3OIWA

H-rasg12v with allosteric switch in the "on" state
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oiwA00
1ZM4A 3PR1A 2HJVA 1B0UA 1G3UA 2HLDA 4MYTA 2P5TB 1W2HA 4R71A 3KQLA 1HQYE 3IDQA 1I2MA 2Q21A 1YZNA 1A2BA 3BJIC 4N1AA 4Q9KA 3THWB 2OCBA 2WMNB 1G6OA 1W2GA 4DDUA 1T6NA 2H1LA 5TARA 4EFNA 3QNUA 2DWPA 5JHGB 2JEOA 3J81k 2ERYA 2PZFA 2OESA 3QOFA 3GLHB 4P3YA 1ZBDA 4TN1A 4B44A 4HZIA 4MDEA 2IYZA 2A30A 1ZM9A 3TH5A 2XGJA 1SVIA 1SHKA 2W0SA 1E96A 3FB4A 3EC2A 2R65A 1L4YA 3DMNA 3HU1A 3TSWA 4A2PA 2ANCA 2IS1A 1E3MA 3U3MA 2QRZA 2WTUA 4WXPA 4XIGS 5CYOA 1UBEA 2RGCA 4IDOA 1M7GA 2ZU6A 1N6PA 2XEXA 3EPLA 1R10A 2F6RA 1TF5A 5DISB 3H0KA 1OH5A 1GRNA 1R5OA 1DAMA 1IN8A 2CCJA 4DCVA 2C95A 2CK3D 3CR8A 1XJCA 2JA1A 4URYR 3QG1A 1FOEB 4B6EA 2PBRA 3B1WA 2O0JA 2CLDX 1KYIA 1OKKA 3HU3A 5FH9A 3B8HA 1YZTA 3LFUA 4ZV4A 4CEIA 2QMEA 2JIZA 2C96A 4U5XA 2GZHA 2GAAA 1TU4A 4YXWA 1OFUX 2Q6TA 4QXAA 5K8UA 4TLDA 3K9GA 1VCNA 2C8VA 3FHCB 2WMOB 2C99A 4JLDA 2ZUCA 4M1OA 4RD2A 5KDLA 4KFRA 5JSZB 4DCSA 1HV8A 1RKBA 4ZDJA 1XTIA 1QZXA 1EFRD 2AX4A 3EAQA 2DWOA 1NMXA 2IS2A 2QA5A 2GRJA 4V0NA 3OEHA 2HV8A 4IEEA 4BUJA 4EFMA 1NY6A 1PJRA 4XVRA 1KI3A 1ZNWA 4DBLC 1KNXA 2X8AA 2PZEA 4GI7A 5FTMA 2CJWA 3A6PC 1HQCA 2YC4C 3IBYA 3PEUA 5SZJA 2QE7D 3LO5A 5E4FA 1YZQA 1UM8A 1DTSA 5G3ZA 2HUPA 2HT1A 4KBFA 4M9ZA 1IAQA 1OV4A 5E3HA 1R0YA 1ZNXA 2D2FA 5JJLA 2RGAA 3U44A 3RABA 221PA 1CF4A 2VL7A 2FA9A 1OH8A 5FOUA 4KFTA 1N6NA 4XVUA 2XB2A 3LH5A 3SU8A 1KKLA 3NDPA 5KNBA 4PC2A 1GITA 3PUZA 3TNFA 1L8QA 2REXB 2YNMA 3KKQA 1AN0A 4LJYA 4MYUA 3SBEA 1CXZA 1KI8A 2GXQA 3FMIA 4LDJA 4BLSA 1ZJ6A 1DAGA 1G9XA 3LY5A 4V0KA 4Z51A 5CIQA 2F1HA 3EZ2A 1SVMA 4A0RA 4QFMA 1GRQA 1KJYA 3CIOA 4RD0A 2IEZA 3U2QA 3VKGA 3KJHA 1CU1A 3IHLA 2E1RA 3ECCA 3THXA 1PV4A 2GAOA 4H1UA 1N6OA 3QF7A 4HAWA 4GL2A 3U4QA 1W4RA 1CR0A 4HEJA 1AZSC 2XITA 4GBMA 1BYUA 2JASA 1DS6A 2XJ9A 3W8NA 2REBA 2FEMA 2G77B 4URZR 3ZJYA 1GDDA 2Z5FA 2Q3HA 1OT3A 1ZAKA 3QQ5A 4YDSA 5KHOC 1VG0B 1G3QA 4TMVA 2NTYC 1OH7A 4HLDA 2QSYA 5K8TA 2XX3A 1KDRA 1P9WA 1VG9B 1TF7A 2J0VA 1CTQA 4G5OA 2IYXA 4GOKA 5L3RA 1U9IA 3EARA 2O0HA 3KTAA 1E69A 3I62A 2ZQ5A 1KI6B 1K6MA 1XTQA 3X1ZA 2GA8A 2GVZC 2JLVA 5EXSA 4MKHA 1S1MA 4P4UA 2FSFA 1G7SA 1G1MA 2RHDA 3AKCA 4YLGA 3K70B 4K8OA 4QBGB 3HWSA 5KNDA 3TSOA 1KTVA 4FINA 1GAJA 4QHTA 4HZUB 1ZUNB 4B43A 1E1RD 1K5DA 1T8TA 3I1FA 5DI3A 1ESMA 1NIJA 4QG7A 4B2IA 4C0LA 1NN0A 3BK7A 1SVWA 3D31A 4JLKA 2V1UA 2ZJBA 5J4YA 4PC6A 4OHXA 4CDGA 2ZJAA 4LUCA 3WRXC 3GLFB 4C0AC 1XXHA 2QT1A 4KO8A 1EX6A 2IYTA 1CJVC 4HI0E 4B74A 1TTTA 1XEWY 2ZAMA 3QF4A 3GD7A 1TQ2A 4LV6A 1KMHB 3BH6A 4OJQA 3IIMA 4URUR 3RRMA 2X2FA 4NU0A 3A4MA 3R9WA 1U0JA 3E5HA 1MO6A 5JWRA 3QEOA 3OIWA 4N3NA 3L0OA 5JRJA 2QBYA 4JSYA 3GFTA 2OAQ1 4TT3D 2IXFA 2J5XA 4HAUA 3VAAA 5TB5A 1X3SA 4A36A 1AQYA 3C5CA 4IOMA 2XSZD 4JBWA 5E95A 3GJ8A 2CK3A 2OXCA 4PPFA 2JATA 3T1TA 2YWFA 1Z63A 1YU9A 2V6JA 2VSFA 2IX3A 4JLMA 1KNQA 3SS8A 3JVVA 2VHTA 2P6RA 2GEDA 3VX3A 4KSCA 4JKIA 4MRSA 1Z6YA 2R6DA 2OCPA 1QG2A 1Z47A 3VR1A 5BWMA 3MLEA 3UWKA 3PQCA 3VKWA 3B1ZA 2YZ2A 3IIKA 2O52A 3CX7A 1E9BA 3TGPA 3SN6A 2B21A 2WBLC 3Q3JB 4TSFA 4A0FA 2NOAA 3NG1A 4JT2A 1OYWA 4DLVA 4TQAA 2MSCB 3GLIA 4AKIA 1XPRA 4O2RA 3BOSA 1DO2A 1R5BA 5AR1A 5BQ5A 1N5IA 2H17A 5TY0A 1HYQA 1MH1A 3U7HB 4NHOA 3SJZA 2XZLA 1XD2A 5JCZA 1E2KA 1WE2A 2ZSDA 3WHLA 1LTQA 3NHAA 3B2EA 5TVKA 3NWJA 3CH5A 2RGGA 5F9HA 2B7CA 2AR7A 2KWIA 2QMOA 5HZKA 2XTMA 4G5GA 1NSTA 3C14C 2NIPA 2ODWA 3QJYA 2EWVA 1XTJA 3DOFA 4G1UC 4D25A 2IYSA 3KXIA 3QENA 1W47A 2RAPA 5HPYB 2J41A 4W5HA 4BPBA 2O8DA 4LWZA 1G64A 1AKYA 2FEOA 4BEJA 4ESVA 3K0FB 2QN6A 2YC2C 1UKZA 4B3DA 1G8GA 4PHFA 1AZTA 2GJKA 3PENA 5HKKD 3WBJA 2P0EA 3A4LA 2QAJA 4DT1B 1OPXA 4GOJA 1J90A 1E2EA 1E9AA 1MABA 2C9YA 1MABB 4V02A 5D3MB 2PMDA 3LW7A 3SYLA 4IDHA 4PX9A 4HAZA 1VIAA 2J7PA 2Q9CA 3E2IA 4DXAA 1Q0UA 4O0MA 4IRUB 3P20A 1TPZA 5EZ6B 3ND9A 1CS4C 1E99A 4YQFA 4C0JA 1LV7A 3G0HA 4CEJA 4PPQA 2J46A 2QORA 3VR5A 2I3BA 1CRPA 4LY6A 5AJZA 2WWFA 3OEHD 4HATA 2IXEA 3D6TB 2PEZA 3X1DA 1BMFD 1EWRA 2GBLA 4M1YA 1NVVR 2CXXA 4LI0A 3H86A 5CIWA 2QGNA 3PG5A 1IJEA 2GXUA 3U3RA 1DPFA 1KJZA 1T0JB 3OAAA 1A4RA 2CDNA 5FTJA 3Q9LA 5KPJA 1QG4A 4M9SA 4D0GA 3F3YA 1SVKA 3R7WB 4Q02A 1L4UA 3IKJA 2P65A 3B1VA 1YZLA 5EXPA 5C4GB 3RWOA 2WJIA 2ODNA 1G7RA 2WVJA 3L43A 3PITA 4TL9A 5FOTA 3TRFA 1P3JA 1FNNA 3CF2A 5F9FA 1VHTA 3KX2A 1N6LA 2XOKA 4IVRA 3BWDD 2O8BA 5M04A 3I3SR 2O8BB 3QXCA 4Q7MB 5GJVC 2EYUA 2BMJA 3RAPR 1FMJA 4XVQA 2GCNA 5HE9A 1D9XA 2UZIR 3IHWA 4M9QA 2EWWA 4Z1MD 2ZXUA 2QQEA 1MOZA 1TX4B 1Z6XA 2VEDA 2HXSA 3DZ8A 1FQKA 1QVRA 5LBIA 3ZQJA 2G0TA 4NPHA 1M6NA 4CYMA 4JVLA 5DGXA 4ZI2A 4EPTA 4IOLA 4LV5B 2GJAA 1N5LA 2GKSA 3K09C 2F1JA 3OE7D 2HYIC 2ZSAA 3B1YA 1LFDB 1QBKC 3AF3A 1LB1B 1XFAA 4N0EA 3GLGA 1N6RA 3ND8A 5BN4A 4OQFA 5KTYA 721PA 4RSGA 3T34A 3T12A 3AP3A 1VECA 4Q4LA 5GJCA 4R7ZA 4Q03A 3RVBA 1RJ9A 5HE8A 1H8HD 5J40A 3CZQA 2WPDD 1NG1A 4FMBB 2GTPA 2IYRA 3OEED 3R8CA 2J7KA 1UKEA 1X1RA 4D4MA 1YZUA 5A0FA 5KSOA 3HJNA 2IWRA 4D2IA 1W36B 2RGNC 2OFOA 4C0HA 5FPHA 2W2VA 2AWOA 4IDPA 2A2ZA 1UBGA 3QIAA 5AJXA 1HY3A 4FMCF 1S1CA 3KKNA 1UEJA 1CR2A 2A7QA 2ZTSA 2KSQA 3WYFA 4DRZA 3PUWA 5FTLA 4A9AA 3VNUA 1E2FA 2CNWD 1NL3A 1W4CA 3ZLJA 1ZM3A 3WNCA 421PA 3ADCA 4L5BA 1ZVQA 3U4QB 3ZZUA 1E1QD 5LD2C 5C4MA 3ZGXA 3BGWA 1JALA 1AS3A 1AM4D 4I1VA 5JBQA 1Z83A 2I1QA 2QY9A 4C9BA 4UNRA 4DDVA 5CK4A 1Z22A 1R7RA 4ILEA 4OK5A 4PZZA 5FFMA 2OV2A 5L3SA 4C4PA 2P5SA 2RB4A 4XD7A 4LPKA 3IIJA 2OUKA 3NBYC 4XSHA 2RGNA 1PLJA 1OJLA 2DBYA 2PL3A 3B9PA 1Z6TA 2ZRKA 4KJZA 1OFHA 1CJMA 2N42A 3RS7A 3CNLA 3DDCA 4QJ4A 2IUUA 1M7HA 5LD2B 1XTSA 4IFBA 3AQ4A 4NL4H 4PR0A 2ATVA 2QP3A 5GVSA 5ANRB 2ZR9A 1BH2A 3FKSA 4I1UA 4MUBA 4RZ3A 5BYKA 1F2UB 2QG6A 4II7A 1SHZA 1KO4A 4ASUD 1E0KA 4B2LA 4PZYA 5KSZA 3DL0A 3S1AB 1LY1A 2CHVA 1EFRA 4HUQA 2JLXA 1NVVQ 4HUQB 4MRVA 3IPXA 1TQ4A 3C16C 3CPEA 4RZXA 2QM7A 3AVQA 3WMFA 1W5TA 1EFCA 4DSOA 1P9NA 2J0UA 1M2OB 2R44A 2ZREA 2LCFA 2GK7A 4B35A 3BXZA 4MUAA 4HLCA 5J4HA 2FX3A 3GJXC 3PV0A 4KU4A 2UVQA 621PA 4TYPA 5GVRA 2IS6A 3JZAA 1XCMA 4US0R 2EFDB 4KAXA 2ZRJA 4BFZA 1AIPA 3DZDA 2QTVB 4HSEA 4Z8XA 2QBYB 2GDJA 2ZAOA 4I1SA 2EYQA 3TAHA 3MG9A 2C04A 2ZRDA 1ZCBA 4B73A 1NBMA 4FWIB 5L3SB 3AV0B 3KQKA 3CX6A 1S3SA 3QE0A 2AXPA 1ZU4A 2PX0A 2PMKA 3G82C 5J4LA 2GEUA 1RW4A 2VSXA 4WXRA 1R5NA 2ZJYA 4BECA 3NEJA 1QHSA 2ZS8A 1YJ5A 2DFTA 1KAOA 3K53A 4D26A 1DARA 2ZRHA 3RC8A 5FBWB 2QM8A 1DADA 4GRAA 4BE7B 3THYB 2XNDD 4H9GA 4E03A 3TK1A 2XZOA 4LZZA 2G1KA 5FUWA 5L8VA 1G5TA 2ZI9A 4GZMA 4LX0A 1G20E 3MRSA 4WZAE 1G291 4DLXA 1FTSA 2WWGA 2R6CA 3ADDA 1Q3HA 2CE2X 3R8FA 4JSTA 3I92A 3W3AA 2O8CB 3SHWA 5J4KA 3ONWA 3AF4A 2CBZA 4BRUA 2O8CA 1F48A 1NF3A 4HAVA 1XD2B 4KYUA 3AGQA 2ZR7A 1V5WA 3NBZC 2IBMA 5EZ5A 3WRYC 1P72A 3FMPB 3GLFA 2VP0A 3QKSB 2EFGA 4NCIA 4Y0VA 2WSSA 2JJ8A 3DVLA 1U8ZA 2Q9BA 3B9QA 1AK2A 1FFHA 1SKYB 2CL7X 2XTNA 3UATA 4OQXA 1IY2A 3AP2A 4AURA 1N0VC 3GFOA 1VTKA 4IXNA 1O3YA 1X1SA 1E2PA 1P5ZB 2FGJA 4NYMQ 4B3GA 1ZM7A 4URVR 3SE0A 3Q7QA 1XPUA 2QQ0A 3GQBA 2RKOA 3A1TA 3C4JA 3WNBA 2BV3A 4GFDA 4DLZA 3RANA 1E2NA 1COWD 1XD8A 4KXFB 5SZIA 1ZUHA 3B78A 2OO7A 4QGHA 3U3KA 1VKJA 3BERA 5IDVA 4JLVA 1OIVA 5JWHA 5D3MA 4XD7D 1I4TD 1OW3B 2HT6A 3CX8A 4DLYA 2VF7A 4NYJQ 4MYHA 4PZLA 4PPGA 4URWR 3SDZA 5BN3A 4D6PA 4RKFA 4ZCMA 4LC1A 4DEYA 1KZGB 1QRAA 4A2WA 4YXWD 2FZ4A 2BC9A 4QHYA 3TVDA 3B1XA 1F2TA 3DO6A 1SXJA 1XJQA 4Q5IA 2V55B 3NH6A 1XRJA 2ZUDA 2P67A 4ZPXA 4DEXA 1T3SA 4M8NE 4B32A 4DDWA 1E1QA 3HPRA 4MGYR 3D8BA 4IFEA 4A6PA 3MGCA 4NONA 2HDNB 2F9LA 1IN5A 4FMDF 3EASA 3L0SA 3BB3A 4HDQB 4YONB 4URXR 3NBXX 3CNNA 3QVVA 2IS4A 4LCBA 5FBRB 4DLUA 3T1QA 1AA9A 1U98A 3N70A 1ZUIA 4B3FX 1IBRA 2OAP1 1VYTA 4ARZB 4AD8A 3NC0C 4EQ6A 3B85A 1IM2A 4UXIA 5CM9C 5FPKA 4Q4JB 1NN3A 3UWOA 5KNCA 3CWQA 4GSYA 1S8FA 3V9PA 3SNHA 4L9WA 1LS6A 4Q4AB 3A4NA 4UNNA 5GJWC 3BE4A 1J8MF 3K09A 2QEQA 4OI0A 2QUZA 4M1TA 1C4OA 1XF9A 1D2NA 2ZRNA 1KMHA 1U81A 5IRCD 1CR1A 3Q5EA 4JLJA 2V7QD 2ZRBA 2H57A 4YMWA 5E7IA 4F7WA 4V0MA 1W4BA 1HTWA 2YWEA 1WF3A 1NN5A 3TMKA 1J70A 3OZXA 4YMSA 2J45A 4DUGD 4RD1A 4BZXA 4OQLA 3RLFA 1PLKA 3CW2A 2HCJB 1OF1A 1OH6A 1OHHA 4TYQA 4X8OA 3K0AB 2NG1A 3M0EA 4DCNA 4DSNA 1R6BX 5K8IA 2QT0A 1IONA 3UANA 1BKDR 1KGDA 4CEJB 2ZPTX 4ESHA 3TE6A 2YYZA 4P4TA 1DEKA 1E2IA 1GKIA 1PLLA 1T91A 3WBKA 4A82A 1NLYA 4MRPA 1RE0A 1RZ3A 3AH8A 3W6NA 2QROA 1X8LA 2GETA 2H18A 2EU8A 4D80A 4YDHB 1BS1A 1SVOA 2ANBA 2Z6VA 4QHSA 4A8JC 3U6BA 4TTPA 4LYAA 3CH4B 1KZ7B 1CULC 5EE3A 1T3HA 2IHYA 5FOVA 2Q9AA 3KFVA 1VCOA 1GNRA 1JR3A 4D4JA 1OYYA 2LKDA 3M1IA 5GADl 4JL6A 2O8EB 2WOOA 5BXQC 4B33A 2CHGA 5H1YA 4HB3A 4NYJR 4HLUC 3RRNA 3CRMA 4KFUA 2J9RA 1XTKA 3EWAA 3QKTA 4QJ5A 2GNOA 2O0KA 2GWHA 1Z6GA 3RS2A 1Z07A 2Z4SA 4KVAA 3FE2A 5LB2A 3U7EB 4D0NA 1EFUA 1DE0A 4C0QC 4BASA 4US1R 1XMJA 3K1JA 3I32A 1Z8FA 3RDPA 2ZE7A 4OL0A 2FFAA 3EG5A 2QAGA 5CK5A 4XH9B 3FVQA 4DB4A 3WNDA 3B13B 3V4RA 2BDTA 3BRWD 3CRVA 4JJKA 1M74A 4LJAA 3SZRA 1SZPA 1UADA 4WZBE 1WCV1 3U5ZB 4ZDIA 2D62A 1HEIA 3P32A 1CLUA 2IC5A 4Q9JA 3THWA 1Q1QA 5HKKA 1AGRA 1EXMA 1RYHA 3SYKA 3ADBA 1S96A 1YR9A 2ZS9A 4DLSA 1OXXK 2F7SA 5FI1B 5BN5A 4BQSA 3SEAA 1T8UA 4HB2A 1SXJE 3LLUA 4TLEA 4DJTA 4MGIR 3EPJA 4TYWA 4AIIA 2V9PA 4KLNA 2WSSD 2HXYA 1ELOA 3W6OA 2BKEA 3OFND 4X8LA 3CRW1 4QRHA 4JVNA 2REOA 4EIWA 1W5SA 4HDCA 2V8OA 2GZDA 1TUEA 3FYHA 2FN4A 1XX6A 1XXHE 3BFVA 2WM9B 3R9IA 3TJZA 1SKYE 3KQNA 1DAEA 1NP6A 2QU8A 1II8A 2GXSA 4KV9A 4GP6A 1MO5A 1JJVA 1D8TA 2BHRA 3RRYA 4RZUA 4E22A 3Q7PA 1E6CA 2YKGA 4Y0AA 5EE5B 3LBIA 1WDTA 1ZMXA 3PXGA 1XU4A 2QNRA 2PH1A 2J3EA 4IOJA 3TKLA 3AVTA 4EUNA 3VU9B 5AUNB 3I5YA 2MSEB 3KZ1E 1Z0FA 4DUGA 4F38A 1MO4A 4UNSA 5FBQB 2ZRCA 3FOZA 3SI7A 2A5FA 2ZUBA 5B57C 2EW1A 4UXHA 2OZEA 4A8JB 3L8YA 4R2IA 4DCTA 1OLOA 3M4YA 1G8YA 4EFLA 4E5UA 2ZJOA 4LYHA 3X1YA 4GMDA 2ZM5A 3QKRA 2EVWX 5FTKA 1XEFA 3QKRB 3GLHA 2PZGA 4G3XA 1U94A 3N5CA 3TW8B 2PT5A 1U0LA 2G83A 4AK9A 2G0NA 4M1KA 4MRRA 3CNOA 3MUFA 1W7AA 1XEXB 1JAIA 1E9CA 1T5IA 2ZITA 2JJ2D 4RZ2A 5AUOB 2D3WA 3GLGB 2BMEA 1GNQA 1NVUQ 2OBMA 3DKPA 4GMXA 4B3XA 1FP7A 4U7DA 1B23P 1KK3A 3GEIA 5J5CA 1YRAA 5CJPA 2ZIAA 3KKPA 1I4LD 3CPHA 1NJGA 1DAHA 3LLMA 4RCZA 2AHOA 3ADKA 1NBMD 1DG3A 1E9DA 5L3VA 4PPNA 4Q47A 4H1VA 1FQJA 1G4UR 1XWIA 5FUVA 1Z0AA 3B5JA 4I1OA 1E98A 2ZETA 3P4XA 2JLSA 1C1YA 1JR3E 2WJVA 3KJGA 4MRNA 3KL4A 4CEIB 4AC9A 1CJUC 1G3IA 5FR1A 2I1VB 3TUIC 3K9LA 5B64A 3SFVA 1FNMA 4OHWA 1HT2E 4CGZA 3GMTA 1G19A 2FH5B 5KDOA 1DELA 2EFHB 3B60A 1U9IC 2FWRA 3LW8A 4Q9IA 3PFIA 4AI6A 3ASYA 3BS4A 2IK8A 4A8JA 3U61B 5H8WA 2ODBA 5L3QA 1UF9A 4IJMA 5EP2A 3UIEA 1G3MA 2CLSA 3UXMA 4G5SA 4PTLA 1SQ5A 3REGA 1QVAA 2VP2A 1D2EA 2RCNA 3GJ5A 4TYYA 2FFHA 2L0XA 2UZ3A 2QSZA 3GCGA 5B2ZA 2CJWB 4AG5A 1O87A 1RIFA 2IYUA 5G40A 3PUYA 1W36C 1BYIA 3AUYA 5HCNA 3QXHA 1E2HA 2QP9X 5SZKB 4IXMA 1QHNA 1J7KA 3ZS9A 4HAYA 3SJAA 4M22A 2D4HA 4Q7KA 1NVXQ 1Y3AA 3AEZA 4M9XA 1I4DD 5AUQA 5FUXA 1XMVA 3NIBA 4UQOA 3FHOA 4TL7A 4JL8A 1SVSA 3B7GA 5EE0A 2K5UA 1TQDA 4XWAA 4BRWA 1E9SA 3OEEA 3TIFA 1Z0JA 4ABYA 1Q1EA 2A5JA 1E9FA 2VYFA 3GJ6A 1P73A 1LF5A 3N2IA 2NGRA 4MKGA 3I8SA 4ZI3A 1ZU5A 2FU5C 4ZCLA 2FF7A 3GJ3A 3THXB 1T0HB 2H5EA 1QDEA 2JJ1D 4A0HA 1JXMA 1TF2A 4CZ2A 1TAGA 2IEYA 3MMPA 1K5GA 1JR3D 4K46A 1IXRC 1F6BA 1F60A 1J99A 2EFEB 1G7CA 5GJBA 2MMCA 4N0DA 2WWIA 3R9XA 2X19A 1VYUA 3GJ0A 2NQ2C 1E9EA 1WMSA 1E2LA 2BBOA 3OIYA 4BFVA 4US2R 4KCGA 3TUZC 1XMSA 2VLIA 4E07A 3T1OA 2OSBA 2WPDA 4IVPA 4BZQA 1YQTA 4QGFA 4OHZA 3C5HA 1P2SA 2OT3B 4DSTA 2BCGY 1XNJA 4TYNA 3LA6A 4Z8YA 1G6HA 3DKVA 4LBZA 2BEKA 2GJ9A 4RY2A 2BJVA 1PUJA 2DPXA 4JZKA 1JEDA 1W1WA 3N2EA 2YINC 5EUQB 3UG7A 3WXMA 4CW7A 5EP3A 2JIZD 3BIFA 2QZ4A 3GLHE 2RGXA 3I8XA 3FGNA 2GESA 4HZUA 3TVTA 4Q21A 4B76A 1LVGA 2EQBA 2CCKA 1WXQA 4CRWB 4PAMA 4QGAA 2W2TA 1GL9B 2ZYUX 3AVPA 4Q18A 5JWOA 2OEPA 3TR5A 2C2HA 2ZJ5A 2ZR0A 3IEUA 4FCWA 3RNLA 4BLOA 1E1RA 3MJRA 2GVDC 2ZRPA 3AKDA 3CZPA 1N0WA 2WHXA 3QVUA 4NCKA 1OXUA 4EJSA 5EE9A 2O8DB 4L15A 4B48A 2HYDA 4W5JA 2BKUA 3RSOA 4QKQA 2JLYA 3SJCA 2BMDA 2V4ZA 3LV8A 4YMUA 1G7TA 1HH4A 1NBME 1P4SA 1LW7A 2JDIA 4UJ5A 2VHCA 3MWLA 3DM9B 1XBTA 4LJ9A 4KLZA 3SBDA 3W5JA 3RS0A 4B75A 5F98A 4LPSA 2IUTA 3U6KA 3ZIAA 1SVLA 3THOA 2CLCX 1Q57A 3UKDA 4DT1A 1XD9A 3P4YA 4MGKR 3EA0A 4PC7A 4C0BA 1OFIA 3QEJA 2X77A 5A4JA 1JPJA 4AKEA 2GCOA 2IHBA 5HZHA 1U99A 2O5VA 3VR6A 4HLUA 1AQUA 2AKAB 1S2MA 4UKDA 4TZ6A 4BFYA 4F4CA 4IKEA 2OLKA 1HE1C 3ETLA 2BBWA 3HYRA 4QM7A 4QNRA 2E9SA 2C5LA 3QUSA 4Q1AA 3GFPA 3CWZA 1KO5A 3X1WA 4BLQA 4F93B 2AD5A 3FPAA 3PCRB 1YZKA 3P26A 4OI2A 2Q3FA 5IK2A 5DN6A 1KDPA 4JBXA 1L2TA 4TMKA 2VP6A 4CT4B 2QRNA 1EFHA 1GRRA 3L2OB 2J1LA 1FX0A 2WKRA 4DSUA 1CJKC 2VH5R 3VX4A 1FX0B 1L7VC 2WSMA 4X8HA 1G4AE 1R8SA 3IPYA 3ZH9B 3AVYA 4PO1A 4Q48A 5AWFC 4WW0A 1JAHA 4TLBA 2NPFA 5IK2D 3NC1C 4LSGA 1Z6AA 5DIFA 1ZC3A 3WMGA 3RC3A 4CVNA 5FPTA 2XXAB 2O8FB 2HF9A 1JQLB 5HTKA 821PA 2JJ1A 3K9NA 2VHQA 5JJIA 1KO7A 5FOWA 4Q4AA 5JRZA 2KBEA 4O2LA 2CE7A 3T5GA 4JS0A 5LDDC 1AKEA 3BORA 1ZD1A 4FD2A 1T3LA 5JZVA 1UFQA 1G5RA 2GF0A 5FUYA 4JT4A 4HB0A 2DR3A 2PLFA 2H8KA 1AS0A 5FBLB 4Q19A 1KI7A 4AKGA 4G0NA 4FW9A 3IO3A 2WAXA 1JNYA 1H8HA 1YE8A 4EPRA 4A4DA 1AS2A 2CCGA 1RYFA 2ZI3A 4M21A 5AK0A 5DN6D 5J47A 3ICQB 4QOSA 5JFGA 3LXXA 3K9HA 4XTRA 2GILA 1ZW6A 1Z06A 3EZFA 2FSGA 2FNAA 2RMKA 3FTQA 1NY5A 2ONKA 1E2MA 1K8RA 4M1SA 1W46A 4WIAA 3CRRA 2B92A 1KMQA 3BH0A 1RFLA 3L0PA 3AUXA 3EX7C 4ZIRB 1RC8A 1GKUB 3ZS8A 2OHFA 2OXRA 1ZP6A 2XTZA 3C7KA 4TZ0A 3LDAA 1UAAA 1ZM2A 1G17A 4TL6A 4U00A 1W49A 5CJ2A 3GLFE 1X86B 3AP1A 3QPWA 3ZVLA 4OJKA 1NKSA 3BFXA 3AF0A 1US8B 2ORVA 5DLQC 3JVUA 3VTKA 3ZZTA 4DLRA 2CL0X 3ZD7A 4CF7A 2XXAA 4QBFA 4GP7A 3QY0A 2WICA 521PA 3LVQE 2O8EA 3BFKA 3LXRA 3SYNA 1N3BA 1U2RA 2QTHA 2ZANA 3O8DA 4TMZA 2OCYC 3VU9A 2D06A 4HAXA 2G1JA 5JSZA 4LBVA 4FIDA 3RS3A 3IQXA 1U0HC 2VA8A 5JS7A 2RGEA 4BGDA 2GEVA 1ANKA 2R6FA 3A1SA 3AVUA 2JLWA 4FCTA 3SC3A 4Q7JB 5IF9A 4IVQA 3UPUA 3NXSA 4BLRA 3HU2A 4QM6A 5JCPA 3NVAA 1IXZA 5TV2A 3W8RA 2Q3MA 1YR8A 3AKYA 1QHYA 4C7OA 2FG5A 3L0IB 4XWKA 3GLIE 2BM0A 5JI3E 2BWJA 2AXNA 2GCPA 3RHFA 2VO1A 3ZZ0A 1A82A 1R8QA 2FGKA 1EFTA 1GVNB 2J0QA 4Z54A 1KI2A 1CBUA 4ZO4A 1MRNA 4Q4HB 2DYKA 1CRQA 1G21E 3Q72A 1D5CA 1U90A 3T35A 1YHNA 3GPLA 5CDFE 5JJKA 3FFAA 4MDFA 5DI9A 4TMTA 2DHRA 4PFSA 4A15A 4FCVA 3EA5A 3GEHA 4P32A 1N6KA 5KPDA 1Q12A 4EPWA 2W6IA 4FWTA 1G41A 1UBFA 1NVWQ 4Q1EA 1Z3IX 2ZRMA 4KITB 3JZMA 1NKTA 4PC3A 2NO6A 4BWYA 5JHHB 1II0A 1S9DA 1RRPA 4XWOA 2FDCA 1D2MA 3E1SA 3ASZA 3TBKA 4HLQB 3WHKA 2X1VA 4I99A 2OLJA 3MSXA 3KB2A 4O25A 3QXXA 3LAWA 2WOJA 3VR3A 1Z0KA 3OE7A 4LHZA 3K0EA 4DLTA 1IXSB 2ZYTX 2IYWA 4KODA 4V0ME 1UJ2A 2W83A 2ZRGA 1OFTA 1VYVA 2D7DA 3T06B 3LX5A 4Q1BA 1KK0A 2KB0A 1XDBA 2H16A 5C2JB 1JR6A 4RJLA 4RCYA 1YZGA 3KJIA 5KO2A 2QL6A 3LQQA 3OFNA 4OQNA 1QHXA 3EPHA 1PUIA 4KSBA 4C2TA 4C3ZA 2NO1A 2ORIA 2BBTA 2FZLA 4F4IA 1CR4A 2QMUA 3CPJB 4TT3A 2WKPA 2QMHA 2R9VA 1CIPA 3IGFA 2W6JD 1II9A 4EPYA 5JEDA 4A92A 4XOIA 5EJEA 6Q21A 3GJ7A 3L82B 4DVGA 2DCUA 1GM5A 2WJJA 4Q4HA 1D6JA 1NG9A 1TADA 5CYPA 3SOPA 3VNVA 4PQRA 1RRFA 4L16A 1F2UA 1ZIOA 2C98A 2IT1A 3MWYW 2ZI5A 2JLZA 2XZPA 3H4MA 1G8PA 1T9HA 4KVGA 1ZD9A 4CT5A 2AD1A 5A5GA 4M1WA 2C77A 1GUAA 1XEXA 3ZYCA 2CMKA 2VP9A 3S1AA 3I4LA 4P31A 4M0LA 4OK3A 2W0MA 3V4FA 5AUPB 1T4GA 5KUTA 3HDTA 2A9KA 2ZJ2A 2ONJA 2CEAA 1Z2AA 2CVFA 2DFNA 3QKSA 3EXAA 4BFWA 2ZE6A 2FSIA 3IUYA 3KFXA 4ERNA 1FUKA 2ZRAA 3M6AA 5SZHB 4EJSB 2NO7A 4DB2A 1KK1A 1VCIA 5JEEA 2VIIA 2A78A 1H65A 1NLFA 2ZS7A 3AGPA 5KOYA 1P61B 4R9UC 3VR4A 2ZE8A 1M1YE 3CUEF 5EUMA 3ZQ6A 3CB4A 2WWHA 2B8TA 5C1BA 4PSVA 1JQJC 2WZQA 1E2GA 2OFWA 3K0CA 4JBYA 3C41J 4NTZA 3DMDA 4XSGA 1CEEA 3FDIA 4NCJA 1EG7A 2C9OA 3P1JA 4IOKA 1E4VA 1KSGA 3FHTA 4ZDKA 1Z0IA 4KBGA 1S0UA 2E87A 3BB1A 5DO9A 1XP8A 2V3CC 1E79A 2HF8A 5FL7A 4CEHB 3VKHA 1YVDA 4EAQA 4CEHA 5JLJA 1DG1G 5FOSA 1KKMA 1DVRA 1W0JA 2AFIE 3LBNA 3SR0A 4I4LA 4WZ6A 4NYIQ 1M7BA 5FL7D 3WMEA 2CHQA 2F1IA 1KI6A 1VG8A 2JJ2A 1FW6A 1ZYUA 2KI5A 3W6PA 3W5IA 1G8FA 2WWYA 3K8YA 2Y8EA 1IN7A 5EP4A 1LS1A 3AVVA 1KI1A 1AJEA 2QP4A 1N6HA 4MQBA 4OBEA 1ZCAA 4Q9LA 2ECKA 4BFXA 1VMAA 8OHMA 5HCIA 1NNEA 3UMFA 1OXSC 5F3WB 3TQCA 4TQUS 2XNDA 3O47A 1N6IA 2WIBA 1IQPA 1VG1A 4YC7A 1XCPA 5CB6A 1DAFA 1Q22A 1Q44A 2AKYA 4OYHA 2C9CA 1GSIA 1ZC4A 4DC9A 5CDFA 1KDOA 2J59A 2B8WA 3QF4B 2DFKB 4PSAA 3A37A 5EQTA 3TUJC 3W3ZB 4JVSB 1EX7A 4B6FA 3VQTA 5J4VA 2H7VA 3Q8XB 2HJGA 4ITRC 2DWQA 1TMKA 1NMYA 4EQ6B 1KI9A 2MSDB 2V7QA 4A1FA 5DYIA 4Q4JA 1Z2CA 2CNWA 5UKDA 4DZZA 4JMPA 1FMLA 2Z43A 2D2EA 4FN5A 4DKXA 4PANA 3MAAC 3CF0A 1BIFA 1Z08A 2PLRA 3LRPA 1XZPA 1FUUA 1QF9A 1W0KD 4ZCIA 4PXAA 3OIUA 4TLAA 2W6ID 4P4SA 1CP2A 2IUSA 4AYWA 2W58A 2OG2A 1E0AA 2WKQA 3HP1A 4TMXA 4GDFA 4LJ7A 4MH0R 1NI3A 1J8YF 2YVUA 2GK6A 5P21A 3PEVA 2OE2A 2MMGA 2ZI7A 2FPMA 4NCNA 1Y63A 4NH0A 2RHMA 4TQ9A 2XSZA 2GJ8A 4P33A 2IXGA 2VP4A 4NP6A 2IF0A 3VR2A 1OB5A 4EDHA 1JPNA 4B3CA 4AYTA 2BMFA 3KXKA 4OI1A 4JKYA 5TMPA 1VIYA 3F5FA 1KY2A 4D81A 1N0UA 4V0OA 5AJWA 1P62B 3A36A 1F3OA 3MD0A 4GOXA 3V00A 3FKSD 1OXVA 1SXJB 1GTVA 3KKOA 4HB4A 1UBCA 4GPTA 4ZIRA 3KQUA 4LBWA 3HR8A 4D4KA 2VTKA 3WYAA 4V0LA 4AYXA 3DM5A 3LNCA 1E79D 1MV5A 4LHYA 2OFXA 4R98A 2IWHA 2F3RA 2I4IA 4RFSA 1H8ED 3MFYA 3RRZA 3QBTA 2EFCB 4QGGA 121PA 1ETUA 2QPTA 2QI9C 2Z83A 5DHFA 2N46A 3D7MA 4B34A 4CIDA 3TAUA 3EZ9A 1W48A 4B3BA 3T61A 2P2LA 2H92A 1ZIPA 1SXJC 4QBHA 1P6XA 5ELXA 3NKVA 3SQXA 4LBYA 2HCBA 2YHSA 1W36D 1OB2A 4ACBA 3C8UA 1IY0A 1KK2A 1ODFA 2YOHA 3LD9A 4JLBA 2DFLA 4UNQA 5FPSA 4TSFD 1AGPA 2YOFA 2VHUA 2NMVA 2QPAA 4PHGA 5CLQA 2JCSA 3A1WA 1Q1ZA 2PCLA 2PJRA 1XB2A 3KDSE 4L8GA 3CBQA 5FR2A 4ZKEA 5IT5A 1ONBA 1Q21A 2VPPA 2WV9A 4OHYA 2FJUA 5FOXA 3HYTA 1WQ1R 1W0JD 3AB3A 3UG6A 2ASEA 5TDHA 2OILA 1Q20A 4PQYA 3IQWA 2A3RA 4JIMA 5CLLA 1SKQA 1XEWX 1JEEA 3K0AA 3BBPA 2ZU0C 3F8TA 1Z28A 5E7JA 1RPZA 4HDOB 4R2HA 4B2PA 1KSFX 1OIWA 4LJ6A 3KB1A 3EPKA 1ZINA 3RYTC 3RSLA 1X6VA 2FFBA 2VSOA 3NBFA 4OK6A 3KKMA 1RJ9B 3VFDA 3TR0A 1IN4A 1KJWA 3O8CA 4J0QA 4RFSB 1IY1A 3EZ7A 3MWJA 5D3QA 5JI2E 3DEFA 1TL7C 3NH9A 5BYJA 2R6AA 1GKYA 2OCAA 3W34A 3H2YA 4BFSA 3DHWC 2PJZA 3UMSA 5EXXA 4TWZA 2BIFA 4QL3A 4QJ3A 2IW3A 3SFZA 4WAUA 3BB4A 3T15A 3SQWA 5FL3A 2IL1A 2CL6X 4ACAA 2Z0MA 5FI0B 2ZROA 1KAGA 3MCAA 4IDQA 3VHLB 2F55A 1P9RA 4KFSA 4ASUA 3AKEA 4LV8B 3A8TA 2QPOA 3IBGA 1F5NA 4QNMA 1HA3A 1XCGB 2ORWA 1P2UA 1DAIA 3Q85A 4Q1DA 2C03A 3EWSA 2FPLA 3DOEA 2YOGA 1W4AA 4PQFA 3IO5A 4LJ4A 4GZLA 3CF6R 1IOZA 4RD3A 4C0SA 1OXTA 3AVXA 3QXSA 4LYFA 2QAGB 2F1RA 1KY3A 1NN1A 2VQSA 3CO5A 4HUTA 1N25A 5H70A 1R4AA 3I72A 5E7MA 1E0JA 4OHVA 2Q0HA 4G01B 4NE2A 4RVCA 4W7SA 5EXTA 2ZRIA 4G5QA 5DHAA 3U7GA 2ZEJA 2QGZA 4WVFA 4KI0A 4DIEA 2WWXA 3EIHA 2QE7A 3VHXA 1MR3F 3WP0A 4DDTA 5CB8A 4NKRA 2PCJA 4JYBA 2R6GA 1X8KA 1Z0DA 5CITA 1XPOA 1GZSA 2ZJZA 3FMOB 3CRQA 2VP5A 2FSHA 1UKYA 2RH5A 3QBVA 1JXOA 5C46F 2KE5A 2GZAA 4IDNA 1S3GA 3A58B 1I2DA 1R0XA 1KI4A 5G41A 3TW4A 4LHVA 2J0UB 1GWNA 1NMZA 4EPVA 1YKSA 4JLAA 5H68A 3OIVA 5KDDA 4MITA 4W5WA 4LC0A 3UK6A 4A2QA 1COWA 4YMTA 4B71A 4S35A 3K70C 1V43A 1JI0A 1Z29A 1IJFA 1GNPA 1US8A 1W0KA 1RVDA 2NO9A 1E2QA 4M2LA 1GP2A 2P6NA 2XNSA 1FL9A 2F9MA 3FFBA 1P2VA 5B58C 4MA4A 3TLXA 4KYIB 1NRJB 2ZVPX 4AG6A 1QHHA 1WB9A 2UKDA 2F43B 4AKHA 1KOFA 1RRGA 3CONA 4TTRA 2AFHE 1EGAA 2JLUA 4W9MC 2AWNA 1NJFA 4KHZA 1JECA 2ZJ8A 1QHGA 1JJ7A 2WJHA 4NDZA 2BEJA 2HLDD 2SHKA 4EKDA 2J87A 1E4YA 2VF8A 3HR7A 4HYYA 5C18A 1GFIA 3O8RA 4PAOA 2ZYVX 4LJ8A 2HEIA 2PEYA 4F4JA 1NLZA 3KTAB 1HURA 2NO0A 1GL6A 1YR6A 2KBFA 4Q01A 1X8JA 2AK3A 3G5UA 2D74A 2D7CA 3TQFA 5KYKA 1YR7A 3GEEA 4I81A 2FE4A 3MWKA 4LK2A 4M53A 4C7OB 3K0CC 2OBLA 3QXJA 4YMVA 2RGBA 3OHMA 1R0WA 2WJGA 3B6EA 2AK2A 2AN9A 2J0SA 4WOPA 1UDWA 2IA5A 2RGDA 1OHHD 4LJ5A 1WA5A 2IF2A 3W90A 2YWGA 4LRWA 3FMFA 4L4UA 5LB4A 2NZ8A 3IILA 3LX8A 3U44B 2R8RA 4Q7LA 4PAQA 5EE1A 1PZNA 3P27A 4BFUA 3B82A 2ATXA 3QPUA 4L9SA 2A5DA 2P3SA 1KHTA 4JVMA 2B6HA 3RWMB 4FI3C 2V54A 1J2JA 2P6UA 1A7JA 2QAGC 3FWYA 2KJQA 2IYYA 2G6BA 2IYVA 1ZRHA 2V1XA 4PO9A 2PT7A 3PUVA 2XOKD 3OESA 5FTNA 5K8LA 3W9YA 4NYIR 4LGMA 1M8PA 3R20A 4PSKA 3K70D 1WRBA 4FXPA 4P0TA 1P7CA 3PEYA 5DH9A 1XMIA 5HR5A 3EZ6A 2R2AA 5BW8A 3D3QA 2VRWA 5JECA 4OKSA 1TQ6A 4E09A 1G3RA 3PVSA 3THYA 1U8YA 5L3QB 2BBSA 2GJSA 2X2EA 4FMCB 3RS4A 4A0GA 5LPNA 2G3YA 2G9NA 3AVWA 3HPQA 1BMFA 1G18A 1E0SA 3I61A 1F2TB 2F3TA 4DIDA 2OBNA 3LWNA 4OQMA 3U7FB 1ESNA 5KSYA 1JBKA 2ZE5A 3GLIB 3ZVNA 5IHPA 4QBIA 4C2UA 2NPIA 1R0ZA 2LWIA 2JAQA 1UEIA 3NEYA 4G5RA 5G3YA 4O3MA 2VHJA 4IHQA 1G5PA 4MKIA 1XTRA 1P60A 3A1UA 4UXJA 3KJEA 4UJ3A 1UKVY 1P75A 4Q66C 3QSYA 2VBCA 3A1VA 1PVOA 1E2JA 4TLCA 4FMDB 2ZSEA 4XJXA 3BH7A 2AL7A 2ZRFA 3EIEA 3ZIAD 1P2TA 1R2QA 1DOAA 4OI4A 4PC1A 4M1MA 3PEWA 4F92B 5DI3B 1QHIA 2JLRA 4DLWA 4U02A 3X2SA 1A5TA 1CKEA 1MT0A 4ARZA 1TU3A 2XJ4A 4IEIA 4RFVA 1XXHB 3QKUA 3RS5A 4AWXA 3ZVMA 5FBVB 1JB1A 2FFQA 1E94E 1OKKD 1CJTC 2B7BA 4D0LB 1NIPA 3MJHA 1NSFA 3LVRE 4M4SA 3TSZA 1VHLA 1GOTA 1E9RA 2JGNA 4ZKDA 1LF0A 4POAA 4ON9A 3WY9A 2G88A 4X8MA 4DWJA 4EPXA 3EIQA 2ZI4A 3LBHA 5AJYA 1TEVA 1WP9A 3L8ZA 1W44A 4EJSC 4BEBA 4RD4A 4TTQA 5F2EA 2FV8A 4DHEA 4RKEA 2R62A 4JJZA 3UMRA 3U60B 2A5GA 3PJRA 2IYLD 1KO8A 1ZNYA 3BD9A 3VMFA 3SJBA 1A1VA 1YRBA 4S2EA 4Z1MA 4BLPA 3U3OA 3I73A 2W2XA 2IYQA 4Q1CA 1GL7A 1TEXA 3BC1A 4C0KA 3ICEA 4V03A 3H84A 3GJ4A 4BLTA 3BAFA 4B47A 1BOFA 1KIMA 3E70C 5EP1A 4MYCA 4BFTA 1MKYA 5DNYB 3GLGE 2DB3A 4GNKA 2W00A 4GT1A 1U8AA 3QG5A 2BJWA 4K81B 4RD6A 1OIXA 4ZDWA 3H1TA 1HE8B 4AY2A 3QI2A 3ZDQA 2LKCA 1UPTA 2TMKA 3Q5DA 4TMWA 4PO8A 1TUIA 1UDXA 2YJTD 3OAAD 5DYGA 1SULA 2A5YB 4D82A 3R7WA 3REFA 3CKLA 1FZQA 4Q00A 5CM8B 2Z4RA 5KSPA 1G8HA 2NZJA 2WJYA 3C15C 1DO0A 3QPVA 2JDID 2JLQA 4DCUA 1Z5ZA 1FTNA 4BZPA 1S9HA 4C30A 1LNZA 4NBSA 1BO6A 1SXJD 3KUDA 2CVHA 2ERXA 4QC2A 5TXGA 4TL8A 3K0SA 2O8FA 4UNPA 5AJVB 4JLPA 3K0FA 5JMTA 3F0TA 2QENA 1SGWA 2ODEA 4LYJA 5G53C 4IW3B 3T5DA 1N2CE 3KUCA 1FPMA 1H8EA 2BOVA 2OM2A 4LHWA 1VDZA 1FP6A 1Q1BA 5DSZA 4NMMA 4WA7A 1Q3TA 4P4SB 3FKQA 1XJ0A 3T1VA 5FPYA 1GILA 1EWQA 1E32A 3SHFA 2ZYWX 1M34E 4JYCA 5DE3A 3O8BA 2ZVQX 2WWWA 2N1BA 4D4LA 2GCOB 4NCHA 4Q9HA 1EK0A 4XTCS 4A6XA 1KDTA 4LOAA 3KQHA 2XAUA 1WBBA 3X1XA 3AM1A 2FMXA 1A2KC 1ZNZA 4MGZR 4PHHA 3CR7A 2QTFA 3NHBA 3KXLA 1IN6A 4F91B 2ZI6A 4PHTA 1C9KA 1VPLA 3IEVA 1E2DA 1TNDA 2DY1A 3PIRA 1GG2A 3LQRA 2W6JA 3GP8A 1G16A 3ZD6A 2J7PD 1VCMA 3DPUA 2BCJQ 2V6IA 1HT1E 1IHUA 1KO1A 1T5LA 2WIAA 2ZSFA 5B30A 3CM0A 3EW9A 4NYMR 2BVNA 2XB4A 1OSNA 1WBDA 3AVOA 1KSJA 3EC1A 2GHIA 1N5JA 1II8B 1EESA 2C78A 2GF9A 2GXAA 1D9ZA 4LHXA 2PX3A 3I5XA 1MO3A 2BM1A 4Q1FA 2FOLA 2FPKA 1RRCA 1S4QA 1DBSA 1GIAA 3AF2A 3CLVA 3OF5A 3U3JA 3WYGA 1QHHB 4MKFA 3NTUA 4NZYA 2F43A 3WP1B 2ZSBA 1DAKA 1MRSA 2ZRLA 4WBSA 2YV5A 2YWHA 3NDBB 5KU1A 2WAYA 3AF1A 5JS8A 4JL5A 1XZQA 1ZD8A 1N5KA 4JLOA 3PUXA 3ZVRA 1KSHA 2GBLC 1HUQA 4JLNA 1OE0A
chains in the Genus database with same CATH superfamily
2IYEA 3RUCA 4G1BA 3UZUA 4JROA 1E66A 2NVBA 1Y1RA 5CM2Z 4UPVA 2IHTA 3N3BC 1GAWA 1HQYE 2XV1A 1OILA 5DTIA 3GNQA 5AVUA 3TLJA 2Q21A 3GP5A 1YZNA 1L4GA 3V8QA 4ZZ1A 1F6DA 1W2GA 1T6NA 2KLBA 1PUXA 2IIVA 2ZSKA 3DW3X 2HF7A 3QNUA 5HJ7A 1WOMA 4G4IA 2JEOA 2NUAB 4J0KA 5JHGB 4I0WB 2ERYA 2BGWA 2C9DA 1NOIA 1ZBDA 2WTEA 5I7HA 2BELA 2O0MA 2WDZA 4IHAA 3KEQA 4NHEA 2CHFA 5DX8A 3KOXA 5F7JA 2VHYA 3FB4A 3HU1A 5DDIP 3IP6A 5REQA 2P6OA 2ANCA 2PZJA 4MQUA 2IS1A 3U3MA 3ZVKA 1EHCA 1E3MA 3DOIA 3D54D 3E9ZA 4WXPA 4MW9A 1UBEA 1T8YA 4IDOA 4XB2A 3HSYA 5DYYA 3MXTA 2XYGA 3VBEA 5JCXA 2F6RA 2Y67A 2X4IA 1BDJA 1RZVA 3H0KA 5KSWB 5HKOA 2BFEB 3GO4A 4G8DA 1DAMA 4D4IA 1BOOA 5JU6A 1UOPA 2OHJA 4GZ6A 1PSDA 3GDOA 3IP3A 1XJCA 1GPAA 1TI7A 5EJ5A 2X4LA 2OM6A 4B6EA 2C84A 1DDOA 3N2YA 2Z6UA 2O0JA 3U13A 4BU0A 3CUTA 2I99A 2INGX 5FH9A 1WNFA 5EXDA 3VSDA 4CM3A 1JUDA 2QMEA 2H4JA 1WSWA 1OGYA 2XRFA 3OPMA 1WEHA 2VYQA 2ARKA 1SH7A 4HWOA 1TU4A 1AURA 4YXWA 4Z6KA 3A04A 3KSAC 4TTVA 2PMFA 3F3KA 4MW6A 1Z13A 4HZGA 1VCNA 2O50A 4MVJP 5M34A 4K0RA 2WMOB 2D2VA 2DX7A 2C99A 3ROEA 2JANA 2NUPA 3DZKA 1XRMA 5KDLA 1SRQA 2J3KA 1RKBA 1TM5E 1KU0A 1TM3E 4DNFA 2XH8A 3HBFA 3OHSX 5BMVA 2CKMA 2QA5A 3VU1A 2WTNA 2PU5A 4V0NA 1XN1A 3FY4A 2HV8A 1GYQA 4IEEA 4EFMA 4QZVA 2HSEA 4XVRA 4PHCA 3VR5D 5TQVA 2H2WA 3E7WA 4IBOA 4DBLC 1I3OA 4G5XA 4HCJA 5TT1A 3VPXA 4I4TF 1AUOA 1PSZA 1A2OA 3D1JA 3FDJA 4GRDA 4Z0TA 1XYGA 4CMKA 3PVZA 3IBYA 3L1UA 5SZJA 3TRIA 4DRYA 3M6UA 2EFYA 3IQZA 1FMCA 3BSSA 3LO5A 4DV7B 1DTSA 2ET6A 3JQEA 1WB5A 2HT1A 3EYAA 3GLVA 1M8JA 5E3HA 3JTMA 2GH1A 4G4JA 1ZNXA 3TQIA 1SEVA 3WYCA 1PQUA 3CUUA 3U44A 2WZBA 3RABA 3TFOA 5D00A 3LWDA 5DT2A 2FN3A 1OLSA 1JG2A 1UKBA 3ZWOA 4ENRA 5KQRA 2XB2A 3RYCB 2J6CA 3BWYA 3A6GA 4OHBA 3M2TA 1GITA 2PGJA 1I3LA 1J56A 2OCDA 2PAAA 2ZK7A 4PC2A 3VPCA 4YRGA 2J4CA 3VH3A 1SM4A 2Z5VA 3ZHZA 3RTBA 1OLUA 2RAVA 4P92A 5FFNA 4AJKA 4GMHA 1KI8A 2GXQA 2NLOA 4PCLA 5JXWA 1PFUA 2C2XA 3OJ0A 5BSTA 3FNRA 4Z51A 1EJ2A 2ID8A 1K88A 2QU7A 2VDOB 3ORRA 3PPYA 1UIRA 3PE4A 4O2AF 2GTHA 3ABZA 3M9LA 3BQNB 3H1BA 1P8AA 3IQFA 2C5GA 4N6NA 3V1KA 3KJXA 1BD4A 1A97A 1PT7A 3ECCA 3THXA 1PV4A 2GAOA 4H1UA 1N6OA 2QLNA 3QF7A 1P7PA 2DVMA 4ND7A 1W4RA 5IAKA 2NUPB 5A0VA 1CR0A 3Q9UA 4EP1A 2DFVA 2IKQA 4R1NA 4RTKA 4GBMA 2UUAB 2GD1O 4LK3A 4KVFA 4C76A 1VKZA 2WZCA 2V7VA 4Y2YA 4COOA 2I2XB 1XDDA 2ZR8A 3H2KA 3W8NA 4F21A 1RP7A 1YS4A 2AQ8A 4EW3A 2WHRA 3QPCA 5L4LA 3G59A 1MZVA 4MPRA 5GTDA 5KHOC 4ND4A 1FDIA 1IBLB 1G3QA 2NTYC 4GGMX 4LXYA 4D0RA 4Q37A 4ZGWA 2R8OA 3MD9A 5A4KA 3MCWA 2EERA 3IRVA 4MTLA 2Q3BA 3OQOA 5FWXB 1HL3A 5LXTF 1TF7A 2J0VA 2IEIA 4HQFA 2RIRA 3KTAA 4Q16A 3I62A 4BWGA 4DANA 1GZUA 4L7VA 1B26A 3T7RA 2KMLA 3TOXA 4E7PA 1QTIA 1X1BA 4ZXPA 3QEMA 4N18A 2XQVA 1S1MA 2XCQA 3C3EA 3K70B 2X0IA 3HWSA 1GG9A 4HADA 3DQPA 4AS2A 2WIGA 3BXHA 4HZUB 5AKKA 4YRZA 1NNI1 3NKLA 2H7YA 1NNEA 3SZMA 1QORA 3RYHA 4LZPA 1M2WA 3KZNA 5FLKA 4EMUA 1SVWA 2IHKA 1IK4A 3TTSA 3ZKWB 1EFVA 5C0OE 2V97A 3OFVA 5J4YA 4NE7A 5K3SA 5CLGA 3N0WA 3S68A 1V96A 4LUCA 4MCHA 5BV8A 1N8SA 3MMNA 2LIVA 3O91A 4I6JA 3WRXC 5IBRA 3GLFB 4X1YA 2QT1A 4F1WA 1L5SA 2NTJA 1AK9A 1GNVA 3NVKI 5CA0A 1P81A 4B74A 4NZNA 3GD7A 3GUHA 3ZXXA 2AMLA 2Q1SA 2GFQA 3T7DA 5BSMA 2FW7A 3A4MA 2J30A 4MVXA 1DIBA 2ADFA 1WSBA 5JWRA 4QBTA 4KPUA 4HQOA 1RQXA 5IPFA 4N3NA 2G5CA 2MT9A 3LYUA 3KVNA 3BHIA 1H1LA 1IFXA 3CLKA 2J5XA 1AQYA 3Q9SA 4KHPB 2ENWA 3HKCA 2XSZD 4NBNA 1SUDA 4EITA 3D3EA 2PKRA 1XP5A 3KSZO 4JOBA 4N76A 3OE5A 1MJNA 2OXCA 3NBMA 3T1TA 4S2UA 1V5EA 4BPRA 3Q8WA 1FBTA 1NLMA 1ENZA 2V0NA 2YWFA 3RV4A 3K15A 2IRWA 3FVVA 2V6JA 3GELA 3DE2X 3JZIA 2QVCA 5DNAA 7ABPA 2IX3A 3JVVA 1CIJA 2P6RA 3EDCA 1A9RA 4COKA 3VV2A 4KSCA 3SP1A 3X2FA 1JIUA 5GQSA 4MRSA 4DCMA 1B1AA 5DM4A 1V11A 2R6DA 2EZTA 2OCPA 3C24A 4TWRA 1U8UA 1DZ3A 1ZMBA 2G0AA 3CEPB 4OLFA 2Z2XA 5FLEX 2YZ2A 2O52A 4CQLB 2C9BA 1VP3A 4UASA 1M2NA 5I01A 1Y9JA 2JRCA 2B5VA 2B21A 4ZQEA 4TSFA 1PJ4A 2WKWA 4UHBA 3TTVA 3WKDA 4BATA 1UL1X 4RKYA 2PA0A 4AKIA 4BFCA 1DO2A 4WL0A 2OLEA 1UJ4A 1HYQA 3GB9A 3G68A 4CN8A 2PGNA 4NHOA 2X76A 1J24A 3TVYA 1XD2A 4UATA 5BYAA 2WF7A 1WE2A 1L5LA 3W5UA 2Z58A 3F9CA 3WSWA 3B2EA 1JR2A 5TVKA 4R0MA 3GDGA 1XK6A 1V7ZA 3NR2A 3VSEA 2YWBA 5HZKA 4G67A 1NSTA 2VRCD 4G9EA 2CYBA 2ODWA 3DE4X 1XTJA 2WG2A 5JSKA 3VDNB 1WVGA 4G1UC 4I4TB 3KXIA 5F1PA 5HPYB 3FPHA 1R0BA 1UXOA 3S6JA 3LF1A 4KUEA 1O6BA 3C5EA 1G64A 2B82A 2WNSA 3CNQS 3IKTA 4G84A 1PCXA 1AKYA 4L3OA 1BA3A 4X45A 4BEJA 4EYGA 4F46A 4ZVMA 4DWVA 3NOVA 3CEHA 1RWKA 1TU0A 3F5QA 3GPDG 1TC1A 2YC2C 3C4QA 4KQIA 3PUJA 3JCZA 5HF8A 3MK31 1D09A 2ZYGA 3ORQA 3S2GA 1AZTA 3WGUA 3UV7A 3HXKA 3A4LA 3NYQA 2YNMD 2QAJA 1MNQA 3UAWA 3E8SA 4J6FA 1KRWA 5JW6A 4GOJA 3ITDA 4QVKA 4QREA 2NXJA 1YHYA 2C9YA 2BF4A 3AMVA 3PGXA 1U7OA 3BMQA 4R54A 4RJJA 1HX7A 3LLVA 4LXTA 1U65A 3IPRA 1GTJ1 4RLSA 4K05A 1T4CB 1U0NA 2GASA 3RUFA 4IDHA 4N6OA 2FZVA 1H2ZA 2P9BA 5LL6P 1VIAA 2J7PA 1P9LA 2DPYA 3E2IA 4ITUA 4L6CA 3TPCA 2VQEB 1NJ2A 4E30A 3P20A 3ND9A 3IVAA 5L7YA 1CS4C 3EZGA 1E99A 4YQFA 2YWJA 2Q2WA 4QUBA 3GUVA 1T2CA 1LV7A 4RK0A 3G0HA 3MOGA 4PLCA 3VSAA 3VR5A 4FE4A 2XDWA 3H9JA 4RHFA 4R1MA 1L5QA 2WWFA 5AJZA 3U3XA 2IPMA 1V1MB 1L5OA 3D6TB 3DEIA 1BMFD 2J9GA 3WC4A 4X00A 2Q4DA 4M1YA 1WXFA 2WYOA 2O3SA 4LI0A 5BSEA 1YACA 4C1NA 1L4LA 5CIWA 3PG5A 1IJEA 3DUFB 2GXUA 5IJAA 5E1DA 5JZOA 3KPVA 2OAEA 2ZBFA 2VT2A 1XAIA 1AY0A 3LOPA 4F2GA 4YUYA 3COWA 5KPJA 1QG4A 3NEAA 1SVKA 1T2EA 3U4IA 4PGMA 5TS2A 1PJCA 3TX6A 1ZKMA 2FQXA 3IKJA 1YZLA 4BTVA 1BAPA 1HE4A 1TA9A 2IPLA 1CUIA 1VXRA 3AONB 3O95A 3PNOA 4KGZA 4J2TA 5AJTA 5J5VA 2H2GA 3VR4D 4RPIA 1G7RA 3L43A 3OZCA 3BWEA 3DGFC 2RC6A 3FWKA 1J09A 1T6YA 4JIGA 1ZS9A 4NFHA 4OYYA 1FNNA 1VRWA 3TRFA 5HUJA 1RE1A 5F9FA 1VHTA 1RYNA 3WKEA 3ECSA 1B74A 3G2OA 3AY6A 4MHSA 4C4SA 2XRYA 4F5DA 2DBVO 5KTPA 5HP4A 3G13A 1FFGA 3I3SR 4L8VA 3ZCUA 2O8BB 3RJ9A 2EYUA 3GGJA 3N05A 2BGJA 2BMJA 5CTAA 4ENUA 1R4NA 1CSEE 1IUNA 2GCNA 4U9IS 5HE9A 1GEGA 1TKAA 2VJMB 3ZHTA 4AT1A 4N47A 1CNFA 2ZZKA 4GI1A 3ZV6A 4XWTA 4Z1MD 1F38A 1VHQA 2QQEA 1MOZA 3EB9A 4RWZA 1DUIA 1O97D 2QNBA 1Z6XA 3PFHA 1WUTA 3Q9NA 2H9YA 2G0TA 2XUIA 2XMBA 4JUCA 4S1OA 4DR1B 5DGXA 3FPCA 4O2BA 4LV5B 2GJAA 1RJDA 2VJDA 2GKSA 3K09C 3OE7D 3HYNA 5B55A 3U1BA 1P6QA 4IH9A 3D7RA 3AF3A 1IHOA 2QZSA 2R5WA 5FULA 4Z7QB 1O96A 1JEQA 4G4SP 4OHKA 5ESDA 1MIHA 4OQFA 4WD3A 1HXHA 4LDNA 4E4TA 3T34A 4DM3A 3KU1A 1T1IA 2GK4A 2WG0A 3GRAA 1PEAA 3GT7A 4GX0A 3OEWA 1AV6A 2FP3A 5CH3A 4UEQA 1ZZEA 5HE8A 1SPXA 2PSJA 4OAPA 3ZUGA 2W9XA 2EGHA 1TMOA 1NG1A 4FMBB 2GTPA 1BDBA 5HIMA 2J7KA 1UKEA 2NO4A 4RZHA 3HO1A 3I9OA 4D4MA 1QX4A 1YZUA 3E7PA 5KSOA 1JHVA 1JL3A 2FZEA 3AWIA 2FW1A 3HVUA 1KFCB 3I45A 4L2IA 4BCDA 2PV7A 2HN9A 2ZCJA 1TOAA 5FPHA 1UH5A 2Q6KA 1BCSB 1ULBA 2A2ZA 2IP2A 2JBHA 3DOOA 1HY3A 2GKOA 3T9FA 4ZGGA 1S1CA 1A8QA 1UEJA 1CR2A 1EVIA 5ALGA 2KSQA 2P2ZA 3DE1X 3QVGB 4OEHA 4WV3A 3WRYA 3H4TA 3VNUA 4JI6B 2CNWD 4IL5A 2E18A 4B7CA 3EG9A 4OM8A 5HTOA 4KO4S 3ZLJA 4YFVA 1UM9A 3S5UA 2WD7A 2ZUVA 2QM3A 3TD6A 2IH5A 1VA4A 3AEQA 1KRXA 4YCLA 2PQ0A 3RJTA 2ENUA 4F3TA 2V65A 4R2LA 2C29D 2ZB7A 1AS3A 2ON6A 4I1VA 4LQDA 2Q5IA 5JBQA 2FQQA 2KLHA 2I1QA 4MUJA 1QK4A 3A3OA 1V8OA 1UCFA 4WH0A 2GEKA 4Y9DA 3V3KA 4YJ3B 1WCIB 3ZWDA 1R0RE 3GDFA 3KOOA 4E5NA 3PA6A 2OV2A 1ZGCA 2I4TA 1EK2A 2WVAA 4NCXA 3VRHA 3BX1A 3D4NA 3IS3A 4LIPD 1NBAA 4MWGA 2DKOA 3SYRA 4ZT7A 2VJPA 3NJRA 1XZ8A 4IIBA 5LKAA 3T95A 4QFDA 1OA0A 3IAXA 2PGLA 3B9PA 5EJ8A 1OFGA 1A4XA 4KJZA 1FDSA 3KQTA 4DUPA 1Z56C 1PS0A 2DRIA 2I2FA 3WIBA 1ISHA 2I62A 1TK3A 5A4MS 1M7HA 4HRVA 3UENA 5LD2B 2PUFA 3DMRA 4PR0A 4P22A 5ANRB 1JFRA 3T9CA 3T3PB 2CJPA 2NUAA 1WZ2A 2LP4Y 4PTYA 3TW8A 2VUIB 2RFLA 1KO4A 5L6MB 2Q5HA 1R0LA 1E0KA 3QMVA 4XFKA 3RYHB 5KSZA 3PXEA 2QTLA 3VR2D 1EFRA 4EYSA 5K9ZA 3P9ZA 4YJ2B 4MRVA 3C16C 1SUAA 1Y6JA 4JB8A 1JN0A 5KTMA 4D0SA 1Y3CE 2ZIUB 5HFNA 2PUJA 2DBQA 2P9ZA 3GLKA 2V7XA 1YRQA 3VYSB 2GK7A 3GD5A 5CHEA 5CEJA 4MUAA 2XQKA 5NLLA 1IMOA 4PG7A 4UCXA 4DREA 3GJXC 3SWWA 1YB1A 2UXDB 2IS6A 1CQXA 4MQLA 4EG4A 3CBGA 3NHLA 4JU9A 3STXA 1AIPA 2WHEA 2QTVB 1A8SA 4HSEA 4V24A 4Z8XA 4RHTA 3TAHA 2H1OA 1PGQA 2EYQA 4H1WA 4TUYA 3OT1B 3P45A 2E2WA 5B1SA 2VZLA 4IJ6A 5JMPA 1SUEA 1PJ2A 2XECA 1PO7A 3O5AA 3QVSA 1YRHA 4GYKA 1L7QA 3KQKA 3LECA 1Y6QA 1S3SA 2MIIA 3FZNA 3OJXA 1V3QE 3ILYA 3Q7IA 1W1IA 4CMEC 1ZHHA 2PMKA 2OQRA 2ZVJA 1R3DA 1G0OA 5J4LA 3HFRA 1XTUA 1GL3A 1LC0A 2O7RA 2QTMA 4PU0A 1QHSA 2ZS8A 1RHUA 1FA9A 2DFTA 3B3QA 4G2NA 5GP1A 3WDLA 1KAOA 1X7DA 3G7SA 3HI6A 1DARA 2XTJA 3K53A 3QGMA 4KQ9A 3MN1A 1TKCA 4BE7B 3F47A 5I8PA 4Y2VA 2WDPA 4RETA 3THYB 5D5QA 2QD2A 1EX9A 4LZZA 2G1KA 4GQIA 4ZVQA 1DBWA 4LX0A 4TZKA 3MRSA 2QAIA 1QIFA 1G291 4WZAE 5DW3A 1W85B 4N5HX 3UAYA 3LHFA 3TLMA 1Q3HA 1CF9A 4MPTA 2X1HA 3ETHA 4JSTA 4Y2SA 3W78A 2I9KA 2O8CB 4UULA 1NXTA 3WGMA 2CBZA 1KETA 3CZMA 3P94A 1IEWA 2Q49A 3R3XA 4HEHA 3HY4A 4N6GA 4Y9RA 1YIAA 3LJKA 4KYUA 4NH4A 2P1ZA 4FNAA 4YCBA 2CNOA 3NBZC 1K66A 5DZSA 5EZ5A 3ZOZA 5JXGA 3FMPB 3WLAA 1XKTA 1ISGA 3C7TA 4IUCS 1XVIA 1OI3A 1QCCA 2YMLA 3RAJA 3DVLA 5KQPA 1NNLA 1U8ZA 3MERA 4PW0A 5KKCA 3B1FA 3GH1A 2CL7X 3UATA 2GEJA 4H0FA 1XRLA 1QZ3A 2CL5A 2HRQA 3P5SA 2YZKA 3TE7A 5I7VA 2CFCA 2X8JA 1RXWA 3DW1X 1J20A 1Q0PA 4HFNA 2IV7A 2CXPA 1IQUA 5FOTA 1D1SA 4GYWA 5AKHA 1ZM7A 3SZOA 2GBGA 3SE0A 3H19A 3Q7QA 5I7RA 4B3GA 2HJSA 2NXEA 3EA4A 1QOPB 3GL9A 2QVGA 3ZWKA 1SY7A 3A1TA 4PG4A 4G1FA 4U9HS 3WNBA 2ZZNA 3V8BA 1ODKA 2VRCA 2JW5A 3QFSA 3BRCA 3HKBB 2O1EA 4TKMA 2O07A 3EK2A 4MR8A 5SZIA 4FT2A 3U3KA 1CUCA 3LNTA 2PUCA 4ZYWA 5IDVA 3QLUC 2HMUA 1OIVA 3CG0A 2ZIEA 4O4LB 5D3MA 2VR1A 4IGEA 2OXTA 4DLYA 3LCRA 3L46A 3WWYA 2HZ7A 3OIDA 4HNRA 4MYHA 4PZLA 4CG0A 1IBKB 4F84A 4D6PA 1XMOB 4K9RA 4ZCMA 4LC1A 3HXQA 1HNWB 5EIHA 4A2WA 1L5KA 4C04A 4YXWD 2FZ4A 4O02B 1J7JA 1WU8A 2BC9A 3TVDA 5I4IA 1F2TA 1E3WB 1U02A 5D7NA 3GNLA 1CZKA 2P67A 3EBOA 2JFQA 1I3MA 4DA6A 2DKFA 1E1QA 1GGNA 1YVUA 2ZAGA 1XCOA 3DBRB 1KJNA 4A6PA 3IKVA 3AKZA 1I0IA 1XQXA 1Q17A 3L7LA 1PJTA 2HDNB 1JTEA 3CNHA 1C9NA 3BB3A 4KX5A 1QFJA 3ZJ4A 3CNNA 1O1YA 2RBKA 3QVVA 1AGNA 1NKVA 3GUYA 4QUGA 1PDWA 4K1XA 5JZMA 5JUWA 4LCBA 1M1UA 3NDRA 1L5HB 3T1QA 1AA9A 1MVNA 1RKUA 3LGSA 4K9SA 5KQMA 1IBRA 5KU7A 3EXG1 4OL9A 3F78A 2W6MA 2G40A 4DMGA 3B85A 4EQ6A 4MP6A 3S2ZA 4ZC8A 1NN3A 1G2PA 1RWWA 1TA0A 3CWQA 1I7PA 2VKTA 3RVNA 3UGQA 3V9PA 2R1TA 4BKUA 1DEHA 1LS6A 1H9AA 3GG2A 2HWKA 3HG7A 3O2JA 4O4HA 4Q4AB 4S1NA 4UNNA 2GN8A 4N01A 1GNSA 3C5WP 2RK6A 2DHQA 4RNCA 3K09A 1HLGA 3HJUA 4FEEA 2NZYA 3U0VA 2AFHB 4YB8A 4F8JA 5H02A 1T0IA 3H9BA 1MT3A 3CKKA 1ISJA 4NZ9A 1O95A 2Y66A 3BTOA 3UYLA 4RANA 5IRCD 1N9GA 5E7IA 1XKLA 4OSOA 3I58A 1GQ2A 2WSLA 4YAUA 1VJTA 5CHYA 1HTWA 1K7SN 2CXQA 1WF3A 4JAVC 5JATA 2YN2A 1T2AA 1X0XA 2J45A 4PNEA 1I2AA 2JLBA 4F1JA 4PS1A 4Y6GB 5L53A 5HW0A 2ZYHA 3T3GA 2ACEA 2P9HA 4L5JA 4JLUA 2ZG6A 1OHHA 3IP7A 4X8OA 4X7RA 4MEAA 3HO8A 5CX1B 1L5FA 4AZVA 3M0EA 4CQMD 2A9PA 4DCNA 1KMIY 4YJ3F 1R6BX 1Q0ZA 3N6XA 3HKEB 5IM4A 1DEKA 1PLLA 3FYUB 1T91A 3L8CA 4MV1A 3RM3A 3FYUA 5ALKA 3DTVB 1TMGE 2AOXA 2XQIA 3A2NA 1RZ3A 4JGGA 4WZAA 3EMKA 2GRAA 2QZ9A 5AW4A 3FNIA 4IIJA 4JK3A 5LWHA 4QHSA 2R96A 2Z2ZA 4TTPA 2EQAA 4HQRA 3WA7A 2YX1A 3BL5A 1PHPA 2WEKA 2NVUA 4C0WA 1CULC 1VBKA 3G2MA 4RJ2A 4V3CA 2OO5A 3T5PA 3NORA 4P84A 5FOVA 4RTOA 3I1IA 2R8YA 3HI4A 3TRJA 1GNRA 4B82A 5M2QA 2XWBF 1BJRE 1YA4A 1GCGA 3M1IA 5KBYA 5AVJA 2CUKA 4CBVA 5BXQC 3W6ZA 3GCXA 3G2LA 4HLUC 1BEZA 1JHMA 1FK8A 2E5WA 1A7AA 5IYZF 4BNNA 2C94A 3HB9A 5AW9A 1G55A 3RUDA 4NMXB 4BVLA 3QPBA 1XTKA 3EWAA 4L9RA 2V7EA 4LDZA 3WGTA 4OQDA 3G3EA 5E6RB 1YFLA 3MHPA 4UCWA 1EP9A 2ILTA 4GI2A 3RVPA 4IWYA 3RRBA 5ALEA 4BVHA 4XYGA 1WD7A 3FE2A 5LB2A 2ISQA 4D0NA 4C03A 2WY2D 4JODA 4RTQA 2HOQA 2NZUG 1XMJA 1GLGA 3K1JA 4WTOA 2ZE7A 4OL0A 4RMJA 2ZJ4A 4TVKA 1R6UA 1C4XA 1SUBA 2C5FA 1GG5A 3WRVA 2VOJA 2O3JA 2XXBA 3BXFA 4QUKA 3WNDA 4DB4A 1Q0TA 4UUAA 3V4RA 1VIVA 2BDTA 1QIEA 1C7JA 3SZRA 4WEQA 4QQKA 3TKYA 3W5DA 3U37A 4HGZA 3IE2A 4IXDA 4WZBE 4ETNA 1WCV1 4EA6A 2PN1A 5DOVA 5M3BA 3RASA 2IXBA 5E2AA 3E1GA 2XDQB 4C22A 2D62A 3I6ZA 1CLUA 1TT5B 1XSEA 3W04A 4DIMA 3QUAA 1UWCA 1EXMA 1KDZA 1S96A 1NZJA 5E4JA 3BXEA 3BUSA 3WHIA 5LIRA 3BJZA 1JP7A 1CQJA 2GN6A 2PT9A 2BRUA 1E1DA 1PYOA 3TTYA 1K8XB 1QS0B 2AC7A 2K4MA 3ESRA 4LRTB 5ESXA 1Y48E 2H51A 4BVJA 1QKKA 3LLUA 4PR3A 1GJRA 4KE9A 1LK0A 2OCIA 5DHQA 5DULA 1A72A 1HOTA 2W6ZA 4NZMA 1XLTA 1UMDB 3OUUA 4KXQA 4OXIA 4OQ4A 3TMAA 2P2DA 4FB4A 4MPPA 5T4BA 4H3SA 4P53A 2ZUUA 3UJHA 3SXJA 1RI4A 4MROA 3A06A 4HPJB 3BXGA 1B93A 4MPDA 3CRW1 4EIWA 3GRFA 1W5SA 1WCYA 3PNMA 2RHGB 2V8OA 2IITA 2XGMA 1HDYA 3MUEA 1PAUA 4D02A 3FYHA 1RACA 1XXHE 1FDUA 1PTJC 2BKXA 2YFYA 1Y82A 1EAYA 3KQNA 2QU8A 2VH2A 3AI7A 2GXSA 3W5SA 1U2TA 1XVUA 2AT1A 1WX1A 2YQ4A 3IPAA 4O1IA 1Q7RA 4BV8A 1MO5A 3ECAA 3G49A 3ZTWA 5LR6A 1D8TA 3BIOA 3IUMA 3Q7PA 4IDDA 2YKGA 1GCAA 4G4SO 4RS4A 2I7CA 5EE5B 4EENA 1JLLB 1FYFA 1UPUA 3IMGA 2WQZA 1NUPA 2QNRA 4AF6A 4WN9B 2PH1A 2J3EA 1PR2A 2E4XA 1EDOA 1T3TA 3IESA 3P52A 3S5JA 1ESEA 3TN7A 3W6UA 3WLMA 3AVTA 1L7OA 2QVBA 3RFUA 5DNCA 5JJCA 2R25B 4DQDA 4KIJA 1SG6A 4G5HA 4Y2QA 1MO4A 3LPNA 4UNSA 4EAAA 5FBQB 1E3JA 3D8RA 5C7YA 2GSDA 2EW1A 3LDHA 2OZEA 4A8JB 3ZZMA 5SY4A 5T4FA 1O94D 2WD8A 4HQKA 5B6IA 1A8UA 3OC0A 1PT8A 4LFAB 4XEHA 4MRAA 2A59A 3K9QO 2ZM5A 4LXXA 1BU8A 1MEJA 3AETB 3RREA 3A1EA 1ZK1A 4A16A 2GZ3A 3C3BA 3I3OA 2PZGA 5KWEA 1W8DA 3TW8B 1U0LA 2G83A 4Y67A 3Q6MA 4AK9A 3U5TA 4BL5A 5EJIA 3WB1A 5CEEA 4L1KA 3S0JA 3OOEA 2ZPAA 4LCJA 1JAIA 1E9CA 1O96B 1OYVA 1JYEA 2K2WA 3QA3E 2IDKA 4KMSA 4RPGA 5AUOB 4JXZA 2TMDA 1Z73A 3G1TA 1PZFA 1U3TA 1Z88A 3W4IA 1B23P 4U7DA 1EDBA 4YRJA 5CJPA 2XYVA 2XY4A 1JTFA 2JIDA 1NJGA 1DAHA 1FSFA 2I03A 3G1WA 5H4GA 2AHOA 3ADKA 2AOVA 1W8IA 1DG3A 3NAMA 5L3VA 2GD6A 1SVUA 3OD5A 1P1BA 2W6NA 1KR2A 4XIYA 1FJGB 2QLTA 1CYDA 5FUVA 1Z0AA 4PLTA 1QGDA 3P4XA 2JLSA 1XPOA 3KL4A 2BTQA 4JC5A 1DGQA 4TUYB 1WNTA 1Y6RA 3D2CA 1NVKA 4G0XA 5B64A 4EI8A 1MO2A 4HDNA 4WKGA 3SFVA 3EF3A 3HH8A 3VZDA 5CCXA 5C5IA 3BKXA 3GUCA 2WP0A 3DDHA 4CGZA 5KDOA 5I7FA 1AKVA 4AWAA 3IDSA 5BWOA 1M8GA 3BG5A 5ESRA 3T5TA 4C08A 4EUSA 5BWCA 3AUTA 3FG9A 1YNOA 2OXEA 2IK8A 1JW9B 3EOAI 3A70A 4IX9A 2ODBA 4OCZA 1KEKA 4I4CA 3EGDA 3S2EA 1KPHA 2ZATA 3DB1A 4IJMA 1CP3A 5LQDA 1N2CA 1CZRA 1QSGA 2O9JA 3SZGA 4RULA 3JQ9A 3V2HA 3M4ZA 3SX2A 2WYWA 2FFHA 2L0XA 4I1IA 2QSZA 3V7UA 1YR2A 3W2GA 3VZPA 4KNVA 3ZQUA 4ZREA 4UM7A 1FVOA 1IRXA 1QBGA 2I33A 1NURA 3MYYA 3NEPX 3NHMA 3NRJA 4R2KA 5SZKB 2QP9X 2HNKA 3KHKA 1Y98A 2RJNA 4HAYA 2D4HA 4Q7KA 3FAKA 4WKCA 5DP2A 2PKXA 1KQPA 3IAEA 4KQCA 4MB0A 4IHKA 4KH1A 3NALA 4M9XA 4DPMA 3B6MA 3NTVA 3D0KA 5AUQA 2ZAYA 5FUXA 4BO0A 4CM4A 4JHLA 3JXEA 3PQ7A 5A4FS 4JL8A 4EO9A 1U1FA 3DF7A 1OLSB 3DDOA 5JC8A 4LAFA 4YHBA 3EZNA 1Z2NX 3KXDA 5PNTA 2GB4A 3TIFA 4JX9A 2D1FA 1Z0JA 2QD3A 3L6CA 4EMBA 2A5JA 3HLYA 3T5AA 2X1LA 1E9FA 1KP2A 1O95C 1NQWA 3GJ6A 3LMKA 3OX1A 3P9CA 4I55B 4LZNA 3TBFA 2J3JA 2YJ4A 3NTRA 5CXSA 4U6NA 4KWHA 4CKEB 3ZXYA 4WJLA 3N2IA 2QIOA 1JQ5A 5GINE 1YJAA 2P35A 1ZG3A 5AKJA 5HKLA 2FF7A 3GJ3A 4BNLA 3PTAA 1EX1A 1G8JA 1QCZA 1J06A 2H5EA 1NI5A 4X6UA 1FW8A 4LA4A 2QWXA 1CF2O 3ITNA 1BQ3A 1JXMA 3Q5GA 2Y9PB 4PIMA 1K5GA 2B69A 2CB0A 5CR9A 5C80A 2EFEB 5GJBA 1ZRNA 4PVCA 2MMCA 2PUTA 1PR9A 2VATA 3HLKA 2HGZA 4G41A 6CHYA 5KJFA 2R86A 2J0EA 5FA5A 2AOUB 1T10A 3JWJA 1VYUA 1E9EA 2BONA 1RLTA 2OB1A 3HKCB 1USVA 4JY7A 2NP6A 3M4NA 3A4TA 3GK3A 2PGDA 1JVBA 3NWBA 2DUJA 2CXNA 5GOTA 4HH1A 4POOA 5HM8A 1QB8A 2OSBA 1V2HE 2VI5A 4IVPA 2JIOA 1YQTA 4QGFA 3VA7A 4X0EA 1LI5A 3KUKA 1W96A 1YDEA 1B0ZA 2OT3B 4DSTA 1XNJA 3RNOA 4B9EA 4Z8YA 2XUKA 3BCSA 1WUJS 2F48A 3O4RA 5A7HA 2BJVA 2EZ8A 3ODPA 2JFHA 3B5EA 2DPXA 3G0GA 4QPJC 4JZKA 1TFUA 3QE4A 2EJCA 1BFUA 5AI9A 4CMAA 7REQA 3N2EA 5EUQB 4D3ZA 5LYJF 2ETXA 1KKUA 1P1JA 4YAWA 1QDUA 3MOSA 2QZ4A 3KSUA 3FGNA 3O0DA 3N28A 4X97A 3TVTA 4Q21A 1NF8A 3H2IA 4FDLA 1DWOA 3FB1A 1LVGA 4B76A 3HJBA 2IZZA 4QJBA 5LVAA 1WXQA 4JUDX 3P9RA 5IUJC 4MVYA 3BSWA 1B15A 4WY8A 4DAOA 2ECQA 4E6EA 4EF6A 2P27A 4CCWA 1IY9A 2OEPA 4O2AB 3TR5A 3U4GA 5BV0A 4BX2A 2ZR0A 4FCWA 3RNLA 2HWWA 3JR7A 5HX7A 5EIOA 2PL1A 3SF0A 4WVLA 5D5HA 4K03A 1I1NA 2ZRPA 3AKDA 5MF6A 4AP9A 4F12A 5EL0A 2EZUA 3H97A 1OXUA 4EJSA 2VPTA 5EE9A 3MMXA 1VPWA 4L15A 3IURA 3TS1A 1GZDA 2FPXA 3RH0A 3SJCA 4B0OA 2AV6A 3CF4G 3O8NA 4XQ0A 1TPYA 2AYXA 3TZBA 4IIFA 1KQFA 1HMPA 1P4SA 2HIGA 4NULA 4RSMA 1L7EA 1U6JA 2ZB4A 4LJ9A 4Y2GA 4JEUA 3F4BA 4BNHA 4HWRA 1EEHA 5DSXA 2IUTA 3U6KA 1SU7A 2A84A 4F6RA 2Z9DA 3VJRA 3I04A 1Q57A 1GCOA 3SC2A 5BR4A 5K5EA 2D8MA 1KS9A 1XAGA 3RVKA 1OFIA 2VBGA 5LYJB 4N8SA 3CZ9A 4KIFA 3GJZA 3COPA 5IANA 2P5UA 1T9KA 1WS6A 1JPJA 3DEHA 3LLSA 3HXLA 3PFCA 1U99A 5K7SA 3L8FA 2AKAB 3E0XA 3ZZ1A 4BO8A 2H4ZA 5JS6A 3DXYA 4UKDA 3L04A 4ZJYA 1GUBA 2IEDA 3G7UA 2MINB 2H31A 2C4TA 4IKEA 1GTSA 2OLKA 3H1EA 2BBWA 1RMTA 3S1LA 4J0FA 4OSEA 4QNRA 2WT8A 1EM6A 2C5LA 3LT2A 3QUSA 5EA2A 4IFTA 5GM2A 1CRZA 2AD5A 1YNSA 3OZTA 1DBRA 1RWVA 2JFNA 3FPAA 4AS3A 5HIKA 3S3TA 1JA1A 2OBBA 2PGAA 3DF9A 2X6QA 5BXYA 5DN6A 4GKKB 4DRXB 1W93A 3UHOA 1L5MA 5JSQA 2QRNA 2PGXA 3G89A 4MEJA 3RUIA 1ZVVA 3GQVA 2XUFA 1FX0A 3EXFA 5AHWA 2O54A 3OCUA 1CJKC 4X8HA 4X60A 3OP4A 1JE1A 3IPYA 3SM9A 3WNZA 4EEXA 4PO1A 4GO1A 5JCJA 5ALWA 1Z75A 4YPFA 2XF8A 2HWXA 2PM8A 4TLBA 2WNHA 4TV8F 4HWTA 5DIFA 1DCMA 3CNBA 5F2NA 5JH7F 1M1YB 3WICA 4TTSA 1RQGA 1JQLB 3BE8A 1RRKA 2OKGA 5HTKA 821PA 2JJ1A 3OETA 2VHQA 3FUWA 4F71A 2F8TA 5FOWA 1RZUA 3CLHA 3GT4A 3TG8A 4JS0A 1EPUA 3QZUA 1NM5A 1TT7A 2R8EA 1UIMA 2YIJA 3KKZA 5KEIA 1EZZA 4ZVLA 2AUNA 3MBOA 2KHZA 4X24A 1KVTA 4G0NA 1RYDA 1AKUA 3KOZA 2VK8A 4FW9A 4ZU6X 3WTCA 3TD9A 3ZY3A 3PD1A 2XBMA 1BWSA 3ROQA 1NVTA 2CCGA 3N0RA 3OCZA 1D2RA 2OQ2A 3AO0B 4M21A 2C7RA 2VWHA 2I8CA 2YN0A 2DG2A 4GR5A 2XA1A 3MC1A 1ZW6A 3RVRA 1OU0A 1M66A 3EZFA 3PRJA 2FSGA 2FNAA 4QOHA 1HKUA 3FLAA 3FTQA 3PC3A 4XGRA 1F0KA 5EGNA 1K8RA 4W8OA 1IPHA 1YQUA 1W46A 4BV2A 5FHRA 1N57A 4FFDA 2PX4A 1ZHOA 3CRRA 4ZMSA 1N32B 3MFQA 2PR7A 1RFLA 3D6VA 1ZI8A 2MYTA 3L0PA 1XMXA 3LI2A 1I51A 2XYHA 3CN7A 3FDZB 4KUGA 3R5KA 4YPVA 3ZIDA 1M5RA 3KSMA 4BQOA 2WF5A 1GKUB 3EVTA 4DNOA 1V1MA 2HCRA 4FHGA 4XJSA 3UJBA 4WNAA 3O4JA 4TZ0A 3L0ZA 1SOWA 1G17A 3FAZA 4IRXA 4OHOA 2FTKE