1VSQA

Solution nmr structure of the productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
132
Chain Sequence
b'TIAIVIGTGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVETGREGVKALKAKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannose-specific phosphotransferase enzyme IIA component
molecule tags Transferase
source organism Escherichia coli
publication title Solution NMR Structures of Productive and Non-productive Complexes between the A and B Domains of the Cytoplasmic Subunit of the Mannose Transporter of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
total genus 43
structure length 132
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.1.191: Protein-N(pi)-phosphohistidine--D-mannose phosphotransferase.
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 1vsqA00
3B48A 1PDOA 3GX1A 1VSQA 3CT6A 1VRCA 3LFHA 2JZNA 3IPRA 3BEDA 5T3UA 5IM4F 3MTQA 3GDWA 2JZOA 4TKZA 3CR3C
chains in the Genus database with same CATH superfamily
2PYDA 3O3CA 4TUYB 4DCVA 3D3WB 2NZVG 3TWOA 5C5CA 2XHEA 2P9CA 1KYXA 3F7TA 3EPRA 1JDUA 1GPH1 1UBGA 4PR0A 5A4KA 3QMWA 4XM2A 4X1OA 3EPHA 2PRSA 3RVMA 1NAIA 2VP0A 2QTHA 1E2UA 4JOCA 3R7DA 2EZUA 1W73A 2YIJA 1RFGE 3L7JA 3QPCA 2I3BA 2CV2A 2RE8A 1B43A 2C61A 3KEMA 3T99A 3WMXA 2AX4A 2CHVA 3ANYB 1R6UA 3IAS6 3V7YA 4AL4A 4LCJA 4DLNA 4GOKA 3G13A 5C4IA 3CPSA 4MDEA 3ZWWA 4GL2A 2EG5A 3WNCA 3D4OA 4B48A 3L6EA 1ACMA 2C96A 1SM4A 2PS3A 4QOHA 4NLLA 5EXDA 4D3DA 5CA1A 3JZDA 2Z2IA 1QOQB 1KHHA 2J0QA 2W98A 5DW3A 3GAAA 2D06A 4F46A 3RC7A 4ZIRB 3SHWA 2C0CA 3HJTA 1MRZA 3NKVA 3O03A 1Z83A 3O3OB 4LS3A 4KC0A 4NENB 4PG5A 2A0YA 2H08A 4G36A 3KQQA 2V7XA 2GHQA 1ONOA 2OLKA 4RD6A 3EIHA 2CVZA 5IM4A 3A6PC 2O7RA 4I4TA 3KOOA 4KKXB 2UZ3A 4X91A 4AY5A 1W0KD 2W4QA 1CRWG 5KPDA 4L6AA 3JATA 2GPAA 1E8MA 5HF6A 2VRCA 1JG7A 4W7IA 1WHTB 5ALHA 3TKYA 1DJQA 2BL4A 3IP1A 1YBVA 2P9BA 4TWAA 4BFWA 4CM7A 5BXQC 1GTVA 5BY2A 2V3CC 5MHTA 1W85A 1WBJB 4XSHA 3IKMB 2R87A 3VRHA 3TJMA 2P2YA 4FNGA 1N2GA 3BGVA 3DVLA 1GL6A 3DLTA 2HEGA 3V2IA 4EFMA 3HABA 3KQWA 1ZVVA 3WLQA 1JSRA 2FP4A 1YK0A 4ZV7A 2HO5A 3L8ZA 2BBSA 2YMLA 4B6GA 5BMOA 3VDNB 4FHDA 1RT9A 1TUEA 3P9SA 1FNMA 1A2QA 4YBZA 2A94A 4ENTA 1S8AA 2GO7A 2QAJA 3M33A 2CLLB 5BQXA 3G2QA 4QICA 2EW8A 3O8RA 3BCUA 1WMAA 2YC4C 3O95A 5J58A 3ZKWA 2VNSA 1QLHA 3V4VB 4LFAB 3L9XA 3MJHA 3QFFA 1UDRA 3OEED 3LSYA 5LP6A 4MV4A 4K3UA 2YZ2A 1DV2A 1A76A 1KMNA 2I3ZA 2PZMA 2FUKA 3AIMA 2IOYA 1GKUB 1JIKA 5HZMA 1Y5LA 3AR9A 1N1MA 5A6SB 1KK2A 3FVQA 1XJWA 3RYHA 1L4KA 1N6HA 3TFQA 1W5BA 4DDTA 3PCTA 1XTIA 2QLTA 1TA9A 4YJFA 4DDWA 3MERA 3ICVA 4E94A 5E3IA 4QVKA 4W5WA 2P5SA 5HQ3B 4EWLA 4BP1A 5D7NA 1PL6A 3DLBA 3SHOA 3TLAA 4AF7A 5TIIA 5HKOA 2HU2A 1OXMA 2JAWA 3SZGA 1UC5B 4UHJA 3G1UA 5E6SB 1IBKB 3T4UA 1VCIA 5H9VA 2WJ3A 3TQCA 3I2YX 2IPNA 1RZUA 2YJ4A 2WIJA 3MSXA 3OQPA 4QPDA 2X86A 1PZFA 2V4MA 2A0FA 3LQ1A 2YASA 1GPNA 4MGIR 4LOKA 4PFSA 4UM9D 2YW2A 2MCFA 1AZSC 2OZPA 3PE6A 4WL0A 3A1CA 5KMGA 4RVGA 4V3CA 4YXWD 4KN9S 2XMBA 4JWKA 3D3WA 1OVMA 3PK0A 4IQGA 2AXPA 3WG9A 4BLRA 1G1AA 4WQMA 5CCXA 3NRBA 3PQ8A 4RF3A 2Y66A 3UY4A 1MT0A 1V9LA 4DLLA 4G07A 4PG4A 5B57C 1QSGA 5SY9A 4IIYA 4M2LA 2O48X 3KHUA 5CH5A 1EG2A 3H1GA 4QJ5A 1X7GA 2QD4A 1JFVA 3MTQA 4C43A 1KZGB 1L7QA 2H9YA 2BBTA 1I7NA 2FPGA 5L95A 1AHNA 4NULA 5FO1A 5KTNA 2ZE6A 2FUEA 1YS4A 1CRQA 1UK8A 2P79A 2R6JA 3IOYA 1SK8A 3KT8A 4L3WA 4B82A 1FFYA 3NM4A 2X9LA 3GRZA 1HYGA 3JZAA 3VZDA 3QW4B 3W04A 2ZXEA 4DUGA 3K30A 3AJ9A 4QBKA 2NVBA 1YO6A 3U4IA 4K9RA 4M36A 5FAXA 2HMTA 5HM8A 3Q5DA 1H5UA 1NMYA 2XA2A 3VSAA 3ESZA 4Y6LA 5EP4A 4D8XA 3QBJA 4G1FA 3HNOA 1QMPA 4B9AA 1U2QA 2WF8A 4X66B 2XEXA 3I1YA 4G5GA 4RNDB 1RWPA 1TM4E 4R2KA 2VZEA 5KTRA 3QSYA 5K0LA 4JASB 4C20A 3DBLB 4UXHA 2VH1A 1VKRA 1YJ8A 1C3LA 3F98A 4X63A 4PO9A 3UKDA 3TFOA 1WKVA 1QGAA 2XWBF 3P4YA 2QSZA 4KI0A 4Q12A 4YC7A 4AJ4A 1EFCA 2XOEA 1W36B 1A0OA 2KJQA 4FYVA 4P4TA 1KMCA 1TYDE 2EFHB 5E6RA 5AXCA 2GVNA 5M2QA 3VSCA 3AHIA 4D82A 1Z4KA 3EAQA 1U28A 2HCFA 3FRIA 5KTPA 3E9YA 2DULA 4NABA 2NTVA 1U8XX 1DC4A 4NEQA 4MB2A 3PNMA 5FA5A 5AVVA 1H8HA 2Q5HA 3DDOA 1LBEA 1SIUA 1K68A 5CIWA 3AM3A 2FJ0A 2GJ9A 1NI4A 4TVOA 4YHBA 3D4BA 3D4PA 4MVJA 5BSKA 2DHDA 3MXTA 1O03A 3LYAA 2GAJA 4LV8B 3HJGA 5E4FA 2UU9B 2D7JA 1V25A 4KQGA 1I13A 3OCYA 5SV2A 1P72A 1YRYE 3O8QB 1KRHA 5AJWA 3RI3A 4C6SA 4ZXPA 1Y7TA 3HUUA 1HRKA 1YJCA 2B8JA 4GXQA 5CM8B 2OY0A 1KEVA 2I7VA 2IYYA 4GYJA 4KAAA 2DWUA 4P98A 4UBIA 4MS1A 2A59A 3O8BA 4TYMA 4ZVLA 3KSBC 3USCS 1KP2A 2IHYA 4NAUA 5IG2A 2JCYA 3DMGA 4DY4A 2O8FB 1U8CB 4O1HA 3M5CA 5AOAA 1G5FA 3OFJA 5CDFA 3IJPA 1WTAA 4S1TA 1K06A 4MRRA 2J46A 1LLQA 2R3SA 3CRQA 3H18A 1C2YA 4PU0A 1AKYA 1Z68A 4G0QA 4TS3A 4B5KA 1GM5A 5DTIA 1FNSA 2AJBA 2RFLA 3INYA 1W2GA 1AHIA 5EYPA 3FW1A 2J7KA 1MU0A 1CUBA 2ANCA 5I7SA 1VFPA 2V0NA 1EHYA 1DKOA 2PRKA 1N33B 1NSYA 2PS9A 2QRGA 1F4PA 1Z8HA 1DE0A 3NM6B 1KVTA 1VJCA 3QPAA 1VHJA 4HAYA 2PANA 5IDYA 1RLMA 1T3HA 1LDMA 3KLNA 1B8UA 4I2VA 4O2RA 4PNPA 2W6NA 5HTKA 2NO1A 3PI7A 4PIMA 4RK7A 4UTZA 1HNNA 5U4XA 4PX3A 1IVNA 4YRGA 2HU7A 2IPXA 3M5DA 2C4MA 1G3RA 2PH5A 1WKCA 1P2DA 1YS1X 1PSDA 2LKDA 3F5DA 4II3A 2NPOA 1ZA1A 2QQEA 4WY2A 4C0SA 3R5JA 4CG0A 5J3JA 2WYIA 1Z4MA 5BQPA 2GZ1A 1ECBA 1RPNA 2CMFA 4GL4A 3K6RA 3SMQA 3VH4A 3FMVA 4EG1A 4UOZA 2YNMC 2O8CA 1VIDA 2R9VA 3SSAA 4CR8A 3JARA 4C2BA 1U0LA 2FSPA 2I22A 2NSLA 4KIUA 4JP1A 5MN6A 2B6HA 2WU0A 3QTBA 1FTNA 1PNOA 4NMLA 1H0RA 1EWYA 4YRDA 3IX7A 3V4FA 1Y3BE 2FW0A 2I2BA 1KDTA 4OHCA 3P9IA 1M7GA 4OJQA 5JT1A 1U7DA 4ZVOA 2HT1A 2IIVA 4MW6A 4H0CA 1Z4IA 4RAOA 2C94A 2I7CA 2P6OA 3CEHA 5AI4A 5I7AA 1QU3A 2ZS8A 4PHHA 1D1QA 1JAHA 1SQ6A 2GHTA 2FMHA 4P3NA 2BGTA 1L7EA 1SPXA 1TTHA 4LMPA 2ZYTX 3AV0B 1N2CB 4PFQA 4WZAE 4JH0A 3EOAI 1YFJA 2Q5LA 3A26A 1FQKA 1QIFA 4OLBA 1H42A 3A9UA 4P81A 4C5AA 1A4RA 1G9XA 4EUHA 1WBDA 2HWXA 3FIJA 3TEFA 4Y2SA 4ZAWA 2YIVX 3L8YA 4WBNA 1NNI1 1PK8A 2FPKA 3AT1A 4PYNA 3ORSA 2CLKB 2Y0BA 2JEYA 4BQQA 1EK2A 1TCBA 1ONNA 1I4EB 4JEUA 2PRJA 1GGJA 3PHJA 3PRYA 4Z4IA 3LVFO 4QG3A 1IQUA 1SO8A 3UJDA 2XMSA 1IJKA 1TU4A 1Y82A 2PLWA 2QZJA 2XYQA 1C8KA 3H16A 4WOJA 3L8CA 2EZ9A 3MGAA 1N8NA 3X3HA 3U4QB 2HXGA 1ORWA 3GNSA 3DL7A 1ZC4A 3HGQA 3OOSA 4YACA 2CLIB 1L5FA 1RHKA 3I42A 4KMSA 1QVAA 5E1BA 3NBZC 3ONNA 1E3TA 1G16A 2MSNA 1BHJA 2RKOA 4KNWA 3TMYA 4R1SA 1MQ8B 4MPJA 4QPZA 1Q3TA 5FUWA 4LCBA 1W76A 4E12A 2C8KA 1UKAA 4GLFA 4R6XA 4G1EB 3HB0A 1IH8A 1P0FA 2H18A 5J5AA 2Z95A 3ULKA 1MZPA 4PICA 1RWQA 2XGOA 3GFGA 5H8WA 4WV3A 4XJXA 1VCMA 2VJAA 4MKGA 5SZIA 1P6QA 5FF9A 2WLTA 3SEQA 2V0CA 2R1VA 1RJWA 5K6TA 2H7YA 7MHTA 4HAVA 4J0FA 3M3DA 2BZ0A 1PYOA 3SEAA 4E5DA 2VHZA 4PHGA 1E7YA 1VTKA 1K3TA 2BSXA 2RGXA 4QTZA 3H13A 5E3JA 3FOAA 3HR4A 4XR9A 1XZMA 2BI7A 5FTWA 4K40A 4LSGA 1E0SA 4ZMBA 2C5LA 3R6DA 1MW9X 3A6KA 1OROA 2X7JA 2NZXA 3BFXA 3E03A 3GEMA 1U1CA 3C3WA 2YHUA 1Y8ZA 2VWGA 2COKA 4ILEA 4EL0A 4BGEA 4ZHQA 3T7CA 5A7HA 5TY0A 2X76A 2YINC 1MJ5A 1QIKA 2HK6A 3O90A 4KFSA 3RKUA 1XALA 1A9OA 5B55A 4JX8A 5MGNA 2W70A 1S6YA 2I0FA 2MMCA 3SDBA 1YIAA 4BMVA 4RKRA 4ZAFA 2FPSA 3WNDA 1PE0A 2C8JA 5B7NA 1T8RA 2VDPB 3SE0A 5G1PA 3CX3A 3MBIA 4TMXA 4MGEA 4OH7A 4TUYF 4QUBA 3ZD7A 1MXFA 1E6EA 1EVQA 3BFKA 3GPIA 2BDUA 3L8EA 4JJ6A 5IYZF 3C7DB 3VBCA 5FL7D 5EEHA 5JCOC 2BGRA 2IKQA 1M7BA 3O0DA 3JR7A 4ZQFA 1XLTC 3EA4A 3U4MA 3WIBA 1U9CA 4K8OA 1PAUA 3DE5X 1KEEA 4ZI7F 2C9OA 2JFZA 1E2FA 3U4AA 4MS3A 4L4UA 1JLRA 2GVDC 2Q3EA 2QF7A 4Q3KA 2EF1A 1P3JA 1QUFA 1NT2A 2PMCA 2R6ZA 2X5XA 1L3BA 5CH3A 5AI8A 3I62A 1E2BA 5IJZA 1F5NA 3I3OA 4ZDKA 5DCLA 2WB4A 2C5FA 3D4NA 5HBRA 2FW1A 3HCPA 2MHCA 2QG4A 3HCFA 2NXJA 4UCFA 5IJ9A 4N3GA 1BE0A 1FPQA 5TEVA 2OPHA 1H6DA 3IRUA 3I45A 3VO2A 3CVVA 2DEUA 1XNRB 1Q74A 1MBZA 2VDKB 3NHJA 3GAFA 1X70A 4HH0A 5DW0A 4AAYA 1M8GA 4J4HA 4JUFA 2NU7B 3K32A 1EWTA 4KPUB 4GS5A 2UZ4A 1O6BA 3HFRA 3OIDA 1HNZB 1BRTA 1M1ZA 3JYOA 4HBGA 5KBYA 1I6LA 2VNAA 4PIPA 4LCEA 5H16A 3VR0A 4X71A 5J4VA 2IUUA 2G63A 3EMKA 1HDOA 3AB3A 4BIIA 3K4QA 5JVDF 5JAHA 4W1PA 3TZEA 2G36A 3OKFA 3H2BA 4YT4A 5K8VA 121PA 2ZBPA 4JL5A 4UFNA 5CVDA 2FN4A 1XDZA 3A4NA 3ZQ6A 1P9NA 1YQQA 3LKDA 4Z4HA 1J00A 3AGPA 2E89A 2QX9A 1UBTS 3R0ZA 5T4BA 3UAYA 3AIOA 3T8YA 1Y9DA 4WOKA 1JSXA 1QS0A 2XVZA 3I2KA 2HLNA 3LUJA 1QGED 4DE5A 2ZULA 3TYXA 3VO8A 2GUGA 3INGA 2P9GA 2JIMA 3E0XA 4X93A 2GPSA 4WIAA 1UMCB 3S44A 2B4YA 2INGX 3C7AA 3AF0A 3G0DA 3U1VA 3TW8B 4ZVSA 4AU1A 1GL7A 4E5SA 4XM0A 1KZ4A 4XSGA 5HMLA 3U39A 1Z0IA 4J7XA 2EHDA 1E9VA 2UYOA 3GGDA 1R0WA 3BZBA 2B20A 2YWXA 3A6EA 1TZJA 3DTYA 3NJ4A 3OEEA 4OGKA 3EULA 5PNTA 3U7GA 3G2HA 1LSOA 4B8WA 5CEEA 2KQUA 4XYGA 1QKJA 2E85A 2BEVB 3U0VA 5F3WB 4RSHA 4XEUA 5SYAA 5GMOA 1UKZA 2FVYA 4RCYA 2AN3A 3DEIA 1TJPB 5FOVA 3F5QA 3AGQA 1XU7A 4DQKA 4ODIA 2IYAA 5MFPA 1AGXA 2GPWA 4U4AA 2IXGA 2W00A 4IH1A 2B5OA 2OYRA 2VF8A 3FFTA 1CV2A 4F72A 1WZIA 4GWGA 4YAEA 2HHLA 2XYVA 3ADDA 3TIVA 4BNGA 3GQVA 3PFKA 3WMWA 5BV7A 5DM70 3A4TA 1P9WA 1PIWA 5GGXA 1CEYA 2SKEA 4JUCA 4LA4A 4BFZA 4BMOB 1RLUA 2C5SA 4HDMB 3PD1A 4KGXA 3UJ6A 2CXTA 1XZLA 3ADCA 1L7VC 2PKWA 2QTTA 1XQXA 3UQYS 5AVYA 1HE4A 1NLUA 1BWRA 3BGWA 2I7TA 4EKEA 2O0LA 3N2LA 1J8DA 3D2AA 3W8RA 2WIAA 1MV8A 1E2LA 1SK9A 3CCBA 2VC2B 4Y2JA 1V1RA 2CSUA 2G0TA 4O4LA 5HKKA 4BMZA 3IUJA 4TS4A 5FBWB 1I1QB 4RD3A 3VR2A 1BROA 1P2FA 1NWCA 1U4SA 2OYSA 3WMGA 5CD1A 1CUHA 2MYNA 1WS6A 1FBTA 2V54A 1XNHA 1JG4A 2D2EA 1EB9A 2PY6A 5FX2A 5GADl 1SHUX 3GH3A 1V8ZA 4YDHB 1MAAA 4U39A 4F3KA 4JI0B 4QGFA 2HK8A 4NZ9A 2NGRA 2X8AA 3T9FA 5C81A 4BC1A 3MWEB 1MVOA 4M1EA 4AYTA 4D9NA 1GPAA 4EFKA 2Q3MA 3IB3A 1AKUA 1AT1A 1E9AA 1R3UA 2W2VA 4FUQA 4L95C 3PUZA 4YT5A 5DNYB 1QU2A 2IHKA 3UEOA 2ZB3A 2ZLBA 3EUEA 4KTVE 2Y05A 1JSZA 2QN2A 3RC1A 1DPFA 1O5OA 4YA6A 4BKOA 4L07A 5BNTA 5AKJA 4ZCPA 2NG1A 4I50B 1E3DA 1AO3A 1B2RA 4HF7A 4UHKA 3WDKA 1QNFA 2J3LA 3ENVA 4HSGA 5CX4A 1NRJB 4MVJE 4N7BA 3WNZA 3K9WA 1DGQA 3FBGA 2H5IA 1W29A 3PTLA 1U7HA 4ZEVA 3THXB 1M1NB 2EWVA 2BP7A 5DVZA 3M81A 1OKKA 3MWGA 1ATZA 2DF8A 2C4NA 3QPBA 2P6UA 4JLUA 3A1WA 5HBGA 4Q1FA 3ZLVA 1YI0A 5HX7A 1JIIA 2ID9A 1YACA 2XTZA 2F4VB 5J23A 2O0KA 4GGPA 1NULA 4TWIA 3S8MA 2Y8EA 2Q8NA 1QVVA 3NLLA 4DJ5X 4DA4A 2E5LB 3OPNA 2IHNA 4JELA 1NVGA 3IR7A 1G8YA 2D7CA 3KR9A 2CW5A 1JEYA 3HO1A 3JU3A 4R2JA 3NKFA 1DC5A 4K9QA 1M72A 1W44A 1ZLXA 3ZWCA 2WT4A 1XJQA 3V1YA 4BNLA 4Q24A 4DIMA 2F9LA 5KVVA 1ETHA 2QU7A 3IUBA 4AKSA 3WLSA 1QJCA 3MRVA 4BV2A 2VRBA 5JYCA 4YXWA 1G7RA 1X6VA 1UMCA 1X1RA 3EZLA 4ZVMA 4LWPA 1KFKB 5KYWA 1E98A 4H7PA 1HM5A 1JHMA 1XJCA 1PBNA 2ES4A 3DFFA 1GO2A 1ZN7A 5REQA 3CZMA 3U7IA 2QGFA 1YUMA 3O8LA 1FMFA 1GPBA 2CFTA 3QY0A 4NOMA 1FE8A 1X74A 3EGXB 4MV0A 4CM3A 821PA 2BM8A 1PHRA 1U6JA 2FGJA 4MUNA 4JLSA 1Q0SA 1W4BA 4IYJA 5JSYA 1X7ZA 1QV7A 2JAXA 2WG2A 4LZNA 1V11A 1W5SA 4JQCA 3QXCA 2ENWA 5ALDA 3QIAA 3RYFB 1SCDA 2AMJA 4HOYA 2R48A 1BDIA 4DSAA 3OICA 5EJ7A 2WR8A 2CLDX 4XDZA 1RD4A 1T0JB 1UPBA 2ACKA 3PGVA 2J0UB 4QD3A 5EMHA 5TJHA 1O9GA 2VAWA 4J3NA 3Q1KA 3OWXA 1IZ0A 2QTRA 2CJWB 4LQ4A 3PC8A 4RDCA 4RY2A 3T9DA 2WA1A 3WK6A 3DL0A 3ZJYA 4RPIA 1QDEA 1EGVB 3E2IA 3FZNA 5AVUA 4D25A 3DTVD 1R74A 2GEVA 3MT8A 2H51A 4V0SA 3SDSA 4JB0A 4QRHA 1Z18A 4ZO9A 4DUGD 4HX2A 1LK0A 2EBWA 2ISCA 4KW7A 2FXVA 2NAPA 1SA0A 4MUEA 5DHQA 5BWOA 3VV3A 2JFBA 4OJTA 1VB3A 1JDNA 2TYSB 3R5KA 4L0QA 4RORA 5ALMA 5EQFA 3WIVA 1ZGHA 2P5UA 4XX0B 3ECSA 4V0NA 2C2MA 1VPTA 1J9EA 2CBZA 2X58A 3T35A 4F1KA 1YVDA 2CXPA 2NSJA 3COSA 1FQJA 1X0VA 3GU3A 3ZVMA 3LCUA 1P7ZA 3RAFC 4RH0A 1KWGA 2VWPA 5C4MA 1IUOA 4MS1B 3PUVA 3N6VA 3WGHA 5LU8A 3LJKA 2AC4A 2V6JA 3MWKA 1JWLA 3D31A 3FAKA 1MC4A 1P1IA 3BIOA 1XPRA 3RT9A 3L46A 1MH9A 1UP4A 3KJEA 3IAUA 4RTMA 3B1FA 2IHBA 1IDN1 1RLIA 2G5TA 3PFNA 5EWMA 4ZAGA 1JYSA 4P6VF 2WJAA 3NBKA 4BV8A 5DLEA 2ZRDA 1YRHA 4DW8A 1BMQA 1T36B 5ALSA 2BELA 1SKUA 1XQ6A 2VAVA 2CFSA 3L41A 3NV9A 4PLWA 4XD7D 1PL0A 2B99A 1U0JA 4LPSA 4PAGA 3NEPX 3T3GA 5A2GA 4FWTA 1Q0TA 3BD6A 5A5FA 3PLAE 2JAUA 2XF2A 4R7TA 1E3EA 3ZK7A 1Q5PA 3B5EA 5FWDA 5FV7A 3TAHA 1C2TA 2BZGA 2LZ0A 1NF8A 3N6XA 2Y6UA 3T54A 4BASA 3U13A 4BKUA 2HCTA 1XAIA 2BTEA 2I65A 3IDOA 4AN4A 2BJWA 5IXJA 1QAMA 1WOMA 1V5EA 1PD0A 1A82A 1L5WA 1II8A 3D6TB 5WRFA 3TRHA 1IN1A 1N9GA 5DNWA 4YT2A 4JOQA 1O77A 2W83A 4ZN6A 3ZGOA 4H7IA 1UKCA 1GNVA 2Q9UA 3TVDA 2C2ZA 2GTIA 4NNJA 4IO0A 4QPPA 3OCZA 3ZWVA 4C3UA 4DZTA 5BWLA 3ZH2A 1ODIA 2C58A 1NVEA 3BUSA 3W9YA 1TFRA 1F7UA 2J9FB 4O0MA 1WR8A 4XTRA 5B1YA 1AE1A 2H4WA 4D6PA 3EXFB 3RUCA 4QBFA 3FTEA 5JFOA 3IQIX 3SBEA 2DUUA 5JNVA 4TXJA 3GQBB 1FP4B 1CJSA 2YS6A 2Z43A 1JT2A 2XKAA 3F8TA 3WSWA 2PUVA 1D0SA 1RSZA 4AW9A 4KXLA 1U7PA 4F91B 1QTIA 5HIMA 3OZVA 1KAGA 4D56A 2X40A 3GLGA 2GTHA 3RK1A 3ZU3A 5IVIA 4LXXA 1LLFA 1XEXA 2AT1A 2R97A 5BQ5A 3NCTA 3STTA 2I33A 4AI6A 2OYCA 1CUVA 1HI9A 4IGIA 4DCGA 5ALXA 3LGAA 4WASA 3U56A 3LQFA 1VHTA 3N59A 5KCZA 4F2DA 4H60A 1KZ9A 2FW7A 3BEDA 3P45A 2NVUB 3V1MA 5KSWB 5ISMA 1AN9A 1Y6QA 3HJAA 1JH8A 1GNRA 1XZJA 5GONA 3T3EA 1FXWF 3FJYA 1LPSA 1P8AA 2B1GA 3EFBA 3VH1A 3IVXA 1N2JA 4YXFA 3NBYC 4RZUA 3RYTC 4D5GA 3T95A 2I8CA 1L5VA 4WRRA 2X6TA 4H6VA 3FI9A 3NNSA 4B7XA 2ATIA 4XIJA 4E4RA 2KLBA 3DZJA 1SU7A 3Q7TA 4RNCA 3B13B 4H0FA 3Q8XB 5JQGA 1JFTA 2VK1A 1QFJA 3DB1A 2SKCA 3HE3A 3HYNA 5ULLA 1I4DD 1AGPA 2NV0A 3SJAA 1EXNA 2CXUA 1RYMA 2RGYA 5DSZA 1QAQA 5DI9A 1TPZA 1XQ1A 2JA1A 2WYUA 1U9JA 4QGBA 1PS8A 4B80A 3HLTA 4CMEC 5DM2A 1HLFA 2R7MA 3THOA 4EVQA 5TMPA 3QX9A 3STXA 1YNOA 5ENDA 1CERA 3RBAA 4N49A 4EKIA 1VE7A 2BT4A 4PFKA 4TWBA 1TEXA 3QI2A 3THYB 1H2HA 2I67A 2WICA 3PNQA 3QVWA 4LFCB 3RRMA 3W9UA 3WL7A 2PE5A 1TQ2A 1M3SA 2AD1A 2N9UA 2HJGA 2Y0EA 2BOVA 4LWQA 4OJNA 5CFOA 2QRNA 2NZ2A 2YWEA 5EUCA 4CKWA 1PT7A 1WX1A 3OUZA 3CO0S 3CNEA 3D0KA 1OLSA 3MJRA 1SZDA 3NAQA 1G21E 1P4RA 3C3JA 5IYZB 3BE4A 5LU9A 3SP1A 4PINA 3VMFA 3NFYA 3TUIC 4AJ1A 4FLFA 3DGEC 1DCKA 1NV8A 5CLQA 1TK3A 2ZI6A 1AVTA 3QPWA 4G1BA 2PS0A 2H7CA 3K1TA 2HF2A 2HH9A 4UQOA 3O5AA 1CYDA 2W6PA 3BXGA 5DX8A 3LDAA 2X4IA 3OJEA 2BFCB 3WO1A 4UUQA 1E4EA 4US1R 2R65A 1JR6A 1B26A 1WG8A 2VRWA 3LUDA 3QYPA 3CMMA 3JALB 4UMVA 5LYJB 4BTEA 4DVGA 3KLBA 1QHYA 3QF4B 1XHEA 1LW6E 2SNIE 3CF2A 3BBPA 4CZ2A 1RWKA 2R8BA 1CHDA 4J0QA 4C5CA 5EGNA 4TKUA 4LV6A 3FBWA 3WK5A 1SBHA 1AIPA 3ESAA 3AVUA 5K09A 5JANA 4U6QA 3MINB 1DBQA 5KQRA 4MXDA 2WWYA 3BXOA 3ZOZA 4XDGA 5TGTA 2E4WA 4NPCA 3EGEA 4C0HA 3PT5A 2A8YA 2FRDA 3NIGB 1EJ6A 4WOPA 1TFUA 3JQCA 3K0CC 3SMVA 4A73A 2NO5A 2QG6A 2Z1NA 4NAHA 3PWKA 1FP7A 2IIPA 1VG1A 2VZ8A 2IXAA 1CB0A 4I9UA 4UBLA 1SN7A 1WXDA 1Z7WA 2CYCA 3RVSA 5ALIA 2R7NA 5AHWA 1PF7E 2H85A 5JPIA 4IIUA 3Q8MA 1DTEA 2YXBA 3ANTA 5IDXA 1CQJB 1EB8A 4BFVA 1L8XA 2NM0A 1TCCA 3IIEA 3KWLA 2EJTA 1FF9A 1R6XA 3CNHA 4FN5A 3HA5A 2VWHA 4IUBS 4RMJA 3CX8A 4R0VA 1QQAA 2YJ5A 3FWPA 2HMSA 2OK7A 2ZTHA 3LMKA 4HTAA 5KJEA 3OQMA 5HA5A 1VA5A 1KI6B 2QSYA 2ZIVB 3ZHOA 2O8BB 2J0SA 3BGDA 1YR3A 4R40A 2VIIA 1A9SA 5FTJA 1JGTA 3HS3A 3VR5A 1QE0A 3QXSA 4OEHA 4ZYTA 2QMQA 5DHTA 4EGAA 1X9HA 4NF2A 1B14A 2L42A 1HWYA 4JHLA 1B6SA 3DEYX 1G64A 2OCYC 2P62A 3AXSA 5DYYA 1TGVA 1ZG3A 1YQ9A 2XOXA 4HN9A 1SRRA 1UIRA 1G0OA 3HB7A 5AWFC 3MS4A 3AERB 1WF6A 3CH5A 4QYIB 4RENA 1Z4OA 4J4BA 2QIOA 2QLBA 4DMFA 5TR9A 3TTSA 2PTGA 3CZRA 5KYNA 2HA5A 4MVJM 2RG1A 2VZLA 2C54A 3KB1A 4DRXB 1O08A 1Q1BA 2YOFA 5CBKA 1KY2A 4E46A 2IEZA 4Y2GA 3G8YA 3JQ9C 2C4KA 2QX4A 1VHWA 5K7SA 1V16A 1QZUA 4TVSA 1DMSA 1QP8A 2JI4A 1O94C 3OX1A 2XHZA 3SZ3A 2Y9MB 2ZIXB 1RU3A 3AEQB 1F51E 1KERA 2PQMA 4ALKA 1NTOA 4MV3A 1RXUA 1S2GA 2FZ5A 2IW1A 3PFWO 2A14A 2VHJA 4QGSA 3H84A 1ZZGA 3DBHB 4PN7A 5LOVF 3ZDRA 4F2GA 4DV4B 1Q95A 1TMOA 2WIFA 4N48A 3IC5A 2P1ZA 2VJBA 2UZ1A 4B73A 4HMPA 1VE9A 3EEIA 1DWQA 1TTPB 1F4VA 3KKEA 3GGSA 2IVFA 2W0SA 3GUHA 2PWZA 1SXJE 1VMKA 4H3HB 3M6IA 1YULA 3P0FA 2FI1A 1C0LA 1YQWA 3CTMA 4O1IA 5YASA 3VDXA 1O97D 4LAFA 3IVMA 5K8UA 4CUJA 1MJNA 1RCUA 1D07A 1IHYA 2F64A 2IEGA 1PYDA 2GEBA 2HI0A 3WZLA 2C7RA 2P2CA 4ZODA 2AFVA 4P7FA 2PR2A 4BEWA 5AVXA 4MWEA 3HXTA 2V1XA 2D0DA 4ZXFA 4QXRA 2D00A 3IP7A 5AJUA 2JGIA 3GUUA 1N2OA 4JHXA 4RELA 4RLFA 4X3CA 3TZBA 3IPAA 4JLKA 1N92A 2PA3A 4MI6A 1OR8A 1XDGA 4EGFA 4ZCRA 4BP9A 3VVBA 4EJFA 1JHRA 3WADA 4MCHA 4IAOA 3V7WA 4Q3DA 1BQ3A 1YGYA 1YFKA 2EKZA 2FHSA 4MHOA 4Q39A 3RSSA 3S2YA 4DLZA 5C8YA 4TUYA 2YBEA 3KVVA 4FM9A 5AYVA 3OCXA 4WXYB 2Y1CA 4CDRA 3LP6A 3T1VA 1E6WA 3H1EA 1HOTA 2Q8PA 2QSUA 3H8SA 4KAFA 5ELLA 2WTAA 5I5GA 3GUCA 4MCAA 3GRCA 3BD9A 4WESB 2Q1XA 4BE9A 3OG9A 3P2KA 5J1SB 5E7QA 3DT8A 5DNUA 3JYQA 1CE8A 3OUTA 2YWRA 4ENSA 2OAP1 1ACJA 2ZSHA 1KK3A 1EU1A 3MOSA 4MQ4A 2JANA 3GT4A 3GDFA 4INAA 4DJTA 3IIIA 2JFPA 2MDTA 2EF0A 5DFAA 2F1OA 2A58A 3NORA 1R0LA 4RIEA 4U5XA 2ZBEA 1ZM3A 3F0TA 4B2LA 4EPWA 5LA6B 1AUXA 1I6MA 1P8JA 2QE6A 2QKYA 4U7GA 4ZVRA 3GC6A 4WNCA 3ZTTA 3FPFA 3IHTA 5EJGA 1GT91 1L5LA 2BGIA 4KYUA 4RBNA 1W9HA 1Q84A 2CLSA 2FQ1A 3PDWA 1SB8A 2I76A 1W25A 3RVBA 4OFZA 4PAOA 4Z4EA 2JVKA 3E6AA 4ZHQF 3GNLA 1VM6A 2GPTA 4OJKA 3E53A 1NPYA 4IIJA 5KVQA 1W49A 4L74A 4HLCA 4L4YA 4IICA 2ZR8A 5IBQA 4EDFA 3N0XA 3L0ZA 5KQMA 2PUEA 2PS1A 3TRFA 1GRQA 4O02B 5EMKA 1HQDA 4S12A 3ROPA 2A1TS 3LQQA 4NV0A 1YZTA 5IT5A 4TMZA 2FLKA 2WIGA 4LI3X 3SZMA 5FFFA 1V5IA 2NO4A 3AFNA 2O07A 3Q0IA 4FHEA 3UV3A 1R4ZA 1HZZA 3FYDA 3AEZA 5EQJB 4J0JA 4OBXA 4AZWA 4JLAA 2BBOA 2ZTVA 2CCGA 2P6MA 3I9LA 1GNPA 3MB8A 3MM4A 4GNRA 5DGDA 3JD1A 1C9EA 1KXZA 4DCSA 3WWDA 4DA0A 1OJLA 5JDIC 3LX6A 2NO0A 2G9VA 4GE0A 5DKFA 4WECA 5AK0A 3R23A 2ORWA 4JUBA 3A2MA 5AICA 3ZDQA 2ZRLA 4CE6A 5JD4A 3TUZC 3UJNA 4R8LA 3LECA 4OXKA 5I5EA 4F6RB 3HZRA 2JLUA 2IXFA 3NVAA 4UNPA 1A1VA 2R84A 1UQRA 3R3WA 2WKRA 2BH2A 3L93A 1NR5A 3ABZA 3G9UA 5A3SA 1NMQA 3UBTA 1MAHA 3E5MA 3KBBA 1DAPA 3RQSA 4NMXB 4EYSA 1JRLA 4GR4A 1IY9A 5DO9A 3V7FA 5IDWA 4PR3A 4YRBA 3R1IA 4TLMB 4WZBB 2C59A 2I4TA 3K15A 4PLVA 1FB5A 1DT3A 1FJHA 2HIMA 3TL2A 1X7ZB 2OEPA 4TL7A 4Z5XA 1Z16A 3FCSB 4PZCA 3ZJ4A 2ZVQX 1ZI6A 3JVUA 5DZSA 1AQUA 3C3AA 3H6KA 1G4AE 4U7FA 1EIWA 3WBBA 3M2PA 2CJXA 3DJYA 5JU6A 2OC9A 3PBKA 4DNPA 4RKQA 4DUPA 2BF7A 5H83A 3S2GA 1VSTA 2P91A 2ZAMA 4HNUA 1J8VA 3Q9SA 1T8TA 1OV4A 1CFJA 5BW5A 4K6KA 5KYUA 4B6SA 2OBFA 1PK7A 2ERXA 4ZDWA 2JZNA 4YAIA 1G5HA 4IDHA 2DGDA 3DKIA 3QTTA 4HH1A 4MUFA 2M6SA 2FZCA 2X3YA 1N77A 4KQCA 3CUEF 2A84A 2P65A 4JJ8A 1O87A 4XA8A 3DDUA 5A06A 4X1KA 4J2HA 1L5NA 3CWQA 4I4LA 3G8DA 4CUZA 4KWCA 1SKBA 1J2YA 4WPGA 3VH3A 4C3ZA 1QPBA 2X8JB 5K8LA 2R7KA 5EESA 3QGMA 2QRKA 2P8JA 3T9CA 2OLEA 1Z5WA 2X8BA 2C8VA 4IDCA 3OT1B 3EIXA 1RHMA 3DTTA 2BDEA 3P2EA 4IS2A 3PDIB 1L4FA 5EKTA 4YQEA 2Q5FA 4KVFA 5ANRB 4C2TA 2IS1A 5LZ9A 2E4UA 4DCOA 2IPMA 2VDMB 5TE9A 3RO7A 5JATA 1NPDA 1T3GA 4J4TA 4JUIA 3FCYA 4WCDA 5G40A 4GX2A 1O94A 2IXTA 4C78A 4DPMA 1PTJC 3C24A 2W93A 4F9EA 4YUZA 4D0RA 2VLIA 1CDDA 3VHLB 1L9KA 3EZNA 1AJEA 1DAHA 2I9PA 4GH5A 5EEGA 2WG0A 2PUTA 4GI1A 3S27A 1PTKA 3UUWA 3YASA 4J2TA 3IT3A 2PSEA 2AXEA 4QXPA 1Z12A 3KE8A 2EKLA 2ZI9A 1U5BA 1NVMB 3MN1A 1SD5A 1RXEA 2O1SA 4B83A 4DQ0A 3I1FA 1K0UA 3LPLA 2Y3IA 1FTQA 1Y1SA 2GEUA 4ZV9A 4LRTB 3T5PA 3C98A 4NMMA 3AINA 3U49A 3JWEA 3FWNA 1ODCA 2POCA 4GYYA 4OBWA 2YV5A 5DTEA 2G4LA 2OV8A 5CLGA 2YFQA 2BMVA 1TIBA 3DB2A 4B7AA 3DZBA 3H0CA 1V4VA 3CNOA 2BW0A 3RGWS 3RM3A 2BSQA 2IU0A 1XWFA 2F6RA 1NYQA 3MEQA 4J91A 4MI9A 2QQFA 1PFVA 1TO6A 4B3SB 1A88A 4HSEA 1KMHA 4KO4S 5TB5A 1TM3E 2Q99A 5JZMA 2IHTA 2FEWB 4FI3F 1ZNYA 3D02A 1JKIA 3TQOA 1XVLA 3H6GA 3QVUA 2QRLA 1NI4B 3PFHA 3KKPA 1MTOA 1C5KA 2I6SA 3I6ZA 3OTQA 4J1QA 4M22A 1UQTA 4K2AA 5ICFA 5JH7F 2EJCA 4UPDA 5HSGA 1A5SB 1DXQA 2HHJA 2P5TB 4RQUA 4NFHA 4TN5A 1TYCA 3W4IA 2GJKA 4GZLA 4TT3D 1ISIA 2A3NA 1REQA 1NC3A 3PEVA 5ITZA 4MITA 2CMHA 4BQEA 1TEZA 2GYVA 2QS9A 4QUDA 5B3AA 3OZ7A 3I1JA 2PD6A 5AMXA 5HKAA 5H0IA 5BSTA 1KH3A 3S7ZA 2ZCJA 3HPQA 5A4FS 2JLWA 1UJ4A 2UZ1B 3IPCA 1X0XA 4KUHA 2X42A 2QXUA 3LK6A 5LMZA 2VK8A 4EL5A 3EMBA 3TX6A 3U9TA 4DV3B 4LY6A 2ZYUX 2GZRA 4GOLD 4RPLA 3DWEX 2F00A 2R1VB 3IQGX 4K9MA 1V8BA 5KOIA 1XMOB 3AY7A 2FPUA 4WADA 4JJAA 4NK5A 5AOVA 3CKLA 5BSWA 5FWXA 2VXOA 1Y7HA 2YXLA 2YWBA 2Z9CA 3ZZ0A 1CUIA 4ALLA 7REQA 3N8IA 2AG6A 4TZTA 3QLUC 2GLXA 2VPIA 2WAOA 5CFQA 4CLOA 4JYZA 2ZSEA 5L3RA 2EJVA 1JIJA 3PRJA 2OCPA 3WGVA 4OFBA 2WJHA 3I2IA 4IXMA 1O97C 4G9BA 4P4SB 2AIRA 4LZAA 1KQFA 3L4BC 4NOJA 2AHOA 1JHAA 1H05A 1GITA 4R51A 5JEDA 1Q83A 3UENA 3V8EA 2AWOA 4ZQGA 1NMSA 2O06A 3IAAA 2P9EA 4HGNA 2V98A 3C2QA 3PE4A 3VHXB 3FOEC 3DSRA 2HUNA 2E49A 1USIA 9MHTA 1JBEA 2FSIA 2YVUA 2I6FA 3CE6A 4AJHA 2AG0A 3EPJA 3JQ9A 3GRUA 4N7RA 4P4GA 1JXMA 1KRWA 3W1EA 1UBNA 5CB4F 5I8WA 3PGKA 3ZOKA 2FE1A 5DK6A 1EVLA 1IRXA 3E22A 3OQBA 1E9CA 1Z5VA 2PH3A 2BJVA 3QOWA 1TOAA 4I5GA 4M49A 4GPAA 4LZJA 1GPJA 1BC5A 4BZWA 1VRWA 4I36A 2FWAA 4JJ7A 4TL6A 3T7SA 4FS3A 3FNIA 5CK4A 2I4OA 4FT4A 4FWIB 5A9RA 6ADHA 4CEHA 4JDPA 2VTVA 4DIOA 1NBMD 2H1OA 2CXNA 2I2WA 1R0KA 4PRKA 4XQ0A 3UFXB 4F9TA 5I7FA 3RIMA 2GPBA 1IHXA 4OU5A 1U1DA 2YVKA 4X64B 4CXMA 1QC5A 2O7QA 1E1CB 3KYDB 2BV3A 3ZE1B 1F20A 2NU9A 4JI5B 3DXZA 3CE9A 1YIOA 4I6JA 4EG3A 1ZITA 5IBCA 1VLLA 3NS7A 1YR8A 2A9KA 3EPLA 5L3QA 2IV7A 1DJNA 4PCAA 4C04A 5IKEA 1BW9B 5NULA 3EGDA 1R18A 2CNDA 5C3UA 3ZHQA 3DV9A 3UJPA 5JHGB 3GYBA 3F3KA 4BNKA 5D8DA 2CMKA 1NVTA 3BTOA 3AUJB 3LBNA 3SQWA 3K9GA 1H6CA 2P77A 2RBEA 4XUEA 4AO8A 1K7CA 2I3AA 2YS7A 2X3UA 1MN6A 2OFPA 2FSGA 1X13A 2WYHA 5EJ5A 2X23A 2C5AA 1RMTA 1TAGA 2AQIA 1PNTA 1TA0A 2EOAA 3ZQJA 3EZFA 3ZK8A 3E9ZA 2AA3A 3LHFA 3NBQA 4KXWA 4MPTA 3BXXA 1XTZA 3G1WA 3E9EA 2GB4A 3JPWA 1F5SA 4N01A 5HIAA 5AW7A 2VBIA 4CTJA 1JQAA 4U0KA 1AS2A 3JRWA 3D2CA 4ZP1A 3RT1A 3MAAC 2WK1A 5JCJD 3HK2A 3GLUA 3LUPA 2FUNB 4TRMA 3ACCA 5FFNA 1JWBB 3UA3A 1J0DA 1ZR2A 1TZMA 2V7UA 1Z47A 3MWDA 2OZVA 4A8TA 4D3XA 3CVWA 1HK7A 3FNFA 3IMFA 1U0FA 5L3ZA 1B0ZA 3THWB 1U2DC 4PX9A 4WZBA 1NQ5A 3BIJA 3H75A 2R68A 4LV5B 4UASA 4Y7DA 3ZI4A 5A1JA 5FOQA 2QBYA 1YA8A 5EJAA 4I99A 2VF5X 5JCJA 3M4NA 4GOMD 2QNIA 1UBFA 1RP7A 4KMRA 1N1EA 4JQSA 1G5QA 1RC1A 2NQTA 3NTQA 1BIFA 2NSHA 4X84A 2BZSA 4KN8A 2PL5A 1O6FA 1VXOA 1WXFA 1L1EA 4QODA 3V2GA 1HYHA 2KSQA 1Q0ZA 2P2SA 2EJWA 3UIEA 5G0UA 4PHCA 2V7BA 3ADKA 4AMVA 4Z53A 3K0KA 4YQYA 3WLNA 1SC1A 4EI7A 5HQJA 1QOZA 3RW9A 4FZ5A 4JC0A 1NYLA 3I61A 1DOAA 3SIXA 1ULZA 3ZWNA 1XLTA 3RU7A 1VECA 1RI4A 1E60A 1CP3A 3TL3A 3HR7A 1GG8A 1OA1A 1D1SA 1TL7C 1Z6YA 2X7XA 1NMXA 3V8BA 5BOSB 3WBFA 4E1AA 3KQMA 4JENA 2PYZA 4R9RA 1Y89A 2AX3A 1HURA 2IVZA 3ABIA 1BSVA 3ANMA 3SJ7A 3TR0A 3D7MA 4JYMA 1GDHA 1NX9A 5BYBA 5BR8B 3CCCA 1NUPA 4OX9B 3KG2A 2C4TA 2HU5A 3RYCB 2ZATA 4N8EA 5AVRA 1IN5A 4KXMA 3CLSC 1WPRA 3PNSA 1G8GA 2I03A 5CFRA 3H83A 2RK3A 4LYEA 2CCJA 5K0SA 3DGFC 3A1FA 1A9QA 2VAMA 3M6WA 2HUPA 1G6HA 1Q57A 3COVA 3PGA1 3QM1A 4LMBA 3I23A 5D86A 2X0EA 3MLBA 4IQFA 1NFQA 3ROKA 3B1KA 4B3IA 1YMVA 2ZREA 4L5BA 1TUBB 1OX5A 3ZNNA 4OFWA 3PHCA 1JMVA 2Y1XA 4OA5A 3U0BA 3OZFA 3GV0A 2HMWA 2PK3A 1LPPA 4IIBA 1SD1A 3UMSA 4C05A 1ELOA 2XVMA 4RV9A 3KOUA 4IIXA 3PQ7A 5TPZD 3EXAA 1YFZA 3V80A 3PFIA 3OEHD 2Y1GA 2Y92A 4IVQA 3BM5A 4CLRB 2XCRB 2XRZA 3G9ZA 2Y6VA 2P9QA 4XLZA 4L85A 1TNDA 3R41A 2D0IA 4RK1A 1WO8A 1ZK0A 2C4UA 3TSWA 4TZKA 4ALNA 1NXTA 2XAUA 1U2RA 4OK3A 1EKXA 1K6XA 1SRQA 4L4XA 4QX6A 4CEJA 2Z9BA 2I2CA 3AFMA 2PT9A 3OZRA 4G23A 5AUOB 2FPMA 3B9RA 1OAAA 1I7DA 4TKLA 2Z5VA 4HYQA 3K9HA 5LZ7A 4UE2A 2BFOA 9GPBA 1LBQA 4K1XA 2AYYA 3F7MA 1NXWA 4Z7QB 2H9AA 4YWJA 1J6UA 1J33A 4Y2XA 4BWGA 4CM9D 1GWNA 4N6OA 4DPLA 4BBJA 3J81k 1WSDA 3H87A 5FEUA 2NXEA 3R3UA 4RLSA 3HXPA 2I2AA 3OJXA 2A0WA 3D54D 3PXUA 3UB4A 4UZSA 5BUQA 3ZD6A 4PPQA 2RIRA 3E3AA 2M1XA 3FMIA 5CT9A 3OTWA 1ZWLA 3ASYA 1W35A 3PLRA 4REQA 2FWIA 1XTPA 2W42A 4RGBA 4D0LB 5B5SA 5KO2A 1CZRA 2GF9A 1E2HA 3IDFA 3O38A 3VNAA 3ILSA 1KZYC 2J9XB 1ODLA 4ND1A 2NO6A 2C04A 3SBXA 1B0PA 5IAJA 3T7JA 5FWXB 1EFTA 4QLOA 1O54A 3OETA 1Z3CA 4EI9A 1ZVKA 3K9LA 3OHSX 2V7GA 1N7IA 3Q7EA 5FCDA 4BX9A 4PLGA 1ZGJA 4PLYA 2XKJE 4FQ5A 2COUA 4MZXA 2GN0A 1N4AA 3HEBA 2CYAA 1DLJA 2QTVB 2VTEA 3WHKA 3HKCB 2B8WA 1SCQA 3I76A 4ABTA 3LU1A 2G1AA 4Z1MD 3OSUA 3LKBA 7MDHA 4CWAA 1P7YA 2CUZA 4MR9A 4NI5A 1FYDA 4PLZA 4AO7A 3GLRA 5A4IS 4F84A 4OL0A 4QOIA 1S2NA 1FTYA 4FR5A 4TZ0A 1CQIB 5LXTF 1JQ3A 4PW0A 3PX3A 2YICA 1D6JA 1MX3A 2IIBA 1QG0A 1UK9A 1CUGA 1XD2A 1PDOA 4MWSA 5H3HA 4W1SA 1HQKA 3R2JA 3D5QA 5ITZB 2DE0X 5K3EA 1QB7A 2JAQA 1BWQA 2ZEJA 2C7VA 1QQ7A 3UUFA 1IMJA 1ZD2P 2IUTA 1S3IA 4WJKB 3RS2A 3P8ZA 2H9IA 2J5QA 2P4HX 4HFRA 3KYCB 4JGGA 4OK5A 3X1ZA 4KSBA 3T7TA 2OHFA 4B2PA 4D9GA 1WCXA 3FPCA 5LFAA 2MYPA 2VHXA 1SVSA 2IOFK 2ZRQA 3TIIA 3GFSA 1C7EA 1F9EA 3WK8A 4P5PA 2F3QA 1VMAA 4TL8A 2VK4A 5KS2A 2AG5A 5C4GB 3RAEC 1JEAA 4KXFB 2ZJ1A 5JC1A 1UPUA 3UFXA 4F97A 1R0RE 3NALA 2IT1A 1KY5A 4K86A 4JZKA 4LMAA 3VTKA 1IUNA 2F4NA 4DJFC 1L8OA 2AKAB 2WZBA 4EKYA 2AC7A 1ZNXA 2RH8A 3L1VA 2IPLA 3TZ6A 1MAWA 2X5NA 3E2PA 5BV2P 5E6SA 2PQ6A 5H81A 3TKLA 1SBYA 4FFOA 3CLRD 3SKYA 5D5PA 2OGSA 2OR3A 1L5MA 3B1JA 1ZQ1A 4BRWA 3LPMA 5TT1A 4YPVA 3AV3A 1UBOS 2JL1A 1JF8A 2EC5A 4W4TA 1QLWA 1YH3A 2I5PO 2ILTA 3H1FA 3NHMA 4HH3C 4O4HB 4QT4A 3ESYA 2D5CA 3SYRA 3SKXA 2BC9A 4L3VA 4LTMA 2ZJ8A 1K6JA 1VMIA 2F1JA 4NU0A 4UUMA 4YN3A 3VHXA 5FH9A 4HNRA 5JJKA 3SEZA 1IJEA 2FSUA 1ZL0A 3M4XA 2JFWA 4MH0R 4QXAA 4BNYA 1JAZA 5CT4A 2J5KA 5IJ0A 3QVSA 3GRRA 5I48A 4P54A 4EY5A 1J7KA 4KV7A 3ZWMA 4DWJA 2ZBGA 2FZKA 4M89A 2OBBA 2OMKA 4LGMA 1R0XA 4G0ZA 1F38A 2GNAA 4OLJA 2WUFA 4BB9A 1VBNA 1RYHA 5I47A 4X3OA 3Q6IA 1C8LA 4AY6A 4DBVO 3ET4A 3NT4A 2HREA 3C85A 1PQWA 2AFHB 4W8OA 5BOVA 4KYVA 3RAPR 5A3QA 2BY4A 3L05A 3WLRA 4DJAA 3X1JA 4X8MA 4XOUA 2GH1A 1U28C 3H4IA 4B34A 3OX4A 4MS4A 5DMXA 1FZTA 4YMTA 3QVJA 3HU3A 1QH8B 3NI2A 4K03A 3BHMA 4Q7KA 4IZ6A 2PUBA 1GFIA 4HAZA 3ZCVA 4P0PB 5KSZA 3DNFA 1PN3A 3EZ6A 1EUCB 4QYWA 2RCNA 1K88A 5FOUA 3EVCA 1D6SA 4DLTA 5HOEA 4I4TB 3RRNA 2J08A 4RL4A 1L7RA 1M73E 2Y9PB 4Y6RA 4EM6A 4RTNA 2XUAA 3ZBPA 1JNYA 3OU6A 4FBMA 5DMHA 4HJXA 5FPYA 4Q16A 3H5OA 3JQQA 3V34A 1QHNA 1GGVA 3DT6A 1Z4QA 3UPUA 2JCSA 2PTHA 2QZZA 2ZDHA 3I34X 4L8LA 4R9NA 4Q0MA 4RGVA 5AHRA 2PNJA 2DXIA 1C81A 3KFLA 1EA5A 4X6YA 5M29A 1HDRA 2N47A 1DC7A 3GEGA 4BO0A 5K0EA 2F67A 5DBOA 2IYEA 4TV8B 4OQEA 3I3SR 5EAIA 4AFNA 5BNWA 1HDZA 3WJAA 4M9UA 2HN9A 1LTHR 2GNOA 4QGGA 4HAXA 1VI5A 3WGTA 1EBUA 3AQIA 3I32A 4HEA6 4N0MA 3QELA 1CNMA 1KEUA 2FF5A 2V7QA 2AEMA 3D2BA 4GRAA 5TQ2A 3WICA 1FFWA 3ZHTA 1RKXA 5I9IA 1Z5GA 3KYCA 1LVGA 2DTXA 1VYUA 2DFNA 4FIZA 1NOJA 2OV3A 1SCUA 1C8BA 1H65A 1N1GA 2G5GX 3VPDA 3ZNPA 2DQ4A 4B3TB 3EGXA 1SOAA 3FGPA 2GBFA 4G56A 5GWXA 4DCJA 1L4EA 5ILQA 4S1VA 1YOVB 3KYBA 1CY4A 4Q7QA 2HWYA 4EGCB 2K6GA 3R5HA 1DP4A 4MICA 5H02A 2ECFA 2YVAA 3H2YA 4WD3A 4FCCA 4XXHA 3ROXA 3QKSB 4TQUS 1KAQA 3U62A 1TYZA 1G3QA 3NH9A 5E2IA 1D2RA 1TU0A 4I46A 1GQQA 4CQMD 4ZYWA 3ND6A 1JKXA 1KJWA 3UZUA 2GT1A 3NWEA 1XZPA 3H17A 4D80A 2DERA 1W85B 3NHSA 3A1TA 1SCIA 5HQ3A 2K2QB 3PF9A 3VR3D 4JXJA 4ZTZB 5ED0A 3URKA 1UAAA 2FNAA 5H3LA 3ETLA 2MOKA 2XBUA 5FR1A 5LQCA 3EQ6A 4LRXA 1Y34E 2ZJAA 3SX0A 3QVGA 1I6WA 1CS4C 1MIHA 3GWGA 4HL6A 3CUYA 3VPBA 4CMEA 2FUG6 2XB4A 4BKMA 4LX0A 1YR1A 1JR3D 2X2OA 4XKJA 4BATA 5JDIA 2J0VA 4LBWA 4CKBB 4N9WA 4BNZA 1GZSA 3FSJX 3IEPA 4OAPA 1B6GA 4IDOA 1CUYA 1QH1B 3DLHA 2PVPA 2FRXA 3GNQA 1BWSA 1FRNA 1SCJA 4YJDA 4ZCSA 5ABPA 2V58A 3IIKA 1Z0FA 4U63A 1R4MA 4A4DA 4IEIA 4QBGB 4EY7A 4BQRA 3ZJ5A 4CIDA 3Q7QA 1HL3A 4O8ZA 2F9MA 1L2TA 4ZARA 1PR0A 1HO3A 3BSWA 3O26A 3T0IA 5LDHA 2WQZA 3QNUA 5TC4A 3I4CA 1V2HE 3W5VA 4JI4B 2XBMA 5CVVA 1RQ7A 3S1AA 1E62A 2Q1UA 1HDIA 3ANLA 3LP8A 4OG2A 3RKRA 1KGSA 5K01A 3TKAA 4ASUD 1M5UA 4BV3A 3FUUA 1NYTA 1I5RA 5DBGA 5I7WA 3T1OA 4RETA 2E37A 5KNDA 2BDTA 5DYNA 5FADA 3DMPA 1Y3AA 3LDHA 3D59A 2R6HA 3CTPA 1U6IA 3OEYA 3W2IA 1F17A 1WUJS 1KO4A 2OZKA 3LC0A 2WMNB 3V4OA 1AGYA 5BYJA 1EP3B 4TM8A 1FRQA 1QE3A 2I62A 3NBUA 3REOA 2C88A 2GHRA 2YXPX 2M9MA 2A57A 4UEQA 4BMDA 1U5AA 1RXWA 3H7AA 4KEAA 2CMDA 4R2IA 1WY7A 3F1KA 4BDTA 4BQNA 2BONA 3BB1A 1AHHA 2ECKA 4WK6A 2LR0A 4WKNA 4E6PA 3IKLA 3C5WP 4DRXA 3AHFA 5E6RB 3BQMB 2I6GA 1ZFNA 4W63A 1I7LA 3C43A 5IWAB 1UXKA 3RS7A 3SICE 3SLKA 3VQTA 3BMXA 3SX2A 2W2KA 3C6XA 3JQFA 4NIMA 4YP1A 1D3AA 1JEEA 3DCYA 1SAYA 3AEQA 1CJUC 3FSEA 3LRPA 2Y0PA 1LV7A 1HMYA 1SFRA 2Q7DA 4H1WA 3T06B 4C4SA 1E3MA 1Z63A 5BVHA 2QK4A 1RXVA 3MIZA 3TQRA 2H63A 1SU4A 3KL4A 5EJIA 4K3VA 1F3OA 5T4FA 4EQ6A 4F92B 3ZDCA 3QEKA 4YB8A 1CQWA 2ZYDA 4QT0A 5EXEA 2CJFA 2ZJ2A 3IBSA 4DF3A 4CDGA 1B8NA 1C9NA 3GL9A 2O2YA 3LUGA 4LHYA 3WAJA 2Y27A 4K7JA 5LMNB 2HCBA 4LNUB 4OX9Y 3E9RA 4NZYA 1SXQA 1SIOA 1DRJA 3AHEA 5B58C 3K0FA 4YAWA 3FTPA 1GQSA 1SH7A 3FUCA 4R71A 1QH0A 2FMTA 4MCIA 1YVEI 1VBMA 2WT8A 1FK8A 5IYZA 3HA3A 1GPWB 4I9NA 3ZWXA 1V35A 2P9HA 3FSGA 1XCMA 3K6KA 1N1DA 2VP6A 4KXNA 2GPNA 4KL8S 4QGHA 5D1NA 2IS4A 2R6GA 1WXQA 1ZIXA 5EI5A 3P9KA 4N3CA 1ZC3A 4Y2RA 5ED4A 1CZLA 3SZUA 1CYEA 2O6LA 5D6NA 2Q6OA 4ENPA 3S4YA 4DWOA 1JHXA 4RHXA 4E3WA 4PPGA 3N28A 1IHUA 4YAFA 2HNKA 5F3DA 2D4AA 4EG7A 3W7VA 4O4JF 1MJGA 2BKXA 4N8DA 4WN9A 3H2HA 4L6CA 2CVFA 3MWLA 4HDSB 1Z0AA 5J63A 1W0JA 2ZJFA 2PFGA 3DXYA 2LPMA 5EG5A 1NBME 3TPFA 3AVWA 3FZYA 5FBKA 1Z45A 2PX2A 4BL5A 3BMOA 2HMAA 3DMYA 1CZKA 1IDOA 1TQ6A 2VJLA 2PU7A 3DYVA 3D7RA 3DWGA 2HA0A 2J3KA 3EUFA 3MUEA 3NC4A 1JKFA 2JCGA 4LZWA 4ACAA 1Q0LA 1U2PA 1CQJA 1GA1A 1PT9A 2YMQA 4K9NA 4F11A 3D4IA 4DLWA 4URWR 3RARA 1AV6A 2GK6A 2JDID 2NUTB 2DYKA 2PJUA 1W0JD 3F6SA 2J3IA 4TL9A 2GM5A 2VVTA 4DM7A 3BIFA 3TNFA 3KZ1E 1ZA2A 4RDHA 4A1OA 3LG2A 1O7JA 3JZIA 4LXQA 1Q22A 3AK4A 3TXXA 3K71B 3LT2A 2FX5A 2ICAA 4KOAA 3K6SA 4Y8VA 4EPVA 1QIJA 2WD7B 2REQB 2YMMA 3FPEA 4JQOA 4LK2A 1F2VA 1U31A 5FBRB 1EVYA 1XTQA 2FB9A 3DFUA 4JBNA 3N70A 1R6VA 4NVRA 5F7JA 3B8HA 4MP6A 4N6GA 1KIMA 3S2IA 2IA5A 1K98A 5CNJA 1P1CA 3FSGD 3WGNA 2O8BA 5HZHA 1BKSB 2BTQB 3PRKE 1ESZA 3PYXA 4YDRA 2YCBA 3F78A 2ZUDA 1Q7EA 5ARDA 2XCTB 2R0QC 5DB4A 2OV6A 3IULA 3QV2A 3ITKA 1IWOA 3CH6A 3PNKA 3QI7A 4R0NA 2R96A 4GP9A 5BV8A 2AN9A 5JZOA 3BXZA 1QGUA 2VDRB 5BN1A 1H23A 1Z74A 4QJ4A 5J2UB 2G77B 4QOGA 5T64A 1N3BA 4IQ8A 1T2FA 3G2PA 5SZJA 2G88A 4M7RA 2P9YA 1EPUA 3HKCA 4NHOA 3VM6A 5E8JA 3M9WA 4AQYB 3ETNA 5ER9A 1MZVA 2XLBA 2APJA 5KVAA 4TYYA 1AKNA 4B76A 3S8EA 4N7JA 2F1IA 3CU5A 3ZCQA 4TYNA 4B85A 1OJ7A 5E4YA 1GDDA 1CEXA 1DUVG 3SF8A 1A5BB 1E1RD 2GF2A 1OLUB 3MCAA 3JRNA 4J1NA 3KL2A 2HRQA 2CHFA 2PGNA 4I08A 1L4YA 4NY1A 5JD5A 2A78A 3G5UA 4EPYA 1PW5A 2O8EA 1OXKB 1ENYA 2QY6A 3M49A 2NQ8A 4UD6A 1SCUB 2WYOA 1D2EA 5DISB 1C4KA 1S01A 4TYQA 1LA2A 1P77A 1PJRA 3KVNA 2Q4DA 1TUIA 1Q1NA 2FV8A 1ISFA 3PHLA 5DRYA 3TNLA 3G0GA 1QDLB 3B9BA 3JQ7A 3OOHA 3P5SA 1Q15A 2AOTB 2J33A 1DWPA 3BFPA 1CC1S 1E2PA 1M34A 2RG7A 4L08A 4MI1A 5EVJA 4CFYA 1VDMA 4KYIB 2HQBA 2VL7A 3HCCA 4MV6A 1EEHA 4RS4A 2HJ9A 3F74A 4BNJA 1VI6A 1ISRA 2PWAA 1N6OA 1AKMA 4KREA 2Q4TA 1TT5B 2Q4RA 3AB8A 4Q19A 4W5HA 2O9JA 2VCHA 2JLBA 5JAIA 5G2OA 5LXTA 1KAEA 1DIRA 1LI7A 2UZIR 3Q12A 5ALNA 4X6UA 2WTXA 1N36B 3U3JA 4OYYA 4BE7B 3KDSE 1UINA 1SOMA 3LFHA 3PC2A 5A9SB 3ICQB 4P58A 3HVIA 4TOIA 3WV4A 2B34A 4QFDA 3O3MB 4JT4A 4S24A 1A50B 2HA3A 5CJJA 1NVVR 1DQPA 5HQTA 3V6MA 1U9ZA 4H7JA 2ETVA 1KZ6A 2HSGA 5DOZA 4NC9A 1JXOA 2DB3A 4RVUA 2ZTSA 3KAPA 2HBZA 2N1BA 3H2SA 4NDAA 2NZ8A 4AZSA 4BU1A 2I34A 4I1OA 4CTNA 1NOIA 3U44A 1OIWA 3LK7A 4ZK2A 4E2FA 3KALA 4I9HA 2EV9A 3MA0A 3GMSA 2BI4A 1D0VA 1VSUA 1L1FA 5DNAA 4D8WA 3R3XA 4BB5A 1NXSA 1T1SA 2GBPA 5K0BA 4C4TA 3LC7O 2GXQA 1MB2A 1YI8A 1YCDA 1PFGA 3UGQA 2HLDA 5JS2A 1DG3A 4RXTA 4JLOA 3F5MA 5IK2A 1SMKA 2JH9A 3IVRA 3IR6A 2CHGA 1S2OA 3ND5A 4V0LA 3VPXA 4D42A 3ESRA 3A04A 3IHWA 3NHLA 3SQOA 3PFFA 3CPJB 3IUEA 1R37A 1YR7A 2BAGA 2PLRA 2PR7A 2XOKA 3HP1A 2WILA 3OWOA 2FYTA 2B82A 4DGQA 1VL5A 2G07A 4EHAA 3OLVA 1RLJA 1MV5A 2BZ1A 4KDFA 3ONWA 5CB6A 2GYUA 1QQ5A 3UAZA 1Y1LA 5TPWB 4EHLA 2NVWA 2DCMA 1F3LA 5LWHA 1OYYA 1N3LA 1NONA 2AG1A 4INJA 5E2BA 5GJVC 5M7EA 1DADA 3A9WA 3O4VA 1SHZA 5JWHA 2FPXA 2FK7A 3IFSA 4NHEA 2NNWB 4X7BA 4E1BA 3DP9A 1EVKA 3DTVA 3HWWA 4JN6B 1X87A 2IF0A 5EXSA 4TYPA 3SHQA 1RRCA 1D7AA 1GPDG 3I28A 5EIBD 1N2ZA 3LT0A 1RHJA 2GPYA 5EWLB 1M75A 3AETA 2ZCUA 1ONBA 5IPFA 4HZUA 2JK0A 1PVOA 1VKZA 1KKUA 2DFPA 3LWDA 3V48A 2WKQA 4Q4JA 4A2PA 1F7VA 1RIIA 4K6MA 4MRMB 5IP5A 2PD4A 1S4QA 4R1NA 3ORQA 1A9PA 4LDQA 3ZI7A 4B3GA 4ZOCA 4RA6B 4K6GA 4NJOA 3ZIUA 2WJIA 1WB5A 5KNBD 2AJDA 3NIDB 3D3EA 1HYBA 3FLBA 4YJGA 3L04A 1CX9B 3RROA 3I04A 4K1LA 4L4RA 4C1NA 3CVXA 3IV9A 2V8OA 2AD5A 2AXNA 1N2SA 3ABRB 4RX1A 5FTKA 5REQB 4J8PA 4YY3B 2O50A 2N1MA 1CY8A 1SELA 2BVNA 1FNCA 2LGJA 2ODQA 1TK2A 4X3PA 1RI5A 3P9QA 2AOWA 3MMXA 3OCUA 2YY7A 4MWDA 3ZH9B 1XWIA 4FZJA 4DVJA 5K8JB 4Z9BA 2BM9A 2YV4A 4BOYA 4DLYA 3KQUA 4J9UE 1Z39A 1E4YA 1OTYA 5I7EA 3KQKA 3DPUA 4C2UA 3N2KB 2BRUC 1CNFA 5P8WA 4ZGGA 1Q50A 3EWAA 1N8TA 1UAGA 3FA2A 3GFPA 2XPCA 4K6CA 4RK0A 4WEQA 5FPTA 3C3MA 3NBMA 4MPPA 5BQ3A 4PLPA 4YCAA 4H31A 4YJHB 1XQ9A 1BHQ1 3GFTA 2WM2A 1BHSA 4XQGA 5FWYB 2BHLA 1BU8A 1ZHHA 3HSSA 3UMVA 4DIBA 2X1LA 1EHCA 1HYEA 3B20A 2RGGA 4IDBA 4O4IF 3N3BC 1NP3A 1EX1A 3EEQA 5JY6A 2WMYA 2E2WA 1X1AA 1MXHA 2IITA 1QK3A 1CZNA 1PV2A 3WMEA 3ZZ1A 3GELA 3QBEA 5HKBA 3RC8A 3B51X 5DEIA 4L6IA 1PZHA 2IZZA 2R00A 3HKBA 4MQLA 4GBGA 3FRJA 1EK5A 5L6MB 4XYLA 1N4DA 1FSPA 2ZAOA 3IA2A 2WAYA 2D6FA 1CIPA 2JHPA 4X54A 5DSXA 3V9PA 2VTBB 4E09A 1G59A 4WFJA 3N8DA 3MT0A 5AW6A 1AB5A 5AW2A 3N75A 1A4IA 3QBTA 4YR7A 4ZJZA 1P60A 4K6FA 1X80A 4OUKX 1Z0JA 1COZA 1KFCB 5ALUA 2V55B 2Q28A 4MV5A 4PZLA 4DRYA 2OOKA 4DDUA 1T8WA 4G4JA 1OH8A 1KMQA 3L7BA 4DA7A 3WDSA 1FQWA 4KTTE 3VPFA 2JIZA 1X7HA 3V4LA 3P0IA 4INOA 3L8HA 1GQ2A 5I4IA 1GZHB 4L9RA 4Z3DA 5FI0B 1JHDA 2GJ8A 4BFLA 4MR7B 4DCTA 3ED5A 4HQOA 1XI2A 1Y3IA 3BTSA 4UZEA 3GLHB 4DSNA 1JIXA 3VH2A 4B3MB 1NW6A 3I9NA 4I1YA 2HHCA 2PMKA 2RAVA 2WM9B 3HA7A 2PRIA 3PE3A 3TSCA 5J2TA 5ENVA 2OSVA 2UZAA 3WFZA 3LC1O 1P1FA 2F7SA 3EAGA 4UZFA 3FYCA 3MTAA 4CF3A 5HKKD 1A9YA 1DIAA 1GEGA 1KAOA 1WU7A 1XTRA 2OL4A 2PX6A 3N74A 1POXA 4A8JA 1OCEA 2MSCB 4G0UA 2JGJA 3P52A 4RE6A 1V71A 1JDTA 3LOPA 3M1LA 1VMEA 2PV7A 1AURA 1QFXA 3AXTA 3PQEA 1HT2E 4JT2A 3VGPA 2XIQA 4CFZA 1HL7A 1KMHB 2QVLA 1WW8A 2EQBA 2JAPA 3DUFA 4LY9A 1NM5A 3ZR4B 2FEKA 2RJNA 1MPTA 1E3SA 2AE1A 1AKTA 3ORYA 3EC2A 2FW6A 1JDPA 4KVAA 3RU9A 1V26A 2V6GA 1YD7A 2JK1A 3NB0A 2ZK7A 3DEJA 4OQPA 1WLSA 4OPMA 4UM7A 3S7TA 1R9MA 2J32A 3VC3A 5I01A 3WB9A 5TT0A 5LZ4A 3VNVA 2DC1A 5F52A 4WUVA 3HEMA 1ND5A 3AESA 2RHBA 2R1TB 2D0OB 5F1KA 2XJ9A 2B6NA 2Z6QA 4OGFA 1IXZA 1WCYA 2WNHA 4UAGA 4KRFA 2W2KB 1NATA 2VEOA 5BRNA 4E03A 2XDYA 4P4LA 4PLHA 2H1IA 4M1TA 4EKDA 5ALEA 4YCBA 1JA1A 1YZFA 2GETA 4CV0A 1UFKA 2GM3A 3PI6A 3QU2A 1PBTA 4XX0A 5DBIA 1IEWA 3FZQA 4DABA 3DUWA 1NT4A 2OFXA 3LCMA 3QYFA 1P61B 3EOZA 1XX6A 3FTFA 5AW5A 1IOZA 2JIRA 4LYFA 3TE7A 3KZMA 4HUJA 1Y4ZA 3LY9A 1UBLS 3T41A 4QIHA 1S2MA 1ULUA 2PYIA 2YYSA 2ZFUA 3L7AA 3R7WA 3E5RA 4WJLA 4QU8A 1H2WA 3DOJA 1FXUA 5DNDA 5E9WA 2B21A 3WRYA 4IFIA 4R8KA 1CHNA 3EYWA 3KQNA 4YX9A 4DC1A 4XM1A 4HMQA 2WQ7A 2P8SA 3UBMA 1R4NB 4NEGA 4WZ6A 4F2PA 3U4DA 2XCSB 5HZGA 4FT2A 1U8EA 2CV1A 1F0NA 7ADHA 2LP4Y 3MCWA 1I2AA 2W2NA 4FEEA 4LXHA 1DBWA 2VWQA 4BLPA 5BWCA 3W5JA 5BPHA 5HKLA 1Z28A 1XCGB 2H8GA 3HCDA 4OY3A 2VF2A 2V45A 1EFDN 1OXUA 4URYR 4G8DA 4D3YA 5IXSA 2ODTX 5G4LA 4WMLA 3KQHA 2HJWA 3OFVA 1M2HA 1Y4AE 1C0KA 2O7SA 3OE5A 4NZPA 4D45A 1CDOA 3S5JA 3VA7A 2H17A 5G0WA 1PL8A 1F0KA 1G291 4YECA 3T52A 1IB0A 1Q44A 3LL4A 4HDMA 3AJEA 4NV1A 5IC5A 4W6QA 1NW7A 1E3JA 1SCBA 3QE3A 2HRCA 4CU5A 3WO0A 3OZBA 4DV5B 2ZBUA 2XB8A 4MAMA 4HVCA 3JQFC 3OLWA 3BPSA 5BPFA 1JN0A 1GARA 1P62B 1DC8A 4IG4A 4TMFA 5CB4B 1G6OA 3NHYA 2MSDB 4M55A 2GYWA 2P0EA 4CKCA 4EY4A 4ZYVA 1HSZA 3W1VA 4HYEA 4G8JA 1Y80A 5EL0A 5JAOA 3VI3B 3EVZA 4R98A 1NFFA 3N2IA 4E4YA 1GA4A 3BJRA 2B8TA 2G28A 1JSLA 2IP4A 4JLBA 5CGZA 4JR1A 5JNLA 1JZQA 4PRZA 1IG3A 2XIJA 3ADPA 1RTTA 2PKQP 4WOBA 3KLMX 3VR6A 4DBLE 1O95C 5TGDA 1C1DB 3EXHA 4GPIB 3U7RA 3NEYA 4G24A 2OENG 1OLXA 2NTJA 4WI1A 1A9RA 1AUOA 2OV2A 4FNAA 5LYJA 1OMOA 2CKDA 3GJSA 3MJCA 1RZ3A 1T36A 4ND7A 4RZ2A 3UPTA 1TMKA 4FFBB 2GN4A 2MINB 3WY9A 4HT3B 1TC2A 4W7SA 3L1JA 1QDUA 2A86A 5LLTA 1WUIS 1SOUA 2IZ0A 3RIHA 4H7KA 4TKMA 4JI1B 3R4CA 2QN9A 3NYQA 1FTSA 1NQXA 4IXTA 4J94A 3EDYA 3A8TA 1ZJ5A 2C3YA 4JFAA 4M1MA 4AJNA 3DYIA 4PYOA 4ZKEA 1TF5A 4HQRA 4EI8A 1II8B 3WA7A 2JHCA 3TRIA 2PDAA 5SY6A 3SR4A 4EOGA 2VQEB 2O2IA 2REXB 5TMDA 5FNVB 3K2EA 3KR2A 2FPPA 3HBLA 3NWBA 2C9YA 2GCOA 2QJTA 1SXPA 1KYZA 1P18A 1JAXA 4KQMA 1ZU4A 3JTEA 4LC9A 1DXHA 4P5EA 4HQKA 3WYGA 4KPEC 2WFLA 4HKTA 4JOSA 3SK0A 1CF2O 4WZAB 2DT5A 3MELA 1AHPA 1YCGA 1EE1A 1RZRD 1SUSA 3ESXA 3K5IA 4LTNA 1U80A 2PZFA 4U8GA 5JE8A 1TJYA 2PO5A 3R0QA 4FFLA 1UK6A 3RYIA 2OHHA 2X77A 2CZCA 1KL7A 1O8BA 2BR3A 2GVZC 2HSWA 2TMDA 3N2GB 4G5QA 1NKSA 1ECPA 1XV5A 1NN5A 2WJYA 3JWJA 4PLTA 1UXHA 1U2TA 3ZS9A 1E9BA 3Q7SA 2BFWA 4WE3A 4IIJF 3GARA 1KDOA 3N86A 4JT9A 4UHBA 1UBKS 1HLDA 1TF2A 2IHZA 5BN3B 5DP2A 2Q50A 4GWKA 3K7EA 4OIFA 4DLAA 1AXRA 4Z3OA 1JV2B 2ACEA 1SWVA 3NATA 2V7TA 2WJJA 4HP8A 4D97A 4OHVA 1DNPA 5H5JA 3KKZA 4BAGA 1Z22A 3EXHC 1GAJA 4GVXA 3I09A 2DPXA 2GEDA 3IAS1 4Q1DA 5LM3A 2AOTA 2JGAA 4DTCA 3ZHZA 1OAKA 3H5VA 2QMZA 1VIVA 3H5TA 4OJMX 3GLIA 2LV8A 3BMNB 3M6VA 2B0JA 2C5EA 5HM6A 1II9A 1JQBA 1YRQA 4MDFA 4F3TA 4J1TA 3OHMA 4M0DA 1CQIA 2PUCA 4UXIA 2PMFA 1K8QA 2DKOA 4YCCA 3S1SA 3F9RA 3T4XA 4UDYX 2AMFA 3GA7A 4O4JA 4KN6A 1Z2NX 1P17A 3H9EO 3LVBA 3S2SA 3QX3A 4FEGA 3HCEA 3DBHA 1OLUA 1UBEA 4P8RA 4QJIA 5GY7A 2AUTA 1C41A 2L69A 2PAAA 3MNFA 4AIRA 4F9FA 2RGNC 3ESCA 1S1CA 4PYQA 5T5QA 3UC5A 1WZ2A 5AW0A 4NS4A 1Y9ZA 3RDPA 2H2FA 4LHEA 4S1PA 4M37A 2ZT5A 1Z15A 1A77A 2WUDA 4YDSA 3RODA 3RSOA 2O7NA 3ZHSA 4Z7NB 1RLTA 3B1ZA 3KHTA 4RWEA 3RFVA 1GG5A 4M0UA 2IS2A 2RGEA 3E7DA 1G5TA 1N9KA 2PLAA 5ALOA 4L7QA 4RVFA 4L1KA 2E4YA 1JKJA 4FSHA 5EIXA 3CEMA 4WW0A 2WIKA 1TADA 3UCXA 1D7OA 1Z08A 4KQXA 4PPNA 2G08A 1Q0QA 5DE3A 4BKPA 1YUBA 2NT4A 5JD6A 3LBHA 4BTLA 1J0XO 3PNLA 4OBBA 2YL2A 3B7GA 4DQDA 1Y98A 3EDRA 4FP9A 3FCUB 3TAXA 2HO4A 1UWKA 4RFSB 3WRYC 1XKLA 1ARZA 3C97A 4DC9A 3BERA 3PGXA 4HHEA 2IQ5A 3RRFA 4G85A 5HGXA 4MDYA 3IEVA 3DF7A 2IODA 3KQYA 4L0MA 5HRCA 1GFSA 2OHIA 4G5RA 4CQMA 3C8HA 3CRVA 3A6ZA 3SOPA 4CNBA 3Q9UA 4U3JB 2PVCA 2GX6A 2QU8A 4UW9A 3VX4A 2JC3A 1K92A 2QYHA 3QF4A 4LHXA 2M6LA 3VZQA 5ETJA 3KVOA 3WK4A 1L5ZA 4GC5A 5EZQA 1Z2DA 4IMPA 3NO4A 5EJ2A 2GILA 5FNVA 2B37A 1L5GB 5CW1A 3ZYCA 1YS2X 3HCWA 4G3XA 4GBMA 4AZVA 3ACBA 3FGZA 3GD7A 1CVIA 2O59A 4TTJA 3VTAA 3EF0A 3ZX5A 5DYWA 1ZK1A 4BVEA 3K1YA 2LE0A 4B81A 4G01B 5COQA 3SF0A 4E5PA 3FX2A 3W8DA 1BWPA 2NTYC 2I8AA 4DREA 3W2TA 1IHDA 2ACVA 2BE7A 1E0JA 1M0EA 3JWIA 2WZCA 3VMMA 2MTBA 1UEXC 4QREA 2VKQA 3M3PA 4MW7A 4RTSA 3DE1X 4GXNA 1FFBA 5IBRA 1LDEA 1KNQA 5IABA 4BPRA 3SVZA 2IF2A 3I5AA 4NBUA 2PGJA 1Z38A 1FFAA 1GQOA 2E21A 4K9LA 4DDKA 5I4KA 2DLCX 1H2FA 3G2OA 1RKQA 1ABFA 4CCYA 4EHDA 3CIFA 3E7FA 3O47A 3COPA 3U37A 4EKGA 1Y1QA 4N3BA 1GKYA 1JLKA 1OZHA 2HX1A 5KWEA 4N0EA 4BNFA 3LQKA 4YRKA 1T25A 2P4EA 2V9CA 2ZGVA 3MS7A 4DT1B 1M1UA 4AKIA 1ZR4A 4PIVA 4XWYA 3WKDA 4FFDA 3LNTA 1XXLA 4ZRMA 4BQPA 3MJSA 5BWNA 5FDFA 1Z37A 2J7PA 2ZZNA 3VKUA 5KC9A 1XK6A 3FMFA 1X9IA 3ODPA 2MT9A 3E18A 4L78A 1DC6A 1UMDB 3FOFC 1ZQ9A 3DVQX 1O95D 1NZJA 3IMGA 3ZYZA 2JLVA 3FR8A 1OHHD 1G7TA 5CVTA 5GVSA 3E8XA 1DTSA 3HMKA 5CA0F 3VVLA 5INTA 4PQYA 5GVRA 3WX0A 4RM2A 2HSEA 1E1NA 2VBFA 2EYUA 2YMPA 1K9SA 2HSZA 3JVVA 4X65B 4WN3A 2HFJA 2NU6B 2C2HA 2XH8A 4XPIB 4A9AA 3CX6A 4F8YA 2C77A 4FGSA 4U2BA 4PC1A 1BU5A 2W5UA 2ATEA 3IS3A 1U9IC 3OZCA 2WM8A 4YUWA 1BJRE 1PYGA 4MJ7A 5JZVA 4R4JA 2WWIA 3QX8A 4J6FA 4L8VA 4OBEA 3GMIA 4G0PA 3MC1A 4LJSA 4G1VA 4PZ9A 4YREA 3HM2A 1VLQA 3VJKA 2G1KA 4IBOA 1NM5C 3L0SA 3WHIA 1TD9A 2YOHA 3ZWKA 1OAOA 2QX6A 1YHNA 1GHTA 1VJ5A 3HI4A 4W9NA 4YV2A 4C30A 2C99A 1G8SA 5B1IA 3JQGA 1NKTA 2ATVA 3GHHA 1ADGA 4LJRA 2FWNA 3FOCA 4YCMA 4EABA 5KX5F 5CU7A 1XZCA 1B3RA 4B6RA 4HI0E 1VZ2A 2ZAGA 4C4ZA 2H52A 4DKXA 1DWOA 4JJ4A 3QUSA 4IGEA 5SZKB 1OA0A 4WNAB 3RJ9A 3UB2A 2RGDA 2IEYA 2Z56A 2DFLA 2R8OA 1G4UR 2Q1WA 3GIWA 1VP9A 4BNDB 2GD2A 5CX1A 4U1RA 5F73A 5K0ZA 4K81B 4JEMA 4H1VA 3ZD8A 2C9CA 3G82C 1GCAA 4G41A 4KE8A 4M60A 3FPKA 4RF2A 4URHA 1SHLA 1IE3A 5FUVA 4DNFA 2X5JO 3OM8A 4BIMA 1E6CA 4RA9B 4YMSA 1KI9A 1MO2A 1U0RA 1EDOA 2G80A 4FW9A 4AUNA 2C5GA 5JEEA 4YCNA 3AEUB 2VYVA 4AJOA 4FYHA 1HA3A 4L76A 3PXCX 3RWOA 5AVKA 1EX9A 1SUWA 1M2WA 4QUAA 1BKDR 4B7UA 2AN4A 4IH4A 5JCXA 1N0WA 4ZZIA 1R27A 4FMCF 3HLKA 5AKZA 3SFVA 3WAGA 4CM8A 4L0DA 5LA6A 4RTOA 3R0VA 1KK1A 2UYYA 1SOWA 1U7XA 3FE2A 4R5MA 5H4HA 5CYFA 3QLVC 2D74A 1CDEA 2R8YA 4POAA 2XUKA 2QT0A 3CXUA 5LBIA 5BV1A 5JNRA 1AV7A 2QEQA 1B8OA 4M1YA 1ZP6A 2WF7A 2BFFB 1XLVA 1E63A 2PWPA 2YQ4A 4H27A 1COWD 2MSKA 3HU1A 5ILOA 4DHWA 2XCOA 3FYSA 5LCXA 3MGKA 5LUAA 2Y1DA 2O05A 4C3OB 4EB6B 2NSYA 3NHWA 4FE7A 4R1OA 4I55B 5GGYA 4D92A 4MV9A 2YKGA 1T5IA 2PXCA 3QJ5A 3K09C 2YTZA 5FL3A 4P3YA 3RUHA 4EVSA 3O31A 5CFMA 2FQQA 1KS9A 4ZT7A 1Y9EA 2ZVJA 3B9QA 4Z7OB 1MCZA 3QKWA 4FB5A 2V7QD 2PV0A 5HFNA 3V7NA 1FUIA 3FPGA 3SQDA 3T1NA 1U2GC 4LHVA 3W0LB 2YHSA 3WWCA 4DBZA 5B7PA 5MFZA 3I92A 2QL6A 1I7QB 3BB4A 3ZC3A 1W4CA 3SHTA 3U81A 2ZM5A 1M6EX 3A70A 2EIXA 1PWYE 1J2UA 3LIPA 4H7HA 4LJKA 4MYUA 4WLNA 4ZQBA 4EECA 1K27A 1ZK4A 1MA0A 1U0OC 4MX8A 2VH2A 4DMMA 4EGSA 1X38A 3WQHA 3ND8A 3E82A 1DKLA 3OY7A 4HNQA 4AJEA 4TKZA 4J1TC 4U2CA 5COBA 2VQ3A 1DCTA 2WP8J 3HFGA 2EATA 4JA0A 4TV8F 2Z30A 2D5LA 2QP3A 1DKPA 3ZXUB 3ZWAA 4Z4GA 5GV7A 3MF4A 4B6OA 2VZ9A 4NG4A 4ED9A 1I8TA 3OA2A 2OD7A 4CTKA 2FW8A 1CNEA 1ZJYA 1U5CA 5FFMA 5JLAA 1C4WA 4Y1RA 3RIEA 5AM1A 4FOTA 3ZHRA 1QQ6A 3FHCB 2QXTA 3ZK9A 1A9XB 1NF9A 1YE3A 3UK1A 3F1LA 4MVJP 1QRAA 3S3TA 1B1AA 2FFJA 3N7AA 2Z3VA 4URZR 4P93A 2G3YA 5LNK6 4PO3X 2EKBA 2O1WA 3QNWA 3LO5A 2IU6A 1XPJA 2PUWA 2XGMA 1EVZA 3FYUB 2EEZA 4X8OA 4TRNA 5HZKA 2B1IA 5DBHX 5ESDA 1OX4B 2SECE 1K8ZB 4EAAA 3DAYA 1JG3A 2BFDA 2HNAA 2B25A 2O2XA 2RC6A 2ADFA 3LLVA 3QFHA 1KTIA 3VNSA 1TYAE 4W99A 4KPYA 2O6HA 5BXYA 2EKDA 4OB8A 1G8PA 5LYYA 1URPA 1P0IA 1VQ1A 2YCLA 2ZYIA 4OU4A 4QUJA 3V8RA 4BQSA 4QELA 5AIAA