2ZI5A

C4s dck variant of dck in complex with l-da+udp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
219
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 219
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi5A00
3RAPR 5AJYA 5EE0A 2FPMA 4AG6A 4YMSA 3C14C 2NZ8A 2Q9BA 2C2HA 1LB1B 1OPXA 1U98A 3FKSA 4LJ6A 1VIYA 2FFHA 2ZUDA 4M22A 1EWQA 1M2OB 3BD9A 3UMSA 4F38A 1G5TA 2QAGC 3VAAA 3KFXA 4RSGA 1FMJA 4GZMA 4B75A 1EFRD 2VP6A 4KJZA 1T9HA 2D7CA 2ZSDA 5TDHA 5K8UA 1KK2A 2CVFA 1NN5A 2GBLC 3SHWA 4PPNA 1RRGA 5SZIA 1G4UR 3DM5A 3U7FB 4G01B 1SXJC 3DPUA 1UJ2A 2QMHA 2J0UB 2ZJYA 4RZUA 5BN4A 2OFWA 2Z4SA 1FZQA 2GK6A 2KB0A 2RGDA 3C16C 1IN4A 2UVQA 1HV8A 2DWOA 1SVKA 1KKMA 1KNQA 1XEFA 4Q9IA 4KBGA 1RJ9A 4FN5A 4CT4B 4Q9LA 3KQUA 1E9CA 1SGWA 1NMYA 2OUKA 4GPTA 4B3FX 3ICEA 1JB1A 3EWSA 4BFWA 5KNBA 1VKJA 2OCPA 3LLMA 2XB4A 4FMCB 4Q48A 5CYOA 3SU8A 4JT2A 2W0MA 1VPLA 5FBQB 1UDWA 4GMDA 2JATA 3C7KA 4C0KA 1MO3A 4DLUA 2BWJA 3I92A 1OYWA 2PMKA 3FDIA 4MDEA 2H92A 1BYIA 2WWGA 4BUJA 1XB2A 1J99A 4TMXA 2GK7A 4TYWA 4D80A 3EW9A 1CJKC 1AQYA 1QBKC 1TEXA 1ZUIA 2CLCX 2GCOB 2J7PA 2OLJA 2YWHA 2ZRNA 3UWOA 1PV4A 2GESA 1T3SA 3AUXA 4POAA 3CPHA 4LV6A 2XSZD 3R7WA 4TN1A 1GM5A 1SULA 1OH5A 1HUQA 3MFYA 1G41A 3ZVLA 3EZFA 1P9NA 2O8BA 5FTMA 3V4FA 3HWSA 5IK2A 1MABA 2OM2A 3IHWA 1AS3A 1LF0A 2IF0A 5EXSA 1Z83A 4DLSA 4XWKA 1MOZA 1N5KA 1S3GA 3EZ7A 1W4AA 1IQPA 2QPAA 1F48A 1FL9A 1E2LA 1KSJA 3I8SA 2NO0A 2ERYA 4IVRA 3PV0A 4RCYA 4HSEA 5JWOA 2V3CC 4EDHA 2O8DB 3NEJA 1FX0A 1OH6A 2JIZD 3OAAD 3CPEA 1M8PA 2FSIA 5LPNA 2BCGY 2XOKA 1FUKA 2VHCA 2PLRA 1ZBDA 3KQNA 3QE0A 4XH9B 5HKKD 1SVWA 5DI3A 4C7OA 3KJIA 3IUYA 4NZYA 4OI1A 4NBSA 3QI2A 5CIQA 4OHYA 4RD1A 1NF3A 5E4FA 2CCGA 1W5TA 4NDZA 2J3EA 2ZROA 3ASYA 4OHWA 1T91A 2P5TB 2XTNA 3SBEA 4KITB 2PZFA 4LJYA 4ILEA 1Q44A 2F9LA 3B6EA 4TT3D 1TF5A 2QL6A 1ZM3A 1NIPA 1S9DA 2VHUA 1NJGA 4TL7A 3DDCA 3E5HA 1U0HC 4MRNA 3KFVA 3LNCA 3WRXC 1P2TA 1N2CE 2R6DA 1K5DA 4AWXA 2HT1A 4TLBA 3I73A 4FMDF 5SZHB 1FP7A 4AIIA 1TF7A 1KI6A 3B1WA 4RCZA 1W5SA 2WSSA 4DDVA 2V4ZA 1U9IC 2RB4A 5KDLA 3TIFA 4M9SA 4MDFA 2CXXA 4XTCS 4HDOB 2VP2A 3TRFA 2IX3A 1XF9A 1ZM9A 4AG5A 3VX4A 1YZUA 4JLPA 1Q0UA 5CM9C 5FPYA 1A2KC 3QPWA 2FFBA 1RVDA 3VR3A 4JVSB 4S2EA 4DXAA 2ZJAA 4TYYA 2VSXA 2YV5A 1FPMA 1XEWY 4NHOA 4V03A 3WMEA 1T5IA 3QXSA 3R9XA 3QY0A 1WBDA 1ZUNB 1KHTA 2QAGA 3LW7A 3EPHA 4BZXA 4IHQA 2XZLA 2CE7A 4C2TA 1X3SA 2QTVB 4IOMA 2GBLA 2QROA 2W58A 1E2IA 4KSBA 4QBFA 2IBMA 2IK8A 4UNPA 4B73A 3H84A 1YR6A 4HB2A 2ZYUX 4URYR 4Q9HA 2WIBA 3B1VA 4Q1EA 3K09A 2ZRLA 4WIAA 3X1YA 1D6JA 1NSTA 1E96A 1ZAKA 3R7WB 1KI4A 1E9DA 3OE7D 4JYCA 1CEEA 1UFQA 2BEKA 2O8CA 5GVSA 2OFOA 3KB1A 1E79A 1KMHA 2O8BB 4RD6A 4PAOA 2FSGA 2DR3A 1MABB 4Q1FA 2GJSA 3ZYCA 4W5JA 4M1MA 4M21A 3GD7A 4YXWD 1NVWQ 4RD2A 4YMUA 3MWLA 3AVPA 3WMGA 4PHHA 1KDOA 5H1YA 721PA 4TQUS 3VR6A 4OL0A 2VL7A 1OV4A 1WRBA 3QXHA 4Q19A 2JLSA 2WJGA 2XAUA 3EZ2A 1G9XA 1R8SA 4Q02A 4DLYA 2F1HA 3MGCA 1M34E 4DSUA 1YZKA 1P9WA 5BWMA 1DO0A 1FX0B 4KFTA 2O8EA 2XJ4A 1E4VA 1YU9A 2IS1A 1SKYE 4PHFA 3KUDA 1DAKA 3ZIAA 5JI2E 3EWAA 5BYJA 1C1YA 1E2KA 3TUJC 1VIAA 1S3SA 2GCPA 2ECKA 2ZRAA 1Z5ZA 1GVNB 1TAGA 4JSYA 4GSYA 2CL0X 4C0QC 4U5XA 4ZIRA 3QXCA 3SDZA 1O87A 3NC0C 5E7MA 2P5SA 5DHFA 1CJMA 4KCGA 4QGGA 1P61B 4QG7A 1NKTA 1DG1G 3DOFA 3P4YA 2SHKA 4DLZA 2ATXA 3MJRA 2ZE5A 1JR3A 3K0CC 3BERA 3ZS8A 5FUXA 4NYMQ 5FPHA 4Q00A 4IDPA 2QRZA 3LVRE 4B3CA 3H0KA 4OYHA 2P6RA 2GDJA 2V55B 3U3OA 4KFSA 1MO4A 3ASZA 4DT1A 2FU5C 1XX6A 2GF9A 1EGAA 5HZHA 4IJMA 1XTSA 2JCSA 1L4UA 4TMKA 1W7AA 1DAHA 4RD3A 4CRWB 3LQRA 1G17A 4QM7A 3RRZA 4ESHA 1SKYB 1ZM4A 3ZLJA 2W0SA 2W2XA 2ZI9A 1VCIA 2ZR7A 3CF6R 2IW3A 1E0AA 2FEOA 2ZJ5A 1KOFA 4MGIR 2Z6VA 1U0JA 4BLSA 3NIBA 3AVXA 2NTYC 3GJ4A 4GMXA 3IBYA 5IRCD 2GKSA 1G16A 4IW3B 3BB3A 5CK4A 1X8KA 4UXIA 3W3ZB 1OXSC 2QGNA 4KYIB 4BFZA 2QZ4A 1G7CA 2G83A 3TJZA 2GEUA 2GNOA 3MJHA 1G5PA 2R6CA 4K8OA 3WYAA 1Q22A 4EPTA 5FBLB 3UMRA 3LFUA 4QJ5A 3VKWA 4HAZA 2VBCA 5FL3A 1KJWA 1BOFA 4Q7LA 4BLRA 2XB2A 4QBHA 4G1UC 1XU4A 4OK3A 1MT0A 1DADA 2VSFA 1U9IA 4OQXA 1L4YA 3OIWA 2FZ4A 4EUNA 3D31A 3QG1A 2O8CB 1GKIA 1KMHB 5KNCA 4L15A 2IXGA 1MO5A 2AFHE 2YOHA 3IGFA 3WBKA 1Z0IA 1CP2A 2C04A 4AK9A 1DAGA 4QNMA 3VU9A 3K53A 2IF2A 4WXRA 3MRSA 1T8TA 2W83A 3TAHA 2WBLC 3DOEA 3TQFA 3UXMA 1Z8FA 5LB2A 3PEWA 2EYUA 1TMKA 3SNHA 4NH0A 4B2IA 4A0GA 4D2IA 2WTUA 3W5IA 4D6PA 3B7GA 3AUYA 4Q4HB 3ECCA 4S35A 2AL7A 3EAQA 4DLXA 1G8YA 2F3TA 2HYDA 2IYWA 1G7SA 4LBVA 4CVNA 2CL6X 2R6AA 2ZYWX 3VR4A 3GCGA 1F2UB 3AKDA 2WKRA 3RANA 3R9IA 2PCLA 1RYFA 4P32A 4KLZA 1VTKA 2AXPA 4ZIRB 5EE5B 1QRAA 4P31A 1AQUA 3REGA 3M6AA 3MWYW 1T4GA 2JLYA 1HA3A 3BC1A 4TLAA 2C98A 4B48A 4HAUA 2FGJA 1VCNA 3K70B 4W9MC 3AVQA 3SOPA 3LQQA 3M4YA 2FPKA 1ZYUA 3REFA 3H4MA 2ZEJA 2ZE7A 3ZJYA 4FMCF 4DT1B 2XX3A 1ZUHA 5JHHB 3WRYC 4AYTA 3O8CA 1NL3A 3SI7A 2C77A 3PIRA 1F6BA 3WHLA 3PEVA 5JJKA 1XCPA 4IVPA 2FZLA 3T1TA 1W44A 2GXSA 1N0WA 5IK2D 1KKLA 3T5DA 2B21A 2CCKA 2ZJOA 3Q72A 2VRWA 3U7GA 5JJLA 4RJLA 4IEEA 3ZVMA 1ZC3A 2GAOA 4LHXA 2X1VA 3CRQA 1NVVQ 1XTIA 4DUGA 1UBEA 1KDTA 3UPUA 1KZ7B 3AEZA 3TUIC 2J0SA 4JLNA 2NO1A 4XTRA 1G6HA 4Q1DA 4IFBA 3U7EB 2ANBA 3BXZA 5JZVA 1G8PA 3BOSA 3SYKA 2EYQA 3LAWA 4MKHA 4MRRA 1C4OA 1TL7C 2XOKD 3LX8A 1P75A 4JBYA 4B2LA 3P26A 1Z6TA 2BMDA 4HZIA 3B5JA 521PA 3PEYA 4TMWA 1RE0A 3EC1A 4WVFA 4UQOA 4A0FA 2B7CA 4B43A 2BIFA 1W0JA 3CR8A 4ESVA 4RY2A 4ON9A 2KBFA 3QKRA 2Z4RA 1JQLB 1I2MA 2V6JA 3ND9A 5C4MA 4RVCA 1OB5A 4LYAA 1UKVY 4AYXA 4XVUA 1KDPA 2GVDC 2ZJZA 1VMAA 3BWDD 3EG5A 4KSCA 1IN7A 3AP1A 3VR2A 1E1QA 2CLSA 4Q4AA 1XJCA 3X1WA 2WSSD 1YR8A 2H8KA 2O0JA 1KI8A 3HPQA 1A4RA 1OH8A 4N0EA 4U02A 2QTHA 3DL0A 3QKSA 2RGXA 1U8ZA 1GOTA 2OLKA 4FD2A 3KL4A 2AN9A 3THYA 4I1SA 3GJXC 4RZ3A 1OHHA 2CEAA 2GJAA 3AF1A 2NQ2C 5J47A 4LX0A 2GJ8A 4BLQA 4BEJA 2OT3B 1KI2A 1OXXK 4L4UA 4MYUA 3HU2A 2N1BA 1W48A 4LYJA 1Z47A 3B78A 4Y0AA 2FJUA 1XBTA 2ORWA 4G5SA 3SE0A 4M1OA 4A82A 3A58B 1XD8A 1MO6A 1V5WA 1X8JA 1SVIA 2VH5R 1SVMA 3KX2A 1FOEB 2IYUA 1TQ6A 1KSFX 4GRAA 1S0UA 1GAJA 4OI0A 5FL7A 2HV8A 2FA9A 3CRW1 4Q4JA 1Q3TA 4JJZA 3TMKA 2HF9A 4U7DA 1AJEA 2A5YB 2EVWX 4BFUA 2YYZA 1NVUQ 2RGAA 3VNUA 3K0FB 5HE8A 2QSYA 5CDFA 3MG9A 4AC9A 1EX6A 1OFUX 3FMOB 4AKEA 3GFTA 2IYZA 3CO5A 4BASA 1KO5A 2ZANA 3LXRA 1HE1C 1W0KA 3LX5A 1RZ3A 2D7DA 5BYKA 4DRZA 1E79D 3NH6A 3UKDA 4G3XA 3GLHB 4A2PA 4A2WA 4F4IA 2J41A 4JSTA 5KSZA 4DB4A 5F3WB 3KDSE 4DKXA 2RGCA 1YE8A 3EC2A 1M7HA 1ZD9A 1CXZA 2NO9A 5LB4A 4EPXA 3MWKA 1XD2A 2ZR9A 5L3QA 4FINA 2CLDX 1Z2CA 1IN6A 3EASA 4RKEA 5G3ZA 3PUYA 5KPJA 1IJEA 1PVOA 2WZQA 3ADCA 2EFCB 4LCBA 3FMFA 1SQ5A 1QHHA 4MGKR 4WZBE 5AUQA 3O8DA 2V54A 2IHYA 1X1RA 3LA6A 3AVVA 2NO6A 5B2ZA 5AUNB 5J4YA 2GETA 1N25A 1M7BA 2R8RA 4XIGS 4ARZA 3ZIAD 3SS8A 2W6ID 4P4UA 3B9PA 1JNYA 3B82A 4QBGB 1Q12A 3AF4A 2D2FA 3EIEA 1ESNA 1DELA 2V1UA 2VF8A 2W6JA 2Z5FA 3HDTA 2QM8A 1S4QA 3K0SA 5BW8A 4URUR 4IVQA 1Z0JA 1W2HA 1G7RA 2XNDA 1JR3D 3QG5A 3QKRB 2JLUA 2J0UA 5A5GA 3ZGXA 2FOLA 4JLMA 3U7HB 3B1ZA 3L8YA 1P7CA 4KVGA 4IDNA 3GLIA 1BKDR 3EA5A 3KTAA 4KFUA 1KI9A 2I3BA 4PXAA 1NLZA 2ZYVX 4ACBA 5CDFE 2IUTA 2Q9AA 4P4TA 3IIKA 4Q4AB 4WAUA 5DYGA 3SEAA 1CR4A 3THXA 2ZSEA 1CR1A 1N6IA 1UDXA 2ONKA 2QORA 2REOA 4C2UA 4NYIR 4II7A 4L16A 1Z07A 4LJ7A 1OT3A 2ZRMA 4PAQA 2P2LA 3THYB 2ODEA 1W46A 4UNSA 3T06B 1F2TB 3BB4A 2AX4A 4IDHA 2FF7A 2RHMA 3D7MA 4R2HA 5FOXA 3ZH9B 5B64A 1YJ5A 2VA8A 2BHRA 1T0HB 3UATA 4DSOA 4XSGA 2AXNA 2ZAOA 3GP8A 1QHGA 1DAIA 1E2PA 4OK6A 1OF1A 4PZLA 4XSHA 1ZMXA 3GJ0A 1E2NA 4YDHB 1KSGA 3HR7A 1LTQA 2IUSA 2OE2A 3GJ8A 2ORIA 4MA4A 5DHAA 2F9MA 5TVKA 4LGMA 3T15A 2BMFA 3ZZ0A 1PLLA 3RHFA 1HQYE 3LV8A 4IFEA 1VG9B 1XCGB 3V00A 1QG2A 2D2EA 4DLRA 3SQWA 1Z63A 4KHZA 3SN6A 1Z2AA 2X2EA 1FNNA 1VECA 3EXAA 1XZPA 1OH7A 1XP8A 2C78A 5JS7A 1KTVA 2X8AA 1PJRA 4D25A 5C4GB 2GF0A 3DZ8A 5TMPA 1IOZA 1F5NA 4JS0A 4X8MA 3SC3A 3A1WA 4LDJA 3EPKA 1ZD8A 2HDNB 2ODBA 5FTKA 1XD2B 3CRMA 4I1UA 5FOWA 3B1YA 3C5HA 1DBSA 3BORA 1ZC4A 4LC1A 3RWOA 3QSYA 3LD9A 2AKYA 1NLFA 2IC5A 1K5GA 2WWFA 3LO5A 421PA 3GLIE 2A5FA 2BCJQ 2O8DA 4OKSA 1QHHB 4JVNA 3WYGA 2A3RA 5EQTA 3GEEA 4Q18A 2P3SA 4CGZA 3IHLA 5HCIA 4R71A 4EJSA 2AHOA 4F7WA 3LBIA 4MUAA 4G5RA 4HAXA 5DISB 1JPNA 3LWNA 4NYJQ 1CJTC 3CF0A 3T1OA 4LPSA 4ARZB 4OBEA 2OBNA 1P4SA 1GWNA 4MRVA 4JLAA 3ZS9A 3GPLA 4PO9A 4UNQA 5TXGA 2VHQA 3WXMA 2CCJA 2QP9X 1YZGA 4C30A 2V6IA 1E9AA 1RYHA 4M1TA 4ASUD 1EK0A 5C1BA 2ZS8A 3L2OB 4NYMR 1J90A 2ZI4A 2EFDB 4HATA 2BEJA 4PSVA 3O8RA 1GL9B 4ZO4A 3K09C 4AKIA 2VSOA 4YMWA 4HLUA 3PENA 1YZNA 2HYIC 1COWA 3I61A 1TEVA 1G291 3PJRA 1JI0A 2DFLA 2DYKA 2OBMA 3GLIB 3TAUA 3KTAB 1BYUA 2GZDA 1WXQA 1FQKA 5EXTA 4OHXA 5CJPA 3RS3A 1XTQA 2IT1A 3ADBA 2VO1A 1GSIA 4TTQA 1T3LA 3THXB 2OCAA 5IDVA 1KO8A 1EWRA 2QY9A 2DB3A 5G3YA 1RFLA 5AWFC 1CIPA 4DHEA 4EPVA 3KJGA 3TUZC 2WOOA 3IDQA 3K9GA 1N6HA 2QA5A 1HY3A 2QQEA 3MMPA 4EAQA 2OV2A 2XGJA 1Z6XA 5E7JA 3I1FA 1WMSA 3CF2A 4DUGD 1NN3A 2WOJA 1EESA 1ZU5A 1AIPA 2B7BA 2O8FA 2R65A 5LD2B 2JLWA 2GXUA 2WJVA 4JLVA 4MQBA 4DIDA 3BGWA 5GVRA 8OHMA 4KBFA 2GZAA 5G53C 4A9AA 1N5JA 1X1SA 2EW1A 2YNMA 2PBRA 4LV5B 4TMZA 3VTKA 4O3MA 1Y3AA 1GFIA 3BFXA 3U3KA 4JL6A 3DM9B 4M9QA 3AVYA 2BVNA 1R0YA 2EFHB 2R62A 1PUJA 4HYYA 3FKQA 1TQDA 4QHSA 3PUWA 1G5RA 1HEIA 1AZTA 1N5IA 3K70C 1WQ1R 4BFXA 3U5ZB 4FMBB 4WA7A 2FN4A 4L5BA 5H70A 3UK6A 1E99A 4B3BA 3ZVRA 1W2GA 2J87A 4I1VA 4DWJA 2PEYA 3A6PC 2NZJA 2YKGA 1FP6A 1S96A 4KVAA 2X77A 5JRJA 3IEUA 2FDCA 1G3QA 4LV8B 2YJTD 5EUMA 3OIUA 3NBXX 2CK3D 1S1CA 3IIJA 1XTJA 4UKDA 3IO3A 2AK2A 4EJSB 2FWRA 1LY1A 2Q3FA 3FE2A 1OHHD 3PFIA 3R9WA 1VG1A 1K6MA 1ZRHA 5JS8A 3CBQA 4LHVA 2J59A 621PA 4P4SA 2E1RA 2FGKA 3NBFA 2J45A 4AD8A 4Q01A 4RD0A 4HUTA 1U99A 2D62A 2MSCB 2WHXA 2PH1A 3RS4A 3WYFA 4H1VA 3KXIA 1UF9A 1HT2E 3QKTA 4ZCIA 1OFHA 2IA5A 1II0A 1T5LA 2G0TA 1NBMA 2WMOB 4DJTA 2BOVA 2IYSA 4X8OA 2PLFA 2DFNA 2IWRA 5D3MA 2XZPA 3IQWA 4WXPA 4BRWA 2H5EA 5F98A 4HAVA 2ZR0A 2QGZA 3K0EA 2ZI5A 4M1SA 1W0KD 3AB3A 3UIEA 1GRQA 1OSNA 3U44B 2F6RA 2AR7A 3B13B 4DZZA 1W4BA 1Q3HA 3QXJA 2H57A 3U60B 1XZQA 1EFHA 3CLVA 2OESA 4M1WA 3FFAA 3ZVNA 3Q3JB 4AKHA 1CBUA 4KO8A 1Z29A 2WKPA 3BK7A 4HB4A 2BBWA 2JJ1D 1H8HA 4NTZA 5TARA 4D4KA 1D9XA 4QM6A 1ONBA 2B8TA 2ZRJA 4DLTA 2IS6A 1DS6A 2O8FB 4HUQA 3FHTA 1I4TD 4OQFA 2XXAB 4CF7A 2MSEB 1J8YF 2QMEA 2KJQA 1XMIA 4IOKA 3T5GA 3B1XA 1IXRC 4N0DA 2VHJA 3F3YA 2O0KA 1E32A 2ANCA 5DYIA 1LNZA 1GG2A 2VLIA 2D06A 2WAXA 5AJXA 5J4HA 1OKKA 1MRSA 2WKQA 3EPLA 1XPUA 5CITA 3I72A 1LVGA 2CE2X 3UMFA 2AWOA 2XJ9A 1WB9A 2R44A 1RW4A 1OW3B 3QBTA 1GL7A 1WA5A 2YOGA 3DMDA 4HZUA 4BLPA 4D0NA 5C2JB 2A2ZA 1NN0A 1BS1A 3ETLA 2J0VA 1G7TA 2XNDD 1R7RA 3FMPB 3HPRA 2YC2C 5GJBA 4O0MA 2J5XA 1P2VA 1LW7A 1NBME 1OXVA 1W47A 5JEEA 4PPGA 1ETUA 4BGDA 2PJRA 4IDQA 4IKEA 1KK1A 1I4DD 4NONA 1E0JA 1NY6A 3NHBA 4GP7A 2WMNB 4Q4HA 4ZDWA 1A82A 1T6NA 3DKPA 5KNDA 2A7QA 3U3JA 4EFLA 3THWA 1ZW6A 3PG5A 1F2UA 1G3IA 2H1LA 2ERXA 2QN6A 1FUUA 4BLTA 2OAP1 1E69A 4LBZA 4MKGA 1P6XA 4JYBA 1G4AE 4P4SB 2RGNA 5FOTA 2ZI7A 1OJLA 1XNJA 5DLQC 3MUFA 3QENA 3RS7A 4KAXA 1VCOA 3TSOA 4QHTA 5KSOA 3X1DA 2ODNA 2FPLA 4A92A 3ZD7A 1PZNA 3IPYA 1AGRA 1Z0FA 5LDDC 1S8FA 5EE9A 2H18A 1DO2A 3CPJB 3Q5EA 4BZQA 1P2SA 1ZCAA 1W4RA 3F5FA 3KZ1E 2V9PA 3OZXA 4V02A 4JVLA 1IHUA 3A36A 5D3MB 1BO6A 4Z8XA 1OIWA 1R5OA 4DCVA 1BIFA 1HURA 1XRJA 1CLUA 4LBYA 4M53A 5EE3A 2F7SA 4BE7B 4LY6A 3I62A 2JJ2A 4BRUA 4BQSA 5ANRB 3TNFA 4DB2A 1CU1A 4E07A 1KZGB 3T1VA 4D0GA 3OEEA 1II9A 1EG7A 3FB4A 4WZ6A 2YWGA 4DDWA 4ZKDA 4OJKA 2X19A 4B6EA 4I99A 5JECA 1T0JB 2QSZA 4LPKA 1E4YA 3TW8B 3CRRA 4C0BA 1JAIA 2WJHA 4NU0A 4D81A 1CULC 4DLVA 5SZKB 3ADKA 4HUQB 4LUCA 2V7QA 4Q1CA 3W90A 2JA1A 4OK5A 1RRFA 5GJVC 4DCSA 3DEFA 1OYYA 1FNMA 4N1AA 4LYHA 4CYMA 1UEIA 5EP1A 1LF5A 2VIIA 3U6BA 2XTMA 3FKSD 4ITRC 4TMVA 4XVRA 2DWQA 4Q7JB 2YINC 2QQ0A 4K81B 1MRNA 4AKGA 1SZPA 5BXQC 3KQHA 2WWHA 5DE3A 3VKGA 3UG6A 4JVMA 2QENA 1R0XA 1Z6GA 4A8JA 2EU8A 1Z6YA 3THOA 3TVTA 5FH9A 3AM1A 3AGQA 1E9RA 1C9KA 2ZRCA 1N0UA 4HZUB 2ZQ5A 4B6FA 2R6GA 3CB4A 3EIQA 4MKIA 4FI3C 4TYQA 3CZQA 1COWD 2HF8A 2PT5A 4GOXA 4BPBA 4Y0VA 1Z28A 3DO6A 4RKFA 5G40A 2G88A 5JCZA 1MKYA 1EX7A 4B34A 2FG5A 3AV0B 2JEOA 3H2YA 2FH5B 4P33A 4A4DA 2JJ8A 4ZKEA 1GP2A 3VX3A 1Y63A 1O3YA 4JMPA 5KSPA 1E2DA 4Q7KA 3THWB 1VHLA 3W6PA 4B3GA 4AURA 4QHYA 1TX4B 3OIVA 2OFXA 1JBKA 1N6RA 1D9ZA 4URXR 3C8UA 1DAMA 2GJ9A 1YRBA 4DLWA 1J7KA 1HE8B 2DHRA 3A1VA 3LH5A 4M1YA 1YZLA 2YWEA 3BB1A 3OIYA 2HJGA 5EE1A 1SVSA 4E03A 2J7PD 1JPJA 3CWQA 2ZSFA 4LK2A 4EPWA 1RRCA 3K0FA 4ERNA 2AKAB 3TK1A 4JT4A 3FHOA 3FFBA 2WVJA 4FXPA 1DAFA 2G6BA 1US8B 5AJVB 2GILA 1JEDA 1J8MF 2E9SA 3CNNA 1E94E 4QL3A 3W9YA 4V0MA 1Q1ZA 5FBVB 3GJ3A 2ZM5A 3TQCA 3GLHA 1HH4A 1KO4A 2QT0A 2ZS9A 2HLDA 3WY9A 4PZYA 1IN5A 3CIOA 3V9PA 2W2TA 2IYXA 4R9UC 2ZVQX 3QKUA 2MMCA 1FMLA 5SZJA 5A0FA 5EP3A 4YC7A 2IUUA 1PLJA 1RIFA 2CMKA 2JLVA 5CK5A 1WF3A 3CKLA 4XOIA 2ZRKA 3PVSA 4IOJA 1MV5A 3QF7A 4M8NE 1CTQA 1OIXA 1UBCA 3B2EA 2VYFA 221PA 3OF5A 3KKOA 4HDQB 2JLZA 2DCUA 4DVGA 3FMIA 3NEYA 3K0AB 1M1YE 3LVQE 4Z1MA 3I5YA 2AFIE 2P6NA 1GITA 4R2IA 2Q0HA 5JJIA 4M2LA 4RZ2A 1QHXA 1Z0DA 2EWWA 2RMKA 3EZ6A 1YHNA 3X1XA 1NVXQ 4EKDA 5DGXA 4E09A 1QHNA 3IEVA 4JKYA 1CS4C 4FCTA 1G8HA 4WBSA 5DO9A 4LJ9A 2IS2A 4KV9A 5UKDA 3X1ZA 5LD2C 2D74A 4A8JB 2IYTA 3ZQJA 3QIAA 1NRJB 3GLGA 4KFRA 4UNRA 2DFTA 2N46A 5IT5A 2BJWA 3W6OA 1NBMD 1KAOA 4V0KA 5CLQA 2NGRA 5GJCA 1FFHA 2G1JA 2XSZA 3Q85A 1A1VA 4PC7A 2FEMA 1E0SA 2DBYA 3AKEA 2O5VA 3VMFA 1OB2A 4HLQB 2WWIA 4CEHA 3SFVA 4AY2A 3EA0A 2NIPA 3HR8A 3X2SA 2A5JA 3Q5DA 1S9HA 4IXNA 1DAEA 3ONWA 4PC6A 4V0ME 3BE4A 3SYNA 5C18A 4PTLA 4PQFA 1F60A 3GLHE 3OEHA 1F2TA 2IWHA 5ELXA 2VP9A 2HXYA 1VYUA 2AK3A 1IM2A 1AN0A 2C5LA 3SJBA 3SFZA 1VG0B 2OBLA 2JDIA 4QRHA 2EFGA 1H8HD 2C95A 3LRPA 1XDBA 1YR7A 3Q7QA 2AD1A 3OAAA 4GNKA 4EJSC 1CJUC 5J4VA 4D0LB 3CUEF 4G0NA 3BBPA 5JWHA 3WNCA 5KU1A 3TKLA 5CIWA 2CVHA 3P27A 2ZRIA 5HKKA 2IXEA 3AF2A 4M1KA 4D26A 5DIFA 3QXXA 3K9NA 1OKKD 4IRUB 3KB2A 3G82C 5FTLA 2YZ2A 3QVUA 4C0LA 3GJ5A 4GFDA 3VNVA 1X8LA 2ZU6A 1N6NA 2ZVPX 3Q9LA 2FMXA 4A0RA 2OHFA 5KDOA 2OG2A 2N42A 3RYTC 1QDEA 2G77B 5FI0B 5JI3E 5EJEA 4HI0E 4HLUC 4DEXA 4YQFA 3GLGE 2O0HA 5FR2A 2K5UA 2WJIA 4DDUA 1S1MA 4KI0A 4M9ZA 3L0IB 1NI3A 2YC4C 4PSKA 1R2QA 4B32A 2QE7A 3A1TA 3UG7A 4B33A 5EZ6B 4DSNA 2G1KA 4EPRA 3J81k 3CWZA 4UXJA 5IF9A 2JLRA 3U3RA 4A0HA 1AZSC 2Z0MA 2F1RA 5DN6A 2CBZA 4YMVA 2QBYA 3W3AA 5B58C 5JMTA 1ZNXA 1KJYA 4XJXA 4MRPA 3GLFA 3S1AB 1OFTA 1UBFA 1XEXA 5B57C 3PR1A 3A1UA 2LKDA 2R9VA 1VCMA 3PCRB 4HAYA 1ZM2A 3W5JA 3ADDA 3GLGB 2VP4A 4JKIA 1P72A 4LI0A 3K70D 2AD5A 2IYYA 2QMUA 1M7GA 1UKYA 1YZQA 3BS4A 2WWYA 3IIMA 3MWJA 2IYVA 3AKCA 5JEDA 4CEHB 3I8XA 1ZINA 3RSLA 2JAQA 1U90A 3VR5A 1E2MA 2WV9A 3B9QA 4F4CA 2ZJBA 2JJ2D 2NMVA 3E1SA 4EPYA 2VPPA 4TWZA 4WOPA 2R6FA 1Z6AA 3IO5A 4YXWA 3OEED 2QRNA 2QT1A 4YONB 1T3HA 4BECA 1CF4A 1H8EA 3B60A 5BN3A 5L8VA 3BFVA 4JBWA 1DE0A 1GNPA 4O2RA 4Q03A 4DIEA 3L8ZA 1AS0A 2WIAA 2CDNA 3DHWC 3CM0A 4ABYA 2PT7A 4XVQA 4Z54A 1U0LA 2WPDA 3A1SA 2O52A 3L0PA 1Q57A 2DY1A 1E9BA 3AP3A 3KKMA 3RVBA 1L7VC 1E6CA 3N70A 1E2JA 2C99A 3BFKA 3BH6A 2HEIA 4GOKA 5HTKA 5EP2A 1YQTA 3AF3A 1SHZA 3FTQA 4FW9A 4M9XA 4GP6A 2ZETA 5JSZA 2BDTA 3U4QA 2NPFA 3R8CA 1TNDA 4FCWA 4DC9A 3NWJA 1P5ZB 4LRWA 2ATVA 2EQBA 4LJ4A 4PX9A 2BKUA 1S2MA 1ANKA 3GLFE 2GEDA 1JALA 1XEWX 4TLEA 1MH1A 4IXMA 4P0TA 1KAGA 1PLKA 1QG4A 3NG1A 2WWXA 1HT1E 5FTJA 2H7VA 1KI1A 4TZ0A 1GRRA 3JZMA 4LC0A 2ONJA 4A36A 1IY2A 3ND8A 2H17A 4PO8A 1TU3A 1NLYA 4PR0A 1XTKA 4C4PA 4TQ9A 1N6PA 2NG1A 1QHIA 2IXFA 2GVZC 4HB3A 1TPZA 3DKVA 4NCHA 1RRPA 1G3MA 3TSWA 5AUOB 2W00A 1JQJC 3CW2A 5FR1A 5TY0A 2FFQA 3QVVA 4CIDA 3NDBB 4AI6A 2ZI3A 3EPJA 2QBYB 3KUCA 4NCIA 4ZDJA 1Z0AA 4PSAA 3K8YA 1NKSA 1P62B 2OSBA 3RNLA 2B8WA 5AJZA 3GLFB 1LS6A 1FTSA 2BM0A 2ORVA 2Q21A 4JLOA 1XEXB 4C0SA 5KDDA 3AVOA 1JJ7A 1IXSB 4QKQA 4TSFA 5FOSA 4RD4A 5K8TA 1CR2A 4JL8A 2REXB 1HTWA 3FOZA 5BN5A 4LSGA 1D8TA 4URVR 1NNEA 1QVRA 4U00A 5IHPA 2RGEA 1E98A 2PEZA 1GL6A 1TQ4A 4B35A 4CEJA 1E2QA 2GAAA 3N2IA 4DDTA 3U44A 3RS5A 1JXMA 3PUVA 4B71A 1K8RA 2A5GA 1GKUB 2ZRDA 1SVOA 4TL6A 1YVDA 4US2R 3NDPA 3OFNA 4L9SA 2HLDD 3LDAA 4JLJA 1JJVA 4QJ4A 1JR6A 1E0KA 3A4NA 2B6HA 4MITA 5F2EA 1XMVA 5H68A 2GZHA 5KPDA 1L8QA 2ZSBA 1DG3A 2J9RA 1XMSA 2GCNA 2QPTA 3SZRA 4ZCMA 2F3RA 3VFDA 4TZ6A 2BV3A 2G0NA 2OCBA 3QJYA 3GFPA 1AM4D 2XXAA 3IILA 4C0HA 1N6KA 1ZNYA 5CYPA 1CKEA 2DWPA 2CHQA 1AKYA 3CONA 3Q7PA 4B76A 4MGYR 4UXHA 2WWWA 5FOVA 2BBTA 2ZE6A 3KJEA 2CHGA 4X8HA 1KI7A 1KMQA 4Z1MD 1CRPA 4UJ3A 4CEIA 2BKEA 2RGNC 3AQ4A 2G3YA 4G5GA 2YWFA 5FBWB 4B2PA 5JSZB 2V1XA 3U4QB 4PHTA 4L9WA 4QGAA 4QGFA 3L0SA 4B3DA 5P21A 5DH9A 1D2NA 1W0JD 2KE5A 2VHTA 3G0HA 3DZDA 3VKHA 2P67A 3B8HA 4W5WA 5AJWA 4Q47A 3BRWD 3O47A 1ODFA 4BEBA 2ZUBA 2KWIA 4LJ8A 2OXRA 2ZI6A 2F1IA 2P0EA 2V8OA 3AH8A 4TYPA 4CDGA 3MAAC 1GRNA 4W5HA 5FI1B 4IDOA 3JVUA 4XD7A 3T1QA 1Q21A 3BH0A 1E1QD 4AYWA 3H1TA 3L82B 4LJAA 3KXKA 4L8GA 3FHCB 5JLJA 1NN1A 1N5LA 2C9CA 4ZDIA 1P9RA 3RDPA 3NXSA 2QP4A 2FE4A 3BH7A 2ZREA 1ELOA 1KO7A 3MCAA 3OEHD 4F4JA 2VTKA 1TU4A 4GL2A 5HCNA 2JDID 4V0NA 2D4HA 5JHGB 3SR0A 3GEHA 1J70A 1GZSA 1W36B 4KODA 2GRJA 3CZPA 1U2RA 3A4MA 2FSHA 4JLKA 3GMTA 2KI5A 4BFSA 5FL7D 2BMJA 3EARA 1G20E 3KKPA 3D8BA 4LJ5A 2ZXUA 4NP6A 1XPOA 1FTNA 1U81A 4QOSA 4D82A 1VHTA 3TR5A 2YVUA 4C3ZA 4QGHA 4RZXA 2B92A 3RABA 4TLDA 3R8FA 1E1RA 4CEJB 4UJ5A 1FW6A 1A5TA 3EX7C 2RH5A 3WMFA 4X8LA 3CX8A 1MR3F 4A8JC 3BJIC 1OIVA 4F91B 4MUBA 5FUYA 5J4KA 4HLCA 1NVVR 1G1MA 2RKOA 1OLOA 2ZAMA 1XPRA 4Q1BA 1QF9A 1E2EA 3C41J 2TMKA 2HCJB 2JASA 2OCYC 5EP4A 3NC1C 1EFTA 5TV2A 1VYTA 2VP0A 1E2GA 3VHXA 1RJ9B 2QE7D 2C03A 121PA 2MSDB 4PO1A 4CW7A 3P4XA 2A5DA 1Z06A 1P73A 2PJZA 3CRVA 4URWR 1Z3IX 1KGDA 2WICA 3C4JA 1Z22A 1D2MA 4A6XA 4NYIQ 5DN6D 2LWIA 4NKRA 2PCJA 4CEIB 3CX6A 4MYTA 4I4LA 2HJVA 5CJ2A 1N6LA 1SKQA 1Q1EA 2W6JD 4HEJA 2PL3A 4PHGA 1LV7A 1TUEA 5GJWC 4BZPA 3O8BA 3MLEA 1ZD1A 5JBQA 1M6NA 1HQCA 3DMNA 1SXJA 1I2DA 4G5QA 3F0TA 3F8TA 2FFAA 3M1IA 1GUAA 1TQ2A 3QPUA 3VQTA 4GOJA 3SJAA 1Q1QA 3Q8XB 1RKBA 2JLXA 5J4LA 1EFCA 1G18A 2AWNA 5TB5A 4F93B 1QZXA 2BM1A 3CR7A 3DVLA 1OXTA 1AGPA 2HT6A 4NL4H 5KUTA 4H1UA 3KQLA 1N3BA 3G5UA 3WP1B 3WHKA 1LFDB 4P3YA 3C5CA 4A15A 1H8ED 1GDDA 4QJ3A 2NOAA 5H8WA 1AS2A 3K9LA 3EZ9A 3NBYC 1UAAA 2ZITA 5FUVA 5FPKA 3NH9A 3LXXA 4EFNA 1IBRA 2ZRFA 1UEJA 3QF4A 1TUIA 4TL9A 3RRYA 4IEIA 4MYHA 1JAHA 4Z51A 2WPDD 2A9KA 1ZCBA 4QNRA 2BBOA 1OFIA 1D2EA 1US8A 5AUPB 4LWZA 4TQAA 2IEYA 1UM8A 2W6IA 4OQLA 2BC9A 5LBIA 1SVLA 3W6NA 5DI3B 4C7OB 4LZZA 2HCBA 2WSMA 3TSZA 1IY0A 4B47A 2QU8A 4N3NA 4MRSA 1CJVC 1D5CA 2GEVA 4UNNA 4FIDA 2LCFA 2DPXA 2HUPA 5KTYA 5BQ5A 4B74A 5K8LA 1SHKA 2OZEA 1QHYA 2FSFA 2UKDA 1V43A 4ZCLA 3UANA 3QPVA 3FVQA 5CB8A 3R20A 4CZ2A 1SXJE 1JEEA 2L0XA 3WNDA 4OQMA 2PX0A 1CRQA 1KI6B 3QUSA 3ZZTA 4BFYA 2J1LA 4D4LA 1DPFA 5E95A 1BMFA 5E7IA 1G3UA 1ZIPA 4WW0A 4GI7A 2F43A 2NPIA 4PFSA 4R7ZA 1GILA 4BFVA 3IBGA 5CM8B 4PANA 1R5NA 3BAFA 4DCUA 3K0AA 4DSTA 3A4LA 1X6VA 2Q3MA 2KSQA 3HYTA 1NJFA 1Z08A 2QAGB 2CNWA 1KDRA 1UKEA 1YZTA 1W36D 3V4RA 1OXUA 1T8UA 2QM7A 3OESA 2ZTSA 4M4SA 2XEXA 2ZPTX 4TSFD 4MH0R 4Q7MB 5KHOC 1PUIA 2EWVA 3KJHA 5A4JA 2BBSA 4V0LA 1SXJB 5KYKA 1XD9A 2WM9B 3GJ7A 1GNRA 1B23P 3N5CA 3SJZA 1Z0KA 1XFAA 3GFOA 2ZE8A 3FGNA 5EXPA 1M74A 3FWYA 2UZ3A 3K1JA 1GKYA 5GADl 1I4LD 3CX7A 5KOYA 5L3VA 4W7SA 1KK0A 2VQSA 3AKYA 3D6TB 4MYCA 4LHZA 4NCKA 3TR0A 3IPXA 4NMMA 4JLDA 3OFND 1YRAA 1E9SA 3TLXA 4M0LA 1A2BA 2QUZA 2ZIAA 1JR3E 3HYRA 2RGBA 3LLUA 3P1JA 5FUWA 3P20A 2GXAA 2ZJ2A 1ZNWA 4NPHA 3JZAA 1R0WA 4TTPA 2Z83A 1KIMA 2ASEA 1U94A 4US0R 2WAYA 3ZQ6A 4EFMA 3HJNA 4C0AC 2Q9CA 3ICQB 2Z43A 2CJWA 2CL7X 3QF4B 3N2EA 4US1R 6Q21A 1AK2A 5HZKA 4TYNA 4F92B 1TF2A 3JVVA 3L0OA 2P65A 3LW8A 4H9GA 2F1JA 1ESMA 4KYUA 4MKFA 2O8EB 1U8YA 1B0UA 2ZRBA 1E2FA 2YOFA 2QI9C 2QMOA 2ZJ8A 3T12A 3NTUA 2HXSA 1IXZA 1W49A 4HAWA 3L43A 3WBJA 3W8NA 1EFRA 3RRNA 4ASUA 3T35A 1R8QA 1BH2A 5DNYB 2OEPA 4YMTA 3IKJA 3FPAA 2FNAA 5JWRA 2OAQ1 3E70C 4HDCA 1WDTA 3I3SR 1G3RA 3RS2A 1VYVA 4RFSA 3RC3A 3CH5A 4PPQA 4JZKA 4XWOA 1P60A 4J0QA 3QQ5A 4K46A 4DCTA 4XD7D 1R4AA 3E2IA 5D3QA 3NKVA 4C0JA 5K8IA 1QHSA 2IS4A 4NYJR 4JLBA 2X2FA 4Z8YA 5G41A 5FOUA 3ZZUA 2J46A 4QXAA 2F43B 3SHFA 5HR5A 3CNLA 4OI2A 4PC3A 1OE0A 4B44A 1AKEA 3A8TA 1UKZA 4EQ6A 2IYRA 1W1WA 5FPTA 5CB6A 5M04A 3S1AA 3TVDA 2D3WA 3ZDQA 5EZ5A 3P32A 2IL1A 4FWIB 2A78A 1HYQA 1G8GA 1XXHA 3GJ6A 1KSHA 1R5BA 2C9YA 3B85A 1DEKA 4PPFA 3K0CA 1JXOA 4MGZR 1J2JA 1KY3A 1G64A 5AK0A 3RC8A 1P2UA 4Q4LA 1Q20A 4YLGA 4E22A 3EIHA 1DVRA 1KO1A 2QTFA 1NMXA 2E87A 2GWHA 4DCNA 4ZI3A 4JIMA 2ZYTX 1R0ZA 4NCJA 2QPOA 4KLNA 1GNQA 4V0OA 3U61B 3HP1A 2IEZA 4Q21A 4JJKA 2IHBA 1E1RD 4PC2A 3SQXA 2FV8A 3SBDA 2CHVA 1WP9A 5L3SA 1VG8A 5EXXA 1KYIA 3NBZC 1Q1BA 4LBWA 4OQNA 4NE2A 3VU9B 3AVUA 1II8A 3MD0A 2XZOA 1NP6A 4O2LA 5JCPA 4Q5IA 1TTTA 2RHDA 5L3RA 5C46F 1E9FA 1R6BX 3RRMA 2QNRA 3IQXA 3RSOA 4NCNA 2JIZA 1XWIA 2CK3A 1ZIOA 2WJJA 2ZU0C 2EFEB 2P6UA 3T34A 2CJWB 1IAQA 4FMDB 3RS0A 4QFMA 3AVWA 2H16A 1IY1A 3PEUA 1RPZA 3I32A 5AR1A 1CR0A 1QVAA 2J7KA 3ZD6A 4ZPXA 4LOAA 2I4IA 1KI3A 2YHSA 5F9FA 1W36C 1E9EA 1E3MA 2ODWA 3WNBA 1X86B 4TT3A 4A2QA 1WBBA 1R10A 4Q9JA 3RWMB 1KK3A 3KQKA 4HB0A 1XXHE 3UWKA 1AA9A 4ZDKA 3LBHA 1EFUA 2PMDA 2QEQA 1SXJD 4RFSB 3PQCA 2DFKB 1ZP6A 4PQRA 4TMTA 4QBIA 1E2HA 2JLQA 2VEDA 4BLOA 1XJQA 3A37A 1NG9A 2GTPA 2NO7A 3SJCA 3U6KA 2ZRHA 1FQJA 2OILA 5FPSA 3TW4A 1DARA 1DTSA 3PUXA 2VP5A 2J0QA 2G9NA 3TE6A 5HPYB 2XITA 1UADA 2ZUCA 3PXGA 1YR9A 4IOLA 2R2AA 3D3QA 3KKQA 4YDSA 4R98A 1YKSA 3VR1A 2GHIA 1TADA 1G19A 1KJZA 1IN8A 2IYLD 3AGPA 4EQ6B 2ZRPA 2JJ1A 1GIAA 4FWTA 1XMJA 4PC1A 1EXMA 3HU1A 4DBLC 1ZM7A 3VHLB 1XCMA 2Q3HA 1XXHB 4A1FA 1GTVA 5FFMA 1KNXA 4JL5A 4LHWA 1G21E 1N6OA 1LS1A 1UBGA 1UPTA 1WCV1 2Y8EA 3MSXA 1XJ0A 2RGGA 4TTRA 4OHZA 5JRZA 2I1QA 1IONA 4Q1AA 4DEYA 2XNSA 2REBA 2OXCA 3I5XA 1RC8A 4LYFA 3OE7A 4PQYA 1L2TA 2ZS7A 1JECA 3TGPA 4BFTA 3QNUA 2MMGA 1NIJA 3LY5A 5E3HA 4O25A 2ZRGA 1DOAA 1ZJ6A 2XTZA 821PA 4XWAA 5J40A 5L3SB 3OHMA 1NG1A 5J5CA 4CT5A 1WE2A 2VF7A 4PAMA 3RLFA 4ACAA 2GA8A 4G5OA 4ZV4A 4OI4A 5FTNA 3GQBA 4I81A 4GT1A 1II8B 1KY2A 4A6PA 1ZU4A 4TL8A 5F9HA 3CH4B 2WJYA 3C15C 3I4LA 3KXLA 3QEJA 2V7QD 4I1OA 3U2QA 5DSZA 3T61A 4KXFB 1U8AA 3QKSB 2GXQA 3GEIA 1BMFD 3HU3A 3PUZA 4QC2A 1NMZA 3QOFA 1VDZA 4PZZA 3WP0A 1ZVQA 4EIWA 2BMEA 4GZLA 3LBNA 4OJQA 4Q9KA 2FX3A 3PITA 2PZEA 2IYQA 3AP2A 4HLDA 4LHYA 3M0EA 1G6OA 4E5UA 1H65A 1IJFA 4JBXA 2RAPA 5KSYA 1G8FA 2CNWD 1NY5A 4OHVA 2GCOA 2GJKA 3SYLA 4FCVA 2LKCA 4WZAE 4Q4JB 3BIFA 4TLCA 1F3OA 1W4CA 2KBEA 3FYHA 2OO7A 3U3MA 3TH5A 2RCNA 2ZSAA 3AVTA 5CLLA 2UZIR 3TBKA 3NHAA 5JFGA 4D4MA 5HE9A 4D4JA 4B3XA 1NSFA 3QBVA 3QEOA 2C8VA 2PZGA 2JGNA 2Q6TA 2W2VA 3KKNA 5FBRB 2QP3A 1N0VC 1P3JA 3K9HA 2A30A 2F55A 3NVAA 2BJVA 4URZR 2C9OA 5EUQB 5L3QB 4ZI2A 1XTRA 3W8RA 2QG6A 3H86A 3W34A 5B30A 4BWYA 3AF0A 2I1VB 5KO2A 4C9BA 5DI9A 3CNOA 1ZNZA 2PX3A 4GBMA 4KU4A 2C96A 4RFVA 4GDFA 2QAJA 4Q66C 1A7JA
chains in the Genus database with same CATH superfamily
1FSSA 1JDPA 1NJ8A 4UASA 1WR8A 4DR3B 3UYLA 4WN9B 4MIOA 4Q6WA 4TS9A 3SCZA 1XDSA 1Y8QB 2Q9BA 2C2HA 1U98A 3FKSA 3G13A 4LJ6A 2ZUDA 4M22A 4B1FA 2CFRA 4UHBA 3DKRA 2Y0PA 3BD9A 3F6PA 2PGOA 1V1RB 5H02A 4LF7B 1XELA 1TT5B 1PF7E 2R3SA 2QTCA 1FMJA 2ZJ3A 3HSKA 3NT4A 3CKMA 4KNVA 4RSGA 2YXBA 4B75A 2FMIA 1Z7EA 3MQFA 2CNLA 2VP6A 4KJZA 2D7CA 3ZZ1A 3DO5A 2Q5HA 4K6OA 4QT4A 4L4ZA 4WNYA 4WBNA 5LQMA 3IODA 2WQZA 5AXDA 2GLTA 3DPUA 2J0UB 1E5TA 2WVAA 2KB0A 4UUNA 3EXHC 2A0KA 1YF3A 1IN4A 3RROA 3ZPXA 2XZDA 5DW0A 1HV8A 1HGXA 4TWBA 5LQNA 2GYVA 1KNQA 5IKEA 4CT4B 4ZYWA 4AB1A 1QFYA 5CLHA 2GBGA 1SCJA 1B1CA 3BL6A 4ZVTA 3FCSB 4MLDA 3HGMA 3PNQA 3GLIE 2OUKA 1NVMB 2BI8A 1VKJA 3VUFA 4JIGA 1TOAA 5KWEA 4PCUA 4JT2A 1SR8A 3I9JA 1YB5A 5LU9A 5FHQA 5K99A 4FIZA 2EG5A 4CM5A 1NVAA 4I1IA 2ZB8A 4G2TA 4HYEA 4IKPA 1IN1A 1CY2A 1AG9A 2GVNA 2H92A 1VA5A 2NSHA 4HWRA 2HJHA 5HBGA 2JJMA 1BW9A 2YVKA 3UK1A 1J99A 2GK7A 2HY7A 3EW9A 1X9IA 3KBOA 1FUIA 2QRVB 3GGPA 1QBKC 1TEXA 1POWA 3MNFA 3WLHA 2GCOB 2ACWA 4I4TB 2QLFA 2RC6A 1PJBA 2ZTUA 3HNPA 1CPYA 1PS9A 2WK1A 1DKOA 3LUPA 3Q2KA 3PC7A 4MS3A 4PGMA 4PINA 3QOYA 1UDRA 3CPHA 3R7WA 1QIDA 1N5MA 4D97A 3AY6A 2QWXA 4R31A 1HMYA 2WINI 1G41A 3ZE2B 3ZQKA 5A03A 1K7YA 3GT0A 3EZFA 5FFNA 1MV8A 4JHXA 4UEWA 2O8BA 3IMGA 4BJ5A 4GQIA 3E9EA 4KXYA 1YZ3A 2B4AA 4YRQA 1A8IA 4LGCA 2AI2A 1DQYA 2P9ZA 3A1CA 1CYDA 4OXKA 4JI3B 2IHKA 1LF0A 2IF0A 4JOQA 4NIMA 3UPDA 5EXSA 1Z83A 4XWKA 1EE1A 3NATA 2W2OA 3QVWA 3ZBQA 3EZ7A 1QYCA 5FULA 3NHRA 2Z3WA 3CG4A 1F48A 4NQRA 2W98A 4BNTA 1E2LA 5DX1A 5LC1A 1Z6PA 3S3TA 3TQIA 2ZJ7A 1ZCFA 2ERYA 3L6CA 3KHTA 4KDFA 4PHCA 3C3WA 3PV0A 4PGFA 3SVZA 4WXYB 3F49S 1F8GA 2I2DA 2ZWOA 5EWMA 5JWOA 1Z74A 5JO0A 1RM3A 3NT2A 4EDHA 5KX5A 2CNNA 1ESEA 1KFEB 3DEHA 1FX0A 4BZWA 3OAAD 5LPNA 2GSWA 4ENTA 3AJ8A 2I7CA 1FUKA 4FSDA 4LRQA 2IZ1A 5HKOA 1GEEA 4OMFG 3LDHA 3QE0A 4EARA 1GQ2A 1SVWA 2WD8A 1MIOA 2NUBA 2PGJA 1MFPA 3BVPA 3KV1A 4J07A 5DI3A 9MHTA 3AEYA 4G8BA 3QI2A 5CIQA 2Z1DA 2XYGA 2O3TA 2CCGA 5F78A 4BO0A 2DCMA 4NDZA 4DZTA 4KACA 1H0HA 2JFBA 2P5TB 3HDYA 4QUIA 3RK1A 3SBEA 4IHJB 1GCOA 1HDYA 1RBZA 3AZQA 3K35A 1XKTA 1OD6A 2DRIA 2HFJA 2XMCA 2QL6A 2A33A 2C2OA 2E85A 3B6EA 3PQEA 3TECE 1H4SA 1JH9A 1PQUA 4G24A 3IR6A 3WMRA 2GT1A 3FPJA 2CDAA 3DDCA 3E5HA 4G4SP 2QTGA 1V26A 2YRFA 4H15A 4M54A 4KQWA 2VOEA 3GV0A 4AXBA 3VNSA 3U56A 2OOKA 4P84A 4ROSA 3I12A 2A88A 2Y9MB 3ASVA 2VWGA 3NB0A 4TLBA 2FKNA 2QL7A 4NENB 4MO2A 3WK7A 3RYHA 4L73A 4C1NA 2FB9A 1AGNA 4M9SA 4MHOA 3T3GA 4EG0A 3U31A 5JROA 4MDFA 4P53A 5B3JC 4ARIA 1VLMA 4HDOB 3PTAA 1T4MA 1ZM9A 4O4HB 2BFDA 3GLVA 1YZUA 1DUSA 1Q0UA 2O2YA 4LE0A 3TE7A 4CI0B 3HUEA 2FFBA 4DXAA 3HUUA 3SSMA 1T8RA 2VSXA 4V03A 1UWLA 1SBZA 3SC4A 4BNUA 5I7UA 5LOVF 1WBDA 2ZT5A 1Q0PA 3ANNA 3LW7A 4B7AA 4TT8A 5G1OA 3EPHA 1NVDA 4NLLA 1PFQA 4E6EA 1KEEA 5LA6B 2JIBA 2VRCD 2W58A 4IOMA 4KSBA 4UNPA 3U13A 1NRWA 1BDIA 1XDWA 4IDAA 4GD3Q 3H3XA 3IMFA 3QU4A 4XDYA 3ZV6A 4Q1EA 1N2CB 1O4VA 2J9FA 1UXGA 3FOFC 2HTEA 3KPJA 1D6JA 4G1VA 1R27A 2JGAA 3SWWA 5H3LA 3T3PB 3VI4B 1ZWLA 3HA2A 1E9DA 4L51A 5DYYA 3PHJA 1U4NA 4C7JA 5C7YA 5IASA 1V0JA 2BONA 4JYCA 3BA6A 3KB1A 4M0UA 1ZD4A 2FCAA 4HAOA 2W6ZA 2OKCA 3OT5A 1U8TA 1MABB 1K6XA 3AHJA 3C1TA 1X8XA 3KK0A 4KWHA 3ZYCA 4CM9D 4W5JA 1HX7A 4M21A 1LI5A 2JFNA 3OSZA 2A4MA 2QLNA 4LQCA 4YXWD 1C7ZA 4K86A 4RD2A 1T2FA 3OCYA 3UMBA 4NEHB 4B7CA 2EEPA 1ZGCA 2GN4A 5H1YA 2QT9A 1K7EB 3T3HA 5AFSA 3BQNB 3B3JA 2VZ0A 5H5JA 4YJ2F 5TRTA 4OL0A 1FFCA 4Q16A 5KTKA 1TQHA 3QXHA 1BHSA 1XHEA 2I8CA 2JLSA 4CXMA 2WJGA 3X3HA 1JAXA 4Q02A 1BC5A 4TTVA 2F1HA 3I01A 2RIPA 4DLYA 4ZI7B 3KHKA 2HW8A 1P9WA 2C5SA 4JXKA 1DO0A 4MV8A 1EXDA 3ANMA 4BV3A 4KFTA 3ONNA 1FMTA 3VYRB 2AYZA 1TFRA 4M6WB 5DXAA 4GUDA 2XJ4A 4M7OA 3S4YA 4DQVA 3RV3A 5TEWA 5JI2E 3FBTA 3EWAA 3HFSA 3V8BA 1VJGA 5THKA 5DX8A 1E2KA 3NJ4A 4LF9B 2I6SA 3ISVA 2ECKA 3K4PA 1QK5A 1TAGA 1Z5ZA 2I33A 3RJ5A 4AKGA 4TKMA 3T1YB 3AT1A 3F3SA 4RMGA 2W22A 4C0QC 4FU0A 3SDZA 5LNK1 1O87A 4K8RB 1DNPA 4FDVA 1B2LA 2DQSA 4KCGA 4QG7A 1P91A 1NKTA 1SC1A 1QZ3A 2B34A 2PPVA 3AV3A 3FDXA 3OT1B 3UQYS 1WOYA 4ZT5A 4CUJA 4R81A 2LIVA 5EJ9A 2EHDA 3FUVA 2RAVA 3OWOA 4XKJA 1GZ5A 3D7LA 5FUXA 5FPHA 2YXDA 4Q00A 1N2GA 4UPEA 4DM7A 1I80A 2P6RA 4C04A 1H1LB 2V55B 3U4IA 3ASZA 2PZLA 3B9BA 3U3OA 1T1EA 2JFUA 3ZU3A 3FOBA 1XX6A 3PNKA 5E6SB 4CODB 1A9TA 3OU7A 5HZHA 4IJMA 1XTSA 2JCSA 1W7AA 1DC4A 5IC5A 1DAHA 3G5TA 1UZNA 4MCJA 4ZVQA 4EB3A 4YAGA 5K0FA 1KP2A 4QM7A 1JIXA 3RRZA 4ZJPA 3B7WA 5LQDA 1KWGA 3F8WA 4C7VA 1L8LA 4ZYXA 3NU1A 5LQJA 2W2XA 1JJFA 2HJWA 4GWLA 2X0KA 3ZLJA 2FWJA 3QI7A 3CLTC 2IW3A 5HEKA 1E0AA 1A4IA 1HFWA 3BXEA 1E8MA 1GNVA 2YVQA 3H6KA 4D92A 4O29A 4EJ0A 2Z6VA 5AVXA 5A9SB 4KR3A 1U0JA 3FI0A 4IWXA 1E5QA 1I51A 3AVXA 3KAQA 3MWGA 2CN1A 5IRCD 1BVRA 3NPAA 4E1VA 1G16A 4FT2A 2XWQA 1HE2A 1X8KA 5K3DA 3OPMA 4KYIB 3EGDB 2G83A 1K08A 3UJHA 3VPHA 3ZJTA 2YWJA 3OZAA 4YN3A 3SC2A 3BTOA 2CDRA 1UPBA 1LLFA 4HTAA 4IYRA 4KR6A 2CV0A 3EMBA 1Y6ZA 4M0DA 3FCEA 4QJ5A 4WOBA 3VKWA 3WLKX 4DOMA 1DC6A 4KPEC 3ZIDA 1T8SA 4IAOA 4HP8A 1KJWA 1BOFA 3Q15C 4L4SA 4Q7LA 3T3MB 5J2UA 4PBSA 4BQQA 1RKVA 4YIKA 4BVHA 1DADA 1DEHA 2VSFA 4HAIA 4OQXA 4U4AA 2O2SA 1RWXA 4EUNA 2O8CB 3PIDA 3MMSA 5F73A 3KELA 4BVJA 2YOHA 2D8MA 1QB8A 2ZTLA 4PCLA 1Z0IA 1P2BA 3ONEA 5IVDA 1T9KA 2HL6A 3OQOA 4TPKA 4ZJYA 1K2WA 4L74A 4CPDA 1UBLS 1VSBA 3VU9A 4BRSA 4WXRA 2Z2KA 3LKZA 3TUIC 1Z17A 2M1XA 3TQFA 3PHCA 3UXMA 3KSRA 5I4BA 3PEWA 2EYUA 1CIJA 4LOJA 4AAYA 4NH0A 4B2IA 4H7KA 5KSOA 4HG2A 2OK8A 3HM9A 4CTNA 2R48A 2D1QA 1RJGA 3QOWA 5DIZA 5HNKA 4WINA 2YFQA 1CUYA 2AL7A 2W4IA 4ZO7A 5I9SA 4URFA 5KNBD 2QUJA 3H42B 1G7SA 1Z33A 4AUEA 3P4UA 3VR4A 2R6AA 2ZYWX 3QJ5A 4J7CA 4J0DA 3GCGA 1F2UB 3HI4A 2VPXA 1O5TA 1X1BA 3MCWA 2JLAA 2F62A 4YP1A 2NT3A 1VE9A 2PCLA 4V3CA 2BW0A 3SK0A 3FPLA 2AXPA 3I34X 5DBFA 2BSAA 4RJTA 2IU6A 4GPIB 1YA6A 1NUSA 1QIKA 5L7WA 3FUUA 3ZHCA 1I3OA 2R00C 4FZ3A 4P5DA 3I45A 3LYLA 1Q15A 3MWYW 3QMVA 1OC4A 2H2GA 3BC1A 1AUOA 5EZYF 3HJGA 2D5LA 2M1ZA 1ADGA 1E1MA 2QVBA 3N0VA 3NAZA 1SMKA 4TLAA 4R1OA 2GEBA 1CY1A 3QE2A 4AZ3B 4B48A 4W9MC 3SOPA 3LQQA 4PZPA 1D2HA 1JTFA 5BSGA 2DHEA 2QUIA 2ZEJA 1JDNA 5TF0A 1CDOA 1LBTA 4IIYA 4GZ6A 2GA9A 1ZUHA 2V74B 3AETB 3BBLA 3HKCA 3LP6A 3QEMA 4P22A 1F6BA 1G8SA 3ZCSA 1XCPA 3H1BA 3BMCA 5COQA 2FZLA 3ZNQA 1W44A 3T1TA 1KKLA 2XUQA 4P9NA 4WDQA 5HBRA 3R41A 3Q72A 1GPYA 4K7JA 3U7GA 3E35A 2XMSA 4RJLA 2NSLA 4IEEA 2OGUA 2GAOA 1W1UA 3HUDA 2ET6A 2BHSA 3AJ9A 3B3QA 3OPYI 4DRXB 4R68A 1XTIA 2IZ5A 4GHWA 2PA3A 3WO0A 4N8DA 4DUGA 1B8OA 4NSNA 3AEZA 3O1IC 5FA6A 3I23A 3QWIA 1FSFA 2NO1A 2P9CA 1KXZA 4XTRA 3TQSA 2PSSA 1BN7A 1G6HA 2FYTA 1JB9A 1M10A 3DT9A 3R4CA 1EUQA 2ANBA 1I7SB 4YRNA 5LZ9A 1JFSA 2JJQA 1XZNA 3BOSA 5BT8A 4D4IA 1BVYF 2JB9A 3GVPA 4MRRA 1BX1A 3OCJA 3OTGA 4Y30A 1R74A 1P75A 1ZGJA 2GR9A 4OFXA 4OYYA 3SICE 2MYPA 3BIWA 2XUOA 2H59A 4AMYA 1JF8A 3S2IA 5H16A 1XCLA 1OBHA 2HCRA 3OMXA 2J3IA 4M49A 1FDTA 1GR0A 3EC1A 3D5EA 3N7TA 4UQOA 4YRIA 5CB0A 2A9RA 4HX2A 1R0BA 4F45A 1OVGA 1QIFA 1NT2A 3CR8A 5KWVA 4I14A 4DANA 5H80A 3BRWA 5JH7A 4FYPA 4YAWA 2Z4RA 5H3CA 4BRZA 1I5OA 3LK7A 4RVCA 3RKRA 2EKBA 3SHTA 1OB5A 1DPGA 3DEKA 4AYXA 4MV3A 4RH0A 4XVUA 2R86A 1E2UA 1U9YA 2JD1A 3LQFA 1RQ7A 3FLEA 4P7BA 5D85A 1N8TA 2ZJZA 1VMAA 4QPPA 5TNXA 3JWEA 3EG5A 3RU3A 5CBKA 5K0BA 1E1QA 3OLWA 4ZT7A 1GGFA 6GPBA 1Z6QA 2CLSA 1XJCA 2CUNA 2WSSD 2H8KA 4P3NA 2Z09A 1QPGA 2O0JA 4J6EA 1SEVA 2D1YA 1BSVA 3ICCA 4NMHA 3W2EA 1PR5A 3WLSA 4COOA 2YW9A 1E2BA 3KL4A 2AN9A 3EGCA 4I1SA 2VQDA 2OORA 3DQPA 5D8DA 1T0PA 2GJAA 3N8HA 1COZA 4DV5B 3AF1A 3MJFA 3B3FA 2HM7A 1C50A 2NQ2C 3TLGB 4B3HA 4BLQA 4HTFB 4DLAA 1ZZEA 3HU2A 3LZ6A 4IZOA 1DLJA 4BO6A 2X4LA 4O0LA 1XBTA 2ORWA 4G5SA 5CD1A 5IPFA 1OX4A 2PK3A 2RK3A 2VH5R 3Q10A 3ERCA 1FOEB 4G1BA 1H22A 3CSDA 3DZJA 4QJIA 4GIBA 1KSFX 3Q2IA 4GRAA 4CLOB 1GAJA 4EA6A 2HV8A 4W5TA 1UOPA 4U7DA 1TAQA 5JZ9A 1GSHA 2YYZA 3L93A 1NVUQ 2RGAA 2Y6VA 2ZIEA 3LGXA 3QVXA 3UCFA 4O4IF 4EM6A 1L7MA 4YPOA 5THQA 2VXCA 1KIAA 3RG2A 3PKJA 1VLZA 3GQVA 3GFTA 1UIRA 2IYZA 3I9NA 1EBFA 4I19A 2ZANA 1I36A 1HK7A 5CHYA 3T5CA 4B17A 4NV0A 3S27A 4CF6A 2HIGA 3UKDA 3E03A 4D3DA 4F4IA 2MCFA 5KSZA 5F3WB 4HBZA 3ES9A 4DLKA 2RGCA 4OV6B 5AKKA 1CXZA 2NO9A 2C3UA 4KVFA 1H2YA 4BN5A 1G9TA 2HDOA 1IN6A 3D7NA 3FYCA 5LP6A 1IJEA 2NACA 1JIKA 3JR3A 1ZHFA 4FYXA 4XB6B 3OTHA 5KKNB 3EVCA 3R6TA 1XMXA 2GRUA 3IQHX 3O1JC 3TS1A 2Y2VA 1IEWA 1RZVA 3COWA 4IQ4A 1KHHA 2QOEA 2VDPB 5K0LA 4MGKR 3MJVA 3NNSA 3QPCA 4WZBE 5AUQA 4KOEC 4ATNA 3ABSB 3IQEA 2V54A 3RVOA 2UUCB 4KNYA 1B1AA 3LA6A 2AOTA 5GJBA 1GCGA 4ENQA 3DVSX 4JJ7A 4C88A 2ZB7A 3GNSA 4MUEA 5DOVA 4DR5B 3A3YA 5BO5A 4L5AA 2Q6IA 2R8RA 2H48A 5DXJA 4ARZA 2Q4TA 4MUFA 2UVDA 1PWYE 3D3WA 1Y1TA 1U0BB 1TT5A 2PSEA 3BSYA 4FGZA 4MJ7A 4B4KA 1JNYA 1BU5A 3BUSA 4QOHA 5JASA 3AF4A 1EFLA 2KQUA 4J75A 4Y6GB 5HS4A 4IIUA 1CEQA 4HPXB 2FEAA 1Q0LA 1H9CA 1H69A 1AO0A 1XTBA 3B6KA 2Z5FA 1SHLA 2O57A 4KREA 3HDTA 2PGXA 5AOCA 4DWWA 1S4QA 3K0SA 1WB4A 5ALPA 5BW8A 2HMUA 3LOPA 3PJDA 3O8OA 1Z0JA 2XNDA 4U39A 4URUR 4EOGA 2VTVA 3LDUA 2JLUA 2J0UA 1DBIA 1KPGA 1PAUA 1UZLA 2WAMA 3B1ZA 3L8YA 1ZCJA 4LIPD 1P7CA 2UDPA 3MB5A 3VJKA 4PLGA 2VJMA 2W2MA 4DMGA 5DK4A 1BKDR 1UC8A 1UCFA 2HA2A 2YNMC 4H3HB 3RS8A 1GNLA 2I3BA 1P29A 2VN8A 1OWMA 4S1VA 4ACBA 2IUTA 3PF8A 4P4TA 3IIKA 3O1HB 4Q4AB 5DYGA 2W2KB 3IB6A 1O95C 1CR1A 1N6IA 1W8IA 2ONKA 4HNAB 5IAOA 4ZYTA 3FJ1A 3PNMA 4K3VA 1WPRA 3KNZA 3ILXA 1OT3A 4L16A 5F33A 2WZBA 5NULA 4PAQA 4H6XA 3THYB 2H65A 2VYQA 1P17A 3NIDB 1W46A 2DT8A 4UNSA 2VHVA 3W4KA 3BWVA 3G7UA 1XTTA 2AX4A 4JU8A 4HRXA 4ZHQA 4MVJI 5FOXA 1L5OA 5HG0A 5B64A 3FDFA 4AQDA 3BWEA 2BGKA 1PI3A 2Z1MA 1PE0A 1SQSA 2C4UA 2ZOSA 4WLEA 3ZX5A 4LTNA 3CVOA 3N0XA 3NONA 3A9UA 1ZESA 1V8OA 3GJ0A 2K2QB 1E2NA 1ZKDA 4MW9A 5B36A 3UGTA 2UXCB 1OAKA 2ORIA 2DKNA 5TVKA 3AG5A 4LGMA 3ZZ0A 4UCWA 2XDWA 2YMQA 3WFZA 2HK9A 3NGMA 2G1AA 2X76A 2W4MA 4I1RA 2I67A 3NPMA 4IFEA 4RJIA 1XCGB 3W4JA 2I3GA 2VK8A 5DMXA 3MAJA 2PM8A 2VF5X 3E23A 4KX3A 5HWSA 4WI1A 1A50B 3SN6A 1H3EA 1OH7A 3EXAA 4KG7A 5K3FB 1C4KA 1XP8A 5IH7A 2ZBVA 2YIDA 1KTVA 4M55A 2X8AA 1PJRA 1M54A 4YEDA 1QQAA 1CQZA 1IOZA 4XCQA 1F5NA 3G5MA 2J6IA 3ZXIA 4RABA 3D54D 3KC2A 5GIOE 3R3XA 4U8HA 4D9NA 1ZD8A 2ODBA 5IDWA 2PY6A 1H2FA 4GXNA 3GZNB 1IDOA 4IIJB 3CWCA 5FOWA 4DN6A 4H17A 2G5GX 1NJSA 3BORA 5C8VA 1RTKA 1QM5A 4F3KA 2PH5A 1E6UA 4TS3A 3T3DA 3UOAB 1RT9A 3LD9A 1Z15A 2R8OA 3OY2A 1QH1B 4WJZA 5FPPA 2WUWE 1ODSA 2WWFA 3PC8C 1IPFA 2BCJQ 4KE6A 1QE3A 4M0PA 3WK9A 4OKSA 3HWWA 3WYGA 4ZC8A 2XMGA 3RUDA 4N03A 4ZAGA 4CGZA 3IHLA 4OX9Y 2H07A 1H2XA 2FDXA 3QH4A 4OATA 5HK8A 3R8XA 3MAGA 4IRXA 4KMMA 1XHFA 5DHUA 4HAXA 2CKMA 3CB2A 3LWNA 4FGSA 1NUPA 2XF8A 1W581 1XZBA 3CF0A 4HS9A 3GLQA 1OYVA 1P4SA 1QOZA 1EZ1A 3L0BA 3C6QA 5AI6A 1E7MA 3A1DA 1H6CA 4PO9A 5D7BA 4IJ6A 3V46A 1YZHA 3WXMA 5JATA 2O7RA 1YZGA 4C30A 3T7AA 4KPYA 1RYHA 2MDTA 3K1TA 4IHJA 4JR1A 5EEGA 1SBYA 3UWMA 1AH2A 3TRIA 4D9KA 4XCVA 3WYDA 5A4KA 3IERA 2PSDA 1NC1A 5IJXA 3QA9A 1U4OA 4PSVA 3WISA 4EB6A 1GL9B 1AKUA 2DR2A 3K09C 3PX3A 2KW5A 1Q92A 3R77A 3TD9A 4YMWA 3GFVA 3I61A 3CRZA 1XZGA 4MEJA 2HWXA 3IPRA 1JIVA 3TAUA 3O2QB 4NENA 4WLVA 3EGOA 5EXTA 1A71A 5CJPA 5EHNA 4UUAA 3RS3A 1XTQA 1LLCA 4DYVA 1M0SA 4R7GA 1WCYA 3E6AA 2WTNA 2TMYA 3JQAB 2AEFA 4OHFA 1KH3A 3HBAA 1MZPA 1EWRA 2XAAA 4EI7A 2QY9A 1PU2A 3HCNA 1GG5A 5AWFC 3KJGA 3R3SA 2FVYA 2I7DA 2QA5A 3FOWA 4KQFA 2WHQA 1MAAA 5T8KA 3UMYA 3I1FA 3R40A 1FTYA 2GPWA 2B98A 1XIVA 3FDJA 4RDIA 2ZYSA 3WLRA 3E15A 1A5SB 3DDHA 3SC6A 4CM4A 2NXNA 5BUQA 5ADHA 2GXUA 1N2CA 3WGZA 1W5FA 3CUUA 4WLOA 2WJVA 2GHTA 5I8WA 3G68A 3DSRA 4FKBA 4DIDA 4G89A 4O4LA 5IJ9A 2AXQA 1KF0A 4KBFA 3ZY4A 4K3UA 3UWDA 5G53C 3VZBA 1NXOA 2PU7A 5JNVA 1N5JA 2EX1A 2WA2A 1VJDA 1XZ8A 2AZ4A 2PBRA 2YNMA 1IL0A 3GGOA 2X1HA 2Y05A 3IKMB 3M5WA 4S2UA 3TMAA 4AVYA 2OV6A 1EUYA 3ZLBA 4CNQA 1CCWA 3AVYA 1EP9A 4ZOBA 1R0YA 1O95A 2JLBA 4XYBA 4BKUA 4YT2A 5KVSA 5EMJA 3FKQA 4YJFB 3PUWA 2YN4A 3V34A 3KAKA 4M7PA 5JSHA 1AZTA 3I0ZA 1YR2A 1OMOA 3BWYA 2WTMA 2I7VA 3Q3GE 5ALJA 3SE7A 4GC9A 2I87A 4BFXA 5H70A 2FN4A 1E99A 1Z2EA 1P9LA 5IP5A 1VSVA 3R5XA 1YOVB 5BT9A 2J3LA 4I1VA 4R41A 2HHHB 2PEYA 2JCXA 3VVCA 5KC8A 1XG5A 1QF6A 1WY5A 1QZUA 1WLSA 2NZJA 3D1LA 2YKGA 1UC9A 1CZUA 2N0SA 1FP6A 3IHKA 4J1NA 4KVAA 1YQQA 2CHUA 2JL1A 4N0QA 4PYMA 4ZI7A 2IELA 1SBNE 1G3QA 3DTYA 5EUMA 3SHOA 3PXDA 4FYYA 2MYTA 2D0PB 5KCZA 1OHHD 2I7XA 4JASB 5EJIA 3R9WA 2GYUA 4E32A 1V3VA 4RHXA 3OJCA 5I7HA 2OB2A 2E1RA 4P6VF 2FGKA 2HBQA 3QFFA 2J45A 2PYZA 2IH4A 4RD0A 5TQ0B 2HRCA 3EAFA 3AR8A 2MSCB 2Y1WA 3DVQX 3RS4A 4DGSA 3WYFA 1QYIA 2ZGVA 3TTYA 4RPIA 5GQSA 2VDOB 2JAWA 1OFHA 1II0A 3N59A 2X9VA 2QMQA 2DPHA 2M6LA 4L5YA 5K6AA 2HZBA 3DAOA 5E9QA 1HWYA 2QX8A 5D3MA 5SV2A 1H1LA 4KO2S 4MVJP 4BRWA 1E6EA 5F98A 2I9PA 2QGZA 4HWOA 2ZI5A 2ZULA 1W0KD 5DEOA 4Q4CA 1JR2A 1FS5A 1GG8A 2H29A 2P6OA 2UZ0A 3GLKA 4MVWA 4RAOA 1BA2A 5G1NA 1XA3A 5U1PA 4EHNA 3LHIA 5TC4A 4N01A 3TD6A 3U60B 3G2HA 1J5EB 2OESA 3GPCA 5P8WA 5KVVA 3CYFA 3HNOA 1CBUA 3ZWXA 1U9JA 2WKPA 3H83A 3UJCA 4JJGA 3OMLA 1KY5A 1P4RA 2F2TA 3A3NA 1H8HA 1NZJA 1U5BB 4NTZA 4D4KA 5K2OA 1LPPA 2B8TA 3JZDA 2VP3A 1P0QA 1CQWA 1DS6A 1T3GA 2VAPA 1T2AA 4HUQA 4QDUA 3TGWA 4F3YA 3FHTA 1PX0A 4CF7A 1J8YF 1HDCA 3K0KA 3L1UA 1F1JA 2QZSA 4IOKA 2SKCA 2Q3DA 3DGFC 3OHSX 3CV3A 1O6FA 5KOHA 3SEZA 4LWQA 3GMSA 3S8YA 2YZKA 5BPFA 5CEFA 2Z98A 3CUYA 3NAMA 2RKWA 2IYPA 5AJXA 5AW0A 4AXXA 2K87A 1KBOA 4FPXA 3JRNA 2V0GA 2FXIA 3ZHZA 5EZQA 4HQNA 3ZNPA 1C3JA 5FP0A 3UMFA 1Y33E 2LR0A 1XL1A 1WB9A 3OO1A 1PR6A 4HMPA 1AOXA 2YOGA 4HZUA 1REQB 2X40A 4OLAA 3LDFA 1YI1A 3VZQA 2A2ZA 1E5DA 3ETLA 3NEPX 2J0VA 1G7TA 3HM2A 3GGCA 4IV5A 4KKXB 3FSGA 1LW7A 4B87A 3IQIX 3O95A 4HOYA 4CQMB 3IPLA 2YHBA 5F7JA 4HQFA 1URPA 4J3FA 1LPBB 4EHIA 5LWHA 3U81A 1FY2A 4X3CA 1LUAA 3LUJA 3SX0A 1I30A 3K5WA 2O0LA 1AV7A 2Q2NA 3TEFA 1RR6A 3BWXA 1PK8A 4MUKA 2CZCA 3ZNOA 4XRRA 2NX2A 4FCCA 2A7QA 2FR8A 3BWBA 3FIJA 3WLFA 3L1VA 1UBKS 1V4BA 4KN9S 5DGHA 1ZW6A 3SHQA 5HIKA 1T6BY 1VKNA 4KK3A 1F2UA 3HO1A 2W2NA 2QN6A 1B41A 1QYXA 2OAP1 2XMBA 3KEFA 4FLEA 3HRIA 4F5ZA 1I7QB 4PYRA 5GONF 1UBSB 2DLNA 4A73A 2LW7A 3CY6A 3CN7A 2FSVC 4H7EA 1XNJA 4HXEB 4MTCA 3DXXA 1JHOA 3E5MA 3ONDA 4KAXA 1VCOA 2RH8A 3C1OA 3R6LA 4QHTA 2AIRA 3TEJA 3M1YA 3TSOA 4A92A 2KX7A 1THGA 2QVXX 3OCWA 3YASA 1ZSVA 4BB6A 5KMGB 1RYZA 1PZNA 3IPYA 3OG9A 3SGLA 1PEKE 2ZSIA 4AZ3A 4E33A 4RNCA 1ECBA 3CCCA 3FHJA 3HLYA 3Q5EA 4MB2A 3OZXA 3ZXUB 4EITA 5IWAB 2V9PA 5CVVA 2VNIA 1AC5A 1I5RA 4NBWA 5ES4B 3LECA 1IHUA 1UBTS 3V7UA 4CL2A 2B4QA 1BO6A 1N7HA 1OIWA 2JKZA 3AETA 3WLLA 3JS5A 4EMBA 5JY6A 1XRJA 1CLUA 1OWOA 4LBYA 4XVHA 2DF8A 1VIMA 1N92A 1ZOPA 5EE3A 5BUZA 4RHEA 3EXG2 4NXMB 3I62A 4NVRA 1D4ZA 4GXQA 4QUBA 1NJ6A 1TLFA 2XRFA 2D2VA 2YWBA 3F96A 5ANRB 3L5KA 3TNFA 4E07A 4O3FA 1FJXA 4Y9RA 1KZGB 3FJYA 5ETJA 1BXGB 1CQIA 3F6CA 5BYAA 2DR0A 3KM0A 1EG7A 1PW7A 3E3NA 2YWGA 3PZRA 4S12A 2B78A 4M86A 1T9GS 2XQGA 1XQWA 3DZCA 2QSZA 1E4YA 2WFMA 3USES 5A04A 3CRRA 1NW4A 4NU0A 4C0BA 3IUQA 4XUDA 5C35A 3JSXA 1A3CA 2R751 3W90A 5I7AA 1P31A 1UK9A 2L42A 2AJCA 4G1FA 4RZHA 4GL4A 1Y34E 4Y67A 4F5WA 1THTA 1H85A 4QDOA 2ZWPA 3VH2A 1GQQA 2AQ8A 1DXQA 2A7XA 3GIDA 2XTMA 1ZJYA 4NJMB 1TYEB 4TMVA 4B3JA 3SZMA 1DIOB 2QQ0A 3PWKA 2Q1YA 2Z6QA 1ZCZA 3K05A 5CT5A 3ABQB 1YBAA 5DE3A 4ZODA 3RODA 2EJBA 2QENA 1F7VA 5G0SA 4R05A 3Q7TA 1A7AA 1Z6YA 4LZAA 4PV7A 4QDZA 1WB6A 3TVTA 4DDKA 4EVSA 1RRKA 2R8PA 1N0UA 3BM5A 5AK4A 1IZYA 1O7JA 1Z9BA 4AWBA 3ZY3A 4B6FA 3EIQA 3TLYA 5IXYA 2IEAA 4FI3C 13PKA 4O5OA 3CZQA 1COWD 2QV0A 3OPYB 3B36A 2BI4A 2PT5A 1Z5OA 1QU3A 3DO6A 1C7IA 2G88A 1TD9A 5CCEA 1JT2A 1KQ3A 1QH8B 3H6GA 2HSGA 1A96A 3OUZA 4RF4A 2Q99A 2FH5B 2XBUA 4A4DA 2GJ4A 4ALNA 3WNZA 4ECAA 1BVHA 3GLSA 1O3YA 4WOKA 1EJ6A 4FFRA 3TLGA 1W2WB 3THWB 2ZAGA 3EBOA 3I9OA 4HTFA 2KMLA 2ORYA 4QHYA 2VRNA 1WMAA 3C24A 1N6RA 1K0FA 3R24A 3SZ3A 3C8UA 1DAMA 3PLRA 5FLXA 1GCAA 3AR6A 1SD1A 2CV2A 1N57A 1GPJA 3OZCA 3HO6A 3L1KA 1A8UA 1J7KA 5BSUA 2DHRA 3OIYA 1NQWA 5ERYA 1BCSA 3JXEA 2ACKA 2OCXA 5FBHA 1RPTA 3LOUA 2LDBA 3P0IA 1UFKA 1V8ZA 1RRCA 5EWJB 4JT4A 4OAOA 1RYNA 2YMMA 4FXPA 4QQ8A 2GM5A 1LPNA 3VGPA 2CBXA 1O5IA 3ZWMA 1PJZA 2DJIA 2GILA 4R16A 3LBFA 3ER6A 2OCKA 4IHAA 2OFFA 3W2GA 5IHXA 5FBVB 2UYYA 3GJ3A 4PCAA 3TQCA 2ZM5A 1YU6A 1NT4A 5C8DA 4GC5A 1QYWA 2ZYHA 4RQTA 3IUPA 1LK5A 3CIOA 2VK4A 3V9PA 2ZZKA 2R1VB 3WLEA 1NJ2A 2VQ6A 4LXTA 4UARA 2VR1A 2W2TA 3PJFA 4R9UC 5B2EA 1MW8X 4FHFA 1FNDA 1RCFA 4EW3A 5E6UB 2MMCA 2HB6A 3AIOA 2IZ6A 4N7BA 1EQAA 2CMKA 2QJFA 3HVHA 4ND7A 2XDYA 4CT0A 1R0CA 3X1KA 3DDOA 3P2MA 3HJUA 3RHZA 3BQMB 5DBHX 2ZRKA 1RCUA 5KJCA 1YS1X 5EYPB 3D43A 4JT8A 3PNLA 2NUTB 3C3MA 1CTQA 1OIXA 4CLRB 3B2EA 4HDQB 2JLZA 3KKOA 1FC0A 1IXKA 4BQIA 3ANLA 2AOVA 4OP3A 4U7PB 3DOCA 2A59A 4Z1MA 2DUMA 2C9MA 1GITA 2Q0HA 4M2LA 1J20A 1UM9B 1Z0DA 2EWWA 1UBOS 5K8VA 3EZ6A 5KJFA 1NVXQ 4E09A 1G8AA 3FYTA 1CS4C 4CV1A 1G8HA 4I08A 4N3CA 2BKLA 1ZLXA 1Q7GA 3FW1A 1K27A 1T8WA 3IAXA 2QRKA 2AB0A 1FYEA 2XGMA 2ZYRA 4Z4CA 1JKJA 1XYGA 2FUEA 4JJAA 4KFRA 4ITUA 3E7WA 5IT5A 1Y89A 4CKBA 4V0KA 3RJTA 5GJCA 5CLQA 2WYHA 3AKEA 2A57A 5J2TB 4FYVA 4HLQB 4CEHA 5I9MA 2ZZMA 4AY2A 2GYWA 2NSJA 4FBMA 1J6UA 2Q6KA 3EA0A 4BMCA 2L82A 3E22B 3HR8A 1W34A 2A5JA 3HN7A 1NUTA 1S9HA 1DAEA 1ADYA 4TWIA 5IS2A 3NAQA 3TOCA 5ALVA 1XEAA 1H9AA 5K3SA 5BWCA 1Q77A 2XA2A 3QUCA 3GG9A 4LZOA 5KYUB 1NBEA 3SYNA 5KZMB 1PTJA 3GBSA 1F60A 3GLHE 2V3VA 3L7OA 3MF4A 1J8VA 4H60A 4XPIB 5IBRA 2IWHA 3W5CA 2HXYA 1IM2A 1AN0A 1U28C 1PEYA 3SJBA 3DXFA 3DYBA 2WSBA 2OBLA 2EFGA 1CF2O 4PEVA 3WOVA 5D5PA 3HFRA 3VO9A 4WGFA 4M8LA 4W8HA 1V95A 3BGOS 1U3VA 4TKLA 4X7BA 4P7GA 4D8TA 2AD1A 1WW3A 4LK3A 3OAAA 4GNKA 1Z4MA 4MVYA 5JSFA 3UCEA 1EBUA 4JNKA 1HZZC 5J4VA 1OILA 4JVOA 4G0NA 4EA9A 2FX2A 3WWYA 4Y0NA 2L19A 1V71A 4P86A 2Q7XA 5T3UA 3SY8A 4M1KA 1X77A 4XUCA 1Y9AA 5BOVA 4MQLA 2GZMA 2ALJA 3FTNA 2R6HA 3G82C 5FTLA 2B2CA 4UBOA 4R2JA 3GJ5A 5D3ZA 4GFDA 4ZV7A 3VNVA 1Z7GA 2PGDA 1N6NA 2FMXA 1GZ4A 3SS7X 4TMYA 4ZN6A 4YCAA 2Q8PA 1ORVA 4B5LA 1P9OA 5FI0B 3ZKAA 1HNZB 4PZCA 3V1LA 2XD4A 2CLMB 5EWLA 2HRQA 3GRFA 5FR2A 1W73A 4BO9A 5BWBA 4G25A 3VR6D 4M9ZA 2D2XA 3S5JA 3NFYA 3CT4A 1QH1A 4R54A 2Q45A 2VH2A 2C5BA 1S6YA 3SF0A 4G0OA 1ZSNA 2J30A 1S2NA 2ZDQA 3C8ZA 4W6QA 3PTZA