2JVKA

Nmr solution structure of the hyper-sporulation response regulator spo0f mutant l66a from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIAKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation initiation phosphotransferase F
publication title Covariance identifies dynamic residues at the interfaces in protein/protein complexes
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 40
structure length 132
sequence length 132
ec nomenclature ec 2.7.-.-:
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jvkA00
5IUKC 4N0PA 5CNJA 4E7PA 1R8JA 4WXEA 3D02A 2GI4A 8ABPA 1DCMA 4G0XA 3M9WA 3O2SB 1T34A 3L49A 2IPAB 4RK1A 3O1IC 4RXMA 5KQLA 3SNKA 4N76A 4P1ZA 1U0SY 1SXGA 4ZJPA 5KWSA 4D74A 3JVIA 4NCBA 1OXKB 4RXUA 4NV3A 2GKGA 4KQ9A 3RVMA 1ZH2A 4LZLA 1P2FA 3H5LA 1F51E 3VNBA 1QPZA 4O1IA 2MYTA 3OQOA 4H60A 1QQAA 1S8NA 1SD5A 4QYMA 4EVQA 4JB0A 3SQNA 2WWVD 1NXPA 1MAVA 1TLFA 3JTEA 3O2JA 9ABPA 3H75A 1JX6A 3N0WA 2NZVG 3QEMB 4EYGA 4JA2A 4F3TA 3N8IA 1JDNA 3LTEA 6ABPA 5BRJA 4RK0A 2PUCA 4O5AA 2H0AA 3HK2A 3IP5A 5IEJA 4RK4A 3QEMA 2NT4A 3OLWA 3SM9A 4IMJB 5HKOA 3RVSA 3JY6A 3JPYA 1LBHA 3O2QB 4RK7A 1YIOA 3KLNA 3JVDA 1KGSA 5KC8A 4WWHA 4YO7A 4W5QA 1U8TA 2IPNA 2PJUA 4JP1A 4EGSA 2P9HA 3MA0A 1EHCA 1UDRA 1LJLA 1NXVA 5T3YA 5TQJA 4B09A 1Z12A 4DN6A 3SG0A 5T7BA 1ZAYA 1DP4A 1L5ZA 1USKA 3C97A 1FFWA 4KNYA 1B00A 3OLYA 3Q7SA 3NHMA 3BILA 3LMKA 3IDOA 4LRQA 2PUEA 1BAPA 2JBAB 3OLZA 4RV5A 2HQRA 4G0OA 2WY2D 5BRAA 2LUOA 1JYEA 3TB6A 3GBPA 3NNSA 1QO0A 2HPHA 3Q7TA 4Q6BA 1JF8A 3EAFA 2JBAA 2XDYA 4PE5B 4RSMA 1KMIY 3O1HB 1VPWA 4KQCA 1D1QA 3A0RB 2MYNA 2IKSA 3H5WA 3HDVA 4S04A 1TM2A 1NY5A 3O74A 1K66A 3QLUC 4XASA 1EWVA 3T6KA 1QQBA 1CYEA 3H5OA 4F12A 2PL9A 4KFCA 1RNLA 4O1HA 3GA5A 4EY3A 2A9QA 1U2QA 3I42A 4EVRA 4NCAA 4OBBA 4JOQA 3KCNA 4KRFA 2MYPA 2J48A 1RZRA 3URMA 1ZH4A 4L4UA 3EDCA 5TE9A 3FFTA 1NXOA 3C3WA 2ID7A 1E6MA 4Z4IA 2DRIA 1YMUA 4P98A 2L19A 3HXMA 1I3CA 1VLZA 2YHAA 1ISSA 1GUDA 1NATA 4N47A 5JNTA 1H9CA 4KMRA 4QICA 4IF4A 1YVUA 1PEAA 4S05A 4MQEA 2IPLA 4HYEA 3W9SA 2E4VA 3K4HA 4XLTA 3BBLA 3CLKA 3MIZA 3KS9A 5I4CA 1ZHHA 2KYRA 2R48A 4PICA 3ROTA 4D6YA 5DKFA 3EQZA 4CBVA 3IPCA 4D6XA 2FQXA 4F8JA 5FBHA 3RVOA 2W42A 4Z9BA 5DTEA 1GCAA 1TMYA 1Z2DA 3CFYA 4GNRA 4Z4FA 2H3HA 4RDCA 4KPYA 1ZGGA 4FE7A 1ABEA 3IP9A 4G97A 3NHZA 2IPMA 1FQWA 2AYZA 1QKKA 2WRZA 4ZYLA 2FQYA 3G85A 3OO0A 4RY9A 1DCFA 5PNTA 4ZMSA 1JFTA 5ED4A 2FEPA 3OQNA 1Z26A 1ZDMA 5JNUA 2VYCA 4JAVC 3BRQA 3GBVA 2JRLA 1U2PA 1IIBA 5CNKA 2ID9A 4EYKA 1BDIA 1KRXA 3GRCA 1D2AA 3TD9A 4TLMB 3CTPA 3UK0A 5BQ3A 1GLGA 2E4YA 5GOTA 3F6CA 4MR9B 4MLCA 4IRXA 4KK4A 2FQWA 2NUBA 3H5VA 4EYOA 4EUKA 1QNLA 4OATA 3LUKA 3OM1A 4DADA 1P6QA 3HEBA 4H3KB 3BRSA 5KQPA 3CZ5A 4MR9A 2RJOA 1P6UA 1GUBA 5FBKA 3LKBA 3RVLA 2PUFA 4F06A 1AB5A 1Y1LA 4N41A 3DLBA 3H1FA 3MQ4A 2PL1A 2PMCA 3EODA 2L18A 3F73A 1L5YA 3H5TA 1NXXA 2WJAA 4W5NA 2WMYA 3JPWA 3JS5A 5GQSA 1FFSA 3DZDA 4JB2A 3H1EA 1BDJA 2GWRA 4G0YA 3TX6A 4MS3B 3T95A 2JCGA 1E2BA 3CRNA 2E4XA 5B3JC 3UUGA 4MQFB 3KYJB 5JNVA 3OLVA 2PUGA 1DRKA 4MS4B 3MYYA 4MS3A 4RWEA 1JHZA 2M1ZA 1URPA 3CNBA 3KLOA 4ZMRA 2L17A 5IUJC 4HNQA 2FSPA 5HQJA 5JS2A 4MQFA 2A9RA 2FEKA 4YS6A 4MS4A 4TMYA 3CKMA 3O75A 1NXWA 4F11A 2QR3A 2V0NA 5FWXA 2QSJA 2I6FA 3MMNA 5TPZD 2AYXA 1BDHA 3N6VA 2B4AA 1A2OA 4RKRA 1YS6A 1QP4A 4ETIA 3HZHA 3TO5A 3RVKA 2YHBA 3VNAA 2FKAA 3HJFA 1PUXA 3EULA 1MB3A 1MVOA 5KQGA 1YK1A 2FTKE 5IEBA 2IDMA 5E3JA 3QX8A 2FN8A 3HM9A 1A0OA 1YMVA 3QLUA 2R25B 4RZSA 3GYBA 1JH9A 5JNSA 1Z16A 3EJWA 3LUCA 2O20A 3LUAA 2E4WA 1E6KA 1ABFA 4OG2A 1M5UA 2QVGA 2CHEA 1SXHA 3A10A 2LBPA 1A04A 2P4UA 3A3KA 3HCWA 4Q7EA 1VKRA 4XXHA 3N0RA 3EGCA 1RXEA 1SXIA 2PAFA 3DLHA 3IP6A 2PKXA 4YV7A 1WETA 4ML3A 2GX6A 4DQDA 5C5CA 2PUDA 4GPAA 4MQEB 3RVJA 5TPWB 1TVMA 3CS3A 3DGFC 1EWTA 2JVJA 1KRWA 3BREA 4PZ0A 5KQMA 1M2EA 3IP7A 3OMXA 4HNSA 1DZ3A 2E4ZA 2FMKA 2QVCA 3H1GA 5IBQA 1NXSA 5TPWA 4ETNA 4W5OA 2JK1A 4XARA 4YLEA 3OO1A 3KJXA 2M98A 3RQIA 4WT7A 3QLVC 4WZZA 3HV2A 2RJNA 2NT3A 2A9PA 4RS3A 3OQMA 3ROFA 1Z15A 4UHJA 5TQ2B 3OLXA 3HO1A 1ZY2A 2F8TA 3KYIB 4G86A 2TMYA 3GWGA 3MF4A 3S99A 4G0QA 1QP0A 4NICA 3H6GA 3GV0A 5TQ2A 4PEVA 3C6QA 3RH0A 5EWJB 3QELB 4FB4A 5IUNC 2VK2A 2PE5A 3CZCA 2QXYA 3O1JC 1JFSA 3N53A 3O21A 1CHNA 3NNDA 4TN5A 3A0UA 2PUBA 3HUTA 5CHYA 3SAJA 2MYUA 3LUGA 1JFVA 3KTOA 3QELA 1HEYA 5DGCA 5EWJA 3UKJA 1JYFA 1M2FA 4PYRA 4UHKA 2LIVA 1JWLA 1DRJA 4MR8B 1C0EA 1EAYA 3E61A 1BVHA 4H3HB 4MAAA 2PLNA 3T8YA 5TQ0B 5IX8A 2FXIA 4RXTA 1Z25A 4KVFA 4EVSA 4LDZA 1TJYA 5DLEA 3C3MA 1D5WA 3E3MA 4MR8A 2QU7A 3RVNA 3M6MD 3CG0A 5TQ0A 2RGYA 2FEWB 1FSPA 5JS1A 3LOPA 1RPJA 4Y9TA 2IOYA 1NXTA 4G0MA 1W9HA 4RKQA 1JLKA 2WB4A 4JASB 4LE1A 4YCSA 2PUAA 1BA2A 2ZWMA 3D8UA 1OXBB 3HS3A 4Z4CA 2LP4Y 3DBIA 4OLAA 1LK0A 1ZN2A 1QP7A 3RVQA 1C4WA 4KZKA 5C5EA 5B3JA 4FE4A 4IILA 2VUIB 5EWLB 1JDPA 2B1JA 3N0XA 4WUTA 1GCGA 3FDFA 1JBEA 4YWHA 1CEYA 3I45A 4E7OA 3ILHA 1ISRA 5D2CA 3Q15C 3T38A 2ZAYA 2FMIA 2MSWA 2X7XA 5EWLA 2OENG 1Z18A 4ETMA 3HVRA 5FWXB 2QV0A 5TPZA 3FFWA 3HUUA 3I5AA 4MPTA 4LE0A 1XHEA 1DC7A 2HJ9A 1DC8A 3IPAA 1USIA 1JL3A 3CG4A 4Z4EA 2FVYA 5JNRA 2QZJA 1DBWA 2RDMA 3MM4A 5FWYB 4MLDA 2JVIA 4HNRA 1PEYA 3LUFA 2CD7A 1RXIA 1U04A 3B2NA 4LE2A 3SY8A 2FMFA 2FW0A 4Z0NA 3FGZA 5FWYA 3K9CA 1P8AA 5HSGA 2E4UA 4OLBA 2N9UA 2QW1A 1Z2EA 3LUDA 4ZPJA 4WXMA 4YP9A 2FN9A 3QK7A 4MRMB 3NNNA 1MIHA 3F6PA 4RK6A 2JB9A 4Z4GA 4RY8A 1D4ZA 4QYWA 3R0JA 4KREA 3Q41A 2HQBA 3G1WA 4Z9AA 2VUHB 4NQRA 2CHFA 1DBQA 4MYRA 5IC5A 5KI6A 1USGA 4XFKA 2FLKA 3LKVA 1K68A 4MRMA 3N75A 2HSGA 1VRVA 4W5TA 1YS7A 4N0QA 3RVRA 1PNRA 1DBPA 1LBIA 1FFGA 4MS1B 3L6UA 1ZVVA 2GBPA 3GL9A 5DCLA 1ZGZA 1ZESA 5IULC 4YR7A 5F64A 1YTUA 4KK3A 1M5TA 3FMVA 4G0ZA 1J56A 4MR7B 1QO0D 4MS1A 4TLLB 5CNMA 3I09A 7ABPA 2IYNA 3LFTA 3QLVA 1NTRA 2A9OA 2NZUG 4RK5A 2FMHA 4RY0A 2F8SA 3CHYA 3KG2A 4IMIB 4YGXB 3RVPA 4W5RA 4MR7A 1XHFA 2MSKA 3P9YA 2CWDA 2HQOA 3ILYA 3LUHA 4MGEA 4YRZA 3KKEA 3HSYA 4LDAA 3GT7A 3H6HA 4G0PA 1YK0A 4Z4HA 1APBA 1D1PA 1DCKA 3Q7RA 4XAQA 4Z99A 1ZITA 1RZRD 1EWKA 4RU1A 3C3KA 3QLTA 5ABPA 4M88A 3H5IA 1EFAA 3M9XA 4OTZA 4EYQA 5JNWA 3TMYA 4L85A 2LPMA 2MSLA 4LX8A 5CNIA 1LJUA 1F4VA 1Z13A 3Q9SA 3F7NA 3LUJA 3DGEC 2WJWA 5BR1A 3OMWA 4Q6WA 4IGAA 1Z17A 1E6LA 1QMPA 5EWMB 3QX9A 2BGGA 3EQ2A 5KC9A 1AB6A 2Q5CA 1XWWA 2L2QA 3FFXA 3QEKA 3KHTA 1SRRA 6CHYA 1DJMA 3KSMA 2FLWA 3HDGA 4N03A 3OM0A 1PNTA 4KV7A 2R4QA 3CU5A 1DG9A 5EWMA 2OQRA 1W25A 1PHRA 5HM6A 1MB0A 3NBMA 4QPJC 2JVKA 2R47A
chains in the Genus database with same CATH superfamily
1BNCA 1U1DA 2QR5A 5CNJA 1R8JA 3S8MA 4JNKA 5H3CA 3DL4A 1WF3A 3UK2A 1JEQA 2W2XA 2P75A 3M9WA 1H0KA 1TCUA 1PBNA 2N46A 5F35A 3L49A 3DPIA 3FRIA 4GKBA 4HR7A 4BLQA 1PP4A 4GU5A 4EEXA 1XQYA 2FPOA 4BP9A 4EUKA 2P30A 4D3ZA 1OBHA 1Z6GA 3OT1B 4ID3A 5B1DA 4OQLA 5I7FA 1EUDA 1VYHA 1ZRMA 4A0QA 1O08A 4YV0A 3H5LA 4URHA 5GWXA 5J58A 4O1IA 4LOAA 4GWGA 4O0MA 1DZIA 2OK8A 4Y9SA 1KY2A 3P9QA 2P2DA 2C2MA 2Z6VA 3WWOA 4XSHA 1SXQA 1Y1RA 2PVSA 3V1KA 3RS7A 2ZTUA 3M83A 3S8YA 4D98A 2FPPB 4HNAB 4P8RA 3V8VA 1DAMA 2QBYA 3U4QB 2CNNA 3DJYA 3K35A 2D7CA 4OQ4A 3W6PA 4ARZB 5LOVB 4LBZA 1T5OA 3OZUA 2XWBF 1YZKA 1E3DA 1G5TA 2A5FA 4BRWA 3WP1B 4PPQA 2J9FB 2H00A 3GX1A 4J49A 3AYXB 4JR1A 2GPJA 1DIGA 3WQHA 1HFEL 4GXRA 2ZBFA 4WH0A 5ALYA 2GB4A 1QP8A 4EG3A 3ZGVA 1RBQA 1U2RA 2IP2A 5FEMA 5JAQA 3TPFA 3NUZA 2QNIA 2VPIA 3ZZNA 3MA0A 1CRWG 1EHCA 3Q40A 2NUAB 2HAEA 5HVNA 1Z12A 3FVVA 5KOHA 4N3AA 2X0RA 4US2R 5CVEA 3ME5A 4QE3A 3SSNA 4P92A 2NU6B 2RSLA 3FCSB 4V02A 3W2GA 2IEYA 1SCKA 1E79D 3AMVA 3QM1A 2B4RO 4HWPA 3OX1A 1RQPA 5C4IA 1USWA 5IM4F 4UATA 3VU8A 5AUNB 4MB6A 1W1WA 2WDPA 4ZN6A 1T4BA 3HQ4O 1GPUA 3QFCA 3QV1A 4KO3S 3K73O 3AKZA 4GBGA 2ZAGA 3NNSA 4HSEA 2G4CA 1YKFA 5C81A 3UXEA 2C4TA 4W8HA 3ETLA 1FEZA 2PFGA 2VDRB 3A6EA 2WHPB 4W7SA 2MU1A 4DV2B 4DR5B 4I5FA 3H5WA 2DQZA 3LZCA 2EX0A 3HGMA 3IT0A 5H02A 1V7QA 2PMFA 3QHAA 3ZJ4A 4CG1A 3WJ1A 2QZPA 1VHWA 1PX0A 1P9RA 2ZR7A 3WO1A 4XCQA 5CFQA 5HXAA 3VC7A 1PJSA 2C82A 1KO4A 3WLHA 3OKCA 4JYCA 4OLJA 4M98A 3MS4A 2E21A 5JE8A 1T2AA 5U4XA 3SX4A 1IQ0A 4JSRA 1IB6A 1QG0A 1WCIB 4KRFA 2Q4TA 4IRUB 5BN5A 5K3DA 2GJ4A 5JASA 3WQQA 2FAXA 1JPVA 2QT0A 4MVJF 3E5MA 4I55B 4IHQA 3DEAA 2YHAA 3OZXA 4PFJA 5FULA 3DKIA 2BMVA 3UWMA 5IN4A 2NZWA 5CVTA 5ITVA 4BU1A 4OQFA 4KPFC 2HRRA 3GJTA 1ZAKA 1NP6A 3GLTA 4QICA 5F76A 2WMNB 5B57C 3F3SA 4MQEA 3EFEA 3QXJA 1NVMB 4U5QA 3RGWS 1H94A 2VSYA 1U4NA 3TLMA 1A5AB 1TTQB 1Y98A 3HU2A 4JBLA 2ZI9A 5L3SB 5E4TA 1W7AA 1WQ1R 2VOJA 2WHXA 3U3JA 1J20A 4JQSA 3ER9A 4YREA 5IKOA 4E5YA 3PZRA 1GSIA 4MCJA 2F9FA 3EQZA 4H3SA 4M9CA 5LYJA 1SO8A 2H11A 3SF8B 1Z0UA 4OHRA 4IIVA 4DDUA 1A7JA 2IIBA 2XMDA 3M9LA 4H9GA 4DNOA 4MWCA 4BCDA 1IHYA 1TJ4A 3B1VA 1XDBA 1MC1A 4YJ3F 2QW0X 3GRKA 4OKIA 2A0FA 5JSHA 1ABEA 1ORHA 3CH5A 3RKRA 2WZDA 1KJNA 1Z35A 2VS1A 3IV9A 2X2EA 1EM6A 1NVUQ 3PC8A 3GG2A 3VMMA 1DB3A 1TK9A 3A9TA 4P5PA 5HF9A 1IHXA 3E27A 1Z26A 2XUFA 2YJGA 2EKDA 4JNCA 5E1BA 5FPHA 3DUFA 1Q0SA 1J06A 3AEUA 4QDKA 4R2WA 1WBDA 4EGQA 1YD7A 3OP4A 4QFBA 2QZ9A 4CIYA 1D2AA 3BRCA 5FPYA 1X9GA 2E4YA 3OZCA 2O8EA 2RGAA 4IDFA 4MLCA 2BI8A 4BMNA 3IODA 1RWWA 2JFVA 3EEIA 1N6KA 4LAFA 4XX1A 3RC1A 4FEEA 1LVUA 2QIOA 4ACAA 1ZD5A 1CPYA 3AY7A 3CURA 3NYIA 4OATA 4F9GA 5KTPA 3K05A 2B5OA 3OQPA 5EFOA 2Y77A 3LRPA 4QU8A 3UJDA 3MFYA 1P6QA 3E9EA 4H3KB 4QDXA 3MG9A 5KU1A 3CZ5A 1N8KA 1NA5A 4CF7A 2PK3A 1YBMA 3K15A 1J2UA 4JMLA 4HATA 2L18A 1O87A 3ESQA 1Q92A 2P6OA 4TV8B 5FD8A 3I9V6 3N8HA 1VHLA 5EA2A 3ZWPA 1W85B 3IL2A 3MK31 3ND6A 3LKDA 3JQRA 4C9BA 1RQ7A 2ZYRA 1MO5A 1UOEA 3JATB 1R4NA 3EN0A 4C3ZA 2I1VB 4ZTZB 3AM1A 2BP7B 2AZMA 3FYHA 3QG1A 2JCGA 2BFBA 5CEJA 4G56A 3TGPA 4L75A 1U2DC 1FUYB 2DECA 5DHUA 5JNVA 2OSBA 3EQ7A 5JXWA 1YQTA 4F8EA 3DEHA 4INOA 4OXYA 3SIPA 4PAQA 1YR2A 1M2OA 3L05A 2Q6IA 2GAAA 2ZJYA 4CF4A 2X2FA 1B0UA 2B3DA 4BUZA 1WSBA 1FS6A 1E79A 2V6GA 3OZFA 4IIBA 4R8VA 3W7AA 3MT7A 4YS6A 4BNHA 1Q15A 3CLUD 4Q4AB 3W2HA 4OPMA 4BGDA 5FWXA 1JFFB 4RD1A 3PQ3A 5IJXA 4BLRA 3LO8A 1BD3A 1CZRA 1II8A 1RWNA 3HCEA 3RSFA 3KXLA 4I3GA 1IJEA 2YHBA 3QTBA 1IEXA 1MB3A 4O8CA 2MSNA 2Q46A 1YK1A 4A03A 2JFHA 2C7VA 3ETGA 2O4CA 2HGZA 1JQDA 3DS8A 4JLMA 2C7RA 2AE2A 2V7VA 1U8FO 5FBQB 3ZQ4A 1GKIA 3BSWA 5LU8A 3OVMA 4RZSA 1HNXB 1AF7A 2C88A 2CHUA 2AOUA 3TLAA 1RAHA 4F85A 5J4VA 3RIXA 121PA 1CY4A 1J9ZA 1DAKA 2AHOA 3E23A 4YFVA 3FGNA 3K1YA 2QRUA 4KI7A 2HUPA 4GQBA 1OYWA 1K88A 3KPWA 1T8TA 4GPEA 1YRQA 3KQQA 2IZ6A 3OCWA 4TV9B 1DINA 3WDKA 3AZOA 3HM2A 5EIWA 1GCOA 1RXEA 1YQGA 1R64A 4Q3BA 4LF4B 1OOEA 2PAFA 3IP6A 3C4VA 4AECA 5EE0A 1QK5A 1R9MA 4ZOAA 1WUTA 4YBRA 2NSJA 4MV7A 1XA3A 5KAMA 3HPQA 2XAAA 4HGQA 2YJZA 4AG6A 2ZTSA 3DCJA 3K9FC 1JAZA 4UUQA 4PZ0A 5JAHA 3N6XA 3CVVA 5AW3A 3FJYA 1WQ3A 1WE2A 2A35A 4EA6A 2DOKA 1EUCA 3MPUA 4LFCB 2Z56A 5EGNA 1AK1A 4POAA 1TT5A 4CQLB 4V38A 5JR3A 1Y9EA 3PFCA 5A4DA 1Q1AA 1TAGA 1ZUD1 5TRTA 4CG3A 1IM2A 2M98A 4O2BB 1OFHA 4LYEA 2Q4RA 3LQKA 2DAPA 1JQAA 3IILA 3B51X 5T5QA 4RS3A 2X6TA 2VZ9A 4BRUA 5JQGA 1DIOB 1C2YA 2XCRB 5EJ6A 1ZKDA 2QRZA 5BRNA 4P7FA 4GPBA 3HN6A 4G86A 5HILA 2E48A 1GTVA 4EI7A 3H6GA 1LD3A 4RTMA 3ZCPA 4UVHA 2Z08A 5TQ2A 4D25A 4PEVA 3AHCA 3WQBA 2BI7A 5GOZA 3O1JC 3AR6A 5DULA 5KOJB 1Y5RA 4HDAA 1Y1TA 4QIHA 3VHQA 1WXEA 3R7WA 1SOAA 5BN3B 4NZPA 1XA4A 3CINA 4BCBA 3EPJA 4B3FX 1T3SA 2C8LA 1J1UA 2X0IA 2CVHA 3R6DA 3SAJA 4DIKA 3QELA 4PQRA 1JEYB 4JEHA 3RYCA 2C95A 2X9NA 3IAM6 1XDDA 2CUNA 3PFWO 4HEHA 5ALUA 5AUQA 3V2HA 5BR4A 1F60A 5LMCA 1TYEB 2ZR9A 3VH2A 5EIBC 1RTKA 4JBIA 4E5VA 4OL0A 4Z9XA 3WK8A 5K8CA 2PLNA 4H27A 1QZXA 4LOKA 3BJMA 4WX2B 1ZH6A 4UFPA 4ZOEA 1R8XA 4PCVA 3VU0A 4PGAA 4LHYA 4R1TA 5FWDA 3SHVA 2XKAA 2RE8A 1L4NA 2EGHA 1Y1QA 5AR1A 3CJTA 5GV8A 4IEIA 2HY7A 1E3LA 1XDWA 2W6MA 1VIYA 3BX1A 4L1KA 3H2YA 4M8IA 2PV7A 3U4HA 1ORDA 5JISA 1VFNA 1C9NA 2QRVB 5LMUB 1Y9DA 4JOBA 4LMPA 1YC5A 1ZN2A 3KBOA 5K99A 1QP7A 4I50F 1M34E 3MWDA 1HQCA 3AU9A 5IM5A 5IXSA 3EUEA 4YCLA 1JDPA 3T3OA 3JD0A 3IAHA 2WKPA 1CQZA 3H86A 1KOJA 1L3IA 1HE5A 5E9WA 2B83A 3MTIA 4I5DA 4D0GA 1PYOA 4E5SA 4YJGA 2VDJA 2JNWA 2RHJA 4MTLA 4YAGA 4ZOCA 1A1SA 1KIMA 1Z18A 4OXIA 1FLAA 1RYDA 3USCS 5SYAA 1HSZA 3I8SA 2I9KA 3ZD6A 2GCGA 2C20A 4M0DA 3CEHA 3E9NA 1Z4MA 4KITB 4W1RA 2Q1SA 5CH3A 5LLSA 2QN6A 3L4BA 4IJ5A 4PZCA 5H5JA 2VK4A 5DM70 1RQLA 3I01M 1DC7A 2PZJA 1DC8A 1E92A 3VNRA 1OX4A 4RJKA 2J32A 5ALRA 2QVXX 1FP4A 3UMBA 3NIDB 1X14A 3Q5EA 5FYDA 4BNYA 2A6PA 5BSMA 5A03A 4WADA 1XDSA 1MLDA 1U3DA 3OJXA 1PEYA 3VYSB 4AJEA 2VJKA 3G2LA 3MELA 2CDNA 4JT8A 4QYIA 4DEVA 4UOEA 3AVWA 5A6VA 1OZFA 5KKNB 3CVJA 2JD0A 2CLMB 3DDSA 4KR7A 4JU8A 1X19A 3DZKA 4FOSA 2X4IA 1KPHA 3A9VA 1AKYA 3MS7A 1Z2EA 1YAHA 1NQWA 3CW9A 4S1OA 2HCFA 5KSYA 5EIFA 2NADA 1UK6A 2IKQA 3WLJA 5K45A 3DOOA 2DUWA 2J8ZA 5LA6B 1E0JA 1FXWF 2J3DA 3PEEA 3R0JA 2X8AA 3CR8A 3RRMA 3N2LA 1P3DA 3Q6MA 4X41A 5HE9A 4ZQEA 1L7NA 1MZPA 3BH6A 2ILVA 3O3NB 2GAJA 5EZ5A 4CIVA 1WZUA 2JKYA 3HHEA 3N5CA 2XTAA 2P9JA 4ZCRA 3TLEA 3GMIA 2NPIA 4PC7A 4IGKA 1TO6A 1E9SA 2QD5A 2VZ0A 3MW8A 2E5FA 1OH6A 4ND5A 5A5DA 3A9WA 1M5TA 3H9BA 4FE3A 3SIWA 2HB6A 2A92A 1DOZA 2IL1A 1NLUA 1XU7A 2YZNA 4GE0A 2I2XB 4F4DA 1I7NA 5TT0A 1LEHA 2WT9A 4E2FA 1CDOA 9GPBA 4Y6QA 3QFHA 4L5JA 4TKMA 3CVWA 3P97A 1FDWA 1SXJE 1OJLA 1ZS9A 4Z7OB 4WCFB 2IYTA 1VMIA 5L3VA 3VTAA 3QVXA 1N7HA 2TSYB 2NO5A 3GMDA 1L7MA 1HZJA 4DLVA 3V4FA 1R27A 2LZ0A 5E6RB 2FWPA 4AYWA 4YRZA 1Y5NA 4KJZA 2BZSA 1X7ZB 3IV7A 3BKWA 4IJ6A 3GJYA 4JK3A 4UCWA 1O5IA 3PQDA 2M6KA 4B44A 1WU7A 1KMHB 4G0UA 1DVRA 2V7GA 4COKA 3D9QX 1VL5A 3HBLA 1S3SA 4NNOA 5AI4A 2CL0X 1EX7A 2WU0A 4FHDA 4Q05A 2O54A 3QLTA 2DHRA 2PKQP 2O0HA 4NCIA 1Q7RA 1BU8A 3IJPA 1B43A 4KW7A 1DWUA 2QIPA 1SEPA 4X00A 1X2BA 1VPDA 2HK7A 3OE1A 3ZS8A 4BO1A 5K8VA 2HJRA 4ZO9A 3S27A 2IU3A 3OU7A 4XIGS 3L1VA 3RRXA 4NBSA 4FZ5A 3V33A 4B17A 1Y5LA 1PQPA 5JROA 3MILA 1ZCJA 2HWKA 4EYEA 4ZZ2A 4CIWA 4YCAA 4LWOA 2GNAA 4DSTA 1UBOS 2BGGA 1PK7A 1FDOA 3CIFA 4MDYA 3G9QA 4ZYWA 3DBRA 1UBGA 4J0GA 4X3OA 4BYGA 1BG6A 2XB9A 1CJVC 2PJZA 2CMFA 3VC2A 2GHIA 2KE5A 1WXGA 3ROPA 2ATIA 1NJ2A 4QAJA 3L7CA 3WSTA 3N1UA 2R6HA 4F7DA 4DB4A 2PL3A 5KQSA 1D03A 1EAMA 1Q14A 2DUJA 4AKIA 5DRYA 1JEQB 2RFLA 3QI7A 5CR9A 2VT6A 3U26A 1NNUA 4Z8XA 1LI4A 2XV1A 3JZAA 2M2IA 3FSEA 1MFPA 4O1MA 2BGWA 3UW1A 1XCPA 4YRFA 3ZVKA 3OT5A 3DTVD 2JLUA 2GI4A 4ZC1A 4EHIA 4F72A 1SXPA 5K3OA 3RVBA 1YE5A 4AX8A 2W6ZA 1EUDB 1F1BA 2A3NA 4Y18A 4QTZA 3F8SA 2DFLA 1H3NA 3SNKA 5JSFA 2X5XA 1MG0A 4CLRA 4DW8A 2G3YA 1CQXA 4JUCA 3CB2A 3T9DA 1XTKA 5U9CA 2G0TA 2O2HA 5EQTA 3FBGA 3SC6A 4EATA 4LZLA 4FDUA 4W9RA 5B58T 5MDHA 4PSAA 3D31A 5AQEA 1E9AA 4Y2HA 1SVIA 2FW6A 3DMHA 4DJDC 3G0BA 4JXXA 4X6YA 2QBYB 4BMZA 1WA5A 1H4VB 3R23A 3ANSA 1SUPA 1JDVA 1KC1A 3BXEA 5TGZA 5G41A 4PYKA 3BSFA 2NZVG 4RDHA 3RQSA 3W9BA 2DC1A 3GJZA 4EDFA 4I8DA 1JEJA 4FXPA 4P3PA 1C5KA 1GV0A 1Y9ZA 1OF1A 3E5NA 1IJBA 1V6CA 3RBXA 4GX0A 3IALA 5JFOA 1FJXA 3HK2A 1ZYUA 3PUZA 3QYFA 5I4IA 5AI8A 4ILKA 5HKOA 5KOHB 3U56A 1T9HA 3WC4A 2F9MA 1Q74A 4UXJA 4AFNA 3LPNA 4R01A 3RIEA 4DMUB 4ED9A 3SYKA 3DKRA 5T7BA 4B09A 3WRXA 2KPOA 5CYOA 2XRZA 5AKJA 4HX2A 4QAQA 1XALA 4BFYA 4K9SA 5ALVA 1N2HA 1QUFA 2Q3EA 2AEMA 5D7NA 3UAYA 1NUAA 3CGWA 4IQ4A 3UMSA 3QLJA 2NV2B 3TG8A 3U62A 2C1XA 1CHDA 2HDOA 3FCXA 4RM2A 4G0OA 4X44A 4R54A 4C0QC 4ZYYA 2BD0A 2F3SA 2P69A 2XNKA 3A6LA 3IUQA 3NTRA 3UM9A 1G5PA 4NJMA 5GONA 4Q6BA 3HI4A 4LGCA 2XDYA 3S7ZA 5B7NA 4AZWA 1R0LA 1KZGB 1L8XA 1D1QA 1HY3A 1G1MA 1QJCA 5KYYB 3G6KA 2GMWA 4PWZA 1Z7BA 1O6ZA 2FN3A 4J4TA 5CTAA 3VU1A 1QH1A 3ZDQA 2VSNA 4CI0B 3BT7A 3RSHA 5BN5B 5FPSA 2VTKA 3DF9A 1V9LA 3H05A 3OJ0A 2WJPA 4MW5A 3AF6A 1X1QA 4HTAA 1VIMA 5TEWA 4EY3A 1JJVA 2DTEA 2ASVA 4U2BA 3UXHA 2WDZA 5AM0A 3ZU4A 1LV7A 4C0JA 3K0AA 2DERA 3TAUA 1OIWA 4DJTA 1WAMA 2FOLA 2PLFA 5BQFA 4BJHB 3C3WA 3GVCA 3K70B 3NUQA 3A1DA 1O7JA 1G8AA 2ZS8A 4JS0A 5FA8A 3AM4A 2R00A 5DYNA 5CDYA 1JIIA 2NTJA 3H4IA 5CURA 5D1HA 2FN7A 1HV8A 1N75A 2Q5LA 1NE7A 1B73A 3A25A 3WX0A 4KMRA 5JANA 1ATIA 2QX7A 3NLLA 3EY4A 2ADMA 1DT3A 1IVNA 3OWHA 4QGFA 4GM1A 1DMSA 4AWAA 4JEMA 4PAWA 2H5JA 2NQ2C 2A2ZA 2WSSD 3KJIA 1E7SA 3DR5A 3LFUA 4DWVA 1NQAO 4E4YA 5LYJB 1AS0A 1T9GR 2ZYUX 2OD2A 4FR5A 4GRDA 1R0XA 3IDSA 4CFZA 2WBLC 4CJXA 5F2OA 4UMDA 5E4YA 4JLDA 1SOWA 1F0PA 4GI1A 4YTEA 2JLBA 4KACA 4ZHQA 3ROTA 1X70A 1QIDA 3SS9X 4RGVA 3F4LA 3DA8A 4QFDA 5FTMA 1NUHA 2WJZB 4FYWA 2JC3A 1H2BA 1WDLA 1Y6JA 1B8NA 1O1YA 3WOHA 2O57A 3DUFB 1L7XA 2C54A 4FE7A 4FYJA 3AEUB 4K7JA 3KLMX 3MC1A 4JJ6A 4HJXA 3JZMA 1C0LA 2NVOA 3UWDA 4LVNA 4E1AA 3HL4A 2I2WA 2XB6A 4KUEA 4DCVA 3OQNA 1M1YA 2GK4A 3N86A 2VYCA 1ORWA 5JNUA 2O8EB 3NIGB 3WHKA 1EFUA 1MGPA 2QRNA 2RI6A 2XW6A 3NO4A 2BYTA 2P3QA 4E70A 4EYKA 3NHAA 1DPFA 2JAXA 4C76A 5K03A 5L3QB 4OLFA 3OECA 1YBFA 1KKMA 1EQAA 4W99A 5EIBD 3UK0A 2JEOA 1SG0A 3RUDA 5JQGB 3I9OA 3BCHA 4U2EA 4ZKDA 4BNFA 1MH1A 3QJGA 3BD7A 1L3CA 3WIVA 3JWEA 2VWGA 1KVUA 2PLRA 3MBOA 4CQJA 2WHRA 1FNNA 2C78A 3DDUA 3R3JA 1YCFA 2I6TA 4KV9A 1I51A 1YDHA 4KKVA 3HEBA 3ZE8A 1CEEA 1V3QE 2CFCA 2INGX 1SD1A 1Z6PA 4L5YA 1R0ZA 2ATCA 3PJDA 5FXMA 2OHGA 1PWXA 4W7HA 3C4QA 1DKUA 3IMEA 2G70A 2GZ2A 4BO0A 1R4NB 4OH7A 4PR3A 4TT3D 2F3QA 4GIBA 5B7QA 2BFBB 2XB4A 1M76A 3TL2A 5EIOA 1N7JA 4PG6A 3DXXA 1IBRA 3LI2A 5ENVA 5G2OA 1U2DA 4C14A 1LNSA 2C77A 4FZJA 1M2OB 1SCNE 2F7SA 1NBWB 3DT6A 4K6HA 4GR4A 5I9TA 1QLWA 3EWNA 2ZPUA 1B23P 6GPBA 5DSZA 4GYKA 2VUUA 1CJMA 2OFFA 3Q9NA 4DBLE 1GRQA 5ADHA 4RTPA 3OOSA 2UVQA 5CLIA 3UWPA 3EVFA 5DX1A 1U3WA 2BZGA 3INGA 4G9EA 2G9NA 4ZMRA 5A5GA 4LJ9A 5AW2A 2O0JA 3IPXA 4RGYA 4JA0A 5CVVA 4DVGA 5JUWA 1II8B 2A9RA 1Z7EA 1QPBA 4OQMA 2YXBA 5E3IA 3DW3X 1NXWA 1A71A 1OXMA 5J5AA 3UAGA 1A50B 2O06A 4WKOA 3WMGA 1KC3A 3B7WA 2R8ZA 4PCUA 5HPYB 2WU3A 3VYTB 4NULA 1DAEA 3TR0A 2NO4A 3R74A 3W77A 4N0MA 4UE3S 2AOUB 1KI1A 3CA8A 2B2CA 3JYHA 2IYOA 3R5TA 3NRJA 5JYCA 4K6FA 2JHAA 1J70A 4YMIA 4N3BA 1PJRA 1I3KA 5FEUA 1A0OA 1G6OA 2QPLA 2QTFA 5ECGC 5IP5A 1THTA 2PS1A 3LHDA 3NT4A 3L2OB 3VH4A 5JNSA 3HE3A 5HJ5A 4LZJA 4DNXA 3PR3A 3R5SA 5LYYA 1GA4A 3A10A 1QIHA 3X1YA 1KSJA 1CY2A 3RT7A 1K2WA 1JECA 2I7TA 4IDBA 4AJLA 3IOMA 4JI5B 3I9V1 2X0DA 3PR2B 3R3VA 2NVBA 5THXA 3RFFA 3ZCQA 1MNQA 5LWHA 4RHYA 3QPCA 1P17A 3M5WA 2NO7A 1N32B 5FUBA 3T4EA 2PSJA 3STWA 4DQDA 2ZYGA 3IYLW 1V41E 1CUSA 2DP4E 1TT5B 2YQ4A 4XW2A 4X95A 3DDOA 1GG8A 3LVFO 3HJTA 5CM2Z 1S2IA 2WSSA 3DGFC 3TRJA 2FX2A 3QZUA 1QORA 2QD1A 4JH0A 4GKAA 2ZQ5A 3HEMA 3U7QA 3AF1A 2P9ZA 2FPSA 2UUBB 4XQ9A 3TLGA 1T1JA 2F3RA 2H1IA 1SVNA 1Q6YA 1NXSA 2V7TA 1NQOA 2FCRA 4LY3A 4MROA 3CUUA 4BEWA 1HL7A 1X1CA 3OO1A 3P94A 2A3RA 4ZCLA 5TIIA 5EE5B 4RF5A 1YJ8A 4Y6GB 3ELDA 1VPEA 1L7BA 3A6JA 1RABA 2VF7A 2VPYA 2J3KA 5TQ2B 5KYWA 1CVLA 3DZIA 1CNMA 4GWKA 1TW2A 2CDBA 3EB9A 1VA5A 3B82A 3FM9A 2QZ4A 2X8JA 4KBYA 4O2RA 3WLPA 2NYRA 3GWGA 3CRQA 1XAIA 4ND3A 3IQGX 3FNEA 1E1MA 3QPBA 2YS6A 5B1IA 1VLLA 3R7WB 2RC5A 4U02A 3E35A 1T9CA 1NWCA 4Y2XA 2F59A 2O7NA 4HDQB 3QELB 1TF7A 5EOVA 5E8JA 3RYCB 3OF2A 3R3XA 3GGCA 1DAIA 2DFVA 2I4TA 1E9VA 4P93A 1CJCA 4Q9NA 4YYZA 3PXCX 3OSZA 6LDHA 3AB7A 3KQMA 3A0UA 2JAHA 3E0XA 4A6DA 3FTNA 4CMHA 4B9AA 2JFGA 4DLBA 4JSYA 4OIMA 4QD3A 3ECSA 4K0KB 1AZSC 1CUIA 1J0BA 2IDZA 4AQDA 1C0EA 5EXEA 3VZBA 1I3MA 3D2AA 4AKEA 4PZAA 1T0IA 1JHDA 2CJPA 3B52X 3LDFA 4ZO4A 5FT9A 3OUUA 3TZQA 5IX8A 4N12A 1Z25A 2ZULA 3TZEA 3EOBI 2XQVA 4H1VA 4IW3B 4TTQA 1A98A 1D5WA 1CK4A 3FRJA 3I8OA 3FVWA 3GFFA 1XB2A 1N4AA 4XB6B 2HRBA 5JEEA 5JS6A 4R1LA 1OXTA 1E5QA 1RRVA 3ESXA 3N74A 4TT3A 1SBQA 1XLWA 4YCBA 1UKBA 5I7EA 2A9VA 1ZSYA 3A6ZA 2VP0A 3KZXA 3OETA 2BT4A 2ATVA 3MWDB 4G0MA 3AXTA 4NC9A 4KQHA 4QBTA 5BSVA 3F6RA 4PG4A 5EJ8A 1MD9A 1HR0B 4Y1EA 1OXBB 3P96A 4NCKA 1U7PA 5CAEA 5H4GA 1OH8A 3EIOA 3MLEA 3VKUA 3F7MA 1C4WA 2HRZA 1DO8A 1R10A 2JEZA 3CMMA 4IILA 4YJGB 2P8SA 1BHO1 2Y1OA 5BSGA 3ZHOA 3NTQA 1KAMA 4NU0A 4W6QA 3TYXA 1SC1A 4DILA 3HA3A 3R9XA 1RLUA 2X76A 2J3LA 1I5EA 1BMTA 4GGOA 2H4JA 2KJQA 4GEKA 1QWOA 2VA9A 5D2CA 2BUAA 2W2VA 1EX1A 5EWLA 3ON5A 5JDCA 1AD2A 1OX4B 2A30A 2P2LA 1D6SA 1FP4B 1G3QA 3EISA 3FD8A 4JMPA 5FA5A 1K8QA 4FIDA 1YDFA 2F3PA 1T8SA 1LGYA 3G2IA 1W2WB 3VSEA 1SBYA 3IPAA 4QYIB 5TGDA 5A4IS 1A96A 3LA8A 1QNFA 4PV7A 2EGGA 4ZZ1A 5IABA 5M34A 4RV9A 1FTGA 3IAM1 4TSRA 1RD4A 3G2JA 3TXAA 3EG9A 5FOXA 2AFIE 2BGKA 1FDUA 1JYSA 1D3AA 3E3OA 4P22A 4PN3A 1K5PA 5L8VA 1EEXB 5LPNA 4WKBA 1SCJA 3DMTA 1XTZA 2NTVA 3PQ6A 3NIWA 4CHGA 1IY8A 1KKLA 1TD9A 5BYBA 2QROA 2N9UA 3JXEA 4G9GA 3ZIAD 2QMUA 2C59A 4HRAA 1KBOA 3L6CA 4I5GA 1JKMA 1MQSA 2FR0A 1NJSA 2JGRA 3AWIA 3F3KA 4PLCA 5GY7A 1ISPA 2VH2A 3CUKA 1H1TA 2OEPA 3DXYA 2VZ8A 4RY8A 1Y6FA 3NI2A 3T3DA 3WAGA 3RIGA 4UMEA 2NUTA 4DLYA 3HFRA 2GEUA 2PGDA 1EBFA 3O4GA 2PBLA 4LI0A 1X92A 4MHOA 4RJJA 5CGZA 3TB4A 2VDVE 3CF4A 1I0ZA 4K9QA 4DMFA 1NV9A 4N0QA 2R4TA 1V96A 4LUCA 4QARA 2Q6LA 5BSKA 1Q3HA 2ZW9A 4CPDA 1NOKA 1HEIA 3STVA 3K1TA 3ADBA 4O2AA 1L8QA 3BWDD 2P77A 1F4LA 4C6TA 2QENA 3VHLB 3B12A 4UU8A 2W58A 3FMVA 3ZZMA 4ARUA 1LK7A 4G0ZA 1JAIA 2OG2A 2QJOA 3G2QA 4PANA 2V7XA 2ZI6A 4YUVA 4KIJA 1L9XA 5DWVA 2WU1A 3STXA 3T9AA 3DXFA 3M3HA 2IZ1A 4HMPA 2FMHA 3CUTA 1MO4A 1GU1A 1C9JA 4NR0A 4IMIB 1P2UA 1LS6A 4NH0A 3U7RA 5MGNA 3IS3A 4MR7A 1PSWA 3KPVA 4A73A 5EZYF 3TSYA 4JLUA 3IO3A 2DUUA 3DBVO 4CNQA 4Q02A 5THKA 4TYNA 2OGZA 1IBLB 4A4DA 2IS2A 4XZ3A 4PLTA 1XZQA 2HMAA 4HPXB 1JQKA 1EWKA 2G5GX 1YUNA 2QAJA 2D8MA 2QYSA 3BIOA 4RU1A 4DUGA 1Y1KE 4EHHA 4IS3A 4X6UA 5ABPA 3PYXA 5K01A 3HHPA 1G6Q1 3C2QA 4F21A 3CONA 1U8AA 5C8DA 4FMBB 4IXNA 1LLCA 3LPDA 3OEWA 4D8UA 1H8HD 4EA8A 1DKPA 2DUNA 3OJOA 1A8PA 3F7NA 3DBRB 4KH1A 2PXCA 1EUQA 3OMWA 3PNBA 3TJRA 5JXGA 1T5DX 1OTHA 4W9NC 1U0HC 3A4LA 1LBSA 1XNJA 1G5IA 1E1DA 1RYNA 4N48A 4YT8A 1BRMA 1OW3B 1V2HE 4BQNA 1XWWA 1XVAA 4DJJA 4Q1VA 1KK1A 1QIKA 3B9RA 4WLOA 2Z2XA 4MQBA 4HFNA 3I04M 1N5KA 3DLTA 4Y1RA 1JU9A 2HQ1A 3WKAA 2FSGA 2I6UA 3AHDA 4PRKA 4QREA 4DYVA 9MHTA 1P5HA 1T1EA 4X7MA 2OQRA 3EMDA 5E7JA 4ZVQA 4PQGA 3RIMA 3U13A 4LC1A 2YJ3A 3S55A 2A57A 2UVDA 3TMKA 3UA3A 4ME6A 3UMGA 3NBXX 4DAEA 4B3MB 1H0SA 1N1EA 2MIIA 2HA4A 1ZN7A 1CLUA 2QU8A 2R68A 3LLUA 4NOMA 4B6GA 1A9OA 4OUKX 3TZLA 2DCMA 3D81A 4RIEA 5T4FA 4CLRB 1QF6A 3A9UA 4DTCA 5DN9A 4C78A 2WD9A 1PV1A 3BPSA 2I6QA 4FTWA 3U61B 3O83A 1PS9A 3EXFA 4FGSA 4M36A 3UOAB 1XTUA 3ZGLA 4ZJPA 2XVYA 3HG7A 4LK2A 4XWWA 1YO6A 4G4JA 4LF6B 4NPCA 4QTXA 1G63A 1V3TA 2Q9BA 3Q0TA 1AIPA 4OMDA 1SOVA 5CH8A 1AUXA 3RCBA 3C3EA 2VHUA 4U4AA 4BMOB 3U0BA 2WAMA 3QU4A 2ZE6A 1Z5UA 2BBTA 3QVKA 3G49A 4PBSA 1GQOA 2QMZA 5I5GA 4QYMA 3UCEA 3NBZC 4AZTA 4WZBA 2YMQA 4ZVVA 4QQKA 3U19A 2GJ9A 3LPLA 5EVJA 1EH5A 1WSWA 3FHOA 5SZHB 1MPXA 1VHQA 1I3OA 2Z95A 4U39A 5H81A 2DBQA 3KELA 2QN2A 5F5NA 1VIAA 3ETJA 1GTSA 1S6YA 5EMMA 5LM3A 5EJIA 5I4KA 3N8IA 4QZVA 1N5RA 1ZXBA 1JLRA 1G5HA 3BHNA 4IJKA 3PD7A 1Z2CA 4E03A 2PWAA 4HXEB 3GUVA 4GYJA 4RSHA 3RLIA 3RK0A 1YE8A 3ZIAA 3SM9A 1ZWKA 4R2KA 2H29A 2DH6A 1YIOA 4R8MA 1X1DA 2LCIA 4LOLA 1KE2A 4UBNA 1KGSA 4AMZA 4YRPA 2CSXA 1LPAB 3DHEA 4IZOA 2RAPA 4ROSA 3S40A 1Q0LA 1YDEA 1E66A 3HP4A 3NFYA 8AT1A 3QP9A 2HHHB 5GJCA 3RR2A 4G5SA 5JCXA 4QGAA 2AC7A 1NRJB 2XCLA 1B00A 4HH0A 1YL7A 3BQMB 5EE1A 5BV7A 3PJFA 3Q7SA 3ZE7A 4ERNA 4NJMB 3GXOA 5GONB 4TKZA 2P3OA 1YTLA 1T4GA 4LZPA 4JC4A 4BVLA 2XRYA 4OK6A 1PV4A 1VB5A 5BRAA 3QPVA 1Q50A 1YB1A 3FYSA 3I73A 4L57A 4ZO6A 4C4YA 1QH1B 1SKAA 2XMGA 3RK1A 4UTNA 2C4NA 1OH5A 3IIJA 3WRWA 1JF8A 2C3UA 4ZQIA 5CW2A 1P7VA 1S2MA 2EKPA 2NO6A 2F1IA 3BULA 5D51S 3RDPA 3H97A 4HDSA 3ANLA 3PLNA 2OXRA 1M73E 3UYLA 2CXPA 2J3HA 3K0AB 4F45A 5HRAA 1ETHA 2XMSA 3HB0A 2H59A 1VL0A 2Q1XA 2FWAA 5HJ7A 4YYEA 1MJFA 5AICA 3VTKA 1WXDA 3SC3A 1KDPA 4FCWA 1LSJA 1U2QA 2PBFA 3ZCSA 4NCAA 2YJNA 4EP1A 3I62A 5J4YA 2DULA 1Q7BA 4DZZA 3FVQA 1WZNA 2O23A 1UZMA 2CMHA 3R9KA 1YUMA 4AMYA 4FFNA 1MVNA 4NZOA 4CFSA 1SB9A 2A9FA 3G7NA 1VLZA 3LP6A 3TX2A 2C83A 3UN1A 3VVLA 3WB9A 1H8HA 2FSSA 4N47A 2YXEA 4KLRA 2QOEA 2IGTA 2C0QA 4YT2A 2QLBA 1R12A 3BHMA 3MUEA 1XUOA 5KWIA 1VOTA 4B5KA 5DCWA 4ZHQB 3COJA 3ZD9A 1O95C 2V7BA 2AG5A 1H5NA 3D0KA 4GH5A 2J08A 2ZJ0A 2VP9A 1TFUA 4W6ZA 3U7GA 2HPVA 3ELWA 3PRHA 5IYZF 1NNLA 1DC3A 2Q0XA 2VBFA 5BWLA 5KREA 1XEWY 4D6YA 4D6XA 2R8RA 5GPBA 2JG3A 2ARKA 5L3QA 2GN1A 4Y2TA 1E61A 1KEUA 3ELYA 3R8FA 3BTOA 4R68A 1KXZA 1BKYA 1M1YB 1HO3A 1NLZA 3F4KA 2VHCA 2XUQA 4RQTA 2XWPA 4DTIA 1CT9A 3B3QA 4QT4A 5HIKA 2KBFA 1NL3A 1UXOA 2BJHA 2IPMA 1AQ6A 2X1LA 3Q3HA 3H5NA 2FQYA 1G291 1J2EA 3PFBA 4OB6A 1EGMB 2DUMA 3IR6A 4DMKA 1L8LA 3KB8A 1GGKA 1FPMA 2ID9A 4QECA 2YMMA 4KEAA 1CZLA 1GTL1 1BDIA 4B79A 1PQ4A 4D82A 2PG3A 3TD9A 2GZDA 3R4VA 4YJDA 1X8JA 3UWSA 5CK4A 2EYQA 5C37A 5ALMA 1Z74A 4XJXA 1D2CA 1DL5A 1WWKA 2A7XA 3BGWA 1T9DA 4KQMA 4R1QA 4EBBA 1YRWA 5J43A 5KNLA 1O0CA 3PXBA 1K3FA 3FZEA 4URWR 3UK1A 1QNLA 2XVAA 1NONA 4P0TA 3V8BA 5B2EA 5KHLB 5KYNA 1UP4A 2HDHA 3MJHA 3FBTA 4BVEA 4N82A 2ONKA 1LLQA 3EDYA 3JD4A 5F23A 4YIKA 3LKBA 4CM5A 2YDXA 1PCXA 1PJ8A 4MVJD 1IBMB 3DE1X 1Y1LA 1Z7YA 4QQ8A 1W0JD 5I9BA 4YRGA 3FOEC 1G42A 2WT4A 3X0DA 2ZJ6A 5GVSA 1XBTA 2R8OA 1O3YA 1ULBA 3L18A 1KQNA 1NW8A 1BOOA 2BRUC 2H16A 5HCNA 2EV9A 2ALJA 2XUKA 4DC0A 1J2TA 3HMQA 5JIBA 5CFMA 2PYZA 2Y71A 3CXRA 1A9ZA 1C3OA 1GKLA 1KQ3A 1P91A 2B8WA 1NMSA 1LPMA 5HNKA 3B1KA 3JASA 3OI7A 1K5GA 1N2JA 3RABA 4TVOA 3RWOA 1QHHA 5B3AA 2ZOSA 4MYCA 2YH2A 3A37A 4IJQA 1UWKA 3ICOA 2QDXA 1GGFA 2L17A 2VQEB 1L6RA 4HNQA 2GJKA 2FU5C 1IXYA 1X9HA 3R77A 3KT6A 2QR3A 4MW7A 1CV2A 2IXGA 3OFSA 4GS5A 2AN5A 3DEJA 2VHEA 4PYMA 2KHZA 1X7YA 4TTSA 3VDMA 2ZYSA 4DR7B 1DO0A 3TO5A 1XLTA 2KLBA 3CQ9A 5ALNA 2OUKA 1C0IA 4FX2A 5KKCA 1MX1A 1L6IA 2FKAA 2RB4A 3DHVA 4IXMA 1MVOA 4WA7A 1T8PA 4KN5A 3ZEAA 1FX0A 5IEBA 3NH6A 4BO4A 3U7FB 5AIBA 3T3NA 1II9A 1Q1ZA 1BGVA 3I4LA 1PK9A 4P4UA 2R25B 4WK2B 1JH9A 4QDUA 4CM4A 4E07A 4H1WA 1P0CA 3TAXA 1Z16A 1O58A 1I33A 2PX5A 3W6NA 1QAMA 1JEDA 1FK8A 2X7JA 3E9CA 2I4MA 2IF0A 4YDSA 2XGGA 1SXHA 1HZZC 3KLBA 4M9QA 3RU9A 1YASA 3F3MA 4YMWA 1WD7A 2I78A 2PSFA 5CYFA 3VDXA 3ICVA 4D43A 4RZQA 4GMDA 3PJGA 3DLHA 1PGOA 4OHMA 2XA2A 2X1MA 2QZZA 1Z5WA 2FRDA 2W0SA 1QHXA 3CUYA 2D59A 2IX9A 1UPFA 2JCXA 4PW0A 4QUKA 3TLGB 2C96A 3U7QB 3ZWNA 5BSWA 3NHJA 4DSOA 5DYIA 2Z4TA 1TGYA 1U2TA 2CCKA 5K0EA 4EFKA 3FKSD 3MRSA 1H5UA 1JN0A 2CBZA 3HKDA 3NS7A 4IS2A 3VMFA 3HA7A 4W1PA 1KWKA 2OV4A 1TPYA 5TPWA 1E4VA 5A05A 2GCPA 1AC5A 4J7AA 4WIAA 5KYWB 2IT1A 1R0RE 3ZDZB 2OAQ1 2X8JB 2PD3A 3DNFA 4KSYA 2QTLA 3DPSA 2ZRQA 2D06A 2JARA 2WUEA 3OA0A 3P2OA 4PG7A 4WXPA 1NVDA 2PHZA 3OE5A 4H6WA 1DFHA 1L1QA 1U8YA 3KEGA 1MB2A 1Z6TA 1C9DB 1Z15A 2AE1A 4P54A 2G17A 5ARDA 5IM4A 2NO0A 4MKFA 1YL5A 3ZWAA 1GTG1 2QAIA 4AXBA 2ROQA 5BVHA 4UNNA 2CN1A 3MF4A 3OD5A 3RS2A 4V0MA 2ZANA 4CIDA 1QH8A 4IVQA 3IDFA 4ABTA 1UBNA 5AH0A 5HBRA 1P2SA 1WDKA 2GEKA 1JDBC 1KO1A 1P2BA 2QUJA 5CX1B 2XYHA 1MQAA 4DA0A 1DX6A 3UHOA 2Z9DA 4ZT4A 5EZQA 4G84A 4AF7A 2HO4A 5B1SA 4AX4A 1QKJA 3GFSA 3G9UA 4BY9E 1JFSA 1RYBA 5F52A 1OZGA 1PVDA 3A4YA 5I8PA 4K9NA 2ZIAA 5HR5A 2OZKA 3GCGA 3RADC 3WL8A 4BFUA 2UYYA 1PWEA 5BSTA 1E3JA 2V4ZA 4IVNA 2GVZC 2BHSA 1J8FA 1P2GA 3BORA 2ZK7A 3COPA 3DO5A 4BRZA 3K6KA 4DLTA 5K05A 2XGOA 1EG2A 3Q0EA 1UPTA 3H0EA 1O97C 2PZ8A 4FCCA 1YC2A 2H1SA 4Q1DA 1QRSA 1EX9A 1NZJA 1TM7E 2GKSA 3FAZA 1E7MA 3UT6A 1NJ6A 4MVJA 3WI7A 4MI9A 1XPUA 1TZ2A 1LLDA 3PGA1 1RRGA 1XAHA 5CYPA 2ODTX 3SHOA 2ZDQA 4E0BA 1YVEI 1KR5A 2ZREA 1JHMA 5EEHA 3V4PB 4V2IA 5EINA 5CAEB 1OB2A 1KDYA 4OA5A 1V48A 2DKOA 2EJCA 4N49A 5HDQA 4KSCA 4INJA 1E63A 2QRLA 2O0KA 5DP2A 1W9HA 3TQOA 3MN1A 3KCQA 3WO0A 3T0IA 3FPSA 3L0CA 4JASB 2IY8A 5LQMA 2WT8A 4IVRA 4C05A 3EBOA 3KUUA 4Z4CA 3UHAA 5FJJA 3GDGA 4F6CA 3BBPA 4QFMA 1S4QA 2BV3A 5AOCA 3UJ6A 4A2PA 2IEAA 5JS8A 3QPUA 2C8JA 5EWLB 1AMUA 4WUTA 3IRUA 4M1EA 3GZNA 4LJ4A 1UBLS 2C4UA 2XQFA 3TUJC 3SYTA 3ZV5A 1W6UA 1JQEA 2AX4A 2WVAA 4Y8VA 4F0JA 1H2XA 4QLOA 4YJ3A 2J07A 3PIDA 1ZI8A 4PPFA 5F2NA 1E9FA 4F46A 3BMQA 3RS3A 3SZLA 5B64A 1O9HA 4ZVRA 3PUHA 1UK7A 2A0XA 1N9KA 1IQPA 4EZEA 1OILA 1DV2A 4M7RA 4I6EA 3EG9B 4Q19A 1E2GA 1JWAB 2HYDA 4HI0E 2HIHA 4TMXA 3HJHA 2J30A 3CG4A 4P08A 4AT1A 1NM5C 1R00A 4L74A 3JZDA 1H2RS 1XWIA 2Q07A 4HRYA 4ZCSA 4JOSA 2IE0A 3E1GA 1QVVA 3A6HA 1M9NA 3SS7X 3WWYA 1X80A 4XUDA 2GA8A 1DBSA 1SQGA 2CD7A 1ZP6A 2X0JA 3EZYA 3B2NA 3NYQA 4MVWA 4AUNA 2YCBA 1SHZA 4QUHA 3BHIA 2X4GA 3IAFA 2ODBA 6YASA 1Y7LA 2QAGA 2E4UA 1D8TA 2O1WA 4G01B 4HLNA 1GZSA 3EIUA 5IZ4A 3P0JA 1YONA 3UB2A 4Q9JA 2NUTB 4OHVA 4J6EA 3KJNA 4GYWA 3T54A 1ESNA 3F6PA 4RK6A 3UZUA 4FNOA 1SPBS 4FN4A 2YJ6A 4RFSB 2PKYX 3EWIA 3QENA 4ALLA 3KAJA 2ZAMA 4HS4A 3O73A 4B73A 4H7EA 3DDZX 3L79A 1KFEB 4GXNA 1G7TA 1PR0A 1PS0A 2OBLA 3OM9A 4O2AB 3R3HA 5L9AA 4WAUA 4C6TB 3LSYA 4JZKA 5BYAA 1DBPA 3N59A 4MA0A 4AN1A 3FKSA 5LZ4A 4HAUA 4N3GA 1DQYA 1C1YA 4XFDA 3OIFA 4NYMQ 1CQIA 3O8BA 2WG2A 4A5SA 4HN9A 1KJWA 4OKSA 3RC2A 1PQYA 4MR7B 5M29A 3ZTWA 3WDSA 4MITA 4DCNA 5JO9A 4C43A 2CWWA 2DWQA 2J5RA 3T5CA 4RFLA 3BEOA 5JSUA 3QXXA 1XHFA 1SVWA 3MHPA 1JIVA 2GRUA 3OPNA 2W6OA 4ND1A 3UANA 1QHIA 3UGTA 1X3SA 3RWBA 4BKQA 3GLUA 4ZVNA 3ZE0B 5JH7B 5DN6D 2O52A 1MRNA 1OXXK 1LBEA 4FJ0A 4EMTA 2ODNA 1KZ4A 3GJRA 2BFPA 2Q3DA 3QF4A 1SUEA 1ZNZA 3IO5A 3T1TA 2P5TB 5FPQA 4XLLA 2AX3A 1J99A 1NYQA 4OTZA 3FI9A 3JQFA 1L1RA 1U5BA 2LPMA 3CLTC 4JIGA 4BNTA 4LWQA 1F4VA 3RRYA 2BF4A 3K8ZA 1XDUA 5CX4A 2YJ4A 2YIMA 4PO3X 4Y1RB 4L5IA 3HXOA 1T6BY 2HXYA 3PKZA 5JJIA 2OP0A 3EX7C 1Z17A 1IXRC 2CJXA 2WQZA 1N36B 2G8NA 3JD3A 3KVYA 2ZIEA 2BISA 5KC9A 3AF0A 4DLNA 5JXHA 2ASEA 2WAYA 4OM8A 2QWXA 5HE8A 2HNBA 2ZRJA 2UUCB 5EEGA 3B1XA 5TT1A 3HY3A 3BF7A 1CC1S 3KT8A 1P77A 3GFOA 3P9SA 1W25A 3PQEA 4JELA 3T7TA 1CERA 1AN0A 3ZV6A 1W5TA 5HQTA 1Y1SA 1R66A 1UZUA 2BONA 3HY4A 3WLRA 2GN8A 2HIGA 3EXFB 2A9KA 3EZ2A 2AZTA 5GZ6A 3JD2A 4NHEA 4NZNA 1XEWX 4I4CA 2V7PA 4EG7A 5AK5A 1WABA 2JZOA 2XD4A 4LVOA 5EMHA 3SWWA 3O2SB 5FOTA 1T34A 4MCIA 3TFOA 1E0KA 3NPAA 5CT5A 4EYOA 3I52A 5AIAA 5KWSA 1ZUIA 4X0EA 1SKQA 1J42A 1UOQA 1PFGA 1XEXA 4REQA 4WZBB 2JIMA 5FQOA 2GKGA 2B4TO 4LNUA 3OFKA 4P4TA 1FFBA 3NASA 4BIMA 2PU5A 5JZ9A 4LJ7A 1HPLA 5ULLA 1N2IA 3ACBA 4ZA2A 1TLFA 1I6LA 1IN8A 1Z3CA 4CT5A 2UKDA 4QUIA 5TMPA 2F4VB 4R1UA 2QLTA 3QBTA 2O2JA 2VP6A 1OWPA 8LDHA 3FMIA 2GHRA 3U4AA 3C6XA 4LNAA 2H5IA 5C31A 3EMVA 2GAFA 1Y3AA 2B9EA 3GD7A 4FQ5A 1JDNA 4HAYA 1C41A 2PZKA 2XEXA 3BH0A 3EXG2 4CEJA 3IP5A 3W5BA 3QXCA 4BNDB 3O93A 3F49S 2PSHA 2F2TA 5AXAA 1TX4B 3H7IA 4ARAA 1VMEA 3RKUA 2FEXA 3VRHA 3F78A 1B0ZA 4YUWA 5KTSA 2JLYA 3T7IA 3SSOA 4ER7A 3D4IA 3PX3A 1U0FA 5LL6P 4F3YA 1XGKA 3FLEA 4OGFA 1CUXA 4PZPA 4CL2A 1FFWA 4CKEB 1NRIA 1C80A 2W2LD 6Q21A 4B6JA 3BILA 2GBGA 1KVQA 1Z8NA 3WGIA 1IK4A 1ZUWA 3T1HB 4I50A 3GJ7A 4TYYA 1IC6A 5K0CA 3CO0S 3I2GA 2VSXA 3I39X 1FS5A 2JGDA 3TJMA 4HDSB 3BAFA 4XRGA 1PE0A 5AKIA 1MHTA 2IXBA 1LK5A 5HMLA 3H2IA 5IDYA 2IHTA 3I9FA 1VE1A 3Q7TA 4MX8A 4RVDA 1O6CA 3EAFA 2YVQA 4RSMA 5ETJA 2WOOA 4B82A 2G0NA 3OURA 5DNVA 3BMOA 3MTQA 4KXMA 2O0MA 1G60A 4G4SO 2X41A 3M1IA 3ETCA 4I4NA 2I34A 3ANTA 1QB8A 2JAUA 1R0BA 5DPMA 5IBPA 4BNWA 2ZT7A 1NOJA 3T12A 1HRDA 3FXAA 1ISJA 1ZD1A 4DABA 2HA0A 2NSHA 3B6IA 4DGQA 4GT1A 2VDWA 3R7LA 3JQ9C 1DRWA 2XCSB 4PPYA 4D92A 4KNVA 3L7BA 3F8WA 2G1PA 5I47A 4C6HA 1ESZA 2RARA 1DWOA 1PL6A 3AF4A 4MK4A 2HRQA 5IMBA 1I13A 2Q3BA 3U9SA 4PZ9A 4UBKA 3K7EA 3AR7A 1N3BA 3VYWA 4E14A 1EE1A 2B0CA 1W4ZA 3OTWA 1GUDA 5KNDH 1XPOA 5LJIA 3OC6A 2WV7A 4FYPA 3RSGA 4U9UA 1U9JA 4JHXA 1S2LA 1MOSA 1NUQA 3Q12A 1YVUA 2N1MA 5CEEA 4HADA 5JAIA 1T10A 3TNLA 5JY6A 2Z5VA 4XX0A 3NM6B 2J5KA 2RIPA 3ONFA 4IKPA 1CZKA 2PGIA 4I08A 4CL0A 2RHRA 2I3BA 1FXWA 5KJ6A 4IDOA 3WQRA 1LUAA 5I4CA 1ZHHA 3HJBA 3LCRA 1J33A 2HDNB 3KZ1E 4FC6A 1V3VA 2XYPA 2REOA 4UKDA 2WEKA 5AM5A 5EC8A 1XCOA 3T3HA 2WYIA 4AMBA 2IP4A 2PKCA 1O0SA 1DLJA 3FYCA 3OPMA 2W42A 4KI0A 3ACDA 4IL5A 1NP7A 5JBNA 3WWPA 4BQIA 2OAEA 1GNQA 1A5TA 3ENZA 2C9YA 4LN1A 5I3CA 4PGFA 4ARCA 4XQEA 3K1ZA 2BBOA 2ZRFA 1PN3A 3L8CA 3R0QA 1OBCA 5DMHA 4URXR 1QKKA 2Z2KA 3JAWA 5K4GA 4C0HA 4II7A 5EQFA 4FLEA 1SXJD 1J39A 3A27A 2JHPA 3DJFA 5J2UF 1SB8A 1WUIS 4K2HA 3QMWA 2QG9A 5GTDA 4KQGA 3WLFA 3I3SR 1W5AA 1I1NA 2V65A 2XUPA 4PTLA 1ZIDA 4J29A 4RA9A 3GVPA 4IRXA 2FQWA 3BXHA 1O97D 1RFGE 2EG5A 1QBKC 4O4IF 4TXMA 3SDSA 2C97A 3CUWA 3I1IA 4MI6A 5KYGA 2B21A 3BUSA 3FUVA 5B4VA 5LR6A 4DADA 3KKLA 1XZHA 1XQ6A 1P4SA 3BFKA 3VDQA 1Y0BA 2C5FA 2PCLA 3EXIB 1EMDA 3LC1O 1W36C 1HNZB 3CY6A 1GDHA 1S89A 1SOMA 3DOCA 3EODA 4LVUA 4RE5A 1Q1GA 3FIJA 1C3OB 1U28C 2D5CA 2H5EA 1KU6A 1QVWA 5DI3A 4A23A 2V1UA 1RM4A 3HUFA 3JASB 3KUDA 4C3UA 4LV6A 4LV5B 1I6MA 4YRNA 4G8DA 1QHHB 4G6ZA 4B7AA 2V0CA 3S29A 4J2HA 2HTFA 3COSA 4ZOBA 1L0BA 4JGIA 5B3JC 5K3EA 3BAZA 4TQ9A 1HDEA 2HWWA 2FUG1 2WIKA 5AXDA 3I92A 1LTKA 2ZUBA 4JI1B 1OLSA 2Z2JA 3FNIA 1NQVA 3I4FA 4ASUA 3MT0A 1GUZA 2ZE7A 1URPA 3OU6A 4RDIA 1X7YB 2W2LA 1P5FA 1PW7A 1XDZA 2FSPA 1JQ3A 1NX9A 1Q0PA 2YY6A 3NATA 4KP7A 2XMQA 5J5CA 4WTOA 3D3EA 2CB0A 4E2XA 3ADKA 3CKMA 5DM60 5KIAA 2C2OA 3OOYA 4PLHA 3F46A 2AQ8A 2FP4A 4EZBA 1AO3A 5HG0A 3WBBA 1FX0B 2EZ8A 1D2HA 1EXDA 5KINB 1VP3A 2X8BA 5IU6A 3LLVA 3HVKA 1KPIA 4BZZA 1IATA 2BE7A 3GRUA 3PJEA 4G8BA 3VVMA 2Q2QA 3NHYA 4CM4B 4BEBA 2QQ0A 3IDZA 4B84A 4LFAB 4KE8A 1D2MA 3O9MA 4Y6SA 4FUTA 4L8YA 4RSGA 5MN4A 2FN8A 3BWBA 1XX6A 4S1NA 2SKCA 1ACLA 1J9GA 3DQPA 2G83A 4TTRA 1CY0A 3A04A 1PR1A 3ZHRA 3WTBA 1HZZA 2CVQA 1VB3A 4HWGA 4UARA 3EXHA 4X66B 4YMHA 3LGAA 4KGVA 3CV3A 4LYYA 5C5DA 4B3SB 5ESRA 3A3KA 4JR2A 1I2DA 3R8XA 3CTMA 3G2OA 2FSVC 1USVA 4B3DA 4ENWA 4G1MB 5E4JA 1U7HA 2W2QA 2FZLA 1QX3A 3GWZA 1HDGO 4ESOA 1HFKA 2R6AA 3PFGA 1JI0A 3AIOA 3HKDB 4JUAA 2W70A 2TMDA 3PQ7A 1CS4C 5LDDC 2C07A 1Y82A 1MOZA 5TPWB 3RVJA 2IEGA 3H1TA 1ZNQO 4C06A 2PZFA 2JVJA 1RJFA 5K3BA 3JVVA 2O2SA 4C4ZA 1A9YA 2HK6A 3HP1A 5KQMA 4WNAA 1EA5A 4R5HA 1YCDA 5ICEA 1MF7A 1GGHA 3LNCA 4ETNA 1WUKS 3Q1KA 4W5OA 3VR6D 3E15A 5HBGA 1F1JA 3QLVC 5BVHB 2HWUA 5IH3A 2JAOA 3LBNA 1ECBA 3AOEC 4X6LA 5GAJA 1QH8B 5DU2A 1PFKA 3IMFA 1XIVA 3AHIA 1MJGA 1BX3A 3EZFA 1BXKA 3FPAA 4QGHA 3BDIA 2WUWE 4DA9A 1QIGA 1ZY2A 4LFBB 5F1PA 4FYXA 4US0R 2RONA 1SUSA 3ZVMA 4XEUA 3DFZA 2J7PD 4JYPA 3AEZA 1SXJA 3MPOA 3N0VA 2DFKB 3HN2A 2NXNA 1WB9A 4CV0A 5JWOA 1MFZA 3QA9A 1B0AA 2DKNA 2WTMA 3GEIA 1ZSVA 1WVIA 2EARA 4DCCA 4C20A 3CLTD 2O2YA 3VUFA 2ENWA 3HUTA 3V8MA 4AWXA 2PUBA 1FMTA 2BM8A 4IDPA 5DGCA 3RV4A 3LUPA 2I3GA 3DFMA 5FPKA 5E4FA 3N28A 4J7CA 1PSDA 1I24A 3DCIA 5KPJA 1DRJA 4HG2A 3RLFA 4MIYA 1BVHA 5D86A 3H9GA 2V7QD 3WA7A 4TMWA 4RXTA 4LDZA 2VHWA 3WRYA 3OWXA 2BUCA 2GT1A 3D3KA 4HLUC 4GSKA 2ZYWX 1RJ9A 3B1FA 5IAJA 3PXXA 5MF6A 3PRKE 1NDUA 3TF5A 1QE3A 4C6RA 2FX5A 1OROA 4PYIA 1YHNA 3BD6A 1RPJA 3HA5A 3ZWMA 4FS3A 2D00A 3DQQA 5A4FS 4QGGA 5AHWA 2WM8A 2PS3A 4JY7A 5IG2A 1OE0A 1W36B 4PYLA 4LE1A 1Y7PA 3DAGA 4EFMA 1OU0A 1R9JA 3A58B 3GZNB 1NVKA 4JDUA 5ICMA 4HQ0A 5KTOA 1NMZA 4IAOA 1T2EA 2G6BA 3MCAA 1YJAA 4IVPA 4YJ3B 3UJ9A 3FE2A 3RFVA 3JVEA 4Y7DA 3BMQB 1Z2OX 4N0DA 2VT7A 2OFOA 3KOZA 1X8XA 3DLPX 4IJWA 5BNFA 3ZHUA 4KDFA 1M6HA 3FF1A 2G28A 3I45A 3GELA 1IRIA 3W9YA 2VTVA 3C3XA 2V4MA 1PZGA 2QN7A 3EVGA 3A9CA 3O2NA 4JLWA 2VAXA 5E9QA 2V6FA 3A6PC 4CM8A 4JIMA 4B4DA 3NEAA 3WBKA 1I1HA 3JD1A 1BJRE 1VHJA 4K26A 1M67A 3AK4A 1EPUA 1MT0A 1X80B 4A5OA 4QOIA 1XD9A 2Q5HA 1TO2E 1B14A 3E22A 3HO6A 16PKA 1Z5GA 3FPEA 4XSGA 3IUNA 3R7SA 1DBWA 5AW9A 3ZH2A 1JQJC 4BBZA 3OFJA 2ODPA 2QAGB 4EHBA 1IZ9A 2HRDA 2IU4A 1NLFA 4AUKA 1IPHA 1QWSA 1E2UA 1XZPA 4ONEA 4O29A 2DFTA 3VNSA 4L22A 2A7QA 2ZZMA 4PZEA 3C8HA 3K9CA 4R1MA 4UVGA 1FTSA 4D9JA 3I23A 3X1KA 4L2IA 2HF2A 3AM3A 4DA4A 2OBBA 2VEDA 4NI5A 5C8VA 4J0DA 4YP9A 3H5RA 3ILSA 3DYBA 5LDHA 2EZTA 3KQSA 4UEWA 3ND7A 4ZAZA 5G4KA 2X4LA 2P2YA 3GT4A 3FYUA 5K5EA 1YA4A 5LU9A 3UCFA 5ILOA 4DLKA 5IKXA 1VG8A 4AK9A 2WJ4A 2VUSA 5B5SA 3PE3A 2QQ5A 1H0HA 4K5QA 4Y0AA 4JLOA 3T9CA 2Y0DA 1CQIB 1PWYE 3TRIA 4G65A 1RKVA 2AOWA 1YWGO 1NW9B 2OMEA 3MB5A 3FH0A 1U2GA 4MWOA 2NXCA 2R6FA 4UD2A 4AJKA 2NQ8A 1FPQA 3ABOB 4GLFA 5GM1A 4F1JA 4Z1OA 3CLRD 3D8NA 3LXMA 4KE7A 1ULTA 4C1BA 3VR6A 3VSAA 2FFJA 3MVEA 2FZGA 5H4HA 4UNRA 2JIQA 1KFKB 3E8XA 3IBYA 2VUTA 3PUIA 1OVGA 4CV1A 1Y4DE 2Z3ZA 4B87A 3BL5A 3TZHA 2ZI5A 3AVPA 3OICA 1G2IA 3IQIX 1ZONA 5C8YF 4NATA 4N9QA 1OBOA 3SXUA 3THXA 2JGEA 4B7CA 1R2QA 2D5IA 3U3RA 2Y1FA 1LBQA 4GBMA 1T9GS 3QF4B 5CITA 5C3MA 1I9CA 3BXZA 1JHYA 1G8SA 3TGLA 1JHQA 4BS9A 2DGDA 4Q4DA 2UYGA 2XMPA 5ALTA 4DV1B 1CR2A 4ZVMA 5AHKA 3SMQA 1U5BB 3LZDA 3WLLA 1E3QA 1K8ZB 1X1SA 3KIPA 4FFSA 2CL6X 4QUGA 4EY5A 2RHCA 4PC3A 4PFSA 3IOBA 5ELXA 3V7NA 4WZ6A 1IBCA 3NRBA 2B7BA 3DWFA 1HQYE 1TCVA 4JLVA 1N5IA 5A4MS 2J46A 3V4RA 3VUEA 5FFFA 4G5QA 5HCIA 2GN2A 2R7MA 5A1TA 1OFGA 2ZRAA 3MCWA 1GR0A 4QJIA 3UTCA 1Z2NX 4OYYA 4YY3B 1MJ5A 4ZJYA 2PLWA 3LE8A 1DDIA 2WR8A 1I32A 1G5QA 3TQTA 4E51A 2V7QA 3BM5A 3N3BC 5A9SA 3N05A 1K4KA 3SEZA 3WYCA 5C32A 2QN1A 5FHRA 4NLLA 1Q11A 4UXIA 2EFHB 1T5TA 2J0VA 1KZHA 1G17A 5AD1A 1FNMA 3L0DA 1XZLA 4GWLA 3W3AD 3WNQA 1VLVA 4TROA 1JTVA 1P72A 3GEPA 6CHYA 5L7WA 1MU0A 3KSMA 1KQFA 4CEHA 4ZAWA 3NYRA 3DLAA 4LXHA 5F2KA 4B4OA 4KV7A 4R81A 4RZUA 3FJ1A 1HDIA 1SIWA 1DG9A 1PFYA 4PFKA 4WHMA 1ICIA 3ZWKA 5HM6A 1E6WA 1ZCAA 5IDVA 4ARBA 4GYYA 2EWWA 5LIPA 4MUBA 1QYCA 1NW7A 3ZWDA 1IAQA 3SMVA 2NU7A 4TYWA 4KXWA 4DC1A 2DR3A 3DZFA 5IUKC 2HI0A 1VJ1A 1NSFA 4TKVA 3PEYA 1FZTA 1FMLA 2X3YA 4ZCTA 2H1LA 4D02A 3GQVA 1XEXB 4REQB 3QTLA 3FTEA 2QD3A 1ISMA 4MMYB 4JWKA 5CVDA 2Q1UA 4DPLA 2JH3A 4ZI7F 5DRTA 5EG5A 3ORSA 4LNUB 1OAKA 1JMVA 1U0SY 1XR3A 4H1HA 4NZMA 3RTDA 5LNK6 1MA0A 3DM5A 4YCDA 1JR4A 4UTPA 3REOA 2OGSA 1I1OA 3OZTA 5AOVA 5L40A 3PE6A 4MV9A 3FNQA 4WNCA 1FRFS 1QDEA 3MTJA 4H0NA 3VNBA 5BSRA 3W8FA 1V7ZA 1QPZA 4S2EA 4D9GA 4X8MA 3OIGA 3OQOA 1BWRA 5C7LO 2DR2A 1X1EA 3UQZA 2GBFA 2OM6A 4Q7KA 4KKXB 3PX7A 1NVFA 3ZEIA 1QCZA 4DV3B 2R8XA 5LQRA 2Q7XA 3ETHA 4CEJB 4YVFA 3EW7A 2J9GA 1RCTE 1EFVA 3O1LA 3EUAA 3W4IA 1KJ9A 3BL8A 3I6BA 4B32A 4IUBS 4CTOA 4LCJA 5JYEA 4F3TA 1A7KA 2XEDA 4RNDB 1UC4B 4X90A 1EFHA 3B3GA 3EEQA 4II3A 3TKYA 3UAZA 3UUEA 3USZA 4EUEA 4MW9A 1IOZA 2ZU0C 3E82A 3EE6A 3PDIA 3FUUA 1G7CA 3ONVA 3SZMA 1PG0A 3CSSA 3MMXA 5EI5A 1ZICA 4LJYA 4M6WA 4QGSA 2FJPA 3GGPA 1AK2A 2IZZA 3P2KA 2WJVA 4DJEC 3TOSA 3IKTA 5FOWA 4TGLA 4I50B 5K4AA 1ONNA 3K96A 3UXMA 4B3RB 1NJ5A 3SR0A 3EGDA 2DWOA 1UKVY 1LZLA 4QC2A 3WMWA 2JGDB 2X77A 1IU9A 1CR1A 3DP9A 2RAUA 2OBFA 4HDRA 3VO8A 3WGNA 3IEVA 2C84A 1D6JA 4Q7MB 3WISA 1BAPA 2FZVA 4M2LA 2IYAA 4B48A 1YNSA 4WLEA 1E1YA 2YINC 4ZO7A 3BMOB 1SFRA 2ILTA 5JEDA 2H8KA 3GBPA 4FBGA 5A3RA 1KP9A 3P2YA 1EVYA 4CDNA 2V74B 4DDVA 1RI4A 4IIEA 2I65A 2WKSA 4EPWA 4QUAA 3TZBA 4DIMA 1KEZA 1HI9A 2LR0A 4GZ3A 4JL5A 5F33A 2MYNA 1R6VA 2VF2A 2CNBA 5A71A 2BKLA 4M9RA 2HMSA 3BMNA 3O74A 4XASA 5EHXA 5JDIC 1I1QB 3CISA 3K09C 4CQNA 1RP1A 3COWA 3O0TA 4JQOA 4MGIR 3D3NA 3L6BA 1UM8A 1YZQA 1ZG3A 4MEAA 4O1HA 3NAMA 4PZLA 2AKAB 1T5HX 2NN3C 1M2HA 1LA2A 4CUKA 1CTQA 2Q5OA 1DMRA 3C6MA 1QF7A 3H5AA 3M4JA 1T8UA 3EBPA 1DKMA 1PTJA 4MHSA 4P34A 5I7VA 1XZ8A 3KE9A 1QAOA 3BB1A 1P0PA 4YDHB 2FSIA 2VEOA 2WW8A 4I14A 4QRDA 4BFZA 1U1EA 2I55A 4XX0B 3AG5A 2WF8A 5G53C 1XMJA 3GAZA 2Z6QA 1I0IA 2SKEA 4BATA 3ZW9A 2WVGA 4RMIA 3VPGA 2NVUA 2CXSA 4BWYA 3PGJA 3OOWA 1IONA 4OHCA 3GEDA 1TM3E 4JGBA 2V8OA 1I5OA 4CMEC 4LXGA 3ICWA 1YQUA 3TNFA 3OQJA 2DHQA 4PGGA 3TQQA 1TCAA 2UYOA 3KUXA 2CF6A 3GXBA 3I2JA 3DBHA 1G0NA 3KU1A 3PHIA 3IVGA 3W3AA 4JBGA 2WPNA 5FAXA 4XVRA 2OGUA 5EP4A 5T8KC 2PBZA 2VNAA 2DFDA 1AKWA 3HP7A 2JFWA 3IPCA 3SHTA 5DLQC 1O4VA 3JAWB 3A4VA 2PO7A 4FGKA 4K6KA 5HGXA 1JDZA 4GNRA 3F7TA 5CDFE 4JJAA 2R6R1 2X0KA 2GM3A 4JUIA 2BMDA 4ZYUA 1HTTA 2OILA 2WZCA 1NNI1 5FO0A 3ZY2A 1TIKA 1XZNA 2OV3A 3MGGA 2JKVA 3U09A 5HOQA 2QGNA 3NALA 2A1TR 2ST1A 4L50A 1BN7A 1YU6A 1NQXA 1KMNA 4KODA 2QVBA 1W44A 2WD8A 3IAUA 2M9MA 2O6LA 1R5NA 3UHPA 4JI8B 1UADA 2A1IA 3P0EA 3Q3VA 4Q00A 3ESDA 4RA9B 6PFKA 1NNEA 1SVKA 1BCSA 1CS0A 2I54A 5HZMA 3GDHA 1SQ0A 3BXFA 3L8FA 1NDQA 2YFYA 3PFFA 5EZYA 5BQ3A 4EELA 4F5WA 4F97A 1A77A 4NG4A 1KI6A 4M99A 4OF4A 1KSHA 3N7TA 4JKOA 3V4LA 4I9UA 3IE1A 3TNYA 1Q3TA 4A3SA 1QG2A 3VDNB 5DI3B 3MUOA 3R3ZA 1QV9A 1GUBA 4X92A 3WZMA 4D9KA 3QRWA 2JAQA 1RCUA 1AURA 1HE3A 2JFQA 3K6RA 4WBNF 5AXBA 3S2YA 1TRHA 2I6XA 3MQ4A 4Q7JB 3O8OA 1D2GA 1O6GA 2H92A 2QM3A 4ZK2A 5J63A 4H7KA 3BD8A 1IMOA 4MGKR 3T5GA 4LY0A 2P68A 5C51B 4KWCA 1WX1A 3AI2A 4MJLA 3CH7A 2D5AA 1OLSB 3WP0A 3N2NA 3GPIA 2NYVA 3G6WA 3GUUA 5REQA 5JI2E 4ISBA 1QANA 5IAAA 1V4NA 3LQ2A 4D2IA 5A04A 1FNSA 1RWBA 2FNAA 4MV8A 4JENA 5CPBA 4AJNA 3L01A 4P58A 4ZAGA 1GKUB 5AHXA 3F1LA 2P65A 4MUXA 2FP4B 1SZDA 1V0JA 4M0LA 1UAGA 1SH7A 3SKVA 4DOMA 4BX0A 4AP9A 4JVNA 3KUKA 1AS3A 3LBIA 4NAUA 5HGJA 3B89A 3C3BA 3D5EA 3MZ0A 1GRNA 3WXMA 3ZJUA 1UODA 3DF7A 3QFSA 1ARZA 1BDHA 1F2UA 3BB3A 1ELOA 2GPAA 2QUAA 2HXSA 3V4OA 3VPHA 4WSOA 1OX5A 3G0DA 1M1NA 3VR5H 3PWTA 1T3ZA 1R0SA 5P21A 2PD4A 4ZRDA 3R7FA 3PPXA 2VXOA 1XRJA 1PYDA 2PR7A 4QU0A 3GYGA 1E2IA 1DJNA 1FFAA 1F5NA 2PZLA 1JU4A 2RH9B 3BL6A 3DE2X 3EDMA 3PI7A 4IUDS 4JJFA 1N2BA 5DM2A 3AFNA 5E7MA 5IT5A 5HUQA 3UA4A 3UMRA 5L53A 3ZDCA 3R3SA 2VJAA 4NOKA 4H6XA 4Y2GA 2AR0A 1RC1A 2GEVA 4L4RA 1N5LA 4R2LA 3EXHB 1YULA 2AFIA 1ABFA 1TF5A 3AEYA 4KRYA 4WK4B 4ABYA 4BTEA 4C4TA 4F38A 4YAIA 3NTLA 5EJ5A 4BAUA 2OA0A 4FMDF 4AD8A 1DAHA 1WKBA 3EGCA 4MRSA 2YW9A 1SXIA 3MT8A 4AUEA 1X2EA 2RAVA 3LBHA 1BX1A 1CCWA 4ZEXA 4BFSA 1U7XA 1XMIA 2Y1LA 2ZBQA 4BKPA 2GFHA 1R6BX 3TSWA 1UBUS 2AJ8A 4Y2VA 1IWBB 5HFAA 2V1XA 4DY4A 2O3SA 4FFMA 1PW5A 4XTRA 2NZYA 2BTQA 2EIXA 3M7IA 3KDSE 3GGOA 3DL0A 3QV2A 4G37A 4NFLA 3KPUA 1OFVA 4X1KA 4BWGA 2ZYDA 1MIOA 3NHKA 1WRBA 4FINA 4M76B 4N65A 4RWZA 3UFBA 4CMGA 2VBGA 4PG5A 1EFCA 4HTFA 2P4QA 5DNDA 3PDCA 3UAXA 3R41A 5EJAA 3PWSA 1OAOC 4HZGA 2RHTA 2AF3C 2BVNA 2WKWA 1SXJB 4TTAA