3OIWA

H-rasg12v with allosteric switch in the "on" state
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oiwA00
2CLSA 1DEKA 4HSEA 1FMJA 4E07A 1HTWA 1Q57A 2CXXA 5DN6D 1TF2A 4D0GA 1GKUB 1SVOA 2C99A 4NYJQ 4BFZA 3BAFA 4FCWA 3WHLA 3EW9A 5JWOA 3U3KA 1KI6A 4IDOA 3GLHE 3ZYCA 3K0EA 2GF9A 1E1QA 3U4QA 2P3SA 4US2R 1KI8A 4EDHA 2PT7A 4JBWA 3GJ3A 2XOKD 2J59A 1XNJA 2KB0A 1Z28A 5E4FA 1Z8FA 1N5KA 3M0EA 2V6IA 5GADl 4URVR 1FOEB 2VQSA 4IXMA 1F5NA 3G0HA 3R9WA 4KODA 1YR6A 2ZYTX 2ZJ5A 4I81A 4LC0A 1G7TA 1W0JD 1KAOA 3B6EA 3ZQJA 1TUIA 4QHYA 621PA 1IQPA 3IHLA 1WRBA 1Y63A 1GRQA 1YZNA 4KYUA 4A1FA 2ZI9A 1Q3TA 3BB3A 4TQAA 3U44A 1SXJC 4OQLA 3QPUA 2IYQA 1NMXA 3BH0A 4PHFA 5TVKA 4Q7MB 4F93B 1Z3IX 2XB2A 3I5YA 2QL6A 2V7QA 2CEAA 5J40A 4A15A 3X2SA 2H16A 2IYSA 5BQ5A 4EUNA 1TX4B 4Q7KA 1TEXA 3LA6A 3CO5A 3W5JA 4QXAA 3PUZA 5A0FA 4DWJA 4B3GA 1QZXA 3FKSA 2AKYA 3QENA 5FUVA 1G1MA 4BFUA 3C8UA 1KO4A 4XJXA 4B48A 1XTKA 5DNYB 1VCNA 2JLRA 4XVRA 1ZVQA 2FWRA 3A1VA 4TSFA 1NBME 2JAQA 4BZQA 1NVVQ 2QTFA 1Z5ZA 4C0KA 2FFAA 4P4SB 1VHTA 2GJAA 1G21E 1KJWA 1Q20A 2ZI5A 5IK2A 1I4DD 1GSIA 5ELXA 4IRUB 1KJZA 3THXB 2V6JA 5KDDA 3RYTC 1LFDB 3UIEA 1DG3A 4UNNA 1E1RD 3NEYA 2PL3A 4JVNA 2RGNA 3ZVRA 1E98A 1XWIA 1P2UA 1DO0A 4U5XA 2B21A 5KSPA 4ZCMA 4BLRA 2CCKA 1CXZA 3AEZA 1N6HA 1VYUA 2PT5A 4PZLA 4JBXA 4PHTA 5AWFC 3T1TA 3RC8A 1R0WA 4A4DA 3AGPA 4Q1CA 3B78A 1D2NA 1Z6TA 5H68A 4NONA 2MSCB 1VKJA 2P6RA 3ICEA 4C7OA 2JJ1A 2GBLA 1IN4A 3PFIA 2QAGB 4LY6A 4CVNA 5JS7A 3KQUA 3THYB 5IDVA 3TUIC 4ERNA 4WA7A 1P60A 4JJZA 5D3MA 2H1LA 2F9MA 2FSFA 4OJKA 1G5PA 3CWQA 3PUWA 4CIDA 4CEIB 5L3SB 2OCPA 4DUGD 2A5GA 5EE5B 3KKOA 2QGNA 3AF2A 1FP6A 3L2OB 1JQLB 3DMNA 1FTSA 1E9AA 2G3YA 3IIJA 3WNDA 3UWKA 2HJVA 5K8LA 1QF9A 2J41A 2VP2A 3M4YA 1HV8A 3SNHA 4DDWA 4Q4AA 2VP4A 3B1YA 1G3RA 1K6MA 1SVKA 4NMMA 3FYHA 3VR2A 3WMFA 1KY2A 3SI7A 3VFDA 5JFGA 1Z06A 1HT1E 2QA5A 2WJJA 1XDBA 2WWXA 4NP6A 3THOA 5J4KA 3GLFE 1YZTA 1U8ZA 2KI5A 4CT5A 2G1KA 1XMIA 5E7MA 1SXJD 1F6BA 4RZ2A 3SS8A 2A7QA 2FGKA 3GJ7A 2RH5A 3LAWA 2PJZA 2R6DA 2GJ8A 3PVSA 4IDHA 4IVRA 3SFZA 1BIFA 3WRYC 1S2MA 2Q6TA 3L8YA 2HUPA 2ZSBA 4CT4B 4OHWA 3VMFA 3AF0A 1KO5A 2GVZC 1E9BA 2JLUA 3CZPA 5A4JA 2HV8A 1N6IA 3AP2A 3BERA 1KNXA 2BWJA 3KKNA 4B74A 2C9OA 4IXNA 5A5GA 1UBGA 1A1VA 5FBLB 3A8TA 4O25A 4DC9A 1TF5A 3GLIE 3OEED 5L8VA 4IOKA 4HAZA 2QP4A 1Z0DA 4TMWA 3ZS9A 4WBSA 2GCOB 4IOMA 1N5LA 4PR0A 4EPWA 2HF9A 3ADBA 1PJRA 3ECCA 3KX2A 4D4LA 4TL7A 1AQUA 5KNDA 5KPDA 2E87A 3ADKA 1G291 1XMSA 1VIAA 1KSJA 1G7SA 2DWQA 5KU1A 4LJ7A 3AB3A 3KQHA 1LVGA 2ZAMA 4D4MA 4P4TA 5FR1A 1Z6AA 1ZMXA 3HR8A 5FPSA 4U02A 1R2QA 1ESNA 4IEIA 2IYZA 4Q4HA 3H84A 1S9DA 3L0PA 4O0MA 4RCYA 1XCGB 4FMCF 1VCIA 5K8IA 3H86A 2JLXA 2F55A 5KUTA 2UZ3A 2ZE8A 3BB4A 4HB2A 5JJLA 3FHCB 1EK0A 1OXSC 2ZETA 4HZUA 4KLNA 3UKDA 2ZE6A 4C0AC 3SJCA 3OHMA 3NVAA 5TXGA 2HT1A 1CLUA 2XSZA 3ZIAD 2VP0A 2GJ9A 4BFYA 5JSZB 4ZV4A 3V4FA 1W5SA 5J4LA 1FZQA 1ZC3A 1T4GA 3TGPA 2JDID 4Q9JA 3OFND 3WY9A 4Q1BA 2WSSD 1RYFA 4MYUA 5DGXA 3PUYA 1YR9A 4ASUA 3VKHA 5B2ZA 2QAGC 1IAQA 2X8AA 4LZZA 5BN4A 2QSZA 3OEHD 5B30A 3TW8B 1FX0A 5TDHA 3TSWA 1UJ2A 2Z4RA 4AKEA 2XXAB 2JLZA 3VAAA 4PQYA 2C95A 2XNSA 4QGFA 5JBQA 2UVQA 3SC3A 2O8CA 3VR4A 1E0SA 2QM7A 3TSZA 4DCTA 5BWMA 2QP9X 4KO8A 1E4VA 1FUKA 2CE7A 2ZYWX 3UMRA 2I4IA 3K53A 5JEEA 5C46F 3TBKA 3SJAA 4PTLA 1VG1A 1JALA 4QBGB 2ZRJA 2IYYA 1WXQA 2D74A 2GRJA 2OFWA 3D6TB 3A4MA 2O8DA 4A0GA 4OI4A 3MGCA 4HEJA 5LD2B 5CM9C 3AVXA 5DSZA 1E9SA 3DHWC 1A7JA 1AS2A 1W1WA 4MUAA 4D0LB 4B3XA 2FSHA 4NYIR 4A6PA 1QHSA 1AKEA 2RGGA 1GRNA 4ITRC 4URWR 2ZRLA 3B60A 4DSUA 3A37A 1D8TA 2ZRKA 3QF7A 4HI0E 4X8MA 4CEHA 2VHJA 3BXZA 2FZLA 1TPZA 1ZW6A 3RHFA 1YZLA 4UXHA 4AKHA 2F1IA 2AHOA 3SE0A 2OBMA 4TLBA 4Q1EA 4BRWA 3UG6A 1K5DA 1KO1A 3C5HA 4JT4A 2QORA 5AUQA 1IY0A 4LJYA 2BC9A 3VHXA 2NZ8A 1N6PA 3K09A 4ESHA 3AUYA 3E2IA 2BOVA 4DSTA 2FPLA 2Q0HA 2HDNB 5G3YA 2QMHA 2QTVB 3QOFA 1AGPA 2J0UA 4JKIA 4FMDF 2QN6A 2WOJA 5HZHA 1E0AA 4EFMA 3GFOA 3U3JA 5CM8B 2WBLC 2OT3B 2XJ9A 3EPKA 1QG2A 3QXHA 3P20A 4DLSA 5DH9A 4D26A 5JMTA 4TL8A 1KO8A 2XZPA 4NH0A 2IEZA 5C2JB 3AVOA 2XB4A 1XBTA 5IRCD 3CM0A 1FPMA 3GLGB 1EX7A 1G8FA 3RS0A 4B34A 1J70A 1JQJC 3HP1A 4N0EA 4Q47A 3MJRA 3T5DA 2H8KA 2EFDB 3LW7A 1DAIA 1DAGA 1G17A 4KAXA 3T06B 3PENA 4B33A 4DDVA 4G5SA 4G3XA 1T3LA 1OLOA 4MGIR 3QKRA 1W4RA 1XJ0A 2QPAA 1RJ9B 4AYWA 5AJWA 2QM8A 1D2MA 1X6VA 4AK9A 2J0SA 2Z5FA 4Y0AA 2XTNA 5FUXA 1X8KA 3DVLA 3C5CA 4NL4H 1H8HA 3TNFA 3OAAD 5FOWA 3AKCA 3B8HA 4ZCIA 1EX6A 4MYCA 2WPDD 4B3DA 4IHQA 3TUZC 4CEJB 3CH5A 4G1UC 4FMCB 2UZIR 4MKFA 1A2BA 1ZU4A 5C1BA 3K70B 1E32A 2FFHA 1JR3D 5FL7D 3SBDA 5DI3B 2ZVPX 4IFBA 2ZR0A 2J7PD 4BFSA 4IKEA 3A4NA 4V0MA 3CRQA 5D3QA 3SHFA 1GM5A 1YKSA 3PG5A 1KGDA 2BKEA 4JLNA 2V4ZA 3U61B 4XOIA 2BBOA 3T5GA 5KSOA 5HKKA 3MWYW 1ZM3A 1KI7A 4JLMA 5KSYA 2IBMA 2ZVQX 3UATA 4HLUA 4U00A 5GJCA 1RC8A 1FUUA 1R5NA 4TL9A 5EE0A 3I8SA 2WWFA 1QDEA 1QRAA 1S9HA 1KK0A 3QEOA 3ZH9B 1OIVA 2AD1A 3P27A 2AK2A 4M2LA 4C0SA 3JVVA 4MRVA 4Z1MA 2O8BA 2I3BA 1HT2E 4RD2A 5EUQB 1G8PA 5K8TA 1N6LA 3UWOA 2QY9A 3GLHB 1GKIA 2BCGY 2Q21A 2XGJA 2IHBA 3LD9A 1HUQA 2YC2C 4RFSA 2IXGA 4MGZR 2RCNA 3R9IA 2GVDC 4OI1A 5LB4A 2C03A 2A5YB 4KHZA 4PXAA 5LD2C 4IVQA 3D7MA 1W0KA 2G77B 3NHBA 2XZOA 2AKAB 3HR7A 3EARA 2ZQ5A 3ZJYA 5JI3E 3KKPA 2AN9A 4BASA 1Q1BA 3HU1A 1HA3A 2PH1A 5CIQA 2C5LA 2GTPA 3AVWA 4GMDA 2DFTA 4RZUA 3U7EB 3NWJA 2F43B 4P0TA 3BGWA 1WBBA 4YXWA 4ZDJA 4TQUS 4I4LA 1G16A 2YJTD 2ZRPA 2QGZA 1VCOA 2BMEA 2HCBA 2W2VA 4JLJA 1UAAA 5GVRA 2DPXA 3OIUA 1GOTA 1OB5A 2GETA 1KZGB 3CNLA 4MITA 4EQ6B 4EPTA 4CW7A 4L4UA 1KK3A 5LBIA 1Q3HA 4LV5B 2IYUA 5EE1A 3TUJC 4FI3C 3LRPA 1ZD9A 4M1WA 1UBCA 3DO6A 4RJLA 3UK6A 4YMVA 4XSGA 2ZRGA 3KZ1E 4MGKR 1CJUC 4KVAA 4L9WA 4D6PA 5KNCA 3CPJB 1NMYA 1R0ZA 3QEJA 1IN5A 3QVVA 2G6BA 2BKUA 5L3VA 1Z29A 1OV4A 5FH9A 4D25A 4OQMA 1J99A 2O0KA 2ZRNA 5DE3A 1W4BA 4LC1A 4QG7A 5DISB 3H0KA 4UXIA 5IHPA 1R5OA 2V55B 5HE8A 1Z08A 3TW4A 2LKCA 2YVUA 3KB1A 4V02A 4AWXA 1NI3A 4W7SA 2C98A 4DDTA 2YWGA 1WF3A 4KFSA 4MQBA 3U6BA 2BM0A 1WMSA 3GJXC 1DS6A 3REGA 2GXUA 2D2EA 4TWZA 3W6PA 2H18A 5H1YA 5HCIA 4EFNA 3AVTA 2KE5A 2G1JA 4QBHA 1F2UA 4CRWB 3SBEA 4PSKA 2WKQA 3K70C 3MSXA 5EXSA 1Q21A 3D3QA 3RC3A 4JYBA 1YU9A 3R7WB 2QT0A 2ZE5A 1W49A 2F1JA 4K8OA 4PSAA 1KI4A 1XTIA 2QRNA 3MCAA 3R8FA 3LBNA 1UF9A 3KTAA 2OFOA 3Q7PA 4N0DA 2EYUA 2ZU0C 3NBXX 1J8MF 4OQNA 3CR8A 3TLXA 3L43A 1Q12A 2RGAA 5BYJA 4AKGA 2W00A 1N3BA 3CUEF 1U9IA 2BDTA 2DFKB 2QG6A 2BIFA 4EJSA 3OIVA 4NYJR 2PJRA 2W2XA 5F98A 1LF5A 3QKSA 1KOFA 3GLFB 1E2KA 3CW2A 2J1LA 4S2EA 1HE1C 1EWRA 2WICA 4U7DA 1MH1A 1W7AA 2HJGA 4D82A 4DJTA 4M1MA 3MUFA 2ZRMA 1E2MA 1P2SA 2DY1A 1M1YE 1WE2A 1PLKA 2VSFA 2J87A 4NYMQ 4NCIA 5L3QA 1CJKC 1P62B 3L0IB 3N70A 4G5OA 1OFUX 1YJ5A 1XD8A 2BJVA 2FMXA 4IVPA 4UNRA 1M6NA 3N5CA 2WV9A 3GEHA 3M6AA 2GXAA 1M74A 3QI2A 3F0TA 3VQTA 2ZANA 1GL9B 4LYHA 2YWFA 1NSTA 1FQJA 1E2FA 2ECKA 3K0AB 2W6ID 3HYRA 4M9SA 1XEWY 3AH8A 3GJ6A 4LJ5A 4EPVA 1CRPA 4KU4A 4LUCA 1UKEA 4Q03A 4R98A 1GDDA 2O5VA 4V0ME 2N1BA 1KY3A 4M22A 1VECA 1KMHB 3IBYA 4QFMA 4WZBE 3N2EA 3BB1A 1KZ7B 3DEFA 3FMIA 5E95A 2RGCA 4US0R 1JB1A 1N2CE 1US8B 2KWIA 2EFHB 2QMOA 4X8LA 4UKDA 3AKYA 4GNKA 2ZJ2A 1XPOA 1NVVR 3AP1A 4MKGA 4JLVA 1P5ZB 3AUXA 4GT1A 3W5IA 3EPLA 1G19A 3AVPA 2ZS8A 1OIWA 3EIHA 2ATVA 4DLXA 3DM9B 4RFVA 5FOUA 2QRZA 2XNDD 3SU8A 4F4JA 1U0LA 3O8RA 4MKIA 3PEWA 5CLQA 1HY3A 1G20E 1AM4D 2GZDA 2IC5A 4HB4A 1CJVC 4Q1AA 1KI6B 1T6NA 2FPKA 1ZUNB 1WCV1 2GA8A 1ZJ6A 2B7BA 3CRVA 3KJEA 1D9XA 5AUOB 3U4QB 2GAAA 3ZD6A 3KDSE 2CL0X 2J45A 2AR7A 4Q4JA 3T15A 1XRJA 1IBRA 2DCUA 2QMEA 3IO5A 4OK3A 2GJKA 3IQXA 1W48A 3GEEA 2FZ4A 3ND8A 4C0HA 2RAPA 2HT6A 1Z0AA 2Z4SA 2P6UA 1A4RA 1KKLA 3CIOA 4YMUA 4Q5IA 3FVQA 5EP2A 3U44B 3DKVA 4L15A 4GFDA 1S0UA 1NLYA 4PANA 1E3MA 5KHOC 2BV3A 2OCAA 3LFUA 4FWIB 2C96A 1EXMA 4QBIA 4ZDWA 1E2IA 5FOXA 3NH9A 2FSGA 1SKYE 4IW3B 3WMGA 3H1TA 4ACBA 3LX8A 1P9WA 2R6AA 1L2TA 5FBVB 3KQKA 2ZI4A 2GCNA 2MSDB 1XF9A 2CHQA 2V8OA 2YZ2A 2GEVA 3GJ4A 3TQFA 1G3IA 5IT5A 1YZUA 3NTUA 3UPUA 2WIBA 2IS1A 4ACAA 5FPHA 1GNPA 2W6JA 2WAYA 2ZI7A 3QPWA 2ONKA 5EZ6B 1RE0A 4WZ6A 1TMKA 4FWTA 2F3RA 3BORA 3FMFA 1EFRD 1CRQA 1HQYE 1R7RA 1G3UA 1ZIOA 1JPJA 3PITA 1CBUA 4XWKA 1OH5A 2OCYC 1E2NA 2FEMA 4PC7A 3E70C 4NDZA 3SQXA 4DLZA 2JJ2D 4Q02A 1CKEA 4ZIRA 1E9DA 3TIFA 2BBWA 3UANA 2ZJAA 3R20A 3SR0A 3CX8A 3QY0A 4BFWA 3ZD7A 3ZS8A 2OCBA 3WNCA 4FN5A 4D4JA 4C7OB 3CRRA 2G9NA 2O52A 1NLFA 1P4SA 2QP3A 1NBMD 2JIZD 3O8BA 1FNNA 3RDPA 1E9EA 1CULC 1WQ1R 4RZ3A 3SOPA 5D3MB 2LCFA 4QNMA 3NBZC 5IF9A 1YRAA 3LQQA 4EPXA 5KTYA 4OHVA 1Z0KA 1IN6A 3OESA 3HDTA 1WDTA 1HQCA 3OE7A 1OSNA 2FX3A 5HR5A 3PJRA 2ANCA 2KSQA 3E1SA 2H57A 3W9YA 4R2IA 1T8TA 3GMTA 2W83A 2N46A 2Q9BA 4C30A 4PPFA 1CF4A 2VHCA 1P6XA 4HLCA 4JKYA 2W58A 3A6PC 2C8VA 5CJ2A 2XEXA 1IHUA 4JT2A 3NIBA 3EPJA 3IEVA 4PAMA 2ZXUA 1JPNA 1COWA 1DPFA 5BXQC 2DR3A 4A92A 2X2EA 3NDBB 3OF5A 2ZSDA 1E94E 1TTTA 5FUYA 3I8XA 4HYYA 4B32A 1KI2A 2QMUA 1S1MA 3CPHA 5HTKA 1NY5A 5CDFA 4G5GA 4GRAA 3V4RA 2CK3D 1GFIA 4OKSA 4C2UA 4TT3D 4H1UA 4NBSA 3FGNA 3P4XA 2OEPA 5C4MA 2R44A 1HEIA 4DB4A 1OHHD 3EC2A 2VBCA 1T5LA 5AR1A 5AJZA 3AV0B 4MYTA 4GL2A 1CJTC 4MDFA 3ZGXA 2V9PA 3S1AA 2ODWA 4F38A 3AVVA 1UM8A 1U0JA 2G0NA 3B1XA 4GI7A 4MRNA 4HLDA 3REFA 1G8GA 3WBKA 3SQWA 1LF0A 1SXJE 3B2EA 1KDPA 3PEYA 4OK5A 4UNPA 1O3YA 5DIFA 3CNOA 5FBRB 1DELA 2BBSA 4NU0A 2WOOA 2FE4A 4JLKA 2VF7A 1UKZA 3FTQA 4DDUA 4AYXA 5H8WA 4WW0A 2Q3HA 1NRJB 2FH5B 4HDQB 4JMPA 2OLJA 1DAFA 4DVGA 4OHYA 3DZ8A 4LJ9A 1AS0A 4Q4HB 1SVSA 1VG9B 2VF8A 1TEVA 5BYKA 1GRRA 2A5DA 1SHZA 4LX0A 2QENA 1BMFD 2OESA 3MJHA 4WOPA 1ZM2A 4ZKEA 1M34E 3DOEA 3U2QA 4X8OA 3PIRA 4DSOA 4RD0A 5E7JA 3CH4B 1W4AA 4BFXA 4US1R 2WJYA 2AWNA 3CF0A 4KLZA 4XD7D 4HZUB 2FGJA 1E96A 3T1OA 1XD2A 3FHOA 1FNMA 3UMFA 1QHXA 5F9HA 2QAJA 4MRPA 4AY2A 3RNLA 4XTCS 4AYTA 2BMJA 2WVJA 1TADA 5KPJA 4OHXA 2ZYVX 5LDDC 221PA 2GK7A 4C0BA 3VR6A 1WBDA 4TTRA 2IF0A 4XH9B 3TE6A 1F2TA 2OZEA 1B0UA 1OXUA 1XPRA 1NKSA 2X1VA 3RLFA 1KDOA 5EZ5A 1R0XA 4AD8A 1OFTA 2GBLC 2ORWA 2JLQA 3LLMA 4TLEA 4WZAE 5JJIA 1QHYA 3LVRE 1RRFA 2FU5C 5FTMA 2REOA 1S8FA 3EIEA 4E5UA 5KDOA 2E1RA 4EPRA 4L8GA 2N42A 1G18A 2CVHA 2OM2A 2O8CB 1GL6A 1W44A 4TMXA 4POAA 1E1QD 2H92A 2J7KA 1SVLA 1M7GA 2QUZA 2Y8EA 4PC6A 4TMKA 1BYIA 1IM2A 1MV5A 4LCBA 3K1JA 3G82C 3K0FA 2D06A 4GZMA 5KOYA 2O8DB 2ZTSA 4BLOA 1W47A 3TAHA 1G41A 3IQWA 3CR7A 3EZ9A 1ZNZA 4LHZA 3J81k 3ADCA 1BKDR 3X1XA 1C9KA 4CYMA 1WA5A 1G3QA 2ATXA 3CNNA 1SQ5A 3X1DA 2XITA 1LB1B 3OIWA 3B82A 4CEHB 1NG1A 1X3SA 3CZQA 2I1VB 4B76A 5KSZA 2V7QD 1Q1QA 2WJVA 3EAQA 4LBWA 3CB4A 2XZLA 4DB2A 4RD3A 1E4YA 1GG2A 2IYWA 4CZ2A 3EX7C 1CTQA 2PLRA 2NGRA 5F3WB 1N6OA 3K9GA 2FPMA 3FKSD 2CHGA 4KV9A 1ZBDA 2JASA 3NDPA 3TR5A 3A4LA 1JR6A 3LWNA 3WYGA 3MRSA 1YVDA 4TLAA 5SZKB 1YZQA 1D6JA 2CL7X 1KSHA 2HXYA 1XMVA 1E79A 4M8NE 4HDCA 1T5IA 4TSFD 2J0UB 3LX5A 1QHHB 4FXPA 1K8RA 3RSLA 1U0HC 2FFQA 2J5XA 3AM1A 1P3JA 4WAUA 3O8CA 1II9A 5IK2D 3EA5A 2HLDA 5JRJA 1GNQA 1JI0A 3RVBA 4EKDA 1CP2A 1GL7A 4LYFA 1Y3AA 1MR3F 3K0CA 3IBGA 3NC0C 1RRPA 2CJWA 1UADA 4R71A 3H2YA 3RRZA 4Q21A 1RW4A 4KSCA 4LJ6A 4LJAA 1TQ6A 4A8JA 4KSBA 3P26A 121PA 1OXXK 1SVMA 2MMCA 2XTZA 1RRCA 2WWHA 3ADDA 2CBZA 4TQ9A 1PUJA 2R65A 4QJ3A 4DEYA 5FR2A 2BM1A 3FFAA 4NHOA 4DLVA 5CK4A 1Z2AA 1CS4C 1P7CA 2JJ1D 3FWYA 3LV8A 4Q9HA 2AK3A 3QKRB 3PEVA 4NCJA 2IA5A 3SJBA 3U3RA 2HXSA 2VHQA 3GD7A 4AC9A 1LS1A 1EESA 1U98A 2YYZA 3Q5DA 2NTYC 5HPYB 5DI9A 1ZM7A 1F48A 4QJ5A 2A3RA 5DHFA 3SEAA 4F92B 3PEUA 4M1TA 5JI2E 4B44A 4Q19A 4QGGA 5EE9A 2ZJOA 5CDFE 2JCSA 3GFPA 1SVIA 1XU4A 2ZR9A 1TQ4A 2PX3A 1U90A 2Q9CA 1XPUA 1IJFA 3AF4A 2ZRDA 2EFCB 4TYPA 1I2MA 4BLSA 1DTSA 5EXXA 1ZM4A 1NN0A 1S3SA 1AKYA 1H8EA 1G5RA 1M7HA 3KUDA 1OT3A 4M1OA 1GIAA 5G3ZA 1TNDA 1X8LA 4NTZA 1VIYA 3EXAA 1R8QA 2QE7A 1ZU5A 3QF4A 1JEEA 5BW8A 2R6CA 1A82A 2C2HA 3GJ8A 1G4AE 1MRNA 4HUQA 2FF7A 4NCKA 4LRWA 1R5BA 2ZSFA 1LTQA 2OBLA 3TVTA 5B58C 3BRWD 2IX3A 1GKYA 1BO6A 1ODFA 2P0EA 1GAJA 2REBA 4EFLA 1TQDA 4A9AA 2RGDA 1XXHB 4MH0R 4WXRA 3B5JA 3Q3JB 4E22A 1J90A 1EFHA 1X8JA 3GPLA 1DO2A 1E2QA 4AG5A 1OXTA 3EZ7A 3C7KA 4RSGA 3ZQ6A 4Z8YA 1W2HA 4IDQA 1HURA 1OF1A 2JA1A 2R8RA 3MWJA 1S4QA 1JBKA 2A5FA 3AQ4A 2F1HA 1PLJA 3KFXA 1DBSA 1F3OA 2ZJ8A 3GFTA 4EAQA 4E09A 1KHTA 3KFVA 4RD4A 1QVRA 2J9RA 4PHGA 3QKUA 2WWIA 3UXMA 3LH5A 3K9LA 4D4KA 2VHTA 4DZZA 4OHZA 1XCPA 4NE2A 3V00A 3SZRA 1NJFA 3U7HB 1CJMA 2G83A 2RHMA 1XTSA 2ZIAA 5EXTA 5DYIA 3KXLA 4M1KA 4B73A 5DI3A 2ZUDA 3MWLA 1MABA 3LW8A 2YC4C 4A2PA 4B2IA 4Q7JB 5JJKA 1E2LA 1ZUIA 4DSNA 2NO7A 1FW6A 5DN6A 1E2EA 5TARA 4Q9LA 2WJGA 3B85A 2O8FA 2ERYA 5JCZA 1A2KC 5G40A 1BS1A 3B9PA 3TR0A 1SKYB 4JSTA 3K09C 4LHXA 5L3RA 4QHSA 4OJQA 4BLTA 4DT1A 1MO3A 2BBTA 2WMNB 3IHWA 4BEJA 3QQ5A 1II0A 4QRHA 3P32A 2ZRAA 3VR1A 1UPTA 2XOKA 3CX7A 2IWHA 3KKMA 3I61A 1R6BX 4P31A 4YMSA 3Q8XB 4M4SA 3RABA 1K5GA 1II8B 2V1UA 4GPTA 2PLFA 3L8ZA 3RS5A 4JLBA 2GZAA 4O2RA 3GQBA 2QU8A 1EG7A 3PXGA 4NCNA 3ICQB 2PBRA 3KKQA 1OYYA 3VKGA 3M1IA 1P9RA 1W0JA 2XSZD 4NYMR 1MOZA 2ZS9A 1IN7A 3L82B 5TY0A 4FCVA 3WYFA 4XWOA 4N1AA 4W5WA 4GOJA 3UMSA 5FPKA 4HUTA 2A5JA 2BHRA 1Z0IA 2XX3A 5KDLA 1MRSA 2C78A 4G5RA 4PZZA 2RGXA 4BZPA 3H4MA 4PC2A 1E2GA 2OG2A 5BN5A 1TU3A 1J2JA 521PA 3HU3A 3THWA 3VR5A 1I4LD 2A2ZA 2DWOA 1U2RA 2PCLA 3RS2A 1G6OA 1OYWA 2AD5A 5EXPA 4HDOB 4JLAA 1JJ7A 2JEOA 1F2UB 4PSVA 3T61A 3KB2A 3ZVMA 2F6RA 5HZKA 5FBWB 4DCNA 4UXJA 1CR4A 2H5EA 3VU9B 3WBJA 2EW1A 3TRFA 2YHSA 4MDEA 4Q66C 2C9CA 3KJIA 4XWAA 1NLZA 2D7CA 2NG1A 3KTAB 2GAOA 4EQ6A 3CBQA 1VYVA 1JJVA 1NVUQ 3SYNA 3UG7A 1ZYUA 2R62A 4JVMA 1NL3A 1OE0A 3IUYA 1E1RA 4L5BA 1UDXA 1OFIA 3SN6A 1FFHA 2VSXA 1E69A 4HLUC 2FJUA 1XFAA 1AIPA 3FOZA 1EFUA 3HPRA 2G88A 4QOSA 5C4GB 4EJSB 4TZ0A 3NKVA 3Q72A 2REXB 1DARA 4QHTA 4ZDKA 1D2EA 4XVUA 1E0KA 2VA8A 3CF6R 4W9MC 2ZRBA 1KK1A 5FTKA 3SDZA 4C0JA 3TKLA 1TU4A 4FD2A 1KI1A 1AZTA 4MRSA 2V1XA 1YR7A 3DOFA 3RAPR 1CR1A 4PC1A 4OBEA 4WIAA 2PZGA 2IXFA 2D3WA 4GP6A 3PUVA 5L3QB 1T0JB 4DUGA 5FI0B 4G01B 4GP7A 5JECA 3DMDA 3TJZA 3LO5A 4M0LA 4BQSA 3QVUA 5JWHA 1KI9A 4AKIA 2CDNA 3WRXC 1P75A 1TUEA 1PZNA 2VSOA 5K8UA 1ANKA 3C41J 1G8HA 2CMKA 4URXR 4DLTA 1KSGA 1L4UA 721PA 2E9SA 3R7WA 4JLPA 4KFTA 1OXVA 3FB4A 5AJXA 3WNBA 3W6OA 4BE7B 2NOAA 2WSMA 3BIFA 3ZIAA 4TL6A 2OE2A 4P4UA 1XEWX 4Z8XA 1FL9A 3G5UA 4ZKDA 5JHGB 1HYQA 1TAGA 2VP5A 3GLIB 5FOTA 1SXJA 1RYHA 2VPPA 2FA9A 4ESVA 3FFBA 2EFEB 3D8BA 2A78A 1Z6YA 1ZRHA 2OAP1 1BYUA 1JECA 4OQFA 1XEXA 2JLVA 2GEUA 1NN1A 3KXIA 3AF3A 5CYPA 1N5IA 5E3HA 3NXSA 2YINC 3CONA 1JEDA 1CIPA 1CR0A 1H8HD 1GVNB 1N0WA 3IPXA 4QGHA 5EP3A 1M2OB 4BLQA 3BC1A 4Q9IA 5HCNA 1C1YA 1ZD8A 4TLCA 1ELOA 3I92A 1GITA 4LWZA 2VYFA 4PQFA 3RWMB 1LV7A 2P67A 4MGYR 4PPNA 1FP7A 3OEEA 3IKJA 2X77A 3TMKA 1ZM9A 1CR2A 1WP9A 3P1JA 1Q1ZA 4Z54A 2R6FA 1N0UA 5DYGA 3W6NA 4BZXA 2IT1A 4Q4JB 1PLLA 3ND9A 4Q4LA 1T3SA 2HCJB 4P32A 3WP1B 2GXQA 3Q9LA 4Q7LA 5HKKD 2X19A 4LV8B 2A30A 2OILA 2AFIE 1Z47A 3WYAA 1XJQA 6Q21A 1C4OA 3W8RA 1P2VA 2D7DA 1GNRA 4GOKA 2GXSA 4FW9A 5TV2A 3IIKA 5FTNA 1F60A 4F4IA 3T34A 2RGEA 2R2AA 1VG8A 3IDQA 4M9QA 2IHYA 1OKKD 4ZI3A 4II7A 4Z1MD 5AJVB 2ZJYA 4MRRA 5B64A 4ILEA 4RD1A 1I2DA 2ORIA 2IF2A 4L9SA 2QBYA 1N6NA 1D5CA 1US8A 3QBTA 5E7IA 2DWPA 2O8EA 1NN5A 2HYDA 4QL3A 5CYOA 3N2IA 4JBYA 2RKOA 2BEKA 4JVSB 4PX9A 4RVCA 3LXXA 4YC7A 4KI0A 4ARZA 2CNWD 4JJKA 1KAGA 4LJ4A 4ZPXA 2ZUBA 4LDJA 1W0KD 2KBEA 2WKPA 2OSBA 1T3HA 4UJ5A 2XJ4A 3ZZUA 1WB9A 2AXPA 4B6FA 1U9IC 4G0NA 3RRNA 4EJSC 2IW3A 1P73A 4BUJA 1MT0A 2ZEJA 2JDIA 2CCJA 3A1WA 3OFNA 4IOJA 2GESA 4RCZA 1RRGA 4RZXA 1EWQA 1T91A 2WSSA 4OYHA 2CL6X 1NVWQ 2DHRA 2OBNA 4DHEA 3K8YA 1XTRA 1KDRA 2AL7A 3U3MA 2GEDA 2W2TA 3Q85A 5TB5A 1Q22A 2DFNA 1LW7A 1G8YA 1LS6A 2PCJA 3OEHA 3QG5A 1D9ZA 2ODBA 3RRYA 1XX6A 4PFSA 3ZZTA 4YXWD 1AJEA 1IXRC 4KFUA 2WZQA 2AWOA 2ZM5A 1EFCA 3CRMA 5FFMA 4ZIRB 1AQYA 2OV2A 4TTQA 5FBQB 2CE2X 4M1SA 1XEFA 1NG9A 1P61B 1XJCA 4HB0A 2ZS7A 4A82A 1Z2CA 3U60B 5JRZA 4TYYA 1M8PA 2WIAA 2BCJQ 4GDFA 3RANA 1KNQA 3FE2A 3FMPB 2NIPA 4LSGA 5AUNB 3NC1C 5CB8A 1ZAKA 2EWWA 2NO9A 3RS4A 1P2TA 3OZXA 5EP4A 4C4PA 3SYLA 3PR1A 2PMDA 5F2EA 4YONB 3MAAC 4BGDA 2OHFA 3D31A 1QG4A 1VG0B 3LBIA 4XIGS 4C0QC 3T12A 4GBMA 1PV4A 4PZYA 1KK2A 3DL0A 1KJYA 1DAKA 4PO9A 3IEUA 5J47A 4Y0VA 3KJGA 3L0OA 5J5CA 4XTRA 2VH5R 1EFTA 3EZFA 1IONA 1HH4A 4A0RA 4A0FA 3AKDA 2FN4A 2ZRCA 2VTKA 3L0SA 2QQ0A 2HEIA 3K9NA 4LPSA 4XVQA 4YMWA 4TZ6A 4GSYA 2OUKA 2GDJA 4K46A 1KDTA 3AVYA 4I1UA 4D2IA 4OQXA 1N6RA 1R4AA 2ZR7A 3NG1A 1UDWA 4OI2A 1RZ3A 4URUR 2CLDX 3C14C 4LYJA 2YV5A 1NNEA 2DYKA 1BH2A 2ZJZA 4RKFA 5CLLA 2QQEA 1X1SA 2PZEA 2RB4A 4Z51A 4GOXA 3C15C 5SZHB 2WWYA 4Q4AB 2KBFA 4BWYA 4P4SA 1R10A 2IUTA 4Q1DA 4AIIA 1XP8A 3EWSA 3C16C 1V5WA 1A5TA 4ON9A 4YDSA 2BMFA 2VP6A 3THXA 2ZUCA 4CDGA 1XD9A 3B1ZA 1GUAA 3EC1A 5FOVA 2R9VA 1G4UR 3TK1A 3A36A 4LHWA 1IXSB 1QHGA 4KITB 4K81B 3S1AB 4A36A 3BFVA 3BH7A 3EZ2A 1JAIA 4V03A 1MKYA 1ZIPA 3U5ZB 1L4YA 4KXFB 1G6HA 3QG1A 4BRUA 4LBZA 4ZDIA 3FMOB 4B3FX 2QTHA 2L0XA 3LY5A 1QVAA 1NKTA 3LVQE 2QAGA 5J4HA 1KYIA 4FIDA 2FFBA 2XTMA 2J46A 3THYA 3F8TA 3LXRA 3NH6A 2IWRA 3DM5A 3QPVA 2VP9A 3U3OA 4BFTA 3OAAA 4NKRA 1KKMA 4V0OA 3DPUA 2P6NA 5H70A 1OH6A 4LI0A 3SYKA 2WPDA 3GCGA 3A1TA 3CWZA 3TVDA 5L3SA 4UJ3A 4CEIA 2ZJBA 4Q1FA 4QM7A 3A1UA 1JR3A 5FL7A 1TF7A 1QHIA 5B57C 2C77A 1LY1A 2C9YA 2JJ8A 2ZAOA 3NHAA 4CGZA 2J7PA 1NSFA 3RS7A 4DIEA 3IPYA 5CK5A 821PA 4F91B 3B9QA 2J0VA 2I1QA 1IN8A 3FDIA 3QXXA 3QBVA 4JL5A 4MA4A 2WJHA 1Z63A 2ZE7A 4M53A 1ESMA 4WXPA 4PAQA 3HYTA 1XD2B 4C2TA 1UBFA 2YOGA 1MO6A 2RHDA 3KUCA 4XSHA 3KQNA 2AFHE 1G3MA 2P65A 1ZUHA 4DKXA 2WTUA 2CCGA 2VLIA 2VO1A 3BBPA 2QEQA 4M21A 4JL8A 3F5FA 4TTPA 5F9FA 1HE8B 1F2TB 3FKQA 1H65A 1KSFX 3MWKA 1UKYA 3QIAA 4YMTA 4IEEA 3RS3A 2GNOA 3VNUA 3EIQA 1R0YA 4AG6A 4DIDA 1E9CA 3B13B 2RGNC 3BH6A 4KJZA 1GZSA 4YDHB 4DXAA 2Z0MA 4RY2A 1ZNYA 3I72A 3WMEA 3LQRA 1J7KA 1KIMA 4CF7A 2TMKA 3LDAA 4QM6A 2ASEA 1Z83A 4HAVA 2VEDA 1G5TA 4KYIB 3MG9A 2ZSEA 4HATA 1IY2A 3I4LA 1NF3A 2GCOA 1JAHA 4BFVA 5JEDA 4R7ZA 1FX0B 3K0FB 1S1CA 3JZMA 3VR3A 2DFLA 3B7GA 2NO6A 4HAWA 3P4YA 1KI3A 4OK6A 2QSYA 1DAHA 4KBFA 3VX4A 2GZHA 3IILA 3RWOA 2QT1A 4EIWA 5AUPB 3T35A 2GHIA 1VPLA 4B3BA 2BVNA 4S35A 4TMTA 4B75A 4DCVA 2J0QA 2W0MA 3OIYA 3WXMA 1RIFA 5GJBA 2YWHA 4LHVA 1UEJA 2IYXA 3BK7A 4DCSA 2ZITA 2EYQA 3DKPA 4E03A 3BOSA 4HB3A 3ZVLA 5EE3A 4LBYA 1IY1A 2P5TB 3AVUA 1GILA 1N6KA 1O87A 2UKDA 1ZP6A 3KQLA 1YE8A 2QPOA 3AVQA 1VCMA 4QJ4A 1OJLA 4B71A 4DBLC 1Q44A 4N3NA 1Z07A 1I4TD 2IYLD 3QXSA 4B35A 4TN1A 1XTJA 4IDPA 1W2GA 1W5TA 3EZ6A 5JSZA 3AKEA 1T0HB 1NY6A 1MO4A 4D0NA 2PMKA 3ZZ0A 3MD0A 2HYIC 1ZD1A 5DHAA 5AK0A 1Z6GA 1SGWA 2Q3FA 4R2HA 3PV0A 2ONJA 2D62A 2W6JD 4JL6A 2YNMA 4PPGA 1PVOA 3BS4A 4V0LA 1VYTA 1Z0FA 1NP6A 1QBKC 4DLYA 4A0HA 1W36B 2CJWB 4MKHA 4AURA 2XXAA 3BJIC 4BLPA 4KFRA 4A8JB 1U81A 4URYR 2ZYUX 4G5QA 3AGQA 2Q9AA 1PUIA 1RFLA 2ZRFA 3B1WA 3SHWA 1P72A 2ZREA 4PHHA 1RPZA 1L8QA 3PQCA 3K0SA 1ZNWA 3GEIA 5EQTA 1SHKA 1E9FA 4FCTA 3W3ZB 1YZGA 2EQBA 2VRWA 3IO3A 2F7SA 3FHTA 2V54A 4HAXA 4NZYA 4LPKA 1UEIA 1AZSC 3VKWA 5GJVC 2ZRHA 1U99A 4H9GA 2K5UA 3W8NA 4M9ZA 4UNSA 3OE7D 4QGAA 3A58B 4TMVA 1R8SA 1DE0A 1DG1G 3WHKA 4B43A 4B2LA 3EG5A 4BECA 1U94A 2NO0A 2IYTA 2NZJA 5LB2A 2GJSA 1XMJA 1ZCAA 3IIMA 1KTVA 5FUWA 5DO9A 1QHHA 4P3YA 4LBVA 2IYRA 3EWAA 4JVLA 5UKDA 4LYAA 3LNCA 4O3MA 5KNBA 1Q1EA 3QF4B 4UNQA 1COWD 1X1RA 4HUQB 2FOLA 2MMGA 4YQFA 4HLQB 1DOAA 1OH8A 4TYQA 4HZIA 1B23P 1Z0JA 1CU1A 2AXNA 2O0JA 1VMAA 2QI9C 3W34A 3I73A 3ASZA 4B47A 2R6GA 1BOFA 4LGMA 5C18A 4ABYA 1UKVY 3EA0A 4JZKA 2FV8A 1W4CA 2EFGA 4KVGA 2FG5A 3NBFA 2CVFA 4JLDA 2W6IA 3NEJA 5J4VA 1JNYA 3CKLA 1DVRA 1JR3E 2IXEA 4B2PA 3NBYC 3GLGA 1FQKA 3DDCA 3A1SA 4TMZA 8OHMA 2ODEA 2O8BB 3LBHA 4C0LA 4JYCA 1DADA 3BFXA 3KL4A 1G7CA 1YQTA 1EGAA 3DZDA 3RSOA 5CIWA 2WMOB 3CF2A 4LK2A 2PEYA 3O47A 2D2FA 4RFSB 5G53C 1IJEA 2OLKA 4L16A 1RJ9A 5CITA 1MABB 1IOZA 3T1QA 4UQOA 2NPFA 3HU2A 1XCMA 1NIJA 2SHKA 3HJNA 4H1VA 5DLQC 4AI6A 5EUMA 1G64A 1E9RA 2JATA 2XNDA 2HF8A 3X1WA 2ORVA 2O8FB 3C4JA 4CEJA 1TQ2A 4NYIQ 2X2FA 3QJYA 5M04A 1AA9A 2P2LA 1GP2A 4LOAA 3TQCA 4TLDA 4J0QA 1P9NA 4DT1B 5BN3A 1Q0UA 3R9XA 2AX4A 3TH5A 2YOFA 2ZI6A 4GMXA 1Z22A 5FPTA 1XXHA 1OKKA 5EJEA 4W5HA 4QC2A 3LLUA 4O2LA 5SZJA 2YKGA 2F3TA 2CLCX 5FOSA 4EPYA 2FNAA 3SFVA 3K0CC 2WM9B 3QKTA 1W36C 2GK6A 4TYWA 1X86B 1MO5A 2V3CC 4A8JC 4DLUA 2IEYA 4DCUA 3U7GA 4Q00A 3I62A 1TL7C 2CNWA 2DBYA 4B6EA 5JWRA 4LHYA 2LKDA 2QZ4A 1VDZA 1UFQA 3X1YA 4BPBA 2FDCA 1LNZA 4GZLA 4NPHA 4FMBB 2W0SA 1E2DA 1KO7A 2C04A 3GLHA 3MLEA 4A2QA 2NMVA 2OO7A 1U8YA 5LPNA 2MSEB 4DLWA 3THWB 3HPQA 3MMPA 2ZPTX 3PCRB 4MUBA 2NPIA 3GP8A 1E2PA 5EP1A 2G0TA 1ZCBA 1RKBA 4DRZA 2IS6A 3VX3A 3VHLB 2ZSAA 2O0HA 5FTJA 4ASUD 2F9LA 3ONWA 4PO8A 1L7VC 2WJIA 1T8UA 2QNRA 2VIIA 2LWIA 3JZAA 1FTNA 5SZIA 1KMQA 2RGBA 4MYHA 3E5HA 3U7FB 2IS2A 4JSYA 3Q5EA 1OPXA 2IUUA 1GWNA 1N0VC 3I1FA 2JLYA 2IK8A 2ODNA 2F43A 1EFRA 5CB6A 3ETLA 4LV6A 3Q7QA 5HE9A 1U8AA 1II8A 2GCPA 2J3EA 1ZINA 2B6HA 4A2WA 2JJ2A 2VL7A 3GJ5A 3HWSA 3V9PA 3ASYA 4RD6A 1RVDA 1ZNXA 1XTQA 4W5JA 2GKSA 2A9KA 4FMDB 5KYKA 3EPHA 2FSIA 2B7CA 4R9UC 4B3CA 2GILA 4I1SA 2PZFA 4PO1A 1NBMA 4JIMA 3VTKA 5FPYA 2JIZA 3TSOA 1S3GA 4P33A 2WWGA 3ZVNA 3CX6A 1XB2A 4IOLA 2OXRA 2ZI3A 4IJMA 2JLWA 2IUSA 2RMKA 3QKSB 4YLGA 2EWVA 3T1VA 2IYVA 1N25A 3W90A 1E79D 1IXZA 2B92A 2OXCA 4Q9KA 2JLSA 3FPAA 1NJGA 1CEEA 3BE4A 2IS4A 3VU9A 5FTLA 4D81A 5JZVA 1YRBA 2HLDD 1JXMA 1E0JA 4F4CA 4I1VA 4V0NA 3I32A 1OFHA 2D4HA 4D80A 1T9HA 1W36D 4WVFA 1W46A 3K9HA 1G7RA 1GTVA 1OW3B 4Q01A 1OH7A 1OB2A 2KJQA 1SZPA 2WHXA 5J4YA 4M9XA 2PEZA 5JLJA 1AK2A 2P5SA 1DAEA 1E2JA 1SVWA 1SXJB 1VTKA 1ETUA 1YHNA 3CRW1 2CK3A 4ZI2A 4TYNA 3CPEA 4TT3A 3BFKA 1AGRA 3QUSA 1AS3A 1XEXB 2Q3MA 1G9XA 3QXCA 4JS0A 1OHHA 1NMZA 2ZROA 5AJYA 2B8TA 2GWHA 5FL3A 3TAUA 5GJWC 1M7BA 2ZU6A 1E99A 4Q48A 4IFEA 5CJPA 2IL1A 3W3AA 3QXJA 2VHUA 3U6KA 5TMPA 1NVXQ 3KJHA 1SULA 2WAXA 1SKQA 4URZR 3EASA 5G41A 4C3ZA 2Z83A 1XZPA 4RKEA 4PAOA 3ZDQA 3R8CA 3GLFA 4X8HA 5JS8A 1H8ED 2BMDA 2OAQ1 2PX0A 5KO2A 4DLRA 3GLGE 1FMLA 3AF1A 4C9BA 2BEJA 3I5XA 2QE7D 3ZLJA 3VNVA 2ERXA 4PQRA 2QROA 3RRMA 3WP0A 1S96A 2FEOA 4M1YA 1YZKA 1Z6XA 2NO1A 2H7VA 5ANRB 1AN0A 1J8YF 4F7WA 2YOHA 5FI1B 5JCPA 3SJZA 2WWWA 4HAUA 3O8DA 3QNUA 2EU8A 2ZRIA 1N5JA 2B8WA 2JGNA 2Z6VA 1BMFA 1ONBA 4V0KA 2CHVA 4FINA 3PUXA 4ZCLA 4PC3A 5P21A 3X1ZA 1YR8A 4PPQA 2QPTA 3F3YA 1ZC4A 421PA 4OL0A 4HAYA 1UBEA 2QBYB 3GLIA 4QBFA 1QHNA 2O8EB 3KXKA 4DEXA 4OI0A 3K0AA 2OFXA 2XAUA 2ANBA 4NCHA 4QNRA 4XD7A 4A6XA 2DB3A 3I3SR 4KCGA 4ZO4A 2EVWX 4I99A 3B1VA 4ARZB 3MFYA 4I1OA 4IDNA 3QE0A 4Q18A 2GF0A 2NQ2C 1KMHA 3GJ0A 3IGFA 2BJWA 1NIPA 1E2HA 1NN3A 1XXHE 2WKRA 4QKQA 5GVSA 4BEBA 4JLOA 1VHLA 3CLVA 1JXOA 1V43A 2H17A 2YWEA 3JVUA 3K70D 3AP3A 1OIXA 3BWDD 4KBGA 2Z43A 3BD9A 1E6CA 2F1RA 4LJ8A 5JHHB 1DAMA 3QSYA 1XZQA
chains in the Genus database with same CATH superfamily
2CLSA 4ALNA 3MOGA 1P6QA 1Q57A 4TOIA 2CXXA 1AGNA 3GUUA 4RTJA 5THQA 1SQGA 2G9RA 2P1RA 2JK0A 4D0GA 3O9VA 1KVQA 1OX4B 3O1LA 4M86A 1QO0D 2CJPA 3OJLA 5CA1F 2G04A 1LPBB 3OLQA 2DLDA 3BAFA 3DVQX 4FCWA 1EUQA 4DQKA 3AF5A 1KI6A 1I3CA 4WNCA 3JQPA 3M9XA 2WABA 1EZ4A 3ZYCA 1M5RA 3ET5A 1TYBE 2UVDA 1SELA 1E1QA 3L7AA 1UPBA 4LWPA 2P3SA 4BCDA 2H08A 5B58T 4U9HS 2XOEA 3L8FA 1SPXA 1K9SA 2PT7A 4WACA 3JATB 4EB3A 3FHLA 5IG2A 3TDMA 5HEKA 2OXFA 2B2NA 5KZMB 1GZDA 3N8DA 1W1IA 3LUBA 1YQ9A 5CX4A 1Z8FA 3A28A 4J0JA 4JP8A 2I34A 4R1QA 2KW5A 3HCOA 3V6LA 1SZJG 2Q3BA 4LYEA 1ITZA 4NICA 3GPCA 4KODA 4QXQA 3SR3A 2YR0A 1YR6A 4I81A 1G7TA 5LYJB 2GPBA 1KAOA 1TXGA 1FYVA 2LVBA 1TUIA 3WKCA 2XMCA 4G0UA 3LFTA 2XMSA 3I9OA 1GRQA 1BAPA 2ST1A 4KYUA 2OPHA 3IQIX 2JGDB 4EHFA 3WYNA 1CZNA 4TQAA 4OQLA 5HF8A 4X3CA 2Y1FA 2IYQA 4GPAA 4XPIB 5K2MA 3STUA 4Q7MB 1Y48E 1Z3IX 1T6ZA 2QL6A 3QWAA 5B1EA 1CUXA 1JDSA 3L6DA 4OLHA 1YVPA 3JVIA 1NYRA 3R40A 4CKZA 1OXKB 1RDFA 3ZI7A 3CO5A 4EVIA 3I3OA 3Q10A 1WU7A 2EX4A 4E46A 1F6DA 2FFRA 4GKAA 3PUZA 1ZLXA 5FUVA 5COAA 4BFUA 3C8UA 3BQ9A 2GFQA 1KO4A 3IKLA 4HDRA 3FSGA 4LQ4A 4YV0A 1T0PA 1YRHA 2H07A 3O0TA 3E3MA 3P0RA 3CC8A 5H59A 1LTHR 4A5SA 1NVVQ 3GLVA 2J32A 3HACA 2B9VA 4FC6A 3A3NA 1G21E 2HIHA 3FZYA 4YN3A 3NUQA 1LWOA 1U11A 4AZ0B 5CB4F 3L0YA 2V6JA 2VWPA 1Z8DA 1LFDB 1KZ4A 3T9EA 1E92A 4UNNA 5DXAA 2BCEA 3G0CA 1UAGA 3NEYA 1H5QA 3OJXA 1BE8A 1U8TA 2RGNA 1E98A 2XBLA 4WN3A 3CW8X 4BX2A 5ESDA 4BLRA 2CCKA 2VNHA 3AEZA 4PZLA 1FQWA 4PHTA 1U2ZA 1SBZA 3AG5A 4FR0A 1WSDA 4UC0A 5AHXA 2XD4A 4CIXA 1SA0A 1RWWA 4YP6A 3OQJA 1GA6A 2H7CA 1IQUA 1HDYA 3F2IA 2HB6A 3JQFA 3PQ3A 1WM1A 4NONA 5H68A 3RUPA 1VI6A 3VMMA 4BNMA 1A96A 4CCYA 3ICEA 2JJ1A 4P81A 4L3WA 1X1QA 2BTOA 1YB2A 4LY6A 5DK6A 3TFQA 4JCOA 1L5RA 3UJ3X 3W5VA 3JW8A 4ESOA 3FM9A 4FUTA 5BR8B 2DHQA 2OV1A 3UV6A 1SBCA 4RPKA 3UJHA 1P60A 1U65A 4JJZA 3UAYA 2A0KA 1XQ6A 3ZKWB 2QJFA 3QEAZ 3KEFA 1Q0HA 3I1IA 4OJKA 1Y5IA 2QR3A 3GUCA 4G0PA 3D3KA 4K9QA 1P44A 1QIHA 1XDZA 1RMYA 2OCPA 1RC0A 3OKPA 4FLFA 4NSNA 2QB5A 2EDCA 2H11A 3AF2A 1FP6A 3NNDA 3W4JA 2I22A 3Q2KA 1FTSA 1E9AA 1XZDA 3WNDA 2Z5GA 3UWKA 1R37A 1I32A 2WP8J 2Y4NA 1PT8A 3NQ41 1HV8A 4DAEA 5HW0A 2JFHA 1VMKA 2YIDA 3EGVA 4Q4AA 3GFSA 3IP3A 3PFCA 4G84A 1PL7A 1SVKA 5I9LA 3SS7X 2QX6A 1T5DX 5JFGA 2HPHA 3IT1A 5J4KA 3BRWA 1YZTA 2DQSA 2R97A 2KI5A 4B3HA 3PICA 1W6UA 1ODJA 3P9RA 1QF6A 3G1WA 1Z5UA 2XMZA 3W1VA 3WMXA 1Y8CA 4D4HA 3SS8A 4XW2A 2RH5A 3BZUA 2PJZA 4Q3BA 3AT1A 4X95A 2VHEA 1PJTA 3D8SA 1F0NA 4IS3A 4JA2A 2ZJ7A 3GAMA 2VXOA 5JD5A 2QX4A 1UMCB 3G9QA 9LDTA 4MI9A 5AVQA 3AF0A 4H7PA 3FTDA 1RTKA 4HHEA 4E5KA 1E9BA 3CZPA 2B99A 2JFZA 3SZOA 1YV9A 1M73E 2CWDA 1MA3A 3RM3A 2C7BA 1KVTA 3AP2A 3BERA 4L4ZA 1KNXA 1M9NA 3L6OO 3JWEA 4OVKA 2C9OA 3NBAA 3HKDA 4C05A 3HRKA 4O4JF 5F33A 1ZUD1 1TF5A 3GLIE 1T9KA 5L8VA 1GCOA 1STOA 3KKLA 2P9BA 4TWBA 1HMYA 1TCCA 2V7WA 3FD8A 2WUDA 3EIFA 1Z75A 4O2AF 5TQ0A 1GGHA 3KAPA 4DV7B 4INJA 1N9GA 3LOQA 3OZSA 3RWBA 1V9LA 2H1WA 3AUAA 1OWNA 4TL7A 3ZK8A 2DVMA 3UAOA 3VOAA 3NHPA 5LSAA 5AW5A 5KPDA 4NMLA 1FRQA 4O5OA 4W5NA 4YRZA 3ITEA 1XVIA 3LUFA 1B3BA 1V11A 2DWQA 1KPIA 5C8XA 1NP7A 3K31A 2BHSA 3CA8A 4YHBA 3ZDDA 3GFFA 4NFHA 1U7HA 3TCKA 4ID3A 4EKIA 1Z6AA 4DAOA 2AYXA 1XG5A 4E2YA 2WSBA 3I62A 2VOJA 1IBKB 3G2OA 2F1OA 3WGIA 3MD9A 3ESAA 1JJAA 2HA3A 2EFYA 1QB8A 2JIDA 4XGQA 4EL0A 4F2PA 2F55A 4CM3A 2Z3ZA 4MUFA 4F1JA 3BB4A 2NSHA 4L3OA 4LC9A 3ORQA 5FX2A 3Q8LA 2YZGA 4D0RA 1TGYA 2ZBFA 2IE0A 4ETMA 1V8BA 2Q3DA 3LQFA 1AKNA 5CLJA 3LCCA 5JNWA 3NVAA 1ND6A 1QVVA 3RUAA 4G9EA 4M49A 2JFFA 3I2KA 2XSZA 2YQ4A 1PQUA 1O54A 5HTOA 3IKTA 4WOJA 1D1PA 3EBOA 3DLBA 1Z8HA 4URHA 3EPRA 2MOKA 1FZQA 1Z5GA 1FFXA 1L4KA 1PT5A 1QQTA 3AETA 5LBTA 5T8KC 3TGPA 5AW0A 1R4NA 4H27A 3C97A 2NPOA 4MQFB 1KZ1A 2VNJA 3P0HA 4MYUA 3PUYA 4ASUA 2DTEA 1CQPA 1DT3A 2MINA 3AEXA 3AESB 3TLAA 2QJWA 4AWAA 4BX9A 2HA5A 1OI3A 2X8AA 4JWKA 1A72A 4BB9A 3AM4A 5ED4A 1ZSYA 2EP5A 4MW9A 4PG5A 5B30A 4XPZA 5BY2A 1PZFA 3FKJA 1N34B 1O6CA 4KQEA 2PQMA 3V9AA 1EVLA 3DO8A 3HXLA 3I23A 1LNQA 3ITKA 4EVQA 4WKBA 2W7TA 5KYVA 2GN6A 2M98A 4EG7A 3DBVO 3ELWA 1BFUA 3WJ1A 3ZGYA 3SC3A 2CKMA 3F98A 4P2GA 4ZGWA 1E77A 1NQAO 1QGOA 2Q4OA 4K5QA 1JYFA 4GE0A 3TSZA 4DCTA 1GUZA 3RTAA 4K9MA 1CCWA 2WFMA 1KARA 2Z2YA 2ZYWX 2BZ0A 4RTLA 2AJ8A 2QN2A 1VG1A 1JALA 5E9WA 2ZRJA 4KXVA 3VZPA 4GBJA 2D74A 2GRJA 2LXNA 2YICA 2ZYDA 3DHVA 4L4SA 3EEBA 2Z1MA 4QODA 5DHTA 4RL4A 1PFVA 5B7GA 5LD2B 4Y9DA 1KVSA 1XZMA 2P91A 1E9SA 4MUAA 1SUPA 3OO1A 1NOKA 5H9WA 1P91A 4ALKA 4A73A 4A6PA 2IVFA 1JXAA 2GZRA 1AKEA 1GRNA 5DB4A 2BGRA 3Q2IA 4WI1A 1YZFA 2X8WA 2ZRLA 3QLVA 3X2FA 1D8TA 2ZRKA 3DMTA 4KQIA 2YMMA 2WD7A 4HC4A 2CF5A 1RQLA 3R24A 3OCYA 1TPZA 1JLLA 1ZW6A 2M6KA 2NXCA 3KEOA 4YCMA 3RHFA 3TL3A 2I6XA 4UXHA 4D79A 4RGYA 4NJEB 1BU8A 4MIOA 4Q1EA 3KOYA 4BRWA 3UG6A 2P77A 1JE0A 1K5DA 5F5LA 1CNEA 1ENYA 4DREA 1UBMS 3ZPXA 4JT4A 5K99A 2QORA 2X5NA 5AUQA 3S81A 1P7WA 2IZZA 2NZ8A 2PZJA 3B2QA 5HF6A 3RTCA 4AZTA 4ZZ3A 2BOVA 3HJAA 3JQ7B 5D51S 4OHPA 2Q0HA 2PZ8A 4DSTA 5G3YA 1Z5VA 3J80A 3ENVA 2DWUA 1Z3CA 3QOFA 2FN9A 4ZK6A 4JXZA 1QV6A 4FMDF 4JKIA 4MUEA 4YS6A 3RJMA 1C7RA 1E0AA 2VDMB 4N41A 5CM8B 2WBLC 1P7YA 4D8VA 4IR7A 1QG2A 3QXHA 4UMDA 3IXLA 3P20A 5ELLA 5C8VA 2AZTA 3MTJA 5JMTA 2PGNA 3MJSA 3MOSA 1O0SA 5EZSA 2JAPA 2VSNA 5H4HA 2CUZA 1XBTA 3CM0A 3M81A 1ENZA 3TZKA 1S5PA 3HKEA 4HQOA 4D8UA 4E5YA 4FYJA 3CSUA 5HJ2A 5HMMA 3R74A 3MJRA 4IUYA 1IB0A 4GBED 3V8NA 4CM4B 3E35A 1VLZA 1G17A 5EMLA 4OB6A 3ESCA 4DDVA 3ZOKA 1T3LA 1K08A 2XCQA 4ZTBA 2GZ3A 3M4NA 4NOLA 5KQGA 3OIDA 4QYTA 1UBJS 1BQ3A 4R1PA 5AJWA 1LJ8A 1X6VA 1RWXA 4WJZA 4RTKA 2Z5FA 1U8CB 5JSFA 3DVLA 2CKDA 1H8HA 2AFIB 1C7JA 2JAXA 2NSYA 2OHJA 3KR1A 4RKQA 4X6YA 1Z4LA 3EG9B 3C6ZA 4IHQA 3TUZC 3T41A 4MKFA 4FMCB 4J07A 4BVBA 1A2BA 1ZU4A 3K70B 1JR3D 3OCXA 2QE6A 1DQSA 2V7EA 3DBLA 2FJPA 3KZNA 3R6GA 2ZVPX 1O5OA 4LTDA 2J7PD 4X91A 2E5LB 3ZBTA 4IKEA 1JG1A 1QYXA 3D2LA 5FYQA 1GM5A 1YKSA 2FKAA 3PG5A 2ZYGA 3UH1A 4KPEC 1X39A 3TLKA 5HMLA 5JH7F 1B0ZA 1S4MA 2IQIA 2V4ZA 5CD1A 4G0WA 2W6QA 2SCUA 3ZE9A 2YHIA 1QE5A 4ENUA 1YR3A 1NWHA 4JLMA 2D5CA 3WGNA 1XRMA 4I9HA 4E6EA 2GYUA 2IBMA 2XWQA 5CFNA 4I4TA 4QXMA 2X5JO 4TL9A 5CAEA 4RWZA 5EE0A 2HU2A 2FPWA 1ORHA 2CV1A 2WWFA 3ILHA 1S9HA 4GLLA 1SUFA 1K7EB 3QEOA 4G1FA 4TXHA 4DPMA 5EHGA 4CR6A 1QFXA 4EARA 3TTWA 5ICMA 1JIKA 1YSCA 1VM6A 4MRVA 3HDJA 5HA5A 2QXYA 2I3BA 4FHEA 1HT2E 2H2WA 4CUZA 5EYPB 1E3JA 5T3UA 1NJ1A 2AX3A 4PIVA 3CISA 1UJ6A 1LQTA 2H2FA 4G4JA 4F2WA 2FZGA 4RFSA 1XE3A 5REQB 3W5BA 3ZHRA 1I1NA 4IZIA 2H9IA 2HU7A 1Z2OX 3PZBA 4JCCA 3R9IA 4OOEA 5HXAA 2ECFA 2OENG 1KOGA 2CMGA 3GHYA 4KHZA 4KVZA 2QUBA 4RHEA 4H1WA 5LD2C 3D7MA 2G77B 1QTIA 2VF5X 3BHMA 3TRDA 4UUNA 1CEQA 5CH3A 3V8MA 2XZOA 3PGVA 1KYVA 4KRGA 5C5CA 3EARA 2GN8A 1J8FA 1KJ9A 3WRXA 4BMZA 1ZI6A 1U7ZA 2JZCA 3KKPA 3Q4GA 3NFYA 3KIPA 4M1ZA 2VDJA 3PDIA 4M0EA 2ZB4A 1P29A 2HSJA 3CLTD 5EMJA 5KKAA 4ARCA 1M2HA 4DWVA 1E3EA 5A3SA 1I4WA 2C5LA 3VR3D 1UZLA 3KHKA 4FJ1A 5CPFA 1MVLA 5K0EA 2DFTA 2GK3A 3C6QA 1RI5A 1SOVA 4XVCA 2A9RA 4ALJA 4ZCRA 1F4PA 1YB1A 2F43B 4B9EA 3BGWA 2EGHA 1I7PA 3FGPA 3LBAA 1DWPA 5CIYA 2OVBA 1WBBA 4INPA 5B1YA 4HDSB 1RABA 4I4LA 5EQDA 5KTKA 1NLMA 4W1RA 1G16A 4K9KA 4ZI7A 4JLJA 3ZOZA 4CM9D 2D59A 5TT1A 4QTTB 1EYZA 2DULA 4TWAA 3NVMB 5CVCA 4R6WA 3D6NB 5GVRA 1JT2A 4CM8A 3BHIA 2GETA 1KZGB 2WSLA 2HDWA 4BRSA 4EPTA 2P4SA 1KK3A 1FNSA 3F9CA 3VZCA 4LV5B 5EE1A 4BLUA 4FE7A 3TUJC 2I6TA 4FI3C 4FYWA 5LR6A 1PQYA 1Z0SA 2GTHA 4H18A 1MLDA 4CLEA 1X7ZA 3QVMA 4K28A 2IDJA 3K2IA 4MGKR 1CJUC 1X0XA 2D0PB 2E55A 2AOUA 4KJXA 4HDNB 4KVAA 1CDZA 4TMYA 1Y3CE 2G6BA 2BKUA 2R8XA 1OV4A 1VXRA 4ZO7A 5IDXA 1W2WB 4ALIA 3UA3A 5HK9A 2ZIZA 1G42A 3C1OA 2O0KA 2ZRNA 3EXHB 4LFAB 3ZZMA 5DISB 1SCUA 4UXIA 5LMCA 1BHSA 3WAGA 4YJFA 1T3GA 1R5OA 1Z37A 1QC5A 1XVUA 2OB2A 2V55B 5ITZA 4AWXA 3ED1A 1C81A 3H9CA 4WXYB 4LXQA 4M7RA 1NI3A 2PJUA 4DGSA 3L41A 4O4LA 2Q7XA 2C98A 3AOGA 1OBOA 1WF3A 3U6BA 2ORED 1PHPA 5DU2A 2BM0A 1WMSA 3D6UA 3GJXC 3GT0A 4N3CA 1DS6A 4TYMA 2GXUA 1O0CA 3NDJA 4BQRA 4QXOA 3OI7A 4H7HA 4HPXB 4YDRA 2HWWA 4AZ3B 1RWBA 1FP4A 2E48A 2EX1A 3AVTA 4J1NA 3MJDA 4QUDA 5GWXA 3SBEA 4CRWB 4F9TA 4PSKA 4YAEA 2WKQA 1I1HA 3K70C 3HUDA 2AJLI 3MSXA 5EXSA 3AXTA 5F1YA 1IVYA 1WWKA 5LC1A 1OASA 3PIDA 3PQ4A 3D3QA 3KHUA 5K09A 2R0QC 2YX1A 4Z4HA 5IKPA 4ZMRA 5HF9A 2PS3A 2PUGA 2F1JA 5E6SB 4J7AA 1YMVA 4PSAA 1XTIA 2QRNA 4BJHB 2XCSB 4X00A 1Z9BA 2ZCUA 1C9MA 4N0DA 4YCAA 3UJ9A 4A0HA 1AHIA 3M5DA 2XMDA 4JC4A 3BMQB 1J8MF 5E0OA 3LUAA 2UXCB 1BJTA 1T4DA 4WNAB 3C5WP 3QK7A 2BDTA 2DFKB 1RQNA 2JGIA 2RHWA 5AI9A 1KPGA 1UOQA 5GAJA 1NW3A 2JC3A 2IEIA 3D9QX 1LF5A 3NHMA 2GBPA 1GA1A 1WDKA 4HWRA 4BFLA 4PY2A 4RMIA 2J1LA 1XF1A 4UHHA 3LGSA 4Y2SA 1LPPA 3F3KA 1VIVA 3JWIA 3L8HA 4BGVA 1YZYA 3S27A 1QRTA 2IODA 1NUHA 2ZRMA 3L06A 1K3TA 4GEGA 2CSUA 2DY1A 1PLKA 2VSFA 1H2XA 4EW2A 1WPQA 5J9FA 4NYMQ 2AFHB 1MJGM 4NCIA 1O8BA 4Q05A 4RETA 1CT9A 2YMLA 3ZQUA 4EB6B 5HGJA 3HI4A 1YJ5A 2HCFA 1YRQA 3A9WA 4KMMA 3GGSA 3OZRA 4WTOA 4DMRA 2WV9A 3INGA 5E4YA 4U3JA 5LP6F 1IWOA 3F0TA 2NU9B 2AGVA 3RYHB 1OX6A 2BFMA 1ONOA 4CG2A 3USZA 2GCGA 2FAXA 4RLQA 4BTLA 1NSTA 5KAMA 3HABA 3K0AB 3MLBA 2VDLB 2WFZA 2QW0X 3UUGA 1GTRA 4QGSA 4YJ3F 4B3SB 4QFCA 4EPVA 4F5WA 3TTYA 3SEQA 4LUCA 4P4LA 3D1LA 4DMUB 1JFFA 1UKEA 3PEFA 2BFBA 2O5VA 2AI2A 2QYHA 2VTVA 4MWZA 2N1BA 4RA9B 4V0ME 1DKNA 4P5PA 3ZW8A 2C29D 5KPJA 1ULBA 2P9JA 4HFJA 1LBQA 2JVJA 1JB1A 2RHTA 1SBHA 2CVQA 2KWIA 2W2PA 3DUFB 3H5OA 3HBMA 3AKYA 4NS1A 3C4QA 1JG2A 4GNKA 4QWWA 1ZGHA 4QWMA 3DFZA 1XZEA 3L05A 5CH5A 4HFRA 4KPUB 3NASA 4MKGA 4JLVA 2RJNA 3QVGA 3WO1A 1ICIA 3W5IA 3AVPA 1X77A 2PUAA 1Q83A 2ATVA 1C3OB 5ITSA 1SFRA 1K88A 4RFVA 1BCSA 3A9SA 4LRQA 3LT2A 2FQQA 2XNDD 1RSZA 1A77A 1M6YA 1U0LA 2RAUA 2X0IA 4QAJA 4Y98A 3O8RA 1G20E 1AM4D 3F9IA 2IC5A 3NR2A 1CJVC 1UKCA 5I3ZA 3DA8A 2GPJA 3HCBA 3R0ZA 2PX4A 4JJEA 1ZUNB 1UBNA 3ZJVA 2YCBA 2RBEA 3KJEA 4B6GA 3ZWXA 4KN9S 3EXHC 5CDHA 1B1CA 2GAAA 3MMSA 2FWBA 3EB9A 2QMQA 1AXGA 3COJA 2J45A 2AR7A 4L5CA 1Z15A 3AONB 4G65A 4KN6A 4EMUA 1VJ0A 3GQVA 1B00A 4MUIA 1IBRA 3E3NA 4NXNB 3BTOA 4Z9YA 4J91A 1YL6A 2VUHB 1UZNA 3EISA 3GEEA 3ND8A 2EBFX 3JASB 2FXVA 5EN4A 3LUKA 5FNVF 4C0HA 1EIWA 2R7KA 3HU5A 4H7JA 1Q7CA 1O95A 2Q3JA 5AVWA 5IDQA 3I58A 2ZWVA 1V8ZA 2UUCB 3A9RA 1A4RA 4F1WA 2XUHA 2VTBA 1KKLA 3ZWQA 4Q5IA 1MJFA 2G4LA 1R0LA 3DKVA 3FVVA 1TZ2A 2IITA 1DIGA 3IVXA 2DM6A 1E3MA 3V48A 1X19A 1SBTA 2BD0A 1PJZA 4QJIA 2C96A 3DDHA 1IBMB 4UBNA 3KR2A 4FC7A 4HGPA 4MP3A 3KQPA 1JVSA 2FY8A 4FHDA 4ONEA 2B8NA 2WYHA 3CLSD 3NH9A 2X6RA 4MW2A 4TRMA 3FPJA 3LX8A 1Y0BA 1FXWF 3DFIA 2Q9UA 3DAYA 2R6AA 1O77A 1YJCA 5FBVB 3H8SA 3R2JA 1U2DC 1DEAA 2KPOA 3PNYA 2V8OA 3AHDA 1J2RA 2FOIA 2GEVA 1G3IA 2D1QA 3EMVA 3GJ4A 2XXBA 5EWMB 2DUUA 3JARA 2NYAA 4B6PA 3UPUA 3BWXA 2IS1A 1R6DA 3NW9A 3PEEA 4H16A 5C8YB 1PUXA 1XAHA 1GNPA 2JA2A 1AUVA 3C24A 1SXGA 2HK8A 2G4CA 2HN9A 5CEFA 2ZI7A 3ROEA 3QPWA 4ZEVA 5EZ6B 1EINA 1F9AA 5AM2A 1LBHA 5C7OO 1IATA 3FPLA 1EUDA 3BWVA 3W04A 4D4IA 3BORA 4U7GA 3B6MA 1MJ5A 4UD6A 1HQYE 1XMXA 4EG8A 3LUDA 5JCJD 1JPJA 1Y81A 2PAAA 2SKCA 3F7MA 3GAZA 1ZIXA 1E7QA 2OY0A 3PITA 4BAGA 2FEMA 1G5HA 2XHEA 1NUPA 2P35A 1RJDA 1TT7A 3HJRA 4NDZA 4JI0B 3MTBA 1CUCA 2WIJA 4Q02A 5I9IA 1CKEA 5D6OA 4CMHA 3TIFA 1PU2A 3K7EA 2ZJAA 3TZLA 3R20A 3V2HA 1PR9A 3AFNA 5E4JA 1LXCA 3CX8A 3ZS8A 2QPLA 4NBTA 4B5KA 3WNCA 1HZJA 4FN5A 2XQIA 3U7QB 4D4JA 4C7OB 2G9NA 2B1QA 2O52A 1NLFA 4QRDA 2RGUA 2QP3A 1NBMD 2O59A 3AJDA 2JIZD 2IP1A 2XVMA 4DNXA 4OMCA 4CHGA 3Q6MA 1EGMB 2X58A 4ME6A 3RDPA 5BMVA 3A9UA 1KR5A 1CB7A 1XKQA 1ZD3A 2WPNA 3NBZC 4FGLA 5FA6A 4LJSA 4EPXA 3IP9A 4I0WB 4UHDA 4Q15A 2WTMA 4YQEA 2GUGA 3PRKE 1WDTA 3PJRA 1DTWA 1OSNA 2FX3A 3T7SA 4ZOLB 4EZEA 4B4VA 1QRUA 1EK2A 1C30A 2Q5JA 3MTAA 4ZAXA 5AESA 1H6CA 5DN9A 5TSDA 2N46A 3M5WA 2Q9BA 3EVFA 1LBTA 3V3KA 5JAHA 4XQGA 5AW8A 2ETVA 4HLCA 1MIHA 2GPNA 5BUQA 4HQKA 3UK2A 5A71A 1IPHA 1U6IA 4DCJA 2JARA 2C4MA 5BPHA 4WWHA 4A7PA 2VUIB 5BXQC 4UUPA 2DR3A 4K86A 3KE8A 3HBLA 2X2EA 2BGMA 4A92A 4EH1A 3OF5A 13PKA 4IHJA 3X0DA 4QUGA 3BXPA 2VYVD 2X5OA 2HHCA 3PK0A 5FUYA 1FQOA 2QG9A 1UWCA 2B82A 3VKHA 5BQXA 4YP0A 1YH3A 1KI2A 2QMUA 3P0EA 1S1MA 3ZHYA 4Z3OA 4OLJA 5CDFA 1FTGA 4JXKA 4G5GA 3FA2A 4D9NA 1A0OA 2CK3D 4JXJA 4U63A 3RG8A 1ZJWA 4YCDA 3MS2A 4KUHA 3NJ8A 2B20A 2R6JA 4UHCA 4WX2B 5JQGA 3P4XA 2SICE 3N39C 6YASA 4CDMA 3PWTA 2V45A 3TW0A 4B0PA 4JJFA 5GQSA 3TAXA 4BNNA 1PKXA 1BE6A 5F1PA 6PFKA 2IEDA 5F5NA 3ODGA 1MB0A 3CEHA 2E4AA 4DOMA 5IXJA 2CHEA 3W3AD 2L69A 3MINA 1BDJA 4IKOA 2O2JA 4XWWA 1OD6A 1U0TA 1LBEA 3AVVA 4MWBA 3RSSA 4OHBA 1QOPB 1JX6A 2G0NA 3KQUA 4MUYA 4F4DA 3C0KA 1LF0A 1SXJE 3O1JC 5K0JA 2WF6A 1O3YA 1P3DA 3SS9X 5LZ8A 4JC5A 1OVGA 5FBRB 1N1DA 2BBSA 1F4VA 2P6PA 3GZNA 4I2VA 4M83A 5ICGA 3YASA 1FCJA 2B5OA 3CH6A 4JLKA 4LKRA 3UAGA 5K3AA 1UKZA 4GEKA 2H00A 4DDUA 9GPBA 3TLZA 1ZOIA 4DDHA 1MRZA 4ATNA 3P97A 3QITA 4EYKA 5LMNB 5KOIA 2I91A 3BILA 4WUVA 4D92A 2O5CA 4U6SA 4YJ2F 2FH5B 2PG3A 2PKWA 1ADCA 2PUDA 4HDQB 2OLJA 3TEMA 2HMVA 3UM9A 4KR2A 3WQBA 1ISRA 1GR1A 3QVTA 4I46A 4ZGGA 1AS0A 1VPDA 4Q4HB 1VG9B 1MBZA 1BWQA 1O94D 2E21A 2VF8A 2ZG6A 4FLEA 3H1FA 3AZOA 1JA1A 1M34E 5JQWA 1V5EA 4NFLA 3AFMA 4G8BA 4ZRMA 1BW9B 3X43A 4DSOA 4FQ7A 3MQ4A 1FUYB 2H2HA 3CH4B 5ED0A 3GLSA 4PWYA 5KOHA 3ROMA 3EFOB 3MERA 2P7HA 4XD7D 2GYYA 1XD2A 2PZBA 4I50F 3FHOA 3V4VB 2XCRB 4LZWA 2C94A 1EXNA 1TQHA 1OLXA 5ES4B 1PQ4A 2H8GA 3P0IA 3U4IA 1PWHA 4QOEA 4AYTA 3BMNB 5CA1A 1P9LA 2YJNA 4QDXA 5J43A 1BDHA 4LZPA 2C42A 2O2ZA 3O4JA 4FGZA 1GU0A 2FEWB 4EGJA 4BMYA 1N0HA 1M2NA 2JFQA 4F9GA 1F2TA 4G09A 3OQIB 4B3JA 3L0ZA 3EPLA 4RV4A 1NKSA 1QIMA 3RLFA 2GBLC 4AUNA 3VC7A 1VFPA 3ETEA 1C2YA 4D9JA 1TM3E 3B51X 4W63A 5AT1A 3WLQA 3MT8A 2FZVA 1T35A 4MYRA 1BQ4A 1EKXA 1QHYA 1R6UA 2HQOA 2PZAA 3H5NA 4WGGA 5DXFA 5HUHA 1SXQA 3BIXA 1C7QA 3WXBA 1L5LA 3EIEA 4D44A 1IDN1 3JR7A 4N8DA 3TQHA 4EPRA 2G1PA 5BR7A 2IBSA 1NI4B 1G18A 2CVHA 5CT8A 4F4FA 2MYNA 5JLAA 1ARZA 1JLSA 5L40A 4POAA 3E9ZA 4N9QA 2ZBUA 1P1HA 1E1QD 1WSWA 2QUZA 1BXRA 1TA0A 2DFDA 3NYIA 4PC6A 1WCIA 3K1JA 1X1EA 2VSQA 1P17A 2NSDA 3K96A 3L46A 5CTAA 1IAVA 1X7XA 4FU0A 4IILA 4ENSA 5K20A 1AMOA 3BMCA 1H2HA 2IPNA 2ZTSA 3QYJA 4JP5A 2W4IA 4NU8X 4OLFA 5H0IA 4NIMA 4LHZA 4RF5A 3IMGA 3ZK9A 3BX1A 5K0BA 5H83A 3S0JA 1C9KA 2I55A 2BL4A 3C74A 4IYJA 1WA5A 2HZ7A 2P8SA 1DIBA 2EG9A 2ZBPA 1DKOA 1S8OA 2I2AA 2XWBF 3DOJA 2IIBA 3HVIA 2J3IA 3ZWCA 1W35A 2XDWA 4X94A 3ZTYA 1KKUA 2ZTLA 3X1DA 3TSCA 2EZ8A 3CZQA 4CE6A 3V46A 4MWSA 3D3JA 3O4VA 2HU8A 4JNKA 1L4GA 2WJVA 2EKDA 3FFTA 3VSCA 3OZVA 1M5UA 2E4VA 1B6GA 3TLEA 5EKUA 1GG2A 2BF4A 3DYIA 5CB4A 3SZMA 1H6AA 1H0SA 5K7SA 3PJGA 2PLRA 2NGRA 2IIVA 1T8RA 3HH8A 1P8AA 3SHOA 3STVA 1JLMA 1BKSB 1Y3FE 3C98A 2JASA 3OA0A 1NDQA 1YU6A 3C8HA 5LXTB 3MRSA 3FSGD 3QVKA 5SZKB 2Q3CA 2Q4DA 1SKBA 1UM9A 2DEUA 4HAOA 2J85A 2J9XB 2ZB3A 3JPWA 4MUHA 1CF9A 1K8RA 4QA9A 3SZLA 2VRCD 2G28A 2QLBA 3RSLA 3PC6A 1PE0A 3BRSA 1QU3A 1TOAA 3OHPA 5I47A 4QAQA 1X3LA 2X9QA 3RVNA 5JRJA 3FMGA 5DW0A 2QN1A 3RVBA 2QUKA 3O91A 2Y9PB 3A2MA 1K0FA 4G5YA 4HCJA 4LYFA 3K0CA 3IBGA 2C5AA 2Q5QA 1TUBB 3NC0C 2H4YA 2R25B 3GFQA 3OLVA 3MCUA 2PFSA 4KDEA 4KSCA 5HS6A 1C0PA 1A27A 3EGIA 3RHSA 4D0SA 1YQUA 3GBSA 1A76A 3VYRB 3C87A 3KVOA 3P26A 1OXXK 3I9V1 2RE8A 1RRCA 3NAQA 1RQ2A 4WBXC 3ADDA 5ENZA 1MJNA 4JJAA 4JUFA 1CDEA 5LQAA 2CUKA 2WNSA 3CEPB 4DEYA 5FR2A 1QQ7A 3FFAA 2O7NA 4JQSA 1TM1E 2JJ1D 3OU6A 4MK4A 3ZV5A 4BIMA 4CMIA 1BKYA 3DVAB 1TVKB 1ZG3A 1NVTA 3QBJA 3GD7A 6REQA 1X9HA 1LS1A 3GZ4A 3QYFA 4JI5B 1V6CA 3Q5DA 4KBYA 4JP2A 4D3YA 1M67A 5ALWA 1L5SA 5AOVA 3EF1A 3RJ9A 3ZHVA 3WL8A 1ZM7A 3K4QA 4QJ5A 1GYPA 3L8CA 1J5XA 1NX9A 1RI4A 1ST3A 3PEUA 4YJKA 1T2EA 2B2CA 4QGGA 2FLVA 5EE9A 2J3LA 2JCSA 4NHEA 1SVIA 4ALMA 5F64A 4B6OA 3RK4A 1OTHA 3K0BA 2UZ1B 3C3PA 4C22A 2BI8A 2C2XA 5BUZA 1F8FA 1JMKC 1S3SA 1TCAA 1KJJA 1R9NA 1AKYA 1VKNA 2XEDA 3L40A 3M7IA 4GQBA 3D1JA 1G8AA 1L7XA 3VYUB 3R3VA 5AP9A 1L5MA 1OT3A 1T1SA 4M1OA 4DBLE 5I8PA 2XR1A 5A62A 3BCUA 3E48A 3ACCA 4BIIA 1DCMA 1U5BA 4DYDA 1ZU5A 2QTLA 3GRUA 3WB2A 3RYFA 5BW8A 1A82A 1E58A 2G08A 5AVJA 1G4AE 4NCKA 5KS2A 1VL0A 2ZSFA 4LRWA 1LTQA 5FP0A 5B58C 1G5QA 2W71A 3BRWD 2REBA 3N76A 1C9YA 1V1RB 2Y4OA 4O4JA 4EB0A 4MH0R 1V45E 2BEUB 4I9FA 2F9FA 3F2VA 1YS6A 3Q3JB 5K1ZA 5B4UA 1J90A 1Y7IA 1L5VA 2PFGA 1GAEO 3PIIA 4O2AA 5K9ZA 3GPLA 3L7KA 1YRWA 4JLWA 3HGMA 3DXFA 2LV8A 4DW8A 5KTNA 2J6HA 2O3QA 2WHQA 2JA1A 2HA0A 3Q8KA 4P86A 2WMDA 2F1HA 4MJ7A 1DBSA 2WNHA 2ZJ8A 3ESDA 3ORHA 5ESWA 1C4XA 1G20A 4E09A 1KHTA 2G76A 3NIDB 2E4ZA 3FBWA 1QVRA 4HY3A 3O2SB 4PHGA 4G67A 3R0JA 2OQRA 3LH5A 3NVKI 2C4VA 1Y4SA 1RVV1 1YDWA 1EUZA 4TTSA 1K9VF 3SZRA 3PNVA 4YUZA 5AFSA 3U7HB 1CJMA 2OV6A 1UQUA 2EJCA 3CINA 4BV3A 2FW7A 3V1LA 4D3XA 3HYCA 1IN1A 1MABA 3QMWA 4DV5B 3DO5A 1EFPA 3JYPA 5DX1A 3GRYA 4JQZA 1A98A 1Q0PA 3N0XA 4C0QC 4ZEWA 2FMHA 5DGCA 4J3JA 1JQ5A 1CUUA 3MK31 5JCZA 1A2KC 4FFBA 5FBZA 1BS1A 3QPCA 2O2GA 1TZBA 4WGFA 4PNEA 3I5UA 3BEOA 3GJSA 4JSTA 1MQSA 2RCYA 4PIMA 1VJGA 1CHDA 3STHA 4C2BA 5B1SA 5DKFA 4OJQA 4NCXA 3MJVA 4PV7A 2F8LA 3QQ5A 3TL2A 3KZKA 5CFLA 1JFTA 4KN5A 3OF2A 1DOHA 1E1CB 3VR1A 2NU7A 2XT0A 1Q11A 3BCSA 4HN2A 4V0QA 3VRHA 1CQIA 4MR7B 4PPYA 4P31A 4ECEA 3RV3A 2C4HA 1SUEA 3M6IA 4JBGA 4L6AA 3RS5A 4JLBA 2GZAA 4UEQA 3VM6A 2WYWA 1EG7A 1WCWA 2FPPB 4NCNA 3E84A 1P9RA 2XSZD 3TBFA 5EA2A 4EYQA 1XC7A 1CUGA 1S2OA 4OFWA 5CURA 4FYVA 1AUPA 5KWJA 3R4VA 3EAGA 2ORYA 4N1AA 4OXQA 4TTJA 3EEIA 3ENZA 5IM5A 2FXIA 3ZU4A 1JTEA 3TGLA 1V4BA 3RADC 1KYTA 3F1KA 4PZZA 4WPGA 2ZWOA 4TVBA 4PC2A 5E2IA 4CM6A 2C1EA 1TU3A 1VLJA 1Z4MA 1YA6A 1U1CA 4PTYA 3HU3A 521PA 4QYSA 1I4LD 2NQTA 1UMKA 1U2RA 1G9SA 2DWOA 2PCLA 3GNQA 2XZTA 1NXXA 3IA2A 3DYVA 3IAXA 5EJ6A 5IN4A 4KXNA 5KX5B 4W6QA 4JLAA 2QJRA 2GZ1A 3IVCA 4ARUA 4M3NA 1SQSA 3ZKAA 4C01A 5LM3A 4I1PA 3KB2A 3ZWMA 3DT9A 4JU9A 1M10A 4J76A 1GQYA 2PUVA 1HRKA 1CR4A 4DA0A 3F3SA 3QVJA 3WWZA 2H2GA 2AVDA 2WKSA 2YHSA 2Y1KA 3QUAA 4MDEA 3LBYA 4FDAA 2FN3A 3KTDA 2ZIEA 3WWDA 3X1JA 3A2KA 4K7JA 5COBA 4XWAA 2C9CA 2I6QA 2QVZX 3KJIA 1NLZA 5CP8A 3VYWA 2PY6A 5J2UF 1PD0A 1WB6A 3G2PA 1N7HA 3BXGA 1IQ0A 1J20A 3KTAB 4XGKA 1VYVA 3NRBA 2NT4A 2IUEA 2R62A