2JVKA

Nmr solution structure of the hyper-sporulation response regulator spo0f mutant l66a from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIAKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation initiation phosphotransferase F
publication title Covariance identifies dynamic residues at the interfaces in protein/protein complexes
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 40
structure length 132
sequence length 132
ec nomenclature ec 2.7.-.-:
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jvkA00
4D6XA 3RVKA 2IPMA 1QKKA 3KLOA 2VUIB 3M9WA 4IMIB 1WETA 4RKRA 1W25A 3JVIA 3JY6A 3MF4A 3QEMB 4G0XA 2L19A 3NNDA 4RY8A 1JFTA 2PUDA 3HO1A 1FQWA 4ZYLA 4KK3A 3SY8A 3BILA 1ZAYA 1S8NA 2L17A 4Z99A 4ZMRA 5CNJA 2TMYA 2FTKE 4GNRA 2R4QA 2QVGA 4MS4A 5DKFA 5EWJB 1K68A 1YK1A 1ABFA 5B3JA 3GBPA 2VUHB 5F64A 5FWXB 4RXMA 3DLHA 3LUGA 4LDZA 4MQEA 3JVDA 4WXEA 3O2QB 1GCGA 1ZN2A 3C3KA 4L4UA 3H5WA 1YS6A 5EWJA 2MSWA 1B00A 2GKGA 5FWYA 4RU1A 5FWXA 2FW0A 3T38A 2JCGA 1P2FA 2M98A 1PHRA 1JLKA 3OLYA 1PNRA 5EWMB 1PEAA 2LUOA 2PUFA 5IEJA 5KQLA 2A9QA 2JRLA 2LP4Y 4Q6BA 4JB0A 2E4ZA 4G97A 4MR9A 1JF8A 1I3CA 3DGEC 3HJFA 4EGSA 3MQ4A 5IEBA 3LUHA 2H3HA 5TQ0B 4S04A 4QYWA 2HQRA 5C5EA 4E7PA 1D2AA 4RXUA 5KWSA 4RK0A 3O74A 2FQXA 3QLUC 4LZLA 3LMKA 5TQ0A 3OO0A 3C97A 3CHYA 1USKA 2GI4A 4KQ9A 4XXHA 2IOYA 4MR8A 4F11A 3JTEA 3D02A 3KLNA 3CKMA 2F8SA 1C0EA 1VKRA 4Z9AA 4OLBA 4KREA 1DP4A 2PE5A 4G86A 4WWHA 3RVOA 3LUJA 3N53A 2V0NA 1XHFA 2LPMA 5IUNC 5KC8A 4RV5A 2JVJA 5TPZD 4ZJPA 3T95A 4NCAA 3VNBA 3CFYA 1ZGZA 2FLWA 1JBEA 2GX6A 2JVKA 5TPZA 1K66A 1XHEA 1DBWA 4G0PA 4FE4A 2FXIA 2QXYA 2NZUG 4RDCA 3BRSA 4N41A 1D1QA 4IMJB 2QSJA 1USGA 4F8JA 3F7NA 3LUKA 4MPTA 3K9CA 3EQ2A 1JFSA 3GL9A 5JNSA 1ISSA 3CLKA 3QLUA 1QQBA 4LE1A 3UKJA 3IPCA 2HSGA 3B2NA 1EFAA 3DLBA 3FGZA 4MS4B 2A9OA 1MAVA 3G1WA 5IULC 3HXMA 2FMFA 3A3KA 6CHYA 4Z4EA 2MYPA 3O1JC 4KVFA 4RXTA 5E3JA 1BDHA 1J56A 2P9HA 3KKEA 3P9YA 3RVQA 4G0MA 1APBA 2QVCA 2FEWB 3I45A 4L85A 4TMYA 2PUBA 3C3MA 1DBPA 2L18A 3E61A 4RSMA 3GYBA 3SM9A 3QX9A 1XWWA 1FFWA 3EDCA 3TO5A 4QYMA 3RVSA 3O21A 4MQFA 4MS1B 4MRMB 3L6UA 3N0RA 4F12A 4ETIA 5IUJC 4E7OA 3K4HA 2JB9A 2HJ9A 3NHMA 5DTEA 3SNKA 3OLVA 3I42A 2QU7A 3O1HB 3H1EA 4DQDA 3EGCA 4WUTA 1QP4A 5ED4A 1JYFA 3D8UA 5CNKA 3FFTA 4PE5B 3ROFA 5JS1A 3LUCA 1R8JA 4MRMA 4MS1A 1NY5A 5TE9A 3QELB 3CNBA 5C5CA 4RY9A 1T34A 1W9HA 2X7XA 4G0OA 4YV7A 1FFSA 1DC8A 3TX6A 3HS3A 1Z17A 9ABPA 4EVQA 1TM2A 2MYTA 4MQEB 5KQMA 3TMYA 3VNAA 5EWLB 3QELA 4Q7EA 1PNTA 4N03A 5DLEA 1E2BA 3MA0A 1DRKA 1JFVA 4EYKA 2VYCA 1Z13A 2LIVA 4MR7B 1JDPA 5FWYB 3LUFA 2CD7A 3N0XA 4NQRA 5TQ2B 4W5QA 3OMXA 4F3TA 1USIA 4S05A 1PEYA 1QO0D 2ZAYA 4RZSA 5EWLA 2HPHA 1QO0A 1FSPA 2MSLA 4MR9B 7ABPA 2L2QA 2QV0A 1A04A 1DG9A 3BRQA 4MR7A 1VLZA 5TQ2A 2R47A 3BREA 1SXHA 2E4XA 4KZKA 4Z4GA 5T3YA 4RK4A 5JNVA 3KS9A 1ISRA 3EULA 4GPAA 3Q9SA 3H5TA 3IDOA 3ROTA 3EQZA 1D4ZA 4HNQA 4EY3A 1YS7A 1U04A 1LBHA 3HUUA 2IDMA 3CTPA 4PEVA 1C4WA 3GV0A 3FFXA 1Y1LA 3UK0A 2PUCA 1JWLA 4MR8B 5DCLA 5KC9A 1HEYA 2VK2A 1Z26A 1OXBB 1AB5A 1SXIA 4QPJC 2IYNA 5BRAA 3KYJB 3BBLA 5HKOA 4TLLB 4YP9A 4JA2A 4ZMSA 3GWGA 1GUBA 4OLAA 4Y9TA 4Z9BA 2NT3A 1M2FA 2XDYA 1NXSA 1RZRD 2FMIA 3S99A 1SXGA 2OQRA 2JBAB 1RZRA 1Z2EA 2N9UA 3LOPA 3URMA 2ID7A 3DGFC 4ETNA 4YLEA 3QEKA 4H3HB 1DBQA 1M5TA 4NCBA 1MB0A 1DZ3A 1P8AA 4CBVA 3OMWA 4LDAA 3N0WA 4PZ0A 1FFGA 3O2SB 4O5AA 2P4UA 3IP9A 1KGSA 2WMYA 2JBAA 3IP5A 5BQ3A 1DRJA 1Z18A 4WT7A 1DJMA 1AB6A 1P6UA 3H1GA 4KRFA 2LBPA 3HV2A 3N6VA 4WZZA 1ZITA 1KMIY 2QZJA 3R0JA 4EVRA 3A10A 5FBHA 3JS5A 2BGGA 1LJLA 1M5UA 4H60A 3O75A 3FMVA 4QICA 4RKQA 4JOQA 4NV3A 2WRZA 2AYXA 1RPJA 3EODA 3A0UA 4MLDA 3F6CA 3M9XA 4RK7A 3MIZA 2FVYA 2RDMA 3NNSA 2PJUA 1ZGGA 4XASA 3QX8A 3DZDA 4MQFB 3H5VA 3HM9A 3GT7A 3CU5A 4W5NA 1YIOA 1JX6A 1TVMA 4LE0A 5CNMA 4EYOA 3MYYA 3GA5A 1NXPA 2MYUA 4RWEA 4NICA 3G85A 4YO7A 4MS3B 4OBBA 4PYRA 2FN9A 3EAFA 5TPWA 4ETMA 1GLGA 3NHZA 4F06A 4LX8A 3LKBA 4HNSA 4PICA 1E6LA 4YGXB 4YRZA 5BR1A 3TB6A 4EUKA 3HDVA 4YS6A 1NXXA 1F51E 1CYEA 2H0AA 4MS3A 3O1IC 3HVRA 3HSYA 3ILYA 3IP7A 4G0QA 3HEBA 1ZY2A 3OLWA 4YCSA 4KV7A 2FKAA 3LKVA 5TQJA 3T6KA 3CS3A 3OQNA 2GBPA 1JHZA 4RK5A 3H75A 1Z12A 3I09A 2PUGA 1PUXA 4Z4CA 4P98A 2B1JA 5PNTA 3KHTA 4N0QA 3SAJA 2FMKA 3A0RB 4ML3A 5GOTA 2IPAB 3HZHA 1TLFA 2NUBA 4OG2A 2MSKA 3FDFA 4RS3A 2FEPA 4W5OA 2J48A 1D1PA 2CHEA 3LUAA 1D5WA 1LJUA 1YVUA 1BDIA 3OLZA 2OENG 3UUGA 5KI6A 2PAFA 2QW1A 2AYZA 3Q15C 3RVMA 5T7BA 4Z0NA 2ZWMA 4N76A 2WB4A 3QK7A 3LUDA 5JNTA 1URPA 6ABPA 2E4YA 3IPAA 1Z15A 3Q7TA 3OQMA 2DRIA 3OO1A 1RXEA 4IILA 4IRXA 1ZHHA 2FN8A 3KYIB 1JDNA 1MIHA 2RJOA 1TMYA 2Q5CA 3H5OA 4HYEA 4KNYA 3QEMA 3OQOA 1E6KA 2ID9A 4YR7A 1KRWA 4UHJA 1CHNA 1L5YA 5I4CA 2YHAA 5JS2A 1JH9A 1MB3A 2NZVG 4DADA 4MAAA 4Q6WA 3H1FA 3E3MA 3QLTA 3H6HA 2W42A 1BA2A 2FQWA 1QP7A 1YMUA 1NXVA 3TD9A 4N47A 3L49A 3F73A 5KQGA 1BDJA 4MGEA 3GRCA 4OTZA 4YWHA 3RH0A 3LTEA 2FLKA 1CEYA 4Z4HA 1VRVA 4JASB 2E4VA 1SD5A 1NXOA 3NNNA 4TLMB 2PUAA 5CNIA 1YMVA 3H5LA 4O1HA 2QR3A 3N8IA 5CHYA 3RVNA 3O2JA 3Q7SA 1A2OA 3RVRA 3OM1A 5EWMA 2FSPA 5HQJA 2PLNA 1GCAA 1QQAA 1RXIA 5HM6A 3SG0A 1M2EA 2IPNA 2PUEA 1NXTA 5ABPA 3IP6A 3RVPA 4FB4A 3W9SA 4G0ZA 1LBIA 4D6YA 2M1ZA 5IUKC 4IF4A 1P6QA 3QLVC 3LFTA 5D2CA 4DN6A 4TN5A 8ABPA 1U2PA 2O20A 1A0OA 1L5ZA 1ZH2A 2PL9A 2R48A 2PMCA 3MM4A 1JYEA 2R25B 4KK4A 3H5IA 1QP0A 2PL1A 2FEKA 2WJWA 3OLXA 1NATA 4MYRA 1GUDA 2E4UA 5BRJA 3KJXA 2A9PA 4ZPJA 4Z4IA 1EWKA 1DC7A 4H3KB 4KPYA 1RNLA 3GBVA 5KQPA 5JNRA 4JP1A 3SQNA 1ZVVA 2CWDA 1LK0A 2WWVD 3FFWA 4LE2A 1E6MA 1F4VA 2WY2D 5FBKA 3RVLA 4EYGA 4XARA 3ILHA 1NXWA 2E4WA 2KYRA 3M6MD 4P1ZA 1IIBA 3RQIA 1U0SY 1QPZA 4W5RA 5TPWB 5IC5A 1BVHA 4EVSA 5IBQA 1VPWA 3Q41A 1MVOA 3OM0A 4N0PA 1Z25A 3KCNA 1DCKA 1YK0A 3CG0A 3NBMA 3JPWA 3KTOA 2CHFA 1NTRA 1EHCA 2IKSA 2WJAA 2HQOA 1BAPA 4Z4FA 1QNLA 1EWTA 3EJWA 4RY0A 1SRRA 3HDGA 5JNWA 2JK1A 1UDRA 2HQBA 4RK1A 1KRXA 3QLVA 3C6QA 4EYQA 3HUTA 4KFCA 1TJYA 4LRQA 4XAQA 3H6GA 3CZ5A 3DBIA 5HSGA 4FE7A 1ZDMA 1Z16A 2FQYA 5IX8A 4RK6A 2I6FA 1DCFA 1QMPA 1ZH4A 4XFKA 5B3JC 1U8TA 4KMRA 3HK2A 2RJNA 4G0YA 2GWRA 3KSMA 4IGAA 3JPYA 2FMHA 3HCWA 4M88A 3I5AA 1OXKB 2MYNA 4JB2A 4HNRA 4WXMA 2A9RA 1DCMA 3Q7RA 3F6PA 3RVJA 3T8YA 2B4AA 4KQCA 1EAYA 4MLCA 4W5TA 1H9CA 3KG2A 5JNUA 1JL3A 2F8TA 3N75A 2YHBA 4JAVC 1EWVA 1Z2DA 1YTUA 2IPLA 4XLTA 1U2QA 4D74A 3CRNA 2PKXA 1ZESA 1ABEA 2JVIA 3CZCA 3MMNA 4OATA 5DGCA 4B09A 4UHKA 4O1IA 2RGYA 3C3WA 3CG4A 5GQSA 2NT4A
chains in the Genus database with same CATH superfamily
4D6XA 4LV6A 1DQPA 4EG0A 3ELDA 5FPPA 4G5SA 4IDHA 4MK4A 4P54A 1IPHA 1I2ZA 4KLCA 4ZAGA 2VJMB 5K0CA 1HE1C 2HNAA 3M34A 4LISA 1CY0A 1W6UA 1SBNE 4AG5A 3UH1A 1U2SA 2ZSEA 2QTWB 3NWEA 3IQWA 4JQSA 4K6GA 4RESA 4YWJA 5GJWC 4HVCA 2HU2A 1BYUA 4LZNA 4CR8A 1RM4A 1RXCA 1YACA 3QKSA 4E88A 4RXMA 3AY7A 4D8VA 1W88A 1LNZA 3E2PA 4LDZA 3WJ1A 3CR3C 3NYQA 3O38A 2X8JB 3O74A 4MQEA 5LBUA 4ANFA 5B1IA 4E2FA 4CXMA 4L4UA 2G0NA 1N9ZA 3H19A 2AEFA 1I14A 3IE2A 4UFNA 3ZHZA 2PT6A 1F7VA 4U3JB 2C98A 3S5JA 5DHQA 3ZWQA 1R8QA 4QGAA 1Z5UA 3LCCA 3RUAA 2X9LA 2C99A 2NXCA 3WGLA 1KVRA 3N2GA 2YWCA 4Y2GA 5G1PA 3QPBA 2JRLA 1PNQA 3M4ZA 4J90A 4DMGA 2NO1A 1P61B 2IXFA 1YBFA 4EGSA 1V16A 1NG1A 5CH5A 4CDGA 5BURA 5C7IO 1OA0A 1DAIA 2GAIA 3R0ZA 4OFBA 4PCVA 1GVHA 4DVGA 2W43A 4NU5A 5I51A 4B81A 4RXUA 2IZ0A 2K4MA 2XGSA 4EI7A 4TWRA 4N3CA 1P18A 2XNDD 3M3HA 4H7FA 5JEDA 2F1KA 2NO4A 1VI2A 1G5IA 2IUSA 1LPBB 1P4GA 1YRYE 1IG0A 1Z0UA 2AF3C 3I3SR 2GZAA 4MUKA 4LK3A 5DU2A 3JQRA 4K0KB 3H2IA 1G20A 4FHZA 3N8KA 1SHUX 1N6PA 4N5DA 4M76B 1YGYA 2I3AA 3GPCA 1ZS9A 2WHEA 1AN9A 4D0RA 1GTVA 1R9JA 3I52A 1VA4A 4RD6A 1DINA 4ZCQA 1ZRMA 3SGLA 1A71A 4D82A 5BNFA 1NUAA 1Y98A 2PZMA 2PE5A 3Q6IA 5HK9A 4NNJA 2C3UA 5EKSA 3ABSB 1OVMA 4OHKA 1W5AA 3G5LA 3OQVA 1KU0A 5IPFA 4RV5A 4HZIA 4QO8A 2NXJA 3GGCA 4LF7B 3JSXA 4C05A 2QX7A 4EITA 3SJBA 3T1HB 2DT8A 2D1FA 3LL4A 2ZJ1A 4DPLA 3IMGA 4ZO8A 4OQNA 4ONEA 4YQEA 3SYRA 4Y2RA 3RS7A 3U3DA 2Z83A 4D0LB 3S1SA 4B7AA 2PS9A 3LIPA 4YIKA 1OKKD 1TPZA 1DAEA 4AECA 1DAGA 1NT4A 2FN7A 5FNZA 2ZVJA 4W5HA 3ACCA 3HJTA 3ZQKA 2WF9A 4QEKA 2D1YA 4NBVA 1USGA 2OLJA 2IZZA 2W2QA 4L5IA 2ODTX 2QUKA 5F9MA 3NVAA 1XTIA 4A5SA 4MO2A 1YNSA 3O4IA 4U39A 1Z0FA 2VPWA 1QIIA 1TCCA 1EGAA 4BMXA 1KOGA 4EJMA 2DJ5A 4YJ2F 5H9WA 1T1SA 1R16A 1IY2A 4I5DA 2HIHA 3I2JA 4GM0A 3NT5A 3K0FA 5AJHA 2XUQA 2CKDA 3WLIA 4MW1A 4IO0A 1DJOA 2YDXA 4HDCA 4KEAA 1CC1S 4UCWA 2PHZA 4RXTA 1SBIA 4KVFA 2RKWA 4C87A 2M1XA 1UMCA 4J1SA 1P2VA 4K05A 2P67A 1ZGHA 3HXPA 2OWEA 1D0VA 4DJFC 4DZTA 1W5EA 2DHQA 4ZTUB 2VBIA 3E61A 2ZIVB 3R40A 2J3KA 3FKJA 2HCJB 2J87A 3SM9A 3UUFA 1GIAA 3BGWA 3HU5A 4H6PA 4IIUA 4XWAA 1GG8A 1TL7C 3ZCXA 1CQJB 5B3KA 1Y8ZA 1TT5B 4QYMA 1NBIA 1NQ5A 3O21A 3FWKA 5MFZA 1THGA 3FETA 4WKGA 2LCQA 1JLHA 1JWBB 4QUGA 3Q6NA 1UK9A 1Y9AA 4PAMA 2P0AA 2VHCA 4QT0A 1E3JA 2FF7A 3KSBC 1FX0A 4BJ6A 3GGGA 3B7PA 1DJQA 1AHNA 1N9KA 3PD1A 4UUNA 1OILA 1U2RA 3DB1A 4MZDA 5FLKA 3D8RA 4C29A 2ZYRA 1NASA 4BKRA 4BCBA 5A7HA 5CNKA 5AVSA 4REOA 3OZVA 5AJYA 2IEYA 1B6GA 2ZTVA 1VIVA 5L95A 2FMXA 1HLPA 4IGEA 2HHJA 4TYYA 2C4WA 4KDFA 3IQIX 2JJYA 1IHXA 1K08A 1RAAA 5EJEA 1H4QA 3EGXB 3TLEA 4G5GA 2OV2A 4IYRA 5A9SB 4BX9A 2HW8A 4MA0A 1E2LA 4Q9KA 3O3MB 5KWIA 5BOVA 1QXSA 1SGWA 1VMKA 4HS4A 3VR5A 4BGVA 3M3PA 2DSNA 2EWVA 1NZDA 4BZWA 1DC4A 1E63A 4OXNA 2B5OA 4KQFA 4PLFA 1T4BA 4JYPA 3TSZA 3WIOA 2UDPA 2O8EB 2EJVA 2L69A 4EHLA 3MAAC 3QKWA 3C7CB 2CD7A 1E18A 1M6VB 3OMXA 3ZCPA 1JLRA 2FUG6 3OQ6A 4KLZA 5AQEA 2VDOB 3W6OA 2YWXA 5ES3A 3PQ4A 2XUHA 3QPWA 2FHPA 4MR9B 4P34A 4F86A 1YV9A 2WU4A 1WMBA 3F2VA 1L4FA 4PNZA 4F4UA 4IXWA 2XE4A 4G89A 1VLZA 4CMIB 1BH6A 2IYYA 2W8BB 4YP1A 3TVTA 4YUXA 2HUNA 3JQ7A 4ITUA 2ECKA 2EDCA 4ZT6A 4RK4A 3DQQA 1NVVQ 3TMKA 1CY2A 3TYXA 3V32A 2HJGA 2WK1A 2XWJI 2PLFA 2QLLA 2VJNA 1ZJWA 4HNQA 4OOFA 1EK1A 3IOYA 3IVRA 2P2LA 4DPMA 1OAKA 1OU4A 4TZKA 2I78A 4BO8A 1TFRA 2XNJA 2GXQA 2HNKA 5C5DA 3MYRA 3WKCA 1OFUA 4KX5A 4OUKX 4S2UA 5FUQA 2NZXA 4G9EA 4RPJA 2QB5A 3O93A 4QPJC 4IVPA 1QOPB 5GY7A 3RWMB 4KRGA 1QONA 4OJYA 2VPYA 3WO1A 4LYEA 4NSNA 3YASA 4ND1A 5K3AA 4HUQB 3ZWCA 5L9AA 4BY9E 3GWGA 1N92A 3F7TA 1GGJA 1MJFA 4AKGA 1IOVA 1D0SA 3WGNA 3GAMA 1M2FA 1Z4JA 1GPJA 3MT9A 2BVNA 2HCBA 4C0HA 3G6KA 1W1UA 1IBCA 4R1OA 1Z0AA 4DDMA 2ZYGA 3FNHA 3I53A 4BB6A 3GLGA 3GQBA 3KV1A 3IHLA 2HJHA 2YDYA 1EVJA 3O8QA 3S2YA 1LLUA 1TFUA 3IVAA 2CYBA 3JWIA 1F12A 1FFGA 3ONNA 2QROA 3I6BA 3O7MA 3OZIA 5EYPA 3RFCA 4EFKA 5E6SB 1SUPA 2J9XB 2QAGA 3A2MA 4FKBA 2D2XA 4BFZA 1DJMA 3W5UA 2DVMA 3VDXA 5GMOA 1ORIA 2IZ1A 3BSFA 3W5DA 2DR2A 2W6PA 4UE2A 1TXGA 1W36B 1UKVY 5K6RA 4Q9DA 2HCFA 3FYSA 2GRUA 3EZFA 1YQWA 2HD4A 4JMLA 4L6AA 4L74A 4MKFA 1FTQA 2A35A 1D2MA 1RLOA 2DKFA 1ZXXA 2EDAA 2ODEA 1P0IA 3CLSD 4NX2A 1CY7A 4MVJF 3VPCA 5JR3A 3LQRA 5DX0A 2BMWA 2WG2A 2A58A 3HUDA 1T24A 2A1UA 2FGKA 3D3NA 3UV3A 1N2JA 4XEHA 3SX0A 3E15A 5KTKA 3FW1A 4D9JA 3D6UA 4KE8A 3L7BA 3T7DA 5JANA 4WZBE 3TK1A 2PJUA 3EGWA 4CEIA 1FQKA 5LDHA 4YRJA 3SZRA 4KYIB 2XBMA 2O1XA 2GCOB 3L1IA 2B9VA 3H9UA 2QM7A 4RWZA 3TGPA 1XF9A 5A6SB 5LZ4A 4PZEA 3ZYZA 3H5VA 4MB6A 3TTTA 4LMBA 4X8MA 1VP3A 4ZICA 2JHGA 1V7QA 1NDUA 4PX9A 1OJ7A 3A27A 2ODPA 3EXFB 4KSBA 1XTQA 1N0WA 5EUBA 5TPWA 1Q11A 2YY6A 4AVYA 3G0BA 1CZRA 2PJDA 4ZZ3A 4PICA 2AVDA 4OAQA 4RYDA 1ECFA 2V7BA 4AKHA 3AUAA 1RR6A 4P5EA 4M89A 3TLKA 2RGRA 3DDUA 1JNYA 3FY4A 3I6MA 4MLZA 3ZVRA 4NHEA 4CTJA 3CMMA 4MS3A 2WTEA 4EI8A 4E1BA 1NXQA 1T6XA 1H6BA 1QVRA 3IP7A 1W52X 4G0QA 3RSHA 2W2KA 3BWBA 1D2CA 2WUEA 4RABA 2E21A 1K7EB 1Z06A 5LC1A 3KKLA 4BKOA 1U0GA 1NLMA 4CF3A 4EAQA 1VPEA 3TECE 1I2AA 2W2VA 2ZJ3A 3U3MA 2QQFA 2QG9A 3I6YA 3ZDDA 5K3CA 1ULUA 1EFTA 5K51A 1RQ2A 2UVDA 5LDGA 4PHCA 3FUWA 4Q3EA 4MWEA 4QIHA 5EY5B 2IUTA 3AF5A 3OIGA 3HYNA 2ZSAA 3WL6A 1G41A 3VH3A 1GITA 1NLZA 1EINA 2MSDB 3CWZA 5EGNA 1LKZA 1LDEA 3SEZA 4MRPA 1L4KA 3QTBA 1K7FB 2OHOA 1AXRA 3BXEA 3RT9A 5GWXA 3TE7A 3UENA 5HTOA 2OMKA 3PDWA 1M1YB 3QY9A 3E3NA 2RHHA 1CQPA 4C3VA 4LYHA 3TLJA 1S2LA 2Y0CA 2G6TA 4GZ5A 3UAZA 3A32A 3AINA 5CDHA 4POAA 4RF4A 2WB4A 4HSEA 1FDTA 1U3FA 1YKFA 3DZKA 4OK6A 4Y6QA 1USWA 3EXHA 3HDYA 4MV9A 3LLMA 2R8XA 1J5PA 3IDAA 3S8EA 2JFOA 5BSFA 5ESWA 5IKMA 3Q8WA 1EXMA 4XWWA 1A76A 4IJWA 4B31A 4NMWA 2RB4A 4NOLA 1PWXA 2VHZA 5JBNA 3Q85A 3H8SA 3QW2A 5ICMA 2Q5CA 3B78A 1M2KA 1X39A 2W71A 3AHHA 1FRNA 2V4UA 4JJZA 2VJMA 4M8IA 5IJ0B 1ZM4A 1JHRA 1MMFB 3SR3A 4MDFA 2O8BB 4JY7A 1L5YA 4RHUA 1KRWA 3PC2A 5A0VA 4JSYA 2B30A 3WFIA 2WIFA 1VJDA 3E9QA 3G5MA 3AFOA 3QLTA 1L3CA 3ENVA 1FYDA 1ADFA 4PPNA 1ZQ9A 5J2TF 3PTZA 5JFTA 4RIFA 1O4WA 1Q19A 1H6CA 2IHBA 1LZKA 2AIRA 4FMDB 5ALPA 1GU1A 1YDMA 2ZI5A 4EUEA 1DARA 1S6YA 3NBZC 1V11A 4I1SA 4M54A 3QITA 4U3JA 1ZVVA 3WWDA 1J5XA 1OSNA 3BD8A 1CCWA 1YS4A 1E9SA 1PGQA 3A26A 3CLTC 1SUEA 4N3AA 3U3RA 3ZJ5A 4BNKA 3P52A 3Q5DA 2OHFA 4JHXA 2PKYX 3TIFA 1QQAA 1ZJYA 4ZCRA 3B5JA 3K9NA 4ERXA 1Z4LA 5HFAA 6YASA 2RI0A 4NH4A 3AOGA 3EXG2 2X19A 2W0MA 4PANA 1GRVA 3OEWA 3BIXA 3VR1A 4FCVA 1SKBA 1XFAA 5LFAA 1HRKA 5L4NA 2IYQA 3FVTA 3DUWA 5IUKC 4Q19A 3JXEA 2PGAA 3TW0A 3UJ8A 1YFKA 4D81A 1U2PA 5E6UB 1NQXA 1T3GA 2NXWA 5FV7A 3UMYA 2E37A 1P80A 4WLEA 4TXHA 5BPHA 1E1QD 5E3IA 4BQEA 3HJRA 5A9TA 3VOSA 1GAEO 1DSSG 1K97A 2F67A 2RH5A 3FI9A 4PQFA 1NVAA 1L5NA 2L82A 3V4VB 1B7GO 3KV3O 3QW4B 4G9BA 1UC4B 4WBNA 1L7BA 5JNRA 1X94A 3R3ZA 3SEAA 4A92A 1YZTA 2ATVA 1XAIA 3MS2A 3H2BA 1GKLA 1NRJB 4KN6A 2YZGA 1FXSA 5DI9A 1NXWA 3ZG6A 3KJHA 4UVIA 3SOZA 3RS9A 3FOZA 1IIBA 3VYUB 4ZCTA 2CDCA 3E5HA 2YINC 1I2CA 2A8YA 5IT5A 1BVHA 1E7WA 3L8FA 2I1WA 2A0XA 4CT4B 1Z7EA 4LF6B 2BI7A 2QY9A 1HFKA 1YA8A 1NW3A 2BEWB 3D2CA 1DIGA 1A8IA 1GRCA 3TCXB 4IF6A 3LYAA 1FP4B 1ADJA 4UBLA 4TRRA 4FMCB 4CHGA 2WJAA 3RSFA 2YN2A 3JR3A 1U9JA 4Q1VA 1AG9A 3LWDA 4MUGA 4YDHB 4B3DA 3I61A 1BX1A 1U9CA 1ZBQA 5EA2A 4F3RA 5FWNA 2P3QA 4OHBA 3G7NA 3FTNA 4L15A 1XTPA 4L28A 2FSVC 5LOVA 4IIXA 3BJMA 2BZGA 2QVZX 4HNAA 1FTWA 3LX6A 1VL0A 2JIZA 2AI3A 3R09A 1Y1KE 5HSGA 1A7AA 2VL7A 3JD4A 3TSOA 1JXMA 1FNCA 3L4KA 4PSDA 5C46F 1I1NA 2AI1A 1OIWA 3N39C 2AD5A 4K9KA 4BJ5A 1XTUA 3I8OA 3S2UA 2D0PB 2O9JA 2ZAMA 3HCRA 3L6EA 3CF4A 5C1PA 5LKAA 3R3HA 2MYNA 2O4UX 1K4YA 3QBEA 4IEIA 3ESDA 5AHWA 5K9ZA 3RC7A 4QTTB 1T4MA 4XB2A 3PTLA 5EJ2A 1OC2A 1H66A 1U3VA 3EY4A 2ONJA 4BO2A 1R8YA 4C88A 1SCIA 3LDHA 3IJEB 1FDUA 1GG9A 2WVHA 3VX3A 4DM3A 3OE7D 4FS3A 3K9FC 3EBPA 1ZESA 2J85A 2PEYA 2C9MA 2G63A 2J5XA 3AOEC 1PJBA 1JFFB 3P2EA 4MV5A 4QJIA 2IWRA 4Z9FA 1FXWA 3GAFA 1E1LA 2H5JA 4IEFB 4IO1A 3PT9A 2R1UA 1HKHA 4KBGA 3DOUA 4Q9JA 4QG3A 4OPMA 4HBZA 3NNDA 1A5ZA 2HSJA 3H8JA 3KHSA 2GYWA 3ODGA 5AOBA 4QVIA 1SKYE 3GFSA 3H04A 1LDGA 4YMTA 4ZMRA 5IABA 3FXAA 3L8CA 2BN4A 3MB8A 4MS4A 1SBHA 1XI2A 2VO1A 3W8EA 4EJSB 2DKNA 1WB5A 2H8GA 4Z9XA 3BN3A 1AKEA 1NV9A 1C8BA 1DPFA 3KDSE 4WXEA 4EM6A 4OQLA 3G7UA 1DKOA 3DV9A 5LBTA 2XRZA 4HGYA 2F4VB 1YAHA 4KQIA 2JGIA 4M1WA 3GNTA 1EVLA 4WHMA 4TKVA 5BSEA 3HGTA 1QSGA 1LF5A 2M98A 4XKJA 1G55A 2E2WA 5L51A 1JDBB 2DGDA 4BVKA 2PUFA 3AP1A 5IEJA 4GZ6A 3ABZA 1EKXA 2PO5A 1XZEA 3TXYA 3FF4A 2VDUE 1PLLA 2OCLA 3BJRA 4MR9A 4R1SA 2J3MA 1GYRA 2PAAA 3E27A 3EX7C 3RB8A 1IY1A 1IVYA 1SA0A 2GEFA 2W8BA 3L77A 2AZTA 5LA6A 4ZDKA 3THXA 3CH4B 2QLBA 4FCWA 3QJ5A 3AB8A 5G4KA 3SHQA 3PC3A 3SN6A 1AURA 1TU3A 2FFBA 4IHJF 4II3A 2DUJA 2ZB2A 1B16A 1ACLA 2WJJA 4EQZA 4ABTA 1WXWA 1T9KA 3RASA 3A6HA 5TQ0A 5LYJB 4OHYA 1GGVA 1YO6A 2FWPA 3AI2A 2GI4A 3I64A 3L7YA 4AY6A 1RI1A 1G38A 2ENWA 2VF8A 2WJPA 4F4IA 1G98A 2IGBA 3KYDA 4I0WB 2C9CA 3GLFA 4BZQA 2R79A 5BOSB 4HAYA 3Q7EA 5FRDA 4G26A 2BF7A 2AZXA 3ORQA 1IHDA 3WRVA 1UDAA 4NZMA 4MKZA 1OZ0A 3ROPA 1RQLA 4X7RA 5CHEA 3SXUA 4YJ2A 2YJ6A 1J2EA 2GASA 2P5SA 5J63A 2FFRA 2GX6A 4GH5A 1BDBA 3VO1A 3WYCA 1XHEA 3VVLA 3GOQA 2O0LA 5B64A 4ZAVA 3OKFA 5J2UF 2BW0A 4FE4A 1G17A 2VHXA 1TUBA 3AERB 3ZGLA 1DWPA 4UTNA 3UPTA 5JAQA 5JS8A 1U8UA 3OLQA 1VIAA 2GQ0A 4ALNA 3EJ6A 5I9BA 1U1GA 2HZBA 3KP1A 4N5MA 3PYXA 5ILGA 3WVNA 1YZYA 2QSJA 4AJNA 3CO5A 4B2IA 4DCPA 4F5EA 5IHXA 4O3FA 1U6JA 3TZCA 1BS2A 3C7TA 2QMQA 3K32A 3ROGA 3G2MA 1TGYA 2IUUA 1GU7A 1K88A 1TUEA 3P97A 4GM1A 3X1WA 2E5FA 3T1OA 4PV7A 4P7JA 3GLGE 4ZAZA 3FGZA 4NZNA 13PKA 2A9OA 1LX6A 1UM8A 3OU2A 3A3KA 3QPVA 1QX4A 6CHYA 5LQJA 3LFUA 3PEFA 4Q9HA 4RS4A 5HFNA 4J0HA 2QRLA 3P9YA 5I9TA 5A5VA 4GL2A 2IE0A 3U4DA 4P3NA 1E9EA 2PUBA 5EPEA 4X45A 1CBUA 2VJQA 3NTXA 1RRMA 3DP9A 1PR1A 4GVPA 1QHXA 1EB8A 8LDHA 3NJRA 3TRHA 1XWWA 3PKJA 4EA9A 1N5KA 2X5KO 4KHZA 3VVMA 4B3MB 3AF0A 4EIWA 2ZU6A 1RAEA 4JLAA 2ZQYA 3FR7A 1XQYA 1UDCA 2XT0A 3FZEA 3U4CA 3WGOA 2CT8A 4J94A 3IT1A 2ONCA 4LPKA 4HBGA 2E9SA 3BCSA 2LKCA 4MP3A 3H1EA 3V7NA 1OGIA 1JAZA 1EVIA 2QUHA 3EXFA 3R23A 4IIJF 2ZJ4A 3NFYA 2Y93A 4QUKA 5JS1A 1T9CA 5BV1A 5KDLA 3D0OA 1TM1E 6NULA 1JQKA 1KFKB 2GCEA 3PF8A 3ND6A 3KL4A 1F9AA 2XR1A 4EY8A 5K6AC 5L6LB 4BJHB 4FYKA 1TMOA 5TE9A 4CG0A 3KTDA 1EXNA 3BPSA 3LVBA 2QP4A 2WFMA 2C5EA 2V0CA 3WYEA 3COWA 3F7MA 5K3FA 1IB0A 3VR5D 1H8HA 1FFSA 1WXXA 4BAGA 1LV8A 1N5LA 4P36A 4ZVKA 2AN5A 3GA0A 3CF0A 3QGMA 3GX1A 1I36A 1RBYA 3I2KA 2P69A 4FEEA 1CS4C 3V1YA 3CVJA 2PGIA 2Q3FA 4BX3A 4P32A 1GPLA 1XRJA 4MRSA 3PA8A 3LZ6A 5KYVA 5B6JA 4IIDA 2NO5A 1NLFA 3P9IA 5A3QA 5CDGA 5FPHA 7ADHA 4BMOB 1VLQA 2GPAA 4RPKA 2HY7A 5A62A 1QFMA 4UTOA 4D9CA 1BHO1 4DDKA 2PS3A 1M6NA 1OTXA 1JR3A 2OSBA 5IF3A 1XRNA 2DP4E 1EWQA 5CPFA 1PEDA 2QBYA 2ZULA 4GGPA 5SICE 1UAGA 5JH7F 5JY6A 4N12A 5EKDA 1Q0QA 2W9XA 3PQ7A 3HKDA 5FIUA 1ISRA 2V3VA 3LQ2A 4XQEA 4C3OB 3W5SA 2BSQA 3KIPA 4LXYA 5ALWA 5DTIA 2D8AA 3ETDA 5FL3A 3EHEA 5ICGA 1LBHA 1U3CA 1WXQA 3GW8A 2NM0A 1AS2A 1MEEA 4LRTB 3WE7A 1SRQA 2HN9A 3F8TA 3SP1A 3FFXA 4B7CA 2OZLA 5FUWA 3SMQA 2ZJFA 1X7DA 4X1YA 5KMGA 4U7PB 5DCLA 4HD8A 3K72B 4N9WA 1Y0BA 3T7CA 1Q95A 2HF2A 1RT9A 2AD1A 3KKKA 4AX4A 1TEZA 4LJSA 3RAGA 5IANA 2L42A 1HYBA 2FJ0A 2X13A 4ZMSA 4CFZA 2GTIA 3OZFA 3Q9UA 4R9RA 5JXJA 1Q7RA 1EBBA 3QVOA 1Z5VA 1GNPA 3BMOB 3R9XB 4QPZA 2Y9PB 3JU3A 3X2EA 2EL9A 3PHJA 4IM7A 5EHQA 4EJ2A 1A4IA 4PZPA 1TYZA 4S24A 4NYJR 2YV3A 5JLAA 3I8SA 3ZBQA 3WISA 5L4LA 3OF5A 1Q0ZA 1AT1A 2IHNA 2Q1YA 5JE8A 3HCFA 5DHPA 3LYUA 4QYIB 3GRPA 1XQ6A 3BGSA 4NFYA 1YZ3A 4M60A 1M2OA 2PZLA 3GP3A 3SJ7A 3WL5A 4BKMA 3BIWA 4LDAA 5GZ3A 1QAOA 2ZIWB 1UPCA 1KVSA 2GEDA 3T0GA 4O5AA 2K2QB 2GR9A 1XV5A 2ZKLA 1ZJ5A 3T1NA 1ZGBA 3H5NA 1IN1A 1K8YB 3WAKA 3EIHA 2ZZNA 4W99A 5TVGA 1DC6A 2F3QA 3U4IA 3OF3A 3LLCA 3ZHSA 2X5NA 4CODB 1WCV1 3W7AA 1M76A 4TLBA 5DISB 1ZITA 4F96A 2F62A 3BVPA 2B0JA 5H4HA 1QFSA 4U7GA 1SR8A 2D5LA 4AP5A 5JSZA 2OQ2A 2PV7A 3DOFA 4W1SA 3JVVA 3DEHA 4K9OA 3WLMA 4BE4A 5GADl 2OCIA 1RXWA 1GKYA 2A67A 2J09A 1ZXBA 1X80B 2OTCA 4QICA 3BDAA 4HQNA 4R0MA 4AZSA 4GECA 3D81A 3ZJTA 3RBZA 1R4NA 1MKYA 1TADA 1GRQA 1PTJC 2QVYX 2XVXA 3M9XA 4YAGA 5KX5A 1NA5A 4H59A 3S2EA 4QTYA 4BXOA 4TYQA 2I7CA 2QIPA 2RHJA 4YJHA 4OYLA 5ENZA 3V1KA 4OAOA 1KO5A 2KJQA 4JWKA 2EJUA 1L7QA 1RPTA 3AUSA 2EBUA 4NVRA 4PXYA 4DUGA 2C82A 2W93A 2X1VA 3HU1A 2PRJA 2HI0A 1TVMA 3RUIA 3H2ZA 3U7IA 2NUTA 2CXNA 1DJNA 3BJEA 3F98A 3U2QA 5LNK1 4IQ4A 3RCBA 3TDNA 4TOIA 1J1ZA 2SBTA 2IOHA 3EZLA 5CFOA 5IKOA 3FAKA 1HETA 4M0LA 5HOEA 4D97A 1G1AA 4DWOA 1TA0A 2XBLA 3I76A 3L9WA 1LW6E 1E58A 4OIMA 1ZK4A 3CVUA 2CGEA 4GP7A 1P7WA 3LPDA 4OH1A 5BN4A 1EP1B 2CMDA 1P0CA 3F49S 3ZC3A 4JJ6A 3HSYA 4NATA 3CRW1 1K6JA 3ICWA 4KGZA 1I4TD 1EHYA 2BIFA 4M36A 2ZQ5A 2VTBA 3OQNA 4N3GA 5B7GA 2EFGA 1A2KC 4E30A 1U8XX 1PRYA 4TZ6A 4ZD6A 2ZGVA 3TTSA 1JYSA 4MAMA 4FGZA 3L7IA 2OZPA 2CB9A 3ZQ4A 4KO3S 1Y8QB 3DDSA 1TAUA 1UOOA 1S2MA 1MVLA 1TLFA 1YZNA 3D4PA 5IXYA 2C0PA 2FQ1A 4Q4HB 4RCVA 5FOQA 3GPLA 4CGZA 4XPZA 2DQYA 2W5UA 5ALFA 3RDPA 1P77A 3SKVA 4J07A 4B76A 2VP6A 2ZBRA 5K0GA 2XQVA 4YMGA 1LJUA 2HGSA 2I1VB 2PKCA 2XRFA 1K6XA 3OLZA 3QEJA 4HAXA 1YDEA 1FUYB 2EQAA 1N78A 4M0DA 1I7LA 4WCVA 3F9IA 4RM3A 3P1JA 4XI9A 1HKUA 4Q9LA 4UHDA 3T3IA 4MMXB 2ZWMA 1RLIA 1NUUA 2H00A 2W6OA 3ETLA 3AHGA 2R6JA 3DCJA 3L0OA 4INPA 5T5QA 3ZYCA 3FWPA 5J2TA 3WWEA 3DJFA 3UXHA 2DFVA 2NSDA 2ZSIA 2MJLA 5LMUB 1JFFA 4A36A 3OCZA 1PJCA 1QM5A 1PLKA 2E7ZA 1O4VA 4MTLA 3AL0C 1AK9A 1TU0A 3TH5A 2VUSA 1SMKA 2CBZA 4G37A 3UGTA 3E3LA 3IAAA 1Y6RA 1XVIA 2O7SA 2VDNB 2VNSA 2EG5A 5HIJA 4BTVA 1X9HA 1XJCA 2XGMA 3PQ8A 1UBGA 3P26A 4PSVA 1KE2A 3QP9A 3WDMA 4KB5A 1QHSA 1QOQB 5JC1A 3ESYA 3ZE9A 3UT5B 4EJSA 1KFCB 3PX3A 1O03A 3LRTA 5IZCA 4U02A 5LPNA 1AHPA 4OTZA 1P29A 2FLKA 4JWTA 1HDXA 1XAHA 3FCUB 3ENQA 2ZSHA 2I2AA 2UXCB 3QXHA 5P8WA 5IVDA 1BEUB 1JIKA 5B2ZA 1GADO 1X15A 1CUWA 3CEJA 4CKBA 1DKRA 3NHFA 4RIEA 2GYUA 2IF2A 2B98A 2H8KA 4PGHA 3SG0A 1XVAA 1QTRA 3V2HA 3QE0A 5ABPA 1MUUA 3PDJA 1K3FA 1Y7TA 1T8YA 4WLVA 3H2KA 1IUKA 1QBGA 2C4HA 2B4RO 2NN3C 2YICA 4YLGA 3P0RA 4PFQA 2P6NA 1A95A 3TEFA 4DCJA 3PVSA 8ABPA 1A0OA 1ZH2A 4JP8A 4XLZA 1SVNA 4RPCA 3WFZA 2XVZA 1DO8A 2XGGA 3MD9A 3NX4A 3Q3HA 3IAS1 1NYTA 4XOIA 4YPOA 2J5RA 3H4MA 1OLXA 4KJZA 5K0LA 3WLPA 5F3RA 4JT4A 2A4KA 3K0EA 4WQMA 2HM7A 2ZVQX 4YJFA 4B32A 3GVCA 1OXUA 1QPGA 1Y33E 1LVHA 1UM9B 3L6BA 3L0YA 4H7HA 4XDHA 2YC2C 3B1VA 4J0GA 4JP1A 4PBTA 1OOEA 5E0OA 4AY3A 1DQSA 1H2YA 3PC7A 4DYDA 3MXTA 4D3DA 1XNJA 4LE2A 1JU9A 5JAMA 1FNDA 4AS2A 2F9MA 2Q0SA 3WRWA 2KYRA 4LWQA 3QU9A 1U90A 2DLNA 3QQPA 2WHYA 2CVFA 4ITRC 3JALB 1AQYA 4BMVA 2VCYA 5K8JB 4EVSA 1OVGA 2EFCB 2PZ8A 3Q41A 3MUFA 4Y8VA 4G0UA 4M9SA 4I3FA 1RZRA 2XAAA 5K5EA 4WTOA 3T3GA 1R8SA 5BT9A 4TSRA 4BX0A 1LJ8A 4WJLA 4ZEOA 2C58A 4GICA 2ZRNA 4KWEA 1WW2A 4MWBA 5BXQC 3H4IA 1I4WA 1MT0A 1W0KA 4DIKA 5K8UA 5GONB 2CVPA 1CV2A 2GJKA 2DFDA 3L1KA 4FFSA 3NOXA 2DBYA 4QAQA 5HCUA 3ZLBA 1E2UA 1QJ4A 2G72A 1JIXA 2GNAA 4GLJA 5G41A 3UMBA 4F1WA 1H2EA 3W04A 1YRQA 2JIZD 4ESOA 2H3EA 1OIVA 3A8TA 1E5LA 2WYOA 3EGDB 4ZYUA 4OFZA 1SZDA 1T8PA 4YFVA 2AX4A 1KXZA 2ZUDA 3K35A 4PZLA 3SQOA 4RTJA 3EQ6A 4LYFA 3LBIA 1NR5A 3RK0A 3ANLA 1Q21A 1ORRA 1N9GB 4ZT4A 4RADA 2V5AA 1UIMA 3FJOA 4XZ3A 1M1NB 1RQ7A 4BPRA 3M5PA 1V95A 2FQQA 3PSAA 1EUYA 4LQCA 1ZMTA 4HEJA 1NURA 4YMUA 2BLLA 5L3QA 4BFYA 3HI4A 2FZGA 2GFQA 3MJRA 4QAJA 2IS4A 3CUYA 5J47A 4GOMD 4YH1A 3L8EA 4MH0R 2REQB 4TQAA 1H0SA 2WSYB 3QVWA 2VS1A 4H3VA 2GEVA 3WJ7A 1DLIA 1VXOA 4XDZA 1XZNA 4CKWB 1OF1A 5IAEA 1NVGA 2BR4A 3D1JA 1LVGA 1NRIA 3IQZA 2RC6A 2WIKA 4TMZA 3TDMA 3VV2A 3W1VA 4IDNA 1S9DA 2FUNB 2IPMA 3A1NA 3M9WA 4QXMA 3A4TA 4RYLA 3JZMA 3SZMA 4CKZA 1GFSA 1X7ZA 4DUZB 4C7KA 4B7ZA 3W2GA 5FPKA 2LE0A 2OYSA 3NBKA 3HU3A 5J4VA 2GNOA 2PSDA 3BILA 3AF3A 3UJCA 1RM5A 1M8KA 2G0TA 4GSLA 4I55B 2FW1A 2Z3ZA 2QVGA 1Z2OX 3WB0A 4B74A 1XDGA 3OPXA 3HKCB 3QIVA 1ABFA 5CLJA 2C2OA 1BE6A 4PGGA 5ALQA 2AXNA 2WG1A 3HNOA 5KSWB 3I8XA 4GWGA 2WZDA 4ER3A 1C4KA 3JQGA 1BD3A 1AM4D 1ZUWA 1S9HA 4XUGB 4XUCA 1AJEA 5BWMA 2IU4A 4OHRA 4X20A 2QTNA 2PQ2A 5FLYA 5TARA 4Z2YA 1LWNA 2A5DA 2MSWA 1LDYA 2GKGA 2QY6A 3IHTA 5CGZA 1Y5RA 3IX7A 4MULA 4A2CA 4BNHA 5GGYA 3ZHVA 4U6QA 3KXLA 4C30A 4LCBA 4OSEA 5KJ6A 5LD2B 4K1XA 5TEVA 5D5QA 4Q6BA 3S40A 4D7AA 2E4ZA 4OQPA 5ANRB 5KSOA 1R0KA 4YRPA 4GI1A 1YZLA 4LN1A 4AYXA 1AMNA 1SZCA 3LUHA 4GYWA 1SHJA 3D0RA 4HWKA 4IG4A 5FPTA 3VHRA 4AZ3B 3OJLA 4S04A 1DWQA 1ZYUA 4ZQGA 3SSOA 1SXJA 3VI3B 1M2VA 1UF9A 4RMNA 1RP1A 4RZ2A 4DIBA 2Y8EA 4AMBA 1BWPA 3UAVA 5ERXA 2RARA 1DWUA 5LU9A 3AF1A 4X7MA 4TXNA 4RTRA 2PRSA 1OZAA 1F6BA 1USKA 1YU6A 3NI2A 4U7FA 4XXHA 5REQA 3BXFA 1WUHS 3O8RA 4UOEA 1JR3E 1R4MB 4Z9YA 1R0XA 4KV9A 2IXAA 3CB4A 4QBFA 4U9UA 1AUVA 3GHHA 4G86A 3VJKA 1IK4A 1ETHA 2CBXA 2LGJA 3OZUA 2CB0A 4CJXA 4MW9A 4OKIA 2FDCA 4O2AA 5DXAA 1GKKA 3JX9A 3BB1A 1PUIA 5FWAA 3CNLA 4EHJA 3GG9A 1ODCA 3R9XA 4NCAA 3BAFA 3NYRA 2JVKA 1W7AA 2VWHA 3UGKA 1WMFA 1IK6A 2YXEA 4LC0A 4RPIA 1VLVA 1I5EA 4MGKR 5B36A 1JHOA 3K73O 2BJVA 1Z88A 4HR7A 3ZX5A 1XZCA 2RAUA 3EGIA 3ZNOA 4U4AA 3BMNB 3OZ7A 4C4SA 1XE3A 4A15A 3KQPA 3G23A 3GXBA 2PH5A 4XQGA 3RSZA 2EEPA 4CMEA 2GT1A 5EC8A 1L9XA 4KITB 1W36D 3EQ2A 3MILA 4KQEA 5HHTA 3KBOA 4M86A 2Q1UA 2AKEA 2Q6IA 3SLKA 1G5PA 4OA5A 3EDOA 4K6CA 4QDXA 4MQ5A 4DLAA 621PA 5KQSA 1V1MB 5FXMA 4BMDA 2QUJA 3KT6A 3Q3VA 3VSAA 4ZRNA 3Q11A 1TI7A 4GSKA 2HR1A 5JSYA 4NNOA 1A5BB 1J56A 3EOAI 3PHCA 5DHAA 3HZRA 1G0NA 3HLKA 1PL0A 3IVGA 4P3PA 1WTAA 4E2XA 4GOND 3V8MA 3UH0A 4N5IX 4C76A 5JW6A 1T0BA 3EEOA 3PJRA 1MZPA 2HK7A 4Y6OA 3RPEA 2DPLA 3EDCA 5BV8A 3ZIAA 2QXTA 1YD7A 3A1TA 4XCQA 5L3SB 2WG0A 1TF5A 4FYJA 2DXIA 1CR0A 3CUWA 3THOA 2CXRA 4FUTA 4HLQB 4F12A 3DDOA 4B87A 2I54A 4OCZA 4DMKA 1KEUA 1R00A 2O2HA 3I9MA 3QFTA 5AK3A 4DLNA 1X1EA 2QSUA 5C5IA 1QP4A 1RYZA 1Z5GA 1REQB 4G2TA 5AHRA 1YL7A 4LQ4A 3A1FA 1T3SA 4OY3A 4QPPA 5IG2A 2QJTA 3NTUA 5CVJA 3NLLA 3MRVA 2RI6A 2AR9A 1VJTA 2C7VA 3R3WA 4V24A 4DM7A 2XIQA 3UJ7A 1KEEB 4H4DA 3BMQB 3CNBA 1UT6A 2JLXA 3L4JA 2ZR7A 5AVKA 4BCCA 1MR3F 3EA5A 2WWXA 1KQGA 2INGX 2O52A 3JASA 3O8BA 1H8HD 4ZAYA 1JZQA 3LHDA 3D9QX 4JC8A 4P82A 5A2GA 4R2WA 1UBJS 3MCAA 4I2VA 3FROA 4UZEA 2H2DA 4JBYA 4AUEA 5I7HA 4DSAA 5IZCC 1L7VC 1BROA 2XECA 1IWBB 2PSSA 3KELA 3N2KB 2I2CA 4I8DA 5T6MA 1ZD4A 3TZKA 1DRKA 4LMAA 1U0NA 4NFLA 5ARCA 4MNTA 5MF6A 2X9NA 5HF5A 1AK1A 1KOJA 1JG1A 2G25A 3KQHA 2ZZMA 3UV6A 5D3KA 1OWOA 1USIA 2ZI6A 3SKYA 1SQFA 1Y8QA 2R65A 4LJ7A 3V3KA 5FI1B 4LVUA 1J07A 1N4DA 1UPFA 3NP9A 4MJLA 4QGSA 3ADBA 5DWDA 3SYLA 5EIBC 4KFTA 2PZKA 1SNYA 3ZWPA 2XEDA 1SXHA 3AWIA 1SHKA 1YR6A 2H1CA 5HTKA 3SFTA 3JZDA 4BV3A 2V6GA 4I4TA 4GPAA 2VCEA 3DCYA 4QWWA 5A4JA 4MLPA 3D7KA 4L2IB 4OJMX 2XX3A 1L7OA 2FPPA 1RCUA 5GJCA 3T5PA 4DMMA 5JHGB 1YKGA 3R77A 2VPZA 1J39A 3AVQA 3LGSA 5AI4A 4C20A 6Q21A 3JQ9C 4E31A 1I3LA 1CR4A 4E0BA 1PZFA 2ZIEA 3WRYA 1FFAA 1H0HA 4L8WB 5EXSA 4URVR 3R7NA 4K7JA 3NBFA 5JBIA 2CLFB 2PRIA 1YSCA 1QZUA 4I50F 5DOVA 3RUPA 2O19A 4C43A 1SC4A 5TT0A 1HZZC 4UATA 5CFQA 3VC3A 1YTLA 3VU8A 1ZN7A 2YJZA 3HY4A 3W3AA 4MDEA 1CF4A 4FN4A 4HFJA 4RDHA 3UUWA 4JB8A 2VDVE 2IU0A 3N3BC 2IX3A 2Y1WA 4IQ0A 3SQMA 3OE1A 4JROA 3P5BA 1O5IA 4HQOA 1D2NA 2CJWB 1I2MA 4G1MB 2RGCA 3BTSA 5HF9A 3S44A 4E2ZA 4EUSA 1HR0B 1QVVA 1H2RS 3KC2A 4MMYB 2GETA 2H0QA 4KXLA 2P4UA 2IKQA 2JGFA 1JBKA 3QTTA 4D4MA 5AM4A 1DXHA 1F8XA 3PUWA 4UVGA 4KPEC 4R3WA 4QUHA 4KRFA 2PH3A 2WUVA 1UFKA 5GIOE 2KSQA 4Y6RA 4D42A 3HV2A 3R7FA 4FFWA 4NZOA 1RACA 3NBYC 3PWSA 3U7QB 1V6SA 3K6KA 4PNEA 4JOSA 1IULA 4Q93A 1VECA 2GO7A 3V9PA 4I08A 1SOMA 5JAUA 1ZIOA 2J9RA 1W8DA 4B35A 5LB4A 1ZU4A 3U60B 1K5HA 3KAJA 5KYXA 4BN0A 1BCRB 1XOIA 4H1VA 5ALMA 3WP1B 3BKWA 4JOQA 1I1OA 1EVYA 4HOYA 4R01A 5CBPB 2BFPA 5LQNA 1YE3A 3EAGA 2O07A 1LH0A 4Y1EA 3JAKB 1TMKA 3NGLA 2FCRA 1DIAA 4UUOA 3KKZA 3MIZA 5JD4A 4LDJA 2P2SA 1KJZA 4WRRA 4JKIA 4MUMA 2GAJA 4Q7LA 3MG9A 5G0WA 5I7AA 1H9AA 4MICA 2PZFA 4FDMA 4BB9A 5CFPA 4DUGD 3AEZA 2FNAA 3A9WA 3DZDA 1ZA2A 1HLGA 2NXEA 5EI5A 2IH5A 3EF1A 1EZZA 4AJ4A 1Z34A 2PSFA 1YIOA 2NVWA 3TBHA 3HHPA 4RWEA 5F7ZA 5KKNB 1KAHA 1IEWA 1B26A 3AHDA 1U99A 2WD9A 4UU1A 5FFMA 3TIVA 3CKYA 3TLYA 4EPRA 2ZUWA 4LX8A 2JFWA 2I66A 1VBNA 2JNWA 4B85A 1VLJA 1PG2A 2XV1A 3M82A 4A8JA 4URZR 4DV5B 1UPUA 2X8AA 3ISVA 1NXXA 1QLJA 1T1GA 3KB6A 5FBVB 4JQYA 3LY9A 2OO5A 1QX3A 1JEQB 2OV4A 3F3SA 4PINA 3ILYA 2BGLA 3ZPXA 2YV1A 1T0PA 2EZUA 2WU1A 5KVQA 4CM4B 5F76A 3LKVA 1D6SA 4OGFA 3FUVA 1GSAA 4IINA 3ZHCA 4B6EA 5FWDA 1GPBA 1VMIA 1Z12A 1HY3A 4OJKA 3I09A 4RK5A 4X1KB 3TXXA 1Z7WA 4F9FA 2CN1A 1RAFA 1XEWX 1ECCA 3EGDA 3K0AB 2IEBA 3H7AA 3MGCA 3U1VA 1UDXA 4RVFA 4DRXA 1KFBB 1N36B 2YFKA 3IRVA 3UHOA 2O8FB 3HB9A 1KMNA 2IX9A 4LYYA 3C3AA 4YK7A 3ROQA 1TJ3A 4HY3A 4RS3A 1N9GA 3TKLA 4KVAA 4EHIA 2IF0A 2AT1A 2BFDB 4NMMA 4EQ6B 1DV2A 3L7NA 1E9BA 1D5WA 2ZWOA 4RGVA 4AJHA 1GA1A 1OI3A 4DW8A 3SC2A 3TW4A 3T7SA 1Q7TA 4AXBA 1AKWA 1G7TA 4FFMA 1IEXA 2HB6A 3MN1A 4BFSA 1JG6A 1YRHA 5LP6B 5DGDA 1CDEA 1DI0A 2REQA 3DC7A 5JJLA 3EFOB 4LOJA 3IOBA 3IPAA 3OQMA 1YDGA 4CKWA 1OT3A 5BWBA 1LSOA 1HE4A 1NW9B 2EZ8A 3KYIB 4YN3A 2CMFA 1IMOA 3OH8A 1CZUA 4HLNA 4UD2A 4PCUA 3GQVA 1KI7A 3K0CA 5HQ3A 2G77B 2Q3CA 2FE1A 1NJGA 5I5GA 3H0CA 1YA6A 4FGUA 1N77A 3C1OA 5ER9A 1MH9A 1XIVA 4V3BA 4IJ6A 1N0IA 2P6OA 4B4OA 4LFCB 4B7UA 1ONBA 4I55A 3PF9A 3CLUC 2OFFA 1JJIA 1LU9A 1Q7BA 4Q6WA 2NVUB 2W42A 5HS6A 3UJ9A 4J1QA 2FR8C 3EPRA 1B2LA 2VP0A 4IVQA 2ZRFA 5C0OE 1MORA 2OCGA 2JZNA 1ZVMA 2HA2A 4JBLA 4DSZA 3FTEA 1EDZA 3HPQA 1M66A 3G0CA 1SK9A 1N2ZA 1NVWQ 5C32A 1O54A 1SUAA 3VHXA 2R6GA 1IU9A 3CEAA 2C2KA 1NXOA 3FPSA 3KL2A 4JOCA 2YRFA 1YMVA 2XF2A 4O1HA 3W78A 3FYUC 1PFKA 3WG9A 1YFJA 5B6PA 5A0TA 2FUCA 5HCNA 1F06A 4OHPA 2A6PA 4CMEC 2VSQA 2O8CA 5LBIA 2QP3A 4IDDA 4C0WA 1XZQA 1OQAA 1NDQA 1CQZA 4HQ0A 2WT8A 3SEQA 2FSFA 1ISJA 2ZJ6A 4MV4A 5CDYA 4AZ3A 3V33A 3RSLA 4B9AA 4KGXA 4EWLA 1VFNA 4W9NC 5AW7A 5MN6A 1L7DA 3MWDA 2F90A 4HAWA 2B35A 1OFVA 5ILQA 1E3LA 1KL7A 2GSWA 3OCYA 4PN7A 4CKEB 4L4ZA 3J81A 1Y5NA 1YZKA 3OLXA 5AKLA 1SXQA 5B3LA 2BHNA 2B6HA 4C22A 1EK6A 1XXHA 3KJXA 2HPVA 2EVWX 4LV8B 4ZPJA 1VLHA 1D4FA 1EWKA 2XUIA 4KPYA 2IQ5A 3GJ4A 4XM0A 1DIRA 1K27A 2BUCA 3FB1A 3SDBA 3U7HB 1E1CB 2QN2A 1F4VA 2CXHA 3PFGA 3TR6A 3L0SA 3I92A 2N1MA 3ZUPA 3N7UA 2F3RA 1T36A 3VR0A 2W00A 4HDNB 3DKVA 3E2IA 1NOKA 3HMKA 3CE6A 3ZHOA 1R3UA 3CUKA 3JWHA 1P0PA 4K86A 4AP6A 2DHCA 1II9A 1VHDA 4HF7A 4AJLA 4CKBB 1GGKA 2IITA 1PX0A 2M9MA 3I01A 1Z6QA 4FTWA 2HA3A 1MJ5A 2VHQA 1T5TA 2HFJA 3K2EA 4MYSA 1TC1A 4G36A 3KR0A 4NIMA 1BCSB 1H9BA 3H1TA 4ND5A 1L7PA 3A9CA 2AFRA 1E2GA 1NAHA 3IEIA 1J0AA 2ZAIA 4NV0A 5HKBA 2G1PA 4L4RA 4TT8A 2B4TO 2RK6A 4XAQA 5EQJB 3SE7A 3VU1A 1NW6A 3EN0A 4HFRA 1NC3A 1V1MA 2GVNA 2WU0A 1FTYA 4C3ZA 2PZBA 3PR2B 5CIWA 1ZH4A 3JD1A 4LY3A 3A3YA 4PAOA 1RQPA 1U8FO 1PT5A 4LNAA 4CQLA 1DAOA 3ONVA 1MAWA 1PVVA 2HSWA 4CLOA 1ODJA 4IIBA 2G4CA 3AZPA 5G0TA 2VF2A 3JWEA 4WACA 5A4KA 1Z73A 3DZBA 3ZY4A 4HFNA 2GBIA 4CMKA 2QE6A 5ECWA 5AVZA 2CNKA 4DAEA 2EJWA 5HXAA 4DV6B 2H1IA 2EGHA 4Y3UA 5KHOC 1XQWA 2IC5A 4MVJG 1N8KA 4A2QA 7YASA 3C0KA 2B1QA 2WTXA 2Z6AA 3BULA 3R7WA 3H8VA 4EA8A 2G08A 4NOKA 2IYEA 5JZOA 3OE5A 4B09A 5LQMA 1L9KA 1M2HA 4IVNA 1YR3A 4LV5B 3IC5A 2UZ4A 5GQSA 2LTAA 1C5KA 1GR1A 1J0XO 3HNRA 4C7XA 3EXAA 4R8RA 5E7IA 3C6BA 2DU8A 2EU8A 3C7DB 3HPRA 4R2XA 3U48A 4BFTA 4D9GA 1FQWA 1HG0A 2G1AA 4DCUA 4BUZA 3FFBA 3BMQA 2ZIFA 3JARA 3WR5A 4MPRA 2A2ZA 1MIOA 2A0UA 3RABA 1YK1A 4QFCA 5B3JA 2HU8A 4ZYLA 1FXUA 3O4GA 3KNZA 4AG3A 3BWCA 3NIBA 3I32A 4L02A 5GVSA 4BNLA 1XCMA 3J81k 1E6EA 2H31A 3O03A 5AT1A 2FZCA 1IXKA 1L4LA 2BFEB 3RROA 2W83A 4PO8A 4TYMA 5ICCA 1QKJA 4WEQA 5L3RA 4YJKA 4F8YA 3H9EO 2ZUTA 3GN1A 4FC7A 1ISFA 4C4PA 4C0XA 1PL8A 4G3XA 3HCBA 1Q20A 5DXFA 2W70A 5CB8A 1P4RA 4JB0A 5A9RA 3AEKA 1E3WA 1HORA 1DDOA 2QUZA 1XZLA 5JZVA 2B1IA 3TUZC 7REQB 3KYCA 2AL7A 5COAA 2BD0A 2V7QA 5KYUB 1VP9A 2SKDA 2VLBA 1MC5A 5KJFA 3W90A 1ESNA 2AOUB 4QE3A 1SXJD 2G0AA 2XRYA 3CNNA 4MUNA 3DPUA 5CUQA 1YVEI 3UIEA 4J16C 5AM2A 5CXXA 2B8NA 5EHNA 4A6XA 1NIPA 1MW8X 1TF2A 1ZNXA 2EL7A 5HWSA 5IASA 3IA2A 4KR0A 1UZMA 2RH8A 4LY0A 4C7MA 3AW9A 2J6BA 3PNLA 1EM8B 3SS8A 3SLGA 4BMCA 5KYGA 3HMQA 1PSWA 1L8XA 2BKAA 3NGXA 5JZBA 3WIUA 1ZL2A 2QTAA 1X1DA 2OG1A 1VKRA 1BX3A 3EMVA 3QYJA 3R41A 4D57A 2R6FA 4TGLA 3WWZA 1NC1A 1H6AA 3DTVA 3ECSA 1U8CB 2NLOA 3C39A 5AI0A 2W6ZA 4JKYA 3QX3A 3BK2A 2P2CA 5KC8A 3AY3A 1YE8A 1ATIA 3QMWA 5TXGA 1EFLA 1VG8A 3SZLA 4OX9B 4HAUA 4UEQA 2YIVX 3GJ0A 5E2IA 4ZJPA 5B4UA 1XMQB 1AVTA 1ZGZA 2GM3A 3WJ2A 4EABA 1G8GA 5K4HA 2IP4A 3GWZA 1K66A 1CHDA 2JEOA 2XUAA 4TUYF 4JBXA 5HGXA 2AMVA 1ORWA 5CTJA 4BO0A 2QTGA 4YNBA 1IN4A 1QO9A 2CJWA 3BRSA 3JYHA 4LHXA 3DMFA 2I29A 1U0LA 1J97A 3RYIB 2A3RA 1UBUS 2VNKA 1YNOA 5DBFA 1T2EA 4WERA 4N5LA 2ZXEA 4Y6SA 4PPGA 1HT2E 4TLCA 4B3TB 3CH5A 1MG0A 5BW8A 3NWBA 1S8AA 4DL9A 2BFNA 4B44A 3TLMA 3CLKA 1HT0A 1USVA 2RSLA 3KB2A 5JUWA 2ZB8A 3UKJA 4E4TA 2VPXA 3W1WA 1YASA 1QUFA 4UMVA 2Z4RA 3CYFA 5EP2A 3O82A 3CQ9A 4L08A 4Q37A 4JEHA 5I6DA 4QGHA 1KVTA 3IULA 5G02A 2NV2B 2GKOA 2XCLA 2V7PA 5IFLA 1WHTB 2H5IA 3M0EA 1BDHA 5C8YA 1H94A 4ZHSA 2AMFA 4FCCA 5FUBA 2IELA 2QTCA 1FMTA 4I1IA 1V2GA 2VDWB 4MYTA 2W6MA 4UASA 4Z7JA 1FNSA 1NN5A 1AHIA 1VGQA 2L18A 3DHEA 4PTYA 1KY2A 4OHZA 4B33A 1Q12A 3HCCA 3SBOA 1M10A 3A4MA 1QF7A 1BEZA 1XEFA 2AC4A 3ZIAD 5ALOA 2Z1MA 3I4CA 4D3XA 2H7VA 2XKJE 1AOXA 4QPDA 3SQDA 1SO8A 4J1TC 2G71A 3C5WP 1Z0ZA 3UB4A 3T3PB 2IY9A 4MS1B 5J5AA 4C5AA 4D4IA 3QYPA 3RREA 2G88A 4M0KA 2XXAA 2C78A 1CT9A 3W8RA 3HEMA 1NIJA 4EKDA 3DE0X 6AT1A 3CW2A 4FMCF 5A3RA 4ZO7A 1LI5A 3DEIA 4MUEA 1AK2A 1OBVA 2C7QA 1NQTA 3AT1A 3OZSA 4HEA1 2V9ZA 1EFPB 2PUHA 2Q49A 5A3SA 1RJFA 5IKPA 3MQFA 4JUCA 4MWCA 3Q0TA 2J0VA 4AIIA 3ADCA 3RIMA 1Q44A 2OCXA 3GFOA 4I8IA 3N2YA 1U8EA 4CEJB 1N5IA 1TCVA 3B3JA 3KHUA 2W98A 4U2KA 3AVXA 1R7RA 1CR2A 2HNBA 1MHPA 2Q5EA 3CKKA 3TX6A 2JKVA 5H80A 5A05A 1ZKDA 1HYQA 4FX5A 4D9MA 1Y3CE 1ZJ4A 1PNTA 3C8UA 4N03A 2WPNA 2Q7OE 3V7UA 2PY6A 1Q50A 2YVLA 3ADOA 5THKA 3SZOA 1J09A 4ZQCB 3WBJA 1ZD1A 2HF7A 3WNQA 4DXAA 1H1LA 3GLSA 4UTXA 1KDVA 3VZSA 5IM4F 4CCYB 2XCUA 2PZAA 3OQPA 5EUCA 1AV7A 3EC1A 5E1DA 4Q18A 2R1VB 2ZAYA 5EWLA 2FP3A 2QL6A 4QOGA 5A02A 3QMVA 1QO0A 1XL0A 2I99A 3FCXA 3GLRA 3FNGA 1EFDN 2Y0PA 4MWSA 1EIZA 1J25A 2ZROA 3OWOA 3BRQA 4CGYA 1JQEA 1NSYA 4ZCPA 4MW7A 3NONA 4DQLA 4TMTA 3KUXA 5KO2A 3BXPA 2O7RA 1YH3A 1ZUD1 7GPBA 1T6YA 3MLEA 3BE5A 3DQZA 3WKEA 1GWNA 1YS7A 4TQ9A 4WBSA 3W1EA 2Z43A 1R6DA 2XE6A 1EFUA 2ZT6A 5ICFA 2I3GA 3GV0A 2BMEA 2VOEA 1WBJB 4MA5A 1G5FA 2DWCA 4DB2A 4YRAA 3DAYA 2O2ZA 2HMSA 3RUHA 1VCIA 2GM9A 2ZQZA 3K1AA 4HDSA 4JYMA 1OXBB 1FUUA 4DR6B 2ZRCA 2NPOA 1G64A 4HJRA 3LBNA 4M8LA 3AEYA 5AICA 2ISSD 1V37A 3BF7A 2P90A 4IOKA 1Z6TA 4J9VA 1SOUA 1XD9A 5DF1A 4DIMA 2G8NA 4WAUA 4PO9A 3W3AD 4JUIA 4QTXA 3LW7A 3S7ZA 3B6MA 2VAXA 1B0UA 4NYJQ 5AQ1A 2PL5A 2EW1A 3NH9A 4BMPB 3I73A 5H3CA 3URMA 4D96A 3U4QA 2I1LA 3HDQA 2XITA 1ESZA 1PYOA 3TFWA 2Z1NA 4AULA 3AMVA 1DBQA 2HCTA 3EY9A 1X7HA 1LBQA 3IELA 3K8YA 1ECGA 4XVCA 2DR3A 3KOWA 4KQMA 3IP9A 2Q5HA 1KGSA 2AF4C 3V8RA 1WEKA 2JIRA 3EPKA 2DLCX 1BIFA 5FLEX 1Z18A 1WF6A 4TQUS 4U8HA 1AB6A 4U9IS 4N7JA 1EGHA 2PCJA 5CCBA 4DQKA 4Y1FA 1C9EA 4CMHA 4LECA 4UHEA 2C9ZA 2VZLA 5IBRA 3VZPA 4MCJA 1XNHA 4BFVA 1CTQA 2ZUBA 3IBSA 2ZDGA 4LOIA 1N6HA 2K5UA 1VSVA 4LDRA 5K8CA 5LYJF 3K6RA 4R9SA 1J9ZA 4KAXA 1K86A 4RDXA 5FI5A 1V7PC 5BSHA 2ZJ0A 3EXEB 1JQ3A 3NHLA 5C1OA 1L4UA 1CE8A 1YRBA 2F4NA 3IKMB 3DMYA 1FCJA 1LPOA 3VYRB 1F7UA 4PHTA 2F1JA 4CPDA 4KL8S 2NWQA 4R3UC 5FA6A 4B2LA 1COZA 4LBVA 3IUQA 1SU8A 2RGNA 1EUCA 1WV0A 2XHEA 4AYTA 1TKRA 5IK2A 4ZOQI 5EJ4A 1RWXA 2I6GA 4RULA 1E1NA 2PQ0A 3J7AC 5DEIA 2IPXA 5TS2A 2IODA 4BB5A 4E22A 3RAPR 2O7NA 1KJWA 2AMYA 1E1CA 3A11A 4Q9AA 2LD4A 5CX1B 1YVDA 3QXSA 1K4MA 4HL6A 1OASA 4RA9A 4WN3A 5CNMA 4EGQA 1MH1A 1AQ6A 2I76A 1R6AA 2XUKA 3C3BA 2VP4A 3L4EA 4MEJA 5ALYA 3P9XA 4FR2A 1XXHE 2YCLA 2Q2QA 4CU5A 3PENA 3TTUA 4J2TA 4WLOA 4OBEA 3ITNA 1ONPA 4DAOA 1PT6A 4X41A 1HRDA 1QFYA 2BUBA 4BVFA 2PUWA 3HDVA 4JSTA 4EJFA 2QZSA 3M6VA 1OI2A 4DIDA 3IIMA 1Z36A 2LCFA 4KX3A 3LCMA 1M3SA 2WD7B 4R2JA 4DT1A 3TM5A 1ORVA 2ATXA 4H4CA 1JILA 2R7LA 4OL9A 5M2QA 4R31A 1P5HA 4WNAA 3DFKA 3OLWA 1QYXA 1SCUA 4US2R 3DOCA 1BCSA 4JXZA 3DFFA 3MFYA 3QE4A 2BMVA 1HNNA 1DEKA 4A7PA 1Y81A 2NSHA 5F5LA 1JG7A 3FBWA 4F4DA 5M5BA 1W4ZA 1MOPA 2EOAA 3INGA 5EFOA 1GQSA 1O6FA 3Q3EA 4EO7A 3QV1A 3SXJA 5PNTA 5BPFA 3QVTA 2CBGA 2X9QA 3IVMA 4PC6A 2UZIR 2WU8A 3H97A 1IJEA 1TYBE 2C3MA 3QF4B 4DJDC 1T3ZA 4NBUA 1NNLA 3ZVLA 5BR4A 2QIOA 1BHSA 2R00C 4ZCSA 3W4IA 1TCUA 2GLTA 3H87A 5F1KA 3A6EA 4CUKA 3MPUA 3NVMB 4CIWA 5I01A 4MMZB 1JB9A 1UZAA 3O3NB 1WMDA 3BG5A 1BRTA 1IBRA 3PIDA 3UBMA 5KI6A 4N1AA 1T1EA 2YV2A 4IY1A 3ABIA 1AU9A 4BO9A 3V4OA 3GUHA 3HY3A 1EM6A 4BV8A 2CNNA 2DC1A 2BFWA 1I7QB 4MYHA 3LUDA 4ZU6X 3RRMA 4F9GA 4DLYA 3M4XA 1NNUA 1V96A 4ZC1A 4GM4A 4NBWA 4M8NE 1EUQA 1V4VA 3V1TC 2P9ZA 2ZANA 2HV8A 2Q0XA 1TEXA 4D8TA 4E14A 2ZJ8A 4TKMA 1E9AA 1DBVO 2I2BA 3E81A 5FBQB 2FPSA 2QLMA 4FYPA 4WLFA 2CE2X 2FE4A 2PXAA 2C5LA 5JG7A 4BNZA 1C7QA 3CN7A 3ZNPA 4MKXA 5JS2A 3BMXA 4ER5A 1WDMA 4HWPA 2NZVG 2VNAA 3VX4A 1JR4A 2QRUA 3KTAB 2X0EA 1NZFA 4QTZA 4OXQA 1E4VA 3LYLA 4FOSA 4XWGA 1CUVA 5L7TA 2J67A 3E84A 2UU9B 1RJEA 5GTDA 3NETA 5FOTA 4FN5A 2FYTA 2Z2KA 2NO0A 4B80A 1R27A 1EIWA 5K0TA 2HBZA 3BB3A 1X86B 1N2SA 3AUYA 1ECPA 2HSEA 3PPVA 1CX9B 2W48A 3I2YX 4WFKA 1NUSA 4HXEB 1SC9A 4FEAA 5BMVA 2O1EA 3MT0A 3HFRA 2NYRA 4TL8A 3K1ZA 4WCFC 1NKTA 4LOLA 3WIBA 3GFQA 3ZDQA 2YY7A 1DG1G 2CDRA 1NXTA 2BRUC 2Q8PA 4RFVA 4B6FA 3NC4A 2FZ5A 2O48X 2O2JA 2ZIAA 1EPUA 5KVAA 2WWFA 5HOQA 2D62A 4DIEA 4OI1A 5EXXA 2WHQA 4CLXA 3GFBA 3DTYA 1DBRA 1SUCA 3CBGA 1GPKA 1RFLA 2WT4A 5EQFA 2VP9A 3CUSA 3TR5A 2FEKA 2WAYA 4KYUA 3U1TA 4PX5A 2GBLA 4DQ0A 4DMFA 3ORHA 1UWVA 1QYIA 1DB3A 3HWSA 1T3HA 4GUDA 2DOKA 2DZDA 3QVSA 3WLTA 5JEEA 1Y6JA 4WJKB 4JS0A 4EYGA 3CLRD 3NHBA 1UKEA 2J30A 4YP5A 5JXGA 1M67A 3TVYA 5DMXA 4F92B 1E7QA 3LH5A 2WNIA 2PV0A 3E9CA 5JDCA 5L8VA 3UHAA 5BNWA 3E9EA 1GL3A 4H9GA 5IC5A 5HCIA 4EELA 2X3FA 4F2PA 3D3QA 1LI7A 2A9KA 3OM0A 1TJ4A 1F2VA 2J9YB 4KHPB 3KCNA 1FPMA 1P1CA 1QWOA 3RSQA 2WJVA 1E2MA 3K9QO 3ZI4A 4CN8A 3GLIE 3WMRA 1ZJJA 1IUNA 2MOKA 2WFLA 1EHCA 3DNFA 2QHXA 2HQOA 1P4AA 1UZLA 1PG0A 1ZOSA 2VTDA 4NFSA 4Q16A 3UMGA 3ZKAA 4Z4FA 1YQQA 4JENA 1QNLA 4KKXB 2NVBA 3V4FA 2HWXA 1DKNA 2HQBA 3OHMA 3VJRA 1NFQA 4EYQA 4FMPA 4PYIA 4X60A 1E5XA 2JGJA 3GVXA 2EFHB 3OT5A 1T6NA 2XJ4A 1XKXA 3L0IB 4L73A 2WTBA 5CT8A 3H6GA 1Z3CA 3D3KA 4MJ7A 5J4LA 2O3UA 1KI2A 4IX1A 1WCIA 3K7EA 3PKIA 4P7GA 3B3QA 4XVRA 3ZTTA 4DG9A 1VDZA 1E9FA 3L0ZA 5BYJA 3T7RA 3BK7A 3L7AA 1O95C 1RKQA 3TJRA 1WHTA 4URWR 2Q5FA 2AC7A 5ECGC 3SPXA 3SS7X 2R751 2ZI7A 1DNPA 2HHCA 1AC5A 2Q7XA 3BA1A 2YZ7A 3HCWA 4FNMA 1QU3A 1TVKA 3OJCA 3EYWA 2WM8A 3ELYA 2PFSA 4W1RA 1P1IA 5DI3B 3NM6B 1VMDA 4KH0A 2B4AA 5H02A 4RAQA 2JIOA 1C7JA 2QL7A 2F2TA 2XUJA 1SK8A 3AVOA 3F8WA 3PIIA 4JAVC 5AJVB 1TM7E 2OL4A 3VPBA 3OA2A 1R5OA 4A91A 1IMJA 4S2EA 2YX1A 3LUPA 2JVIA 5BUSA 1EDEA 4YMIA 3GT3A 4K6OA 1T0JB 2RHWA 5JC8A 2IT1A 3EG9A 1PP4A 4IYJA 4G0XA 1PYGA 2L19A 2PPVA 4TL6A 1XJQA 1MGOA 1G0OA 1I3KA 3AF2A 4Q1BA 4DCGA 2F64A 4ZQHA 2RIPA 4IUDS 4EB6B 4DDVA 1O5TA 5CB0A 2OLKA 4OHOA 4L8YA 3V7WA 3MJFA 2Q41A 2MR5A 3PNQA 2DQKA 2V7XA 4FVTA 2ZLBA 4MDYA 4A03A 3OOHA 2AHRA 3BM5A 3E53A 4X1IA 2Q6OA 1JMYA 3D7RA 3WQQA 1P1KA 4C0JA 1UQRA 4IMPA 4Q4JA 2WSSA 2JIMA 3GB9A 4OB7A 2EC5A 4YCBA 1BKSB 1TCBA 4IDOA 1YL5A 1P2FA 3UT6A 2X77A 1SC6A 3GRZA 1XN1A 2R1VA 2EIXA 2WC1A 1IVSA 4U0JA 2IYSA 2V7QD 5KOJA 2EWMA 4OA8A 1XTKA 3ROZA 3SZUA 1BFDA 4R0VA 3KO8A 1S3FA 5A04A 5CXQA 3KJIA 1GT6A 5F2KA 1ODLA 2B3TA 2CDAA 4LC9A 1IRXA 5AYVA 1PV4A 4RCYA 2D4HA 5HMLA 3T5MA 4Z53A 5AVQA 3DKPA 1WWKA 1TGVA 3DVQX 3NS7A 4GI5A 4IZHA 4KCGA 4R6WA 4PN3A 4CM7A 4HRXA 3H2YA 1AO3A 4FYVA 3MJVA 2J9FA 4UM8B 3VISA 3PFCA 2X6TA 4HH3C 4LZLA 5B6IA 4TUYA 4G5QA 3O7WA 3EGOA 1U9IC 1VMEA 5I7RA 1TQ2A 5KNLA 3WYNA 3NVKI 4EFNA 4MO9A 1C7RA 1JLLB 4PS1A 5T8KC 3QOWA 4HN9A 2QYSA 2Q3MA 5IW8A 3IVXA 2V7GA 3WWCA 3DTVD 3B9RA 3MJ4A 4KUGA 3OECA 2ANBA 8ADHA 1M34B 3K2IA 1JT2A 1SVKA 3DBVO 4GPEA 2OORA 3IBCA 3A6LA 4V02A 6ADHA 3C24A 4NPAA 4ZJZA 2UZ0A 4AYWA 1EVEA 2FX5A 4HDRB 4EG7A 4DLLA 3CB2A 3OG9A 5JDIA 2VHUA 3HYTA 1CDDA 3E05A 3IPLA 5CMLA 1TC2A 1ZM2A 5EIAA 3AB7A 3W4JA 1T8RA 5EQDA 1GZ3A 1TO2E 2H1SA 1S4MA 2CFCA 4OJTA 2YJGA 4LF9B 5ECDA 3QLEA 3RNLA 4OO3A 1UMDA 4DSTA 1QDUA 1EVZA 2P11A 3O5AA 1O6CA 1SHTX 2YNMC 5FYDA 1OXTA 3VKVA 5K7SA 4R9UC 4HV4A 2TS1A 1PR4A 3IEMA 1TEVA 5HUQA 5AOAA 1ZC3A 3EGVA 4EW2A 1NNSA 2QR2A 3TDKA 3VDRA 3ZHQA 1J1UA 1WVGA 3IPCA 2HSGA 2QD4A 1QIGA 2IP2A 3B2NA 3OU6A 1N0HA 3TM4A 3W05A 3W4KA 2H06A 3WHIA 3EBOA 7MHTA 1XP5A 4ODIA 3IE1A 3HXMA 2YN0A 4RJTA 5HVNA 3A6FA 1MEOA 2BE7A 2I4LA 2MYPA 1YGPA 2HK9A 3ASYA 4I1OA 4BGDA 4KQWA 4RHTA 5J4HA 1XRQA 5LL6P 4PRYA 1EFKA 3NVDA 2H2HA 2GJSA 3DHWC 2EG9A 3I4FA 3D54D 3HI6A 3PI6A 4GT1A 4C6TA 4BEBA 3R3SA 1S3SA 2FSUA 3RUCA 1YQUA 3VR3A 3S5UA 4E5YA 2FEOA 3ILXA 5EJFA 3W3ZB 5KWVA 1LPMA 2DLDA 4X92A 1JG3A 2HH9A 3LT0A 1FYVA 3FNBA 1YJBA 5FTMA 3CM0A 2CUKA 4M7OA 4TS3A 5GPBA 1BDMA 2O3TA 1CRPA 2IYAA 1HOTA 4HJXA 4KLAA 3E1SA 2JB9A 5DTEA 5BNZA 2EEZA 5IUJC 1J8QA 1SG0A 3ETEA 1QK4A 2QVBA 2QYTA 4Q4DA 1VLLA 4DQDA 3B51X 5IXJA 1II8B 4PE5B 1G3UA 1CZOA 3V4LA 1BU5A 3VAAA 4MRMA 2YN4A 2CE7A 5GONF 4YQFA 3RARA 4DE5A 3QELB 1RSZA 5K0SA 3CZMA 4BUJA 3SQXA 5KOHB 1J70A 1NUPA 1W48A 4D9IA 1QORA 4EB8A 3UHJA 4GP6A 1XU7A 1YBAA 1ZINA 1U8ZA 1YUMA 2C88A 4HGOA 1ZIYA 2RHRA 3UOGA 2IUYA 1M0TA 2JAOA 1U4OA 1ZUIA 2XOKA 2MYTA 3UB2A 4EVQA 4DMLA 5K3OA 3T4XA 2OCAA 3MA0A 4OB6A 1NX9A 4QT4A 5HR5A 1M0EA 1WAMA 5FADA 5ALSA 4IJUA 2PFKA 1ZFNA 3GEIA 2C0QA 1R37A 3V80A 1QO0D 4HGNA 3RTCA 3PWKA 4RZSA 4XSVA 3UGJA 3TMAA 5DK4A 3KAPA 4URFA 2GD6A 3W34A 3I30X 1KK1A 1U0HC 1YXMA 3PC6A 4EFMA 3D2BA 1G2IA 2X4GA 2X58A 1E2NA 1N1DA 2AJBA 4R2IA 5I7VA 5T3YA 4Z4GA 2UVPB 4GL4A 5IAKA 4GS5A 3HBJA 4MUBA 1RC8A 4QUEA 4K1LA 3T9EA 3O3CA 4RQAA 1W46A 2BFFB 4EY3A 1NOIA 4F6RA 4YRDA 2GA8A 3CLVA 5EZ6B 4BNIA 5C8VA 1O9GA 3AETA 1B0AA 1YWGO 1E2HA 3V97A 3ZW9A 3V2UA 2OKCA 2ILVA 1KEPA 3AJDA 5D7BA 5FHQA 3VQTA 2PUVA 3CW9A 3JD2A 4MA4A 5LZ7A 4KODA 4DEYA 5HW0A 4RFLA 5EIHA 2X3YA 2OBMA 2PA3A 3FVWA 5D3MA 5AUQA 3Q7QA 3BD9A 2NYVA 2AJLI 2XOEA 3GU3A 2C4NA 4XIIA 1HDZA 1RE0A 4FXOA 4OLAA 4LOKA 2IEDA 1NXSA 2BGNA 4CLEA 5IDQA 5KYTA 1RZRD 2XA1A 2XYVA 3KTAA 2PMWB 1PJ3A 4G4SP 1S8FA 1SXGA 1T6ZA 3B38A 3DOJA 1GGFA 4K9LA 5FTWA 4QHYA 4X93A 1KSHA 3AEQB 4MKIA 2H1WA 4YLEA 4UJ5A 4KZPA 4ZDJA 3IBFA 4FSHA 1WU8A 3DMHA 1QHHB 3HVUA 1CK4A 5IT9A 1PR0A 2NU7B 3N0WA 4TZ0A 4C7VA 4FLEA 5EVCA 4D44A 1GRRA 1X74A 3CLHA 2CMHA 4DILA 2EX4A 4FZVA 4KR6A 2CVZA 1LTQA 4H7JA 4M1QA 1HGXA 2HAEA 2Q5IA 2R84A 3OICA 2FX3A 4B45A 5ADVA 4IUCS 1Y1PA 1NUTA 1TB4A 1RHKA 5IWCA 1RRVA 3QQ5A 4OB8A 3GMTA 2QD5A 2JI9A 2VEOA 3UUGA 1B3BA 4IH9A 1UAAA 1K6EA 4MINA 3IFSA 2HPZA 3GAZA 4EMTA 3WGQA 1GLVA 1KMCA 3DE5X 3QVMA 4YLYA 4MCHA 5C1BA 3PUIA 1KO1A 1U6KA