3OIWA

H-rasg12v with allosteric switch in the "on" state
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oiwA00
1COWA 3HYRA 1QG2A 3GLIE 4MYHA 2NO1A 1ZBDA 4A92A 2CNWA 3HP1A 1TU3A 3K0FB 3I62A 2OCYC 4IOLA 1G8GA 1RZ3A 3CRMA 3H2YA 3AP3A 4S35A 4XH9B 4IOMA 2H57A 2ZU6A 621PA 3W3AA 4ESHA 1II0A 3CB4A 1OYWA 3CW2A 3K53A 4QGAA 1DAGA 4F4IA 1NY6A 3RWOA 2R8RA 5AJVB 4TTPA 4UJ3A 1RRGA 3OE7A 2ORIA 4HDOB 2PCLA 5FL7D 4TQUS 1ESNA 3SHFA 2PEYA 3U3KA 1YR9A 3NG1A 4U02A 1ZM7A 4C30A 3SS8A 4ZIRB 1XMSA 4GOJA 4D4LA 1OXSC 3RRMA 2Q3FA 4EPTA 4C0BA 4QGGA 1J2JA 2JLUA 1UKZA 1LVGA 3MWKA 3T5GA 5KDLA 4Q00A 2YWGA 2QE7D 5EE5B 5CM8B 3T61A 4A6PA 5KNBA 1U98A 3K70B 2FFHA 1A5TA 1F2UA 4BFXA 4JS0A 2WM9B 1Q1QA 4X8LA 3UKDA 3AKDA 1OH5A 1E4VA 3X1ZA 2P6RA 4WA7A 4OI1A 1Z06A 3VMFA 1X6VA 1S2MA 1AGRA 4XD7A 1CR2A 2Q3HA 2OUKA 3I92A 3EWAA 4FCVA 1ZU4A 1IN8A 2XB4A 4MGYR 2GNOA 2C04A 4M0LA 4RFVA 4IVRA 1UDXA 4JLBA 3IIJA 2WWXA 3EAQA 3EZFA 3LXRA 1EG7A 3W5IA 4KBFA 4IHQA 4EKDA 4HB4A 2QMHA 2RGNC 3TR5A 5HZHA 4US2R 1IN4A 4ZV4A 3QXXA 2CJWB 2IL1A 1QHXA 1XD2B 1YU9A 1OFTA 2FFQA 3QKSB 1DADA 1P9RA 1KDRA 1XCPA 2PCJA 1Z2CA 2AWNA 2PZEA 4HLCA 5E95A 1ZNWA 3DOEA 1XFAA 3WY9A 2H17A 2ASEA 1OXTA 5JWOA 3K70D 4JLOA 3KJHA 2IYZA 4Q4HA 1AS3A 4NYMR 1E79A 3AVYA 1EK0A 4LV8B 1KI4A 4LJ8A 1XXHA 1Z6AA 5GJWC 3RLFA 2GEVA 221PA 1KJWA 4A82A 3G5UA 3QXSA 1CJTC 2B21A 3C15C 1B0UA 2OBMA 3I73A 2GCOA 1D5CA 2JIZA 4TQ9A 4BGDA 3THYA 3ICEA 4DKXA 2FGJA 4QBHA 2QL6A 1N5KA 1R5OA 2JLYA 4QL3A 3ZD6A 3QVVA 3ASZA 3VTKA 1XX6A 4R98A 4TTQA 1DEKA 1IHUA 2ZRJA 3L0OA 3NEYA 4L15A 4DC9A 1E1RD 1KI1A 4Q1FA 4DCNA 4V0LA 3B2EA 4AYTA 2GAAA 2ZRBA 3BBPA 4FMCB 2I4IA 3AVWA 1R8SA 1C4OA 1TUEA 1JBKA 2HXYA 2J7PD 1XTIA 1U8YA 1YR6A 5F2EA 2ERXA 5C4MA 4JKYA 3BFXA 3R9IA 3SE0A 2BMJA 3RRNA 2ZE6A 4OK6A 5LB4A 4DLVA 4LJ9A 3OAAD 5G40A 2JJ2D 4JBYA 4BRUA 1NVVQ 2FA9A 1S0UA 3A1SA 3A1WA 3B6EA 4B44A 1XDBA 1Z63A 4HSEA 3PCRB 4QG7A 1OKKD 1PUIA 4E03A 2ZXUA 2QN6A 4P4TA 3T1TA 2O8EA 1TQ2A 4H1VA 3OEEA 4OQMA 1DAEA 3VX4A 2XSZA 4AI6A 4C0LA 3Q7QA 2DWOA 2D2EA 2QRZA 2C77A 5TARA 2DFNA 1SXJB 1NF3A 1W46A 4PR0A 4LYFA 5C2JB 2YJTD 4DUGA 1AKEA 4Q4LA 1P2VA 5LB2A 3ZGXA 1NG1A 4AKGA 3OESA 3U7GA 5FPYA 1Q1ZA 1X8JA 4D82A 4JLMA 4PSVA 1J90A 3IGFA 4C4PA 1RRFA 2GK7A 1W5TA 2J5XA 3B1YA 2EU8A 3QI2A 2BM0A 3PEUA 4BLPA 4GPTA 1C1YA 2RGAA 2GILA 4BASA 2YWHA 4MUBA 1DOAA 3QF4B 1UBCA 1B23P 4OBEA 1KJZA 3A4NA 2QQEA 1YR8A 1N3BA 1GL9B 3I5YA 3KZ1E 3KKNA 4NONA 4XVRA 4B47A 1Q20A 1SXJD 2OFWA 2WOOA 1N6NA 2E9SA 3WNBA 3Q85A 3I61A 3WP1B 5JHHB 4OI2A 4CW7A 5TB5A 2ATXA 4JSYA 2J1LA 4BFUA 4OHYA 5GVRA 2FU5C 2R2AA 2BCJQ 3KUDA 4D0LB 3KQUA 1NSTA 3BOSA 1IY2A 2QP4A 1F6BA 4Q1EA 5JEDA 1NLYA 5AJZA 5G3YA 2FV8A 3CX7A 3GLGA 2NPIA 4KXFB 5FL7A 2IYUA 4HYYA 4EFNA 4C0HA 2ZRMA 1X86B 2ZI5A 3HR8A 4LWZA 3TE6A 2QORA 1BYIA 3NC0C 1P5ZB 3SYLA 1N6PA 4IKEA 1O3YA 5G3ZA 1E2NA 1VIYA 3EIEA 4PC2A 4KYIB 2W2TA 4I99A 1NMXA 1QF9A 4GZLA 2QE7A 4KSBA 4PZLA 5FOVA 4BECA 3ZQJA 5JWRA 1J70A 3N2EA 1G8HA 3K0FA 1YZGA 3FYHA 4NTZA 2NG1A 4NL4H 4A6XA 4DCSA 4AKHA 2P0EA 3AF4A 4OQLA 1GG2A 3MWJA 4X8MA 3VKHA 3SQWA 4G5RA 1Z29A 2ZE7A 5AJYA 2VRWA 4DZZA 1XMJA 3P20A 1Q22A 3DDCA 3K09A 2CDNA 5E4FA 2TMKA 1D2NA 1E2EA 3ZS9A 3K0AB 4FMCF 2D7CA 1UPTA 4BZXA 1XPOA 5B30A 2KI5A 4XOIA 3IKJA 4DSOA 4DB4A 1JR3D 4URVR 4ZCMA 3TUJC 2KB0A 1TU4A 4UNRA 1FTNA 3PXGA 1Z6GA 3IQWA 4Q9KA 1EFUA 4ACBA 3SJAA 2RGGA 4YC7A 4C3ZA 3T1VA 4PC3A 4UXJA 4RD0A 5FR1A 3EZ2A 3RAPR 4CEJB 1KHTA 3SJBA 1OH7A 1FFHA 2CCGA 4IRUB 1KAOA 3O8CA 1J8YF 2N42A 5E7JA 3QXJA 4PC1A 4DLTA 3EIQA 3VAAA 1TF7A 1U99A 1EX6A 1CJUC 1W5SA 1WDTA 4BFWA 4BEJA 5KSOA 2D7DA 2F43B 1XD2A 1E1RA 1FMJA 2FH5B 2EVWX 3QKSA 4DB2A 1G3RA 2CBZA 3TLXA 2JLWA 1Z0IA 2AKAB 1E2JA 1US8B 1OPXA 2QMOA 2QY9A 1U81A 3GJ6A 4PO8A 4PSAA 4Q18A 4LOAA 2J7PA 2AL7A 1QHIA 5J4LA 1PLJA 1LS1A 5CYOA 1W36B 5JJIA 1KDPA 2P65A 1M6NA 3TBKA 5B2ZA 3PEVA 5EUQB 1GAJA 3REFA 3FFBA 3OAAA 4AIIA 2IX3A 1QHHB 2JJ2A 1JECA 3LAWA 3D7MA 3ZZ0A 4CEHB 1KKLA 1RKBA 2FPLA 3AKEA 5DI9A 4AG6A 1TTTA 1OKKA 1VYVA 3FHCB 4D26A 5LBIA 1GOTA 2DFKB 3E1SA 2A5YB 2ECKA 1Z0AA 3L43A 3ASYA 3WMFA 4EDHA 4P31A 5DN6D 2J0SA 4WOPA 1EFHA 2IXFA 3FWYA 5JRJA 2O8FB 5FOXA 4GL2A 1ZMXA 4XJXA 1RPZA 1KSFX 2JCSA 2AFIE 2F1HA 2QTHA 3KKPA 3SDZA 3BH7A 1W36D 3CBQA 1SKYE 3U3MA 2KWIA 4TYNA 1S3SA 1VG1A 3SHWA 4G5SA 4TYQA 3CWZA 1FQJA 3KB2A 1UBGA 4V03A 4FD2A 2BWJA 1N6OA 2CL6X 4M9SA 2FGKA 2VHTA 4N3NA 1IAQA 2CHVA 2W83A 3I4LA 3RVBA 3V00A 4Y0AA 5GJBA 4V0MA 5JCPA 1DG1G 2NTYC 1YQTA 4IW3B 3OF5A 2PJZA 4WAUA 2FDCA 1W48A 1VCMA 4P0TA 1VTKA 3K0EA 4RFSB 4DHEA 1Z8FA 3WNDA 3AF1A 2ZANA 1AZSC 1AZTA 1R4AA 3I72A 1SXJA 4NHOA 4Q4AB 1W4BA 2Q9BA 4TL9A 4OI0A 3MCAA 3N5CA 2EWVA 2ZI3A 1PJRA 2J59A 2HF8A 1ZAKA 5CJ2A 1TEXA 3B5JA 3CKLA 2W2VA 1KJYA 3ONWA 3SR0A 3W6OA 1S1MA 1Z08A 3RS3A 5TVKA 1DO2A 3CZQA 1VG0B 1HURA 1K8RA 1W44A 3ZDQA 4URUR 1W0KD 4ZI3A 1L2TA 3C5CA 3P4XA 2DB3A 4B43A 1I4TD 1Q3TA 3QF4A 4NYJQ 5JCZA 4YMSA 2OCBA 5J4YA 3A1VA 1GNQA 3ECCA 3HWSA 4M1OA 4HAZA 1UADA 4BZPA 1U2RA 2JDID 4G3XA 3L8ZA 4PHGA 4OKSA 2ODBA 1MO4A 2QTVB 3DZ8A 1E32A 2ZE5A 2IYQA 1XJ0A 3DVLA 1MKYA 3LBHA 5FOTA 3B1VA 2FX3A 4CDGA 1G41A 1P61B 4CEIA 2VL7A 3D31A 2ZI7A 3CR8A 4RKEA 1NP6A 3A8TA 4V0KA 5FBLB 1TPZA 1AK2A 1HTWA 2FF7A 2HUPA 2VPPA 4L9WA 4Q7LA 1CRPA 4I1OA 4LJAA 2OE2A 5CM9C 1CBUA 1VMAA 2ZYVX 1XRJA 1GL6A 2NZJA 2OLKA 5FTKA 4MDEA 2ZTSA 1ZC4A 2VHJA 3B1XA 1JR3A 4PC7A 5EUMA 5BW8A 4PAOA 5KHOC 1UDWA 3RYTC 3UMSA 2VIIA 1LS6A 3LNCA 1XXHE 1G6OA 3B9QA 4HB0A 2VA8A 2NIPA 4EFLA 4D81A 3RS4A 4PAMA 2A78A 5EQTA 1OIWA 1Y63A 1P7CA 4IDNA 3RNLA 3ZD7A 2XXAB 1CXZA 4FINA 1TF2A 2ONJA 2XITA 2WJHA 1NY5A 1NRJB 5AUQA 4UJ5A 2IYXA 1OH6A 1TQ4A 1XTJA 2GF0A 2I1QA 4JJKA 4A2QA 4HZUA 3VQTA 2ZJ8A 3HR7A 3VR2A 4DCUA 2J45A 2OESA 1LF5A 2LCFA 3C4JA 1RE0A 1AIPA 1JI0A 2ZRKA 2BBOA 5LPNA 1YJ5A 4HLUA 4AC9A 5GJVC 3EA0A 3ZIAD 2PMDA 2YYZA 1VHLA 5G53C 2H1LA 2B8TA 1IONA 3GQBA 3JZMA 4DCTA 2UVQA 1G16A 4DLYA 1M1YE 4F4JA 3CH5A 5TDHA 2ZYTX 1KNQA 1G6HA 1JR6A 2ZSFA 5C4GB 2V6JA 1T6NA 2ZUCA 1GDDA 1LV7A 2UZ3A 4MRNA 8OHMA 3QIAA 1A2KC 1L8QA 3NBXX 5DHAA 5CITA 421PA 2NQ2C 1W1WA 3P27A 2F6RA 1MV5A 3QUSA 2HYDA 4P4SB 5KSZA 3MSXA 1ZNZA 1E96A 3B9PA 4FWTA 4CEJA 2WIAA 2C9CA 5JS8A 2D2FA 3OFND 1E9EA 3MWLA 1KMHB 3V4FA 1MO5A 1ZCBA 3NDBB 1F2TA 3PUYA 2ZIAA 5J4HA 3VU9B 1N2CE 2JLRA 3BIFA 5EE0A 1NMZA 1IJFA 3X1YA 3EPJA 3P4YA 4ZO4A 1OIXA 3SOPA 4QNRA 3PJRA 5FH9A 1DO0A 5DN6A 5EE9A 3WP0A 1US8A 3CONA 3H4MA 4M2LA 1GRNA 2IEZA 1DVRA 3FFAA 4KFSA 4QOSA 1CIPA 2D74A 3ZZTA 1C9KA 4NYIR 3LRPA 1KO8A 1D8TA 1E9CA 1FNNA 1OIVA 4O0MA 4W5JA 2HCBA 2RB4A 3GJ3A 1CRQA 1U8ZA 1O87A 2QBYB 4A0FA 5AR1A 1UF9A 4TQAA 5KSPA 3VKGA 5IRCD 3H84A 1QHHA 2XOKD 2GETA 3PIRA 4NCKA 2QRNA 2WKQA 2YVUA 3Q8XB 4L9SA 1ZW6A 1ZNXA 2REBA 4CEHA 4Q9IA 2WOJA 3A6PC 3K09C 3SC3A 2JIZD 1Z28A 1ZUNB 4V0OA 5HCNA 3R9XA 2BDTA 1XPUA 2ZSEA 4PPQA 3DM9B 1II9A 3PUZA 4URZR 5FUXA 4D80A 4QHYA 5FUVA 3KB1A 4C0SA 1Q1BA 3WMGA 2PLFA 4JT2A 4PZYA 3SJCA 4BFZA 2O8FA 3IPYA 2H16A 4JLPA 2DWPA 4R2IA 2P3SA 4RD2A 4B75A 4B2LA 2FSHA 3CLVA 3MG9A 4D4KA 2IS6A 4JBXA 4R7ZA 3GFTA 3GLGE 3K70C 3OEHD 4UNSA 1NMYA 3L2OB 4KVGA 4DSTA 3QPWA 4WIAA 3U3OA 5CIWA 3QOFA 4BQSA 3LY5A 4B76A 3ND9A 3ADBA 3TUZC 1W0KA 2HJGA 4UNNA 5KPJA 1G4AE 1KO1A 4TMVA 2HYIC 4XIGS 2C8VA 4Q66C 3SFVA 1KK0A 1IBRA 3CZPA 3PENA 3BERA 1QBKC 5EXSA 1NLZA 1Q0UA 2VSXA 1UKVY 4RFSA 4NCNA 1XJCA 1KSJA 3ZVNA 2X2EA 3I1FA 4Q4AA 4P4UA 2IT1A 5DYGA 2JASA 1XMVA 3PQCA 4M1SA 2IXGA 3LO5A 4M9QA 1JQJC 4I1SA 3AQ4A 3LWNA 4MKGA 4BE7B 3U2QA 4MKHA 3QSYA 1UAAA 2X1VA 4HDQB 1AN0A 2GBLA 2VSFA 4QGHA 3I8SA 3FTQA 1NVXQ 1PZNA 5DH9A 3U60B 2FZLA 2FOLA 3HPRA 4KFRA 1W4RA 1Z6YA 5D3QA 2BEKA 2BHRA 3N2IA 4BEBA 5FTNA 1GRRA 2DFTA 2ZITA 4JLAA 2GCNA 3T06B 4ASUD 2IUUA 2V1XA 3GEHA 4TZ6A 1T0HB 3B85A 5J47A 1NN5A 3CRVA 4HUQB 3U61B 1CLUA 1M2OB 5TV2A 1D9ZA 2VH5R 1GFIA 4RZUA 821PA 2NO9A 3RWMB 4DEXA 3ZH9B 3KQKA 3WHKA 4BLTA 2AK2A 4TMWA 4QNMA 4V0NA 4LDJA 3O47A 4KODA 1J7KA 2G9NA 1HE1C 1FUUA 4B74A 2RGDA 2ZJ2A 4EPWA 1YRAA 3DO6A 4XWOA 5E7IA 1ZP6A 4TL6A 2RGEA 4IDOA 3CPHA 5DNYB 2PEZA 3HPQA 1LW7A 3QF7A 3AGQA 4RD6A 2GXAA 2CVHA 1W49A 1ZRHA 2WAYA 4DRZA 3ZIAA 4F92B 4TLBA 1JJ7A 3RSOA 5KNDA 3AKYA 4P3YA 1EESA 3BXZA 3L0IB 1XB2A 2FMXA 1MRSA 3G82C 4BFVA 4C2UA 4GMDA 1H8HD 2W58A 1SXJC 4IEEA 5JHGB 1YE8A 2XXAA 2CVFA 1U9IA 2YC4C 5BN4A 4YDSA 3B60A 3MFYA 5BN5A 4GT1A 3KKOA 2FPKA 2C9OA 2ZUDA 3OFNA 1Z0DA 1JJVA 3B78A 1Y3AA 3GEIA 4HAWA 3VHLB 1R0YA 4DJTA 4C0JA 5E3HA 5IT5A 3SN6A 3GFPA 2R62A 1S3GA 5FTLA 4TMTA 5GVSA 1T9HA 2Z5FA 2HDNB 1BYUA 4WVFA 1TADA 1WMSA 1PLKA 4L8GA 1ZM2A 3RDPA 2VHQA 3PUWA 2KBEA 4ZCLA 5C46F 4LGMA 4URXR 5AWFC 3V4RA 3KXLA 4ITRC 3MLEA 1ELOA 3AEZA 1ZIOA 1KSHA 1SVMA 5A4JA 3QE0A 4QXAA 2A2ZA 2IYSA 4AYXA 4LX0A 2B7BA 2HF9A 2BM1A 4DVGA 1KDOA 2YWFA 4GOXA 4B34A 3KXKA 4V0ME 1G9XA 4P4SA 1XU4A 4Q7JB 2MSEB 2XOKA 2CE2X 2EFEB 3IBYA 2DHRA 1KMHA 1ZUHA 2RCNA 1Z3IX 4BFSA 2C96A 3VU9A 1T5LA 5JEEA 2ZI4A 3LH5A 2RAPA 4HZIA 3O8RA 5SZHB 3QVUA 1SXJE 3SNHA 3A1TA 1EWRA 1HY3A 4GSYA 4EFMA 1XD8A 5F98A 4A2WA 4IVQA 4J0QA 4LYHA 1SQ5A 3LW7A 4QJ5A 2O8DB 2F1JA 4LRWA 4JZKA 3AF2A 2EQBA 2REXB 3BB1A 4KFUA 3VR1A 1P4SA 4G0NA 1ZIPA 2CHGA 4K81B 1A7JA 5L3SB 4M22A 2IYRA 1P72A 1DAKA 1YRBA 2ZRIA 3JVUA 1OLOA 5D3MA 3KJIA 1OB2A 3UXMA 4RZ2A 2AD1A 3OEHA 1UKYA 4B3BA 5B64A 3SQXA 3VNUA 4LJ4A 3EPLA 2QBYA 4IOKA 1KI2A 4B48A 1XTSA 2ZYWX 4TWZA 3KJEA 4I81A 1WRBA 2OT3B 1NKSA 1JALA 2VEDA 3EA5A 5EJEA 1R2QA 3U3RA 3B13B 4B3GA 3Q7PA 4DDVA 1G3UA 1ZD9A 5CDFA 1RRPA 1R6BX 2GXSA 1AS0A 4JT4A 5EP2A 1MOZA 4MQBA 3VHXA 4V02A 4A8JB 4Q7KA 5DE3A 5A0FA 3R7WA 3ZYCA 3FPAA 1GIAA 3RS7A 1LF0A 5BQ5A 3IEVA 1KK3A 2ODWA 2QAGB 3DZDA 4BFYA 4C7OB 3CUEF 4JL5A 3GJ7A 1G7SA 2ZSAA 4TMXA 2XNSA 3DM5A 3AVQA 2C5LA 3W6PA 2FWRA 1QG4A 2QMUA 1AS2A 4U5XA 2ZRHA 1KNXA 2V7QD 1P6XA 2QGZA 4B3FX 4C2TA 2D4HA 3C5HA 4C0KA 1E0AA 3IUYA 1CJVC 1K6MA 1R5BA 1SVSA 4A0GA 4BUJA 1JR3E 2DBYA 3VR6A 2V9PA 2ZS7A 4MUAA 4JL6A 2V54A 4AURA 3AUXA 1FX0B 4ASUA 1CU1A 2AHOA 2IYWA 2P2LA 3PVSA 4NMMA 4RVCA 1G291 4TMZA 4F93B 1NVUQ 2BIFA 1R8QA 3D6TB 1GNPA 3PUXA 3QXHA 3U44B 2DYKA 1MO3A 3K8YA 4US1R 4KAXA 4QFMA 3QEOA 3D3QA 2B7CA 3SYNA 1KDTA 2CLSA 3QPVA 4PO9A 1VHTA 3AH8A 3FMIA 2GEUA 2GJ9A 4WXPA 4B73A 5CK5A 5JECA 1F48A 3AVXA 1N0WA 1IM2A 1W36C 4O25A 1CR1A 5SZJA 2WHXA 1P75A 3NTUA 2ATVA 4XVQA 3LVRE 4CYMA 4Z54A 3MUFA 1T3HA 2RGBA 4KU4A 5FPSA 4WW0A 3AVVA 4FWIB 4CT4B 2H5EA 2YKGA 3X2SA 1A2BA 2IK8A 2Z6VA 1G4UR 1ZINA 2BKUA 2IYLD 4MGZR 2ZVPX 4PHTA 3U7FB 2PT7A 3TQCA 1S9HA 3MMPA 4D2IA 1EXMA 2WJGA 2YNMA 5FI0B 2OBNA 1XZPA 2G0NA 3DL0A 1E2MA 3TVTA 1E9SA 2RKOA 4HUQA 3SU8A 2V3CC 2C78A 3ADKA 4UXHA 3I3SR 4LV5B 1H8HA 4NH0A 2P5TB 4Q1BA 2EFGA 2JLZA 4MKIA 4JBWA 3BB3A 4S2EA 3ADDA 1GM5A 2NPFA 4IXNA 5CB6A 4DIEA 4LSGA 2GZAA 1H8ED 1LTQA 4IXMA 4XWAA 4Q03A 4PPNA 4CIDA 3THWB 2J3EA 3ZZUA 4US0R 4OHVA 2FJUA 3AP2A 2VF7A 2VP4A 2GK6A 4PFSA 3KQHA 4LJ6A 2F3TA 3ND8A 4ZIRA 2IF0A 3LX5A 2BBWA 3MGCA 2JA1A 5B58C 1KI7A 2QUZA 4FIDA 5JS7A 2WWYA 1CEEA 3FDIA 3NIBA 1GILA 1GKUB 1WF3A 4LHXA 4N0EA 1ZVQA 1VDZA 3MJHA 1R0XA 4C0AC 4EPYA 4NP6A 1GUAA 1Z2AA 2G1KA 3CNLA 2OFXA 2RHMA 2CEAA 5A5GA 1NVVR 3FB4A 3BGWA 1ZM9A 4ZKEA 4B2IA 3H86A 4LJYA 5CB8A 521PA 4OJKA 4NU0A 5HE9A 3TR0A 2BVNA 3IHLA 2GBLC 2Z43A 3T5DA 2ANBA 3ZVLA 4A0HA 4EPXA 1AQYA 4D25A 4EQ6B 1E3MA 3PEWA 2BBSA 2FSFA 4B33A 3X1XA 2ZYUX 4YONB 2ZE8A 3AVTA 1KSGA 3E5HA 2B6HA 4GOKA 5KO2A 1Z22A 3OIWA 2CJWA 1IY0A 1N6KA 2QQ0A 3B8HA 1OFIA 3O8DA 2C99A 1XEXB 3QQ5A 5AUOB 1E0JA 1E6CA 1WB9A 3VNVA 3QXCA 3C8UA 4WZ6A 3AP1A 1W4CA 4JVMA 4UQOA 4UXIA 1IJEA 3AVOA 3UIEA 3GLFB 3LBNA 3EC1A 4FN5A 2OAP1 3A36A 3U3JA 2JEOA 5JLJA 4B2PA 2DWQA 2MSCB 2DY1A 4RSGA 3S1AB 3TKLA 1S9DA 3DHWC 3WYAA 2O8CB 3P26A 4Z1MD 1KO5A 1MT0A 4DT1B 1X8KA 2QPTA 2HCJB 3LD9A 3TW8B 2ZAOA 2ZS8A 1QVAA 2R6DA 3Q72A 5KSYA 2O8DA 4NDZA 1OHHD 1LNZA 3QJYA 4M4SA 3WBKA 2HEIA 1E9FA 4Q4JB 2ZREA 4HLQB 1KGDA 5CYPA 1I4LD 5KYKA 2QSYA 3OIVA 5DIFA 5L3SA 1ZU5A 1KAGA 2F9MA 1Z5ZA 4HAVA 1FZQA 4AK9A 2Y8EA 2KSQA 1YKSA 1Q44A 1E1QD 2AKYA 1SVOA 2EFHB 2V7QA 4LJ5A 4QHSA 1DAIA 1XNJA 4DLRA 1SHZA 2IBMA 5DI3B 3ICQB 5HZKA 2O0KA 3WYGA 2VP6A 2WWGA 5IHPA 4F7WA 3EPHA 3BJIC 4KITB 1T3LA 3O8BA 3Q9LA 2A5DA 4A8JA 5EE1A 1M74A 1RYFA 2G6BA 1S96A 3PG5A 1CP2A 3R8CA 4YMVA 1FPMA 3CWQA 2QAGA 2QEQA 4POAA 2CCKA 3CX6A 4C7OA 4PPGA 2DCUA 5EXPA 5ELXA 2G0TA 1A82A 4F38A 2G77B 2GJKA 2OHFA 3HJNA 4WXRA 2WKRA 4YMWA 2XZLA 1I2DA 3EX7C 3C7KA 4ARZB 3DMDA 3AVUA 4Z51A 3OIYA 3NBFA 3EZ9A 5CJPA 3HU1A 3UG6A 4RCYA 1F3OA 2ZRPA 1T8UA 4GNKA 3TAHA 1VIAA 1W47A 1KYIA 2J0VA 3U4QB 1Q21A 3GLHB 1UEJA 3WRYC 1G5RA 1DBSA 4GZMA 2PJRA 4RD4A 1FX0A 3CF6R 4KYUA 1UFQA 5HCIA 3HYTA 3MRSA 5CK4A 1GKYA 1ZNYA 2CK3D 1HT2E 4MRVA 1D2EA 3U44A 3A4LA 4Q47A 4DSUA 2NO7A 2QSZA 2ZR0A 4MRRA 4GRAA 4P32A 4LBYA 1EFTA 4HAUA 3TUIC 1NLFA 5FUYA 2WTUA 1NN3A 2KBFA 4GMXA 1AA9A 2JLQA 2YOGA 2AN9A 4M1WA 4ESVA 2P6UA 3ZVRA 4BRWA 1KY2A 4YXWD 1N6IA 1H8EA 1SKYB 2RGNA 3LVQE 5FI1B 5HKKA 2NGRA 2O5VA 6Q21A 5L3VA 2REOA 1KI8A 1IXSB 3CX8A 4GFDA 5IF9A 4MRPA 2FPMA 2LKCA 2C03A 2WIBA 3RANA 1MABB 4BPBA 4DLXA 1J99A 1Q57A 4M21A 3KTAB 1TX4B 1PUJA 2JATA 2KJQA 4B6FA 3M0EA 3CO5A 2PL3A 1PLLA 3AGPA 1E9RA 4DLUA 2PX0A 3RHFA 4A2PA 2JAQA 2WZQA 3SEAA 2IS4A 3DPUA 4KV9A 3BD9A 2WMNB 4Q5IA 4LBZA 3F3YA 2IA5A 3FVQA 1G3IA 1WP9A 4II7A 4OQXA 4TYPA 1HA3A 3THWA 2YOHA 3RS2A 5M04A 4OYHA 2GKSA 3CIOA 4K8OA 2PZFA 1M7HA 4G5GA 3LA6A 3K0AA 1Q3HA 1XJQA 2VP9A 2GA8A 3RC3A 2ZJZA 3JZAA 1Z47A 2A5GA 1XTRA 5E7MA 1WXQA 5J40A 1E2PA 2HT6A 4TT3D 1GSIA 3BK7A 3QPUA 1FQKA 1E4YA 5KU1A 2YWEA 4ZKDA 3EZ6A 3WBJA 2H92A 1EGAA 4QM7A 3VKWA 4IFEA 1G7TA 4LK2A 2O0JA 3PV0A 1M34E 2G1JA 4LHWA 1J8MF 3R9WA 1I2MA 1MRNA 5CDFE 1EFCA 3Q3JB 2E1RA 2GJ8A 4OHZA 5CLLA 1RIFA 5FL3A 1DELA 3SYKA 5LDDC 2WVJA 2F1RA 4R71A 4CT5A 2ZR9A 1JQLB 4IFBA 4LHVA 2AK3A 4Z1MA 5KDOA 3EWSA 1S8FA 4AY2A 3NWJA 4BLRA 2W6ID 4EQ6A 4W7SA 1W0JD 4U00A 1MH1A 1G8FA 2XJ9A 4RD1A 3OHMA 3C14C 4LJ7A 2C98A 1ETUA 1OHHA 2CE7A 2F43A 3EASA 1ZM3A 3BH6A 5LD2B 4ZI2A 4JLDA 4WBSA 1WBBA 1GVNB 4LHYA 3L8YA 4XVUA 4PQFA 4Q4HB 2X8AA 1X8LA 2IC5A 2Z4SA 3A58B 5FR2A 1XXHB 3UK6A 4B32A 5BWMA 1K5DA 3PUVA 5H8WA 2CLDX 3GLFA 1JEDA 2XNDD 1E1QA 1XEWX 5HTKA 2ZSBA 1AQUA 2BJWA 3TNFA 1MO6A 3RC8A 1NJFA 4KHZA 4LPSA 2IW3A 1CF4A 1OFHA 3S1AA 2O8CA 5H70A 4A0RA 1X3SA 2IYVA 4E22A 5JWHA 4EPVA 5EZ6B 2DPXA 4NYJR 2GWHA 2B8WA 1JEEA 2QM8A 4DT1A 1CKEA 1G21E 2CHQA 4DDUA 1RW4A 4XSGA 2LKDA 5DYIA 2GJAA 2NOAA 5JZVA 3CF0A 1FP6A 4KCGA 1VCNA 2Q3MA 1TL7C 3VR3A 2OSBA 4O3MA 1A4RA 1G64A 2R6CA 3LFUA 3P32A 5FFMA 3W34A 1SVWA 2QENA 4JYCA 1JPNA 4NCIA 1G5PA 1VCIA 1HEIA 3DMNA 3U7HB 1ODFA 5BN3A 1S1CA 2W6JD 3GD7A 4OQNA 4GDFA 1Q12A 1IQPA 3HDTA 3W5JA 1E2QA 1W2HA 5IDVA 1DS6A 2CMKA 3I8XA 4IVPA 4JYBA 4H9GA 3KDSE 4U7DA 4GP7A 1KMQA 4NPHA 2P5SA 5DI3A 4G5OA 3TMKA 5L3QB 4JLVA 3BC1A 4BZQA 3KQNA 4QM6A 4HAXA 3IIMA 1OT3A 1GP2A 3ETLA 1KI6B 4YMUA 3GJ8A 3EARA 2JGNA 2VSOA 4A36A 2F9LA 1II8B 3KFXA 1E98A 4QBFA 4A1FA 4MDFA 2CK3A 1L7VC 2WSSD 4LYJA 4D4JA 1OSNA 3K9GA 1HE8B 1U0LA 2ZSDA 2Z4RA 4NZYA 2O0HA 3H1TA 3K9NA 4OI4A 5FUWA 3F5FA 2PT5A 2AXNA 4Q1DA 2EW1A 1U8AA 1YZQA 5AUNB 4NYMQ 4ARZA 1YZKA 3F0TA 4YXWA 1FTSA 5FTJA 1ZD1A 2XAUA 5BYJA 4JL8A 3AV0B 4B71A 4B3XA 4NCHA 1E9AA 2PX3A 1X1RA 1LB1B 2OG2A 3OIUA 1T8TA 1PV4A 4NBSA 3THXB 3U4QA 3ZS8A 3CR7A 1Z6TA 2WJJA 3GLHA 1VECA 2ZUBA 4FCTA 1VCOA 2UKDA 2Z0MA 2HXSA 4TLAA 2QGNA 4M9XA 2MSDB 4TLCA 3WRXC 4ZDKA 1NBMD 2F7SA 4FW9A 2ZRNA 3B82A 1GL7A 1E9DA 1DAMA 1SHKA 2WJIA 1TQDA 1YVDA 1GZSA 5SZIA 5BXQC 4NCJA 3MD0A 3LV8A 2QI9C 2CXXA 4M9ZA 4M1MA 4C9BA 1HV8A 2YZ2A 4TLEA 3T1QA 5P21A 1TF5A 2GDJA 2GESA 3JVVA 5DHFA 4M1YA 2BC9A 3LLMA 1BO6A 2GXUA 3WMEA 4B3DA 2BOVA 2RMKA 3KKQA 3IQXA 1R7RA 5F9HA 4I1VA 2NO0A 1ZYUA 4DLZA 2QPOA 5EE3A 3UWOA 1MABA 3BB4A 4A8JC 4MYCA 1AKYA 4TT3A 1CJKC 3KTAA 2R6AA 1NIJA 1NIPA 2QAGC 3T35A 3QENA 4QC2A 5UKDA 4EJSB 3C16C 5FOUA 1U0HC 2F1IA 1BH2A 3B1WA 5DSZA 2ZAMA 4P33A 4M53A 2N46A 2WAXA 2FFBA 3CF2A 3M6AA 1PVOA 2IEYA 4JMPA 1TNDA 1KZGB 3IEUA 1R0ZA 3M1IA 4URWR 2EWWA 4D0GA 2N1BA 1GWNA 1IN7A 1FL9A 2RGCA 2W6IA 2XX3A 1DAFA 1Q1EA 1F5NA 1W0JA 1Z83A 2IHYA 1G5TA 2QNRA 2ZJAA 3QG5A 3T15A 2Z83A 3PFIA 3I5XA 5FOWA 3SBEA 2WBLC 1ZC3A 1W2GA 3NHAA 4Z8YA 3BFVA 4E07A 3TGPA 2BCGY 3FMOB 5IK2D 4UNPA 4CRWB 4G01B 2AFHE 2JLVA 3LQQA 1K5GA 2OM2A 2OV2A 1TMKA 1KI3A 1FNMA 1YZLA 2XNDA 3RRYA 4ZDJA 2OXCA 2VQSA 2C2HA 3QKRB 2IUTA 2RHDA 2VHCA 5DGXA 3GLIB 2IWRA 2ZQ5A 4D6PA 1XEFA 3W6NA 1JAHA 4AG5A 4Q02A 1ANKA 1S4QA 1DPFA 2R44A 2D06A 3KKMA 2A30A 2VBCA 2FEMA 2JJ1D 1HT1E 2WWHA 3K9LA 4TLDA 5FPTA 4HUTA 2ODEA 4LY6A 4OQFA 1QRAA 1E2LA 4IDHA 4IDQA 4Q9JA 5JRZA 1JPJA 3LBIA 1SKQA 5KOYA 2GXQA 3FKSD 3FKQA 4W9MC 3R8FA 4PANA 2YOFA 1KY3A 1X1SA 1NNEA 2J0QA 2W6JA 4CGZA 1XWIA 4FCWA 3EIHA 3U5ZB 5TMPA 4MH0R 2NZ8A 2ZRCA 4PAQA 4PXAA 4DLWA 1OXUA 2FSIA 3KX2A 2J87A 2ORVA 3X1DA 4I4LA 5JBQA 3AKCA 1E9BA 2VP5A 1Z6XA 4LC1A 5F9FA 2AD5A 3T1OA 4M1KA 3GPLA 4QHTA 4TL7A 1G17A 1BIFA 3FMFA 2WSSA 4QBGB 1SVLA 4XSHA 3A4MA 4B35A 4HLUC 3FOZA 1KK2A 1YZUA 3IDQA 2ZPTX 4L16A 3TIFA 3NBYC 3NHBA 1AGPA 2ZRDA 3UATA 3ZLJA 2IS1A 2XEXA 2WJVA 1XPRA 2QM7A 4WZBE 4LZZA 4AYWA 721PA 3WXMA 2XZPA 2GJSA 5JJKA 5L3QA 2V1UA 5EXXA 2MMGA 2V55B 1L4YA 3KJGA 1G18A 2QTFA 2FSGA 4TSFD 3G0HA 4RZXA 4TYYA 1H65A 1KI6A 1E2DA 2BJVA 1CR0A 3BS4A 3TQFA 2XZOA 4QJ4A 1II8A 5K8TA 2GCPA 1NBMA 2PH1A 2GEDA 1E2FA 2OILA 3IHWA 4ZCIA 4TMKA 2XTMA 2F55A 1G3QA 3UMFA 3SZRA 5JI2E 1P73A 2ZRFA 3FE2A 1QHYA 3E2IA 4O2LA 2ZEJA 4X8HA 4HB3A 4OJQA 5KTYA 4AWXA 2VF8A 3X1WA 4EAQA 5FOSA 4L4UA 3BFKA 3DOFA 4DSNA 4A4DA 3IILA 3TW4A 1E2IA 1SVKA 4G5QA 5AJXA 4HI0E 2D62A 1TEVA 4DWJA 2G3YA 2I1VB 3THXA 2V6IA 1N5LA 3IBGA 3N70A 3CNNA 4UNQA 3U6KA 5H1YA 1D6JA 4JLNA 2XTZA 1M8PA 1HUQA 1XD9A 1EFRD 1WCV1 2D3WA 4IDPA 4IOJA 4TYWA 4B6EA 2C9YA 2V4ZA 2ZR7A 4JKIA 5J5CA 3LX8A 5B57C 1OB5A 4LBVA 1T4GA 4CEIB 4RCZA 2XB2A 2B92A 5C1BA 4PQYA 3GEEA 4URYR 4FXPA 1KO4A 2IF2A 4AKIA 4QJ3A 3MAAC 2HV8A 2EYUA 2A5JA 1OH8A 5GJCA 5HKKD 1P2SA 3L0SA 3TRFA 1XCGB 4N0DA 2KE5A 5JFGA 1N0VC 3BRWD 2R6GA 2RGXA 2CLCX 2CCJA 1GITA 1VYUA 1YHNA 3GLFE 5JSZB 4UKDA 1Z0KA 2W0MA 5IK2A 4WZAE 2WJYA 3WHLA 1T3SA 1ZUIA 3K1JA 1W4AA 3T12A 4JLJA 2Q9CA 3H0KA 4EJSA 2J0UB 4QBIA 2J41A 1T5IA 2OAQ1 4QKQA 4HZUB 4Q19A 2GHIA 2XGJA 4MITA 2ZM5A 2Q0HA 4BLQA 3NVAA 2O8BB 1ZJ6A 4C0QC 1RFLA 2IYYA 4BFTA 2J9RA 2EFCB 2ZS9A 1FMLA 3AVPA 4KLNA 3CH4B 3A1UA 2JJ1A 2YHSA 3K0CA 3ADCA 1IY1A 1SGWA 4Q9HA 3GP8A 2GZDA 3EC2A 4LPKA 4HLDA 3TK1A 4EPRA 2IS2A 2QT1A 4FMBB 2QZ4A 4XTRA 1CTQA 3TSOA 4DIDA 1P2TA 2OCAA 3FKSA 4B3CA 1SZPA 3CM0A 4KBGA 5FBQB 3IIKA 1P2UA 1JAIA 1QZXA 1N6RA 3VR5A 5KPDA 4FI3C 4LV6A 4GI7A 3IO3A 2WWIA 4R2HA 4LHZA 1KTVA 2AWOA 3RSLA 2PMKA 1JNYA 3C41J 3GFOA 3QKRA 3GLIA 4A15A 1F2TB 5AK0A 2GVZC 4YDHB 4ACAA 1BS1A 3QEJA 1OYYA 4LCBA 3UMRA 2A3RA 2K5UA 4ILEA 2WICA 4OK5A 1ZD8A 3NH9A 4XWKA 3L82B 1LY1A 4DEYA 3P1JA 2FG5A 3CNOA 1GNRA 2H18A 2WSMA 2E87A 1YZNA 2YV5A 1XCMA 4TZ0A 2VO1A 4JSTA 5EP3A 5HR5A 3TJZA 2OCPA 4LYAA 3B1ZA 1OV4A 3QBTA 1IN5A 3AF0A 2MMCA 2GVDC 2UZIR 1VYTA 5TXGA 3GJXC 1G8PA 3BH0A 3PEYA 4OK3A 3ZVMA 5HPYB 2DR3A 3GLHE 4BLOA 1U9IC 4KFTA 1OW3B 2QROA 3FMPB 4PTLA 2QA5A 5EXTA 2P6NA 1D9XA 4TSFA 1HQCA 1UM8A 3WYFA 1OXXK 3BAFA 1G3MA 1RJ9B 1XEWY 4JVLA 3CPEA 3A37A 4KO8A 5EP4A 1XMIA 3EZ7A 1UBEA 5F3WB 2PZGA 1BKDR 2R9VA 3RABA 1NN1A 2GTPA 1BOFA 1DARA 3NH6A 5K8IA 3VX3A 2Q6TA 4IJMA 1E0SA 4DCVA 1JXMA 3W8RA 1DAHA 1ONBA 1RRCA 1DE0A 4QGFA 5EP1A 3VFDA 2YINC 4OHXA 3TVDA 4HDCA 4ABYA 2HLDD 4JVSB 1UEIA 3GJ5A 1OJLA 2ZI9A 5TY0A 2FN4A 2QP3A 2QMEA 1U0JA 4D4MA 1IXZA 3PITA 3NXSA 4TN1A 2WPDD 4L5BA 4PC6A 3BWDD 1NI3A 4Y0VA 4DBLC 1OE0A 4YMTA 3OZXA 3EG5A 4AKEA 1HQYE 5L3RA 5J4VA 1EFRA 2OXRA 2H7VA 2G88A 2OLJA 4QRHA 2JLXA 1QHSA 4W5WA 4DLSA 5FPHA 3UPUA 4MYUA 1A1VA 2WWWA 5LD2C 4RD3A 2VTKA 5CLQA 1XBTA 3THOA 3LLUA 4HATA 4KJZA 1UBFA 4OL0A 1UKEA 3EW9A 3KFVA 4NYIQ 1ZM4A 2BV3A 3R20A 2ZJ5A 2J46A 3AUYA 1EWQA 2AXPA 2BMDA 4MKFA 4KI0A 1E2KA 1VG9B 2FE4A 3DKPA 4NE2A 4PPFA 4JVNA 1P60A 1F60A 4NKRA 1T91A 4PHFA 4Z8XA 3QBVA 4RKFA 1IOZA 2VLIA 1MR3F 3QG1A 4Q7MB 3AF3A 3FGNA 3MJRA 1GKIA 2QP9X 4K46A 1E2GA 1Z0FA 4H1UA 4W5HA 4OHWA 2BEJA 4MGKR 3BORA 3KUCA 1OFUX 4Q1CA 3BE4A 1OF1A 4RZ3A 3PR1A 2NMVA 1P9WA 2BMFA 4LI0A 3IPXA 2IYTA 2RH5A 4FMDB 4M8NE 1R0WA 3AM1A 1N6LA 1KK1A 1NKTA 1VPLA 5FPKA 2VYFA 1QDEA 1VKJA 4PSKA 1V43A 5EZ5A 1WE2A 4Q9LA 2ERYA 1N25A 2W2XA 1WBDA 1I4DD 1CR4A 5FBRB 4ERNA 5KDDA 2ZROA 4LC0A 5FBWB 2OO7A 1FUKA 4PX9A 1HH4A 3U6BA 5KNCA 2X77A 3SJZA 1BMFD 1OXVA 1KI9A 1P62B 4PO1A 3CRW1 3RS5A 1YR7A 4F91B 2X19A 5FBVB 3TAUA 3SFZA 2ZETA 1V5WA 4PQRA 1WQ1R 2ODNA 3KL4A 3Q5EA 4TTRA 3D8BA 5JMTA 3DKVA 4IEIA 5JSZA 3KQLA 3FHTA 1COWD 5GADl 2BBTA 3NEJA 4MYTA 5K8LA 4BWYA 5JJLA 1DG3A 2CNWD 2XTNA 3L0PA 1F2UB 3LW8A 4ON9A 5CIQA 3GMTA 3W8NA 1FOEB 5C18A 1M7GA 3REGA 2HJVA 2EFDB 3TSWA 1G7CA 1ESMA 4MGIR 4R9UC 2J0UA 4PHHA 4KSCA 4CVNA 1R5NA 2F3RA 2V8OA 2P67A 2ZRAA 4E5UA 4LUCA 2O8BA 1G8YA 2FFAA 2ZI6A 1M7BA 4O2RA 3OE7D 1TQ6A 4YLGA 1AJEA 2LWIA 1E94E 1KZ7B 2A9KA 3ZJYA 2G83A 4M1TA 5H68A 2QAJA 3RRZA 2ZRGA 2PBRA 2L0XA 3W9YA 4E09A 2QT0A 1CS4C 1HYQA 2OEPA 3RS0A 1RVDA 4HEJA 1CULC 3HU2A 2WV9A 1Z0JA 2GRJA 2A7QA 1XZQA 2A5FA 3IO5A 4RJLA 1AM4D 2FEOA 1E0KA 2ZJBA 3NC1C 1SVIA 2IWHA 1N5JA 1XEXA 3LQRA 1ZCAA 5AJWA 2Q21A 5J4KA 3QKTA 3KXIA 5ANRB 3QNUA 5SZKB 4EUNA 4XD7D 3ZQ6A 1NSFA 1RYHA 2GZHA 3LXXA 2VP0A 3U7EB 2GCOB 4Q1AA 5L8VA 1U90A 2IXEA 3THYB 1QHNA 2NO6A 1NBME 3CRQA 2R65A 5FTMA 3UANA 1E69A 2C95A 2ORWA 3K0SA 2XJ4A 3UG7A 5G41A 3I32A 3TH5A 3WNCA 2AR7A 2VP2A 5JI3E 2WMOB 3J81k 2QPAA 3Q5DA 4GP6A 1R10A 3F8TA 1TUIA 3FHOA 2IUSA 3M4YA 4DDWA 5D3MB 5KUTA 2ZJYA 1P3JA 1NN0A 3T34A 4Q4JA 3W3ZB 2ZU0C 3GCGA 3QKUA 3VR4A 3GJ0A 1E79D 2W00A 4DXAA 4EJSC 5DISB 4EIWA 4LBWA 3MWYW 3TSZA 1YZTA 2HLDA 2CL7X 4JIMA 1T0JB 4MRSA 4CZ2A 1LFDB 2OBLA 2BKEA 1D2MA 2DFLA 3V9PA 2O8EB 1JB1A 3R7WB 2WPDA 2R6FA 2OFOA 4D0NA 3K0CC 4Q21A 1N5IA 5AUPB 1RJ9A 1TAGA 2IHBA 4FMDF 1E99A 3DEFA 1G19A 4BLSA 2OZEA 3B7GA 2JJ8A 2ANCA 2ZRLA 3NDPA 1GTVA 2H8KA 121PA 3HU3A 3SBDA 1CJMA 1FW6A 2VHUA 2HT1A 4KLZA 1G7RA 3EPKA 1SULA 4HAYA 2GAOA 4ZDIA 4N1AA 3SI7A 4I1UA 1KO7A 1JXOA 2SHKA 3LDAA 2Q9AA 4G1UC 2CL0X 2QU8A 2ZJOA 2PLRA 3UWKA 1DTSA 1IN6A 4AD8A 4MA4A 1XP8A 3NKVA 1E2HA 1NJGA 1G1MA 4X8OA 3E70C 4CF7A 1G20E 3K9HA 2ZVQX 3AB3A 1NL3A 3OEED 1N6HA 4PZZA 3GJ4A 1QVRA 2JDIA 2XSZD 5K8UA 1NVWQ 5BYKA 1QHGA 4JJZA 1NG9A 4Q48A 4YQFA 4HB2A 5HE8A 1RC8A 5DO9A 3EXAA 4DDTA 1FP7A 1XF9A 2WKPA 1VG8A 1EX7A 2AX4A 4DUGD 2O52A 2YC2C 4RY2A 4ZDWA 1Z07A 2FNAA 1W7AA 2BMEA 4F4CA 3CPJB 1U94A 3W90A 2GF9A 2FZ4A 2I3BA 2QG6A 3CRRA 2ONKA 1UJ2A 5DLQC 1P9NA 4KVAA 2WWFA 4JLKA 1KIMA 3GLGB 1GRQA 2JLSA 4ZPXA 1WA5A 3QY0A 4GBMA 1XTKA 1N0UA 2W0SA 1KKMA 1KOFA 4Q01A 1BMFA 4TL8A 3NBZC 1XTQA 4A9AA 2X2FA 2EYQA 4XTCS 1L4UA 1IXRC 2J7KA
chains in the Genus database with same CATH superfamily
4EHDA 3GRYA 4MYHA 3HB4X 3ZDAA 1G9TA 4LJRA 4QPZA 2IIPA 3C6KA 3UMCA 1RVV1 4JCCA 4NU5A 1UAGA 4IJKA 4FDTA 1WHSB 5CXXA 4B4DA 4D41A 3EMKA 4IOLA 1RZ3A 3H2YA 5JVDB 1UBMS 2IJGX 3H1PA 2W37A 3DT9A 5A04A 5BUSA 621PA 2ZIUB 3W3AA 1GCOA 3CB4A 1Y81A 3K53A 1DAGA 2P0AA 1NY6A 4NPCA 3AY3A 1UK8A 1JQ5A 1KXZA 1JLRA 3QTBA 4TTPA 1C1DA 3COPA 4HDOB 2VZ0A 2PMEA 1BMDA 4DA9A 4DNFA 5IN4A 5JJCA 1ESNA 3FTDA 3GLVA 3U3KA 1D0VA 4RW0A 5K6TA 4E11A 3NG1A 4TXJA 3DFFA 1Z5UA 4ZZ3A 3CUWA 5BURA 1U7XA 1CS0B 4C30A 3C98A 1MLDA 4ZIRB 1ML4A 5C7LO 3DEYX 2Q3FA 2AI1A 1WZUA 1NJ5A 2JLUA 1UKBA 1UKZA 3MWKA 3HCCA 3NGMA 5IAGA 4F11A 3IEKA 5JC1A 1B2RA 1UUFA 1XRSB 5AKEA 3SPXA 5EE5B 3T41A 3HY4A 1KR2A 5KNBA 4GM0A 2BTOA 5T6BA 2DULA 4MPRA 2VPIA 3JD0A 1CVRA 1F2UA 4JS0A 2WM9B 5DNCA 4Y30A 3J7AC 1E4VA 1Y1PA 3N0WA 1PJCA 4WA7A 4ZCQA 5C8VA 2P6RA 3M3DA 3I5MA 3ONFA 5HW0A 4WJZA 1CR2A 1AX9A 2Q3HA 2UZ1A 1WABA 3OZRA 2D8MA 1NJ6A 3EWAA 2QK4A 4OHMA 1ZU4A 3OFKA 2POQX 3F1LA 2GNOA 4EYKA 4PF1A 5AVVA 2V3WA 3IIJA 3QA9A 1T9KA 3BG5A 2GZ1A 5A62A 4H7IA 3W5IA 3PF8A 4KBFA 4XDYA 4G0QA 3TR5A 3WIDA 1ZS9A 1WTCA 3EMVA 3R74A 2IL1A 4A5SA 3MW8A 4D46A 1DADA 4ZVQA 3RSQA 4Y2RA 4K9RA 2Q4BA 5G1PA 3D64A 1XFAA 3TLKA 1JMKC 2H17A 2TMDA 4HJRA 1P6UA 1HE2A 1NMQA 2FZEA 1HLDA 2PH7A 4L73A 4NENB 4ARBA 4JP8A 2A0UA 2I33A 4Q24A 3S2YA 2QTAA 3RJZA 3GA7A 3KJHA 3K70D 3HVKA 1LLDA 1Q3KA 4BWFB 2OHHA 4LV8B 3U56A 3WWYA 1CY1A 4H08A 4UVGA 2QN9A 1PG0A 5ADHA 3NOOA 1KJWA 4A82A 3KOYA 3M6UA 1QYDA 3EVAA 1VFNA 1B0UA 3G0BA 2GRUA 5ILOA 4GMGA 2ZYGA 4CKBA 2C7QA 3L77A 2BF7A 1ZEMA 1ZMBA 1DU4A 4QBHA 4WKOA 4P35A 4TVBA 1FYFA 1L7EA 1LJLA 3QZUA 3LPNA 4V0SA 3QELB 3VTKA 4GO1A 2OYCA 5JXIA 1IHUA 1DHTA 3DFMA 5EIOA 3NEYA 5L4LA 1J39A 1UH5A 4ZVMA 2QRUA 4FBMA 3R9KA 2CXTA 1IDN1 4NJMB 3B2EA 4NWIA 3EEIA 3IIIA 3PWKA 3P5SA 4R1TA 2VUIB 3OA0A 4YRIA 5IBQA 1NT4A 2H4WA 3SNKA 3H6GA 2CLFB 3BN3A 4QTUB 3WGNA 1RPJA 2QTCA 1TUEA 1JBKA 4ER6A 1L5FA 1U8YA 2ERXA 3VV2A 5CCXA 4JKYA 3B3GA 4B17A 4F7DA 1JKXA 2YW2A 4JITA 2PPLA 1I6MA 4D9CA 4OH1A 3R9IA 3SE0A 4ZHQB 2ZE6A 4LJ9A 5G40A 2XQJA 2JJ2D 3LIPA 4JBYA 3VA7A 3KKLA 4YNBA 2FJ0A 2AOXA 4F2PA 3BMOB 4FK8A 4ZAFA 4ALLA 4B44A 4PGFA 4Z7QB 5IABA 3COSA 4HSEA 5JD4A 1Y7HA 4QG7A 4ZRMA 3RREA 4E03A 2QW0X 2ZXUA 1BEZA 1ZK3A 4X97A 3OJFA 1TQ2A 4H1VA 1AXRA 1N33B 4Q34A 1QSGA 5LZ8A 3VX4A 1BHSA 3EPRA 4NS1A 1U6KA 4IH9A 5B3AA 4L22A 2D2EA 4P7JA 1YS1X 2C58A 2YN4A 5TARA 1HE3A 4YHHB 2DFNA 1NF3A 2D5CA 1W46A 1ICIA 3PPXA 4JELA 4WESB 2WUGA 3VHRA 2YJTD 4DUGA 4Q4LA 1P2VA 4GOND 3ZGXA 1MX1A 4CIYA 4UHHA 1USWA 3KYCB 4WCFB 4LJSA 2HQOA 4WOBA 2Q4TA 3DMHA 3F2IA 5CG1A 1SPXA 2FPSA 3FDFA 3CISA 3QVLA 1LX6A 2XQFA 3AUKA 4JLMA 4PSVA 2WHEA 1KBZA 1YJBA 2HWWA 1RRFA 2IOFA 2YIMA 3PQ2A 3LXUX 4PVDA 5EZYF 1I14A 2J5XA 4Z4QA 5K3FB 1RQNA 2LUOA 1JMVA 4E3WA 1YZYA 3G8DA 1GDHA 1LSOA 4DV7B 1ZH8A 1U1DA 4XX0B 3ZY5A 3QF4B 5AI6A 3A4NA 4TWIA 4X45A 4ND7A 2RE8A 4AY6A 2QRVB 2Q5CA 3ZDRA 3SYTA 3KHSA 3KZ1E 5FBKA 5IAEA 3I76A 4RPIA 2O2SA 3L4BA 1N6NA 3C5EA 4GX2A 1PFVA 1Y7LA 2DBQA 1KS9A 2BGUA 5TB5A 3GAFA 2DC1A 4CW7A 1FFAA 1N1MA 1NQUA 4YRNA 2J1LA 5FFFA 2R2AA 1OOEA 1U2PA 2O20A 4D0LB 4AZWA 5LOVB 3BOSA 2QP4A 1TZKA 3E9CA 4RJIA 4DLNA 1SUAA 3GMSA 4P92A 1O94C 1NLYA 4UBKA 4XD2A 3HEAA 2G40A 5AJZA 1G63A 2YXEA 5EJ7A 4K0KB 2C4HA 3NO4A 5ESRA 3GLGA 1Y98A 1KYYA 3OEWA 4KXFB 2EQAA 5HZGA 1GZ3A 2MYUA 2YXDA 2ZRMA 1ODKA 1X86B 5DMHA 4POOA 1PK8A 2JH8A 4E6PA 4RULA 4EDFA 4DR6B 1MVNA 4QXOA 3NC0C 3FZGA 4ARUA 5EMKA 2XVMA 5TJ9A 1I9CA 3AEKB 3GRZA 1O3YA 5E7QA 1X80A 1E2NA 3DNFA 3SEFA 4LCEA 4YRMA 4J1QA 4DEXA 2W2TA 4KSBA 5FOVA 4D96A 2QE7A 1DUIA 4ML3A 3ENKA 3W06A 4YIHA 3IMKA 4QG3A 5K05A 1EA7A 4NTZA 3TLGA 1M2EA 1WHSA 4A6XA 5E4YA 4C5CA 4YR7A 2BN4A 5JVDA 1ZMOA 3EZNA 2DY0A 4H16A 5AJYA 3WWOA 3VOSA 1UWVA 5GTDA 7AT1A 4AZVA 1QS0B 1IVSA 1Z4KA 4EZBA 4E2XA 3DDCA 1PU2A 5LSAA 3K09A 3JQ7B 4MKXA 4G1EB 5HFAA 1R64A 1UPTA 2LGJA 4BZXA 1XPOA 3MCTA 5B30A 3W2TA 2KI5A 1CS0A 2V7XA 4N5NA 3ORRA 3SKVA 4DSOA 3KT8A 1ID8A 4P81A 3G5TA 1DWOA 3I5UA 3DA8A 3MXOA 4LWOA 1WEKA 1A8IA 2QB5A 1SBIA 2G28A 3QTTA 2GN4A 5FJIA 1BEUB 1HXHA 4Q9KA 3JD3A 3DUFB 1EFUA 2CY0A 4FFWA 1YS9A 4BVGA 4E94A 3S27A 3B2QA 4EUFA 5K0FA 2HRCA 4TUYF 4PC3A 2QD5A 1SRRA 3QU4A 3ZNQA 1XDZA 3EZ2A 3SJBA 1OH7A 1FFHA 1V45E 4IRUB 1KAOA 3O8CA 4IV5A 3RLIA 1L4EA 4PC1A 1E3IA 2X5OA 3VAAA 2ICAA 3SZ3A 5JXHA 4DUZB 1GQSA 3VSCA 1U99A 1VL0A 1CJUC 1MT3A 2QDXA 5KSOA 5CGQB 1IZ9A 2RHJA 1ZESA 3H2KA 2DLCX 4XYBA 3S2FA 1E1RA 2ADOA 3R09A 4CKWB 4X65B 2CBZA 3PR2B 5CLFA 1Z0IA 4MVJH 1US8B 2ECFA 3F7OA 4AXBA 3K31A 1QQBA 4PO8A 4ZOBA 4I9HA 5TSDA 2M1XA 1X87A 2C5GA 2N9UA 2J7PA 1M5RA 4O02B 1V41E 1X7XB 1E6UA 4O3FA 1CQZA 4MB0A 2DQZA 2FWIA 3VNBA 1U3VA 4DG5A 5JJIA 2P65A 1T2EA 2OV8A 3LKZA 1ZK1A 5B2ZA 3PEVA 4IHAA 5EUQB 3VPAA 1XA4A 4PG8A 3VAZA 1RKQA 1VCHA 3O2QB 3NRBA 5C8XA 3DBLA 5A3JA 2CMHA 3LAWA 1J1UA 3D7MA 3M49A 4CEHB 4DNOA 2FPLA 2VS1A 5DI9A 3SIRA 3L7YA 3IR7A 4HS9A 1BSVA 3QBJA 3WLSA 3PPWA 4TWRA 3R9XB 3NWBA 5KZMB 3QELA 4E5MA 3HRIA 2VNJA 4DSZA 3D3NA 3RTGA 1VLJA 2G8NA 1Z0AA 2CJXA 1NF8A 3AIMA 4GXNA 2PYIA 4J43A 4JNCA 2VHXA 4NJMA 5DN6D 3AXSA 3DKRA 1E1CB 1WSDA 4ZMRA 5CG2A 2JPDA 4KACA 5P8WA 4UHFA 2EEPA 3OOYA 1NXWA 3ZI0A 2V7VA 4OQ4A 1PZFA 1JA9A 2ONCA 4WRRA 1KAHA 4MWTA 2AFIE 3EUFA 3RFVA 2CUNA 2WUVA 3A3KA 4ONEA 1FSSA 1SKYE 2KWIA 1Z68A 1S3SA 3GVPA 2XA9A 3PIDA 5ECGC 4ZHQA 5FO0A 2ST1A 1GG9A 2R7KA 3RUCA 2OLEA 4RDCA 3DZCA 3O4RA 4MWBA 4TYQA 3KB2A 4TN5A 2OCKA 3T1HB 4AY3A 3S29A 3I42A 3BMOA 3QYFA 4MWDA 4N3NA 4EY6A 3GA5A 4DTIA 5KTPA 5GJBA 3BK1A 1UBKS 1JDUA 4V0MA 4U2KA 1NFFA 1WNFA 2NTYC 2O3JA 3FSEA 3PF9A 1MOPA 4F5YA 4XJTA 3HP7A 1YQTA 3SEZA 2FRDA 4Z7JA 3BMXA 3CE6A 1U31A 3S68A 1Z7GA 5I7AA 4TTJA 5I7EA 1KJJA 1YCGA 1U9ZA 1GKLA 1KJNA 2DEUA 5KTRA 1DBPA 2J08A 4NHOA 4DQXA 1W4BA 5ER9A 2ZBFA 3KTDA 3USZA 5F1KA 2PSEA 4MV1A 4TL9A 4OI0A 4H7FA 3MCAA 3EGEA 3NV9A 4WESA 4OAQA 3WHPA 4L07A 1ZGZA 2EWVA 2DWCA 2J59A 2IYFA 1CC1S 2B0JA 3CURA 1ZAKA 3KYCA 3VDXA 1TEXA 3B5JA 4RVDA 4WCFA 1RRKA 3W9BA 2EX1A 1TKBA 3T4UA 5B4VA 1GAXA 4BKOA 2PRJA 1S1MA 1Z08A 2O2YA 2WF5A 1Y1SA 2XQIA 5DP1A 3K9WA 1T8SA 1K8RA 2JHGA 2B6NA 2DH5A 1UBOS 3NTLA 4N39A 4URUR 4NK5A 5KB3A 3JQCA 4ZI3A 3BMQB 5K3FA 2HDWA 4NRDA 1FIUA 3C5CA 1V8OA 1VE7A 1ZL2A 2GZ2A 3P4XA 4B43A 2HPZA 1B6TA 1Y1RA 4LZLA 4WI1A 3QF4A 1W6UA 1FTGA 3GT3A 4NYJQ 3TFWA 1GNQA 2CNKA 3ECCA 3HWSA 2FWNA 2HO4A 3PXBA 4TT8A 5ALJA 4Y8VA 2NT4A 2QRVA 3VH3A 2H7YA 3DMPA 2A14A 2OP0A 2CDBA 2BI4A 2FSVA 2OGSA 4HAIA 2F8TA 1MO4A 4JA0A 4NBKA 3SQDA 4H7PA 3DZ8A 1E32A 2RAUA 2IYQA 4IZHA 2VBFA 5DHSA 3LWBA 1MKYA 1UBSB 1YQ9A 3QX3A 3WXBA 5LOVA 2VL7A 3D31A 1A9QA 2IZ0A 2ZI7A 2CN1A 4RKEA 4RKYA 3ZNOA 1NKVA 1NP6A 2AUMA 3A8TA 4V0KA 1TPZA 4RIGA 2HUPA 2FF7A 2ZYSA 1CRPA 4J07A 5AW9A 4RHEA 1DQZA 4RVHA 1JHPA 3TKYA 4LJAA 1Y5NA 4B8YA 1KFCB 2Q7OE 2H1OA 1TDJA 3KO8A 3I39X 4FBGA 5AHXA 3UAVA 1XRJA 2NUTA 1ZC4A 3D7NA 4PC7A 3D4NA 1UDWA 1JQ3A 3RYTC 1ZIYA 1MQAA 5K0SA 1XTVA 4WE3A 4CHTA 1A27A 1XXHE 3DYVA 4RNDB 1J33A 2VA8A 1OXMA 2ZW9A 4ZEVA 1YO6A 3C7TA 3RS4A 4WINA 3JTEA 1XAIA 3E18A 2BFAA 4YCLA 4WLOA 3QEAZ 4IDNA 3PC3A 4GYJA 1UPCA 3B8EA 4BB6A 5JAUA 4CLOB 4FINA 1GA1A 1TF2A 2KW5A 2C3OA 4KK3A 4B82A 5AUQA 3OCWA 1XAJA 5BN5B 4YUVA 4UAUA 1DP4A 4K1XA 3GRPA 4MUEA 4CTJA 4D5EA 4RIIA 1OBOA 4JJKA 4KXUA 4A2QA 1VJRA 4DMMA 1AXGA 1OD6A 1QS0A 1DMSA 3A6ZA 3HYSA 1P5HA 3HR7A 5AW2A 4II3A 4BKUA 3JQ7A 1YIAA 2LCFA 2YQ4A 3IAAA 4M87A 4QT0A 1L5ZA 1UT5A 2MYPA 4FFNA 3NKFA 1RHKA 3URMA 2ZRKA 2BBOA 4QEZA 4JKOA 1YJ5A 3ZGLA 3PA6A 4AICA 3RW9A 4DA7A 1E1MA 3HTXA 1XRNA 3UJNA 1WHTB 3KU1A 4ZQHA 4ZYWA 4OJYA 4XWYA 1NF9A 5G53C 3UEOA 1IHPA 4B7AA 3NTRA 3HXMA 2JK0A 1G16A 4MWOA 3ETDA 3HHPA 2C8KA 1MC4A 2PBZA 4MWGA 1G6HA 1M6VB 2Z56A 4RH0A 3ZW7A 2ZUCA 3M9LA 5EQDA 1JR6A 4ES6A 1ZGAA 1J42A 2UZ3A 4RTMA 8OHMA 1W9MA 5I9MA 2PS3A 3DUFA 1A2KC 3PUIA 3NBXX 2FP3A 5DHAA 1SHJA 2D5LA 1MW8X 2NQ2C 1W1WA 3C6QA 1N5MA 3QUSA 1J9EA 4FKZA 1E96A 5JSUA 5EMJA 1UPUA 5DOZA 2KMLA 4JIGA 1E9EA 1UFOA 5CH5A 3DNPA 2YMMA 5JY1A 1OWLA 5DTJA 4RAQA 1PYGA 1NVTA 3HA3A 4TN1A 2HNKA 3DMRA 1K86A 2A9VA 1IJFA 2H1WA 1IOWA 3WJ2A 2QKYA 1CJSA 2ON6A 4OKIA 4A7PA 1HBJA 3UJHA 4R83A 1ZCJA 5BVHB 4CKWA 1P0QA 2VDPB 3OTQA 4KW7A 1US8A 4V0RA 3UA4A 3WP0A 2H51A 1GRNA 1CUBA 3CT4A 4DLKA 1LI7A 3OZTA 4G36A 4KFSA 3GP3A 3D8SA 3NRJA 2P6PA 1C9KA 3OQPA 4AY4A 1X7XA 1JU3A 3PRJA 1W30A 4FEGA 1U8ZA 2B25A 3BRSA 3CV3A 4MIKA 4XIJA 1XZFA 3S2UA 5KSPA 2VAMA 3VKGA 4LZWA 4G0ZA 1THZA 5IRCD 4IRMA 3B6ZA 3IJ5A 1ZJJA 4OMUA 1C1HA 4S3MA 1VA4A 1L6RA 4KTTE 1NFRA 1CUFA 1U2ZA 1QAQA 2BKAA 4NCKA 5BSRA 3X3HA 1NJ1A 4CEHA 1ZW6A 1ZNXA 2ADMA 2GS9A 4JR1A 4YIKA 2FVYA 3UCEA 2XQKA 1IB0A 1ODTC 4K03A 1ZUNB 1RYZA 1GN9A 3S2SA 3R9XA 2NZWA 1XPUA 4PPQA 3LFHA 3SR4A 3TSAA 4F2GA 1II9A 1PJQA 3PXEA 2HCRA 4URZR 3ZWYA 5HK9A 3B9RA 4JXXA 2TMYA 2JIBA 4UTXA 2J3DA 4NFYA 1RRMA 1ZXLA 2RI1A 4KQ1A 5LA6A 4C78A 1GUBA 1Q1BA 3WMGA 1KFKB 2PLFA 3PQ7A 1E1CA 4JJ6A 4JT2A 4PZYA 4IIGA 2CHFA 3ZCSA 4R0NA 2RB5A 4RD2A 3TI7A 2GHQA 4FYHA 1Z15A 3CLVA 5ARCA 1T9GS 4JBXA 3CIFA 4EAAA 3K70C 4BVBA 2PUVA 1NMYA 2JK1A 1I0ZA 1AK9A 3L2OB 3N2ZB 2QTGA 3N6VA 5C1PA 2HU8A 2A94A 2CFRA 4WFKA 3U3OA 5IKEA 3FYCA 1P3DA 3FMGA 3L1UA 10MHA 2JIQA 1UXOA 3K2QA 3LY5A 3PNOA 3ROMA 3WLHA 4LN1A 1X38A 3QEMB 1WCWA 2IBTA 4BFCA 1KP9A 2PMBA 3AR6A 1FYEA 3P9KA 4JR2A 3PKIA 3A0UA 4DJJA 3HB5X 1NOIA 2HYIC 1B41A 1T8RA 4A91A 4CFZA 4P3NA 4D8XA 3NYWA 1J00A 2WF9A 5LL6P 3PENA 2R8ZA 4JI5B 1QBKC 1KMNA 3LKDA 2R4QA 5TEWA 1MVOA 4QODA 3U5TA 3ZHOA 1LXCA 2JFBA 1PWHA 4ZMBA 3IB3A 3KHUA 3I1FA 3I34X 2CDRA 3ORHA 2RBEA 3GQVA 2O5RA 1I3KA 1F14A 2V8BA 4NV0A 1GCAA 4DR1B 3LO5A 1CZOA 1IHXA 5B1IA 4HQFA 2FQ1A 1XL1A 1IMJA 2E49A 2X1MA 3AQ4A 1SKUA 2I71A 4MKHA 5HOQA 1CZNA 2CZGA 4QOEA 3VPGA 4FILA 4WNYA 4ZRNA 5I6DA 2E37A 4JSRA 1NVXQ 1Q1GA 3D0RA 4KYTA 3C7DB 3T0GA 1O58A 3OE4A 2FZLA 3HFJA 4EY4A 1FU8A 2AXQA 3BMQA 3HPRA 5IANA 2P62A 1H2YA 1F1JA 2BEKA 1NUSA 1VM6A 2BHRA 2VYCA 3FNGA 2FN8A 1XHLA 2HF7A 2WILA 4BEBA 4KHPB 3QQPA 3RGGA 1GRRA 4JLAA 4TRNA 5H82A 4ASUD 1Q77A 5AI0A 2IUUA 3ICPA 2QOEA 2I76A 2R87A 2VXOA 5BP7A 1VHWA 4QQKA 3BKWA 5G2OA 1NN5A 2LV8A 3CRVA 4HUQB 3U61B 2KLBA 3P97A 4HSGA 4U2FA 4G23A 5AXAA 2HZBA 2DPGA 4BDSA 4JBGA 1D9ZA 2AA3A 2BSXA 4HX2A 4RZUA 4WV3A 4QTYA 3ZH9B 3V8VA 2XWQA 3NRCA 2VLBA 1M33A 5AHWA 1QH9A 3SWWA 3VJMA 4KODA 2ATCA 2WYHA 3FZNA 3NTQA 2GO1A 4IDFA 1KETA 2JIOA 3VOAA 4F4UA 1ND6A 4PX3A 2NU8B 2ZJ2A 3PXCX 2JI9A 4UOQA 1FYWA 5T4EA 3QSGA 1Q1AA 3DO6A 3I9MA 4G86A 1DBQA 4MQUA 5EUBA 1JE1A 1I3OA 1NUQA 3LT4A 3LUJA 3F5QA 4XB1A 3G0DA 5T57A 3CNBA 5LQDA 1N32B 3C74A 4X1OA 4H3HB 3QF7A 5EPOA 2GXAA 4WWHA 5DM4A 1NVGA 1W49A 2WAYA 1HL7A 3ZIAA 1XT6A 3DJYA 4S1VA 4XXHA 4DMCA 3H1FA 4PGMA 4YHBA 3KLBA 1EESA 5E4TA 3BXZA 1GLNA 1XB2A 2FMXA 1UBJS 1ZZEA 2VDMB 3IUEA 3QVWA 3UWSA 5I47A 3GGOA 2VZ8A 4GMDA 4YFVA 1V37A 2G67A 4XRRA 1Q0RA 5ERGB 3C8DA 4X1YB 2ACWA 4E2WA 4CLOA 5ICSA 2YC4C 3BSYA 5EHQA 1I5RA 1HPLA 3BK2A 1I7NA 5BN5A 4GT1A 2WC1A 4UOEA 3PDIB 4G97A 2ZUDA 3LBAA 3OFNA 1ZKMA 3JW8A 2DKNA 5HMMA 3TTSA 1P8JA 3B78A 3FPFA 5ECYA 3GVIA 3RHZA 4C7XA 4HAWA 4DS3A 5EJMA 1YVUA 3BZBA 1BEEA 3O38A 2PKCA 5H9VA 1OWMA 4YPVA 4TMTA 2O1EA 1MB3A 1RBMA 3K1ZA 1T6YA 3A6KA 1L1RA 1IK4A 3DXZA 3HBAA 3NIWA 4INZA 1WHTA 2BY4A 1J0XO 1Y9DA 3PUWA 2KBEA 3K96A 3QTLA 2WA1A 4WOJA 4YRPA 3RCBA 1A0OA 1KU0A 4D1YA 2F00A 2YCBA 5F5NA 5L6MB 4WNAB 1ELOA 2ORED 3CVUA 1Z8NA 1M6VA 3FNQA 4BO9A 3OPXA 3G5MA 3HLKA 2OY0A 5IKXA 1OLXB 1FRFS 2HF9A 4KQ6A 2BM1A 3WV5A 3L05A 1ORTA 1L7PA 4A23A 5L9AA 1KDOA 1SC4A 5DCYA 4GOXA 4BZWA 5EESA 4JI4B 1AHHA 4IGKA 5KREA 1HNZB 1XU4A 2MSEB 1Y4ZA 3H5WA 3TB4A 1NRWA 2JFFA 3KCQA 1V6AA 1DQSA 4HWPA 5K3EA 1BDIA 1NURA 4BFSA 3GL9A 1T5LA 2F3QA 2ODAA 2PTHA 2WD8A 2ZI4A 2J3IA 4W82A 1KH1A 1SXJE 3QVUA 1EWRA 1NHGA 3E23A 3Q0IA 3JPWA 1R15A 4TVKA 3WK5A 2PUDA 5F98A 4IVQA 4LYHA 3UJDA 4QJ5A 3HB1A 5BVHA 4JZKA 2G8LA 2EQBA 1K4KA 3AF2A 3GHHA 4IIEA 1P4SA 2GTHA 1ZIPA 2XYQA 3Q3GE 4M0PA 3U3XA 3ZD8A 4AZTA 2F3UA 1HOXA 1ZDMA 4HH0A 3HDVA 1ZX1A 4K81B 4M22A 3UC9A 3KAJA 3IUNA 1P72A 1DAKA 3JVUA 4ZVOA 5H0IA 2DB3A 5G0WA 3HBJA 4RZ2A 2AD1A 3IP7A 1YBVA 2ZB8A 3UXMA 3VNUA 2LR0A 4LJ4A 3W5UA 2JI6A 5K0GA 1KI2A 2PX5A 3RJMA 1XTSA 1M0WA 3DB2A 1B14A 5M2QA 1NTRA 2DTDA 1JNXX 1NJ2A 2HH9A 4BYMA 1WRBA 4G63A 1NKSA 4AX4A 1T36B 5EJEA 3IALA 4IIVA 4N03A 4JGBA 1EQ2A 1NVDA 3HBLA 4I2VA 3ETJA 3Q7PA 4RVGA 2BISA 1NVEA 1G3UA 2H2HA 3J80A 5E8JA 1ZUNA 1DHRA 1BWRA 2YXNA 2GXSA 4OM8A 4ND2A 1AS0A 3R3YA 4JT4A 1MOZA 4KIGA 4PLVA 2GCGA 2OXEA 4KXLA 3AG6A 5A0FA 3RV4A 3B6IA 3ZYCA 3FPAA 4Y2QA 1NYLA 3RS7A 1FDRA 1J8VA 2FN9A 3JRWA 1QP4A 1KK3A 3CX4A 2YZMA 1GO2A 4QYSA 3DZDA 4UVDA 1OVMA 3C6ZA 1BS9A 2AJCA 16PKA 4KE9A 3CUEF 5ALYA 3HUEA 3BKXA 4ZQCB 5G0TA 4BNHA 4JDUA 5J4HA 3DM5A 4IXDA 2UV8A 1WZ2A 1JILA 3BICA 2P77A 3RU2A 3VZBA 4B8WA 3IUQA 3UZUA 1P6XA 2EBFX 5TQ2A 2QYOA 3CA8A 2D4HA 2J48A 1KGSA 1CJVC 1K6MA 1V4NA 3N53A 4J1SA 3SGLA 3IQFA 1EE1A 2R8BA 1SD5A 5CXQA 1WXIA 1JR3E 3QEMA 4RMJA 2HU2A 5T8KC 4CF4A 1SUIA 3NHJA 4JL6A 1NPTO 2C2XA 3DWIA 3SS7X 4XI9A 4AURA 4WFIA 2BR4A 3X44A 2XCUA 4F93B 2IZ1A 4RVCA 5ALMA 3N0VA 4XJSA 2C4TA 1QDLB 1EGQA 2R5NA 4JJIA 3RYFB 1RAIA 1K27A 4MZDA 3D6TB 1GNPA 3IQEA 1K9VF 1UDRA 2IFTA 2NWQA 4NG5A 1NXQA 3U44B 3WC4A 3DO8A 1UMKA 1MO3A 3RYCA 4QFMA 3AILA 5DGCA 3QEOA 5C5DA 2V45A 3E61A 1E5QA 3FI0A 4ZALA 3AF5A 4G81A 2JGMA 3FMIA 3TLYA 2GEUA 4BLVA 4M7OA 3ITEA 3QHAA 5CK5A 5D00A 3Q4GA 4M0UA 3T3NA 3D3EA 1W8IA 5F33A 5AXCA 2EF0A 4GAEA 2Q0QA 4D9IA 5IAOA 2R8YA 5SZJA 4V24A 3HRKA 3UOWA 1G5FA 3LVRE 1R4NB 3FCSB 4MXDA 2QT9A 3FBWA 3KZNA 3MUFA 1T3HA 2H7XA 2RGBA 4KU4A 2HK8A 1XZGA 4FWIB 4LMRA 4UVIA 4JXZA 1HG1A 5DBFA 3X2SA 4YH1A 1O6GA 2HGZA 3NIFB 4Q4DA 4DQKA 1ZINA 3OJ0A 4JR0A 5L4NA 1MIOB 3T7TA 4RZSA 2AYZA 4WDQA 5J9FA 3MMPA 1EXMA 2OVFA 2XADA 2QD3A 3KU4A 2YJZA 3ICOA 4PNPA 5EKXA 3PDHA 4LY9A 4LNAA 1DIGA 2X0NA 1D4AA 3BIXA 3G8CA 2Y9MB 2C78A 3HL0A 4HUQA 3SZGA 4DQLA 1TD1A 4FNGA 1JE0A 1XTBA 3HCRA 2LDBA 5IAAA 2JI8A 4DV4B 3O83A 1M6WA 1JDBC 2EFGA 3PQ4A 1XA0A 4JBWA 3INYA 5FPPA 4MB6A 4S2EA 3ST7A 3E5RA 5KVAA 2R7AA 2I3ZA 3EGVA 2CV1A 2VDJA 3QX7A 4MUMA 1R6AA 4MV8A 5CB6A 4YN3A 4DIEA 2ZSJA 1O5TA 3V2IA 4IXMA 2HPAA 4S12A 1SB8A 2G1UA 3AR7A 4XWAA 4DWOA 4PPNA 4PYOA 1ISMA 3I83A 3A6GA 3ZZUA 3BCUA 2ZB4A 4HWTA 1ACJA 4J1TA 3NFRA 4XRGA 2FJUA 4RK7A 4E1AA 3AP2A 2GASA 3B53X 4L74A 4R7GA 4N5MA 2GK6A 4OXKA 4JUAA 4PFJA 5AW7A 5ICMA 3KAKA 3LO8A 1H42A 2OORA 4GVXA 1W94A 3IOYA 3NT4A 4BLUA 4DJDC 2VDVE 4F8JA 5I9LA 5A6SB 4MTCA 1KI7A 2XUGA 3NV7A 3USCS 3FDIA 1EHYA 3NIBA 4LOJA 4TSKA 5LWHA 1AKWA 2XIJA 3I0NA 3FI9A 4B79A 1BXGB 2R8EA 4WUVA 1VDZA 3MJHA 3IBSA 3E3MA 4X1YA 1FXUA 1GUAA 1HETA 4YAOA 3BILA 4HWSA 1NUUA 1FZTA 2RHMA 5B2FA 5GIOE 1Y7PA 1ZM9A 2FZ5A 3OX1A 4ZKEA 4B2IA 4GZ5A 3IOEA 3PDIA 3IOCA 4RHFA 4GQAA 4PCAA 1KZYC 4Y6SA 5EAIA 4C5BA 2WB2A 4U2BA 3GPDG 3IHLA 5AK4A 4D25A 2X41A 2PZMA 3QOWA 1E3MA 2I54A 2BD0A 5HRUA 2BBSA 4PAGA 5CNMA 3RHTA 4S1WA 1XKQA 4QOGA 4YONB 4X3PA 1QFXA 3AVTA 1MTOA 4S0XA 2CLKB 4JT9A 4FJ2A 4GOKA 4XR9A 1Z22A 4QUHA 1DXOA 3EGOA 4UMFA 4D3XA 1X70A 2NZXA 1RZRD 1YMQA 3B8HA 2AXEA 1J1ZA 3O8DA 3UAOA 1HZZA 5AUOB 4NCXA 1WB9A 1PR1A 4V39A 4WNAA 3AFHA 3RS8A 3EDOA 1W4CA 4RACA 1E89A 2C7BA 3P0EA 3G88A 1OLXA 4FN5A 5LP6C 3AQIA 3NGXA 2EWMA 5JAIA 1SIUA 2FLVA 3MGKA 4DCGA 1F2DA 3L8GA 4R41A 4HMQA 2IEIA 2EP7A 3TKLA 1GYRA 3JY6A 3R75A 2C5HA 1NNLA 1KO5A 4H4EA 2EATA 5KHLB 1QF6A 4RVUA 4DT1B 1YB2A 2QPTA 4G8CA 3C1TA 5TNXA 1B8UA 4TROA 2EG5A 3S4YA 5JROA 2XA1A 3VYUB 3H83A 5F9MA 4LDRA 3Q72A 1SXHA 3AV3A 3JVIA 3NONA 3CX3A 3QJYA 4OO3A 1PHRA 1D7OA 1DCFA 1HRKA 1KGDA 4HLQB 3L4SO 3OFJA 1J5PA 2Q5IA 3NANA 1ATIA 4NATA 4HFNA 5DCWA 3V42A 4C7KA 2PKWA 2CHUA 4HAVA 2UVPB 1LLCA 4WDRA 1LSSA 2DHCA 2KSQA 2EFHB 1SVOA 4DQVA 1F6DA 2VRCD 3F6EX 1TO1E 2PNJA 3C3CA 3MQFA 3PNPA 3MPOA 3K9CA 3DQQA 4ZT6A 3MXTA 5HZKA 4MVJI 3HDGA 1PAUA 2Y66A 2PRYA 3MB8A 4QREA 3SIXA 4G4JA 1HFJA 2XWJI 3ASVA 3CS3A 2G36A 1Q11A 2C3UA 5DK6A 3BJIC 3TRKA 4F7WA 4YCNA 3EPHA 3OE5A 2C1ZA 1KJ8A 3H9CA 4YJKA 2A5DA 4KVFA 1YDMA 5CGZA 3T9EA 3PG5A 3GEMA 4U3JB 3R8CA 1FFBA 3JQGB 4L5YA 2QEQA 1QLHA 3A31A 3CX6A 3ZIUA 1EB8A 2DCUA 2EBHX 5EXPA 2CVOA 4CDNA 4CU5A 4R2WA 5AVWA 5JSQA 5ELXA 2XNCA 4F38A 5FCDA 3DD1A 2L17A 5I7RA 5JJLA 1QANA 2ZFUA 4YP0A 4OFBA 3BCRA 4AM8A 5LMNB 3M4JA 4O4LB 4WXRA 4YMWA 2VPQA 1I2DA 4ENTA 3C7KA 3LLCA 2ZBDA 2PR2A 2PUWA 4Z51A 1IOVA 1QZTA 3VO9A 1Y3IA 4P2BA 4BVJA 1P5FA 4GNKA 4WVLA 3KSMA 4FKMA 2GYUA 4WXHA 5KMGA 4B84A 3FR8A 1L5VA 3AOEC 3F5SA 3WRYC 1G5RA 2ZBPA 4LCJA 4UQPA 3L6RA 4KQIA 1GAQA 2VPWA 2XHZA 3LZDA 5CUQA 1GKYA 5J1TB 3D8HA 3IP5A 4C76A 3RYFA 4K0RA 4CLEA 3U44A 2C29D 2D00A 4F3KA 3E6AA 1E77A 2WHPB 1PTJA 1ZEJA 2QSZA 4KB5A 5EFOA 3VZPA 4GRAA 4HWOA 5LYJA 5LNK6 1OZFA 2JCYA 3C6YA 4DIMA 4L4XA 5LZ7A 3HNPA 5L6LB 4R0MA 2GK3A 2LP4Y 4N6GA 2X9QA 5GPBA 2P6UA 4IS3A 5GY7A 1M66A 1TVMA 4JUBA 1KY2A 3ZVRA 4YXWD 4RTQA 3GDFA 5IDWA 5JRDS 1SKYB 2J3MA 3AR5A 4D8UA 5F23A 4WJLA 1R4NA 4XB2A 4CLRB 2VUSA 1XTUA 1VC2A 4D9JA 4F71A 4YRSA 3W05A 1Z4IA 3ZEIA 3EVGA 4MCIA 1IXSB 3WX0A 4WZBA 3ER8A 3FHLA 4FNMA 4MRPA 2DXIA 3QUBA 1L4BA 1MIOA 4QSMA 4RTNA 2AT1A 2ZWPA 4N6OA 1MA3A 3HJBA 3WYEA 5KSWB 4BPBA 1NM5A 3HCNA 3EOZA 4OXYA 1A72A 5TJHA 1Y5LA 4WMLA 3KTAB 3JQAB 1ZUD1 2ZJ1A 3IMCA 1PUJA 2VTDA 4KXMA 4S04A 5AK5A 3I28A 2CT8A 4FXOA 1TPYA 1GTZA 1SUPA 4G37A 2J9GA 4BO8A 4Q3OA 3D8RA 3IX7A 1E9RA 5M3BA 2YUTA 3HV0A 4I3FA 1R6DA 3KP1A 1H9AA 3QMWA 4K9LA 5A3QA 5CW2A 5BQFA 1SXPA 2X5KO 2WZQA 2IS4A 2QN2A 1N0HA 3LBFA 2G9VA 2AOWA 1GAWA 1F0PA 1SZJG 1ZWLA 4Q5IA 9MHTA 1TMOA 1WEHA 4KO1S 4ZANA 4LBZA 5FV7A 1E7RA 2G5GX 3FVQA 3N5KA 1G3IA 2RAVA 3JARB 5REQB 4QARA 3DFKA 1RAFA 3GJQA 1TZCA 1Y1LA 4PWZA 1U2DA 4QUDA 3V6MA 3WZ2A 5JCXA 4MVJD 4OD0A 1G55A 1PT8A 3PQ5A 3D59A 1M7HA 4G5GA 1XTPA 3LA6A 3P2OA 1Q3HA 5EWJA 1BX3A 1NVFA 4HV4A 5IG2A 2GA8A 5AM3A 2XF2A 2G08A 5KVCA 1Z56C 2NM0A 2C4KA 1BKSB 1EX9A 1MG5A 3LFTA 1QIGA 3M4NA 3IR5A 3PC8A 3VC3A 1SC1A 5JV5A 5F5LA 3S70A 4CMHA 1YACA 3FM9A 4FZ5A 4TT3D 3QPUA 5A6SA 3RADC 1E4YA 4LY3A 1KFEB 4I9UA 1O89A 1QH8A 3DVRX 5T5QA 2BFDA 4GPAA 3EZ6A 3A3PA 3WLMA 5ITVA 2ACVA 4YUAA 1NW9B 2IU6A 2IDZA 1BXGA 4YJGB