3IKTA 4EIWA 1IM8A 1NMYA 1WCIB 4EW2A 13PKA 3LL4A 2PH1A 3I09A 3E82A 1M2OA 4H7KA 3TL3A 3ZQKA 1VG9B 1RJFA 3AFIA 3BHIA 3EXIA 4C21A 2GA8A 1RXYA 4G5YA 4KDEA 3RUFA 3EDOA 1X8XA 5DNAA 1GN8A 2ZJ4A 3GMTA 3QTTA 1PJTA 3R7NA 3PJDA 1FU8A 4TQAA 2VHEA 5BSMA 2FQ1A 2NO7A 3ZHSA 3RSLA 1MOQA 1V6CA 4TLAA 3ZWMA 2QYTA 3AI2A 1KOLA 3K05A 2QPLA 1AGPA 1GL3A 2GKGA 3PKIA 4PX3A 1XTBA 3OFNA 4XX0A 4KXVA 1V37A 2RHRA 1JHPA 1NF8A 1IC6A 3IP8A 4RE6A 2O8DB 2J9XB 2Y77A 3HSSA 2HFKA 3CNEA 3IP7A 1WV0A 1BDJA 1ZOLA 2TSYB 4M60A 5CW1A 3AEZA 2IXEA 3FR7A 2YS6A 1B6SA 4YJGB 5DP2A 1KDVA 1KZ7B 1F0NA 2HTFA 2HYDA 3BIJA 5GJCA 5I3CA 1F0PA 5IU6A 4D45A 2JKZA 2APJA 4JT8A 1QKIA 2H63A 4KIFA 1CJBA 1LSUA 2P1ZA 2F59A 1EH5A 3EDRA 1VPWA 2PJDA 4HAZA 1XF1A 1Y8QB 1G9SA 4G1BA 4CLXA 5F7OA 2DEUA 3E5NA 2CLFB 1FZQA 3GF4A 3IKVA 2EZ8A 1DIOB 4BQSA 1ZA2A 4IEIA 3QVUA 1MRSA 3KG2A 1YUMA 1EVKA 3NPMA 4KVGA 5EJ9A 1SUSA 4DLXA 4I9GA 3H5TA 4NV1A 3S27A 1MORA 2J1LA 4WK4B 4ZHQA 5G4KA 2B4TO 3PQ4A 4UOEA 2WJJA 1VXRA 2CFIA 2WYUA 1BVYF 4Q00A 4RAQA 5D01A 5UKDA 1PYDA 5IZ4A 1JEYA 3SQMA 2ZBVA 3EF0A 2PRJA 3L0OA 4EHAA 3C3WA 3H4VA 1FNNA 4KGZA 3GJTA 4JITA 3NQ41 2FP4B 3NAGA 4QUKA 2WF8A 3TNYA 1K7FB 2CN1A 2QN7A 3LCVB 4S1WA 3HP4A 1JEJA 3PQCA 2DM6A 2NUBA 2ATCA 1GKLA 3S6JA 4CQMD 4DPLA 4KKVA 2NZJA 1W85A 1AS2A 2AEEA 4LDQA 4PXAA 3H8VA 3HLYA 4KQEA 5MDHA 2XHZA 4IIJA 5GIPE 4HQFA 3T4UA 1QG4A 1T2FA 3GD5A 4FEEA 4OKNA 4PCVA 4JLPA 2BFPA 3D7MA 4FMDF 4CMEC 4C05A 3EHEA 3TZEA 4W1PA 1BHJA 2E82A 3IBCA 2DY1A 3FWNA 4BNHA 2EYQA 1JHZA 1IHXA 1R74A 2ECQA 2PMFA 1FLVA 4I2NA 4PQEA 4U7HA 5DDIP 5EMNA 5I7RA 1PAUA 1B16A 1VL5A 1K8QA 2NVOA 4A3SA 4BMSA 1OAOC 5CH5A 3HFSA 4TYNA 1MAAA 1RADA 5F2KA 2WPDA 4ZT7A 4B7ZA 4PAMA 5DHTA 4F38A 4RSRA 1G16A 1RACA 1EGHA 4XLLA 4FM9A 2PZFA 2AYZA 3OETA 4OHPA 5LYJF 3P27A 1UKZA 1J8VA 2OBBA 1HTTA 1PL7A 2I65A 2RJOA 3EY4A 5AW5A 2QYSA 2QA5A 2NU6A 3EBLA 3TLXA 3I4FA 2NVUB 5KZMB 1SWVA 2ZM6B 3B1WA 1ZG3A 4BE4A 4IYRA 1CR6A 3VHLB 2WIDA 2X1HA 2ZSHA 2A30A 4WCDA 1IOWA 1QGAA 3LWBA 1SVSA 4GD3Q 4C20A 1MTOA 3B85A 2JD1A 1HQCA 3LY5A 1U4NA 3LHIA 4LG1A 4NQRA 2D1TA 3MCUA 3THXA 4KQ9A 5I5EA 4NJEA 1FQJA 2ATEA 1GRVA 5DEIA 5LMCA 2F3PA 2CUKA 1Y1SA 2RONA 4CW7A 1UDBA 1WSDA 3BA6A 3AZPA 4NFYA 3KSZO 1RQRA 4ZV7A 2E4VA 4RDXA 4HNSA 2PU7A 2ZQ5A 3P96A 3IV9A 5ESXA 1DUVG 3MN1A 4H0NA 3VJLA 2Z2XA 1JHOA 3AK4A 1JFFB 1MOZA 4KKXB 3X1XA 3ZI4A 4R2LA 4BLQA 1HI9A 1K8YB 2F67A 2BZSA 3MJVA 4EGAA 6AT1A 1SVMA 2XW6A 3B20A 1AK9A 4XYLA 2R6HA 4LJ4A 5LLSA 4EAQA 1YONA 2EWVA 1XAJA 4MVJF 5F12A 2C29D 3EXHB 5CT6A 3CLTD 1U3DA 2CVPA 2ZB7A 3D8UA 1GNRA 4LJAA 1L7AA 2OG1A 4FCWA 4R9UC 1JV2B 1II9A 2TMKA 5LQCA 3NW9A 5E1DA 3CZ5A 1GJRA 1L5OA 2AR0A 3GLFB 3SNKA 1T2VA 3A4TA 5CLJA 3WIUA 3KC2A 2X1LA 2W90A 3FMPB 3QVGB 4UEWA 2R97A 5DK6A 2CB0A 4PC3A 1QAMA 2VC2B 4E3ZA 4O02B 4G09A 4BQFA 1OYOA 2QN3A 1CQJA 2NXEA 1U2SA 5AW4A 2WTNA 3HACA 3ONWA 3MHPA 1M34E 3IDAA 3KQTA 4F71A 3G9XA 4YXWD 1VC2A 1KKMA 2YWRA 4II3A 1T5SA 1EVZA 1PVVA 3SK0A 4Z4QA 5AVOA 1IYZA 1OT3A 3TD2A 2XE6A 2L0XA 4UMFA 1QK3A 1PV4A 3L02A 1AQJA 1OWLA 2A1TR 3B1VA 4KXQA 5IF9A 4BMXA 3EWSA 2WJ4A 3LBHA 1UK8A 3TZLA 4BE9A 1LTHR 5EP3A 1QH8B 3F2IA 5HJ2A 5J2TF 4ZYVA 6ABPA 4UNQA 3HDQA 4MRMB 4G86A 1FUIA 3AB8A 5IXSA 1DEXA 1XZMA 2QLJA 4KFSA 1X3SA 3V32A 2XOKA 4PFKA 3FUWA 3CSDA 3BWBA 5DM70 4UJ5A 1UMCA 3JQ9A 4UFNA 1Q0SA 1E9BA 1MOPA 4XFJA 3ZW9A 4OVKA 4WK6A 4BKQA 3BD8A 2PT7A 4WESB 1Z2NX 1F7VA 4AP5A 1MB2A 2H9IA 2P6RA 2WTXA 4FNAA 1U8CB 3KE8A 3QU9A 4QBKA 1I5EA 4LZPA 3N59A 2ZIXB 1S0UA 3WVNA 1ZNXA 3D6NB 1X7XA 5KWJA 3A2MA 5EERA 2CEAA 5HZHA 4K87A 4OD0A 3K20A 2PVSA 3TBHA 3GDGA 4KFTA 3H5WA 1BQ3A 1UFKA 2ZRDA 1PJZA 4HYTA 3QLEA 3KR9A 1RWOA 2PL5A 4I5EA 2XQJA 5D8DA 1N2CA 2N46A 3QUBA 3TYXA 3N2YA 4U9HS 1YZUA 2QWXA 1BW9B 2HGSA 4I08A 2XHEA 5EPUA 3VU9B 1AUOA 2R48A 1SCBA 3C70A 4TZTA 4ZAFA 4D5GA 5JH7B 1E2GA 2FUG6 1S96A 2VPQA 2WAOA 4EY7A 3TXAA 1IJBA 1SG6A 5H9VA 4GRAA 2FKAA 3H1TA 2PMKA 2NUPA 3ACCA 4JXKA 1J20A 3A28A 3CN7A 4RHUA 3THYB 2FMTA 4CIYA 4RMJA 2FLKA 1U80A 4P32A 1M67A 1C30A 2EKQA 3AUYA 4QZVA 2OHVA 3RUIA 4HZUA 1DX9A 1GGEA 4F4IA 3AVQA 5JHHB 1DV2A 5JPIA 1DWQA 1R5NA 2E3JA 1A5TA 2YZ7A 5TMEA 4UREA 4XI9A 2ZULA 1QONA 3PE4A 4ZO7A 4HVAA 4IKPA 5CX1B 5KKCA 2RIPA 4MK4A 4BJ3A 3BGOS 3V4FA 3THOA 3KSUA 9ABPA 3GAAA 1ZC4A 2NNWB 5KNBA 1PK7A 1GA1A 4YMIA 5LZ5A 1NXVA 2J7PA 5ALNA 3F9RA 2OHGA 3I73A 3AG5A 3ZEIA 1F8FA 5LQRA 3WV4A 4FEAA 3QOWA 5BRAA 1KJYA 4YDQA 1NQTA 1NXQA 2B9EA 1E2KA 1JEDA 2FAXA 3I9LA 2D62A 5P21A 5CT8A 1BG6A 1EI9A 2BM1A 3E7DA 3QSYA 1G2OA 1D7AA 1QRDA 2OC9A 3GFVA 4OCZA 1KAQA 5ITVA 1NF2A 1TVKA 3VU1A 4EA9A 5B4UA 1IJKA 4IKEA 4QTUB 1UKVY 1OVMA 1CDDA 1NDHA 3D1LA 5BR7A 1XQVA 2JGDA 3G9QA 3GFOA 3UJ3X 5JYCA 1OLOA 1P6QA 1PFGA 1MJNA 1QYVA 1YMUA 2R8EA 2PMCA 4JXXA 1KVRA 4HPJB 4QOJA 4RQBA 4CIDA 3TPFA 1P72A 3EE6A 4JB8A 4LN1A 4RESA 1R4NA 5CDYA 1BE6A 2OBMA 1A2OA 2B7BA 2ZIZA 3EQZA 3EMDA 3KXKA 2I2FA 2XMZA 3AP2A 3EXHC 4TWJA 2GD0A 4XPIA 3RUHA 2CMKA 3ETCA 3BRWD 1Z6XA 2RHTA 2RH5A 3O8DA 4UU0A 2DPLA 3LFUA 3SXUA 4N48A 1Z6GA 3ZX4A 1LRLA 3L7AA 4PYNA 4YJKA 4Z51A 2HYIC 1RQGA 3B9RA 3SVLA 5CCXA 1BKYA 3LY8A 2GBIA 3JV7A 4MQ6A 3SKXA 4J29A 1UL1X 2Q6VA 2OLJA 4M86A 1KEVA 2DU8A 5K3FA 3FPHA 5DLEA 4KPYA 3O91A 2P8JA 1DOZA 4YPFA 1T0IA 4BTVA 1V1JA 3VC1A 3FHCB 4EF6A 1FRVA 2IE8A 1H69A 3SFZA 4Q4JB 1M6HA 2NPIA 3TPCA 4TKVA 4M1SA 3GYGA 1XOIA 1KEZA 1PR2A 2NN3C 4C4SA 1FJXA 5E8JA 2VATA 1QTNA 4Y30A 3R2JA 2CSUA 4N54A 1NVGA 1TZKA 3ZU2A 3A2KA 1WAMA 5IK2A 2AV6A 2HA7A 4RDCA 3S4YA 1TUIA 3QE3A 3O2JA 4S1OA 1S3IA 2E21A 2OFWA 4QYMA 1Y3CE 2C1XA 1XV5A 3MW8A 4OQYA 4A8TA 4KR2A 3I0ZA 1HNNA 1XALA 1NP7A 1TJ3A 1GLVA 4LQCA 1OYVA 1GZ7A 1VA4A 1T15A 3O26A 5KTOA 4BBAA 3HM9A 3PEYA 3TKYA 1J09A 1TEVA 5DTJA 3ZTWA 5KYWB 2F1OA 4MQ4A 4CE6A 3UT5A 3D4BA 2R11A 2EEPA 1UK7A 1NNLA 2B3TA 2VRBA 3T7IA 4YMUA 1M7HA 3NVKI 3DBIA 1XHFA 3KLPX 4BVHA 4ZI3A 1WDKA 2H1FA 3GFPA 4AUNA 4CBVA 1F6WA 3T3MB 2ES4A 4A36A 3PPIA 1DXOA 2VJMB 3H4MA 4DIOA 4EEKA 4DQVA 1TU3A 3ZX5A 1HMYA 2JKYA 4O5OA 1QWOA 3C3MA 3L5OA 3SC3A 3VJRA 1LDGA 5EJFA 1C1HA 1XCPA 1MQSA 2JLUA 2P90A 3CLUD 4Y6GB 3CVJA 3D2LA 1JFTA 1QJ4A 3ZY4A 4RS3A 4AXBA 1UJCA 2SCUA 3EUAA 5H3LA 1ZVMA 4I5DA 1B7GO 4DA7A 1I3KA 1ZO8A 2EBHX 3IR6A 3A04A 5BNWA 2R4UA 2QVZX 5EKTA 5FRDA 3VHRA 3B82A 4TROA 5KOJA 2GBGA 2CC2A 1XIVA 4N6NA 5EIOA 1SC3A 5FF9A 3S2ZA 1ZRHA 2GT1A 2AXQA 3GGGA 1XZDA 1F6DA 3AT1A 2GASA 1VIMA 5DNYB 3PJRA 1WW2A 4MKHA 5IH7A 3IUJA 3LUGA 1HFWA 2HMAA 3L1KA 4BX9A 5IFKA 4RTSA 5MGBA 4JXZA 3FNHA 4JQCA 1WP9A 2GBCA 1SD5A 2A5LA 2H48A 3GEIA 1ONSA 2Y05A 2LRHA 1PR9A 2NADA 2PTHA 3G6WA 4MQEB 1EX6A 2PXHA 5IAJA 3EGCA 5LA6A 1RBMA 1TPYA 4K88A 4UAGA 2C1ZA 1IY2A 1IDN1 3VH1A 4CDRA 2NUAB 4RPIA 3R0VA 4JY7A 4D82A 4DMKA 5KTPA 4GICA 3NWBA 1FU7A 3EG5A 3LQ2A 1VE1A 3OOSA 3KP1A 3SI7A 4LZAA 3V00A 5KVSA 1XU7A 2DUMA 1B15A 2J0VA 2BOVA 3C8UA 1N2GA 4MEJA 1YVDA 3H2IA 1TIKA 4X60A 1CFZA 3AEYA 3HV0A 4CKBA 1E66A 1GG9A 4D44A 5J2UF 3I2KA 1U0JA 3PFKA 3BF7A 4N6GA 1EWTA 1L7PA 2XAUA 4O4JA 4XUCA 4I6GA 2IUUA 2AR7A 1NI5A 2GDZA 3OZAA 1GDDA 3D02A 3WNVA 2NMVA 2J4DA 3SMVA 4OQQA 1BGWA 2FPWA 5GVRA 3JD0A 1MOSA 1TTQB 1UKEA 4DV2B 3VH2A 3CVXA 2VRNA 4RDHA 3U37A 4U8GA 1TAUA 1CETA 1ZFNA 1S2DA 1GGKA 4QGHA 2IHNA 5JW6A 5A9SA 4QXRA 3UK2A 1IB6A 1I3NA 2QXYA 2VPYA 4HX5A 4RKWA 3UJPA 2ZRAA 3SR0A 3QVLA 5GVSA 7AT1A 3ABOB 3K8YA 4H1VA 3SS8A 1E6LA 2D5IA 4AF6A 2O14A 3HUEA 2JJQA 3MMXA 3P0EA 3DKIA 3NVMB 4OGKA 4RH3A 1KGSA 4JELA 3DFUA 3UAWA 2Z6QA 2K7ZA 1ULSA 2C97A 1HH4A 1R4ZA 1BMDA 1TGVA 2D0OB 2NQ8A 2ODEA 1CT9A 3L4EA 4RD0A 1T3TA 1EP2B 3DZFA 1LI7A 3UW3A 3H2YA 1WZIA 1N36B 3NGLA 1JUDA 5H83A 4M6WA 1EK5A 1Z4PX 1LBEA 1RVDA 3OFJA 2CEKA 4I50A 3P9IA 4K9MA 5SY6A 1ILWA 5LIPA 1XZCA 3HY3A 3R5KA 2X58A 3JQDA 3IUEA 3PI7A 5JR3A 2VHZA 2J0UB 4DOMA 2V7PA 2VP2A 3B51X 1L7DA 1E8DA 3W2TA 5ADWA 2Z95A 4QUIA 2VAVA 1I7SB 2CFTA 4CEHB 3CTMA 4IV5A 4BGDA 3MM4A 1B0ZA 2EL7A 2OBNA 3Q0EA 2J41A 4A92A 3THXB 4RD1A 4S2UA 4B3MB 4FFLA 3UXHA 1W9HA 1EM6A 4NBUA 4RUKA 3D6HA 1DCTA 1DEOA 4HN2A 2JGKA 1O0SA 2WD7B 2XPCA 5AQ1A 1H2ZA 2BM9A 1FMFA 3OLZA 1U5BB 3FHLA 1VYUA 4N65A 4A7PA 4IWXA 1T8RA 2BFFA 3IEKA 1WDTA 3IS3A 4LZWA 2ZAMA 1NQVA 4Q02A 3IT2A 2AX4A 5FTLA 5LMNB 5C2JB 3LVFO 3VX4A 1X87A 3P9YA 2ZLBA 3EEYA 4FYJA 1S4MA 1XAIA 4XQGA 5E8RA 2QD5A 3H7AA 4M0UA 2PX2A 2WBLC 5EZ6B 1IULA 4G8DA 3U5ZB 1AKMA 1YVRA 1BHQ1 1RC1A 2PX8A 3DR5A 3EVTA 1GAQA 1TMYA 1I80A 1KZ1A 2ADFA 2PV0A 4MB6A 4ALIA 4A2PA 4IVPA 1RE1A 2VHWA 1BX1A 4BFSA 2J5RA 4Q1DA 4WWHA 3F74A 4TN5A 1QGUA 4JCCA 1USWA 3P8ZA 2FXVA 3GQBA 3DFMA 4TQGA 1SKQA 3V6MA 3QPAA 3NM6B 4DEVA 4LYFA 1RYHA 4FHFA 5ITSA 3HCCA 1P2BA 1RAAA 5HF8A 3ZS8A 2XEDA 4ISBA 4QDKA 1YOVA 2ILVA 3AR5A 3T52A 3HYTA 3HK2A 4HS9A 1A9TA 1XZ8A 3TSAA 2B8JA 1ADBA 3FCUB 3M4JA 2Q50A 5TPWB 3DHNA 2BMDA 1Q57A 4RULA 4AZ0B 3GPLA 2A0XA 3LRPA 1RM4A 3N0XA 3AOEA 1C3XA 2JJ2D 4GBGA 1Z0KA 4IDGA 1QYWA 4U2FA 2PUJA 4IJ6A 4UM8B 2PEYA 4E13A 1ZJWA 4DV3B 4N0PA 4U6NA 4HB3A 4LBYA 5BSWA 2ASVA 2H1OA 2XYRA 3GL9A 4IDEA 3V4OA 5DOVA 3I6ZA 2A94A 4H3VA 1ISPA 4Y2PA 3B89A 4LWPA 3Q3VA 5C8YA 3SC4A 4A6DA 4QYTA 1OFHA 1NU8A 2RI6A 1JKIA 2BBOA 3KQWA 1XYYA 1P1RA 1TLLA 3KOYA 4UU7A 5AOBA 4HWRA 2A0FA 1Q95A 4LGVA 1V8PA 1BCSA 3K09A 3LGAA 4P9NA 1P0IA 2Q1XA 4N5DA 1Q17A 4HS4A 1QFMA 3X0DA 4OXQA 4C87A 3F7NA 3U9TA 2R1VB 3NIDB 4F9TA 4DKXA 3HGMA 2VSNA 4TYWA 5AFSA 4AF8A 4BMZA 1NE2A 3H3JA 5K0SA 2MINA 2QM7A 3OM1A 4OAOA 5FO0A 4BQNA 5CFPA 5TIIA 1WM1A 2LZ0A 1SXJA 3O90A 2MSLA 1TQ2A 4KQGA 2BI4A 1DBQA 4L15A 2VP6A 2BMEA 2AVNA 4EECA 5DM1A 2BF7A 2PLNA 2QAJA 4QECA 2YL2A 3TRIA 1I3OA 3LU1A 5DMHA 2A5JA 3VU3A 2W6MA 2XXAA 2REXB 3WADA 3BB3A 3PRKE 3G7SA 1J0BA 1M0WA 1AGNA 3HKBB 1CJKC 4ZODA 5H5JA 3DW3X 4KVFA 5K3DA 1KDZA 2IV3A 3H6GA 4N5IX 3ZCUA 5J4LA 5ITZA 1T8PA 2V1XA 3QZUA 1ES9A 5FA6A 4DQKA 5LYJB 4DXAA 4Z0TA 2HNBA 4LTMA 3SHVA 4G5OA 4RHFA 5EIFA 1OTXA 4V02A 2F9MA 3RM3A 5L45A 1VP3A 2GH1A 1E2FA 3DFZA 3WBKA 5IUNC 5K0BA 1NX6A 1ISIA 3AU8A 2XAAA 2OGUA 3U7HB 3FWPA 5F3WB 3KU1A 1XDGA 2GZ3A 1LK0A 2Z58A 1K68A 3GAFA 4HDNA 1Z0FA 4QJBA 4R84A 4XOIA 2WFLB 1DRWA 1WKCA 1JDZA 2O2GA 1F14A 1RLIA 3ETGA 4LRYA 1R8QA 1U3VA 4M7PA 1IY9A 3FN4A 4PZAA 4ZMSA 2V7QD 3DTTA 3MRSA 4QUAA 4AJIA 4C0QC 4CV2A 4DYHA 2HA6A 4NCBA 2PRKA 1TK2A 2A7QA 3E27A 1WB6A 3FYDA 3A1SA 2KYRA 1C1XB 1JIIA 1Y5RA 5HQ3B 5ARCA 3IPYA 3QQPA 2ZTLA 4QSHA 2C0CA 1A50B 4QOFA 5DHAA 4EB8A 1MIOB 1JFVA 2V97A 3IBSA 2O8BA 1Y1KE 2BP7B 2D54A 1CRLA 3H2KA 3ZNOA 4RTRA 4LJ8A 5E3HA 4DBLC 1XNQB 1GN9A 2C82A 1ONOA 1YDMA 4G4IA 2BTQA 4XCXA 2HW8A 5B12A 4QLBA 2FEXA 3C41J 4PQYA 4A0SA 3PUZA 4QLOA 4BMPB 4MWSA 1ZD5A 4CIAA 1EEXB 5JI2E 3TF5A 5E7QA 4MB0A 2OXCA 1A27A 4RS4A 4NE9A 2Y27A 2ETXA 1XMIA 2QRQA 2WUWE 3AP3A 3QUAA 1BS9A 1DQSA 2H4YA 4GBJA 4R1LA 1RRKA 3OCWA 5CW2A 5I4IA 1SKAA 1KJJA 3FLEA 5LDGA 2QVGA 1YIAA 1B8OA 3EBOA 2J3HA 2RCNA 5AUQA 4YV0A 4KREA 2AH5A 4JDPA 1QH1B 1VFPA 2XT0A 2FG5A 4LI3X 5YASA 4N7RA 1CZHA 3VI4B 1FPQA 2C88A 3EASA 4O08A 3M2PA 4KCGA 2PZMA 4WZZA 3JAWB 1KORA 2QRMA 2CE2X 1MNAA 3K31A 4WX2B 5CR9A 5DNVA 2GN9A 1PX2A 5T64A 1OUMA 2X6TA 1VL8A 1ZCBA 4MA0A 4PZDA 1YQ9A 4YCJA 4ZJPA 3HGQA 1ADGA 1SUWA 3REQA 4GQBA 4TSRA 3PLAE 2WZQA 1M5RA 2FQYA 1YDWA 4WLVA 4BWVA 3R9WA 2K87A 2Y4NA 2PX5A 3BS4A 1J90A 1PV1A 5FKJA 2WT9A 2C57A 3ZDEA 2XTMA 1AIPA 1BH2A 3IQEA 3LZCA 3NCTA 4PF1A 2OXTA 3SLGA 4DSZA 2FNAA 4RM3A 4EMTA 3C8DA 4L74A 4RNCA 3RWOA 1ZM4A 2J09A 5TPZD 1KYYA 4C5AA 4JLOA 5CVUA 1TCBA 3QRWA 1SC4A 1AD2A 1UZAA 4E2FA 5TB5A 3GFFA 1P1BA 1EM8B 3TTXA 4PSVA 1CVIA 5BN3B 3GG2A 3QWHA 2PRZA 3TKAA 2M2IA 4L5CA 2M9MA 3EXFB 3H05A 3MXOA 1BJTA 4DCMA 2OAEA 4V1CI 2TRSB 2BFEA 1Z4OA 2VJNA 1YBVA 4JVOA 2R6FA 1EFHA 1KA9H 3G7UA 3LUFA 5IAKA 1A7UA 3DOJA 4MIEA 5L7YA 4C7XA 5THXA 1DG9A 2R87A 4BDTA 2J9RA 1DS6A 1YR1A 4NG4A 4XD2A 5C5CA 4L50A 2FEPA 4N0EA 2C7PA 3OKAA 3AKYA 2HCBA 4R1SA 4IXMA 3VSCA 3FD8A 1VGQA 1E6EA 3G59A 1AHPA 2B0CA 5CYPA 3EC7A 1VSTA 3OHMA 2A8YA 2RHOA 3TFOA 3JAKA 1CVLA 4RTMA 1H1LB 4GDMA 4QYSA 4Q4LA 3WNBA 1QCDA 2HSGA 4R1PA 3FTEA 3OZGA 3VI3B 1BDIA 3DTYA 1X7ZA 3NPAA 1FNBA 3FMIA 3RS9A 2YHSA 2JIQA 1C8BA 5KTRA 4L95C 1RU3A 3IPCA 3D3EA 3FI9A 5JS2A 3CKLA 1VP9A 1U8XX 3PRYA 2PX4A 3TLZA 3BMQB 4K7JA 4ZHQF 2PBZA 4C2BA 1SXGA 5LXTA 1AUVA 3WB0A 2B34A 5A9RA 1M6YA 1AHHA 1OKKD 4DTCA 5BSVA 5JXWA 3J81k 3ZGVA 1ADYA 3CB2A 3JZMA 3UHAA 1JAYA 1JJ7A 1YE3A 3O21A 4IFEA 3F97A 4Q3DA 4UZSA 5EVCA 1RFLA 2QZ9A 3ZDRA 4JI8B 5ED0A 1ULBA 3M6WA 4JNKA 1IRXA 3T9FA 4AUMA 1ULAA 421PA 6GPBA 1B6RA 3PNQA 1KYTA 1N1MA 3FWZA 5EIXA 1E3IA 4GE3A 4U2EA 1FTQA 3ME5A 1Q91A 4RY0A 5KYXA 5KJEA 1RAHA 5E0OA 3VO9A 5KQPA 2IITA 3BBLA 3CKMA 1P0FA 4IW3B 1E2EA 1DKLA 2H08A 3T1NA 3ZBQA 1YD7A 5IM4F 2ENUA 1T13A 2ZDHA 1L5GB 1VMIA 1N1GA 4HSEA 2CXUA 4UBLA 3BL5A 3EG9B 4AJPA 4BTLA 3IOBA 1H1DA 2BDTA 4M2LA 4R2KA 1G5PA 4B74A 1SIBE 2XSZA 4FNGA 3UAZA 3LPLA 1X13A 4XM2A 3VPHA 2XUKA 5AXDA 3QNUA 3DPIA 2IZ5A 2AYYA 1ZIPA 3GCZA 1YMVA 2W6NA 3E8XA 3FCCA 4IGKA 1ZK2A 4JEMA 2H5JA 4B7AA 5I7HA 5KTSA 5LJLA 1SCJA 3HBMA 5T3UA 4EVRA 4IH4A 2G3YA 3OEHD 3FUVA 4M1EA 1E3LA 3DZCA 1ZA1A 3IT1A 1T9CA 1IUOA 5BYAA 4F9GA 2BFWA 1A5BB 3HA5A 2OUIA 4HV4A 3DQZA 3IEPA 4BMNA 5DT9A 1HNXB 4RA9A 1MO3A 3OC0A 1A9ZA 4NEHB 4RKFA 4V1CB 2NTEA 3D0KA 1DKNA 2R68A 5JFOA 2JLWA 2KBFA 1U8YA 1VE6A 3MSCA 3E35A 3QNMA 3CT6A 2JAHA 2XKJE 4YECA 3O8QA 5IVDA 4C7KA 4CMIA 1IG0A 2B0JA 3HUUA 2D74A 1Y5NA 5TMPA 4G26A 1QHSA 1OD6A 1IZ8A 4BVEA 3ROXA 3ZEAA 2DWCA 4OB6A 4DABA 2W7TA 1X1EA 2UYOA 3DHVA 1JB9A 2CZQA 3EARA 1ZAYA 1AUPA 4B3BA 1O5IA 3D5TA 2XYGA 3IT3A 1ZVKA 1NONA 4L02A 1UBUS 4LCBA 4J16A 1Y6ZA 1DPFA 3LM8A 2O2DA 3LYLA 4RK0A 3U3MA 4CHTA 1XKTA 5B1EA 5GGXA 4HNQA 3N3BC 5C1IA 4MS4A 4Y9TA 4ZK6A 1NGSA 1HT2E 2QTNA 2SNIE 1OXMA 4IR7A 1OXBB 1KEPA 2DX7A 4JKYA 5DHFA 4QVKA 5L3SB 5HM6A 2N47A 3LDAA 2VG8A 1NW3A 2WPDD 3MIZA 1A8IA 4MPRA 4V0NA 2XVAA 3WJ2A 1SQFA 3KD2A 3GLFE 4QPZA 3L43A 1XZLA 3EVCA 3VZBA 3O2QB 1X14A 2Q5CA 5H59A 5AXCA 1AK2A 1ZN2A 3H2GA 2FMFA 2GRAA 1DKOA 3OO0A 3NO4A 2OCYC 2QL7A 2W2LD 1JR3A 3G2HA 3ONFA 4JI4B 3NBUA 2QE6A 2QSYA 2CLEB 3DEYX 5MHTA 4OLBA 3VTFA 2Q4RA 1C0EA 3HCAA 3QXHA 4G1UC 1T5DX 2X4GA 3AVOA 3SHFA 3L7NA 1Z3IX 4KGDA 2HSDA 3M5WA 1NNSA 1Z0UA 3HA3A 3ZU5A 2ZG6A 1IZ0A 5KB3A 2V58A 3GUHA 4J2HA 3T5BA 1ZIDA 2RGEA 3SIWA 4UHEA 4QVIA 3SEFA 4B3SB 2OLEA 2FN8A 3WIVA 1SGWA 2RG1A 3DCJA 3G1WA 1V11B 4PANA 2W2XA 2IODA 3H1FA 1N8SA 2OP0A 1GVNB 2HQSA 2JATA 3VU0A 4COKA 4PBSA 1W5SA 1UP6A 4Y2VA 5E9QA 5BWBA 2CUTA 3QLTA 3U26A 2XDQA 3OZ7A 1C7RA 1U3UA 2QLNA 3A3YA 3RC7A 3R7FA 4C0SA 3ELWA 4GXTA 1ESEA 4L7QA 5EHGA 3VPGA 5A0FA 4I55B 4BNDB 1ZR4A 2ODAA 2OLKA 5GZ1A 5ALJA 2DLCX 1QOPB 2O06A 4GX1A 2C04A 1Z45A 2AG5A 1NNUA 3O2NA 1MC5A 5EP1A 1GRCA 4CCWA 4ZI7B 3TB4A 4OLAA 2C8VA 3PP8A 3INTA 3PHIA 5KAPA 4EHHA 1KJ9A 2J9FB 5L8VA 1PK8A 3X2EA 4P38A 5EHXA 4TS3A 1N6IA 1W34A 3H1EA 2G1AA 1J5PA 1VGRA 3D8HA 3I0NA 1COWD 3PXUA 3QVJA 4Q9DA 3WL4A 4EQ6B 3KSMA 3PT5A 2YWCA 4DLSA 1X86B 1VE5A 3OQIA 4B6FA 3MYRA 2HWWA 1BZYA 2D7CA 3R8CA 5HGJA 1ZI9A 1O6ZA 2AMYA 3FWKA 5D3ZA 5J9FA 3RJ5A 1P19A 1VCHA 1VJGA 2HWXA 2ZTHA 4A0FA 3T4PA 4B83A 2BGUA 3U1BA 5JUWA 3RU2A 1GTZA 3N5CA 8ABPA 2IH5A 2DP4E 1UAAA 4PVDA 3TKLA 2QR3A 2GZAA 4UATA 4ZEMA 5KVVA 1IUPA 2J3KA 2VUSA 3CZ4A 3BAZA 3HV2A 5G3ZA 1D03A 2XOKD 4M53A 4MPTA 1SD1A 1NUUA 1L7EA 3JQEA 5IAOA 5HCIA 2G5PA 2V3VA 2R2GA 1LS1A 3COSA 3ZHBA 3G0CA 1RKUA 2R8OA 5ECWA 3OECA 3D7SA 3H9GA 1PT5A 3GT3A 3GLVA 4YONB 4DLZA 3FLBA 4IP0A 4PO1A 4JJAA 1U4SA 5HS6A 4R6WA 2CJWA 4BNGA 2I2BA 1YBAA 1I4LD 4HKTA 4Y1RB 2DGDA 2G6BA 3MGBA 5LL6P 2HM7A 4MUXA 4A1FA 3QKRA 5B1HA 2ONJA 4ZGGA 3VTKA 1M0TA 4C3VA 1QFYA 1TMOA 2WIAA 1LQ2A 2FWNA 2IY7A 2XF2A 5CURA 4C4XA 3N2NA 2WUVA 4IL5A 5C5DA 1VHQA 1VKHA 1Q1NA 2V65A 3P9PA 4X8MA 1WLSA 1I0LA 3TD6A 4M7WA 5FUBA 1EUCB 3PNVA 4ZRMA 1UOOA 3TTYA 5L3QA 2QUKA 2LCFA 1UODA 2YC4C 3PLRA 4U00A 1DHRA 3PPVA 3MJFA 4Z4HA 1XMXA 1QFSA 2OB1A 2MYTA 3AGQA 1GZDA 3BREA 3JWEA 4HRAA 4XQ0A 5DX1A 4ZAXA 5LP6B 4GE0A 3TGPA 1TUGA 5FUYA 1G3UA 1FP1D 3QPUA 3R0JA 4H60A 4E2WA 3PX3A 5BSRA 3TFWA 4LRTB 2AN1A 3KTAB 4U2GA 5TE9A 5LFAA 1NMXA 3PSAA 2W2KB 2QAIA 3CEJA 4B40A 5KNDH 2EHJA 4KQMA 3NMUF 1RYYA 1RYEA 4G23A 3NX4A 4CR6A 3IUBA 3VPCA 1JSRA 1YBFA 1FXSA 5ESDA 2PGIA 4AK9A 5BUSA 4U5XA 3RU7A 1D8TA 1UMKA 4J6EA 5L4NA 2V6GA 1E2IA 2A3RA 4GAEA 4HDRA 3KAJA 4M0MA 1Q0PA 4GZ3A 4NFHA 1WVIA 2BFBB 5FPKA 3M9LA 1P45A 5ELXA 3N2GB 5FWYB 2NPFA 2OFPA 4U0JA 4ZN6A 5KNBD 2RHDA 2XNHA 1D0VA 2W2QA 4HDKA 2JFPA 1ECFA 5TQ2A 4N1AA 2ARKA 1NKTA 2E6UX 4C08A 2EIHA 2FSPA 1FU4A 3N05A 2YKGA 2FEOA 3WKCA 2EZ9A 1E3DA 1QIDA 4BN4A 1ZGCA 2XX3A 4NKRA 1E58A 4DSUA 3ETLA 2OECA 1KY5A 2JHFA 2V4ZA 2OUKA 1AHIA 3EWNA 3FETA 4P4NA 2JLXA 5C3UA 4BNKA 2HL6A 3FJOA 1C8KA 4RVOA 3RUEA 4DT1A 1NQAO 1PSZA 2WB4A 4KB5A 4ZMRA 1VSBA 1MMFB 3IVAA 1BEUB 3IHTA 4LMBA 5B6PA 3CNNA 3D59A 1Y7IA 3QFSA 2PUEA 1BDMA 2C9CA 4DWWA 1THZA 1E0DA 2ZYTX 3FOWA 4ILKA 1QS0B 4I1OA 1P29A 1X80A 3W2FA 2W2OA 2XGOA 5JCJA 1Z4KA 3ROTA 1HE2A 1DXYA 1DFGA 1OA0A 2I6QA 4RMIA 2ZETA 1M2EA 4TX1A 3WDKA 5LU9A 3OOJA 4HD8A 2ZYDA 1EA5A 2F9LA 1Z4QA 5K0TA 3MINA 1R6BX 1TEXA 2Y2VA 3NHWA 3RV3A 2JJMA 2WTUA 3NC4A 3BEOA 4DTIA 1GTSA 4DDHA 3MK31 3WR5A 1D1QA 1W6RA 5H9WA 4EKEA 1VG8A 2Z2ZA 1Q7TA 2GUWA 2OHOA 2QVBA 2ZJAA 4OQMA 4ZDKA 5IZCA 4H6WA 2PFKA 2Q6IA 3PD7A 3C6MA 2O1WA 3GLHB 5GPBA 3RTCA 1MHTA 4FMCB 2HV8A 1PW5A 1U0LA 3L6BA 3QE4A 3B8HA 4F1WA 1JDVA 1RI1A 4DL9A 1OILA 1RWKA 2OCKA 3DZDA 2E1RA 3NKVA 1YZGA 2FR1A 1M2WA 1P4GA 2B2XA 2V59A 5BORA 3Q1LA 4QL3A 2XBUA 2CW5A 1C1YA 1OMOA 2ZAOA 4YCCA 5KSZA 4K6HA 1DG1G 2R2AA 3PNMA 4U9UA 1RAGA 4WZBE 5DYIA 5I8PA 2XWPA 4S2EA 5LLDA 3KLMX 4CMBA 1R37A 5JEDA 3IA2A 3F6BX 5BP7A 5J40A 2PGAA 1U81A 2C9OA 3LA8A 4FHZA 1AVTA 1GDHA 2X3YA 1L1FA 5J5VA 4PBRA 3ZIAA 4W6ZA 1RHRA 1IBCA 2DPHA 2ANBA 4WKBA 1D0IA 1DTEA 4KMSA 1LNSA 3P2KA 4MYTA 2H1WA 2Y67A 3BKWA 3WLFA 2RGNA 2QTWB 3L84A 3I9JA 4EKDA 1OSNA 1W48A 3JQPA 3OAAA 3P2OA 4HLNA 4TT3A 4XSVA 3ROFA 1M1YA 1Y6RA 4WV3A 2XGGA 3WE7A 4E5NA 3I8OA 2G04A 2Z4TA 1L4UA 3N3AC 1HYEA 4M46A 4P22A 3IXLA 4COOA 5K6RA 4TKMA 1ST3A 3U7QA 4URUR 1NXOA 4L7VA 5JWHA 2HD4A 4JP5A 3MJCA 5FLYA 4H18A 3I9OA 1Q1BA 5SYAA 1IQ0A 5AIAA 4P54A 2FHPA 4AM8A 4B6RA 4D8UA 4JU8A 3HVRA 1YKSA 2M1ZA 2IYWA 2QROA 4JQSA 4POAA 3CX6A 4WY8A 5H0IA 1VCNA 1NN1A 1IMJA 1X1TA 2D2VA 2YNMC 4BDSA 5BUCA 3WIBA 1M2VA 2OM6A 3OHPA 2ZUWA 1T1IA 5KNLA 3BORA 3KE9A 1YR9A 3ET5A 4I3FA 2HRZA 3LNCA 2C2HA 3OE5A 5BOSA 2W4IA 5LQAA 2GA9A 4KQXA 1GZ5A 1XSEA 1PS8A 2IC5A 3WHIA 5LP6C 4NAVA 4YP9A 3ORHA 3ONEA 4RFLA 4BKOA 1ZONA 2W22A 1GHTA 4IF6A 3CBGA 1P75A 4AN1A 1LVGA 2CLKB 1VJ0A 2ZZKA 4PG4A 3T0FA 3B6KA 3FB4A 2JFYA 5EIEA 3WWDA 1U65A 2VBCA 3KLBA 2UZ1B 4PEVA 3NH6A 2FSFA 3OQJA 5T4FA 1TEZA 1NRIA 3U7EB 4EG1A 3KR0A 2DLDA 1XWWA 2BGRA 2G63A 2RJNA 4FS3A 3AEKA 1AMOA 3TVDA 4YCAA 4RX1A 5D5PA 1RE0A 3JWGA 1O03A 4FIZA 2XUZA 3DOEA 4LXIA 4MWDA 3I72A 4GQIA 1G59A 4WDRA 5EXTA 3Q3JB 5H4HA 1UC9A 2QG4A 3ANTA 3I2HA 4TVKA 1A7KA 1AZWA 3COVA 1DO0A 2RH8A 2WNHA 1XDSA 2FHSA 4TMZA 4JUFA 1ND5A 2ONCA 3PD0A 4D3XA 1T36A 3EMVA 1PFYA 3DDOA 4GM0A 2PQ6A 1M1NA 2VN8A 2VP3A 5EQTA 3K1ZA 1EFCA 1SC1A 3ZU4A 5DGTA 4CI0B 1JNXX 1AC5A 2P6NA 4B87A 2DULA 1XMJA 1HZJA 1VLHA 3TQTA 4R8RA 3UUWA 4BP8A 1U2QA 3JXEA 5J1TB 1KOFA 2PAFA 3B12A 5FBLB 1MD9A 3GJ4A 2CDRA 4OFBA 4UW9A 1E1QD 5JIBA 4W8OA 3ZVMA 1EJ6A 4MWCA 5JVDA 1MGOA 2OO5C 3WYCA 7YASA 3R7AA 1L5SA 1C8VB 2IP1A 2WMDA 3GLSA 3KVNA 4MJLA 3VSDA 1ZINA 3U1TA 2H2FA 4BHTA 1V4BA 2B61A 2NXWA 2VHQA 2PUAA 4YMGA 1R1DA 5EJAA 3TIGA 5JNLA 4HNHA 4PZYA 1NVDA 4PCUA 1RS0A 2QSUA 3PITA 1WB9A 1DI0A 2BT4A 4DUPA 4QM6A 1JQAA 5JMOA 4M8LA 3AESA 3HCPA 4ZU3A 4EGCB 1JQ3A 2LGJA 4EPVA 1EFVA 4LRWA 5BUQA 2H2WA 2ASEA 4MWEA 3RG2A 5KKAA 3A6PC 3L1HA 1CJCA 2CJYA 4HQRA 3A2NA 2EX4A 3F96A 4OHYA 4FX5A 3STXA 3GA5A 2CLMB 2QZJA 3KKNA 1R00A 1HL7A 1V8OA 1ZMTA 1UXIA 4CEJB 3FZQA 5C80A 4FEYA 1W6UA 1E64A 1RTKA 2VUHB 1P8JA 3K70B 4RF5A 5SYMA 1U9IA 5BR1A 2AOTB 5FT9A 4BAUA 2B8NA 3NASA 2YVQA 4I4NA 4YREA 1XJQA 1N0VC 2RC5A 3EMBA 4MYSA 1YS7A 1Z7EA 3F67A 3K0CC 3GGCA 4JWTA 4YS6A 2UYHA 2JA2A 4LDJA 4BMVA 3SYTA 1U0EA 1X1DA 3HJFA 1W30A 2XUPA 3HU1A 4P82A 1XTQA 4Q4HB 2EWWA 4H7EA 2VZ8A 1DNPA 3INYA 2QQGA 3VFDA 3EIQA 5BSHA 4C7OB 3EVEA 5DTMA 3UMVA 4BCBA 1E1MA 5E4FA 3SJZA 2IUEA 2W8BB 4Z3OA 3M6AA 5T5QA 3CF6R 5C1OA 3AMVA 3IQWA 1SXPA 3QXGA 2X0RA 2PFGA 2XEXA 2AG8A 4Q15A 2ODQA 3LIPA 4UE3S 5F7JA 3SKYA 3V7YA 1GGHA 1MVLA 1CUAA 5AWFC 2XWJI 3WY9A 2AEJA 1KEWA 3MIIA 4CMAA 1XTIA 4M9RA 3AYXB 3QGMA 1HOTA 1I5RA 3I8XA 4YRCA 2R3SA 2ZU6A 3QKSA 1RBQA 4CN9A 2CL5A 2BFOA 1NBMA 3U44A 1XLTC 1NYLA 3PWSA 4BNZA 2FZKA 1VB5A 1Z4MA 3TNLA 1YH3A 3GDFA 1KZ4A 1XZKA 3FPEA 2J30A 1KJNA 1DBSA 4I2VA 1BRMA 1C3OB 1Z16A 3F1LA 4R81A 2ZVDA 4HAYA 4KNWA 4F9FA 4WXYB 1KAGA 3TLGA 4QUJA 3UK0A 4KFUA 1XQYA 2HPVA 1QGDA 4TLDA 1W36B 1Y80A 1V16A 2Q9AA 2Y1FA 4L57A 3JW8A 5ALSA 3EQ7A 3WOVA 5AUNB 1XVTA 2WOJA 5CA0A 4FDLA 1OXVA 5E6UB 2BBWA 4KWIA 4QXMA 3I12A 4LQLA 1UZNA 2B6NA 1C4OA 3OZCA 4EOGA 2Z2YA 1C0PA 3GNSA 4WVLA 3RROA 4AIRA 3UKDA 2E4XA 4MUYA 1C29B 3QPWA 1FXWA 5CU7A 5ERXA 2M6KA 3ZE2B 4BP3A 3CLSC 2BMJA 1CQIA 3A1NA 4PPGA 3TZKA 4CLRA 5I8ZA 1XLUA 4JR0A 1MP0A 4Q66C 4ROTA 3PR1A 3Q0IA 2B99A 2ZJ3A 4OFWA 5H70A 3OEWA 4OA5A 3LUJA 4QG3A 1Z37A 3FOFC 4UMDA 1U1FA 1H4VB 1HDCA 2QUBA 2AW5A 4V0OA 3NHAA 1Z75A 2HRQA 3D8TA 1JR6A 3BJEA 3FH0A 4KPEC 3QU5A 4I6JA 1XO1A 4W1RA 3X1JA 5JMWA 5LKRA 3AKZA 3LRTA 1I33A 4IINA 3SZRA 3U7IA 2MMCA 1HR0B 3GCDA 5D85A 2WYOA 4UVGA 1O95A 2CVQA 2ZRLA 2C1EA 3DWFA 3HEMA 1DJOA 4N6OA 3O4IA 4ML3A 1DC5A 3WP1B 3VM6A 4ER6A 1G3QA 1JIVA 4J9VA 4U2BA 1E9CA 3EDMA 4KQCA 4IIEA 1W4RA 5JECA 4FLFA 3RF7A 4GUDA 1WY5A 4UBOA 4RF2A 3L8ZA 5AW9A 2IY9A 3GP5A 4TZ0A 3W2GA 1A72A 5EJ7A 1JG1A 1E3QA 2GWHA 3OC6A 4HQ0A 4L08A 4PYRA 3ZWDA 1TA9A 1IXSB 4DHWA 4ATNA 1V25A 1P5JA 1GCGA 2PHZA 5BV0A 1FCJA 3E1SA 3GD7A 2P35A 3NHJA 1KTIA 3JQBC 3K3PA 1GPUA 1UBFA 2ZWVA 3IQHX 4MVJE 3L7DA 3L2OB 4G1VA 5C5IA 5EUCA 2E85A 1E9FA 1Y1TA 3PE3A 1QE0A 3PGXA 3BMNB 2BLLA 4QODA 1WDLA 5ARBA 1P4JA 4LJSA 4F6RA 1FFXB 4S24A 3QEMA 4Y6SA 3A4NA 3A26A 4K6MA 4C6TB 4ZHSA 4GPTA 1E0AA 4BO7A 1PT6A 2ZWAA 2QN9A 5FI0B 1N4AA 4CF6A 5KNDA 2BGKA 2HJHA 5AKZA 5C7OO 1N9KA 4CF5A 1U3TA 4ZU1X 3K70C 5IXJA 2GEUA 5FBQB 3BWMA 4TUYF 5GTDA 1DBRA 2B5WA 1ZUNA 3M6XA 4O1HA 1XJ0A 1DKQA 4LTDA 5DYNA 3O3CA 4KMRA 3TRDA 4WA7A 1I7QB 1IY0A 5B7GA 4J1SA 4X94A 1D8AA 3WLEA 4LKOA 1QAQA 3TG2A 4C3ZA 4XARA 5B36A 3B9QA 5AI0A 3FTQA 2NO4A 2VJKA 4OP3A 4XH9B 4EG7A 4KOEC 4G5XA 5BW4A 4Q1AA 2PUTA 4FZ5A 1WCV1 4X20B 2O54A 2GI4A 2O0LA 3SIRA 3NAQA 5BV8A 1WX1A 3UH1A 1DBIA 1R0YA 1RKVA 3MMZA 4EJFA 2JFVA 1PFWA 3SIXA 4QGBA 2WV7A 3CMCO 1LSJA 4PNEA 3ROKA 5CB4A 2VDPB 5J23A 1W2HA 2H31A 2QLTA 4QE3A 1QWSA 2FW6A 1G8YA 4FGJA 4K6GA 2DKNA 4O3FA 2C5LA 1P9WA 1QV9A 1BQEA 2Q3LA 3LQ4A 4INAA 1A76A 3CRMA 4OYYA 5T6BA 5CBPB 2QU8A 2I7TA 3ZLBA 3A2LA 3O3MB 1VJDA 2WU0A 3WLQA 1XN1A 1BX3A 3LQKA 3BMOA 1OROA 5KC8A 5A2QA 1ZN7A 3BXZA 1P5FA 1EK6A 1TPZA 5TDHA 4LXHA 4EGFA 2BONA 3BMCA 4QQKA 2CMHA 5AVKA 3TD9A 3UHPA 2FSVC 2AF3C 1C81A 3WGQA 4A2WA 4B6EA 5BYJA 1QHIA 3C3PA 4C0WA 2VQ6A 3VDMA 1IONA 1I32A 4O2BA 4Y1FA 5F1KA 2VI5A 2WIKA 1FMTA 2ZGVA 1W36C 1DAIA 1H8HA 1ECCA 4Y6OA 3KB6A 3BMXA 4OSEA 3UMFA 2H18A 1Y34E 4NC9A 4WOCA 4Z4FA 2X2FA 4UU8A 4GDFA 2W37A 1N8NA 2IVZA 3WGIA 4KPGA 3RTGA 4OMFG 4NE2A 1JHMA 3A0UA 3BJRA 4QWWA 5TMDA 1NIPA 3V4VB 4Z49A 5AVVA 3T3EA 2KQUA 5HK9A 4FN5A 2FG7C 2LW7A 3H5NA 2GR9A 4WZAB 4XWKA 4ZYUA 721PA 3SDBA 5GZ3A 5J4HA 3C1OA 2X0DA 4ZOLB 4B45A 3IX7A 4PAGA 1PG0A 4HLUC 4U3JB 3N0WA 1GO2A 5LXTF 3SN6A 1P4AA 3TLKA 1WPGA 2FUNB 3FSGA 1TTPB 3W9YA 3MJHA 4US0R 3TMKA 1W5FA 4KXUA 4URVR 3ZVKA 2IKSA 4IRMA 3AB3A 4FYXA 4IGAA 3R40A 4Q12A 2DPYA 1GRRA 1R27A 4P83A 1OXKB 2I55A 5DHRA 2YWBA 1Q22A 2BEUB 3EDCA 1V5EA 5CX4A 1L1RA 3H97A 3ZXUB 5DNUA 2J3LA 2WK1A 5K3BA 3P2IA 2DHDA 3R5TA 1TZCA 4TV9F 2AWNA 1L8AA 3BJMA 1G3MA 1U90A 4RXMA 1W5BA 4JSYA 5AJUA 3UVEA 3T9DA 4EYSA 1HG0A 2PLFA 1VA5A 3OESA 3QVKA 2GDJA 5AICA 2FWRA 4D0NA 5HJ7A 3EH2A 3RVPA 5HF5A 3QFTA 1E3WA 4XRRA 4O2AA 1VCIA 4Y8VA 5CB6A 1SM4A 3E0QA 5E95A 3ONDA 4F06A 2UXCB 1I36A 2BBSA 3U7RA 2FTKE 1F1BA 4C14A 4FINA 2FFQA 1RT9A 2IHKA 2M1XA 2XDWA 1Z33A 5ECYA 4NJOA 5J4YA 1HQKA 1R0SA 5JRZA 3U6BA 1FYFA 3T6KA 1V2GA 2AG6A 2YICA 3HJGA 3ILHA 3P4UA 5AVUA 4IDCA 2R7LA 1QQAA 1ECLA 4DAEA 4B9AA 3TDKA 3LECA 3RDPA 4IXWA 1GQOA 3RAJA 4IIDA 1CD5A 4RFSA 4MIOA 3ZE0B 2DBVO 4XYBA 1CZKA 1PIWA 3R3HA 5ALDA 5B37A 4DEYA 1M6NA 1P5HA 4L1KA 4OEHA 4IILA 5A1JA 2YWEA 4QASA 3B6MA 4UQOA 5ALYA 4WN9B 2CKDA 5J63A 5FJIA 4E22A 2F1HA 4E3WA 2BH9A 1JP7A 3IV7A 1EJ0A 4DSAA 4GZLA 2P79A 3H83A 4PQFA 3U3OA 2B83A 4NMLA 4OXNA 1J1ZA 2PWZA 5GM1A 1LA2A 5B4VA 3ABQB 1GG8A 2D0PB 4OQZA 3TAUA 2BDUA 2FK7A 2R7AA 2A4MA 3MMNA 4U7JA 2WD9A 1AKRA 4YRLA 1E5LA 3VVBA 1KEEA 4H15A 3RVLA 3A9VA 3LC2O 1T2DA 1O96A 2AJCA 2BEWA 4TGLA 4DNFA 2QBYA 4C2UA 3STHA 1XD2B 3TO5A 3RYIB 2J07A 3TTWA 4NMHA 2QGFA 2XSZD 5A7GA 1M1UA 5EGNA 4MRPA 1UMBB 3OLXA 4XRGA 4FOOA 4L3VA 3OX2A 1X1CA 4NDZA 1M34A 1FUEA 4B3DA 1CNFA 3FM9A 5DO9A 1LBIA 1Q1EA 1SVWA 3ENNA 3OM8A 4UM7A 4QDZA 4E5DA 4HB4A 4B80A 1YB4A 3PUIA 1NM5A 4Z9BA 3OCYA 4BVJA 4C06A 4DJ5X 2IS6A 1PR3A 2DTDA 3GFQA 3P9XA 3R3ZA 4ITUA 4K9LA 2LPMA 2RGRA 1IBLB 1P8AA 3W5JA 5TGTA 1IHUA 2NAPA 3QSGA 1J9ZA 1SRQA 1XQ1A 1F0KA 4URXR 5J5CA 2P2LA 2Y1EA 3LOUA 4EL0A 4IDOA 3T8YA 1EFPB 4D4JA 1T9KA 3OPVA 2FSGA 4I1UA 5T67A 3Q8LA 2O05A 5F78A 1W0KA 2ZJ6A 1J56A 1NF3A 5ECGC 3TWOA 2IGBA 1V43A 5IJZA 3N1UA 1AGRA 3OOHA 2GCOA 4P4UA 4QPJC 1HM5A 4QRHA 1M72A 2VXCA 3R23A 3L4BA 2HQRA 2OKGA 4DGQA 3VYVA 1GAWA 3LT1A 3KQSA 4L51A 5JEEA 1A97A 4M8IA 1H6AA 4I5GA 4TLBA 4DLAA 2O8EB 4BCDA 4Y7CA 4DV6B 3ESYA 4JIGA 2NLOA 4DMLA 1G8MA 1NP6A 3K6RA 1NWCA 5AI9A 3WWEA 2EARA 2Y0DA 4AVYA 4YQEA 3O38A 3WO1A 1RHUA 2AF4C 3CYFA 3A14A 4C6SA 1QRAA 1X7YA 3N8HA 4ALKA 3P26A 4AJKA 5KEIA 4Z4CA 3M34A 3FRHA 1AY0A 4AJ2A 3EZ7A 1WPRA 3L0PA 3NOXA 3IMKA 3WB1A 2XQVA 1KO4A 1ORTA 4MUNA 4ARZA 4AQ7A 3U0VA 1EGAA 1QGED 3HCBA 3FVQA 1LPBB 3CUSA 3JPYA 1EUDA 2HJWA 3N0RA 4FFMA 3CF4G 1KSGA 2QL9A 1AN9A 1H3FA 1TTHA 2FPPA 2X8JA 2YV3A 1OJLA 4NDAA 4PXYA 2YIDA 4TV8F 3AR4A 1N2ZA 1QP8A 3TZBA 4X7MA 5EJGA 2XJ9A 3NU1A 3PYLA 4GOKA 1VE7A 1Q5PA 4R2IA 5H16A 4PRKA 2WYVA 4XD7A 1JR3D 2YDXA 4DC1A 4NU6A 1D2RA 1T10A 1AKEA 2MU1A 3C4VA 2JKVA 3G2MA 1E6UA 5KI6A 4KXYA 4MI1A 3V46A 3QV1A 2BE9A 1V7CA 2BHSA 4ENSA 1HDGO 1VLVA 2BR4A 1B23P 2OZEA 3RTAA 5DU2A 1DWUA 3L6DA 4BNUA 4BYMA 4DARA 5JZOA 1GD1O 2A9RA 2RGYA 1AE1A 3JQGB 1NN3A 4N9WA 1U63A 1ZNZA 2GYUA 2G4VA 2QRVB 1JXQA 2FX5A 2YVUA 2ZIFA 1RXIA 3KQOA 3KTDA 3W9BA 3H18A 4G0YA 1FJ2A 1R0KA 1SHJA 2ZAGA 4FOTA 2HEIA 3AXTA 1OWNA 3AHDA 4BIMA 1B76A 1LZKA 4J91A 2OHXA 3DB2A 1N6KA 1KJZA 1W4BA 3AUFA 3Q0TA 1B0UA 3X1MA 2FPGA 3K6JA 5BT9A 4FWBA 3DZHA 4KQWA 4W5NA 5E1OA 4MPDA 4O4IA 3DEZA 2QUHA 1DQYA 4NYIR 1PD0A 2ZUUA 1K4MA 2DFPA 1N3YA 3KV3O 3RSSA 2FEMA 1QE3A 2WJYA 2BCJQ 3EXG2 4U7TB 2REQB 1J0XO 3FAZA 1T2NA 4FGKA 1WMEA 4FW8A 1TKRA 4P3PA 4RLFA 2A5FA 1YZNA 1OU4A 4I4TF 3VR1A 3E9EA 4FI3C 2EFHB 4OB8A 4B3FX 5K8JB 2MSWA 4HC4A 1JAZA 4BP9A 2K7FA 2O8FA 4MUGA 1J8MF 3DXXA 4XDZA 1SQ6A 5LQNA 4UAUA 3VSEA 4I1SA 1A5ZA 4M0FA 4NCAA 3LA6A 4MUAA 5D86A 5JALA 5CGZA 3A1WA 4E5PA 3GA7A 5HUQA 4UEJA 4L4UA 3ZW8A 4A6EA 3ADDA 2QTFA 5IXYA 4D0LB 2P6UA 2IELA 2VHCA 2VUUA 3IP6A 3C7DB 3MJRA 4LJ6A 4FBMA 2PL9A 3WLMA 3FMGA 1YGPA 2QN8A 1V3TA 1ZOIA 5KJFA 4MSUA 2IT1A 3ROEA 1IN1A 4R4JA 1JN0A 1R4MA 2PO7A 3I6YA 2AD5A 1FPMA 3AFHA 5JO0A 4JLMA 2D06A 2B25A 1DE0A 4KAAA 4U2KA 5HDQA 4C88A 2EP7A 4RKRA 2K2QB 3WKEA 2QMZA 2LVBA 3FI0A 3RFCA 3SC2B 2RCYA 3RVNA 3PCTA 2XYQA 4M1MA 4QDXA 4LSMA 3P71T 3JASB 4H7DA 4F56A 5B7NA 2HX1A 4R1NA 2XYVA 3UTDA 1ZVJA 4TLLB 3QEJA 1L5WA 1ECBA 4IS2A 4WBNF 2G07A 4FHDA 3T12A 1PJRA 2Q0SA 3VAZA 3CH6A 2G88A 2QAGB 4WY5A 4E32A 4UPDA 3EIFA 3IUPA 1JI0A 4DZRA 1B3BA 2JFNA 2YV2A 3WJ7A 2QJRA 4PW0A 5BV7A 1R0RE 2G77B 3N6VA 4FYPA 1YKGA 3LC1O 2DLNA 1XWFA 2D2FA 2WKWA 3HA2A 4HEA6 1XZEA 4IIYA 3ENQA 5DIFA 4F7WA 4OB7A 1A9OA 2D00A 4ND7A 5HJEA 1R9MA 3NGXA 4OLFA 2JARA 3OJ0A 6REQA 3EQ9A 3ZV7A 1S9HA 3N75A 1I4DD 1PWYE 2QNIA 3FUXA 4MJ7A 4NI5A 4Y2QA 4AMVA 4YJ3A 1GV1A 4IAOA 4LXTA 1APBA 4U02A 1L5VA 4IEEA 2OFXA 3EF1A 1ZGHA 2JFGA 4ETNA 4KRFA 3MMPA 4WLFA 1AQLA 1HV8A 3GGSA 1O0CA 4TS9A 1GPMA 2R0QC 3V2HA 1V4NA 3DAHA 4MQFB 2CNWD 5EE5B 3UJDA 1YB2A 1L9KA 1U0FA 4IH1A 4PONA 3SJUA 5KYKA 3CLRC 1BMTA 2PQ0A 1JLLB 16PKA 1ZYUA 2VPPA 1R6TA 4WFJA 3RRZA 1NHWA 2Y0EA 4JGIA 1XTSA 3PC8A 5GONA 3GLHE 4Y1GA 4PN3A 5HWSA 3WA7A 5CIQA 4DM7A 3L06A 3G49A 4XLZA 5EJIA 2W43A 2XODA 4LXXA 5A05A 2X3FA 3ML1A 5KAMA 4EW3A 4PC6A 3LCRA 4KSBA 3RSQA 3UPTA 1X1AA 2JS7A 2WF6A 3C6ZA 3V1KA 1ZXBA 3LWZA 2A92A 3WTCA 4US2R 1UPFA 1U4OA 2ID4A 2IYLD 3IULA 1YQUA 4UD6A 4FD2A 3MOSA 1YL6A 4B46A 5COAA 3ZJYA 1Y7HA 2CCJA 1X8KA 1C7IA 3H3XA 5EWLA 3O1JC 3PUHA 3MJEA 1E5VA 4QEZA 5FHRA 2HNAA 2A3NA 4PR0A 2MSKA 5GGYA 4PY2A 1AA9A 3KSRA 2FUG1 4WOPA 1K86A 3PIIA 5K05A 1ZKMA 5DMXA 5L51A 2FPMA 5G02A 1VRCA 3KM0A 3ZY3A 1HKHA 1GFWA 4LYJA 1UDCA 2GOYA 3DV0B 1ZVVA 2HHAA 1BQ4A 3CW9A 4AJ4A 2X9NA 4JKOA 4U7FA 4NOLA 3DAPA 5JCJD 5HVNA 2R25B 2QG6A 3NKFA 3LG2A 1SULA 3B38A 3CZRA 3WL3A 2XB2A 2ZYVX 1KKLA 2YOFA 4MVXA 3ZKAA 2Z3ZA 3FPCA 4K9PA 4YO7A 3PFHA 1QU2A 2R8RA 4Z3KA 3O3OB 3LWDA 1JH8A 1T2AA 3V1YA 2ZIGA 4HLQB 5LQMA 3HUTA 3PDIB 4PPFA 1WQ3A 2WUGA 2XY4A 3CW2A 2SKEA 3UQZA 4J0HA 4CQMB 1JW9B 2ZUCA 1FTSA 1U7DA 4PYOA 5I4BA 1QDEA 3B6IA 4TT8A 1GEGA 4YR9A 1ULHA 1QVWA 1OAAA 4UDNA 2I1VB 5CNJA 3ZHCA 4UBNA 4C6HA 1G18A 5A6SA 3T61A 2MTBA 5MFPA 3JX9A 5TF0A 3T3GA 2H0AA 1V1MB 5EMKA 2IF2A 1K3TA 3PQFA 2YC2C 4M76B 4FFPA 3ABIA 3O4RA 4WOJA 4LV6A 1VI6A 3KOUA 2ZI9A 2B30A 4OHWA 1XPUA 3T34A 2X5KO 2KLHA 2XUHA 3VKFA 5AD1A 2QIOA 3JRNA 4AYWA 1MB3A 1LX7A 3ZIAD 3T1YB 1PHRA 3CTPA 3ZBTA 1PX0A 1VBKA 3DBRB 1JXAA 4YRSA 4TT3D 5A1TA 5TVGA 5KTNA 1B26A 3LGSA 1FDVA 4HF7A 1ODFA 2CMFA 4P4TA 5DYWA 1QO0A 4FFVA 2HKIA 4Q39A 5FO1A 4LYEA 5EWMA 1WXQA 2XCLA 4QELA 1PWZA 4H1UA 4HCJA 4BVKA 4BKPA 1B0PA 3A11A 3C0KA 4CKWB 1KF0A 1YFJA 2J3DA 4IIVA 5L7TA 1XQ6A 3Q7PA 3E9ZA 1B1AA 5IJWA 3I2FA 1VQ1A 2QAGC 5F7XA 1DIHA 3HDYA 1G4AE 4BNFA 4D9IA 3EZ9A 1Z4LA 1G8SA 1DHTA 1L7MA 3MERA 1A9PA 1UQRA 4GP7A 2JRCA 2XZPA 4AL4A 4DLWA 3D81A 2BH2A 1DC6A 1SJ9A 2YV4A 1NBWB 2CXPA 3GWZA 1Z18A 3GK3A 3SJAA 5LOVB 4AU1A 2ZK7A 1A3CA 2EZ4A 2PSHA 2XB8A 5BQXA 3VH4A 1LDEA 4KJZA 1MEOA 1USGA 5EE9A 2QKYA 1K6JA 3WLSA 1NW6A 2O0KA 2Q9UA 1JDBC 4ABYA 2V5VA 4CL3A 1E1RD 4M8SA 4NU0A 2IQ5A 4D3SA 2AFIB 2JFOA 1J1UA 5C8VA 3G8CA 3OZTA 4ND4A 5DBOA 1WXIA 4HJRA 5SZJA 2WUEA 3I61A 5DISB 3TBFA 2HCTA 4PO3X 4E46A 4OPMA 3UGQA 3O3NB 2W11A 3KKEA 5DM60 4NJMA 3LX8A 3K4HA 4R8VA 4ZZ3A 1H3NA 4XDHA 4L6AA 4MRNA 2XBLA 3Q40A 1HORA 4D9BA 2J31A 3K0AA 4FT4A 3I4CA 3LRXA 4Q7QA 5A71A 1PSWA 2QOEA 3TE7A 1SG9A 1DADA 2O48X 5KS2A 1Z7YA 3L9XA 4F1KA 1XRNA 5AW6A 5A3VA 1TRHA 2KS6A 1VIAA 3F73A 3FZNA 1XZQA 4ALNA 4A26A 5KPDA 5C8ZA 2BC9A 1E7SA 3WZLA 1E79A 1EUZA 3CH7A 4XWOA 1Y8RA 1W1WA 2OXRA 2W71A 4P3NA 3IT0A 4EG5A 1SUFA 2JF0A 3QM1A 1CR1A 1XCGB 4NNJA 4HXEB 4KAJA 5FCDA 3LSTA 3ZU6A 1YBHA 1W94A 3O4GA 1Q7BA 4MAAA 5JDIA 1AF7A 3WMGA 4YUWA 2R6R1 2VDNB 5KTYA 1BA2A 1MAVA 2C9DA 3NYRA 2QI9C 2UAGA 2GS9A 1YDFA 4H27A 2VHYA 3KL2A 1UDAA 4IOJA 2C4KA 3NDBB 1RCFA 3O7MA 3SQLA 2PR7A 2PUVA 2R85A 1KVSA 4DJAA 3FVWA 2ZS8A 5GINE 2YRXA 4Z4IA 3M3DA 2DH6A 3FPKA 2WTAA 5DM0A 5EMJA 3WGLA 3EFEA 1OX4A 3LVQE 4C2AA 1IHPA 4YXFA 1U3WA 3SOZA 3I23A 1AG9A 3JYNA 4GZMA 1KDYA 3GNQA 4C04A 3MT0A 3O8OA 4JBLA 3VQTA 3JYLA 2FW8A 3MJTA 3M1IA 1CJMA 3NLLA 1T2EA 1G41A 2VH1A 4FFWA 2OG2A 3DKKA 4OXXA 4WNYA 5HG0A 4EPWA 5CA1B 2VF5X 4JI2B 1FC0A 1IL0A 4FUQA 3KOMA 4DV4B 1DWPA 1FJGB 5DSZA 1JWBB 3WHLA 1IQUA 3VA7A 3AIOA 4ITRC 4K5QA 4KN6A 1CCWA 2WR8A 2Y68A 3UXEA 4B82A 1HTBA 2YCBA 3AFMA 3FDZB 4FX2A 5IJAA 4JI0B 1H6BA 4Y2TA 4N8EA 5B1DA 3EOAI 5HX7A 5CM9C 2BN4A 3LBIA 1NSFA 1IY1A 3D3NA 3O5AA 4OH7A 4LGYA 2F43A 2J5BA 3EGDB 1SBHA 4GMFA 3AVXA 1CF2O 4WK2B 5KYTA 3KQLA 1NR7A 5ALRA 4ND8B 3O47A 3S1SA 2R1UA 4YEDA 2C8LA 2OBXA 4DPKA 2DVMA 2EW8A 4YMTA 1ACMA 3PC2A 5BXYA 9GPBA 3Q41A 4O4LA 4FFNA 2JHPA 1HY3A 2F17A 2PU5A 2WG1A 4P7KA 5P8WA 2GZRA 2I4NA 1L4KA 4MDEA 4N9QA 3I39X 4CMEA 2YJ5A 4G4SP 1SK9A 4M7RA 3WOHA 1EAYA 3EZ6A 1T25A 4UUAA 1ENPA 3BSFA 1Z38A 2GAOA 3ED1A 4R05A 2UXBB 1G8HA 1NBMD 5AI4A 3VOBA 3I6MA 4X7PA 3OPYI 5CJ2A 4I8DA 4GZ5A 1DIAA 1Y4UA 4AKSA 1ZU4A 2NZYA 3A37A 4MAFA 2HV9A 1N5MA 1QB7A 2FW0A 2HRDA 2WUDA 3G0OA 4PZUA 4L8FA 1UBHS 4GI1A 2Z5VA 5BN1A 2N75A 2H2IA 2XLBA 4JXJA 1SOUA 4NVRA 1AH2A 2HBQA 4JDUA 4DV5B 1T5HX 4IRXA 3VR5H 2NXJA 1RJ9B 1L6RA 3CA8A 2Q4OA 3Q2KA 4GO1A 4A73A 3N5KA 4X64B 3EIHA 2FR8C 1L5NA 3VYWA 1D9ZA 1TQ4A 4LJLA 5CFRA 2I3DA 5AOCA 3C5WP 2QGZA 3BULA 1SHTX 3NC0C 2IWHA 4C76A 1LLDA 1ST2A 4IQ8A 5KWIA 2FSSA 1MQ8B 1TJ5A 3X43A 3X2SA 2IRWA 5K3SA 2BFNA 4XKJA 3QPVA 1ZS9A 3LMKA 4KAFA 3CZCA 5I48A 5LB2A 5IPFA 3NDJA 1HE5A 1K6XA 4IQ4A 3L1UA 3ZIDA 3WDSA 4ZDIA 1UDRA 3DHEA 1JVNA 4E33A 2ZT6A 4XGKA 2A35A 2HK6A 4JLAA 3KB2A 1RTTA 4AO7A 3ESAA 1RP1A 4LFCB 5IC4A 2JFXA 3DBHB 4ZI5A 2ZYIA 2RGCA 4BC0A 5DM2A 1UANA 2ZKLA 3OPQA 2YQ4A 2R6CA 4U39A 5E6SB 1VHLA 3ELUA 4R68A 1J2JA 3R9XA 3PGKA 1E2UA 3R3YA 4CLDA 4AKIA 3VX3A 4ER3A 1O9GA 4PG6A 2JCVA 3HWSA 2H6EA 3W4IA 4MDHA 3A10A 2Y6VA 1UKYA 3KXLA 1M66A 2W98A 2EOAA 4M87A 4DZTA 3CT4A 2O5RA 2QUJA 3DBOB 4Z0PA 1A71A 2VNAA 4JI1B 3C6BA 2ZTUA 5K8VA 2B20A 4FZ3A 4WXHA 1O95D 4Z0HO 4OI4A 3KQKA 3QYFA 1VECA 1FXUA 1BXGB 1R0ZA 3VPSA 4RBNA 3UB2A 2HIMA 5LDDC 3IBFA 4YO8A 4AO8A 4QUDA 1CLUA 5KHLB 3EVDA 5I45A 1XZPA 5L3RA 1J42A 1KU6A 1GFIA 1NI4B 1WBJB 1NVXQ 4Z9YA 2IH2A 1LI4A 3CUTA 5HYVA 3SP1A 2ZPAA 3DE1X 3E3NA 3K4PA 4JR1A 4B9EA 3CE6A 2NIPA 3E4CA 3EC2A 2O19A 2IJGX 2OQ2A 4I3GA 4RC9A 4W82A 3SNHA 3UCFA 2ZZNA 2X76A 3QIAA 4KBGA 4P92A 1BCRB 1WSBA 2W93A 4C78A 1WOYA 2JIPA 4RY8A 1TF7A 1Z2PX 2HH9A 4H4EA 4E2YA 3ZD6A 3JALB 3CNBA 3IBYA 3UGTA 2AJDA 4LMRA 4MRSA 1LQUA 4F5ZA 2R86A 3DFFA 4TV8B 3FYHA 2V7BA 5LQKA 1RWMA 4KGVA 2C20A 4KODA 5KNDD 4U6QA 2IU4A 3DDCA 1P3JA 3ZW7A 2QR5A 3WMXA 2YMLA 2FWPA 1XKQA 2DR0A 4DF3A 2G72A 4DXDA 1DMSA 3W7VA 3ZXYA 2DECA 2YQZA 1VIVA 4AKEA 3K72B 5K4AA 3IESA 1Z12A 2ZI7A 2I2DA 1YK1A 1BMQA 1F2VA 3O7WA 4PSDA 2PPVA 5CVJA 1RQPA 2IYOA 3UK6A 1NMSA 2DSTA 1QDLB 3AVYA 4WBSA 5AJHA 2FPIB 2KLBA 2RHJA 2ENWA 3R09A 1PN3A 1ETHA 1TQ8A 1JE1A 3NWEA 4QAQA 3RBZA 5TGZA 3DO5A 2D59A 1RWXA 1XZGA 2VNJA 3B78A 3L77A 5ADHA 3L9WA 4BB0A 1XEXA 2WKPA 2WWXA 1PE0A 3S81A 2V6IA 4IQFA 1D0SA 4ARIA 1MG5A 3KEFA 1N92A 1MH1A 5J1SB 4L4SA 4EGQA 2WTEA 4JUCA 3PUKA 1U5CA 1PF7E 4FOPA 5FNVB 1Y1RA 1S8NA 3H2BA 4FFBA 4Q19A 5CLGA 2RMKA 1EMDA 3H4TA 5KVQA 3TW4A 1W76A 2NSLA 2WI8A 4LQ4A 4RV9A 4D42A 1AUQA 1H6DA 4EDHA 2H0QA 4P8RA 3HRHA 2XVZA 3K73O 3JZAA 3I9KA 1UP7A 3QNWA 4NQZA 5BSUA 5HZGA 5K20A 2CV0A 1G2QA 1ZH4A 3O1LA 1YCGA 4BLVA 1Z25A 2B1IA 2F3TA 5BWLA 4YJ2A 5JJBA 1VLMA 5DI3A 2EBFX 3V33A 3ZWVA 3FUUA 1RKQA 1DBVO 2H4XA 5JY1A 1Z6QA 4JYMA 2QTCA 4MZXA 4NBTA 4B48A 1EUQA 4PXSA 4R9RA 2NVWA 2WNIA 1ICIA 4R5MA 5GV8A 1SVKA 1XHEA 3MLEA 3FKSD 1VJTA 2R1TB 1AXRA 3B9BA 4FBGA 3WAGA 2OZLA 4X7RA 2LCQA 1WVGA 4EVQA 3AWDA 3HNOA 1GZ3A 4C2TA 1YRHA 1P4SA 1K27A 1C9MA 3OT4A 4XSGA 5A4IS 5COQA 4B3HA 1E89A 4MXDA 3AFNA 4BNMA 2HHLA 4E12A 5BPHA 4R0MA 1NDUA 1HXHA 2WFZA 3DC2A 4K2HA 3ZJUA 3E9CA 3H13A 1N7GA 1VTKA 2P2GA 3KK0A 1NVWQ 1GUAA 4QBIA 4AS3A 5KDDA