2ZI5A

C4s dck variant of dck in complex with l-da+udp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
219
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 219
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi5A00
1VHLA 4FI3C 4DLRA 1N6LA 2QG6A 3W3ZB 2DPXA 2REXB 3ND8A 1BOFA 1OXVA 4P32A 1ZNZA 4FWIB 4CEHA 1ZINA 3I32A 3MWJA 1YZUA 3ZVRA 3TSOA 3NEYA 1S0UA 4EDHA 2RKOA 2YOHA 5HCNA 5C1BA 4RCZA 4EFLA 1A4RA 1NVXQ 5J47A 1G8PA 5D3MB 4HLQB 4JL6A 5JI3E 2ZJAA 3TBKA 2OILA 3GEHA 4JLKA 4LOAA 2AD1A 4TT3D 5LPNA 5JJIA 1KJZA 2ZREA 1XTSA 2ZE7A 2CCGA 4LJ5A 3UKDA 4Q1BA 4DUGA 5BQ5A 4BWYA 3GJ4A 4LJ4A 3R20A 121PA 1KDRA 5JJKA 1TUIA 4HUQA 3TAHA 4Q4JB 2QMUA 4LBWA 1EFUA 2JLSA 3EZFA 4WVFA 5E7JA 4PPNA 1X8JA 5EQTA 4IDPA 1XTQA 3LVRE 1KK0A 3AP1A 3OZXA 5JHHB 3HDTA 3PUXA 4FN5A 3ZIAA 4B33A 3PUWA 1XEFA 1XMSA 4IXNA 3SU8A 1EGAA 1JXOA 4R7ZA 4Q9KA 3SOPA 1JBKA 3KJIA 1E98A 4OQFA 2REOA 4F4IA 2H57A 2JLQA 3QKUA 1R5BA 1IJFA 1T8UA 4E03A 5IK2D 1N25A 4C2UA 1GOTA 3WY9A 1G8GA 1RE0A 2ZJ5A 3JVVA 2WHXA 3CPHA 4TMXA 3K70C 3SNHA 2IHYA 2RHDA 3UIEA 5AUPB 2Q3HA 3DPUA 2FPLA 3U3JA 2YWEA 3TUZC 3DO6A 4G5OA 2HXSA 4I1VA 2PL3A 2QZ4A 2O0KA 1VTKA 4B71A 2UZIR 3KL4A 3UATA 4A2PA 2RH5A 4YDHB 4IOJA 4URXR 3B9QA 2AFIE 3A1TA 4KSBA 5F3WB 1W2HA 3WXMA 2B8TA 4R2IA 4NYMR 3PEWA 1DVRA 5C4GB 2Z5FA 1WA5A 1T5IA 1IM2A 4Q1FA 1XTKA 4GT1A 2VA8A 3EZ9A 1XU4A 2IYSA 4QJ4A 1AKEA 2WJHA 4WXRA 1NJGA 2Z4RA 1YRBA 2N42A 3MAAC 4RD2A 4YQFA 3SZRA 2AL7A 3I62A 2NO1A 2ZE8A 2CXXA 2HT6A 2ZITA 1XPUA 2C03A 2R8RA 4V0KA 4DDTA 1G4UR 4Z1MA 1CU1A 2PT5A 2D62A 2G9NA 3O8CA 1ZC3A 2ASEA 3T06B 3RRZA 5GJBA 2A5DA 1HE8B 2C04A 4ZIRA 2CMKA 1Z8FA 4LJ7A 4NBSA 5AUNB 1MR3F 1TQDA 3JZAA 5C2JB 3RRYA 1IY0A 1XJ0A 2H7VA 4ERNA 2P3SA 4C0AC 4C7OB 4NU0A 4QM7A 3FHCB 1DAIA 3CKLA 4TLCA 2IWHA 5FL3A 4P4UA 4ILEA 5FUVA 4PPFA 1W36D 4MDEA 1OPXA 2KI5A 3A1UA 4M9ZA 4TQ9A 2OFWA 4NCKA 2X2FA 2L0XA 3AF1A 3BERA 4QHSA 1TQ4A 1CJMA 2PBRA 1EG7A 3A37A 3FDIA 2O8DA 2P65A 1JEDA 1PZNA 2WSSA 3VKWA 2RGAA 3K9NA 1R10A 1Z07A 1XTIA 4L9SA 1XXHE 3QF4A 4D25A 2H16A 2YJTD 3QUSA 4NE2A 4PO9A 4GL2A 4FMCB 4OHXA 4Q18A 4LJ6A 1OHHA 2QRZA 2FEMA 3SJBA 2W0SA 3FMOB 5JSZA 3GJXC 4RFSA 3B8HA 3OESA 4LBZA 5E3HA 2CL7X 2QENA 3A58B 3CBQA 2HLDA 2G77B 2GJKA 2IYLD 1E2PA 1ESNA 3SYNA 4FW9A 4UKDA 1CRQA 4AG5A 6Q21A 1GRQA 1E32A 4NCHA 3VNUA 5FTMA 5FH9A 1Q20A 4A6XA 2YOGA 1FL9A 3CB4A 1A2BA 2C99A 4GP6A 2J0SA 4US1R 3AVOA 4IFBA 4XTCS 1C9KA 1DOAA 2VSOA 1SGWA 2F9MA 4D4KA 4K46A 1OT3A 2JDID 5TY0A 1IY1A 2XJ9A 3RNLA 4BEJA 1WP9A 2GBLC 3Q85A 3EZ7A 1DARA 3WYAA 4B3CA 4A36A 1VCOA 3NHBA 2G83A 1W0KA 2QN6A 1F60A 3QENA 2H17A 1EFRD 4TYNA 3X1DA 1X3SA 3IEUA 2IS6A 2BV3A 4R71A 5K8IA 1GILA 2HDNB 1YJ5A 2VIIA 2ZR0A 3Q5DA 2EYQA 4DSNA 1D9XA 2CVFA 2ORVA 2A2ZA 1E2JA 3PENA 3UANA 2VPPA 3TH5A 5JECA 1ZD9A 1DAEA 1IN5A 5ELXA 4MDFA 2IW3A 2OO7A 4TLDA 5CLLA 2N46A 2ZU6A 1OIVA 4BEBA 4A82A 2DWOA 1E0KA 3EIHA 5IHPA 4QNRA 2QT1A 1GITA 1GP2A 3NC1C 1E9DA 4J0QA 3U3KA 3A6PC 1UBFA 2VHUA 2XZPA 4BLPA 1A7JA 3U6BA 1G9XA 3F5FA 2WICA 2RHMA 4URWR 3SJCA 1W46A 1YZKA 4TMVA 4DLWA 2ERXA 2ODWA 2XITA 3CPJB 3CUEF 3ZQJA 1IXRC 2D3WA 1XJCA 3VR6A 3VR2A 4XIGS 1KAOA 1HA3A 4M9XA 4HDOB 2J87A 5CK5A 4QJ5A 1EWQA 2ZI6A 3TSWA 4B3GA 3CH5A 1FQJA 5E4FA 5CM8B 3SQWA 4OI0A 3V00A 2J45A 3TLXA 5L3SA 2PJRA 3W6OA 1H8ED 3PG5A 2ZSFA 2GJ9A 3D6TB 1OSNA 2VP0A 1SVWA 1CULC 2J7PA 4W5HA 3QY0A 2EYUA 1R0WA 1KK3A 2GAAA 1VDZA 4Q9IA 3MWLA 3WBJA 1RIFA 3C5HA 4BFXA 3FPAA 1E2DA 1LVGA 2WWGA 2FH5B 1P61B 2GEVA 4TSFA 1AZSC 3AUXA 1GKIA 4AKHA 2ZUDA 2WWWA 4W9MC 2BMDA 4I81A 4S2EA 1U8AA 1XTRA 1G7TA 1O3YA 1E2EA 2ZAMA 2W58A 3R7WB 5J4LA 2F3RA 5AUQA 4OJKA 3FMIA 3QIAA 2CNWD 3OE7A 5FBVB 3QG5A 2XNSA 2OCPA 3GFTA 1QHHA 3RANA 2AD5A 3IBYA 4PFSA 2OHFA 2IYYA 2WOOA 1Y63A 1OW3B 1IXSB 3AF2A 4POAA 2PJZA 3NEJA 3Q72A 1W4CA 1VIYA 4R9UC 1NY6A 4O2RA 4I1SA 4D81A 3SBDA 4RVCA 4F93B 3OAAA 3RYTC 1WXQA 3TSZA 2ZETA 3S1AA 2BVNA 3U4QB 1OE0A 4JL8A 4V0ME 2MMGA 4GBMA 5CM9C 3GJ0A 4IDHA 4KFRA 3BORA 3DOEA 3W90A 1UKEA 2IUSA 1E2MA 3BE4A 1KI3A 4NYIR 4LC1A 5H8WA 1FPMA 1KJWA 5J5CA 2GCNA 3L0PA 2D2EA 3RS4A 4P4SB 2ZRBA 3GPLA 2QPOA 1NSFA 2FSFA 2J1LA 2QUZA 4CF7A 2OT3B 2W83A 5FPHA 2W6IA 5DYIA 1N0UA 3NDBB 3P20A 3H2YA 1U98A 1Z2AA 2QBYA 4RD0A 2IEZA 2ZRLA 2JLUA 2GZAA 1IXZA 4LYFA 4NYMQ 1WDTA 2ZRCA 2F1JA 2VHCA 4Q5IA 2IF0A 5JCPA 4A8JB 4PC2A 4BECA 2HXYA 8OHMA 3BJIC 5JFGA 1XEXA 4X8OA 4JLOA 2VL7A 4OYHA 4BUJA 3TQFA 1GKUB 4IOLA 5BN3A 3VKGA 1RRCA 5CB8A 4N1AA 1Z2CA 2X1VA 2FJUA 2QQ0A 1OLOA 2WZQA 3DZDA 5FOSA 1D2EA 2IBMA 3A8TA 4YMUA 1UJ2A 4TMKA 1ZCBA 2FZ4A 4C30A 4DLXA 2QP3A 4Q4HA 3AVWA 3W8NA 1XD2A 2BM1A 2ZS9A 1XCGB 3OIYA 1ANKA 3AVYA 4KAXA 3FE2A 4EPVA 1W7AA 4DXAA 5FOTA 5JLJA 5KSPA 2BM0A 4EPRA 3TUJC 3RDPA 4DJTA 5J4YA 2O8EB 2XGJA 1ZNWA 2BBSA 3H86A 1OFTA 1J7KA 4DEYA 4C3ZA 2KSQA 2IYUA 3HP1A 4R2HA 5IDVA 2V54A 3B5JA 1ZNYA 4A8JC 2JATA 2PX0A 3VTKA 1M7BA 3C15C 3E1SA 3K0AA 1WF3A 3WMGA 2DCUA 1DE0A 3B9PA 4HLUA 1GL7A 4MKHA 1KO5A 1L4YA 4EQ6A 3UPUA 3NKVA 2ZJ8A 3BH0A 1OFIA 1U0LA 1OXUA 2V6JA 3HR7A 3B1XA 1Z28A 4LGMA 1DG1G 2OBMA 3MGCA 4M1WA 1DAHA 4TL7A 3ZVMA 1U9IC 1P6XA 5EXXA 3LQRA 1S1MA 1P62B 1XEWX 5EXSA 4C0LA 4URVR 1SKYE 4II7A 4IOMA 3AF4A 5G3ZA 2AKAB 2YWHA 4B3BA 2XZLA 1Z0FA 3P4YA 1JR3E 4OK6A 1Q3TA 5EJEA 1TX4B 4KSCA 3VX4A 1S3GA 3I3SR 1F3OA 3QKSA 4RD1A 4UNQA 4A0HA 5JRJA 5GVSA 4DB4A 4HDQB 1N5LA 1QZXA 2CJWA 3GJ6A 2GCOB 3T35A 1ZW6A 3O8RA 4A9AA 5DO9A 4Y0AA 4QGAA 1G6HA 2OV2A 1ZUHA 1FUKA 4MUAA 2FG5A 1XFAA 4QNMA 2OZEA 2P2LA 4M22A 4PC6A 3GLIE 2Z4SA 3KTAB 2IYZA 4Q21A 3F8TA 4ABYA 2Q6TA 3ZZTA 4AC9A 3D31A 4BZXA 4US0R 1R7RA 3AQ4A 2GDJA 4P3YA 2OSBA 2CBZA 1S96A 4XJXA 4B2IA 4LZZA 4P33A 2BCJQ 5KUTA 2DHRA 4JLDA 4NONA 2BBOA 2GF0A 5A4JA 4IVQA 5KDOA 5M04A 1ZCAA 3FVQA 4K81B 3CWZA 1J99A 1RPZA 1KNXA 1CR2A 1W0JA 2FGKA 1JPJA 2KB0A 3GLFE 4JL5A 4LJYA 4EJSB 1QRAA 1QF9A 1YE8A 2IS2A 3EIEA 1VCNA 4FMCF 2Q0HA 4M1SA 2EWWA 4EPTA 3TNFA 2OCBA 3ETLA 4NYJQ 5J40A 3TK1A 2WKPA 4JYCA 5EZ5A 4QKQA 4AURA 4DLZA 4BLSA 1UKYA 3QKRB 4DIDA 1A5TA 1U8ZA 5J4VA 5LBIA 4XD7D 2DY1A 4NDZA 2GXUA 3QXJA 5BN4A 5D3MA 3G0HA 1UBCA 3G82C 3I4LA 3HYRA 1N5JA 1F2UB 3SR0A 3BH6A 4A1FA 4JBWA 5F9HA 1N6PA 4DHEA 1J90A 4KJZA 3I61A 3BGWA 3I72A 2JLXA 4A0FA 1HE1C 4DCNA 1KO7A 1D2MA 2ATXA 2ZS8A 1C4OA 2YWFA 4PQYA 3GQBA 2W2XA 2O8BB 2FSIA 1BIFA 3GLHE 4Q4JA 4DDVA 2ZR9A 3DHWC 2G1JA 5FOXA 3TJZA 2P6RA 4JLBA 2OLJA 4Q02A 4CZ2A 1E2IA 4DBLC 1IJEA 2GXQA 2IT1A 2ZIAA 3RSLA 2W00A 1PVOA 1W5SA 3E2IA 2WKRA 3MFYA 4F92B 2Q9CA 4G5GA 3BBPA 2PMDA 1KO4A 1NMYA 2BMFA 4G5RA 5JCZA 2ORIA 2FPMA 2JLZA 1SVMA 1Z06A 3KZ1E 4B47A 1VG8A 4EAQA 1ZBDA 1CR0A 2C98A 1T9HA 5EE5B 3QXXA 2R6DA 2WWHA 5K8TA 1S2MA 4OK5A 4E5UA 2ZRFA 4QJ3A 2B7BA 2RGEA 3MLEA 2DYKA 4PO1A 2LCFA 5KTYA 4KFSA 2PCJA 2ERYA 5JMTA 1NG1A 1KSJA 2JCSA 2V7QD 3LLUA 1SVOA 5F98A 4PSKA 4KYUA 1TUEA 3T61A 4CYMA 5BWMA 4XVRA 3K8YA 5AJZA 1B0UA 4NCIA 3RLFA 4F4JA 3KJHA 4NKRA 2QM8A 2EFEB 5FOWA 3L0OA 1N0WA 4M9QA 2CCJA 4V0OA 1IBRA 4AYXA 1M6NA 5GADl 1GM5A 2A7QA 3A1WA 1W36B 4TZ0A 2CNWA 3F3YA 1K6MA 2YVUA 2VYFA 1XZQA 3BFVA 3TR5A 3PEVA 4DSUA 1E79D 2F6RA 2QGNA 3BFXA 1S9HA 3U3RA 4KBFA 4QGHA 4RD4A 2FPKA 2J3EA 2NO7A 1G5RA 1Q44A 2GAOA 1Y3AA 4Q1CA 2WSMA 5KHOC 3DVLA 2WV9A 5FOUA 1SZPA 1OXXK 3GLIB 1GZSA 1RVDA 2RGXA 1W1WA 3EW9A 4KFUA 1R5OA 3EZ6A 3GEIA 1MRSA 4QGFA 3SFVA 4QBIA 4PPGA 3VR5A 2VEDA 2JJ1A 2O8CB 5EE1A 2ORWA 3ADKA 4LBYA 1E0JA 4C7OA 1VCMA 4CEJB 1QHSA 2FSHA 1E2FA 1MO5A 5DLQC 1QHGA 4B35A 2E1RA 4QC2A 3ZQ6A 2Q9BA 1ETUA 5HKKD 5KNDA 2GNOA 4FMDB 1ZM7A 2FNAA 3DZ8A 1RKBA 4JKIA 2GBLA 2IYTA 4Y0VA 1MOZA 2C78A 1VG0B 2VP6A 4LBVA 5FTLA 1I4DD 3PVSA 1W36C 2GTPA 4JBYA 1E9AA 1R0YA 3GFOA 1NLZA 5BN5A 1E2LA 3FMFA 3SE0A 1I2MA 1Z5ZA 2QMHA 4DLUA 2IF2A 3T5DA 3TKLA 3H1TA 3K0EA 4UJ5A 2ECKA 2CHVA 2WAYA 4LUCA 4C2TA 2WTUA 3THWB 1J2JA 1N6HA 3W6PA 2J41A 4PHHA 4MGZR 3JZMA 4NZYA 1P2SA 1BYUA 3AP2A 2QL6A 4YMSA 3QPWA 3WHKA 1COWD 1VYTA 3FGNA 4C0BA 4TLEA 2W2TA 5CLQA 3NC0C 4Q66C 2NIPA 4TN1A 4RCYA 3QVVA 1E69A 4O25A 1YR7A 4B73A 4GOKA 1I4LD 3VQTA 1JAHA 2D7DA 3B6EA 2BDTA 1YZLA 221PA 1UKVY 4JLJA 4RY2A 2DB3A 2ZAOA 4URUR 3EXAA 3M4YA 1KZGB 5SZHB 1CXZA 1KY2A 4WBSA 5DISB 1E0SA 3WRXC 3P32A 1Q1QA 2BBTA 2FOLA 2FV8A 4MGIR 2NPFA 5HPYB 3KQLA 1FP7A 4HAYA 4AYWA 3THYB 4FINA 3LH5A 5CYPA 4PZLA 3C7KA 5FL7A 4A4DA 2XNDD 2XSZA 4OQLA 4DCUA 4G0NA 3U3MA 4N3NA 4M8NE 5H1YA 1N0VC 4BQSA 3TRFA 1D8TA 2WM9B 3IGFA 3QPUA 1KI9A 4XVUA 1KMQA 1TL7C 2ZRNA 3KFVA 3FB4A 4A92A 3X1YA 2C5LA 2CVHA 1A1VA 2QY9A 2AHOA 1N3BA 4UJ3A 2BIFA 1NBMA 2WOJA 4L8GA 4UNNA 5B30A 1GRRA 2V9PA 2XAUA 2VQSA 4GPTA 3QE0A 4AKEA 3DM5A 4L9WA 4KFTA 1KSFX 2R6GA 1P60A 3B78A 1NIJA 5FI0B 4PHTA 5E7IA 3WBKA 3T1VA 1V5WA 5EP2A 2CL0X 4WIAA 3SI7A 1KYIA 2VF7A 2XTNA 4DLYA 1KO8A 1BH2A 4BFSA 5AWFC 1G6OA 1Z6GA 3EA0A 4ZDWA 2F1RA 4HSEA 3OIUA 4L16A 3UG6A 3HU1A 4ZI3A 2JLRA 4KU4A 1TU3A 1E0AA 1CJUC 1ZAKA 2QROA 1L4UA 4MUBA 1E2NA 3R8FA 2DWPA 2WJYA 1BO6A 1G3UA 2CCKA 2YINC 4KV9A 1FTSA 4UNPA 3NH9A 4FCTA 3KXKA 4D80A 5A0FA 4TYYA 2BKUA 1ZNXA 2OCYC 3D3QA 4LI0A 1CJKC 2IX3A 2JLWA 1U0JA 2R9VA 2MSDB 2ZRMA 1VCIA 3ZZ0A 4GOXA 2WMOB 3CIOA 2BC9A 2C95A 1G20E 2C96A 1T6NA 5HCIA 3K0SA 5FFMA 1GSIA 4TQUS 2YNMA 2GHIA 2AK2A 3E70C 5KPDA 4LY6A 4D0GA 4DZZA 4US2R 3MSXA 3V9PA 1R0XA 4RD3A 3R7WA 2P5SA 3IILA 4XD7A 1GIAA 1JR3D 5CIWA 4MKFA 4Z8XA 1VKJA 4PXAA 1O87A 4GZMA 1EX7A 2ZJ2A 3LRPA 4DCSA 1X86B 5KPJA 5JS7A 2GZDA 3U44B 2ZI5A 2H8KA 1U90A 3HR8A 1OYWA 1GL9B 1Z6YA 4CW7A 3K0FB 1OH5A 3BWDD 1OFHA 2C77A 4TYPA 4FMBB 1HT2E 3KQUA 1YZTA 2KWIA 2ZSAA 1II9A 2NO0A 4DLSA 2G88A 3NVAA 1R8QA 5FR2A 3TVDA 2CLCX 3B82A 4AD8A 4OI2A 3U4QA 4CVNA 3CX6A 4V03A 1ZP6A 2ODNA 2CK3D 4ZPXA 2V3CC 4M1YA 5DI3B 2I3BA 3WNDA 1GDDA 2DBYA 3H4MA 2ZJZA 4F7WA 3KB1A 1GVNB 1NVVR 1TQ2A 1YZNA 1ZIPA 2NGRA 4P4SA 3RRMA 2YWGA 4CDGA 1BMFA 3UMRA 4Q9HA 1IN6A 1DEKA 2CLDX 2IC5A 1NLYA 4MRPA 3SN6A 1QHYA 3AKYA 2I4IA 4F38A 2HF9A 3FFBA 4XWOA 4CEIB 1PUJA 2A5YB 2OCAA 2ANBA 1G16A 4GMDA 2IYRA 1S3SA 3QF7A 4OBEA 3UG7A 4RFVA 4OHYA 2MMCA 1DTSA 1EFCA 4EUNA 1EX6A 4A8JA 4QHYA 4ZDIA 4B2LA 4GSYA 2WJJA 1G1MA 4FWTA 1U2RA 1HTWA 3GCGA 2QGZA 2QP9X 5FBWB 1DO2A 2VLIA 4KODA 1AK2A 4ZKEA 3B1WA 4JT2A 1IN7A 4Q19A 2EQBA 1N2CE 2OE2A 3AM1A 2QP4A 3RS3A 2YOFA 2GVDC 1U9IA 4JS0A 5AJWA 4EKDA 3AKCA 3LA6A 4N0DA 1CBUA 4EFMA 1ZM2A 5FBLB 4CGZA 2ZRHA 1X6VA 4LHYA 2XZOA 1KDTA 4PC7A 5GJWC 2X8AA 3LX8A 3KKMA 1MABB 2KBFA 2WPDA 1OKKD 3OEHA 1M2OB 2XXAA 3IBGA 3QJYA 2GA8A 1XD9A 3LY5A 4LYAA 4PQRA 2O8EA 4TMWA 4YXWA 4DCTA 1XDBA 1L8QA 3X1ZA 2X19A 1L7VC 2XOKA 2ZJOA 1OH7A 1FP6A 2RMKA 2ZYVX 3WYGA 3LWNA 4BRUA 4M9SA 2ZUBA 2BBWA 2VF8A 3B85A 3KKPA 3W6NA 3GMTA 2G3YA 1AGPA 2VHTA 1X8KA 2RGCA 1T0JB 3B1VA 3ZD6A 3AUYA 1DADA 4B75A 2JASA 2LWIA 1E1RD 4H1UA 3X1XA 1T8TA 1CEEA 2C8VA 3BAFA 3T1TA 2HCBA 4HYYA 1BYIA 2ZVPX 2QMOA 1E1QA 2QE7D 3P4XA 3PFIA 1S4QA 1UF9A 4IOKA 3FHTA 2G1KA 1MO6A 5EUQB 2LKDA 2RCNA 3O8DA 3SHWA 3Q7QA 5B57C 2Q21A 2IYXA 1E9CA 3QOFA 3SHFA 5EXTA 5SZIA 4A2QA 2GVZC 3D8BA 1JI0A 1GG2A 1P5ZB 5LD2B 2GCOA 3MJRA 1JEEA 3TW8B 3BS4A 4P4TA 1LF5A 5TXGA 4HAXA 3FKSD 4JJKA 3U5ZB 2JIZD 4HAUA 2V55B 4JVSB 5JRZA 4QBFA 3KTAA 3PR1A 2ZJBA 3AP3A 1G64A 1CJTC 1WBBA 5L3VA 3P27A 3QKTA 2TMKA 3CRRA 2QMEA 3NWJA 4Q48A 4LJ9A 3SQXA 4NCNA 3PEYA 4FMDF 1RYFA 3CWQA 1Z83A 4TT3A 4D26A 1JQLB 4MYHA 3C41J 1SULA 3Q5EA 2ZYTX 4ACBA 2P67A 3M0EA 3IIKA 4LC0A 2CLSA 3CF6R 1XXHB 3W5JA 1QG2A 4B43A 5G3YA 4B76A 1YQTA 4OJQA 4EJSA 2WWFA 3AVUA 5A5GA 4B6FA 2FFAA 3TAUA 4P31A 4CRWB 4RZUA 2B92A 4QXAA 1I4TD 4TLBA 5F9FA 3UMSA 3KFXA 1R8SA 5LB2A 2O52A 2FFHA 3QKRA 2JJ8A 1E6CA 1NIPA 4KBGA 5BYKA 2DR3A 4Q1EA 1QBKC 2WJGA 4HATA 4DSOA 1IY2A 1F2UA 3AF0A 2O8DB 2B8WA 2G0NA 3HWSA 4B74A 1PV4A 4DWJA 1FMLA 1NN0A 1M8PA 3H84A 4O3MA 2D2FA 1E99A 2EWVA 2NQ2C 4LV8B 3C8UA 4JSYA 4Q7JB 3CRQA 1UEIA 4XH9B 3B1YA 4TL9A 3F0TA 2O8BA 1KIMA 2GJ8A 4MRRA 4GNKA 5IK2A 2ZM5A 1FUUA 4KI0A 4D82A 2GK6A 4M1OA 2FA9A 5JSZB 1LS6A 2JAQA 2GRJA 1DS6A 1G7SA 4RFSB 4Z54A 2BHRA 3SYKA 2QPAA 1Z6AA 1NN1A 4IVPA 521PA 3EPLA 4C0SA 4A2WA 4DT1B 2FU5C 3U7EB 4CIDA 4AIIA 1TEVA 1NKTA 1DAGA 3LX5A 4BE7B 1KNQA 4MYCA 1B23P 5E7MA 5J4KA 3VMFA 3FWYA 2XB2A 2DWQA 2GJAA 2ZROA 3QI2A 2C9OA 1K5GA 4W5WA 5JWHA 2GEDA 2V8OA 1EFTA 4TTRA 5HZHA 2ZXUA 2Z43A 1QG4A 2IS1A 2NO6A 3MJHA 2ZRKA 1ZD8A 1YRAA 3Q3JB 4PC3A 1XEWY 4TZ6A 4HUTA 1KMHA 4C0KA 2QQEA 1N5KA 2IA5A 3FOZA 3CW2A 1D2NA 4L15A 4HZUB 3ZH9B 1G5PA 1E94E 1GNRA 3K53A 1KTVA 2IYWA 4JMPA 2F1IA 1FOEB 1H8HD 1M1YE 2UZ3A 4U02A 1XMJA 4Q47A 2JEOA 1E9EA 2DFLA 4PAMA 5G53C 4C4PA 1DG3A 1XNJA 3NBYC 3H0KA 4D6PA 3GLGE 1F5NA 4Q4AB 1SXJE 1LTQA 5CDFA 1ZM4A 1PLKA 2G6BA 1XTJA 2OAP1 5GJVC 1R0ZA 4ZCIA 1Z08A 4ZDJA 5K8UA 4KITB 3AV0B 4G01B 4JBXA 3KUCA 3RC8A 1W49A 2NZ8A 1LFDB 3MWYW 1E2QA 4C0JA 4LPKA 4LPSA 4WXPA 1EESA 4DSTA 3ZGXA 4M53A 1P9NA 2RGNC 4FCWA 1QHIA 2FF7A 2OG2A 3ZIAD 3AF3A 2AX4A 2ZJYA 2YKGA 1YKSA 2D74A 1J70A 3FTQA 3QXSA 3T5GA 2VSXA 3QG1A 3EPHA 3I8SA 3L0SA 4W5JA 2QAGB 4UNRA 1OF1A 1SVKA 2CK3A 1PLJA 1AZTA 4BFTA 2F3TA 2Z83A 4RKFA 2O8CA 1U94A 4LK2A 1RRFA 2PZGA 2ZUCA 4OK3A 4B44A 5KDLA 4CEJA 2QTVB 3AEZA 1D6JA 3PJRA 4GRAA 1S8FA 3DL0A 2D4HA 2BKEA 2Q9AA 3PUYA 3LDAA 2RAPA 4M2LA 1RYHA 4O0MA 2NPIA 1AKYA 1C1YA 3K0CC 5G41A 2ZPTX 3B1ZA 3TQCA 1W5TA 1ODFA 3CNOA 5K8LA 1SVIA 1XPOA 1VECA 3EC2A 3JVUA 2IUTA 1XPRA 4JLNA 2JDIA 1Z0DA 3IUYA 4MITA 4QM6A 1QVAA 1JNYA 2H92A 4PR0A 3LO5A 3THWA 4ZKDA 5KU1A 2NMVA 2QAGC 3DEFA 3AVPA 4DLVA 1WBDA 4B48A 3CH4B 1IOZA 2OBNA 2IXEA 4DCVA 1ZUNB 5EP4A 1EFRA 1KK1A 4XSHA 3VHXA 1EXMA 1DO0A 2ZI7A 4Z1MD 4AI6A 2R6CA 1DELA 3IO3A 3QXHA 3ZVNA 2AK3A 4JSTA 1JJVA 1P3JA 4KVGA 3A4MA 4Q9LA 3QBTA 4JVMA 1MO4A 4WA7A 3TMKA 2FSGA 1L2TA 2EFDB 4X8MA 5DHAA 4HB3A 4URYR 2CE2X 1LNZA 4UXJA 3CNLA 2BMJA 1KO1A 2ZEJA 4S35A 5FTNA 4Z51A 2JJ2D 1E2HA 1FX0B 5C18A 3BH7A 2XX3A 5DIFA 4EJSC 4PZZA 1TPZA 3OIWA 3RRNA 3RWMB 3THYA 2W2VA 5B2ZA 3VR4A 1NKSA 1TMKA 3U61B 4GMXA 2LKCA 2CL6X 4HEJA 2D7CA 5D3QA 2VP9A 2WSSD 2IUUA 1BKDR 4MH0R 3THXB 3IIMA 1E9SA 2QSZA 3CPEA 4LV6A 4TYQA 5DN6D 2RB4A 1CRPA 5DE3A 1GTVA 4V02A 1NF3A 1G3RA 3KKOA 3PIRA 3IO5A 1A82A 4HB0A 1YU9A 5EE9A 1X8LA 4YLGA 5LDDC 1G17A 5JEEA 1MH1A 3DM9B 1H8EA 1U8YA 5FI1B 3KJGA 1GRNA 1UEJA 1Q21A 2AFHE 1TAGA 4Q4HB 2HLDD 3GLGB 3C14C 2HEIA 1SXJB 5ANRB 3O8BA 1X1SA 1DAFA 5GJCA 1V43A 1KDPA 4BFUA 3IHLA 4Q1DA 3WP0A 1UDXA 3LBHA 1OV4A 3CX8A 1KI4A 3EIQA 4OHZA 1TTTA 4G5SA 1SKYB 1XB2A 4V0NA 4M1KA 2VRWA 4NYIQ 721PA 5CYOA 4B2PA 1E3MA 3R9IA 1EFHA 5KOYA 4KO8A 2OBLA 5KNBA 2WAXA 5HTKA 1W0KD 1OYYA 1VYUA 2F55A 4LSGA 1QHXA 2IHBA 1Z0JA 3N70A 3CR7A 4XWAA 4EQ6B 3EC1A 2A5JA 1XRJA 1UAAA 4M1MA 3MD0A 2J7KA 2QU8A 1WE2A 3EZ2A 2F7SA 5TARA 4JYBA 3SC3A 1JALA 2XTZA 3K9GA 4PHFA 1CF4A 2EVWX 3KXLA 1FTNA 4NHOA 2WJIA 4CT5A 1GKYA 3ZS8A 5KSOA 3HYTA 4Q9JA 2VTKA 3WYFA 5C46F 4HLDA 1XJQA 5DYGA 1GNPA 1MKYA 2IXGA 2DFTA 1LF0A 2ZR7A 3V4FA 421PA 1OXTA 1HUQA 4U7DA 1HQYE 3QKSB 5BXQC 2HF8A 3U44A 3ZYCA 1GL6A 1AJEA 3TUIC 3GLFB 1OB5A 3E5HA 1EK0A 3K0FA 1NVUQ 5FUWA 1G291 4IDNA 1CS4C 2ZRPA 3PCRB 3OHMA 2QRNA 4LJ8A 1TF2A 1KK2A 3LNCA 4LYHA 1W47A 4IFEA 1Z6XA 1Z0IA 5FUXA 4XTRA 2WKQA 3ONWA 2P0EA 2JLYA 5DI3A 1ONBA 1R4AA 2UKDA 2HV8A 3BC1A 5UKDA 4FCVA 1E9BA 4NPHA 4OHWA 4A15A 1LW7A 4PANA 5J4HA 1YR8A 2OAQ1 3DKVA 1II8B 2PZEA 2ATVA 2GK7A 3AKDA 4IEEA 2F9LA 3VR3A 4C9BA 2J0QA 2QEQA 3G5UA 2F43B 3SFZA 3IPYA 3VX3A 1G18A 1Q12A 1ZM9A 4EPYA 4LJAA 2XB4A 4TTQA 3LBIA 5SZJA 4DC9A 4CEIA 3BB1A 2ZSDA 2R6FA 1KI2A 3B13B 3CF2A 3GLHB 4HDCA 4TSFD 1G3IA 4WZBE 3A1VA 1US8B 2A9KA 3NDPA 4KYIB 3K09C 4JT4A 4IHQA 1G21E 1CKEA 1W4RA 3A4LA 4JZKA 3X1WA 4URZR 1JPNA 3RABA 3I5XA 1T3HA 1FNNA 4QL3A 4A0RA 2ZRAA 1XD8A 3OE7D 4LX0A 1H8HA 3ZZUA 2OEPA 3K70B 3D7MA 1Z29A 4HB2A 4QGGA 4U5XA 4ACAA 4OHVA 4TL6A 3DOFA 4MQBA 3A36A 5CJPA 1CLUA 2YHSA 3GJ8A 3OAAD 3TGPA 3MRSA 3QVUA 2FGJA 3THOA 3L2OB 3RSOA 1MABA 3AH8A 4I1UA 4YMVA 4PAQA 5TB5A 3WHLA 1K5DA 2Q3MA 2GZHA 1XCMA 3V4RA 2ZRIA 1AGRA 1P9WA 3PEUA 4XSGA 1KI7A 4PAOA 2Z6VA 4GP7A 1OFUX 5L3QB 1U81A 3QNUA 2ODBA 1NJFA 3LFUA 4MKGA 3SDZA 1Z22A 2W6ID 1MT0A 1X1RA 2J0VA 2AKYA 1RJ9B 2AWOA 4BGDA 1XBTA 2R44A 4PC1A 4X8HA 4YC7A 3NTUA 2DFKB 4TTPA 4ON9A 1R2QA 1F2TB 4PTLA 3ADBA 1CJVC 1HYQA 3BXZA 2IK8A 3B60A 4XVQA 3IKJA 1NNEA 3OFND 4GDFA 1J8YF 3SEAA 2K5UA 3K9LA 3P26A 1NMZA 2YC4C 1NBME 2QI9C 3WMEA 2GKSA 3L8ZA 5TDHA 3VU9B 3EPJA 4P0TA 2WBLC 4D4LA 2N1BA 2VH5R 2FE4A 1NN3A 1NVWQ 2YYZA 1PUIA 1K8RA 2NOAA 4I4LA 4IVRA 4KXFB 2H5EA 1P7CA 4GFDA 5DI9A 5BW8A 1XWIA 1YHNA 3R9WA 1IN4A 1E4VA 1SXJD 2C9CA 1D5CA 3C5CA 5F2EA 1YR9A 1Q1EA 1R5NA 1HURA 2CHQA 2JGNA 2VP5A 4BLTA 2HYIC 1E9RA 3IHWA 1GAJA 1M7GA 1ZUIA 2EFGA 2H18A 3CX7A 4BRWA 5E95A 1Z0AA 1G41A 2VP2A 4DIEA 4RZ3A 1GWNA 3ZLJA 3DDCA 1R6BX 1SVSA 1OJLA 2VHQA 3LXRA 4H9GA 4PHGA 1KY3A 3PV0A 2IL1A 1NY5A 4KLZA 2J46A 4QBHA 2QAJA 4R98A 1KI6B 4ARZB 2GXAA 3LVQE 2GF9A 3KKNA 3Q8XB 2F1HA 1Z0KA 3HU2A 3WRYC 4ESHA 1YZQA 2OLKA 2P5TB 4LHXA 2IYQA 3RC3A 3TE6A 1VPLA 1XXHA 4XOIA 2OFXA 2A3RA 3AB3A 5HE9A 2EU8A 2FFBA 1ZD1A 2NO9A 2FWRA 3ICQB 4EPWA 4M21A 2PEZA 2OFOA 3SJAA 4OQXA 2QSYA 5FPYA 5AJYA 1AA9A 2CE7A 1ZRHA 2VBCA 2ZRGA 2J0UB 1Q0UA 1IN8A 4PQFA 4MA4A 1IQPA 4JVLA 5EZ6B 5EE0A 2JJ2A 3OIVA 4KVAA 5AK0A 2IWRA 2OXRA 2NZJA 1FNMA 1JXMA 3W3AA 5CB6A 1T0HB 1Z3IX 5CJ2A 3LD9A 2O8FB 1A2KC 2W0MA 3IDQA 3B2EA 4LV5B 5AJXA 5JEDA 3J81k 1FFHA 3A1SA 2QT0A 2Q3FA 2GEUA 3SJZA 1N6KA 2HYDA 1WQ1R 5DN6A 3L0IB 2BMEA 3RAPR 2YC2C 1RRPA 3X2SA 4CEHB 1CP2A 1YZGA 1W2GA 3GFPA 4G5QA 1KSGA 2FEOA 2QNRA 5JI2E 3DMDA 3CF0A 1P75A 3REFA 2KBEA 3HPRA 1IONA 2REBA 4Q7LA 5FOVA 1JB1A 4MKIA 1G8FA 1OXSC 4M1TA 4OKSA 3QEOA 4TMZA 5H68A 4DT1A 5P21A 3KQHA 1UM8A 821PA 5KSZA 1UADA 2V7QA 4WZ6A 1WCV1 5FUYA 2PX3A 4HZIA 5FTJA 3WNCA 3VNVA 5JS8A 4HAWA 1TF5A 2WWXA 1W0JD 2J9RA 2OXCA 1NMXA 3I73A 4BZPA 3OEED 4BFYA 3EWSA 4JKYA 2GJSA 4HUQB 2RGNA 2V6IA 3SBEA 3BB3A 3GJ3A 2YV5A 1AN0A 4ASUD 3GP8A 3ADCA 1ELOA 3DKPA 2ZI3A 2ONKA 3AVVA 1MO3A 4ZO4A 4DVGA 3T12A 2P6NA 3FYHA 1E79A 5KYKA 2JLVA 4HZUA 1CTQA 3A4NA 3RS0A 2NTYC 2SHKA 1TU4A 3RS2A 4OL0A 3LW8A 5B64A 2HJVA 1D9ZA 2MSEB 3K70D 1HT1E 3BK7A 5CITA 1RC8A 2W6JD 1AS2A 1HEIA 3WNBA 4Q4AA 4W7SA 4EFNA 3MUFA 1EWRA 4NYJR 1LS1A 4QFMA 3NIBA 3K0CA 1II0A 1QDEA 1RFLA 1HQCA 1HY3A 1P73A 4Q1AA 4CT4B 3KQNA 2OESA 2ZSEA 3HPQA 4Q01A 2ZVQX 5CK4A 5TV2A 5DSZA 3EARA 4D4JA 1ZYUA 1OB2A 3AGPA 3GD7A 5HKKA 1NRJB 3L82B 3AVTA 3THXA 1XF9A 2AN9A 2HJGA 1BS1A 2PZFA 1TQ6A 2QAGA 1VG1A 1XCPA 5EP3A 4TYWA 4I1OA 4QRHA 5FBQB 1DPFA 4BZQA 1G8YA 1SHZA 3CO5A 4PPQA 4D4MA 3KX2A 3BD9A 4LHVA 4Q4LA 1U0HC 4UXHA 1P4SA 3ZD7A 3NBFA 3ZVLA 3W8RA 4BLRA 2WWYA 4DB2A 4LHZA 1SQ5A 1N6NA 4LRWA 2GWHA 4QHTA 2A78A 2GETA 4RD6A 3T1QA 3GJ5A 4WOPA 2HCJB 5HR5A 4IXMA 1COWA 2FZLA 5TMPA 1NG9A 3REGA 1ZJ6A 3I1FA 4IDQA 4ESVA 4IKEA 4ZIRB 2R62A 2ZU0C 3T1OA 4ITRC 3IEVA 3QXCA 3KJEA 2BWJA 1F48A 2YZ2A 1TEXA 1KDOA 1ZU4A 2BCGY 2PCLA 4V0MA 3U2QA 4OQNA 4AKIA 4K8OA 1TF7A 4A6PA 1NI3A 1XMVA 5KNCA 3NG1A 2AR7A 2E9SA 3FHOA 4MYUA 2VHJA 1S1CA 4BASA 2VO1A 2B6HA 3TR0A 1T3LA 5LD2C 3LW7A 1JQJC 3Q7PA 2IYVA 2MSCB 1GFIA 5L8VA 2ZYUX 5DH9A 4LHWA 5DGXA 1J8MF 1KHTA 1M74A 3C4JA 4GOJA 4C0HA 1CR1A 4U00A 3PITA 5G40A 2XNDA 1NLFA 5GVRA 2C2HA 2R65A 3C16C 2D06A 4RKEA 4A0GA 4YDSA 4IW3B 3KDSE 1OH8A 3QF4B 1OIWA 1U99A 1XMIA 2ZE6A 5FTKA 1E2KA 3ASZA 1Z6TA 1JAIA 3UWKA 2PLRA 2FX3A 2JJ1D 4NP6A 2ZRJA 2KE5A 1VMAA 4QOSA 4N0EA 1UPTA 3TIFA 5JWOA 2GILA 1JJ7A 3QSYA 1W4BA 1RW4A 1AQYA 1SKQA 1FX0A 4WAUA 1FW6A 1DAMA 1G3MA 3Q9LA 4M4SA 5CIQA 1TADA 1WB9A 2ONJA 1HH4A 1ESMA 3BRWD 3VKHA 3BB4A 3IIJA 4ZDKA 5AR1A 4JLVA 4B3FX 5EUMA 1LY1A 2BEKA 2ZS7A 3QQ5A 4HAZA 4I99A 4NCJA 4Q03A 5L3RA 2QORA 5B58C 5KSYA 1XZPA 3OFNA 3BOSA 2RGDA 3HU3A 3M1IA 2BEJA 3R8CA 2G0TA 3CONA 4DDWA 4BFWA 3PUVA 3SYLA 5AJVB 4BLQA 4RZ2A 1G7CA 1N5IA 1FQKA 3IPXA 3N5CA 4Q7MB 3RS5A 4HI0E 1SVLA 4DKXA 4EIWA 3KB2A 4KLNA 5DHFA 4PX9A 1CR4A 3OF5A 3GLGA 2AWNA 1LV7A 1ZVQA 1SXJA 2HUPA 2WIAA 1P9RA 4MRNA 4DUGD 3K1JA 1G4AE 4QG7A 3MWKA 2Y8EA 2PMKA 2X2EA 3ZS9A 1KGDA 2WIBA 4KHZA 2GESA 4ZCLA 2CDNA 4C0QC 2I1VB 4TL8A 3W5IA 2ZSBA 3WMFA 1JECA 1YVDA 1VHTA 5EE3A 1AS0A 2XXAB 4BPBA 1M7HA 3W9YA 1P72A 3CRMA 3U3OA 2C9YA 3VR1A 5JWRA 1N6OA 3AVQA 1JR3A 4F4CA 4TWZA 1Q3HA 1Q57A 4M0LA 1KI8A 1UKZA 4D0LB 5FR1A 1NVVQ 1PJRA 1NN5A 2CEAA 5IT5A 3LV8A 4BFZA 4IDOA 1QVRA 2H1LA 1ZMXA 5FL7D 621PA 1TNDA 2A30A 4PSAA 4TMTA 2XSZD 3LXXA 2JA1A 4F91B 1Q1BA 3U6KA 2FMXA 1IAQA 3GJ7A 3MCAA 3TVTA 3GLIA 1RRGA 4B32A 4WW0A 5LB4A 1KOFA 3N2EA 4G3XA 4OI1A 3VFDA 1T4GA 2GXSA 2XTMA 4B3DA 5CDFE 1VYVA 3NBZC 5JHGB 3EX7C 1NBMD 4DDUA 1OIXA 2OM2A 3K9HA 5L3SB 1UFQA 2X77A 1RZ3A 4MYTA 3CLVA 2Z0MA 3LBNA 3RS7A 2O0HA 5JBQA 3RHFA 4AWXA 3K09A 3WP1B 3QEJA 4AKGA 4BLOA 2QPTA 1QHNA 4OI4A 4YMTA 3GLFA 1NSTA 1DAKA 3ND9A 1WRBA 4JVNA 4RZXA 4FXPA 2WMNB 3CRW1 4GZLA 5EXPA 3RWOA 4G1UC 3TW4A 1G8HA 4O2LA 1AQUA 4E22A 2EFHB 4PZYA 2BJVA 2I1QA 3U7HB 4OQMA 4AK9A 4V0LA 3UMFA 4IRUB 1KZ7B 1KSHA 3I92A 2QTHA 3NH6A 1P2VA 3B7GA 2UVQA 3GEEA 2QA5A 4IJMA 4DLTA 4XWKA 4UXIA 1GNQA 3M6AA 4RSGA 1II8A 4NL4H 1QHHB 4WZAE 3RVBA 4E09A 3SS8A 2F43A 3EG5A 1N6IA 1T3SA 4TQAA 1G5TA 2WWIA 2P6UA 3OEEA 1MV5A 3ICEA 3FKQA 2KJQA 3L8YA 3S1AB 4JLPA 5JJLA 4ASUA 1T5LA 3GLHA 2AXPA 4DRZA 2ANCA 1OKKA 1US8A 2QTFA 5JZVA 2A5GA 3EWAA 2IXFA 2BOVA 3EASA 4AG6A 2NG1A 5TVKA 2B7CA 2O5VA 5EP1A 3KQKA 2ZTSA 2IEYA 3W34A 3U7FB 4D2IA 4NTZA 3PUZA 3LAWA 3BFKA 3NXSA 2GCPA 3T34A 3MMPA 2PEYA 2QBYB 1SHKA 4Z8YA 1F6BA 1T91A 2W6JA 4Q7KA 4EPXA 5SZKB 1XP8A 3VAAA 4KCGA 1LB1B 1Q22A 1HV8A 4PSVA 1E1RA 3QBVA 3CRVA 3N2IA 4YONB 1FMJA 2ZI9A 4AYTA 1XEXB 4X8LA 4AY2A 4BFVA 2FN4A 2PLFA 2V1XA 5IRCD 1ZU5A 2QE7A 3NHAA 4FD2A 4NMMA 1UBEA 3UWOA 4FIDA 2PT7A 5FPKA 3ADDA 2QM7A 3KXIA 3UXMA 1OHHD 1E2GA 3CNNA 4L4UA 4LWZA 3MG9A 1KAGA 1JR6A 1N6RA 4Q00A 1KKMA 2ZYWX 1BMFD 4YMWA 5L3QA 4HLCA 5HZKA 2B21A 3T15A 1IHUA 5FBRB 1ZIOA 1XD2B 1P2TA 1RJ9A 2RGGA 5BYJA 4ZCMA 1ZM3A 2RGBA 3AGQA 2J59A 3KKQA 1KJYA 1W4AA 3PXGA 3ECCA 3HJNA 1NL3A 3FKSA 2R6AA 4JLAA 1KKLA 1Z47A 2JIZA 4ZV4A 1F2TA 1G19A 1E4YA 4H1VA 3UK6A 4B6EA 5DNYB 1G3QA 1KMHB 2AXNA 4JIMA 1W44A 2E87A 5FPTA 1UBGA 3BIFA 3NBXX 3IQXA 4LYJA 2EFCB 2IS4A 1ZC4A 1G7RA 3VU9A 1WMSA 3AVXA 3L43A 4MGKR 4DEXA 3VHLB 4LDJA 4D0NA 2A5FA 3U60B 5KO2A 3LQQA 1OH6A 3K0AB 3R9XA 1S9DA 3QPVA 4NH0A 3LLMA 4HAVA 1GUAA 1MRNA 4RJLA 1KI1A 2WJVA 2J5XA 2ZANA 4MRVA 3I8XA 3CZQA 3DMNA 4LCBA 2O0JA 4B3XA 3IQWA 2V1UA 3PQCA 1AM4D 1VG9B 2ODEA 4UQOA 5H70A 2WVJA 2WPDD 1P2UA 3OEHD 1NP6A 2VP4A 2XJ4A 2CHGA 3FMPB 1Q1ZA 1SXJC 4YXWD 1E9FA 2ZRDA 5IF9A 1AS3A 1M34E 4QBGB 3EPKA 2XOKD 1KI6A 2R2AA 4ARZA 1PLLA 3CZPA 2FDCA 4GI7A 3FFAA 1FZQA 3EAQA 2ZE5A 2CJWB 5C4MA 2BJWA 3EA5A 3CM0A 4UNSA 1Z63A 4HB4A 2XEXA 4E07A 1AIPA 4L5BA 3AKEA 3CR8A 1XX6A 3U7GA 2ZI4A 3ASYA 1I2DA 3ZJYA 5KDDA 1VIAA 2HT1A 3I5YA 1CIPA 3KUDA 2J0UA 4TLAA 1DBSA 4IEIA 1E1QD 5HE8A 2V4ZA 3P1JA 4HLUC 5FPSA 5AUOB 4JJZA 4PO8A 4JLMA 4MRSA 1H65A 2O8FA 1W48A 2ZQ5A 3O47A 3ZDQA 2PH1A 4B34A 2FFQA 2VSFA 2OUKA 2J7PD 2DFNA 1YR6A 2EW1A 4MGYR 1UDWA 4ZI2A 1E96A
chains in the Genus database with same CATH superfamily
2H48A 3P5BA 1RXYA 4Q37A 5FEMA 1N6LA 1W19A 2QG6A 4CF4A 2DPXA 4Y67A 4RPIA 1K5HA 2Q41A 3UN1A 4BEWA 3I9V1 4DMCA 3ZJVA 1UPCA 2QTTA 2FOXA 5A3VA 5AKHA 2UYGA 4R54A 3MWJA 1YZUA 1J22A 2K2WA 4X71A 4CM5A 2OWEA 3ER8A 1FDRA 3TSOA 1RAFA 3NEYA 2LIVA 2C2WA 1JQBA 2RKOA 5HCNA 5HFAA 3IR5A 1VGQA 1A4RA 4PIMA 5BN4B 1XUOA 5D3MB 1JHDA 1MT3A 2VKTA 4MUNA 1X70A 3TBKA 2OILA 3GEHA 1HLDA 3GMIA 3JAWA 3EBPA 4TT3D 2ZREA 2P77A 2TECE 2ZE7A 1BU8A 4AZ0B 1RYYA 1X39A 2Q2NA 3GJ4A 5BQ5A 4BWYA 5CFZA 1CP3A 1SQ6A 1KAQA 2HKIA 1RXVA 2J5RA 1E3LA 3PFWO 1KVTA 2YQ5A 2I67A 5JIBA 1PJ2A 1WY5A 4UEJA 3LRXA 4MYRA 5H02A 1B2RA 4AJLA 3TOSA 1K3FA 4ZOQI 3A6HA 4J75A 2GMWA 2C5FA 5E7JA 5EUCA 4I8XA 3LFTA 1ZI8A 3J81A 1EESA 2ZSIA 3DCNA 1QTNA 4NXMB 4MCAA 4K7JA 5IVKA 1CUUA 1XQYA 5T64A 3RUEA 1EGQA 3OZXA 3OLYA 3D9QX 4K88A 4D0SA 3HDTA 3OQJA 4FN5A 5HKBA 5JHHB 4OL9A 1Y7PA 4M89A 1IZZA 2GKGA 2IPMA 1JWBB 5C8YA 4MV4A 1JH9A 2X8BA 2QUBA 4R8RA 3SOPA 3IP7A 2YRXA 4JP3A 2O48X 3CN7A 3TTWA 2MIIA 1I6MA 3HB7A 1SHLA 2BYTA 4HQOA 3I2YX 1NTOA 3HV2A 2B5VA 3BFJA 4UCWA 5T7BA 3FNIA 1GOTA 1DIGA 1DHRA 3JVVA 2V6FA 2WHXA 3M6UA 3S8MA 2DXIA 4CBVA 3K70C 4XE5A 2IHYA 1PF7E 3UIEA 5K0EA 5AUPB 3ZCRA 3DPUA 2W48A 3WO0A 1PCXA 1D2GA 2REQA 3OPYI 5EKUA 3TUZC 5FX2A 3KAPA 3L9WA 3OH8A 1P7VA 3G3EA 2FYTA 4QZVA 3OZSA 3KL4A 1O97C 5GM1A 3OT1A 3UATA 1MEEA 2YY6A 1D6MA 4IZHA 4IOJA 4URXR 2A9PA 3B9QA 4Q1VA 4PCUA 1P0MA 1CUFA 1PT9A 1W2HA 2DSNA 2ZBEA 3WXMA 4R2IA 4RS3A 4NYMR 1J49A 2QAIA 3FJOA 5IULC 2B37A 3PEWA 3JQDA 1WA5A 5BSVA 1MJFA 4P3KA 4DLPA 1X7DA 3JWEA 4PINA 3R5JA 1BXGB 3EZ9A 1PFYA 4AJKA 4QJ4A 3AIIA 2OCGA 2OAGA 2BW0A 1AKEA 3OCUA 2XUQA 1G5QA 1XROA 3SICE 2CNKA 2RH9B 1FJGB 4WX2B 4YP5A 2J9FB 1NFQA 3MJ4A 2LRHA 4RD2A 1BA2A 2J3HA 2NU6B 4ONEA 4ZEXA 3U0VA 1T1JA 1FTYA 1ZKDA 4K9RA 1WX1A 2ZE8A 5KTRA 1OXMA 1XPUA 4BOYA 2X2OA 4J29A 1Z82A 1ZN9A 4DLKA 1EHIA 1G4UR 3E9YA 1CU1A 2R8XA 2D62A 4DCGA 4YUAA 3T06B 3ZDRA 5AW5A 1OFVA 1ZWKA 1N5RA 2AX3A 2NXWA 3UVEA 4ZI7B 1E2BA 2BGGA 3BXOA 2GZ2A 2CMKA 3PPWA 1V16A 3E6AA 4B4VA 2R0QC 3P9CA 4XM1A 5C2JB 4J0IA 2ZTHA 2BGLA 1VL8A 2H7VA 4AMUA 3JQQA 4JSRA 1SJ9A 2GBGA 4C0AC 4C7OB 3JYPA 1M1NB 4CCYA 3CKLA 3PEFA 3WLPA 5H81A 5FL3A 2CT8A 4P4UA 2JEZA 2YUIA 3T95A 4ILEA 1ZNQO 2VTDA 3O3CA 3A9WA 2YZNA 5LIRA 1JLLB 1W36D 1U0EA 2DWCA 1OPXA 2I34A 3UQYS 3N2ZB 3NHLA 2ZOSA 1K98A 2HL6A 5JR3A 2X2FA 2L0XA 5FWYB 3AF1A 4F3CA 4XUEA 5KQPA 3VYWA 3ZNQA 1SUEA 3L7OA 4JOBA 2WG2A 3ENQA 1EFPA 5AK6A 1JEDA 3ZN2A 1PZNA 3VKWA 1YK1A 1A8QA 1ECGA 1HL7A 3BGDA 3K9NA 3N53A 1Y8RB 1XTIA 2X8WA 3EYAA 3NWOA 4K9MA 1OI7A 4UTXA 3WQBA 3CX3A 5AW4A 1D2RA 5GONA 1R6DA 1U7OA 4B5LA 3QVLA 4PO9A 4CMIB 4X9XA 1TT5B 3OLQA 3RYCB 3FVWA 3GRYA 3PLNA 5DBIA 3EIWA 3KCNA 1OHHA 3GCWA 2X86A 4YEDA 3RTEA 5LP1A 4HYQA 3WQSB 2W0SA 4HDRB 5JSZA 1HG0A 3HCPA 3BRSA 1JLSA 3HKDB 4MIYA 3BTUA 4B4UA 1PSWA 1V45E 1X1CA 2CL7X 4LJRA 4ED9A 4PCVA 4AO6A 2G77B 1E2PA 6Q21A 4WD3A 3OCYA 3ROPA 3GLKA 1CRQA 3ANYB 1E32A 3D5EA 4HKTA 4A23A 1KZ1A 3BMCA 5IX8A 5BSGA 3UH0A 4BWFB 1YSCA 3MRXA 2C99A 3PDIA 1NDHA 4GP6A 3RUDA 2J0SA 4US1R 5JDCA 2DUJA 2HCRA 1Y8ZA 3RK1A 4IFBA 3FN4A 1DOAA 2NXEA 2VSOA 3D3EA 1W5FA 1EEXB 1M0WA 5IAJA 3ZOKA 2FUNB 4PLFA 5TY0A 3FCAA 1TTPB 4X91A 3HYNA 4R2JA 3RNLA 4BEJA 4DWWA 2BEVA 4LXQA 4QRIA 1DARA 1C1DA 2R4QA 4I4TF 5L4SA 1W0KA 5FFFA 8ADHA 2E82A 1U0TA 3TEFA 4TYNA 1X3SA 1ZIDA 1V8DA 2IS6A 1UWCA 2Q0XA 1YHZA 5E6RA 4XUCA 4EGJA 1VJRA 4WCVA 3SYTA 2HDNB 1K86A 1KH2A 1SUIA 2PFGA 1WQ4A 3EMBA 1JTFA 1WCWA 3WB1A 1Q0TA 1YVPA 2ORVA 2NU8A 1T2EA 1YTLA 4HQFA 5F33A 3F4KA 1J97A 5CLLA 5CFLA 5B4UA 2JGIA 3K15A 1DX9A 4RV9A 1PDOA 1YFKA 1XU9A 3PZBA 3H5IA 3QWBA 1EGMB 4XPIB 1AQNA 1OU0A 1K7XB 4O2AF 4KGXA 2XKAA 3C6BA 5HK8A 1T6XA 3DEYX 3A6PC 4TV9B 4XR9A 2PU5A 4JOCA 2VHUA 1H69A 3HEAA 1WUKS 2HSEA 4EABA 1A7JA 3RUHA 3TR6A 3TTSA 1EU1A 5DW3A 2WICA 3U6BA 4URWR 4NEQA 3SJCA 1W46A 1KMMA 4AUMA 3JY6A 4HGZA 4J91A 3E9NA 1YZKA 1EI9A 4QXRA 3I1YA 4TMVA 4DLWA 3QVJA 4KR3A 3G2PA 5DHRA 3OM8A 5IH7A 4FDLA 4CV0A 2WVAA 2X4LA 4DIFA 1NC1A 3VR6A 1T3GA 3FRJA 2HK8A 3NGMA 1QO0D 3KAJA 3MRTA 3P71T 4M9XA 2J87A 1HORA 4L2IB 5F2OA 1JZSA 5TQ0A 4RKQA 3RV4A 4RM2A 1NBWB 4DUYB 4MR7A 1P1HA 3UGQA 2YQZA 5ALYA 2A9JA 2XQKA 4D9FA 2J45A 4O4JF 3TLXA 4ND8B 3ECAA 3K31A 3TOXA 3W6OA 4DDMA 3PG5A 3D6TB 2GJ9A 4ISBA 1EUQA 2PSEA 3EN0A 3FIUA 5CA0B 5C3UA 1SVWA 1ZSVA 1T5OA 5IKOA 4JCOA 4OO3A 2JKYA 2GAAA 3KYDB 3MWLA 3O7WA 3C5HA 4KN9S 2OHGA 1E2DA 2F3SA 1Z26A 4YGYA 3VXKA 5DNAA 2G1PA 3AUXA 4WPGA 4ZAGA 2Z8YA 4LRTB 4MI9A 4AKHA 2WWWA 1C8LA 1QH8B 3MOGA 1XTRA 2HRZA 1O3YA 1E2EA 2GS9A 2W58A 3HDHA 3KV1A 2YASA 4MUIA 4QAJA 3R7WB 3VPAA 3HP4A 4Z1OA 3IBFA 1FCJA 1KIAA 2N1MA 1P9OA 3IYLW 3AHFA 3QIAA 5G1OA 4IH9A 3WKEA 3X2FA 2JD0A 4QODA 1RWVA 1QRDA 2VT2A 5EESA 1RLIA 2IOQA 3GFTA 1A9TA 3RVNA 1GT91 2MOKA 4G5YA 2WWTA 1H93A 2IYYA 3AEKA 3RIMA 3I9FA 4TKZA 5EWJB 1IXSB 2HQOA 4FK8A 3TB4A 1NMSA 4O2RA 3BK1A 4I1SA 4L0DA 5CAEB 4G0WA 2X4IA 2QIPA 2VEOA 3RSFA 1U6JA 4N18A 4MQFB 3AEQB 3N8NA 4V0ME 3SM9A 5CT6A 4K9SA 5L51A 4Q9NA 4JB2A 3GJ0A 1NX6A 1JX6A 4XI9A 3VR5D 3W90A 5LQUA 4RESA 1UQUA 1E2MA 4NYIR 3QGMA 4NJEB 3LGAA 1FPMA 1KJWA 1IAVA 5JOQA 1NHGA 4BYGA 3RFVA 1Q7CA 2C5BA 1JFRA 3UKJA 2D2EA 3ILYA 1MB3A 2BGKA 1Z8DA 2H59A 1VSTA 2QPOA 4AFNA 2WAAA 2IU0A 2X1LA 2ZKLA 5FWDA 4YJ2A 2OT3B 2Z30A 1GU0A 1K89A 3Q15C 3G1TA 4RU1A 3KG2A 2WYOA 4EHNA 4DQDA 4UE6A 2O3SA 2H4FA 1HRKA 4JUAA 3GELA 8OHMA 2P4QA 4RD0A 2IEZA 2ZLBA 1NDQA 2GZAA 4LYFA 2PPVA 4DA6A 1HRDA 4G1VA 3FUWA 4RKRA 1PS8A 1I80A 2DH6A 4X1IA 5DM1A 3I34X 4AZWA 4F5DA 1ABBA 1IHPA 1HBJA 2HXYA 1EWTA 3QYPA 4BECA 2XDYA 3BJIC 1XEXA 2PZLA 5CB4B 2HTEA 4HFRA 5LA6A 3ZU3A 1RQ2A 2VL7A 1E7MA 5BN3A 1LPSA 1ZIXA 1R0CA 2BEWA 1G8KA 2ZYHA 1EQ2A 3FW1A 3RKSA 1SCQA 3OQVA 1FDIA 2WZQA 3DZDA 5ENDA 4JOSA 3F6SA 5GY7A 1D4FA 1QNLA 3HJCA 4LWQA 4YFVA 3RC2A 1ZCBA 1WB4A 3AR8A 2FZ4A 4MMZB 1PNRA 4XKJA 4DLXA 4HNVA 3HXKA 3QFSA 3W04A 4DMRA 1Y5NA 2HA4A 1TXGA 2H9YA 1XD2A 2BM1A 3ABQB 1EUYA 1Q50A 1ENPA 2BP7A 4H6PA 1A0OA 3BULA 4M36A 2PT6A 1L4LA 4QDJA 2R79A 4FONA 4NDAA 4JXZA 4L8WB 1T1EA 3UT5A 3RSHA 3FSRA 4B7CA 4C7MA 4CIYA 4PEVA 1KZ6A 4G1BA 4DJTA 1WETA 4NCAA 1X3LA 2QLBA 1U8CB 3ZV4A 1ZNWA 4FC6A 3H86A 1OFTA 3FFTA 4IQ4A 2AKEA 1J7KA 1ZOIA 4RHYA 3VC2A 3TNYA 4Y7CA 2I2DA 3LCMA 1PJSA 1XKLA 3D1LA 1Q1GA 1A9YA 3I6MA 1H6DA 4BGUA 2FR8A 3E1SA 4HBZA 2PSHA 1I2BA 3TGWA 1VBNA 4D43A 1DE0A 1Z16A 3DDOA 5HOQA 1JWLA 3GAZA 2BGJA 5ALLA 5KHAA 2DUMA 1GQRA 2B2XA 4CIBA 3BH0A 1OLXB 1CLEA 1U0LA 4H59A 2H2DA 2O3JA 2V6JA 4BO4A 4WESB 4YWJA 2OBMA 1Y9DA 5IC5A 1DAHA 3LUAA 4F2GA 1OFUA 1U9IC 5CXUA 5EXXA 1MZVA 4PN3A 1NRXA 5TQVA 1PWEA 5KX5A 5EXSA 2K7FA 1BH6A 4MRPA 4RNDB 2AKAB 2QJFA 1VBMA 4O4LB 1YKGA 4X63A 3WK9A 4A10A 5COBA 3TQIA 1JR3E 2X7HA 2Y6VA 1N2BA 3E8MA 3PFNA 3VYTB 4BNKA 4KSCA 3AC0A 4XWTA 1S3GA 3DAGA 3I3SR 4IO1A 4GI1A 1ULTA 4F60A 1BD3A 2XA2A 4UOQA 1N5LA 1YIOA 1QZXA 2CJWA 4GLFA 4RY0A 2R4UA 4DLLA 1NLUA 7AT1A 4MX8A 1KRXA 1NW6A 2IOFK 3INGA 5LXTA 3L8CA 2OV8A 1WSWA 1QYDA 1Z5NA 1GTG1 2FG5A 4MUAA 4OF4A 1ZGAA 2P2LA 5DTIA 3VVLA 3ZDXB 3ZJ5A 2G17A 2YFKA 3KTAB 4IMJB 3USZA 3K1TA 4ABYA 1GO2A 3D5QA 1P1IA 2F17A 2Q6TA 5B1YA 3M4JA 3ZQUA 4HV4A 3C24A 1KOLA 3ZZTA 1XK6A 1R16A 2A4KA 3G0BA 5A03A 3U4GA 5ADWA 5KOJA 3AQ4A 3NR2A 4RA6B 4E2WA 1XDWA 5DT9A 1S96A 4B2IA 4P33A 1I5EA 2BCJQ 2JBAB 2BONA 4NOMA 4KBYA 3W05A 1Y8AA 1YE5A 2DHRA 4AULA 4NONA 3IKVA 4PZUA 5M04A 3K6SA 3KUUA 2IKSA 1KNXA 1CR2A 2EEPA 1AH2A 1JPJA 1I3OA 1T8WA 4WGFA 4MVCA 1JDVA 1QRAA 4GKVA 1QF9A 4EJSB 1Z39A 1YAHA 4LDRA 4RJKA 5A04A 3BTOA 2Q0HA 5C51B 2C4VA 3A70A 3DT6A 1F12A 1PZMA 4HO1X 4O2BB 4XJVA 2OCBA 2H29A 2A1IA 3HCDA 2QJWA 4IYJA 4P36A 2XHZA 2JNWA 2LR0A 4JYCA 2BZ1A 1L5LA 1ZRSA 1MJGA 4QKQA 4YHBA 3AESB 3Q0EA 2YTZA 3BWXA 1A27A 1JSRA 3ESBA 3HLTA 3S2GA 4DLZA 5C7LO 5M34A 4NPAA 4X20B 4H35A 1H5QA 4C7JA 1WZUA 3UV3A 4NDZA 4B5KA 2GXUA 1I33A 1YBAA 2XRYA 2NU9A 3QXJA 5EZSA 1CS0B 4IGFA 1K68A 4A1FA 3LHIA 3G0HA 1F2UB 1GZ3A 2R00C 1WV1A 5F9HA 1B6SA 1QIIA 4YYZA 1N6PA 5A3JA 1DXYA 2EERA 2VJDA 3R5FA 4EUEA 2JLXA 1U8XX 3OG9A 4A0FA 4OQEA 3QW4B 5SYNA 2F64A 4RH0A 4JA2A 4PQYA 1YF3A 1UJMA 1RRKA 3L7AA 1OOEA 2GLUA 3TN7A 1PG0A 3TCXB 4CMJA 4E5SA 2HQSA 4FDUA 1BIFA 5CFRA 4Q4JA 3JASB 2ZR9A 3BKXA 3DHWC 5HW0A 2C9MA 3TJZA 1D7OA 3FPSA 1A7AA 1HEUA 2OLJA 2V7XA 3H5NA 3KPWA 3JAMA 4OFBA 3IUPA 3RYIA 4AUNA 2JLBA 5C8ZA 3S2EA 3AF6A 2H9IA 4PG8A 4WXMA 3C6QA 1IJEA 3Q7RA 1AXEA 2IT1A 1LBSA 1X80B 4P7FA 4BJHB 4CM6A 4GXNA 4I50A 1I24A 4QYWA 2OFFA 3KD2A 2AC2A 2OGUA 4RK6A 3MFYA 4NXNB 5JAZA 2QOEA 1Z4NA 4IWXA 4JIGA 4F06A 3O92A 2PMDA 3ED1A 5AKEA 1QTIA 1SG0A 1CF2O 2I54A 1CWUA 2C5AA 2ORIA 2V9CA 2CNDA 5MF6A 4PN7A 2HRDA 1MQ9A 4UBIA 4F2DA 3IAAA 5AW0A 3V2UA 2C98A 4UVIA 1JIUA 1PT8A 1WB5A 2WF7A 4AS3A 4BGEA 2WWHA 2YX1A 1RXIA 1M1ZA 1X7WB 2ZRFA 3DCIA 4GKBA 1TLFA 1NNI1 3MLEA 4EJ2A 1JTEA 3JQ8B 3I83A 4O5AA 3ONEA 4OXXA 1N2ZA 3KLNA 1KHHA 2H2FA 3GT0A 1ZISA 2NV0A 1M54A 2Q8PA 3D8SA 2Z8YM 3EGXA 3PGVA 2YN0A 5F98A 1SD2A 3DZFA 3PTLA 4KYUA 3T61A 3OZUA 1IIBA 4R1NA 1ZUD1 3LVBA 3WGOA 6ABPA 2RI1A 2NQTA 3Q3CA 3RLFA 4OVKA 2ZJ4A 4F4JA 1U1CA 3TNDA 4QYSA 4BNIA 1D2CA 3GROA 2E21A 1NTRA 1FUYB 5FOWA 4RJIA 3AXSA 3SG0A 3H3JA 1S8AA 3G2JA 2AJ8A 4AYXA 1ZK4A 1R8YA 4V0SA 2AJBA 4DMFA 5GADl 3A1WA 4RTSA 1W36B 4R0MA 3F3YA 1YBMA 3C3AA 4EFKA 2D1FA 4FSDA 4IXDA 4DSUA 1Y98A 2QGNA 2CD9A 3BFXA 1YZFA 4IDFA 4G41A 2J3EA 1UIRA 2CJFA 3W7BA 4ND7A 2VZEA 1SUPA 4HVTA 2GAOA 1IOWA 4KWTA 4BL5A 3GZNA 4E5NA 1OXXK 4CDRA 4QYIA 2Y99A 3A11A 3V1NA 4B4KA 3E5MA 4R83A 5JCXA 4N6NA 3N76A 4KQCA 2P6PA 4UMEA 3GEIA 2XKKA 4C22A 2MSNA 3A14A 3CTMA 4MB2A 3ZU5A 3I2GA 1CUHA 4WLNA 5GAJA 3OEWA 3ADKA 4LBYA 2B4TO 2YBDA 1LPPA 2X9NA 2WKWA 3UENA 1I3NA 3SC2B 1QHSA 2GPAA 4XQ9A 3U26A 1I7NA 3VBEA 3X44A 5AW3A 2NO4A 3IURA 4P3XA 3JWIA 1W581 4FXOA 4B35A 4QC2A 3ZQ6A 4XFKA 2O50A 5EVJA 1E59A 4JX8A 3F1KA 3C3CA 1RC0A 4KIFA 1ETUA 1MAAA 2CWDA 1EG2A 3M81A 4HUJA 2FNAA 3ANSA 3WGGA 1RKBA 3QJGA 1NFFA 3N2GB 3SQDA 2IEIA 1CUEA 1X1EA 2C83A 2YXEA 2YXBA 3H8JA 2W8BA 5A3SA 2IYTA 1XMQB 1MOZA 2IQIA 4KQ9A 4M0FA 3H11A 4UBKA 4CKEB 5LZ7A 4WZBA 4EAAA 4YCLA 1W36C 2GTPA 1TAQA 2WMYA 3CLHA 4CHTA 5E38A 1R0YA 1ZVKA 4RHUA 5BN5A 1E2LA 1YJ8A 5LMZA 2IXAA 3KYCA 4MS1A 2I2WA 2IF2A 1J6UA 1JAZA 1CEXA 3PKJA 4N5HX 3H1TA 3JW8A 3LP6A 5FPPA 1N2XA 2CHVA 2FN8A 4JC5A 4YN3A 4E2ZA 2Q6LA 4RJ2A 3WK8A 4NC9A 4EG5A 1J2JA 1N6HA 3AU8A 3NT4A 1N0IA 2J41A 4IDCA 4MUGA 5LP6C 4CQMD 2W6CX 4NZYA 4JFRA 3MZ0A 4N7BA 1E92A 5AXCA 4DBZA 2V0NA 1RM4A 3AP2A 5KYYA 3QPWA 1VYTA 4C0BA 4TLEA 5CLQA 4IIJB 3NC0C 2Y1EA 4ODIA 3U48A 3QNWA 4Q66C 2N9UA 4UQLA 3HB1A 3Q9SA 1XQ1A 2P9TA 4RCYA 2XVMA 5EERA 4XUGB 1MOQA 1YR7A 1EFLA 4B73A 4W5OA 1JAHA 4RTMA 1SUAA 3FFXA 221PA 3GG2A 4WCDA 2MSLA 4OHUA 1XMOB 1UZAA 5HKLA 2B2NA 4M0PA 3K94A 4OHKA 4KFCA 3P2YA 1DQRA 3P2KA 2FPGA 1QPBA 2ZAOA 2ZB8A 4FS3A 4URUR 3H4VA 4R1PA 2C7RA 1KZGB 2PX2A 1H2YA 1W1UA 2G1UA 4WN9B 1CXZA 5EQDA 3TDKA 5JISA 1S01A 3JYOA 4I1PA 1W2WB 4MQ4A 2NPFA 3KQLA 3L7KA 4LISA 4AYWA 3WJ1A 4FINA 2A9VA 2GN0A 1DAPA 3GIDA 3LH5A 4PZLA 5CYPA 4H0CA 3AZQA 2XSZA 3AEYA 2BRUC 4QUHA 3OU7A 4G0NA 4R6WA 3HGMA 4UBLA 3RK4A 3RYFA 4BKUA 3UWSA 2UUAB 3JYNA 4UDXX 1D8TA 4XVUA 1XRQA 2IYFA 1CC1S 2GA9A 4J7CA 1QFJA 1T3ZA 3KFVA 4CU5A 2C5LA 2CVHA 2VYND 2DBZA 4J03A 3AWDA 5ILGA 5KTMA 2QY9A 3IR6A 2AHOA 1T9DA 1C0KA 1YVRA 1NBMA 3NUQA 9LDTA 4DPLA 4X7PA 4Z4CA 4OIFA 2WOJA 2Q5IA 5BNWA 4YLEA 1P7PA 2UAGA 2C2BA 2V9PA 3IIIA 3MJDA 3K3PA 3F6EX 4ER3A 4GPTA 4EHJA 1ND5A 2BHLA 1JHXA 3CB2A 4KI7A 3EODA 2NTEA 4X90A 5AW1A 2R1TA 1YMUA 4ZAZA 3GRPA 1P60A 4CG1A 3E7XA 3H9BA 4PHTA 2G5TA 3W8DA 1FXUA 5EP2A 3D6HA 1QCZA 1WCXA 3MNFA 3O2NA 3RVQA 3SI7A 5BP7A 5AQ1A 1ORDA 1J8VA 2YH2A 1KO8A 4N82A 3RG8A 5CVUA 5IARA 4DLYA 1P91A 1Z6GA 3EA0A 4GXTA 4HSEA 3UG6A 5JC8A 3SDSA 2XB9A 4HFJA 1A9XA 2JLRA 5I8PA 3AHHA 3GXOA 3K8ZA 1L4UA 4DA9A 1H22A 2QT9A 3ER6A 2HH9A 3EQ7A 1Y4UA 3O4GA 4NE7A 5IM4F 3R8FA 4KW7A 1XTPA 3H1GA 2BZGA 2J67A 4UQPA 5KMGA 3LT5A 1H2BA 1KR5A 5G1PA 3NH9A 3KXKA 3TWOA 3P4UA 2NAFA 4TTVA 5JBIA 2OCKA 3IMKA 4LI0A 1L4EA 2V7EA 1REQB 2HU7A 4RDHA 4S3MA 1T9KA 1U0JA 1TFUA 2R9VA 4D79A 3SVZA 4RTNA 3WGHA 1LRLA 1M83A 2YZGA 1MJGM 2I55A 3A9RA 4IGKA 1G20E 4FYKA 4EQZA 2P9GA 2R7LA 1MDFA 2DFPA 2PK3A 3UMCA 1P1RA 4TQUS 1E7SA 3W5UA 2Z1NA 1IEXA 3H42B 4D3DA 4LY6A 1V6SA 2VSQA 4IFIA 3V9PA 3UPTA 5E1DA 3L6EA 3BCHA 1KQOA 5FLYA 4YV0A 2XEDA 3BXHA 3ECSA 3IILA 4MO2A 2BR4A 3UJ7A 1XHEA 3LIPA 1K0FA 1JR3D 2OLEA 3M3HA 4Z8XA 4CKYA 1JEQA 3OQ6A 1QLHA 4DCSA 1X86B 4B80A 5ERYA 1WUJS 3R2JA 4A6DA 2WLSA 3NXKA 1OYWA 1SOVA 3K0FB 1O5IA 1YS6A 1SOUA 2RJNA 4OM8A 1II9A 2KW5A 4WBNB 1YZYA 3PPYA 2Q1WA 1NU6A 4NH4A 1N4DA 5D87A 4IJ5A 8MHTA 4DLSA 2O2IA 1R8QA 3MWFA 4KN6A 5FR2A 3V7WA 4AD8A 1SCJA 3FHJA 4OI2A 4TV8F 4ALJA 2YHIA 4CVNA 3CX6A 4QLBA 1L8LA 1K63A 4ZPXA 2V3CC 2DLCX 2I3BA 4IQGA 2A84A 1TCVA 4IIXA 3CNQS 3HH8A 3QUCA 2ID7A 1MRZA 5DM60 5KYUB 1UL1X 5K6AC 5LN1A 1JZTA 2NP7A 2ZIUB 1YZNA 4Q3NA 3SXUB 3N8KA 4P4SA 4RIGA 3U9SA 3VOSA 2C7OA 4ADSG 1SU4A 2CLDX 2WABA 2DHEA 2IC5A 1YS2X 2H2IA 1QHYA 1QE0A 3VO1A 4QNNA 3FOFC 3ZJTA 4KQGA 2AJLI 1JA1A 3HJFA 4DDHA 3KZMA 3ROFA 2ANBA 1LDMA 1ORIA 2QRPA 3EZLA 3GJSA 4M1EA 4I0WB 2QMZA 3H5WA 3PXAA 5IYZB 1EX6A 4A8JA 2RAFA 4ZDIA 2OVBA 4B2LA 1N78A 1WHSA 4ZVOA 4GSYA 5LMUB 4QUGA 1MPXA 5EEGA 1LTKA 1ABFA 1TJ4A 3N7UA 3PNYA 1PR3A 1U2RA 3GK3A 1UP6A 1F9EA 2QGZA 5A6SB 2H5LA 3KOZA 4H0FA 1JYFA 4DILA 4YCDA 1AK2A 2OSVA 3WWOA 4JT2A 2Q6VA 2RDMA 3OFJA 4L8LA 5KC9A 3OQOA 1W85B 1AKNA 4MOWA 1KARA 1XZAA 1FNCA 4P35A 5K0GA 5BYAA 2GVDC 1M33A 4LXIA 4QOHA 1EE1A 1YC2A 1EUDB 2Q4RA 1LRKA 1N9GA 2QRGA 3ISJA 3ONVA 3LA6A 4G9EA 4EKDA 4W5NA 3LZCA 3QYFA 3NDIA 1ZM2A 3WAGA 5J5AA 2BD0A 1KDTA 5LDGA 2PFKA 1QJCA 2BLNA 3FH0A 3KS9A 2X8AA 4PBSA 3NT2A 4LY0A 2R8PA 1ZVMA 4YRDA 1PK8A 1OKKD 3D6VA 2A58A 1GUDA 3AJEA 3T9BA 5JD3A 3IBGA 3NYIA 2VXCA 1D6NA 1XD9A 3QJYA 4FEGA 4PQRA 3UCXA 3PA8A 5HIKA 4N9WA 2Y4NA 3BHMA 1L8QA 4NBVA 4L8FA 2X19A 1L7VC 2AC7A 5C52B 1GPYA 3MJFA 1Z5WA 1CVIA 1LK7A 3NRJA 3HVKA 4IV8A 4DOMA 2RMKA 1KXJA 2ECQA 3DTTA 4CDNA 4EI9A 5DNCA 1BAPA 4OYYA 3WYGA 4CKXA 3LWNA 4FDTA 1ULAA 1NQTA 1M76A 2YVAA 2ZUBA 4Q12A 3FYCA 2OFPA 1AT1A 4TWJA 4LKOA 1RYDA 1X8KA 1F4LA 2JGLA 3O0TA 3ZE0B 3CUVA 3I2HA 1DADA 2J4DA 1Y34E 1V3TA 2LWIA 3KVRA 4B75A 5A2GA 5CFQA 4LYEA 4RA9A 4M76B 3VI4B 3T1TA 5DMHA 4Z6KA 4J0FA 4HYYA 3PNMA 3ILSA 3PX3A 4I08A 2QMOA 1E1QA 1JDSA 3B89A 2QE7D 3PFIA 3ZEIA 2Z98A 4DS3A 1DUIA 5A6VA 1J24A 2HN9A 4FKBA 2H06A 2X7XA 5AQEA 1ECLA 2RCNA 2RI0A 4Q4CA 4R7GA 5B57C 4Q3OA 3T3OA 2WE8A 3V8PA 1FU7A 2IYXA 5LM3A 3E22A 4YJ3A 2VJYA 5F73A 4EGCB 2IJGX 5JBNA 3MCUA 3JQGA 3DD1A 3OOSA 1RFGE 1YMVA 2XQIA 1BD4A 3WLKX 4HGQA 2EP7A 4X24A 1RP7A 1KDVA 3TW8B 4B8WA 1JEEA 5LFAA 2C5GA 3BS4A 4MNTA 4P4TA 5TXGA 2C84A 3WWDA 4D46A 3WAKA 2BTEA 4HAXA 3FKSD 4QPZA 1GTRA 4EA6A 2QTAA 2GZ3A 2WTNA 1X38A 4HNSA 1UT5A 3K2IA 3PR1A 4BO5A 2CXPA 4DYDA 4M37A 1WBBA 3SDBA 2BKLA 4JWTA 1L8XA 5CXQA 3WGUA 5EIXA 4AQ7A 4XJTA 4MHOA 4NCNA 2P30A 4GECA 3E2MA 2Y05A 4FMDF 1VZ3A 5DHQA 3I5UA 1H4SA 1D1QA 4MRMB 3C41J 2FHSA 4IMRA 4J8PA 4MYHA 4QOIA 5IJXA 3U40A 4CKCB 1KPGA 5HRCA 4HFMA 4LC0A 3I6QA 5IUNC 1QG2A 1TZMA 3L1KA 3H2ZA 1Y7TA 1NQVA 1MENA 4RHTA 5HXAA 4O33A 4XQEA 4HJRA 2P5YA 5EHQA 4OJQA 1Y1RA 4ALLA 4XA8A 1ZEJA 4RM3A 2WFZA 1KP3A 2WIFA 1B15A 4JJEA 2FK7A 3TAUA 4E4RA 4P31A 3VUEA 2O2YA 1N77A 2UU9B 3QK7A 2B92A 4RZUA 3OKAA 3FTCA 1UBRS 3ZHSA 4UU8A 4TLBA 5F9FA 4R01A 3U7JA 3UMSA 4RZHA 2FI1A 2XF8A 3FI0A 4RFLA 4D57A 2FFHA 3QKRA 1OI4A 1E6CA 4JLSA 1P1KA 2WINI 3ZWPA 3DEIA 3L7LA 4KQHA 2FLWA 4DSOA 1E3WA 1L1EA 2K87A 4KGZA 2PS0A 2O5CA 2QVCA 3HWSA 1E1YA 1CQJA 1Y8CA 1ZH4A 3KVYA 3HP7A 2NTVA 4KMMA 3ADPA 1ULBA 1Z25A 4ND5A 3OMXA 1KEPA 1WHTA 1PYDA 2D2FA 4O3MA 2A14A 5FI5A 1G66A 2ZT6A 3CRQA 3MHPA 1UEIA 2PWBA 4XH9B 1YCHA 2O8BA 4OY3A 4PRYA 1IMJA 2ZM5A 3ET4A 3DYBA 4KI0A 4D82A 3LMKA 3PZRA 3P9ZA 2C2ZA 2GK6A 3PBKA 3PB3A 4M1OA 4MW4A 2GRJA 4QQFA 5AOBA 3SZOA 2XZDA 3O2JA 3OETA 3RVRA 4JI1B 5KVAA 1WXXA 1PJCA 3K4PA 2I7VA 3LX6A 5I7AA 1J0CA 3U7EB 1TEVA 1U2EA 4L74A 4AIIA 1SUDA 1DWUA 1DAGA 4MYCA 4L1KA 4QUIA 2BDUA 2CF6A 4D1YA 1YJQA 3INYA 2LDBA 1L5KA 4DJAA 2GJAA 1SB9A 3D4OA 4KN5A 3E9DA 5FUQA 1H6BA 1XSEA 4W5WA 5JWHA 4EG6A 4Y2UA 5MN4A 1MB9A 4GMGA 1U7WA 3QZUA 4TTRA 1P39A 2FP3A 5HZHA 3L4KA 3HA2A 2Z43A 4XDYA 4PRLA 4DSAA 2I2FA 1PTJC 2I29A 2ZRKA 1MJNA 1XYYA 4PRKA 3FBTA 4TZ6A 4QU8A 4C0KA 4PG7A 3IV6A 1RWXA 1YA8A 2C2XA 1D2NA 3GGPA 3KZKA 3N74A 4C43A 3OM1A 2YIMA 3U4AA 1WCYA 2KYRA 3GGJA 4ZTUB 4FHZA 1U5AA 3VHRA 1H2AS 2H2WA 2GNAA 4HMOA 4XQCA 2AOXA 5TJ9A 1ZH8A 1GYPA 2FP4A 3QUTA 4L50A 4AWBA 4F4DA 1LSSA 3L4JA 1OVMA 2IBSA 2ZIWB 4RW0A 2DFLA 3MTBA 4HMPA 1DG3A 2LZ0A 3GLGE 4JXJA 1OWLA 1F5NA 3WIVA 4BS9A 5AW6A 1SXJE 3G5TA 3ZR4B 5K8UA 2ZDQA 3F47A 3OHSX 3N6RA 3O4FA 5G0SA 4ZCIA 5GIOE 1H3EA 2ZQZA 3DFKA 3M1YA 1W49A 5AMXA 1GUZA 3SD7A 3DYVA 1UXOA 4BAGA 1PJ3A 4LPSA 4WXPA 1P29A 2ZAGA 3G2QA 5EXEA 1T5TA 4JA0A 3OHPA 3N0WA 5G02A 4AMYA 5C5IA 3S27A 1JFSA 1P9NA 1F8GA 3DEZA 1V11A 3BIJA 2NLOA 1SPBS 4H31A 2YKGA 2PWAA 2ZJYA 1QAMA 1YKSA 2HO5A 3CJRA 3FTQA 3IQZA 1QZUA 2VPTA 2VSXA 2Z5LA 4WNYA 5CJJA 4S12A 3L0SA 3WISA 3EPHA 4OMCA 2QAGB 4W5JA 1D8AA 4M7PA 3WZLA 2IZ0A 2NSHA 1J0XO 2O6LA 5E3IA 4ITUA 1XAGA 2XZTA 1BHJA 2AQ8A 4QO8A 1PLJA 4KXUA 1MCZA 1NYRA 2Z83A 3PF8A 4B31A 5LL6P 5HA5A 2M98A 3VPHA 2Q6OA 4B44A 4S05A 3V8BA 2FHPA 2G40A 3KR0A 3LQ4A 4WN3A 2X0EA 1RD4A 1MO2A 5FBKA 1XELA 2JFGA 2XMSA 3KCQA 4CQMB 1E5VA 1L5MA 2GF2A 4R69A 1S8FA 2XDQA 3DL0A 4MUKA 1GLVA 2Q9AA 2NUAB 4G65A 3MF4A 4M2LA 4WZAA 4E46A 4YP0A 2TRSB 3RTGA 2ZPTX 3B1ZA 1OILA 2AZDA 1SVIA 1IY8A 2B61A 3RHSA 3MWGA 1ZXLA 1R8JA 3VZQA 3KVVA 3AUTA 4NBTA 3EC2A 3WL3A 4LSWA 4MW5A 2YWRA 1XLVA 2OD7A 2NYUA 4JLNA 3O26A 1Z0DA 2JH9A 1LTHR 3LCVB 1ECBA 4QM6A 1POWA 2ATEA 4KAAA 4XQ0A 2J0QA 1DFIA 1ZMOA 2C7BA 1QCDA 1XNHA 3T7KA 5KTTA 2QAGC 3FPBA 3DEFA 4DLVA 3AUKA 4Q24A 2OBNA 4DCVA 3WA6A 2FN7A 1PSDA 4G63A 5AW7A 4NPCA 3ZCVA 4E4YA 1DO0A 2ZI7A 1JFFA 4TUYF 4K40A 3FDFA 2R6CA 3AINA 3R6GA 3ZWDA 4UTVA 1GGKA 2AYYA 2EOAA 3AFOA 2EKBA 4XYBA 4DJFC 1WUIS 3O91A 3CZCA 3OQPA 1U0OC 3KOMA 4IY1A 1XZEA 3PUHA 4WLVA 3TMKA 3M83A 1Z4LA 2E4VA 4E3WA 4ZEOA 1DEHA 5CGQB 4BO8A 2MCFA 1TM7E 4GNRA <