3OIWA

H-rasg12v with allosteric switch in the "on" state
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oiwA00
1ESNA 3QKTA 3RSOA 2YC2C 4EDHA 2XB2A 2IL1A 1E79A 1E98A 4B3BA 1AS2A 1US8A 3L0IB 3VR1A 3VNVA 1UKYA 2IS2A 3IDQA 2VH5R 2WAYA 2FGJA 2VHCA 2CCGA 1GL9B 1RJ9A 3SQXA 2O0JA 3U3KA 4PAMA 1P7CA 1X8LA 2YOFA 3QI2A 1DE0A 1LB1B 3U5ZB 1E1RD 3REGA 1ZW6A 3THWB 1ZM9A 1E9AA 3SJAA 3GLHA 4A0FA 1GSIA 3WNBA 5JI3E 2JLQA 1E2LA 2F3RA 3R9XA 2BBTA 2EVWX 3QG5A 2ZU6A 2WWIA 4Y0AA 3WY9A 1WDTA 4Z1MD 1V5WA 3S1AA 5DE3A 4IDNA 1SXJE 2DBYA 4V0KA 1WMSA 2W6JA 4PX9A 4PZZA 3RHFA 2O8DA 5BYKA 3MJRA 4I81A 4NDZA 4F91B 3I5YA 2Q9AA 2LWIA 2PLFA 4D0NA 3KQKA 2RB4A 4D4JA 2I1VB 2IHYA 4OQNA 5JJLA 2QORA 3IKJA 1W7AA 2DFKB 3A4LA 2CCJA 1WB9A 1LVGA 1RKBA 2A9KA 2PCLA 2PJZA 3W5IA 3AF4A 3QENA 3A1SA 3GEIA 1OIWA 1ZAKA 5J5CA 5HZKA 1JEDA 2WIBA 2LCFA 5KSYA 1P4SA 5KNBA 1LY1A 4TMWA 1GVNB 3RS4A 4F4JA 3PUYA 4Q48A 2GCPA 2WJJA 1DS6A 4TTRA 1RIFA 1CS4C 3ASZA 5CIWA 4LYFA 2YJTD 1NSTA 1PZNA 4HZIA 4JLPA 4URXR 4CZ2A 4BPBA 2FMXA 3UPUA 1OHHD 1R10A 4Q00A 5BN4A 5CYOA 4W5JA 2QRNA 2AKYA 3OE7D 4LJ7A 1WQ1R 2FV8A 4B73A 3KFXA 3RS0A 1X6VA 2BBSA 3U4QA 2G3YA 2OZEA 4BFTA 3U3RA 2P6UA 5A4JA 2IK8A 3QKSA 4DEYA 1UF9A 3RRZA 1CTQA 2WPDA 3K0AA 4GZMA 1VCIA 3R20A 1VYTA 4AYTA 1Q0UA 2ZRHA 1I4DD 4FW9A 5TY0A 1XEWY 1U9IA 4KLNA 1IN8A 4DLZA 3OF5A 4ZI3A 3CIOA 3I8XA 2DR3A 5HKKD 1XEXB 1N5JA 4TN1A 4FCVA 1WA5A 2HEIA 3CNNA 1VHTA 1Q1EA 3A1WA 1EFUA 1ZM2A 3QKRB 3NDBB 1JR3E 1K5DA 2WM9B 3VR6A 3KKOA 4C0SA 3L0OA 1A1VA 1EX6A 4HAUA 4OI1A 2IS1A 2E9SA 2PEZA 1VYVA 2HV8A 5TARA 1H8HD 3K70D 2G1KA 5EP2A 4P0TA 4LY6A 3ZZUA 1NN5A 1H8EA 2CVFA 1IN6A 3RRMA 3LNCA 4CGZA 3FYHA 2WICA 3BH0A 4AYXA 1KZ7B 1XD9A 1XNJA 1Q44A 1ZM4A 2JCSA 3CZPA 1R8SA 4KV9A 1YZGA 2R6AA 4JKIA 3ZVRA 4C0JA 4D4LA 5B30A 4HB2A 3ECCA 2ZRMA 4OK6A 3D3QA 2BOVA 4JLAA 3B9QA 1XEFA 4GOJA 5JMTA 5L3QB 4JMPA 4B3GA 1YE8A 2CJWA 2QT0A 5EE9A 1D9ZA 3QQ5A 4QGFA 1T3SA 4L15A 1M1YE 4IDHA 2NO1A 4PC3A 4KAXA 2MSCB 3UATA 3NVAA 5J47A 2QPAA 3U3OA 5IK2D 4PAOA 3VR3A 3KJHA 1XRJA 2A7QA 2MSEB 3CNLA 3RS7A 4XVUA 2RGNA 3W6NA 2P65A 4PR0A 4IEEA 3UG6A 4DDWA 3HP1A 2XSZA 1MO6A 2B21A 4NONA 4Q1FA 4B2PA 4FMBB 1VIAA 2DFTA 3EZ7A 5DIFA 4C0AC 2FA9A 1PUJA 4BRWA 5A5GA 1NN0A 2JJ2A 2KI5A 2WIAA 3FFBA 2V6IA 4JL5A 2WWWA 2JA1A 4AD8A 3N70A 2QPOA 4EPTA 3I1FA 3T1VA 3AVVA 4TZ6A 4ACBA 1Z2AA 1KOFA 2V1UA 4DIEA 2IYLD 2KBFA 3AF3A 2HDNB 3MUFA 4B47A 4EFNA 3FOZA 1Q57A 1QHXA 2G77B 3K9GA 4OHWA 1RPZA 4BZXA 3O8BA 4M53A 4URVR 2XOKD 4AI6A 5BQ5A 3X1ZA 3QG1A 5P21A 4HZUA 1Z8FA 2RGEA 4MGYR 2F7SA 2GDJA 1N6PA 2CLCX 2OLKA 2ZJ5A 5HCNA 1ZM3A 1CXZA 1E4VA 1ZD8A 5DH9A 3EC1A 4A8JA 4YMVA 2BC9A 1G5TA 1UKEA 2GAAA 4FWIB 3LBNA 1JAIA 1XCGB 4MRRA 4DKXA 1NVUQ 1U8AA 2BMFA 3FKSD 1QBKC 2W6IA 4LHWA 5BN3A 4TLAA 1G7RA 2AD1A 4B3FX 3ADDA 1UKZA 1IJFA 1W0JA 2C9CA 5SZIA 1TU4A 3AVPA 2R8RA 3IGFA 2ZE5A 3RC8A 3FFAA 3C41J 2CNWD 4YLGA 4Q4AA 2V4ZA 4GI7A 4X8OA 4BLPA 4EKDA 1K6MA 3THXB 2PJRA 3AVUA 4NBSA 2IYTA 4OI2A 1L2TA 3DHWC 1KMHA 2FWRA 4DUGD 3RANA 5TVKA 3M4YA 4O0MA 4TT3D 5DNYB 2AK3A 3FWYA 2F6RA 2F3TA 4L5BA 1KY3A 1D9XA 2PEYA 4BLTA 1FTSA 5HTKA 1TF7A 4UXJA 2WWFA 2ATXA 5FBRB 2ZAMA 3UMFA 4OBEA 4POAA 3OFND 4BZQA 2QMOA 4D6PA 2ZJBA 1GM5A 4GL2A 3LD9A 3AP2A 1E69A 3ONWA 5E7JA 4B6EA 3KKNA 4LC0A 3D6TB 5DLQC 3TR0A 4LV6A 4TL7A 1BO6A 4A6PA 4E5UA 2V3CC 2P6RA 3D31A 1GTVA 5B57C 1Q20A 2ZRIA 2ZI5A 4A4DA 3TNFA 2W58A 2P67A 4PTLA 4ABYA 5FTMA 1VCNA 3K0SA 1OH7A 1GDDA 2C04A 3BB1A 2QY9A 3TSOA 2BM1A 3W34A 3PVSA 3ZVNA 4B2LA 2F9LA 1TEVA 1VKJA 4W7SA 4EQ6B 3THYB 1ZC4A 1JPNA 2OE2A 2Q0HA 1TQ6A 1GFIA 4LJ8A 4KO8A 4TQ9A 3HU1A 1J99A 3U2QA 3PFIA 2QP3A 4DIDA 3R9IA 4UJ5A 1MT0A 3KFVA 4A9AA 1T3LA 4IOLA 4C0KA 4DCUA 4L9WA 4PQFA 2ZM5A 1Z08A 4GT1A 3B1XA 1SKYB 1QZXA 3RNLA 4PO8A 1XD2B 4NYMR 2BHRA 3EZ9A 5FL7A 1CR1A 3A4NA 4NZYA 3FDIA 4FIDA 2RCNA 1WCV1 3RS3A 2YWHA 1NF3A 2OLJA 3K0FA 3PUWA 3AKYA 2FNAA 1DEKA 4NTZA 1KDPA 3RAPR 1UPTA 2ZUDA 1G291 1KK2A 5C4GB 4K81B 2G9NA 1YZQA 3WNDA 3E2IA 2WJHA 1LF5A 3FPAA 4E07A 2AK2A 3WYAA 1JEEA 3CRMA 3EZFA 2X2FA 3IILA 1MO5A 4TL6A 4IKEA 3X1WA 4JIMA 2EYUA 4LYAA 1JQJC 4CW7A 4PSKA 4QNMA 3NBYC 2G1JA 2OCAA 3LDAA 4ZKDA 3VU9A 221PA 2ZS8A 3WMGA 3MGCA 3W3AA 3U7HB 3VHLB 4BFYA 3CRW1 1SKYE 2BMDA 1GKIA 3B9PA 1S1MA 1NI3A 1HH4A 3QUSA 1B0UA 1R0WA 3OE7A 4RY2A 5CK4A 3TSZA 1ZM7A 1U98A 1W36B 3CR8A 1Z6XA 2YNMA 3BFKA 4M1YA 4BQSA 2P0EA 3IQWA 4NYMQ 421PA 1GRQA 1KKLA 1G18A 2CDNA 4D82A 4PO9A 4UNQA 4U5XA 1IJEA 4QJ5A 5J4HA 1Z0DA 1ZJ6A 1CR0A 4B34A 4JKYA 4LJ9A 4DB2A 1Z5ZA 4F38A 2OM2A 4BGDA 4AIIA 5FOSA 3SJCA 4DVGA 2F1RA 3WYGA 5HKKA 4Q4JB 1KO4A 2QN6A 5JLJA 1E2IA 2QAGA 2ZJAA 3CF0A 1KHTA 2XGJA 3W9YA 2CL0X 2EFCB 1OW3B 3FB4A 4E09A 5SZKB 1II8A 3L0PA 3LQQA 3RRNA 4OQLA 2VL7A 4AG5A 5FPTA 4LHZA 5DI9A 2FPMA 3L0SA 1LW7A 3CWZA 5AUOB 1QHHB 2WJVA 1KDRA 1R0ZA 2FFQA 2Q3MA 4QJ4A 3SNHA 2W6JD 4WXPA 1OLOA 3ZH9B 5AWFC 2XZPA 4Q1CA 1SQ5A 2HJVA 4GMDA 3V00A 4CEIA 3AEZA 2PCJA 1R0XA 1KI7A 2OCYC 2FFBA 4OHXA 4QL3A 3QY0A 4V0OA 2IF2A 3Q9LA 3VKWA 1P60A 2VHQA 4M4SA 5GJBA 4JSYA 1G8HA 3QIAA 2P5SA 1DOAA 4BLSA 1RZ3A 4ZDIA 4PQRA 2GEDA 4PPGA 4WZAE 3C15C 1XMVA 2OAQ1 1VHLA 3BERA 3CUEF 1YR7A 2OO7A 3HYRA 3PEYA 5FTNA 1FUUA 3ZIAA 3G5UA 3RWOA 2A5GA 2DHRA 2VHUA 2UZIR 1KZGB 1WRBA 2A5YB 1G8GA 2MMCA 5DYGA 2GVZC 2C99A 4PSAA 1QHSA 4RFSB 3DKPA 4XTCS 1IY1A 4Q9JA 2V54A 3QXSA 2J1LA 2JGNA 4JL8A 5CITA 1FZQA 2VSOA 3K9NA 1BS1A 3SYNA 5G53C 5DHFA 3N2IA 1HYQA 5JI2E 4PFSA 4Z8XA 5JFGA 3B82A 3K1JA 2ZREA 2XJ9A 5JHHB 1IY2A 4ERNA 4HUQA 1F2UB 4S35A 2RGXA 4A82A 1FPMA 5EP1A 4QBIA 4MYUA 2XOKA 1MRNA 2KSQA 4DBLC 4IXMA 4GNKA 3R7WB 3H84A 5B64A 3BORA 3IBGA 1N6OA 2FEMA 4KBFA 2YV5A 4PHTA 4W9MC 2GILA 4ZDJA 3HR7A 4C30A 2CL6X 2J9RA 1CJTC 3LA6A 3KQUA 1RC8A 2JLWA 1NLFA 1PUIA 1DAHA 1RYFA 2NO6A 5DN6D 3H2YA 1D2NA 3K8YA 2FZLA 4Z54A 2WZQA 4M9XA 4QFMA 2QP4A 1WP9A 2DWPA 3HPRA 4LPSA 5TMPA 1X8KA 1UM8A 3K9LA 1H8ED 2GZDA 2W0SA 3FKSA 1Z6TA 4OI4A 4R98A 4II7A 3O8DA 5AR1A 2NQ2C 3AVXA 4DZZA 2AL7A 2BCGY 1CLUA 1GRRA 3HYTA 1M6NA 3NC1C 2PBRA 3GEEA 2BIFA 2G0TA 5F2EA 5JWHA 1S0UA 3NXSA 3M1IA 1GITA 1D5CA 3BFXA 4DCSA 4WBSA 2QE7D 4XVRA 1ZU4A 1W36C 3T12A 1FX0A 2OUKA 2ZSAA 1KI4A 1KO5A 4CT5A 4OHVA 1E3MA 4BECA 3CX6A 1W2HA 3GLGB 1OJLA 4W5HA 2J0VA 3B2EA 4ARZA 3VFDA 3VNUA 3GJ5A 2E1RA 4HDOB 2OCBA 2FN4A 2ZSDA 3OFNA 4F93B 3WNCA 4DLXA 4X8LA 1KI6A 1TU3A 3OAAA 3NC0C 1HURA 4V03A 5D3MB 3A4MA 1KI2A 2ZVQX 3MSXA 2AXPA 4LBWA 2Z5FA 1KSJA 4JZKA 5CLQA 2O8BB 3LBHA 1LS1A 2GF9A 4EFMA 2FSGA 4HEJA 3UMSA 5F98A 1EWQA 1LFDB 2UVQA 2AFIE 3NDPA 5H70A 4KLZA 4LYHA 4OJQA 4AY2A 3W6OA 4MKFA 2BVNA 1AKYA 3RWMB 1FQKA 2F1IA 1F3OA 2QGNA 2VP5A 3UXMA 3DVLA 3P26A 4Q9KA 3SN6A 5GADl 3GLIE 2EQBA 4Q18A 1GWNA 3KTAB 1UEIA 4N3NA 3CB4A 1DAFA 1IXSB 4EPYA 4ZDWA 2IUTA 4OJKA 2QMUA 3KDSE 4PANA 2CE7A 3VR2A 2YOGA 1WF3A 1QF9A 1D6JA 2BWJA 2KE5A 2ZITA 3QPUA 2CK3A 3HU3A 3ZS8A 1NMZA 3EIQA 1FP7A 2OXRA 2GJ9A 1XTSA 4JL6A 3C5HA 3IIKA 1ZP6A 3ZLJA 3TVTA 2F43B 2W6ID 3BXZA 4BEBA 3T35A 1NVXQ 4KVGA 3LV8A 4B74A 1W4CA 4MKIA 1MR3F 4WZBE 1NBME 3QF4B 5FOWA 2BV3A 2ZI6A 2GJAA 2MMGA 1KGDA 1KK1A 4JT4A 4BLOA 2ODBA 4DT1B 3DPUA 1I2DA 1XBTA 2XAUA 3U7FB 3AP1A 5JSZA 2ZANA 2GNOA 5E95A 3EZ2A 5FI1B 5DSZA 3IIMA 2YWFA 4Q9IA 3JZAA 4FMCB 3WRYC 4B44A 4RJLA 4HATA 4OQXA 4D0LB 2JLSA 3KKQA 4OKSA 4LSGA 1ZINA 3A1VA 1GNPA 2IC5A 2XZOA 1I4TD 3SBDA 4YDSA 5EE1A 1SXJB 2J46A 4HLQB 3QF7A 2R6DA 4TTQA 4LOAA 2HF8A 4C7OB 2B8TA 5BWMA 1HE1C 3MWKA 4QHSA 4XH9B 1KDTA 3MAAC 4ZCIA 3AF2A 2CHVA 3THWA 3QKUA 3MWYW 4BUJA 1N6RA 2QP9X 2AWNA 1DAKA 4PZLA 5KNCA 2AN9A 4KFRA 1AS0A 2QBYB 1Z06A 2ZXUA 3IPXA 1P9RA 2WKQA 1KTVA 1DARA 3DL0A 1OB5A 1TX4B 2FEOA 2WHXA 1NIPA 4Y0VA 5G3ZA 1BMFA 2P3SA 4FN5A 4UNPA 4ASUD 4WA7A 2JLRA 2JIZA 4D80A 2BKEA 4E03A 1G3UA 2Z0MA 5AJVB 4ACAA 4UKDA 2H16A 4QC2A 1ZD1A 3C8UA 5CB6A 1M7BA 4D4KA 1W5SA 5KPJA 2IYUA 4D81A 3I32A 3E5HA 4HAZA 3GLFB 1F5NA 3K9HA 1EFRD 2C78A 1T9HA 1OF1A 3PXGA 1XU4A 1P9WA 1FOEB 4G5RA 5FL7D 3L2OB 4MKHA 1W48A 2IX3A 2QRZA 4TSFD 4DLYA 4NPHA 2J59A 3GJ6A 1E2HA 3N2EA 1UDXA 1UBFA 1AQUA 3LXXA 1P2TA 4YXWA 4HAXA 1P2SA 3IIJA 2IUUA 2H17A 3Q85A 1UBCA 5CDFE 4NCIA 1FTNA 3L43A 4QOSA 5FI0B 3CRVA 1U0JA 3ZGXA 5C2JB 3U61B 3AP3A 4BLQA 3GLHB 2OHFA 4MUBA 4ZIRA 4LV8B 5E4FA 1Z0KA 5FOVA 2E87A 2EFEB 4ZCLA 5KPDA 1Z63A 1E9EA 4EPVA 3S1AB 5EXSA 4DHEA 4AKGA 3GLFE 2ZR9A 2OXCA 2PT7A 4B2IA 1ANKA 5KNDA 2N42A 3RVBA 4B48A 1A4RA 4TYWA 3DKVA 4UQOA 3GCGA 2FJUA 3TUJC 2VEDA 3UWOA 4BFSA 3FMPB 2IXGA 3BIFA 4KSCA 4XJXA 1VDZA 4M1KA 1DADA 2IEZA 1Z83A 3VR5A 5SZJA 2WMNB 1DO0A 4M9ZA 1XEXA 4JLDA 3AF0A 3CM0A 4IEIA 2OBMA 4HAWA 2HYIC 5DGXA 4CF7A 3VKGA 3QKRA 5JS7A 3PV0A 3EW9A 3QPVA 4BFWA 1N6IA 4HAVA 3CKLA 2V6JA 1QHGA 3FHTA 2ZYTX 3HDTA 4I1OA 4KJZA 5JWOA 3GLHE 3TGPA 3I61A 2AXNA 4LBVA 2PX3A 1LF0A 1ZUNB 3QNUA 3BS4A 1SVIA 1VYUA 4IVPA 1AIPA 3AKEA 1I2MA 1M7GA 1CRPA 1FMJA 1MABB 5EUMA 3HU2A 2G83A 1DO2A 2A78A 3Q72A 4YDHB 2AWOA 1WE2A 1OXSC 2I3BA 4LRWA 5DI3B 2GBLC 5DN6A 4QHTA 3UK6A 4FMDB 4G0NA 1ZBDA 2JJ1D 1J70A 1G8YA 3TW4A 1M7HA 1JI0A 2QA5A 4A92A 1WBDA 1EFCA 4KI0A 5L3QA 1OH5A 1IXZA 1YHNA 3QE0A 2FOLA 4JVSB 3KQLA 3ZVMA 1TTTA 3NBFA 1EX7A 3MLEA 4LJ6A 1YZNA 1L7VC 1SXJC 4YMTA 4F4CA 2QE7A 1J8YF 2XTMA 5KDOA 3LY5A 4TMTA 3JVUA 5KOYA 4DDTA 2VIIA 1QVAA 4XOIA 3I5XA 1G8PA 2GJKA 3NH9A 1KAOA 1CKEA 3BB3A 3SZRA 3I8SA 4Q7JB 1GOTA 4MRNA 4P32A 1NVWQ 4BFZA 1JJVA 3REFA 1E9SA 1OKKA 3WP0A 3ZIAD 2JLYA 3ND9A 3RS5A 5GVSA 2SHKA 5FUVA 3P4XA 5LBIA 1U99A 1YU9A 1T8UA 1Z0AA 2NOAA 3HJNA 4RCZA 5JRJA 4DCNA 2WSMA 2ZI4A 2J41A 4MDEA 4DSTA 1S9HA 1RRGA 1XPUA 2GXUA 1ZNWA 1JR6A 1ZD9A 3CF2A 1OXVA 2IHBA 1U90A 2R65A 3IBYA 3C14C 2C9YA 5FFMA 4AG6A 1OFTA 2O8CB 2PLRA 3WBJA 4QBGB 4JYCA 5LPNA 3OEHD 4RZUA 3GJ7A 4Q7MB 4ILEA 3NIBA 2JJ8A 3UIEA 3NTUA 5JJIA 4TQUS 1ZVQA 2R2AA 4MITA 1UBEA 4FCTA 2JAQA 4C0LA 4Q1DA 1B23P 4JLKA 2NZJA 2TMKA 3B13B 4PQYA 1KIMA 1Z0FA 3NKVA 3PUVA 4OL0A 1FNMA 3J81k 1KYIA 5EXPA 4JS0A 1KI8A 1GUAA 3WRXC 1NMXA 2NPFA 5D3QA 5FOUA 1JBKA 5HCIA 4LJAA 2YZ2A 1OT3A 1G16A 4GSYA 1NMYA 5B2ZA 4DRZA 3EZ6A 2GK6A 1L4UA 3T1TA 4HLDA 4HLUC 4PPFA 3GFTA 2VP2A 5FUXA 1DELA 1KY2A 2GETA 3QPWA 4R7ZA 1UADA 4O2RA 1KO1A 2FH5B 3SDZA 1CR2A 1I4LD 4PC1A 1Q3HA 2IBMA 4JJZA 1DAEA 2FSHA 3DMDA 3Q7PA 2G88A 4PHHA 3ZVLA 3THXA 1NKTA 1OV4A 2Q9CA 1IONA 1ZIOA 2YWGA 4TLEA 3ND8A 2VLIA 3CPEA 5BXQC 3EASA 3T34A 4WW0A 4RKFA 3TUZC 3LLMA 3EA5A 5IT5A 1W1WA 2W83A 3B60A 1YKSA 3K0EA 2D2FA 2FFHA 2Z4RA 2ZR0A 3AVWA 3FMOB 2REXB 3EG5A 1KI9A 1ESMA 1G5RA 1JXOA 3SHWA 1FP6A 1E2GA 1UDWA 2ZJ8A 5FPYA 3DMNA 4TMKA 1FFHA 4BWYA 4P4TA 1CJUC 1E2QA 1AS3A 2Z4SA 3AVTA 4CEHB 1R0YA 5JWRA 3F3YA 4DEXA 4DDUA 4QHYA 5L8VA 4RD0A 4F4IA 2QTVB 1M74A 3QEJA 5HZHA 4MYTA 3OAAD 2X1VA 2ZVPX 1VTKA 4PZYA 4JT2A 1EXMA 4EQ6A 3THYA 3CZQA 5FTJA 3CO5A 3RSLA 4IOMA 3LO5A 2JLVA 4PO1A 3B6EA 2HT1A 2QI9C 5B58C 2ECKA 5CLLA 3A58B 3B7GA 4KHZA 2ASEA 1T3HA 1K8RA 2ANBA 2XNDD 2AHOA 3O47A 2WKRA 4JLMA 4UNNA 5CJ2A 1HQYE 5FOXA 1E4YA 3LAWA 2NG1A 2GZAA 2IF0A 1XTQA 2ZE6A 3OIYA 1X3SA 1DVRA 1OFHA 3GEHA 5TV2A 1UEJA 1XMSA 3TUIC 1HY3A 1IOZA 4ASUA 2ORWA 4URUR 1XD2A 3F0TA 4EUNA 3TMKA 1IBRA 1E2EA 2ZSEA 3Q5DA 2YINC 5J4YA 4Z8YA 1XZQA 5GJWC 2NPIA 3AKDA 3NH6A 4LPKA 2AFHE 3AVYA 1YRBA 2ORVA 3EXAA 3NEYA 4UNSA 6Q21A 2XTZA 1GKUB 3W5JA 4URWR 2DFLA 1G19A 1P9NA 4CT4B 1EFRA 3T1QA 1NN3A 3RABA 2CK3D 1WBBA 3JZMA 1ZNZA 1T5LA 1W4RA 3KXKA 4TSFA 4HDCA 3ZJYA 5M04A 3O8RA 3LBIA 5FR1A 1E94E 1S3GA 1SGWA 1Z28A 5SZHB 1S9DA 3SEAA 3L82B 1G4AE 3O8CA 1NY6A 2GZHA 1SHKA 1YZLA 2WWXA 4URYR 4N1AA 2OT3B 3RYTC 3H86A 3AGPA 1A2BA 4CYMA 1G4UR 2B7CA 1P2UA 1KJYA 1ZRHA 3FMIA 3LH5A 1DBSA 2V7QD 1U0LA 3VTKA 3W3ZB 4MGZR 1RE0A 3IPYA 3DZ8A 4DXAA 1S2MA 1SXJD 2F1JA 2ZRJA 3M6AA 2VHJA 1JQLB 4LHXA 1DG1G 5C4MA 3U44B 2IS4A 2GESA 1HA3A 3QBTA 2HXYA 1COWA 1E2FA 1NKSA 1KI3A 2ZYUX 1KO7A 4K46A 3TH5A 1J90A 4LJ5A 2FG5A 4HB0A 1TMKA 2V9PA 4V0ME 2X77A 1N5KA 1XMIA 3DM9B 1JPJA 4I1SA 3EC2A 4KBGA 4Q4JA 2CE2X 5K8UA 4M2LA 1G3QA 5EE0A 2GWHA 1XXHB 2ZE8A 3BWDD 1DAIA 4FMCF 2KJQA 5FBVB 4DB4A 1W0KA 2ZJOA 3Q5EA 1G6HA 3BC1A 4I1VA 2BCJQ 4LCBA 2P6NA 4GOKA 1W5TA 1JAHA 5EUQB 3T5GA 4XTRA 3DO6A 2EFGA 4NYJQ 5JS8A 4CVNA 4HB3A 4G5QA 4A6XA 3JVVA 1KJZA 4Q1BA 1BMFD 1QHHA 4KCGA 4ZCMA 1EESA 3BK7A 4TYNA 1OFUX 4C4PA 2JIZD 2IXEA 4EJSB 1FL9A 4ESVA 3G0HA 4JLOA 1HV8A 1CBUA 2W2TA 1HEIA 1GNRA 2O8EB 3DM5A 1TAGA 4C2TA 2BMEA 1ZMXA 2IYSA 2J3EA 1N6NA 1NG1A 1TL7C 1ZNYA 2QQEA 2QPTA 4G1UC 2RKOA 2JJ1A 2ZS9A 3IEUA 4FCWA 1XTJA 2GCOB 1CIPA 4A15A 2HLDA 1J2JA 2O8FB 1S1CA 1A5TA 1ELOA 4PC2A 1XJ0A 4MGIR 5ELXA 3AUYA 1XXHE 4US2R 1EG7A 1FQJA 1P73A 2O5VA 3ASYA 1LV7A 4JSTA 4KFSA 2W0MA 4NL4H 4RD4A 3VR4A 4YXWD 5C18A 4CEJB 2XTNA 3SOPA 1BYIA 2CXXA 2J87A 3EAQA 5C46F 2OFWA 1NLYA 3V4RA 1G8FA 4FD2A 4MH0R 4JLNA 1PV4A 3SQWA 1XJCA 4KITB 5CM8B 5IHPA 1JR3D 3UG7A 2ZPTX 1KK3A 2C03A 3KJEA 1VECA 1Z2CA 2EYQA 4Q5IA 4H1VA 1IN4A 4CRWB 3ZD7A 2ZRGA 4RFSA 1N0VC 4BFUA 3TRFA 3EPLA 3G82C 3KX2A 1UJ2A 2VF8A 3FE2A 4FI3C 4FWTA 2HCBA 2ERYA 4LV5B 3SJZA 4LZZA 4OHZA 3WHLA 2Z6VA 2RGGA 2ZI9A 5AJXA 4ZV4A 3LW8A 4GBMA 2IWRA 1CULC 1KDOA 3DZDA 1AGRA 3A1UA 2CEAA 4BZPA 1W49A 5JHGB 3B1ZA 1OH6A 3T1OA 4BFXA 1NN1A 2YHSA 1F2UA 1Z3IX 3GQBA 4NCJA 3OEHA 3FKQA 3EPKA 2J0UB 1KSGA 4X8HA 4G5GA 1QDEA 1P62B 3R7WA 1A82A 2CHGA 4YQFA 1XTRA 3Q3JB 1JJ7A 5KUTA 4BRUA 3BOSA 3T61A 3CLVA 3KJIA 3PEWA 2QG6A 4E22A 3WMFA 4IFBA 2ZUBA 621PA 4MA4A 3CWQA 3QSYA 3NEJA 4B33A 1EGAA 4DCVA 2BJWA 2GF0A 1W44A 2HF9A 1XP8A 2ZRPA 3PEVA 2NZ8A 1AM4D 1P61B 1NLZA 5CM9C 3GFPA 5BN5A 3LVQE 5F3WB 5F9FA 4H9GA 4DSNA 4WXRA 4M1MA 1P2VA 4M1TA 3I73A 5FR2A 2DWOA 4Q66C 2J7PD 2KB0A 1GG2A 2VRWA 3TE6A 4EAQA 4XSHA 1OXTA 3A37A 2A3RA 2QTFA 1K5GA 2JASA 3EWSA 1T6NA 3GLGA 2H1LA 1R8QA 2CHQA 2PH1A 1Z0IA 2IYVA 4QRHA 3SJBA 2HXSA 3TSWA 5JEEA 2FE4A 5JCZA 3B8HA 521PA 5FOTA 2JLXA 3W90A 1SHZA 4DLUA 4FMDF 4M1OA 5IF9A 4KVAA 1YQTA 2REBA 4TZ0A 3QXJA 4GP7A 5D3MA 1RFLA 1R5NA 1LNZA 1E2PA 1MKYA 3GJ8A 3WYFA 4V02A 1UFQA 1ZYUA 2JEOA 2ZJ2A 4LUCA 1JNYA 4C3ZA 3GLIB 3VHXA 2YKGA 2O8BA 1XMJA 3KUCA 3QOFA 2XXAB 1ZUIA 2ZIAA 4HB4A 1Q1QA 1RW4A 1G1MA 3X2SA 5AUQA 2D7CA 3P20A 5J40A 1XTIA 4TTPA 4RD1A 1OKKD 3IHLA 1E2JA 4LK2A 2L0XA 4IRUB 4PPNA 3D7MA 2Y8EA 4I1UA 1YJ5A 3A1TA 5C1BA 1Q21A 4MRSA 2AD5A 1OIVA 4KYIB 3SE0A 4EPXA 5JECA 4OK3A 4EJSC 3B1VA 1Q1BA 2ZRBA 1TUEA 5L3SB 4MKGA 5FPKA 1VG1A 4XVQA 1A7JA 1N5IA 1U94A 5KYKA 2O52A 2IW3A 1T8TA 2XNDA 4JLBA 4RZ2A 3EIEA 1C9KA 2HJGA 3KTAA 5FTLA 5L3VA 3QBVA 1F2TA 1E0AA 1NNEA 5FBLB 2A5FA 2Z43A 1E6CA 4QM7A 2FGKA 4L8GA 4QGAA 5A0FA 1Y3AA 3CRQA 3X1XA 3A6PC 1AZTA 2ZRDA 3C4JA 2VPPA 5G40A 3I4LA 4Q47A 2ZJYA 1N6HA 4KXFB 2UKDA 1QHIA 4TYQA 2WWHA 1D2MA 3VAAA 2F43A 4LBZA 4BEJA 2LKDA 4V0NA 2N46A 2FPKA 3TKLA 1XD8A 2GRJA 2A2ZA 2ORIA 3ZS9A 5DHAA 3IO3A 1T4GA 4HAYA 5JEDA 1Q3TA 2ZRNA 3THOA 2ZRCA 1AQYA 1VCOA 1E2DA 2GBLA 3PQCA 4DT1A 4LWZA 1IXRC 3ADKA 3KZ1E 4FINA 4G5SA 5JCPA 1QRAA 1TQ4A 3I62A 4IFEA 3LQRA 3LX5A 2D4HA 5KSPA 3FTQA 2IYQA 4R2IA 2GJSA 1R5BA 2V7QA 2IYRA 2W2VA 1W4AA 4FXPA 4JBYA 4LHYA 1TPZA 5HE8A 2C9OA 4EPWA 4C2UA 1SXJA 4A0RA 1J7KA 1G3IA 1UKVY 1YRAA 2ZYVX 3QXXA 3TW8B 4NP6A 2DB3A 4C7OA 3SS8A 4AK9A 4DLTA 4JLJA 2O8CA 3U7EB 4X8MA 3BD9A 1NIJA 3IUYA 1E32A 2X19A 1ODFA 3GMTA 3B1YA 2QBYA 3AUXA 3EPHA 3FHOA 1KAGA 1G9XA 4BASA 3ZDQA 4MRPA 2GA8A 1E9RA 4XSGA 5AK0A 1TQDA 5CDFA 3BRWD 4G5OA 4ZKEA 5J4LA 5KTYA 4IJMA 5JRZA 1GIAA 5G41A 3WP1B 1MV5A 2WAXA 2VP0A 4P4SB 3BFVA 1ZU5A 1G21E 3K0CC 3AM1A 3SFVA 1BIFA 2HYDA 5UKDA 1X1RA 4BE7B 3TVDA 3GLFA 1CF4A 3ICQB 4PHGA 3KQHA 2AR7A 1AJEA 2VSFA 4LYJA 4NU0A 4Q4HB 4DJTA 4AKEA 1P75A 4ZDKA 3P27A 4D26A 4ZI2A 1N5LA 1SVSA 5FBWB 5EZ6B 2OG2A 3MG9A 1FNNA 4YONB 4BLRA 2F55A 1HT2E 4G3XA 3QEOA 3MWLA 4TMXA 1XF9A 4IW3B 3PUZA 4KU4A 2QENA 1NVVR 3WHKA 4LGMA 4B71A 3TQCA 2X2EA 1KMQA 2QSYA 4M9SA 4B3CA 1MOZA 3C5CA 4RZXA 1KKMA 1IN7A 2B7BA 3KL4A 4DLSA 1RRCA 4HLUA 3RLFA 2CBZA 5TB5A 3ZD6A 2Q9BA 1US8B 2P2LA 2QU8A 3CNOA 3K09C 1RVDA 4GRAA 3UWKA 1GAJA 1YZTA 1AK2A 2IS6A 2KBEA 1CRQA 2AKAB 3MCAA 1RJ9B 4OQMA 4YMWA 2C2HA 2PT5A 2ZTSA 2IYZA 1GL6A 1JR3A 4M21A 4P4UA 2BEJA 2ZEJA 1G20E 2GXQA 3EX7C 2NGRA 1E2MA 1R5OA 1VG8A 2P5TB 1CJMA 3I92A 4LHVA 2DCUA 4U00A 2QM8A 3EPJA 3LW7A 5FUYA 5EQTA 1SKQA 2C5LA 1OYWA 1CEEA 4K8OA 5BW8A 1YZKA 1W36D 4I99A 1SVOA 3ZQJA 2FF7A 1CJKC 5AJWA 2ZAOA 1COWD 2O8DB 1LTQA 4XWAA 2EWVA 2G0NA 4RSGA 2GXAA 3NBXX 2ZYWX 2IYXA 3QJYA 5DO9A 1QHYA 4A1FA 1N0WA 2CVHA 4MGKR 4JJKA 1XCPA 2XX3A 3W8RA 2PMKA 3WMEA 1NVVQ 2C98A 1O3YA 4JLVA 4XD7D 1F48A 4WOPA 4YC7A 3MWJA 4IHQA 4GZLA 4D25A 2ATVA 3IEVA 1MABA 2RHDA 1W0KD 4MYCA 4LX0A 2XNSA 1T91A 2IEYA 4RZ3A 1GRNA 5DI3A 1JECA 1XTKA 2A30A 3PENA 4ZIRB 1OYYA 1RRFA 3LX8A 1MRSA 3AVQA 4A2PA 2RMKA 1Z29A 2NO9A 1TF5A 1ZUHA 3R8FA 3KB2A 3QVVA 2BKUA 5E3HA 2D3WA 1Z0JA 3AKCA 3PEUA 3WXMA 2J7PA 1XWIA 3CBQA 2WVJA 1DAMA 3U3MA 1ZC3A 2JDIA 1OPXA 4NCNA 4M8NE 3P1JA 2NTYC 2HLDD 2VQSA 3U4QB 4TLBA 1E9CA 4WZ6A 2D2EA 3OZXA 1XX6A 4C0BA 1Z6GA 3QKSB 2OFXA 1M2OB 4P31A 4P3YA 1D2EA 4F92B 3K0AB 2Z83A 3GP8A 4QG7A 2C96A 1E1QD 1S96A 1G7TA 3KXLA 4LI0A 5HE9A 4J0QA 5EZ5A 1IHUA 4MYHA 1CR4A 2WKPA 4L16A 3FGNA 1KNXA 2GHIA 3B1WA 1FUKA 3R9WA 1HQCA 4JVMA 4HYYA 1ZCBA 3CX8A 1VG0B 8OHMA 1XFAA 3VMFA 3GJ0A 3UANA 2VHTA 2ZROA 3DDCA 1KNQA 2Q3FA 4AWXA 4XWKA 4B32A 1RRPA 5H68A 1DPFA 5HPYB 1GKYA 1NG9A 4GMXA 1TQ2A 2JLUA 3FHCB 4M1SA 3HPQA 4PHFA 1P5ZB 1HTWA 5GJVC 1YZUA 1R6BX 2W00A 2DFNA 4RD3A 2Q3HA 5FBQB 4ESHA 2F9MA 5TXGA 4B76A 2R6CA 2PL3A 1P6XA 2ZSBA 4UXIA 1KSFX 2CJWB 4LC1A 2XB4A 1OXXK 4NCKA 1NY5A 3TQFA 1G6OA 3E1SA 4I4LA 4TL9A 2ZRFA 2XITA 2YWEA 3GD7A 4NE2A 5H1YA 1NJGA 2C95A 4Q1EA 5LB2A 4A0GA 4A2WA 4ON9A 4A36A 2GAOA 4TQAA 821PA 4JBXA 5CIQA 1T0JB 2YYZA 1GZSA 4B35A 3CONA 5IDVA 2QNRA 2A5DA 1TNDA 3CF6R 5JBQA 3AGQA 3CH4B 2H18A 3HWSA 4JBWA 4Q03A 3NHAA 1G3MA 2CCKA 1DAGA 1GL7A 2GJ8A 2VA8A 2R44A 1BOFA 1NRJB 2R6GA 3PUXA 2WWYA 1R7RA 1C4OA 1W47A 1ETUA 2FSFA 2H8KA 1SVWA 5E7IA 3NWJA 4DC9A 2EFDB 4GDFA 2HT6A 4ZO4A 4YMSA 2QM7A 3TIFA 2HCJB 2B6HA 3GPLA 3C16C 1W46A 4CEHA 4OQFA 5ANRB 2D62A 5DYIA 2RGBA 3NHBA 3Q8XB 4TMVA 1MO4A 1ZNXA 3IO5A 2VYFA 5FUWA 5KSZA 4Q19A 2ZSFA 4Q9HA 2QZ4A 5EXXA 2QMEA 3U3JA 4Q21A 5BYJA 3H4MA 4HZUB 2A5JA 3BH7A 1S3SA 4DDVA 2BEKA 1II0A 4QGHA 4TYYA 1W2GA 3QXCA 4DLVA 2QSZA 3RRYA 1EFTA 1XZPA 3AQ4A 4DSUA 3VQTA 4A8JB 5TDHA 3KJGA 4PAQA 5KHOC 4GOXA 3AV0B 3BAFA 2IA5A 2NO7A 1KI1A 3AF1A 3NG1A 2RHMA 3MFYA 3SYLA 4N0EA 1SVLA 3LFUA 1NBMD 2ERXA 3CPHA 3VX3A 1N6KA 2IUSA 1HUQA 3ETLA 2XJ4A 2R9VA 2ZQ5A 4TMZA 4O25A 2OAP1 3K53A 1F60A 1BYUA 4QBFA 4TWZA 1UBGA 4US0R 2H5EA 4Q4AB 4BFVA 2D7DA 5CYPA 2J7KA 1E9DA 1KMHB 3IQXA 4N0DA 2WSSA 2OBNA 5EP4A 1QHNA 2O0KA 3HR8A 2YC4C 4O2LA 4QGGA 3MRSA 4R9UC 4MQBA 3T5DA 3KUDA 1U9IC 4D2IA 4V0MA 4S2EA 2GK7A 1IM2A 4KFUA 1GILA 4IDOA 3SU8A 4NHOA 5F9HA 4Q01A 1WXQA 5AUPB 3P4YA 1Q12A 3OESA 3SHFA 2FX3A 3AB3A 1E1RA 2CLDX 1NJFA 3U60B 5EE5B 2IYWA 5EXTA 2BJVA 4NYJR 2PX0A 1TADA 1OB2A 2FSIA 2BM0A 4PXAA 3Q7QA 2QTHA 3CH5A 1N6LA 1JB1A 4PC6A 2ZE7A 2BBOA 5FPSA 1AA9A 5LD2B 121PA 2V8OA 4Z1MA 3PITA 3U44A 3TBKA 1OSNA 3ZZ0A 3MD0A 5EP3A 4EFLA 2EU8A 1FMLA 2VBCA 3OHMA 2ODNA 1G3RA 4PPQA 2ZRKA 1TEXA 4Q7LA 1J8MF 1UAAA 3F5FA 2GEUA 1XEWX 3E70C 2H92A 1U81A 2EWWA 5H8WA 4TLDA 3U6BA 3KXIA 3OEED 2ZRAA 4LBYA 1SVMA 4GFDA 1Z6AA 5CB8A 4DWJA 1GNQA 2OBLA 2WMOB 2DPXA 1XXHA 4DCTA 1N3BA 2LKCA 3B78A 3LWNA 2Q21A 2ODWA 1X8JA 3K0FB 3F8TA 1PLJA 1EWRA 3OIVA 3D8BA 2RGNC 4IVRA 2GKSA 2HUPA 2IXFA 2QT1A 3EA0A 4XD7A 4AKHA 2C8VA 4IDQA 2C77A 4EJSA 1YVDA 1HE8B 1XB2A 3PJRA 4RD6A 2VP6A 1KJWA 2O8EA 1OHHA 2ZRLA 1G64A 3EARA 1JXMA 4IDPA 2ZJZA 3U6KA 3TK1A 1S8FA 2WTUA 1O87A 2GCOA 4MDFA 3VU9B 2CMKA 3H1TA 2BMJA 4KSBA 2O8FA 1G41A 2PMDA 1VCMA 4TYPA 3MMPA 1E79D 2RAPA 1SVKA 4YMUA 3TJZA 3OIWA 2IWHA 1SZPA 4ZPXA 4C0QC 1OH8A 2W2XA 2OESA 4KFTA 1E9FA 4U02A 2VTKA 3RC3A 4B3DA 2OSBA 1L4YA 4W5WA 4CEJA 2FDCA 1KSHA 2VP4A 1EK0A 4DSOA 5FH9A 1KK0A 1ZCAA 3L8ZA 1EFHA 3X1DA 3I72A 1L8QA 4A8JC 3BB4A 2FU5C 2H57A 4WIAA 1G5PA 1R2QA 2UZ3A 3BGWA 4QM6A 1E96A 4Z51A 1AGPA 4NYIR 4JVNA 1S4QA 4B75A 1E1QA 2JATA 1T0HB 4GP6A 1M34E 4DLWA 1H8HA 4AYWA 1CU1A 2QAGB 1ONBA 5AJZA 2BBWA 3PCRB 4EPRA 2YOHA 5G3YA 3SI7A 1LS6A 3ADBA 1Q22A 2D06A 3TR5A 4M9QA 1II8B 1X1SA 1AN0A 1HT1E 1E2NA 4JYBA 2I1QA 2JLZA 2J0QA 3K70B 2J0UA 1E99A 4URZR 3TAUA 4OK5A 4Q4LA 4JVLA 1TUIA 1V43A 2PZGA 2NMVA 3DOEA 2QMHA 5HR5A 3IHWA 2ZS7A 4TLCA 3QXHA 4CEIB 4HSEA 3T15A 1IAQA 3VX4A 3ZYCA 4HI0E 5KO2A 5IK2A 1D8TA 2WWGA 4RFVA 4A2QA 2IYYA 3AVOA 3CRRA 1DTSA 2CLSA 2R6FA 3DOFA 5KDDA 1BKDR 3A8TA 1SULA 2FPLA 2ZETA 1M8PA 1IQPA 3U7GA 3MJHA 1IY0A 1FW6A 4QNRA 1P72A 3B85A 4NMMA 4HLCA 2GVDC 4NYIQ 4LJ4A 4RCYA 5KSOA 4ITRC 3K0CA 5LD2C 1NL3A 3N5CA 2ZI3A 4IVQA 2NO0A 1MO3A 1R4AA 2WJIA 5LDDC 4PSVA 1YR6A 1PJRA 4TL8A 1XDBA 5L3RA 2VO1A 1Z47A 4IXNA 2WPDD 5EE3A 3NBZC 2DYKA 2JDID 3BH6A 1U8ZA 2QQ0A 2ZR7A 2ZU0C 4OHYA 3ICEA 1KO8A 4MRVA 1H65A 1QVRA 1N2CE 3GLIA 3T06B 2RGDA 3H0KA 5KDLA 1E2KA 3BE4A 4UJ3A 2XZLA 2XXAA 2OEPA 1E0SA 3C7KA 2B8WA 4NH0A 4HUQB 2KWIA 3GJ4A 4A0HA 2FFAA 2QUZA 3K09A 5IRCD 3WBKA 1E9BA 1PVOA 2I4IA 1G7CA 2ANCA 4GPTA 4CIDA 2Q6TA 3FVQA 1OXUA 2RH5A 2YVUA 4IOKA 5JJKA 3LXRA 4LDJA 4QJ3A 5FPHA 5K8TA 3CX7A 5L3SA 4G01B 1AKEA 2AX4A 1G17A 3V9PA 4HDQB 3ZQ6A 5JZVA 2PZFA 3ZZTA 2CNWA 2QGZA 1E0JA 1YR8A 2RGCA 3LVRE 5K8IA 5GJCA 4Q1AA 3KKPA 1NBMA 4DUGA 1Z6YA 1PLLA 3VKHA 1XCMA 1Z07A 4TT3A 5GVRA 1NP6A 1XJQA 2ONKA 2RGAA 1VG9B 5LB4A 3RDPA 5FTKA 1JALA 1U8YA 4PC7A 3KKMA 4WAUA 2GXSA 4LJYA 2QL6A 4Q7KA 2GTPA 2ZI7A 1A2KC 2EFHB 4DLRA 1FX0B 2O0HA 5EJEA 1U0HC 4D4MA 3TAHA 2DWQA 1MH1A 1PLKA 2GEVA 3EIHA 2V1XA 2XSZD 4QXAA 4XIGS 1OIXA 3RS2A 2ZUCA 4R2HA 2CL7X 2WJYA 3R8CA 4EIWA 4ARZB 3V4FA 1N25A 2JJ2D 4M22A 4O3MA 2B92A 2J5XA 3LRPA 2X8AA 4US1R 1QG2A 2ODEA 3ADCA 1AZSC 1BH2A 2OILA 1E0KA 2V55B 1KI6B 3KQNA 5CJPA 2J45A 3CR7A 2GCNA 2QAGC 4RKEA 5CK5A 5K8LA 4H1UA 4WVFA 5J4VA 1NSFA 2H7VA 2WOJA 3SFZA 3I3SR 5AJYA 3AH8A 1VPLA 3QF4A 3SBEA 3TLXA 4U7DA 2FZ4A 3B5JA 4OI0A 4M0LA 3CPJB 2DY1A 1ZIPA 3GLGE 4IOJA 1P3JA 3UKDA 5J4KA 2VP9A 3K70C 3OIUA 4Q02A 4AC9A 1OFIA 2PZEA 4NCHA 4QKQA 1OE0A 1F2TB 4D0GA 2WV9A 4P33A 5E7MA 1C1YA 1Z22A 2OCPA 4QBHA 2K5UA 3DEFA 2BDTA 3KB1A 4RVCA 4M1WA 4R71A 5KU1A 3CW2A 1X86B 4UXHA 1QG4A 5DISB 3PG5A 1XPRA 2G6BA 2F1HA 1N0UA 4F7WA 4RD2A 3SR0A 3A36A 2WBLC 5AUNB 1T5IA 1Y63A 4Q9LA 1GP2A 3OEEA 2ONJA 2OFOA 5FL3A 1II9A 4V0LA 1TF2A 3W8NA 4B3XA 2XEXA 4L4UA 1VIYA 3BJIC 3PR1A 3SC3A 3X1YA 721PA 2QAJA 1W0JD 2WJGA 3QVUA 2WOOA 1Q1ZA 4HUTA 3M0EA 4B6FA 4OYHA 2REOA 4P4SA 4AURA 3EWAA 4UNRA 4KODA 3FMFA 1CP2A 4B43A 4XWOA 3L8YA 1F6BA 2QEQA 2N1BA 1DG3A 2IT1A 1YR9A 1IN5A 4NKRA 4KYUA 1XPOA 3GFOA 1G7SA 3GJXC 4L9SA 4MUAA 4Q4HA 1CJVC 2J0SA 2QROA 1RYHA 2VF7A 1U2RA 3GJ3A 2D74A 1W4BA 2EW1A 3LLUA 3W6PA 2NIPA 3SYKA 2R62A 2MSDB 4C9BA 1VMAA 2VSXA 3P32A 4CDGA 5JSZB 3BBPA 4C0HA 2OV2A 2WSSD 4AKIA 3PIRA 3UMRA
chains in the Genus database with same CATH superfamily
3L6OO 5KTPA 2JC3A 3FHLA 3H1BA 3N7UA 1JDBB 3KOZA 3RVNA 4L5CA 3IS3A 1US8A 1E18A 3C5EA 4PLTA 1ZGGA 2XMSA 2GEFA 3VR1A 2YHBA 1UKYA 2VH5R 2WAYA 3BA1A 1W35A 4LF8B 1MB9A 1Q2UA 1L9KA 1E8NA 1OA1A 1Z38A 2CCGA 3OJ0A 4ND6A 2E2WA 5H5JA 1EZ4A 1SCUB 5HQ3B 3SQXA 1P7CA 1X8LA 4DR2B 1YE5A 1CVLA 3PD1A 1LB1B 2H4FA 2OYSA 1H9CA 1U8FO 3REGA 2LVBA 3OCVA 2MDTA 2P5UA 2QRVB 1T5OA 3GLHA 3KUXA 2ZIVB 4RW0A 3KG2A 2RCYA 2A9JA 2H0RA 3QVKA 4MI1A 1JAYA 2Q6LA 1VA4A 1E2LA 2QDKA 4G67A 3R7FA 2HK9A 3FTDA 1Z5PA 2P75A 4HXYA 4KQKA 2EJCA 4PNEA 1M73E 3HA3A 2E82A 4K6OA 3I39X 4WSOA 4JI3B 3SBXA 4Z1MD 2BFBB 2VAXA 1NZFA 3IDOA 4Q34A 5FA6A 1SXJE 3LXUX 2DBYA 2YMMA 1WMSA 2PFKA 2W6JA 2EBFX 3G3EA 2Q07A 1DTWA 1OWPA 3GLTA 4IZ6A 3MJRA 4NDZA 5BYKA 4F91B 5KZMB 3I5YA 2LWIA 2ZJ4A 4DMLA 2RB4A 3V7UA 3LY7A 1Z0UA 4EENA 1ORDA 1UXOA 3I2KA 4BMOB 1H2AS 1Z6QA 3MQ4A 3VPDA 4J2TA 2BRUA 3QELA 2QORA 4MVJH 4ZZ3A 5CXUA 4GQBA 4QUHA 5CLJA 3MHTA 1WB9A 1UC9A 1KEEB 2O2GA 4NBNA 1MX1A 5HS6A 5T4FA 2WG1A 2A9KA 1GZ3A 3D7SA 2PJZA 4K05A 1SIUA 2BCEA 4XJTA 3A1SA 3GEIA 5DT2A 5J5CA 1Z5NA 3TRJA 3VPBA 2AOTA 5DCYA 2VRNA 2XEDA 1P80A 2WIBA 3GYGA 2CV2A 2V6GA 3CS3A 5YASA 2BELA 5B3LA 3WGIA 4L9RA 1GVNB 2HLNA 4HCJA 4L0MA 3RS4A 4Q48A 2GCPA 1IZ8A 3JARB 5BSUA 5BV2P 4BQFA 4Y2PA 3DE1X 2LIVA 1PJ2A 3P9CA 1UT6A 2LIPA 2IP2A 1QVWA 4LYFA 1MENA 2XDQB 1SBYA 2YJTD 4HZIA 1Q15A 4BPBA 2VJDA 3GW8A 1P7YA 1R10A 3UPUA 1WV0A 4UVGA 3NP7A 2K2WA 2XNCA 1KAHA 3ANXA 4W5JA 1O97C 5CYOA 3B36A 1SCNE 2RJOA 3ZBPA 1WQ1R 3GP5A 3W77A 1BE8A 3V55A 4B4VA 4B73A 4EA7A 1X6VA 2AN4A 4RK4A 2BBSA 1SWWA 2C3OA 1PG2A 4EUFA 1NV8A 2F64A 2B1JA 3UAXA 1DCKA 2XMRA 1CUFA 3NOQA 2IK8A 3QKSA 4B09A 1M2OA 2O6HA 2HMSA 3KP1A 2P0YA 1Q19A 1SBTA 3QFRA 4MINA 2WPDA 4TV9A 2VSYA 3K0AA 1VCIA 4KH1A 1TM1E 1VYTA 2HF2A 4AYTA 4D4HA 3E9CA 4GPIB 3S2UA 1JIIA 2I67A 1XEWY 2ZQYA 4DLZA 1K3FA 2P9FA 2NUPA 5AI9A 5JDCA 3F5SA 3FX2A 3ITKA 1U2ZA 5AVJA 1N5JA 2SCUA 3RJTA 4RKQA 4XZ3A 1S8AA 1E5QA 1M1YB 1OMOA 2AOUB 3A1WA 5JH7A 1ZM2A 4AY6A 2W37A 3H7AA 4N3AA 3HA5A 3EMKA 5JXGA 3KKOA 4C0SA 1LBIA 1CIVA 1ZLYA 1VYVA 4BKQA 1YRLA 2R86A 3RBXA 1GZ4A 4MW6A 2C2BA 5EWJB 3ZZUA 2GN0A 2X9LA 4QQNA 5JPIA 1H8EA 3WKCA 1IN6A 1FBNA 3U4DA 5I7HA 1FJHA 1U80A 3L8CA 1I7DA 4YXFA 1V35A 3G2JA 1ZOSA 5ESXA 3FYHA 5COBA 4QYXA 2BH9A 5CT5A 2JCSA 4LXTA 1Q44A 3CZPA 1OCEA 3IXMA 1ORWA 1R8SA 1N8TA 1YZGA 2GQ0A 2R6AA 3BHJA 2VKQA 3BXOA 1JVSA 3T94A 5HDBB 1A50B 3FNIA 1ILEA 4P0PB 3A4IA 4JLAA 4OGWA 4EF4A 3VZQA 1XEFA 3PQ4A 5L3QB 2IXDA 4NENA 3RRXA 1HTBA 2CJWA 3FDXA 2P78A 1N3YA 4RGYA 2HRRA 5BT8A 1TKCA 1JFTA 2WU4A 4RC9A 5ES3A 2ZB3A 4ABTA 4IZHA 5BYBA 4K6FA 5K45A 2R00C 2G9UA 1KEVA 1FTGA 1ACJA 2QPAA 3L7LA 3MTIA 1NR5A 3GYBA 2AYXA 4PAOA 5IK2D 4WY8A 4RMNA 1XRJA 4XX0B 3IT2A 3CNLA 5COAA 3V1YA 4DTIA 3RS7A 4XVUA 2RGNA 3W6NA 3W9BA 2WA2A 4DDWA 2RK4A 4E33A 4EKIA 3ENNA 1FNCA 1W87A 2VJLA 2B21A 4Q1FA 1RKQA 3ECAA 3JW8A 5IBQA 7AT1A 2FA9A 1PT5A 5GIPE 1PUJA 4BRWA 3D0OA 1A8IA 4U2DA 1QQAA 1NN0A 4RTRA 4HRVA 3K6KA 3KWJA 4O2BB 4ZQFA 1N2BA 3TOXA 3VNSA 3WLSA 2X7HA 5BRJA 4QDXA 3BG5A 4Z86A 5B1HA 4NRDA 1KEZA 3IBSA 5LBTA 2QPOA 1EBFA 2B4QA 2WJPA 2Q8QA 3PVZA 2OA0A 1O89A 3RTDA 4UUQA 4ACBA 1NVTA 3V4VB 3EUAA 3EFBA 2IYLD 2XD4A 3K0KA 3KHKA 4I9HA 2ILTA 1GTMA 3EQ2A 3MUFA 4TKVB 4UOQA 1Q57A 3A9TA 4KC0A 3SVTA 3IA2A 1ZR4A 1OQAA 3K9GA 3KKLA 1U2TA 4HWSA 4OHWA 1RPZA 5KYGA 1X80B 4M53A 3NFRA 2PSFA 4COOA 3K35A 3GWZA 2WEKA 2GZ2A 4BWGA 3ANNA 4CBVA 4NU5A 4HZUA 2IIVA 3KPYA 1RHJA 3FSRA 1LTHR 1W5FA 1VQ1A 5F7XA 7MHTA 5ERYA 1DBVO 2CLCX 2XDYA 2Y1FA 2HSJA 1KPGA 3NHMA 4MUMA 2H63A 4R8MA 3OQPA 5HCNA 3R76A 3ZWMA 3OQOA 2AFHA 3PNSA 3CSSA 3L0DA 3N2GA 2NTNA 2XVZA 3PLNA 3QU7A 3SD7A 3RIYA 4ZZ0A 1UKEA 2GAAA 1RQRA 2KQUA 3WIOA 3ESRA 3LBNA 5HK8A 3B6JA 3ZHTA 1KYYA 1NVUQ 2C9MA 3JAWB 4LVCA 4YJHA 3BSFA 1Q7RA 4DV4B 2W6IA 2BR3A 4EKYA 1GU0A 1FUIA 1R9JA 4LHWA 4TLAA 5BN3A 4MLPA 3FR7A 1FC0A 4Q3OA 1IJFA 4KFCA 1TUBB 4XWWA 1NVAA 2R8RA 4BNKA 2RHOA 2R1ZA 1A8PA 4DA9A 2PGNA 4I3GA 1JIQA 5LM3A 2CNWD 4YLGA 1PK9A 4BLPA 5BOSB 4GRDA 2PJRA 3CKMA 2C2WA 2IYTA 5HIIA 2P1ZA 2LPMA 1J5EB 3RBVA 3WHPA 5AM3A 4R0VA 1TZBA 3SXUB 3AU9A 3TOSA 4E3WA 1NYRA 5EJMA 5DNYB 3ZUGA 1R0KA 1KY3A 3OM9A 4BLTA 1TF7A 1J8DA 1UXJA 3TIIA 1QYVA 4S1TA 1E5XA 2XI4A 2QMOA 2I03A 2ZJBA 3LD9A 1TDJA 1W6RA 5DGTA 1M76A 2PUTA 3EVCA 3IT0A 4GLJA 4KP7A 4MP6A 5FWNA 1DLJA 5DMXA 3PTAA 3H99A 2CHEA 4LC0A 1EGMB 4QAJA 4B46A 3TR0A 3VO9A 3P2IA 2B30A 4LV6A 4UFNA 3T7AA 4E5UA 3PC7A 3KPVA 5EMHA 3STWA 1HI9A 1GTVA 3D31A 3W1VA 2V3CC 3WV5A 2OO5C 1Q20A 2E4UA 5FB3A 3TNFA 2W58A 3L7NA 3RJ9A 3GLRA 3ND7A 4YRTA 4ABYA 3CX4A 3TW6A 3UYLA 1PR4A 1Z4KA 3ROZA 1E6UA 4MWTA 1FRFS 1QIJA 3B8EA 3MELA 4E5SA 1TFRA 1U6KA 3IUBA 4C21A 3TSOA 5IKMA 2BM1A 2K4MA 4HH4A 1T9DA 3PVSA 4PYRA 5AKEA 3G8AA 1TEVA 3OD1A 2ZT7A 3ER9A 1ZC4A 1JPNA 1R74A 2OR3A 4F1WA 2RBGA 4DQLA 1TQ6A 3PQ8A 4HNRA 5FNZA 3KQPA 4LJ8A 3DTVD 3OFKA 4KO8A 1U0TA 3HU1A 3RUAA 4CIWA 2OOKA 4P08A 4IMJB 1LH0A 4PNHA 4QWMA 1ISJA 2VF5X 3AU8A 2A4KA 1FRVA 1MT0A 2YQ4A 3D6UA 1E3WA 1ODIA 3UW3A 2ZIUB 1V1RA 4PQFA 3HVHA 4R40A 4V1CI 2AF3C 1N5OX 2V03A 1QOPB 4DR6B 3UK1A 1HYBA 1VXRA 2ACKA 1EG2A 1XD2B 3F74A 3MPUA 1H9BA 2FPUA 5KKNB 1MXFA 4FIDA 2RCNA 3FKJA 1L7XA 1VE3A 3ORRA 1NT2A 1NF3A 3K0FA 1T8WA 3Q41A 4O0LA 4BN0A 1G5QA 3AOGA 4NMHA 5CDYA 4MHOA 2FNAA 4CMIA 4NTZA 3HKEB 4N5HX 1FFXB 2WKSA 1E3JA 4HWTA 4P98A 5IMBA 5ALPA 3RSFA 5HS4A 5DN9A 5DASA 4BO4A 3RC7A 4BNGA 2VZEA 2ZBDA 3FGZA 1LI4A 2PUFA 1Q3KA 2BGLA 2FEXA 3KTFA 3SHOA 4D3FA 2FP4B 3D8HA 3WYAA 1JEEA 2VYNA 3CRMA 4LGVA 4D97A 10MHA 3OY2A 4FHGA 4HTAA 1RLJA 1QV9A 5JALA 5K4HA 2WIFA 3ED5A 2CHUA 4IKEA 5BUZA 1DRUA 2ONCA 2EYUA 1QGDA 1A7UA 5BT9A 5HMLA 2WJ3A 4AY5A 2I6GA 4OU4A 4FX2A 3MCZA 3W5HA 1VGRA 4DQUA 5HHTA 3ZWBA 3Q8KA 2B0JA 4JOBA 1EFVB 1YS1X 5CA1F 3T3NA 4HZGA 4QEZA 1L5FA 3RUEA 4EFKA 1L7PA 1X1AA 2I55A 2VUUA 3VU9A 3L7CA 1ID8A 4S3MA 4RHEA 4EX7A 2DPHA 5LOVA 4X7MA 5EJ2A 3EYWA 4AT1A 4C2BA 4L8FA 3B9PA 3G9ZA 2O07A 2PVSA 4H35A 1HKHA 4W5QA 1L4BA 1NI3A 4HH1A 4UZEA 1BMTA 2GAIA 2J8ZA 3QUSA 3TSYA 5U4XA 5JTTA 2OP0A 1EVIA 1R0WA 3LDHA 3S2SA 5CK4A 3FCOA 3W2IA 1U98A 4Z0TA 1R0RE 1W36B 1Z6XA 5DNCA 3BFKA 3GEGA 1X1DA 4AZ0B 1U11A 5B5SA 1B2LA 1M2WA 2MIIA 3BMOB 3K96A 4NYMQ 2DR2A 1GRQA 1TJ3A 4D82A 1SUAA 2CDNA 4XUDA 1R16A 2VXBA 4FZ3A 1R4ZA 1H6DA 4J0IA 4MUJA 4PPYA 3W4KA 3OLXA 1O6GA 2O59A 4QYTA 3L1UA 3UYKA 2ST1A 1Y7PA 2AZ4A 4N8SA 4DB2A 1XVLA 3AETB 1Z5ZA 3INNA 3U09A 1FLNA 1R64A 1WLYA 2OM2A 3SJCA 4DVGA 5B4VA 3WYGA 1SEVA 3RTBA 2ECQA 3S8YA 3HACA 4B3MB 1ZN7A 4O5AA 4KR3A 2QN6A 4JFRA 4C4XA 1B1AA 1E2IA 4IL5A 4IS3A 3CF0A 1RI2A 1X92A 1ZJJA 5TF0A 5IDQA 1PAUA 1TGVA 4INOA 1OW3B 1JS1X 3PRHA 3OZFA 3R3WA 3MUOA 4WL0A 2GN4A 3SOZA 5MDHA 3L0PA 2HBYA 4FFWA 4IIHA 2AN3A 4LHZA 3UHOA 2GM9A 4OXKA 1ZQ9A 1GZ6A 1JU9A 3CWZA 1FTYA 3GARA 3W2TA 3BT7A 4GQAA 3OHPA 2Q3MA 2XB6A 4RIHA 2DERA 2W6JD 4HPWA 2A33A 1L9XA 5DBOA 3HO6A 5ALRA 1UXKA 3CF4G 3GN2A 4GI5A 1XVIA 3V00A 1UDAA 3GJTA 2PCJA 2PT9A 1R0XA 1WMFA 2P90A 1I3CA 3NT4A 4L08A 1KI7A 4QL3A 2CV1A 1AD2A 2VHVA 1B6RA 2ERCA 2IF2A 2OC4A 3GR6A 3QY0A 4V0OA 3P5SA 4JNKA 1Y4SA 4BP1A 4BO9A 2VHQA 4EYOA 8MHTA 2XGSA 4G81A 4PG5A 2X40A 3K16A 5DKFA 4BLSA 2D1FA 4ZDIA 4RY0A 1YO6A 3C15C 5B53A 1VHLA 1UJCA 3ROGA 3W5AA 2GPNA 4L4XA 2VCHA 3CUEF 2OO7A 3ADPA 2I4LA 3HYRA 5JLAA 4LF4B 2WVAA 1FUUA 1E3IA 3ZIAA 3H04A 3CN9A 3E22B 3PGLA 4UM8B 3RWOA 4E70A 1P7WA 3OZUA 2SNIE 1XU9A 3LUBA 3RARA 1F8XA 2HCRA 3FVTA 3V2HA 3O1HB 4ID9A 5THKA 4N12A 5J2TA 2A5YB 1G8GA 2RBEA 3BDAA 5EHGA 1JAZA 4RTLA 2W2MA 3FB1A 1IY1A 4Q9JA 4JA2A 4LXQA 1CF2O 3PHJA 2J1LA 1EKXA 1KE1A 3Q10A 5CITA 3F1LA 3H11A 3K9NA 3N2NA 1BS1A 3SYNA 4DW8A 4CFYA 5G53C 5C9ZA 4TVKA 3T4PA 2P9CA 4LOHA 2HMYB 2XT6A 4NDNE 3WLRA 3ZV4A 3EFOB 3U3DA 5T3YA 2RK3A 4ARUA 1GFZA 4JI0B 1GGNA 4XVHA 1E92A 4J0JA 5IN4A 2CLKB 2ZREA 3ZQUA 1EUCA 2BGNA 3FCAA 5DTRA 1P4JA 4J0CA 3VTZA 4B4WA 4HUQA 4RCVA 3O38A 4S35A 2RGXA 5FJIA 3RM3A 4A82A 4C87A 4DQKA 5A4FS 1G4HA 3ZE6A 1QUFA 1G8SA 4MYUA 3ILHA 4IJ5A 1V7CA 2FW6A 3WDKA 4ND8B 4E31A 4YV1A 3N5KA 1Z56C 4IXMA 3R7WB 3DD5A 3BORA 4ZQGA 4ER0A 1YS6A 3Q2KA 1ZJWA 4HF7A 3UOGA 1S2DA 1T9CA 2GILA 1GZ7A 2L69A 2CL6X 1CJTC 4IHAA 3KQUA 4RTKA 1C7FA 1RC8A 1Q6YA 3L05A 2JLWA 2XT0A 3I0NA 4OYLA 5C3UA 4CLXA 2Q1WA 1D2NA 4MW9A 1L5OA 1PGQA 2QP4A 2WD8A 3ACBA 3JPYA 4QFMA 2DWPA 4PEVA 4WK2B 3L46A 4LPSA 5TMPA 4PWYA 3UJ3X 1YFLA 4AMVA 1H8ED 2FVYA 2W0SA 3IEXA 1QWSA 4YPOA 3ZE9A 2P3OA 5AR1A 1I1OA 1JQKA 2JIQA 2BAGA 1OWLA 1Q83A 1L8XA 2JF0A 3FWNA 3OOJA 4M9RA 3GFRA 4M9CA 5FBKA 2BIFA 4F45A 5FAKA 3RYIB 1T9ZA 1AZLA 3LHFA 4AP9A 4EITA 1DBWA 4J7CA 1UIRA 3E35A 4K7JA 4AZ3B 4WBSA 1VBNA 3ZJ4A 4HDKB 3K2IA 2BJHA 4F2HA 1P7PA 3DGFC 3Q1KA 4XI9A 1GEGA 6PFKA 3D02A 3G2NA 3ZDZB 3GLGB 1JDNA 1OJLA 2AUNA 2VOJA 2HIMA 1SZDA 1FVXA 1ZS9A 2PSSA 3B2EA 1A9TA 4ARZA 5CB4F 4GXQA 1F1JA 2R6JA 3AIOA 1DXQA 3O8NA 4BFCA 4EF6A 4MMYB 4KVZA 1VJTA 3NYIA 4H60A 2ZSDA 4F93B 3UMVA 1J0XO 4G89A 1HX7A 3K94A 1KI6A 4MEAA 3S2ZA 3NC0C 1HURA 3Q0TA 4HVTA 3TRDA 3A4MA 3MSXA 4BQNA 4E5KA 2I5PO 5HRAA 1N33B 4BB6A 3C1AA 1QGUA 1KSJA 2O8BB 3O03A 2IEBA 4EFMA 1G98A 3MRTA 4PRZA 4AJ1A 1VIVA 4CM4B 1BDJA 3WAGA 1EWQA 1Z34A 2R87A 4GSLA 3T3GA 1IEQA 2AUMA 5IJZA 4G0YA 4OH1A 3RYFA 1JDZA 1X2EA 1UWKA 1Y8QA 2AFIE 2HJHA 3PQDA 4FK8A 2Q5IA 4ITVA 4GPD1 2AV6A 1CV2A 2ZP1A 4KLZA 4BNDB 4CKBA 4AY2A 1J20A 5A1TA 5AKJA 3W6OA 4EDFA 2QG9A 2E18A 4WZBB 4K9PA 3HJRA 2CUKA 4UVEA 3N2YA 2ZT8A 1F3OA 2VT2A 2GPWA 3MB5A 2AG0A 2J85A 3RNOA 3GLIE 3BK2A 2R8PA 1CJSA 5EIAA 1CB0A 2NWQA 3UJAA 4C20A 1QYXA 3WYCA 2UYQA 3BFPA 3KTAB 1UEIA 4N3NA 4REQB 5MN6A 1U3CA 3CB4A 4ZCQA 1EGHA 4ZDWA 4EG7A 1UZAA 1MHPA 1VJRA 1FNDA 2QMUA 4OJKA 4PANA 4ZHSA 5L53A 2YOGA 4G8JA 4YDQA 3QX8A 4FW8A 4EEKA 5JY6A 3HEBA 5CDUA 1QF9A 1D6JA 1UPAA 3MVEA 3O4JA 4TTTS 1JTEA 3EQ9A 3QPUA 3HU3A 1YDFA 4UHKA 4ANFA 3D0KA 3ENWA 3K9BA 4EHFA 2OXRA 1XTSA 4NBKA 1RAHA 3C5HA 2CVOA 3BREA 3E9MA 2R48A 5DW0A 2W6ID 3T35A 3B3QA 3UV3A 1E8MA 2N9UA 2XKJE 3NM5A 1NVXQ 5EGNA 4LI3X 2MHCA 4QQRA 1W4CA 4JC0A 3U37A 3EXFB 3OQIA 3PXAA 4MKIA 1ULSA 2VK8A 6REQA 1NBME 3D6FA 3INTA 5EPUA 3UA4A 4X71A 3NWEA 4U7TB 2GJAA 3NAZA 3TFWA 4EHJA 4IJWA 3ZDDA 3R2JA 5K0EA 4JT4A 3R74A 4DT1B 3DPUA 1FIUA 1TK2A 3R0IA 4G9BA 3CVUA 4JJEA 4W7HA 1KYVA 4U7JA 1QRRA 1LRKA 4UM5A 4YT5A 1TT7A 1Z5WA 1LNQA 3L6UA 4IH1A 1CRWG 3MF4A 5FI1B 3V7WA 3WRYC 4X7RA 2QXTA 2BKLA 1LPAB 4B8YA 2NVBA 4IIEA 1PBNA 4KN8A 1ZK4A 2JLSA 1VBKA 4BYMA 3TIGA 5JAMA 1F9AA 4LSGA 2C31A 1O8BA 4YQZA 4ZV7A 2EP5A 1ZLXA 3SBDA 5KKAA 3LCVB 1VP3A 1OI4A 1JG2A 5EE1A 4NZPA 4PZDA 3ZGYA 3I83A 4MW0A 5HQ3A 1ZHOA 1DQZA 1SCUA 2NM0A 2EFJA 2PA0A 2VT6A 1XALA 1HE1C 5F7OA 4QHSA 4ZCIA 5LWQA 5EYPB 3T6KA 3SEQA 1FRNA 1JQ3A 3QKUA 2Y77A 1KFEB 2QP9X 2QRVA 3MWYW 1WWKA 5AVTA 5J5VA 2JK0A 4B3HA 4BO6A 3U5TA 4FZJA 1SKBA 3HI6A 1V37A 3EHEA 3NLLA 4MR9B 2QD1A 4BY9E 1ZDMA 2LDXA 4CLDA 2F59A 1NIPA 2BFBA 1J0CA 2HU5A 2P3SA 4FN5A 4R2MA 4XQCA 3PJFA 1K3TA 4C3VA 2JIZA 1NBIA 1WKVA 2DTEA 2OC9A 1G3UA 3LYAA 3HUTA 5CH8A 5HF9A 4OQPA 1HKUA 5B37A 2H16A 3ZCXA 1TLFA 1TOAA 1SCQA 3WWYA 4D4KA 5EZSA 5B12A 4F9GA 3VR0A 4D81A 1GG5A 3I32A 3E5HA 4FJ0A 4AJLA 5DTMA 1JFVA 3SLRA 2WC1A 2R1TB 4BMCA 1F5NA 3K9HA 3ELUA 1T0PA 2C78A 4FVTA 2BZSA 4IGAA 4FSHA 4P92A 4YMIA 2OAGA 4ZWNA 5TQVA 4E2FA 1XU4A 1KEEA 4G5RA 5AHRA 1W48A 4BV3A 3CJQA 2IPXA 3C5WP 4CIXA 2HA6A 1Z8NA 4NPHA 2ZJ7A 3BRQA 3NHLA 1NBHA 1UDXA 2MR5A 1U0GA 1KYXA 1TXGA 1UBFA 1AQUA 1Y82A 3I6YA 3RVKA 4FFBB 3JARA 5EVCA 3FDJA 4GKBA 1AXGA 1C7ZA 1P2SA 3IIJA 5KMGB 1C81A 3I5UA 4IIJB 4U7GA 3Q85A 5DB4A 4RV5A 3H5AA 3LZCA 4F96A 1SIBE 5CDFE 4ARVA 1FTNA 2XDQA 3FROA 3NIWA 3CRVA 3IPAA 2JCVA 1GARA 3PL5A 3U61B 4FKBA 3AP3A 4DR7B 1H0SA 5LP6F 2TMYA 5FOVA 2D5IA 1E6LA 1Z74A 2R2GA 5HBRA 2OV6A 3O8QB 4PN3A 2E7ZA 1Z63A 1E9EA 3NUZA 1F1BA 4DLKA 1Z8HA 3PS9A 5K0BA 1JBEA 3ZDBA 4DHEA 3MCTA 3GLFE 1ECCA 4FCCA 2EEPA 4LTDA 2OXCA 2YXEA 4MV4A 4B2IA 1ANKA 3D3JA 4CIBA 3G0DA 4G09A 1CUDA 1JHRA 1H94A 4N0PA 5LQAA 4LK3A 4TYWA 1VZ3A 3GCGA 4QTZA 2UYGA 2H06A 5CCBA 4CR6A 2JFWA 2Y1XA 1NQTA 3CNEA 2SICE 3D7KA 4RABA 2IXGA 3STXA 3UWOA 5FFFA 5BUSA 3N86A 1NOIA 1ESCA 4M1KA 4MOWA 5DBEX 3QFFA 5HZGA 1DO0A 4RGBA 1YB7A 4G85A 3RK4A 4ETIA 4IEIA 3TYXA 5MF6A 2HYIC 1Y1LA 3B3JA 5DGXA 4CF7A 1F51E 1J06A 5CH5A 4MUFA 5LMCA 2AOUA 5A3RA 4I4TB 4Z7JA 3EW9A 3T8YA 3QPVA 1ODJA 3CKLA 3AJEA 4U02A 1CHDA 1T2DA 3IP6A 1MB0A 2ZYTX 3HDTA 1SWVA 3RRFA 2QRPA 1FMTA 2YZGA 3A11A 6NULA 3HA2A 3Q8MA 3SEZA 3RVSA 2PX6A 3SIXA 1VJGA 5EWJA 3CLTD 5F52A 2L42A 3PFCA 1Z88A 2P4SA 3PEEA 4L4ZA 5LLSA 3REQB 5JQGF 1DO2A 2Y0EA 2AWOA 4R2KA 4AMZA 1YRYE 1WE2A 4X95A 1GCUA 5DN6A 1CUAA 2GBLC 3ICWA 4QHTA 3UMMA 2BP7B 3NNSA 1JW9B 1MAHA 1UJNA 1K0FA 1Q0HA 2CXOA 4O6VA 2JJ1D 4PLZA 4BNNA 4XCXA 1SOWA 1M7HA 1M0SA 4RPJA 3RVMA 1Y1KE 3TAXA 1EBBA 1NYLA 5L3QA 5HSGA 2J3QA 3C6XA 3USES 5H9WA 1L7NA 2BDEA 2CLIB 3FDZB 3E4DA 2IUFA 3LPAA 1KMNA 1MDFA 2B8EA 2PO7A 3QE0A 1TA0A 2FOLA 1YCDA 3NBFA 4AN0A 1I1NA 3OPXA 4H0CA 4DV7B 1L7VC 2D1QA 5JNLA 4YY3B 2WAAA 4MIKA 4C2AA 1ZWLA 1Y42X 3MWEB 4QGBA 5DTIA 1JG1A 4XX0A 3VVLA 1MN6A 4Q93A 3DOIA 3IEPA 4FR5A 4CG1A 4TMTA 4HBGA 4IFTA 2LRHA 3AR7A 3VJKA 1PFQA 1I4WA 1UK9A 4YYZA 1G8PA 3NH9A 1K6JA 1K86A 1WR8A 3BB3A 5ALQA 1PKEA 1U6IA 2PVPA 4K8RB 4OXIA 1GOTA 2C8LA 1JJVA 4O2BA 2ODAA 1SUCA 3ZIAD 2EJVA 3SJ7A 2JLYA 4B6RA 1K8ZB 3RS5A 2VSQA 5FUVA 2RONA 3AYZB 3I30X 1X9GA 4DCNA 2P9HA 2C83A 3VH4A 4DJAA 1P8JA 3CW9A 1JR6A 3BCUA 5LL6P 2R65A 2IHBA 3IBYA 2NUAB 4EO7A 2C9YA 3E7PA 2C97A 4BNIA 4G56A 1WOYA 2Q4RA 4QBGB 4JYCA 5LPNA 3BAZA 1X80A 4V2IA 2BPOA 2XUFA 3GJ7A 4J16C 4F60A 4K6GA 3TNDA 2J9XB 4Q16A 3NIBA 4JJ6A 4DNQA 3OBIA 3NTUA 2O3TA 1NJ1A 3ILSA 4TQUS 1ZVQA 2R2AA 3LDUA 4XDHA 3A9UA 1C8BA 4RAQA 2JAQA 4C0LA 1T3ZA 4Q1DA 3LPCA 1QIHA 4UVIA 2ZK7A 4YUAA 2VPZA 4RHYA 1TI7A 3SIPA 2DUNA 5EZYB 3NKVA 3DUFB 3PUVA 4HTFB 3WIUA 2DE0X 5FADA 1E1CA 2VUIB 4N7MA 1G2PA 1HNNA 1SG9A 2X9QA 5D3QA 1JBKA 2NPFA 1ZH4A 4HPXB 1NR1A 3T3DA 1HQKA 3H4TA 3RRBA 3IP5A 5B2ZA 3EZ6A 5KOHB 2H51A 1L4UA 3JAWA 1V48A 2R7MA 3FSEA 4PPFA 4X94A 1U5CA 5DCUA 3W5CA 1DELA 2XY4A 2P35A 1KY2A 1TUBA 3WQRA 4N6NA 4MI6A 4EZEA 3SFTA 5DM1A 2QYSA 1CR2A 1I4LD 4PC1A 4X20B 5DF1A 3RH0A 2IBMA 3HCNA 5AI0A 2FSHA 4WK0B 5FNVF 3ZVLA 2GN9A 3RKSA 3EAGA 3PDCA 4YJ2F 4ZV9A 1OV4A 5BOSA 1IONA 3HV2A 4D5EA 3O92A 1GT6A 4G23A 3VA7A 3KJXA 3ZUPA 3R23A 2VH2A 1E5TA 3UMCA 5T6MA 3SXUA 1H0KA 3AHDA 5B3AA 1R88A 1HOTA 4GZ5A 1NM5A 4RYLA 1YKSA 3K0EA 4B5KA 3UUGA 4AM8A 4P7FA 3ESBA 2ZR0A 2Z4RA 5AK5A 3AVWA 1K5PA 3W2GA 5KYNA 3DNPA 2REXB 3HMQA 1ESMA 1X77A 3H2ZA 4KWCA 4PVCA 2OFPA 3L5KA 3N39C 1UDWA 3SHWA 3FZGA 3I9KA 2ZJ8A 4N03A 1OU0A 4NWIA 1SXPA 3R9KA 1EGVB 3A9SA 2YMQA 3HRHA 3QA3E 5EERA 5SY6A 4P4TA 1TYCA 1UBNA 3UH1A 2YS6A 1CJUC 5J23A 1AS3A 3AVTA 1PX0A 1I6KA 1QPGA 1R0YA 1APBA 3KDPA 5JWRA 1HRDA 4J1QA 4Y9RA 1KERA 2BW0A 4WCFB 5M34A 2JI8A 4MYTA 1PQ4A 4NY1A 4XKJA 2BYTA 1Z82A 4ZYLA 1EXMA 1WHTB 3CO5A 3U56A 4FUTA 5KQRA 3HRKA 2IU4A 3SDSA 1OGIA 2GBGA 2Y71A 4YJ3F 4RVNA 3BRWA 3GD5A 2BHTA 2FK7A 2RC5A 4IXWA 4KMOA 3ZEAA 5B58C 3OCUA 2CD7A 3GOHA 1LXCA 4A16A 1KQ3A 4PS1A 1SC1A 3O47A 4JR1A 2WKRA 1LK0A 4JLMA 4JODA 3VKVA 1HQYE 3ZNNA 5FOXA 1E4YA 1T4DA 2ZAIA 1VMDA 4OCZA 4U8HA 3OIYA 3IAAA 1B8UA 2XZDA 3DGEC 1MX9A 4FQ5A 5TLSA 1FDSA 3D7RA 4RKYA 2FW0A 2DHCA 3HBNA 3HKCB 1K88A 3Q0IA 2FR1A 4E11A 1JILA 2MR6A 5REQB 3FRHA 1XD2A 3KT0A 4M0UA 4TKMA 5KTNA 3BL8A 2CFTA 5FPQA 3CLSC 4WY2A 4BGEA 3Q5DA 4K6MA 4Y9TA 5DLDA 5GJWC 4MYRA 2NPIA 2WIDA 3ID6C 3ZH2A 3FUVA 1CFJA 2XVYA 4J03A 2VHEA 4JXXA 3HKEA 4GHWA 1FFXA 4ZD6A 4G4SP 1GKUB 4RESA 3PGJA 4URWR 3I5MA 1P9NA 2PLAA 3V80A 2FDXA 2FP4A 1NN3A 2C4WA 3RABA 4ZIRA 4X7PA 1WBBA 4NLLA 2ZZNA 2MYNA 4CWAA 1T5LA 4TX1A 5JPCA 4NBLA 4F2PA 3U31A 3O93A 721PA 3O8RA 3EY9A 5FT9A 4D79A 1E94E 1SGWA 1Z28A 1S9DA 1WMBA 3QVXA 1Z36A 1C4KA 1EFVA 5BSFA 2O0LA 3RSQA 3NHZA 2WWXA 5BY2A 4N1AA 3RYTC 3FR8A 1A2BA 1V39A 3HB0A 1EBUA 2OCIA 3N0RA 3B48A 1L6RA 2HNAA 4BMNA 3RD5A 4Z9XA 5AQ1A 3EY4A 1S2GA 3WGLA 3QEAZ 2BGKA 5JW6A 3B5IA 3FJOA 2VNAA 2W4IA 3UMYA 1RE0A 16PKA 3IPYA 3DZ8A 3M5PA 4HWGA 5J3JA 2ZWOA 2OQIA 3HCEA 3M6AA 1YB4A 4MUXA 3V2IA 5T64A 3RT7A 1UINA 1WL8A 2Q46A 3EE6A 2PSDA 4OB7A 3WQSB 1EDBA 3UGKA 2W6QA 1NRIA 1ISIA 3BMOA 1COWA 1E2FA 1QKIA 4UMFA 1KI3A 2QN8A 1RSZA 3ANMA 2G5PA 2IEAA 4MSUA 4E2ZA 3K2QA 4BQRA 4TQGA 4DJEC 2DSTA 3GT7A 1RJFA 2FG5A 3WLKX 1TMKA 5IJ0B 4EM6A 2V9PA 3IAM6 1JEQB 2DTDA 1TYZA 4V0ME 2DEUA 1TA4A 1MV8A 3AETA 4PWZA 4KR7A 1JPJA 1MNQA 2C1XA 2AG6A 2O5RA 3N28A 1R0LA 3F5DA 2BGJA 4I1SA 4F72A 3LF1A 1QO7A 2WILA 4YMGA 3FF1A 3IUQA 3PX7A 3Q7TA 1TLLA 1G3QA 1W29A 3FYUB 1L4EA 3L6CA 5EE0A 5LMNB 5FBVB 1PFYA 1DAIA 2FG6C 4DB4A 1P0PA 3JQFC 5ARBA 3Q5EA 3BC1A 2CL5A 3L01A 3PKJA 2O3QA 1USVA 2XRYA 5GY7A 1D4ZA 2GWRA 1I0ZA 1JAHA 4ECAA 2I22A 2EFGA 3LUAA 4YBRA 5JS8A 3GFFA 2Q41A 4KCGA 3AVXA 3RHSA 4NEGA 1UT5A 2JIZD 4EGCB 4X85A 5B2EA 4GUAA 4ESVA 1U7PA 5K6TA 3G0HA 5LLDA 2HO5A 1BCSB 2CB9A 3I01A 4K9MA 1GNRA 3OZDA 2I8LA 4ND2A 3SZ3A 4ER7A 1SCKA 1ZMXA 2VHYA 5C1PA 4ZVSA 1N6NA 2CKMA 4Q1CA 5DWVA 2QPTA 4U9HS 4KIGA 2WF5A 4FCWA 4XM1A 1UT8A 4JJGA 4BE9A 5G0VA 3OUTA 1CIPA 1STOA 5F1PA 3DKIA 2I2FA 1J2JA 3GOQA 3BIOA 3T9FA 4DLNA 4WHMA 1JFSA 1IRIA 1S1CA 2VJQA 1RAAA 1A5TA 1YAJA 3P9RA 1SK8A 5KI6A 5K7SA 5ELXA 3AUYA 5C51B 3FF4A 1DWQA 4EVSA 4US2R 4TT8A 1EG7A 2O5VA 2R1VB 3LA8A 3UAOA 3L92A 1EVQA 3OSZA 3ASYA 4PIPA 2IXBA 4YRDA 3ZDRA 5BNWA 5BRAA 1HORA 2WE8A 3ZI0A 2EEZA 3GEMA 4UHEA 3EPRA 3E22A 3SOPA 2J87A 1VLJA 5C0OE 3TTYA 3W7BA 1NLYA 2BFOA 4OB6A 4FD2A 2WP8J 4JLNA 3SQWA 1XUOA 3KL2A 4KITB 5IHPA 1QP0A 4AO8A 3KJEA 1KK3A 1MGOA 2B78A 4Q5IA 2P40A 1K1EA 4PX3A 1IN4A 2C54A 2J3DA 3GUVA 4CMAA 3WLEA 2Y4OA 2JFFA 5B1DA 2VF8A 5BWBA 3QVWA 2HCBA 3E9ZA 4JAVC 1ZY2A 2ERYA 4G2NA 4LV5B 1XA3A 4IIUA 4LZZA 3VO1A 1SPBS 1OAKA 2GN2A 1D6NA 2Z6VA 3OQMA 3JYLA 4LEIA 1GSHA 3LW8A 3WGNA 1ZD5A 3ZE1B 3DZDA 3EFOA 1HF3A 1DFGA 2X86A 1Y7HA 2Q28A 3A1UA 2CEAA 2FXIA 4G5YA 1W49A 4IIBA 2DUUA 3B1ZA 4IXDA 5CW1A 3UJ6A 4BZPA 3OE4A 5LMUB 3ON5A 4RGQA 1IZ9A 1UMKA 4X45A 3RVOA 3QMWA 1N9ZA 3ED1A 4EWLA 1T2UA 4OQQA 3FCUB 4TV8F 4B85A 3GRFA 2HI0A 3TQQA 1FUEA 5BNIA 2ZZMA 5EHZA 4BBZA 2WLSA 3NTRA 4ND8A </