2QTMA

Crystal structure of nicotinate mononucleotide adenylyltransferase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
189
structure length
189
Chain Sequence
b'MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
molecule tags Transferase
source organism Bacillus anthracis
publication title Kinetic and X-ray structural evidence for negative cooperativity in substrate binding to nicotinate mononucleotide adenylyltransferase (NMAT) from Bacillus anthracis.
pubmed doi rcsb
total genus 49
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qtmA00
1N2OA 5TS2A 4MWDA 1EFPB 3VRHA 3M5WA 3U1VA 4KPUA 1IQ0A 1B6TA 4ZT7A 4MVCA 3MXTA 3VU8A 3TQOA 1COZA 2QUJA 4MUHA 3FHJA 1Q19A 5TEVA 1EUQA 1IRXA 3P0JA 3FNRA 1NUTA 1NUPA 3HFJA 5DASA 4MUNA 3IUBA 3TZLA 1XNGA 1EXDA 1YUMA 4DDHA 4ZCTA 1WXHA 5F23A 2OQ2A 3CA8A 4MLPA 1IVSA 2QJTA 4DJAA 3AG6A 2HGZA 1V47A 1N77A 3A04A 1MRZA 1Q11A 1WQ4A 1X6VA 4I6EA 4EF6A 2JA2A 3SZ3A 3ZJVA 3FY4A 4U7JA 2Z3VA 3ELBA 1TQ8A 4FZJA 1J70A 3TZEA 4HPWA 5BNZA 3COVA 4CDMA 1MOPA 1PFUA 2DUMA 3LOQA 1XNHA 4EG4A 1N78A 4JXZA 4ZT6A 2J08A 2CYCA 4G6ZA 4EG6A 1WOYA 2H2AA 1R6UA 3NV7A 3SYTA 3TS1A 4MUGA 4MW5A 5IJXA 1PG0A 2RE8A 4KPUB 3CVYA 1M83A 4QREA 3IOCA 1TFUA 3QTBA 3IMEA 1ZH6A 1JGTA 1O94C 2QTRA 4MW6A 4TS1A 1I6LA 4ZT4A 1KH1A 4MWEA 3CLSC 4WNYA 4ZT5A 1GTSA 2A86A 1NP7A 4K0RA 4DLPA 2E89A 1O97D 1G8FA 1MC1A 3RHSA 1KKUA 4MUJA 1HYBA 4OUDB 3RK1A 1KQOA 3FIUA 3TQIA 1KH3A 1GPMA 1KH2A 1OWMA 3L92A 1F7VA 1F9AA 1QJCA 4EFKA 3K9WA 2QTNA 4L2IA 1Q15A 3ZXSA 4ARIA 1TEZA 3AG5A 1WXGA 3IVGA 1NUUA 2H29A 1VBNA 3ZJUA 2ZP1A 3E27A 3SDBA 1WQ3A 2X1LA 1KAQA 4MUIA 1I2DA 3PNBA 1M8KA 3ND7A 4P2BA 1N2JA 1T9GS 1U0BB 2C5SA 3GMIA 3COWA 4MVXA 2E21A 4MUEA 4MW9A 2E18A 2CV2A 4RPIA 1O96A 5HG0A 1MB9A 3PRHA 1KQNA 4DDMA 1JIJA 1MAWA 4CDNA 5H16A 2O5RA 3CVXA 3UOWA 3DPIA 3CLTC 1F4LA 4AS1A 3IOBA 1TYBE 3RJZA 3SEQA 2PFSA 2AG6A 1OBCA 4GU5A 2CYBA 1FFYA 3ZJTA 3QE4A 4JXXA 2CT8A 5FO0A 5FNZA 1I6KA 3NBKA 4H3SA 3NBAA 3FETA 3IVCA 5TEWA 1QU2A 4L2IB 4RUKA 4UZFA 1K92A 3GLVA 1ULHA 2A1UB 4GRIA 4KR7A 4XSVA 4EG3A 1T6ZA 4YP5A 1J21A 5LM3A 1N2GA 3ZXIA 3IVXA 4ARCA 4J76A 1ILEA 5LLTA 2DR2A 5HUJA 3OTWA 1VLHA 4I6JA 1LI5A 1TYAE 4MWCA 1O96B 1NSYA 4JZYA 4MULA 4XFDA 1LW7A 1KQPA 1J09A 3LCJA 4DNXA 5H7XA 3H97A 3IMCA 4JYZA 1N2EA 4MW1A 1T6XA 4HJRA 2R5WA 1N75A 1VBKA 3H99A 2QJOA 4MAFA 3SEZA 3AIIA 2A4MA 2AZXA 5IHXA 3H05A 5K0SA 3ZGZA 1SURA 1U3DA 5LFAA 3CLRC 3I05A 3CLSD 1M8JA 1M8PA 1KP3A 1V8FA 2VTBB 1IFXA 3LE8A 4AQ7A 3D6VA 1NURA 2HZ7A 1ZJWA 3P0HA 3AFHA 1EFVB 1IHOA 2AKEA 4S1OA 3KT3A 4Q16A 2VXOA 5DK4A 3IDFA 3G6KA 4ZCPA 2YWBA 2WQ7A 1OWNA 2IELA 5FO1A 4ZT3A 3INNA 1MJHA 1K4MA 1WY5A 3Q10A 4KKVA 4OUDA 4QBTA 5AHWA 1OBHA 3FDXA 5K0TA 3QTTA 4QRDA 4E1AA 4KR6A 3FI0A 1XNJA 1QU3A 2OV4A 2DPLA 3IMGA 4PY2A 2CV0A 3N2YA 3KFLA 3FWKA 4MVYA 3CVVA 3KT6A 4U63A 1GZUA 1MB2A 3L93A 2QUKA 4MUKA 3SZGA 1U7DA 1UFVA 2GM3A 2GKSA 3D6UA 3HGMA 1EFPA 3GUZA 5DB4A 1EJ2A 2CV1A 2DLCX 4UZEA 1BS2A 2J5BA 3X1MA 1T6YA 4R0NA 1O95D 3G59A 2JANA 5J5AA 4R2LA 2V0CA 1FYDA 3BL5A 2VTBA 3N8HA 1TYDE 4PBSA 5TGTA 2WQ6A 3N05A 3RFFA 2YWCA 1TYCA 1X8XA 4DDKA 3JXEA 2NSYA 1YULA 3MMXA 2RD2A 2I1LA 3KT0A 2Z08A 3ND5A 1KR2A 2A1TR 3HMQA 1K97A 1J1UA 4ZT2A 3Q12A 1G8HA 1YI8A 4G5FA 2PZ8A 1M1ZA 1RQGA 3RBAA 2D5BA 3P0IA 3HL4A 3IH5A 3AKZA 1P7PA 5DEOA 1QRSA 1O94D 2A1UA 5EKDA 2X3FA 4PBRA 4BWVA 2QJFA 1NUQA 2D13A 1JMVA 1JZSA 3CVUA 1NUSA 3ILVA 3A4IA 1O5TA 2IP1A 2PXHA 3RK0A 1O95C 3ZUGA 4EG8A 3IOEA 1IQUA 1O97C 3SP1A 3F3MA 4NZPA 1M8GA 1XJQA 3HV0A 4R2MA 1WXEA 2B7LA 2YXNA 3DV2A 3ND6A 4NX2A 4WSOA 3COZA 1U7XA 1JEEA 1QRTA 3H9CA 4KR9A 1VBMA 1H3EA 2E0IA 3UC5A 3S3TA 1J1ZA 1NI5A 1S4MA 4U8HA 5HUHA 2XRZA 1WZ2A 4J75A 3PNVA 1Y42X 4G5YA 1K4KA 4MW7A 4NAHA 1Q77A 1QTQA 4MUFA 1GAXA 5JBNA 5KWVA 1PG2A 4CT0A 3MLBA 5KCMA 3TNJA 2J07A 2QTMA 3DO8A 3UK2A 1J20A 1JIKA 1OWOA 4EG1A 1I6MA 1IQRA 3G5AA 4A91A 3PNYA 3ZIUA 1O0CA 2A84A 1WJGA 3H9BA 3ISJA 2GOYA 3X1KA 4YP6A 1PFYA 1PFVA 4HK4A 1EE1A 4NDAA 2TS1A 1OWLA 4EG7A 1H3FA 1MAUA 2BTEA 1T9GR 2CSXA 2EL7A 4PBTA 3CLTD 3KT8A 2J4DA 4MQ6A 2CFOA 2X0KA 4F3RA 1NZJA 3COYA 4DE5A 3CVWA 4OJMX 2V0GA 1D2RA 3IUEA 5J59A 1ZUNA 1N3LA 1VL2A 4MW2A 1KP2A 1LI7A 1U3CA 2PG3A 1PFWA 4F4HA 3MUEA 3CLUC 4Q93A 2G36A 2YY5A 1GTRA 2DEUA 3X1JA 4ND7A 3A05A 2EJCA 2XRYA 1WXIA 4EGAA 2CUZA 2QUIA 3A2KA 2D54A 3N9IA 2A88A 2HMAA 4X0EA 4HJXA 4NAUA 2WB2A 2A1TS 2O8VA 2CYAA 1G59A 2A7XA 1O0BA 3UY4A 3VGJA 3UMVA 2WSIA 4ZCRA 1YUNA 4K03A 4ZCQA 1WKBA 3P52A 4EG5A 1QNFA 2BYTA 4MVWA 3CLRD 3FG9A 1YIAA 3FH0A 1N2BA 1KORA 1IH8A 4JFAA 3FOCA 1OD6A 1QQTA 1GLNA 1O6BA 1N2HA 4I6GA 4MW4A 5J58A 1CT9A 1F7UA 1KAMA 1H3NA 1A8HA 2ZUFA 2DETA 1JIIA 2JAXA 1JILA 4ZCSA 1R6TA 1EFVA 2DXIA 3PXUA 2PIDA 4ND6A 1N2IA 3MLAA 4YP7A 4NATA 3K32A 4MW0A 1JHDA 1OWPA 3Q4GA 5KHAA 4XFJA 1GN8A 2NZ2A 1JEDA 3HZRA 3CLUD 1M8FA 1JECA 2IJGX 1H1TA 1ZH0A 3AL0C 4CQNA 2Z09A 2X1MA 1JZQA 1G8GA 3CR8A 1EUYA 2DERA 1YIDA 4MWBA 3C8ZA 1WXFA 3IODA 3OP1A 2PZAA 1QRUA 1R6XA 4YMIA 2ZUEA 1NYLA 1DNPA 1MBZA 4YBRA 3DLAA 2J09A 2QUHA 2PZBA 1N1DA
chains in the Genus database with same CATH superfamily
2DY1A 3VYUB 2IYWA 3A1CA 1EFPB 4V0KA 3REQB 4D4HA 3TRJA 1Y3DE 2D2XA 2W2PA 4E31A 1E69A 1WSBA 3D8RA 1KPIA 1AGNA 1SBIA 1LLFA 1HFKA 1QGAA 1U0RA 1AK2A 4AL4A 1C7QA 1ACMA 1N2ZA 1O87A 1Q6YA 1RHJA 2DWUA 2Q6TA 3EDYA 4P9NA 2ZWAA 1ZVQA 2I2XB 4ZQGA 3AEUB 5DLDA 4B8ZA 1P9LA 4KU4A 3A32A 1KU6A 3PC6A 4AUEA 5BRJA 5I51A 1U0SY 3NI2A 1SHTX 1E5TA 3WFIA 2BSQA 3C45A 1CY0A 2Y1EA 3BREA 2H1FA 1ENOA 2R7AA 2QPTA 4FSHA 1C3EA 3D6MA 2W58A 1Z62A 5C5IA 3Q15C 1UPXA 3AGQA 1L0BA 5EPUA 3A04A 2VRBA 3HRKA 1GA1A 3NR2A 2KJQA 1W5TA 4IDDA 4JJKA 3W4JA 2FP4B 2IC5A 3I9V1 1VCIA 2IPLA 2PU5A 3A1DA 4DZTA 2P68A 4BLTA 2ZT6A 5K9ZA 1B7GO 4OOFA 1ZD8A 4JC0A 5EKXA 5IDWA 4G0PA 2I4TA 4GPAA 2IS1A 2AYXA 1AS2A 4JXZA 1W94A 2HK8A 5EMLA 2PUWA 4WCDA 2E4VA 1YOVB 1HSZA 1JSCA 3DG9A 2PJZA 1HDYA 3HI6A 3I4CA 2R7LA 2DVMA 2PE5A 4RTMA 1GL9B 5JADA 2Z6UA 3LY8A 5L3SA 2B2CA 1ZGGA 2FK8A 4TYPA 3KUXA 1NAHA 2GBPA 2OB2A 5AJZA 3EXIA 4FDMA 4J9UE 1QF6A 3ZDEA 5FYQA 1GNPA 1LF0A 4QEKA 1XCBA 2VN8A 5EJ7A 4FFBB 1US8B 1KGSA 2COKA 3FVVA 4BZQA 1F1JA 1X1RA 2W4QA 1Z34A 1T2AA 1DO8A 1ZAKA 1E6UA 2JIOA 4AG6A 2ZI5A 3ZC3A 1R9GA 1VMEA 2A5LA 2RKBA 3HR4A 4HX5A 1TVEA 4U5QA 4WFIA 4ZHQF 3H1FA 2P11A 1TB4A 5CFOA 1CS0A 5G3ZA 3CX7A 3UWSA 1B8PA 4KHPB 1YCFA 1K98A 3AVWA 1JXQA 3AETA 3CLHA 4KW7A 5ALGA 5EP4A 2KBFA 3A4LA 1HYBA 2D00A 4FHFA 1KQOA 3FIUA 4M86A 4MAAA 2OFFA 3SJAA 4DV4B 3H17A 3ZYZA 3BXPA 2O8CB 2X0JA 3TOCA 4WXEA 1F2TB 3RS3A 3O4RA 4YS6A 2IUYA 3KPVA 1CUIA 4RVUA 2XGSA 2VL7A 3C8HA 3OQJA 4R2WA 3D8NA 4KXMA 1C4XA 5CLGA 3WLSA 5LP1A 1W0KA 1IIRA 1TDJA 5EXSA 3VV3A 4B6RA 4PNHA 1NUUA 2WD8A 3FTNA 2C4NA 3NBFA 3MSCA 3AESA 1NVMB 2BKEA 3LX6A 4FFNA 4DA0A 2WSYB 2Y1DA 3W5UA 5BVHB 1E9VA 1OC4A 2OO3A 4UHJA 1YMQA 1NRIA 1CYDA 1E94E 3K0AA 3ZZ1A 3ND7A 3NPMA 2RHTA 4DSUA 2NV2B 4MW9A 3A6EA 3KS9A 2FMHA 4UKDA 5FR1A 2P6MA 3PE3A 3KQPA 2Q0QA 3M6MD 1VM6A 2QSZA 2GJ4A 3G82C 4IJVA 3OQIA 2AQ8A 2YXDA 2QZ9A 2XDQA 1FRVA 4GLOA 3N2EA 1AC5A 2JFPA 3OQMA 3IALA 1L5YA 3W3AA 2DBQA 2EWWA 4FGUA 2O0HA 1NVGA 2I66A 3I2YX 3E9QA 1XTPA 2WJJA 4EHNA 2AG6A 2H9AA 5K0NA 4E5YA 6LDHA 2OFPA 5B5SA 3ROPA 1UANA 1SBHA 2WJ6A 1Z45A 3GDHA 2L82A 2FPPB 2IU6A 3I6IA 1PUIA 3MGCA 5FO0A 1T2NA 1I6KA 1U7TA 4IJWA 4DXDA 1HRDA 3WHPA 1R00A 3E2MA 4P0TA 1K8YB 1CY7A 3GRRA 4BO1A 5EMNA 4UZFA 1NBMD 4H7PA 4D25A 1DHRA 3NXKA 1SXJD 2BM9A 3RVRA 3KIPA 3Q7PA 3LO5A 5AVRA 1W35A 4OGGA 3U40A 4WLFA 3JQAD 3K1AA 4P83A 1JQKA 3UJBA 4QL3A 1A9XA 3TIXB 2F48A 5A9TA 4F3KA 1XMIA 2W2XA 3VKVA 2H7VA 2JEOA 4Q02A 4MUMA 2HRBA 4TTAA 5JMOA 1E2IA 3IL2A 3RS2A 4DT1B 4P86A 3K71B 4HNVA 2W00A 3HN7A 2UYCA 3EIFA 2D62A 2Q4EA 4IIFA 1EK2A 4KJZA 4AVYA 1OIVA 4YRGA 2D0PB 2P0AA 3MWYW 4F6CA 4W1RA 4AYTA 2OVBA 1J39A 1ZGCA 1Z4PX 1D3AA 4EHDA 1KRXA 4MR7A 1WUYA 1NOJA 3EVBA 1P1CA 2XQIA 3HZHA 4I4TB 5BN1A 4GR4A 3B2NA 1J49A 4R81A 2R5WA 3GD7A 1QVRA 4OFWA 3UUWA 4MQ5A 1SXIA 4YUWA 2OR3A 2C2YA 2IZ5A 3L8GA 3SDSA 4AKSA 1JDBB 3ON5A 4QWWA 3OLYA 4YREA 4BNFA 2X1VA 2XAAA 2ZS8A 2JK0A 3GEEA 3O1JC 3S8YA 1E3LA 2I1WA 3GG9A 5IJ9B 4Y2XA 1XU7A 1CP2A 3WLTA 4L76A 1K3TA 1S1MA 4Z8YA 2HZ7A 3K73O 1QH1A 1EVYA 4QA9A 3IBYA 2Q4OA 3U6BA 1IHOA 4ZHQA 3OZDA 2GBCA 2I7VA 4QYMA 4S1OA 3GDFA 3O47A 4PYOA 1ZMTA 4IFTA 3EIWA 4OUDA 3Q10A 4MR9A 3E1KA 2GN0A 3HR8A 1T4BA 2C2GA 5FFNA 3EOZA 4EEZA 4E1AA 3LCMA 5IUJC 3RF6A 1MX3A 4C30A 3C6XA 1EVLA 4OU4A 1FPMA 5BUQA 3VHRA 4DT1A 1PWEA 1ZSYA 2R8RA 1FLAA 2B21A 4IQ8A 4KIGA 4PE5B 5DHUA 3SD7A 2HK9A 2HA3A 1PJAA 1Q50A 1VHTA 2HOQA 3CUSA 2H1WA 5DM2A 2ZSUA 1U5CA 1O77A 3MJCA 3S2EA 4AKGA 4TRJA 3AJ8A 4U63A 2IIQA 3U62A 2EV9A 3PTAA 4C0LA 3V1KA 5G3YA 1X7HA 3GMSA 1PV2A 1P2GA 2XOXA 3O6VA 2VDPB 3CN7A 1ULAA 2X2EA 2GM3A 1ZX1A 4KWTA 1Y8RA 3SU8A 5JC1A 5FLEX 2GN1A 3R3WA 3F9IA 1RXSA 3A6JA 5DWQA 2PWPA 4LBVA 3HM2A 4BMSA 5JR3A 3V8VA 2VZ8A 4JOCA 1VLLA 1NI3A 2DFTA 4NZNA 4P4SA 1TO2E 1T4DA 2EDCA 1N6HA 3L6OO 3X1MA 4BYGA 1PIWA 1NR1A 2CNBA 3EODA 1T1SA 3EQZA 3LSYA 4JS0A 2RGBA 5FWDA 4E21A 5COBA 4DSZA 2OK8A 1TPZA 4M46A 1CUFA 2X4DA 3DF7A 2VA9A 3F2IA 1KDOA 4BUCA 1QXSA 2AOUB 4GM0A 4OMDA 2VSOA 2QG6A 3A1WA 3HSSA 3EGWA 4GDMA 4GPEA 3E70C 1C2TA 1IZZA 1JFFA 2QTVA 1RYDA 1BKYA 3AFIA 3E8XA 1NY6A 1YF3A 3S27A 5CDUA 3A11A 3P2JA 4QQFA 1FQOA 1Y5IA 2F17A 5ALTA 4XJVA 1YNSA 3OM0A 4GR9A 3HDQA 3ND5A 1KVTA 3MG9A 4JJEA 1KR2A 4MV7A 4MS4A 4QPJC 2C8LA 4CI9A 4XSGA 1CDDA 1S2IA 1U9IC 4G26A 4QOEA 3WLKX 5FFFA 1VHWA 1BU5A 4U00A 1QYRA 5KAPA 3TZCA 3WWEA 2BOVA 3PWZA 3Q5GA 1XCMA 3P0IA 3DO5A 4QEZA 4BO4A 4NYMR 5M7EA 4N7BA 2EGUA 2MINB 1L4YA 1RJDA 3MT7A 4XFKA 5J5VA 1IBLB 5JFOA 3U0BA 4D3YA 4F56A 2P2CA 1TEVA 4L6CA 4DCTA 1Q7TA 2DHRA 3G23A 3ZXYA 5BW5A 1XI2A 2BDEA 4DRXB 4TM7A 4GX2A 4W9MC 2CEAA 3KAQA 1WPGA 3ZE0B 2QLJA 4D1YA 1Y8RB 5AIAA 4FCCA 1GLGA 4BGEA 1QIFA 1M8GA 2W2NA 5CM2Z 5EUBA 3UJDA 4CCYA 1ORTA 2YWXA 4JKIA 1RQRA 3ND8A 3AHHA 1TVKA 1CEXA 4ZC1A 4EQZA 1POXA 3ONEA 5EZ5A 2DCUA 5DZSA 1H0RA 2IXEA 4G2NA 5FUWA 3V80A 3W8RA 3VSCA 4IHJB 4CKCA 4EI7A 4PYRA 5AXDA 5JCJD 3QLTA 3MB5A 1D9XA 1FF9A 4PZPA 1XVVA 2EERA 2JJYA 4UPDA 4KAJA 1B74A 3VPBA 3KYDB 4JI6B 3HU1A 4LY6A 3ERCA 1Y42X 3CPHA 3JWPA 1ZEJA 4IHQA 1BTOA 3OF3A 2ZRBA 2PSHA 4W7HA 4AAYA 3RUIA 3EVFA 4LZWA 1GQ2A 1A9TA 1DOAA 1XLUA 4RAQA 5E2AA 3TGLA 1EVKA 4HNGA 4OJYA 3NFRA 4TT3A 1XG5A 3HWRA 4LPSA 5KWVA 3CJTA 4LAFA 3OCUA 4NSNA 1BCRA 1IN7A 1JIKA 2NV0A 2O2JA 2IPAB 4IILA 1BMTA 4CMIB 3TTXA 1PN3A 4NTZA 3NHBA 1ETUA 2BSXA 3GLUA 1MB4A 4P32A 2AF3C 5DVZA 3T7CA 5K0ZA 3GLIE 3EVGA 3A4NA 1LLDA 5EZYB 2FSVA 2BR5A 3L0IB 3LT0A 4XUEA 4ACAA 4NDAA 2FSUA 3G2QA 4MRSA 4MSUA 3CZ5A 1FP4A 4L75A 5DSZA 1H8HD 2QU8A 1XL0A 1N0UA 1T9DA 3H18A 4C6HA 2BFMA 4ZZ0A 1M34B 1KMMA 5K8IA 3R9KA 1W6UA 4B71A 1QGOA 2C61A 1R4MA 5I7UA 3BE8A 3UOAB 3QJGA 2EW1A 3N3AC 2V3WA 2ZVPX 2V54A 3O21A 3ORHA 5ALUA 1XVUA 3V4PB 1XDUA 1G63A 1Y8CA 2WVHA 4KDFA 4HUTA 1DWQA 1GZ7A 1OPXA 4M7WA 4OQMA 4C29A 2PAFA 1ZM7A 5DK6A 4PCAA 2J9RA 1AKVA 1EUZA 1C3LA 1LZKA 5I7OA 3WA6A 1PT8A 3CVJA 1KJ8A 1QR6A 3QVOA 4GPIB 4QYTA 4CIWA 4JC4A 4QUJA 1G7SA 4LOAA 3A6HA 2XA1A 3VH3A 2G36A 1Q16A 1GTRA 4IBOA 2XUKA 3K6KA 4F6LA 2QRPA 3BQNB 3ZVMA 3ETNA 3RVDA 1TM7E 2ONZA 3ENQA 4YAWA 2VJLA 3RFUA 1GL6A 5FFMA 3HJFA 1ZC4A 3L6DA 1RNLA 1NG1A 2QV7A 4RJ2A 3NVKI 2D54A 2X9VA 3O90A 5CRIA 5T41A 3TUJC 4QDUA 5ETJA 2JNWA 3TX2A 4UCXA 3A6LA 5EJFA 3U7QB 4FCVA 1E7WA 3OZRA 3PI7A 4I50A 3DOOA 2JIPA 5AUQA 2HNBA 1M1YE 1R4NB 3H13A 1HPLA 1W8DA 4JDPA 3RQSA 1Y7TA 2YWGA 4MHOA 4X5OA 5JYEA 1KOGA 5HIJA 4IL5A 1V1RB 3NIDB 4J0QA 3BE5A 3FPJA 1QV9A 3BAFA 4AMBA 4OK6A 1A9QA 3O8DA 1WHSB 1YMUA 4I1RA 4P35A 2H0RA 4R1LA 3FHCB 2OPBA 1QNFA 2VDQB 1N92A 3CNOA 2YJ3A 4Z4CA 4CF7A 1WMDA 3PG5A 4J94A 3NRCA 1VDZA 1E1YA 1GHTA 2Q9BA 3GN2A 3L0SA 1NJSA 2JIRA 4F8EA 4WEOA 1B0ZA 1Y63A 2XZPA 3F6PA 3AB7A 5AVKA 4II7A 4BLRA 3FH0A 3D6HA 3H84A 1EE2A 4B43A 3JZAA 4IIEA 2RBEA 4UQLA 3WS7A 2WJIA 5A05A 1JDPA 4Q4LA 3SOZA 4B8YA 2I6GA 3MS2A 9GPBA 9LDTA 3I6YA 2C5GA 3QH4A 1AMOA 1ONBA 2NAFA 1GLNA 4OGKA 4XUCA 3LO8A 1N2HA 1JH8A 3OQHA 4EA8A 5A9SB 3FTPA 3LAWA 1F7UA 2CLEB 2F8LA 2E87A 3BYZA 4NZ9A 4WIAA 4XWOA 2OV3A 2ZUFA 4Q7LA 4M1OA 2EBHX 4KO4S 4RAOA 4YJFA 2CFIA 5CURA 4ZCSA 2XA2A 4KBYA 1CJMA 3IURA 3RTAA 3SDZA 3A0RB 4RPGA 1CUWA 4O29A 1ZZEA 2JCVA 3DUFA 3SFTA 3RSZA 1N6KA 5E4YA 3IE1A 4PX5A 3L6BA 3KZKA 3URKA 2JFGA 1MHPA 3L5OA 4NU5A 1SXQA 3FDZA 1N6LA 2NZ2A 4R5HA 5DU2A 10MHA 4CG0A 2H65A 2W6NA 4L5IA 4JJ7A 4WX2B 2ILTA 3LUPA 3D59A 5FOWA 2PJDA 4ETNA 2Z09A 1N32B 3F78A 3AR9A 2R1TB 4EABA 3V4RA 1FDRA 2WKSA 1WCV1 3UK0A 1AUXA 4KXLA 1S0UA 2GD1O 4LISA 3DFZA 4O4LF 1GPKA 4OGWA 1PG5A 2PZAA 5K8JB 1PJTA 4K46A 4LS3A 1K63A 2V7PA 3T1YB 1T91A 1L5ZA 2HJVA 2H4YA 3K5HA 4DL9A 2E1PA 3QVKA 1BYIA 2IYSA 1FYEA 3NHRA 2AX4A 3P26A 4GWLA 4IJUA 4MVCA 5DTMA 3RBVA 5IKOA 1LBEA 3M5CA 3TLMA 3UUEA 2B37A 2PGDA 4L5AA 1M74A 4UBOA 3A9WA 1B0AA 1D2EA 3VBCA 1ML3A 2A78A 1GGMA 1Y7HA 3C3DA 3M4JA 3LPNA 3N7AA 1IUPA 3TQOA 1SXPA 4XKJA 3VO2A 1LK0A 4W8GA 3CN9A 1EUQA 3KJFA 4QO8A 1WB9A 3AY0A 4JSRA 3BVPA 3S5UA 4QARA 1NUTA 3FCEA 4B82A 1GTL1 2I7XA 4I55A 3ZCXA 3ONNA 4YRMA 4JITA 2HLDD 1CY2A 3S0JA 1V41E 3DOHA 5E7JA 1XA4A 4RCZA 4PAQA 2OQ2A 3ABOB 3GCWA 4MYCA 3WK6A 3AVUA 1QIEA 3ADPA 4QM7A 1MNAA 1EB9A 1NHGA 4P38A 3L07A 4P54A 5BSUA 1PQ4A 1IATA 1KEEB 4JCOA 5AM4A 4CM9D 3IUNA 3TLBA 3GGCA 2Z9DA 3OZUA 6NULA 5TC4A 1NJ8A 1KY5A 2BGUA 2G0NA 4GGPA 1RYEA 2RSLA 2Z0MA 4BFWA 5FI0B 1RLOA 3G8CA 3WMFA 4A03A 1TQ8A 2A94A 3LUJA 3LWDA 1VSVA 4UMFA 3JRNA 3AFGA 2QW8A 5KTPA 5EJ9A 1NZDA 1NF2A 1H1DA 1GQOA 1ORIA 1FS5A 1V48A 1ZNYA 2JBHA 2WFZA 3MUFA 1Q74A 2JGLA 2P7IA 3CPSA 3T61A 3VO1A 4ALIA 4RZHA 3DHYA 2CYCA 5IVIA 4B75A 2XYRA 4RA6A 1ZIXA 2I03A 1FFXA 4Q9LA 2GSDA 4YRTA 4BV2A 3I2KA 3M3HA 3L0CA 4BNDB 5CB4B 2G40A 1IUNA 2O9JA 4Q66C 2A5DA 2ISQA 3M6UA 3B12A 3N70A 4RK7A 4U1RA 3ZW8A 2JA1A 2JKZA 2ZIZA 3WGJA 4RMGA 4DLAA 2QG9A 1SVMA 4ZQEA 1SPBS 2E7ZA 2JLRA 3CH7A 3CNEA 3AUTA 4ZGWA 5IKMA 1BW9A 3I1YA 3WGNA 4I55B 4UE2A 3TZ6A 2VKQA 2HRRA 2E89A 2WI8A 2R6AA 4NBLA 3NATA 4ZQBA 1KKUA 4KNWA 2V1UA 3TOXA 4M0UA 1FQJA 5FBWB 4Z4IA 1OWMA 1P9WA 5FUMA 1UM8A 2OAP1 4QJ3A 1RWKA 5JZVA 2PJRA 1P5ZB 3BIOA 3PXEA 1IL0A 3R4VA 1LBSA 2N46A 4RJIA 1Z7WA 1RT9A 2ZJYA 4EB0A 3E7DA 1RI4A 1J9ZA 3UYLA 4AY3A 4QELA 3SC6A 4M88A 1ZSNA 3HKEB 1SCIA 3OIVA 2C7OA 3ZKWB 1G9XA 4ZRNA 4FB4A 1X1EA 3O9ZA 3HDVA 2H2FA 1RAIA 4PZYA 4C43A 3ZJUA 1SVNA 3BJIC 1BD4A 2Q9CA 3G02A 5I6DA 3BWEA 3RJTA 1DDOA 1X80B 3LXMA 5FWXB 5EIHA 3EGIA 1LUAA 5CW2A 2CGEA 3G9UA 3JVUA 3PDIB 5JNRA 3QE9Y 1LS1A 1OAOA 5JBQA 4AJKA 4BNDA 1T9GS 3JWEA 5DE3A 1T8UA 3HJTA 3DW3X 2BTQA 5IMBA 3RGGA 4AN4A 3AKEA 2CK3A 3LQ4A 2GCOB 3O94A 2IOFA 5H8WA 4YBZA 1KTVA 3PB3A 4Q1FA 5H16A 1BQ4A 1LDEA 3TTWA 1KI8A 4BNHA 3SI7A 4BZZA 2CLCX 2FSIA 3Q9LA 3IEPA 1YE8A 1J25A 4KV9A 1XZGA 1NJ6A 2ZB8A 1QBKC 4R9UC 5ERXA 5L3RA 4UAUA 3TIGA 4YIHA 1WNFA 3LCVB 3ELDA 4I19A 3O7WA 4GL2A 1UC4B 2DJIA 4MINA 5LL6P 5HZGA 1MD9A 2WKRA 2IQIA 4UFNA 2RGWA 1P62B 1OBCA 2CYBA 3RUFA 2QAIA 2IF2A 3WI7A 4R1QA 4MYTA 5DXJA 4Y6PA 4EHIA 2V98A 1GRVA 1F2TA 3K9QO 3UHFA 1GADO 4A0HA 1KO4A 4MQBA 1BDIA 1ICIA 3I83A 2QRHA 3FNEA 4Q4HB 5CPBA 1ZR2A 1V3VA 1OAAA 2WNSA 4BKPA 4YI5A 4ZAZA 5HHTA 4WNCA 1UJBA 4NYJQ 3UJHA 4BVFA 2XWBF 3VZRA 3OZSA 2G4VA 2HBQA 3H8WA 3RVBA 4ZIRB 3UV7A 1N2GA 6CHYA 3MCVA 3G8BA 4BAUA 3QOFA 5BNFA 3T7EA 3HYLA 4YROA 5B1SA 3E3MA 4NE2A 2HU7A 4Q12A 1XQ1A 4B3DA 4I6JA 1W88A 2ODQA 4MPPA 3THOA 4UVEA 2PUBA 2CLKB 4YCDA 1NSYA 4NP6A 5EIAA 3V4VB 3WKCA 2F1JA 2CDNA 3CQ9A 4C0SA 2NN3C 4GQAA 2PRIA 2WDZA 4DNXA 3CWCA 2C29D 2QBYB 1XX6A 2G08A 3KNZA 3M33A 3DWEX 5LLSA 3VR5H 2SECE 5MN5A 3IPXA 1E96A 4RDIA 3G5MA 3V1YA 2RI6A 1HZZA 3KR1A 3I1JA 3QE3A 2MSEB 4HS9A 1Q21A 4L4XA 1YSCA 1M2WA 3TJRA 3KV3O 2Q3CA 3LRTA 1XTZA 3V1MA 2W2OA 3LQ2A 3PEUA 3PFWO 4OLBA 1AS0A 1EAMA 2ZSDA 3IC5A 5J1TB 1ZCJA 3NBYC 2ZAYA 2AXPA 5KNCH 3KKPA 2YNMC 2QLNA 3AI3A 4DMUB 4OJTA 1S4QA 5KOIA 1KOJA 3CGGA 3LE8A 2OCAA 1WX1A 1M1NA 1RBMA 3DXXA 4DILA 2PMKA 9ATCA 2CXRA 3FWNA 3OC6A 4E5UA 1A9PA 4ETMA 5DI3A 3T5AA 4RK1A 4W9NC 1U2DA 1JLLA 2VI5A 3I52A 2AWNA 2QL6A 4O2BA 5KQMA 3K2QA 1Q0ZA 4OQDA 2E55A 2BEJA 3A2LA 1T0PA 5EEHA 1OWNA 1E5LA 1JLHA 4ZT3A 1I80A 4MICA 1F06A 2FN7A 3F98A 1HR0B 4E6EA 5I3CA 1HE5A 5EP3A 3RC1A 1E2NA 1P9RA 3J80A 1QU3A 2QRNA 2BEWB 1MCZA 1M6WA 1XZPA 2Q2QA 3T1HB 2AL7A 2W4MA 1EHCA 2F7SA 1AURA 1G8SA 2G5GX 2WR8A 4RM2A 1Z8HA 3ND9A 4V3CA 3SAJA 1MB2A 1PV1A 3SYNA 4YAUA 1P7CA 3GLIA 2C94A 3OLXA 3ADDA 4J7XA 1N1MA 2WFAA 3QLUA 4FDAA 1Q83A 1GDHA 1OI4A 1L8XA 2G1AA 2GN9A 3LH5A 4TROA 4I36A 4CMJA 1J9EA 2FZEA 2HF9A 2JJ1A 1VLQA 3TVDA 1O8BA 1QVZA 3SJUA 3CKKA 1H66A 4IIGA 1AVTA 4POOA 1GRRA 2HWYA 1MO6A 1OXTA 1KEZA 4BFZA 1Q3HA 1K2VN 3PHLA 1TD1A 2DG2A 3QPUA 4JL6A 4EW3A 2C96A 5FA8A 1CIJA 1U1EA 3LBYA 4LNHA 4PQRA 4RQBA 4RWZA 3VU9B 3OAAD 3P9YA 4IIVA 3TJMA 1KWGA 4ZVPA 4AQYB 1M1NB 1TYCA 4OP2A 3TD9A 2XB8A 4B2IA 2B20A 3LYAA 1X8XA 3V7UA 4MTLA 4FJ1A 4DDKA 3UXMA 3RJMA 3RSFA 2ZI4A 4JUAA 4G5GA 2RD2A 3LI2A 3PDWA 1J1IA 3N39C 4NKRA 4BJ3A 4BGDA 1Y6FA 2IX9A 3AXSA 4BMZA 1K97A 3JQ8B 4M0FA 1KK2A 3JQPA 4NBUA 4RENA 1G41A 5JZOA 4A2PA 4WH0A 5IASA 3PZBA 3OE7D 3CIFA 4H6PA 4I7EA 4RPCA 5AOVA 3AB3A 2VQSA 3N2KB 4L50A 3TW8B 3G0HA 2VP6A 3NU1A 1PYGA 4EI9A 1EE9A 2Z8XA 5HVNA 1AMUA 1N6NA 5C7LO 4QNNA 2V7QD 1S2OA 1J2TA 4V0NA 1IMOA 2QTCA 3ACDA 1B76A 2I0FA 2X3FA 3CF4G 3G13A 3QKUA 5EKDA 5LA6F 1YONA 1QGDA 3ELWA 3R7LA 1KJIA 4M3NA 1ABBA 1Q20A 4BQNA 1X77A 4A10A 2M6RA 4JN6B 3A4IA 1ADBA 3ZY2A 3GBSA 5D7BA 2X1HA 3EQ8A 4UVIA 1ZH2A 5B4TA 2Q9AA 3DAHA 2MSKA 2OO7A 3OZTA 2FZKA 5TJ9A 4YYEA 3DQPA 1W1UA 2QXTA 4PGMA 2ZW9A 5C4GB 2PBLA 3PE6A 4EPTA 4M53A 1XVIA 4IDFA 3D5EA 4C4OA 4FSXA 4R2MA 1BMQA 3VU0A 5KDDA 1JQ5A 1LU9A 3IPYA 2IHZA 2HCRA 2P79A 3KUCA 2UYGA 2EFGA 3O4HA 4RZQA 5EE9A 1UBUS 3AY3A 3W2IA 4BB5A 1EJ6A 3B1YA 5KU7A 1Y9EA 2MCFA 4CLRA 3K53A 4X1OA 1PK8A 4BNIA 2DHQA 4ZOQI 4XPIA 4CM5A 3WLFA 1NGSA 2EL9A 4MZDA 1QGED 2QX4A 1WB6A 4DABA 1Y9DA 2AJDA 2G25A 1E6KA 1BAPA 1PL8A 2Q99A 2IXAA 2EAUA 1OASA 1BE1A 4JVOA 5I9NA 3PGLA 5C32A 1K0FA 1SJ9A 3KVOA 2ZBEA 5KOJB 3KJGA 4EJMA 3MSXA 1I5RA 2NU7B 4Q9IA 2A92A 2DFLA 5DHTA 1QHYA 2TYSB 3DO8A 4CR8A 4YUYA 3VR4A 4J4BA 4UVGA 2Q1YA 1QP7A 1RLJA 2CHFA 3PNYA 4Q3OA 4MQUA 2VP5A 3QX3A 3EPPA 5P8WA 1IZYA 1Y7IA 3C1TA 3P0FA 4QJIA 3KWLA 3OM1A 1MRNA 4FYHA 4M21A 1SC6A 4Z99A 4MYUA 3SBXA 2ZUBA 3QJ5A 3DTVB 4XOUA 2LCFA 4GMXA 3I9KA 2QRUA 4BDSA 4RV9A 1EE1A 3KXPA 3TSOA 3E9CA 1YJ5A 2NZJA 3BWMA 4JOQA 1ZM2A 4ETIA 1IMJA 1EM6A 5A4DA 1L5OA 2CVOA 2G63A 3NAZA 1OYVA 5B3JC 1DEKA 1BHO1 3MGBA 4H7JA 1DUVG 2EL7A 4X3CA 3SK0A 4GXRA 4KVGA 2JI6A 5K51A 2G1PA 1SG6A 1N5LA 4N9QA 5GM1A 3FMPB 2XMCA 5D3ZA 1KZHA 2TMKA 2X22A 3WK8A 2WHRA 4IHJA 4F3RA 2ZYVX 3PFHA 1HFJA 3C6BA 5HJ5A 3QWAA 3TECE 3OCJA 2H54A 3GDOA 1Z6PA 1ZLXA 3INTA 5ITVA 5F3WB 1D2RA 4KMRA 3RQIA 4NG4A 4S24A 4ER7A 4ML3A 3LP5A 4OMFG 2AR9A 2DUNA 1G5TA 3PGVA 2PG3A 1YC2A 2YDYA 3CZ9A 4DANA 1DIBA 1VB5A 2EJBA 3R6DA 4ZP1A 1GARA 5JLAA 1DKUA 2XVZA 3BF7A 4M1YA 1G21E 3DLBA 1F12A 4O59O 3FDFA 2Y93A 1PZGA 1IWBB 1X15A 5DGCA 3GLHE 3WQRA 1NBMA 1WW8A 3KWMA 3R5HA 1SIWA 3MWEA 4O1IA 4CR7A 1RMYA 2ZIEA 5IJZA 2CXUA 4ERNA 3DDWA 4GP9A 1IZ9A 1RWPA 4X44A 1XZFA 1CVRA 1I3LA 4F9EA 5SY6A 1XC7A 4ZVUA 2YMLA 4OATA 4EB8A 4F3CA 2XADA 1E63A 4IGEA 4QQRA 3AOGA 2O3QA 1KI6B 3JARB 3PUKA 3TYXA 1GOTA 1XO1A 2XUAA 1N3IA 1NNUA 3O0TA 3PHGA 4MOWA 3CX4A 3HY6A 4J1NA 2EYUA 1J24A 2HDNB 3BE4A 3L2OB 5DO9A 2C2KA 3TRFA 3SZOA 5BYAA 4KPYA 1U94A 1GT91 3LHSA 1QG2A 4OLJA 4OY3A 1KQGA 4GMHA 4DZRA 2AW3A 3BE6A 2CN1A 1SQ0A 2FPLA 2HCJB 3H0EA 2C2WA 5IBCA 3EC7A 3CLRD 2AOVA 4Y2JA 4TKZA 4W6ZA 5ECYA 5IULC 2W2TA 1N2BA 5EJGA 1QCDA 2K4MA 3ANNA 4PLGA 1IM2A 1BE0A 4NMMA 4QPNA 4OHBA 1OHHA 3UWPA 3ZHZA 2PGNA 1OD6A 5C35A 4M98A 1V7PC 1LBHA 1JVBA 3IPRA 3QPWA 4OMUA 5LA6B 1ZJ4A 4WCFC 1TO6A 4IO0A 4XDGA 1W75A 2HH9A 4CR6A 1FUEA 1TUGA 2Z57A 3WYAA 1U3UA 1NMZA 2GF2A 3PGA1 1X9HA 2WJGA 2BPOA 4N54A 1DXOA 2PIDA 1RXYA 3U7QA 4IIJB 1M76A 2WINI 4YLYA 1QUEA 1UBHS 1AQYA 2ZSFA 2NZVG 5IMSA 1CQWA 2XKBA 1G6KA 2FWNA 3T06B 1ZJ5A 4ZVRA 5KHAA 4LF9B 2P6UA 1TKAA 1USKA 2ZIGA 3MTBA 2AUMA 2FUEA 1UJMA 1WSDA 2CB0A 4BP1A 2ZCJA 1FP1D 3GCZA 2I8LA 2EJVA 4YDSA 6GPBA 2FG7C 3CNBA 1H0KA 2R751 5KTTA 1Q0UA 1ULZA 2XB9A 1B8UA 4PZUA 3GLGE 3V4OA 2JFOA 3IBGA 1G8GA 3QITA 1PRYA 2GLXA 3FX2A 4MS3B 1OLSA 2C9OA 1PEDA 1HUQA 4U7WA 1YS6A 3MJDA 5DOZA 2X0RA 5C7OO 3DFKA 1TW3A 2LR0A 2QTZA 3SQDA 5KO2A 3HSKA 2DRIA 1A96A 2ALJA 3P2OA 4I9FA 4E46A 1N8SA 1VPTA 2CKDA 4OLHA 2XRFA 2JI4A 3KEFA 3GCGA 4Y9UA 4MWDA 2QMUA 5DBOA 3ZWAA 1QG4A 4B0OA 3GLQA 3OESA 5IXYA 1WF6A 3GT0A 1IQ0A 1G16A 3R3XA 3NEJA 1KDVA 1JKJA 3MXTA 5HOEA 2F3SA 2D2IA 1D9ZA 2QUJA 3PKIA 1CR0A 1FJXA 1XSEA 3WGGA 1Z17A 3P0JA 3SN6A 3KAPA 1Y1KE 3E7XA 4YDQA 2R6GA 3VYRB 1L1RA 3H2HA 1P80A 1DDGA 1DKNA 4FFPA 1HLPA 3SC2B 2FW8A 4WTOA 3F6SA 3IUSA 3QG5A 4GMFA 4KVAA 5EJ8A 5HP4A 2WICA 2VHXA 1QPBA 4X1YA 2OHFA 1Q1AA 3O8QB 4JUFA 2ZRQA 4L4RA 1NDUA 5EWMA 4YRNA 4N7RA 4W5OA 1KBOA 1JX6A 5JAHA 2V8OA 3VGPA 3EGDB 3OO1A 1KIMA 1GYRA 1VZ2A 3GROA 4XGIA 3IAS6 5KC8A 2WIJA 3K9GA 1ZK0A 4L78A 4WLUA 1VE6A 2NXEA 3OIFA 3MB8A 4XJXA 4DV0B 1FLVA 2GHIA 1A7UA 1CETA 2DU8A 1N6RA 3GGDA 4JLVA 1FJ2A 1OOEA 5EZYF 2ZSBA 5HWSA 1NRJB 1IB6A 5LQSA 3AOEC 4LBWA 3CMCO 1FTGA 2EFCB 1RHKA 3RUPA 2YMMA 4LC1A 3KOUA 4YR7A 5K8CA 4ZT6A 1WW2A 3DBVO 3OWOA 4GUAA 1TM3E 3NM4A 3K3PA 3K2BA 5D3MB 3V32A 1QVWA 4BVGA 1MXFA 4MUGA 3F5MA 2HTEA 4EWLA 3V1LA 1RI5A 4BKRA 4DMRA 4YGXB 1G20A 1RI2A 4JYAB 3MVEA 3BIWA 1OKKD 4X41A 3ET4A 2RAUA 5T3YA 2ZJ0A 4QFCA 2XYGA 3WY9A 5BSWA 4EKYA 4WXHA 2RGDA 2X58A 2YASA 5DLQC 4JGIA 2V03A 2X5XA 4TYMA 1CQXA 4U9HS 3WXBA 4U2FA 1I6LA 4CKEB 1BEUB 3TMAA 3V8QA 1D5WA 1VKRA 3G8DA 4K9QA 1KH1A 3B6ZA 5AJTA 4ZT4A 4DF3A 4YV1A 4FNMA 5C53B 1G20E 4R9RA 4AG5A 2I2FA 3A6PC 3IB3A 3WKEA 2CUKA 2VBFA 1MC1A 2VUIB 4NXNB 4MA4A 1UC5B 2AXQA 3VAAA 3RHFA 2HT6A 3O8QA 1GPMA 4HKTA 1KH2A 1IE3A 1NVKA 3S81A 2WDPA 3CJRA 4Z3KA 5DSTA 5LQCA 4HAZA 1TTHA 1XYYA 4P33A 3EGDA 3P9ZA 1W4ZA 1WHTA 3ABRB 1F8UA 3HCEA 4C87A 1A9SA 4ZKEA 2EBFX 3LUBA 3BHIA 4PZEA 3C3MA 3K0HA 3ZXSA 4ZXFA 1VXOA 2O1SA 3WRYC 3RNLA 2Z6VA 1FDIA 2FZ4A 1I30A 1XF9A 2J5XA 2JGDB 4JL5A 3E27A 3A10A 1W2WB 2QZPA 3QHAA 1W6RA 3DW1X 5LXTF 3NNDA 5KB3A 1D4OA 3DSRA 3R3HA 1HTWA 2FEKA 2ZAMA 3L5KA 3MUOA 3ROXA 1L7AA 2BF4A 4BASA 4BEVA 5A5DA 3LPCA 4K9RA 1THTA 4MVXA 5GADl 1CR4A 4TV9B 1XJWA 2OL4A 4H1VA 2XNDD 5AK6A 3ZI4A 2CV2A 4IZOA 1QHHA 2P5UA 1WZNA 2VWQA 3IHWA 1PL7A 2JCSA 4KCGA 2CXPA 1V11A 4JZKA 1QP4A 2FGJA 3ONDA 4I4NA 4ZDIA 3KSMA 3H04A 1XZJA 4UM9D 4D8YA 4EFDA 4PGHA 4MQEB 3USCS 2ZK7A 4K05A 1NC1A 3KLPX 1EX6A 4LHEA 4M60A 1TYBE 1UWLA 4B6GA 5JROA 4OBBA 4CTOA 2O54A 3AXTA 1YHZA 3E9YA 4YCAA 4QDJA 4ZVKA 1SKYE 4RD4A 5CDSA 3FHLA 1RWXA 1FFYA 4FYIA 3FNIA 4ERXA 3JW8A 3QHQA 4ARZB 2YRWA 1KQ3A 5F2OA 1Y9AA 3WISA 4MGZR 4WZBB 5A3VA 3O2SB 3A1FA 3G68A 2CVHA 3EEBA 3ICPA 5C5DA 2ZI7A 3LWZA 3N0XA 3UHOA 1OXMA 3FYUA 1ZI6A 4WUTA 4Z1MD 3N07A 4LMRA 5BN4B 1WHTB 1G5HA 1QQ6A 3CH4B 3GPDG 3T3PB 4A26A 1E5XA 3SBDA 4DJFC 4NMHA 2RHBA 1VECA 3JX9A 1HXHA 1BG6A 3OEHD 3HABA 4LRQA 5GQSA 2IIVA 3ZVNA 1C1DB 1E8NA 5IAEA 3OH8A 2V5AA 3MMZA 3WB9A 1X7YB 1QIDA 2FEOA 2ORED 3EZNA 3LWBA 2CHQA 4JVNA 5EQJB 2VG8A 3KEGA 4MV6A 1MORA 1VLHA 1E1RD 1ORHA 1UQRA 3Q7QA 2X4LA 4PS0A 1WMAA 4ZJYA 4X8LA 1GSAA 2P27A 1OTYA 2MR6A 4KZPA 3BD9A 4MV1A 3C8MA 1ISGA 1FXSA 3MN1A 1W34A 3GI1A 3LCJA 4QDTA 2C3UA 4Y2QA 1YZYA 2JZOA 2CJWA 1CQIB 4AJNA 1CRZA 4P93A 3CSUA 4JBIA 3S2GA 6PFKA 5T4BA 2DULA 3OECA 3Q1KA 5C81A 2QROA 1JR3A 3QWFA 3H9UA 4LNUA 1VBKA 4YJDA 5F76A 3C5HA 3V8MA 3LCRA 3FSGD 3KU4A 3T7DA 4QX6A 4DDWA 3E3OA 2WWRA 2JPDA 5IFKA 4EUNA 4MARA 1FFWA 4CLEA 4AO8A 1B42A 1G42A 2XTMA 4NEHB 4CMHA 4D43A 1SUBA 1V9SA 2V7BA 3ZGZA 4W7SA 2G9NA 3H3XA 2ODAA 1MHTA 1SB8A 3KV1A 2VTBB 1IFXA 4B3CA 1OREA 3Q2KA 4R41A 1UUFA 5B2EA 1EDEA 2Y9PB 3WMGA 1RJ9B 5JNTA 1U1CA 2HUNA 4JLWA 3PNLA 3LECA 3JQRA 4KQCA 3FAKA 1KFKB 1JS1X 1SCQA 3DC7A 1T9AA 2YXEA 5F78A 3EDQA 2PNFA 1EFAA 1SVSA 2HDOA 1ZRHA 3IBCA 1MX1A 4LDQA 2R0QC 3PFGA 2IYTA 4DWWA 3HE3A 3LC0A 3VDXA 2H9YA 4YHHB 1UFOA 5DYNA 3U3KA 1DSSG 3AEYA 2G71A 3QTTA 4MJLA 2O8DA 5DT9A 2XBUA 2QE7D 3EVZA 1I2ZA 4PGGA 4E2ZA 5KS2A 1CUDA 5JXHA 5LWQA 1UP6A 4MVJG 3C3CA 1F3LA 1S7CA 3ICCA 4HWRA 2ZJFA 1E9RA 4YALA 1P4SA 5LB4A 2W8BA 2IUFA 1JMKC 1W47A 5E0KB 5FNVB 1KMHB 1RD4A 3OQ1A 1EFRD 1VL5A 2AFIB 3O84A 3W6ZA 2CLSA 2D1YA 2WRZA 4JJZA 4W9RA 3TKAA 4HDNA 5A6SA 5IVPA 5H02A 3A4MA 1TUIA 1WPXA 4L1KA 1OW3B 4A73A 5J4VA 1UM9A 3QOXA 3EPLA 2XQFA 3N3BC 5CVTA 2R66A 1JHZA 4EB6B 2J5BA 3HBLA 3KHUA 1SIBE 3IHKA 2UDPA 4WOKA 4YECA 2M6KA 1Z88A 4ZXPA 2RBGA 5E6UB 2HQBA 3CZAA 2B7CA 5BOSB 3DNMA 2YFQA 5KHOC 4G25A 2ODNA 3T5DA 3QF7A 1KZ4A 3LHDA 2WHXA 4OQLA 5GV7A 5CCDA 3SHTA 3ZE9A 3PRJA 1NVAA 1CB0A 4EBBA 1JEYB 4LY0A 1ESCA 1MPXA 2QP4A 3KL2A 4KSBA 4OQZA 5E7QA 5JSZB 3FNFA 4XQEA 1PJLA 4WN9B 2CMHA 4NONA 3UKJA 4AJPA 4EY5A 1PVOA 1Z4LA 4KYIB 3LU1A 3QJYA 1W4AA 4WOCA 5DLYA 5BWBA 2OCGA 3HMQA 2B1JA 4BNUA 1U81A 1KMNA 2R4TA 4OYYA 3VISA 4LVCA 4TMTA 4B80A 3V7FA 5FX2A 5JDIC 1XHLA 3LGXA 1ZGHA 3Q3IA 3M4ZA 1JNYA 1SXJA 3HB4X 2IU0A 5EHQA 4BFSA 2AQIA 3ML1A 4AY5A 1SC9A 5FULA 2O7QA 3TSWA 1ZU5A 3DHEA 4GBJA 3DEFA 4PNZA 3OIUA 3U7EB 3ZZTA 4YRPA 3WADA 4BE9A 3D0RA 4ARAA 3JD0A 2YINC 1MV5A 5JZMA 1Z2AA 5E8JA 2ZJZA 4IZ6A 4P53A 5IWCA 2BBWA 2O8FA 1O5TA 1UKZA 4BLSA 3C7CB 1VJTA 3BPSA 4YACA 5JC8A 5IVHA 4EG8A 4B76A 1CNFA 4MJXA 1BX3A 2EF0A 1FLDA 1T8SA 1COWA 1KFJB 2LIPA 4OAOA 2IDJA 1EVZA 1CEQA 1LBQA 1D2MA 1CZKA 4IJ6A 3S4YA 2HK6A 2VHZA 1DFGA 4G5OA 1CJBA 1DJQA 4RE5A 2C2XA 1IBCA 1LQTA 1N2CB 3SFZA 3VXKA 3JSXA 3K0FB 1CVLA 2QW1A 2SCUA 1ADCA 3KYBA 4REQA 3WKDA 3DBOB 2BR4A 2IODA 2WAYA 4J75A 4OQPA 3W5IA 2F8TA 1A9OA 2G07A 1AZLA 4TZ6A 1T1IA 3ZX4A 2PKCA 1C14A 2QTAA 3NWBA 3G5UA 1SVOA 4NFHA 3GJ4A 1D6MA 5HE9A 4JLUA 3BCRA 4YRDA 2NTYC 1J0AA 2ZSEA 1T8TA 1SG0A 3GU3A 3WGUA 3TW8A 4ZDWA 3TQQA 5ALIA 5JBNA 1VPWA 4U0KA 1RAFA 4IZHA 5AKLA 1X2BA 2C0QA 3CG0A 1C4WA 3FB1A 2QVYX 2WWWA 4YJ3F 3EIOA 2IUUA 1RTKA 3Q98A 3UBMA 4EITA 3WNVA 4KBGA 1YZUA 1NSFA 5LZ4A 1RPNA 2JFBA 4YRLA 3QNWA 4X91A 4BNMA 4O2AF 2CMGA 1P4HA 121PA 3AF5A 1OVGA 1ZVKA 3DWFA 1B8NA 4FFWA 4XYBA 1DFIA 1K5GA 4BX0A 1EX9A 2CF6A 1ZUHA 1BS1A 2PO5A 4HK4A 4F38A 2YYYA 2GFQA 5AQEA 3ZVLA 2NUAA 4NZOA 4IH4A 4RHFA 4NMWA 4LC9A 4IQ4A 1XV5A 3HEAA 3QFSA 1LF5A 4N5HX 5IYZF 4I2NA 5IX8A 3TI7A 2HLDA 3D8TA 3DT8A 2ODTX 4X95A 3J81k 2ORWA 4M0MA 4O5OA 4N01A 4FGLA 1N2CA 4P08A 4E4YA 5TARA 3GEGA 1CNEA 1PJQA 2GPJA 2XTZA 4H17A 2ORIA 4KIUA 3KYIB 1F2DA 4JEMA 3VOBA 4E3ZA 5AW2A 1F6BA 2FF5A 3TM4A 1SK8A 2QQ0A 2G4CA 4GI5A 3PDHA 2B9VA 4KIWA 1G2OA 4F4HA 1H5QA 1KTIA 1XN1A 1D8AA 3EG9A 2FXVA 4G4IA 3ROKA 5CTJA 3KFVA 2EJCA 2ZYIA 3O3MB 3I37X 4WESA 1MLDA 2GRJA 2XCQA 1YGPA 4M9QA 4MCIA 4WGGA 2LKDA 3KUDA 1UBTS 1AMNA 4AU1A 4H3KB 1L4NA 1PGNA 1CP3A 1ZD1A 1EFKA 2N42A 2WD9A 1HEYA 1LZLA 1U7UA 3X2FA 2GERA 4TUYF 1T6BY 3W77A 2HJ9A 2PKQP 2VDWA 1MIOB 2W2LD 5EA2A 1LDNA 1XXHE 3ZR4B 3EXG2 2VHVA 5AKJA 4E94A 3ER8A 2AVDA 1VRVA 1DRKA 2Y2UA 1C4OA 3ICOA 3P97A 4H60A 3VGJA 4K3UA 4J0JA 4PHCA 1PZHA 2FSFA 2CWWA 2O1WA 3I53A 3NG1A 1DC3A 4Z8XA 4DCPA 5IBPA 3ZDQA 3MHTA 4KGXA 1G64A 3X2EA 3MTGA 2BEVA 4PG5A 1YKGA 4X1IB 2YZKA 2LPMA 4ZO9A 4JC8A 2W43A 3EZXA 2OCPA 2V6MA 4JLNA 2PT6A 3Q1LA 1AX9A 2PL3A 5CHYA 1L7BA 1KNQA 1QAQA 1XTTA 2PS0A 1FTYA 3NBUA 4I4TF 4LCEA 4HLCA 1IJEA 4AJLA 5AW8A 5AVXA 1OX6A 2FFQA 2FLVA 2DPHA 2FWAA 2IPMA 2RONA 2EG5A 2WTAA 3BMCB 2PT5A 5A4KA 2XQGA 3M1IA 4QODA 4DM3A 5BV8A 1C7ZA 3CPEA 5AOBA 3K6SA 3FZYA 2OA0A 1ZH8A 1IXRC 1O6BA 5FBQB 1GG8A 1WMSA 4FNOA 4O2AA 3MRVA 2I1VB 2YQ4A 3HY4A 1KDRA 1LNZA 3KQWA 2Y1OA 3KXDA 1DBVO 1NATA 1O9BA 2J5RA 3PV0A 5FI3A 5FUXA 4EQ6B 1V1MA 3U9SA 1P17A 1SXJC 4UNRA 1W48A 3KALA 4NEGA 1EG2A 4Y67A 3ADKA 4C3OB 1SVKA 1JXAA 4KWEA 1R6TA 1NIPA 3GX1A 4IOMA 1QCZA 2DQZA 1N0IA 4MK4A 3RAJA 4BFYA 1SBNE 2QYHA 2ZJ7A 2CLMB 3U9TA 4AF8A 1TC2A 1HKHA 1VCHA 1EA5A 2Z4SA 1MGPA 4P0PB 5PGMA 2YJ4A 3GNTA 1MUUA 5EWLA 1EWYA 3RIHA 1G2PA 1PX0A 1WV1A 2F9MA 1D0VA 1LLCA 1XRSB 2GZHA 1Z13A 4KDRA 5DHPA 5BSMA 1QPZA 2Q6LA 4WWHA 3AL0C 2P9ZA 3GA5A 1A97A 2FQXA 3NWJA 7MHTA 4DUPA 3T38A 3O3OB 4IMJB 5BQ5A 5ABPA 1JZQA 1YQDA 2I78A 3DAYA 3JRWA 1CJTC 4GVLA 1VMIA 2ATEA 3AF4A 3PIDA 4TKUB 3T3IA 1UBLS 1U5BA 2B6HA 5EHNA 2R1ZA 1RZRD 5ESDA 2OO5C 2IZ7A 3B3QA 4C0KA 5M29A 3BGDA 2B8NA 5T6MA 4YJHA 3VPHA 3NTQA 5IHPA 5FWYA 3QFRA 3ACCA 2PUJA 4HWOA 1PTKA 2MYTA 1F2UB 4RJLA 5I01A 5ILOA 2QUHA 4DR3B 3DZHA 3IQIX 1TIKA 5AJXA 2O57A 2CXXA 4R6XA 3BMQB 3G1TA 4URHA 2IHUA 1N9ZA 1H05A 1ADJA 2HMWA 4F93B 2YDXA 1ZEMA 4UM7A 2GM4A 3DDUA 1TCUA 3HHEA 1RPAA 2QN9A 2FQWA 1QR2A 1DKLA 3EBOA 1UBOS 3AZPA 3FOZA 5LOVF 2ZI3A 5AI6A 4IIJA 5DF1A 2FW9A 3CNHA 1NVDA 5BSGA 1Z16A 1HM5A 4ZVNA 5JCOC 1KMIY 3CKLA 3ETGA 3GNLA 4UHHA 2UV8A 2Q8QA 3LKBA 1XQWA 5TQ0B 5AUPB 1XVTA 1BGVA 3C6QA 1X13A 2VSFA 4BBPA 4MV4A 5DM70 1YIOA 5UKDA 4KAAA 4PO9A 1SD1A 3G6WA 5HKAA 2QWXA 2QN3A 3LC2O 1O08A 3G2PA 1T4CB 1JQ3A 4L0DA 4Y2UA 5K3OA 3NTOA 4RH0A 1ZC3A 4E2FA 3TGWA 5AHRA 4A0FA 1BS9A 3OQBA 5KVVA 4HQ0A 1IHUA 2Y66A 4V3BA 1LRLA 1LJ8A 3LUKA 3WAJA 1N9GA 1ZN9A 2ISSD 4GVPA 3GLFB 2BH2A 4I9UA 3MS4A 2WPDA 1VG9B 3FSRA 4QYWA 1RYYA 4EG4A 1QE5A 2VSQA 4F71A 1UJ6A 3O03A 4EX6A 1VFNA 2Y0PA 3B5EA 2ILVA 3OWXA 3R8FA 1GYPA 4LSMA 1NKTA 5DFAA 5IYZB 1J2YA 1I4LD 2XXAA 2PNJA 4JI8B 2NZWA 4KPUB 4G0WA 2J1LA 2PQ6A 1HFWA 1ZMXA 5LQKA 1E0KA 2JCBA 2YMQA 5JZSA 1HNXB 3VNAA 5BW8A 4AULA 1D6JA 1ORWA 2BI7A 1OYWA 2FETA 2ZJ5A 4ZCLA 1ZH6A 2QTRA 4O4IF 3FIJA 3M6LA 4S3MA 1N25A 1S3GA 3SR4A 3LL7A 5LOVB 3GBVA 5FBHA 1VIVA 1VHQA 3CLSC 1CR6A 3DKRA 4WNYA 1QONA 2DP4E 2WJWA 5JDCA 1YRYE 3QELB 5ENZA 1AQNA 2IS6A 5J2TB 2XVYA 2ZWPA 3VPSA 5CFPA 2IITA 3AUKA 5AI4A 2IHTA 3ZHQA 4AO7A 5BWOA 4QPDA 1T8YA 1SHZA 3UENA 3UJ8A 3NT5A 4EFKA 5K6RA 5FEMA 3ZBQA 5TB5A 4MWOA 2ZVDA 3W1EA 3ZIAA 5ARCA 5TNXA 3HJRA 3VPDA 3HQ4O 1F2VA 1KP9A 3ZEAA 4YMUA 2NYVA 4G0OA 3H5AA 3N58A 1G8YA 4HDAA 4AS3A 4G89A 3GLGB 2EZTA 3RS4A 1RFLA 1Z4MA 2YWDA 5DBFA 4EUSA 3RADC 1THGA 1G4AE 3L1JA 1E1MA 4LMBA 2OY0A 3QUBA 2WY2D 4D44A 1KYZA 2VHCA 3M2TA 3DM5A 5LP6C 4B17A 1QIMA 1T24A 4AIIA 3GFTA 1VGQA 2CKMA 3X2SA 4BEJA 3PCXA 4DLSA 4CT4B 2OV2A 4DJTA 4DQVA 1JKFA 2R11A 2P3QA 3COWA 5IC6A 1YU6A 3IP3A 1BGWA 1ICEA 2NPOA 3OFKA 4Q7QA 4RCVA 1Z4KA 5MN6A 5C8YB 4E15A 2IPNA 4RHUA 2ID9A 4GZ5A 4HN9A 3JD4A 1QE3A 2ZRGA 4PSAA 1NE2A 2PYZA 4PCLA 4RQUA 3O8CA 1DX6A 4UU7A 2O5RA 3WBJA 4HRYA 1DJMA 4XI9A 1GXSB 1LGYA 4MNTA 2FW1A 4LOKA 4L16A 2C8VA 2GF0A 1L5HA 3E23A 2YJ6A 4F72A 1V1JA 2QYSA 1EUDB 1YDFA 2NXCA 3VZSA 1A5ZA 1NIJA 5CVDA 1Q3TA 4EP1A 1P39A 1E7MA 4HC4A 4QQNA 3T5TA 2Z58A 3I30X 2OAGA 3LDUA 3QE4A 2VPWA 4LXTA 4YRRA 5IVDA 5FXMA 1XMOB 2ZIUB 4R7ZA 4HYTA 3WRXA 1F20A 5JDIA 3NBAA 4EELA 4IWXA 4M22A 2BY4A 1TZBA 3GLVA 4QXQA 1RQNA 1TM5E 1IY0A 4K86A 1TU4A 3EWSA 3PNQA 4H6WA 4YP5A 4AZ3A 5ICCA 5CFLA 3L43A 4IDPA 3TZHA 3ZH2A 3EIEA 3AUYA 1Z5WA 4DWOA 5C4MA 5F35A 5FV4A 2GPBA 2DFNA 2CXTA 3PC7A 2IXBA 1LI5A 1Q1ZA 1G9SA 4L57A 5JAQA 3W34A 1QHHB 1X3SA 2O07A 2PIAA 1P91A 2QRKA 3QM1A 1S8AA 5BURA 1W46A 1WULS 2G80A 4X60A 4IKPA 1PT5A 2IZZA 2QN6A 3DZBA 1PJZA 3MIZA 2QSYA 2AD1A 4MW1A 4CZ2A 1Y80A 4X90A 4WFQA 1VLJA 2BGJA 3GUYA 3DLTA 2WYWA 4R1MA 1VIMA 1XTSA 3OUZA 1D5CA 2VUSA 2P65A 2YIVX 3GAFA 3OFVA 1QDEA 2BDUA 1L5HB 1OKKA 1P7VA 2A4MA 2J9YB 3KXKA 3LYHA 4RFSA 2H06A 4AIRA 4YY3B 2REQA 1EP1B 1NFQA 3P2KA 1Y82A 2N0SA 2A30A 2AZ4A 4AN0A 1U3DA 1PYOA 3PDJA 5LFAA 1FYXA 5ALYA 2J6IA 3SSMA 3VSAA 5F12A 1KP3A 2BC9A 1V16B 1WUHS 5GM2A 1CUSA 3D6VA 1NURA 1YVEI 5LP6A 4UAVA 3FF4A 3MCUA 2HJWA 2D74A 3SYLA 1QC5A 3NVMB 2G77B 4G1MB 1U4OA 2GAJA 1CS4C 4G63A 3DZJA 4TGLA 2UZIR 5CNKA 2OGZA 3AVYA 5EJAA 1NF3A 2ZU0C 1X1CA 2CT8A 1PV4A 5LKAA 3R9XB 3C98A 4A8TA 5DNWA 4CMCA 1OFIA 2O5VA 5LJIA 3VHQA 1P4JA 3FPAA 1PP4A 1VBFA 2QRLA 3QX9A 1D6NA 2OV4A 3GELA 1NXQA 2ABWA 2PZGA 1MAVA 1FOEB 3L82B 2O4UX 1XRPA 3EIHA 3MK31 4D46A 3BD7A 1OZHA 1JTEA 4JYCA 4MKFA 4MVYA 2EJWA 1CZRA 5DN9A 2FJUA 1VE7A 4MUKA 5KMGA 3ASZA 1UXKA 3U16A 2W6MA 1SXJE 1VI2A 1JG6A 2QVXX 2R00C 4I5GA 4EUEA 4WADA 1SOAA 1IHDA 3FCOA 4H4CA 3QLJA 3RAFC 3GT4A 4FONA 1HQCA 2ODEA 4U7GA 3LC7O 3IIMA 4LI3X 1QHGA 2O3TA 3NIWA 3QW4B 1DCKA 2OZKA 2CV1A 3EZFA 3R3YA 2XVXA 3FJ1A 3W06A 3V48A 3QYPA 4K7JA 2ZU6A 4IS3A 3WDLA 3FCUB 2A33A 4RVFA 4RESA 2WE7A 2B4AA 1G5FA 1ZM3A 3ADBA 1Y1LA 4GC9A 4V1CA 1GRQA 2J0QA 1DEXA 4EGQA 1RJ9A 5CH3A 3T3GA 4M9UA 1MENA 2A0XA 5DLPA 2YWCA 2DLNA 5ESRA 1XEWY 1PLJA 1RXEA 4W1SA 5JMWA 5KYWB 1FYWA 1UMDB 3L6RA 4JUCA 3A1NA 2ZSHA 3F97A 4E51A 4AXXA 1Q84A 4HYYA 1AK9A 3TMKA 1LNQA 3MCZA 4IAOA 2CSUA 3CBGA 4G65A 1AUPA 3ONFA 1P2VA 4NCXA 1TADA 2XB2A 3CF0A 4TMXA 1N7GA 4MV5A 3KE9A 4N18A 5KI6A 2FFBA 3HVUA 4TTTS 2XIQA 5K1ZA 3KB1A 2X0EA 2D8AA 3DVSX 4YYZA 1T5HX 1R6AA 4S0ZA 3WZMA 2NUBA 3AKZA 1FMCA 3GR6A 3NB0A 5C51B 2AWOA 3Q85A 3ZG6A 1MMFB 5H1YA 4BAZA 1Y4AE 3LHKA 3ENZA 2GASA 2O2GA 1KVQA 2FWBA 1FXWF 1TUBB 2CHEA 2RJNA 3HDTA 3RTGA 2X4GA 4FQ8A 5FNVF 3ZGNA 2FQQA 5IAAA 3W6UA 2I34A 1N5KA 2HDWA 2Z83A 4ODIA 1NQTA 4XD7D 1P1JA 3N87A 4TMZA 5DLEA 3LA6A 1AXEA 3R0QA 3WJAA 1ACLA 4R1SA 4U6NA 4GLFA 3F3MA 4NZPA 4GKVA 4CIYA 1HA3A 2J3QA 3I1FA 1LPOA 1XD2A 1OX4B 2FZVA 3L7NA 2EIXA 3E1SA 2EXXA 3HA7A 2Q5FA 3VPAA 3UGJA 3QFHA 5TRTA 1T2FA 4RKFA 1L5WA 2PGOA 2ZXUA 4LF6B 2PQ2A 1I4DD 1QKKA 3RC3A 3DT6A 4N8EA 1KYXA 1H3EA 2JARA 1ZHOA 4Q3KA 1X8LA 1NMYA 4WCFA 4FHEA 4PO8A 5EE5B 5HDBB 3E4CA 3SCZA 5BT9A 3L7DA 3TQRA 3U4QA 2HWUA 1ZVVA 1B3RA 4PRKA 3WIUA 2P78A 4KX3A 5FTJA 1JDVA 1G60A 3LKZA 2R87A 1PD0A 3S1AA 3ORSA 4U7FA 1TK9A 2RIPA 3C3PA 4IGFA 3UATA 3D1VA 1PGJA 4NAHA 1RIIA 3EF0A 3IA7A 1DMRA 2V6IA 3NNSA 2PMBA 3VHXA 4JMPA 2VT3A 3KVYA 3H2GA 3OMXA 3QE0A 4ZOAA 1L1FA 4E1BA 1R9NA 4S2UA 2UVPB 3SFVA 5EFZA 2VZ9A 2V4MA 2WVAA 3QNMA 3TDMA 1J8YF 2EQ5A 2WF6A 3ILSA 1QOPB 2PKQO 1SU7A 3ZKAA 2GAFA 4L5YA 3RS0A 4PLPA 1JB1A 2BLNA 3L9WA 3W2TA 3SS8A 4KPFC 2WIAA 4D96A 5L4LA 4CBVA 5FJJA 4EO9A 6YASA 2C2HA 2MR5A 2PL1A 1ZP6A 2XYQA 3TQFA 4YAGA 1MJNA 5IG2A 1DADA 1ND6A 1EGQA 3NZEA 5BVHA 4FX2A 1X1DA 3RRXA 4O25A 2YN4A 2W71A 4CT5A 3HMKA 3TMYA 2V65A 4E03A 2DKNA 2HYDA 5KZMB 2RGNC 3CRRA 1ZN7A 4EKEA 5B7PA 2WSSD 3V2GA 3K9BA 4U5XA 2IHVA 2P40A 2G9VA 3MRTA 3CSSA 1T9CA 2R5NA 2SCUB 4GKAA 1IOWA 4N6OA 2B8JA 1V43A 3AI2A 1OFUA 2A4KA 1T5BA 2ZRIA 3M83A 1A72A 1YC5A 3ZWKA 2O8NA 4ZEWA 4YJ3A 4PC7A 1U0FA 1PFWA 4JLSA 1GG2A 4MB0A 4YAIA 3I2IA 2GHRA 4PSVA 5A71A 2Z56A 3LP6A 3IELA 4TTRA 3TLEA 4KFCA 2QI9C 4NFYA 5E6SB 2AR7A 5FYDA 4Q15A 4C2AA 2EX0A 2CDAA 4XE5A 3PEFA 2AK3A 3FYCA 6REQA 1SPXA 1DUIA 1ECLA 4HP8A 3NV9A 4P3PA 2IIBA 2NQTA 2QRQA 4Q1DA 1RQPA 5JANA 2XZOA 4YT5A 1O4VA 1H5UA 3N7TA 1SHLA 3VZDA 3EAGA 2RCYA 1NYRA 3G7SA 3Q72A 1ZITA 2HMAA 2XMGA 3HCOA 4NOJA 4P7FA 3W78A 4XVHA 3LZCA 3N2IA 4OBEA 1A8SA 5J2UB 3AT1A 1H2RS 3BICA 2OCKA 2FUCA 1KZ6A 1LPSA 2Q7XA 2Z1NA 3DEAA 2HA4A 3D1JA 3AKDA 4RV5A 2NUAB 3UH0A 3VOAA 1H1LA 4P22A 1GQRA 3UFXA 4LYEA 5B64A 1OLOA 2AEEA 2XCUA 3DMRA 3KX2A 4ND1A 1DCMA 4ECEA 3FHTA 5ITSA 1DIOB 3L0ZA 4PX9A 4KLAA 4S1NA 2NSJA 3YASA 4XXHA 3DWGA 4S2EA 3EGOA 3ZWVA 4C0JA 3M5PA 3SHOA 1CX9B 1SUSA 3AKYA 3T12A 5E8RA 2BFBA 3GY0A 6ADHA 4HLNA 1H23A 1SC1A 4R7TA 4HV4A 4INAA 3L3BA 3KP1A 1ZVMA 2HSEA 3C5VA 5FTLA 1IPHA 4I4TA 3B52X 4I1IA 1ZUNB 2C98A 2XYHA 1PHPA 4D3ZA 5C1BA 1QRAA 3FOCA 4V03A 5K8LA 1H85A 1WKCA 4ND4A 3TAUA 3IKMB 1SCDA 4IHKA 3BDIA 3DVAB 2F55A 1WLYA 3IIIA 2OD2A 2G5TA 4J1QA 3RFXA 1Z74A 4Y6QA 1H3NA 5E6SA 2NXWA 2B3TA 3OPNA 4ENUA 5C8DA 2Z9BA 3HYCA 1JE0A 1JIIA 1K6XA 2O2XA 1BEZA 5BRAA 4M8LA 3AY7A 3PTZA 2XAUA 4P4LA 1A5SB 3PXUA 1USIA 4FE4A 3UJ3X 3GLFE 5KNDD 1BDHA 1M0WA 1NMXA 2J45A 3EQ7A 4MW0A 2B4TO 4NULA 1Y89A 3A9SA 5CX1B 4I8IA 1GAQA 3SE0A 3C6YA 3V8PA 3W5AA 1ANKA 2GAAA 4OHXA 4LRXA 2V3CC 2WTBA 3P9RA 1U8CB 1NY5A 2C9DA 4HVTA 2ZUSA 4DA7A 3AUXA 4KYUA 2L69A 3F5FA 1ZD2P 2VIIA 3AQIA 4CMIA 1O89A 3EXHC 4MI3A 4J0KA 1PR1A 4CHGA 4D98A 2JFZA 1K7FB 4F6RB 5AK5A 5FRDA 1BE8A 2IOHA 3RUCA 4CM9A 5FEUA 3IEMA 1R27A 3C8ZA 3IODA 4MUYA 2GK7A 2KB0A 1UAAA 3H11A 3PGMA 3ZLJA 2NP7A 1RABA 2PJUA 4L6IA 4LDZA 4EF4A 2WF5A 2VPXA 5GAJA 3Q3CA 3LRXA 3SBOA 3B1ZA 1U3VA 4PPYA 3ZDYB 4LKRA 1U80A 3VKUA 1I0LA 1N1DA 2MU1A 2PUVA 4H15A 5SZKB 3ANXA 3OPYI 2G7ZA 2PRSA 1F5SA 1U7ZA 1U6KA 5B12A 2X41A 4FHGA 5T4HA 2QRZA 1LPMA 1Y3IA 3ZV5A 2C9CA 2ETVA 5LQMA 2OENG 5BYKA 3PHCA 5ENDA 2QP9X 3FHJA 1ZW6A 3MT0A 4LUCA 4Q39A 1W0CA 2JHAA 4U2EA 2WT8A 4EY4A 5LNK6 3UZUA 1CPYA 1P74A 2NG1A 3CZCA 5JRDS 2PGIA 1YZKA 2O19A 2H51A 1ZO8A 3VOTA 2D5AA 1CDOA 1IEVA 4MZXA 2W6QA 4LY9A 1UDAA 2NLOA 3DCIA 4B4VA 4GL4A 2X0IA 1IVSA 5BWLA 1TU0A 2PSDA 2JIZD 5U4QA 4BLUA 2P1RA 1N77A 1ZG3A 3CZMA 2XNJA 5EXDA 5KINB 1IDN1 1CK4A 5HKBA 1BU8A 3TW0A 4D80A 4QRIA 5FI1B 4LJSA 5K0FA 3KSUA 4FZ5A 2PMDA 4TKUA 2PUCA 3E3NA 1YAHA 3FY4A 4D57A 5T8KA 4A5SA 1UBCA 2ZS7A 3NHAA 2OZVA 2IHYA 2YS7A 4GOND 3VNBA 3ZV6A 5AW4A 1EX1A 3EZ7A 2ZRFA 1O57A 5T6BA 4CCAA 2WWXA 3WWCA 3E48A 4WOPA 1V1RA 2HD4A 2O3JA 3E03A 4ZMRA 1T8PA 1URPA 4G6ZA 2Z2JA 3IIKA 4XLTA 1Q1EA 1KE2A 4E13A 4XEHA 3KD3A 4YXWA 3STXA 3TIVA 4CM8B 1OBFO 4JXKA 4M8KA 4A8PA 2Q50A 3S8EA 1DLJA 4B7CA 3S28A 5F3RA 1ZY2A 4GXTA 3T4XA 5CG1A 2ZJBA 3RIMA 3UC9A 3EDRA 2PX4A 1RVDA 3FR8A 3KJQA 4C6SA 3SBEA 3QYFA 5GZ3A 5L3QA 2C9MA 4MW6A 4DDTA 4BMYA 3DE4X 3VR5D 4A92A 1VRCA 3GGOA 2PD4A 2IUSA 2YWHA 3RT9A 4UTVA 1PS9A 4K0RA 2VK8A 2ZRNA 5BR4A 2QPLA 5KYVA 4COKA 1O97D 1H94A 1XZAA 3PT9A 5CP8A 2GYYA 3LSTA 4MUJA 2G9RA 1JDNA 4RE6A 4KC0A 1JAHA 2BV3A 2O0KA 1GCOA 5AJYA 4Y18A 5BSRA 4ZKDA 2FMIA 4CKZA 1P0FA 5LMZA 1XXHB 3CISA 2MMGA 4YJFB 2GNOA 3ED5A 1U04A 1RKQA 4H2DA 1GDTA 4YV0A 1GKYA 1HYGA 4N6NA 5TMPA 1BFKA 1U9ZA 2ZSIA 3GRFA 4L2IA 4RVDA 1H2YA 3TFQA 4Z2AA 2Y71A 4FJ0A 3TRIA 1L7VC 3LY5A 5J2UF 5JCXA 3BORA 1X19A 1ODSA 1K27A 2ZFUA 1W4CA 2AZTA 4R9VA 2QMQA 5AHKA 5CXXA 3EVAA 3NGLA 3SC4A 3T94A 4PRYA 2VHTA 3SIXA 1J7KA 1GGFA 2BAGA 2BGLA 3GRKA 4FX5A 4OBXA 4QLBA 2FN4A 3PNOA 1XMQB 3UWOA 2ZB4A 1M8KA 2VBGA 3A1SA 3G2HA 4MUXA 3KKNA 3OE7A 4FFSA 1W36D 5E9AA 3F7OA 2PUDA 1FP7A 2IHBA 3AI1A 5AR1A 1O96A 1LTKA 1OHHD 2AR0A 3AJAA 3HLTA 3VO9A 2QMYA 3MPOA 4TTPA 2ZTLA 4A1FA 4BOYA 5K7SA 2GXSA 2NO4A 1W30A 3WVNA 2WAXA 3MC1A 3R5SA 4FMBB 5ALDA 1GZ3A 1JBKA 1EXMA 1EU1A 2CW5A 3EF1A 1R6BX 2JAQA 3LLVA 2P35A 4J3FA 4WZZA 3TL2A 1A2QA 1XA0A 2X23A 5JTTA 1UQUA 3IA2A 2C04A 4G1UC 5J2TA 3Q6IA 5DHRA 1POWA 1VA4A 2OCLA 1E1DA 3BULA 3M1YA 4HH4A 2BLLA 4G1CA 4MKIA 5HIMA 1EJBA 4ZAWA 4CL8A 3MJVA 4JLBA 1W25A 4Q1EA 4LF8B 4W5NA 3C15C 3F1KA 3PQ2A 1KEKA 1XXHA 1V3UA 1CNMA 1DG9A 4KAXA 1H2FA 3H2YA 5F21A 3SM9A 5IC4A 4BQEA 4NHOA 1P7YA 3A14A 1G3MA 5HIIA 2FCAA 3LJKA 4HGZA 3BMNB 4L2IB 5E3HA 4YP1A 3QQ5A 4DSAA 3T3DA 3MTJA 2HMSA 4XSVA 2WD7B 2GPTA 3UF0A 4HB4A 2AUTA 3GWZA 2R2GA 4P2GA 1T5LA 2IBMA 1FRQA 4B0PA 4EMSA 1FC0A 3MAGA 5ERYA 3RYCA 2PYIA 4YDHB 2HT1A 1PW7A 4XJSA 5C2JB 3Q2IA 1RRPA 4P4TA 2QAGB 4HPXB 3TKYA 5L7TA 1NG9A 3Q3HA 1PGOA 3HJNA 5H5JA 4FOLA 5G4KA 3N5CA 1JFTA 1XU4A 2NWQA 3WO1A 4ZOEA 3IOMA 3AEQA 3EWAA 1ESMA 4ROTA 4XIFA 4C7BA 3UUFA 1ONOA 3C4VA 4K9OA 2PLRA 4HGNA 7YASA 3O26A 1X87A 3OCVA 4FGSA 2QOEA 1JJVA 3H97A 2Q1TA 2Z4RA 4NH4A 5JEDA 1N2EA 2AV6A 5I5GA 3RAPR 4HJRA 4FB5A 1X1TA 2I2AA 3AHGA 1S5PA 2WIGA 4Y2VA 1N75A 5I48A 1S96A 1FFBA 2POQX 2QJOA 3UMSA 4C14A 3JQAA 2R86A 4WJZA 4KRGA 2HR1A 1JP7A 5BQOA 3WXMA 2WSBA 1MP0A 2ARKA 2Q4BA 1QGUB 3E58A 5EIFA 3RKSA 1GILA 3EIUA 1DBQA 2RI0A 4M7PA 3UMMA 1AKNA 1M8PA 1I1QB 3P94A 1VPLA 4KGZA 4YAJA 2DWPA 2CDRA 1IY8A 2HF7A 1QB7A 2OBXA 4YPVA 3BSYA 3VVBA 4LJRA 5I8ZA 2YRXA 3QVWA 4DMFA 2IBTA 2EYQA 3R0JA 3UK7A 3IDFA 3N0WA 1TCAA 2LCIA 5K01A 1E6WA 3WK4A 2V4ZA 1XVLA 1FVXA 1MA0A 2ADOA 1Z73A 2FPGB 1GUFA 2IT1A 2LD4A 4HDSB 3LT2A 5IM4A 4LMAA 3AUFA 4EYGA 1XNJA 2YNMA 4HQLA 5IVKA 3WJ7A 2VDRB 2NNWB 3G7NA 3OKPA 3DPUA 2BFOA 4CMEA 2CNWD 1KEWA 4DIMA 1PWXA 4RQAA 1S02A 4D4KA 2HNKA 2UZ4A 1L7XA 1YJCA 3ENKA 3FYDA 3N2NA 3NOQA 2R1TA 2DQ4A 2CLIB 2QUKA 3LFHA 4P7JA 4G0ZA 2KHZA 5ES4B 3KVVA 4HZUB 1Z26A 1ZN2A 3FUTA 1XAIA 3BKXA 1Q0PA 1KJZA 3MT9A 4XM2A 1R0YA 2QVBA 1TJ3A 2XNDA 2F9LA 3JV7A 4KXVA 3EBLA 1IQPA 5JS1A 1R10A 3AR6A 1EFPA 3K6JA 3DD5A 3G9QA 3ITEA 3WRYA 3HCRA 3LQQA 4MI1A 2Y1LA 2REQB 1XK6A 4DR2B 3A2MA 3KG2A 1FNBA 1OYOA 1SUPA 2DM6A 2BFAA 2IDKA 4JP2A 1PCXA 4RSHA 5AT1A 5GV8A 1FYDA 1OI3A 3HBNA 1V16A 4P36A 2IPXA 1ZKMA 3ZWWA 3DULA 1RHQA 4RC9A 1RPZA 2IEYA 3ISTA 5HGJA 3LP8A 1D07A 2CWDA 4MEAA 3VNRA 1GG5A 1UBKS 2YHUA 3UKOA 1YFLA 2CZCA 3ZJ5A 1V0JA 4FN4A 1MTOA 5MHTA 4R8KA 3JAKB 3FRHA 3T5GA 1TKCA 3B1VA 3HFRA 4OBWA 5AW1A 2ACEA 2O2CA 5ECDA 3KZXA 2EARA 1QORA 5DNVA 4ZVQA 4OH7A 4EATA 2OCIA 4QG3A 5LQAA 2WKWA 3W2GA 3M82A 4LXYA 4NDNE 2D5BA 3H2KA 1EM8A 1J5XA 3NOVA 1P7PA 2NXNA 1QOZA 4HWGA 1VB3A 2VH1A 3MD9A 1AHIA 2EFEB 3O8NA 1CYEA 3LQYA 1FNDA 2WUFA 1E2KA 1BMDA 1W29A 4B3IA 3CVUA 4ATNA 5AM1A 2PXHA 2Y68A 3OT4A 4G1EB 1KZYC 3FUCA 4K9PA 5KMGB 1DQRA 1PWHA 4LSGA 1P29A 3DOCA 3S1LA 1DC6A 1TCBA 1U0OC 4BVJA 2QPAA 3A2NA 1E1LA 1KVSA 2IOFK 4WNAB 2XMQA 2Q07A 5L3SB 1EZ4A 4PSKA 4IIHA 2ZBUA 4FT4A 1FFXB 1II8B 4UHFA 3T1TA 1Z6GA 2B7LA 2EBUA 2I8AA 3DV2A 4R3NA 4G85A 4WSOA 2M98A 1JEEA 2EC5A 1ODIA 1RRVA 1QM5A 3GJTA 3H9CA 2X6QA 1VBMA 1XCJA 2JVJA 1E3TA 3CV3A 3LK6A 4FGZA 1U7WA 2E0IA 4JYMA 4ZI2A 2OBNA 5HKLA 3WICA 2ET6A 3NC4A 1QWOA 3ANMA 5U1PA 3RIYA 2XI4A 2AMLA 5DT2A 3IS3A 1ZM4A 3FCAA 3IOYA 5LIPA 3KZOA 3VHLB 1J07A 5JZ9A 4UHBA 2OLJA 4QE3A 3S2UA 3CUWA 2WSMA 1EK6A 1GPWB 1Q77A 2IYVA 2NW6A 2YVKA 3TTVA 3RREA 5A3JA 3SJBA 4MDFA 2WVJA 3GAAA 4RF2A 4KSYA 3MJSA