3OIWA

H-rasg12v with allosteric switch in the "on" state
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oiwA00
4HLUC 1EFRA 2G9NA 3GEEA 4ASUA 1P2SA 2ZJ5A 5DN6D 2GJAA 2YNMA 3TMKA 1W4RA 5JS7A 1N2CE 1OKKA 1VYVA 3P27A 1FFHA 3GCGA 2GKSA 1EFRD 4MRVA 3DPUA 5KSPA 1E1RA 4FINA 2OV2A 3GPLA 2WJIA 1D9ZA 3MSXA 1NMZA 3OESA 2GXQA 5JMTA 3F5FA 5CJPA 2IYVA 2JEOA 3BH7A 5H1YA 1S9HA 1T4GA 3VR4A 3WY9A 3U7HB 3DMDA 3I32A 1E1RD 5AJYA 5GJWC 2WAYA 2MMGA 3VKHA 3K9GA 1LB1B 3GLFE 1QHNA 1SXJB 3TGPA 2JCSA 5HKKA 1G3QA 1S4QA 2V7QD 3DMNA 1N6HA 3Q85A 3B7GA 2GDJA 3R7WA 2ZIAA 4S35A 3T5GA 4OQNA 1HE1C 2ZRPA 1GL6A 1EK0A 3CKLA 3SI7A 5AUNB 4IEIA 3MAAC 2P0EA 4ZKEA 1Z08A 4JBYA 1NP6A 4Q1DA 4DLSA 3D8BA 2ZEJA 1DAFA 1FQJA 1XTQA 1WCV1 5AK0A 2PMKA 2G88A 4NPHA 2AWNA 4RD1A 3MMPA 4TL7A 3ZD7A 3TBKA 2CCJA 1Z0DA 4AG6A 1N0UA 2XXAB 2JJ8A 4DSUA 5DIFA 1IN7A 2O0JA 1NF3A 1IY1A 4C30A 5M04A 2NO0A 1IQPA 3LXRA 4PPNA 1R5NA 2WICA 4L8GA 2GBLC 3KKNA 4B3CA 4E07A 1BOFA 3UATA 4B35A 1HV8A 5FL7D 1DAMA 1G19A 2AL7A 4C0QC 5J4HA 3W9YA 2A78A 1OYYA 3ND9A 3Q3JB 4IFBA 2ONKA 1OV4A 2D7DA 2IYTA 2J7PA 1XTIA 1COWA 1Q1QA 4RZXA 3ADDA 2BMJA 2REXB 1TQDA 4MUAA 1U9IA 4PC1A 4FWTA 2O8CB 1K6MA 2WJYA 1KJZA 4F7WA 1EX6A 1NVVQ 3ZVMA 3THYB 2BKUA 2CVHA 1H8EA 2ATVA 5KDOA 3N5CA 1R4AA 3DKVA 2D7CA 2ZI9A 1Z2AA 3H4MA 4US1R 3KKMA 1G3UA 4XIGS 1CKEA 1JXOA 4R2HA 5G41A 5BN4A 5IT5A 2YWHA 2VRWA 5JWRA 1CR4A 1GILA 3WP1B 4HSEA 1AKEA 5E7IA 5HE9A 2ZTSA 4DEXA 4MQBA 1DAHA 4N3NA 3W5IA 2WHXA 1YR9A 2IYSA 1X8LA 2IHYA 4IRUB 4R9UC 5DYGA 3HYTA 1OJLA 5B64A 2LKCA 1G8FA 3DOEA 1GG2A 5DI3B 1GOTA 1VHLA 1UKYA 1C1YA 2BM0A 2GJSA 2R6GA 3U3MA 4A92A 3K70C 4OJKA 2OCBA 3DL0A 2IYWA 3OZXA 4OJQA 4KYUA 4R71A 2ZE5A 3R9WA 4TLAA 5EUMA 3FHCB 1AZSC 4GZLA 1Q57A 1XTRA 1NRJB 4B43A 4O2LA 1AS2A 1W46A 4PHGA 4ESHA 4TWZA 1G64A 4FCVA 3U2QA 4ZIRA 4LJ9A 1IY2A 5KUTA 4LYAA 3T06B 2RGCA 3X1XA 4C0BA 1UDWA 2ZI3A 3CPHA 5KSOA 4OBEA 3RABA 4PZYA 1T0HB 3SJBA 4A2PA 1IBRA 2W6ID 3CRRA 4NKRA 4Q1FA 3GJ7A 4Y0VA 2QY9A 5AUQA 3NIBA 4C7OB 5EE0A 2OUKA 4JLPA 2G0TA 4MYTA 3TQFA 2CHQA 4HI0E 3Q9LA 2J5XA 1BKDR 2AKYA 4RCYA 5SZHB 4DDTA 1YE8A 4B2LA 1VCMA 5H68A 2W6JA 2QMEA 3VQTA 5GJCA 3CNLA 3K8YA 4Q19A 3U7FB 3DEFA 1QHGA 4ZV4A 4U7DA 3FKSA 4C0SA 1W2HA 3W3ZB 2GEUA 3NH6A 1XBTA 4XWKA 4LJ5A 2BMFA 3NC1C 1WP9A 2ZSEA 4KFRA 2WJGA 1ELOA 4V02A 4TYYA 3CRMA 3Q5DA 3AM1A 3L8ZA 2P6RA 1ZW6A 1NN5A 3ZS9A 3OIVA 1TTTA 1T3HA 2QPOA 2X19A 3C5CA 2RMKA 2X77A 4TL6A 1F2TB 2G1JA 3H1TA 5K8UA 4MGZR 4P4SA 2ZM5A 2WSSA 4G5QA 4TQAA 1TL7C 4JSTA 1HURA 4B71A 4M9QA 4OQMA 1GL7A 5GJBA 4TMTA 2OO7A 1QHXA 3EIHA 2W0MA 1E9FA 3CPJB 4Q01A 2C5LA 3TUIC 4P3YA 1XTSA 4B75A 1IN4A 1KZGB 2Q6TA 2XZPA 5LBIA 4Q7MB 4D0GA 3TIFA 4M21A 5JLJA 4DC9A 3W6NA 3NTUA 4URZR 2A5JA 3K70B 4GP6A 3L0OA 1SZPA 1S1MA 3VX3A 4HAWA 4QJ3A 4RKEA 4YLGA 4F38A 1DEKA 5IDVA 5FTLA 3A1VA 1W48A 4FCWA 4ILEA 3FKQA 3SR0A 1GVNB 3WBKA 2GETA 4NONA 4TMZA 4NYJQ 2HV8A 4QHSA 3UKDA 5C46F 2XSZA 2P67A 4Q9IA 4G5GA 3SZRA 5L3RA 2O0HA 3AVOA 2FH5B 4OQLA 4V0LA 2NIPA 3M4YA 4L9WA 1NN0A 1PZNA 1NKSA 3QXJA 4TMWA 1QVRA 3SOPA 3QVUA 2WIAA 3UPUA 2XZOA 1XD2B 1Z47A 1E2LA 3X1DA 5FH9A 1NMXA 1FMJA 121PA 1P62B 4LHXA 4LOAA 4UNRA 3KKOA 4OHWA 4YMSA 2BEKA 2RGEA 4NCKA 1N6PA 4TLBA 3VR5A 3WMGA 5DISB 3FB4A 4JKYA 2ZROA 1FW6A 4M0LA 4OI0A 5FBLB 4KYIB 1DELA 3L82B 1YRBA 1EESA 2ATXA 3GP8A 4NU0A 1KI4A 3A1SA 8OHMA 4D6PA 4GFDA 4BFVA 3CX8A 4CT5A 2QQ0A 1CXZA 5TV2A 1YZUA 3EZ7A 1UEIA 4IDHA 4B3GA 1YR8A 1OT3A 1X1RA 1FL9A 4PPGA 3BH6A 3E2IA 2QTHA 3QF4A 3SHWA 1E0AA 2MSCB 1II9A 1ODFA 4NTZA 2ZU0C 4PC3A 5FBWB 4LWZA 4CVNA 3AVXA 1P73A 3R9XA 4LV5B 2IBMA 2ODNA 2MSEB 5B2ZA 1P9WA 4KFSA 4DJTA 3K0CC 2X2EA 1T0JB 4LDJA 3ZGXA 821PA 1EFHA 2GZDA 3CM0A 1K8RA 2O8FB 2J1LA 3X2SA 4BGDA 4OL0A 4LHVA 3K0SA 3A4NA 3IO5A 1U9IC 5HTKA 4PZZA 3REGA 1NI3A 2XAUA 1CJVC 2Q21A 3WHLA 3K0FA 2VPPA 2WTUA 4XSHA 3AKEA 5P21A 4XVQA 2VA8A 1ZJ6A 4Q7LA 1LFDB 3TJZA 4L9SA 1T5IA 3RHFA 4JLKA 4KCGA 3AEZA 1XPOA 2FE4A 4JVLA 4QGFA 1E2FA 3K09C 5LB4A 1XMSA 4LHWA 2C96A 1OF1A 1KJWA 2J45A 4AKGA 4RZUA 4UQOA 3VNVA 4PQYA 3I8SA 2EVWX 4LPKA 1E9BA 1W36D 2R8RA 4HATA 1H8ED 3M6AA 2B7CA 3ASZA 2UZ3A 1XRJA 1T3LA 4Q48A 1TF5A 2BMEA 4JSYA 2JJ1A 3K0CA 3MJHA 4B44A 1PVOA 4ON9A 4AIIA 2ZJBA 5J4YA 2PCJA 2VP6A 4BZPA 2J0VA 1JQJC 1NVWQ 5SZIA 3ICQB 2V4ZA 4B3FX 1ZYUA 3HDTA 2ZRFA 1NLYA 1A2BA 2ZREA 1E79A 4PO8A 1L7VC 4PSVA 4JLNA 4DIEA 5JI3E 2DFKB 3H84A 1DADA 5CM8B 2RGDA 4M9SA 4MRPA 2FN4A 4MYHA 4V0KA 1RW4A 2IW3A 5F9HA 2PT5A 5EXSA 1Z06A 4W7SA 5DHFA 1ZM2A 2ZRLA 4AC9A 1OW3B 2XGJA 3A58B 1U8YA 2BJWA 4A0RA 3U44B 1S1CA 2I1VB 4JVMA 2FGJA 1LS1A 4IEEA 2J3EA 5FPSA 4LV6A 5JECA 2FZ4A 1XJCA 2O8FA 3B8HA 1NY6A 1KK2A 1BH2A 4BLTA 1I2MA 5KYKA 1Q3HA 4B3XA 4F93B 1KMQA 1FP6A 3U4QB 4F4JA 3I61A 3THWA 3K0FB 5L3QB 2QG6A 3IUYA 3VR6A 1OH5A 2YZ2A 1E2DA 1GITA 1VIAA 1KK3A 4DDUA 2BOVA 3WNCA 3UMFA 3UMRA 2Q3FA 4DCTA 1AS0A 3AVQA 3QPVA 5JFGA 1M7HA 2IS2A 2PEZA 2R2AA 2ZI7A 3BBPA 2A7QA 3CIOA 2GVZC 2P2LA 2WOOA 4OHXA 3WYGA 5JRZA 3IBGA 1I4LD 5FOWA 4LYHA 1NBMA 1S8FA 2V6JA 3QKRB 5KDLA 3LVRE 4MKFA 2ZRGA 4U00A 4EJSB 1ZNZA 2IXEA 1G7RA 2IS4A 1Z6XA 3IGFA 1CTQA 1YR7A 3PUWA 4QJ4A 2NTYC 3LH5A 1RRGA 1M6NA 5DN6A 3IPYA 3IKJA 3I62A 3C41J 4Z1MA 2QI9C 3NBZC 2YV5A 3NDPA 1Z07A 2CVFA 3PUYA 1NMYA 1SGWA 4TMXA 4LZZA 1E9SA 2ZJZA 3V4RA 1Z6AA 2QM7A 2XXAA 3MWLA 2R6DA 1M7BA 3KUDA 2QAGA 4RD3A 1U8AA 5AJWA 4D81A 2W6IA 4GPTA 3D3QA 2IXGA 1IM2A 1BO6A 5AJZA 3U3RA 3DVLA 4BLSA 3FMIA 5F3WB 1ZD9A 5TB5A 3VHLB 1E2HA 4IVQA 2ZJAA 3BB3A 4LJ4A 1UM8A 1TQ6A 5FOXA 1MKYA 4PAMA 1FUKA 2DCUA 3NBXX 3DZ8A 2W58A 2P6UA 4IW3B 5FI1B 4ZCIA 3AUXA 2RGGA 1NVVR 1LY1A 3GLHA 2NO6A 2I1QA 2I4IA 2GK6A 4B2PA 4GI7A 1R7RA 5L3QA 3JVUA 5JEDA 1E99A 1GL9B 2QMUA 2EYUA 4UXIA 1CIPA 2BBTA 4BFUA 2DFNA 1TEXA 3OIUA 2F55A 4EPXA 2BEJA 2J0SA 1IAQA 4KU4A 2Q9BA 4GOKA 3K9LA 1N25A 2QRZA 1GKUB 2GJ8A 2OILA 2QPTA 1XEFA 2A3RA 2ZRDA 1LF5A 2WVJA 1VCNA 3NXSA 5AJXA 2CLSA 1WRBA 3CH5A 1VPLA 3LQRA 2EW1A 2HT6A 3PV0A 5CK5A 5JBQA 2QTVB 5FTKA 3FYHA 4A36A 1IJEA 3D31A 1P60A 2MMCA 2VSXA 3HYRA 4IVRA 2QGNA 4PC7A 4QFMA 1ZP6A 1D2MA 4TYPA 5EUQB 1VTKA 4YQFA 2VH5R 6Q21A 1E2IA 2V9PA 4NCIA 5DI3A 5IF9A 3LDAA 1DOAA 5BXQC 5HZKA 2IA5A 4NL4H 3WYFA 2ZYWX 4XOIA 2ORWA 4C9BA 1PJRA 1I4TD 2QP9X 4ZPXA 3LFUA 4EPYA 1YZQA 2XEXA 1SVIA 2VYFA 4EPRA 3QKSA 3ZJYA 3GFTA 5JS8A 4FMDB 5F98A 1GRNA 2XTMA 4A6XA 4DT1B 3S1AA 2J46A 3KXIA 2PX0A 1IHUA 4BLPA 4D2IA 2YOHA 5HPYB 4HDOB 3OF5A 4DUGA 4URYR 4PSKA 4RJLA 5J5CA 2GCOB 2D3WA 1KO1A 2NO1A 3I92A 2GJ9A 3I5YA 3I8XA 4UNPA 2DPXA 5G53C 1OIWA 4BFSA 1OXSC 1DO0A 1SULA 1T8UA 4DCSA 4A2QA 4DLYA 2G77B 4RZ2A 1OHHA 1RRCA 4B3BA 3ZD6A 4KXFB 3VKWA 1T9HA 2KBEA 1UBCA 2ODEA 3B9PA 1IN6A 4Q4JA 4JZKA 1ZIPA 5FOVA 3CONA 4MGKR 3K1JA 3FE2A 3IQWA 1E6CA 1G9XA 3ND8A 4XSGA 2FA9A 2YC4C 2ZVQX 3SYLA 2AR7A 1HUQA 2JDID 3RS2A 2H7VA 1AA9A 1DVRA 1F2TA 3J81k 1U94A 2CL7X 1U0JA 2FPKA 3KXKA 4I4LA 4JLAA 4W5HA 4A2WA 2YOGA 4HAXA 2D62A 2IC5A 5CIWA 3VR2A 2JIZA 4DLUA 4HUQA 1EG7A 3CF0A 2ZSFA 5DNYB 4D4MA 5FPKA 2CL0X 3KQUA 1TNDA 2WJVA 2XNSA 2IF0A 4OHZA 1Z22A 1RFLA 5HCNA 1FQKA 1QG2A 2NGRA 4G5RA 1UBEA 4TZ0A 3RRZA 3UWOA 4D25A 3VU9A 3H0KA 2XOKD 1S3GA 2FSHA 2JASA 4GDFA 3KB1A 1YKSA 4ZIRB 1OFTA 2WV9A 2Y8EA 1X1SA 5FUXA 4QG7A 2BDTA 3BOSA 3EIEA 3B78A 2WSMA 1T91A 2QBYB 1CR2A 3EC2A 3T1TA 1YR6A 3WRXC 1D2NA 1BYUA 3QXSA 1TQ2A 3FDIA 1F48A 3IQXA 1ZUHA 2PCLA 2XB4A 3LXXA 1PUIA 2O5VA 4P33A 4DT1A 1OXTA 4A9AA 2PEYA 3BJIC 1Q1BA 4LGMA 2R6AA 4R7ZA 5EP4A 3BD9A 4QRHA 3EZFA 1N0VC 1S3SA 4LJ8A 4MITA 4Z1MD 2O52A 3TVTA 3K9HA 2GCOA 3OIWA 3GJ3A 1XMIA 3OFND 3QQ5A 3QPUA 3K70D 3GLIA 1XX6A 1E2QA 2OZEA 1MABA 3N2IA 5FPTA 4OK3A 4A0HA 1WMSA 2ZPTX 1M2OB 4HAVA 2RGXA 1KO5A 1GM5A 5EE9A 2ZR9A 1UAAA 1ZNXA 4PC6A 2CJWA 5BN5A 2AHOA 2ZJOA 4BEJA 3PIRA 5HR5A 2DFTA 5DH9A 1GZSA 3SFVA 1RYHA 2ZYUX 4WA7A 1II0A 2ZRAA 3AGPA 2ZRMA 2LKDA 3LBIA 2WBLC 1D6JA 1F2UB 1N0WA 3OAAA 4Q03A 1JR3E 3JZAA 1R5OA 1P2UA 2C77A 5H70A 4E03A 3U6KA 5KPDA 1VG8A 1CBUA 3LBNA 1S9DA 5H8WA 1XXHE 2RGNC 2W83A 5B57C 2GXUA 3KXLA 3MWKA 2J59A 1AGRA 3PUXA 4RD4A 4YXWA 5EE3A 1U98A 1ZU4A 1OB2A 4IDPA 3A8TA 5E4FA 5B30A 2HUPA 1E4YA 4B34A 1N5LA 4Q4HA 1OFHA 4RFSA 3VTKA 3A1TA 2O8EB 2NZ8A 4M1WA 3N70A 4KITB 4V0OA 4BFWA 4QGAA 1PV4A 1E3MA 1HTWA 1VDZA 3BS4A 4BE7B 3MWYW 4UXHA 2JAQA 4KVAA 4B47A 4CEJB 3E5HA 4TTPA 3T12A 4DSTA 2WMNB 1KDRA 1KK0A 2QSZA 4WIAA 3LD9A 3QPWA 1F6BA 4CW7A 4QBGB 3EA5A 1TADA 2DWOA 4NCHA 3NH9A 4QJ5A 3GLGB 1HQYE 1RC8A 2C9YA 1A82A 1NKTA 1GFIA 2DR3A 2FFHA 2HXYA 3IPXA 3U7EB 3C15C 2Z83A 4H1UA 4DB4A 2QL6A 3L0IB 1TU4A 2Z5FA 1R8SA 3T1VA 2R9VA 4JLJA 4JMPA 3ADBA 2GXSA 4A6PA 4P31A 1TUEA 4MYCA 2JLVA 1GSIA 2WAXA 1K5DA 3HU3A 4JLMA 1A7JA 2GZAA 1NJGA 1V5WA 3I72A 2HDNB 4XJXA 3AVVA 1Z0JA 2VTKA 4AKIA 2ZE8A 3GMTA 2BC9A 3QXXA 1OH7A 1K5GA 1R2QA 3VR3A 4PPQA 4WZ6A 4ACBA 5C18A 5A0FA 3TKLA 1M34E 4YDSA 1XCPA 4KVGA 4AG5A 3QG5A 2VHQA 3KZ1E 4UNQA 2D2FA 4NYIR 2IUTA 1IN8A 2AD1A 4V0MA 1Q1ZA 1OPXA 4A4DA 1CULC 1OKKD 2C8VA 3RRYA 2EFCB 3QXHA 1OE0A 3BE4A 1VYTA 1SVWA 5FUVA 1NLFA 4I1SA 4M53A 2DWPA 4DCUA 3QG1A 3W90A 5C1BA 1DG1G 4QM6A 1MO5A 4TTRA 2H92A 1HEIA 3LW7A 1KDTA 4U02A 1VYUA 3O8DA 1TQ4A 1OFIA 3BRWD 4TSFA 3T1QA 3WNBA 1DPFA 2RKOA 2H57A 1NVUQ 3GD7A 3K53A 3PVSA 3AVUA 3ZLJA 3GJ6A 5SZJA 4JLVA 3VR1A 3KUCA 1FMLA 1WDTA 4PQFA 3IO3A 1KI1A 1UPTA 4JYCA 1GKIA 1GWNA 5KPJA 2FEMA 3NKVA 3KL4A 1Z6GA 1G7CA 2JGNA 4LSGA 4ZCMA 3KJHA 4HB4A 5LB2A 3NHAA 4F92B 2Q9CA 2B21A 3LAWA 4JIMA 3LVQE 3SE0A 3UK6A 1MO6A 1IOZA 1MO3A 2MSDB 2OXCA 4JLOA 4V0ME 2GBLA 4M22A 1WBBA 4OHYA 5KNDA 5D3MA 1M8PA 2CMKA 4W5JA 4JJKA 2V54A 1KSFX 3H2YA 4IHQA 1DAGA 2BVNA 2WJJA 2GCNA 4F4IA 1QHHB 5JHGB 4PHFA 5J4VA 4A8JC 5FBVB 2WM9B 2NQ2C 1FNNA 4OHVA 1DO2A 4AYWA 1Q20A 4DB2A 2D74A 4XVRA 3O8CA 1Z0FA 1G3MA 2QAJA 3HR8A 3PITA 2ZUCA 5CM9C 1KI8A 4NYIQ 2ZQ5A 2EFGA 4GOJA 4M4SA 4B73A 2QA5A 5FL7A 1YZGA 4M2LA 2N1BA 2LWIA 1J8MF 3TSOA 2H18A 2FSIA 1XMVA 2F9LA 5EXPA 5JJIA 4K81B 3L8YA 3T35A 2WKRA 1E32A 1E2EA 2BM1A 2ZUBA 4IKEA 3WNDA 4UNNA 1XEWX 1QDEA 3CB4A 1WQ1R 1A2KC 1N6IA 1KI6B 3P4XA 2P65A 1E96A 1CP2A 2GNOA 4LK2A 2FDCA 4RY2A 2GWHA 3PR1A 4Y0AA 4ABYA 3KJGA 1T5LA 2BBWA 4BFZA 4G01B 1A1VA 2HF9A 4ZI3A 4NYMQ 1DTSA 1CS4C 1MOZA 1RJ9B 3QVVA 3TK1A 5KDDA 1GRQA 2ANCA 4PO1A 1D9XA 3BH0A 5FR1A 3NHBA 3AF3A 5DE3A 2OLJA 2VEDA 4JL5A 2XB2A 3Q7PA 5G40A 1NY5A 3SQXA 2HLDA 4IDQA 2QAGB 2IYLD 4O25A 3VKGA 4A8JA 1BMFD 3U44A 1J99A 1G20E 3FKSD 2DYKA 2JATA 3WMEA 3ZZ0A 4G3XA 4OI2A 4KI0A 2EWWA 2BKEA 2HJVA 521PA 421PA 3BFKA 1JR6A 4YMVA 3I5XA 5GVSA 4WZBE 2F1JA 2OT3B 1Y63A 4L16A 3U7GA 4AY2A 4HAYA 5FOUA 1YHNA 1UKVY 4IDNA 5JHHB 4PFSA 3MRSA 4CEIA 3THXA 2A5GA 1IXRC 2B92A 3M0EA 2KE5A 3EZ9A 4BWYA 2PMDA 1Q12A 2FFAA 4LV8B 1N6OA 1U8ZA 2KJQA 3B9QA 1OFUX 2C03A 2ZUDA 5DSZA 1NVXQ 1ONBA 2QGZA 1XPRA 2PL3A 1GUAA 2OXRA 3OEEA 5KTYA 2IX3A 4N0EA 4MRNA 2NO7A 4EQ6B 1ZUIA 3QKRA 5TY0A 5AWFC 2HCBA 4EJSA 2SHKA 4HZUA 3IIKA 3B82A 3RWMB 1Q21A 1R6BX 2WWGA 2PBRA 4PQRA 2ZS8A 1X8KA 1G8GA 5EJEA 1B0UA 4V0NA 2ZJYA 3NDBB 2Q0HA 3EZ6A 1UEJA 3SJAA 5JCPA 4A82A 1EXMA 5ELXA 4E09A 2FJUA 4GL2A 2R44A 2CLCX 4NZYA 2FG5A 3FOZA 2VHCA 4WAUA 2G6BA 4Q1AA 1XF9A 3SU8A 3CH4B 4KJZA 2BV3A 1DE0A 1G4UR 2RCNA 3ADKA 4Q1CA 1YJ5A 2V8OA 2QT0A 1UDXA 5KNBA 1E2KA 4E22A 2YYZA 5EP1A 3OAAD 3QOFA 3TH5A 4M9XA 1M74A 4WZAE 4ZKDA 5KO2A 3BORA 2BBOA 2C98A 1SQ5A 4Q4AA 4HAUA 4O2RA 1JALA 2ZXUA 1ZIOA 1EFCA 2H16A 3S1AB 3F3YA 3KQKA 4D26A 3KTAB 3UMSA 2C95A 5EP3A 4PANA 2OFXA 4BRWA 3SQWA 2A30A 3GLHB 1Q22A 2J0UB 3IBYA 4URVR 3ZQ6A 5JRJA 2XTNA 3QI2A 3VX4A 621PA 2ODWA 2OBMA 4GZMA 2UKDA 1JPNA 2WPDA 3FFBA 3SS8A 1FP7A 2QM8A 3P26A 3GLIE 4PXAA 4R98A 1KO4A 2V7QA 1V43A 4RKFA 4DLWA 1KDOA 4DXAA 3LX5A 4YONB 2XITA 4GMDA 3RSOA 2IS6A 1KNQA 2G1KA 1KO8A 3EZ2A 4K46A 5A4JA 3PFIA 3TW8B 3ZQJA 4LBWA 3AVTA 3RDPA 3IDQA 1P6XA 2C9OA 3BB4A 5EE5B 2W2TA 2FZLA 2QZ4A 5EXTA 1G17A 1O87A 2NZJA 3BGWA 5TDHA 4DCNA 1VCOA 2B8WA 2ZSBA 2VSOA 1WE2A 4YXWD 3ZYCA 4UKDA 1OH8A 2OBLA 1SXJA 1LS6A 3NEYA 4MRRA 2CBZA 3R7WB 4B33A 4AWXA 2RGBA 1IJFA 1AKYA 2QEQA 1MH1A 4QOSA 1LNZA 4FMDF 4WW0A 1JBKA 3ETLA 5CB8A 3VU9B 1BYIA 3SDZA 3SC3A 1KDPA 5C4MA 3KFVA 2J7PD 2R6CA 4C0LA 4KSCA 4M1YA 4MA4A 4FD2A 1E1QA 3JZMA 4M1MA 1D2EA 3ZZTA 1OIVA 2ORIA 1KOFA 5J40A 3AH8A 1KTVA 4DLXA 3IEUA 5ANRB 3G5UA 3EIQA 3KB2A 4DCVA 2BCJQ 4MDFA 1J70A 1X6VA 1E4VA 2RHDA 3WP0A 3ASYA 1J8YF 1UKZA 3PEWA 2V3CC 4NCNA 4H9GA 5FTNA 2HEIA 2VF7A 3EC1A 3ADCA 3GJ8A 1FZQA 1P9NA 4RD6A 1E2JA 2J0UA 2IYUA 1G7SA 4HB2A 4Z8YA 3GLIB 4ARZA 3G82C 1LVGA 1H8HD 4DIDA 5FUWA 2CK3A 2G83A 4BUJA 3EPKA 3OEED 3QIAA 2ZS9A 5CLLA 1KO7A 3W8NA 3PEYA 1FTNA 3THYA 4IOKA 4Q4JB 5J4KA 5KU1A 2J87A 4D80A 4YMWA 1XMJA 2CJWB 4OI1A 5G3ZA 2BBSA 1DAEA 1G18A 2OCPA 4C3ZA 1R0ZA 3LY5A 4OK6A 5BYJA 5AUPB 1SVOA 1H8HA 3C16C 2QP4A 4G5OA 1D8TA 1TF2A 3TUJC 4RFVA 3GEIA 2QPAA 1R10A 3REFA 2E1RA 4AK9A 1E9EA 2QQEA 4OQXA 2H1LA 3EWSA 2GZHA 3R9IA 1MT0A 3CRW1 4WXRA 2ZRJA 2WWIA 3K0AB 1M7GA 4FIDA 1G21E 3FMPB 4QNMA 4BQSA 4LYJA 3TW4A 2OG2A 2QUZA 4HDQB 2EFEB 3GJ5A 2QT1A 2NO9A 3OEHA 5BWMA 3ZIAA 4P32A 4URXR 3LNCA 1L4UA 1JR3D 3NWJA 3SJCA 3VFDA 3CX6A 1XCGB 1R8QA 3PJRA 3MD0A 4FXPA 1W0KD 1Z5ZA 1W2GA 1ZCBA 4HDCA 3RVBA 2ZR0A 3OFNA 1GDDA 2ZAOA 1EWRA 2JLWA 2A5YB 5CITA 3OIYA 1U81A 2KB0A 5IK2D 4CT4B 4EKDA 4ACAA 4Q4HB 4RFSB 3TR5A 3VHXA 4HB0A 2O8EA 5EZ6B 3QBVA 4IDOA 3B1YA 3CR8A 2O8DA 4LBVA 2OFWA 3QJYA 1ZNWA 3BB1A 3W8RA 1W5TA 1P9RA 4HUTA 3DKPA 1YZKA 3AB3A 2IEZA 4NE2A 2B6HA 4XD7D 4GT1A 4CEHA 2IT1A 1R0WA 5DO9A 3NBYC 5FPHA 4YMTA 1S2MA 3P4YA 1EGAA 1E2MA 2XNDD 5CIQA 3RWOA 3TNFA 4Q21A 2R6FA 4FWIB 1Y3AA 2PH1A 1NBMD 2WKQA 1P75A 2BCGY 5JJKA 4M1SA 3AKCA 3EA0A 4DEYA 5E7MA 3ONWA 1WBDA 3FHTA 4B74A 2ANBA 3QUSA 4G1UC 2O0KA 3LLMA 4JLBA 4ZDIA 5FPYA 2FV8A 4NMMA 5K8IA 2OHFA 2GILA 2GJKA 1WXQA 2F1RA 4FN5A 3KQHA 1W36C 3BIFA 3SN6A 1QHIA 4G0NA 3QXCA 2I3BA 3D7MA 2CLDX 2FPMA 2HLDD 1FOEB 4CZ2A 1W4AA 2JLSA 4BASA 1XTJA 1US8B 4L4UA 4TMVA 2GHIA 4C0HA 5TMPA 4P4SB 4DZZA 1YZTA 1AQUA 2YOFA 4BECA 3B1XA 3FMOB 2KSQA 2Q9AA 2Z0MA 4DLZA 2YWGA 1I2DA 3N2EA 1RZ3A 4J0QA 3MLEA 3OE7A 2AWOA 2WMOB 2CDNA 2KI5A 3ZDQA 5A5GA 4XWOA 4HYYA 1J7KA 3TLXA 2IS1A 1CJTC 4Q47A 4QHTA 2FGKA 2Z6VA 4C2UA 4LC0A 5FTMA 2ZJ2A 2JLXA 1PLJA 1Z83A 2A2ZA 2FFBA 5DHAA 4PSAA 1LF0A 3CBQA 3QY0A 2JLQA 4PZLA 2IF2A 2EWVA 2C9CA 4Q9JA 3AP3A 3UG7A 2O8DB 5FL3A 2IXFA 4JLDA 1E94E 2A9KA 4KLNA 5AR1A 5IRCD 3HPRA 4YMUA 1BS1A 4LJAA 4CEHB 1Z2CA 3GLGA 1NBME 1ZINA 1ETUA 2H8KA 5TVKA 3U3KA 1SKYE 2JLRA 1UJ2A 1AN0A 4A0FA 5D3MB 4M8NE 1G3IA 3E1SA 3TR0A 4TYQA 2QSYA 1NIJA 5UKDA 2IUUA 1FNMA 1OB5A 3L2OB 3BAFA 4ITRC 1GRRA 1ZD1A 1Z0IA 1G291 3QENA 2GESA 3R8CA 1XDBA 1IONA 3W6OA 4L5BA 2GK7A 4IOJA 4LJ6A 4XVUA 3G0HA 3U6BA 1XEWY 4PPFA 1W4CA 3CNNA 3RANA 3U3JA 3AF2A 3LX8A 1VMAA 2V1XA 3Q7QA 1W49A 1FPMA 5KNCA 1XFAA 2IL1A 3ZVRA 4BRUA 4QBIA 4QKQA 2IYZA 3BXZA 3I4LA 721PA 2RGAA 2XTZA 3GLGE 3K9NA 4TT3D 2AX4A 4HZIA 4MDEA 2O8BA 4F91B 4B6EA 1OSNA 1L8QA 2PZGA 1U0LA 2FSGA 3HWSA 4N1AA 3K09A 4Q7JB 3GLHE 4HLDA 1MR3F 4BLOA 3TE6A 2ZSAA 3LRPA 4JKIA 4DLVA 4PAQA 3RS3A 1ZUNB 3QEOA 3T34A 1OXUA 4R2IA 3ECCA 3SHFA 3B1VA 4LBZA 3RNLA 3VMFA 2CEAA 1XCMA 4IOMA 2QMHA 4FW9A 1JECA 1KI9A 1NN1A 4OI4A 1Z6TA 5K8TA 2ZITA 4CF7A 1N5IA 2G3YA 4TT3A 221PA 4TYWA 3I73A 1AJEA 4Q7KA 4AURA 3B2EA 3Q72A 4L15A 1PLKA 5L3SB 3NVAA 2UVQA 4AI6A 2W00A 4D0LB 4UJ5A 3LW8A 3O8RA 4C2TA 3L0PA 1D5CA 4K8OA 4V03A 1QHHA 4Q9HA 1KKLA 2GCPA 2VHTA 2QROA 3KQLA 3THXB 4POAA 1VG1A 3X1WA 4B76A 2F1HA 2J7KA 4PHHA 1U99A 4M1OA 5D3QA 3V4FA 2DB3A 2OE2A 2PZEA 4GBMA 5AUOB 3O8BA 4S2EA 2CXXA 2VF8A 4RSGA 5K8LA 4KO8A 4D82A 3IHLA 3RAPR 1XEXB 4WOPA 3B5JA 1CJMA 1IXSB 4HEJA 1E2GA 5BQ5A 2ZS7A 1XD8A 2C78A 2JJ2D 2ZRKA 3TVDA 3EG5A 4X8HA 4DLRA 4LBYA 4A1FA 2CE7A 2XNDA 3MG9A 2NMVA 4JL6A 5HE8A 3THOA 1E79D 2PT7A 3ZVNA 4FMCF 3PENA 2GEDA 2NG1A 4NH0A 5DI9A 4TMKA 3CWQA 1H65A 1KK1A 3FGNA 1OLOA 2VP2A 1N5KA 2ASEA 1DG3A 3QBTA 3AVWA 2WWYA 1SXJE 4JYBA 1TF7A 1Z63A 2GTPA 1C9KA 5SZKB 3IIMA 1AM4D 4DDVA 4IOLA 3OHMA 1VG0B 1E0KA 1NNEA 2CNWA 3CLVA 1KJYA 1CF4A 1Q0UA 1W44A 4A8JB 4A0GA 2KBFA 2ODBA 4US2R 1P2TA 1NSFA 4NYJR 2WZQA 1T8TA 2ZJ8A 1N6NA 2Z4SA 1Z0KA 2VP0A 1IN5A 1QZXA 1ZU5A 3AF1A 3IHWA 3CF6R 3PG5A 4JL8A 2DBYA 5KSYA 1A4RA 1G8HA 3KTAA 2KWIA 2WIBA 3FVQA 3QF7A 2XJ4A 1NSTA 4OYHA 1EWQA 4Q9KA 2FSFA 3I3SR 1DAIA 5JCZA 4HB3A 1DAKA 3THWB 3NBFA 3SEAA 3PUVA 1SHKA 4YDHB 2QP3A 1KIMA 1M1YE 1CLUA 5FFMA 4BZQA 3UXMA 3BFVA 2XZLA 1TUIA 1ZBDA 3AQ4A 4CRWB 5JZVA 2VL7A 2QAGC 3AF0A 2VBCA 4DDWA 3UIEA 2GRJA 4ESVA 2GAOA 3EARA 3GQBA 3U4QA 1UFQA 1XEXA 3DDCA 2PX3A 4MGYR 1U2RA 3SJZA 3ZVLA 2DHRA 1Z29A 3W34A 1R0XA 3A4MA 3GFPA 4II7A 2OBNA 3MWJA 4TLEA 2REOA 3X1ZA 2D2EA 1QF9A 1ZAKA 2ZRCA 2X1VA 3KX2A 4CDGA 1ZCAA 3B60A 3EPLA 4XTRA 3SBDA 1E2PA 1HY3A 2WWFA 4TQUS 1G7TA 2RB4A 1ZM4A 4NDZA 2WWWA 1Z8FA 1RRFA 5JI2E 2A5DA 1G8YA 5FUYA 1EX7A 1HA3A 5JSZB 5KOYA 3TUZC 3IILA 5HZHA 1NLZA 1G6HA 2CHGA 2EQBA 3RS0A 4UXJA 2HYIC 3QKUA 1Z0AA 3UG6A 2UZIR 3RRMA 2HF8A 5IHPA 1JAHA 3MGCA 2FNAA 1G3RA 4PAOA 2IWHA 2DWQA 4KAXA 1VIYA 1KMHB 1RYFA 2J9RA 2QU8A 3CX7A 5KSZA 3CO5A 4LYFA 1LTQA 1EFTA 2YJTD 3EW9A 1JAIA 1B23P 1ZC4A 4X8MA 4JBXA 1N6LA 1GAJA 1E9AA 2ZRBA 3AUYA 3FWYA 4PR0A 4JT2A 5EXXA 3EXAA 4AYTA 1P7CA 5CJ2A 5LD2C 2RGNA 1JEDA 1XXHA 2YC2C 4ARZB 2R62A 4KODA 3OE7D 4Q9LA 5TARA 4TL8A 4C4PA 1YQTA 4Q1BA 4RZ3A 5L8VA 1PLLA 4P0TA 4M1TA 3A4LA 3MJRA 1L2TA 4O0MA 3PEUA 3CRQA 1GTVA 4FI3C 1CR1A 4QGHA 4WBSA 2WPDD 2VP9A 4EAQA 1J2JA 2ERYA 2OFOA 4PO9A 1IXZA 3RSLA 5DGXA 5CB6A 2AD5A 2AKAB 4EDHA 3CNOA 3AKDA 5EP2A 2RHMA 1W0JA 2ZANA 4MYUA 1RIFA 1GNQA 3K0AA 4CGZA 3B1WA 1CU1A 4IXMA 4RD0A 2X2FA 1G1MA 1KYIA 1ZD8A 2P3SA 4PTLA 4B32A 5BN3A 5J4LA 3LO5A 1E1QD 2GVDC 1HE8B 2DFLA 3RS4A 3EWAA 1G6OA 5FR2A 3AVPA 4EJSC 1LV7A 2IYQA 4URWR 1FX0B 4EFNA 4NP6A 4JVSB 1TX4B 4QBFA 5JSZA 5G3YA 4ZCLA 4ASUD 2OEPA 4G5SA 4AD8A 3IIJA 1PUJA 1CEEA 4OK5A 2WOJA 4BFXA 2N42A 3BERA 2NOAA 2W2XA 4XWAA 4TL9A 3AV0B 5HKKD 5CDFA 3C4JA 2OCYC 2ZU6A 2PJZA 4LJYA 1KMHA 5JEEA 4MKHA 2VSFA 2ZRNA 4JBWA 3V00A 2QE7A 1DS6A 3QKSB 3B6EA 4BLQA 4Q00A 2BIFA 3A37A 1AIPA 4KHZA 1J90A 1JPJA 2GF9A 4U5XA 4EFMA 2VIIA 4C0KA 5J47A 5LDDC 2CL6X 2V6IA 2WWXA 2XX3A 2QENA 1XXHB 2AN9A 1DBSA 3WBJA 1ZVQA 2VO1A 1DARA 3D6TB 4XH9B 4B3DA 1IY0A 1UF9A 1C4OA 2E87A 4EUNA 1JI0A 3SYKA 3I1FA 4DSNA 2B7BA 4M9ZA 1W4BA 2ZSDA 2QNRA 3TRFA 2OLKA 4C0JA 2JLUA 3TAHA 2O8CA 1ESNA 2CCGA 3C8UA 3LV8A 4XD7A 3KKQA 1US8A 2C99A 4LX0A 2Q3MA 1KSGA 3GJ0A 3M1IA 2ZAMA 2C2HA 4LHZA 4OQFA 1KI7A 2ONJA 1E2NA 3CZPA 4GP7A 4HUQB 4KSBA 2VP5A 4D4LA 3WHKA 2OSBA 4GOXA 5E95A 1E69A 1F3OA 2HJGA 1E9CA 3WYAA 1VECA 1YRAA 4MH0R 1MRSA 4LC1A 1QHSA 2JJ2A 1U0HC 1TEVA 1OHHD 2F6RA 3GEHA 3PXGA 1S0UA 1FX0A 5C2JB 1N6KA 2P5TB 4A15A 4P4TA 1ZC3A 4Z54A 5EZ5A 4Q66C 1KI3A 4MKGA 4IXNA 4D0NA 2HXSA 2ORVA 4TLCA 2QBYA 2V1UA 3MCAA 3L43A 3WXMA 2FFQA 2IWRA 1SVKA 4FCTA 4JVNA 4JT4A 2CNWD 3MFYA 3MUFA 4Z8XA 3EPHA 4KBFA 2FEOA 1RE0A 3CWZA 2W2VA 3EX7C 1G16A 2F43B 1WF3A 2C04A 1W47A 3HPQA 1XZPA 4JJZA 4LJ7A 4NYMR 4I99A 1EFUA 1BMFA 1MABB 1NIPA 4EPVA 4PX9A 1SKYB 2HCJB 3HU2A 1JXMA 2D06A 3CPEA 3Q5EA 4AYXA 2Z43A 1U90A 1NL3A 2ZYVX 1KSHA 1E0SA 2F3TA 4N0DA 3GLFA 4I1OA 2BWJA 4BFTA 1TU3A 4UJ3A 3Q8XB 2H5EA 4W9MC 4ZDWA 1E9DA 2PLFA 2F7SA 3AGQA 4LRWA 2ZVPX 2ZI5A 4E5UA 5LPNA 2OM2A 1CJKC 1GP2A 3F0TA 3UANA 4F4CA 1JB1A 1AZTA 4B2IA 3RS5A 1BIFA 2QORA 3L0SA 5FTJA 2OCAA 3T15A 1RVDA 4NBSA 2GAAA 3P20A 3RRNA 3WMFA 3RYTC 5CYPA 1TMKA 1SVSA 1I4DD 2RH5A 5BYKA 4JS0A 3QE0A 2ERXA 4AKEA 3ZZUA 1F2UA 2Z4RA 2IYYA 5BW8A 5EQTA 1CRPA 5GADl 1P72A 2OAP1 4C0AC 1AK2A 3PEVA 4XTCS 4DBLC 2R65A 4D4JA 1UKEA 1QG4A 4TN1A 2FF7A 3SFZA 1NN3A 1T3SA 1XJQA 3RS7A 4CEJA 1XJ0A 2PLRA 4H1VA 2LCFA 4CYMA 4DWJA 1KZ7B 1GNRA 1SKQA 3RC3A 1R5BA 1MO4A 5FBRB 2HT1A 3EASA 4MUBA 2QTFA 4Q5IA 1W5SA 1KHTA 4IFEA 4US0R 2JLZA 4MKIA 4KLZA 3CW2A 3DZDA 1SVMA 4PC2A 2WSSD 2G0NA 5EE1A 3LQQA 3SNHA 2AK3A 1SVLA 3UWKA 1TAGA 2EYQA 1JNYA 3IEVA 1NG1A 2F43A 3GJ4A 2WJHA 2ZE7A 1KAGA 4HLQB 4IVPA 4MRSA 3CRVA 4RD2A 3ZS8A 1HT1E 1XU4A 4TQ9A 1KGDA 1KKMA 2ZYTX 5LD2B 1KSJA 3HU1A 2BJVA 2CHVA 3U5ZB 1X8JA 4C7OA 4ZO4A 1MRNA 1N3BA 1XTKA 4LUCA 4EPTA 3NC0C 3GLFB 3PCRB 3PUZA 2DY1A 5FBQB 2PJRA 4QXAA 4I1VA 3CR7A 3TQCA 4WVFA 3VNUA 1KI2A 1YZNA 2PZFA 4B48A 1OXVA 3VAAA 4I81A 4TLDA 3AF4A 4QM7A 2F3RA 4QGGA 2O8BB 2QRNA 2AFHE 2GA8A 4AKHA 1O3YA 3LLUA 4EPWA 1F5NA 2D4HA 3U60B 3ZH9B 1P61B 1RKBA 4D4KA 5B58C 1TPZA 1SHZA 2J0QA 2F1IA 5F2EA 1RPZA 4GNKA 1W1WA 4QL3A 1QBKC 2FMXA 3RLFA 2ZRHA 1G5PA 2ZR7A 1XZQA 4CIDA 1II8A 2J41A 3A1WA 4W5WA 2IEYA 4HLUA 4DUGD 1OH6A 1G5RA 4BLRA 4Z51A 4LCBA 1Q1EA 2AXPA 2QMOA 3LA6A 1X86B 2IYRA 3KJIA 1W36B 1ZMXA 3W3AA 4FMBB 2CK3D 1ZNYA 2YWEA 4NHOA 3FFAA 3A1UA 4TZ6A 1CRQA 4TTQA 1COWD 3KDSE 2CE2X 2FOLA 3P32A 2P5SA 3KKPA 3AP2A 5DYIA 5L3SA 1VCIA 4Q4LA 5TXGA 1LW7A 4LPSA 3ICEA 1G8PA 2NPIA 2TMKA 1AQYA 4I1UA 1JJ7A 2EFHB 2X8AA 4QBHA 5GJVC 1OIXA 3C14C 5KHOC 2WKPA 1NJFA 5HCIA 1HQCA 3AP1A 2QN6A 3GJXC 1OXXK 1Z6YA 5AJVB 1WA5A 2CCKA 3R20A 2F9MA 2GF0A 2ZRIA 2RAPA 2QE7D 3DM9B 1AGPA 1NG9A 3U3OA 3W6PA 4X8OA 1HYQA 2JIZD 1GNPA 3T61A 4KV9A 1KY3A 2BHRA 3A6PC 4P4UA 1G41A 3HP1A 4YC7A 3TSZA 1P4SA 2L0XA 1XD2A 3JVVA 5IK2A 2ZETA 4QHYA 2JDIA 3EPJA 3PQCA 2H17A 2W6JD 4LHYA 1E98A 1CJUC 1G5TA 1GIAA 2OESA 1N5JA 1JJVA 3H86A 3QEJA 3X1YA 2NPFA 3CZQA 1FUUA 1QVAA 3ZIAD 2VP4A 3R8FA 2XOKA 5JWOA 2BMDA 5JWHA 3SBEA 1UBGA 3K0EA 4QNRA 4RVCA 4BPBA 1FTSA 4BZXA 4TSFD 3FHOA 3TSWA 4QC2A 1XPUA 1VKJA 3C5HA 2ZI6A 1RJ9A 1ESMA 4PHTA 2VLIA 3GFOA 1XNJA 1Q3TA 3TAUA 1KI6A 1II8B 4DSOA 4KFUA 2ZE6A 2P6NA 4DVGA 4EIWA 3KQNA 2FU5C 4B6FA 3DOFA 2YWFA 5E7JA 1JEEA 1UBFA 2JA1A 1AS3A 2IHBA 4EFLA 3QF4B 1ZM3A 1Q44A 4URUR 1P5ZB 3DO6A 1ZM7A 4ZI2A 2V55B 5CLQA 1S96A 2ZI4A 4DLTA 4DRZA 1ZRHA 2GEVA 5C4GB 3B13B 3U61B 1F60A 1R0YA 2AFIE 3OEHD 2IYXA 1E9RA 5CDFE 4ZDKA 4O3MA 2AK2A 2JJ1D 1JR3A 2OAQ1 3AVYA 1KAOA 2FPLA 3QKTA 1KY2A 3HJNA 3RC8A 1XWIA 1W0KA 2EU8A 3T1OA 3LBHA 3LWNA 3A36A 3NEJA 1E0JA 3BC1A 5E3HA 4CEIB 3KJEA 2XJ9A 2XSZD 4IJMA 4EQ6A 4M1KA 3WRYC 3C7KA 1Z3IX 3QNUA 5FOTA 3SYNA 3DHWC 2YHSA 1GKYA 1YZLA 2VQSA 2HYDA 2AXNA 3FPAA 1VHTA 1QRAA 3FMFA 3O47A 4GMXA 1UADA 4BFYA 3KFXA 1OYWA 4GSYA 1YVDA 1HT2E 4RCZA 4ERNA 3CUEF 1QHYA 2ECKA 4HZUB 4WXPA 1RRPA 2A5FA 3BK7A 3AKYA 3B85A 2EFDB 5GVRA 3W5JA 1P3JA 2FX3A 4DKXA 4Q18A 1YU9A 2VHUA 1XD9A 3F8TA 1ZM9A 3HR7A 2GXAA 4KFTA 1Z28A 1N6RA 3EAQA 4KBGA 5F9FA 5DLQC 3DM5A 1A5TA 2VHJA 4DHEA 1ANKA 4LY6A 2E9SA 1JQLB 4GRAA 3BWDD 4BEBA 3E70C 4FMCB 3B1ZA 5CYOA 2IUSA 1W0JD 4HLCA 4MGIR 2IK8A 4Q1EA 3NG1A 2YKGA 5FI0B 3FTQA 1SXJC 1WB9A 2FWRA 2REBA 3BFXA 3P1JA 2YINC 5FOSA 4HAZA 1CR0A 1KNXA 2N46A 1XB2A 1G4AE 4Q4AB 2JLYA 1P2VA 3T5DA 2WWHA 2Q3HA 5L3VA 1SXJD 1HH4A 3CF2A 4NCJA 4OKSA 2YVUA 3QSYA 2K5UA 4TYNA 5CK4A 4Q02A 2B8TA 1L4YA 1VG9B 1XP8A 1MV5A 1X3SA 2W0SA 4LI0A 4X8LA 4UNSA 1T6NA 5JJLA 3V9PA 1W7AA 4ZDJA
chains in the Genus database with same CATH superfamily
3A31A 2ZJ5A 2VDLB 2C4UA 4MQ6A 1P5RA 2W2MA 3PKZA 3M2PA 1AXGA 1N2CE 5B1IA 3Q88A 3VGPA 2FOXA 3VOAA 5D5HA 3MTIA 4DV2B 2SCUA 4YRFA 2Y6UA 3SF0A 2EV9A 5KSPA 3MF4A 2E7ZA 3OESA 3PFBA 2XUQA 1A7KA 3JQFC 4XRGA 3VR4A 3U7HB 4Y9TA 1E1RD 3G8BA 5AJYA 1Q14A 2WAYA 4Z4FA 3AYXB 3K9GA 4L3WA 4D9FA 1L5MA 5HBRA 4I4TF 1H2YA 1QHNA 4RK0A 3STVA 3ZCRA 1WCWA 3DCIA 4PYQA 3GIWA 2ZIAA 1B4DA 4EBFA 1Q19A 2A6PA 5IASA 2VAXA 3H1FA 3SVTA 3DVAB 5KQGA 2CMDA 2CLHB 3G6KA 3L3BA 1ULAA 4PLZA 3SI7A 1YTUA 2WILA 4IEIA 4I36A 4ALNA 2VUUA 4S0XA 3F78A 4Q1DA 1RLTA 1IIRA 1SCUB 1FNBA 3U4GA 3D8BA 3VOTA 2OHHA 1FQJA 4BN0A 5HBGA 2XCSB 1WCV1 4UU1A 2PBZA 2AWNA 3H2SA 3MMPA 4I6GA 4QDJA 4RVOA 5AK3A 4TL7A 4ZCSA 1OA1A 1XDSA 2CCJA 3M83A 1BJTA 5GPBA 5HOEA 1X39A 2IIVA 3AIOA 1BNCA 1N0UA 1ZEMA 3EPRA 4QXRA 3TTXA 2JJ8A 4A26A 2UZ0A 5DIFA 1IN7A 1MG5A 1IIBA 3FF1A 4R0NA 1T36A 3VO9A 5TQ0B 1IY1A 4C30A 3LXRA 3UQZA 3JQQA 1SC3A 3OBBA 1OI4A 1DFIA 4B3CA 4YMIA 4B35A 3AM5A 3HJHA 4HXFB 5FL7D 2CLIB 4UBIA 3CF4G 1G19A 3C6MA 3D8NA 5B37A 4DYDA 1IOWA 3KM0A 1PG5A 3KOMA 3D6NB 1XELA 5J4HA 1Z34A 3OLYA 3Q9NA 1G0NA 5CAEB 1QE0A 4KXNA 1YJXA 4LMAA 4C01A 1COWA 1Q1QA 1TCBA 1RJGA 5AM4A 3NHLA 1TQDA 2C5BA 4MUAA 5J1TB 4CFYA 2Y9MB 3JQGB 2UYCA 1RQ2A 4XKJA 5K8VA 2FAXA 3ENWA 3EOBI 3FPLA 4AY4A 1YJAA 3K2QA 1P2GA 3QUCA 2NUBA 2WJYA 1TO2E 3KZKA 3G0OA 3K9BA 4ZT4A 2JRLA 3BUSA 3THYB 1QVWA 2CVHA 4MRMB 3TMAA 1FYEA 3QU7A 4H77A 4JYMA 4XX0A 2DU8A 5ER9A 3ZHQA 1R4AA 3DKVA 4R6WA 2ZI9A 4RIEA 5B1SA 5FOQA 1J5EB 3H4MA 1SU6A 1NI4B 1QP0A 4LKOA 2GERA 1JSLA 3E0QA 3R8XA 5G41A 1HZZA 1YS7A 1PNVA 3H1PA 3NZEA 4DMHA 5BN4A 4Y1EA 5JNWA 2VRWA 2UYQA 3IEMA 1GILA 3HJCA 4OAQA 1C4WA 3UHJA 4NXNB 2H1CA 3T1HB 4MCIA 4TZKA 5HE9A 2OHOA 3UAVA 4DEXA 2B4QA 1M2FA 4MQBA 4PFJA 1DAHA 2A33A 2A5LA 4W5TA 3W5IA 4J0HA 3HCWA 5IM5A 2X4IA 4YV1A 1X8LA 2EKLA 4IRUB 1BA3A 2GBCA 4Q24A 1QX4A 1W1UA 4F71A 4H60A 1OJLA 4ZAWA 5AW4A 1GG2A 5GV8A 4RLFA 4YH1A 2QTNA 4GLJA 2HA2A 1R0LA 2VZ8A 5CA0B 3WWPA 4A92A 3U3MA 3IUQA 4OJKA 3LRXA 4JU9A 3N0VA 4KYUA 1BDHA 1K8YB 4KIGA 4TLAA 4JGBA 2ECPA 4Z5XA 3LRTA 3N05A 3K32A 1YB5A 1A77A 4PHGA 4E0BA 3AF6A 1G64A 2UYOA 5E1OA 1RXSA 4LJ9A 2JG3A 5BOSB 1T1JA 1IY2A 4IHJA 4LYAA 3AM4A 5F1YA 1J25A 3T06B 1UJ6A 4HQFA 5KSOA 3GVPA 1WS6A 1D4FA 5TEWA 4YT8A 4YJGB 5DCYA 5KWSA 3GJ7A 3KOWA 4MCHA 4DXDA 2QY9A 5AUQA 3NIBA 2CLMB 4EOGA 4JLPA 2G0TA 4MYTA 3FUVA 2JD1A 3SC2B 3P9XA 2ZJ3A 4BJHB 3OLQA 2J5XA 4LDAA 4UFOA 2ZBFA 3ZU6A 2H63A 4PLPA 4REMA 5EHQA 4EB6A 4DDTA 4UU0A 4HFRA 1VCMA 2AH5A 3U7FB 3VQTA 3H5RA 5GJCA 3CNLA 3DEFA 1EGVB 1QHGA 4E4TA 4ZV4A 2A92A 4P80A 4C0SA 1J0DA 3G8CA 1M2OA 5EJMA 3T52A 3NH6A 2P62A 4XWKA 2Q27A 2R5WA 3V8PA 2ZSJA 1BEUB 1WP9A 3R1IA 3E9RA 4KFRA 4V02A 2JFYA 3HL0A 3RUPA 4XSVA 3CRMA 1UJ4A 1AUXA 1Z5NA 4ZVUA 1ZW6A 1RCFA 5H81A 1PDOA 3ZS9A 2LRHA 3AHHA 4NEHB 5FPPA 1T3HA 1QH8A 2QPOA 3OUZA 1EXVA 2VP3A 3DSRA 3H1TA 2G1JA 4QTZA 2WSIA 4LDQA 4P4SA 4KRXA 1ZN7A 4TQAA 1O0CA 3A70A 1JH9A 5GZ1A 4IH1A 4YRCA 5K0LA 1TIBA 4RPKA 4B6JA 1CUYA 3RS8A 1ZA1A 4OQMA 5TGZA 2EEZA 4EEZA 4TMTA 4AX8A 2FY8A 3TJMA 1E2UA 1BWQA 1NXPA 3CPJB 2FR0A 3EAFA 2E0IA 4MVXA 5WRFA 1A9QA 2Q6TA 2XZPA 4QYWA 4L4RA 4NENB 2AOVA 4Q7MB 4RZSA 4D0GA 4D0SA 3HBJA 3SCZA 3RUDA 1MA3A 1M6EX 3TIFA 3K30A 5JLJA 5I51A 1C1XA 3CJQA 1P4GA 1Z5VA 5CFOA 2I67A 1CV2A 1A97A 3L0OA 3F6PA 1SZPA 1S1MA 3NTXA 4JEIA 3WSVA 1QS0A 4QJ3A 1GXSA 1DEKA 3V8EA 1Y8ZA 2WB4A 4MWOA 2H48A 4IIVA 2GETA 3DLTA 3X2EA 4TMZA 4KHPB 4C03A 4KMSA 1JMKC 3R74A 1W85B 2DUNA 3ES9A 1MDBA 2P67A 4EYQA 3O95A 4ZEVA 1TGVA 3I5MA 4G5GA 4KXLA 1GTG1 5D1NA 4Z3DA 3PNPA 2EIHA 2Y71A 5L3RA 1E3LA 2OUIA 3G7NA 4CQNA 1E20A 2EP8A 4V0LA 2N75A 2NIPA 4RDXA 1FEZA 2FZVA 1PVVA 3MWEA 2IQIA 4QKQA 4LVNA 4TMWA 3LSYA 1IZ9A 1QVRA 2BEWB 3CY6A 2X15A 3I6BA 4AX4A 3CSDA 3A6DA 4YIKA 5IEJA 2C9MA 2P9GA 5L4SA 4MB0A 1I5RA 1U0FA 3DKRA 3EWNA 2ORED 4H1TA 4J3JA 3L6EA 3X1DA 5CA1B 3UB2A 3MYYA 3D2CA 1FMJA 3RCBA 2HIGA 3ELUA 1OYVA 5K2MA 1EVLA 4K9SA 1XKTA 1WLYA 4PCAA 4LOAA 5JPDA 1BGXT 2G08A 3GRKA 4NXMB 1CDOA 1DFGA 1JPVA 4LNUA 4TLBA 4BAGA 2CXRA 4EKYA 3M4ZA 2AN4A 1BE8A 3EFOB 2D1YA 3FH0A 2D0DA 3QPUA 4U7WA 5FBLB 4FN4A 4KYIB 1LBIA 4MWSA 5ALGA 4COOA 1EESA 4KO1S 4ERXA 4G5HA 2DCMA 1IAVA 5KREA 4NNJA 1PT5A 2AV6A 3UAGA 3ZK8A 1PX0A 2I6GA 1PZHA 3INGA 2QQ0A 4HDNB 4Y2PA 2A0XA 2IZOA 1Z16A 1YZUA 3A9TA 4EABA 1G21A 4B3GA 1YR8A 4W4TA 3ZQJA 1VA5A 1X1RA 4FXOA 3NVKI 4KNVA 3ZWCA 1MAVA 4HDMA 4PPGA 2FWIA 3BRCA 1JDBB 2WUFA 4PINA 4GI3A 1ZUNA 4P93A 4IPTA 1ODFA 5JYBA 2ZU0C 1ZMBA 4MV7A 5FBWB 3WMXA 1CJBA 2ILTA 3HGQA 3LK6A 3NFYA 1R9GA 2NVOA 4CVNA 1QJ4A 2QTMA 5KTOA 2CD7A 2HWYA 5I9MA 1PR4A 4LV5B 4ZCRA 2ODNA 2AW3A 5JMOA 3V33A 5B2ZA 4ZN6A 4J1SA 4DJTA 1ZR4A 4N5MA 5KCMA 3LTNC 4G84A 1U3UA 2C8LA 4IMIB 4QELA 1D03A 2J1LA 4KRYA 3K0SA 1LK7A 4KSYA 4LHVA 4PFKA 4KX3A 2IH5A 5HTKA 4KXQA 2O3UA 2ZZKA 3PX2A 1A5SB 4DL9A 4O08A 3C6BA 1CJVC 2PRYA 1J8VA 2IDJA 2PO5A 1C1DB 3N2KA 4AO8A 4BX2A 3KRTA 1QZTA 3M1LA 3QUAA 4WE3A 4DR7B 3AKEA 2FFRA 4P9NA 1TVCA 1MG0A 1U02A 2X6RA 4KMOA 3IRVA 2OVFA 5JAPA 5JS1A 1JQDA 3G8AA 5KJ6A 1T5IA 1NFFA 3JZIA 3RSCA 1E18A 2PRJA 4O63O 2NU8A 4KCGA 1X14A 3H5IA 2HN9A 3ZY3A 5KOIA 4YACA 2Q2NA 4DA4A 4U9HS 1XPOA 2WZCA 1YRHA 2IYFA 5L7WA 1PR2A 2HO4A 4MW7A 2JJQA 4Q12A 3MS4A 3E9QA 3IPLA 5I8WA 4WEQA 3RK1A 5HM8A 2J45A 3KSRA 5CGZA 2Q49A 5THKA 3CLTC 2D4AA 1NVGA 1ABBA 5KQPA 4YR9A 3LOUA 4Q4DA 4YP1A 5F52A 5LOVA 4UQPA 2JEYA 2VDWA 3F1LA 3GIDA 4HNUA 3K96A 1NPDA 3MTJA 1W36D 2AEJA 1A3CA 2VPTA 2YYSA 5JCJD 2JHPA 4LXIA 3I2JA 1H8ED 2YVKA 4KWTA 2B7CA 3ASZA 3GQVA 4TZTA 1RNLA 4F7DA 1AB6A 1X15A 3S2FA 3F7OA 1HK7A 2ZJ4A 3F67A 1L3CA 5DTQA 3I4FA 3K0CA 4ZOAA 5BNWA 2NX2A 3KUXA 5KWVA 3VYRB 1PVOA 2SICE 2B3DA 2ZJBA 2VP6A 1Y3CE 4UU7A 1JQJC 2PWZA 1DC7A 1M2KA 1ONSA 1DIAA 2ZRFA 1NLYA 1A2BA 4MPPA 1F0KA 2HRDA 3H1BA 5I01A 5T57A 1N2CB 2XWBF 4PO8A 1Z39A 2AI1A 1QXSA 4QQRA 5ALTA 2H54A 3A27A 1DADA 3FUCA 2C4WA 5CM8B 1GQ2A 1T35A 3BAZA 4J8PA 1YB4A 2ZT5A 3AI3A 4M9SA 3EQZA 4V0KA 1MW9X 4F2HA 4DNXA 1PFYA 2YXEA 1Z06A 4MWGA 8LDHA 6ADHA 3DF7A 5DHFA 1ZM2A 4JP3A 1BCRB 3WOVA 4XFDA 4JUCA 3A58B 4OHMA 4OL9A 2BJWA 1ADJA 2I7VA 4RGBA 4JVMA 5ALWA 4A0RA 3FVRA 5ECWA 4LV6A 3GDOA 1E1KA 1XJCA 1Y81A 1Z5PA 4ZU3A 3T5AA 3B8HA 2VS1A 2XCRB 2ZBEA 1SFRA 4BLTA 3ROKA 3DEYX 2CW5A 4F93B 4OX9Y 3UJBA 1KMQA 4I5GA 4OOEA 2E1PA 3OIFA 1YR1A 4WH0A 3RR2A 1FP6A 1ZSVA 2JFHA 1IHXA 2ZXFA 3ZU2A 3K0FB 4YR7A 2QG6A 3GUVA 1WCXA 1JMYA 2YZ2A 4Z7NB 3ZUPA 1MX9A 1KK3A 1J09A 2PH5A 3M1AA 5IT0A 2AQHA 2LNDA 5K3FB 3UMFA 1RLMA 2Q3FA 3NC4A 1INLA 1XQYA 4E6EA 3OPYB 1PFQA 5JFGA 2IV2X 1RZRD 2IS2A 2EIXA 2R2AA 1ONPA 2W2QA 2A7QA 2G6TA 3CIOA 3R5SA 4NFSA 3K8ZA 1NURA 2WOOA 3AFMA 3PNSA 2PKRA 2Q0XA 2XWSA 4KREA 1LQ2A 5FOWA 3N9IA 4L6CA 4K9LA 2V6JA 4UTZA 2L82A 2ZRGA 4D3DA 3ANMA 4EJSB 1ZNZA 2E4XA 2IXEA 4YFYA 3E48A 3VMMA 5IKPA 5HW0A 1OYOA 4DV7B 3QQPA 3B3JA 2W43A 1E3WA 4FS8A 4ARVA 5JNUA 3PRJA 1QCCA 1QIEA 1XZFA 4BB0A 4LCEA 3GBVA 3L0ZA 2YIJA 3I62A 1GYQA 3E9DA 3AW9A 1SCUA 2OV4A 4LK3A 4ZAYA 4UTNA 1GR1A 1YS4A 2WD8A 4EUKA 5EZYA 3UGTA 2DPMA 1KJNA 3PHLA 5DM4A 1SQSA 1Z07A 3BIXA 5C32A 3TDMA 3BD6A 3AUUA 3MUOA 3WGUA 5KYYB 1KZ9A 4LTMA 4TMXA 4DQVA 1QQ5A 2FXIA 2IDZA 2PGOA 5I47A 4DR2B 1Z6AA 1HPLA 1ZHFA 2GHRA 1LTKA 2X8LA 2QM7A 1BU8A 2Z57A 4F5EA 3PFGA 4BWVA 4YRAA 4AM8A 2IELA 5HRCA 5BUCA 1Q95A 3P97A 4MEAA 4E4RA 3FTEA 4RD3A 2QAGA 1QV6A 3JQCA 1V25A 3IDOA 5KHLB 3EGEA 1BE0A 2IXGA 1KEVA 4UM7A 1ZD9A 3KQPA 5TB5A 4IVQA 3VHLB 4D3XA 5A5VA 1QYIA 4NSNA 2ZJAA 3BB3A 3HWRA 4AUKA 3LUBA 1I2ZA 1TQ6A 1CUIA 2ST1A 1YGPA 1LI4A 3UMYA 3NBXX 1XPJA 4ZCIA 3EXHB 3DE4X 3ZCQA 3TS1A 3UV6A 4I50A 2R1TB 2PA0A 2POCA 1LY1A 2B8NA 2QYHA 4MIEA 5JNLA 5IM4A 2GK6A 1N8TA 4R1QA 4QFCA 4BX0A 1SVNA 4PLWA 5JEDA 2GD1O 2QMUA 1D07A 4L5YA 2BBTA 2DFNA 5ALDA 1TEXA 3AXSA 3IV9A 3KZVA 5ALVA 4D8UA 4FOTA 2KX7A 5JSYA 3K7EA 3L8FA 1DHTA 5IAEA 1RCUA 4DG8A 1VRVA 4F1WA 5A3VA 2YFYA 5ALLA 4AFNA 2Q9BA 3V4PB 3WGTA 5K3EA 2AMVA 1N25A 2YWRA 3K9LA 3OZDA 2CWDA 1GKUB 1U0GA 4QECA 1N2GA 2GGSA 1VLLA 3PHGA 4TLMB 5A71A 2FW8A 2Z3WA 2A3RA 1NW4A 2IXDA 4C7XA 3WK4A 3ZNNA 5HS4A 4DCOA 3LVFO 1VCNA 3M6IA 5AJXA 1WRBA 1EEXB 1FDUA 1VPLA 1XMPA 3BD8A 3LQRA 3NLLA 4YRMA 4JC0A 3VJKA 2XR1A 4JI1B 5FTKA 5K3DA 4LX8A 3U7QB 3D31A 3DBLB 3PT9A 4MZDA 4GOND 1ZIXA 3HYRA 3V1UA 4PC7A 3ONEA 1A7AA 4FYJA 4HNAA 1RQXA 4TYPA 1PZEA 4YQFA 3VDQA 2VH5R 2GN8A 4Z0PA 4YAJA 1T3TA 2XA2A 3IPAA 4PYLA 4NESA 5A4AA 4FE4A 2IA5A 3DYIA 4MR8B 3I9KA 1TGYA 3A6HA 2PRKA 2RJOA 2ZYWX 4NL4H 4XOIA 3OP4A 1S2OA 5IKOA 3RUAA 3FY4A 5J2UF 2O8NA 1QQ7A 2WT8A 2CYBA 2DBZA 2MT9A 4QDZA 1GUFA 1PJRA 4XEUA 5KQSA 4QTYA 4YUXA 2VZ0A 2Y6VA 3OC6A 2GD0A 2XEXA 4UMEA 2Y1XA 1OZ0A 3ZJYA 5H82A 3GFTA 1PT8A 5HVNA 4RTLA 1ISMA 2PSDA 4X62B 1Y1PA 3CSSA 1Y3FE 4FOSA 3QIVA 1H69A 2OAGA 4WD3A 4LDPA 1KRXA 4H59A 2IYPA 1T43A 1ZL0A 2PWBA 1YJCA 3H5NA 4G0ZA 4BLPA 5LYJF 4MEJA 3UWSA 2ID4A 3E9YA 2PMWB 4RJLA 3PT5A 2CLLB 4YO7A 3B89A 1V16A 3I92A 1NF2A 4ODIA 3U17A 3I8XA 1CUZA 2DPXA 4TV8F 2PLAA 1K68A 4GD3Q 1AO3A 1SULA 1GPDG 1T8UA 4DCSA 4A2QA 4Z4QA 4RZ2A 1HT3A 3HKDA 1UPUA 4KN5A 4D9GA 4XJTA 1WY7A 2GKGA 2ODEA 1V9SA 3B9PA 4NHEA 1IN6A 5JTTA 4JZKA 4QBTA 1ZIPA 3PC4A 5FOVA 3CONA 2QIOA 1EU1A 5DX1A 3NUGA 1DI0A 3STWA 1ARZA 3IQWA 3M1YA 1E6CA 3Q9UA 3OE4A 2AOXA 1MJGM 4BGIA 4Z6KA 2Y0DA 3T3OA 2ZVQX 1HTTA 4M89A 3SYLA 2OZPA 2VJLA 3IAM6 4C1BA 1X7GA 3M3PA 4G41A 5EJAA 5IPFA 4DRYA 1U7DA 5CX1A 1DVRA 1F2TA 1VE1A 1XKQA 2WVGA 3EGXA 4XASA 4D98A 3WYCA 3J81k 4I4LA 1U0JA 2FPKA 2SECE 3KXKA 4W5HA 3IE1A 2O0LA 3AY7A 4RHUA 4Y9UA 2D62A 4E08A 1E7MA 4O1IA 3VR2A 3W2EA 5LQCA 3IOYA 1H1DA 4R7TA 3CF0A 5U4QA 2DLCX 1M1NA 2JVIA 4AROA 1JYFA 1V5FA 2C2MA 2CL0X 2W8ZA 3BSSA 5H7XA 1XZIA 3CBGA 3TE7A 3TZCA 2DXIA 2HSDA 3SIPA 5HCNA 1QG2A 1XAGA 2KLBA 2NGRA 5DGIA 3VVBA 3RRZA 3AR3A 1WV0A 4KRGA 4LMPA 4UEJA 5F5NA 2IPAB 3VU9A 5DOVA 1DEOA 4WOJA 3KLNA 3EXHC 2NVWA 2OK7A 4OHRA 4YCBA 3TXXA 2H1WA 3ML1A 4F5ZA 5LOVF 2WV9A 4NFYA 5EQFA 4QG7A 1U28C 3MTBA 3D5EA 2R6R1 1CR2A 3EC2A 3E9EA 1YNSA 4HPWA 1YR6A 2Q2QA 3LY8A 2FPRA 4Q05A 1D2NA 1BYUA 1VFPA 1TQ2A 4RTOA 3QBEA 3K73O 5A06A 3BJIC 1Q1BA 3GA5A 2IHJA 2R6AA 3AZQA 3IAUA 4EZIA 2PK3A 4K86A 5DBFA 3TOZA 5DLPA 1QK5A 3P2JA 1WZIA 1V8ZA 3VPAA 4F4UA 3ZCXA 2FMKA 4H4EA 1UBHS 1BHQ1 1ONNA 3BSWA 4Z1MD 3BCRA 1W5FA 4OFWA 3GLIA 1XRNA 3PX3A 2QIPA 1MABA 1E1MA 4OK3A 2C5GA 1CUSA 1P2DA 2VYVD 2ZPTX 3EHDA 3OT1B 1KO5A 1XTBA 5KYVA 2OCGA 3QUBA 3KPUA 2FR1A 1MENA 3FI0A 1NQAO 4R8VA 2WLSA 5ALUA 4D57A 4AQYB 5KS2A 3P9PA 2CJWA 1G1AA 1LLUA 4XQGA 1O9BA 2PS0A 3ZUGA 1EWVA 3KOZA 1T4CB 5C9ZA 2ZJOA 3FLAA 2X9GA 3PIRA 4X1YB 4D8YA 3D6FA 5HR5A 1GZSA 1NF9A 3WAGA 2ZYUX 4GSLA 4WA7A 1MJHA 2ZRAA 1QHFA 3RW9A 4E3WA 4ZHSA 5LJLA 1WMDA 2LKDA 1GA1A 3LBIA 2PN1A 2Q0SA 2QSUA 5D01A 4ES6A 2JK0A 2HW8A 1N0WA 1QFZA 3OAAA 1FYVA 1RVV1 5HQJA 3VV3A 3W5VA 2QLTA 1VPDA 1EAYA 5KMGB 3U6KA 1H2EA 4Y2QA 4CFSA 4N6GA 1NW8A 3LBNA 3ZBQA 2RGNC 3K5WA 1NVKA 2XADA 3NKFA 5B57C 2NSJA 4QO7A 3MWKA 4X97A 1DQRA 5G1PA 2EF1A 2J59A 2FWJA 2YWDA 4KPUB 1AGRA 3QMPA 4MCAA 3OE5A 4FX5A 2XT6A 2DKOA 1OB2A 2O1WA 1B7GO 5A1JA 1CD5A 5B30A 2ZIUB 3IPRA 2HV9A 1OFHA 4Q4HA 2X8BA 1CEYA 1N7JA 1OILA 3A1TA 5LQDA 2IHNA 3IT2A 3KYCA 2HF2A 3AR2A 3EEQA 3JQ7B 4UHDA 4MROA 4KITB 4QGAA 3L4KA 1P29A 1PV4A 4UXHA 3IUJA 3CB2A 2QXYA 3KKEA 4KVAA 3WA6A 5DM70 4CEJB 1JKXA 3LKVA 3QLVC 1E6EA 1M6YA 2A0FA 5KU7A 1X7ZB 1OAOA 2V74B 1UDRA 4PYJA 4K9NA 4RE5A 2QSZA 3WL7A 4WIAA 1W35A 2DPGA 3BXOA 1TKBA 1RIIA 3LD9A 1Y3DE 4LSZA 2P2ZA 3QPWA 4YRRA 1IPFA 3AI7A 1PJAA 1CZHA 1KP2A 3TW0A 1ILEA 4LOJA 1WG8A 2DULA 1CK4A 2BGIA 1AB5A 1GFIA 1WKVA 1XDWA 5ES4B 2HHHB 2OQRA 4W5QA 2FQWA 2Z83A 2QL6A 4GXTA 2Z5FA 1R8SA 5ED0A 1TIKA 2O7SA 3P2KA 2C5EA 5D87A 2ZIWB 4A6PA 2XVYA 1GSIA 2WAXA 3ENVA 2I55A 3QYPA 3HU3A 3TPCA 1YDWA 3EW7A 3EDMA 2UZ4A 2C2GA 3FMVA 2OZLA 4X64B 2WMDA 2E4YA 1D7AA 1WTAA 2GZAA 4B0PA 4QT4A 2BUCA 1T9BA 2EL7A 1WL8A 1V47A 1XFDA 4PZPA 4OMFG 1AD2A 2FR8C 2ZWIA 4QASA 5KTSA 5LOVB 2BC9A 4IL5A 1K5GA 2WA2A 2R6ZA 3PKIA 1CFJA 1P81A 1TM3E 4PPQA 2AJBA 3LPLA 3TKLA 4WBNA 4YDSA 1XCPA 3PJGA 4Q16A 2D8MA 2ILVA 4ALKA 2IUTA 1IN8A 3DHNA 2G07A 3F5MA 3OCZA 1VKOA 4JA0A 1CULC 4RK6A 2HAEA 1VRWA 4HDAA 4I9NA 3RRYA 2EFCB 2WQ7A 3QXHA 4J3NA 1NX9A 1QX3A 1VJCA 1FS4A 4JHLA 1SVWA 5FUVA 1I6MA 3A3YA 4FHZA 1DJNA 3O31A 4I1SA 4DCUA 3HSYA 5EIEA 5C1BA 1DG1G 4UHCA 1K0UA 4M9RA 2H4FA 2X0FA 3H7AA 3ZWNA 4U02A 1VYUA 3PHJA 4NNOA 3WNBA 5KOJB 1DPFA 1HRDA 3ETCA 5C7YA 1N2CA 1FJXA 2BFCA 1MB9A 2PMCA 2PNFA 4F8YA 3ZLJA 3OTHA 4YP5A 4G81A 3RD5A 4L9AA 5K45A 4X1IB 1NBAA 3LCCA 4JLVA 1F51E 4N9QA 3KUCA 1FMLA 1WDTA 1UPTA 2ZLBA 1GWNA 5KPJA 3ISVA 2QTLA 3DAFA 1ZBQA 1A8SA 3KL4A 4IDBA 5LZ8A 3JQEA 3L7DA 4ZCMA 1CNEA 3F46A 5LB2A 2OBFA 5IJ0B 4DXHA 4AQ7A 3E8MA 3NM6B 1RHRA 4H2DA 1U1FA 2GN4A 2OWEA 2Q9CA 1TW3A 1GPYA 3LAWA 3MJFA 4EJ0A 2MSDB 4JLOA 3H9EO 2OXCA 2BGNA 4C88A 1ZD2P 4BC0A 2DP4E 3A9SA 1R6DA 3SSNA 3PGJA 5KX5F 3QMMA 3Q7RA 3KSUA 1NYRA 2ZYHA 3ME5A 4HEA1 4D44A 4J1NA 3V4ZA 2BVNA 3PF8A 4F4IA 1FDVA 3S3TA 5DTRA 1BD3A 2ZJ7A 2GF2A 1E66A 3O3MB 4QO8A 5GV7A 5JHGB 5LQJA 1RS0A 1BXRA 3ZW7A 5FBVB 2WM9B 1XO1A 2P90A 2NQ2C 2ZXEA 1FNNA 3FPGA 3IA7A 4KQ9A 4N18A 2G8NA 1TT5A 3WLTA 4AYWA 4DS3A 5JAOA 2ERCA 3KBOA 1G3MA 2QAJA 3HR8A 2WIGA 3E3AA 3B51X 3R0IA 2IEIA 2EFGA 1BMQA 1BHO1 2ZQ5A 3IKMB 3OX2A 2EG9A 2HSWA 2QA5A 4R1LA 4ROSA 1YZGA 5ECYA 5FL7A 3CINA 4P2BA 2FJ0A 2LWIA 3D8SA 4FHCA 5GAJA 3UQYS 2MINB 1XMVA 3MNFA 2J0EA 3RTDA 4TTJA 5H3LA 4QOGA 3SR4A 2BM1A 1TRHA 4IKEA 2LPMA 3FPEA 1SZCA 3GRUA 1EI9A 1QDEA 1TM2A 1WQ1R 2JFVA 5CCXA 4PVDA 3F6BX 1E7WA 3QTBA 2ID9A 1USWA 3ADPA 1QYXA 1VHJA 4MAFA 1MQ9A 1V1JA 2ONZA 1W88A 1N8SA 1NXQA 3IOCA 3A6ZA 1FFDA 4LK2A 1H9AA 1SA0B 2GWHA 2XI4A 3EVZA 4NR0A 4PG7A 4ABYA 5HF6A 3OEWA 2BBWA 4BFZA 4G01B 1IZYA 4NU8X 2HF9A 5EWLA 2IE0A 1VZ3A 3C8DA 1MOZA 5F73A 5KDDA 1AC5A 4YV2A 1C7JA 4O33A 3WGMA 3BH0A 3TLYA 3WO1A 2J9YB 3HEMA 3O3OB 5T67A 5DE3A 3TTTA 4BATA 5TJHA 1QH1B 1LPOA 4JL5A 4DNPA 1WAMA 1EFDN 1TKCA 3WIDA 5IT4A 1Y98A 3PEFA 3L92A 1UJNA 2C83A 2HLDA 3L79A 2IYLD 2GS9A 3SHTA 1IM8A 1U2DC 1WNTA 2ZULA 3U44A 1J1UA 3FKSD 4Q3EA 2HWUA 3WMEA 4G3XA 1EVZA 1HDYA 3LQFA 1CRWG 2C4MA 4GL4A 1VGRA 4QFBA 1V3VA 3U4DA 3WZLA 2HXGA 5JSUA 3BFKA 5A6SA 1GAQA 1GZ7A 2DVMA 3EDCA 1VLQA 2HMSA 4WZBE 2VJMA 2R8YA 1SQ6A 4INAA 3U7GA 4K6FA 4NJEB 3K35A 5JHHB 4PFSA 3MRSA 4TUYF 4B82A 5HGXA 2NXWA 2B92A 3A14A 1SQFA 2BPOA 3SM3A 4EL0A 1TKRA 4UQLA 3WWOA 1QFSA 1WB6A 3HA3A 3RG2A 4YT4A 4DV6B 3QFSA 1EB9A 1Q12A 1U8ZA 3DT6A 4CG0A 1OFUX 2Q4BA 2J3HA 2RHGB 2WIFA 3JATA 5IFLA 4LYDA 4A8PA 4B1FA 5LP6B 1GUAA 2OXRA 1XPRA 3UWDA 2GPYA 3INYA 1M0WA 4AJIA 4EQ6B 5HILA 5JC8A 3O3CA 2I91A 2ODAA 3QKRA 5TY0A 5I7AA 4PIPA 2ZIFA 3WGVA 5AWFC 4OU5A 3E6AA 3NHFA 4K9PA 2HMWA 3D0KA 4RMGA 5FHRA 2BTQB 1R6BX 1EE9A 2WWGA 3VYVA 2PBRA 4PQRA 1O94D 4M38A 4AZ0A 2J9GA 1GU0A 2Y4NA 3FDXA 2FYTA 2W22A 3EZ6A 4GC9A 1UEJA 5GONB 2QRQA 5JCPA 4G89A 1EZ1A 3E7FA 4W7IA 4WLUA 1SB8A 2FW6A 3UTDA 2FJUA 1M2VB 2IEGA 1P5HA 2GMWA 4UHBA 1XVLA 2CLCX 1GLNA 2Q1TA 3TQTA 4GI1A 4MHSA 1QV7A 3FOZA 2XDQA 1FX1A 2JW5A 2JIQA 4J2HA 2GJ4A 3NORA 4NWIA 3D3KA 5FLKA 3LT1A 1QWSA 3OJ0A 5C8YF 1G8JA 2DPYA 3PJDA 4BFXA 5KTNA 1P0PA 1TM7E 2HPHA 2FUCA 1HYEA 4PZUA 3OOWA 4QYXA 1I7NA 1KARA 1NQUA 4LRYA 5IM4F 3RFUA 2YYZA 2RIPA 1M74A 5LJIA 2PJUA 3A2KA 1WWKA 1T13A 1NKVA 4MUNA 4WZAE 4ZKDA 5KO2A 1GAEO 1YC2A 5K2OA 3RVNA 2I0FA 1K8ZB 3I37X 2BBOA 4XPZA 3JWEA 1EDEA 1BZYA 1SQ5A 1XUOA 3L8HA 4HAUA 3ELBA 5LP1A 4O2RA 3LHDA 3H7IA 1EFCA 5E6SB 2H16A 1F4VA 1R4MB 5GTDA 4HLNA 3S1AB 5T8KA 4WOBA 4YASA 2C95A 5U1PA 4PANA 4BRWA 1Q22A 2J0UB 3DB1A 4CTNA 2FJPA 4URVR 2XTNA 3I05A 4OGGA 3NGXA 3VX4A 4CR7A 4GZMA 1KFCB 4BKPA 1CEXA 3FFBA 1TFUA 4LQ4A 3RROA 4CG2A 1T26A 1WVGA 3SS8A 5A62A 1CVIA 1K75A 2ZYSA 2QJRA 1W34A 1EH5A 3HKDB 1KO4A 3NHJA 1V43A 4RKFA 4FEYA 2PA3A 1KDOA 4K2AA 2XITA 4Y6OA 3RSOA 1XNRB 2G1KA 2ZWAA 5F7XA 2ATIA 5MN4A 1ZVMA 3D2LA 3F7MA 2ZRQA 3PFIA 4IJUA 3AV3A 3F71A 2WU0A 4L6AA 5J5AA 3C1OA 3MOSA 3T3IA 3ZBPA 3ADDA 4BDSA 3BULA 1E62A 2RGUA 3IVXA 3TXAA 3VNBA 1KYVA 1NBEA 1XI2A 2OD9A 3N75A 3AR5A 3UJ3X 4LVUA 4RDHA 3WLSA 1XTVA 5CX1B 2X13A 2B78A 2XTJA 1BDIA 3FTFA 1G17A 1O87A 2DTEA 3DE1X 1VCOA 4X20A 3V1LA 1DBVO 2BSXA 3Q7TA 4TS1A 4YXWD 3TFOA 2HSJA 4L57A 4M88A 4ML3A 4UKDA 1TVEA 5HMMA 3TRKA 4HGOA 1JLSA 3NEYA 5AJTA 1B0ZA 3R7LA 5HRUA 2NUPB 3HRHA 4I8XA 4OFXA 3R7WB 4AWXA 5IVIA 2RGBA 1XT6A 1IJFA 1E64A 1YKGA 5CLHA 1X8XA 1UOPA 2RAVA 2NUTA 2XMCA 4HUJA 1JWBB 4KOAA 1D04A 2C2BA 3AEQB 1WQ3A 4FMDF 4PS1A 1JBKA 1QFJA 1D1SA 1JDNA 5CB8A 1XNHA 4IUYA 1RWVA 4NAHA 3I6IA 2Z8ZA 3U9SA 3VU9B 1HZZC 2QDXA 3SC3A 4CU5A 4Z4CA 3CNHA 3KFVA 2BDEA 2UVPB 3C3PA 1MXFA 1NPTO 2XIJA 4IGKA 1M33A 1ORWA 1NNLA 1E1QA 3FZYA 4N76A 4WZBB 1JV2B 3V7WA 3AK4A 4I0WB 2FMUA 1OIVA 3RF7A 3SC6A 3ZZTA 3R0XA 3C7AA 4H0CA 3QV2A 3AH8A 5J40A 2GPJA 3GAFA 5ESXA 3G5UA 2BR3A 3UFBA 3E4CA 5AKIA 4DCVA 1GQSA 3DDOA 3U16A 4LECA 2H1RA 5LMUB 1X6VA 3V8QA 3WP0A 1TTHA 2P27A 4YRLA 3Q15C 3KJFA 3PHCA 1FSGA 1E2JA 1G7SA 1NV8A 4HB2A 3GGGA 4MULA 1QK4A 3OZUA 3IOBA 3RFVA 4C6RA 3CE9A 3TEFA 4DIDA 2DFPA 3GPIA 2G83A 4IYRA 2RGRA 1Z3CA 3MK31 1JEYB 3OEED 1L5HB 2ZS9A 5CLLA 4DLBA 3THYA 1DLIA 2C5AA 1H5QA 1A76A 3IODA 4O4HA 1NVAA 4OGFA 3OX4A 1PT9A 2HNBA 3O8NA 1XMJA 2C20A 2CJWB 2G25A 2P4HX 4G97A 3OT4A 1DAEA 1G18A 3WZMA 1J1ZA 5AUPB 2ON6A 1A8QA 1NI4A 4EHAA 1JNXX 1J5XA 4G5OA 3ZTTA 3TUJC 2PYZA 4ALLA 3A4VA 3GEIA 5CVJA 5ALNA 3VDXA 1AO0A 2E1RA 4HKTA 4AK9A 1LZKA 4EG1A 4OQXA 3EWSA 3R9IA 3IYLW 1ZVKA 4ZU1X 3UXHA 4WXRA 1FQOA 4BVKA 7REQB 7YASA 3GMSA 1FB5A 1M7GA 2UZ1A 3K0AB 4QNMA 4R6XA 2CF5A 3PUIA 4NBLA 3OQNA 4HJXA 2NO9A 4HDKB 4BNHA 1ORIA 2G09A 3ZIAA 1EWYA 2DHDA 2JFXA 1SIWA 1LDYA 4CQMA 4NATA 3NV9A 1JR3D 4BNJA 1E1DA 1R8QA 3PJRA 3MD0A 4FXPA 5A05A 3UPDA 1Z5ZA 1AU9A 1OLUB 4G9EA 3RVBA 1GDDA 3FCAA 5DLYA 5BURA 4FX2A 2VNHA 3VA7A 4O1HA 3MAJA 5JBIA 4Q4HB 2FUEA 2G9RA 1EP1B 1RPNA 2WUGA 4PRYA 5HFNA 3WQBA 5JD3A 3ED1A 2IVZA 5CNJA 3SLRA 4X65B 3R5HA 4IDOA 4L27A 2O8EA 3KJQA 2GI4A 4I4NA 3ZWBA 2CNKA 4GKVA 1SC9A 3BB1A 2PL1A 2JD0A 4YQZA 3W8RA 4W7HA 2CXOA 5EJGA 5BOSA 5I7HA 2AQKA 1FF9A 3DKPA 4JELA 4BN5A 4ENVA 4ZODA 3UXYA 4LXUA 3HDYA 2HBYA 3AEYA 1QM5A