2P9JA

Crystal structure of aq2171 from aquifex aeolicus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
158
Chain Sequence
b'ALRDRVKKLKLLIMDIDGVLTDGKLYYTEHGETIKVFNVLDGIGIKLLQKMGITLAVISGRDSAPLITRLKELGVEEIYTGSKLEIYEKIKEKYSLKDEEIGFIGDDVVDIEVMKKVGFPVAVRNAVEEVRKVAVYITQRNGGEGALREVAELIHFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ2171
publication title Crystal structure of AQ2171 from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 46
structure length 158
sequence length 160
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2p9jA00
3UMBA 1L6RA 1WVIA 4XE5A 3U13A 5AVTA 3ZTYA 2WFAA 5A3QA 2GO7A 3QUTA 2YJ3A 3D6JA 5AKHA 4KNVA 5AI6A 3WGVA 2YJ5A 3ZWDA 5AKYA 1Z5GA 4L6CA 1Z4MA 2EARA 5AKLA 1RRCA 2RARA 5ALDA 2FUCA 3OCXA 5AKZA 1CR6A 1U7PA 5AI4A 5AKKA 2AMYA 1Z4NA 2P11A 2HF2A 4GIBA 3WK9A 5IS2A 3CZ4A 1N8NA 4JDPA 2IOFK 3AR3A 5AKJA 4ZEWA 3NIWA 2WHEA 4Y2UA 1RMYA 5ALXA 2FPRA 4UMDA 1QQ7A 5ALNA 4YIKA 1U02A 3NASA 2OYCA 1NF2A 3ZX5A 3N8GA 5IT4A 2YN4A 2WF8A 1K1EA 4CF3A 4B6JA 2PR7A 5AM4A 1AQ6A 2YJ6A 2YBDA 3L0BA 4F71A 3GYGA 2B8EA 5AI5A 2ODAA 4BNDA 2OA0A 1WZCA 5AW2A 1LTQA 1ZJJA 2W11A 1VFPA 3MMZA 1KYTA 1Z5UA 3AR4A 1RQNA 2G0AA 4UU1A 3MC1A 1Z4PX 4UM5A 2YMPA 2ZBFA 4EEKA 3ZVMA 3OCYA 5ALEA 3UM9A 5T41A 2EAUA 1QQ6A 2FI1A 1RMQA 2WF5A 4KX3A 1TE2A 4EENA 2P9JA 1U2SA 3ZUPA 4BX2A 1JUDA 3W5CA 1O08A 4Y2XA 3KOOA 3DAOA 2G08A 3QGMA 5AK3A 5AKGA 4BEVA 5AKXA 1QYIA 1L8LA 3OCZA 3A3YA 3WKDA 2G1AA 2RBKA 3OCVA 4Y2PA 1L8OA 3CNHA 5ALFA 4AS2A 2I7DA 4UMEA 2CFRA 1RLOA 2X4DA 3MN1A 3FPBA 2IA5A 3N28A 3QXGA 3WK8A 1RKQA 3NANA 4G63A 4OCZA 2G80A 1TJ4A 4KN8A 3L1VA 3QYPA 3EF0A 4I9FA 5AESA 4HAIA 3QUQA 2ZBGA 3L7YA 1QH9A 3NUQA 3L8HA 2Q5EA 5ALLA 2FPWA 3AR6A 4OHFA 4YCLA 2B8JA 1T9ZA 5AVSA 1ZRMA 4PNHA 3HLTA 3W5DA 2MSNA 2B1QA 4F72A 3QUBA 2IOFA 2ZG6A 2O2XA 2C88A 2CFSA 3ET5A 5AM3A 3FGOA 5ALSA 2WF7A 5AW7A 5ALMA 3WK4A 5AW3A 2GHQA 3ZVNA 3W5AA 3IJ5A 5AVXA 2YJ4A 1YNSA 2HX1A 5JJBA 5A3RA 3QNMA 4L6AA 2ZBEA 1Z4IA 2IYEA 3HYCA 3I28A 3OPXA 4CF5A 4CF4A 1ZRNA 5AK6A 5AI0A 5AI9A 5AVQA 1Q91A 3QU5A 1Q92A 3EPRA 5ALZA 2HO4A 5AKEA 4YIHA 4RESA 4EZEA 3FM9A 1T5TA 3M1YA 1VJRA 2P69A 2JARA 2O9JA 3AR7A 1RKUA 2G09A 3FZQA 5AVVA 3F9RA 3U7EB 1QQ5A 3QU2A 1PW5A 3R4CA 3FVVA 2OBBA 1N9KA 3L8FA 3BA6A 3N5KA 2NYVA 4EX6A 4XPZA 2WM8A 4I9GA 1Z4JA 4Y2JA 3WK7A 3L8GA 4YCNA 3IB6A 1EK2A 2B0CA 2C4NA 3K1ZA 5AVRA 5ALTA 1IWOA 2PKEA 3AR9A 1SWVA 2C9MA 5AVWA 3NRJA 1RKVA 1RMTA 5ALQA 1L7NA 4AS3A 3ESRA 4Y2YA 2BY4A 2ZXEA 3B8EA 3ZWKA 3ET4A 4UATA 2HF7A 4BX0A 1NRWA 1Y8AA 2R8YA 3L1UA 5AI8A 5FP0A 3UMGA 4UU0A 1YV9A 4QQFA 4OFZA 1L7MA 2WF9A 2FDRA 4UAVA 4GXTA 3DNPA 2W43A 2NO5A 1WR8A 4NABA 2HDOA 3B9RA 3KBBA 4DW8A 3VAYA 5ALUA 2PQ0A 4ZEVA 5AW8A 4O8CA 3L8EA 2HOQA 1EK1A 2YFYA 2OM6A 5ALWA 3S6JA 2GFHA 4HYTA 2Q4TA 3WKAA 2QLTA 2C8LA 5ALGA 4NV0A 3A1DA 1TJ3A 2YMMA 3U7HB 5AM0A 2GHTA 4BBJA 5AHXA 2VKQA 3EF1A 4YH1A 3TLMA 3WK6A 3ZU6A 2IOHA 3ED5A 2I55A 5AW4A 2CN1A 3MPOA 5AM1A 1U7OA 4C4TA 3DDHA 4KNWA 4UARA 4C4SA 3E8MA 2YY6A 4EELA 2W4MA 3SMVA 1ZOLA 2BDUA 4L57A 2G06A 3RFUA 2AUTA 3ZVLA 1TA0A 2EATA 2RAVA 2D2VA 3OCUA 3U19A 2Q4RA 4HGOA 2GMWA 5AW5A 5AW9A 1NNLA 3U7GA 5ALVA 2FUEA 2BDEA 1RLMA 3I6BA 2MU1A 1RC8A 3ESQA 4CNQA 2YMLA 4BKMA 2HI0A 2FPXA 5AK4A 3ZTWA 3L0YA 4MUMA 1SU4A 2HEGA 4HGPA 4YGYA 4G9BA 3QLEA 3WGUA 1X42A 1VJ5A 3OTQA 4OD0A 1S2OA 4EX7A 2FPUA 1F5SA 4HGRA 1FEZA 3PGLA 4FE3A 4DFDA 1ZD4A 1O03A 5AW0A 1ZD2P 3OCWA 4KX5A 2JAOA 1XPJA 5ALHA 1Z4LA 3PCTA 3AR8A 1XVIA 4BX3A 2NO4A 2YMQA 1RDFA 3E81A 2C8KA 5ALIA 3SKXA 2R8ZA 2I33A 1XP5A 1YMQA 3E84A 4UASA 1J8DA 3EWIA 3QX7A 2AH5A 3QU7A 5A3SA 3SF0A 4UAUA 4XOUA 4E88A 2R8EA 4BYGA 5AVYA 3I1YA 1RQLA 4UW9A 4KYTA 4HGNA 5AIBA 4BNDB 3N1UA 3R09A 2JGAA 2WF6A 4QJBA 3N07A 5ALPA 4DWOA 1LVHA 5AKIA 3RF6A 3QU4A 1J97A 3L5KA 1Z4OA 4DCCA 4FYPA 4RETA 1U2TA 2B1RA 3I76A 3R9KA 4XQ0A 5ALKA 3DV9A 2AGVA 2HSZA 4BEWA 3NAMA 2HCFA 4H1WA 2I54A 2FPSA 2P27A 1ZD3A 3FPSA 3QUCA 3ZI4A 1S8OA 2DQSA 5AW1A 3KZXA 3P96A 3KD3A 4Y2SA 3WK5A 3BWVA 2ZBDA 3PDWA 5ALOA 3B9BA 4Y2RA 2I6XA 5AM2A 1ZS9A 3W5BA 4MWOA 2B82A 4HGQA 4CE6A 2G07A 4NFLA 2JAWA 4J2TA 5ALJA 1Z4KA 4NAVA 3ONNA 3SHQA 3U7FB 3U26A 2JAUA 5AW6A 3KDPA 3UMCA 3PGVA 2I34A 3NALA 3A1CA 1L7PA 2R8XA 3KC2A 1Z88A 1TJ5A 4IG4A 2B30A 3L0CA 1L7OA 3SKYA 5AICA 4IFTA 1SWWA 1CQZA 1T5SA 4C4RA 3E58A 2RB5A 1MH9A 4J03A 4Y3UA 2CFTA 4Y2TA 4YCMA 4UM7A 3ZW7A 3A1EA 3J7TA 3WKEA 5AVUA 5AM5A 4UMFA 5IT0A 4Y2VA 5AVZA 1Z4QA 4FFDA 4Y2QA 1YJ5A 3ZX4A 5AK5A 5ALYA 3QU9A 3M9LA 2ZOSA 4AP9A 1WPGA 1YDFA 2QYHA 5ALRA 4JB3A 3WKCA 4UMVA 3SLRA 2FEAA 5E0OA 4NWIA 3AR2A 5AIAA 3SD7A 1RPZA 3WKBA 2HHLA 1ZD5A 1RLTA 3AR5A 4ZEXA 3IRUA 1YS9A
chains in the Genus database with same CATH superfamily
2ZI4A 3T3DA 2VUUA 3UFXB 2QX7A 1ARZA 2OL4A 2ZYSA 1RYBA 3SXUB 2BGKA 1JHXA 2O48X 4XAQA 5JNSA 3H9GA 3U7QA 1X80B 2OXRA 3GPBA 4J0DA 4X71A 1X7YA 5A3QA 4OLBA 3ELWA 4HNAA 1GA4A 3T1OA 3H3JA 4UAJA 1NF9A 2W2PA 5B1YA 2IDMA 2ETVA 2PQ6A 1R50A 4RIHA 1PR1A 1I2DA 2R66A 1ISFA 1T36A 3R0VA 4JC0A 3UXYA 3JQAA 4KQXA 4NBKA 4MICA 4X7RA 3VGJA 3ZW8A 1CLUA 4FFVA 4ND5A 1YD7A 4MW1A 4G1CA 4YN3A 2Q1TA 1TVEA 4BTEA 1JTFA 1CE8A 1CQIA 1IRIA 2AI2A 3AZOA 4HDNB 2QZJA 4LRTB 1PZEA 3A1SA 1W75A 5FOWA 3ZD8A 1KRXA 5G1OA 1A04A 4FMCF 1RRKA 4D80A 3EGWA 4M86A 2D62A 4KCGA 3SR3A 5F4ZA 5AKJA 2EBWA 2FSIA 5FTNA 4BMDA 1R4AA 3L0PA 3NHRA 1FFCA 2E6KA 2PY6A 4W63A 3CUKA 1RMYA 4ZO9A 3B53X 1LX7A 1K06A 1M8GA 3BXGA 1LQUA 1NQOA 1YKFA 5CX4A 4FHCA 3SK0A 1M34A 4JHLA 4EJMA 1GCUA 1Y4AE 5AOCA 2B8TA 1N9GB 4KQCA 1E6CA 1NOJA 5IT4A 3K6SA 3HI6A 4IDBA 3RREA 1COZA 4MYHA 3R3UA 2L19A 1GPNA 2OBXA 5EGNA 4PZEA 1GGNA 3R4VA 4WECA 3H1PA 3OEWA 5C7IO 4GR5A 5AI5A 3K30A 4WGFA 4OXXA 2IWRA 3STWA 1GO2A 4AVYA 4CMBA 5HIAA 2JJ2A 1N1MA 3GT3A 5E95A 2C9DA 1Y9JA 5CT5A 4Q4HB 5DBOA 2F3TA 4ZKEA 1JALA 1KYTA 3KQVA 4M1KA 3RVKA 1RQNA 3STYA 2FDCA 5KWVA 5FWDA 1PVDA 1KXJA 3HYRA 5H1YA 4EG7A 5JBIA 3KOWA 3SVLA 2IODA 1E79A 2FSGA 4G0MA 1A4RA 2LV8A 2YMPA 3IEMA 1X74A 1C9MA 1J99A 1Z6ZA 4EG8A 2BGWA 3QIAA 1YUBA 5CYPA 3CN9A 2FFHA 4OXNA 1NVAA 1W9MA 3A1NA 5EQDA 4F1WA 4BNGA 4S2EA 1D5WA 2RHBA 1E3LA 2FR8A 3ETCA 2AE1A 2P8JA 3NYRA 4JVLA 1ML3A 1NAHA 2LNDA 3U49A 4ZJUA 1KQ3A 1Z62A 2IXTA 3EDMA 1ZWKA 2FR0A 3KOOA 4Y2XA 3AEXA 4OQEA 3W5JA 3BREA 3QY9A 4C0LA 4I2VA 3SE0A 4Q9DA 5LP6B 1ZK4A 2IU3A 1TUGA 3CC8A 4Q01A 3PX3A 4ZXFA 3ZGNA 3L7BA 4NU5A 4P7FA 1P44A 3OCVA 4O2BB 1VLLA 5FWYA 2J9RA 3F3YA 3RUFA 4F4CA 2D2XA 1L8OA 4PO1A 4R98A 3V1KA 3OPNA 1X1AA 3NM6B 3PJEA 2EYQA 1YF3A 1D9XA 2Q3FA 3A11A 3BQMB 2QVCA 1K66A 3NDJA 5CFPA 2BR5A 3GA0A 4FFMA 3W5CA 2WJJA 1LK5A 1KFCB 1T8SA 1Z5PA 3N70A 4QEDA 5C0OE 2OENG 2V74B 3JRNA 1J0AA 1PTKA 4C76A 4ND2A 4YJ2A 3ORRA 1RXCA 3BTVA 3BWMA 5CIYA 2G82A 1FU7A 3CNQS 5HZKA 3DEIA 3DXXA 3ITKA 3PYXA 3L7YA 4FGKA 4B43A 1O6GA 2D06A 3ZE7A 1NDHA 4B3GA 2FPWA 2FWRA 2KX7A 2QSUA 4FWIB 4ND8A 1XUOA 2R4TA 4KFRA 1T8TA 3KZ1E 4KR7A 1Z0KA 1GTMA 2BTEA 2GVDC 3W8EA 4HXFB 4TYYA 1P0CA 3FZNA 3UY4A 4DLTA 1WMAA 5JCXA 3ZCTA 1CRWG 1JG1A 2Z0MA 3DM9B 3PXEA 1BE0A 1NT2A 1FJ2A 1QTIA 2PX8A 3T3GA 3HYNA 5J4YA 5JEDA 3GAFA 1DXOA 4K87A 4XGQA 4A0SA 4EA7A 3RBZA 2X76A 3D7LA 2QSYA 4LXGA 4BY9E 3PXGA 1ZH2A 3W2GA 2Z9BA 1E0AA 3FPHA 4GAEA 3U3JA 4IZIA 3UN1A 2DMRA 1GPH1 2WZQA 1A82A 3F6SA 1X8KA 4OP2A 4E09A 5ICCA 2HWKA 1SC9A 1R6BX 4KVFA 1XZNA 1QIGA 2FJUA 2PCLA 4OK6A 3VO2A 2QN3A 1KI7A 2BKUA 1EQ2A 1GRCA 4LGMA 4OHXA 4CI0B 3D6TB 2J0VA 3ZKWA 2EKLA 1E1DA 3DFZA 4N1AA 3QE3A 2A5YB 1ADBA 3VDQA 4UUNA 2XVXA 2P6RA 1ANKA 3KYDA 3O4FA 2GM9A 2C29D 2H11A 4CDGA 2QZPA 3CBGA 3IUYA 2D7DA 1B00A 1Q5PA 2BTQA 4IO1A 3UOAB 2K7ZA 4Y6RA 1G19A 1MIHA 2BEKA 1RQXA 2XMQA 5K9ZA 2WQ7A 3DBLB 1Z6TA 1BWRA 1QH8A 3ZCQA 5FR1A 4GMGA 5KAMA 3C6MA 4YT2A 3VR4H 2C5GA 4YR9A 1VIMA 3GRZA 1KC3A 1KY3A 2QI9F 3IYLW 2A8YA 1ZD9A 3A9VA 2X5XA 3AVYA 2P4UA 3HJRA 2I4TA 4OU4A 3AL3A 3VR1A 2ZUFA 4HN2A 2O1SA 1D6SA 4JI1B 5LXTF 3RDPA 2W93A 1XEAA 3V7UA 2JZCA 4B8YA 5COQA 1PW5A 1X1RA 1NIJA 3THXA 1ECGA 1ORWA 4FDLA 4LGVA 2ZCVA 4QTXA 3FPKA 5CDTA 1KI3A 1IULA 1NP6A 2TMDA 2VNKA 2H4XA 3ZG6A 3U37A 4IXMA 3ZDDA 2WG1A 4W6QA 1LLFA 2B0CA 4IUYA 2EKQA 5K3EA 2F4NA 5KOIA 3IQHX 1N0HA 3CUWA 3K92A 1ONPA 2GEJA 5FOTA 4I1UA 1EH5A 1RLIA 3HKDA 3M4NA 1XA0A 3E7DA 4CL0A 2OFWA 2ZR7A 3G79A 2CT8A 4P0QB 1JX6A 2QW0X 4MV5A 3ZWKA 5KREA 4A2PA 2UUBB 1KNXA 4J7CA 1GQSA 2R8YA 4PRYA 5TGZA 1N6LA 3UMGA 4NPCA 2E89A 4UU0A 1BROA 1G42A 4G37A 3V32A 1HMPA 1N7JA 4U02A 3A4LA 2GTIA 2VJKA 2QUIA 1RQGA 2R7NA 3OZAA 4WN9B 3I5YA 1FJXA 3ZCRA 1DINA 4YAWA 3SYNA 3HA5A 1SKYB 3N7UA 4WE3A 2HU2A 2JKVA 4X7MA 3BCUA 5EVJA 3FGPA 2O6LA 2CXNA 4QWWA 4BBAA 3ND7A 2ODWA 3A6ZA 5BT8A 1IQPA 5KPJA 4OI4A 2HDOA 5DDIP 3EWSA 4DCGA 1L4UA 2FUKA 4HH1A 3O1LA 3VAYA 2Z2IA 4LIPD 4WY2A 3NDBB 3IILA 1MEEA 1UKZA 1RHJA 2XNJA 4BATA 5I4CA 3R3SA 5FHRA 3EQ2A 4DF3A 2QRVA 1JDSA 2ZSIA 4QJ5A 4EHAA 1U80A 1MJGA 3MCTA 1KHHA 3O3NB 1I3NA 4M0UA 3H2HA 2IXFA 3KHTA 4GOOD 3RASA 5C8YB 3LBHA 2F2TA 4CHGA 2GF0A 3QF4A 1VSVA 2PZLA 2WV9A 3KTFA 2OD7A 2C9OA 3OBIA 3DWGA 4J49A 1BXRB 4HYTA 4URVR 1RCUA 1P4SA 3BIJA 1KDYA 4Y9DA 4W1RA 1OT5A 1OOEA 1XRQA 2E49A 2HF8A 1UM8A 1G0NA 4M0CA 4ZOLB 5CB6A 2OCGA 4U7DA 1WULS 3EG9B 3OOHA 2PO5A 4KIWA 1KVTA 2ZYWX 2C3UA 3NYIA 4ZOCA 3TLMA 2I3BA 3HBAA 4EAQA 3PQ5A 2XYHA 4Q02A 1GCGA 4F5DA 1FW8A 1ICEA 1P9NA 2K2WA 3MPOA 3NEAA 1TPYA 5JAZA 1T8PA 1WOYA 1QG6A 3U4AA 3VPCA 4LOKA 3QA3E 2QV0A 1JDJA 4MS4B 1LY1A 5G1NA 3GNLA 3VBEA 1O8BA 4UXJA 1K89A 2JLQA 4G0OA 5D1HA 2MJLA 1Y3FE 1J9EA 2A0UA 4IEFB 5GM1A 1RM5A 1Q16A 2QPAA 4I1RA 4LCBA 4QUDA 1TEHA 5HA5A 3VR2D 3WL4A 3SQXA 1IN6A 5DCYA 4V0ME 1KMIY 3CRVA 2CVQA 1B8VA 4OM7A 1Y3HA 2J5KA 4N0QA 3U19A 1DPGA 3ZLJA 1P1BA 4PCAA 4E3WA 5HUJA 4DR7B 2PZKA 3NVAA 2OBYA 3NHUA 5HGXA 4AG6A 5DULA 1C3XA 2CLDX 2XTZA 1NJ1A 1VGVA 2DE0X 4YTEA 3H42B 3BTSA 1HLGA 4O4LA 1AURA 3MWDB 1TQ8A 1GG9A 2EKPA 1ACMA 2VF2A 3O21A 3C0KA 4HN9A 2QRQA 1JQEA 2UYYA 3JQBC 3C3EA 4L0MA 4R69A 2NPFA 2PMEA 3IKVA 4P80A 1NAIA 1PFQA 4MX8A 1ZL0A 3CNEA 3TX6A 3ZXXA 2RGRA 1YFJA 3PHHA 1X94A 3QITA 5J43A 1XB2A 4XFKA 2BFDB 4D4GA 2FW9A 4JD5A 1M8KA 3FYDA 2XUKA 3AP1A 1XNJA 2WPDD 4IV5A 4BHTA 4ED9A 4KV9A 3V3KA 4ZICA 1JILA 3EYWA 4KR3A 1VTKA 5EJ9A 1K08A 2YNMD 1J1ZA 1Y8CA 3C2QA 3PGLA 1AUXA 4HBZA 3FLBA 3E53A 2O2HA 3KKEA 2JFWA 2AFHB 3K4PA 3H16A 1U1EA 4YCBA 1WXWA 3DMRA 1RADA 4TSFA 1OLOA 3T5TA 5ICMA 2FW6A 3KJNA 1WXEA 2AZMA 5LKAA 1H5UA 3R5FA 4E2FA 5EUMA 4TMYA 5M3BA 3U61B 1R0RE 4QARA 4UHBA 2LGJA 1Z13A 3NHLA 4XX0A 2WIKA 4DV2B 1SKUA 2IBMA 1C9NA 3VU1A 1P19A 3HABA 4AJHA 3K20A 1CY1A 5TEWA 2A4MA 2Q3MA 2YRWA 3L93A 1FTNA 1RYDA 1WEKA 4EITA 4CV0A 4POOA 4N7BA 1II9A 1DKMA 4F2PA 2VHJA 3H75A 4Y67A 4MRNA 3AGPA 5JXWA 1L5WA 3HKCB 2EF1A 2X8BA 3HU2A 4KYTA 3U4GA 2QT0A 1NQVA 4N5MA 3IAXA 1EMDA 4ZT5A 3ISJA 4EFLA 2HK6A 3WHPA 3ENWA 1XXHE 3IVMA 4FHEA 4E1VA 1LVHA 2QGZA 3RT7A 3ZI0A 3DGFC 4RQAA 2R1ZA 3NM4A 4RC9A 4E30A 2EKBA 2C99A 2I29A 4QDXA 1DIRA 4NBUA 4QO7A 4BE4A 4ZEMA 1RBYA 2NYRA 1C7EA 3GUVA 4UPEA 2WM2A 5LOVF 1VXOA 4BLPA 1MJFA 3GV0A 3DNFA 1D3AA 3GFSA 3P0IA 2ZYGA 4IH1A 5HF8A 2GN2A 3ZU4A 4BVKA 1OPRA 1YC2A 1PDVA 3ADPA 2I54A 4S1TA 3ZIDA 2DU8A 1F4LA 3EPKA 5DTIA 2UZ3A 5K3FB 1FLVA 2AI1A 1E69A 1L5SA 1D4OA 3W8FA 3A2KA 3QIVA 4OQNA 1AJEA 5LZ2A 3G5AA 4RLFA 1GAEO 3LQQA 1XZHA 3D4OA 4PZYA 2AZDA 5BSEA 4R2JA 1UK8A 1JXAA 2HWWA 2RAPA 3IMCA 3A37A 2VCYA 3LHKA 4H3HB 2H31A 4KN9S 3OAAA 4OU5A 2JAPA 1P72A 5E6UA 3F74A 2V8OA 3TL6A 3WTCA 4FYYA 2O2JA 4MRMA 1XSEA 4C1BA 3TVTA 4ZI7F 2NM0A 1AD2A 4BBPA 3OP4A 3PVZA 1L0BA 4FGJA 4WJZA 3MPUA 1R5BA 2BGGA 1KI6B 2R00C 2AZTA 1DG9A 3ABOB 1R8QA 3E3AA 1PF7E 1LI4A 3R7BA 3SHQA 1IN5A 3BICA 5BWLA 3QVSA 2MSWA 1AV6A 5H3HA 4F4FA 3PKJA 4LXIA 2WVJA 1C0LA 4MCAA 4RLSA 1P45A 3KC2A 1D4ZA 4M8IA 4OYRA 4DIBA 4ARAA 3LT1A 1MG0A 4L8VA 4WIAA 1KJYA 1E92A 1I4WA 4ZAXA 3CRW1 4MKGA 1B7GO 1KMCA 1B6RA 4G1EB 3EDYA 4HB0A 5CB4A 2EJTA 4G4IA 1M0WA 1VJ0A 4KAAA 4R1SA 2QS9A 5FPQA 3EEYA 3IP7A 3N2LA 5HE8A 4WINA 2HW8A 1OIWA 3DDUA 3FKSD 4L95C 4M9XA 1XQXA 2QM8A 3DD5A 1TI7A 1JPUA 3RS0A 2KWIA 1Z8DA 2ZQ5A 5CFNA 1Z39A 3BXEA 3GF4A 4EB8A 1C4KA 2X1VA 5JMTA 1R5OA 3RC9A 1JWLA 2ZSFA 5SY9A 1MLDA 1MQ8B 3ZX4A 5JISA 2EBFX 3PE4A 4AP9A 4HD8A 4RLHA 1IYZA 2IZ5A 3V4OA 3HVKA 3OE5A 1W44A 1VBFA 1E2QA 4JQSA 2Z58A 1X1DA 1VCNA 1YDFA 1ATIA 3M70A 3VJKA 2HNAA 1J0XO 4GMKA 1Z18A 2ZAMA 4BS9A 1M9NA 2EWVA 3CWCA 2SICE 3QKWA 2X6RA 4FR0A 4NWIA 4XTRA 1ZGAA 3RUIA 3W8DA 2XUQA 3GJ6A 2PLAA 1SUWA 3BXFA 5HDBB 2HBYA 2Q7OE 4LX8A 1GAQA 4RAQA 2G0TA 3E48A 3D8NA 3LKVA 1CWUA 1RZVA 4EZBA 2OXIA 1P75A 1UXHA 2DRIA 4G5HA 2H6EA 3EIWA 2R5NA 1Y6FA 2W0SA 1V8DA 3S8MA 3MFQA 4RJIA 4MVJE 5FX2A 1QDUA 4IQ4A 1T2FA 1TXGA 3QMWA 3SZMA 2W22A 2VF8A 5TT1A 2TSYB 2B92A 3KWFA 3K15A 1CYEA 3D6JA 4PANA 1R0KA 1GPBA 1ZA1A 2C2YA 1FL9A 2Y4OA 2ZJ5A 1VE1A 3L5OA 2WIGA 1NQUA 1UBEA 3LCUA 4JJAA 5FF9A 1AHHA 2W6JA 4CN9A 2ZWVA 1DV1A 1EE2A 5HTOA 3TX2A 2EARA 2A1TR 2B5VA 2WTMA 4HWGA 4Y6PA 3RVPA 1T2AA 5ALDA 3VZBA 4C7OB 4DJEC 2PMDA 4P58A 4TTJA 1P33A 3AHFA 5H4GA 2DAPA 2VDOB 2QL6A 4KU4A 3E3NA 2OMKA 4MO2A 5CT8A 2JW5A 3M6UA 2VSQA 1ULSA 1IBLB 3M5DA 1CF2O 1LTHR 1PS8A 2XOXA 3BBLA 4GGPA 3K5WA 3AVPA 3LCVB 3R6LA 1RT9A 5JVDB 1A9RA 2JEZA 1ZU4A 3GZNB 3LLVA 2MINA 3TW4A 2I66A 4AN1A 4HLCA 4D6XA 4E7OA 4AI6A 4XB2A 3KFXA 3QKSB 1I2ZA 4C07A 2M6SA 4PZDA 2X15A 2ZJ7A 2A9PA 3N3AC 2WABA 4QUHA 1HSZA 5CFRA 2GD6A 1GNRA 2LR0A 3KKMA 4IVNA 4QPDA 4V0RA 4XJVA 2WINI 2WNSA 3ULKA 1BCRA 2JHAA 5FHQA 1YS1X 2QRNA 3D4LA 3L4BA 5H9WA 1XKTA 4DMRA 1FYVA 1JYFA 1TOAA 3DLAA 5CJPA 2PWAA 1XK6A 1CUUA 1QHIA 1T6ZA 1XZBA 2VK8A 1JWAB 1NW9B 2JFBA 3Q6MA 3UCEA 3M49A 1IWBB 5EZSA 4L3OA 2OA0A 4N9QA 3LBNA 4BCCA 1L7RA 5JC8A 1SVLA 1NMSA 1XMPA 3EVEA 1UBHS 1NE7A 4HAXA 4DUPA 2C9CA 2RHWA 5EXTA 4CL8A 4BN0A 2IFTA 3PQ8A 4FFWA 3MILA 3RK4A 3T1NA 3BGOS 5IDYA 3Q15C 3VU9B 3C5WP 1UPFA 3WGQA 4BO7A 1IN1A 1DHTA 4L4ZA 2WE8A 5EP3A 5KINB 1KMNA 3G1TA 3PYLA 2O1WA 4C0HA 1BC5A 1JHMA 5FTWA 1XMIA 2C1XA 2G5GX 4DG9A 3QWHA 3FNHA 1RZUA 2IYAA 4BNJA 4EB6B 2DH5A 2PRYA 2WWWA 1VGRA 4Q1DA 1ZUNA 2CLCX 2MSDB 2GBIA 2YZKA 2DR2A 5CNIA 3OQIA 2A7QA 3MS4A 4LVUA 4N3GA 4R40A 3QTTA 3MAAC 4C0KA 1E5DA 3L01A 1CX9B 2PSHA 2C20A 5U1PA 3WKDA 5BWMA 2P6UA 1UT5A 1JLKA 1VMEA 2IU4A 4GOND 2Q5OA 4ME6A 1QRAA 4QXMA 1E9SA 1UKEA 4LBVA 1FIUA 1GPUA 1ZUD1 3KVYA 3PIIA 3UJ9A 3W04A 1OLSA 2YN2A 2VJQA 2ZJZA 4OA8A 1EM6A 1MX3A 3RYFB 4F4IA 3U3RA 5BYKA 4EUEA 4AKEA 2CFRA 3HU5A 1QANA 3MN1A 1T3ZA 3ZE9A 3AUJB 5BMVB 2RGCA 2P3LA 4I5DA 1KBZA 5DT2A 3U3MA 4G1MB 1JDBC 2VZ8A 3LPAA 2QD5A 2B8NA 1T8RA 1OC4A 1OJ7A 1W49A 2H9IA 2PKQP 2R751 2VRNA 1H5NA 4U7TB 2NU9B 4KGXA 4XCXA 5H8WA 4LJAA 5IDXA 1VG1A 1DJMA 1GRNA 2F8SA 4GOLD 4HADA 2CSXA 1WQ1R 4M6WB 2ZI7A 2R6JA 4LHVA 3JZAA 4BV8A 4C0BA 5IEJA 1RPTA 1RAFA 2QRZA 2XVAA 4J4BA 2W6IA 5I7RA 4I1IA 1E4OA 3DDCA 4JLMA 1Y1KE 3NFRA 2MCFA 1G3RA 1Q7TA 2OG2A 3C48A 4QL3A 3LTEA 1HNXB 4RK0A 5DM4A 4FUQA 5FPKA 4W1QA 1WLYA 5TMBA 5ARCA 2CXSA 3K8OE 1Q22A 2GHQA 4NULA 5FWNA 3W9UA 5JW6A 4AO7A 3TW0A 1XWFA 2Q8QA 3KKZA 2MTBA 1VL5A 4DCUA 2WG2A 2QSZA 1OVMA 1K7XB 1GNLA 1K8QA 3IXQA 4TVKA 3A9WA 2JIOA 4PC3A 4DUYB 4FSHA 4LF9B 1QYDA 4B7CA 2WEKA 4R9VA 2QUKA 2R5WA 3O9VA 3GIDA 1GG5A 1JHVA 4ZAWA 4AMGA 3BPSA 1WMDA 1SB9A 2A1TS 3L6RA 4MKFA 3RARA 5JATA 3S99A 3U0BA 1NMQA 4ARZA 4GM1A 3AR7A 2J7PD 4X1IA 3DW3X 1DLIA 2H16A 1F48A 1HGXA 5JDCC 1LPSA 3CB2A 3W9YA 5AVVA 1YR2A 3DOCA 1OXUA 2FSUA 5BSKA 4AMVA 1T0JB 2GN8A 1T0BA 1F9AA 2I7TA 1QQ5A 2QX9A 3DEHA 3JARA 1PX0A 4RM2A 5CK5A 3WWPA 2FPKA 2YUTA 3IOYA 1ZCBA 4LXXA 4PSAA 1TQ2A 1X38A 1W88B 4TQUS 2VJCA 4NX2A 1VE6A 1XKQA 2NYVA 3BA6A 4HTFA 4B8WA 4UHKA 1NJSA 1NVEA 1N4AA 3H2IA 1PSWA 1NKSA 4B31A 3GLGE 1DIOB 2AJCA 4UULA 4LDAA 2G9RA 3NAZA 1NMYA 4EKYA 3LG2A 2NPIA 1VPLA 2IRWA 4ITUA 3UBTA 1E62A 3IR7A 5MHTA 3L7NA 2HWXA 3UJDA 5TR9A 2C7OA 4KVGA 2O8BA 8LDHA 3TB4A 1K86A 4MYSA 2VNAA 3KV3O 3KXKA 4UUQA 5A71A 3ZDYB 3AI2A 5C8VA 3A10A 2EKDA 3PBKA 4UVHA 4JLWA 1TAUA 2I8AA 4XIYA 4EVRA 1KETA 2EF0A 2C5AA 3DH0A 3FZEA 2WWXA 2W48A 4PGGA 4X93A 5ILQA 1UJNA 4TMXA 4F6RB 3NBKA 1QYCA 3H5VA 4RVOA 5BNTA 1U0FA 4ENPA 1I24A 2NP6A 2NUTA 4TT3D 3MXTA 3EEQA 3UTDA 3ANNA 4NJMA 3HFRA 4NHEA 1GXSB 4GXTA 4DGSA 1VA5A 4Y6SA 2NO0A 3W4IA 4UFPA 4S3MA 1FFSA 2D2EA 2Q9UA 3Q3IA 4FQ8A 2VHEA 1FF9A 2B94A 4H6PA 4E46A 3O2SB 4YFYA 4WBNA 2QQ0A 1Z3IX 4JXJA 1KP3A 4DW8A 1UBUS 3BS4A 4MVWA 3ANLA 2CVPA 1E99A 3O9ZA 4H59A 4MULA 3GVHA 3OTIA 1T91A 3OHSX 4JJZA 4Z9BA 1BW9A 2PV0A 3W79A 5JARA 3ZNQA 1XXHB 1N3IA 4TWRA 5DN9A 4Z53A 1YFZA 1BMQA 4V0QA 5F76A 4TYNA 1AKTA 3IDQA 4ZOBA 1V16A 3K5HA 4OHUA 4DR3B 4JT8A 4ESVA 4ZC1A 3DE2X 1Q1ZA 2NOAA 3JZIA 2H8GA 2Q4TA 3WKAA 2Z4RA 3OT1B 5BSMA 2Q1WA 1W7AA 1H6DA 1VIAA 1US8A 1B1CA 2B6HA 2SCUA 3GJXC 3UAWA 1GZUA 1X39A 2VKQA 5IX8A 3ZU6A 1PNOA 2C5LA 2IE0A 4OQ4A 1FMFA 4MKRA 4C01A 1UPAA 1NY6A 5KJFA 3EF3A 1CB7A 3BGSA 1FUUA 3C8DA 4I55A 2KBFA 2D5IA 4WBNF 1C0KA 3AY0A 4H15A 1COWA 1P2GA 2PDAA 5CNMA 5K2MA 2PIDA 1ZINA 3B3QA 2CVFA 3LBYA 4U9IS 4Q9HA 3FTFA 1XZLA 1ZESA 5BN1A 4CKWA 4LSWA 5EJFA 5AVJA 4OHZA 1JSRA 1RBMA 4H4CA 2ET6A 1TA9A 2JFPA 4BV9A 4CODB 4EI2A 3DL2A 5K3DA 3PEEA 3VR5A 4CBVA 3G6KA 4TUYF 3GXOA 4GRAA 1XQYA 1JHYA 1U2DA 5DYGA 1GZ3A 5FCDA 4BFTA 2XCLA 1EWTA 4MW4A 2XMDA 1FTSA 1TM4E 1FRQA 2VP9A 1MR3F 2ZWMA 2GERA 3IHLA 4HWTA 2PNFA 4RFVA 4K7JA 4RDIA 5FB3A 3V42A 1AQJA 2RGUA 2Z43A 1TCVA 4G0NA 1DO0A 4HBGA 1NURA 3HCOA 4EJSC 3SFVA 3IDOA 1ZJYA 5G3ZA 1ZHOA 3QOXA 5JNVA 1Z9BA 1JIXA 3DZCA 3EVAA 3G1UA 1JEYB 2PPVA 3V97A 1QH1A 3LFHA 3U9LA 3WA6A 4TTSA 4RDCA 1S8AA 2ZRHA 4YMGA 5A05A 3ELUA 3QVGB 1R4NB 2Y1CA 5EE0A 1UMBB 4MUMA 5KHAA 4EHLA 4QXPA 1UBOS 2C2OA 2B7LA 4I55F 1UPXA 2MSEB 3FCCA 4PIMA 1I2MA 2XUAA 1U8EA 1WZUA 3VTAA 2WILA 3N58A 3M83A 3LWBA 4XVCA 3CT4A 4OD0A 4O1IA 1SOMA 4ZO6A 1MAUA 1NXTA 2J4FA 2GPNA 4N9WA 3C16C 4JYCA 2OXEA 3FYCA 1EBUA 1AOXA 5AHOA 4FZ5A 2GZ2A 4HEJA 4CDRA 4P34A 2JAOA 1XPJA 1DDIA 4XD7D 3PCTA 4IDCA 3AR8A 4OJYA 1RCFA 4IJUA 4U4AA 5BURA 2ZSUA 2HU8A 2YMQA 3NNSA 2C8KA 2BN4A 1S3GA 4ZO4A 4CQMB 3V4SA 3IR6A 1PFKA 2YZ7A 2VAMA 2ZT6A 1RLJA 3KUDA 2WMDA 3NC1C 4INZA 1KARA 4H6XA 4LCJA 4XDHA 4O3FA 3L7LA 3QHQA 3K71B 4UOEA 2GBGA 1SHTX 1ZVQA 1C1XB 1EFDN 2HPZA 2JD0A 1SG9A 3USCS 4EG3A 3H2GA 3QJYA 4RQTA 2F1OA 3GUUA 4KV7A 4CMGA 5BNWA 5CA1F 1Q11A 1SCBA 2RI1A 3EDOA 4CMKA 4DBZA 4TWZA 4W9NA 2XUPA 3VSDA 1MENA 2XUGA 3H13A 3NIGB 3RSOA 1HNWB 1SGWA 1WO8A 3ZCVA 1IN4A 1G63A 2R6HA 3KEMA 2JGAA 5K0SA 3VHRA 2GRUA 1U28C 1STOA 2XHEA 2XQFA 1TW2A 5BY2A 2I1LA 4X6UA 1AN9A 1ZCFA 4DZTA 2AYXA 3CH5A 1FA9A 3NTQA 2RB4A 4WOCA 3BK1A 4IR7A 3PZBA 1M2VA 4UBMA 4AJ4A 3QQPA 1BU5A 3RS9A 4RETA 4AKTA 2LUOA 3AF3A 2X1LA 3C74A 1E6LA 4HUQB 4EPRA 1XVAA 3NP7A 1UK9A 4EUKA 1SUBA 1VL6A 2BSXA 3H4MA 2C57A 1SVKA 2Z30A 1CUXA 5TC4A 3SBXA 4JA2A 3RRNA 3GJRA 4BLWA 5KX5A 4FR2A 5C52B 3QKRA 2ZZMA 1MNQA 2YVKA 3PUHA 3BFKA 4KO3S 3ZI4A 1G21A 2F3QA 2ONKA 1EZZA 3IXMA 1E7MA 4PXAA 4Z1MA 5HOQA 1ZQ1A 1EP1B 3I9V1 2P0YA 3T99A 4TTQA 5LZ4A 1QIEA 4QBIA 4S1NA 3D2AA 3SZOA 3CONA 4RADA 2VH2A 2F67A 5BUCA 3WGTA 1YVRA 2R6GA 4LC1A 4OTZA 2IXDA 2W6OA 1SJ9A 4A3SA 3L40A 2WAMA 1XI2A 3KYCA 4UREA 3UUFA 3O8CA 4CFSA 4L27A 3PRHA 4LF6B 1R10A 4Z7QB 2RHOA 4YB8A 1L5OA 4MO9A 4MVJG 4QECA 3PYMA 2QENA 5KJ1A 1QHHA 2QJOA 1PLJA 4M7RA 4P3NA 2NNLD 3L77A 1INLA 3Q6NA 4RNDB 3MCWA 4MJ7A 2Y0CA 3E7FA 2Y8EA 3ITEA 4WI1A 2I34A 4JI5B 4V39A 3A1CA 1E4YA 4EBFA 3X2FA 2DBRA 2OXCA 3EXFB 4ZVOA 5HHTA 1ZITA 1ZXBA 2IXEA 2OQ2A 2RGYA 2OCLA 2JFXA 5KHLB 1TT7A 1XHLA 4OLHA 3RWBA 1PQPA 3HK2A 1QO0A 2QU8A 5JNRA 3FWKA 5CLHA 3D8BA 3IR5A 4FMDF 5AHRA 3BXXA 3MD0A 3PQ4A 3QYFA 5KWIA 1R6TA 4TKMA 3SIPA 1DAGA 3UYLA 3VC7A 3LPLA 3U7IA 3DOJA 5LR6A 6REQB 4GNKA 4KLRA 1VHDA 4OXIA 3EGDB 2I2CA 3IQFA 5I9LA 4NJEB 4UM7A 4MVCA 1RWOA 5CH8A 3NGLA 3A8TA 3RE1A 4EVIA 4YUZA 5J2UA 3T0GA 1YB6A 5AO9A 1JFRA 3QFSA 4EJSB 4PQGA 2WE7A 1XDWA 4WEOA 1Z4QA 3D2CA 2MYTA 2RIPA 3MCZA 3A6DA 3F6RA 3L1KA 4QC2A 2OORA 1GDDA 2NAFA 2ZOSA 3PE6A 1I4TD 3R6DA 1UFQA 4G41A 4G8DA 2DBVO 2W2VA 3BGDA 1U0HC 2L2QA 3PSHA 2QQ5A 2WMYA 4HTAA 3R7LA 4JB3A 3ZOKA 3E3MA 5FI5A 4AS1A 3O3MB 2PUDA 1V96A 4LZWA 2ZR9A 3ZDFA 5C1BA 2QUBA 3M6VA 1M34E 1SBIA 5EKUA 4EL5A 9GPBA 4EFDA 4G97A 4CMIA 3KAJA 3OCJA 4PNEA 1RJWA 2ZYTX 1YDWA 1EJBA 3OCXA 4ZEXA 3TLGA 4NH0A 2P41A 4JELA 2F17A 1KJ8A 3DXZA 5GVSA 4MDEA 5BN5A 1ESMA 2JIQA 4RKEA 1RBZA 1BN7A 1T15A 2V6JA 3P19A 1YZGA 3WDLA 3QSYA 4QUEA 1LSUA 4I1SA 5IABA 1CJMA 2IY8A 4KNVA 3S7TA 5AUNB 2G1JA 3PHJA 1YZHA 1PFYA 3OF5A 4WK6A 3RANA 1DX9A 5A9SA 3OPYB 3ASYA 4G5SA 3I9LA 4D4MA 1X7ZB 5BNIA 1PTJC 5AKZA 1T8WA 2O2YA 2FH5B 2H2IA 3V7NA 3SSNA 4MR7B 1IMJA 3T9EA 4RULA 2P3QA 3CJQA 4LS3A 5TXGA 1AKUA 4Z9XA 1QP7A 5DNYB 5KU7A 2XVMA 4HSEA 3I30X 3WK9A 5DK4A 3KSMA 4DWJA 5K8LA 3TDMA 2XT6A 4NV3A 1TIPA 4XGRA 1IL0A 4HV4A 3ESXA 2VT3A 3F2IA 3GJTA 4HHEA 4YPOA 2E37A 3LXMA 1KO7A 5DTEA 4UTZA 2B37A 3GJZA 3M8KA 1LRKA 3CEMA 3G7UA 3JCZA 4D81A 5BW8A 1UZLA 5E0KB 4CYMA 2WYUA 2P5UA 2XMPA 1R4MA 3AIMA 3AMVA 4G36A 5HQJA 4A7PA 1DADA 1XXLA 3PZRA 2NO1A 3H04A 3JYPA 2NTNA 4BFUA 2QA5A 1QQAA 3COYA 3IV9A 3ZV4A 3NASA 2PE5A 3RSFA 3GZJA 3LT4A 3QXXA 5K6RA 1UIRA 2A88A 1N3BA 5EWLA 1QP4A 4E4RA 4PG4A 1Y81A 4WFJA 2FOIA 3CINA 2COEA 2JA1A 1D2HA 1X3SA 1OAOA 3WLFA 3UWDA 4C05A 1XEFA 4RMIA 3KJXA 4D6YA 3T1HB 1D03A 1L5HB 5FBZA 3OUUA 5B2FA 4Z0HO 2VATA 1XF9A 1VZ3A 4NBRA 5D5QA 4G8CA 4H0NA 2WAYA 4YUWA 1QAOA 3L4SO 4O4JF 2ACEA 1ADFA 1SUPA 3WGGA 1GSHA 2O8CB 2ZTHA 2WW8A 4Y1RB 1QKKA 2IY7A 3AUAA 4WLVA 2VOJA 5KYXB 1ZWLA 2W2KB 4B1FA 3MJRA 3ACDA 3ZWYA 2NZVG 2CNLA 5EHQA 3ZWVA 1CJSA 3A9CA 3KL4A 2NIPA 1BMTA 3K09C 4EENA 2VI5A 3HB0A 2GZDA 3OM0A 3UB2A 2HT1A 3BRCA 1EVYA 1K8RA 1F0YA 1Z6AA 2Q5HA 2XE7A 1B42A 1BGWA 1RKXA 2QNRA 3H86A 2M9MA 1G0OA 5T5QA 3WZLA 2FEWB 2RG7A 3QXCA 4MUIA 3PJFA 2IPXA 5JH7A 1EA5A 3KXDA 4F0JA 2IEYA 3HB7A 1GYRA 4WKGA 1SQSA 1KTIA 2IBSA 2H63A 4FDTA 1CY6A 4HDRB 3HACA 3QV2A 5H3LA 4GL2A 2JGDA 3SF8A 1AV7A 1T10A 1T26A 1WKCA 1JKIA 3NDIA 2PKYX 4DQVA 3U1BA 4I4TA 1VYUA 4ZU6X 2V6IA 1QORA 3KTAB 3KS9A 3QXGA 4ZN6A 1ISGA 3PC8A 3UOWA 4R8SA 3KSAC 4DTIA 1S2NA 2DHRA 5FBVB 3SJAA 4IY1A 4OQQA 1N6RA 1UWVA 1Z2AA 1VDMA 4S1OA 1RIIA 1S2GA 2XA2A 4HFRA 1YBHA 4QDTA 3RADC 3V55A 3EGCA 1Q3KA 2OXTA 5MN5A 1I33A 4YDQA 2Q5EA 3SS8A 2D13A 1H8HD 4XKJA 5TJ9A 3W2HA 3EIQA 1TUBB 4POAA 3RJ5A 1LJ8A 2PS0A 4WL0A 3NHZA 2WD9A 3CSSA 3M2PA 1T1JA 4DNFA 2N75A 2X0EA 3I72A 3HLTA 4RJTA 1F0PA 2PVPA 1L5MA 3EIXA 4WFIA 3WYNA 1BHO1 5AQ1A 2XB9A 2IPLA 4GU5A 4IF4A 4GLBA 4PX2A 3UH0A 1BA3A 3B60A 4EY5A 4HZUA 2P6NA 1MJHA 2IZ7A 1E0DA 4RXMA 2PGIA 4JGBA 4TMKA 5HMLA 2NTJA 3HCEA 2KS6A 5KUTA 5LWQA 4I4TF 4FFSA 1Y3IA 4LHXA 2O4UX 3WYCA 4CEHB 5DI3B 4WKPA 1G17A 2JI7A 2OPBA 1WP4A 2OB2A 5I9IA 3VYUB 1X7DA 3QNMA 1I7NA 4JVSB 4J1NA 2ZBEA 4UD2A 4L5YA 2XBMA 1FNNA 5AK6A 4RY2A 2G72A 3LHFA 1JDPA 1Z5OA 2P9QA 4MJLA 2IEIA 3LT0A 4IDAA 1VG8A 4FPXA 4K3VA 1O2DA 1QVZA 3SHTA 3O8QA 2BEWA 1DEXA 2PFKA 5GZ6A 5G41A 2JARA 1S1MA 2F59A 3IBYA 4X45A 1LS1A 3EZNA 2ZB3A 3H7IA 4MV3A 3T15A 5JZMA 3IIJA 4IJQA 4ABTA 1T0UA 3ECCA 1JR4A 1XK7A 4KL8S 1JVBA 4MAAA 1Y6ZA 4U9HS 5HKBA 2HREA 1ECJA 5L3QB 4XJTA 4FVTA 3C3YA 3GNQA 4LVOA 1Y7LA 3E1GA 4G01B 3TUZC 1KH2A 2YC2C 1J5PA 1QGDA 1ZH8A 2GR9A 4HVAA 4O4IF 5EE9A 4EQ6A 3EXHA 1FP1D 4QOIA 1CDEA 3FVVA 4ILKA 2WSBA 4Q12A 1UBKS 3JY6A 1QCYA 1KL7A 4MS1A 5E3IA 5IW8A 3H4IA 4CUJA 3B48A 2D2FA 3NONA 2Z3WA 1EK2A 1Y6QA 4KACA 5AVRA 1E89A 4R1QA 1V9LA 2D00A 1OILA 3B7WA 2IIBA 1E3IA 1PEYA 3NRJA 3D8SA 3OH8A 5F64A 3AILA 3KHSA 5LP1A 1L7NA 4D44A 4DLRA 1WUIS 1Y82A 4RSHA 4CW7A 3H4TA 2QVGA 4OH1A 4Y2YA 2QD3A 4LBYA 4G0VA 2O0MA 1ODFA 1V71A 4UATA 1EP2B 1NNI1 4U1RA 3I42A 4BNMA 4NKRA 4HEA1 5JAHA 1Q50A 1RLUA 5FADA 3TCNA 3W78A 2IHKA 3CLKA 4DMCA 2ZI9A 1ENZA 5IJ0A 2XCIA 3WIEA 4I08A 5GGXA 3ZNPA 1GQOA 2ZQZA 1SKAA 1E1YA 1W93A 1F8GA 1ZM9A 5LVAA 5AJYA 4D9FA 1G6Q1 3LK6A 3KVRA 5DTMA 2D5BA 3C7CB 4QBGB 2JAHA 3ANTA 4G86A 5IVIA 4L4RA 3SJ7A 2PQMA 2ZSEA 3CA8A 3ANSA 2W6ZA 3O9MA 1CRLA 1Y5RA 3C6ZA 4GPD1 3ZHXA 3U5ZB 3EWAA 1E2JA 2FR8C 5B37A 5SYNA 4BC1A 1JDTA 3FE2A 4O8CA 1JFFA 3WQSB 4ZMRA 3F0TA 3FA2A 3DHVA 1O96A 4W5OA 4A36A 5KQGA 3L9WA 1TCBA 4FT4A 1NXXA 1JR6A 2YFYA 1XU9A 3G0GA 2W6QA 2Q0SA 3ITNA 4NJOA 3O95A 1QVWA 3DE5X 3PEVA 3ZH9B 2GGSA 4B79A 4B2YA 2ZYDA 4CLHA 2HH9A 1H93A 1QFZA 2VPTA 2QR2A 1U3DA 1MFPA 4GZLA 3QHPA 4LY6A 1THGA 6AT1A 3QSGA 2IYWA 5D3MB 4D4LA 1XWIA 1KYQA 3M9WA 3P1JA 3ZGVA 1WHTB 2IEZA 1DBVO 2XQGA 1A71A 4OFBA 5D1NA 1DOHA 1UP4A 1A3CA 2QXTA 3I2IA 1S96A 3MJFA 4MQFB 5CCBA 1N2BA 3EXG1 1MX9A 3TIIA 5BN3B 3COJA 2C07A 1TIBA 2Q3CA 2ESRA 2VP3A 3DBRB 3FNGA 1FDIA 1O3YA 2Q2WA 4NMXB 1C0PA 2R7MA 2ZTUA 5I45A 2OHFA 4A0GA 2IV3A 1KORA 3K32A 2G67A 1Y7PA 2OHXA 4R16A 4WLFA 4IICA 3GFFA 5ER6A 3QMVA 1JJVA 2OGTA 5IJAA 3TR5A 1KZ9A 3MJ4A 3GP5A 5F51A 4NY1A 2BYTA 1PHPA 3VNRA 5CVDA 2IYTA 4ML3A 2QI9C 5AHWA 1HFEL 2QX6A 5FUYA 2XRYA 2V6GA 3NXSA 1N2JA 4L9SA 4L9AA 5HF5A 1U0TA 3SYKA 4EHDA 1YE5A 1DKUA 2NPOA 2QTVA 3VI4B 2I1WA 3ELYA 5BW4A 3AHDA 4ASUA 3W2EA 1H2YA 1ZN7A 1E3TA 3T3PB 3HHPA 5DSTA 3GK3A 3FWPA 4ALNA 1XQ1A 4NU6A 3U7QB 4N01A 1XHEA 3PTZA 1P7PA 1X7YB 1UC8A 4HNAB 2JJYA 3I6BA 4LAFA 3TEJA 3TDNA 3FPEA 4KODA 1B16A 2FDXA 3R41A 5CTAA 3IOEA 3S1LA 2R4QA 3OEED 3ZTWA 5BOSA 1T36B 4RSRA 1PLLA 3JQAB 4Y9TA 5AXBA 1T0IA 5J23A 4PN3A 2WVAA 3OEYA 4OQMA 2YJTD 3D6VA 4DKXA 1G20A 2IHTA 4MRAA 4BU1A 1CE8B 1CQIB 1JR3A 3BBPA 3FMVA 1T13A 1VL1A 3NT5A 1VJCA 1DBWA 4HS9A 4QUKA 5CU7A 4EZIA 2C83A 2D3TA 3H2YA 4R8RA 1DTWA 3SXPA 4E0BA 2DY0A 4NXMB 5DHUA 3DOUA 1WEHA 2JLYA 4BGDA 2G17A 1V1MA 4KLCA 1Z4LA 4I3HA 3RV3A 3FDJA 4CQJA 1AG9A 2H4HA 1BHJA 1W0JD 2B4AA 3TVYA 4F46A 5HS6A 3AIKA 4N5IX 2R7LA 1WSWA 1GTVA 2A84A 3L05A 4TV9A 2E5WA 4JVNA 4DPLA 4QPPA 3TMKA 1IXKA 2HLDD 4U2CA 1M34B 4R9SA 4NONA 2HGSA 3AQ4A 1HT2E 2C5HA 2ODBA 4NYJQ 2FLVA 2YINC 1CK4A 3CE6A 4KZKA 3T7SA 3DCYA 2SKDA 5KKCA 3VH2A 2H7YA 3Q5DA 4U5XA 2VRBA 3LGSA 4DC1A 3D02A 4Z3KA 5DHTA 1M6NA 3OEHD 5F2KA 5BWCA 4Q03A 1QFJA 1HKUA 1PT7A 3KZKA 3ZUGA 2CZGA 2P8SA 3VR6A 2QQFA 2VSXA 1U9ZA 4RTRA 1FMCA 2VRCD 3MBIA 3QX9A 4RWEA 3AHEA 3F3KA 4B81A 1GAWA 4BFVA 3GGJA 4IP0A 3WTBA 3Q3EA 3Q7TA 3GO4A 4BWVA 2X8WA 1JHDA 5KNBA 3F6PA 1V3VA 1KS2A 3VM6A 1Q0SA 2WG0A 1U2ZA 5CNKA 1W36C 1IRXA 3AEUA 4EKEA 4N5LA 3G0HA 3W05A 4O4HA 2IP4A 4XQ0A 2I4LA 5F5NA 3GP8A 1G4AE 2D5LA 1J6UA 2IYQA 3DV9A 3P94A 2FLWA 2IK8A 4QWMA 1V1RA 4JAVC 2FPSA 3EZ7A 1IM2A 4FILA 1U7TA 3SMQA 4AJ1A 4Z4FA 3HZRA 1J33A 1S8OA 1WXGA 2ZUCA 1EX9A 3NGMA 4R1LA 4TQ9A 3EXAA 4KQ2A 2VNIA 2BLNA 4JX8A 4V38A 1OWNA 1OT3A 4F06A 3NTLA 2BF4A 5FWYB 4BFYA 5K8UA 3W7AA 2HR1A 2A0KA 3VSBA 3ABZA 1HEUA 4MWOA 2OCPA 1T43A 3Q1KA 1T34A 4YMTA 2FFQA 4WJLA 4H1VA 4MKHA 1VE7A 4U2BA 1OTYA 3OQMA 2IF0A 2K5UA 2XJ9A 4EDHA 2VJOA 4PRZA 1W5BA 3HVHA 1GPMA 1WMBA 4EARA 3K5PA 1Z4KA 2Q6TA 2XB2A 1DNPA 1JGTA 2G40A 2X2FA 5KO2A 1XYVA 4MGZR 2QX4A 1E60A 3K0EA 2DGDA 4NBTA 1J8FA 1LH0A 3PUWA 3GBPA 4YJ2B 4ZI5A 3P2EA 3WY9A 3KUUA 1GUYA 4NECA 4R51A 4ZJYA 4GX0A 3QI7A 3C6XA 3BQ9A 3WQRA 4H18A 3EPPA 2W9XA 2WR8A 4ND8B 2PK3A 3L0CA 3T5MA 5HUQA 2EP7A 3BD9A 2K4MA 2YICA 4ISBA 2WIAA 3HGTA 4ZYUA 2ATXA 1ZLXA 2JH9A 4OAQA 5I3ZA 1SA0A 1GLNA 4OI0A 1UJBA 2QP4A 3JTEA 1T6YA 3CU5A 3ZCXA 2Y68A 1DJQA 4FFBA 2IS1A 2H4FA 1MRNA 5CB0A 1DCKA 4RGVA 4X85A 3U56A 4R2LA 1ZW1A 3DWFA 2AF4C 3MHPA 4EO4A 1MXFA 4TKVA 2A4KA 2XJ4A 4KVAA 4M9CA 4YAGA 5BXYA 1SIBE 2OHGA 3EOZA 3FSGA 4F84A 1GGMA 3ICQB 4KR6A 1YJ5A 4UCWA 2I03A 3OI7A 1H4VB 4WH0A 3QU9A 2ANCA 3G1WA 4S35A 5B6IA 1Z7BA 4PZAA 2INGX 3ZKWB 2ZBQA 3BUSA 2GRJA 2EZUA 4RZUA 2IHYA 2QB5A 4IEIA 2HL6A 3TD2A 3PRYA 4GHWA 3ZY4A 2X8AA 5BPFA 3KYDB 1OH7A 5AIAA 4TRMA 2PL3A 3W34A 2WDZA 3LVBA 5I7HA 2ZWOA 2F62A 2HIAA 1R6VA 3AW9A 1WL8A 4HDAA 1NVWQ 4JJGA 4PHCA 3HV0A 2BTQB 1OAKA 5CYGA 2FZGA 3M81A 3WLLA 4BJ1A 3JAMA 1QIMA 1K3FA 1QH8B 3SIXA 3C1AA 1Z5NA 3RTAA 1USUA 3TUIC 4KH1A 1G59A 1V8FA 4DA9A 2QKYA 4DMUB 4ER6A 2O7SA 1C4XA 3OY7A 4ZQEA 4HLDA 1QSGA 5E4YA 3Q2OA 3SZLA 1KEZA 1O5TA 1A9ZA 4BFXA 5BQOA 2HXGA 4JEIA 3OMWA 3Q8MA 1Z7GA 4QVGA 3MEQA 4R5MA 4CCSA 5JPDA 3ORHA 4MK4A 4X61A 3UUGA 1YS4A 2LCIA 3WGVA 2YJ5A 3THXB 5CA1A 1J8QA 1Z4MA 2H2DA 4U2EA 1U7XA 3WHKA 2RARA 3TAXA 4G1BA 3IFSA 1R8SA 2WSYB 4KIJA 4L85A 2B25A 3HFJA 4A0RA 3K94A 2GRAA 2OTCA 2FMKA 4TYQA 1SKBA 3G2HA 4QX6A 3VVMA 1IBKB 1SUIA 1G7CA 2WKWA 1X7HA 5BSWA 4B5LA 4F3NA 4CIAA 2ONZA 3HKDB 3GXBA 1TZ2A 4DZRA 1KJ9A 2OV3A 1S01A 4RTJA 1RNLA 3IKLA 4OFXA 1NU6A 3LNCA 2AJLI 1JU3A 4K88A 3MELA 3IUBA 5L4LA 3USZA 2HZ7A 1Q0RA 4ZGBA 5AVKA 3I34X 4LNUA 2V7QA 3QE0A 3VI3B 1U2GC 4OPMA 4Z9YA 4HDSA 5CP8A 1PJBA 3IC5A 1CUGA 3OP1A 4RV9A 4P31A 4DJFC 4CQMD 1JHOA 4EMTA 5K0TA 2JFGA 2PTHA 1KMQA 3WBFA 4WZBA 2CE7A 2VTKA 4Q21A 1DHRA 1TD9A 4NQRA 5AM4A 2O2EA 4ZCLA 6CHYA 2J6HA 3NI2A 3CKYA 3GYGA 1SELA 4F7DA 1W4BA 4F71A 5EZQA 4GX1A 4J4HA 3JWPA 4EHBA 3Q2IA 3EW9A 3NORA 4Y18A 4C7JA 2WA2A 4E5DA 2NSHA 2EX0A 3L0OA 3AL0C 4MVJD 3GDFA 4H6VA 2QRVB 2J59A 3AR4A 3IUSA 4EUHA 5LPNA 3M6AA 3FR7A 3IOCA 4MITA 1JHQA 1GZHB 4K6CA 2V5UA 3QLUA 3R3ZA 2J3MA 1CERA 4OXQA 3QF4B 3G2LA 1IC6A 2XF8A 2P6PA 2YXLA 2GSWA 2HYIC 1GR0A 4KO1S 1XQ9A 3UXHA 5IMSA 3F3SA 3ZBQA 1MHPA 4EHJA 3LHDA 3F9IA 4KRYA 4TX1A 4FQ5A 1ZM2A 1OIVA 1M72A 3OJ0A 1U8FO 1U2SA 3UA4A 4F56A 2O59A 3HBNA 3P71T 4MWCA 3T5AA 5K05A 3JWHA 2P6MA 1UKYA 4O2AA 4GMDA 1O08A 2OV4A 5GIPE 1ISMA 1GARA 2IYLD 1WMEA 3RVQA 3AG5A 1GY8A 5D5HA 1L8LA 2DFTA 2ID8A 3A3YA 3HJBA 4JUBA 2LIPA 4OP3A 2I9PA 4FYXA 4YASA 1AHPA 1SXJA 5DLEA 3HDQA 1ODLA 5J5CA 1XWWA 3EYAA 3GRYA 1E9AA 4G5XA 5I3CA 3IPLA 1N6NA 4IMIB 5JZSA 4IGKA 2V59A 3Q5EA 3N28A 3Q7RA 2IA5A 2JCVA 3EVDA 1FRFS 3GY0A 1OA1A 2V7BA 4PCUA 2GPSA 3L4JA 1CY2A 1ZO8A 3AKYA 3QVKA 4WN3A 3I9KA 3QI2A 3KKKA 2FWAA 3DFUA 3JW8A 4OSEA 1MW9X 3LBIA 3QTLA 5A6SA 1OXVA 2LZ0A 2RCYA 4P2BA 3W0LB 1ZIDA 2J87A 3IDFA 2WV7A 2RE8A 1NW3A 4EMSA 1EXWA 3S2GA 4D9CA 1EVLA 1V95A 2ORYA 4OHFA 3GLHA 4D8UA 4L8FA 3F47A 4OREX 3T3OA 4O4LB 2F8MA 4AZ3B 3BFVA 3HCAA 5E6SA 3L1HA 1T9ZA 3WIDA 3LCJA 4X6XA 1ATZA 5DV9A 3QEJA 4C9BA 4DLSA 2B4TO 1KAGA 2JPDA 4LYDA 3A0UA 1JSLA 2DP4E 2IYRA 2EIXA 2IHVA 3AL2A 3LKDA 1UOOA 2GHRA 2VO1A 1PRYA 1GV0A 2JB9A 1ISRA 4QT0A 4JYPA 2G25A 4JLKA 5E2IA 4ZAFA 3FTCA 3DQQA 3LC1O 4WFKA 1F3OA 1I1NA 2ODEA 5KDDA 2B61A 2E55A 2GM5A 3AUTA 4KXQA 4YMLA 1N5LA 3P0FA 5FOSA 1CUHA 2FZ4A 3OZGA 1KOJA 1PHRA 1MQAA 2VXYA 2R7AA 4M38A 4MKXA 3DUFA 2Q3EA 3CEAA 5ILOA 3KPUA 2PUCA 3IBGA 1EDDA 3M3PA 2P3OA 4FB4A 1CV2A 2GAOA 3C1UA 3FMFA 3BN3A 5DGDA 2FP3A 5CNJA 2XH8A 2VWHA 4DLUA 4A23A 2HCRA 2QLJA 4LDZA 4XX0B 2JAQA 4K9LA 4WX2B 3HDJA 5AKEA 2H2GA 4QG3A 2XTNA 3VNUA 5LFAA 3WWCA 3M1YA 4YACA 3ELBA 3MMXA 5CJ2A 2RHGB 3PPWA 4ZXPA 5A3JA 3QPAA 821PA 2C96A 1WSBA 2PMKA 3EA0A 3DJYA 4DMGA 1QK3A 1CEYA 3OZCA 1O95D 1K6MA 4JKOA 5DN6D 4HNSA 3ZZTA 4D99A 3C7AA 1YOVA 1D4AA 3MXOA 1FFYA 3HBFA 2PBLA 1XVTA 2DPMA 2DHDA 2HU5A 1ISPA 2IHZA 4G5YA 4EG4A 2X0RA 6LDHA 5KOHA 2GVNA 5KKNB 4DBLE 4Z54A 3UCXA 3UAGA 1NL3A 1E1CA 1KFEB 3OQBA 1MBZA 5AMXA 4Y2JA 4DR6B 3TCXB 4CLEA 4NPAA 2CZQA 5TB5A 1PJ4A 2HBQA 1QZTA 4M8LA 2WIFA 3SIRA 2NU8A 5KVAA 1OR8A 2QTLA 3VUFA 4B3SB 5KSOA 5ALTA 1IWOA 3LUPA 4BP3A 1OQAA 1ZMXA 2YWGA 3ESZA 5ALQA 3PF9A 3HO8A 5GONF 4MLZA 3CUVA 2VR1A 3L4BC 1EZ4A 2NNWB 3E70C 1E7QA 3DFIA 4N3AA 4WLOA 4RKQA 4C1NA 5C37A 2ORED 3MF4A 3ZHSA 4ESHA 4EM6A 1D1TA 1ZQ9A 2O7VA 2RIRA 1YSCA 3AWDA 2RSLA 3B8EA 3ETNA 3SQNA 4DR5B 3GEHA 3QRWA 4F04A 1PDOA 3HXPA 4U7PB 1AN0A 1DP4A 2GZSA 3H5NA 4TKZA 3HO1A 4GI1A 1ZDMA 4EG5A 2Z6QA 3KALA 3L8CA 4RGBA 621PA 5E6UB 4KDCA 4ENQA 2WHYA 3FAZA 1D6NA 3FDXA 4MRMB 3L46A 4BNUA 1MIOA 4EF6A 1O97C 1KWGA 3L6UA 4D3XA 5TDHA 2KLBA 3CUTA 2V4UA 4AJOA 1GTJ1 1QTNA 1YQGA 1SOWA 2PQ0A 1M8FA 1NONA 2Q8NA 3AHHA 4RUKA 4BAGA 5HZMA 3HRKA 5U4XA 3W7VA 3OZIA 1MCZA 4KK3A 1ZA2A 3OLCX 4UNRA 2X2OA 3TI7A 2BM0A 4GPIB 2HA0A 4GW3A 4CV2A 2WAAA 1WXXA 3ETJA 5EMNA 5ALWA 4OAPA 2V58A 2J41A 5K8JB 2DYKA 1CS0A 2PPLA 4KBFA 4TTAA 2H52A 3DVLA 2CB0A 2H07A 1T4BA 3I0MA 4IKOA 8ADHA 1XAJA 5SZJA 3JSAA 3JALA 3WLQA 1TZBA 4CHTA 3M33A 5IN5A 2Z1DA 4AMYA 3EPJA 2ZR0A 2YWDA 4C20A 1CR4A 1TUEA 4Q4LA 3HA2A 4WVFA 3IEIA 1ZKMA 2C7QA 2QTNA 3DO6A 4RPCA 3RC2A 3ZWPA 4TPKA 1CR2A 4QFMA 5IAOA 3NWEA 4JJKA 2H1CA 4C0AC 4UARA 1GAXA 2W4IA 3E8MA 3BM5A 3GFRA 3UC9A 3UT6A 2PUFA 2GKSA 5AXAA 2O57A 3TLEA 5KMGB 1AXEA 4IX1A 4YHBA 4QEKA 4BO8A 1SZPA 1E6MA 2YFQA 2V7VA 1DKQA 3T4EA 2E4YA 2G1PA 3EJ6A 3KQYA 1U7UA 3CRMA 3EEBA 4H0CA 4TL6A 4BNXA 4NLLA 2NZXA 1D2EA 3LXXA 3CX7A 3A4IA 3EMBA 4IF6A 2BHNA 4GQBA 2FYTA 3KJGA 4QXQA 1XALA 2XLBA 1T9GR 2PBRA 3DBVO 1YASA 4RHEA 5CVEA 4CMAA 1PL0A 4EKDA 3TQFA 5L7WA 2O5EA 1HE1C 3W06A 2Y71A 1UBTS 2ERYA 2ZJ2A 1RYFA 3REQA 5FR2A 4DLZA 1AK2A 1M5UA 2COUA 2LPMA 1JHUA 4P0TA 1BG6A 4D0GA 3K9NA 1BWPA 1Y0BA 1NBEA 4Y1FA 1HF3A 4CNQA 2OGZA 1IN8A 3THSA 1RZRA 1TMYA 3OM9A 5ELMA 3OA2A 1CUVA 2HEGA 4LJ9A 1XRNA 3EC2A 4IIDA 4OUDA 3WRXA 3IDSA 4DRYA 4F3RA 4L9RA 4G9BA 3WLKX 1E64A 4UTNA 4AKGA 1S7CA 2V0NA 3H5RA 4M1YA 1VLVA 4ZVKA 2BFFA 3T0FA 3PC7A 5BV1A 2PUHA 1C2YA 3PQ2A 4HGRA 3B1KA 2BFWA 4JHXA 1Y8ZA 4K0KB 2QN2A 2VHQA 3QXSA 4U2DA 4UNPA 4YDRA 2GLXA 5A5GA 3VKHA 3HZHA 5KWJA 3LIPA 5B1IA 4H2DA 1NLYA 1XVIA 5IBQA 1ZW6A 4XGIA 4HVCA 3DCJA 2MINB 2P2GA 2R8ZA 5JJKA 2B2XA 5B3KA 2VQSA 3ORSA 4Q6BA 4CIBA 5FH9A 3KEFA 3MYYA 1YU6A 5EUBA 1ZL2A 3GT7A 4ERXA 3ROKA 3AVXA 5LQRA 3QX7A 4PNPA 1MEJA 3RSZA 1MDFA 1HNNA 3WJ2A 4BFCA 3FDIA 1QIKA 5MGNA 4PGMA 1WD5A 3D3QA 1N7GA 4DUZB 4BRSA 2QN6A 4KTVE 2ZZNA 4FDMA 3AK4A 3I92A 3T7TA 5B1EA 1BWQA 1KFKB 5AVYA 1N6KA 4L2IA 1BTOA 4IYJA 4B3BA 2E2WA 1ES9A 2CNWA 4Q3DA 4CFZA 4HLUC 4I6GA 3H9JA 5TQJA 4MQ6A 3WDKA 1ILWA 4DC0A 2JJ1D 4LF5B 3JSXA 3WQHA 1P18A 1WXHA 3GFBA 4GD3Q 3I6YA 1V3UA 4L51A 4LWPA 1T5LA 5ALPA 1NULA 3QU4A 1S8FA 3JD1A 5FRDA 3UHPA 2W37A 5JFGA 3P7MA 4MWZA 3TRFA 3GBVA 2R48A 1HTBA 1P39A 2VDVE 3DHEA 1R5NA 4IS3A 3GPLA 2P78A 1PS9A 2CVHA 4G26A 4WKBA 1X14A 2Y9MB 4QD3A 3FWNA 5F9MA 3WFIA 2AXEA 3RS2A 3IIEA 3FWYA 1IJKA 5ES3A 1SEVA 2NV6A 1ZUNB 2OO3A 3ETHA 3A25A 3GRUA 3HVUA 2ZUWA 1QK5A 3LZ6A 3QUCA 4M9SA 3RFFA 2NG1A 2XVYA 3OQIB 4FGWA 1JRLA 3A2LA 3KZXA 3MS7A 2PCJA 2DSTA 4MQ5A 3UGQA 3EW7A 3KD3A 1U8AA 4LHZA 2HA2A 4YJ3F 1KEPA 5ERXA 1J2JA 3HA3A 3I12A 2TMYA 4L6IA 1PV2A 2B82A 1E8NA 2XT0A 2ZANA 4B33A 4N6GA 1RQRA 5KTRA 1VLMA 1AU9A 1OLSB 3HGMA 4HMOA 3TAHA 3DW1X 4GYYA 4L8GA 2ZS9A 2A78A 2PGLA 1E3JA 2M1ZA 3AKCA 1KERA 1ND6A 2IYVA 3HM2A 3MQ4A 3PE3A 3K0AA 4TYMA 4UHFA 2Y05A 2H4YA 3HCPA 1BDHA 1RHQA 3QLVA 3K9BA 2J6CA 3FOBA 4R7ZA 1T0PA 2PNJA 1L7PA 3PA8A 2C7VA 2I65A 4WOKA 3CVYA 2QYOA 5M2QA 1GL3A 3BMOA 1CVIA 4QVKA 2VLIA 2D2IA 3KXPA 1WU8A 4C0XA 3EAQA 4IFTA 2PL9A 3KPJA 9ABPA 1H69A 4CNBA 3COVA 2BGLA 3UMVA 2E0IA 4JI4B 1N2GA 3NBFA 2X2EA 2R62A 1WMFA 1E20A 3C8MA 1FFHA 5JI3E 1C8LA 3GMTA 4FMPA 3FRJA 1I13A 4GXQA 4R7TA 5CM8B 3R76A 5A4IS 4PHGA 2WC1A 2X5KO 1G9XA 2GJ9A 1NLFA 1PQUA 1U2DC 2WFMA 4GX2A 2C84A 1QIJA 5EPEA 5EVCA 3RYHA 3VC1A 5CIWA 1TYAE 3TR6A 3GJYA 1S2MA 2PRZA 4QYMA 1IY2A 1UC4B 1AKVA 4LE0A 3NGXA 1P3DA 2ZVQX 4WZAA 1F38A 1NXSA 2JCXA 1DARA 4IS2A 3FETA 4KRFA 1HI9A 2EVWX 1W5AA 4WJKB 2RBEA 4NL4H 3DO8A 3DPSA 3S8EA 1LV8A 1XCMA 3ENVA 3HXLA 4BB6A 1IOLA 1IBCA 3O4IA 3OWXA 4MEAA 4N41A 3ROTA 1X1CA 2HN9A 3GLUA 3MRTA 1UJ6A 3ESYA 3QEKA 3QJGA 2E82A 1PUIA 2C78A 2VK2A 4IV8A 3SP1A 3C8HA 2DFLA 1XCOA 2HBZA 2HMWA 3IUJA 4FW9A 5AH0A 4QVIA 1XU7A 1QCZA 3U1VA 5IJXA 4NG4A 4ARZB 5HVNA 5A7HA 2UYOA 4X1IB 4A16A 1RPNA 1UKVY 2GZRA 3KFLA 2IUFA 3WL5A 2QSJA 3I2FA 2YWJA 1PQYA 3CXRA 3KUKA 3P45A 4RKYA 3FYHA 1XKLA 5DNUA 4WLUA 2YJ3A 4C4OA 4HWSA 3K0FA 4JT9A 4YQFA 3JARB 5HS4A 1GVNB 1HM5A 1ZMBA 3PHCA 3LX8A 1E3SA 4KKXB 5HKAA 4LRQA 4LJYA 3AFHA 1PG0A 2E4AA 4HTFB 4DSUA 3X43A 4EECA 4MUJA 1XELA 1NUPA 3RFVA 3VX4A 3OBBA 4D3SA 4D45A 2IITA 5HKKA 1VMKA 1P4RA 1TQ6A 1PJSA 3BMCA 5GMOA 4ZT7A 4Z4GA 2XECA 2WUWE 2ZVPX 3JQAD 3TGPA 1SQFA 3VVCA 5JCOA 4KQ1A 2A35A 5F5XA 1Z2NX 2HRZA 5KNDA 1ULHA 3AHIA 2O8BB 1N78A 2DR3A 4QU8A 1B0AA 4C7MA 3PIDA 4W9NC 2XB4A 3V4ZA 2FY8A 3LJKA 1CIPA 1SAYA 3WR5A 5FDFA 4RVGA 5FA6A 5I5GA 5A7GA 5JSFA 3RRZA 2FQQA 5LA6A 1CTQA 3T3NA 5JWOA 3ZN2A 2JIPA 2PQ2A 4ILEA 2AF3C 1G5FA 1QX3A 2NUTB 3S68A 1FFDA 5KJCA 4DV5B 1OFGA 4IIXA 4NJMB 2ADOA 2QN8A 3CGWA 2PD6A 4G67A 3PJDA 1DX4A 4V0NA 4G23A 1Z6GA 4WBNB 1MU0A 1YJQA 1XZGA 4QUBA 3J80A 2YBDA 3DD1A 4RZQA 3QPWA 1E0JA 3AY6A 2C5BA 2FOXA 1CJBA 2B1IA 2XE6A 1ISJA 1IE3A 1BW9B 1DLJA 1MV5A 1QGAA 1NPDA 4TN5A 3E5RA 5T57A 2Q29A 1QTQA 4KGVA 1ZJ6A 3VR5H 4YXWA 5JPCA 1CUYA 1DJPA 3R7FA 1Q0HA 5C7OO 3IMGA 1QGUA 1VHWA 2Z6UA 5IAKA 1V16B 2JJ2D 4L8LA 3VVBA 4F4HA 4BOYA 3WLRA 1AUOA 1IOVA 4LBZA 1WABA 3BDIA 4QE3A 1PWHA 3CO5A 4QUIA 1G8SA 2O20A 4D4IA 5K6TA 5JFOA 1HDZA 4OHRA 1E79D 2IOQA 1US8B 3EQ7A 5LA6F 2SCUB 4OQXA 1ONBA 1H2FA 1J20A 4EY4A 1FUKA 1A9TA 4RYDA 2O8FA 5IJZA 1YQQA 1TZKA 4MWDA 3MERA 1Z47A 2JGNA 4RVSA 2I3DA 2AG5A 1KKMA 2NSDA 3DAOA 1LJLA 5E8JA 4JLNA 5LYJA 3OJOA 5IFLA 1F5NA 1T2VA 2ORIA 3H5TA 4I55B 1TMGE 3DB2A 4XRGA 5E3JA 4KAJA 5JROA 3LPCA 4ZO7A 5KYGA 3G13A 3T3HA 4MA5A 2EBUA 4HK4A 1WF3A 1VKOA 1X1QA 4QTZA 2XRMA 5ENVA 1JQKA 4CKWB 1Y3DE 2HLPA 4M1ZA 2H1SA 1VKHA 4XFJA 4EUNA 1XE3A 2LW7A 3QEMA 4QPZA 4R0MA 4RS4A 3NANA 1MVOA 3OHMA 4ECEA 1PP4A 3HMQA 1IZ7A 4GKJB 1YA6A 4DG5A 5DM70 2ZQYA 1VJDA 4H17A 4FHFA 1CVRA 3CX3A 1DE0A 1K8XB 4HAIA 4E2YA 2IYZA 3OCCA 4WXEA 3HDYA 3BGVA 4KPUA 5B64A 4RTLA 3K70C 4ZI3A 3O47A 1A76A 2DWUA 1SULA 2JFOA 3OY2A 3Q9UA 2DUUA 4GF5A 4Z2AA 4UEQA 3ZWMA 4GC5A 1PSDA 2FFAA 1D07A 4QASA 3UXEA 1FQJA 1H65A 3JAKA 4OY3A 4PQRA 1J0EA 2OORC 1NFFA 1QH1B 5F7JA 3FFAA 2IPAB 2AG8A 5CDHA 1U1GA 2XUIA 4TL7A 3HCDA 4B44A 1YB1A 3HQ4O 1AXRA 4D8VA 4DDTA 3NS7A 1S8NA 1Z0SA 2JKZA 1QOPB 2JHGA 2VYND 4RTMA 4F2DA 3TB6A 3EC7A 3ZGZA 2Y0PA 3GFVA 5EWMA 1LUAA 1PFWA 1T5HX 5B58T 4QQKA 3W6NA 3STVA 2P30A 4GT1A 4LQ4A 1QHNA 5LD2C 5ELXA 3IV6A 3L1JA 4KO4S 3I52A 1UQUA 4U3JA 3FJ1A 5IAEA 3GNSA 5NULA 3TZCA 2QTTA 4CETA 4ROTA 2QD2A 4JU8A 1E5XA 1CQXA 1QH0A 1M2JA 2BZ1A 3K8ZA 4X3PA 3BJEA 3MIIA 4LTNA 2C4KA 5C9ZA 5FLXA 5AR1A 5PNTA 1GRVA 4DQKA 4FZRA 1S1CA 1JLMA 3U4QA 4ZT4A 4BNKA 2AB0A 4IV0A 4WESA 5DNEA 3B1JA 2MSCB 1FFXA 1VXRA 2IS4A 3DZKA 4YV0A 4WUVA 4OEHA 4XPIA 5D3ZA 5JANA 4J0CA 2H1OA 2HB6A 3F49S 4NCJA 1ECCA 2PV7A 3RVDA 3GG9A 3F6CA 1XEWY 1QBGA 1IUNA 1RJEA 1VRCA 1ILEA 4Y7CA 4DLBA 4UDXX 1YHZA 3AUUA 1FXWA 4BLSA 1TGYA 1W0KA 2VDJA 1JZTA 3FYSA 3FVTA 4R68A 1SNYA 1TTPB 5A62A 1CSEE 2AW5A 3C98A 4QGSA 2HPAA 4URXR 3FCYA 2YY5A 1N9KA 3PDCA 1O8CA 3AG6A 1M2VB 1UDBA 3ZDBA 1JE1A 1P8AA 2BFEA 2EJBA 2VJAA 4B4KA 1XN4A 1L7QA 2PZBA 1X1TA 1I5OA 5FPSA 2GA8A 1YS7A 1VSTA 4FYIA 4G4GA 4BJ5A 1XPOA 4LZAA 1J2UA 4WNAA 1MH1A 2CUZA 4F8JA 4AY2A 4KTTE 1J00A 5L7TA 5KX5B 3A3NA 3QKRB 4UNIA 2AMVA 2ST1A 2J6IA 2XQVA 1XMVA 1G21B 1OAOC 2VDRB 3HH8A 3K9QO 5CUQA 3L0SA 4FMDB 1HYGA 3U6BA 1GZ4A 1IUOA 1KMHA 1JG4A 5AI8A 3L1UA 4CM9D 3TGLA 1GQ2A 2E87A 1HR0B 1KVRA 1GOTA 1NX6A 1QF9A 1YULA 2B7CA 2DTXA 2OAP1 3F7MA 3KYCB 4FE7A 4JSTA 4WTOA 3UUWA 4B7UA 5F4BA 2WJ3A 1FXWF 1SN7A 1JDVA 1N1EA 1RIFA 1RJGA 2FP4A 1SU7A 2YWEA 2VNHA 2CXUA 2MR5A 2H8KA 4NABA 1QHHB 2VT7A 1NBAA 3HNPA 3NBAA 4K2HA 2H92A 1W4CA 4ZODA 1Q7EA 1UF9A 2JA2A 4GBJA 3RYCA 1OX6A 3VTZA 1NOKA 4LV6A 1XEWX 4PVDA 3RRBA 4JEUA 2ID4A 1QG0A 3ROXA 4BZPA 5JMOA 2Y1KA 1P1CA 1XLVA 3A9RA 3OQPA 2CBGA 2Q6IA 4XD2A 4OG2A 1NVVR 3F4BA 3VDXA 4C5BA 5BSGA 2M98A 1CP3A 2OQRA 3HCBA 4LHYA 3NHBA 3NP9A 4H7FA 1KXZA 4Q7LA 3G8CA 4YFVA 2LIVA 3FJYA 3SU8A 3A1DA 3HXOA 3PGA1 3ACCA 3CVVA 2YHSA 2HK9A 1YCFA 1P7VA 3I6MA 4YRQA 2GHTA 4NNJA 3GRPA 5J47A 1V48A 4FHZA 4LOAA 3PC8C 2HLHA 2PKQO 3IAM1 4YH1A 4WXHA 1RM3A 5J2UB 3MUOA 1VQ1A 4Y6OA 5JSHA 4HXGA 5IKOA 3C7TA 2R9VA 1P74A 2XMZA 1XTIA 3GGGA 3L7IA 3NH6A 4J8PA 4I9UA 4WAUA 2EP8A 2WKRA 3AKZA 2HDHA 1M1NA 2WWIA 2FX3A 4BB9A 1B76A 3B7PA 4Q19A 1ZIPA 1G8FA 2AMJA 3LC0A 2H06A 1TQHA 4L0DA 3TOCA 3BD8A 3KB8A 4E1AA 1MOPA 4BGUA 2GXUA 5FO1A 1B0UA 4JOQA 2W7TA 1GKIA 3IPYA 4HZGA 4L57A 1LJUA 1K0FA 3L8MA 1A7JA 4LJKA 4CMIB 3E8SA 3PVCA 1LBSA 3BRQA 4DLYA 3O90A 4ZQCB 3RVBA 2J08A 1PT5A 4UBNA 3TLGB 3QPCA 5HCNA 9MHTA 3TLYA 3PPVA 1R0ZA 1EQAA 1I36A 1MB2A 1OC2A 3U7GA 3CKKA 4LOIA 3FPJA 5BN5B 4K9MA 3ICPA 4NNPA 3TK1A 4F5YA 3PNKA 4LRSB 3JQ9A 3QQ5A 1T2UA 3OETA 2X4GA 2ZTSA 5I7UA 2IX9A 3WXBA 2ZJ4A 2DUNA 1FYWA 1RPAA 1NDQA 1QE5A 3A4TA 2ZTVA 5HCIA 5I7OA 3DDWA 1TC2A 1OWOA 1U90A 2C00A 4KYVA 2JI4A 2H5LA 2JGIA 1XZDA 3FYUA 3G9XA 4PONA 5A9SB 4DKJA 2ZUEA 3DLBA 1XZ8A 4RXTA 2PG3A 1P73A 3LVFO 4IILA 1L4YA 1OD6A 1UDCA 5SY4A 2DFPA 3WRVA 2B5WA 4AY5A 2AZXA 5DBGA 2PYIA 3PIRA 5IKEA 3PQ3A 2A9JA 2Y66A 4DDWA 4QA9A 2VWQA 3OZVA 5T3UA 3PUXA 5LYYA 3AVTA 2HRDA 1O03A 4G9EA 3GQBA 2X2PA 4GVXA 3IKTA 1VCIA 3IA7A 4NEQA 4BO2A 3G8DA 3DTVD 2X3YA 4OOEA 4RKWA 3VYRB 3LKBA 5FBQB 4BX3A 2VQDA 2VTVA 3L02A 5ALIA 4PYQA 3ILVA 2I33A 4Q4DA 1CR1A 1A8SA 2EX4A 1AVTA 3X0DA 1R4MB 4CEIA 1H5QA 1SK9A 1YMQA 4XWTA 4YRTA 5A5DA 3LI2A 1BZYA 2BE7A 3EXHC 1XLUA 1MP0A 5IANA 4C7XA 3ETLA 1YTUA 3IAHA 1DRJA 4F5ZA 4JLUA 2PSFA 5EWLB 4EA8A 5K7SA 4CMHA 5E4FA 4JI0B 4LJLA 1JVSA 2VF5X 1DEHA 2BLLA 5LQMA 3T9DA 1HL7A 1GL9B 1RQLA 1X15A 2WIBA 3RVMA 5JAIA 4IYRA 5JY6A 3PEWA 2GWHA 4Z0PA 2AN5A 2HKIA 1JLSA 1KDRA 3ANYB 5IRCD 5ITSA 5H70A 1GPAA 1Z73A 5LZ5A 5KOYA 2PZEA 4IDFA 1Z4OA 4DMKA 4RZIA 3NHPA 4AZTA 1JXMA 3LC2O 2V7PA 1M1YA 1NI5A 3PEFA 4UJ3A 1F7UA 2NUAA 2R8BA 4AF7A 2QMUA 4JB2A 1S9HA 1BS2A 5HKLA 4ZDWA 3G68A 4JP2A 5F21A 3V8MA 1WCV1 4EYEA 3HS3A 5FUQA 2ODQA 2BBOA 4I5EA 3RR2A 3AF6A 2J0UA 4E15A 1E2KA 3UPUA 4AUNA 3ER6A 2ZUDA 1EWYA 4JOBA 4CCYA 1Y4DE 2RH4A 3T3EA 4L4UA 1N6PA 5CBPA 1AK9A 2YR0A 3HSYA 4GXRA 1PZGA 2X4LA 3FW1A 3ZU5A 1OZAA 4Z6KA 2CLEB 1EUQA 1M1ZA 2V4ZA 4AJ9A 2QM3A 4RA6B 3PHGA