2ZI5A

C4s dck variant of dck in complex with l-da+udp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
219
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deoxycytidine kinase
molecule tags Transferase
source organism Homo sapiens
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
total genus 76
structure length 219
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi5A00
4YDSA 2AHOA 4CZ2A 2H1LA 5FUWA 4MGIR 2WIBA 2GHIA 3GFTA 3ZZUA 1GFIA 1R8QA 1TAGA 1NMXA 3DM9B 3LX8A 3QVUA 1DTSA 1PUJA 4NP6A 4C0BA 4AKGA 5SZHB 1OIWA 1Z06A 1DOAA 1VCNA 4QGGA 1G6OA 2ZSFA 4OBEA 4OI0A 4Q4AB 2BMEA 1UKZA 4ZCLA 4OJKA 3DZ8A 4MQBA 2DB3A 4PTLA 2IYYA 4TQUS 1DG3A 4IDNA 4YONB 4RKFA 4HLUC 3VR1A 2O0KA 2D62A 4B44A 5BQ5A 3BH0A 1ZNXA 3ECCA 2Z83A 4GMDA 2KE5A 3N2IA 5KO2A 2PT5A 4ZV4A 4CEIA 1GRQA 1KO8A 1A2BA 5E4FA 2R8RA 3U4QB 4EQ6A 1NF3A 3NH9A 3T1TA 1GITA 2CK3A 1E2JA 1N5JA 4P4UA 3Q72A 4GSYA 1ZBDA 4JJKA 1YZUA 2ZS8A 2VSFA 2QRNA 3LRPA 3UXMA 3NXSA 2PLFA 221PA 4A8JA 2WKQA 4DSUA 2FH5B 2X2FA 2H7VA 2P3SA 2ORVA 3QXJA 4M9XA 2ZE8A 4BFUA 3RLFA 5L3SB 2YJTD 1EX6A 3K09A 4F4CA 3MLEA 4BLPA 4DUGA 2NMVA 4B43A 2UZ3A 5FPKA 2XXAA 821PA 2FFHA 4ESHA 1TQ2A 2OCPA 2CCGA 2VPPA 3CBQA 4BZQA 2YOHA 1E2LA 4FWIB 3NEJA 3WRXC 3B13B 4LHYA 1ZMXA 1ESMA 1E2DA 5KDLA 4C0LA 5C46F 3OFNA 1P2SA 2GESA 4DWJA 1JXOA 2VH5R 1DO0A 2FSFA 2QGNA 5A0FA 4R2IA 1G291 1YR7A 3L0PA 2HLDA 5EP4A 3FE2A 1KMHB 2R6CA 1EG7A 2C04A 5JI2E 1XNJA 2ZI9A 4LOAA 1R2QA 1P9WA 2VHTA 3FHOA 5FI0B 1CR4A 5BN5A 5JSZB 1NL3A 2QA5A 3VHXA 5KOYA 3ADBA 3DKVA 4MKHA 1IBRA 3GLIB 1CR0A 4E07A 3NDBB 3B85A 1R7RA 2H17A 4NH0A 2VL7A 2WJIA 2JIZA 2RHDA 1FUUA 3T15A 1U90A 2ZJZA 3W3ZB 1A1VA 2Z43A 4NYIQ 1E79D 5EZ5A 3I5XA 1IN4A 1PVOA 2ZIAA 1TUIA 4GBMA 3ASYA 3AVTA 1TQ6A 4Q4JB 2J9RA 2JLQA 4WZBE 3IPYA 3RYTC 1G3IA 4QKQA 3CX6A 3AKYA 2WWFA 2OCAA 4M1OA 1COWD 4Z51A 2EYUA 3UMRA 2FA9A 5C4MA 1H8EA 5AUNB 3O8CA 4HYYA 4KXFB 4KYUA 3RS3A 4W5WA 2C8VA 4PZYA 3WMFA 4Z1MD 3WMEA 4TL6A 1X1SA 2R44A 4C9BA 2ZRDA 1TTTA 1RRFA 2D2EA 621PA 1Q12A 2JDID 4NYJR 5JECA 5FTKA 1JPNA 4E22A 4C0HA 1XX6A 2FE4A 5LD2C 4LHVA 2G0TA 4JBWA 3DOEA 2R6DA 3LFUA 3SYNA 2WJGA 4A2QA 4ZDKA 5FL7A 4P33A 1AIPA 2GZHA 3R7WA 4C2TA 1C4OA 3BK7A 3SJZA 3UMFA 1J2JA 4O25A 1OH6A 4TZ0A 5JBQA 4S35A 2GA8A 1IN5A 4LUCA 4CEHA 3Q5EA 4V03A 3R9WA 2WHXA 8OHMA 4EPYA 5J40A 1OH7A 3IIJA 3CR7A 2I3BA 2ZETA 1QHSA 1VHLA 4LJAA 3KUDA 4HAWA 4P31A 3B1XA 2XSZD 1NIPA 1XD8A 1XXHA 5KHOC 2GVZC 4BFVA 4UXJA 1A4RA 4YQFA 1EGAA 1W5TA 4UQOA 1FTNA 3DZDA 1NMZA 4IEEA 3AKCA 3LVQE 3PUWA 1FL9A 4OK3A 4M9QA 3VQTA 3K0AA 4OHXA 2ZRMA 3WNDA 2CCKA 3KXKA 4XJXA 4Z54A 2IYTA 3Q3JB 2P6UA 1XXHB 2VF8A 1IN8A 2O8FA 1G5PA 3FMIA 3T5DA 2DWQA 1ZU5A 4RD1A 1I4TD 1KK3A 1NJGA 4DCSA 3F5FA 4AKIA 1YZNA 1KK2A 1P60A 1JBKA 3I32A 4KI0A 5L3QA 3QKUA 4BFWA 1M7GA 4XWOA 4XVQA 1GUAA 2DFTA 1XTSA 4Q5IA 4LBYA 2V7QD 1G7TA 1XD9A 3BB1A 4RD0A 3GLGE 5JCZA 2CJWA 3IEVA 4M21A 4HUTA 1U9IC 2DYKA 3U44B 4DSOA 3SQXA 1KJYA 1AK2A 3AVVA 2PLRA 4G5QA 2OT3B 1CP2A 3LBIA 2J3EA 1AJEA 2JLRA 1JAHA 3WHLA 4DLXA 2NZJA 1U0HC 1EK0A 1R5OA 2NO6A 4KJZA 1I2MA 1RZ3A 2ZRKA 1R5BA 2LKCA 4JZKA 5IF9A 2CL6X 1YR9A 2QY9A 1D2MA 1XB2A 2QMUA 4RFVA 4D80A 5EE1A 3T34A 5F3WB 1J8YF 1W0JA 3SC3A 2W2TA 1AA9A 2A5DA 3AUXA 4KFRA 4URUR 4JL8A 3AH8A 5BW8A 5K8TA 2RGNC 4ZKDA 4MKIA 4DDVA 4ITRC 3BAFA 1XTQA 3T12A 2RHMA 5H68A 4R9UC 3AM1A 2ZSDA 2KSQA 1ZUNB 3KQNA 4LYHA 3GEIA 4FINA 1KKMA 2C9OA 3GEEA 3EIEA 3MJRA 4QJ5A 1QZXA 2QMEA 3JZMA 4YMWA 4X8OA 3QKTA 5FBWB 3X1YA 4O0MA 3A8TA 4ZCMA 4G5OA 1RE0A 4Y0VA 5B30A 3LA6A 4MRPA 1XBTA 2YVUA 5HKKD 1PLJA 2KI5A 4IDOA 2JJ2A 1UKEA 2OM2A 2ZRFA 5JEDA 3THWA 2P6RA 4PC3A 1E1RA 4Q4HB 2ZPTX 2R6AA 4BFZA 1XTJA 1WRBA 4FCTA 1UAAA 2FZ4A 5EP1A 1SKQA 1T5LA 1SVSA 1P9NA 2WMOB 4ASUD 2IS6A 3FDIA 1AS0A 3A4LA 5FPYA 1E0JA 4D4MA 1GDDA 1YKSA 3VR6A 2GXAA 4IDQA 3QXCA 4Q4HA 3LO5A 4LX0A 4OQXA 2ZEJA 1KI4A 4MRRA 1G4AE 1NIJA 1Q57A 3SI7A 3SNHA 5G53C 3U3MA 3GLIE 4DUGD 2QG6A 5FFMA 5KSZA 2AKAB 3R20A 2VF7A 4EJSC 1S4QA 2QENA 3RS4A 2QT1A 4NCJA 2ZJBA 1ETUA 1C9KA 4R7ZA 2IA5A 2GBLC 4XSGA 4BLOA 1OF1A 2XNDA 3VMFA 4GDFA 1CR2A 1JXMA 1KHTA 1RJ9A 3B1WA 1CBUA 2W83A 1G18A 1M34E 1SVMA 2C96A 4PQFA 4BUJA 2XGJA 3SN6A 3PJRA 2ODWA 4PHFA 2I4IA 2QSYA 3EC2A 4Q9IA 1DAKA 2C2HA 1XFAA 4D6PA 3X1ZA 2R6GA 3N5CA 4POAA 1GNRA 1RFLA 4B33A 2W00A 3H2YA 3LX5A 5J4KA 3GLHE 4PANA 2EFCB 4HZIA 2ODEA 1D9XA 3MGCA 1U8ZA 1N0UA 4DIDA 2YYZA 4NPHA 4L16A 1TQ4A 4DLSA 4CEIB 3WRYC 3AP2A 3V4FA 3H4MA 4QL3A 2G6BA 1LF0A 1N6RA 2WJHA 5FOXA 1KTVA 4HAUA 5AUPB 5CJ2A 1SULA 1IJEA 3CR8A 3PFIA 2NTYC 2BMFA 4LJ4A 4DLYA 1CKEA 4D2IA 2QNRA 3NKVA 3UIEA 1BKDR 3X1WA 1IXZA 1QG2A 1YZTA 3WXMA 5LPNA 3QPUA 1W47A 4AD8A 3ZH9B 4TMVA 1DO2A 4RCYA 5EE9A 1VCOA 4Q7MB 4TLDA 4OQFA 2AK3A 3C41J 1Q1ZA 1XD2A 3QEJA 1FFHA 5FUXA 2W58A 5KSYA 1AS2A 5J4LA 2MMGA 4FMCB 2F1RA 4YXWA 4C2UA 4RD3A 3VNUA 1F2UB 4A0RA 3AP1A 2OLJA 2ZROA 4PSVA 1X86B 2XOKD 1Z22A 1VECA 4XD7A 1AGPA 2GCOA 3O8RA 3TBKA 3IO3A 2SHKA 2VIIA 3EZ9A 2D74A 4B71A 1QG4A 2ODNA 4IFEA 3LLMA 1VYVA 5LD2B 3ZDQA 4FD2A 1U99A 2CNWA 1GL6A 4QC2A 3OF5A 1E2IA 4PQYA 1A5TA 1EFHA 1VIAA 4UXIA 4F92B 5A4JA 5GJCA 5AK0A 3GLGB 2WWWA 3NWJA 2RGGA 2QP9X 4HB2A 2OV2A 2BEKA 1U81A 3LXXA 3WHKA 2VP6A 4G5SA 3RS2A 4NYMQ 1F2TA 3W34A 3NHBA 3O8BA 5EXPA 4IOKA 1KK1A 4BLQA 4DDUA 2JIZD 1E2NA 1RRGA 4MKFA 3CPJB 5DSZA 2ZRBA 2FFAA 3AF4A 5LB2A 4D81A 1XJQA 3IEUA 1Q3TA 4M53A 1XEXB 4TLBA 3T5GA 1Q1BA 3HWSA 4F7WA 3QSYA 4PO1A 1XEXA 1X6VA 1PUIA 2BMDA 3FHCB 1KOFA 5F9FA 4V02A 4ZKEA 1NVVQ 3K9GA 5DN6D 2Q0HA 1H8ED 2C9YA 2VHQA 4QNRA 4BLTA 4QBFA 1D2NA 2B6HA 2GNOA 3EZ7A 3ZVLA 1E32A 2O8BB 1GRRA 4J0QA 2AFIE 3KUCA 1JR3D 1ONBA 3RVBA 2G88A 5B2ZA 1SVKA 4OL0A 1OIXA 2JDIA 4HAYA 5JWHA 1G5RA 1VYUA 1ODFA 2DFLA 3KX2A 4RFSB 3L8ZA 4JVNA 4KFTA 1NBME 2CXXA 5DH9A 2YKGA 1CIPA 1FP6A 2AX4A 2D7CA 2G3YA 2IBMA 4BPBA 5FL7D 3AVWA 1G8FA 3W3AA 4YMVA 2OFWA 4ARZA 3AKDA 2W0SA 3VAAA 3QPVA 1I4DD 2QZ4A 1Q44A 1KDRA 3A1SA 3KJGA 2JJ8A 5JHHB 4P3YA 5C2JB 3CF0A 3P26A 2QTHA 1NLYA 4Q9JA 1YE8A 4Q4LA 5DI3B 4ABYA 4C0JA 4I1OA 5CK4A 1HYQA 1VG0B 4LWZA 1KI6B 4U7DA 1OHHA 2VSXA 4Q1DA 3TW4A 3BXZA 1F48A 4DC9A 1U8YA 3LBNA 4XH9B 4I81A 5FBLB 4ZCIA 3SHWA 3PEVA 4IXMA 3H0KA 3MCAA 4LZZA 1LF5A 3L0OA 3QJYA 3RRMA 3GD7A 2VYFA 3SJBA 2JLSA 2OBNA 2C77A 3U61B 4UNSA 4D26A 4IKEA 4RD6A 1GM5A 2RGXA 3ZZTA 1EFTA 4JVMA 1UBFA 3B9QA 4PHTA 5J4VA 1Z47A 1UPTA 1Z3IX 1JEDA 2BOVA 2HJVA 1KSGA 1OYWA 1NVVR 3MWYW 3ZVNA 4DT1B 2Q21A 1NNEA 4PO8A 2ZUCA 1KI8A 4QHSA 2ZAOA 5DIFA 3CNOA 2XSZA 4P4TA 4QGAA 4ILEA 1ZP6A 1UBGA 3PCRB 3P4YA 4Q03A 4MRNA 3HR7A 5E7MA 1VYTA 4XOIA 4KYIB 1N6KA 1XCPA 4DJTA 2YOGA 4V0MA 2AKYA 4HAZA 4BRWA 4Q7JB 5JFGA 5L3VA 3R8FA 2OCYC 2A78A 1AKYA 1Z0AA 2PX3A 4LHXA 4B2PA 1FW6A 1E9RA 1OE0A 2NPIA 2ZS9A 1T3LA 4KLNA 1WBBA 1CU1A 5SZJA 4UNPA 2CBZA 3PIRA 4LBZA 5M04A 2QT0A 4NU0A 4IDPA 1MV5A 4B73A 1E2QA 4PHGA 4URWR 4OHYA 4B3XA 2F43B 3UATA 2DFKB 3SR0A 5KYKA 3EIQA 3U60B 1LY1A 1MRSA 4GMXA 4GP7A 5C1BA 4BQSA 2ZJ8A 4URZR 3CLVA 2ZRPA 1XD2B 1RW4A 3CF6R 1E0SA 4R71A 2FPKA 3KB2A 1M8PA 2MSDB 5CLLA 3GJ0A 4B32A 3FVQA 5HE8A 1KGDA 1QHHA 1ZNWA 2YC4C 1P5ZB 3HJNA 4HDOB 5CLQA 4DB2A 1FPMA 4EUNA 2IC5A 2VHJA 1WXQA 2NGRA 3CRW1 4B3DA 4TL7A 1XRJA 4GOXA 1OFHA 1KAGA 1P6XA 1ZJ6A 5C18A 4LDJA 2GVDC 3REGA 3WP0A 2GAOA 4JSTA 2VA8A 3SU8A 4W9MC 2VP4A 1CR1A 4Q01A 4EFMA 1E2MA 4PPNA 4DCTA 2O8FB 2PT7A 3FKSA 2IXGA 3OHMA 3SFVA 1XMVA 1T8UA 3TKLA 2BCGY 2QEQA 4A6PA 5HE9A 3TAHA 3L0IB 1OH5A 3CRRA 2GJAA 1GL9B 4TSFA 4LYJA 2OAP1 3RAPR 3AVPA 1UDWA 1Y3AA 2FFQA 4OYHA 1BIFA 2BBWA 1VHTA 2ZE7A 3A37A 1DBSA 2OXCA 2RH5A 3AF0A 4IVQA 1YZGA 5HCIA 1K5DA 4OK5A 2A5FA 4M1MA 1OB2A 2RKOA 3IGFA 3AEZA 2A2ZA 3GJ3A 1KI3A 1XP8A 1KY3A 1IN7A 1II8A 4RZ2A 5HZHA 1ZNYA 3H86A 1SQ5A 3R8CA 2ZQ5A 2YOFA 4AYWA 2VTKA 4GFDA 2NO1A 521PA 4MGYR 2VEDA 5C4GB 1QVAA 2QROA 2PEYA 2ZRGA 2EWVA 1R6BX 3BE4A 4V0ME 5GVSA 3U7GA 1IXRC 4BE7B 3TGPA 3FKQA 3GLHA 4JJZA 2JLYA 2AN9A 3QF7A 3D3QA 4LBWA 3RC3A 1ZC4A 3W6OA 4EDHA 4TT3D 2FF7A 1W46A 1RC8A 3ZQJA 1HY3A 2GEVA 3BB4A 2IS1A 4LI0A 2AD5A 1ZM9A 4W7SA 3AVYA 2PX0A 3VU9A 5JWRA 1VIYA 5KSOA 4ACAA 3FHTA 2BM1A 1XJ0A 4LV8B 3QKSB 1Z63A 3OAAD 3MSXA 4JLBA 1NY5A 2FWRA 3SYKA 4RD2A 2OUKA 4R98A 2IEYA 1M6NA 2IHYA 3MJHA 5CITA 3IIMA 2GWHA 4D4KA 2WWIA 4Q00A 4X8MA 2P67A 1LB1B 2ZE5A 5DI3A 5DYIA 3EW9A 3RSLA 1WE2A 1QF9A 5H1YA 1Z2CA 2QI9C 4C0SA 1M2OB 3LAWA 2O8CB 3EIHA 2IYWA 3BRWD 2XJ4A 4NYJQ 2G1JA 4V0NA 4OI1A 4CVNA 3BIFA 3MRSA 2XNSA 5FOVA 3VHLB 4DSTA 2OE2A 4A36A 4HI0E 2WSMA 4CGZA 4GOKA 1W4BA 3AP3A 1OT3A 2C99A 3JVUA 1F3OA 2FNAA 3DM5A 1W2HA 2OFOA 1GKUB 3K1JA 5GJVC 3QVVA 2V8OA 2OHFA 2HV8A 2ZYUX 1XZQA 3PUXA 3PR1A 5AJYA 4D82A 4C0QC 1SVWA 3AVQA 2QTVB 3KJEA 3SDZA 4URXR 1LNZA 2C78A 4IFBA 3KQLA 4RVCA 4OK6A 1XXHE 2ZRJA 4LV6A 4LSGA 4Q48A 5J4YA 2KJQA 3G0HA 2N42A 1Q0UA 3TIFA 4Q1FA 3EASA 2WJYA 3NVAA 3Q8XB 5JCPA 1M7BA 3CPHA 1KSHA 1D6JA 3AUYA 3EZ2A 3NC0C 4WAUA 3L82B 4LHWA 3NBZC 3HU1A 1COWA 1SVLA 1KI1A 2QAGB 3QENA 4PC2A 1E4VA 1HE1C 3WNCA 4JBYA 3DVLA 2LKDA 2X8AA 2V4ZA 3P27A 4KFUA 4US1R 3GLFB 3K0CA 3SEAA 1BMFA 1E99A 1ZD9A 4MYTA 1ZM4A 4ZO4A 4B47A 3S1AB 3EARA 2A3RA 1XDBA 1JALA 4LJ7A 2ZU0C 3CF2A 4B35A 1W5SA 3LLUA 2FEMA 4BASA 2K5UA 1ZD8A 5EP3A 1II8B 1FMJA 2D4HA 3MWKA 2YWHA 1G6HA 3NIBA 4GT1A 4B75A 4CIDA 3FYHA 2OAQ1 3HPRA 4GP6A 4Q1EA 4DLVA 4H1UA 3A36A 3AF1A 5BN4A 3KQUA 4JLVA 2ZUBA 1N25A 5F2EA 1Q1EA 4TZ6A 4RJLA 2DWOA 2OG2A 3B7GA 4RZUA 2ZRLA 2PMDA 4Q19A 4TQ9A 4YC7A 1QHYA 1LS6A 1OFTA 1D5CA 2ATVA 4RCZA 3OEHA 2ONKA 1VKJA 3QPWA 3GLFE 5FBVB 4DCUA 1L4UA 3MD0A 3ZD7A 5CM9C 4Z1MA 1RRCA 4TQAA 3RDPA 1A7JA 1TF2A 4B34A 2XTNA 1XEFA 1E0AA 4UXHA 5AJVB 1EWRA 3OESA 4FW9A 4HLDA 3TQCA 3PG5A 2CVFA 4LJ6A 1Y63A 4QXAA 1XPRA 1WP9A 4OHZA 3U5ZB 3PEWA 3K9LA 3QUSA 3LH5A 3CNNA 3GPLA 5EJEA 2CLCX 4G5GA 2J7PD 3P1JA 1Q1QA 2QU8A 5L3RA 4V0OA 2ZYWX 4A8JB 3RC8A 1DAFA 3AF3A 2QPOA 1KYIA 3KFXA 4DLTA 3RABA 4KLZA 1R0YA 3GCGA 3ADDA 3AGPA 4QM6A 2QM7A 721PA 2FMXA 4M1YA 4JT4A 2TMKA 3K9NA 1PLLA 1MO6A 1VG9B 4QHYA 1OKKD 3FFBA 1E2GA 1MKYA 1BO6A 2ERYA 4US0R 3DO6A 4IJMA 4TMKA 2IWRA 1XMJA 2ZAMA 3THWB 3BS4A 5FTJA 3L0SA 1TL7C 1A2KC 4A0GA 4C4PA 4NBSA 1US8A 4A92A 3SBDA 4JLNA 1S3GA 2BC9A 2FGJA 4ZI3A 2J1LA 4OI2A 5IRCD 2JATA 4OHWA 1DAEA 1QHIA 2RGDA 3OIUA 4QNMA 2PZFA 3SBEA 5FTLA 1EESA 1ZD1A 4V0LA 4PPQA 2FV8A 2Z4SA 5FPHA 1E2HA 2N46A 3HYRA 3WYGA 3BERA 2QP3A 3EG5A 4OHVA 2BHRA 2CEAA 2NPFA 1BS1A 4LPSA 1KMQA 1G3MA 3BFKA 4TWZA 2WJJA 3GJ8A 2XZPA 3QBTA 4AIIA 4G3XA 3L43A 3CH4B 2G0NA 4RSGA 1ZNZA 3X1XA 3E2IA 4EKDA 2IUTA 1G64A 1N6HA 4WW0A 5E3HA 1GG2A 1YR6A 3HDTA 4YMUA 4CEJB 1YZKA 2WAYA 4UJ5A 3NH6A 5AJZA 5HZKA 3W6NA 2VLIA 3ASZA 4KBFA 4B3GA 1R8SA 4Q1AA 1CTQA 1NBMA 1NSTA 3KTAA 1OFUX 5D3MA 4KSBA 2IF0A 4JYCA 4Q9HA 3TQFA 4G0NA 2MMCA 4C7OA 5E7JA 3VFDA 2CCJA 3SJAA 3X1DA 4BZPA 3GJ5A 4FMCF 2E1RA 2R2AA 2XJ9A 3FWYA 3T35A 3KXIA 1Q3HA 5BN3A 1QDEA 3KKNA 1F5NA 4GZLA 4PZZA 5P21A 1E94E 2AL7A 2OCBA 2WOOA 4HLUA 5D3MB 4F38A 4UJ3A 1KO7A 2ZI7A 2MSCB 1JECA 1SXJD 1OLOA 1YZLA 1SZPA 1E9AA 1L7VC 2Z5FA 1DG1G 1KO5A 4D4LA 4XWAA 5BWMA 3O47A 4TT3A 3GFOA 1CLUA 2X77A 4BRUA 3PVSA 5AUQA 3BFVA 1CJTC 4BWYA 1MH1A 3CZPA 4H9GA 5EXTA 3TUJC 1E2PA 3D8BA 2DY1A 1RJ9B 2J41A 2P5SA 2E9SA 1DAIA 2GRJA 2O52A 2Q3FA 1SKYB 2IYZA 3IBYA 1N6IA 1YVDA 1I4LD 1RIFA 5ANRB 3QKRB 3TLXA 3KQHA 1W48A 1T91A 3AGQA 3F8TA 1AZSC 5CM8B 2FJUA 3QXSA 2REXB 2ZM5A 2JLUA 4YMSA 5E95A 3EZ6A 1U94A 5HKKA 1EX7A 2HF8A 3RNLA 2QM8A 1S9DA 1Q21A 4BLSA 4WBSA 3HPQA 5EUMA 3CIOA 4Z8YA 2GJSA 2VP5A 1KJZA 2WWHA 4IDHA 1OV4A 2G1KA 4RZ3A 2CL0X 4GOJA 1AM4D 3CONA 3Q7PA 1CRPA 3QXXA 1JEEA 3TVDA 1WMSA 3R9XA 2GAAA 3AVXA 4ACBA 3ADCA 4TN1A 3LBHA 3B82A 1Z0FA 2F1HA 4F4IA 5IK2D 1S0UA 1Z8FA 1IM2A 3TMKA 2D06A 5G41A 2ANBA 3K0FA 2GF0A 4ZDWA 1OYYA 5FOWA 3EWSA 1E9EA 4R2HA 2WBLC 3F3YA 1E96A 3C16C 4XWKA 5J47A 2BJVA 2CHQA 5K8IA 2RGEA 3KKQA 4W5JA 2BV3A 4F4JA 2Z4RA 1DAHA 3VX3A 3K0CC 1EFUA 1NN5A 3I62A 2QORA 4LV5B 4TLAA 2A5GA 4M9SA 3U3OA 1J7KA 2IXFA 3A58B 2WTUA 5FBQB 2ZU6A 3VR4A 4GNKA 3IQWA 4WZAE 3CUEF 2BWJA 2IXEA 2RB4A 5KTYA 4CEHB 3L2OB 1IXSB 2CHGA 2RGAA 3VKGA 5L8VA 1HE8B 2PBRA 2KBFA 3DMDA 4AG5A 4MUAA 3DPUA 1N3BA 2FZLA 2ASEA 2UKDA 4PAQA 4PPFA 2YC2C 4QGFA 2KBEA 1F2UA 3OIVA 5LDDC 4HB0A 2EWWA 4ZI2A 4HAVA 2HF9A 1B23P 5H70A 4UNNA 2MSEB 4B3BA 1BMFD 1RPZA 3BFXA 4Y0AA 4A9AA 2QAGC 1TUEA 1UADA 1MR3F 1IY0A 1OH8A 3EA0A 4Q02A 4B2IA 2NQ2C 1DEKA 1M1YE 3I8XA 3OIWA 4WOPA 1Z6GA 4DIEA 2PMKA 4TTRA 3SJCA 2XOKA 1K5GA 1NVUQ 1W4RA 5HR5A 2G77B 1FQKA 1UFQA 2EU8A 1L4YA 5GJWC 4HDQB 1IAQA 4OQMA 2FN4A 3U7FB 1M74A 4QFMA 5TY0A 2O8DA 1CXZA 4IEIA 4JVLA 5DI9A 4L5BA 2C9CA 5J4HA 1YR8A 2JA1A 4ASUA 1F2TB 3F0TA 3RANA 1E3MA 2Q3HA 4MYUA 5FI1B 1Z6YA 1TF7A 4L8GA 4A1FA 4ZDJA 3AV0B 1GL7A 2X1VA 2IX3A 3C8UA 4O3MA 1NI3A 1V5WA 2QE7D 3B9PA 1QHNA 3GJ7A 4L15A 5GADl 2ECKA 3ZVMA 4JMPA 1NLZA 1KI6A 2DPXA 2J7PA 4MKGA 1N2CE 2JJ1A 3LNCA 4C7OB 1XEWX 1Z29A 3CNLA 4A15A 2AWNA 3LQRA 1AN0A 1NY6A 1CRQA 1YRAA 2IYUA 2WICA 4JT2A 1E2FA 2B92A 2J7KA 2YHSA 3EPKA 1Q22A 2VO1A 1AQUA 2IEZA 2ORWA 3MMPA 4JLPA 4A8JC 1ZIPA 5HCNA 2A5JA 2BKEA 1P2TA 1HH4A 2HUPA 1O3YA 2EFDB 4HATA 1T9HA 5FL3A 3I1FA 1E1QA 3W8RA 3TE6A 2ZRHA 4E5UA 4EPTA 3B2EA 2J0UA 3DOFA 2P5TB 1NP6A 1JAIA 5EE3A 1GSIA 2PJRA 1GOTA 4MRVA 4AYTA 3QI2A 1JR6A 3IDQA 1HT2E 2CK3D 3KJIA 3ICQB 2W6JD 1G3QA 3CKLA 2F6RA 1CJKC 2IYSA 2W6IA 4PAOA 4AWXA 2IYRA 3I73A 4HSEA 4OQNA 5FR1A 2VSOA 2ZTSA 3QKSA 5FOTA 5JJKA 2WWXA 1TEXA 1FUKA 4OI4A 2ZSAA 3W5JA 2VBCA 1ELOA 4DB4A 2GK6A 1OXUA 1HUQA 2GBLA 4JVSB 1TEVA 3CPEA 1FZQA 1V43A 1NRJB 3JVVA 1G3UA 2ZJOA 4D25A 4DLRA 5H8WA 4IOMA 3GEHA 3E5HA 4BFSA 4HEJA 5E7IA 2J5XA 4B6EA 4I4LA 1NN3A 1H8HD 2X19A 2OBLA 3FMFA 5JHGB 1FTSA 1JR3A 4P4SA 1P7CA 1TU4A 3K0SA 4AI6A 2GXQA 1KDPA 2F3RA 1SHZA 4H1VA 3IO5A 3TVTA 2XX3A 1OPXA 3PUVA 2QQ0A 1SGWA 3GMTA 4IHQA 4II7A 1B0UA 1W36B 3EPHA 4GZMA 1P72A 3U2QA 1UKYA 2BMJA 4DXAA 1A82A 3VR3A 4HDCA 1GRNA 1E1QD 1E2EA 1LTQA 2O5VA 4LHZA 2PJZA 3W6PA 4TL9A 4B74A 1Z5ZA 4DLUA 5AUOB 2WWYA 1U0LA 5JS7A 2D7DA 1G19A 3BB3A 4QG7A 4Q47A 4ERNA 3LQQA 2WKPA 5CYOA 2QGZA 5KDOA 1QRAA 3DMNA 5B64A 1QHGA 2ZVQX 2ANCA 2I1VB 1DAMA 4KODA 1XCGB 2CLSA 3QKRA 1P3JA 3U6BA 3VR5A 2JASA 2AK2A 1W7AA 1P61B 1P62B 4I1VA 4WXRA 3FPAA 2RMKA 2UZIR 2XTZA 3B5JA 5CDFA 1DELA 1KI2A 4RKEA 1S1MA 4FMBB 4NYIR 3RWMB 5JZVA 3MAAC 5BXQC 5TVKA 1T6NA 3IQXA 5L3QB 1H8HA 2A9KA 5KNCA 3K09C 4PAMA 2ZS7A 3E70C 2RGNA 2WPDD 4US2R 1SKYE 2YZ2A 2JEOA 4MH0R 3BH7A 4V0KA 4C0AC 3NBYC 421PA 4MYCA 1Z0DA 1CEEA 5GJBA 3CH5A 3WNBA 3S1AA 4D4JA 5KNBA 3GP8A 3OE7D 5JRJA 2R9VA 4AY2A 4PO9A 3A6PC 2FG5A 4ON9A 3ZIAA 1X1RA 3IKJA 3N70A 3J81k 4NHOA 1WQ1R 3EA5A 1P73A 5KUTA 4MUBA 4Q9KA 5IK2A 5EE0A 1QHHB 3FOZA 1S96A 2GDJA 2W0MA 1U9IA 1YHNA 1F6BA 2V3CC 3KXLA 1MOZA 2WOJA 2F3TA 4JKYA 4FIDA 4L9WA 1VTKA 1JQJC 4DVGA 1MRNA 4M2LA 1NG1A 1ZAKA 1U8AA 4IXNA 2GTPA 4U02A 1LFDB 4CDGA 3LDAA 1KI9A 1UBEA 4ARZB 3I4LA 4IOJA 3UKDA 4FCWA 4IOLA 1GVNB 2FU5C 4TMWA 4CYMA 2BBTA 3A1WA 4JLMA 1SXJA 2F9LA 5J5CA 2IF2A 1T0HB 5KNDA 3MWJA 2WSSD 2ZSEA 2ZXUA 2JLWA 3ZD6A 5JEEA 3Q9LA 3VTKA 4QM7A 3N2EA 2F43A 4TYYA 1FMLA 2NZ8A 3VNVA 4NONA 3DEFA 3C5CA 2PZEA 2YV5A 5EXXA 1T8TA 1G3RA 4TYPA 2XNDD 2DR3A 3U3JA 1XU4A 1BH2A 1WB9A 2ZI6A 1T4GA 2R62A 2HCBA 3IHWA 1JPJA 2REBA 2QL6A 2OFXA 1TX4B 3CM0A 1ZCAA 4MDEA 2CL7X 4DEYA 3NBXX 4JBXA 1K6MA 3QBVA 4Q4JA 4EPWA 2ZYVX 1Q20A 3CX8A 3LWNA 3NBFA 4OJQA 2EYQA 2Z6VA 3KB1A 1EFCA 4P0TA 4TYNA 4PR0A 1OW3B 4WIAA 4G01B 3FFAA 3ONWA 5CJPA 1G7SA 1N6OA 2BBSA 1KNQA 3LV8A 2O0JA 2QQEA 3FKSD 4PC7A 5SZKB 2A7QA 3G82C 5AJXA 5CDFE 4YLGA 4N1AA 2ZREA 1TNDA 2GJKA 4HAXA 2OSBA 5AWFC 2BEJA 3HU3A 1J8MF 3TK1A 2WM9B 4DT1A 4PSAA 3AVOA 4AC9A 1H65A 4D0GA 2AWOA 1KY2A 1P4SA 2R65A 3PUYA 2O8EB 5JJLA 1S9HA 2OZEA 1MO5A 4M0LA 5FUYA 4B2LA 5EZ6B 1S3SA 5FPSA 4DDWA 3U3KA 4UNQA 1YRBA 2JLZA 1X8KA 1JJVA 4LC1A 2QPAA 2DWPA 4KAXA 4M1TA 4DEXA 3P20A 4M1SA 4S2EA 5TB5A 5CB8A 1BYUA 5KPDA 2J0SA 3KQKA 1UEIA 4PZLA 3WYFA 4F93B 2CHVA 1RYHA 1MO3A 5SZIA 1SVIA 2DFNA 1FX0A 3RHFA 3I3SR 4A2WA 4KITB 1OXTA 1GP2A 4XD7D 4BFYA 1JR3E 3M6AA 4M8NE 1S8FA 2P0EA 4RFSA 3DKPA 4FMDF 5JS8A 3SQWA 4HB4A 4TTQA 1Z6XA 3I5YA 1G20E 3M0EA 1GKYA 2CNWD 3UPUA 1E9DA 1EFRA 2HDNB 2WAXA 3LXRA 4DLWA 5JMTA 1U0JA 4MITA 5DLQC 5D3QA 5FPTA 2O8CA 3ZZ0A 3GQBA 2D3WA 2ODBA 1G8PA 1KO1A 1L2TA 3D7MA 3MG9A 3THYB 2GEUA 1KKLA 1HV8A 3UMSA 3K0FB 5FOSA 4DCVA 3IHLA 2ZI5A 3PV0A 5JJIA 4AYXA 3CX7A 1AS3A 4XIGS 2QBYA 4Q4AA 1WF3A 3U3RA 2V55B 3SS8A 4M22A 2W2VA 2WJVA 4ESVA 5EE5B 1QVRA 3KDSE 4BFXA 4WA7A 1M7HA 3VR2A 1SXJC 2NO7A 1NVXQ 1ZINA 1PZNA 3ZJYA 2EFHB 4NDZA 1E2KA 1G8HA 1W1WA 5DN6A 2IYVA 4BECA 1C1YA 1TPZA 3WY9A 1JB1A 1ZUHA 3K70C 4JYBA 3RRZA 1CF4A 1CS4C 2GCOB 4NZYA 4NCKA 1W36C 3MWLA 2WVJA 3ZVRA 2JLXA 2IS4A 1XPUA 3CWQA 5LBIA 4Z8XA 5DO9A 4KHZA 3TUZC 3CRQA 2ZRNA 3QF4A 1QHXA 3TAUA 1PJRA 2HXYA 1AGRA 4D0NA 2H92A 2VQSA 4KFSA 1ZC3A 1T3HA 3ADKA 4NCHA 1IOZA 4CF7A 4A6XA 2ZJAA 2YWGA 3TSZA 4ZIRB 1P75A 1G8GA 2BVNA 1G16A 3PITA 2DCUA 1Z0IA 2F1IA 4ZPXA 4EJSA 1G5TA 1E98A 1OIVA 3BOSA 3RRYA 2XZLA 2JJ1D 1S1CA 1AQYA 1CJVC 3A4NA 2FPLA 4LJ5A 1E9CA 1NLFA 4X8HA 4LBVA 1NVWQ 3OFND 4Q18A 3PXGA 4TMZA 4TLEA 1GZSA 5EQTA 3HU2A 3OEED 5DE3A 1FP7A 1DE0A 1LS1A 2B7BA 3OE7A 1ZM7A 3OZXA 4DLZA 4JS0A 3C14C 1AZTA 2QUZA 3LW8A 2H8KA 5BYKA 5B58C 2FGKA 2E87A 4L4UA 4CT4B 2P65A 3ZIAD 3GJ4A 2ZRIA 4I1UA 4EPVA 1W2GA 2BM0A 4LRWA 5TARA 1N5IA 1N0VC 4IVRA 2HT1A 2J87A 5K8LA 3SZRA 1VG8A 3SE0A 2HEIA 2IUUA 1N0WA 3K8YA 3OEHD 3EC1A 3L8YA 3RSOA 1ZM3A 3RS0A 4C0KA 4TTPA 1XJCA 1W36D 3PQCA 5TDHA 3FGNA 4A2PA 3SHFA 3UG7A 4ZIRA 4LY6A 3HP1A 4EPXA 3ND8A 1KIMA 3UWOA 4HLCA 2CMKA 3THYA 1T3SA 1K8RA 4UNRA 2GXSA 1KO4A 4MRSA 4MGZR 1MABB 2HXSA 3TJZA 2XXAB 4O2RA 2WSSA 4QHTA 4LJ8A 1Z6AA 2H57A 2OILA 2ZJ2A 4K46A 2XTMA 3NTUA 4NCIA 2RCNA 3FMOB 2ZI3A 3IIKA 1NSFA 3DL0A 4U00A 2J0UB 1Z6TA 3QIAA 4FCVA 4GL2A 3FMPB 2H5EA 3CRMA 2JAQA 3W8NA 3ZQ6A 3KTAB 5AR1A 4GPTA 1HA3A 2WPDA 5TXGA 2W2XA 2J45A 3CRVA 2OESA 3WBKA 2GCPA 1SHKA 3KJHA 1HEIA 2ZR0A 3ZGXA 1YQTA 4DRZA 1Z0JA 2D2FA 4XTCS 1NBMD 2WWGA 3QY0A 2EFGA 4D0LB 4O2LA 1R0WA 2XZOA 1DVRA 2ZI4A 3PEUA 2ZRAA 2BJWA 2CDNA 1FX0B 2DHRA 2HJGA 3G5UA 5FTMA 5F98A 1GNQA 5FOUA 3NG1A 1IY1A 4Q1CA 1ZIOA 2AXPA 2IS2A 2GETA 4LYAA 2QTFA 1ZRHA 2LWIA 1QBKC 2JGNA 3V9PA 1FOEB 1T5IA 2AFHE 2XAUA 2PH1A 5CYPA 4CT5A 3THXB 5JLJA 1WDTA 5FR2A 2OLKA 1E0KA 2FEOA 3QQ5A 1NKTA 3TSWA 2IYXA 1ZW6A 4B48A 1TF5A 3TRFA 5AJWA 5B57C 1D9ZA 3B60A 4KSCA 3T61A 1E9BA 2ZSBA 1GAJA 1WA5A 3LVRE 5LB4A 2G83A 3A1TA 4XTRA 3U44A 1JJ7A 2DBYA 3NDPA 4AKHA 2QBYB 5KDDA 1DADA 3GJXC 1JQLB 4I1SA 2PCJA 1P9RA 4DKXA 4Q21A 4EIWA 3R7WB 1ANKA 3C15C 4K8OA 5G3ZA 3SFZA 1I2DA 3IUYA 1IQPA 3K53A 1OKKA 2ERXA 4JLKA 2R6FA 4E03A 2C95A 4IRUB 3W90A 1VCIA 4MYHA 2B8TA 2J0VA 2AXNA 2A5YB 1U98A 3TR0A 4HUQA 4EFLA 3I61A 3VKHA 2QMOA 3CB4A 2O8DB 2RGCA 4TMXA 1P2UA 3BD9A 1G41A 2FSIA 3K0AB 4OKSA 3V00A 5EP2A 4M4SA 3EPLA 1FNNA 4EPRA 3NEYA 1WCV1 2FSGA 3LY5A 4PPGA 3HR8A 1E9SA 4TL8A 1II9A 2QPTA 2V1XA 2NOAA 3THXA 4HUQB 3TNFA 1Z2AA 2CLDX 2N1BA 5CK5A 4WZ6A 2V54A 4W5HA 4EAQA 5DISB 2EQBA 4Q7LA 1HTWA 2H16A 4LPKA 2HYDA 5HPYB 3QOFA 2F9MA 2GJ8A 3W5IA 2HYIC 2OO7A 2V1UA 2JJ2D 3M4YA 1G7CA 1XMSA 1G4UR 1LW7A 2L0XA 3H84A 1OXVA 3RRNA 3ZYCA 1Z08A 2QMHA 1DAGA 1YU9A 4LCBA 1IONA 4PSKA 1X8LA 2CJWB 1KNXA 4HLQB 2EFEB 1XF9A 2BIFA 3QE0A 2GCNA 3UANA 3K70B 2RGBA 4BEJA 1KZ7B 3T1VA 4EFNA 2FX3A 3REFA 3RS5A 4C3ZA 5L3SA 3PUZA 3BWDD 2ZE6A 2ZVPX 3GLHB 3DDCA 4WXPA 1N5KA 1SXJE 2UVQA 1GNPA 3ZLJA 1X3SA 1G1MA 1Z07A 4AG6A 4MGKR 3BBPA 2J59A 1W0KA 2YWEA 2QRZA 1KZGB 4NTZA 1GKIA 2X2EA 3UK6A 5FH9A 2PEZA 3QEOA 1D8TA 3KKOA 4B6FA 4KCGA 4G1UC 3U4QA 2EVWX 1AKEA 5KPJA 2HT6A 1J70A 1MABA 4RY2A 2C5LA 1VCMA 3RWOA 3VKWA 1R0XA 3VU9B 3QNUA 3Q85A 2QE7A 1OB5A 1E69A 4CEJA 4KV9A 4QBHA 1E4YA 1DS6A 3B1ZA 4JIMA 1FNMA 4BEBA 2VP0A 1XMIA 1VDZA 2Y8EA 2A30A 4U5XA 5JSZA 4PC1A 1EWQA 1SXJB 4LGMA 5TV2A 1KDTA 1KSJA 3V4RA 1KMHA 2GK7A 2FPMA 3T1OA 4Q7KA 4L9SA 4I99A 1P2VA 1GIAA 5DGXA 1EFRD 5GVRA 4WVFA 3MFYA 1UDXA 3BORA 3DHWC 4AKEA 3B8HA 4URYR 2IYQA 1VMAA 1IN6A 4P32A 2B7CA 4JLJA 4M1WA 2WV9A 5A5GA 2HCJB 1NN1A 2ZJYA 1FQJA 3TSOA 4IVPA 4TMTA 1ZCBA 1W44A 4RD4A 4QOSA 1R5NA 1IHUA 1KJWA 3B6EA 4QGHA 3T06B 4YXWD 4A4DA 2P6NA 4PX9A 2GILA 2F7SA 2XB4A 4AURA 1DARA 3IILA 4P4SB 4LYFA 1IY2A 4OQLA 3AF2A 3CZQA 4KU4A 3ZS9A 2HLDD 5FTNA 1UEJA 4BLRA 1RVDA 4JLOA 3ZS8A 4B76A 1PLKA 1S2MA 1RRPA 3PENA 5G40A 5CB6A 3MUFA 4UKDA 1BOFA 2CE2X 4FXPA 4LJ9A 5IHPA 1TMKA 4AK9A 1E6CA 1G7RA 2ATXA 3A4MA 3GFPA 4HZUA 4DBLC 2VP2A 2W6JA 1R4AA 3OEEA 1X8JA 3VX4A 1GTVA 2IYLD 3BH6A 4JLAA 5DNYB 3E1SA 3KKPA 4KVGA 3GJ6A 1YZQA 1R10A 1ZUIA 2YNMA 4N3NA 4NE2A 1XTRA 3WBJA 4E09A 3U6KA 5EUQB 3TW8B 4X8LA 1JI0A 3ND9A 2Q9BA 2FOLA 4JSYA 2GJ9A 2V6JA 4QBIA 3WMGA 1O87A 4C30A 1W4CA 3FB4A 2OBMA 1TU3A 1G21E 2NO9A 1N6LA 4JLDA 2NIPA 3C4JA 2ZJ5A 3M1IA 2ZR9A 3P4XA 2NG1A 2JLVA 3SYLA 1YJ5A 5G3YA 1RKBA 2ZANA 1Z28A 2IT1A 2C03A 5JI3E 3D6TB 2J46A 1LV7A 3EWAA 5IT5A 4DHEA 2QN6A 5DHAA 2LCFA 121PA 2ZYTX 4A0FA 1XPOA 3TR5A 1UJ2A 4QJ4A 3GLFA 3ICEA 4N0EA 3BJIC 1OFIA 2YWFA 3KKMA 3QG1A 3UWKA 1J90A 2B21A 3IBGA 4XSHA 1RYFA 1UKVY 1W4AA 1OXSC 2GZDA 2B8WA 3H1TA 1HQCA 1US8B 2BDTA 3Q5DA 4DDTA 3EX7C 4EQ6B 3U7HB 3KL4A 5F9HA 1N6NA 1OJLA 2Q3MA 4KO8A 4NL4H 2GKSA 3TUIC 1L8QA 2KWIA 1E9FA 2XB2A 1R0ZA 3NC1C 2ORIA 4JL6A 4NYMR 2RAPA 1BYIA 1XEWY 4NCNA 2PZGA 2O0HA 4B3CA 3PEYA 4ZDIA 4PXAA 1G8YA 3HYTA 3UG6A 2IHBA 3B1YA 2WIAA 3KZ1E 1GWNA 2W6ID 1E79A 3BC1A 5CIWA 1KDOA 1W49A 2Q9CA 3EZFA 4DZZA 1UBCA 3AB3A 3QG5A 2ZR7A 3B1VA 3R9IA 2BKUA 3O8DA 1OHHD 2C98A 3KFVA 1KI7A 4CW7A 3P32A 1PV4A 4QJ3A 2CE7A 2VRWA 1XCMA 4PQRA 3THOA 4XVUA 4N0DA 4LC0A 1EXMA 1NMYA 4QRHA 2AD1A 4TLCA 2QP4A 4YMTA 5KU1A 3AVUA 3RS7A 4IW3B 2WMNB 1XWIA 3IPXA 4LK2A 2NO0A 3FTQA 2PL3A 1WBDA 1N5LA 1ZVQA 4BFTA 4FN5A 2EW1A 4XVRA 3C5HA 2V6IA 3K9HA 1XZPA 3A1UA 2P2LA 1ZU4A 4TYQA 4GRAA 1IJFA 5KSPA 3I72A 1KAOA 2VHCA 1VG1A 2GZAA 2VHUA 3AKEA 2IL1A 4FMDB 2FSHA 1TQDA 1Z0KA 4RZXA 4LJYA 1NG9A 3EAQA 4PFSA 1UM8A 3K70D 3OIYA 3GLIA 3K0EA 2FDCA 4DCNA 3T1QA 2KB0A 4A0HA 3EXAA 4URVR 2O8BA 3W9YA 1W0JD 2V9PA 2VP9A 4MA4A 4Q1BA 1NN0A 2OXRA 1Z83A 1N6PA 4A82A 1GILA 1J99A 2ZUDA 2QAGA 2REOA 1XTIA 2PCLA 4B3FX 4F91B 2O8EA 3X2SA 5ELXA 4FI3C 4Q9LA 3ETLA 3I92A 3D31A 4NMMA 5JRZA 2G9NA 2H18A 1KK0A 2IK8A 2BCJQ 4DSNA 2ZITA 4JKIA 3OAAA 1ZM2A 1LVGA 5K8UA 2QAJA 2GXUA 4JL5A 3Q7QA 2IWHA 2F1JA 4CRWB 2Q9AA 2XITA 3QXHA 4NKRA 2FFBA 3WP1B 1NKSA 1E1RD 3A1VA 1CJMA 5EXSA 1G17A 4PC6A 4MDFA 1NJFA 4G5RA 4M1KA 3EPJA 2IW3A 1JNYA 1F60A 2GEDA 2WKRA 3NHAA 4GI7A 1ZYUA 3CO5A 2BBOA 4HZUB 5HTKA 5UKDA 2ZRCA 3LW7A 1D2EA 1VPLA 2V7QA 5JWOA 1CULC 3AQ4A 1T0JB 3CW2A 3B78A 4KBGA 4K81B 4YDHB 5FUVA 5TMPA 4PHHA 1SVOA 2Z0MA 5IDVA 2JCSA 5FBRB 4KVAA 2ONJA 2F55A 3QF4B 4BGDA 2WZQA 2QSZA 3I8SA 2YINC 1HT1E 2XEXA 1CJUC 2J0QA 1UF9A 2AR7A 2GF9A 4HB3A 3C7KA 3U7EB 1HURA 1XTKA 3TH5A 1KSFX 4TYWA 1G9XA 1MT0A 5DYGA 1MO4A 1OXXK 1U2RA 3BGWA 2I1QA 2IUSA 4Q66C 5DHFA 5BYJA 1TADA 3SOPA 3CWZA 4FWTA 4QBGB 4M9ZA 3JZAA 1DPFA 2Q6TA 1II0A 1OSNA 4TSFD 5CIQA 3WYAA 4EJSB 6Q21A 3GLGA 2CVHA 2OEPA 1W0KD 4BZXA 1HQYE 1ESNA 3LD9A
chains in the Genus database with same CATH superfamily
3TFOA 4PIVA 2XUPA 1TTPB 2AHOA 3T54A 3QELA 3OT5A 2IBTA 2AQKA 4Q9NA 1WDMA 4ND3A 3I30X 4OJYA 3ZZUA 3GGGA 1U1GA 3BMNA 3LK6A 3LX8A 4NP6A 1DTSA 5GTDA 2X1MA 4QQKA 3UBMA 3QPDA 4EB3A 5KYXB 1U28A 1VCNA 1GN8A 3C4QA 3N8GA 4OBEA 4G23A 2ZIXB 2BMEA 3A6FA 2QX4A 2QX7A 2G4VA 1E1LA 4LY3A 1QLHA 3ESYA 5KSYA 2IYYA 3VMMA 3DULA 5KCMA 1DG3A 5DRYA 4YONB 5JD5A 5G0WA 1GTG1 3O94A 3VR1A 4B44A 2D62A 1M5TA 3QMVA 4CL8A 1M2WA 4DY4A 2D3TA 1EUCA 2P27A 3ECCA 4GMDA 2RK6A 1M6EX 3H9BA 2Y1FA 5I7SA 3BT7A 3N2IA 5KO2A 1QKJA 4OB6A 4Z4FA 1QIGA 2PT5A 3F3SA 2BFDB 2R8RA 3OQVA 3U4QB 4EQ6A 1IEVA 3LPLA 1GITA 3ULKA 2CK3A 3TTUA 4DV1B 5HZMA 3HSYA 3L04A 1M2VA 1YZUA 2A92A 2ZS8A 4NU6A 3R5FA 4F3RA 2JHAA 3LRPA 3NXSA 1JH9A 2PLFA 2C2XA 4A8JA 3FPJA 4FGLA 4DC1A 1XC7A 2FH5B 2X2FA 2H7VA 3MGGA 3R3XA 1NXWA 2B82A 3KPYA 3VJLA 4ZICA 3TF5A 1JXQA 2YJTD 1EX6A 3ZNNA 3OZGA 4RDCA 4BLPA 3AJRA 2EQAA 2PR7A 3AR4A 4R2MA 1MB4A 3PGLA 2H48A 3A28A 4B43A 1L5SA 3TE7A 1B8VA 1OWOA 5LQSA 1DQYA 4POOA 2ZUWA 5CFRA 3WWYA 5FPKA 4YALA 4OLJA 3UB2A 2FFHA 5DULA 3UTDA 3CA8A 821PA 2VPPA 3CMMA 1E20A 2BE7A 4BZQA 1M2EA 4CL3A 2R7KA 1OC2A 5AVKA 4HCJA 4LHYA 1LW6E 4XGQA 3KD2A 3QU5A 1ESMA 2KLHA 4RIEA 5KDLA 2Y1XA 5C46F 2IE8A 2BN4A 1L7MA 1Z75A 3C3EA 3COVA 4LRTB 3VUFA 2GESA 4HBGA 4DWJA 5TT0A 1R50A 4NMXB 2QGNA 2QG4A 3JYNA 5JDCA 3MTBA 1G291 4R2IA 3L0PA 4OX9Y 2HLDA 1KMHB 3RTEA 3AJ8A 1MG0A 5E1DA 1CYDA 1R6TA 1ZH6A 2DTDA 2LZ0A 3FHOA 3ZDYB 4HH4A 5FI0B 7GPBA 3VHXA 5KOYA 3F98A 4D41A 3ADBA 3HBAA 4RYLA 4YAJA 4CQLA 1IBRA 4FFVA 1ND6A 1OLSA 3IAM1 2Y68A 3B85A 4E07A 4F8YA 4HFJA 3F73A 1IUPA 2I91A 5CHYA 4QELA 2VL7A 4YCJA 2AOVA 1MGOA 2HH9A 5BN1A 3W3ZB 4XRRA 4CM4A 3WLNA 1E79D 2DKOA 2Z3VA 4OSPA 1A9YA 4W8GA 4BNIA 1TUIA 3BXEA 1TQ6A 3ILHA 2FHSA 2CSUA 2FN3A 2XRMA 3DDOA 4TLLB 1YDHA 5AKKA 4WEQA 3RYTC 1G5QA 2ENUA 1G3IA 3PR3A 2P2CA 3ASUA 2X9VA 2WWFA 4OQQA 1YASA 1CQXA 1COWD 1XYYA 4X1IA 2HNAA 1P1KA 3RPEA 4QU0A 4TROA 2C5EA 5C4MA 1OBHA 3O8CA 3VPDA 2C94A 2Q5CA 2VTVA 2HU5A 1DIHA 1JHAA 1UM9B 5JG7A 2UVPB 6REQB 3ZHCA 1EE2A 3LC0A 4C9BA 2W4MA 4BX3A 2FMUA 621PA 1Q12A 2ZYHA 4FZ5A 4K6OA 4Q82A 1V8BA 2YZMA 3ANMA 3AI7A 4R1TA 1EVEA 1M34A 2XW6A 2FE4A 1JYSA 4UZSA 1YQ9A 4FDVA 1SM4A 2G0TA 4LHVA 4OGLA 4RHTA 3SNHA 3UWMA 1LTKA 4CM8B 3SYNA 2WJGA 4KIUA 4B85A 4EBFA 4P33A 5IASA 5IS2A 4C2TA 5G0VA 2V7PA 2XE6A 2CXRA 1JIXA 4EYKA 4O25A 3DVAA 3LQ1A 1W4ZA 4XUEA 4TZ0A 2K4MA 1XDDA 4QDUA 4M0EA 3VDXA 4LUCA 4AXXA 1PZEA 3OZBA 3Q5EA 4V03A 2ATEA 3OP1A 2X0RA 1M2OA 4PONA 1NZFA 5KJ1A 3CR7A 2I3BA 3QYPA 2GH1A 3A06A 1CQIA 1THZA 1AXEA 4D9MA 4P31A 2SBTA 4RM3A 4CMEA 4BZZA 3B1XA 3SE7A 2XSZD 4YVFA 3M81A 2QDXA 4RVDA 1NIPA 1TC1A 5IBPA 1YUMA 2I99A 4UXJA 1W5TA 1TM7E 3DE7X 4N3GA 4UQOA 3R5XA 2Y67A 2P9CA 1YNOA 3LVQE 3L4SO 3PUWA 1TJ4A 1FVXA 3L8MA 1YD7A 2R8XA 3JWHA 3LQKA 2E4WA 5JZSA 4C04A 1KRWA 2ZRMA 3CISA 3UQZA 4X6YA 1L5OA 3E9QA 4GKBA 4RKRA 4EW1A 2FRXA 3A9RA 2AZ4A 3TSYA 3EDCA 4KQIA 4RTQA 1X13A 1VBMA 2DWQA 4JCCA 3VZBA 1TCVA 1KK2A 4KI0A 4XOUA 3G0CA 5L3QA 4FEAA 4UTPA 2OP0A 4XVQA 1DBIA 1GUAA 2C7GA 3E3NA 1LSOA 4Q5IA 4OSEA 1AN9A 4IFTA 1TKRA 4U2FA 3ZEAA 5DHSA 1UPCA 4QOFA 1G8AA 2B8NA 2V7QD 4Y2PA 1XD9A 1NJ2A 3GLGE 1QG0A 4FR0A 2FUKA 1U9IC 1EB9A 1PJQA 4GNRA 3SSAA 3SQXA 4KIWA 1D8AA 1UBOS 2PUTA 4NAVA 3A4TA 5A5FA 1JFFA 3AUAA 2EKLA 2CXNA 3MVEA 4X61A 5AD1A 2H7XA 5AVQA 2JLRA 1JHUA 2O2IA 1BSVA 1QVVA 3OO1A 1KH2A 1OTHA 3CUUA 4IQFA 3FPLA 4O63O 1P1CA 2RHCA 3ZCRA 2QN9A 3C97A 4P58A 1R5BA 2ETVA 4JZKA 3WZLA 1YR9A 2PVSA 1CNFA 2QMUA 4RFVA 5F3WB 3DOJA 5BSVA 1W0JA 2NX2A 1YO6A 3B70A 3SC3A 4WKPA 3T3GA 1AA9A 1ATZA 1M54A 3N53A 3RAJA 5C7IO 3AH8A 5ED0A 4EHBA 2I0FA 4LNUB 7YASA 1QSGA 4ZKDA 2QLTA 3MIZA 4LDNA 4Y6GB 5K8TA 1Z7GA 4PINA 3PGVA 5HA5A 1GQQA 1LI7A 4YRJA 3T12A 5JQWA 4EUSA 3JTEA 2NXWA 2PFKA 1B73A 1VLJA 2QD5A 4I50B 3JD2A 5KTSA 1NA5A 5AHRA 3GEIA 3WDKA 5IWAB 1T4BA 3GEEA 1PV4A 3BYZA 3GBPA 4B4WA 2VAXA 2PTHA 3T95A 1NE2A 1ZKMA 3X1YA 4RVHA 3A31A 1XALA 4NZMA 4BKOA 3LA6A 3P5BA 3V7NA 2FLKA 5CD1A 4QICA 2EIHA 5ADUS 4HRAA 4ZWNA 2IHKA 1PLJA 2KI5A 3ELDA 4EF4A 5KYUB 2UXCB 2FW0A 2ZPTX 3OICA 2EDCA 2PUJA 2WR8A 3DMPA 3JVIA 3OJLA 5FAKA 4HNAB 1WRBA 4CMJA 1R6XA 1UAAA 2EZ8A 4DILA 3G6KA 1MEJA 2VH2A 4IMJB 1UWKA 1EWKA 4IL5A 4A3SA 2WMOB 1KRHA 1TVCA 4MSUA 3R7NA 4R0NA 5D6NA 1I1QB 1E0JA 2AGVA 3EWNA 2FWNA 1OX5A 2H2HA 1DJNA 4D4MA 4W1PA 4Z9BA 4RHXA 3S2YA 3G7UA 1ENPA 3HA7A 3VR6A 2CV0A 4Z4CA 4LJRA 3LSTA 1BCSA 2I66A 3TPCA 1ZI6A 4OQXA 1NSYA 1DRVA 1Y1TA 2ZEJA 4EG6A 2ZLBA 4RU1A 1DIRA 5IAOA 1L7OA 4JJ4A 2J08A 3DLIA 4K2HA 4L5JA 2WSBA 1E59A 2QG6A 3PUHA 4OUDB 1XAGA 4MV9A 4QWWA 3RUIA 4DUYB 1QLWA 1J97A 1XKXA 2R66A 4XD2A 4JWKA 3PPIA 3GAAA 4AS1A 1LX7A 3RS4A 4EB6A 2ZJBA 4JI1B 3TFWA 1NBIA 2VK1A 1FXUA 1BCSB 5AVXA 4MR7A 1FRFS 3AEKB 4BLOA 3LNTA 1F14A 3VMFA 3WVNA 2P9YA 1KHTA 3PT5A 3RAGA 1M34E 3AF5A 4RVOA 4MP8A 4CMGA 3CKYA 4OUDA 3ZWVA 2ODWA 2VQ6A 3BCRA 4JJEA 2I4IA 4Q9IA 3W5CA 5K99A 3FOFC 4U8HA 1U8EA 1IVSA 3FAKA 1A8SA 4R7TA 4D6PA 4KGZA 2R6GA 4R3WA 4GVPA 3N74A 3ZZNA 3FOCA 4YAIA 3H2YA 5JCXA 5HCUA 3LX5A 4H0FA 3Q98A 3OY7A 2Q8NA 1J23A 3EHDA 4HZIA 2FJPA 1ZA2A 2ZAGA 3EF3A 4PYLA 2OYRA 1OBOA 1D9XA 3BRWA 1FNSA 1XVVA 4OL9A 5CIYA 4C0WA 2VHWA 3FOWA 2VZ8A 3QVLA 1VJ5A 2EDAA 1WUYA 3QV1A 5H3CA 4KR6A 1JFFB 1GQOA 1Q0SA 1UOPA 2G6BA 4CUZA 5BRJA 1N6RA 3SXUA 1N2OA 2O3UA 1VSQA 3PX3A 3V8VA 1L7EA 2FPPB 1XDZA 4M0FA 4WASA 5CJ2A 4Q15A 4XRGA 1IJEA 1L7RA 2UYGA 3PFIA 2NTYC 1JE1A 2C7RA 3LA8A 1CKEA 3O3CA 4DLYA 3UIEA 2G04A 1L1QA 2AXQA 4LJLA 1C7FA 1N5OX 1UPXA 3EH2A 5LPNA 3LWBA 3FIUA 4HNTA 3FCAA 1DO2A 2RARA 4OQ4A 1VCOA 4RDHA 5EJGA 2QD2A 1NUSA 4FN4A 4JI7B 3ZZMA 2CXHA 4OQFA 2AK3A 3A6EA 3PVZA 2GAFA 1FFHA 3QEJA 3WNQA 2W58A 5CLJA 1SD2A 3HSKA 3PICA 2AG5A 2DX7A 4FGJA 4M99A 2D13A 3ICCA 3KS9A 3W8DA 4A0RA 1B1AA 4IZOA 1W2WB 1U02A 1OFUA 2IYEA 1IUNA 2XOKD 3V4LA 1Z22A 4EHNA 5JU6A 4ZVKA 1DX6A 4Z7NB 3OFVA 4HNGA 5BY2A 4KN8A 4PXYA 1AGPA 2GCOA 3QY9A 3ZDZB 1QGED 4WUVA 1HZZC 3TBKA 1WL8A 4YRAA 1NFFA 1V45E 1V7PC 3I34X 5LDHA 2SHKA 3EZ9A 2V8BA 2P7IA 4LRUA 4KDFA 5LD2B 1U99A 2CNWA 2E4YA 3F5MA 4DMRA 1BVHA 3AEYA 3OF5A 1Q1NA 4QC2A 5AKGA 5E3IA 1THGA 2B2NA 2V65A 5BSUA 1UBUS 3CHYA 3LK7A 4BXOB 4G6ZA 2ERCA 2RGGA 4KE7A 2PMFA 3ONFA 2OV2A 5DXJA 5LZ9A 3OT1A 3SY8A 4IIYA 3LXXA 1XYGA 1FRVA 4NYMQ 3W34A 4C88A 2Y93A 1KQPA 5E0KB 3RYIB 3KHUA 2ZJFA 4QYIB 3CLSC 1W19A 2YXBA 5IZCC 5JCOC 1KK1A 1VIVA 3QTLA 3C3CA 1T1EA 2JIZD 4MKFA 1JH8A 4BP8A 1BGXT 4FYMA 3AF4A 5FJIA 1Y37A 4D81A 1CE8B 1E3LA 4B2YA 5JS6A 3H8SA 1JUDA 1Q3TA 3IODA 2FSSA 4AF6A 3GCXA 4RHYA 1T2DA 1GPDG 3GDGA 2I3GA 3AO0B 3QE3A 4GX5A 1CEQA 2BPOA 2MT9A 2NWQA 3K7EA 2C8LA 1XEXA 2GO1A 4IIVA 5H9VA 3WADA 4GF5A 2BMDA 3RW9A 1A96A 1KOFA 3IDOA 2RE8A 4Y2UA 4AT1A 3OQBA 2FPIB 4B82A 4U8GA 5DN6D 1T3TA 5FUQA 5ALLA 4CQMB 1Z5WA 2Q0HA 1H8ED 2IODA 2VHQA 2B6HA 2GNOA 2WYIA 2AR9A 1EFVB 3GEPA 1E1CB 4MX8A 3B6MA 1EEHA 5BVGA 4YI3A 4KWEA 3KUCA 2ZWIA 3PEEA 3CUVA 1HORA 3ZV3A 2G88A 4ERXA 2NV0A 2LE0A 4LOKA 3MHTA 3CH6A 1ZXXA 1MIHA 1OIXA 3UK0A 1N8KA 1NE7A 5EHNA 4J0IA 1VYUA 4FDAA 4EG1A 1ID8A 4I4NA 5IT0A 4DOMA 2YKGA 1NBME 3NR2A 2AX4A 1M6HA 4MVJI 4BPBA 4LZJA 1PZGA 2FLVA 2XQVA 1YBVA 2Y1CA 2BGIA 3DBLA 4MVJG 1TJPB 1A8HA 5EMNA 4F45A 3AVWA 4YMIA 2I2WA 4MVJM 4EY5A 2GD2A 4ZT7A 4ARZA 2JBHA 4RGQA 1GFZA 3VAAA 5ADVA 3U5TA 1K3FA 2QZ4A 1X39A 2VNHA 2Z2IA 1KDRA 3NZEA 4RQAA 5HJEA 4AO7A 1V1RA 2W2PA 2G40A 2JJ8A 2I29A 2VH1A 1EVKA 1XL0A 3P26A 4OO3A 4KG7A 3R0VA 4Q9JA 5HF8A 2EFYA 4Q4LA 4ABYA 5DI3B 1SC4A 3AR5A 1V8PA 1VE3A 4I1OA 1VG0B 5IXYA 1KI6B 2VSXA 4XQEA 4G8JA 5IC4A 4O1IA 2ZFUA 1F48A 3BXZA 2BKLA 3KBBA 2VDNB 4CI9A 2AF4C 1N32B 3PXCX 1B43A 3BMOA 3M34A 1QQBA 1SNYA 4I81A 5FBLB 4IIJA 2EG5A 3F7MA 3ROXA 3MCAA 1EEXB 1LF5A 2P75A 1RQXA 2H0AA 3L0OA 4D3ZA 2PS1A 1O5OA 5H4GA 3KWJA 3U39A 3RSQA 2VYFA 3O82A 5A3SA 2BGGA 2C77A 3ED1A 4W9NC 3U61B 2C54A 1NTRA 2QW1A 1DQZA 4UNSA 4ZCRA 5B2FA 3LT2A 4RD6A 2JKZA 1VSUA 3LT0A 5GV7A 1EFTA 3ZZTA 5BT8A 3EFOA 1O7JA 1AB5A 1RWQA 1YQGA 1Z3IX 1JEDA 4FNAA 4KHPB 4KUHA 3NXKA 1UKCA 4AG3A 1ST3A 4NWIA 2IIVA 4YCBA 1KSGA 2CC2A 3RK4A 4RLFA 3R6DA 3ZVNA 4DT1B 5JAIA 4RHFA 1FTYA 3KOOA 4MJLA 2Y2VA 4G5FA 4NMLA 2XVAA 1KI8A 4LE2A 2VAPA 3OZDA 2ZAOA 4QHSA 4TPKA 2VYNA 5TC4A 4DDHA 1YS9A 3WGKA 2NO5A 4MV7A 4KQCA 3VYRB 4DJAA 4QGAA 1OU0A 1KL7A 1YR3A 4PQGA 5KMGB 2XCLA 2XUOA 4B8WA 1UBGA 1P7VA 1Y1QA 3OT1B 4HFMA 5IM4A 2UYHA 3I0NA 4MRNA 1KA9H 5FEMA 3FNBA 2C4WA 1VYTA 5E7MA 3TQIA 1SKMA 4IGAA 5LP6C 2AFIA 3NKFA 1ATIA 3KQVA 1N6KA 4TS9A 3CN7A 1CW2B 5KTOA 3HN6A 1TUGA 4DJTA 3P8ZA 4ID3A 4V0MA 4HAZA 3W3AH 4QAQA 4BWGA 3BGOS 4L78A 1F8FA 1AKYA 3PGKA 4MULA 5AKIA 5A7HA 4BOYA 2NPIA 1BX0A 1Z38A 5EZYF 3TECE 2ZJ1A 4PZPA 1T3LA 5K45A 1JT9A 2ZIEA 1CU1A 3TFQA 2I2XB 2H1IA 3HO6A 4UNPA 4LBZA 3LSYA 4ZOLB 5M04A 2QT0A 4IRXA 1ZJJA 2W2QA 5JAZA 4G8CA 1F2DA 1NUTA 2AN1A 4JLSA 3USCS 3WGGA 2YIJA 4B3XA 2PD6A 4B71A 1K1EA 1RBZA 4X7BA 3RUHA 1JQEA 2F43B 4RUKA 5I9IA 3DFFA 3A2MA 5CA0B 3KOUA 3WXBA 3U60B 2FPGA 4JBIA 1LY1A 4Q6WA 1SBNE 3D7NA 1JKXA 1QX4A 3SDSA 3CF6R 1M83A 4MS4B 3T9AA 5CDTA 5CLLA 2LBPA 4OEHA 4FFOA 4B32A 1YJ8A 3NBKA 5HE8A 3TLGB 2CN1A 2YC4C 1DX9A 1U7UA 4AF8A 2DJIA 4YLEA 3HSSA 4Q3KA 5LL6P 3N0TA 2EZUA 4K9NA 4DB2A 1FPMA 2FPGB 2IC5A 5IN5A 4EUNA 1T4CB 1WXQA 4YO8A 1A1SA 3ZLVA 4ZCSA 3FJ1A 3UV6A 2XIQA 3O03A 3TS1A 4D26A 4NARA 2HIGA 4EO4A 3A9WA 2NU8B 2W4IA 4JSTA 4L4YA 3TQQA 4RULA 2YYYA 4AX4A 3ICWA 2O2DA 3E7FA 4Q01A 4J2HA 5A4AA 1E2MA 3KUXA 2O8FB 4HR7A 2GEKA 4DSAA 2PT7A 1SUSA 1HTBA 3QOWA 2FOXA 1G2OA 3OHMA 2JI9A 3DFZA 1M0TA 4C05A 3DXZA 2CMGA 2QEQA 1AG9A 1QE3A 4GX2A 4ZI5A 2FPSA 5C5DA 2QE6A 4QLBA 2HHHB 5ETJA 1I1OA 4TZTA 4XARA 3CRRA 2MYUA 2GJAA 1GL9B 3IE0A 4U7TB 4XEUA 3JATA 3PFNA 1MOQA 4OYHA 5K0TA 3A37A 5D87A 1X7YB 2VR1A 3AF0A 3GFVA 2FW7A 3TAXA 4OK5A 2BFCB 2A5FA 3HZOA 5CNKA 4EB0A 5BXYA 2P4HX 2RKOA 4MMYB 3ZCXA 4Z2YA 2PGAA 2AYXA 4LZWA 1NQOA 1LEHA 3EISA 1FXWA 1UBKS 5IF3A 1IN7A 1G0OA 5BSGA 2CLEB 2IH5A 4OD0A 5F4BA 5HZHA 2HL6A 1YC2A 4KQEA 1ZUNA 3TW6A 2ZQ5A 3OOEA 1JHVA 4IR7A 4JODA 2POCA 3DH0A 1TZMA 2VTKA 1E6LA 2NO1A 4GFDA 521PA 4MGYR 2N75A 2IPXA 5C4GB 5DW0A 5EFOA 4B7CA 2G9VA 1X92A 4K0RA 1DKLA 2ZTLA 1TD1A 2EWVA 3IJRA 1KZ1A 4V0ME 1LZLA 4BE7B 4YP5A 4RPJA 2PH5A 1E0DA 3F6SA 3RC3A 2ID8A 3HCPA 4EHHA 2YWBA 5JH7F 4TRRA 1JWLA 2H4WA 2BD0A 1RC8A 3MAJA 4Y7DA 1GU1A 2GTHA 2WNIA 1QQ5A 1W5BA 4MQEB 2IHNA 3SIXA 4NG4A 1TVKA 4XM0A 3W7BA 2J07A 4FZ3A 5GGXA 5SYMA 4BV9A 3T3OA 3GGCA 4C08A 5JWRA 5BW5A 5KSOA 4ACAA 3FHTA 5IKXA 1Z0ZA 4KREA 3ETGA 1N7JA 3CH7A 4C78A 3AUSA 1IWBB 1NY5A 3SYKA 2VJMB 3PQEA 4FYJA 4RD2A 2O23A 1M6NA 2V45A 3MJHA 2VRNA 3IIMA 2I6SA 5KTNA 1BKYA 1V1MB 2YJZA 5F1KA 2MR6A 1IL0A 4FGWA 4L0QA 4JJ8A 1LB1B 5C9ZA 3L8DA 4ROTA 1QF9A 5H1YA 4M0DA 4HDNA 2O7SA 4HX5A 1RR6A 2P68A 3GFSA 4C0SA 3Q7SA 1V6SA 2W43A 4CM4B 1B93A 3COZA 4MK4A 5KWJA 1WXEA 3KQYA 3ZWWA 3K5WA 3JQ8B 2XNSA 5CLHA 5FOVA 4WXYB 3UPTA 2H5JA 1QGZA 1R9JA 1UXIA 5DCWA 2DETA 5EZYB 1EX1A 2ORYA 3DM5A 3K1JA 4CBVA 3C45A 4NFLA 1E3IA 2V8OA 4OHBA 4G2TA 3HB1A 4MI1A 4OQYA 2O54A 4JH0A 3WK7A 1MHTA 3PIIA 4QPZA 2WVHA 4MPRA 3AESB 2QTBA 1FA9A 2Z2JA 1X7GA 3FXAA 4ZAGA 3DHEA 2W42A 3ZX5A 5TMBA 2C78A 1R9NA 4IFBA 3EVFA 4OK6A 1ENYA 3PD7A 4P3XA 5ARCA 5H82A 2ZRJA 2NUTB 4LSGA 3FYUC 4LFBB 5I4BA 3IUNA 5EZYA 1AGYA 2I6TA 3Q0IA 3UTCA 2Q3JA 4UM9D 4C6HA 5HOQA 2F67A 1Q0UA 1X7XB 3R0ZA 1DC7A 4MUYA 3IQGX 4Q1FA 3AT1A 2WJYA 4X95A 5JCPA 3ZDFA 4QVIA 3K1YA 4W5TA 1TTHA 2P5UA 4HH1A 1U0NA 1ISRA 1KSHA 1D6JA 2C2OA 4PV7A 3S0JA 4ZQIA 1Q77A 1U0RA 3DTVB 3EODA 3NBZC 4LHWA 5B4TA 4JUFA 1COWA 3IP7A 1SVLA 2H9IA 3WNCA 2J5KA 3C3JA 4G9GA 3DVLA 2WSIA 4JR2A 4LCEA 5M3BA 1CB0A 2OP1A 1O6BA 2OQIA 2V4ZA 3H6KA 4P81A 4US1R 2YTZA 2HCFA 4F4HA 3GRKA 3K0CA 3SEAA 2TECE 4GVXA 2ZJ6A 1ZD9A 1EA5A 1KF0A 1PD1A 1GTZA 1ZM4A 1J0CA 2HK6A 2J6CA 3AFIA 2CFOA 3NYQA 2G4LA 5AOVA 2Q1YA 1E3QA 1XDBA 2ZBQA 4MDHA 3MGAA 2ZU0C 1UWVA 3ETNA 3IV7A 4OP3A 5EKTA 5DNDA 2XNHA 2QOEA 3HBNA 4BASA 1ZA1A 3WA7A 2XV1A 3ID6C 3M9LA 2PX2A 1VLMA 2D4HA 4CIDA 4GT1A 2YZNA 1EDDA 1Y4DE 3AF1A 3LT5A 4H1UA 4JLVA 4ZQCB 2V74B 5F2EA 1Q1EA 3MJ4A 4RJLA 2DWOA 3B7GA 1ADCA 5DOZA 4AQ7A 5LXTF 5M29A 1ECFA 1VOTA 3EE6A 1FTGA 4YQZA 4QTUB 1NR7A 2PMDA 1BMQA 1PR9A 2BONA 4TQ9A 4EJFA 1QHYA 1GEGA 4WZAB 3TLAA 2GHRA 1DXQA 2XCSB 4K88A 4XX0A 1MD9A 1J4AA 2JFBA 5CM9C 1WXDA 4Z1MA 3KELA 1NF9A 3P52A 2QQFA 1A7JA 3ZIUA 4B34A 2MIIA 5F35A 1PT9A 3D02A 3DE2X 3UHPA 5AJVB 3UEOA 3OESA 4FW9A 1J5EB 3AFNA 2NSHA 4HWSA 5IP5A 4QXAA 3ER6A 1I2ZA 3S81A 1CZNA 1XPRA 1H2FA 3FFXA 1WP9A 5T4FA 1LV8A 3U5ZB 3PEWA 1SG6A 2ZXEA 3CNNA 3OQIB 3VR3D 3HVJA 5GONF 1NC1A 3SMQA 5AW4A 4A8JB 4QVGA 5EJMA 4LQCA 1YU6A 2A4MA 3DEJA 2C5BA 2A57A 1TZKA 3K15A 3W6ZA 3ZE9A 4LOIA 3IP3A 3BWYA 4R1NA 1TZJA 3IIIA 3AGPA 3TRJA 2AI3A 4M9XA 4EA8A 2QM7A 4N0PA 4DA7A 1ILEA 3D0OA 4A91A 1PT6A 4JT4A 4R1UA 4YP7A 1MO6A 5U9CA 2TYSB 4J7UA 3C8HA 3ZHXA 4HWRA 2PUDA 2QZJA 2ZZNA 1MKYA 1BO6A 4AXBA 4TMKA 1C9YA 3K8QA 1FFGA 1J5PA 2E89A 2PRKA 3GEGA 1LH0A 4K3UA 3L0SA 1TL7C 5A05A 1WABA 3LT1A 3WSWA 4C4PA 3Q8KA 2OBBA 5LQMA 1US8A 1F51E 1UWCA 2BC9A 4ZI3A 1GHTA 4QFDA 4DSZA 4QNMA 2WYVA 1ZJ4A 1NQXA 3VYSB 1I5RA 2EV9A 4EKYA 2FVYA 1LLDA 5FO1A 4ARBA 4BO6A 5GOTA 3WYGA 4BAGA 3BERA 2IPMA 2HPVA 3U7JA 2EGGA 4FLEA 1AK1A 3F8SA 4OHVA 1FDWA 2B3TA 1BS1A 1NYTA 1KMQA 1G3MA 3BFKA 4FQ7A 4HEA6 2WJJA 5B3JC 4GECA 3GJ8A 2D54A 2NN3C 2XZPA 1BEUB 3QBTA 1E1MA 5AI5A 3E8MA 1VL2A 5HIMA 3L43A 3CH4B 4QARA 5B7PA 5KNBH 4IM7A 2H00A 3QM1A 3LTNC 3WKCA 2QRVA 1E2UA 4JHXA 3E2IA 4TWBA 4CCWA 1WKCA 2IUTA 1N6HA 1S2OA 1YR6A 2D0OB 1OMOA 2IHJA 4CEJB 1YZKA 3IP8A 1QC5A 3GNLA 4FVTA 2W71A 4OV6B 5AJZA 3W6NA 3ASZA 2W2NA 3PQ8A 3TNJA 4CETA 1CTQA 1NBMA 1NSTA 4NFSA 3I9LA 5E4TA 5EPUA 2XE8A 4MLDA 5JXWA 3C98A 2IF0A 4Q9HA 2E5LB 1XZDA 3HB5X 3PA6A 3ZGZA 2CDAA 5E7JA 3X1DA 4ENQA 1NRIA 1YT5A 2BFPA 2GZSA 2KS6A 2AJLI 2WAAA 4K6GA 1KE1A 4GSLA 4KN6A 4OHFA 1Z7EA 5DK6A 2PUCA 3LIPA 4P4LA 2A9OA 1LDEA 4GZLA 1D2GA 3T94A 1BJRE 3OKCA 3DC2A 3AI2A 4BNWA 1JIUA 5E0OA 1KMMA 2XMQA 3DJYA 4DREA 2OCBA 5JC1A 4FP9A 1P4HA 1KO7A 3MRTA 2MSCB 3KEFA 3OLVA 3ZV6A 3X2EA 4AY6A 3KWFA 3V1NA 3H1BA 1E9AA 3FVVA 4D4LA 5BWMA 4MUMA 4XWAA 1A27A 2CLIB 2IU4A 3O47A 3GFOA 2GYWA 2X77A 4NG5A 3PVSA 3SC6A 1L1EA 5AUQA 3BFVA 3I28A 1CUFA 4S1WA 4BWYA 3AR7A 2OB2A 4WECA 4H7IA 4MGHA 5T4HA 4JBGA 1UJ4A 3K0HA 3BG5A 3LY7A 2IYZA 3K1ZA 2KW5A 5ANRB 4XFJA 1KR2A 1W48A 3KU4A 4MUFA 2AW5A 1I5EA 4TTAA 3PGA1 5CM8B 4ZXFA 4FXOA 421PA 5ALVA 3VTZA 5AW3A 1Z6QA 3MYRA 5DEIA 4YMSA 4MCHA 3GT0A 5DEOA 3EQ7A 3EZ6A 4OG2A 5ALDA 2ZYGA 1KE2A 4TVSA 2HF8A 4I46A 1O08A 3FPFA 5DTQA 1WMBA 3RNLA 4P4GA 5EGSA 5EKUA 1Q21A 1Z33A 3OQ1A 4ZGBA 5BRAA 3I2JA 3LP5A 3HPQA 4Y6PA 4D7AA 4WACA 5AESA 3GK3A 2WWHA 2P9QA 1J22A 1O54A 5JY1A 1OV4A 4RZ3A 2QLJA 4U2KA 1XU7A 1ZDMA 1GNSA 2HK7A 3Q7PA 4J1QA 1JEEA 3HBJA 3OPYA 2DECA 4EHFA 4DR5B 1JE0A 3DTVD 2VDLB 3ADCA 4ENWA 2UV8A 1S0UA 5FT9A 3TMKA 2VJAA 3H9QA 4D5EA 3K0FA 2DHQA 4C4AA 4TUYB 4OHKA 2ZBGA 3WB2A 3L01A 4CE6A 3C16C 2B1IA 4XWKA 1PU2A 5K8IA 2GPWA 5BMVF 2R1ZA 2ZYRA 4F4JA 4XFKA 2Z4RA 3LYUA 4P92A 1CD5A 4IDFA 4INAA 3K0CC 1EFUA 1V9LA 2VBFA 3HE3A 1NN5A 1N2CB 2IGBA 1M1YB 3G2NA 3U4IA 4HQ6A 5CT9A 4LV5B 1JPVA 1Z26A 2WU4A 3QA9A 4M9SA 4U0JA 5AJTA 5EFZA 2IXFA 4R01A 3T7AA 2WTUA 5L7YA 2ZU6A 3ZEIA 1TW3A 2CVPA 1BXRB 1FZTA 4O4JF 4OYYA 2BWJA 4X7PA 3DMTC 5KTYA 3PA8A 4BMNA 3L2OB 2I6FA 1WLSA 5L8VA 2JIQA 5LOVF 1FRQA 3DMDA 4AG5A 1N3BA 2UKDA 3GX1A 4FOSA 2HPZA 2KBEA 3LMKA 4FFMA 4MJ7A 3HDQA 3OIVA 5LDDC 5CEEA 4B3IA 4HAVA 2HF9A 3GJRA 1RJWA 4X7MA 3RVQA 2IUYA 3M6VA 1ADBA 3ZC3A 2Q4OA 1K75A 2ADOA 2BEUA 1YJQA 1UADA 3OEYA 3RRBA 2FPIA 3OCYA 4N82A 2O8VA 3FSJX 3GRZA 4Q02A 3DDUA 3OZVA 2NQ2C 2WTXA 1M1YE 1UJ6A 2VK4A 3OE1A 4C7BA 1QGUB 2OFFA 4DIEA 3V34A 2PMKA 4TTRA 3PL5A 2XOKA 2WW8A 3CZ5A 5BVGB 1LX6A 1HLFA 2EU8A 2M1ZA 3A2NA 3FCOA 3TCKA 2NU9A 3DZIA 3SPXA 3IUBA 1IAQA 4YJGA 1WETA 1PVDA 2YNMD 4YJ3A 1GQFA 4F2WA 3IPCA 4X1KA 4QFMA 1EKXA 1F4VA 4IEIA 3N6XA 5DI9A 5TS3A 1WV1A 4L5BA 2C9CA 1YR2A 3SX4A 3C4VA 4R2KA 4U7PB 4WOBA 2H54A 2Q4DA 5LKAA 1OT5A 2Q3HA 3PFGA 3R3UA 3T38A 3EXIB 4GU5A 1CVIA 4BB0A 2VJKA 1T2NA 1R66A 5IM5A 4G09A 4D9FA 1JEJA 1S8OA 3HCDA 4FFBA 3HCBA 4TLMB 5DLYA 5ERXA 5DTEA 1NQUA 4BQEA 3CO0S 5JAHA 4P7JA 1XRQA 1NI3A 2WILA 2G7MC 1QQ6A 1QFXA 1QHNA 3D7RA 3GJ7A 2ECKA 1HX7A 4A10A 4NK5A 1ML4A 4AL4A 1B4DA 1GCOA 3NHYA 4AW9A 3DL2A 4ND6A 3VR4H 5CAEA 1KI6A 4L8VA 1QO0A 1WHTA 4EY7A 1YOBA 3U31A 2X3YA 5CR9A 1X80B 1E7MA 1XEWX 1Z29A 1L4BA 1ONOA 1TVMA 2SICE 3LQRA 5D8DA 1B6RA 1FP2A 5G0TA 4EHIA 1E2FA 2J7KA 3E7XA 4HS9A 3ZI7A 1C1HA 4EG7A 3ASVA 2YMQA 4AZ3A 3A1FA 1N9ZA 1K97A 3MMPA 3ITNA 3P9IA 2OPHA 4TMFA 3PNLA 4A8JC 3WOHA 1KRXA 3JQEA 5E9JA 3NGMA 1ZIPA 2BKEA 5IAAA 1JLKA 5I5EA 1P2TA 3HJHA 3P9YA 4MHOA 4HFNA 3A6ZA 4H0CA 2YHIA 2G70A 5FL3A 5L4LA 5J2TF 1SK9A 1Y1KE 4C7MA 1GCUA 1DKQA 2DEUA 4XW2A 1XZLA 3CVUA 3P96A 4OB7A 3FYTA 3G8BA 1GSIA 1DC8A 2PJRA 4FONA 4XLTA 3QI2A 4Z2AA 3IDQA 1GUBA 3VVLA 3ICQB 8ATCA 2DP4E 2W6JD 1M6VB 2CT8A 3KOYA 3CKLA 4G4IA 1CJKC 1WDLA 4WZBB 2XCOA 2XMGA 2X1HA 2W98A 1W94A 2VSOA 4KWHA 5FR1A 5FOTA 3RVLA 5EEGA 1AU9A 1O4VA 3CUKA 4P2BA 4QRDA 4EMUA 2B99A 2A4KA 2XLCA 3QLEA 2W4QA 4CKYA 1JILA 3JX9A 5FADA 5IULC 2JFWA 4YRFA 1OXUA 5LJLA 1SCQA 2WFMA 3CPEA 3Q7RA 5BR1A 4OATA 2FW6A 1WXXA 4YJKA 4M7WA 2HIMA 4IOMA 4YAWA 2MDTA 3U81A 2R751 4DLRA 2CL5A 5H8WA 3GEHA 3TRIA 3H17A 4JDUA 3AEUA 3OLWA 4BO1A 5B3LA 4HWKA 4I4LA 1NN3A 1H8HD 5K05A 3GPIA 2PKXA 3E4CA 4PX3A 3U16A 2OBLA 1GGJA 1J25A 3I23A 1NXXA 1UIMA 4MIKA 2YRWA 1KMIY 3VI4B 3K0SA 4AI6A 4D3DA 1KDPA 5K09A 4G5HA 1J8VA 1J06A 3H19A 3EVEA 1MFZA 3PF8A 1LBIA 1SGWA 4IHQA 4N41A 2CZGA 1U3DA 4IINA 1B0UA 4O4HF 3C8MA 5EUCA 4O5OA 4EB8A 1DIGA 1Z8NA 4N0MA 2ZQYA 3T0IA 1W36B 2X5XA 2NYUA 3GNQA 4DXAA 3JQ9C 1MJHA 3VR3A 1ZO8A 3JAKA 4HDCA 1LTQA 2HDHA 3FMGA 3W6PA 1ZS9A 2PJZA 2PSDA 4TL9A 4V2UA 4WK2B 1PVVA 2HGZA 3SSOA 3VISA 4DLUA 2JBAA 1U9YA 3GAFA 5ALYA 5AUOB 2WWYA 5FB3A 5HXAA 3LXMA 4ERNA 2VTEA 5DK4A 5B1SA 3USZA 1TO1E 4LMRA 1XTPA 2XQKA 5CYOA 5KDOA 5EAIA 4YA6A 5B64A 2QJTA 2ZVQX 2ANCA 1MJ5A 1XCGB 4REMA 4FKBA 3VR5A 3IVCA 4V1CB 2UVDA 2K6GA 1E5QA 4C4OA 3S1LA 2B5OA 1P62B 3KPUA 2R4QA 4WXRA 5EG5A 2N1MA 2W2LD 3FWKA 1PN3A 3KNZA 1LDMA 3W5UA 4ZYLA <