2ZI5A

C4s dck variant of dck in complex with l-da+udp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
219
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 219
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi5A00
4YMSA 1G7SA 1P9NA 4EPYA 3K09C 2ZAOA 3IPYA 3FMPB 5J5CA 3B1WA 3SYNA 3WXMA 1RE0A 3FTQA 4JLPA 4LRWA 5B57C 4DWJA 2C95A 4PHFA 2V3CC 1RJ9A 2ZE5A 4DIDA 2YHSA 1W36C 5KUTA 4IFBA 2WJHA 1YRAA 1ZUIA 1G8YA 3BK7A 3T1VA 2OEPA 2ZI4A 1GNPA 1OYYA 1X8JA 2ZJOA 4LI0A 3RVBA 4BLPA 2Z4RA 3GEEA 1N2CE 3BWDD 1LS6A 1QHGA 2MSDB 5SZJA 4HAUA 4B34A 3GLIE 3PV0A 4D4MA 5HR5A 5FI0B 4JVNA 2D7DA 4RKEA 1Q57A 3K9NA 3RYTC 3CPEA 3BB4A 4CIDA 3ZQJA 1KY2A 3MAAC 4WA7A 3TVTA 3BBPA 3PVSA 1E2JA 1U8AA 3T61A 1KO4A 3CR8A 4OQMA 3OEED 3DKPA 1W4RA 4IVQA 3B60A 4LHXA 5FUVA 3VHXA 4MDFA 2PJZA 1Z0JA 3BH7A 3SU8A 1CR4A 2IEZA 3THYB 2GKSA 1TUEA 3BXZA 1IOZA 1VCIA 3X2SA 3L8ZA 4G0NA 4POAA 1HA3A 4Q7KA 3QSYA 4IOKA 3W3ZB 2DFLA 4A9AA 4QGFA 5JHHB 2F55A 2IX3A 4TYNA 1Z6YA 1IXSB 2R6AA 4X8OA 1BS1A 1EX6A 1ZUHA 4XJXA 2OCAA 3EIHA 3Q85A 4GRAA 2IYRA 1Q1QA 1DOAA 2CBZA 1S4QA 1U90A 2C77A 2DWPA 3AEZA 4UNQA 4JL5A 3BORA 1AS2A 3ADCA 4O25A 5FTNA 1KKLA 3VR3A 2W6IA 1GITA 3A8TA 2BEKA 4ZDKA 2N42A 4TWZA 4B3XA 2KJQA 2JEOA 1XD2A 3LRPA 3C14C 4C2TA 1LV7A 1T8UA 3IDQA 4IOJA 1XMIA 3Q7QA 4EKDA 4XVQA 3VU9A 2D06A 4MRNA 3U7HB 2WJVA 3TKLA 1GKUB 5E7IA 2VP4A 2QMHA 4B2LA 1VG1A 4KITB 5FTKA 4Q02A 4IJMA 1OPXA 1SKYB 3QKRB 2H18A 3PEWA 3NBZC 1IN4A 3ASYA 3TAUA 3UK6A 4A8JB 4E03A 3VKWA 1R8SA 1G64A 3FMFA 1OF1A 3SNHA 1RW4A 1ZM2A 2BMDA 3IIMA 4EJSB 2GZDA 4Q9JA 3V4FA 4R71A 2ZU0C 3UATA 1Z29A 1HT2E 1EG7A 3TSWA 1XZQA 2CJWA 1T5LA 2YVUA 2Z6VA 1JPNA 2ZSFA 3CWQA 3FE2A 4XWOA 4TSFA 5F3WB 5FPTA 1YRBA 2WBLC 5CYOA 3KL4A 1JJ7A 1IBRA 1UADA 2PZGA 1RYHA 4V03A 5JLJA 2WMOB 2OXRA 4HB3A 5L3QA 5DNYB 4BLSA 3RSOA 2J0VA 2DB3A 3BGWA 3NTUA 4US2R 5EJEA 1KK0A 1J70A 3WBKA 3ZD7A 4JSTA 1IN6A 1IY1A 1E94E 1OE0A 2FV8A 2ZJZA 3LVRE 4OKSA 3U7EB 5L8VA 2WSSA 2C96A 3CH4B 4EPXA 1UEJA 4JSYA 1ZUNB 4H9GA 4NPHA 2ZS7A 4R98A 3T06B 4KI0A 2GCNA 2OG2A 1R10A 2NOAA 4LV6A 3RAPR 2OFOA 1E98A 1BIFA 2XTMA 1QG4A 2ERXA 2O5VA 1N5KA 4HYYA 1KO8A 3PEVA 4XVUA 3FHCB 4IDPA 1NBME 4WZ6A 2R6CA 1OJLA 1Z28A 1RRPA 4HAWA 1KI4A 1G5PA 1IN7A 2OFWA 4A1FA 1R0WA 1NBMD 1W49A 1G5TA 4M8NE 4JT2A 1XEFA 1J90A 4G5SA 3KB2A 4C7OB 4QL3A 1IQPA 2Q3FA 3VMFA 2G0NA 2DFKB 4LYAA 2O0HA 3THYA 3ZVRA 4RJLA 2RGAA 2ZRFA 3K0CA 4KFRA 2JLSA 3ADDA 4Q4AB 2IHBA 3Q9LA 4FN5A 1M34E 4AURA 2VP2A 2B7BA 2VSFA 1FUUA 5FL3A 1G7TA 3SJAA 3DM9B 4XOIA 3WHKA 2GJKA 2FEMA 4GPTA 4DLVA 2Q3MA 4PXAA 5LPNA 4DLRA 3EASA 4KBGA 1LVGA 3L0OA 1HUQA 2G6BA 3QY0A 1AZTA 4D26A 4BFSA 2ZR0A 3W6NA 1N6PA 5FPYA 2LWIA 2FSGA 4W7SA 1SVSA 3HPRA 3W8NA 4IEEA 1MV5A 4KO8A 3QXHA 5IK2A 1U0HC 1R0YA 2G9NA 4UNSA 4LOAA 1CULC 3RS5A 2A5JA 3QJYA 4KLNA 1S1MA 4JLAA 3Q3JB 4QBHA 3BERA 5FPKA 5KSPA 5JEEA 1RC8A 2KE5A 4B6EA 3JVUA 3C41J 4GZMA 1YZNA 3GJ5A 4UJ5A 3GLHA 4PPQA 4DKXA 5JJLA 5IHPA 1RZ3A 1U9IC 3QKRA 2E1RA 1EWRA 1C4OA 4AK9A 4NKRA 1N5JA 4A8JA 4N1AA 2IYZA 3U5ZB 5A4JA 1E2EA 5DYGA 4EJSA 3SE0A 4KCGA 3QVUA 3K53A 1E3MA 2ZTSA 4WOPA 1U98A 1QVRA 1W2HA 1G9XA 5BN5A 2QN6A 5CDFA 3UWKA 4B47A 1CS4C 3MFYA 4GOJA 4JKIA 4L8GA 2XEXA 4TL9A 5JS7A 2C03A 1TF5A 1SXJE 5EE9A 2WIAA 1GIAA 3EZ2A 3KKMA 2JLRA 4QRHA 1NJGA 5FR1A 1ZW6A 3CUEF 4DDUA 2QEQA 5EUMA 1G3IA 1PV4A 2ZPTX 4I1UA 3WP0A 2VSXA 5FUXA 4NYJR 3AVQA 1YR9A 4RSGA 3RWMB 4MUBA 4EPTA 1NIJA 3WRYC 2NO6A 4CEHB 4LC0A 1S2MA 2BMEA 4BFUA 4ZCIA 3EZFA 5EUQB 3CW2A 4D82A 1OV4A 2Q6TA 4Q1FA 4C0JA 2BVNA 3JZMA 2GAAA 2QT1A 1Z6XA 2XZOA 4NCKA 2QUZA 4MA4A 3IO5A 2X77A 5UKDA 3SOPA 4RCYA 3DL0A 1JI0A 1OW3B 3VFDA 2C2HA 2VL7A 2ZJAA 1E69A 4XWAA 4TZ6A 3KKPA 2WJYA 1OFTA 2ZSDA 1A2KC 1RKBA 5FTLA 1ZU5A 3LO5A 4XVRA 2XTZA 3ND8A 4B74A 3LW7A 5TB5A 1PUJA 3G82C 2WTUA 3UIEA 3W8RA 4JBWA 1L4YA 2QORA 3AGQA 3B78A 4C7OA 3NHAA 2I4IA 4US1R 4QM6A 5EXSA 1XZPA 4EPVA 4PFSA 3IBGA 4B76A 1SGWA 4PQFA 5JZVA 3R9WA 2R6DA 4Q4AA 1XFAA 2F9MA 1LS1A 1DG3A 2XTNA 5EE0A 1Z2AA 4B71A 1GOTA 3TUJC 4DLZA 4C4PA 1LF5A 3NKVA 4HEJA 2REBA 3KDSE 2BIFA 4I4LA 4M1WA 2ZRMA 3DZ8A 3QKUA 5EQTA 4V0MA 1E2HA 4HUTA 2ATXA 3BS4A 1N5IA 1S9HA 2JGNA 2ZRHA 1E2NA 3MSXA 1T3HA 1KI7A 1JNYA 2V9PA 2ZRNA 1OFHA 4PPGA 2GXSA 4PX9A 2H57A 3NBYC 4QBGB 4GFDA 1OT3A 1NJFA 2P2LA 4Y0VA 2YWFA 3PR1A 2W6ID 4YONB 4PANA 4O0MA 3O8RA 3FGNA 3HDTA 1KO1A 1VCOA 1OXTA 2ZRPA 1VHTA 2GEUA 4BFVA 1E2KA 1UDWA 2RKOA 3T1OA 1GAJA 3E70C 4Q4HB 4RD2A 4TTRA 4HAXA 2WJGA 4OK6A 2EWVA 4OK5A 2B6HA 1W7AA 1G41A 4I99A 4NYMQ 1NMXA 2JJ2A 1DE0A 4Q4LA 3OAAA 4LV5B 3RRNA 1TQ6A 3GLIA 4DEXA 1X1RA 2PT5A 2VHTA 3WP1B 4AI6A 3OE7A 2Q3HA 1CR0A 1GZSA 3I72A 3QF4B 3MG9A 4JZKA 4ZDWA 5JCZA 4Y0AA 1JAIA 2PMDA 4DSNA 5B2ZA 4GP7A 5HE9A 4B43A 4EQ6B 3KQUA 3P26A 4CDGA 2NIPA 4DSOA 1E0JA 2ZEJA 1JR6A 1E79A 4TSFD 3BE4A 3MWJA 2RGNA 2Z5FA 4F91B 2AK2A 1GRQA 3CR7A 2QRZA 3CH5A 3NEJA 4P4SB 2NQ2C 4D80A 3AF0A 4HDQB 4Q1BA 3U3MA 4D0NA 4B3DA 2VA8A 4XSHA 3TBKA 4LHVA 1J8MF 1G4UR 2HCBA 2W2TA 1W5SA 4DXAA 4CEHA 4TYWA 1GDDA 3Q5EA 2ODEA 1NVXQ 5ANRB 2WSSD 1SKQA 1GILA 5BYKA 3H84A 3IEVA 1UKVY 2PEZA 1BYUA 3QF7A 4R7ZA 5G41A 5JI2E 4DDTA 3I92A 2QENA 1ZVQA 4LHYA 2OE2A 3TH5A 1YE8A 1AKEA 2XX3A 1DAGA 3FDIA 3FPAA 4PSKA 5JMTA 3NBFA 3IGFA 2YWEA 2RMKA 1Q22A 4PO9A 4P32A 4OHWA 2ZR7A 4B3FX 3EWSA 2HDNB 3TR0A 2EVWX 3CNOA 4NTZA 4RFSB 2V6IA 4JL6A 1VECA 2UZIR 4GI7A 2ORVA 4RCZA 1UDXA 3AKYA 2OXCA 2R65A 2QAGC 5HKKA 4MH0R 2WHXA 2QM7A 1YZLA 2PMKA 2BDTA 1KGDA 2IYLD 2DY1A 3EA0A 3O47A 1HQCA 3WY9A 4A6PA 5AUOB 1E9EA 3K0SA 4WZBE 1SVOA 2BJWA 1YR7A 3SQXA 4F92B 2F9LA 3RC8A 3CKLA 5FH9A 1XTQA 1EWQA 1X3SA 3BB3A 4L5BA 5CITA 3T1TA 3EAQA 5SZKB 3A1WA 4PC3A 2EFGA 1MABB 5AR1A 5M04A 2QQEA 4LJ6A 4M1TA 2WKPA 4I1VA 3K0AA 2GJ9A 1JR3E 3BB1A 1BYIA 2GVDC 3PG5A 1KNXA 3N2EA 1OHHA 3A37A 2LCFA 4JLOA 1A2BA 4ZIRB 2PT7A 2KSQA 3T35A 1WXQA 2J1LA 1TAGA 2WAXA 2WZQA 3QPWA 3ZS8A 4PHTA 1KIMA 3GEHA 4B73A 2ZSBA 1W4CA 1ZC4A 1SXJB 2O8BA 2WM9B 4M2LA 1XJCA 5IK2D 2QP3A 1RPZA 1KZ7B 3QKSA 5GVSA 1AGPA 4M1OA 2C9YA 2C9OA 4UNRA 1QHHB 1YZGA 3TIFA 2C98A 4AYTA 4KXFB 4Q9LA 4NL4H 1CJTC 4M9SA 4TZ0A 2JLZA 4OBEA 5DN6A 4PZZA 2WWYA 3U7FB 4XTRA 4A6XA 4CEIB 3G5UA 2WOOA 2XZPA 3L0PA 1XEXB 3MRSA 3EX7C 2J0QA 1HTWA 2GXQA 5IDVA 1ZCAA 4JLNA 4F4CA 1NF3A 2J7KA 5KDOA 1F5NA 3G0HA 4LC1A 4QGHA 4PO8A 1ZIOA 3W34A 2PLFA 2GF0A 4MYUA 4OJQA 2DWQA 1M1YE 4V0KA 4BLTA 1BMFA 3GJXC 5CDFE 3PITA 3QF4A 1RFLA 2ZRAA 2XSZD 1I4DD 4WZAE 4BEJA 4EQ6A 121PA 1OB5A 5J40A 1XEWY 4ITRC 3ZS9A 1TQ4A 3RWOA 4OQFA 3SEAA 1S96A 2O0KA 2PBRA 4MRRA 3DPUA 1JQLB 1KO7A 5B64A 2WSMA 2KBEA 4ZI2A 4LJAA 4P4SA 4URZR 2ZRJA 3E5HA 4IDNA 4GZLA 3GD7A 4TN1A 1MRSA 1TEXA 4KAXA 3RDPA 3REFA 4LK2A 3MD0A 4FWTA 2HEIA 5EZ6B 2WOJA 4AIIA 1E0KA 3U6BA 1E9FA 3W3AA 2CLCX 4TMTA 2HXSA 1G1MA 2A5YB 4G5GA 3EC2A 4JVLA 4IRUB 3T5GA 1NLFA 2OBNA 1F3OA 2W00A 2WAYA 4W5HA 3EPLA 3KKQA 1CJKC 3B8HA 4HATA 3LBHA 5DSZA 4ESVA 4YMTA 1XDBA 2QPOA 1DEKA 2IBMA 3L2OB 2GA8A 5LDDC 1E1QA 1MO3A 2GAOA 3HWSA 5BYJA 2ZRCA 3I61A 3CRVA 4DRZA 2VH5R 4AY2A 1FFHA 1D8TA 3SYLA 3ZZTA 2YKGA 2QP9X 2G3YA 4H1UA 5A5GA 4CT4B 2D2EA 4RFSA 3CRQA 4JL8A 3THXB 5FBWB 2BCJQ 1LF0A 1TU3A 3A4LA 5G3ZA 2QGZA 2QI9C 2L0XA 4EAQA 1LTQA 3SHWA 3CRMA 2GK6A 4NMMA 4AKIA 1NSFA 4OQNA 3K70D 3U4QB 2IL1A 4JJZA 3I4LA 5K8TA 4JLBA 5A0FA 2ZYUX 5F2EA 1NY6A 1P2SA 1D5CA 1QHNA 4TMZA 2XAUA 1OB2A 1VTKA 4IFEA 4A0HA 4DC9A 5KPDA 2CDNA 1E2PA 2DYKA 3TQFA 1SHZA 3L43A 4V0ME 1FQKA 4NP6A 3EZ7A 1OXUA 2WWFA 2RHDA 1ESNA 1W36B 2GBLA 4DBLC 3AH8A 3GJ8A 3ONWA 1QVAA 2BBSA 4Q00A 1OIXA 2IA5A 1FMJA 3A1TA 4ZIRA 5EP2A 2IHYA 1MOZA 3H4MA 5JI3E 1P72A 3REGA 3O8BA 4N0EA 4S35A 4KYIB 3QPUA 4CT5A 1G8GA 3CRRA 2YV5A 2ZXUA 4LBWA 5DI9A 1SXJA 1WP9A 2XB4A 3RHFA 2DCUA 3ZYCA 3LWNA 2CVFA 3QG5A 3B6EA 4HLUA 2CCKA 421PA 1F2UB 4NCHA 1QHHA 1P75A 3D6TB 4E22A 2VP9A 3KB1A 2G0TA 2OILA 1X86B 5GJVC 3IQWA 4IDQA 1UBEA 1R5NA 5TVKA 4CEIA 4TT3A 3AVYA 4TLCA 1UF9A 1X8LA 1XEXA 5HZHA 2YZ2A 2XB2A 1N0UA 1W0KA 2BHRA 1KSHA 2HLDA 2PZEA 3I8SA 2JJ2D 1DAFA 4G5QA 3ZIAA 1XPOA 5AJVB 3OAAD 2BBOA 4LHWA 1LNZA 3UG6A 1XPUA 4HLDA 1HE8B 2EWWA 4L9WA 1EXMA 4HSEA 4LZZA 1Z6GA 5L3SA 1CRPA 3OE7D 4JLVA 3ZLJA 1CKEA 4M1MA 3HYRA 3U44B 1TF2A 3B1VA 2ZRBA 3EIQA 3NG1A 2YNMA 4H1VA 4M9ZA 2FFBA 1GP2A 1R0XA 2YJTD 1A1VA 2AXPA 1E79D 1L7VC 3WMGA 2VP5A 4BFZA 2V1UA 4NCJA 4F4IA 2FGKA 4OI4A 4L9SA 1QG2A 4DDVA 1O87A 2ZVPX 1RRFA 4I1SA 4XTCS 1TQ2A 3CPHA 1KTVA 5JHGB 1ZCBA 4B75A 2QM8A 3RRMA 1SHKA 5J4HA 3SZRA 4B48A 1KK3A 3ICEA 4LDJA 4DUGA 2H1LA 1IJEA 1HQYE 1BH2A 2ORWA 4UXJA 2VHQA 4F93B 1AM4D 3EW9A 3CO5A 3DO6A 3OESA 5JS8A 1Z2CA 2ZETA 4AKHA 1LW7A 3QXXA 1IY0A 2BJVA 2VHJA 2J3EA 4TMKA 521PA 1U94A 4Q4JB 1XB2A 2TMKA 3CNLA 2F3TA 1G3MA 3P4XA 4FD2A 5JWRA 1L2TA 3BOSA 1KDTA 2BMJA 2HJGA 2EU8A 3ND9A 3QXJA 4FI3C 1IY2A 3LBNA 4KHZA 4KBFA 2PH1A 1XD8A 1VHLA 1R5BA 4Q7MB 1GFIA 4YQFA 1TPZA 2J59A 1QF9A 1U0JA 1XTKA 4HAYA 1Z06A 2ZVQX 3RRYA 2KWIA 1ZD8A 2IUSA 2VIIA 2IXEA 2JAQA 5HKKD 4RFVA 3GQBA 3PQCA 1EFUA 3U4QA 2XITA 1YZTA 4XSGA 1KI1A 2CLSA 4Q5IA 4A0GA 1OSNA 3K09A 3OIWA 2A3RA 4LUCA 3MMPA 2AWOA 2V6JA 4S2EA 3BJIC 4GOKA 4F38A 5G40A 1LFDB 1XTRA 2ZM5A 1SVMA 1R8QA 5FFMA 2A5FA 3U2QA 2VTKA 2X19A 2WMNB 4TLDA 5FI1B 3DOFA 1OHHD 1KDPA 4TLEA 4NYIR 4ZV4A 1BO6A 5FR2A 1QHXA 2VQSA 4LHZA 4DZZA 5B58C 5KDDA 3QNUA 2W6JA 1ANKA 1JXMA 2JJ8A 1E2GA 2UKDA 3A1SA 1P60A 3C16C 3FHOA 3IIJA 5CK4A 2G83A 2ZS9A 4NHOA 1VYTA 1JXOA 2QMOA 2VYFA 1NLZA 2ZRIA 4PC7A 1KJZA 4DSTA 2R6GA 3LDAA 1J7KA 1O3YA 2AWNA 5BQ5A 5AUPB 1AQUA 4WAUA 4OL0A 3I1FA 1U8YA 4JYCA 4D4LA 2O8CB 1F2UA 1EESA 4ZCLA 1IM2A 1T3SA 4ON9A 3SJZA 2A5DA 3CWZA 1D2EA 1KI2A 4OI2A 2IYYA 4YXWA 5FOTA 5D3QA 5KSZA 2V7QA 5DN6D 5J4KA 2EW1A 4Q19A 3B7GA 1W2GA 2J41A 2K5UA 3BAFA 3TUZC 3LXRA 1DS6A 1YKSA 3IQXA 2QMEA 3HU1A 4ZKDA 5KNCA 1J8YF 1GKYA 1DBSA 2WWIA 3GJ7A 1ZIPA 1EFRA 2IYSA 3AF3A 4DCUA 3VR2A 4IOLA 1L4UA 1N6IA 2NO7A 5K8UA 4EUNA 1MH1A 4DEYA 4HAZA 3TRFA 2OT3B 3TW4A 4D2IA 1BMFD 2DFNA 3U44A 5HPYB 1VKJA 1X6VA 1UBGA 4UQOA 3T34A 4BE7B 2IT1A 4P31A 2VP0A 3OHMA 4DCVA 4DDWA 1UAAA 2VRWA 2HV8A 4LJYA 1KYIA 4A82A 4LV8B 1A82A 3NEYA 5IT5A 2QROA 4QOSA 2V8OA 1KK2A 2QY9A 3LBIA 4B32A 4BFTA 1COWA 1NVVR 4EDHA 3GMTA 4E07A 3EPJA 2HT6A 2IC5A 4B35A 3DKVA 2H7VA 4OHXA 4URYR 2R6FA 1E2MA 1QHSA 3AP1A 3EIEA 2P65A 4BZPA 1Y63A 3FMIA 4PHGA 3LVQE 3R9IA 1JR3A 3PUVA 2PEYA 4NZYA 2XNDA 1E9CA 4O2RA 4JVMA 3EG5A 2F3RA 1Z0IA 4DCTA 3D7MA 1N6RA 4X8HA 3O8DA 1C9KA 3H2YA 3AB3A 4BFWA 2OZEA 1Z6AA 1PLLA 1Q44A 1R4AA 4PTLA 4Q4JA 1WCV1 3A4MA 3LNCA 1ZD1A 4R2HA 4LYFA 1OFIA 2A2ZA 3M0EA 1NRJB 5CB8A 3K70C 2ZJBA 1E1RA 3H86A 5AK0A 2VEDA 3QKTA 3U3JA 3U3RA 3ADBA 4BASA 2JLQA 3SI7A 5BN4A 4FCWA 2ZSEA 3CX8A 4U7DA 4BRUA 1FX0B 2HF9A 2QMUA 1S8FA 2Q0HA 1CBUA 2H8KA 1YVDA 4FMDF 5JRJA 4KYUA 2WKQA 3KX2A 4MRVA 2GCOB 4A2PA 1PUIA 2FPKA 3ADKA 1JQJC 1GTVA 3DMDA 2HF8A 2AKAB 3KUDA 4Q48A 2O8DB 4U02A 2OHFA 3LD9A 1Q3TA 4O2LA 1G6HA 4TL8A 2ZI9A 3TE6A 3UMRA 4DLTA 1NP6A 2ZJ2A 1E9BA 3A1VA 1D9XA 5GJCA 2UZ3A 5HE8A 1M6NA 1Z6TA 1GKIA 4IVPA 4XWKA 4QJ4A 2YWHA 1NN3A 4KFTA 3ZJYA 3VKGA 3U7GA 3ZVNA 1Q1EA 2IXGA 2R9VA 5LD2C 3B2EA 5BW8A 3ETLA 3HJNA 1ZM7A 3IBYA 2CHVA 2R8RA 2F1JA 1SXJD 3VR5A 1KI9A 2OCYC 2O8CA 1P6XA 3KFXA 3J81k 4LPSA 4R2IA 4O3MA 4JLDA 4ACBA 1RRGA 1ZNWA 5DGXA 1T4GA 3CZPA 4GDFA 4MDEA 3VNVA 4DSUA 1XD9A 1XPRA 3S1AB 2IXFA 3PEYA 1M74A 3OFNA 1G8HA 3M6AA 1HY3A 2ZANA 1KAOA 4MITA 1W0KD 1ZBDA 4TYPA 2HLDD 3ZIAD 3W6OA 1HT1E 2O8BB 4IW3B 4IKEA 1FP6A 3FWYA 4LPKA 4GMDA 4DIEA 1XXHB 3T15A 4IOMA 1FMLA 2ZUDA 5CIQA 4EPWA 4AC9A 3KJHA 1NKTA 3NBXX 2Y8EA 3THWB 1OIWA 1SQ5A 2H17A 2FNAA 2W0SA 4ZI3A 5EP1A 5E7MA 4Q9HA 3KZ1E 2RGNC 3HYTA 3PUWA 2GHIA 3RNLA 1G5RA 1FZQA 1E2LA 3AUYA 3GJ4A 1ELOA 4Q7LA 1TTTA 2OM2A 2AD1A 4ABYA 1CF4A 1G3UA 1NMZA 3GFTA 3DOEA 5DH9A 4QHYA 3P1JA 1G19A 1YZKA 3WNBA 3X1YA 4QKQA 1Z0AA 2JJ1A 1W48A 1ZP6A 2QU8A 1VCMA 4D4JA 4FCVA 1KI8A 3GLGE 3R7WB 3TSZA 5C46F 4QBIA 2RAPA 4YC7A 4CGZA 4DUGD 5AJZA 4ILEA 1ZMXA 1RVDA 4IXNA 1I2DA 4W9MC 2FU5C 1ZINA 3LY5A 4PAMA 1R7RA 4AKEA 5JJIA 3FFAA 2F7SA 1EFHA 2Q9BA 2KB0A 2I1QA 4P4TA 2AXNA 2F1HA 3FKQA 3CNNA 2O52A 2DWOA 3CF0A 4Q1AA 4WIAA 5FOVA 4KLZA 3VX3A 4TT3D 1JJVA 2XGJA 2F1IA 3L0IB 3ZGXA 5EP4A 2JCSA 1HV8A 4WW0A 4TLAA 5EE1A 1ZNYA 1FPMA 1XTSA 2FFHA 4QG7A 4FIDA 3RS4A 3UXMA 1G3QA 2FA9A 1M7HA 3JZAA 4URXR 1FX0A 3X1WA 1NN5A 2CMKA 4GOXA 3AGPA 2XZLA 5FL7A 2V1XA 3BH0A 5J4VA 3TGPA 1E2IA 3P20A 1DELA 1M7BA 1Q21A 2GCOA 1D2NA 2O8DA 3TMKA 4M1SA 2GF9A 3QEJA 5FTJA 2OO7A 3A4NA 3C5CA 2IK8A 4HZIA 3ASZA 2ECKA 2Z43A 1RYFA 3Q72A 4IDHA 3IKJA 3ZQ6A 4V02A 4MQBA 2QGNA 3SJBA 5B30A 1PLJA 1N3BA 2ASEA 1S3GA 3I5YA 1Q0UA 3F0TA 3TK1A 3SFVA 1KMHB 3IEUA 1WE2A 1XX6A 4PQRA 4E09A 2W6JD 1R6BX 1DAHA 2EFDB 5G3YA 4YMVA 1VPLA 1NI3A 1ZJ6A 2XNSA 3QPVA 4NCNA 4C0AC 5C1BA 1UJ2A 3GCGA 4QGGA 2X8AA 4KODA 4EFNA 2WWGA 4QXAA 4Q9IA 3T1QA 1LB1B 3KUCA 5DE3A 4OI1A 3B1YA 2AK3A 2QAGB 3A36A 4R9UC 3TUIC 4A0FA 3IO3A 3B82A 4Q47A 5TV2A 1OXSC 2HUPA 4YXWD 4XD7A 3S1AA 2V7QD 4MGKR 4OHYA 2IS4A 3JVVA 1R0ZA 3LX8A 2O8EB 2QZ4A 1YR6A 1ETUA 4K81B 1GUAA 4CEJB 1TU4A 1TMKA 2QT0A 4RZUA 1XWIA 4TLBA 4MGYR 4BGDA 2V54A 3QG1A 4ZDIA 3CPJB 4TL6A 3X1ZA 4B44A 1EFRD 2IF2A 4FMBB 1US8B 2IYQA 1FL9A 1IXRC 3GLFE 2RB4A 4Z1MA 3IHLA 1GVNB 4FWIB 2W0MA 2WJJA 3EWAA 3H0KA 2GXAA 1K5DA 3EPKA 2NZ8A 1Z22A 4AG6A 1CR1A 1KAGA 1ZU4A 2AHOA 5TMPA 3SQWA 1E0SA 1TL7C 3V4RA 2H92A 2IYUA 2P6UA 5FUWA 5SZHB 4DLSA 4PPNA 2DBYA 4PZYA 3AVTA 3EXAA 1IN8A 2QSZA 4JBYA 1IHUA 1MO4A 1COWD 2NGRA 2WWWA 2HT1A 2FSHA 1II9A 1ZM9A 2OBMA 2Z83A 4YDHB 5FTMA 2ODNA 2IS1A 3ZZUA 2J7PA 2HYIC 3DM5A 2CK3A 4GT1A 4TMVA 1KHTA 2QE7A 3P27A 5H68A 5CM9C 1Q20A 3R7WA 1JR3D 2YINC 2QTVB 4M9QA 3B13B 2XNDD 5FOSA 1XF9A 2FJUA 4GNKA 2P6NA 5JEDA 1M2OB 3CX7A 2IS2A 4Q01A 4U00A 1AS0A 1Z8FA 4JYBA 1PVOA 4AD8A 3ZD6A 4ACAA 3BD9A 5BWMA 1T0JB 4NDZA 3C4JA 4M1KA 5EXXA 2QQ0A 4G5OA 3AVPA 4Q4HA 5TXGA 4WVFA 3LAWA 4HAVA 5KO2A 4JLMA 5KNBA 4MYHA 2ZRDA 1P9RA 4BLRA 1E1RD 3MGCA 1RRCA 4QM7A 4OYHA 5JCPA 1OFUX 3KKNA 5IRCD 4TQUS 3KXLA 1TEVA 3EZ9A 3HU2A 4QHTA 4WXRA 5F9FA 2ERYA 5AJYA 2BBTA 1PZNA 2AL7A 1A5TA 3I5XA 2CNWA 1T6NA 2WKRA 3FB4A 4Q03A 2EFHB 1P7CA 2GBLC 5H70A 3SBEA 1UM8A 1S9DA 2J5XA 5TY0A 3AM1A 3I32A 1G20E 3ZDQA 2FPMA 1OH6A 5C18A 2Q9CA 2GESA 5CB6A 4F7WA 4PAOA 4M53A 3KJIA 3EPHA 1XEWX 1G291 4ASUA 1KMHA 3MJHA 3IILA 1SXJC 4B3GA 4GL2A 3AKCA 1VG0B 4NE2A 4A2QA 4BECA 1GM5A 1K6MA 4HLQB 1KSGA 1E9AA 3LLMA 3LV8A 4PZLA 2WWXA 2BWJA 1MRNA 3K9LA 4MRPA 4NCIA 3VHLB 3N70A 3SN6A 3AP3A 5FBLB 2VBCA 1P4SA 3QENA 4BFYA 2FN4A 4AKGA 1H8EA 2QAGA 2FPLA 4JIMA 4JBXA 1CR2A 3MCAA 2XJ4A 1KOFA 2ZI7A 3THOA 1KZGB 1OLOA 4FMCF 3GLGB 2JIZA 2O8EA 3VTKA 3OFND 1R5OA 3DEFA 3HPQA 2J9RA 4PC1A 2FE4A 4CEJA 4ZCMA 4KVGA 3ZH9B 5JSZB 3AVVA 3CF6R 2BBWA 3PUXA 2JLUA 1T8TA 2O0JA 2P5SA 1US8A 5DYIA 1W44A 4JLJA 2W58A 4L4UA 4MUAA 1QHIA 2ANBA 4BPBA 2FX3A 5D3MB 1DAIA 3A58B 3AF2A 4EPRA 1XJQA 2YOFA 1P62B 2QL6A 4LBYA 1CP2A 3KFVA 1VYVA 4OI0A 4LY6A 1BKDR 2AX4A 2C99A 3LFUA 5GJBA 2NPIA 5J4YA 3I3SR 3SYKA 1GNRA 4HDOB 2VLIA 4M9XA 1MABA 1W47A 2ZYTX 3VU9B 2IUTA 4NU0A 1VDZA 1SZPA 2OFXA 2ZUCA 2P6RA 2RGBA 4TMXA 4UKDA 4UNPA 5CK5A 4L15A 1L8QA 2JJ1D 4P3YA 1P61B 2AFIE 2DFTA 2H5EA 2Q21A 3WNCA 4BUJA 2D2FA 2RGCA 4A0RA 3KJEA 3U3KA 1DADA 4RD4A 3K9HA 1UPTA 4QC2A 3IUYA 3WHLA 1N6LA 4AG5A 1UBFA 4B6FA 3WNDA 2F1RA 3I73A 3C8UA 2X2EA 2FZ4A 721PA 1K5GA 2FG5A 4M21A 4BLOA 4A36A 1MKYA 1IXZA 2ZI3A 2ONJA 4NYJQ 3RS7A 4X8LA 2BKEA 3KJGA 3SJCA 3PENA 4V0NA 1NSTA 1XU4A 1KO5A 2LKCA 2EFEB 3GJ6A 2OSBA 2G1KA 2OAQ1 3BIFA 4LYJA 5SZIA 2MSEB 1G17A 3NDBB 1WF3A 3B5JA 4MKIA 3TLXA 4C9BA 1LY1A 2D4HA 4G3XA 1DPFA 4P4UA 2QG6A 2NO0A 5HCNA 4IDOA 3WRXC 4HLCA 5L3QB 3C5HA 4OQXA 2V55B 1JB1A 1OH7A 2IWHA 2A7QA 1VMAA 4P0TA 2OLKA 5FL7D 1Z47A 3EA5A 1ONBA 4WXPA 3VX4A 2CL6X 5JRZA 3GPLA 4PPFA 1E96A 1OXVA 4MGZR 4LGMA 2QPAA 3NDPA 4PC6A 1FP7A 3NWJA 4Q7JB 4OJKA 3GLFB 3AF4A 2GWHA 5K8LA 4NYMR 5CJPA 2FFQA 1DTSA 1VG8A 2BM0A 2FZLA 2KI5A 1WBDA 1V5WA 3BFXA 3PIRA 4YLGA 5EXTA 1UKZA 4RD0A 2VPPA 4RZXA 3RS0A 2REXB 2ZRLA 1AKYA 4DCSA 2PLRA 3L82B 5IF9A 4D0GA 1JBKA 1CLUA 2C5LA 1QDEA 2ZE6A 4EIWA 3KKOA 1N6OA 1E32A 1GWNA 3QBTA 4RY2A 5KDLA 4P33A 1E2QA 4C3ZA 2OLJA 1KK1A 4G5RA 3UKDA 4F4JA 3U60B 5KHOC 3HU3A 1IONA 4LBVA 2FDCA 4ZKEA 4TQAA 4XD7D 3AVOA 3GLGA 2B8TA 4RKFA 2OBLA 1XXHE 1E6CA 1KSFX 1CJVC 4CZ2A 1KNQA 1TUIA 5L3RA 5JSZA 1N6NA 4Q1EA 3PFIA 4KJZA 4C2UA 1E9DA 2A5GA 1NIPA 2VF7A 1TADA 4BQSA 3THXA 3CX6A 1XCPA 3KQHA 4FMCB 1NNEA 4Z1MD 1QHYA 1OKKA 2CHQA 2N1BA 3QUSA 5D3MA 2XXAB 2GJSA 3K0CC 1GL7A 2PX0A 2YYZA 3UWOA 4JS0A 4AWXA 5EE5B 2QTHA 1S1CA 4N3NA 2FEOA 2IW3A 2R2AA 2JASA 2JLXA 1F2TB 1VIAA 2JATA 3VQTA 3AP2A 3WBJA 3K8YA 1HYQA 4PO1A 1YR8A 1AA9A 1GL9B 1T9HA 1P5ZB 2YWGA 1GRRA 3DHWC 3RC3A 2XOKA 1D2MA 2A9KA 4JLKA 3PJRA 2WJIA 4FCTA 5CYPA 3VR1A 1OH8A 2VHCA 3R20A 3GLHB 3ZVLA 3KQNA 2J7PD 3TW8B 4GSYA 2CK3D 3Q5DA 4A4DA 1H8HA 5H8WA 2QE7D 4DT1B 1MO6A 3AKDA 2X1VA 5P21A 4V0OA 1WRBA 1KMQA 3QBVA 4D81A 4B2IA 1CU1A 4M0LA 2MMCA 5J4LA 1CXZA 2RGXA 2GVZC 5CIWA 1AJEA 2C8VA 2I3BA 2PL3A 1N0VC 3BRWD 4C0KA 1BOFA 5GJWC 2VO1A 1NL3A 2GJ8A 2YOGA 3C15C 3B85A 1ZM3A 2NPFA 1IN5A 2IS6A 3I62A 1JAHA 1U99A 1FNNA 1XTJA 4LYHA 4NBSA 2G1JA 5TDHA 2N46A 3T5DA 2J0SA 1XBTA 2CVHA 3W9YA 2CLDX 1W0JA 2Z0MA 5DLQC 3TSOA 4A8JC 1II8B 2VP6A 5JECA 1OXXK 4V0LA 5L3VA 3AUXA 4EJSC 5TARA 1ZM4A 1NN1A 2J0UB 2W2VA 2FSFA 4UJ3A 4US0R 4URVR 2CNWD 5KYKA 3Q8XB 4M22A 1EFCA 4OHZA 3IHWA 1P73A 4NH0A 4PAQA 3P32A 4IEIA 3A6PC 1Z83A 2PX3A 2NO1A 3SS8A 1DAMA 1E4VA 2EYQA 3GLFA 5FBRB 1DO2A 1OIVA 4GMXA 3WMEA 4C0SA 4HUQB 1CRQA 2ZE7A 2MSCB 5FOUA 2NZJA 1G21E 4LSGA 1Y3AA 1G18A 1N6KA 2C78A 1HH4A 2OCPA 1HURA 4PSVA 3NC0C 4ASUD 4Q1CA 5E7JA 1RIFA 3QQ5A 3W5IA 4HB0A 1VYUA 3X1XA 2QTFA 5KPJA 1E9SA 3LQRA 3H1TA 1UEIA 1N25A 5EXPA 5C4MA 3K70B 4D4KA 1P2UA 1H8ED 3AV0B 5DHFA 2GEVA 4JMPA 1Z0FA 3AQ4A 4HZUB 4TYYA 2GJAA 4D6PA 5LBIA 5FOXA 1ODFA 4YMWA 3RABA 3O8CA 2QP4A 3RANA 3NC1C 1I2MA 2JIZD 1E1QD 3CBQA 2XJ9A 5JFGA 3ECCA 1IJFA 1TNDA 1Z5ZA 3BC1A 1Z07A 3IPXA 3RRZA 4AYWA 2PZFA 1WA5A 4ERNA 2D74A 2OV2A 2ODWA 1V43A 1NVWQ 5E3HA 2WV9A 1S0UA 2ZI6A 1E2DA 3HR8A 5EP3A 621PA 1YZUA 2XXAA 1GSIA 3GFPA 5C2JB 5CLQA 2F6RA 3AVUA 1GNQA 221PA 1G8FA 5LD2B 1F2TA 3CLVA 3QEOA 1SVIA 5DI3B 1UFQA 2E87A 2I1VB 4KU4A 1NMYA 4X8MA 3M1IA 4BLQA 4Z51A 1AN0A 3R8FA 1H65A 2ATVA 4C0LA 2R44A 1NY5A 1T0HB 4AYXA 2EQBA 2OAP1 4CYMA 1F48A 5DIFA 1B0UA 1KI6B 4GBMA 5KSYA 2FWRA 3F5FA 2ORIA 1CIPA 2QRNA 3L8YA 5DHAA 1OYWA 2DPXA 2ZYVX 2OCBA 1ZNZA 4DCNA 3AF1A 4DT1A 2A78A 2FOLA 3SR0A 2QA5A 4RZ3A 3GLIB 1Z3IX 2QAJA 4QNMA 5GADl 4PHHA 3DVLA 2LKDA 1XMSA 4M1YA 1W4AA 1XMVA 2AN9A 4CF7A 2XSZA 3TJZA 1Q3HA 2P0EA 4A2WA 1U8ZA 1AQYA 3FHTA 4TTQA 3SC3A 2GILA 1FNMA 3TNFA 3VR6A 1G8PA 1FOEB 3QXSA 2CXXA 2Z4SA 1HE1C 2QPTA 3SHFA 4B2PA 3K9GA 2AR7A 1DO0A 3N5CA 2J46A 3LW8A 3OEHA 5HCIA 3KTAB 3OZXA 1II8A 2CE7A 2DHRA 2JA1A 3B1XA 4Z54A 3NHBA 2J0UA 4DLXA 2HJVA 1QRAA 3TR5A 1NKSA 4Z8XA 2DR3A 2P5TB 1KDOA 4BZXA 1XP8A 1I4TD 1XRJA 1TQDA 4DB2A 2WVJA 2YC2C 3FKSA 4A92A 2O8FB 2RH5A 1D9ZA 3TQCA 4RZ2A 2JLVA 5F98A 1N5LA 2C04A 3KXKA 1DARA 3BFVA 3OIYA 4HUQA 1E0AA 1G4AE 2ONKA 3QXCA 4JKYA 1T3LA 4C0QC 1FUKA 1KI3A 1TX4B 2JDIA 3T12A 5KTYA 1SULA 3KQKA 4HI0E 5BN3A 4C30A 2ZS8A 4DHEA 3QI2A 4QFMA 3KQLA 3AKEA 1ZC3A 5FUYA 3CONA 2C9CA 3PXGA 4OQLA 5CJ2A 1E9RA 4URUR 2IUUA 3SFZA 2CL0X 1XCMA 2A30A 4DLYA 3OIVA 4HZUA 4TQ9A 1CTQA 4QBFA 3MJRA 2NTYC 1FTNA 1PJRA 2CL7X 1KKMA 1I4LD 2GDJA 1A4RA 1Z0DA 2OUKA 1U9IA 2GETA 2WPDA 3DMNA 4L16A 3FFBA 1CEEA 5AUNB 1U0LA 2B7CA 1Z0KA 1SVWA 2ZQ5A 4Q66C 3K0AB 3E2IA 3M4YA 2HYDA 5FBVB 1G16A 4HB2A 4ZPXA 3U6KA 3P4YA 4N0DA 1AIPA 2ZRGA 4JT4A 3UG7A 3K1JA 3LX5A 4OHVA 4G1UC 2PCLA 2P3SA 3B9QA 1OKKD 2EFCB 2VHUA 1VIYA 5DO9A 4ZO4A 2J45A 2IWRA 2R62A 1J2JA 1DG1G 1X1SA 2RHMA 2ANCA 3Q7PA 4QJ5A 3V00A 4IHQA 1OH5A 5K8IA 1AK2A 2X2FA 5EZ5A 1YZQA 5DI3A 4YMUA 1KJYA 2VSOA 3QKSB 4ARZB 2GXUA 5JWOA 4XH9B 4BZQA 1M8PA 3LLUA 5EE3A 2BC9A 2XOKD 3FYHA 2IYWA 1CJUC 2B92A 3PUZA 1JALA 3MWYW 4B3CA 4UNNA 1KI6A 2ZE8A 3FVQA 4DB4A 4DVGA 4II7A 1W36D 4FMDB 1FW6A 1E4YA 3OIUA 3WYFA 4LJ7A 1B23P 4MKHA 2D7CA 1H8HD 4J0QA 1DAKA 5FBQB 3X1DA 1YU9A 5FPHA 1ZD9A 3LQQA 1N0WA 1UKYA 2GNOA 2VF8A 2YC4C 3LXXA 4G01B 1TF7A 3NXSA 3GJ3A 4KVAA 4PC2A 3D3QA 4XIGS 5KOYA 2WICA 2D62A 1JECA 1VG9B 3OEEA 4MRSA 1EK0A 5C4GB 4CRWB 1S3SA 2CE2X 5E95A 3U61B 1F6BA 1G7RA 1GL6A 1AS3A 5JBQA 4W5JA 3QOFA 8OHMA 4LJ9A 5JJKA 2GZHA 1UBCA 4PQYA 2RGGA 2F43B 2GTPA 4W5WA 1D6JA 1WDTA 3AVWA 1ZRHA 1NVUQ 1WQ1R 3R8CA 1AZSC 3KTAA 1W0JD 3CF2A 1QBKC 2E9SA 2EYUA 2HXYA 1Z08A 2PCJA 3HR7A 2CHGA 4KSBA 4URWR 5F9HA 1K8RA 1XXHA 4HDCA 3TVDA 3WYGA 2V4ZA 4M4SA 4D25A 3GP8A 2FF7A 4UXHA 4D0LB 1MR3F 1AGRA 1X8KA 2O8FA 4MYTA 4B33A 1KDRA 3LH5A 2BCGY 3MWKA 4LJ8A 4DLWA 3THWA 5GVRA 4BFXA 1WB9A 3ICQB 2ZROA 3RS3A 3CRW1 3FMOB 1J99A 4DJTA 1NLYA 1T5IA 1KJWA 2ZI5A 5KNDA 1Q1BA 2GCPA 5AWFC 1YQTA 1II0A 3LA6A 5G53C 1Q1ZA 2BEJA 1JEDA 3RS2A 1EX7A 2OESA 3MUFA 4FXPA 3NIBA 1DVRA 2AFHE 5AUQA 3RLFA 2GK7A 1SVKA 3W6PA 3QIAA 5DISB 1W46A 2H16A 3UANA 1A7JA 4Q1DA 4KSCA 1FTSA 4RD6A 4NYIQ 3K0FB 3PCRB 1P9WA 4QNRA 1XJ0A 1DAEA 3GEIA 2WIBA 3K0EA 1PLKA 2ZREA 1SVLA 1GG2A 1NG1A 1JEEA 4CW7A 2G77B 4LWZA 4NONA 3EZ6A 5CLLA 821PA 2HCJB 3TAHA 5J47A 1YJ5A 2IYTA 4K8OA 2NMVA 1M7GA 2QBYB 3D31A 3WYAA 2QNRA 2ZR9A 2ZJYA 2REOA 2CCGA 4KFSA 4TTPA 1IAQA 4OK3A 1JPJA 3W90A 3D8BA 2AD5A 3NH6A 4QHSA 4PR0A 3NH9A 2JLYA 2FGJA 2IF0A 4MYCA 5JWHA 4ARZA 4MKGA 1FQJA 1RJ9B 5HZKA 3F3YA 2BMFA 3HP1A 4QJ3A 1KSJA 1ZYUA 3GLHE 1U81A 5E4FA 1XNJA 3ZZ0A 1ZAKA 3V9PA 4JVSB 1SKYE 2Q9AA 3UMFA 6Q21A 4LBZA 1W1WA 3GJ0A 4ESHA 5FPSA 1G7CA 1W5TA 3EC1A 3I8XA 1XTIA 2IYXA 2BM1A 2ZSAA 2FH5B 3PEUA 2MMGA 3GFOA 4DLUA 4MGIR 4RD3A 4TMWA 2FMXA 1NN0A 2IYVA 1Q12A 4HLUC 1NVVQ 1WMSA 1MO5A 1E2FA 4UXIA 1NBMA 4LX0A 1W4BA 4LJ5A 3FOZA 4BRWA 5L3SB 3SBDA 4FW9A 1NG9A 3B1ZA 2ZUBA 2JLWA 3CZQA 5HTKA 3ZVMA 4A15A 1Z63A 4HB4A 3MLEA 1F60A 2CEAA 1UKEA 2BKUA 3WMFA 1R2QA 1T91A 2P67A 1YHNA 2W2XA 2F43A 2GEDA 3CIOA 4I81A 4JJKA 1XCGB 3VAAA 5FOWA 1E99A 3F8TA 4K46A 3OEHD 4EFMA 4Q18A 4ZDJA 1EFTA 2ZYWX 4GP6A 1G6OA 5CM8B 4Z8YA 2FSIA 2D3WA 1XMJA 5LB2A 3DDCA 4KV9A 4IVRA 4TYQA 2UVQA 3CM0A 4IXMA 4YDSA 3VKHA 2NO9A 3FKSD 3CB4A 5H1YA 5AJWA 3BH6A 2ZU6A 3PUYA 4RD1A 2ZIAA 3SDZA 3R9XA 5LB4A 2RGDA 2ZAMA 5AJXA 3QVVA 2RCNA 1XD2B 2JDID 2NG1A 2FFAA 2GZAA 2IEYA 2PJRA 1C1YA 1HEIA 3DZDA 3NVAA 4LCBA 4WBSA 4B3BA 1ZNXA 1P3JA 2G88A 4MKFA 5KSOA 4CVNA 1N6HA 4FINA 3L0SA 4BEBA 1EGAA 2BV3A 4I1OA 1GRNA 3UPUA 2AKYA 3VR4A 2SHKA 2RGEA 2GRJA 3QE0A 1KY3A 1QZXA 3OF5A 1G3RA 1MT0A 2W83A 3U3OA 5BXQC 1P2VA 3K0FA 4E5UA 3IIKA 4KFUA 3RSLA 3BFKA 4C0HA 2ZJ5A 5ELXA 1WBBA 2ZRKA 4EFLA 1P2TA 3B9PA 2WPDD 2BOVA 2ZJ8A 3N2IA 3W5JA 2CCJA 4LJ4A 4Q9KA 2ODBA 4PSAA 4U5XA 1CJMA 1U2RA 3A1UA 3C7KA 3VNUA 5KU1A 3AVXA 3UMSA 2KBFA 2CJWB 1VCNA 3KXIA 4C0BA 2WWHA 3EARA 2J87A 3E1SA 4QGAA 4Q21A 1ESMA 2ZITA 2QSYA 2QBYA 4RVCA 4BWYA 3MWLA 2YOHA 4TL7A 2B21A 2B8WA
chains in the Genus database with same CATH superfamily
3MCUA 4NJEA 3WGOA 4PN7A 4MULA 2LV8A 3L41A 4NFSA 3DC2A 4MWZA 3EZLA 4KQJA 5B1SA 1C30A 5IJ9B 3HE3A 3OP4A 5J5CA 3VKVA 3CLSC 5TF4A 1FQOA 4L5YA 3TRIA 3WXMA 3FTQA 4HH3C 4RKRA 2F4NA 1Q92A 3F49S 4Y9DA 2ZWPA 3OECA 4YJ3F 3ZY5A 4JI2B 4Z7NB 2YX1A 3IYLW 1X7ZA 2D1RA 3K5HA 2OAGA 5SYMA 1W36C 1MA0A 1L5WA 2WJHA 1YRAA 3AHIA 4F9FA 2GPNA 2UYOA 1G8YA 3T1VA 4F3NA 4KC0A 3RVBA 1GNPA 1Z68A 4LI0A 4E51A 2GCGA 5EIOA 5IHXA 1FRNA 3HXPA 4XGNA 3G8BA 2MSDB 3GLIE 3OPYB 1NF2A 1DZIA 1NV8A 4MGHA 1E7MA 5CXSA 3CJTA 1ORHA 5FWXA 3PT5A 1J0EA 3WBBA 2XF2A 4RKEA 1Q57A 3CPEA 2QL9A 1I1HA 3GRPA 5K2OA 2NSHA 1YDHA 2I91A 5JO0A 4WA7A 4IH4A 4JIGA 5F35A 1WHTB 3TVTA 5DM70 3LX6A 4QYTA 1CRLA 5EVCA 1QB8A 4J9VA 1KRWA 5HG0A 1E2JA 1U8AA 1P9OA 1GPH1 3ENQA 3T61A 3CR8A 1MCZA 4OL9A 4YQYA 5JUWA 3FAZA 1YZFA 2IOFK 1S5PA 3EFOB 5LP1A 3BH7A 2IEZA 3L7YA 3STXA 2DR0A 3EQ7A 3UW1A 4Q3EA 4X3PA 2VQ3A 5EKTA 4DMRA 1F20A 3KSAC 2Q5OA 3ZEIA 4POAA 1R0LA 3E7XA 2BFCB 3IBCA 3QSYA 4AQ7A 1PT5A 4A9AA 4LTMA 3VR6H 4WT7A 1QVVA 1N2XA 2PR7A 3FSRA 4EA7A 4CQMB 4KAJA 2R6AA 3PNQA 2J09A 4BYGA 1UIMA 3V8BA 2KLBA 4Y1RA 1L9XA 4LMPA 2CZCA 1BS1A 3OZDA 2RIPA 3D43A 3D2CA 4L5CA 4ZXPA 4ATNA 3CG4A 5F52A 4GRAA 2V5AA 5FF9A 4PGAA 3UA3A 3GCDA 4B87A 3FR8A 1ZVVA 1Q1QA 2PMCA 1GPYA 1TT5B 3E35A 3PF8A 2CBZA 2OV3A 4TV9A 5F77A 4EHNA 3LHDA 3CVXA 3AEUA 1RWKA 4UNQA 5KMGA 3W5BA 4JL5A 3MA0A 3HSSA 2JIRA 3VR3A 1PJLA 4NNPA 2UXCB 1GITA 1VJ5A 3A8TA 2JVJA 2BH2A 3EVEA 2O2DA 1GDTA 1DIGA 1NPDA 1NT4A 4XEUA 2TMDA 4TWZA 2V6BA 4EY3A 1DV2A 2KJQA 1Y8ZA 2JEOA 1XD2A 5EIXA 3C14C 4X64B 5I4IA 1XA0A 1MLDA 4IOJA 1XMIA 2WYWA 4E0BA 2EKDA 1BQ4A 1CLEA 1J7JA 3A06A 4IQGA 3PPIA 1JDJA 4ND3A 4DCOA 3U7HB 3TKLA 1GKUB 4EA9A 5TX7A 2I9PA 3DCNA 3IDZA 4Q7QA 1F0NA 1SOAA 1U3WA 2VP4A 4G26A 3WADA 4DA7A 5A9RA 1VG1A 3MUEA 4BFCA 4Q02A 1CUSA 3C4QA 4IJMA 4RH0A 5F23A 4LYGA 4OQZA 2QVXX 2FRDC 1I3CA 2OC4A 1KEUA 1QFZA 2PUTA 1OJ7A 2WFLA 3K6RA 1IN4A 3J7AC 3QP9A 4O2BA 3GEMA 4MR9B 3ANTA 1G64A 1BJTA 3A4YA 2IPNA 3UAOA 3UGQA 2NZYA 5JPDA 2XR1A 2ZB7A 3RSFA 4WN3A 3UJPA 4Q9JA 5LA6B 4UVEA 3LKBA 3W8EA 5AI9A 4XDZA 3HB7A 3TSWA 1OAOA 4CKZA 1XZQA 2YVUA 3HNRA 4MICA 1EK6A 4I9NA 1DCMA 4RHFA 4YASA 1MG0A 3FE2A 4IDAA 4F8JA 4XWOA 4CTNA 1SCNE 5KNBD 3T9EA 1YRBA 3L6RA 4E6EA 5AW3A 3IAHA 4MXDA 1UADA 5DF1A 3IP9A 4COOA 2WMOB 3PPYA 4JI7B 1KERA 1WW2A 4C4RA 5IJ9A 3NTUA 4YJ2B 4US2R 5EJEA 1KK0A 4EEXA 3T9CA 5U9CA 4OUDB 4KO4S 4L95C 3CC8A 3JVEA 4OKSA 2QLJA 1E64A 2VZ0A 1BAPA 3U7EB 4JBNA 4ARVA 4GHWA 4IIHA 4KLAA 1ZUNB 4H9GA 3ZDFA 1Y4ZA 4L72A 1RZRD 4R98A 4A23A 3P9QA 2O23A 3E9CA 4ZEWA 4BVFA 2VWPA 3KD2A 4QXMA 4LV6A 3ESAA 2G82A 3K4HA 3LKDA 3OPYA 2ZTUA 1RWNA 2M6RA 4XVUA 4JQOA 2V45A 3JYPA 2XB8A 3FHCB 1NBME 2D5BA 4E70A 4R1SA 3T3HA 4LZLA 4LXGA 2JLBA 1TVKB 2AQKA 1T8YA 1KYZA 3BMNB 3NPAA 3ORYA 1KI4A 5DSXA 3O9ZA 1G5PA 3LC0A 1Q11A 4AXXA 1WHTA 1IHPA 2N3ZA 3KD3A 4NK5A 3ZHRA 1NBMD 5DXAA 4M8NE 4C29A 2EC5A 3W06A 2DKFA 1XEFA 4G5SA 4ZVQA 4C78A 5KIAA 1JDSA 1NJ6A 1VJ1A 1M72A 3QELA 3HJAA 3V8NA 2Q3FA 1T13A 3R24A 4ZTUB 2I1WA 1SVUA 1QX4A 1MPTA 2G0NA 3E5RA 3EFOA 4OQPA 3RT1A 1RBMA 5K03A 3F74A 1QXSA 2I80A 1YRYE 3NNDA 4BLVA 4FFMA 4KFRA 1PEDA 2JLSA 3RSHA 4RPKA 4Q4AB 3CZMA 3CEAA 2Z9BA 2BFCA 4QLOA 2B7BA 4HGPA 3C6ZA 3TF5A 4FJ2A 3QFFA 4CQMA 2FEMA 3CLTC 1DWUA 3E6AA 2Q3MA 3M49A 4H31A 1RYZA 5DTQA 3GLSA 3PRHA 2P11A 1O94C 3HK2A 2EKPA 1ZK0A 5F9MA 3V7YA 3FWKA 2HLHA 5KWSA 1XRRA 3RYFB 4BFSA 3QOYA 2R8EA 4Y9UA 2W4MA 3IUMA 3EH2A 2Z5LA 3TDKA 3LWBA 5ICMA 2LWIA 2FSGA 2PUHA 3CFYA 3RTDA 2YRXA 2Y1DA 3V7UA 3CZ9A 4N65A 1JWBB 3W8NA 4EBBA 1M0SA 3EYWA 1Y4SA 3MUNA 4IEEA 4KO8A 5TF0A 1QIEA 3PDUA 4HQ0A 3M6UA 3Q8MA 1KQPA 1CULC 3CX4A 1Z6QA 4V0QA 2PSFA 2A5JA 4LK3A 4X20B 3ZIUA 4D5GA 4L0QA 2VDPB 2R79A 3OU2A 3GJZA 3NOQA 4O63O 4MPTA 4RPCA 4PTYA 4HVLA 2GN8A 4FW8A 3LPNA 5FPKA 1XNGA 4QXOA 4RKWA 3RE1A 1JLHA 4X66B 1HDEA 4B6EA 2FE1A 4UJ5A 4GZMA 4QRIA 3QYJA 3VR4D 1IYZA 4C03A 1JSXA 1KPIA 4PPQA 3UXYA 1MXFA 3GCWA 1U9IC 2PGLA 3KDAA 4LWOA 4I08A 1GHTA 1GR1A 1N5JA 1JHUA 3OH8A 4C05A 3UKJA 5G02A 1XN4A 1AKQA 2H2WA 4N1AA 2X4DA 3FLEA 2C2GA 4Y1FA 5A4JA 5DYGA 3D6UA 5JDIC 2LIVA 3SE0A 5C53B 4GVPA 4ZP1A 5LA6A 5JT1A 3F3SA 3BQNB 5KWJA 1X2EA 3K53A 4BKMA 1D2GA 4JWTA 4NHEA 5T6BA 1Y9EA 1UPXA 2X8LA 3K9BA 4WOPA 2PGNA 1JXAA 1U98A 5IKMA 1G9XA 3CCBA 4EVRA 1Y7HA 1XOIA 5DN9A 3BEOA 1M5UA 4ZRMA 2WF7A 2X2PA 3CW9A 3UT0A 4KR3A 1TECE 1DC5A 1RYNA 5AK3A 3N0RA 1TIPA 4TL9A 5K0LA 1P3Y1 5K8VA 3E1GA 1J07A 3EN0A 3R3JA 1GIAA 3EVGA 3EZ2A 2JLRA 3ZHYA 4YT2A 2JCBA 5G0VA 5JR3A 4QRHA 1BHJA 5FR1A 1ZW6A 5BSUA 3OMXA 4DDUA 3JTMA 2QEQA 3QU4A 1PV4A 2HBZA 2A9QA 2ZPTX 4HYTA 4CLOA 4YJ2A 2E18A 2Q4DA 3D3WA 4WNAB 4DWOA 4G4SO 4O02B 5CBKA 5HP4A 1SXPA 2VYQA 3BXHA 4OUDA 4RSGA 3RWMB 4ZOCA 3WRYC 1SCKA 2BMEA 5D3ZA 1SBIA 5EUQB 1A1SA 1A7AA 5DW0A 1OV4A 3PQ8A 4D82A 1ZUNA 3GY0A 4Q05A 4IXDA 2P9JA 5B1EA 1Z36A 3THSA 2W8BB 1A71A 4BJ3A 2AQHA 3FOWA 4YR7A 4NCKA 3JWPA 4MA4A 2X77A 4BQOA 3QVGA 1B74A 4UE2A 4X1OA 1V8BA 3DNMA 2VDWA 3P5SA 4M7PA 4QPDA 3VFDA 2ZJAA 1PFGA 1BHSA 4Z9BA 1TVKA 1JYFA 1Y9AA 2WJYA 3KKPA 3NDIA 4KEAA 1IRXA 4OH7A 4B0OA 3BMNA 2QTGA 1IM5A 4ZVVA 1A8HA 3LO5A 2L19A 4OTZA 4TXNA 1PUJA 3B7WA 3G82C 3T0IA 4JBWA 1L4YA 3M89A 3SHQA 4MAMA 1IUKA 1EIZA 1ZK2A 1B2LA 3JQFC 4L0MA 4BVAA 5EXSA 1I0ZA 1VE1A 2O7VA 2G4CA 3U56A 3DEAA 4F4FA 3U26A 4R81A 3FFTA 3V97A 1VI2A 1XFAA 2WWRA 3CO0S 1Z7EA 3GMDA 4Q4AA 1RTKA 3RKRA 2EHJA 1DG3A 1GOTA 3TUJC 3NKVA 5FV4A 4HEJA 1G8KA 5HF9A 4CODB 1PNTA 3KDSE 1NVTA 2X4IA 3ROEA 2ZRMA 2FF5A 4TKZA 4TTIA 3VU0A 2IFTA 3X43A 3QKUA 5EQTA 3A05A 4QUGA 5CT9A 3ZWNA 4HUTA 7ABPA 5ADVA 3BS4A 1U0RA 2OL4A 4D9KA 5ES4B 2JGNA 3HBLA 1BQ3A 1E2NA 2KM1A 1O5TA 3KEGA 1T3HA 2HRDA 5KQSA 3VC3A 3HKBA 5MFPA 4HFNA 3G89A 2GXSA 4X95A 4CCAA 4ZFNA 1AGYA 1F9EA 3NBYC 3Q41A 4QBGB 3UOGA 3M2PA 5JD3A 1NJFA 2VTEA 2AF3C 2FWMX 2YWFA 2ZK7A 4UAJA 3U62A 2YMMA 4S04A 2AR9A 3FGNA 1XWFA 2BLLA 4BFVA 3ILSA 3IT2A 5HSGA 2EZUA 4U9HS 2Q5JA 4Y18A 4X20A 3AY7A 4Q4HB 1E3DA 5THXA 2HV9A 4O4JB 2IYFA 4TTRA 3EQ8A 2WJGA 5K3AA 4BN4A 2UV8A 3GAFA 1Z0SA 4IKPA 2EDCA 4MVJG 3F73A 3JQGB 3MINB 3T1NA 1W7AA 2FUCA 1TKBA 3HRKA 3KKKA 4LOKA 3LZ6A 4K9OA 4NYMQ 1TGVA 4FGJA 1NMXA 2Z4TA 1Z7WA 3OQNA 2QUIA 4WCFB 3OAAA 3NO4A 4LV5B 1T1SA 3UJ9A 4C88A 4FFDA 3EY4A 2X0JA 1TC1A 2PD6A 3G8DA 1E7RA 1X1RA 4CKXA 2ECFA 5DP2A 1SUCA 1R18A 3OE7A 2Q3HA 1MF7A 1CR0A 4D46A 4JYZA 3KWJA 4ZTBA 2BE7A 4YT5A 2AFVA 1UH5A 2EJCA 1Q7CA 1JAIA 5HIAA 5JSHA 5HE9A 1G8AA 1YCHA 2BRUC 1NV9A 1WY5A 3PFFA 3C3WA 5BSKA 3D1VA 3FA2A 4N01A 1OGYA 2ZJ6A 3OD1A 2M1XA 4JWKA 5C37A 3DOJA 2P41A 2XUJA 3MWJA 1RXCA 2RGNA 1C9NA 3S99A 1NXPA 4Q3OA 2KLHA 4Z4IA 3OM0A 2FDXA 4HHEA 1FFAA 3GRFA 2C4UA 3WLTA 4D0NA 1XA3A 5IABA 2O3TA 4B3DA 2VA8A 3O8NA 2UVPB 4WNAA 3TBKA 1DZ3A 1FS4A 3O2QB 2VYND 1VOTA 3AO0B 3AXTA 4UVIA 5A3RA 5FHRA 1IFXA 4CMEA 4R69A 2ODEA 3EVBA 4UAGA 2VNKA 2WSSD 5BYKA 1D3AA 1KEWA 4IILA 2P4UA 3H84A 4JD5A 2EX1A 4R7ZA 2HQSA 1BYUA 2W8BA 1YKFA 1QLHA 4IICA 1K75A 4DDTA 5H9WA 4ZQIA 5ED4A 1DV1A 1ZVQA 1Z39A 3TH5A 1YE8A 1GO2A 1PD1A 2IEGA 2WUFA 3FPAA 2GBFA 2YBEA 3HBAA 3L7DA 1H94A 2C83A 3DAPA 2Q1UA 3D4OA 3NBFA 4PSKA 5JMTA 1C0EA 4J94A 2RMKA 3I2IA 3F3KA 1SHTX 3DLPX 1YH3A 3WLJA 4XJTA 4EEKA 5C7YA 3BWYA 1NQAO 3RKUA 3IB6A 4CMJA 4KACA 3TR0A 2EVWX 3CNOA 3LUBA 2FZGA 1Z4LA 3F8WA 4JL6A 5C3UA 2GO1A 3WGZA 2BL4A 4LA4A 7MDHA 1UDXA 2FW7A 2OXCA 5T4EA 2O1WA 4WY8A 5CHYA 5C35A 5HKKA 4CHGA 1YAJA 2WHXA 3AIMA 4S24A 3PXUA 1ZIXA 1YZLA 2AJCA 4FC6A 4BO5A 2GEFA 5CNMA 2DY1A 3O47A 3TFWA 2FJPA 3SQWA 3G5LA 2XDAA 4A6PA 5AUOB 1EFVB 1U5CA 1RABA 3DV0B 2F9LA 2OKCA 2WQZA 3BHIA 3S68A 4YAEA 3QLJA 1LSJA 4EZBA 2C7QA 1XGKA 3PGLA 1OB2A 1EK1A 3I1JA 4AICA 1EWVA 1X3SA 1ZH6A 3P2IA 4QYIB 3EAQA 3M33A 5FIUA 3ZHVA 2EFGA 3FBTA 1MABB 2LXNA 1BGWA 4CDMA 3LC2O 1T24A 2YV1A 2QJTA 1T5OA 3PI6A 1OHHA 1V7QA 3PCTA 2HA6A 2JHGA 5CW2A 3VGJA 3BD6A 4ZIRB 2PT7A 5FA8A 2HF7A 2LCIA 3DWGA 4M37A 2X5KO 1TAGA 2FY8A 2GBPA 1EG2A 3IQHX 3O3CA 1ULBA 3LY8A 4I3GA 4MW4A 2WZQA 3Q4GA 2Z2YA 4IIJA 5DX1A 4MV6A 4YMGA 1E3LA 5HUJA 5IH7A 3WGKA 2Y1CA 4AZ0A 4QQKA 5IWAB 5DHUA 1ZC4A 2ZXFA 2WM9B 2HSEA 4E2WA 1H22A 5L7YA 3G2QA 5D8DA 2BR3A 2IU4A 3L9XA 1VM6A 2QP3A 3AXSA 4LXQA 1ZN7A 5FPPA 3NOOA 4G1EB 1KWGA 2JCYA 3AL3A 2BGLA 1P0CA 1P39A 3N0XA 5KYVA 4D1YA 2C9OA 4WLEA 1QHHB 4O4JA 3DCYA 4I5IA 4KXFB 4Q9LA 4NL4H 4TZ0A 2ZYAA 1OD6A 4XZ3A 3M3PA 1EHYA 3MINA 4XTRA 2PBFA 3G5UA 2XZPA 2LRHA 3ZI0A 4YRZA 2C7PA 3HS3A 3MRSA 3ZTTA 1HTWA 1ZSNA 2DTXA 2JGFA 4TVOA 5LVAA 1ZCAA 4FKMA 4G36A 4WCFA 5KDOA 3N2KB 3ZGOA 2C0CA 5K7SA 1YK1A 4H7KA 1KMIY 5HF8A 1BXRB 1KVUA 1ZIOA 4Y6SA 4RDXA 2YS7A 1PR5A 1MORA 2I4OA 3TRHA 2O3UA 5FULA 3RGWS 3AL0C 2OGUA 4QYXA 1I4DD 1ZUD1 4WZAE 5CGZA 4BN5A 3WV4A 1RWMA 1VPTA 5J40A 4K88A 4KNVA 4RL4A 4L3WA 3HEBA 4OQFA 3SEAA 1S96A 2O0KA 3G0OA 3GEPA 1T8SA 2X9LA 2ZIVB 1WMEA 3V1MA 2R47A 5LMNB 1YASA 4AJ1A 1HE3A 4ZI2A 2DC1A 2ZRJA 3E5HA 5C5CA 4GZLA 3GD7A 1MRSA 4NESA 5HEKA 3JSAA 1L7PA 4DQXA 3PHIA 1TKRA 2HEIA 1TD9A 2WOJA 2UVPA 3HYLA 5EG5A 1WXXA 3H2ZA 3PFGA 5A1JA 1PS9A 4QARA 4HUJA 3ASVA 1VHQA 4MYSA 2A5YB 1NMEA 5E1BA 3EC2A 1PWHA 3BG5A 4IRUB 3AWIA 1NAIA 2MDTA 2OBNA 3H8WA 4FYWA 3AW9A 1YQWA 2EOAA 4I3HA 4M98A 2X23A 1CJKC 1VSQA 2GR9A 3B8HA 4MJ7A 3LBHA 1PNQA 3OOJA 4WN9B 5DSZA 3WC4A 3LBFA 4EELA 2AEMA 3MJCA 2QPOA 3H11A 3VJRA 1CZRA 2GA8A 4GM0A 5D6OA 4MB2A 2LTAA 5I9LA 3LUFA 3G0GA 1L1EA 5BYJA 2OPHA 2M32A 4RHEA 4Z4HA 5K0JA 4X62B 2QNBA 3ZZTA 4BKOA 3MTDA 3GT0A 4NRDA 2PIDA 2XRFA 3WGNA 2B1QA 4OXIA 1P7YA 5BV8A 4JL8A 1CY4A 3QVMA 5KX5F 2BGRA 1LF0A 2G0AA 4EYEA 3ZTYA 4HXYA 4LC9A 4UATA 3TW0A 5KOHB 3MPOA 4OBXA 2QI9C 4JDPA 1X92A 4EAQA 1LTQA 3GQBB 3SHWA 3C7DB 3T3DA 4RW0A 1CEEA 4NMMA 1EM6A 2Z2ZA 4OQNA 3ZEAA 3K70D 3U4QB 4L0DA 3LPAA 1E1NA 1SK9A 1A8PA 1BJKA 2VPXA 1D5CA 3DV0A 5ALWA 1X0VA 4R1PA 1U7DA 2NSYA 3OY2A 3PR3A 5D6NA 2FOXA 3TQFA 1LEHA 4V0ME 2P1ZA 3FUXA 4L9RA 2FWAA 4LVOA 2WWFA 3HI6A 2GF2A 3P52A 5U4XA 1W0CA 1M54A 1XG5A 3BFJA 3M9XA 5ALRA 1QVAA 2B82A 3WL4A 1IPHA 1LRJA 1W88A 3A1TA 1FMJA 3H9UA 3QV2A 4RIFA 4ZIRA 5EP2A 5ADWA 1RMYA 5JI3E 2AJTA 1E77A 5AM0A 2FXIA 2GM3A 1T2VA 2B35A 4WKPA 2CD9A 4KYIB 3NHPA 1W8DA 1G8GA 3DC7A 2YV5A 4GVXA 4CT5A 2ZXUA 4F2PA 4INAA 2PUGA 4LBWA 3FUTA 5K3FA 4CI0B 2VDMB 1AB6A 1ZHOA 2DCUA 4TM8A 1EP1B 1ESCA 1Z15A 3QG5A 4YO7A 3UAWA 1AOXA 4HLUA 1EIWA 4UM7A 4D8WA 421PA 3Q7IA 2AQ8A 1D1TA 4E6PA 1QHHA 1PL7A 4XGIA 4X85A 3T5TA 2COUA 4E22A 5JNLA 3KB1A 1YRHA 1HLFA 1Z7BA 1EBFA 2G0TA 1IPEA 1SXIA 1X86B 2Y1FA 3OQBA 1A3CA 5GJVC 1ZA2A 1K6XA 1KZ6A 4TLCA 1Y1LA 1URPA 3T7RA 4FXOA 1N0UA 3PXBA 1L8AA 2VI5A 4MQ4A 4R8KA 3HVRA 4JXZA 3ELYA 4O33A 4TGLA 1EE2A 3ZIAA 1ECFA 1KH3A 3KOUA 4DUYB 1FFGA 3OZAA 4ZAGA 4F60A 2BBOA 4AX8A 4LHWA 4DUPA 1TLLA 1BXRA 1I51A 2GFQA 2HDWA 3JQ7A 3UG6A 1XPUA 4EY4A 3N8GA 2EWWA 4P58A 1WY7A 3BXFA 3L6UA 1VPWA 2AZMA 1E58A 2OO3A 3ZLJA 2Q5QA 2YJNA 2BGGA 2JZOA 3R41A 4LDNA 3ZIDA 3U44B 1TF2A 2E6UX 5HKAA 3B3JA 4BGVA 4LI3X 3OLXA 3OQ1A 4H1VA 3TQRA 3OZ7A 4A1OA 1YB1A 1JNXX 1XZGA 3DDSA 2XIQA 1QIKA 2IIQA 3OJEA 3IOYA 1E79D 3I0MA 4MLDA 3RF6A 3WMGA 2V1UA 2HUNA 4NCJA 4DDKA 1CUVA 4WUTA 2DG2A 5BPHA 1Z75A 3T5AA 2HMTA 3RYIB 2PUFA 2HMUA 4FBMA 4L9SA 1HMPA 5B1HA 4WQMA 4XTCS 3GCZA 3EEIA 5KJFA 1TQ2A 3NM6B 1JEYB 2LNDA 1PGJA 1RQ7A 2XMPA 3UTDA 3AEXA 5JHGB 4B75A 1UXHA 1C8VB 3RRMA 3LK7A 1EFPB 1KK3A 2PA3A 3IOEA 1H6CA 3AOGA 1KMMA 4LDJA 4DUGA 2C3MA 1R50A 1Y1KE 2PD3A 3DE5X 1DFGA 1M76A 5CVTA 4WN9A 2ORWA 2VHQA 4QBKA 5JS8A 3T9BA 1GQFA 1NDUA 1VL0A 2IYEA 1RJGA 2H9AA 2PK3A 1Z2CA 2ZETA 3SLKA 3N0TA 3ES9A 1IY0A 3QXXA 2J3EA 4IZHA 1U94A 4YJKA 1GSAA 1UMKA 3BA1A 3CNLA 4JOBA 1G3MA 2Q50A 3BOSA 1QRDA 2HJGA 3ZI4A 2YCBA 3QXJA 4FZ5A 3BGDA 3LBNA 2A9OA 4QXQA 1K0UA 2H1WA 5CH8A 3VH1A 2BZ1A 3WB2A 4YQFA 1CUWA 1V11B 1DIOB 1TPZA 3RVDA 1C8KA 1OFVA 2HBYA 1XTKA 2RGWA 5TPZA 2JZNA 3RTCA 4E46A 3SHVA 5KOHA 1ZD8A 3GFFA 2IUSA 4AZVA 2JAQA 2JNWA 4HFJA 4MW5A 4EF4A 2PO7A 3GQBA 4F46A 3B2QA 4WMLA 3UPTA 3U4QA 2XITA 2XE6A 3IMCA 1HT0A 4C06A 4B17A 4X45A 2ONZA 3I2JA 2CLSA 2XVYA 1QYCA 3MTIA 3B6IA 3IPLA 1SBTA 5KX5B 4AZSA 5HOEA 3H9BA 2AEEA 3IA7A 4AUKA 4BL5A 4UUPA 1L7MA 3H16A 1TM1E 4NMWA 3H9QA 4ZGGA 2BFBA 3LQYA 2IP1A 3LUCA 3OU6A 4FONA 3U0BA 5A7HA 3H4VA 1MQAA 1QIGA 4L3VA 5JTTA 5LYJF 1B6GA 2Y2UA 4WACA 2A5FA 5KKAA 3AUFA 3WGQA 4JA2A 1P0IA 3KEMA 4OATA 4TLDA 5CPBA 1QTQA 2XIJA 1R0CA 1SQ6A 2HLNA 4TLEA 3L06A 4GM4A 3T9DA 4R1MA 5FR2A 2VQSA 4RF4A 5TQ2B 3QNUA 3P9CA 1JXMA 5J63A 2UKDA 5GQSA 4EK9A 3EEOA 3VBEA 4OU4A 3HTXA 5CXUA 4FDAA 3TECE 2IP2A 5DNEA 4F1KA 5JS6A 2R6GA 5IC5A 1Y5LA 3GRYA 1NFFA 2AWNA 4G2NA 1JEOA 1TQ8A 1UJ5A 4OL0A 5IH3A 2GFHA 3L6EA 1PJ8A 1HL7A 2O20A 1FUIA 2B8NA 1QIHA 3CS3A 1NVDA 4W99A 2V7VA 3EAGA 2XYPA 3G8AA 5FOTA 3A1EA 4P84A 5D3QA 2V7QA 4EABA 4RO0A 3IUJA 3R2JA 2IKSA 1HDZA 2EZTA 2Y0BA 3B7GA 1T1GA 4HCJA 1W2GA 3F9RA 4Q19A 1NNI1 1Z62A 1DS6A 4GNRA 3WVNA 4ZKDA 4OP1A 2BFAA 1JFLA 2WFMA 2WWIA 5CT4A 1QF6A 3NHYA 3HCNA 1ZIPA 3AF3A 3UNXA 4RF5A 4OXQA 3C74A 3DE2X 1L4UA 4U9IS 5JAZA 1CQIB 3U4MA 1WSAA 4EUNA 4RZSA 4TWJA 4HYQA 3TRFA 3COSA 4LOHA 3HN2A 2NM0A 3H42B 4G1MB 4EHLA 1NNSA 3CISA 4N9QA 3WGIA 3B3GA 2NU6B 3HBMA 3U44A 2QX8A 2CW5A 3OIDA 4P31A 1ENZA 4DDWA 1UAAA 2TMYA 2VRWA 5DM1A 3MGAA 1UCFA 2P8SA 4DCPA 1M2VB 2I54A 2CUTA 2D5CA 4LWPA 4MCJA 2GWRA 2PQMA 1A98A 1MX3A 4QOSA 5HDBB 3LA8A 3DLBA 1KRXA 1STOA 3L1HA 5CMLA 2ET6A 4BFTA 1AVTA 5BN3B 1NVVR 5ALMA 1LJUA 1TZCA 4EDHA 2OK7A 1LU9A 3MC1A 4E07A 5DGTA 3RYIA 1WPGA 2Q4EA 2HT6A 3O84A 3AY0A 1ZK3A 3CLHA 1MOQA 3PHGA 1GR0A 3DKVA 3M4JA 4UUOA 3ZWBA 1WNFA 3AUTA 4PYOA 3AZQA 3PQ3A 2R6FA 5D85A 2J3QA 1E2MA 5BUSA 1JEYA 3W3AD 5L51A 3A25A 1W1IA 3EIEA 3OC6A 4XGQA 1SG9A 2E4AA 3W2GA 2BUAA 4BZPA 3LE8A 2B1JA 3R9IA 1EFPA 1Z4IA 1M8GA 1RI1A 1QNLA 4UZSA 2PEYA 5LKAA 2XNDA 4O2RA 2WNHA 4UHJA 5DK4A 5EMNA 2AFIB 1N5OX 1O6ZA 4MIOA 2C94A 3CVYA 4OQYA 2O7SA 4WLFA 3ZHXA 4CM4B 4DCTA 1YJQA 5DM2A 2IBTA 4QZVA 3O8DA 1YDGA 4PXSA 1WCYA 2RONA 3MXTA 3MT8A 2OZEA 1PLLA 1Q44A 1VI6A 4IYJA 4PTLA 2GN9A 4XE5A 4CMKA 2DBVO 2C1XA 1M8FA 3NHZA 4JXJA 1USVA 4MUFA 1B14A 2I33A 4BWVA 2GAFA 3HU5A 1OFIA 4FUTA 5TMBA 5EPUA 1D4OA 3Q3IA 3MF4A 4KXQA 1V11A 3M2TA 3NM5A 4GWKA 1RLIA 1GNSA 1E1RA 2CSXA 3WQBA 4HMPA 3T5PA 3C98A 4GKVA 4ZJUA 4OOFA 2PXCA 4U7DA 1FDWA 1FSGA 2QMUA 1S2DA 3WJAA 1PDVA 5NLLA 5JRJA 3X3HA 1DEXA 4KYUA 4E4YA 1KJNA 2WKQA 3GN2A 4GX5A 3CUSA 1PUIA 2J5KA 3WICA 2AKAB 1QYVA 1SUIA 5DNAA 4AUNA 3ORHA 3SNKA 4GC9A 1RJFA 2B0JA 3DOUA 4CI9A 1MVOA 3AUKA 1NQWA 4C3UA 4KR7A 4HC4A 1V48A 1ZHFA 3R5XA 3TLYA 1ODTC 5GJCA 1I8TA 3L7KA 3S2IA 4J0DA 3O3MB 5IZCC 1ZLYA 2WDZA 1GKIA 5LZ4A 2ADOA 7GPBA 2QZ9A 4QJ4A 3GJTA 5TQ2A 1GRCA 4TVKA 5LUBA 1KFKB 2AC7A 1PZXA 5FJJA 1H4QA 2H1RA 1Q1EA 3NASA 4GYWA 2IZZA 1N9GB 1BOOA 5LYJB 3ZWXA 2EDAA 4N5NA 3FZGA 4CTKA 3CW8X 2WLSA 4YVFA 8MHTA 3AK4A 1SXJD 1Y5NA 4HFMA 3TGWA 1KTIA 1JG7A 1KI9A 4JR2A 1GZ5A 2ILTA 2ADFA 3OZRA 4UBNA 1P6XA 4WD3A 3ZU3A 1U2SA 3NT5A 1SR8A 2Q28A 5B3AA 1QVWA 1X7GA 3F6RA 4UU0A 4JLDA 1FLAA 4X91A 1RRGA 2GSDA 2VTVA 1EVEA 1JA0A 1TVCA 4BLWA 4K9RA 5JFOA 3CH6A 4J8PA 3NMUF 3KJXA 2VJAA 4CL3A 1XD9A 1KVQA 2FCAA 3S1AB 1M6WA 1DIAA 1G8HA 1G98A 1QZ3A 3B20A 1KAOA 3ZK9A 2AOVA 2E5WA 1W0KD 4TYPA 3ROMA 1VGQA 2HLDD 1OFUA 1O0SA 3DB1A 4GECA 4DV1B 3KTOA 2NP7A 4F1WA 3M1AA 1EI9A 3FWYA 2DT5A 2GK4A 2ZYDA 2YTZA 3H1PA 1Q83A 3P0FA 1HORA 4GMHA 1CQIA 3LOUA 3RFCA 5CIQA 4BZZA 1LRLA 4AC9A 3T4UA 5DU2A 3TO5A 4UAVA 4EHKA 3R44A 1KETA 3MTJA 2D0PB 2NU6A 4P7KA 4PLGA 4LDZA 1AUPA 1SQ5A 1Z0UA 3O94A 2CSUA 1H69A 4ZI3A 2HOQA 4Q9HA 3T41A 2YNMD 2YHAA 3W2TA 3L8CA 1G5RA 1M2VA 2OCKA 1E2LA 2SKCA 3GJ4A 4X3OA 2JGIA 1ELOA 1PRYA 2OR3A 4DVJA 2PVCA 1SD5A 3VPXA 2GN0A 1IK4A 1YOVB 2JD1A 1P4RA 4ZAVA 3F6SA 4IUCS 4J1NA 2AD1A 4OYLA 4R8VA 3DGEC 4RCVA 3TTTA 2ONCA 3ZBPA 4ABYA 1R9NA 3MYRA 3U17A 2ZYRA 1HFWA 1NMZA 3GFTA 3I2YX 1YO6A 3G17A 3KOYA 5CT5A 2CUNA 3HVKA 4G0XA 1GT6A 4QHYA 4ALKA 1I94B 3P1JA 1K9SA 7MHTA 1U0BB 3WNBA 3WGUA 3IE2A 3K2BA 2X3UA 1ZI8A 1W48A 2FW1A 1K1EA 1VCMA 3RFXA 3S44A 2O8FA 1B43A 2H2AA 3KV1A 3F7NA 1ZO8A 3R5JA 1GQ2A 3NEAA 5C46F 1H4SA 3GYGA 3T7JA 5AJZA 1I0IA 4ILEA 1ZMXA 2QU7A 4DXHA 3KPYA 2C57A 4W9MC 2AFIA 2P62A 3WFIA 3E84A 1FE8A 4N4AA 4V3BA 4B8YA 3LY5A 4CM4A 4J7CA 4QEKA 5ESXA 4HNSA 1ND6A 4PAMA 3ANSA 5AI6A 1H2ZA 1Z2DA 1R7RA 3MT0A 4QU5A 4Y2VA 2OYSA 5CVCA 5TGZA 4AECA 1EFHA 5GAJA 5CFLA 1TM7E 3WWEA 2F1HA 1E8NA 1ADBA 2Y9MB 3JCZA 4HNAB 4CG2A 3TG2A 1ZOSA 4V1CI 3I4FA 4J76A 4BKUA 2C0QA 1VKOA 1TT7A 2G9UA 4H17A 4WIAA 2XGJA 4PM4A 1J6UA 1Z6ZA 2VZ8A 3L0IB 1A9TA 3WSVA 4B45A 1IVNA 4IRMA 4KQHA 3L7CA 2RJOA 2C1ZA 2I2XB 3HCWA 1DKLA 4TLAA 3TL3A 5I7HA 2JEZA 1GPDG 4Y7DA 1K68A 4CM3A 4EUSA 3L0BA 1ZW1A 3EJWA 2JFBA 1SBNE 3CT4A 2G6TA 1ZQ9A 3WTCA 5LP6F 1U6IA 1FU4A 1U7ZA 1D4ZA 4MS4B 4E2YA 4ZYWA 1N78A 4OBBA 5DM4A 4N5HX 1DELA 1LLCA 3BE5A 4N76A 3RAEC 2B2CA 4WX2B 5E1OA 2GF9A 3VDXA 3A4NA 2PH3A 2IK8A 1V1JA 1PYGA 3UWDA 1UC5B 2QDKA 1EVKA 2ECKA 5BN1A 3IB3A 1DFIA 3NM4A 5K2MA 1VA4A 4FFSA 4R9RA 3E3AA 1GGJA 2CJYA 3VAYA 2CL5A 1DQYA 2DHDA 2ASEA 2J9ZB 3GAMA 1MIHA 5FPQA 2XOEA 4M76B 2FKNA 1SKUA 3SFVA 4N8EA 1WE2A 4IH1A 5LXTF 1N7HA 1XDWA 4MAFA 4ER5A 3FHLA 4QPZA 3KPWA 1ZJ6A 1NI3A 4ID3A 1N9GA 5G3YA 3BXXA 4YRBA 4QGGA 2X4GA 3R5FA 4HJRA 4EFNA 1YQXA 3ANLA 2GM4A 1LB1B 4NPAA 3ZWMA 2YW9A 1ZCJA 2WD8A 4KGVA 4YRCA 1PIWA 2QAGB 4S3MA 1NUAA 3B82A 4U1RA 5F4ZA 3GJYA 1LPOA 2RHTA 2IZ1A 3L6OO 3OCCA 3FPKA 3S2EA 2R84A 4YXWD 1T9ZA 1JUDA 4FQ7A 3AOEA 3S1AA 3PHLA 4PWZA 1J9ZA 4UARA 2Q3DA 3OJLA 4YCMA 4DA9A 1R0ZA 3LX8A 4EX7A 1SG6A 5DLYA 3MWGA 4K28A 1O4WA 3PKIA 1GUAA 1T34A 4I6JA 2HN9A 3HCBA 2QT0A 1S7CA 1C5KA 1EWTA 1TMKA 3OC0A 4YTEA 1XWIA 4TLBA 4BGDA 1XEAA 2R8YA 4QQRA 5KNCD 4TL6A 2P2NA 2VPTA 4YFYA 1E3WB 4GKBA 1EFRD 1O95A 3W7VA 3X1ZA 4B44A 5JZSA 4FMBB 4C7KA 3FWNA 1QZUA 4UUMA 2ZQYA 1E1CB 2X22A 3ABOB 3EGXB 3OUUA 1ZJJA 4ZZ3A 1KS9A 3RS9A 2M9MA 1EDZA 1RT9A 4M0KA 4MVJI 3SDSA 2GXAA 1ZOIA 2OCIA 2NZ8A 3HCEA 1CR1A 2CFSA 2AHOA 1JDZA 2Y1LA 1E0SA 1T6ZA 1TL7C 1NATA 2X2OA 3GGGA 2JFXA 3HHEA 4YBRA 2IYUA 1FXWA 2XMCA 4ARUA 2FDRA 4PYJA 3L7OA 4HBZA 1JLKA 2AN1A 1UKBA 3ZHZA 2E3JA 4Y67A 2C7GA 5I4BA 4YCNA 2XUFA 4ZAYA 1TAHA 1QO7A 2NGRA 2FI1A 2RK6A 2C00A 1CZKA 2GLUA 1U8TA 2XUIA 2FSHA 2F1KA 2CZQA 3JQ6A 5DHRA 4EAAA 1TO2E 5LQJA