2JVKA

Nmr solution structure of the hyper-sporulation response regulator spo0f mutant l66a from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
b'MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIAKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSNLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation initiation phosphotransferase F
molecule tags Transferase
source organism Bacillus subtilis
publication title Covariance identifies dynamic residues at the interfaces in protein/protein complexes
rcsb
total genus 40
structure length 132
sequence length 132
ec nomenclature ec 2.7.-.-:
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jvkA00
3M9WA 4RK5A 2IPAB 5EWMB 2JVKA 2VK2A 1WETA 3RVLA 1DBWA 3IDOA 3JS5A 3LUJA 1ABEA 1EWVA 4GPAA 1C4WA 4TLLB 3D8UA 4RS3A 1Z17A 4RY8A 3SAJA 3OQNA 2PUFA 4QPJC 3JVDA 4RV5A 4JASB 3IP9A 2R25B 4YRZA 1S8NA 1URPA 1RZRD 1QPZA 2VUHB 1D4ZA 3EQ2A 3FFXA 5FBKA 5TQ0B 3HVRA 1QQAA 4F12A 3LFTA 2NZVG 4EYOA 2B1JA 3DGEC 1NXOA 3FFWA 4ZPJA 1IIBA 1CYEA 1XHFA 4KK4A 1DBPA 4W5OA 3FGZA 4N41A 1BVHA 2HQRA 3CRNA 4XFKA 3HJFA 1L5ZA 1T34A 3L49A 4OLBA 1VKRA 3I42A 3BRQA 4OG2A 2FMKA 4EYGA 1MB3A 2FQYA 2PJUA 1D5WA 2GX6A 2VUIB 3I5AA 3IPCA 3O1IC 5EWLA 3HZHA 4PE5B 5BQ3A 2L18A 2LUOA 4ETNA 1RXEA 1MIHA 1LBHA 1QMPA 1BDIA 3DLHA 5DKFA 4O5AA 3C6QA 4IMIB 5JNWA 1CHNA 2OQRA 5TQ0A 4XAQA 4RK4A 2WMYA 2WB4A 5EWLB 1JBEA 4MS1A 1LK0A 1DZ3A 1F51E 4YR7A 3RVQA 1JL3A 2F8SA 3GT7A 1ZGZA 4W5NA 4NCAA 3T6KA 3N53A 1Z12A 1NXXA 3S99A 1FFGA 4YWHA 1XWWA 3LOPA 1SRRA 3SQNA 2CHEA 5D2CA 4MQFA 1DRJA 1FFWA 1YTUA 4OLAA 5JNVA 4MR7A 4WT7A 3H5WA 3RVKA 1U8TA 4F06A 3NHMA 1BDJA 1BAPA 4LZLA 3O21A 4TMYA 4F3TA 4DADA 4G0XA 2A9PA 3RQIA 4N03A 2QXYA 1M5UA 4IILA 3SY8A 4Z4IA 3QK7A 2PL9A 1NXWA 3TB6A 3C97A 4TLMB 2PUAA 1PEYA 9ABPA 2QVGA 1C0EA 3EODA 4G0MA 3Q15C 1TLFA 3GA5A 2LP4Y 3I45A 3CHYA 3NNDA 3RVOA 6ABPA 3IP5A 3O1JC 3CU5A 1Z18A 2QR3A 3I09A 2WWVD 5ABPA 3N8IA 3CG4A 2CD7A 3HM9A 4OTZA 3K9CA 4MLDA 4PEVA 4D74A 4E7PA 2GI4A 4MR8A 3QELA 3QX8A 5ED4A 4RSMA 2JB9A 4YP9A 3BILA 2QSJA 3MM4A 1FSPA 2NT3A 4LDAA 2H0AA 3Q9SA 5EWMA 4RKRA 2LPMA 4KREA 1VLZA 2JCGA 1DCMA 4ML3A 5KC9A 3NNNA 5FWYB 5IBQA 3NHZA 3BREA 3EULA 3H5LA 1PEAA 4ETMA 4RY9A 3KG2A 3O75A 1QP4A 1KRWA 1FFSA 4FE7A 1UDRA 4HYEA 1MVOA 3CG0A 4F8JA 4GNRA 3P9YA 3KTOA 1EFAA 5TQJA 3N0WA 2JK1A 2H3HA 2ZWMA 5T3YA 3CLKA 4N0QA 4OATA 1E6LA 2N9UA 3ROFA 1JHZA 2WRZA 4NQRA 1YMUA 1SXGA 1QO0D 5PNTA 4P1ZA 1JDPA 4RU1A 2FMHA 1YIOA 1JFVA 2FN8A 2JVJA 3HUTA 1QQBA 4W5TA 2PLNA 5FWXB 3OLZA 5KWSA 2J48A 3T95A 3FDFA 3E61A 3T8YA 4WWHA 5IEBA 3D02A 1Z26A 3LKBA 4ZMSA 3LUCA 3EDCA 3RVSA 3KKEA 4WUTA 1PUXA 3HEBA 4WZZA 5JNUA 1R8JA 3DZDA 3O2QB 2GWRA 1ZDMA 2FQXA 3GL9A 5CNKA 2PMCA 2ZAYA 3Q7SA 4IMJB 3OM1A 3GWGA 3QLUC 4Z0NA 3NBMA 3O74A 3SG0A 4ZYLA 1YK1A 3OO0A 3JTEA 1ZVVA 1ZY2A 2AYXA 1GLGA 4OBBA 1U0SY 3MQ4A 1JH9A 1RZRA 3M9XA 1JWLA 3QLUA 2FLWA 4KK3A 3LUDA 5BRJA 5TPZD 1U2PA 3NNSA 4RWEA 4MQFB 2FTKE 5JNTA 1JFSA 3KJXA 1W9HA 2IOYA 4MR9A 2JBAB 4P98A 1GUBA 3TO5A 1VPWA 3LUAA 3DGFC 2V0NA 2MYNA 3HDVA 3OLVA 1ZHHA 5TPZA 5B3JC 3TX6A 1LBIA 1USIA 3GRCA 4LE0A 3H5VA 4N76A 5FBHA 3OO1A 1NXTA 5DTEA 5TE9A 1QP7A 4RK1A 3JY6A 5HSGA 1EAYA 1TVMA 2BGGA 2WY2D 2W42A 3OMWA 3ILHA 3KYJB 3T38A 2F8TA 4N0PA 1LJLA 3Q41A 3EJWA 4QICA 2E4WA 4Q6BA 4MAAA 2L17A 4LE2A 3VNAA 3HUUA 2FEWB 4E7OA 2B4AA 4LRQA 1USGA 3IP6A 5DGCA 3H6GA 3MYYA 5KQMA 2CHFA 3HK2A 3MMNA 1NATA 4KVFA 4MQEA 1A0OA 4MR7B 1SXIA 4B09A 4WXMA 2FVYA 4XASA 3CTPA 4YGXB 5B3JA 3UK0A 4KZKA 1ZN2A 1DBQA 1NXSA 1TM2A 2GKGA 3HCWA 2KYRA 4KFCA 3ILYA 3O2SB 5CNIA 1APBA 2PUCA 4NCBA 3GBPA 1BDHA 1E6KA 2IPMA 1JLKA 2FW0A 3QEKA 3O2JA 4XXHA 4W5QA 5DLEA 4MPTA 1QO0A 4KPYA 1A2OA 1F4VA 4KV7A 8ABPA 4DQDA 1QKKA 4Y9TA 4JB0A 1L5YA 1PNTA 1YS7A 1EHCA 4Z99A 4EVQA 4EGSA 1Z15A 4FB4A 4ZJPA 5IC5A 4ZMRA 1YVUA 2R4QA 3CZCA 3SM9A 4MS4A 1KRXA 3H5IA 4JOQA 3OLYA 4TN5A 3MA0A 1Z16A 2PL1A 3KLOA 3O1HB 1M2FA 5EWJB 2FKAA 5IX8A 1U2QA 4YO7A 1JYEA 1M2EA 3K4HA 4ETIA 1JYFA 3RH0A 4XLTA 1Z2DA 1OXBB 2MSWA 1D1QA 3BBLA 3LUFA 4IF4A 3HO1A 3A0RB 1YS6A 2TMYA 4L85A 3VNBA 1DC8A 4O1IA 3DBIA 4RY0A 4DN6A 3Q7RA 4G86A 5EWJA 4H3KB 1ZAYA 1DRKA 4RKQA 3N0RA 1JX6A 3GBVA 2L2QA 4RXTA 3LUGA 5JNSA 4KQCA 2JVIA 3EQZA 5TQ2B 2LBPA 3G1WA 4Z4FA 3QLTA 4MS3A 1U04A 4W5RA 1KMIY 3H6HA 2WJAA 1Z13A 4NICA 1RNLA 1QNLA 5DCLA 4S04A 4HNQA 1HEYA 2E4UA 1LJUA 2MYPA 2PKXA 1K66A 3BRSA 4RXUA 1P2FA 2QW1A 5KQGA 1H9CA 2E4XA 4YCSA 4UHKA 3QEMB 3JPYA 3IP7A 1E6MA 3KSMA 4MS3B 1ZITA 4Q7EA 3HS3A 2QV0A 4PYRA 3QX9A 2HPHA 3EGCA 3EAFA 4JAVC 1KGSA 4Q6WA 4RK7A 4Z4CA 4KNYA 3CS3A 5JNRA 3B2NA 3HSYA 3A10A 4RXMA 5CNJA 2RDMA 3OM0A 1NTRA 1MAVA 2RJNA 5KQLA 1GCAA 4MGEA 1CEYA 1NY5A 4MLCA 4MRMB 3RVJA 2FXIA 4IRXA 2JBAA 2L19A 5IUKC 2A9OA 1NXVA 1OXKB 1AB6A 4G0PA 2QZJA 5IEJA 1W25A 4H3HB 2HSGA 2HJ9A 5T7BA 2WJWA 1SD5A 3LMKA 5CNMA 4LE1A 4QYWA 4F11A 1VRVA 3OQOA 3H1FA 2FEKA 5BR1A 4Z4EA 1ZH2A 3QEMA 6CHYA 2GBPA 5HQJA 3KHTA 4HNRA 1DJMA 3RVMA 4KMRA 5HM6A 3GYBA 2IPNA 2FSPA 2HQOA 2MYTA 3JVIA 3GV0A 3H1GA 5F64A 3RVNA 1QP0A 2PUBA 1J56A 2LIVA 1Y1LA 4O1HA 2IYNA 1BA2A 1ABFA 1D2AA 3LUHA 1AB5A 4RK6A 2CWDA 1SXHA 3KYIB 4YLEA 2E4ZA 2R48A 2NZUG 2AYZA 5KQPA 5IUNC 1Z25A 2VYCA 3CFYA 4FE4A 2A9RA 4MQEB 4D6XA 5JS1A 3TMYA 2M1ZA 5C5EA 5IULC 2FN9A 2ID7A 3A0UA 3FFTA 2IDMA 4Z9AA 4KRFA 4MR9B 1ISRA 5TPWB 5KC8A 3TD9A 4LX8A 3UKJA 2P9HA 1ISSA 1FQWA 3L6UA 4MS4B 4EYKA 2NT4A 4G97A 3RVPA 5BRAA 2QVCA 1B00A 3F73A 2I6FA 4G0YA 2M98A 1P6QA 2MSKA 3H75A 4MRMA 1PHRA 2PUEA 4Z4GA 3UUGA 4HNSA 1JFTA 3LTEA 3MF4A 2IKSA 4YV7A 4RZSA 4NV3A 2NUBA 1YK0A 3M6MD 4LDZA 5IUJC 2XDYA 4XARA 1PNRA 1P6UA 4JB2A 2IPLA 3C3MA 1RXIA 3W9SA 1A04A 2FLKA 3CKMA 4YS6A 3OQMA 2JRLA 1ZGGA 4PICA 3DLBA 3IPAA 1M5TA 3KS9A 1ZESA 1RPJA 1XHEA 5C5CA 1YMVA 3OLWA 3CZ5A 4D6YA 4EVSA 1ZH4A 2E4VA 2FQWA 4JP1A 4MR8B 4MS1B 2ID9A 3C3WA 1JF8A 1I3CA 3LUKA 3E3MA 4M88A 5TQ2A 2FMFA 2PE5A 2FEPA 3SNKA 2YHAA 1K68A 3N75A 1USKA 7ABPA 1TJYA 3HV2A 2PAFA 2P4UA 2R47A 5JS2A 1DG9A 5GQSA 1DP4A 2DRIA 4G0ZA 2PUGA 4RK0A 3FMVA 2FMIA 3QLVC 4G0OA 3KLNA 3N0XA 2O20A 1EWTA 1E2BA 4G0QA 5HKOA 3URMA 5E3JA 3JPWA 2X7XA 3HDGA 2OENG 1EWKA 5KI6A 4S05A 4EY3A 2Q5CA 3OMXA 1MB0A 3F6CA 3KCNA 4KQ9A 3F7NA 4JA2A 1DCKA 1GCGA 4WXEA 3LKVA 4QYMA 4EVRA 2RGYA 1D1PA 4Z4HA 4IGAA 2MSLA 3QLVA 2E4YA 3N6VA 3H5OA 4EUKA 1DC7A 3C3KA 2HQBA 3H1EA 4PZ0A 2RJOA 1P8AA 2MYUA 3G85A 4MYRA 3F6PA 3R0JA 3ROTA 5FWYA 2QU7A 3MIZA 4H60A 3OLXA 1TMYA 1GUDA 3CNBA 4L4UA 4Z9BA 5GOTA 4UHJA 3A3KA 1Z2EA 5TPWA 4EYQA 1JDNA 1DCFA 5CHYA 1NXPA 5I4CA 5FWXA 3QELB 3RVRA 4CBVA 2YHBA 3Q7TA 3H5TA 4RDCA 2A9QA 3HXMA 2PUDA 4N47A
chains in the Genus database with same CATH superfamily
1SK8A 2C4UA 3SLKA 1GTMA 1JILA 3O7WA 1J6UA 2JKYA 4GE0A 5I3ZA 1Z2OX 2R2GA 4GOMD 3RUEA 1T43A 1G21A 2AJTA 1P5JA 2X15A 4CKWB 3OQNA 4RY2A 2QW0X 1O94C 5FOVA 3WNQA 3TLCA 3KLBA 4PONA 1TB4A 2D0PB 1ESDA 3TMKA 4BLWA 2P9CA 1QPZA 4YT8A 2DB3A 4HDKB 3SVZA 2HFKA 1H0RA 1F8GA 1Z5GA 4LC0A 4HH4A 1CUYA 2VSYA 1VP3A 4IAOA 4EMUA 3KNZA 1GT91 4YR9A 3EVZA 2CF5A 4BX2A 2O5EA 1UKCA 5K3CA 3MCTA 4YJHA 4XX1A 4IUBS 4RF4A 3DF7A 5T5QA 1RM3A 2CD9A 4JP8A 3L05A 1GGNA 4N18A 2GARA 4JT9A 3HJHA 2VTKA 2FMKA 4B5LA 1RZUA 1MB3A 5M34A 1YB7A 2QMZA 1LQUA 3SJBA 2W6ID 5EHNA 1D4FA 2IOQA 5F3WB 1GAXA 2QPOA 4HAUA 1LS1A 3EB9A 1QRTA 4FILA 4OJTA 4J7AA 2RGUA 4DIKA 1G6HA 3G9XA 2RGBA 2V8OA 3LPDA 3AR4A 4TS9A 1MIHA 1FVOA 4BFTA 5B36A 4DUPA 3SHOA 4FONA 4CN8A 3DLHA 3M1LA 5DX8A 2AI1A 2P9ZA 3R6GA 4PAQA 1RHQA 2GHTA 3UJNA 1QR6A 4OFXA 3PKZA 1MNQA 2IHUA 1T6XA 1EP2B 4N49A 4O8CA 1GG5A 1M72A 1TCUA 5GM1A 4EMSA 3MS4A 3NWBA 5A5EA 1F51E 1U63A 3FGPA 3HB0A 1HXHA 1JL3A 2GTIA 3DA8A 3FRHA 3K1ZA 4J2TA 3H97A 2P0AA 1Q50A 3AF4A 4KWCA 1MG5A 3PC7A 1TC1A 4IY1A 1I3LA 2AJLI 2GCOB 5E8JA 1U2EA 2Y1EA 3LOPA 3ULKA 4NXMB 3SQNA 1XELA 2P4QA 5KYUA 4NBTA 1UPBA 1WA5A 4MQFA 2M2IA 3ZGLA 1T8WA 1EYZA 3VV3A 4DM7A 1N2SA 4OLAA 4LOJA 3P0EA 1RWBA 4NEHB 4F06A 3IKTA 1E1MA 5DGDA 2BKEA 1A7JA 3FLBA 2A1UB 3DL0A 4TM7A 2G70A 4B0PA 1A1SA 1M1YE 1PJ3A 1OJLA 3MT8A 3IOMA 3ZV4A 3UT6A 2X8BA 3VXKA 1IHUA 1WUTA 1NI4B 2JATA 3TXYA 1D6MA 1NASA 5GIOE 3GPLA 2R4UA 3SD7A 4F6RA 2H08A 1A2KC 1ZQ1A 3LHFA 4P22A 3U3DA 4BMPB 1PYGA 4MDYA 3VJLA 3CEAA 3ED1A 3QK7A 4PYKA 4ZU1X 4C2BA 1Q1ZA 3ZE9A 4KC0A 3V7WA 3KOUA 1JMKC 5DYTA 2DQSA 1TLFA 1X8JA 2HDNB 4CL3A 1JI3A 1JVBA 3MCVA 1HYHA 2EERA 3ML1A 4UHCA 1ULUA 1LRLA 4IUDS 1YWGO 1E32A 1JHUA 4KI7A 4MMYB 4YJ3B 3O03A 1GRVA 3BWEA 1X74A 4D0SA 5IF9A 3STXA 2O8EB 2ZLBA 1KHTA 1CUIA 1UH5A 1XKQA 2ATXA 4OSEA 4RSMA 4XVQA 1UOQA 4KACA 3LRXA 1HG1A 2R00A 4IDFA 3VGPA 2H0AA 1YFJA 4BO5A 1M6YA 4B40A 4CWAA 4TSFA 5FJJA 4BQOA 4B3HA 4Z54A 3KAPA 1GFIA 3OZTA 3ZJ4A 1VHLA 3FLEA 2H18A 1OYOA 2EP5A 1T91A 5TXGA 4YXFA 3B6KA 4BRWA 5BMVB 5BXQC 5KB3A 4EG7A 1VMIA 5AHXA 3K70C 1BE0A 3CPEA 4AO7A 1MVOA 5C8XA 1TUEA 1LRKA 5FBLB 4BFWA 4ARSA 4CMGA 3W34A 1I2ZA 1OF1A 3FOCA 4JJAA 3HKCB 4GMDA 4CE6A 1E9SA 5C46F 1JIIA 3NX4A 2C4KA 5AW4A 2N9UA 3DEIA 4N7MA 2ZVDA 1EHYA 1IC6A 1SXGA 1Y33E 4NJEA 2DUUA 3EGOA 3E9CA 1OASA 5EJMA 5JCJA 1JDPA 2HTEA 4GLFA 4EUSA 1EDBA 1M1YB 2GZ3A 3ZZNA 1GTSA 3HUTA 3KTAB 5C52B 3S8MA 4AZ3B 2G63A 2DPXA 3FPEA 1YJXA 2XEDA 4R71A 5KWSA 2X14A 5AD1A 1NU8A 2IOFK 2EFCB 1W34A 4XA8A 2KMLA 3CX3A 4Q47A 3IOEA 5E4JA 2C9MA 3RIMA 4P5PA 3JQCA 4I9GA 3UW3A 2I34A 2R2AA 3UICA 2D74A 2ZRLA 4IVQA 3MTDA 2V55B 4LXIA 3DEYX 3EXEB 13PKA 3VNRA 3S44A 2IHVA 4E22A 4ZO9A 3PPIA 1NJ5A 2J85A 4W7HA 3ZHOA 5JH7B 1Y6FA 5E9JA 2M6KA 1M8JA 4LN1A 1HEIA 2CSUA 2OECA 3BMXA 5DT9A 3OICA 3ROZA 4NCHA 1VRCA 5I5GA 4GLLA 4PFKA 2QUIA 3STVA 4OBBA 1DDGA 3ADPA 4RPCA 2PGOA 4RANA 2IBMA 4M7OA 4OHUA 2FDCA 4HFMA 1LTKA 2AQIA 5ARBA 1WHSA 1C5KA 3K2BA 2QTRA 3PFBA 3SBXA 3CZPA 4LIPD 4CMEC 5JI3E 1CR0A 1PEKE 3D9QX 4X61A 1NPYA 4C3VA 2I7CA 2GXSA 4ZQHA 1YF3A 2IYPA 2IEIA 1DKNA 5DTMA 2QE7D 3GHYA 3R7NA 1V4BA 3NGLA 5FI0B 4MR9A 3L7IA 3R0IA 4H7EA 5CDGA 4UCQA 1U8AA 1Y5NA 1BXGA 4JOBA 4NCJA 5A3JA 2IZ5A 3A36A 1JE1A 5AI4A 2OXRA 3L8HA 1I9CA 4HWKA 5IF3A 1IXZA 4KMMA 4L78A 3ZWKA 4B8ZA 1RWXA 3Q7QA 2C5SA 1QP7A 2KBFA 4KN5A 4IS3A 4E4YA 1B2RA 1TVMA 3NIGB 2XT6A 3WYCA 1V96A 4WV3A 5E2IA 1RXWA 1NMYA 1QGOA 5DASA 1LPAB 1O03A 1XAGA 5E0KB 3VR5D 1PK8A 4KFRA 4F4JA 1SBTA 2FSSA 1W59A 4RO0A 5EPEA 3D59A 4KQ1A 3UBTA 2D1YA 3OZBA 3IB6A 3L8ZA 1HRDA 2VAPA 5GWXA 3RNOA 3KT6A 4IFTA 3QHAA 4IHKA 1KYYA 2HM7A 1USGA 4RFLA 3VYRB 3I76A 1T0BA 2VYNA 3DOIA 5BYBA 1XTUA 4KVFA 1Z88A 4IJ5A 4OQNA 3E3AA 2FVYA 2UV8A 3G9ZA 1XDDA 3PQ6A 1Z6AA 4JJKA 1LX6A 1BVRA 4TT3A 4E5SA 5HP4A 1U7UA 3FFBA 2VOEA 4JBXA 1Z63A 4NBWA 2ZIWB 1ENZA 1TL7C 3DCIA 2JNWA 1SXJC 3HMQA 4TV8A 1Q19A 5HZGA 1O9BA 4QHTA 1C1XB 4K81B 3T54A 4BV2A 1BEUB 3D0KA 3EVBA 5FKJA 3ZH9B 3FBTA 1QKIA 4WZAA 2HO5A 3ZBQA 1YI8A 3S8YA 5INTA 3FTFA 4NAUA 3RE1A 1LDBA 2O2CA 3HZRA 5CD9A 2M6RA 4WCVA 2Z2IA 1Z15A 5H82A 3DG9A 3LY5A 1V5FA 3PFWO 1CUSA 1MT3A 1OQAA 1Y5IA 2GN9A 4DLLA 2QYTA 4DQUA 3N8HA 1XMQB 1E3JA 3HDJA 1DAKA 5KWEA 4GNKA 5LJIA 4GG1A 2FKAA 1YSCA 2PT6A 4CHTA 3OQIB 1VA5A 3GO4A 4YTEA 1NY6A 3VUFA 4K9SA 5DOVA 3K4HA 3U1VA 3U6KA 2X6TA 4HXGA 4EHIA 5A4KA 5DH9A 3RH0A 3G0GA 4LRSB 2WIFA 3BBLA 1IL0A 5HFJA 3D6VA 5A5GA 3DPIA 3PF8A 3S1AA 4L9AA 1V7QA 4CNBA 1R0CA 3WL8A 3NMUF 4HEA6 4N82A 1D7AA 1EJ2A 5FPTA 2QUAA 1T8SA 2ZATA 3ENVA 4TGLA 2WOOA 3GBVA 3UAYA 2UZ3A 3EWSA 2WUWE 1RRCA 3P9PA 2WI8A 1DQNA 1XZHA 1GZVA 3D2AA 1R6DA 3QBEA 3UV6A 5AHOA 1HSOA 4FYIA 2O4UX 3SBEA 2H4WA 3E15A 2ZI6A 4GMKA 3S40A 2BR3A 1MD9A 2I2BA 3PCXA 1M0TA 2E4UA 5JOQA 1ONPA 1Z37A 3D5EA 5GP1A 5C8YF 1V8FA 4JA0A 2I1VB 4RXUA 3CO0S 3FVQA 1BD3A 3QX3A 2QZ9A 2JEOA 4DC1A 1N5RA 4M9UA 3V8VA 4UBNA 3TOZA 4PNEA 2G67A 2OD7A 5AKJA 2DPMA 4QSMA 5EZQA 4BLVA 1NMSA 1TQ2A 4PYRA 2D00A 4NBLA 5KOIA 5TQVA 4V2UA 2B9EA 3PEEA 4HLQB 4HXEB 1Z0DA 3CQ9A 4DEYA 3GJZA 1LDNA 4OQEA 5H3LA 5FLXA 3IVGA 4TYMA 2A14A 3VTAA 2NWQA 3FTEA 3THRA 3MD9A 4BMDA 4GVXA 1YCDA 4KR7A 1T4DA 1EZ4A 3DYBA 1SPBS 2IU0A 1P9LA 1B6RA 2EJWA 2H4XA 3ND8A 5B1IA 1JR3E 1FDWA 4NOMA 4CUJA 3E22B 4JJ8A 4WNCA 2L19A 1EWQA 2O2IA 3EC1A 3BL8A 2DY1A 4BBAA 5SY4A 2XB4A 3PC8C 2X0DA 2NACA 5DF1A 4M49A 1KZ9A 4XQCA 3EMKA 1V37A 3PXDA 2P75A 1OKKA 2PMWB 1NLFA 1EVKA 1N2IA 1R00A 2A7XA 1SWVA 2VKTA 3H1FA 4BGIA 3QEMA 4ZZ3A 4KX5A 5G02A 5I7OA 3QU4A 2CXOA 4ZDWA 3ZZ0A 4FKZA 4Q1FA 5AKYA 1ZMBA 2DPLA 4BVHA 1DTWA 1YUBA 1JZQA 2W98A 3QYFA 4KLCA 4UUBA 4B17A 1H3EA 2O8DA 1Z83A 3V2HA 2IPNA 3V34A 4MGKR 3CH5A 3T9CA 2X9LA 1Q3TA 3MNFA 1KYVA 4JOSA 5I9MA 4IJVA 1L7VC 5LZ7A 1P74A 1XXHE 3EMBA 4ASUD 3NHAA 2JLZA 1RI5A 1WF6A 4G2TA 3F74A 2O3SA 4AWBA 3RC8A 3H1BA 4ZQGA 4CQLB 3HI6A 2BTEA 1IM5A 4EZIA 3N3BC 3KVNA 1Z25A 2HRZA 1PL0A 3TLMA 3LL7A 1XJ5A 3HH8A 5BWBA 5IULC 2IXBA 4GMGA 2ERXA 1DL5A 3GFFA 4K1XA 3AF0A 5DEOA 1U3CA 1VE5A 2DUWA 3NGMA 3ISTA 1YZNA 1DE0A 3Q98A 1ZNYA 1Q22A 1WUJS 4D9GA 3HEAA 1OSNA 3URKA 3NBZC 5A5DA 4HDRB 4HGQA 4MLPA 1CZNA 2JANA 5EMNA 1QUFA 2VVTA 2QR5A 3HJAA 5KSZA 1O6GA 1IN4A 4MTLA 3V8QA 3M89A 3PIDA 4ZZ2A 4AY6A 2RJ3A 4OBWA 4QUIA 2OKCA 1KA9H 2I7VA 2D5AA 1QRDA 2YNMC 4XPZA 5IJ0A 5KIAA 1J8QA 5KYGA 4IX9A 1TO1E 3G2JA 4ESOA 5GM2A 2C5HA 2FX2A 4JB2A 1E0KA 2Z6AA 3NKFA 5AIBA 4LJKA 4XQ9A 3W9SA 1ADYA 3QI7A 4C4ZA 1ZJZA 1UJ2A 3EOZA 4KNVA 2XYRA 5IZCC 4BO7A 1WZEA 5CAEA 1M83A 4FR2A 4P7GA 2XNDA 3I2IA 2Q2VA 1M5TA 4BJ3A 2Q9UA 3S29A 1EI9A 1XHEA 3D64A 2MIIA 3DBRA 5C5CA 5LZ8A 2ZYUX 4FGUA 3UFBA 4QUGA 5J4KA 3FB1A 4ZICA 2AQHA 2ARKA 2C92A 3C6MA 4JQSA 2GZHA 2XI4A 3C3PA 5HDQA 3QBVA 4A6EA 2UXBB 5ALXA 3IPLA 5I8WA 2ZYSA 1QGUA 3GLSA 3IMFA 3NIWA 4FB5A 4M9RA 1QH8A 4FHFA 3U4GA 2XE8A 1JFFA 3DE4X 1B3BA 2G25A 3O73A 3FNQA 1II9A 4OXKA 2C5EA 4D57A 1F6WA 4J03A 1M2VB 2HSZA 4BO4A 4KW7A 4FD2A 5JEEA 1HQCA 3ZNNA 1PWZA 5IM4F 3AX6A 1WQ4A 4G0OA 4OHCA 3UMRA 1F0PA 2V9CA 1A3CA 1P44A 3CX8A 3EXIB 4XVRA 3LL4A 4PWYA 1QRUA 3CPHA 4DRXA 5FBZA 2XUIA 4LDPA 1GTG1 4MWDA 2ZIVB 4X7MA 3SSAA 1EWKA 2WG2A 3NBAA 1KXZA 4J4BA 3DUWA 1U7DA 1A8PA 3F5DA 4X3OA 4XRRA 1MB0A 3WBBA 4DWOA 2RH4A 3SNHA 1SKAA 2GESA 4RIEA 4EMBA 1PNVA 2WTAA 1F8XA 3AR3A 3Q7IA 3ZWNA 5CJJA 5KPJA 1MZPA 3VAYA 2VCEA 1NC3A 4WY5A 4GM0A 4HVTA 1D1PA 2EZ4A 5F5NA 4Z4HA 1U80A 2YMLA 2V9ZA 2B92A 1LGYA 1EVQA 2HMVA 2PA0A 3V4SA 4BZQA 3QLVA 2WLSA 1RAGA 4JZYA 2ZI5A 3E2PA 1MV8A 2YQ5A 4GUDA 1GHTA 3B5JA 3RYFA 4J16A 1D9XA 3ONFA 4QBTA 3HYLA 3UYLA 3NDIA 1JR4A 4IIJF 1IE3A 1QQTA 2ZKLA 4PLZA 4Q05A 5FO0A 1PR4A 3OLXA 4B3FX 1XT6A 1VCNA 3LT4A 5FOUA 1JDTA 2PH1A 4MJXA 2GB4A 3DC2A 2C00A 4LDNA 4HQNA 4KXMA 5DRTA 5ER9A 3SC2B 4YPVA 1CJVC 2AB0A 1W88A 1WXQA 2BFPA 3ZHYA 1AX9A 4YRQA 1ZK4A 3VU0A 3E9ZA 1BE8A 1T2DA 5CJPA 4TL6A 3H4VA 1MAUA 3T1VA 3TTTA 4N7JA 1CU1A 3UAWA 4OKNA 4CBVA 5L45A 3EYWA 1KZYC 2WWFA 2Q5IA 3DBRB 3PA6A 4HP8A 4ACAA 4ZEVA 1ZJJA 3CEHA 5BSEA 4YX9A 1X7WA 3LDFA 4RK5A 2A58A 1PKEA 1TQ8A 2RGXA 2PU7A 3O6VA 1W52X 3NWPA 3PENA 5B2EA 2AKEA 4DR4B 1CB0A 1VKNA 2CT8A 1F8UA 1Y7HA 4TLLB 3NJRA 5KYVA 3N2KB 2A92A 3SAJA 4J91A 2J07A 1VL2A 1TZCA 3I1YA 1S8NA 1ZM7A 1I51A 1XTSA 2Y1WA 4LRXA 3DWIA 1QPBA 2VCYA 3CF4G 3BERA 3PA8A 4JCOA 2HSWA 4Y67A 3TIFA 1N1EA 3U4QB 3LFTA 2CMHA 3E05A 3KUXA 4G9EA 2FSFA 3WIVA 1NXOA 4PBSA 1E58A 1IHDA 1BX3A 4KQFA 2NPFA 5IJZA 4RC9A 1O5OA 2ADMA 2ZUCA 3ZVLA 4DCNA 2QQGA 1N5DA 1UBMS 2O6HA 4FMDF 4PXYA 4IIGA 4C5AA 1T29A 2ONCA 2FWNA 1RRPA 1WB5A 3CKKA 1PWXA 4GP7A 5K3OA 3SE0A 1LSUA 3GN2A 3EXG1 2J7PD 1ZMXA 1MOPA 3A1SA 4HN2A 4JBHA 3WAGA 1VSUA 1OH6A 2QV7A 5E7MA 1KI1A 3NRBA 4IXDA 4KRYA 5EIFA 2ODWA 2AD1A 3JV7A 1M0WA 3K2QA 1YVEI 4Z3DA 2VZ8A 3D0OA 1YS4A 4Y6GB 4ALKA 1TQ6A 2UYHA 4JI2B 2YJGA 2Z6VA 1P2UA 1FSGA 3QU7A 2G4CA 2XPCA 2G4LA 4HDSA 4JYPA 3SDBA 4NU5A 5FBWB 4UXJA 4KO1S 1EFVA 4H9GA 4N6OA 4QGGA 1WU7A 4RK4A 3X1DA 1FNMA 4RPIA 1E4VA 1W29A 2ZR0A 1KC3A 5DHQA 3T52A 3E5RA 4JGIA 4KXFB 2Z95A 3LPLA 3RNLA 5CFNA 3WA7A 3CJTA 3EIOA 4CI0B 2OLJA 3Q10A 1Z73A 4FU0A 1U0OC 2YYYA 3QPAA 4WVFA 4B4KA 3ZIAA 4CM8B 1Q7BA 4JJFA 1UK6A 1XWWA 1GCUA 1W36B 2OLKA 3BWMA 3M6VA 1Y6RA 3CF0A 2GEDA 2FW1A 4IOKA 1GTJ1 4YT4A 3VKUA 1HK7A 3H5WA 4RIGA 4EX7A 3NHMA 2EQ5A 3K96A 1RHMA 2OCYC 3BCRA 3S7ZA 3GELA 1Y8CA 1NKSA 5AM4A 3ZI4A 2C4WA 3AW8A 3RADC 1BCRA 4UU7A 5LD2C 4HCJA 3EY9A 1AF7A 4XWYA 1KSJA 4V0OA 3DEHA 4DV7B 4MVYA 1M5UA 4JELA 1CY1A 2UVPA 2VF8A 2OXIA 4EENA 1SIOA 2PLWA 2YUTA 1JHOA 1R64A 2EKPA 2GF2A 1V11A 3RU3A 3VZDA 3U1TA 3FJYA 4WRRA 4CG3A 1SK9A 5TVGA 3O1JC 2E7ZA 3GCZA 2P30A 2XLCA 3LUPA 3N8IA 4GL2A 5HQ3B 3E03A 3L1JA 3NUGA 1L8AA 1TVCA 4MLDA 4D74A 4CQJA 3QHQA 3AV3A 1O08A 2P78A 3BILA 4YJFB 5LP1A 3AESB 1R4AA 2QSJA 4PW0A 1YXMA 3KFLA 3UJHA 4D3SA 4C29A 2QRNA 1XL0A 3Q9SA 4CKEB 1V6SA 3RAPR 4XJXA 1ZW1A 4CHGA 1N0UA 2ZRKA 2H54A 5IT4A 1YZTA 1HZJA 1CQJB 3G5AA 3NR2A 4ND8B 4R2XA 5FD8A 5JPIA 5CLJA 5KJ1A 3GD5A 4WGGA 3S6JA 2ONZA 4FNAA 3EFOB 2NZ8A 2C2OA 3WFIA 2GM5A 1TJ4A 4FFMA 4H7IA 4KE8A 5HF5A 4D6PA 4F5DA 2XCQA 3ZWAA 4CMCA 3P9YA 1KK0A 2GH1A 5ECDA 1LDGA 4CCWA 3GZNA 4BEBA 1NW4A 2O7NA 1YJQA 5BW8A 4IXMA 3JQGB 1BW9A 1CTQA 3HB7A 3OFSA 3PNKA 3Q0EA 4OHFA 1PR1A 1SCUB 3ROFA 4DNQA 1DAIA 2P8SA 4M0FA 1XR3A 5FUQA 4KJXA 1FTWA 1U5BB 4DRYA 2G9RA 3OT4A 4G67A 5E7IA 4U3JA 1KDOA 5G4KB 4RW0A 4OQQA 2JI8A 1ZMTA 3C4JA 1KYIA 2IF2A 4HGRA 4UMDA 3V6LA 5JQGA 1ZEMA 2WFLA 1PFVA 3GJQA 5EHGA 4EAQA 4NXNB 1RXSA 3T8YA 2C7PA 5IYZB 3B82A 1XVAA 1SQSA 3LKBA 4Q1BA 2G07A 4P7FA 1ZM4A 4WLOA 4Y6RA 4YAIA 4JV5B 4E5MA 2NTEA 1R0XA 3B5EA 3EIXA 4HAIA 1Y3BE 3U0VA 1RHRA 5F2NA 4B2IA 4QBFA 2MR6A 2APJA 3DZDA 1XRQA 3CO5A 3ZEAA 1MAHA 1R9GA 3GMDA 1ZUIA 1TVKA 4IMJB 4Q16A 1MW9X 1W88B 1XQ9A 4Z8YA 4B6OA 2BKAA 3CCBA 1WDKA 3NO4A 3U3OA 2V03A 2VZ0A 4QXPA 3E9DA 1J70A 1H85A 3A28A 4ZI2A 1L3IA 2ATCA 1K6IA 1IXKA 4DWJA 2G08A 5TPZD 4CF4A 2DVMA 2D4HA 2XECA 3BEDA 3LCUA 2YRXA 3GZTB 4Q9AA 2FTKE 4E33A 3IHLA 1U99A 5F21A 3QKIA 1GFZA 3SBDA 1Z38A 1Z68A 2IGTA 3TSWA 3W7VA 2W2KA 1I6KA 1JQEA 1WM1A 3JVVA 2AOUB 2XXAA 4EHHA 4LE0A 2CLLB 3P4UA 2PU5A 3H5VA 5A62A 5GJBA 3U0BA 3OSUA 4MVJH 4JC8A 4WXHA 2BRUA 3FVWA 1HUQA 3UIEA 3LY7A 3SZOA 3VZQA 1N77A 4FZJA 1QG0A 2OVFA 2UZ1A 2WY2D 5KDOA 3RG2A 1KFJB 2VT3A 3E48A 1EFPA 3OIFA 4HH0A 3T38A 4Z1MA 4ZI3A 3DBOB 2PUTA 3BGDA 4EG3A 2BI7A 3LQFA 3G1UA 1NYLA 2W6NA 3WGMA 4MAAA 1SCKA 2I2FA 4JLWA 5D8DA 3K6KA 1PT5A 1NP3A 3IAAA 3MILA 3UV7A 4AZVA 2A35A 1OI3A 3L7OA 4DYDA 2IKQA 2VAXA 2ZSIA 3PIIA 4DJAA 4ZCPA 1SVLA 4CI9A 1TGVA 5ALJA 4AF8A 1M1XB 3M6IA 1YCGA 3BKWA 2WJ3A 2Q6OA 5DJ5A 1LF0A 2J67A 4YJGA 1PS0A 5B3JA 4YUYA 4UNQA 2ZE8A 1TLLA 4NQZA 1OWOA 2XQIA 1JDUA 5ANRB 2MOKA 1WX1A 2IXGA 3K9NA 1FP7A 1GJRA 1OTXA 1TM7E 2J3IA 4NG5A 2XGSA 4QGSA 1RR6A 3SEZA 1JLKA 2ZIGA 4GQBA 3EA5A 2PYIA 1J42A 1A50B 1YA4A 2EFGA 2OGUA 4IIYA 1JALA 4EL0A 3EFBA 1W0KA 3RS8A 4FEAA 5IP5A 4E32A 2DCUA 1SUEA 5CYOA 3A7DA 3GUUA 2W0MA 2VHTA 3NFRA 1CIVA 5AJUA 1YMQA 1L7AA 1UBKS 4PN7A 2ZSUA 5KWIA 2RC5A 4RUKA 2HF2A 3KM0A 4IIVA 5EHQA 3RRYA 3WJ1A 5KWJA 4ILEA 5CA0B 4NJOA 4HDRA 4MITA 4U7DA 1XWFA 1E7RA 5M2QA 3W2EA 1UWVA 4PLCA 1M2FA 1Z2NX 2OB1A 1T5TA 3OZFA 3I4CA 2XOXA 2AEMA 3EF0A 1G5TA 3SC2A 3U56A 1BA3A 4PPYA 3K16A 1NW3A 3IQDB 2C04A 2YXDA 1WKCA 1O96B 4KUGA 3TPZA 3IRVA 4IIJB 3K73O 4OAOA 3E1GA 1NFFA 4RY0A 3CX4A 1ULHA 3FNBA 3PD1A 1ZK1A 2NTYC 3NZEA 3TQFA 4CTMA 4RIHA 5KAPA 3BE6A 4H3KB 1DRKA 1AUQA 1Y98A 2E2WA 5AKGA 5L4SA 2C29D 5ELMA 1BYIA 4CDRA 1LV8A 1O6ZA 3LUGA 3UANA 5I01A 2UUCB 4KDFA 1KJJA 3V8MA 5IYZF 3ZHTA 3DXFA 1D3AA 1PZHA 1SEVA 2J7PA 3DT9A 3NM4A 2I71A 1AZTA 4BRZA 1ECLA 3I9OA 1TNDA 5CVJA 3WBKA 4ZYVA 3BXHA 2W71A 3KXKA 3FYDA 3RRZA 5ALVA 3QEMB 2C58A 4B4WA 4A92A 1RJWA 4M46A 1AMUA 3NT2A 2Z8YM 2QLJA 5F33A 3KJGA 4R2MA 4WJZA 1BWRA 2PSDA 2HPHA 2V3VA 3FCSB 4IDCA 5EUMA 3TYXA 2P5YA 3VM6A 5JWRA 3UJAA 4MEBA 2HJGA 2OLEA 4MYTA 1TCBA 4LY3A 4N7RA 1TZ2A 4JWKA 5CNJA 2RDMA 3A06A 3AR9A 3DCNA 1U7OA 1UZAA 4WNAA 3GZNB 5D01A 3K35A 3F67A 4OQMA 4I4LA 2GEUA 5KNDD 1MC8A 1NVMB 2P5UA 5AVUA 2JFZA 1BVUA 4BL5A 2BFWA 4CPDA 4J76A 4J7UA 2AG0A 3Q3IA 3U60B 5GZ6A 2V74B 4XOIA 3V1LA 2HJ9A 5DHRA 1C0PA 2WA1A 1XROA 4DMMA 4EG8A 1UWLA 3CRRA 1ZC4A 2ZJ2A 3ESCA 3IFSA 3NKVA 3QW4B 4MIKA 2RHRA 4PFSA 1EG7A 3HKBA 3RVMA 5HM6A 1OD6A 3SYKA 2BMWA 3ENNA 1XA3A 4LHEA 2HQOA 4GI2A 1Z33A 3SKVA 1T1IA 3QVOA 1NVVQ 1C3EA 2JFWA 2XCOA 4RSRA 1JKJB 4AG5A 4DY6A 4D9JA 3IV7A 1KMHB 3TI7A 2FFHA 2R6DA 3HU5A 2LRHA 2E4ZA 1C4XA 4W7IA 1E8DA 1V1JA 2NZUG 3D6NB 1YASA 3GJRA 4MULA 2DLCX 1YS9A 3PDHA 2PGAA 7AT1A 4MVJM 1DHRA 4R9SA 4HLUC 4FMBB 1XPUA 1RFGE 5C5EA 2ID7A 4UAJA 4UUPA 2QYHA 4OY3A 3UXMA 1UKZA 3CW9A 3Q6NA 3A6DA 1ZPDA 3S2EA 4B3JA 4GP6A 1DKMA 4LUCA 3HBMA 2COUA 3TSZA 1J24A 1FVFA 3HO6A 4U00A 3TPFA 3VVBA 2PZ8A 4C3UA 2OFPA 2RGDA 1X70A 1Q7CA 4G0YA 2QL6A 5DBOA 1RE1A 2YDYA 5DMHA 1PHRA 3QVVA 5DXJA 3IS3A 3KPYA 1AT1A 3LYHA 2EC5A 3KZOA 4F60A 2QJOA 2IKSA 3ECCA 3DHVA 5B4VA 2IDZA 1Y6GA 1XF1A 1W0CA 3M6MD 4RKEA 4HBZA 3OURA 3PR1A 4ZAZA 5BUQA 1RYYA 4RMJA 3R8CA 3K6SB 2EHDA 1P6UA 1X1SA 4JLJA 1EVZA 1NBOA 3I3OA 3A6LA 1E2JA 4CVNA 4F86A 1YAHA 1LLFA 4U5XA 5LJLA 4FGZA 3PD7A 1XD8A 2PX2A 3TJMA 3N2ZB 4QDZA 2DBVO 2NXWA 1XQ6A 1GTL1 2EFYA 5A1JA 3G9TA 1DKUA 2HK6A 3OQ1A 1JG7A 5EYPB 4OJNA 4KXQA 1HBJA 1O94D 1LBEA 3OLWA 5IDWA 3IAS1 3PHJA 3ZWCA 3SVTA 1Q15A 2A9FA 1HPLA 3F5FA 3JYPA 4OYRA 3LRTA 5FPQA 1E9VA 2WJPA 2NADA 4RQBA 3U4DA 2CDAA 1IUKA 4X8HA 3L0IB 2PE5A 3PUYA 4FDTA 2FEPA 2O54A 4UNRA 3WRXA 1B6SA 1YR2A 3OPVA 1X7ZA 3GH3A 1QDEA 1BDMA 5CLGA 1Y1TA 5LQNA 1CDDA 2W2VA 2AK2A 2QZSA 3GLVA 4YIKA 5JS2A 1LSSA 1SC3A 4I5EA 3IQIX 4JI5B 3ZCXA 4C0JA 4YYZA 4KP7A 1Y4ZA 1G8GA 1QLJA 4DKJA 3QLVC 1MJGM 4GDFA 3UEOA 3ZDCA 3W4JA 4YUVA 3BIFA 3Q1KA 1X9GA 3MUOA 2O2JA 4ZAYA 4LBWA 1UDXA 4UFPA 1ZK2A 1H1TA 3T5GA 4F0JA 1IULA 1S2OA 3C6KA 1WBBA 1Q7TA 1GQOA 2BWJA 1Y7PA 3WG9A 2EDCA 3D7KA 3U19A 1W7AA 3MJFA 4I1YA 4YRMA 2YZ7A 4HMQA 2PWAA 3UXYA 1JQBA 1XDWA 3B7GA 3IMGA 2UUPA 5A6SB 3THXB 3LVRE 2F1HA 1ZC3A 4MP6A 5ALYA 1P81A 3WLSA 2OB2A 1FDRA 5A0TA 4JB3A 2E4YA 3G5LA 5AJXA 4DIEA 4YRGA 1QO9A 1R5NA 1Y1PA 1QDUA 4MWGA 3HNOA 3E9NA 2HADA 1I5RA 3VPXA 2NO1A 2FN4A 4DILA 1AMNA 2QAJA 4HY3A 3G85A 7MDHA 3PZRA 2OESA 1KDVA 3WFZA 1P6XA 2PJZA 4UBMA 2J5XA 1K1EA 1OXUA 1VXOA 1WDTA 3GOHA 4JUAA 5EN4A 1QLHA 1H65A 4LEIA 3CNBA 3ITNA 3L41A 1ZG3A 1P1HA 3L8CA 2CLEB 1OGJA 2P6RA 1KIAA 5DX1A 3EN0A 1WZ2A 1U2GA 2IS2A 3C8HA 3PDCA 2PJRA 4QL3A 1D04A 4A36A 5EGSA 2XH8A 4C3OB 2ZDQA 1Q14A 3CH6A 1N6NA 4XVHA 1DJPA 2HEGA 4E03A 3P52A 4PSDA 5K8VA 5IZCA 2VHJA 2Q27A 3THSA 4IOMA 3NASA 1C50A 3IDOA 2OA0A 3OZXA 1O95A 1IVYA 3TUIC 3OZAA 2PUFA 2N3ZA 1TK3A 1WCXA 2I7TA 4URFA 2VPXA 1C0LA 2RCYA 4PG6A 4XGNA 1M10A 1XZAA 2ORVA 3AJ8A 3IX7A 1D4ZA 4P3PA 3A4MA 4QAQA 4WY2A 4Y18A 4A0FA 4BMVA 4X5OA 1CUUA 2UVDA 4CIBA 4ECAA 3PXUA 5KJEA 3OIVA 2FSGA 5IAAA 2HMWA 3DGEC 2KX7A 5EXSA 4EHBA 1EK2A 3AJDA 3L6OO 3WHPA 1H9AA 2WSSD 3L5OA 4BKQA 1X80A 3OOSA 4IMPA 3CWCA 1Z8FA 1WNFA 5LC1A 4Q93A 3ZR4B 1FUEA 3L49A 4OLBA 1FQJA 1Q2UA 1XDZA 3ZKAA 1GLNA 2RHDA 5AI6A 1L5QA 4A1OA 4I8IA 3B89A 1T8UA 3A3OA 3RTAA 1NDHA 1N8TA 1VSTA 1U4OA 2HB6A 2O8EA 3QVGB 2XMSA 2PPLA 2HAEA 2WJ4A 2OD2A 3GJTA 5LQJA 1GP2A 5DLPA 1OA1A 3MTEA 1KC1A 1L5MA 3MPUA 4KIJA 4EJ6A 5A3SA 1J22A 4B32A 4WN9A 1MDFA 1BRTA 2C5AA 4QUJA 5CM9C 3TH5A 3P9KA 5B2ZA 1U9ZA 1YDMA 4RQUA 4PAOA 2QP4A 3NAQA 5TSDA 3JU3A 4DJFC 1L5OA 2V7TA 4HNVA 4G0WA 3PWSA 5JD6A 1OPXA 1EK5A 5DZSA 3ZY5A 2J5BA 4Q1CA 5JAOA 4PGAA 2YIMA 1RJFA 3BJMA 3T5CA 2QM0A 4E5VA 3KZNA 3DDNA 3ZBUA 1JWBB 1TIKA 2ZG6A 3AEXA 5EEHA 4V38A 4C0KA 4EI9A 4M8NE 5A06A 4RTKA 1JXQA 2CNWD 2XB8A 3O38A 2VP5A 3V9AA 5EXXA 4RTRA 2DOKA 3CF2A 2X1LA 3AYZB 4UW9A 5BN4B 1G4UR 3F4LA 3JQAA 3O8CA 4GC9A 5DM4A 1YULA 2A9PA 5CB4A 2DFTA 3T5PA 2FMXA 2O5CA 1U1FA 2QE7A 3U3RA 2OAEA 4A8TA 3WGGA 4AULA 4G5SA 4L27A 1P9RA 2D5CA 3I5MA 2ABWA 1D2EA 1TIPA 8AT1A 3RODA 4UNPA 4HG2A 4J0IA 1B42A 4R54A 4CQLA 1NA5A 2AE1A 2J4DA 3IAS6 2GCOA 1RWKA 4G5RA 4K8RB 1QVRA 2X5OA 2A5GA 2RH9B 5C81A 3INTA 4OTZA 4QLAA 5FV7A 5ALMA 3AONB 4EA8A 4BUJA 1IOZA 4CF3A 4JUCA 4F84A 5GTDA 4FEEA 2O8DB 2R60A 4MGZR 4QBKA 4QUBA 2QQFA 4XTRA 3C6XA 3IBCA 1GU7A 2PD3A 2XBUA 3A8TA 1ZS9A 4MDEA 1PR3A 2ACVA 2AC4A 4ML3A 3UJCA 2EEZA 3ZUPA 1GR0A 4GFDA 4ETMA 5LXTB 2B7CA 3AHCA 1ISGA 3MOIA 4UBLA 1W44A 1P72A 2D7JA 4BB0A 5BVHB 1UPFA 2W22A 1VQ1A 2FUCA 4E6EA 2R5WA 5TMBA 2VP3A 2RHWA 2Y0EA 4YMHA 3HABA 4R0MA 1ONBA 4OL0A 1EFKA 4LBYA 1F6BA 2YKGA 2W8BB 3PDWA 2H3HA 3TMAA 4AO6A 2CDBA 3I9V6 4EMTA 1PYDA 3FVTA 4I1SA 3F3KA 4OATA 4ZQFA 5H3CA 2YJ5A 4B4OA 4BO2A 3HXQA 2IYUA 5M04A 1YR1A 4LWPA 5J40A 5JZSA 3MVEA 2IYWA 1OX6A 4LZWA 3AIIA 1RQRA 2W2MA 4Q66C 2RAUA 3WISA 5LA6A 4PTZA 3CF4A 3M5WA 1NMXA 1M2OA 1GZDA 1C14A 1JQJC 3KAKA 1JGTA 2C3YA 4XVUA 4I1OA 1EJ6A 1XNGA 1XZLA 4HB4A 3CM0A 1G3MA 1M2HA 4M9CA 4NABA 1PUXA 3OE4A 2GN6A 3ZDXB 1NXQA 4X65B 1NX6A 4UFOA 2ZTUA 3TEJA 2FPLA 2JIRA 1RP7A 1YQXA 2ZUSA 3D4LA 16PKA 6Q21A 5K0SA 3EH1A 3CKYA 1ZXLA 2ZZKA 1QFXA 2QGNA 2F7SA 3O0TA 4JSTA 4M1OA 4BQEA 3NBFA 2AOTB 3WIEA 3U4MA 2C5GA 2DAPA 1EEXB 4M4SA 4PYIA 5E1DA 3DB2A 2WHPB 4Z0HO 5IM5A 2PJDA 1KVQA 1ZY2A 2CL6X 4J1SA 1ZVVA 3DVQX 4I4TB 4R9RA 4NYIR 3ROQA 1M8KA 1QH0A 1TKCA 1WUIS 4RIFA 1CRLA 4B3MB 4KAFA 1BEZA 2HLDD 2X0NA 3LHSA 4RD2A 3UMFA 3P20A 3FH0A 4FYMA 2DE0X 1CJKC 3WK4A 3BCHA 3MJRA 4JBYA 4F5ZA 1BXZA 1L4NA 4RZUA 5A04A 3NVAA 4UBOA 5E7QA 2PUVA 5EA2A 1RABA 3NOQA 1OHHA 1SKBA 3TO5A 5K3SA 1W85A 2PYDA 4BEJA 2WAMA 2YW2A 1B23P 1ADGA 1TTTA 4BO3A 1M2GA 3GRCA 1USIA 1YQDA 5G2OA 4BLSA 4RABA 2WDZA 3L6DA 4ITUA 4UUAA 5JWHA 1U2TA 3UNXA 3VZPA 3JY6A 2BTQB 4I50A 1FSFA 1ZI8A 4ZT4A 3CVYA 1CR4A 2HT6A 2BFCA 5IVKA 2ZZNA 1E1CB 3MJ4A 4KXVA 2F8TA 4YCJA 2QTAA 3FWZA 3FYHA 3NJ4A 3TD2A 5ALPA 2LIPA 4R1TA 1L7DA 1Q6YA 5CYFA 2CFTA 2CXSA 4DY4A 1M33A 1JP7A 3PEVA 5DHSA 4UZEA 3DVLA 2AN1A 3UUFA 3CISA 4W9NA 1SZCA 1MFPA 2GM4A 4TVKA 1PDOA 4MQEA 2NU7B 1GTVA 4MV4A 4L0DA 4B09A 3IDQA 3WR5A 2GK4A 1F1JA 4D9NA 1OH7A 3U09A 1SHZA 1PZFA 3BDAA 2XT9A 1P4JA 5E95A 2J9ZB 1ZN2A 2VPTA 1E4OA 4M3NA 2C1ZA 2DTXA 2GAFA 3BA1A 1Z4IA 2XGMA 3F5QA 3PQDA 2J9RA 4DMCA 1F2UA 4DNFA 4KITB 2WJVA 2OYCA 1M6VA 1Y1SA 4DFDA 5HRCA 4MPRA 1E0DA 3V33A 2ATIA 3O2JA 3C3EA 5H9WA 4MPTA 3BCUA 1C4OA 3MOSA 3WYGA 2QIOA 5HX7A 2HU2A 1ORTA 2C7GA 3ZLVA 3ZKWA 4QDXA 3BE4A 3IGFA 2ZIAA 4UVGA 3W5HA 2WSYB 3H1TA 5BV8A 2G71A 1IWBB 4IHJB 3NV7A 4YQEA 3CZCA 5JAUA 4IOJA 3S55A 2VWPA 2VNKA 1VDZA 3ELDA 3ZU4A 1G16A 1GZ6A 1T3HA 2D54A 4U8GA 2G5CA 2X0JA 4YCMA 2IXEA 4GXRA 1TE2A 1N7GA 4R69A 5IFLA 1JYEA 1NF9A 1FMFA 2ZPUA 4OGGA 4WEQA 1NYQA 3GARA 3VNUA 5DSZA 1KAEA 4H6PA 4BZZA 3KQPA 1V9SA 3QA3E 4QO8A 2CUKA 2P4EA 4KQ6A 4L85A 3Q88A 5JD5A 1DC8A 2ZUBA 3Q3CA 4NZYA 5J2TF 3OX4A 3GT3A 4A7PA 4D44A 1C7QA 4FT2A 4B87A 2G3YA 2JAUA 4HFRA 2JLSA 2G5PA 4NU0A 4RKQA 2I2WA 4CR6A 1ZAYA 2XD9A 4P83A 1ONNA 2QRUA 3RDPA 1U0TA 3Q87B 2IP2A 2O3UA 4NPHA 4TMWA 1F3OA 1GN8A 2OZVA 4MS3A 5YASA 3ECSA 1U4SA 4JMLA 4US2R 1BS1A 1F1BA 2EP8A 3GG9A 4HVAA 3RVDA 1BH2A 3U1BA 3RKUA 4ZRDA 3CLUD 2CHUA 1RVV1 1G42A 4MP8A 3KR1A 4FMDB 4PLGA 5FB3A 1W8IA 3AJ9A 3TS1A 5JLJA 3PX7A 1NBEA 2BBWA 4BAUA 1ZITA 4CCSA 2I66A 1B6TA 2LR0A 5AW7A 3TR0A 5IKOA 3WLEA 4PCUA 4Q6WA 4MVJD 1XMJA 1OREA 1WMFA 5TRTA 5KNBA 2J3KA 3JQ9C 1VFNA 3B2NA 4FS3A 3HVJA 4QFCA 4IH1A 3LY8A 3D7RA 4H3SA 1N75A 3OM0A 2ONKA 1QHEA 2BZSA 2Q28A 2AR7A 4TKUB 4QT4A 3HWWA 3E35A 1G1AA 1Z4NA 2WHYA 4QYXA 2JBAA 4TM8A 1GITA 1IXYA 2RMKA 3TQTA 1EXMA 4JGGA 3OU2A 4RBNA 1E92A 1WHTB 1RZVA 5HDBB 1VC2A 5IHPA 4R8RA 2B1IA 1CUGA 3KOYA 5T7BA 3NHLA 1FMJA 3VU3A 2DKNA 1E2HA 4FHZA 3NT4A 1ZIXA 2JEZA 3R0VA 4M0CA 3BL5A 5LLSA 2VL7A 3O4HA 3LGSA 1G21E 4Y7DA 4YECA 1X6VA 4R9VA 1MB4A 4WFQA 4C7VA 1NE7A 4ZCRA 2SCUB 4ZT7A 2C83A 3V6MA 1I6WA 3ZGNA 1JHMA 3QXJA 2DWCA 1PLKA 1SH7A 2XKBA 3L2OB 1KAGA 3QG5A 3DV2A 3GLTA 4LPSA 3ND6A 4OK5A 5LCXA 1ULBA 1A8SA 3WGNA 4U6NA 4UNNA 1KMMA 1PWYE 1SXHA 3V7UA 3KYIB 4KR6A 1NQWA 4YRPA 3GEGA 1GL7A 4NZ9A 5CPFA 3D1VA 3PC3A 3JAMA 4CEIB 4WLNA 5ALKA 4BVFA 1QV6A 1GILA 3ETJA 2W6ZA 3OAAA 1RRFA 1D4AA 1AHIA 1H66A 2YVQA 4G4SO 2HOQA 2V6FA 4AKEA 2QNRA 4C6TA 1FNSA 1QR2A 4FXOA 4B75A 5F77A 4QOGA 1FFDA 1N0VC 1X2EA 3T7TA 4FGSA 4RFSB 4DUGA 1VI5A 3MRXA 1VJRA 1IPHA 4C9BA 2Q1SA 2W7TA 5TPWB 3TD9A 2H06A 3UUWA 1R4NA 1Z7EA 5EOVA 1QHGA 4PIVA 1KNQA 3JARA 3KKQA 3R5SA 4G97A 2JHGA 2QVCA 4AWAA 1B00A 1SBNE 1XLTA 3R5TA 4HAWA 1NJFA 3D2BA 2C2MA 3W78A 1T6ZA 1U6IA 4MAFA 3VOAA 5LMUB 3RC7A 1UADA 2X8AA 4U7JA 3EXHC 3SQXA 3K9QO 1V47A 4EQZA 1O7JA 3PUIA 3BRWD 2BW0A 2G6TA 1SHLA 3JQBA 3EZGA 3VKHA 4KPUA 1POWA 1EE2A 4RPHA 1IZ9A 2BH2A 1IJFA 3AG5A 4TS3A 1KKUA 1OAKA 4Q03A 1FU8A 2BM1A 2CXUA 4G25A 5T4HA 1VBNA 1S5PA 2FLKA 4JLNA 4OXQA 1SXPA 4RTSA 4PICA 1KKMA 3HY3A 1Q6ZA 3FCEA 4UXHA 1Q3KA 1TUBB 1UXKA 5ENVA 3MELA 1DBIA 1PL7A 3DBVO 4N5MA 4WHMA 2QN1A 4G5FA 3UB4A 3VVLA 2AR9A 5LSAA 1SR8A 1EQUA 1THMA 2FCRA 3NC1C 4K2AA 4YAUA 2G8LA 1H2ZA 3CXUA 4H7KA 4CMJA 4CTJA 4I19A 3OJXA 4D3ZA 1G59A 1K68A 5AQEA 3N75A 2QX7A 2XYVA 3A25A 4C2AA 4KBYA 5FNVF 4IYJA 2FN3A 2VI5A 5F7OA 1GVHA 3FD8A 1ZUNB 3N6XA 4XWGA 3ZQ4A 5GQSA 3QMVA 2G9ZA 5MDHA 2NXCA 3Q40A 1J2RA 3I4FA 3DE1X 3K05A 2NX2A 4DLAA 5KTPA 2V6IA 1CEEA 1ZOSA 1A88A 3RYIB 1ISPA 2RHHA 4QGHA 1ZO8A 3QKWA 5AVZA 2BGWA 2F67A 1EKXA 1UUFA 5DWQA 4PC7A 4WERA 4CKWA 1NR7A 3IEPA 4FP9A 5KI6A 2OMKA 3UFXB 4CT5A 5C1DA 3NTQA 1Y3HA 1EUDB 3ZCSA 4EGJA 4ENWA 3CTMA 1LU9A 2XUZA 4W9RA 3WICA 2A59A 3SQDA 2X8JB 3AUTA 4FUQA 1J2EA 3FW1A 1U7WA 1MTOA 3H8JA 4JA2A 4YMUA 3J80A 1E69A 1Y9EA 4AUNA 4CEJA 3SLGA 1U7HA 2C5BA 2TMKA 5FFNA 2P2CA 2WNHA 4O3FA 3SJZA 2A0YA 1CUZA 3EGWA 1G19A 1AHPA 2MSLA 2YS7A 3IP8A 4HZGA 2W90A 2XA1A 4HTAA 1IK6A 1CJTC 4DGQA 1R0LA 1VJ5A 3DJYA 1OXSC 3T1NA 1R9JA 1YCHA 4JL8A 3TLBA 1H6DA 2GS9A 1ZNQO 2ZS8A 3E27A 3N86A 5TR9A 5KTMA 5KSWB 3A4IA 2HA2A 5I9BA 4D5EA 3B6JA 1B73A 3R0XA 4D8WA 2R9VA 2FY8A 1O0SA 4QVKA 1Y42X 3LLMA 4MVXA 2FP4A 4UCXA 5LD2B 1I4DD 2DJ5A 3UKDA 2PCJA 1XPJA 2W2XA 3ZV7A 5I4CA 3FPSA 3EEFA 3V46A 1TX4B 3D6AA 3D2CA 4Y1EA 1P9OA 5K8TA 5CDYA 1SUPA 4Q1EA 3A1TA 1BOFA 1YZKA 3G3EA 3IC5A 1NJ8A 1OROA 3BOSA 2Q3EA 4ND6A 2AFIA 5ARDA 3UJ6A 4L3OA 4AKIA 2QWXA 1CNMA 2XODA 5IANA 3I2FA 2AOXA 3SJAA 3RVLA 2OZLB 2RGNA 2RI6A 3HR7A 3N59A 3BN3A 2F00A 3PQCA 2D2FA 4D3YA 3JVDA 3LNTA 3RJ9A 1J9EA 2LDBA 1J2TA 1XXHB 1Y37A 1W36D 3A1UA 1RYDA 1G5PA 1LZLA 2CVZA 1TAUA 4TLAA 3R7FA 3EZYA 2OGZA 3KFVA 4QC2A 3TNJA 1XDBA 2FKNA 4NESA 5DHAA 5KVQA 2OY0A 3ZW8A 1FU4A 2C99A 1CYEA 4Z51A 3PWKA 3DFKA 4KK4A 3L79A 5AUPB 2I6GA 3KRTA 3FGZA 3M6WA 3X0DA 4E5UA 2AC2A 2OBMA 3FNFA 1YHYA 3LCCA 2OAGA 3LQ1A 1TM4E 1AQLA 2CXPA 3NI2A 4GI5A 1MIOB 4RVNA 2VUSA 1T5HX 5KJCA 1Y3AA 3OQIA 3ZHCA 2H0QA 2JS7A 4A27A 5CA0F 1AO0A 1SBIA 2QGFA 2ZR9A 4PSCA 4QXAA 3LK7A 2VUIB 4RZQA 5ESDA 2WM3A 4C06A 5BN1A 5KMGB 1A71A 4YAWA 1W5SA 3L9WA 2ZRMA 4IINA 1SVIA 5EIOA 5IABA 1GGVA 1JR3A 4Z9XA 2BM0A 3HVIA 4RESA 1YL5A 1ZXXA 2AVNA 3IIKA 2IEGA 2VWHA 1CHNA 1OX4B 3D6JA 2XMGA 2P7HA 4OYYA 3AGPA 1EIZA 4OJMX 4EG6A 4PCAA 4ZI7B 2R8RA 5FWDA 5ADVA 1OTHA 2CLMB 3H11A 3W6UA 3ZGVA 5A2QA 2EV9A 4HHEA 3C43A 1JG2A 1ZU4A 4DJJA 2PV0A 5IXYA 4OL9A 3GT7A 4W5NA 4BATA 2JFQA 2R0QC 1HDOA 2PANA 4MW5A 4O4IB 2IC5A 3RT1A 2Q5OA 1NXXA 4I1VA 4EM6A 5C7OO 4JP5A 2XT0A 4LVCA 2ZJYA 3IVMA 1KBOA 2Q6IA 4ONEA 3KQOA 4IH4A 3RM3A 4PXAA 3ZW9A 1YV9A 4EQ6A 1FFWA 3T5AA 1JPVA 3G17A 2D2IA 3HA3A 1TO2E 3O8NA 4MVJA 5SYMA 3BGIA 3COYA 3K9FC 5EJAA 3QGMA 4N1AA 4BNGA 2XCRB 4NF2A 4GXQA 4MUJA 2QRQA 1G41A 3PL1A 1ZM2A 3IAFA 5KNDH 5KU1A 1GPAA 3GLIA 5JJ5A 3Q85A 1NFRA 4FINA 3JXEA 4YRRA 4GKKB 5A0VA 4PWZA 4XCQA 1LLUA 4OFZA 5CH5A 5GONA 4Z4IA 3AVXA 3HUFA 2YNMA 2BDTA 4RF2A 5L7YA 2RHJA 1KETA 3P45A 1Q0HA 2B83A 1JT9A 3LU1A 3N0TA 3OOEA 1GZ4A 3WQBA 4K2HA 5C8VA 3EDRA 3RU9A 4ASUA 2YZKA 3ZCPA 2VAMA 4RMNA 3ZWYA 1TYCA 3IUJA 2WWVD 1QVVA 4G1CA 1ZJ5A 4UHHA 2H17A 3PGKA 2GA9A 1GGMA 3PEWA 3R76A 3LWNA 3RHSA 3L6CA 5FHQA 3TSOA 4OGLA 5I4BA 5BSMA 2QZZA 1T0JB 5LZ2A 3TD6A 4RTQA 5JO0A 1A7UA 1GN9A 4IDBA 1VOTA 1XMSA 2IOHA 3I0NA 3F71A 1T9BA 3OEED 1KMNA 3ZD9A 1WB6A 4XIJA 1PX2A 4YCAA 3H5LA 3LQ4A 1DT5A 2XKAA 3FVRA 3O8DA 3PHLA 3ZJTA 3OP4A 4AYXA 1N25A 5HE8A 4CTOA 3PLNA 2CXHA 3GGDA 4URXR 1V45E 4GYJA 3W5DA 3OEEA 4O08A 4WKCA 5FOTA 5IJ0B 4KSYA 2VHZA 3MT9A 3IXQA 5AO9A 3WBFA 4BMXA 4B44A 1SHTX 2NVOA 2XQVA 4XIFA 1F48A 1WUHS 1XZBA 4ZT5A 1R1DA 2DWQA 4OMFG 4D4JA 1YMUA 1DV2A 1RLOA 3R4VA 4ZYWA 1E2MA 3HJCA 3DDHA 2YYAA 4E4RA 5ICSA 1K2WA 2FMHA 4LHVA 4AY3A 3IR5A 1UDBA 3KBBA 1WE2A 4DYVA 2IU3A 3BJIC 3K6JA 4F1JA 2EQBA 3JWGA 4WTOA 3ZTYA 1QF6A 4EEKA 2PLNA 1JNYA 4IJKA 1JG3A 2P2ZA 3CUEF 4QYSA 2R7KA 5AHWA 2OHFA 1CPYA 2VH5R 4WWHA 1V4NA 3TF5A 3K0AB 1I1HA 5CA1B 3T7JA 3K32A 2EWWA 3EDCA 2OFWA 3FDZB 3TDMA 4DC9A 1ATZA 1HM5A 1RM4A 1T4CA 3NV9A 4XGKA 4XX0A 5HYVA 3B13B 3VPGA 4MINA 1WJGA 1SCQA 2AOWA 3ZXIA 2ZVJA 1N0IA 1JE0A 4BX0A 3WYNA 1Z0IA 2DULA 2XYQA 1EGVB 1UK9A 3PPXA 1ZNXA 1SKUA 4WAUA 3IKJA 3QKSB 3NBMA 2XGGA 1RHJA 4GI7A 3RS7A 3TTWA 4DR7B 3T41A 2VRCD 5E8RA 2IXFA 1V8OA 3A1NA 1AUOA 4BS9A 3DDUA 3V1YA 3ZZUA 2BGLA 3COSA 2XW6A 3T99A 2V54A 1ZR2A 1RZRA 3W4KA 1YBVA 4NS1A 2XUGA 4R6WA 2ZYDA 5SV2A 4NZNA 3F49S 2GRUA 2NYUA 3TZBA 4MVJG 4ERNA 3E9YA 4BKRA 4DHEA 3PSHA 3ELWA 4JS0A 3GLKA 2EJTA 1C81A 5JNTA 3UBMA 3BXOA 3PG5A 1OI4A 3UMBA 2I4MA 3OIWA 1FJGB 3ICQB 4CYMA 1XNHA 2ZIUB 1J0EA 2Q4EA 3OLVA 3REGA 4OQFA 4URVR 2GM9A 5IS2A 4MKXA 1E1QD 4LSZA 2QG9A 2H1LA 5EKXA 4F1KA 1YRHA 4Y1FA 2DUNA 1SG0A 3DLPX 2YN2A 3K0CC 2N0SA 5ALGA 4KDRA 4M0PA 1EAYA 1VPTA 2QVLA 5JZ9A 2J3EA 4HB0A 3ZDZB 1FP2A 1XMXA 4WGFA 2QL7A 5TF4A 3VR4A 1KWGA 4G81A 5ES3A 5I5EA 2K2WA 3RFCA 1P39A 2PD6A 5JG7A 1T3GA 4IIHA 3MD0A 2XUDA 4ZGBA 3NC0C 2DF8A 3P4YA 2SHKA 2HJWA 3E3LA 4E7OA 3LDGA 1I1NA 3QBTA 4LRQA 2D62A 5DGCA 5JXWA 3FPBA 5FLYA 5KQMA 3E53A 4UTZA 2CNKA 3GFTA 2P68A 1NOKA 1SKYE 4BB5A 3KO8A 3VDXA 3M6XA 2AMJA 4YGXB 3AY7A 4KO2S 1TVKB 4DXAA 2XUOA 1FRVA 3DMRA 4YNBA 3GT0A 3HCWA 4KXNA 2UZIR 2HWXA 4LMAA 3ILYA 1X2BA 2O23A 2P67A 3D7MA 3ORSA 3QPCA 4PZAA 2V0CA 4QPCA 3KU1A 3QF4A 4RKFA 3T4PA 5BMVF 5J4LA 1DAGA 3G8DA 1E6KA 3FGOA 4B9AA 4FCCA 2ECQA 1PJRA 4OAQA 4W6QA 3SIPA 2VAVA 4WXYB 2E5FA 3RJZA 1BVYF 2ECKA 3UCFA 1DTWB 1RC0A 3B6ZA 1OFGA 4QPNA 2CBGA 5K4GA 4TYWA 5ENZA 3GN1A 1HT3A 4B82A 1X3SA 3C3YA 4RLQA 5IC5A 4R6XA 4WOJA 4JT2A 4IQGA 1GIAA 3T5MA 4MS4A 1K8QA 1KRXA 3G0IA 3KJEA 4JOQA 1Z4PX 2OR3A 3K6SA 2WUVA 2WUGA 4P8RA 3HCNA 2F1OA 1FTYA 2PSHA 2V97A 1QIHA 1PJTA 4F9FA 4Q3BA 2BKLA 3V4RA 4X6XA 4KL8S 5F12A 4LX0A 5IK2D 1Z47A 3VNBA 1NNUA 4Q12A 4DN6A 4D26A 3C1OA 1PFYA 2GO1A 2I54A 1I7DA 2BP7B 2FZEA 4X66B 1GA1A 4UPDA 4JBIA 3PXAA 1PVDA 1JX6A 3UG7A 5FWAA 3SR4A 5JNSA 4JODA 1Y1RA 1X77A 4W5RA 3PC4A 3WRVA 1DRWA 1U3WA 3IHWA 3USZA 3AOEC 3LX6A 5DBEX 4RA6A 1JECA 3T0GA 3V1NA 2G1JA 4A0HA 1T2AA 5ALUA 2VJQA 2OC9A 3KHUA 3ESZA 5J23A 3R5KA 3AFNA 3K9LA 4UHKA 3NTVA 2IY7A 3C5CA 4LZAA 1Y9AA 2HPZA 2BFBB 4ESHA 3EIWA 1GWNA 3LXMA 4TTRA 7GPBA 5ICGA 3QX9A 4B83A 4HQ0A 4P93A 4JAVC 4G4JA 1Y6ZA 1XZDA 4WD3A 3I53A 5CFQA 5JHHB 3GRUA 4LQLA 3A10A 1X8KA 1YB1A 5AH0A 4HYQA 4BNVA 1ZCBA 1XDUA 3BUSA 2ZDGA 3UC5A 4FOLA 1JSCA 2C9DA 4EA6A 3P19A 1ZD2P 3AINA 4G3XA 4WA8A 2P2DA 1J8VA 3GCDA 4FFWA 4D45A 3IKVA 2YHIB 3ICEA 3BB4A 5H8WA 1EH5A 1L5HB 1VG1A 4WXRA 1PUJA 2I2XB 4IUYA 2QN6A 3VR3A 4WLVA 4EKYA 1R6AA 3LMKA 2PZAA 4QPZA 2R7LA 1UP6A 1VJCA 2X13A 4BZWA 3REQA 4IWYA 2VQFB 1KOGA 4KE9A 4W5JA 3MJTA 2MR5A 3N8NA 2VQ6A 4K1LA 3PICA 3SJ7A 2AXPA 5BYJA 2O4CA 2WYIA 1Z4QA 2NU6B 5EYPA 5IN4A 2A5LA 5I7FA 3E18A 5D3KA 5K6AA 5B1YA 5ALSA 4UJ3A 2KHZA 2JFOA 1E61A 2GFQA 2HIHA 4HGPA 2J33A 4UDOA 2H6EA 5F1YA 5I9SA 4DQVA 3S2GA 4F38A 1LD3A 5FTKA 2F3TA 1C4KA 1COWA 2CWDA 5EIBD 3TQIA 4F7DA 4ARIA 4DLSA 2ZRPA 3A6EA 1DWUA 3BIOA 8LDHA 1BE6A 3DT8A 1B0AA 1N34B 1PT9A 3W5CA 1A8QA 4MUHA 4WZAB 3VGJA 1JG6A 2WTMA 4M8SA 2BAGA 2XMQA 1PE0A 4RVFA 4AZ0A 3OT1A 4BO1A 1MO3A 3FFTA 1P5ZB 3X1ZA 5BO5A 4J29A 2FJ0A 4RACA 1WPQA 3RUHA 1ISRA 1NUUA 5EUQB 3KKNA 3O26A 1IM8A 5JFOA 2OHOA 3QE0A 1ZU5A 4L8FA 4ZCMA 2GDJA 4BEVA 1OFUA 1PJ4A 5BV2P 2XGJA 1Y5LA 4U2EA 1PX0A 2B5WA 5HGXA 4YP0A 4QLOA 3H75A 4DARA 2C31A 1TM1E 1JAIA 1LUAA 3DQZA 2I6QA 3K0KA 4RGBA 4R98A 1XEXB 1IBMB 3CCFA 3QX7A 1HMYA 2PLAA 2QVYX 4PCLA 5F9MA 5H4HA 1MJNA 1KMHA 1Z0SA 3UG6A 3VPBA 1R6UA 1XPOA 2VUTA 2XZLA 1N7HA 3WMEA 3NHUA 3H18A 1VKHA 3UO8B 1GKLA 4AQ7A 4LK3A 3A2MA 2ZU6A 4O1MA 2ZM5A 4C7OA 1NKTA 3KS9A 3D6HA 5T8KA 2WEKA 4DLKA 4D6YA 5ICFA 2ZUVA 3OQ6A 1ZH4A 1UP7A 1CE8A 4HQOA 3CRW1 1ZA1A 2WZCA 3DQQA 4YJFA 1Y3CE 5BRNA 3VR1A 3VZBA 2CL0X 2I2DA 3WBJA 5BOSA 2FMFA 2E3JA 1S2GA 2IVFA 2ZRNA 4JQYA 4G8BA 1L8OA 1NDUA 5AFSA 2H63A 3VVCA 4X7BA 1OGYA 4DJEC 1BMTA 1GCOA 1T1JA 2A1TS 2QI9F 3E9MA 1IEXA 5G0TA 2CGEA 1WNTA 5DNVA 2DGDA 3V4OA 5HIAA 4MUKA 2XVAA 4NOJA 2HA7A 1EK1A 1RM5A 3B52X 3R44A 5LKRA 1W9MA 2E89A 2ZP1A 3HY4A 5CXQA 2PKCA 3EUFA 3QH4A 2P90A 4Y6PA 2XA2A 2AA3A 3SIXA 2PZLA 3QE2A 1ZHOA 4S05A 4LGVA 4RTOA 3T12A 3TW4A 3OMXA 4G23A 3KCNA 4XX0B 4ENVA 1AQYA 4NJEB 4Y9DA 2YQZA 2N1BA 3KD2A 4R1SA 1CVLA 1TDJA 2B98A 3AUKA 1QK3A 4FJ0A 4HQFA 3ZZ1A 5MHTA 5I7UA 4IG4A 3DO8A 1TTQB 2UVQA 4QATA 1BN7A 4HNHA 1NURA 2G04A 2ZIXA 4OK3A 4TQGA 5FOWA 1FJXA 1R0BA 4MP3A 4BMOB 5DM70 4AUEA 2PGNA 1MV5A 4JFAA 4ZI7F 2TRSB 3D7NA 4QU0A 3H0CA 3SXJA 1LDYA 1YZVA 2IL1A 4W1QA 2Z6UA 4NY1A 5FUWA 1FNBA 2PSEA 5G40A 2ZYWX 1KK2A 2CUNA 1N0HA 1NONA 4JSRA 1GSHA 1GUDA 1I4TD 3AUJB 1AM4D 2CYAA 1ZM9A 2ACWA 5AVSA 4GOLD 4CQNA 5FP0A 4ZJYA 3ESRA 3RSLA 1LNQA 4IO0A 4ZGWA 1EK6A 2GYUA 3WS7A 1PG0A 2V6MA 3R3ZA 5TF0A 1FYEA 1UJ5A 5AW9A 3AFGA 3PX3A 4TXJA 1E9DA 2A9QA 1P0CA 2V9PA 3K9GA 4PG5A 1F4PA 1LLCA 3EWAA 5HEKA 2PUDA 4YO8A 2G7ZA 2H29A 2POCA 2W6MA 2IOFA 2EBFX 3VR0A 4DPKA 2QTVB 1B41A 1R0ZA 4IDNA 2GCIA 1HYEA 3TXXA 3K9WA 3QUTA 3VDQA 1T5SA 1Z08A 2EF0A 3BGOS 1QYIA 2Y9MB 3IV6A 4RY8A 3NIBA 4V3BA 1TEZA 4X24A 5J5VA 2Y2VA 4WN9B 2GYVA 4TZ6A 3DTVA 1FIUA 1GZSA 1W35A 4BGVA 3FYSA 1KPIA 3V4PB 3WRYC 1PG5A 2CV0A 5TQ0B 1G7SA 1JEAA 3LC0A 2UUAB 2B1JA 3JWHA 2I6TA 3OOHA 3BTUA 5IXSA 3STUA 2O8VA 3FI9A 5K0FA 1RLIA 3D4PA 2MWMA 1W30A 1WW8A 2JDID 4DF3A 2XCSB 3GLFA 1ODJA 4KZPA 4PNPA 3RTEA 3VOBA 1MP0A 3BWYA 3DDSA 2EBUA 5ETJA 3ZY3A 5CLHA 2H5LA 5BVGA 3NKLA 2A5JA 3PB3A 3QENA 4MOWA 1TUIA 4GMXA 3WB0A 4I1PA 2ZRIA 2JDIA 3TNYA 3SYTA 3NHPA 5DGHA 1HL3A 4F3NA 3KT8A 3QA9A 5AR1A 1OX4A 4HATA 5K3FB 3UHFA 3I5YA 4RYDA 4PO8A 3JVEA 1KEZA 1Q95A 1XZGA 2X8LA 1B8NA 1NVWQ 3DVAA 4KPGA 1FRZA 3U17A 3FX2A 3H42B 2H1CA 4XAQA 2XVMA 3GFVA 3QEBZ 2H4HA 4GS5A 4EHJA 1FYWA 3N05A 1X7YB 1FTQA 1FVHA 3ELBA 4C21A 3OU7A 4AAYA 4PY2A 3W7AA 2V7VA 4KAXA 5KNDA 2FN7A 2ASEA 3CMCO 1NUTA 3KOZA 4NK4A 4AP6A 4HNGA 1T36A 4QRIA 4RHEA 3TLJA 1Y6QA 3O93A 3JAWB 2J9XB 2RARA 2NP7A 4C30A 2PZMA 3V1UA 3IERA 3CX7A 2ZBPA 2HJSA 1HG0A 4IGEA 4K9DA 1U8TA 2IYQA 3HMKA 4IIXA 3K09C 2XRMA 4JKYA 3C14C 4CGZA 2R6GA 5KQSA 4WMLA 4HDMB 4Z2AA 1U9CA 1DO8A 3VH2A 2FPMA 3IP3A 5EE5B 4F2GA 1E62A 1LWNA 1DS6A 1NVTA 2M32A 4U02A 4B5KA 1X15A 5JO9A 2ECPA 2G0AA 2WYVA 3HCBA 2NTVA 1GA6A 1WBJB 5EJ9A 5K20A 2ZWOA 2ZPAA 4G0MA 1JU9A 1YR8A 1TKAA 3ZGOA 3BIXA 3CUTA 3MLAA 3JQ8A 4K6HA 5IKEA 4RJJA 3UMJA 3ZI0A 2ZT6A 2OP0A 1HDYA 3DNMA 3SSNA 4DQXA 1SC4A 5JZMA 3EZFA 4LVNA 3OA0A 3U3XA 3B3FA 1ICIA 5CFLA 1H05A 1M73E 1KSGA 3L43A 5L95A 1MDBA 1E5LA 2BJWA 1AZLA 1EXWA 4L3VA 5CFMA 2O1XA 5IK2A 1Y6JA 4MIOA 3W6OA 4G0VA 4PZYA 3ZVNA 3G2LA 5BORA 4Z3OA 1R3UA 3PT5A 3LYAA 2AJDA 3RAJA 1P1IA 5D85A 3QVWA 4N39A 3TLGA 5C1OA 2GT1A 3BREA 3GFBA 3AC0A 1JKJA 2RBGA 2W5UA 2XTMA 3FOEC 1L9KA 2B8JA 5IVPA 4INOA 4RKYA 2FSVC 5DK6A 4PGFA 3T1TA 3HCOA 3KVRA 4R1LA 2VPYA 3LXRA 3PVZA 1TYEB 5CEEA 3COWA 3SR3A 4HV4A 3G13A 4FZ5A 4HYEA 4ID3A 2MDTA 3WK9A 2QD2A 2ZTVA 5TQJA 4RZXA 2IEAA 1G18A 1DFIA 5AVWA 3LPMA 1UPTA 3K8YA 3JQBC 4AM8A 3BGVA 1P7YA 1KFEB 2XYPA 3LT5A 4KAJA 2EW2A 4EPTA 2IZ1A 4YRIA 2OMEA 2ZJFA 3EG9B 1CQIA 3K1AB 3ESXA 4CFYA 1FXWA 4GBJA 2ZANA 3COPA 2BGKA 4QGFA 4RVHA 2DTEA 3PQ7A 3HG7A 4UTVA 3HUDA 1AS2A 3PHCA 2O5RA 1J25A 1M7HA 3C74A 2QVXX 2VDJA 3CPSA 3V9PA 3D7SA 4M2LA 3KQTA 1UC4B 2E48A 5JZVA 1NT4A 4Q7MB 3MZ0A 2DZDA 1ECFA 1N1MA 3K5IA 3KSZO 4MMXB 1C7RA 1QGAA 4C04A 1T2NA 2MSCB 2VEOA 4PS0A 4WKPA 3SZRA 2WU4A 2VTDA 3SF0A 5DSTA 4OFBA 1HRKA 3NHSA 5F76A 1U3UA 4FSHA 3I30X 5G0VA 3L7BA 4R7ZA 2VG8A 5K0CA 1X7HA 3HWX1 3EK2A 3CNNA 1E1RA 1G8SA 1TW2A 1UFQA 2V8BA 3FA2A 1ZDMA 3IB3A 4Z0NA 4EFKA 1E2UA 2CB9A 1R27A 1PDWA 4E88A 1H2BA 1JR6A 5EFZA 4HDKA 2QMQA 3JZIA 4EH1A 3OO0A 2MSDB 1UMKA 3A58B 1E5TA 3QIAA 1U0SY 3MJEA 4GWKA 4PO9A 4I14A 3N9IA 4DR6B 1E66A 5BRJA 2VP6A 4KYIB 4RJ2A 4JEMA 2HA5A 4MKFA 3PZBA 4LSWA 5BOVA 1N5OX 4DXDA 4ZYYA 1PFUA 1WBDA 1RBZA 1WXWA 3DYVA 1G6KA 1RPZA 2W37A 1JFSA 4F72A 2NPOA 3TZEA 4X1KA 5LQUA 4N6GA 4K6CA 3TX6A 2R8XA 2D2XA 3FWKA 1BKDR 1XB2A 2F1KA 2XRYA 2WYOA 2Z98A 3EDOA 3H2SA 4GPTA 5L3VA 1S2DA 3TDNA 3DWFA 4D9FA 1H8EA 3CPJB 3DVAB 1KP9A 3EOBI 1VGQA 4UASA 3SEQA 2GXUA 3EXHB 4HADA 3VV2A 5I9NA 2BGGA 4H35A 3M0EA 2IEYA 3SF8A 2W42A 5A02A 3VU9A 1EP3B 2JZCA 4TWZA 4AMVA 3U9SA 3ZD6A 4S3MA 1F2TA 1IU9A 2WM2A 3A9WA 1BMDA 1G3RA 4KU4A 4NFLA 4CR7A 1UM9B 4QICA 2E4WA 4MI6A 2X9VA 1BXKA 5CITA 3I01M 2BJVA 4AT1A 3TEFA 1UWCA 2L17A 1SBQA 2OBYA 1EP9A 3HUUA 3EDMA 4CMAA 2RB4A 4BNHA 1PK7A 1QHIA 4EBFA 2OBBA 4TVSA 2CW5A 3Q3HA 5JR3A 2DTDA 3CR3C 2C8VA 4W4TA 2HJHA 1FLVA 1JV2B 1Z07A 2OTCA 4YAKA 4FCWA 4FNMA 1B1CA 3QE4A 3KT0A 6REQA 1T0HB 1XRMA 4UE3S 1RQ2A 3QKSA 1HH4A 4IDGA 1DBQA 3UTCA 2CCGA 1VJ1A 1QIGA 2VDKB 1GAWA 4OHXA 5CFOA 4A73A 4E2ZA 3LO5A 1Z0UA 4J94A 2X42A 1BDHA 4HFJA 3RTGA 1HLPA 1RYEA 2HFJA 5ECWA 1S01A 3ZYZA 4KV7A 1GNVA 3LVBA 4D9IA 4DQDA 2GEFA 2ZSDA 3R8FA 4JB0A 4N54A 4RAOA 1M2NA 3I4LA 4BVEA 1L5YA 4RD4A 4R3NA 1DEKA 4RSHA 1FTSA 4CV3A 4Z99A 5TV2A 3CJRA 2OKGA 3HDHA 4LDJA 4OUKX 4TQAA 2XLBA 3QITA 3AR8A 1B4DA 2AG5A 2R4QA 3KTAA 4V02A 5ARCA 3ZGZA 2WKPA 3P27A 3BHJA 5IU6A 1VLMA 3D1JA 1KXJA 1Y8AA 2V5VA 2REXB 3OWHA 5CX4A 3AUFA 3B1JA 4UOEA 4WDRA 4D99A 3OCUA 5DP2A 1KP2A 2IHBA 4Q7LA 2DWOA 5JH7F