3OIWA

H-rasg12v with allosteric switch in the "on" state
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oiwA00
4Q19A 5CK5A 1VIAA 2IYZA 1W4CA 4DKXA 1F5NA 1IBRA 2JLRA 2HCJB 4F4IA 1NVXQ 4HLCA 4TQ9A 2YINC 2JATA 3FMPB 3HPQA 3U4QA 4HAVA 1ZNZA 3WY9A 2ZI3A 1NMZA 2HLDD 1FX0A 1KDOA 4DB2A 2GDJA 1IAQA 2XNDA 3B8HA 2KBEA 3GLGB 4HZIA 1F6BA 1QHIA 2BMDA 3KXLA 1P6XA 2PZEA 4A92A 2DPXA 2JLVA 3SU8A 4JKYA 2REXB 4DRZA 1GNPA 1XP8A 2GTPA 3CLVA 1BOFA 3OAAD 1Q1ZA 4LGMA 4M2LA 3DEFA 4JJKA 1TEXA 4Q4HB 3A1VA 5JEEA 3DZDA 4OJKA 4V0OA 3F5FA 3GD7A 5FUXA 5FTMA 4R2IA 1OXVA 4BLTA 1E2NA 2WZQA 1KI4A 3HR7A 3Q85A 4O2LA 4QGFA 4TTRA 4G0NA 4U02A 2H16A 2WKRA 4C2TA 2YWGA 2QNRA 4N3NA 4TMTA 2H57A 2VYFA 1C1YA 1KK2A 4PAOA 3QI2A 3SYNA 4X8LA 2F55A 2C96A 5E7IA 4ASUD 1R4AA 1CR1A 2DR3A 5L8VA 2XITA 2FSFA 2ONKA 1NVWQ 3P32A 1KAGA 4IFEA 2IUTA 3B2EA 1CR2A 4LHYA 4QHTA 1T6NA 4DVGA 1DELA 3VKHA 3QXSA 4RSGA 4BEBA 2QORA 2ZYWX 3RS7A 4PPGA 2EWWA 3T12A 3HYTA 5FOXA 4BLOA 2ZJOA 4Z8XA 3V4FA 1KK1A 1R5NA 1Q1EA 2AHOA 4PANA 1BMFD 1ZMXA 2OEPA 3RS3A 1G3UA 3AEZA 1TNDA 1SXJA 1DOAA 3MCAA 3W6PA 4AG5A 2I1QA 2QMUA 4AK9A 1M7HA 3K53A 4DWJA 3K0FB 4URUR 3B60A 3JVVA 4BPBA 3ZD6A 1S4QA 1HY3A 2KE5A 3KKNA 2ZRBA 1XD8A 3L2OB 2CLCX 2O8FB 2WPDD 1DS6A 3K09A 1XPUA 2WJHA 2GEUA 2IT1A 2ZVQX 1DARA 1MABB 3DVLA 2MSEB 4HAUA 3NTUA 4M1TA 4DCNA 2XOKA 4US0R 3T1VA 2D3WA 2BCJQ 3ZDQA 3WNBA 2ZR9A 3CO5A 1T8UA 1ZC4A 1R7RA 3EZ2A 3WNDA 5D3QA 4AG6A 2ZI9A 1DADA 3GJ0A 3RHFA 1I4TD 1PLLA 4Q4AB 4MH0R 1EFCA 2RGBA 1S9DA 2YOHA 1X1SA 3NDBB 5KPDA 1V43A 2F1JA 1P2TA 1S9HA 4TTPA 2EVWX 1VCIA 3KUCA 1BYIA 4EIWA 1JECA 1SVMA 4HLQB 3BS4A 1G8FA 4BLQA 2VIIA 3THWB 4ZI2A 3EPHA 3M4YA 2P2LA 3VU9B 1ZUIA 3JZMA 3GLGA 2QBYB 1XXHE 2WHXA 4KFRA 2BHRA 2QENA 2HT6A 4EPYA 3SEAA 4C0LA 4QXAA 4E5UA 1L2TA 3RS2A 1JI0A 1YZTA 3A1WA 4PHTA 2OCBA 2V6IA 1EK0A 1OPXA 4K8OA 5EP1A 2IYXA 3F3YA 3HR8A 5G3ZA 3R7WB 4Q4HA 1DAIA 4Z8YA 4PC3A 2C77A 2NO6A 4PO1A 1T91A 3KXKA 4DZZA 3RABA 3K8YA 4PSKA 1FFHA 2FA9A 4BFWA 3N5CA 2P6NA 3GLIB 1NBME 4OQFA 2PZFA 4RZ3A 1N5IA 1XBTA 1ZP6A 2OZEA 3CIOA 3I3SR 1GP2A 2BKUA 1PJRA 5AWFC 1AA9A 1IXSB 2PLFA 4A1FA 3ZD7A 1XEWX 2BM0A 2VSXA 3EXAA 3V4RA 2ZYTX 3EWAA 3CWZA 1Z0KA 5JFGA 3SJBA 1J90A 4XD7A 1TPZA 1U0JA 4Q4JB 1HV8A 3LAWA 3THYB 3BERA 1P3JA 4NCJA 4V0LA 3LQQA 4CIDA 1NLZA 2H8KA 4KI0A 3LV8A 3K0FA 4QJ4A 2CNWA 4RD1A 5TXGA 5CLQA 5B30A 5AUOB 1KI2A 1DAKA 1N6RA 1E9DA 2WWGA 2V1UA 1T0JB 3B82A 2O8FA 1W0JD 2V9PA 2ZTSA 3VHXA 5EP3A 1MABA 1NY5A 1NG1A 1MT0A 3IEUA 2PH1A 5J40A 5JJIA 2WV9A 4TTQA 4O0MA 5KSPA 5TY0A 2QP4A 1Q1QA 4RKFA 4C7OB 3NH9A 1NBMD 5FOWA 3DM9B 1N0UA 1K5GA 4ZI3A 3W9YA 1KI6B 4H1VA 3P4YA 2NO9A 1KAOA 3DOFA 4ESHA 2IS2A 1SULA 1P73A 3U2QA 4DLTA 2F9LA 1E96A 3OEEA 5HZHA 3HP1A 2PX3A 3GEEA 1G5PA 4WAUA 4URWR 2YVUA 1UEJA 3D31A 5FL3A 3BGWA 3THWA 2DFKB 2JJ2A 2ZS9A 3VU9A 3EZ7A 4DUGD 3ZS9A 2QBYA 4CEIB 5K8TA 4OHYA 5HPYB 2Q9BA 3KUDA 1Z47A 4OHXA 3W3ZB 2QE7A 2G1KA 1G8GA 1PZNA 2CBZA 2FGKA 4Q7MB 2VTKA 1Y63A 4TMVA 5EE1A 3UMFA 2X8AA 4GOJA 3GJ8A 1W0KD 2RGGA 1X8JA 3R20A 1XMIA 2EW1A 2R6DA 3R7WA 3WYFA 3BAFA 2OBLA 1QRAA 3CPHA 4EPXA 1KMHB 1ZJ6A 2O0KA 2VBCA 1R5BA 2GJSA 4LHWA 1JB1A 1TF5A 4RZ2A 5EUQB 4ACBA 2C5LA 4OQNA 1JQLB 1DAMA 2EYUA 2YC4C 2H7VA 2RAPA 3X1DA 3VFDA 1KJYA 3GLIA 5HKKA 1U9IA 1TUEA 2WJIA 4Q9IA 1L7VC 3I5XA 5DO9A 4NH0A 5FOTA 1Q3HA 2AK3A 3RLFA 1ZYUA 2A5GA 2ZR7A 3CRVA 1E1QA 4BLSA 1XTQA 2V55B 1ZM7A 521PA 2FZ4A 4PFSA 1CLUA 4CDGA 2CE7A 1U98A 2YNMA 3B6EA 3PUVA 3WYAA 4TMXA 5KNBA 2VHCA 2QP9X 1A1VA 1Z29A 1PVOA 2IS6A 4Q4JA 3I5YA 4GPTA 1KYIA 3H1TA 4UNQA 4NHOA 3M6AA 3TR0A 4TYWA 2Z5FA 1P9RA 2QGNA 2WMNB 1QHYA 3GFPA 3PR1A 4M1OA 2EFEB 1OSNA 2SHKA 2WJYA 5FTKA 1AGPA 3QBTA 1KDTA 3P27A 3P26A 3T5DA 5AUNB 1XTIA 4LZZA 5J5CA 3B9PA 1WCV1 4M1KA 1Z07A 3NKVA 2WJGA 1HH4A 4B74A 4BFUA 3KQHA 4C0AC 1G20E 4PSVA 4CW7A 4Q66C 2CVFA 4O2RA 4BFZA 4C0SA 1HYQA 4D0NA 3OEHA 4UXIA 5AUQA 4IDHA 3D7MA 4AY2A 1AN0A 4C3ZA 8OHMA 4FI3C 2CK3A 2A5FA 1G16A 2FEMA 5IT5A 4BLPA 5E7JA 3QEOA 4C7OA 1HT1E 4PHGA 1WMSA 3GQBA 1G6OA 1RW4A 2O0HA 4Z54A 5KSOA 2PT7A 1VG0B 1JR3A 3T34A 1KI6A 4TMZA 1K6MA 3NBYC 3I62A 1EFRA 1O3YA 4OHWA 4DJTA 4F4CA 4FN5A 2C98A 2D74A 2GWHA 3NC0C 1MO5A 2JDIA 3RVBA 4AC9A 3NDPA 2QTVB 1QZXA 2H5EA 2EYQA 1OH7A 5IDVA 1E2JA 4FXPA 2H17A 4HAYA 3LVQE 2PX0A 4RD4A 1QG4A 4B3BA 4URZR 1OXSC 2RGNA 2O0JA 4NBSA 1G41A 1G7CA 4B73A 1FOEB 3MGCA 4CEIA 1KKMA 4ZCIA 2KJQA 1W5SA 1Z06A 4JLVA 4L5BA 5GJCA 3OIWA 1UPTA 4EPWA 2B21A 2WSSA 3CPJB 1R2QA 4QGAA 2IUUA 3AUYA 1Z08A 2FEOA 1Z0FA 2VL7A 4W9MC 4WZBE 4A0RA 4EJSB 2WOJA 4CEHB 1KMHA 1SVOA 2RGCA 4LPSA 3G5UA 1J99A 4BE7B 1UEIA 4C2UA 1JAIA 4FWIB 1RZ3A 3B1VA 3U3JA 5JSZB 1LF0A 4GT1A 4PQRA 1FTNA 3IIJA 4EKDA 1E0KA 1N6PA 2GVDC 2BM1A 4HDQB 2QM7A 3DZ8A 5BQ5A 5LB4A 3LW8A 4UNRA 5KYKA 3BC1A 4D4JA 4BWYA 3H0KA 4I4LA 1J2JA 3VKWA 3KQLA 4C0HA 4MUBA 4KVAA 3QG5A 4Q1CA 2XTNA 4FCTA 4A0HA 1A2KC 1E2PA 1XCPA 1IY1A 1G4UR 3RC8A 4DLYA 3FE2A 3LNCA 2REOA 3ASZA 3QUSA 2WWFA 2CHGA 4LC1A 4RD3A 1R8SA 2BBSA 2F3RA 4IDQA 4Q7LA 4LBZA 2ORWA 1NJGA 1J7KA 3EZ6A 2ZEJA 3H4MA 3EPKA 2W6IA 4PPNA 1CULC 3SZRA 4EPRA 1XB2A 4OKSA 1MRNA 4NCHA 4KFSA 1DPFA 1A82A 1X3SA 4NDZA 5CDFE 2MMCA 2Y8EA 3ADKA 4L16A 3L43A 5GJWC 2XXAB 3K9NA 4NYIR 1Z0AA 4FIDA 1CP2A 3AGPA 4MGZR 5FR1A 2YZ2A 4IKEA 2E9SA 1ESMA 3A4LA 3EA5A 3QJYA 2ZU6A 4I1VA 3C7KA 1JPNA 2W00A 5J4VA 1TL7C 2GF9A 1RRGA 4QKQA 2PEZA 3BXZA 4M1MA 5TVKA 2R6CA 1XJCA 4L9SA 4EDHA 4A9AA 4G1UC 5L3QB 1XEWY 3FMOB 5LBIA 4DLRA 1N2CE 4F91B 2HF9A 4BZPA 4HAXA 3KKMA 4LV8B 4Q1DA 4BZQA 1Q12A 3VR2A 4Q01A 4LHZA 2RGDA 4D2IA 3V9PA 3ZJYA 2ZSFA 3TSWA 1II0A 4US1R 2OM2A 1SHKA 3GLFE 2NO0A 1OW3B 1KSFX 2QQEA 3KDSE 5HCIA 3CF0A 3GP8A 4PAQA 1OB2A 3IKJA 4KHZA 4EJSA 2FN4A 4CEHA 4TT3A 3L0SA 1Z6XA 1GOTA 2AWOA 1X1RA 5GJBA 4EFMA 2ZE8A 2YWHA 5JRJA 4RD6A 4HYYA 4LOAA 5JSZA 2ZR0A 1OH6A 3FHTA 3NVAA 2ZSEA 4JBXA 5CK4A 5DHFA 2GBLA 2BEJA 5FR2A 1T8TA 221PA 2GF0A 3CH4B 3QPUA 3KX2A 1Z22A 4JLOA 4Q47A 3RYTC 1ANKA 2ZJ2A 1VG8A 4AKEA 1E0SA 5AJXA 1G5RA 4G5QA 3AGQA 1E9FA 1G19A 3BFVA 4Z51A 2RHDA 4OK6A 1OYYA 3K70C 3Q8XB 4V0KA 4F92B 2HCBA 1AS2A 1MR3F 1NSTA 3QIAA 2QI9C 5FL7A 3IHLA 1FPMA 2NMVA 1Q44A 4M22A 1R5OA 3Q7PA 1OV4A 4MGIR 4G5OA 2FG5A 4F7WA 4R9UC 3ZYCA 1YVDA 5GVRA 1IXZA 3PEVA 4QC2A 1WB9A 3KJGA 3IHWA 2J1LA 4DLXA 1TF2A 4URVR 5P21A 3AF4A 3SE0A 1E2MA 2HDNB 1KHTA 4TN1A 3VTKA 2AK2A 2ERYA 3GJ5A 4KITB 4TZ6A 1G5TA 2GRJA 2IYWA 4G5SA 4HB3A 1JJVA 1NMXA 2XXAA 1D2EA 1HTWA 2W0MA 1SHZA 3RANA 2Z4RA 4EUNA 2JIZA 2HYIC 1MV5A 1W2HA 4TYQA 4DSUA 4KO8A 1ZIOA 3A37A 4JVLA 1XWIA 2OFWA 3VAAA 4QM7A 5A0FA 1HT2E 1AKEA 3RAPR 5L3QA 3DMNA 3CBQA 1P5ZB 3DPUA 4K46A 3SDZA 4URYR 4QBFA 4Q1BA 3TKLA 4OQMA 2VHJA 4B76A 3KJIA 4LYHA 3ZVNA 3CZQA 4Q48A 4LDJA 3NHAA 2IXEA 1KO4A 2ZU0C 3CRRA 4K81B 3GFTA 4GOKA 5EUMA 1XPOA 1F2TB 1XJ0A 2WMOB 4XVUA 3UWOA 4TSFD 1OKKA 2MSCB 2ORIA 4DSOA 1YR6A 5B64A 1AKYA 2YWEA 3K9HA 3A58B 2H1LA 4GZLA 3FHOA 4D6PA 2XGJA 1OF1A 3TH5A 2IL1A 3R9XA 3H84A 2IS4A 3NEJA 2O8EB 4JYBA 2F7SA 2QAGC 4NZYA 2ZITA 1RJ9B 3L0OA 2Q21A 1G3IA 2PT5A 3BBPA 2PJRA 3U7EB 1GL7A 3FB4A 5DYIA 2NIPA 2QA5A 5SZIA 3Q5DA 4LY6A 4UKDA 5GVSA 4LHVA 2Q3FA 1IY2A 4LSGA 4RZUA 1RC8A 1OFHA 1KZGB 3LLMA 4B6EA 5BWMA 1P62B 5BW8A 1TQ4A 4CT4B 4TLEA 2XZLA 3I32A 2CJWB 3GMTA 3CF6R 1PLJA 3TJZA 4BZXA 1O87A 2EWVA 1SZPA 1T3SA 4G01B 5H68A 2IHYA 1U0HC 1E9SA 1I2MA 1X6VA 2XTZA 2C9CA 2YOFA 1KKLA 3B13B 3KB2A 3RRYA 3TUJC 4TWZA 4C4PA 1XF9A 1GTVA 2JLQA 3UATA 3T35A 1W36D 2BKEA 3U3MA 4A0FA 1GVNB 5FPKA 2NO7A 2UKDA 3SOPA 2J0SA 2ZAMA 1GIAA 3LH5A 2WKQA 3NBZC 2ZUBA 1XDBA 2QROA 5DN6D 5H70A 1KMQA 4I81A 2J0QA 4UNNA 1E0AA 4AWXA 3W8NA 4XVQA 2XEXA 2FFAA 3WRXC 3SQWA 4O25A 1CU1A 2BCGY 2DFNA 1RRFA 4XJXA 1H8EA 3NBXX 3VX3A 3U61B 5J4YA 4C0JA 2V7QA 3ZGXA 5JLJA 3FKSD 4ILEA 3WYGA 2J41A 3J81k 5JECA 5CYPA 4ZV4A 1PUJA 3PVSA 1W2GA 4V0MA 5AK0A 2FFHA 5JBQA 2J7PD 2UZ3A 3N2EA 5DIFA 1F2TA 2IX3A 1D9ZA 3BE4A 3CNLA 4JJZA 4DDUA 1XCMA 1KSHA 4IOJA 1R10A 2VHQA 3TUZC 2YV5A 3W8RA 2ZI5A 1S3GA 1GNRA 1H8HA 3BH6A 3OESA 3THXA 3RWMB 2ZJBA 3SYLA 4N0EA 2Z0MA 1NSFA 2YJTD 3P20A 1M34E 1JJ7A 4B32A 1ZIPA 4P32A 2O8EA 2ZRNA 4PTLA 1E9CA 2W0SA 2RHMA 4YMWA 1RJ9A 3QXCA 5FPYA 1DAHA 2AL7A 4MITA 5G40A 2V4ZA 2FF7A 4LJAA 1QF9A 4C30A 1TTTA 2F3TA 4QL3A 1VIYA 4HLUC 1ZCBA 2OG2A 1Q57A 3PEUA 1AS3A 2R6FA 4US2R 3DOEA 5KU1A 1II8B 2JLUA 2G88A 3ADBA 3DDCA 1GKUB 2CJWA 3UANA 1UM8A 1U90A 1G6HA 4X8HA 4D0GA 4D81A 1NN3A 3K0EA 2CHQA 4U5XA 1AZSC 1IJEA 2HXSA 3REGA 2NTYC 2OUKA 2D2FA 3K70D 4JLPA 1XRJA 4R2HA 4D4LA 1AQYA 4HSEA 2GXUA 1E3MA 3QF4B 1VYTA 1TAGA 1G3MA 1ZNXA 1XD9A 2OILA 4KFTA 4GP7A 5ELXA 3TVTA 1Z6AA 2NPFA 5JI3E 3ZVRA 1W4BA 3KTAB 5DHAA 1W4RA 2GESA 121PA 2F9MA 2ZROA 3FFAA 3WP1B 1ZD1A 621PA 3OFNA 2IC5A 1SGWA 1IY0A 2FMXA 5FOUA 2GNOA 1FNNA 1N0WA 2Z4SA 3VX4A 5H8WA 4B3GA 4PO8A 4C0KA 1Z83A 1ZAKA 1M8PA 1AQUA 2Q6TA 1UBGA 2OCAA 3MUFA 1XTSA 4DCTA 3WMEA 4DXAA 1FP6A 3QKTA 4A15A 1OHHA 2G77B 2JASA 2G9NA 5AR1A 4V02A 1NN5A 3G0HA 4Q02A 5TMPA 1JXMA 2CL6X 2Z43A 5EQTA 4Q00A 1UAAA 3U44B 5DISB 5LD2C 5IK2D 2JJ2D 1XCGB 3HWSA 3HJNA 4JLBA 3VQTA 2AFIE 3VNVA 4GFDA 3EIHA 4RD0A 2ZRDA 1TQDA 2HLDA 5TDHA 3SQXA 5CM9C 4WZ6A 1G17A 3AKCA 2J59A 1D6JA 1R0ZA 2ECKA 4IVPA 1CRQA 3QXJA 4PPQA 3ZZUA 2GEVA 3UG7A 2MSDB 5DNYB 1COWD 1OFTA 4B3FX 3A36A 3NWJA 4B3XA 4IDPA 3AP3A 3OAAA 4ZIRB 3K1JA 2ODEA 4Q1AA 4I1OA 3FFBA 3AH8A 1EWRA 3HU2A 1CBUA 1M2OB 1JR6A 4WIAA 5C18A 1IOZA 2P6RA 1ODFA 2QAGB 2XJ4A 1Z28A 3ZIAD 2P5SA 4NMMA 4MKIA 1E79D 1LF5A 2DWQA 2HXYA 2G0NA 5AJYA 4HZUB 3BORA 4AYXA 1K5DA 1NY6A 1T3HA 2CHVA 4ASUA 5DYGA 4N0DA 1WBDA 3RRMA 3UMRA 3QF4A 1RYFA 3IEVA 1N6KA 3I92A 5EP4A 4GOXA 3X1XA 4A6XA 1D5CA 2TMKA 4KYIB 4WXRA 1JQJC 1UBCA 2C8VA 3GLHE 2FU5C 2A2ZA 2BOVA 1Z6GA 2ORVA 5CIWA 4A8JC 4NL4H 3RWOA 3R9WA 2WIAA 3PENA 4H1UA 3KTAA 4LJ5A 4MRNA 5FUYA 3EC1A 1II9A 5HCNA 2ZRMA 3QG1A 1RYHA 4DT1B 5JEDA 1BMFA 2DFLA 1QHGA 5EP2A 1XXHB 5IHPA 4ESVA 4AYTA 1Z0DA 4KODA 1NI3A 4B6FA 1GWNA 1UKVY 3CX6A 1KO8A 4E03A 2J3EA 1GNQA 2BC9A 3PIRA 5FBLB 1VDZA 2BMJA 2WPDA 3B7GA 1OT3A 3AF1A 4B3DA 4UXJA 4Q4AA 4PZYA 3MJRA 2DFTA 3EASA 4POAA 1N25A 1DBSA 2BDTA 2GZDA 4ZDIA 2QAJA 1KY3A 1MKYA 2VQSA 2FFQA 4F38A 4DCVA 2ZREA 2HEIA 3QBVA 4XOIA 3Q9LA 2JDID 2GXSA 4B47A 1HA3A 1MO4A 1E98A 4F93B 2VF8A 4P0TA 3SC3A 3U44A 3S1AB 2PL3A 4AD8A 1J8MF 4HAZA 1X8LA 2B8TA 4LJ4A 4TLAA 3LBIA 1IHUA 1JALA 1HUQA 1RRPA 2QRZA 4RZXA 4CF7A 5KHOC 4B2LA 4I99A 1IN7A 3U5ZB 3RS5A 1TF7A 4E22A 2CDNA 1WXQA 5AJWA 4FMDF 2RGXA 4R71A 4H9GA 4MA4A 3B85A 1ZUNB 1N5KA 2V54A 4WZAE 2IYTA 1Y3AA 2OCPA 1GL6A 1LVGA 2N46A 3MWYW 1KSGA 3P4XA 3REFA 1KI8A 4YONB 3CR7A 4ZIRA 4OK3A 1KO1A 3DM5A 3P1JA 3NEYA 1LV7A 4P4TA 4XTRA 4DLVA 5JWHA 5FBWB 2W6JD 1WRBA 4LPKA 4FCVA 4GL2A 4JVNA 1T9HA 3CB4A 2QAGA 3R9IA 3IPYA 3O8RA 3F8TA 4PR0A 1UFQA 4BQSA 4G3XA 1VPLA 1Z3IX 3LBNA 4HATA 4HZUA 3THYA 1SKYE 3B1XA 1FTSA 2A30A 4ZCLA 4UJ5A 2OO7A 2WJJA 4Q1EA 3QOFA 3SI7A 3TSZA 1XZPA 5J4LA 5CYOA 3PFIA 4D82A 3FMFA 2QPAA 1T4GA 2I4IA 4JLJA 5C1BA 3IBGA 1GM5A 3UG6A 2F1HA 3FVQA 3GJ4A 2OCYC 1Z2CA 1D9XA 5HR5A 2AD5A 4DT1A 1NNEA 1EX6A 1E9BA 2V8OA 2N42A 4BECA 4LJYA 1DEKA 1KY2A 3PUXA 3TGPA 1XXHA 2WM9B 4B2PA 4TYNA 4HUTA 5EE5B 4OL0A 2NO1A 4NYIQ 1G8PA 4PAMA 4I1UA 3EC2A 1HEIA 2EFDB 1YR8A 3A1UA 1W0JA 3ZQJA 4P4SB 4U7DA 721PA 5KNDA 3EZ9A 4DLUA 4NYJR 4KAXA 2DCUA 2XSZD 3IIKA 3FOZA 1BIFA 1E9AA 1G18A 5L3SB 3LWNA 3T1QA 5F98A 2IW3A 3L82B 1L8QA 2ONJA 4B35A 2E1RA 4XWOA 1NBMA 3KKQA 3RSOA 5CITA 2PMDA 2ZI6A 1KJZA 1T5LA 1GKYA 5CLLA 3PXGA 1GAJA 1TX4B 2VEDA 3EIEA 1Q1BA 3S1AA 4BUJA 3VR3A 1ESNA 5TB5A 2K5UA 1JAHA 3RS4A 2GXQA 1G7RA 2AKYA 1X8KA 2QPTA 4DC9A 2GAOA 1P60A 1ZC3A 2D2EA 3I1FA 4OI0A 2PZGA 3T1OA 5A4JA 4DUGA 1XMSA 2DBYA 5G53C 3UK6A 4JZKA 4QG7A 4KU4A 3EPJA 4QHYA 3CNOA 5JRZA 5DE3A 5TARA 4A36A 1GRNA 3CX7A 4RCYA 2W2XA 6Q21A 3LO5A 1E69A 2CLDX 4IOKA 4MRVA 3DKPA 2J0VA 3PEYA 3FYHA 1BH2A 3O8BA 1NIPA 2JAQA 1UADA 4OQLA 2ZS8A 2O5VA 2ZJ5A 3TLXA 1ZD8A 2P5TB 2R8RA 2OESA 3C41J 1E0JA 2F6RA 2ZXUA 1M6NA 3N70A 5FI0B 1U8AA 1QG2A 4ZDWA 2OV2A 1E9RA 3ND9A 2P3SA 5FTLA 4ITRC 2OBNA 2IF0A 2ZRIA 2FNAA 2CCKA 1W36C 1G1MA 1VTKA 2KSQA 3GFOA 5FPHA 4DDTA 5EJEA 4URXR 1OYWA 3X1WA 1XJQA 3QE0A 5DLQC 4KVGA 3KQUA 3FPAA 1BKDR 3QF7A 1KDPA 2C99A 1AK2A 2OT3B 2WJVA 1E2DA 3K09C 4QBIA 1OB5A 1KTVA 1CJMA 4CYMA 5TV2A 2HJGA 4YMVA 1Q22A 2XZOA 1OE0A 5C46F 1W47A 3T15A 3QKRB 5E95A 2BJWA 1IN6A 3E1SA 4A8JB 2FH5B 2C78A 2GK6A 3NHBA 4CRWB 2QY9A 1N5LA 2OAQ1 2XB4A 2OSBA 1KSJA 5JS7A 4X8OA 3TMKA 1KZ7B 2GCOB 5L3SA 2G83A 1YZNA 4CZ2A 5A5GA 4PO9A 1MH1A 2X2FA 3AKEA 4NYMR 3W5JA 4JVMA 1EFUA 1IONA 3C15C 3TUIC 1XNJA 3KKOA 3KFVA 2OFXA 4FMBB 3QENA 1G7SA 1I4LD 1IN5A 3HU1A 3SS8A 3VR1A 2QSZA 4IDNA 3WMFA 2R44A 5KPJA 4BEJA 1G291 2C95A 2C2HA 2XTMA 3BK7A 2WICA 1V5WA 4J0QA 1CJVC 2IYUA 2AXNA 1Z63A 2IS1A 3TBKA 1W49A 4KV9A 5AJZA 4BFVA 4QM6A 1XZQA 4M0LA 1C4OA 1VMAA 5K8UA 3OE7D 1MRSA 1OXUA 3CRMA 3ZVLA 2JJ1D 4B75A 4TZ0A 4TL9A 2OXCA 1E1RD 5KTYA 4HB4A 1UDWA 1BYUA 3FKQA 4YMUA 3ZS8A 3RDPA 4WBSA 1CR4A 2UZIR 3MMPA 4B71A 1Z8FA 4D0LB 3A1SA 4S2EA 5K8LA 5EE0A 2ZETA 3LW7A 2ASEA 3MRSA 3QVUA 4JLNA 4UQOA 4YMTA 1E99A 2WWWA 1W7AA 3C5HA 4KFUA 2R62A 1NF3A 2ZQ5A 5DGXA 2QMHA 2IA5A 2RCNA 4DLSA 4LV5B 3LBHA 3QQ5A 1ZNYA 5SZKB 2IXGA 3AP1A 2FPKA 2DWOA 2IYRA 3SFZA 4DIDA 4EFLA 3TIFA 1TEVA 4Z1MD 3VR4A 4TMWA 5JI2E 4M1SA 2ZSBA 3WRYC 3T1TA 5AUPB 3K0CC 2V3CC 4ZDJA 2FSHA 3BJIC 3C8UA 2J7KA 2O8BB 2JLSA 2R6GA 2ZE6A 3AVXA 4Q9JA 4OBEA 3QPVA 4YXWD 1UKEA 3PJRA 5KO2A 1AS0A 1GFIA 1WDTA 4YQFA 3IO5A 1S0UA 3MJHA 2ZRLA 1OXXK 2H18A 3FHCB 4BGDA 1MO3A 2G1JA 2J9RA 5EXTA 1EX7A 2Q3MA 3GLFB 2JLYA 3QKRA 5EXSA 1XEXB 3O8DA 3AQ4A 1IM2A 3KB1A 4A8JA 4B34A 3LY5A 2X1VA 2QT1A 4PSAA 2G3YA 2DY1A 1CXZA 3HYRA 3CH5A 1YZUA 3FGNA 2CVHA 1NG9A 2GAAA 2V7QD 1DO0A 4DLZA 1JPJA 2RB4A 1U94A 2PMKA 5IF9A 2A9KA 4JS0A 2AX4A 2EQBA 3WBKA 4NCIA 1N6LA 1UKZA 2BMEA 1S3SA 3BFXA 2Z6VA 3ND8A 4NONA 4ON9A 3BB4A 4YC7A 1KO7A 1TUIA 1FUUA 3SFVA 3TAHA 2NZJA 4GMXA 1Z0IA 2VSOA 3U60B 2VA8A 3B1WA 5FPTA 4M9SA 4Q5IA 1NVUQ 3CKLA 1YR7A 4TMKA 2XNDD 1I2DA 1G21E 5UKDA 2ZANA 4C9BA 3TQFA 4FW9A 3IIMA 1HQYE 1QHNA 1SXJE 3SR0A 2D4HA 2ZYUX 1UF9A 1VYVA 3QKUA 2NOAA 2BWJA 2KI5A 2D06A 3BRWD 3D3QA 1Q20A 4M4SA 1X86B 1W46A 1DAEA 2OE2A 2X19A 1J70A 3TK1A 1EWQA 3ZQ6A 2VLIA 4L15A 1ETUA 5IRCD 2CLSA 1N5JA 4KLZA 2OBMA 2ZS7A 1VG9B 4MYCA 2JLZA 1YQTA 5CDFA 1F48A 2ZJ8A 1N0VC 2GXAA 4GRAA 2CL0X 3U7HB 1LNZA 1HE8B 3GCGA 3TW8B 2ZRAA 4QJ3A 5DI3B 3IBYA 1OFIA 2FSGA 3U7FB 2XAUA 3LQRA 4JSTA 3CNNA 4OI2A 4CVNA 2QTHA 2ZJYA 4PC1A 2X2EA 3U3KA 1NIJA 2REBA 1L4YA 3TAUA 4LK2A 1GILA 4ZKDA 1FMLA 2ZM5A 2IWRA 3W34A 3EA0A 4MRSA 2O8BA 1W44A 1T3LA 3ZZTA 2B7BA 2NPIA 1VYUA 2EFCB 1Z6YA 2NG1A 4JKIA 1FQKA 1XMJA 3LD9A 5EE3A 3GLGE 5G3YA 2NZ8A 3SHFA 2E87A 4M8NE 1SXJD 4MGYR 1W5TA 2OLKA 1FNMA 3QPWA 1OJLA 2A7QA 1EFTA 1G64A 4HB2A 2CEAA 2MMGA 1YE8A 3GLFA 1FL9A 1XEXA 4GSYA 1W36B 1VCMA 1DAFA 1YZKA 1P61B 4OHZA 1P9WA 3EX7C 2ZI7A 4OJQA 3TNFA 2XOKD 4OYHA 1S1MA 5F9HA 2HV8A 1E2QA 4LJ7A 3W90A 4BFYA 4HAWA 3BIFA 4RFSB 1P9NA 1YZGA 1NVVQ 3H86A 1EFHA 1QHHB 2ZRKA 5LB2A 4TLBA 4TL7A 1CIPA 1HE1C 4B44A 1WBBA 4ZO4A 5F3WB 4NP6A 3T5GA 3GEIA 4YLGA 1OIWA 4HLDA 4A82A 4DEXA 3AKDA 3OF5A 3ETLA 1R0YA 2W2TA 2Q0HA 4TQAA 1ZM4A 2WIBA 5FFMA 1U8ZA 3FWYA 3TSOA 3W6OA 4XWKA 2FSIA 4EFNA 4BASA 2EFHB 1TMKA 5B2ZA 2ZPTX 2VP0A 3DMDA 1AM4D 4NCKA 2IK8A 5HE9A 1ZVQA 1YJ5A 1YZLA 4LCBA 3W6NA 4TL6A 3SJCA 3MG9A 1JXOA 1FZQA 4IOLA 3MD0A 4TSFA 1CJUC 2QEQA 5FI1B 1F60A 3UPUA 1A7JA 4AIIA 4XH9B 3T06B 1AIPA 1H65A 3LA6A 3M1IA 1WP9A 4IW3B 3LX8A 2LCFA 4RVCA 2P6UA 5FH9A 4O3MA 2WWYA 3A6PC 2VH5R 1MOZA 2NQ2C 1XTJA 4R7ZA 2FZLA 2FV8A 2J0UB 3IUYA 5DI3A 4LRWA 5DSZA 3AKYA 3MWKA 3D6TB 4AKHA 1ONBA 2D62A 2AKAB 2BBWA 3AVOA 3K9LA 3R8FA 4Q4LA 2QUZA 1C9KA 2LKCA 3W3AA 3KFXA 3TW4A 2GVZC 1E2LA 4P3YA 5J4HA 2FPMA 3IGFA 4XD7D 1DO2A 1QHSA 2ZAOA 3LX5A 1KIMA 4NE2A 1U99A 4KJZA 2P65A 1PUIA 1VCNA 3TQCA 3HDTA 1N6OA 4LJ8A 4WW0A 3U3OA 3VMFA 4DHEA 1JEDA 1SVSA 2CNWD 1XD2B 2ZIAA 4FMDB 1B23P 3K70B 1T0HB 1GL9B 1XTRA 3EW9A 5DH9A 2J45A 1CEEA 2IYSA 2ODWA 4QNRA 4FINA 3WXMA 4D4MA 2J5XA 2ZI4A 4JVSB 3W5IA 3KQNA 1CRPA 2OLJA 4IVQA 3M0EA 3QXXA 4W5HA 1P2UA 2C03A 3GLIE 1SVLA 4UNPA 5DN6A 4FMCF 3FMIA 2ZE7A 2Q3HA 3QEJA 4RFSA 4IDOA 1T5IA 2OXRA 1N6IA 1QHHA 3NG1A 1NVVR 2FJUA 2FX3A 2QMOA 3LXRA 1SKQA 2RGEA 3PITA 4D80A 2BV3A 1QHXA 2ZRFA 5FUVA 4BFXA 1ZU5A 5JCZA 1D8TA 1M74A 5EXXA 3CUEF 3AP2A 3LXXA 2HF8A 1QBKC 5JMTA 4Q18A 3AVYA 2QT0A 3FKSA 1GRQA 3OEED 2FFBA 2GJ8A 4OHVA 4W5JA 1US8B 4FCWA 5C2JB 4GMDA 4LHXA 4KXFB 2ATXA 5BN5A 1P4SA 2A3RA 2DB3A 3WMGA 1Z6TA 1UBEA 2HYDA 3PQCA 3CM0A 4FD2A 3I4LA 4LYAA 1ZD9A 2J7PA 5EXPA 4EJSC 2QE7D 3QSYA 5JJKA 4IVRA 3ZZ0A 4Q1FA 3WHKA 3LLUA 4XSHA 2G0TA 2JCSA 1AGRA 3CR8A 3Q5EA 4LV6A 5HE8A 3ICQB 1EG7A 3ADCA 2ZRGA 2GBLC 4JLMA 4XVRA 4WOPA 3AVUA 1SQ5A 4WVFA 2JGNA 3C4JA 2ZRJA 1II8A 3ASYA 2ZRPA 4JL8A 2EFGA 4AKGA 4U00A 5HKKD 2WAYA 5JWOA 1Q21A 1E9EA 1NN1A 1CJKC 1NP6A 4JT2A 2IBMA 1S1CA 3AM1A 2B7CA 1JR3E 2J0UA 3B5JA 2DYKA 4LBYA 1E1QD 4MYTA 1SVKA 1TQ6A 1TU3A 4Q9LA 2P0EA 4N1AA 4MKHA 3SJAA 4KBGA 1NKTA 2JLXA 3Q3JB 3B1YA 5LDDC 3U7GA 3OIVA 1D2MA 4QBHA 1Z5ZA 4HDCA 3RSLA 1KO5A 2YC2C 4M9QA 1WE2A 3UXMA 821PA 1VHLA 1ZNWA 3KKPA 3AB3A 3GJ7A 3AVWA 1XD2A 1CJTC 2I3BA 3EIQA 1G9XA 2QN6A 1ZU4A 4HDOB 4XSGA 3PUWA 3C14C 5KOYA 1R8QA 2HJVA 5EZ5A 2WWHA 2CCGA 4ZPXA 1M7BA 2ZE5A 4AYWA 3EPLA 3AF2A 4TYPA 3K0CA 5JWRA 5KUTA 4P31A 3OEHD 2ZSDA 1OH8A 4CEJB 4LUCA 2QGZA 4LBWA 1YZQA 2CK3D 4B3CA 3UWKA 3I61A 5B58C 3ADDA 5JS8A 4NPHA 2Q9CA 2VF7A 4ARZB 2QQ0A 3EG5A 3VR5A 4NYJQ 3FTQA 4JLAA 3KXIA 1P2VA 4M9ZA 1JR3D 1LS6A 4HUQB 4A6PA 2HT1A 1EFRD 4I1SA 3CW2A 4JLKA 4Q7KA 1EGAA 4C0BA 1FMJA 3NIBA 4BFSA 1VECA 3LRPA 3BWDD 1US8A 3CRQA 4IXNA 1R0XA 1N6HA 2BVNA 2ZRCA 2ATVA 3IDQA 4DSTA 3EZFA 1OXTA 3SYKA 4P33A 3TRFA 4FWTA 4G5GA 4PC7A 4PPFA 1R6BX 2VRWA 1R0WA 1HQCA 2AN9A 2QMEA 4PX9A 1RRCA 2KBFA 3CRW1 2WSSD 1GKIA 3F0TA 2PLRA 4LYJA 3OHMA 3NXSA 1P2SA 3PUZA 4KCGA 5IK2A 2YWFA 4Y0VA 2OFOA 4JL5A 2QZ4A 4RY2A 3LDAA 1N3BA 2LWIA 4IEEA 3GLHB 3AVPA 2IHBA 2J87A 1YRBA 4S35A 4C0QC 3X1YA 4KLNA 4A0GA 1ZRHA 4DSNA 1NMYA 1UDXA 4CGZA 3AF3A 1XFAA 3TE6A 5KSZA 3LFUA 3PUYA 5FBRB 3QKSB 3C5CA 3KJEA 5SZJA 3ICEA 3DL0A 3DKVA 4GP6A 4AI6A 5FTNA 4QHSA 4DCUA 2D7CA 1COWA 3RRZA 1ZM2A 4E09A 5GADl 1UKYA 3R8CA 4A4DA 1NLFA 4JL6A 1E2KA 2F43B 2W58A 4M9XA 1BS1A 1A4RA 4MYUA 4IOMA 1XPRA 1M1YE 4QRHA 5FTJA 4HI0E 5JCPA 3A4NA 4LYFA 2XJ9A 4PQYA 4X8MA 4IRUB 5EZ6B 3ZIAA 4WA7A 5EE9A 2AD1A 1E79A 1CS4C 1KI1A 1KNQA 2ZSAA 5BYKA 4Q21A 3ZH9B 1P72A 2W6ID 2W2VA 4GNKA 2PCJA 1G4AE 2I1VB 2V1XA 1DTSA 4YDHB 2PEYA 2R65A 4PZZA 2DHRA 4A2QA 4CEJA 2R6AA 2KWIA 5F9FA 4V0NA 1S8FA 3RRNA 4DIEA 1IQPA 2A5DA 2IYQA 4MRPA 4ARZA 1OH5A 2O52A 2BIFA 3B1ZA 3I73A 1OIVA 1NKSA 4EAQA 5B57C 3HPRA 5J4KA 2GA8A 4JSYA 4NCNA 3KZ1E 4HUQA 2QL6A 2WWXA 4TLCA 3BH7A 4L9WA 1XX6A 4NYMQ 4TYYA 2FPLA 2DWPA 3CX8A 1WF3A 2F1RA 2YHSA 3I8SA 3OIUA 5HTKA 3AVQA 3MSXA 4EPTA 1WA5A 3EARA 1GRRA 1S2MA 1LB1B 2G6BA 2WOOA 1ZCAA 4RFVA 4M1WA 5D3MB 2ODNA 4MGKR 5J47A 4II7A 3VHLB 4AKIA 3CZPA 2QU8A 4YDSA 1SKYB 4GBMA 3Q72A 1YHNA 2PBRA 4LC0A 4LX0A 4PHHA 3THOA 4DDWA 4DDVA 3GPLA 3K0SA 4YMSA 4QBGB 1RIFA 2ZUCA 2RGAA 2ZRHA 4TT3D 3UKDA 5KDOA 2O8DB 1SVIA 3GLHA 3NBFA 3L0PA 4PC6A 2ZJAA 4LI0A 4MKFA 4B48A 1W0KA 3VR6A 2F1IA 5H1YA 2Q9AA 5LD2B 2GEDA 1GSIA 2IYVA 4XIGS 5BXQC 1XU4A 2WWIA 1CKEA 4EQ6B 4Y0AA 4MDEA 3U6BA 3QKSA 1KJWA 3QY0A 2ANCA 3HU3A 1ZM9A 1N6NA 2R2AA 2BEKA 3NC1C 3IQXA 2IXFA 1YKSA 5BN3A 2VP2A 3K9GA 5FOSA 1ZW6A 1EXMA 2OAP1 1KNXA 3E70C 2VP6A 4HLUA 2BBOA 1Q3TA 2N1BA 2F43A 1Q0UA 2IWHA 2W6JA 4GDFA 3GEHA 5KDDA 2QSYA 3V00A 5FL7D 2GILA 3B78A 3RNLA 2IYLD 3O8CA 1KK3A 3IQWA 2JEOA 2VHTA 2C9OA 3AV0B 3NH6A 1SXJC 4ABYA 2JA1A 3KJHA 1PV4A 1RE0A 5FBVB 2VP9A 3MLEA 3B9QA 3IILA 3U3RA 2VP4A 1DG1G 2WKPA 4B33A 5C4MA 3K0AB 3KQKA 4LWZA 1P75A 4QNMA 1DVRA 1F3OA 5JJLA 3QXHA 2GHIA 1E6CA 4BRWA 2YKGA 4R98A 3PEWA 1GITA 4P4SA 2EU8A 4V03A 2QRNA 4QOSA 1NN0A 5CJ2A 2ZVPX 1NJFA 1IN4A 2JIZD 3MWJA 5KSYA 4BLRA 4UJ3A 4PC2A 1E2FA 3L0IB 1IJFA 2FE4A 3Q7QA 4A2WA 2XB2A 1J8YF 1NL3A 1DG3A 4D26A 2A5YB 4XWAA 2Z83A 5CIQA 2CXXA 3ZLJA 1ZM3A 1PLKA 2RMKA 4GZMA 1DAGA 1KOFA 2GJAA 2XSZA 1TADA 3A1TA 3OZXA 4IJMA 5KNCA 3BH0A 2GKSA 1F2UB 2ZUDA 4PXAA 2HUPA 2J46A 1KI9A 1KDRA 5D3MA 3U6KA 4QGGA 3X2SA 2AFHE 1JNYA 3IPXA 1E2EA 5FOVA 2QG6A 2QM8A 4MRRA 4DB4A 2WAXA 1OKKD 4P4UA 3PCRB 4E07A 4MKGA 2O8DA 3FDIA 3WHLA 3SBEA 1IXRC 3QVVA 1OFUX 2IEYA 2YOGA 4ZCMA 5JHGB 3SBDA 2BBTA 5E3HA 4ZDKA 2YYZA 3SJZA 1GG2A 1G8HA 4NKRA 4Q03A 3N2IA 4EQ6A 2AWNA 1CF4A 4RD2A 3BOSA 2KB0A 4JLDA 4MQBA 1VKJA 1NRJB 1KI7A 4KSBA 5BN4A 1SVWA 5LPNA 4QFMA 5L3VA 4HEJA 1P7CA 1G7TA 2GJKA 3BB3A 1FQJA 4NTZA 5M04A 3BB1A 5CJPA 1WQ1R 4Q9KA 2UVQA 3G82C 1CTQA 2D7DA 4W5WA 4V0ME 3D8BA 2ZYVX 3KL4A 2XZPA 3OIYA 4BFTA 3PV0A 2X77A 3DHWC 1OLOA 5G41A 4KBFA 4A2PA 4PQFA 1W4AA 1QVRA 2IUSA 2B6HA 1B0UA 5CM8B 5K8IA 2VHUA 4JT4A 1NLYA 4D4KA 2PJZA 1U8YA 4RKEA 4BRUA 4OQXA 5FPSA 1KK0A 2GK7A 3K0AA 1G3RA 1OIXA 4L4UA 3ONWA 4JBYA 4UXHA 4DEYA 1K8RA 1U2RA 4OI1A 2JLWA 5F2EA 1VHTA 1DE0A 2CE2X 5ANRB 4TLDA 4UNSA 3CWQA 1U81A 1W48A 2BMFA 2A5JA 2B8WA 2ANBA 3ECCA 3L8ZA 2IF2A 2V6JA 4HB0A 4W7SA 1AZTA 1KI3A 2RH5A 3I8XA 1YR9A 1H8ED 2GCOA 1G8YA 2GZAA 3EWSA 3BD9A 4Q9HA 2WBLC 3GJ3A 3TVDA 4OI4A 4LJ9A 1GDDA 5JZVA 2O8CB 2ERXA 1JBKA 2IYYA 3MFYA 3T61A 2VO1A 3JVUA 4DCSA 4D25A 1D2NA 1CR0A 1EESA 4OK5A 4GI7A 5L3RA 3LVRE 4JYCA 1XTKA 2QP3A 5E4FA 1L4UA 4L8GA 2H92A 3BFKA 1F2UA 4M53A 3ZVMA 2CMKA 4TL8A 3UMSA 1U0LA 1A2BA 2WSMA 2XX3A 1XEFA 4KSCA 3A8TA 5E7MA 1KGDA 2C04A 4ERNA 1GZSA 2GCNA 5SZHB 1LS1A 421PA 1TQ2A 1H8HD 2P67A 3AVVA 1UBFA 4PZLA 4RCZA 2ODBA 1S96A 4G5RA 1YU9A 3U4QB 5CB6A 3GJXC 4IHQA 1RVDA 3IO3A 4ZKEA 4KYUA 1M7GA 4QJ5A 3A4MA 1FX0B 2AXPA 4M21A 2XNSA 3VNUA 1I4DD 1JEEA 1U9IC 3OE7A 1IN8A 3CF2A 2WTUA 3QNUA 2JJ1A 3RC3A 4FMCB 5DI9A 1RKBA 3E2IA 5FBQB 1HURA 3THXB 1E1RA 4Q7JB 2VSFA 1E94E 4MYHA 2FGJA 2QPOA 4QGHA 5AJVB 4DLWA 1MO6A 2GCPA 2VP5A 2IEZA 2W83A 2ZJZA 4JMPA 4IEIA 3E5HA 2NGRA 1QDEA 1E2IA 1FUKA 2FWRA 2R9VA 5BYJA 4LBVA 3CONA 4IXMA 4IFBA 2CCJA 5CB8A 2QTFA 2PCLA 3SNHA 4TQUS 1ZUHA 4XTCS 5GJVC 4EPVA 2A78A 1LFDB 3UIEA 2FOLA 4ACAA 3SN6A 1LY1A 1GUAA 4B2IA 4LJ6A 1E2GA 1E4YA 3DO6A 1W1WA 4B43A 1E2HA 3L8YA 4MDFA 4F4JA 4RJLA 4Z1MA 4JBWA 5HZKA 1VCOA 2AR7A 5JHHB 2GJ9A 4CT5A 3EAQA 3O47A 3WP0A 1QVAA 1E4VA 2FDCA 4DBLC 3WBJA 4NU0A 4AURA 3VKGA 1TU4A 2BJVA 3MAAC 3WNCA 2JJ8A 3AF0A 3RS0A 3OFND 4YXWA 2VPPA 2GZHA 1ZINA 2L0XA 1VG1A 4WXPA 1FW6A 1RFLA 1SXJB 3GJ6A 1AJEA 1LW7A 1BO6A 2OHFA 2WVJA 1UJ2A 3PG5A 1ELOA 5C4GB 1YRAA 1E32A 2O8CA 2B92A 1G3QA 3MWLA 3AUXA 4MUAA 5FUWA 4JIMA 4PHFA 3C16C 2GETA 3CPEA 3TR5A 3AVTA 2CL7X 4M1YA 1Z2AA 3JZAA 3I72A 2RKOA 3X1ZA 1LTQA 2LKDA 1FP7A 1Z0JA 5KDLA 1RPZA 3H2YA 2RGNC 1OHHD 1ZBDA 3SHWA 1XMVA 2C9YA 1A5TA
chains in the Genus database with same CATH superfamily
3PHIA 2HA5A 4Q19A 4QDOA 1I3CA 5CK5A 2R1ZA 3VYUB 2FR8C 2XVZA 1W4CA 2QPLA 1B15A 3TFOA 1U0NA 3DFKA 3NUQA 5HF5A 3U7JA 1XIVA 3IT3A 1QYWA 1XDUA 1Z0ZA 5KX5F 2HCJB 2DR2A 1NVXQ 5EEGA 5THXA 1KOGA 3T7CA 1Y8RA 2FG7C 3FTDA 3HPQA 3RHZA 4A1OA 2XYHA 1ZNZA 2CXPA 1MJFA 1T6XA 1V7ZA 3TAXA 5KQGA 1GCOA 1NMZA 4X7PA 4EABA 3ENNA 1A96A 2J3JA 3KCQA 1IAQA 4OLJA 3B8HA 3H1FA 4I19A 4QIHA 1ZN8A 2JKVA 4E13A 3GLGB 1DBIA 5PNTA 3EXEB 3BXEA 4R2KA 4BVEA 1NBOA 1C50A 1MG0A 2DPXA 1CERA 3W7BA 3SSOA 1YWGO 5AQ1A 4DRZA 5I9TA 5KREA 1NW9B 4ID3A 1EFDN 3CLVA 5FBHA 3WZ2A 1BOFA 1H2BA 1BVHA 4HZGA 1EA5A 5FA6A 1T8PA 5BRNA 2HO4A 2MYNA 2I0FA 5E1MA 2E7ZA 2V7BA 2MSNA 2A0XA 4OJKA 4QVKA 4UM9D 5FUXA 1YC2A 2GPSA 1OXVA 4L4RA 4R2IA 5FTMA 3Q85A 3GRPA 3S2IA 4O2LA 5LP6A 4FM9A 3DHVA 2GEKA 1XC7A 3D8SA 4UC0A 4UD2A 3RNOA 2QNRA 4GRIA 1DJPA 4QGSA 3E0QA 1WKBA 4B0PA 4NOLA 5DNEA 3QI2A 4TV9B 4Y2UA 3X0DA 1GAQA 2B82A 4J1TA 1R4AA 4KRYA 4K2HA 1Z7BA 4IRMA 1NNSA 4O1IA 3M83A 3E1KA 2BMAA 1AC5A 4ZOBA 3Q3EA 3KYDA 5HILA 3P32A 5A03A 1QO9A 4I50F 1CR2A 4FLMA 4QHTA 3A10A 5KMGA 1T6NA 3HFJA 1DELA 3OH8A 5EWLA 3IYLW 4DVGA 4NS4A 4J7AA 4DUZB 1G8MA 2PMWB 3DR5A 3QXSA 2UZ0A 1ISFA 4M99A 1WABA 1TMGE 3TKAA 2QORA 2ZYWX 3T7JA 4PPGA 3BWVA 3UMJA 3HYTA 3OQVA 1RVV1 1G6Q1 3HKBA 1FP4B 1R5NA 3GLRA 1CY1A 1OFGA 1ZK2A 2EQAA 2OEPA 1SH7A 3LXUX 1ISPA 1PTJC 2O2SA 4M0CA 4R1UA 5F7JA 3W6PA 2ZUFA 4C6SA 4DV6B 2I1QA 2QMUA 3NWOA 1M7HA 1I3MA 4AK9A 3D59A 4DWJA 3K0FB 1S2NA 5ITZB 3HB5X 1XR3A 1GN9A 3ZD6A 3BSWA 2N47A 3KV3O 2KE5A 3WIBA 4JWTA 4BNZA 3WKEA 2JZCA 4FEAA 1XD8A 2FVXA 5ESDA 5HBGA 3Q3IA 3RT1A 3TCXB 1OD6A 3TTXA 4UARA 1DQSA 4MLPA 4DC1A 4NBVA 2FKAA 4TS3A 1MABB 1RC0A 4M1TA 1BWRA 3GEPA 2HMYB 3KQQA 4DCNA 9MHTA 1A8SA 2ONYA 2XOKA 4OQPA 4MS4B 3ZDQA 1SVNA 3KU4A 1TCVA 3F1KA 3ZE6A 1T8UA 4HQLA 2O07A 2P77A 3BL8A 1U8UA 3TLCA 3WWYA 2P2SA 1HLDA 3GOQA 2HFJA 4I9FA 4RACA 4AG6A 5A4IS 1W75A 4MZXA 4PGAA 5CR9A 1WZNA 3SHQA 3CW9A 1UMDA 2G0AA 2MT9A 2QLFA 3ZU6A 2YOHA 2O3TA 1X1SA 4H7HA 4R1NA 4UOEA 5KPDA 3NDBB 3RSCA 4ZCTA 4Y2QA 5IKPA 1KQFA 4MR8B 4YRSA 2F1JA 2H59A 3AHEA 1S9HA 4TTPA 3KUCA 5I5GA 1BYIA 4NIMA 1SVMA 1XHFA 4HLQB 1Z4LA 4XA8A 4GPIB 1Y1PA 1G8FA 2C3YA 4MPJA 1D0SA 3SM3A 4DBLE 1STOA 1RR6A 3U7QB 2NWQA 4FP9A 4ZI2A 3A1FA 3BHJA 3QHQA 2MINB 4WKNA 1ZUIA 5K1ZA 3V9AA 4PN3A 4IDAA 4KUHA 3ISTA 5CDTA 5AFSA 5EJ9A 4KFRA 2BHRA 1SXHA 3EAFA 4ZGWA 3GPBA 5KWIA 5IASA 3GLUA 3AKZA 4E5UA 1IHDA 3OA0A 1T36B 1YZTA 4Y9RA 3G2MA 1S7CA 5REQA 2EERA 16PKA 4NOKA 4Z3OA 4AJKA 4F2GA 1KPHA 3DW3X 2P4UA 2VEOA 4K8OA 2NVWA 5HXAA 4LF4B 2Q2NA 3HR8A 2RH4A 1Z4NA 3DT8A 2PWYA 4NAUA 1GV1A 3GN1A 3KXKA 1WUKS 3U3DA 4D9NA 1Y1QA 3ANMA 4M37A 4F9TA 3ZJVA 3P0EA 2FZ5A 4EVSA 5BQXA 2GDZA 1SOUA 2M9MA 1P1JA 3F49S 3N5CA 1EVYA 2Q5OA 2CYBA 4OQFA 1YMUA 5FTWA 4RAOA 1ZP6A 2OZEA 3JRWA 3W9SA 2ABWA 1DZIA 5FKJA 2AJDA 4BQRA 5T6MA 3RFVA 1ZVMA 3P97A 4EVIA 3L6DA 3UK0A 1XZJA 2PLFA 4A1FA 3RYHA 5CBPA 3BK1A 1FJXA 1V3VA 1U7OA 2Q07A 3FR7A 1O9HA 1TLTA 1YAJA 2WEKA 2V6GA 3SIWA 3CEAA 4RVSA 5L51A 3CWZA 3V4RA 5JFGA 4QXRA 5EIHA 3CWCA 4PYRA 4S1OA 3SJBA 1J90A 3GC6A 2VBIA 1TKAA 1U0JA 1D4OA 1HV8A 2OL4A 3R3JA 4HWTA 4IQ0A 4F1KA 3BERA 3P2EA 3ZLUA 5CD9A 1KBZA 1P3JA 5AKGA 3OTHA 1NUUA 3FZGA 4LJKA 4HH4A 3FMVA 3DE5X 4IDDA 1ST3A 2VPYA 3LV8A 4KI0A 4QJ4A 2ZKLA 2CNWA 4RD1A 4KDCA 2CB0A 1JFSA 1DAKA 2E4ZA 1WZEA 4LDAA 2HBYA 3C3XA 3TM5A 4QXMA 1W0JD 2V9PA 1CIJA 4DUPA 5EZSA 1VLMA 4R41A 3HCDA 4O0LA 3N2YA 3VHXA 3PP8A 5EP3A 5KNDD 1NY5A 5KQSA 1NG1A 1DIRA 1MT0A 3IEUA 1UDRA 1AX9A 3N87A 3F5MA 5J40A 3Q9NA 4ALMA 3GA5A 1ZH2A 2AG6A 4MW9A 5JBNA 2EF0A 4OJNA 3KWFA 5KSPA 5LBTA 1YS2X 4N3BA 5H59A 2QP4A 5TY0A 3VUFA 1EP9A 4RKFA 1JFFB 2EDCA 2XB9A 1UDBA 4LNUB 2A0YA 3W9YA 3M9WA 4RCVA 2AIRA 1XN1A 4HGQA 3TPCA 3VR3D 1OVMA 4EY8A 4P92A 3IQFA 1YH3A 3KB6A 1GUFA 1EFVA 4I4NA 2JD2A 1G42A 2F9LA 2PR7A 3DNPA 3OEEA 3HP1A 1F51E 1Z3CA 4RQBA 4EHIA 3K35A 4HX2A 4Q3DA 2YZ7A 5FL3A 4F3RA 3BGWA 2DFKB 1ICEA 2ZS9A 3VU9A 1F5SA 3HCFA 3ZS9A 2QBYA 5AVQA 4CEIB 5K8TA 2J0EA 1DJOA 3V8EA 3B3FA 2O2XA 3AR9A 3KWJA 2CLOB 5J1SB 3FPJA 5TGDA 2QKYA 4QUHA 2FGKA 1GGFA 4Q7MB 2NZXA 4TMVA 5IH7A 3UMFA 5IEJA 1UJBA 3KOMA 1PR3A 2LW7A 3K8OE 1L5OA 1HLPA 1XMIA 2IHJA 2E5WA 2FRVA 1QRAA 4EPXA 1LA2A 1KMHB 1ZJ6A 2X1HA 7REQA 2HIMA 3WL8A 4B6RA 1R5BA 4LHWA 4RZ2A 1JB1A 3EEYA 3TFWA 1JQLB 3JD4A 1M73E 4M0DA 4Q6WA 3VFDA 4WQMA 3GLIA 4CKBA 2JVIA 3EDMA 3OY7A 1U9IA 1KAHA 1TUEA 2WT8A 3T9FA 1B6GA 1L7VC 4JQOA 5DO9A 5LLTA 2O3SA 4NH0A 4Z0NA 3E23A 4Y1RB 2A5GA 4YRRA 2CUKA 4CQJA 2FW6A 1XTQA 2V55B 1FFBA 4GF5A 2XTAA 5EVJA 1NXQA 1CLUA 3OEWA 2C58A 2CE7A 4RVHA 2Z1NA 5JS1A 1O5IA 3BHNA 3RS8A 4ZN6A 3FPBA 2X5OA 4OIMA 5CPFA 4KPYA 3HKCA 5JCJD 4BDSA 2EHJA 3QLTA 2IS6A 3H16A 4GPTA 5JALA 1B3BA 2FX5A 2V7PA 2A0UA 2J5KA 4U6NA 3CUVA 2B35A 2H08A 3QX3A 2WMNB 3KE9A 4I3FA 3FCUB 3DKRA 3KU1A 1JLLB 3NXKA 4FOTA 4A23A 1SCIA 2VSQA 4YRTA 5FTKA 1P8AA 4MWSA 1H22A 3GZNA 1C0LA 4NLLA 5AI9A 3B52X 2XOEA 3HJBA 2QX7A 2PJUA 3NKVA 3ROKA 3INYA 3U4IA 2CL5A 1LD3A 1UBTS 4P81A 4C0AC 5DJ5A 2D0IA 4LOLA 3TDMA 2GKGA 4WL0A 4UXIA 2ZYSA 3PFFA 3SYTA 4UHEA 2A5FA 4LE0A 3JVIA 1QOZA 4IH1A 4KQEA 1FS6A 4U6SA 2XWBF 1O2DA 1VL0A 5HBRA 4C7OA 3TQSA 1QLHA 1RP7A 3WKAA 1G6OA 3R3ZA 2O0HA 1TYZA 2PT7A 1JDJA 3JQCA 3T34A 1G8JA 1OASA 3GCDA 1LC3A 5B4VA 2QRGA 5FBZA 2XDQA 3I5UA 1A95A 5E9AA 1RWPA 2QX9A 5C7YA 3QEBZ 4O4HB 3RVBA 3NC0C 1CJBA 3D7RA 3MPOA 5ALYA 2R85A 2EYQA 5G4KB 3ONNA 1OH7A 2Y4OA 2PXAA 4FXPA 3RUHA 1IBKB 4RD4A 3UY4A 4NBSA 2NV2B 4FCCA 3MGCA 1VLJA 3KYCB 4YJ3F 1O0CA 1IXKA 1G66A 3OZFA 1W5SA 1WDLA 4GAEA 2H8GA 2G5TA 5BUCA 2IZ6A 3OIWA 3D54D 2UXBB 1QR2A 3D3KA 3QU7A 4JR1A 3EVTA 2AR9A 3OCWA 2IUUA 3AUYA 2HLHA 1P0CA 2FEOA 3CPSA 1K9VF 2CNKA 2HMVA 2HQSA 2JJMA 2YN4A 4EJSB 2J3IA 5C34B 1JA9A 1JQBA 2RGCA 3G5UA 4BE7B 4E51A 1NU6A 4REQA 1O97C 3LCRA 4F4FA 1CX9B 4CUZA 5JR3A 2QRKA 4U7WA 3A9SA 5K01A 1E1KA 3EY4A 4PCLA 2XNKA 3U3JA 4FN4A 3WLLA 2FZEA 1CEQA 4GT1A 1FTNA 2CVPA 4PQRA 3RTAA 3ZHTA 5F5NA 4C5BA 5KOHB 4BE4A 2J9YB 4EKDA 2NP6A 4B45A 2GVDC 4HDQB 3EVBA 1YS1X 3DZGA 4BO2A 5LB4A 1DBRA 4DIMA 4LXHA 5GTDA 2UZ1A 1QWSA 3SDBA 4BVLA 2R4QA 1J2JA 3VPBA 3VKWA 3WWOA 4CL0A 4LFBB 5TQJA 5ERYA 3UM9A 1IBLB 4GBED 1QYIA 3U48A 4FEGA 4Q1CA 5ALSA 3FVWA 4EKIA 1G0OA 1BHSA 1P74A 2YYYA 3DMTC 1RE1A 3FDJA 3MTQA 4GMKA 4ZHQA 2HLNA 2ZZMA 1B0AA 1FBTA 1UFOA 5DNWA 4FE3A 4J0EA 3SXUA 3ASZA 4B3HA 3KRTA 4DLBA 2CHGA 4RD3A 1KH3A 1GA1A 3BWEA 2BBSA 1I7SB 1FRZA 1IXYA 4LBZA 1CUAA 2HK7A 4H7FA 2VG8A 3PC8C 2ZEJA 4FYPA 4W7HA 2I9KA 3EPKA 2IH2A 1PSDA 2W6IA 4MWBA 1XVAA 1M2FA 1J23A 5CEFA 1B41A 2JFWA 1RM0A 4KAJA 4NCHA 3OJWA 3OX2A 4N5MA 1AZWA 1Y33E 6AT1A 2FLWA 4PE5B 3Q41A 5EQFA 5FFMA 1IJBA 1QRSA 4AG3A 4H1HA 1W76A 3ADKA 5G1OA 3SVZA 3AR8A 3L43A 5GJWC 3I2FA 3L79A 1WVIA 4N9QA 4K6FA 2IKSA 3LVFO 4MGZR 1F8FA 3ZU3A 2YZ2A 5BO5A 1ZO8A 1E5TA 3DW1X 2K7ZA 3QPCA 1ESMA 1RU3A 3N2KA 3RBZA 3BF8A 3QJYA 1WD7A 2ZU6A 5KAMA 3RBAA 3TOSA 3TOZA 4BKMA 1BVRA 3KVOA 2W00A 5EIOA 1RRGA 2CFTA 2O5EA 1YB6A 2QTVA 1UAGA 1ORTA 4G1UC 3W04A 3DV0B 4P80A 4BATA 5FWYB 1UANA 5CH8A 1E3EA 1RCUA 4ZCPA 3EXIB 1N2HA 1PFQA 3TRDA 1OXBB 1V6AA 4BP9A 4PNEA 1UBMS 3KKMA 1M1YA 3U62A 5ULLA 2V7TA 4YP0A 5JBIA 3RE1A 4WVLA 2X4IA 4ZMBA 4LXQA 2CXTA 4Y7CA 5DTIA 3ZJYA 2HSZA 4PLVA 5I7OA 1YCFA 1SBNE 3H5RA 1PR6A 3GLFE 2O05A 2QQEA 1RZRD 5HCIA 3CF0A 4PAQA 4DIFA 1KYVA 4N01A 4V24A 1JUDA 4RPLA 3R5FA 4RS4A 2GPNA 3HHEA 5D2CA 3TYXA 3JALB 3EF0A 4MR9A 1PQWA 4EFMA 5CLGA 1LPAB 1GSAA 1ZKMA 1ZK4A 5GV7A 2C7PA 1TTHA 2JNWA 4L5CA 4Y2YA 4LOAA 3R9XB 2Q0SA 3NVAA 5BVGB 5JZMA 1I51A 2GBLA 5LYJB 1A5SB 4WA8A 4AUEA 2GF0A 3QPUA 4R9NA 3HRHA 5KNDH 1JHZA 2H0AA 4JLOA 3EQ9A 1I5RA 1D09A 3T4PA 5HKOA 3NM5A 2ZVDA 3NETA 3RFFA 3ZNOA 1T8WA 1DCFA 4AKEA 1QRUA 1PJSA 4DCOA 1DFHA 4OHOA 4YJ2B 1T15A 2CBGA 1OWOA 2HAEA 2R3SA 2VWPA 4BNXA 1U2GA 2RHDA 4NBTA 3GELA 1FDVA 4OK6A 2Q2WA 4B7UA 3LQYA 3OTIA 4V0KA 1V16B 3JCZA 4YAFA 5LBUA 4Z7NB 3TBFA 3KXPA 4E4TA 1J06A 3O82A 1F17A 4TKVB 1E8DA 4BRZA 1W85A 3O95A 4H7EA 1CS0B 1UPUA 2BUBA 2NSDA 4G5OA 4G1MB 1F3LA 3MERA 4YRDA 3WO1A 2WQ6A 5KTMA 4XYBA 4BJ6A 3NRCA 1DO8A 2AFHB 3I1JA 3JYHA 4M8KA 4BQOA 3VPFA 4URVR 4U0KA 3SE0A 3ZBTA 1E2MA 1KHTA 1OZHA 4A16A 4TN1A 4MVYA 2AK2A 4UTPA 3PLRA 2VXYA 2GRJA 3EG9A 5K2OA 2FQWA 2N0SA 2JGMA 1F4VA 3O8LA 4G5SA 4HB3A 4X3OA 1JJVA 1JDNA 2XXAA 5LKRA 3RTBA 4HQOA 3BWMA 1IM5A 3BYZA 4O1HA 1K6XA 2BTQB 3WFZA 3W8DA 1NLMA 3DJYA 3HXLA 3OPNA 5AKKA 3I45A 2WIDA 2Y05A 4HUJA 4YIKA 3VC7A 4G24A 5AM3A 4IPTA 4C78A 2HL6A 2ZTUA 2I4RA 3BRSA 4DQUA 4KO8A 2WU3A 3WYDA 1F0YA 2OFWA 4N3GA 3B5IA 4AXBA 4IF6A 2HPZA 2GBGA 2CNOA 5IAGA 1RLJA 3PRJA 4UPDA 2PKYX 1T8RA 4WH0A 3SDZA 4URYR 1GTJ1 3O1HB 4Q1BA 2B9EA 3A6JA 4OQMA 1RLUA 3AETB 4LDJA 2J5BA 2CNBA 3NHAA 5FA8A 2PRKA 4MUFA 1T9GR 1C4XA 4GOKA 4L8FA 4I6EA 1E6MA 4GQIA 4PBSA 2CSUA 3RV4A 1H4QA 1YK1A 1VGQA 4ENTA 3AR6A 2C5SA 2HWXA 1JDUA 1ZS9A 1HTBA 1FU7A 3Q1KA 5K20A 2G5GX 4PZEA 4RWZA 2ORIA 1GZ5A 2C83A 1JLRA 4GM1A 3BJEA 5GZ6A 5A5VA 4G9BA 4WKPA 1AQIA 1P91A 2G5CA 4CLOA 2XGJA 4YRMA 5KTSA 1GLNA 2XCUA 2H2IA 4TRNA 3TH5A 1ZAYA 2PMBA 3T3HA 1ISSA 1NQTA 3NEJA 1U9YA 2O8EB 2BSAA 3ASUA 3A6EA 3LYAA 3GVCA 4JYBA 3NVKI 3P4UA 2IP4A 2ZITA 1RJ9B 3IAUA 2OZVA 1K1EA 3W9BA 2Q21A 2JFNA 2PT5A 1OJ7A 3UYKA 5K3OA 2IIBA 2K7FA 1NJSA 3FB4A 2PMCA 3OKPA 5DYIA 2NIPA 4B6PA 3Q5DA 1Y37A 4LHVA 2JH3A 1WCIA 3PTLA 3ITDA 3FPGA 1JIKA 4NBWA 4R8VA 3HSKA 2FAXA 2JG3A 3A4VA 1B7GO 2CJWB 5DYNA 2UYYA 4DYVA 3G0BA 3SICE 4K05A 1QP0A 3W2GA 4D99A 4TQGA 4BZXA 1PKXA 3SSNA 3KPWA 2G28A 2X4LA 3WA7A 3R6TA 3VVMA 2J3QA 5H68A 4LF8B 3IVCA 1V96A 2ZK7A 1JAYA 2GSWA 1E9SA 2XUDA 2C9CA 2HSJA 3TUJC 4RS3A 2XVMA 3LI2A 1TJNA 3G1WA 4TWZA 4EELA 4M6WB 3O31A 4Z49A 2X4GA 3EODA 1I4OA 1D1SA 1V9SA 1Z39A 1EUDA 4W1SA 1Y3IA 2Z57A 3IOBA 2QJFA 4X1YB 2AX3A 4RGBA 4CM5A 3OPMA 1T2AA 3U3MA 4BJ1A 2VZLA 2VJPA 3MB5A 4MRMB 2NO7A 4ARAA 1M5RA 1J9GA 1M2GA 4UEOA 4F06A 4C1BA 2ZJ6A 3R3YA 3C6QA 5DM4A 3NBZC 1C7JA 4YMIA 2HHAA 4WHMA 2GZSA 4ZO8A 1E0AA 4F3KA 2I91A 1CZKA 2LIPA 2A6PA 2F3SA 3SQWA 2HNKA 3DBLB 5GZ1A 4IZIA 4N03A 2I2WA 2XKBA 3KJZA 1XMXA 1H8EA 5DOVA 5ED4A 1PFKA 4ALKA 2VYND 5J4YA 1Y4AE 3A3PA 3C6KA 2QN7A 1NBEA 2V7QA 2HNAA 3THRA 5JLJA 4RW0A 3E6AA 3NIGB 2Z5LA 4R84A 2H2DA 1K66A 3QUQA 4CMAA 1ZDMA 4ADSG 5CYPA 2ADMA 1J2RA 3DOIA 1NX9A 3PVSA 2X58A 1W4LA 3D6HA 1WQ3A 1Y1KE 1RTKA 3SSMA 4KX3A 1BCSA 1UH5A 5AK0A 3X2EA 4X41A 2FFHA 2HQBA 3WDKA 4CG0A 5JBQA 2OC9A 5BV1A 2YIMA 3GJTA 1DLIA 1N2SA 3N76A 4LDPA 4FFMA 4DA0A 2F8SA 1LPSA 3BE4A 3MXOA 4DDUA 4JJZA 3KJXA 3QYPA 1E5XA 2BL4A 3OMWA 4G9GA 5JPDA 2IOHA 3HC7A 3NZEA 4UVDA 1FCJA 1XFDA 2AUTA 1S3GA 2ZI5A 4YFVA 1GNRA 5F2NA 3BH6A 3OESA 1XKTA 2ZJBA 2P4EA 4KO1S 3SYLA 1U0TA 2WA1A 3W79A 4Y2GA 3NHWA 3P20A 1M34E 4MV4A 3WLJA 1ZRMA 1Z4KA 4KN9S 4BO6A 4PTLA 2W0SA 1MX5A 1U1GA 2MJLA 2RHMA 3HEBA 3IPAA 3QEMB 1WG8A 3QXCA 2D5LA 4MITA 1SG9A 4INPA 4LJAA 1SBHA 4KR0A 3DONA 4WMLA 4QL3A 4DLKA 3T5AA 1W1UA 2OG2A 1DRKA 1JHAA 2KPOA 4RMHA 2CEKA 5GV8A 3UT6A 3TX2A 2YCLA 2DM6A 1II8B 2HDHA 5ALQA 1QXSA 1WF6A 4FJ1A 4XASA 2MSWA 2X8JB 2JIRA 3DDCA 3F7NA 4B4KA 1DJQA 1GKUB 5EL0A 1N2EA 3SR3A 4UBOA 1ADYA 1ZA1A 1EGMB 1G6HA 1SHLA 2QG9A 3B2QA 3C98A 3KAKA 3WIDA 2ZUWA 4HQRA 3K0EA 1MD9A 3KR1A 3EJ6A 3RVLA 2G9UA 2NTYC 2X40A 4FE7A 4JJ6A 1L6RA 2D2FA 2DFPA 5I7VA 3NT2A 1A9PA 3T7DA 3HVIA 3K72B 1XRJA 3Q9SA 4MQ6A 2VJMB 4GI2A 4P84A 2Z5VA 4HSEA 1THMA 2KM1A 3BGIA 3UUFA 4DHWA 4BXOA 1VYTA 1DL5A 2OILA 4FGZA 4F6RA 3MFQA 2QN2A 3BSSA 4EY7A 3JQFA 1UL1X 5JXGA 1YQXA 1P77A 3DMTA 2PZKA 3GRYA 5IWCA 3ZVKA 1MC5A 1W4BA 4B4DA 1UZNA 2GESA 2HSDA 2I22A 3LQ1A 4KN5A 3ZE0B 5BUSA 1N7JA 1ZD1A 3STHA 621PA 3W4IA 1FYVA 3ZCUA 5IJ0B 5E1DA 4CHTA 4LY3A 1TK3A 4U7TB 1IY0A 3VZCA 4C87A 3HZOA 1R4MA 6REQA 3GZJA 3HWWA 4WLNA 1X7WA 5EESA 4EECA 1FNNA 5IZCC 1JQDA 4U2EA 4DMCA 2Z4SA 5G2OA 1FMTA 3TRHA 2RHLA 1RYDA 4II3A 2I6FA 5F64A 4C0KA 3KV1A 4ETIA 5DT2A 4LZNA 3MW8A 3ZK7A 2RHRA 1M34B 5D86A 2XH8A 3TNDA 2AOVA 4ZQIA 3GV0A 3TL6A 4KQXA 4P82A 3P5BA 2VZ8A 1GPNA 3VGPA 4DLPA 1CVRA 1WMFA 1XCBA 2TS1A 4UHBA 4YJGA 1OYOA 3RKSA 4CV2A 3QKTA 1ZD4A 1NQ5A 1B8OA 5DBIA 4P1ZA 4QU9A 1OI7A 1GPMA 1JW9B 1OHHA 1QH8B 3L92A 3WFJA 2G9NA 1L0BA 5KVVA 4V02A 4UU7A 1NQOA 1BXGA 5IDWA 1BW9B 3RUFA 3V55A 1DT3A 4HVCA 4XCVA 4Y2RA 5C81A 3LLSA 1XRQA 1MLDA 4QBKA 5DISB 1TI7A 5IK2D 2WSIA 4BNJA 1UMCB 1WB4A 4JLBA 5I7AA 3IKLA 4FC6A 3HJRA 4GFDA 3Q15C 3MOSA 3SEFA 2QTCA 5TLSA 1ID1A 5IDYA 3PRKE 2C7BA 1TQDA 5JZOA 5TDHA 3EYAA 5KWJA 2G40A 2XZDA 1HEYA 5CM9C 3W2TA 3SQXA 5BN1A 4EGSA 1R12A 2BFOA 4NE9A 4OM7A 4CHGA 5BYAA 4FX5A 3PICA 4IVPA 3B3AA 3QXJA 3V48A 2P1RA 4TGLA 1QIEA 3TIGA 4LE2A 1ZW1A 1MC4A 3OLVA 2EBUA 3HKEA 3MJ4A 3NWJA 1GDTA 4IDPA 2ETVA 1DKLA 2ZKIA 3TPFA 1X94A 3PFGA 3PGKA 3R7FA 4JK3A 4I1OA 3L1UA 1EWRA 3HZRA 3HU2A 2WHPB 4WIAA 2B8NA 4JN6B 5JFTA 1XQYA 2C92A 4HDNA 4D92A 7YASA 1HDXA 4TVOA 3JQ8A 2IEGA 1FS5A 3GIWA 3ZIAD 1L5WA 2NTNA 2DETA 1P2FA 1UMBB 4OLFA 3ONFA 1LF5A 3JAWA 5J1TB 4Y6PA 1ZMOA 4HZUB 2AYYA 3TTSA 1PEYA 3L8HA 2VPWA 1TCCA 2C88A 1KOLA 4NU6A 4O2BA 4KK4A 3GLTA 1M1ZA 1RYFA 4D41A 3RR2A 4HF7A 1BCRA 4QYTA 2JI6A 2O7RA 3PD0A 3I76A 1RMQA 4EO7A 3LT5A 2HH9A 3LUCA 3N5KA 1FU4A 2ISQA 5CIWA 4A8JC 2FU5C 1Z6GA 3RWOA 2HK8A 2WIAA 4KTTE 3VO9A 4OAPA 3BMXA 3KTAA 2PZAA 4ER0A 1QOPB 1VXOA 4FLEA 4HQ6A 1T4MA 2EJCA 3ZWQA 4DT1B 4B7ZA 3JQBC 4JCOA 4WGGA 1NPTO 1QLJA 1D07A 4GUAA 1J2UA 1NQWA 3EUEA 4O02B 3DDNA 1Y5MA 5COQA 3JR7A 3KSDO 4B3RB 2CXOA 3RGWS 5CVUA 3PDIA 3P9YA 5BMVB 1KO8A 2I4TA 3KO8A 4EJ0A 3A70A 4ZVMA 1IH8A 1M2KA 2ZYIA 4MI6A 3DLTA 3AF1A 5ENZA 5F1OA 5A2GA 4UXJA 4PZYA 3MJRA 2DFTA 4POAA 4F1WA 1ATIA 1BG6A 3GMDA 1Q0PA 2VVTA 1L7OA 1EM8A 2VQSA 1FY2A 1H2HA 1V11A 1J20A 3MHPA 2BR4A 1I0LA 1YBVA 3OWOA 1GL3A 4DCVA 2FMUA 4TXLA 2PRIA 3SXPA 4DA9A 5CEEA 1O9GA 2JDID 2GXSA 3HJGA 1SUEA 2JFOA 4L8YA 1MO4A 3ZY6A 1Y98A 4PLWA 1ZCJA 4JI5B 4HWSA 3P96A 1DV1A 1FLVA 1BJRE 5ALXA 2ZUEA 1WMAA 1YI0A 3OPVA 4LF6B 3PXBA 2CNNA 3JWGA 4AD8A 4TLAA 2B8TA 3PXEA 2QL7A 2Y99A 4U7HA 3U4HA 2R8EA 3K32A 4OXRA 1L4KA 4RZXA 4B2LA 3OSUA 3RTGA 1P39A 4KDEA 4G6ZA 2ACVA 3EPRA 2CDNA 5JPCA 2QUBA 1Z17A 4S1NA 1VSBA 1ZOSA 4FMDF 5E0KB 5I9MA 3JWJA 4B4UA 5L40A 3A28A 1LLCA 5TQ0B 4ER3A 3HSSA 1PK9A 5KJ1A 1U7XA 3B85A 4K9SA 4CV0A 2BGTA 1ULHA 1N5KA 4X71A 3ROZA 4BKPA 2IYTA 1A9YA 2JKZA 1CDOA 3GJZA 4CR8A 1V5GA 4WI1A 2N46A 5IN5A 4HRAA 3EVCA 4QRIA 1YFKA 1KI8A 5IJXA 2XQJA 2J07A 4YONB 4RKRA 5BNTA 1KO1A 3DM5A 3O4FA 3NEYA 3P1JA 3DMYA 1JMYA 2DUWA 3KQWA 4XTRA 1VHWA 5CVJA 4G1VA 1TEZA 1J56A 3ELYA 5FBWB 1X9GA 5FUMA 3NX4A 1SUIA 2XTJA 3GBSA 4GL2A 2HWYA 1OGJA 3I01M 4WK2B 2IUYA 4XUDA 3I12A 3F8TA 4I1RA 4XE5A 4HADA 4NBNA 1OI4A 1VPLA 2WFLB 4MX8A 1H66A 1KEZA 3VNQA 1FTSA 1JKXA 1BXRB 2OMKA 1OWNA 4M36A 1YBHA 3SWWA 3P2YA 3C4QA 3NVMB 1PT5A 4HPJB 2BEWB 2WP8J 1XZPA 3CRNA 3NMUF 4RGVA 4D82A 2D1SA 3I64A 4GPBA 4BMDA 3H7AA 1GM5A 2WU1A 2ZBEA 4OGLA 4L4SA 2QAIA 3SX4A 1OZGA 5HSGA 2VPQA 5HR5A 3COZA 3LUJA 1NNEA 1EX6A 3OWXA 3ENKA 3BGVA 1QR6A 2APJA 1KY2A 1U4NA 4D0RA 2UZ4A 1POWA 2ZB4A 5HFJA 5A71A 1NFFA 1V1RB 2CFIA 2FZKA 5EE5B 1G2OA 1W30A 3O1JC 3E9DA 2WFMA 2BAGA 4P08A 2RB5A 2BFCB 2PQ6A 3OJXA 4I1UA 4PAMA 2A0WA 1GUBA 4UM5A 4XRRA 3A1UA 1W0JA 4YQEA 4PLFA 3D9QX 4P4SB 2VTDA 3N58A 4KXXA 2J08A 1Y9ZA 4HN9A 5KNDA 4DY6A 2MDTA 1FTQA 1M2WA 3B70A 3ESYA 1UQRA 1V8BA 3LMKA 4HDAA 1G18A 5AHXA 3U56A 3EUWA 2IXTA 5E9WA 2IW3A 4QDZA 4IMJB 1YD7A 1AKQA 5AW0A 3RSOA 3MTGA 2PMDA 4ITVA 4MVJE 4B79A 1DJLA 1F4PA 1K68A 2GN1A 3NASA 4G65A 1XZFA 4K9DA 2VEDA 5CLLA 4E88A 3S1AA 4HFMA 2ZT5A 4BUJA 2IVFA 3VR3A 4BTLA 4UHKA 1CY4A 1RI5A 3L7LA 3D7KA 4FBMA 4IP0A 3H4TA 3EXHB 3ZWAA 4ALNA 4EYKA 2XD4A 1QZUA 1FE8A 1EFLA 4FYXA 4DSAA 3OJFA 5DV9A 2AKYA 3WLRA 3L6BA 4DC9A 1S01A 3TLGB 2OVFA 1PFYA 1ZC3A 4AZTA 4OI0A 4YX9A 1OY1A 2XE8A 2JGIA 3COSA 1Z9BA 3T1OA 2Y66A 2PT9A 3MXTA 2QR3A 2YUIA 4N5LA 4YR7A 5LWQA 2O3JA 1SN7A 1P2GA 1ZUNA 5G53C 3ER8A 1DFIA 1SBQA 4JZKA 4KU4A 5DXJA 4XB6B 5C0OE 5AW4A 2WG0A 3L0ZA 4Y98A 5DE3A 1P45A 4IIXA 2NV6A 1GRNA 5TARA 4A36A 3KELA 2WF7A 1RHRA 3OQBA 3K20A 2JGKA 4QPCA 3PEYA 1G20B 5EHGA 3QBEA 4RVFA 1BH2A 2A7XA 2FJ0A 2MR6A 3AERA 3NC4A 4OQLA 2YTZA 2ZS8A 5CBKA 1XQVA 2ZJ5A 3OETA 3P9NA 2P5TB 4IIJB 4F4UA 3M8KA 5CXUA 1E0JA 3MC1A 3VTZA 4QPNA 4E5VA 5IT4A 2ZXUA 4GGMX 3MWEB 4ZDWA 2QTAA 4M0FA 4V0QA 4U4AA 1U02A 3AY3A 1LNSA 2D59A 3EZXA 2I2DA 4HMOA 4ITRC 4REMA 5CG1A 2WA2A 2IF0A 3WIUA 1NE7A 1RACA 2ZRIA 3FAZA 3OX4A 3U3XA 2BZSA 2H31A 3PNSA 4XARA 1SBTA 1PKEA 3HBNA 4QTUB 5CW1A 3GRKA 1ACLA 3BCRA 1R4NA 5JCJA 1WDKA 5DOZA 5JDCA 5DEOA 1V37A 3D3NA 4DDTA 1WTCA 4O6VA 4OIFA 5B1YA 1CSEE 1BX1A 1DQZA 2VPTA 3DP9A 3I04M 1XJQA 4AZWA 4KVGA 2XA2A 3FPAA 3O8QA 2EX0A 3OLCX 4DBVO 2I1WA 5IYZB 1AK2A 1UBNA 3LY7A 4JWKA 4J90A 4D8XA 3HB9A 1E2DA 4BFLA 1OB5A 1KTVA 2A88A 3D81A 5TV2A 3GUYA 1GPAA 2R86A 4M0EA 1A71A 5TJHA 2XZOA 1DKQA 1U3WA 4H4CA 3AEQB 5I9IA 4QLOA 1MU0A 3CLUD 2BJWA 2P9CA 4MUJA 5E6RB 1RRVA 2D1RA 3ILXA 4M0UA 2GK6A 5WRFA 3NHBA 3OC0A 3M3DA 3UVEA 3UT0A 5A1JA 5DHTA 5JS7A 1P3Y1 1SVUA 4X8OA 2H9AA 4BE9A 2GCOB 5EJ2A 2MOKA 1YZNA 4EOGA 3QOYA 5A5GA 1DC8A 1P4AA 2ZULA 1J42A 3ES9A 1XNGA 1PYOA 1ZXXA 1UXJA 2WIFA 3BL5A 5ESRA 3PXAA 5CXXA 2FPXA 4TPKA 5KJ6A 3KKOA 4CKEA 3EXFA 1Z4IA 4OXIA 4WEOA 4XEUA 3GA0A 3V80A 1T2CA 2R44A 3SQOA 2RHGB 3FTNA 3L6RA 2C95A 5KPJA 1Q11A 3PZBA 2DECA 1I7DA 1N3YA 2XYPA 4AMBA 1W96A 1V5WA 3OLWA 4J0QA 3UHOA 3WYEA 2IS1A 2PKEA 1W49A 2VNIA 4KV9A 4W1PA 2HY7A 2IUEA 3QJ5A 3G88A 4LA4A 4N7MA 4QM6A 3AR7A 3OZ7A 4G8CA 4HDKA 4BNIA 3QKWA 4LDZA 4GU5A 3ZVLA 4H60A 2JJ1D 3H18A 4TUYB 4B75A 4ZQHA 1JIUA 2M6RA 4TL9A 1ZGJA 1ZSNA 2NNLD 3WWCA 3FKQA 3V32A 5IEBA 2C4WA 4WBSA 3RDPA 3RF6A 5L45A 4ZVPA 2GD6A 2XE7A 1E6LA 1LJ8A 4S2EA 5K8LA 2ZJ7A 3VH3A 2QRVA 3QVUA 4YMTA 5KYGA 4KYTA 3OE5A 1W7AA 2FPPA 2WWWA 3AUJB 4XEHA 2LCQA 3C5HA 3H2SA 4KFUA 4NEHB 4DWWA 4KXWA 1KJNA 5LUAA 4IX1A 3EPHA 1TT5B 3Q5GA 4AWBA 3FBWA 4EI9A 3EHDA 1R9GA 3VZPA 4WD3A 4DLSA 2C1ZA 4LV5B 4G09A 3WTBA 3QQ5A 1Q7CA 4R83A 3OO0A 3ZGZA 4Z5XA 1M2VA 5SZKB 1K2WA 3P9IA 3DWGA 1E3JA 1SCKA 2HQRA 1Z34A 2PG3A 3BMQB 2BFWA 3OPYI 3TIFA 4A27A 2DAPA 3LFHA 3OQHA 4NMHA 2D0PB 2OOKA 1L3IA 1I9GA 1P0QA 2ZSBA 4MP3A 4MUNA 5FIUA 2EXXA 5JI2E 2IU0A </