2QTMA

Crystal structure of nicotinate mononucleotide adenylyltransferase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
189
structure length
189
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and X-ray structural evidence for negative cooperativity in substrate binding to nicotinate mononucleotide adenylyltransferase (NMAT) from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
total genus 49
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qtmA00
2QJFA 1JIKA 3FWKA 2YY5A 1CT9A 2NSYA 1PFWA 1PG2A 1NUTA 1JEDA 1WQ3A 3H9BA 2E18A 2QTNA 1U7XA 3NBKA 3CLSC 4ZT6A 2IJGX 4I6GA 1GTRA 1N2IA 1WXEA 1J21A 1N2EA 3A05A 4ND6A 1G8GA 4I6EA 1O96B 3CLUD 3PNYA 4X0EA 4CDNA 1M8KA 3ISJA 5HUJA 3RK0A 2X0KA 3COWA 3LE8A 5KWVA 1GTSA 1N2HA 1QRTA 4L2IB 3N9IA 1LI5A 1VBMA 1MRZA 2HGZA 3MLBA 3H97A 2XRZA 1T6YA 4MQ6A 4MW1A 4JXXA 4MUHA 4ZT5A 5FO1A 2NZ2A 1G59A 3BL5A 4KPUA 2VXOA 3SEQA 1TQ8A 1WJGA 2IP1A 3KT8A 3FOCA 1T6ZA 1Q11A 1KQPA 2I1LA 1JIIA 1U3CA 4NAHA 1A8HA 3NV7A 3ND7A 3OTWA 4ARIA 4J75A 2A1TS 3SDBA 4EG5A 1U0BB 1UFVA 1XNJA 1T6XA 5J5AA 1F7UA 2CYCA 3AG6A 1OWNA 3KFLA 4FZJA 3SZ3A 3VU8A 4QBTA 2X3FA 4QRDA 3IOBA 3N8HA 4XSVA 1EFVA 1VBKA 1ZH6A 5DASA 1M83A 5JBNA 4PBRA 2X1MA 2CT8A 1XNGA 3MXTA 4ZCPA 1EFPB 4MVWA 1BS2A 5AHWA 4MAFA 1GZUA 5FO0A 4UZEA 1KKUA 4EG1A 3RFFA 5DK4A 4MW2A 4XFJA 1N2JA 3ZJVA 3RHSA 3MLAA 4YP5A 5DEOA 3IUEA 4AQ7A 1O6BA 1QJCA 2OV4A 2J07A 2WB2A 3TZEA 1LI7A 4MUKA 3ILVA 1N2BA 2A88A 3L92A 3K32A 1ZUNA 1J1UA 1IVSA 4DLPA 3IVXA 3FG9A 3TNJA 1H3FA 1WZ2A 2J5BA 1O95D 3L93A 3IH5A 3INNA 2RD2A 3I05A 3K9WA 1I6MA 4MW0A 4KR9A 3CVXA 4KR7A 2D5BA 1N2OA 4MVYA 3A4IA 4MWDA 4PY2A 2GKSA 1I6LA 1TYAE 4MUIA 3IOCA 1GLNA 3SEZA 3G6KA 3SYTA 3CVYA 2IELA 4MUEA 2RE8A 5K0TA 4MVXA 1J70A 1NURA 4PBTA 4ZCTA 4U63A 4ZT3A 1N1DA 1G8HA 2PZAA 2Z3VA 3ND5A 2JANA 3JXEA 4BWVA 2PZBA 2D54A 2EL7A 3X1JA 4S1OA 1M8JA 5LLTA 3ZJTA 1P7PA 3Q10A 1ZJWA 4YP6A 2TS1A 2VTBA 4WNYA 1IQ0A 1QRSA 2X1LA 1IHOA 1M8GA 2ZUEA 1MOPA 2CYAA 3D6UA 1K97A 2EJCA 4MW4A 1GN8A 3HMQA 4OJMX 4MWEA 2CV1A 2GOYA 1JZSA 1TYDE 5H7XA 3HFJA 3HGMA 1MB2A 1N78A 2DR2A 1T9GS 1X8XA 1JEEA 3FHJA 3S3TA 1NP7A 3Q12A 3KT0A 4Q93A 4A91A 4MW6A 1IRXA 1F9AA 1TFUA 5TEVA 4KR6A 3AG5A 4U7JA 2YWCA 3ZIUA 4JYZA 3PXUA 4EF6A 1R6UA 4HJXA 1OWLA 1O94C 4K0RA 1GAXA 3IOEA 2A1UA 2BYTA 1TEZA 1MAUA 1WXFA 4G5YA 2J4DA 3COVA 1KR2A 3ZXIA 3QE4A 1K4KA 1N75A 2A7XA 4GU5A 3CR8A 1KP3A 4R2LA 4KKVA 1M1ZA 2J09A 3OP1A 2CSXA 3FETA 3PNVA 1WKBA 1OD6A 4HPWA 4TS1A 4EG7A 1QU2A 1ZH0A 2QUJA 4NAUA 4ARCA 4MWCA 1EE1A 1MC1A 1NUPA 4RUKA 4G5FA 3X1KA 1NUSA 3H99A 4MW9A 4MWBA 4PBSA 3LOQA 3P0JA 2PIDA 2AZXA 1PFVA 2YXNA 1QQTA 2OQ2A 4NZPA 1QNFA 3MMXA 3FIUA 3MUEA 4ZCRA 2CV0A 1JECA 3FDXA 2QUKA 2DPLA 1MJHA 3P0IA 2JAXA 3FI0A 2J08A 1OBHA 4MW5A 3IMGA 1MB9A 2WQ7A 4G6ZA 1QRUA 2BTEA 3DO8A 3PNBA 3QTTA 1Q77A 1D2RA 4Q16A 2PFSA 4DE5A 3FY4A 4MUJA 4ND7A 5LM3A 1WXHA 1ULHA 2H2AA 2V0CA 2AG6A 1PFYA 1JGTA 2H29A 5TEWA 2GM3A 3CLSD 1XNHA 4HJRA 5TS2A 1YI8A 5LFAA 1PG0A 2CFOA 1NSYA 2XRYA 1NYLA 4EG4A 1OBCA 3ZXSA 1QU3A 2A86A 3VGJA 2PG3A 3TS1A 1YUNA 3CLTD 1PFUA 2A1UB 4F4HA 5TGTA 3RJZA 4I6JA 4NX2A 1O96A 1VL2A 1KH1A 3IMEA 2CV2A 3ND6A 3SP1A 3DV2A 2PZ8A 5J59A 3G5AA 4MVCA 1N3LA 2CUZA 1V47A 1RQGA 3CLRD 3ZUGA 3HV0A 2CYBA 2DLCX 1V8FA 3FH0A 3N05A 5KCMA 4ZCQA 2DEUA 4YP7A 4XFDA 1OWPA 1SURA 4EG3A 3CVUA 1EFPA 1F4LA 3IMCA 4AS1A 1O0BA 1Q15A 4JFAA 1IH8A 2A84A 1IQUA 4OUDB 3IDFA 4EG6A 1EXDA 4UZFA 1IFXA 3CLRC 2A4MA 2QUHA 1J1ZA 1O97D 4MUFA 4CDMA 1O97C 1KH3A 3VRHA 1WQ4A 3C8ZA 4EGAA 1I6KA 4DDHA 1EFVB 2E0IA 3GLVA 4GRIA 4JZYA 5K0SA 4MUNA 1J09A 1NI5A 1R6XA 1B6TA 2DXIA 1K4MA 1X6VA 1WXGA 3RK1A 3U1VA 4F3RA 3GUZA 1KAMA 3SZGA 1LW7A 1Q19A 3GMIA 2HZ7A 3CVVA 2AKEA 1EUYA 1M8FA 2JA2A 2ZUFA 4WSOA 1HYBA 2A1TR 3CVWA 3DLAA 3AL0C 3IVGA 2QJOA 1G8FA 3QTBA 4ZT2A 5FNZA 1JIJA 3TQOA 3F3MA 1WOYA 1EUQA 1I2DA 1VLHA 2V0GA 3ELBA 2DETA 1MBZA 1YIAA 1IQRA 3CLTC 1JHDA 3HZRA 1N2GA 3M5WA 5HUHA 1R6TA 1O94D 1WY5A 1YIDA 2O8VA 1T9GR 3H9CA 4J76A 1O95C 4HK4A 5IJXA 4YMIA 5H16A 2O5RA 1O0CA 4ZT4A 1M8PA 1FFYA 1TYCA 2VTBB 1ILEA 4K03A 4E1AA 3IUBA 3UK2A 4OUDA 1OWOA 4P2BA 1COZA 4DNXA 1N77A 1XJQA 1TYBE 4H3SA 3ZGZA 3TQIA 3AKZA 4MW7A 1DNPA 3D6VA 2WSIA 3RBAA 3X1MA 3ZJUA 4NDAA 3AIIA 3KT3A 1H1TA 3CA8A 1KQOA 5F23A 1EJ2A 3UMVA 3Q4GA 1KP2A 1FYDA 1H3NA 4YBRA 3UOWA 1JMVA 1JILA 1K92A 4DDMA 3COZA 2QTMA 1NUQA 2QTRA 2Z08A 1QTQA 2QUIA 1O5TA 1S4MA 3UY4A 4ZT7A 3IODA 1KQNA 1J20A 4MULA 4U8HA 3AFHA 2DUMA 4NATA 3E27A 1YULA 3N2YA 4MLPA 4MUGA 4L2IA 1KH2A 2E21A 1NZJA 3IVCA 1F7VA 4CQNA 3HL4A 4CT0A 3G59A 2QJTA 1KAQA 5HG0A 3TZLA 4EFKA 4RPIA 4KPUB 2E89A 4DJAA 2B7LA 4JXZA 4ZCSA 1KORA 3KT6A 3PRHA 3COYA 3H05A 5KHAA 3UC5A 2HMAA 2YWBA 1WXIA 1U7DA 3NBAA 4QREA 2C5SA 4EG8A 4R0NA 3A2KA 1MAWA 3A04A 3CLUC 1YUMA 4DDKA 2Z09A 1Y42X 1OWMA 2G36A 3P52A 1GPMA 2DERA 5EKDA 3FNRA 3LCJA 1VBNA 3P0HA 1JZQA 1U3DA 2WQ6A 2D13A 2PXHA 5BNZA 5J58A 2R5WA 5IHXA 2ZP1A 1NUUA 1H3EA 3DPIA 5DB4A 4R2MA
chains in the Genus database with same CATH superfamily
1RCFA 3GU3A 3OF2A 3ESXA 1Q7GA 4XQEA 3RVMA 2FF7A 4MPTA 4NYIQ 2MSWA 4BE7B 4F71A 4EGQA 2ZQ5A 3TOSA 2E4VA 4UM7A 1NG9A 1L1QA 1XZKA 3U3XA 3B7WA 1ANKA 1OE0A 2ZUBA 1KZYC 3NBMA 3OEYA 2XD4A 1ZA1A 4NH0A 4URYR 2XDQB 3NBKA 4M88A 3LUJA 2I4OA 4AWBA 2ROQA 3QSYA 1C1HA 4GD3Q 3I9JA 4TYWA 4ZVTA 3BMCB 3ZDZB 1E3DA 2RK4A 2POQX 3ERCA 4JNCA 4CTOA 1YCHA 4M8IA 3T4PA 2Q1SA 5CCXA 4O2LA 5G4LA 2X5NA 5DVZA 4CMIA 3PJFA 4HN9A 4ED9A 2AJCA 1XAHA 3ER9A 3PE4A 3COWA 2HR1A 5HCIA 3AR9A 4QDXA 1Q12A 3EGDA 3W5SA 3BHNA 1JSZA 3N9IA 1Q7CA 1VBMA 2VPYA 3FGOA 2P91A 1QGUB 1L9XA 4MQ6A 3PEVA 5F2EA 5CA0A 2X0DA 1JIUA 3JQCA 4G0MA 2OQVA 4AJ2A 3A27A 3UENA 3QFSA 3BB4A 1FX0B 3DHEA 4D8XA 2C07A 2GZ2A 2VXOA 1E8MA 3RFCA 1R88A 4YCSA 3Q8MA 2I8CA 1JQBA 2WW8A 3FNBA 3LRPA 1UWCA 2IY7A 4TTTS 4DNQA 2I1LA 4O4IB 2AW3A 4F6LA 1XLTC 4WASA 1T36B 3OTOB 3DKVA 1XG5A 3CISA 2ZSDA 3LOPA 3SDBA 4EJSC 1OAOC 1TAGA 2MYTA 3JARB 2B1IA 3CPJB 1I4WA 3T1QA 2VIIA 1Z22A 3N2IA 3PVSA 3WYNA 2HHLA 2GKOA 4BAUA 4P9NA 1GZVA 5C18A 4GMFA 2P3OA 4IFTA 1KKMA 1XGKA 2OCKA 4QQKA 4UU7A 4DQDA 2OP1A 3F3KA 3HDGA 1SUCA 4ZN6A 2V3VA 4TVBA 4XUEA 2BMEA 2X76A 3FDJA 3R5SA 3GG9A 4S1VA 1ABBA 4PZYA 2WM9B 5H02A 2CT8A 4GVXA 1AIPA 2V1UA 3L84A 1F6WA 3OZBA 3DAOA 1ZJJA 1H85A 4N1AA 2AE1A 2C99A 4YJ3B 1WB6A 1SJ9A 2VP3A 4PFQA 5TQ2A 5I4CA 4X63A 2Q5LA 4EG1A 3DW3X 5CNMA 4EL0A 4OI2A 1MF7A 5HMLA 2WF6A 3SLKA 2YXPX 4QQNA 1GFIA 1J8DA 4MW2A 1JQ5A 4XFJA 2QL5A 3NHZA 2OGTA 1RBMA 2OZPA 1N2JA 1ST3A 2W2KA 3MLAA 3EC1A 3K0EA 2FFAA 2HHAA 2C8JA 3RHSA 3PQ3A 1QIGA 2DF8A 2BSAA 3ICCA 3RYCB 3PHIA 1SG9A 2ZBRA 1LDBA 5FJIA 2R6FA 1QIJA 1Q16A 3BJRA 1KSJA 4ITRC 3HPQA 3KKPA 3W9UA 2DKOA 5AP9A 1JKJB 1K88A 1ENPA 4GLFA 2HO5A 3F7TA 5KQGA 3ZDBA 1NLUA 1TD1A 3G8DA 1EUCA 3T34A 3TXYA 1T29A 1CY6A 1WIWA 3KYDA 2X4IA 4PSVA 4UDXX 4Y6LA 4ZEVA 3CW2A 4HZUB 1W85A 4PAOA 1W6RA 1CPYA 4PGFA 1JB1A 3PXXA 5JNSA 1SR8A 4KVGA 1O95D 1IZ7A 2GEJA 2I78A 3Q7RA 5T57A 5AM0A 3R3UA 5AVZA 1SG0A 1F38A 4L4RA 1Y8AA 5EVJA 1G7RA 3WB2A 1N2OA 3IBSA 4ALMA 2M6RA 4BP3A 2SKDA 4AG5A 4KXVA 3OOSA 3OKCA 5LQNA 3BXGA 2DP4E 3MERA 1OHHA 3MUNA 3QHPA 1PR2A 4P4SB 3ECAA 4UBMA 1DXQA 2EZ4A 3F7MA 1U9IC 3P2YA 4PCLA 5HQ3B 1WXXA 2WVGA 4IDBA 4YIHA 5JR3A 3I9KA 2P9GA 3JQFC 4TV9B 5FWXB 4LA4A 5AK5A 1IJKA 2JGFA 1RM5A 3H6GA 5BVGA 1J70A 3H86A 5EVCA 4ZCTA 4CDGA 3E7FA 1LDYA 2Q6KA 2PZAA 2Z3VA 1E9FA 3TMKA 3N7TA 3V46A 1U80A 2QSYA 4ZGWA 2GPBA 1CZUA 3P27A 3ENQA 3R5JA 2OV6A 2QRLA 3ZVLA 1JBEA 1W4ZA 5T67A 4Q4AB 5EZYA 3ASUA 5AR1A 2JFXA 5C5IA 1P7PA 3OA2A 1RQPA 1KI7A 1XTVA 4XW2A 3WTBA 4B7XA 4H7FA 2VTBA 2E4AA 3TTYA 3I3SR 1X74A 2B1QA 3QJGA 3R1IA 4OI4A 2G7MC 3PQFA 4CFYA 1II8A 4GMHA 3WTCA 1FDIA 4DR5B 4R2HA 3OZWA 2C4HA 3F3YA 1O77A 4AY4A 2DUJA 5EMJA 3GEMA 4ENQA 5JZOA 4ZVPA 4OLAA 3TQSA 4ETIA 4A2CA 3G5LA 2QD2A 4KXYA 4GI7A 4N03A 3KYIB 3NOQA 4GG1A 1T0PA 5HWSA 4HQ0A 1U2TA 1XRQA 3IRUA 3DCIA 3KHTA 1ZUHA 1NRJB 1DV1A 2VDOB 1IIBA 4I99A 3FBGA 3AVVA 3DTVA 4GHWA 2QN8A 4R1NA 2WMNB 2JLCA 3VR4D 4BEJA 3OMWA 3L77A 4BU1A 3AG5A 4RZ2A 4WZAE 3JZIA 4GEGA 4EI2A 3Q2KA 2C3PA 3O47A 4UHJA 1X39A 4MSUA 5E6RB 4OX9B 4JASB 5DM1A 3JAWB 5EESA 1NFQA 4LGYA 4N39A 2JIPA 1T3HA 1Y3DE 4Y2JA 5C7IO 3WBJA 2VF5X 1U7OA 1DSSG 1N75A 2A7XA 2QLBA 3IT3A 3QRWA 4QOEA 4XSHA 4MNTA 3WBFA 3K9QO 5KOHB 3LTNC 4N7MA 4I0WB 2VDPB 1MORA 3ELDA 5H83A 1GCOA 2OHOA 4RVCA 3U40A 2WYVA 3WB0A 3DZ8A 5ECDA 4Q01A 4BKOA 2WEKA 1Y3HA 1MC1A 1AE1A 3OCVA 3OUZA 4E09A 5DTQA 1MRSA 5ER6A 4DG8A 3T0IA 1TJYA 2B8TA 1X19A 3NJRA 3FD8A 3NYQA 4XIGS 4EARA 3O1JC 3QX8A 2V8OA 4WESA 3FVWA 5I9MA 2OQ2A 1QB7A 1YB1A 3OX2A 5EIWA 5EXEA 1Q50A 1ZQ9A 5FLYA 4YAEA 2K7FA 2EFEB 3TLKA 4YQFA 3PVZA 1QQ6A 3K6SB 4MEJA 2NUTB 2CXNA 3TSYA 2XMZA 3KKLA 1SCKA 2Z5FA 4H1HA 1MH9A 1CJMA 2AL7A 3C5CA 4KXNA 1OLSB 4TYQA 3BDVA 5IYZF 4IMPA 2ZIVB 3O3NB 5GP1A 3WLOA 4R2IA 1K86A 4EKGA 4M8SA 1Y1LA 2F9FA 4PRLA 1IL0A 4Q1BA 2HCRA 2WU3A 4JYPA 3D6NB 4B3CA 4EA7A 4EGSA 1YC5A 4Q16A 5JNWA 1OZ0A 4U2FA 1TJNA 1FXWA 3BVPA 1G2OA 1MXHA 2H2AA 1AS2A 3GDFA 2NU7A 3R7WB 4LHZA 3M1IA 1JGTA 3FKSA 2O2XA 5B3JA 1MPXA 1T1EA 2IEAA 2YASA 4FFPA 1VG0B 1D1SA 3ZV3A 2C2OA 5LFAA 5IFKA 3CTMA 1UBNA 1CUVA 2BUCA 1HT1E 1LNSA 2PRJA 3AP1A 3O4HA 4R8SA 3VR5D 1I1NA 1Z0FA 4BMZA 1JYFA 1R0KA 3P0FA 2D5IA 2ISQA 3A6JA 4G5XA 1PI3A 4O2RA 2XCUA 5F9MA 4B43A 2CXUA 1YMVA 2Y0PA 5BMVA 1MEOA 3L4SO 1U0HC 4F4JA 2HNKA 3B9PA 3AQ4A 1L5MA 3ZTWA 3OQMA 2VHEA 3RSHA 4CDRA 4XI9A 4NX2A 2PLFA 4ZTUB 4MUAA 5A3SA 3I9FA 4LY6A 2GM9A 3ZWVA 4TQGA 4WNAA 2TECE 4KREA 1EFKA 3SP1A 1UMBA 3EQZA 3C7AA 2ZSFA 4OQDA 5DK6A 4LMBA 4AJEA 3AWDA 3TW8B 5UKDA 4Q3BA 2EFGA 1HV8A 1B16A 3G8BA 2IOFK 2VBIA 2A14A 4I4LA 5KAMA 3VZDA 3QVOA 2OGZA 3FH0A 1UWVA 3AL2A 5F35A 4M1MA 4BNZA 4ID9A 1OWPA 3F4KA 1Q6YA 1MJ5A 3ZV5A 4UD2A 3ADKA 5CX4A 2F67A 1O0BA 2AI1A 1PJLA 5B1YA 1TNDA 1WXDA 5HJ2A 3O74A 1ZJZA 2GFQA 4UM9B 4JI4B 1CUSA 1JG7A 1KMQA 1KQ3A 1Q95A 5F3DA 2AQIA 3SIXA 1MAHA 3A0RB 3RSSA 2DFPA 3UKJA 4C2TA 2C5GA 3QOFA 2LUOA 1TCAA 2G5TA 5DYGA 3VPFA 4PYLA 3QJYA 4UFPA 5KOJB 3W5HA 1RI5A 3OM9A 1T26A 221PA 2H1FA 2HLDD 4K6KA 3OT5A 1BCSB 5DZSA 3O2QB 1ZUNB 3H9GA 1QE3A 1B6TA 1Q20A 4LHVA 4NK4A 2BONA 2J3IA 3LZCA 4QDZA 4XB2A 4YMHA 2WD7B 1R4MA 3ZWCA 4F3RA 4CLOA 1P4GA 2B20A 3GJ7A 2OZVA 5BXQC 1C4XA 7GPBA 4O5OA 2WHYA 2LRHA 3GMIA 2OB2A 3VUEA 4DT1B 3LC7O 4Y2PA 4Y7CA 5ESDA 2RAFA 5DHFA 2O59A 2O8BB 2QX6A 3ZE0B 2L2QA 4BKUA 2GK7A 3IJPA 4YUYA 3B6KA 2WYUA 4CMBA 4HRXA 1SRRA 2VJCA 3K8OE 3B1ZA 1JNXX 3TRJA 4Y9SA 2J9FB 2G5GX 1IIRA 4M9XA 4Y98A 4AZTA 1JHXA 4OFWA 1CBUA 1HFEL 3TR0A 3HFSA 4OLJA 2JI6A 3HLKA 4H0NA 4X64B 3LZ6A 1IEQA 1BHQ1 1R0LA 3E5NA 4F8YA 3TFQA 1QBGA 1IN8A 4Q12A 5FULA 1ADYA 2ZDHA 4BLRA 2MU1A 4PIPA 3EBPA 4E6PA 4QFMA 2JLVA 3OEHA 3PA8A 3WX0A 1GAEO 1YH3A 4A23A 1GLGA 3O0DA 3ZLJA 3L43A 4PINA 2ID9A 1JPNA 5C8ZA 4RXTA 2Z2KA 4L7QA 4XX0A 1K75A 2JH8A 4OM8A 5GONF 5IK2A 2AA3A 1LVHA 4LEIA 3UAXA 1KK3A 2PSDA 1F2TB 1YU6A 1XSEA 1WMBA 1ZC4A 1D2HA 1U3UA 3A9TA 3E61A 1N1EA 2ID8A 1K7EB 2N47A 4V3CA 4WGGA 3QUTA 1JA9A 5C3UA 3IDQA 1E4EA 2EBWA 1SCAA 4K05A 3WZMA 2NO6A 3EFBA 4XQ9A 1HK7A 1OX6A 1YZFA 2B30A 3ORRA 1XBTA 2ZE8A 3W3ZB 1HNNA 1N92A 3G2OA 2FLVA 1MW8X 1ZU4A 3KEMA 1YDWA 3ECCA 3ZVKA 1CV2A 4X6XA 3X1MA 3GJYA 4IUDS 4HVCA 4V1CB 3M6XA 3L7IA 4DPKA 1SBCA 3CA8A 3D6FA 3BDIA 3NWPA 3UMVA 1YKGA 3O8RA 1A9TA 2F48A 2IUSA 1XU9A 1UBFA 3ZOZA 2XMDA 4P0PB 1KMNA 3DLHA 3Q9LA 2KE5A 4UDYX 1SCQA 5FBQB 3RVBA 4D02A 4BP1A 4GZLA 2WICA 2Y4OA 3K92A 5EIOA 4B3DA 5JXGA 5HIKA 4UNIA 2CXQA 4GXRA 2W37A 2AOXA 1LPAB 1YDMA 1ZGHA 2VATA 2D5CA 5DOZA 3S5JA 3GLRA 4FKZA 1KQNA 4UD6A 3GOHA 4ANFA 2OL4A 2ZIWB 5IUKC 3G7SA 3LNTA 1U1DA 4HYEA 3OT1A 5FUBA 1Q3HA 1E92A 2Z2YA 3PHBE 2PZEA 4GUAA 4LYJA 1KYXA 2FAXA 4MVJA 1T9KA 4YIKA 1RZVA 2QJTA 3U13A 1WO8A 1C1XB 2EIHA 4L9SA 4K26A 1OFHA 4PQEA 3TVDA 1T91A 3K2EA 2PT7A 4I50B 2GTPA 3AKEA 1QHSA 1VOTA 3A3OA 3QPAA 3ZDYB 1WTCA 1DC7A 4E2YA 1LBQA 3GV0A 4GYWA 4HQOA 3KLPX 1YVDA 2HMAA 4B6PA 4BPRA 5CK4A 3AY6A 5IBCA 3SSOA 3NBAA 2WIGA 3F73A 5F33A 5TT0A 3LA8A 5CR9A 2B4KA 2GXUA 4M0UA 4CNQA 2Y1XA 1W30A 4JCCA 1EP9A 3RTDA 1N2CB 3DFIA 3LKBA 3T99A 3UUFA 4DFDA 3DMNA 1EK2A 2H4WA 2ZS7A 3ST7A 1IY8A 1Z5NA 3FMFA 4N0EA 4FT2A 4S2EA 3A9CA 4URHA 3ZEIA 1FBNA 3H7IA 4AG6A 1VP9A 4DEYA 2H4YA 1NUUA 1YA4A 3IUNA 1WABA 1XQVA 1WUYA 2AG5A 4CF6A 1I3KA 4ENUA 3DL4A 3F97A 3KPWA 1RJDA 2QVBA 1W35A 1PR0A 4FE7A 5IAJA 2GXSA 3FWKA 1YACA 2PZGA 5BT8A 2UYGA 4R54A 3HN7A 4NABA 1P7VA 1MVNA 1NUHA 1XZBA 3GEDA 1Q1NA 4RO0A 5EFOA 5I9BA 5EWMB 4IKOA 4OSEA 1I6WA 1ODJA 2ZEJA 5EZ5A 3L8MA 4YV1A 5KDOA 1ZWKA 4UOEA 5GJBA 2ZRJA 1V41E 3T06B 3AZOA 2VNJA 4JNKA 2C5FA 2ZE7A 1UKEA 3B8HA 1HQYE 3CPEA 3WRYC 4OL0A 1NLZA 1J56A 1TKBA 1J21A 1RRGA 2ZUCA 4UHFA 2ZJ4A 3L9XA 3ZE8A 1ZI6A 3DUWA 4MRMA 2JHPA 1QORA 1CRWG 4B79A 5KQLA 3KK0A 4AS3A 1ZK1A 2Z8YA 2CEKA 3OQPA 3WK9A 4CL3A 2ODNA 2WJWA 3GIWA 4HGZA 4LG1A 3E6AA 1CR4A 5CD9A 4DADA 5JHHB 5LQAA 4HG2A 3SF8A 3GJ3A 4CM8A 4GL4A 1GO2A 3T1TA 5FV4A 3ROKA 1MRZA 2VP5A 1V45E 3IRVA 2ECKA 1NONA 1DO2A 2XRFA 1RABA 4WFIA 3LRXA 3K35A 1NMEA 4Z1OA 2FRVA 2VYNA 4LJ6A 3KD3A 1J8QA 3NT5A 4HX5A 3AY3A 4HB3A 3ZV6A 5LSAA 3FOWA 4N5HX 5CFZA 1ZJ6A 4JKOA 1T6ZA 2ETXA 2C98A 4JMLA 4MX8A 1NW6A 4QPJC 4PR3A 4UAUA 4AZ3A 1A8HA 2G9ZA 3IKLA 3OTWA 4FOLA 1R8QA 4U0KA 3VAAA 3PGJA 1C9JA 2ZBDA 4QOGA 1C3OB 3PCTA 4V0LA 4V3BA 4JSRA 1NYQA 2G67A 3OF5A 4DQVA 2Q2VA 2APJA 2AX3A 4LTDA 1DB3A 4L8FA 1QIEA 3MJEA 5BSVA 3IIJA 3MBOA 3EJWA 4N8SA 4NU8X 2CNOA 4R8KA 3PCXA 2JIQA 5FPHA 3RRXA 4L76A 2R4TA 3BD6A 2NWQA 4PC6A 3THRA 4MR7B 4MHTA 4L9AA 1PV2A 4MV1A 5KOIA 4RABA 1Z0DA 3V1MA 1BEUB 1E8DA 2LPMA 2Q3BA 1ITZA 3K0FB 3Q40A 2HWKA 4GECA 3MWFA 2QN2A 2QK4A 5HXAA 2HWWA 2WWGA 2IS2A 3ESRA 3LDAA 3ZK8A 2G1KA 2N1BA 4E2FA 1O6FA 2WM8A 4YMWA 1Q0ZA 2PTHA 3C7CB 1XK7A 1UAGA 3B2QA 3NONA 1NG1A 2O3UA 3ESQA 2WQZA 5CU7A 5DEOA 3T1OA 1E66A 2JF0A 4BIMA 5J4HA 3ZI0A 2P62A 1Z7BA 2B6HA 4BLUA 3HB1A 3UWMA 1FPQA 1JNYA 3EEBA 2NU9B 4DC1A 1ZSNA 2MSLA 3R6DA 2WIAA 3VNBA 3WMWA 3JSAA 3L82B 4ZQEA 3JQ9A 4F7WA 2O06A 2J5BA 3CMMA 1T9HA 3GA5A 3G2JA 4O8ZA 4LKRA 4PNPA 2A67A 2EKDA 5HFNA 2ZYHA 4HDMA 2C2KA 4P84A 4BNWA 1RQLA 2RD2A 5EJMA 1TCCA 2PWZA 5CH3A 2OXTA 2CXOA 2VK1A 3U0BA 5JISA 3QELB 4D9MA 4PGAA 1VHWA 1QOZA 4W5QA 5KJEA 4UVEA 1E7YA 1R6DA 4PY2A 2NZYA 1RWPA 3PGA1 2H63A 2ZJ2A 3MWEB 1NPDA 2V8BA 3R7NA 1I13A 2ZZNA 1I01A 2DUNA 2Y27A 3W8RA 1R0SA 3SYTA 3TQHA 1SBZA 1ODCA 2IELA 1PX2A 5K8LA 2A5JA 3DGEC 3PEUA 3RRBA 1OXUA 2GCIA 2FEOA 2MWMA 3N5KA 1E7SA 4RSRA 3T94A 5K0EA 2FUEA 1GVNB 2H65A 1XD8A 4YS6A 3EX7C 3GARA 5KYXA 4P38A 3W34A 3PEWA 4QDUA 4R51A 1GGFA 2BFFA 2L42A 2PZBA 1SK8A 1XQXA 3DEFA 3C3XA 3STVA 3RWOA 5B12A 2ZBPA 3RR2A 3KHSA 4TWBA 5FUXA 2WABA 1IQ0A 4F93B 2BHLA 4H7JA 1T6BY 1YK1A 1O5OA 3HJHA 1IN6A 1SKAA 1U99A 1Z29A 4ETWA 3EZ2A 3ZY3A 1R00A 2G9QA 3L0YA 3H3JA 4LC9A 4A0RA 4H6PA 2R00A 3T5AA 3ZNPA 4K7JA 4MW4A 2O2JA 3EVCA 3NIGB 1ZG3A 1YVEI 3EGVA 3HMQA 1AHNA 4OJMX 1C30B 3SN6A 3EG9A 3TQFA 1S3GA 1XRRA 4DRZA 2VL7A 2A35A 2ZWMA 3FRIA 1I51A 3CCCA 3ESZA 1WD7A 2FG7C 2Y2UA 4FDVA 2P3LA 2Y1DA 1LSSA 3A25A 3QPCA 4Y9TA 4Q7MB 2B78A 2HWXA 3WV5A 1UBTS 4YCBA 3WFZA 2ZM5A 3DBRA 4YJ2A 4TLEA 2GXAA 1F9AA 1FMJA 2AFHA 3EGEA 2EZ8A 3FE2A 3G2QA 1G19A 5DE3A 3FCXA 4RZHA 3RBXA 4XGQA 3TR5A 1GILA 4IZIA 5DTJA 4OQXA 1E6WA 4MRAA 1L4KA 3UJDA 2DZDA 4HEA1 4E1BA 4E32A 1XD2A 3TUZC 1OWLA 3W79A 2A1IA 1WF3A 2YV5A 4FGUA 3T52A 2XUHA 1GAXA 4J2TA 1XTRA 4UUQA 1G4UR 5C8YA 2D2XA 3C4QA 2E85A 1ABEA 3QE4A 2VZLA 1M2VA 3T3OA 5BWOA 5KTRA 1Y8QA 2HU5A 4XX1A 1FLDA 3U7EB 2B7CA 5BN4B 1YONA 2Q46A 1M1ZA 2ZGVA 3DG9A 4WK6A 5DGIA 1VPWA 5ARBA 3DEJA 3EUFA 3ZWKA 1PZEA 3H2ZA 2FWAA 3LY7A 3INRA 3OESA 4TSRA 1DWOA 3DUFA 5T4FA 4EAQA 1H2BA 4DSOA 1SUEA 4TWZA 5AJXA 4ZRDA 4BO9A 3QVKA 2DGDA 2FWRA 4AWAA 5MN5A 1XE3A 3IO3A 4MW9A 3D4BA 2PIDA 3ENWA 1NVXQ 2V7QA 2AV6A 1KZ6A 2OG2A 4WCDA 3H1FA 3V1KA 4UNQA 2GEKA 3O8NA 2GVZC 4F4IA 3F9IA 3N0TA 5CXUA 2SNIE 5DX0A 4JQOA 4KC0A 3ZQ6A 2ZR8A 4G56A 1L2TA 4I1IA 3RTEA 3C1AA 2CJYA 1O1YA 3AZQA 4BVHA 2FP3A 3TGLA 1TMYA 4AKEA 1A7AA 3FHCB 1L7AA 4ND5A 1XXHE 1P80A 3KUKA 3O8QB 4CKCA 2R7KA 5GQSA 2ORYA 1KDPA 1Y98A 1H1LA 3IE0A 4HGQA 4X71A 5CB8A 2MR6A 3TTXA 3OCCA 4MUXA 2V98A 3IMGA 1U2EA 2B99A 4G6ZA 4BLOA 1CDOA 2F8SA 3FW1A 4K1XA 4MS4A 3QTTA 4WZ6A 1T5BA 4AFNA 5JATA 4I7EA 3HYLA 2GBLC 4KX3A 3RIXA 3RYHA 5KOJA 1PWHA 4LYAA 1YL7A 3PKIA 2JCVA 3MJCA 5BUSA 1P5ZB 1Z7WA 1IEWA 4RY2A 4KO8A 3DBOB 4N5NA 3S6JA 3S29A 4CEHA 3UK7A 1N4DA 3AF0A 1V8OA 3OOJA 1T2EA 2WHQA 3LIIA 5IX8A 3FSEA 4C0XA 2P2NA 1UMCA 2RGEA 1XNHA 2Y77A 3D3WA 5D8DA 4BWYA 5TS2A 3JALA 1Z74A 2AVDA 5H82A 4D4HA 3WGVA 1QK3A 2VQEB 1PJ3A 3AJ9A 1NYLA 2FNAA 2A5LA 3SE7A 4EJ2A 3Q41A 4XZ3A 1T4GA 1NXXA 1W5FA 3I6YA 3H5TA 3ZD9A 5CB0A 5LD2B 4M86A 1G6Q1 1QPGA 2X13A 4YT4A 1J22A 3ND8A 5G3YA 4H6VA 4MIOA 2XAUA 5CG1A 3UFXA 1GT6A 1PNVA 3G9XA 1L1EA 2UZ1A 2Q3CA 3HQ4O 4LQLA 4IIXA 3U4CA 4AYXA 1GUYA 3CRW1 2ENUA 5BYAA 2AH5A 3P2OA 4JGBA 5ALZA 1G0NA 4E5NA 5ADUS 4GMDA 3EARA 1PBNA 3USZA 2ZI6A 2QYOA 5KEIA 4P7GA 1NVKA 1FS6A 1T8RA 2GRUA 1YQ9A 1KI3A 5FA5A 3IESA 4AICA 5AT1A 5ALVA 2GCOB 2I2WA 1L5FA 1H22A 3K70B 4DXAA 1WB9A 1U8TA 4TT3D 3WSWA 1DAGA 4KBFA 2X5KO 4IIFA 4A6EA 3A1WA 1LLQA 5C1PA 4OBBA 4IUCS 2IU6A 2IBTA 1EFPA 1VIDA 4JI0B 1R0WA 2C29D 4MKIA 1U8UA 1ZPDA 4DBLE 2PSFA 4NU6A 4P6VF 1F48A 1P5HA 3NC1C 3VU9A 2ZITA 3AR2A 4LZJA 3WJ2A 4Q1VA 4HI0E 3EXIA 3CMCO 4JB2A 4B74A 1YI1A 5L3RA 3F90A 1J1ZA 3QVLA 4YAGA 2QMZA 3ABZA 2R6AA 2ZT6A 3B3GA 2Z8YM 3QWBA 4KKXB 4RKQA 1U65A 1K27A 1YBFA 1T4BA 1Y9JA 3N2ZB 2N42A 5AVSA 3E22A 3SDZA 4RD2A 1Q0SA 5LLDA 1MOZA 3W4IA 4S2UA 1E60A 3LHFA 5AVTA 4MUNA 2PZFA 2VAPA 1BMTA 4OOEA 3RU7A 3S8YA 4CKBA 4F2HA 1R6XA 3AEYA 3W9SA 2C97A 2IXGA 1EWVA 1NBEA 3DNPA 2VSQA 3V8EA 3W9BA 5CB4F 2J48A 4Q4JB 2Y0BA 1F0YA 4IJ6A 2PFKA 1B23P 4FPXA 4Q6WA 2JGNA 2ORVA 4DV0B 2RK3A 3C6KA 3NVDA 5DXFA 1WW3A 3KSDO 3K3PA 1X14A 3IR5A 3TE7A 1SD1A 1JHYA 5J3JA 1LU9A 4PO8A 4F9EA 5IAOA 1BX3A 3HY3A 2IH2A 4ZT2A 1KAEA 3RYCA 3H2SA 1T1GA 1G3RA 2VF4X 5JECA 1EGQA 4EITA 5L7WA 1E9CA 1ECLA 3Q88A 5LP1A 4B3MB 3KJEA 1S9HA 1YIAA 1UBCA 5H8WA 3LT5A 1SN7A 5ENDA 1Y7LA 2VT2A 1VIVA 4G23A 4QWWA 3KAKA 2H4HA 1O94D 4UU0A 3A1SA 2OC9A 3SR3A 3FVRA 4D3ZA 3DYBA 4J03A 4ZALA 2XBMA 1RKBA 3PFHA 4LISA 1O95C 3DE2X 2J0UA 3U7FB 2PKQO 4GBMA 1NJ6A 4J0IA 3MMPA 1PS9A 1O0CA 3R0QA 1EX7A 3OUUA 4PG4A 4B0OA 5EE1A 3ROTA 2OV1A 4XD7D 2RHRA 4BHTA 1W75A 4E1AA 1ZOLA 4MQ5A 1OWOA 1LPBB 1SOWA 2R5FA 1CY8A 3LLSA 2E4ZA 1WZCA 2Q6VA 2YMQA 4PLCA 4Y30A 4I5EA 4AO7A 4Y6GB 4XPIB 1JG4A 1GV1A 2W6PA 3HKEB 5CBPA 4AJOA 4B4DA 5T3UA 4ZJZA 2VHCA 3HL0A 2YV3A 3CNLA 2O19A 2QD1A 2VQ6A 4WVFA 5AM5A 4OG2A 2PXCA 4F6CA 1W0KD 1FRNA 3W5BA 3C1TA 1CY2A 3CEJA 2VF7A 2O4CA 2ZTMA 1F6DA 1U0SY 1HT2E 2C0QA 2GEFA 2Q3EA 3LHKA 3CNEA 3PNSA 4RLFA 5D5QA 3SLGA 4EWLA 4Q4AA 2VK8A 1Y80A 2B69A 4YECA 4PYMA 5HJEA 1H3NA 4K6MA 2NPIA 3VJKA 3CF4A 3DZJA 1GV0A 4F6RA 4YAWA 4U39A 2E4YA 3HY4A 3HKBB 4H60A 1VM6A 2QTMA 4MJXA 1N2XA 1BWPA 3AOEA 3RD5A 1A5TA 2ADFA 2NVUA 5FPSA 1IB6A 1SVSA 3QHAA 2X7HA 5ALKA 2VSNA 1VI6A 2AN9A 3SQNA 1NBMD 5BO5A 2VH1A 4Q9DA 2JGRA 4Q9LA 5L45A 2ZE5A 2WKQA 3DWFA 1VLZA 3EGIA 4HSEA 2GAIA 5CNKA 3AH8A 3E27A 4ABYA 4KOEC 4EFNA 2AC7A 3PNPA 2X8BA 4RWZA 3GOQA 4E08A 5LA6A 3EOZA 1WM1A 2W8ZA 4IRXA 5TS3A 3TSAA 1EFRA 2GSWA 2I6UA 5FNVB 4BMDA 4TROA 1L3BA 1E18A 2DLNA 2OFPA 3MMNA 2C4WA 2V5UA 1HETA 4QC2A 1E7QA 2PH1A 1L5NA 1KU6A 3VSCA 5C5DA 3LUKA 3JAMA 3DL2A 2HSDA 5M3BA 1IWBB 1ONNA 1PCXA 3GMTA 4OU4A 1ESEA 3QU7A 2WYOA 4MOWA 3PDIB 1L4BA 2I2AA 4D2IA 5ITZB 1KDVA 1AV6A 5FV7A 3VDQA 5KQRA 3THOA 3SOPA 2O1XA 5JFOA 5JI3E 1U7DA 3LNCA 2GZMA 1U3TA 2IYEA 3SJZA 2NSHA 5F7JA 2RIRA 3MZ0A 4MS3B 1YR2A 3ZKWB 5J2UF 3NRJA 4R0NA 4Y67A 3RRFA 4EB0A 4Z3OA 2OBMA 4CIDA 4UEWA 1JIXA 1OY1A 3WE7A 3BORA 4Q3LA 1NNSA 1DAMA 1UBGA 1Y7IA 2C2GA 2G36A 2GN1A 2WWIA 5B53A 1Q1BA 2NO1A 3AUXA 2CXSA 3QMWA 4FFOA 4HOYA 1YJCA 2C2MA 2VDWB 4K46A 5AK0A 2EBFX 1FU4A 2D1SA 5P8WA 1N32B 4YASA 3JYNA 1K0FA 4FUQA 3TD2A 2Q2OA 3ZCTA 4F46A 1CUEA 2SCUB 2PGJA 5CDTA 3MINA 3O1HB 3LLUA 4K0KB 1YZUA 2P3SA 3JWPA 2H7YA 3HGTA 5FUVA 5BQOA 1FDWA 1BDBA 3OAAD 3WMGA 3R6WA 4RCZA 3F8WA 4HWSA 1PG2A 4OJNA 2F3QA 3IV7A 1KI1A 4R1TA 4Z0NA 4XM2A 4LHSA 4E11A 2X22A 3W2HA 4QUJA 5E6UA 3GT4A 3DVSX 3EXG1 4PEVA 4N9WA 3DKKA 2JB9A 5JH7F 1ZVQA 2QTNA 4U7HA 4RVNA 2GZ1A 3HVHA 3TAXA 2XMBA 2JEYA 5DKFA 3MJFA 3DDUA 4JITA 1JL3A 3A05A 3HZZA 4CHGA 2M32A 1WHSB 2PX5A 4D3YA 4LF7B 1Z68A 2ZRNA 2FPIB 5EQDA 3KNZA 4HH3C 3WV4A 4AXXA 2YV4A 2XTAA 1UBRS 1W0JD 3G2MA 3NM5A 2EZUA 4P34A 1CHDA 1LJ8A 4L75A 3E0QA 2EKQA 5D3MA 4DR7B 4N76A 1G3QA 1MO6A 1NBAA 3PP8A 1MDBA 1DTWB 3AF1A 3Q3CA 2AD1A 1T34A 3FYUA 2GX6A 5ULLA 4IXDA 4RYDA 4B8YA 3REGA 1YU9A 3QELA 2CMDA 4L08A 5KC8A 3UG6A 3M9LA 3MFYA 2J32A 1JEAA 4C7JA 2QM7A 1BVUA 3CINA 4C04A 5LQSA 1SD5A 3G9QA 2FP4B 4CU5A 1TTPB 3CWZA 3WLMA 4O4LF 1URPA 2RI6A 4D25A 1ZRSA 2QIPA 3BHIA 5FTNA 2VAXA 1ISGA 1D0VA 4DRXB 2DBZA 1Z62A 3KVNA 4L8LA 1X7YA 4UUBA 1XCBA 1DXOA 2LCFA 1R4NB 1VYUA 2P9ZA 3TDKA 1UFVA 3W6ZA 1QLHA 4BYGA 5AM3A 1EGAA 3JQAA 4RS3A 4TKZA 8AT1A 4L16A 3U4QB 3NDBB 3KV1A 3PXCX 4J2HA 3WIEA 4YCCA 2C2WA 1YJAA 5TIIA 3BWYA 1VG9B 1EFVA 4ZEWA 1CJUC 1IOVA 3ZOKA 3S7TA 4BUCA 3A6KA 3V9PA 2I62A 3HRKA 4RJIA 4FR5A 2DQZA 3SOZA 2VHUA 1HE5A 4FILA 5M2QA 3ICWA 3LVFO 1OPXA 3LPNA 5HTKA 3CLHA 2AR9A 1ZW1A 2C42A 3VU1A 3V48A 5IASA 1QLWA 4P98A 3U4AA 3CT6A 1X9HA 4IFIA 4Q02A 4IHJF 3RLFA 4L5CA 1MX9A 1OA0A 3BZBA 1VE9A 4YJFA 3UAGA 3WYBA 1Q7TA 2ZJ1A 4KLNA 3NUQA 4AIRA 2WKSA 3A4NA 5LOVB 3IALA 4NBSA 3LECA 4ILEA 3F96A 2OILA 3FNEA 4MV5A 1IWPB 1GUFA 4MKGA 3HN6A 3TVTA 3RH0A 2WB2A 3LW8A 2VG8A 2WJAA 3PPXA 4U2DA 2HT6A 1N9ZA 4GIBA 2HUPA 3KKNA 1VP3A 4G4GA 1PYOA 4RETA 1AGYA 2EFYA 1KGDA 4GMKA 4V02A 3D8BA 4M22A 3BM5A 5CXSA 4DLPA 4KJXA 3UJ8A 3BXEA 4G8JA 2X77A 5GINE 5TPZD 4OATA 1VLVA 1BXRA 3G82C 3T4EA 1EP3B 4QYXA 5K3EA 1Q1AA 2X3YA 4KOAA 4P53A 3EF3A 1NTRA 2YS7A 1ZVVA 1N9GB 2IYYA 2QQ5A 2FLKA 3BXHA 4FDLA 4GW3A 4PQRA 4LJ9A 2FRXA 3WNCA 4Z49A 1ACJA 4DUGD 1W29A 5C7LO 3W1VA 2HFJA 1N6IA 1GPUA 2C54A 2IYRA 1A95A 3AFMA 1A8UA 3BE8A 3K30A 2E82A 3KZKA 4Z0PA 4DIFA 3PE3A 3G6KA 3ETJA 2VEOA 2GRAA 3HR4A 4G63A 3RVNA 4MYCA 3KOXA 4Q1FA 1QONA 2QV7A 3JARA 1J2YA 3FB4A 4LV5B 5D85A 3TTUA 2GS9A 3B6MA 3JD2A 5CTAA 1FTNA 4WBSA 1GGHA 1ZK2A 3EEIA 4RKYA 5AWFC 5JADA 5JZVA 4ZAXA 1NVWQ 3IGFA 2HK6A 3MOSA 3N28A 2OYCA 3SEFA 3WYEA 4EJ6A 4BQQA 5IBPA 2EL7A 3LYHA 1EDZA 1QG4A 4UFOA 4X93A 1HNXB 1C29B 3LX4A 1VJTA 1DXYA 4TYPA 3VTZA 1WBDA 3QBJA 2PGOA 1GTZA 1X1RA 2QZ9A 3OZTA 4WCFC 1UM9A 2LW7A 1T8YA 3T3IA 3TZKA 3ZE7A 1QRSA 1AC5A 2X1LA 2QV0A 5AVJA 5DNYB 1G20A 1KRWA 1JDVA 5EMHA 1DFIA 2BHNA 2PAFA 3ZLTA 2ODPA 2O3RA 4IZ6A 1W52X 5JT1A 1QCDA 5CB4A 1Z2NX 1U9IA 4XWWA 4LXYA 3NPAA 5LZ8A 1JZSA 2FSVC 2P41A 1DLIA 3KDPA 2NN3C 3O75A 3QLEA 3RSFA 1L5YA 1QDUA 1NIJA 1H2YA 1K3FA 1TT5A 2ANBA 4EGCB 4DLYA 1UJ5A 5J4YA 2QZ4A 4G2NA 2DR2A 5LB4A 2IOFA 1XCGB 1MA3A 5FLKA 4ALLA 2GUWA 3U44A 1T2CA 3IPXA 1QQ5A 3QQ5A 3U31A 3WXMA 3N2GB 4RQBA 2RHMA 5CUQA 4FMCB 1UT6A 1MJNA 1QG2A 2H2FA 1B6RA 2IP4A 3A9VA 4GPEA 4ME6A 5F73A 2HT1A 5K8JB 6REQB 1UZUA 1UUFA 2NACA 3R3JA 4WACA 1E9SA 2EW8A 1ONOA 4AMUA 5HNKA 1GYQA 2XPCA 1NMZA 4NFSA 3EB9A 4YAJA 3CU5A 3HMKA 1ZD8A 3ZXIA 4C4XA 2BKLA 4C20A 3I2HA 1PZGA 4WJKB 4F2WA 5C9ZA 3ABQB 3BEOA 4R2LA 2P2YA 2Q0XA 2JLZA 3CTPA 1SBYA 5BN3A 1L0BA 3IJEB 3PNVA 1CS0B 2R8PA 2IITA 3TE6A 3GLHA 5HOQA 4ZV9A 3PS9A 3Q6NA 4URFA 1XCPA 2C7BA 2QUJA 4KN8A 5JQGF 3CPHA 1IHPA 1Y6QA 4J0CA 4ZYWA 1ZXBA 3WWPA 1WSDA 1ZNYA 3LPLA 2XITA 3P0EA 4FGKA 4O4HF 4NXNB 4OU5A 3EMKA 4IJMA 5AJZA 1ETHA 3TNYA 1G64A 4BV9A 4UJ5A 1V0JA 2YXNA 1YR9A 3TVYA 3ZWQA 4AROA 5L3QB 1TJ5A 2ZSJA 1M1YB 1U4NA 2W83A 3DEYX 1EJBA 1DUVG 2YH2A 1B1CA 4OH1A 1DBQA 4P31A 3VO9A 5BQPA 1F6BA 5HKKA 3HUTA 3IS3A 1TLFA 3FDXA 3JATB 5G1PA 3UQZA 5KTMA 3EMBA 1GLVA 2J08A 1JQKA 3KX2A 3GQBB 4AKGA 2WILA 4WLUA 1G60A 2OMEA 1Q0PA 1JDUA 2P6NA 3SGLA 3FUWA 1BWSA 1OBHA 1Z4QA 3AM4A 1MB9A 3KCNA 4EJ0A 4DIOA 4TXLA 1ZH2A 4X6LA 3LF2A 1PLKA 4RMIA 3ZKAA 3S81A 3R0VA 4UTNA 3OWHA 4BGDA 3VDMA 1EVJA 5LM3A 4XR9A 5LBIA 2RH5A 4RMGA 4EPYA 2RKBA 4O4LA 5DNWA 4ZO6A 2J87A 3JQ7A 5TEWA 2GM3A 3TIFA 3OSZA 4UBIA 4M0CA 4LCBA 3RBZA 1ULTA 3MCWA 3VFDA 4YUWA 1WU8A 3B9BA 2VPPA 4LQDA 4AKHA 2XRYA 4PLTA 3C3YA 4QAJA 2HIHA 3SC6A 3PGXA 5HA5A 5BWNA 1K7CA 3VGJA 4C4YA 4ERXA 5JQGB 2YJ4A 2F3PA 2HOQA 4IIGA 1EXMA 1BS9A 3CH5A 3MWJA 3UMSA 4ZZ0A 5CTJA 3ZD6A 3BRWA 4X00A 3NHYA 3GRFA 2H48A 3SIPA 4B82A 5KWSA 1XOIA 4KRGA 1OZFA 1R4ZA 2PH5A 3RFXA 1UINA 4YAFA 4F3TA 1IHDA 1XL1A 3MAAC 2P2ZA 4ZC8A 5IH3A 2ZYTX 1KEEA 5K3SA 5DYYA 4DAOA 1P31A 3T1VA 1EQUA 3BWMA 1KIMA 4GDMA 3V9AA 1UQTA 4DDWA 4M0LA 4KE8A 4Q7LA 1Y1KE 2CFRA 3W7BA 1N3LA 4MHOA 1V47A 3FBTA 1V1MB 2PXAA 4OGGA 2CN1A 5K4AA 3NBUA 1DKOA 1X3LA 1HE3A 1KFEB 3QF7A 2JGLA 3VSBA 5F7ZA 4HDQB 4ZCIA 2YYSA 5G0TA 1OZGA 1QH8B 2VNHA 1N3YA 5EMKA 2DLCX 3PLAE 5AK4A 1HY3A 4YJGA 1J0BA 4QUGA 2Q4RA 1NVVQ 3NATA 2Q0HA 5M7EA 4U8GA 1G9SA 3B2EA 3UAWA 1F4LA 4PYIA 4NBNA 3D4PA 2AF4C 5FXMA 1DAOA 2BRUC 3V8RA 4BEVA 5JRDS 3R40A 4AS1A 2GLXA 1W4LA 2EQ5A 2D2FA 2BM0A 3UFBA 4N41A 4J7XA 3L4KA 2IYNA 1IDOA 3E3LA 3QXXA 5AKKA 5ES3A 5I51A 2ZI4A 1B73A 2ZPTX 2BEVB 2H0AA 5KDLA 1DTEA 4NS4A 1M67A 3TJMA 1SHLA 1LZKA 3HDVA 4HAIA 5GTDA 4ZKEA 2M1XA 2G1JA 2WHPA 3VRHA 5CDSA 3TIVA 1PJCA 5G0UA 4BB9A 2NTJA 3S2ZA 3K94A 5DP2A 2QNIA 4BNFA 3WK6A 1NQUA 1NBWB 3UK0A 3ZDCA 3QLUA 4YDSA 1XCLA 3RC2A 2FU5C 3TI7A 3OCZA 5I7UA 2P9FA 1AURA 4DJJA 4V1CI 1YQTA 4HXEB 4TQ9A 3EMDA 5DMHA 5EP1A 4ZIRA 4G4IA 3EPKA 2FZGA 2PPLA 1KAMA 4P2GA 2QD5A 4IWXA 1GPLA 5ICGA 3CGGA 2AKEA 5E2IA 1EQAA 1X13A 4H1UA 4F3KA 2WJIA 4JR0A 3J7AC 1M10A 4IL5A 4CM4A 4XUDA 4JP2A 1L7OA 4LYFA 4OREX 5CD1A 1M7BA 3PL1A 4U7FA 16PKA 3WK8A 1JIJA 1ORWA 4P1ZA 2F8MA 1T4CB 3RS5A 5KNDH 3ELBA 1OFUA 1FCJA 1TMKA 1KAHA 5FADA 4FZ3A 1XZEA 1P2GA 2IXFA 5DIFA 5HUHA 4QYIA 2QVXX 1WY5A 1WV0A 3HVKA 5FPQA 3K6JA 5FOVA 4F3NA 3RADC 2FZLA 1BN7A 1YIDA 2NZUG 4GOMD 4PZZA 5KDDA 1FP6A 2K2QB 4AJLA 2VUUA 2JBHA 4UNPA 5F78A 2ZIUB 1XU7A 3Q6MA 4HP8A 1P6UA 4DABA 4KHZA 4I8XA 4YNBA 3A2NA 2QW1A 3A32A 3TNLA 1SCBA 3M34A 4B3IA 4DPLA 1GM5A 3E9RA 3JWIA 1ZLYA 2VNSA 1CQWA 3COSA 3WBKA 3DFZA 2V6MA 4QO7A 4AZWA 3Q5EA 5CX1A 4CR6A 2IE0A 5CVTA 2P4HX 3H4TA 4FFMA 3VVBA 3EXAA 3GRKA 5EIAA 2TMYA 3RSGA 2W2LA 2WNIA 4YLYA 5D7BA 2VWHA 3FFXA 1LBEA 1B6SA 4RK7A 4H3SA 3T5PA 1E3MA 3TQIA 1WOMA 3EG9B 1C7QA 2AFRA 4ENTA 1Y6GA 1NXQA 2ZSBA 3ABSB 4O59O 4RYLA 4BQSA 3DDSA 5ALJA 4OA5A 1TQ2A 3TRDA 3MJVA 3PE6A 5ALSA 2P75A 4IMIB 1KP2A 1ZIXA 3F47A 4CN9A 1C1DA 4U7WA 4D45A 1BN6A 3DL7A 1EDEA 1EJ0A 1JMVA 1M0TA 3HCCA 3JVIA 4RFSB 2YRXA 3CX7A 3PF9A 1XD2B 5CYFA 1YQUA 3AESB 4ZZIA 2O6HA 3FPSA 1K2VN 3SHOA 2O2ZA 3KPJA 3URKA 5MGBA 3T9FA 3GG2A 2E6KA 3N7UA 4KN9S 2ZRCA 1O5TA 2YWXA 2WPNA 1AO0A 4OVKA 3FFBA 1S4MA 3HXKA 3QLVC 5K45A 1P2UA 2ZSKA 1TUBA 2DUMA 3AFHA 5BN4A 1NR7A 2DTDA 5DHAA 2DG2A 5KU1A 1FYWA 3W8FA 1A1VA 1EK0A 2BLNA 2PKQP 3L7DA 4GKAA 3RJTA 2UZ3A 3KSMA 3AVOA 4R84A 4IEEA 4DVJA 2J1LA 3VX3A 3WKCA 1GYPA 2QZPA 1P7WA 3HABA 1W5TA 1QUEA 1R8XA 2HMTA 3TF5A 5KYWA 3E1KA 1THGA 4LMPA 1AKEA 2X0RA 4LY0A 2YFQA 1OVGA 2XB6A 3PICA 4NBWA 4E12A 4EFKA 2MMGA 5HP4A 2B1JA 2JZOA 2PH7A 3TMYA 3FA2A 3NRBA 3GBPA 4WECA 3GFTA 5BSKA 1GPYA 2VYND 4E03A 1W1WA 3C6MA 1UK9A 2XCOA 4WFKA 1Y4SA 5CEFA 4JVSB 1K3TA 3OJCA 2I5PO 4CMGA 2NU6A 3DM5A 5LKRA 3F9RA 4U7GA 1RRKA 4QVKA 2EZ9A 4W7HA 4EG8A 2R5NA 4CKCB 3RCBA 3JVDA 2OSBA 2VZ9A 4RKWA 4Y1RB 3CLUC 4NPHA 3RK4A 3U4QA 1OT5A 2Z09A 3OJOA 4OMUA 4O2AF 1CRPA 3DPUA 2DERA 4HAZA 4O02B 2D5AA 3UBTA 4IJQA 1BE1A 3D7LA 3DEKA 4FCVA 3RODA 1CZNA 3ULKA 1XF9A 4Q7JB 3AV0B 2D2IA 2Q4BA 3K1YA 4BNVA 2C2ZA 1MQ8B 1NVGA 3INTA 4GYYA 1GADO 1PNQA 2CNLA 4ZV7A 1HBJA 2W11A 2CNNA 1Q17A 2NSLA 1P9WA 1TJ4A 2FLWA 1TLTA 2GQ0A 1ENZA 1OMOA 1GKLA 4XCVA 1II0A 2I4LA 1DAHA 2PYDA 3RIHA 2PUFA 2FZ4A 2XWQA 4CQJA 2XCSB 3BAZA 1NPTO 7MHTA 4OQQA 1N25A 5DSTA 3VZRA 3OSUA 2OFWA 2C9CA 3RUAA 4I4IA 5DLEA 1R5NA 1OLSA 4JU8A 3V6MA 1HRKA 1CG6A 2VTEA 2YRFA 3JRNA 1C7RA 1GP2A 3TM4A 3QKSB 5C34B 3WLAA 4A3SA 4ARBA 5LOVA 1PL6A 3GNQA 4D8VA 2I3DA 4H1WA 1Q0HA 1NMSA 2I4RA 3PDHA 4FI3C 3URMA 1NYTA 1ICIA 3KTFA 2A4KA 4U9HS 4NFHA 5A06A 4RENA 4GOKA 3R9IA 5B55A 3UJPA 5EHZA 2AOWA 3WO1A 3RAFC 1JPUA 2Y93A 1GFZA 3DR3A 3L8HA 1MV5A 1XL0A 2JLBA 4W5WA 5K3DA 3VZSA 3LD9A 3UOAB 1NSFA 2ZJ3A 2I7CA 1XZDA 1NT2A 2D62A 2VLIA 3D3WB 5BOVA 2C7RA 4MVJP 4QXAA 2XRZA 4MW1A 3EH1A 3LQKA 1N1GA 4WXHA 4LJ4A 4MWGA 5EIBC 1NWHA 1XKQA 3DLIA 3EHEA 2PKYX 3K09C 4P5DA 4Q9HA 5CIYA 5JY1A 2BLLA 4FCTA 4HXFB 5E3IA 5FL3A 1RYHA 2AB0A 1SHJA 4PC3A 2FGKA 1BHJA 4BMXA 4TXJA 3FOCA 5A3JA 2FX5A 3WLIA 3VU9B 1EK5A 5FTMA 1GRNA 1Z75A 4Q5IA 2A5FA 4I3HA 3JCZA 1I3NA 4QNNA 3TZCA 4KGDA 3DR5A 4IKEA 5LP6F 2RHBA 1EM8A 4HDRA 1S9DA 3OLWA 3VTFA 1LPNA 3QHQA 4DREA 1T6XA 3O95A 5J5AA 3CCFA 4JI1B 4J16A 1OC2A 3RKUA 5CH5A 1P2FA 3FNFA 3L1IA 3OLXA 5HM8A 5B1HA 2P90A 5DWDA 4XSVA 3L0CA 1CTQA 1TUEA 2ICAA 2WYWA 1JKXA 3AILA 4MQUA 5EERA 1RKVA 3ZCPA 3EZXA 3O4GA 1DRWA 3OPYI 4FZVA 1NI3A 2UUOA 3OIGA 1YDHA 4F72A 2O0KA 4NCXA 4G0UA 1SRQA 5TY0A 5CDUA 4MVWA 5TF0A 3UJ9A 5JROA 2COUA 4D6PA 2B4AA 2CVQA 2Q3JA 4D0RA 5KMGB 1XZQA 4JOSA 1SXJA 2PKXA 3HCDA 3AQIA 3Q7QA 2HA2A 3T5CA 5E4FA 4ZJPA 2R4UA 1I5RA 1QYVA 3T3MB 1F8UA 5I7RA 2X9LA 1JDJA 4IGFA 2QDXA 1ZNQO 3DLTA 3MJDA 2QAGC 2W48A 3P2JA 3O1LA 4P92A 2H54A 2D0IA 2OXIA 1FX1A 3WKAA 1IY1A 3KPUA 5C1BA 3ILVA 4OI0A 2VHXA 5DRTA 1KJJA 3K32A 1FVXA 4UQPA 3LQRA 2W2MA 4FC6A 4B3JA 1GZ6A 4EPXA 1WZ2A 5TR9A 2J4CA 4F1JA 3FXAA 3R75A 1WDWB 2PL9A 3KQWA 5JCZA 3JAKA 4EX7A 2HSJA 3INNA 2J3QA 1Q7EA 2UAGA 1TPYA 2VJYA 5ICEA 3OICA 2ZLBA 5FRDA 3SX0A 4C9BA 1M6YA 3U4GA 4UXHA 2HU7A 3L0ZA 3GLKA 4E14A 2QRGA 1Y1TA 1GWNA 1SPXA 1L8OA 5KSZA 4EI7A 5HZHA 3U7HB 1W9HA 3SEZA 1WBBA 1JE0A 2GWHA 3KWFA 4QODA 4FK8A 1RMTA 5DI3A 1ZGJA 3CVYA 2H2IA 5EA2A 1FA9A 1M2GA 4M98A 4L3VA 1PQWA 5EJ5A 1BHO1 4J0JA 4W1RA 4D1YA 2XUFA 4DQ0A 2PX2A 4PBTA 5FUWA 1LGYA 4HEHA 1ORHA 4TSKA 1B7GO 5IKOA 3PQEA 3L0PA 2YNMD 4PAWA 5H59A 1V11A 5SYMA 1MAAA 2Z43A 4JHLA 1JZTA 3GEGA 2Q6IA 1LZLA 1UC9A 4M55A 3E9EA 2D54A 3K05A 3O94A 2YIMA 2J0UB 3ET5A 4YEDA 3VUFA 2AWOA 2VT7A 5ECGC 5A02A 3C8DA 1CR2A 1FUUA 1V8BA 2L69A 2H17A 3DBLB 1SKBA 2R11A 3K2BA 2I71A 1DAIA 3R0ZA 4D9IA 4Z7OB 4RSMA 1N5RA 4MVJG 3JASB 3H1BA 4FXOA 3VR1A 4DSAA 5LD2C 3BWEA 3ZZ1A 1M8GA 1CRQA 1TVEA 2A0KA 1FFXA 1MOPA 1YZVA 2Z8ZA 3KKKA 4I36A 5K20A 4XYBA 4PE5B 4DIBA 4UVDA 2BFBA 2EJCA 2G72A 3ICEA 3DEAA 1Y6ZA 3ANMA 1ND5A 2GOYA 2JZNA 3KOZA 1GU7A 2JLAA 2TMGA 3TLJA 3HGMA 3ZWWA 4YX9A 4QARA 2A78A 4M6WA 4GUDA 2YJNA 4O4LB 2V1XA 4B34A 5J2TA 3G0BA 1ZI8A 1XTJA 2E3JA 2X2PA 4ND8B 5LMZA 2EX4A 4O1IA 1JLLA 4Z4IA 3IHTA 1HEUA 1MUUA 1W94A 1XJWA 2P68A 3D5TA 4TKLA 4KR6A 2BHSA 2CLKB 2FFQA 4RZIA 4U7JA 2BF7A 2IUUA 4B6RA 3NWOA 1PO7A 1U11A 2HMVA 3EW7A 4B2YA 2WDPA 4HQFA 1V2GA 3SHFA 4UTOA 1GQYA 2V65A 2A1UA 4GLOA 4Z0TA 3PC2A 5KTOA 3HDHA 5T6BA 4YR7A 5BSMA 2WWTA 1N0HA 1RFLA 3COVA 5F4ZA 3B36A 1ZHFA 1RHJA 4JT4A 3GDOA 2OBFA 3HSKA 1ODKA 4M9QA 3M2PA 3LPAA 4PC2A 4TS1A 2CW5A 1HDIA 3GGDA 2GN4A 3OT1B 3S1AA 4BB5A 2FWMX 3KJNA 6LDHA 1EWYA 1RJWA 2IZ5A 2V7PA 1Q0RA 3OTGA 4DMHA 1B8OA 4FNOA 4Y6SA 2R7LA 4CT5A 2FSVA 1T2AA 1KDRA 4CODB 1QYDA 3RUIA 3BAFA 4BRWA 1GPJA 2C3YA 1O6CA 4BJ5A 1ZYUA 4PBSA 1JPJA 3RBVA 2CCGA 3HSSA 2KSQA 4HATA 2XHEA 1PFVA 2PXXA 3HJUA 5EUCA 4RGBA 1QQTA 2AS0A 4MIEA 5JXJA 2PUEA 1L7VC 3MUEA 1JSXA 1D2GA 3HM2A 1RPNA 1KERA 4TQAA 3LUHA 2CL7X 4GPBA 1T5OA 2ECOA 2JAXA 3W1WA 3O6VA 3QKIA 5JOQA 1OH5A 3ECSA 3LM8A 4RDIA 4EA6A 1CW2B 1YQDA 3CO5A 2ZCVA 2RK6A 4RM3A 1Z5ZA 3VR5H 4BVEA 3M70A 2WSYB 1H8ED 2CJPA 2AR0A 1IY9A 2WZBA 1D2RA 3K1JA 2BD0A 3V00A 5C46F 2BFCB 4LVOA 5GM1A 1DX6A 1W5BA 4QFCA 4BLSA 4Z4HA 1MT3A 3LSTA 1DHTA 4IZOA 1N7GA 3SXJA 1KWKA 5H0IA 2IHBA 5CVEA 1BEEA 1QAQA 3ZCVA 2CDBA 5L51A 3P19A 2YJ6A 3HFRA 1JHPA 3VJLA 4G5OA 4MPDA 1MQAA 1JEOA 2FRDC 2J33A 3LY9A 3SFTA 1Q1QA 3AINA 1KZ9A 3CH6A 5KTSA 4TS4A 4D8TA 1JSRA 2FW9A 1BO6A 1DG1G 1KAOA 1FTYA 3BL6A 2GCEA 2FHPA 3MUOA 1YRBA 2O2IA 3NR2A 4FN5A 4QUKA 5DBEX 4ZVLA 2JHAA 2E4UA 3WVNA 2VRNA 4DA8A 3JQBA 4IF4A 4J0DA 5HK9A 4RPCA 1IDN1 2HH9A 2ZWIA 4XD2A 1FQWA 1UEXC 3UJHA 2NP7A 1YFKA 4RCYA 4FEGA 2EBHX 3RT1A 4BZWA 2P6RA 2HMSA 1Z16A 5JAIA 5D3ZA 3CB2A 4JBXA 4RL4A 1OCEA 1ZU5A 5DM2A 1PSZA 2VS1A 1K2WA 3BXXA 1GZ7A 3FOAA 2AI3A 2J6CA 4CCYA 2PZ8A 3KYCB 3R3HA 1QTIA 1VE5A 4KG7A 5DFAA 2O5CA 1AJEA 1HT3A 5JXIA 2E5LB 3O3MB 1PWYE 1MTZA 2IDMA 1DTWA 4Q03A 1GAJA 1Z28A 1LK5A 1H6DA 1RAAA 1RLUA 4JX8A 4BKMA 2YW2A 2AR7A 2OO5C 3QFCA 4QGAA 1QX4A 2YWJA 3BWCA 3IPYA 4WZBB 3ZNOA 5L4NA 2VN8A 3C5EA 4GS5A 1UPBA 3NO4A 5CFLA 3OETA 2OCGA 2XB8A 3B5EA 4WQMA 3ONDA 5JS2A 3RQIA 3V32A 3BCHA 1YR6A 1E1MA 4ERNA 1DKQA 3WRWA 2UVPA 3KQQA 1AKVA 2ZSEA 2P8SA 3F1KA 1NF9A 1T8SA 1YHZA 5DX8A 2A84A 4GNKA 5SY9A 3S1LA 3ZDEA 4AZ3B 5I3CA 3LUFA 3E5HA 1DJMA 4FYXA 3EWSA 4CEJA 5K3AA 4AJ9A 1P4AA 2IYQA 4LWOA 1GQ2A 2P9JA 1AHHA 3L0BA 4B5LA 1J2TA 2GF0A 4Y2GA 3SQMA 3ROQA 1EFTA 2IT1A 3DPSA 3NT2A 2VDLB 4W1PA 3QU4A 4Z3DA 2CHGA 1SBIA 1JH8A 1P1RA 1UMDB 2VA9A 3RRJA 3R20A 4P32A 4FFVA 1T9DA 3PQ7A 4DBZA 3PNMA 1JJBA 4OGKA 1SVUA 4LZLA 3Q87B 4NE9A 4RXUA 1N5IA 4A8JB 1WXGA 4BO1A 2GEUA 4OAOA 2ZRAA 4OIMA 3RK1A 3ZGYA 2HCBA 1Y3FE 3E2IA 2XY4A 3NALA 1TGYA 1U9CA 3DOUA 4X84A 4E5VA 3IEUA 5IM5A 3CX4A 1OIWA 1WMSA 5K3OA 3BKXA 1EUYA 2VPXA 5EJEA 5EKXA 1ZVJA 3W7VA 3CVWA 4JN6B 1BG6A 4QULA 3EDRA 3ID6C 2KS6A 4FE4A 3VPSA 3DXYA 4OJQA 4ZK6A 1Y7PA 3BWVA 3IVGA 1G8FA 3PSAA 1EWKA 5B1SA 3SQOA 3V8BA 4CIAA 2ZVDA 2ZBGA 4LE0A 2G17A 4PSUA 3UB2A 2B21A 2XGMA 1SCUB 2IPMA 2QL9A 5D1NA 1FDRA 1XZFA 2JJ1A 2XUIA 3CKMA 2DETA 1U7ZA 4HWGA 1WX1A 1J99A 2PQ6A 1DJPA 3CBQA 2R79A 1RWKA 3NTQA 4GFDA 4N0PA 1HXHA 3DYIA 2PA3A 4P58A 5GM2A 2Q29A 2UYOA 1I4DD 3EY4A 3H3XA 4Q4HA 2BUAA 1NKSA 1QLJA 4TKUB 1R6TA 2GBCA 1S0UA 3K0CC 3MRVA 4RY8A 2RH9B 2CB0A 3EW9A 5CA1B 3AVXA 1QH1B 3KP1A 2OZLA 1XZIA 4MR8A 1L7RA 5FBWB 2NT4A 4M2LA 1GITA 1SHTX 5H3LA 3TQRA 4D9FA 1KE1A 4ZT4A 2BTQB 2G0NA 1Y4AE 2OVBA 3EOBI 1GSAA 4HWTA 4QVGA 1BJRE 3UXEA 1T2UA 4MV0A 2PQ2A 3VU3A 1WG8A 5BWLA 4QDKA 3IAXA 1FE8A 3M3PA 3B60A 2P65A 4P83A 1Z6PA 3LWNA 1F8YA 4GM0A 1L8LA 2H0QA 3VVCA 3HVRA 4HNAA 4OUDA 3SE0A 2GD6A 3NGXA 4ZVMA 1FFCA 2C9BA 4FOSA 4R2XA 4OQEA 1ZD1A 3OIDA 2PJUA 4MWZA 3OVMA 4MQBA 3JRWA 4MK4A 3G8YA 4TL9A 4X54A 5AW8A 1G8MA 1RWMA 5A4KA 3BJZA 2D1TA 1PEDA 2FVXA 2O07A 3E22B 3ZZTA 1VZ3A 3RBAA 4B6OA 1NNEA 4KQ9A 5LWQA 2ZB2A 2EG5A 3N8DA 5HFAA 4M7PA 5DHQA 1NV8A 1IN5A 2HDOA 2DOKA 5AI8A 1IJFA 1P2SA 5IFLA 2I1VB 2XEXA 3DO5A 3H84A 3Q4GA 3SG0A 2FR8A 2FB9A 1KIAA 3FMOB 1KOGA 4Q9IA 4MVJI 4Q47A 4V0SA 1NRXA 3G0OA 3NEYA 3T7AA 3ZE6A 1T10A 1QDEA 3ZCXA 3OE5A 1E5TA 3WGLA 4JI6B 5BN1A 4DDMA 4Q4LA 4RTMA 2OHHA 3QKSA 2BFEA 4LXHA 4QAQA 4BY9E 2CKDA 4X62B 3ILYA 4BCBA 4Y2HA 1ZRNA 5FL7D 1IC6A 4Z5XA 2ALJA 3GBVA 3UAZA 1GZ3A 4DCMA 3OAAA 1OASA 4G1BA 2DCMA 1F1BA 3A9UA 4PLFA 5E4JA 1JFTA 3W06A 1DEKA 3P2IA 1ESCA 5TRTA 1JT2A 2JAQA 3OD1A 2IYUA 2G82A 1RS0A 2O05A 3FPCA 3PXDA 3OM0A 1CS0A 2JFVA 3H3FA 2XD9A 4RORA 3VH3A 1CSEE 1VL5A 1L5OA 3ND9A 2FR1A 1CD5A 2O23A 4J0EA 4UCFA 4PLPA 3RARA 4A8JC 3EEYA 1Z83A 1CUBA 5JMWA 3KQSA 4URWR 4P4GA 2BEUA 4BE4A 3PC8C 1JQAA 3N2GA 1A0OA 1C50A 3TI9A 4YREA 3A0UA 4F85A 1Z38A 2ZKIA 4IRMA 2O8CA 1MU0A 2YVQA 5EZQA 3E9QA 4IEFB 4OQNA 5A4MS 3H05A 3C7TA 3QVTA 4LJKA 5FPYA 1XTBA 4ZJYA 5K03A 1J8MF 1DU4A 3W6NA 4OQFA 2WIJA 2ORWA 3GUCA 4M4SA 3R0IA 3T1HB 4QA9A 3LX5A 3OT4A 2C5SA 1PDWA 3UB3A 4AP9A 1A3CA 2X8JB 2XDWA 2ZWPA 3NWEA 1G6OA 1LRLA 2DUWA 4JX9A 4QEZA 4TUYB 1SPBS 1IUOA 1RBZA 5A4DA 2ZTUA 1NVMB 4WW0A 1VB5A 2BCJQ 1BMDA 2G08A 2VFAA 3LCJA 4XPIA 3TEJA 3NHPA 4F97A 2D13A 1QGZA 1XDBA 3DYVA 4IUBS 1C9DB 4U9IS 2OCYC 2OVFA 4CCAA 4NF2A 3KLOA 5LQCA 4NZOA 2FMHA 4TS9A 1F8FA 2P67A 2ONYA 3OJXA 3NV9A 4NZMA 4UCQA 5DB4A 1Z36A 3PKZA 1WETA 1QV6A 3H1EA 2R8EA 2JJMA 3IAS1 4HEJA 4PZ9A 3LBAA 4HPXB 3NG1A 3FDIA 3MS7A 1CZKA 2GARA 1LA2A 4IDEA 4M7RA 3SJBA 3PR3A 3B20A 2Y3IA 3NM6B 3AZPA 1B76A 1YRYE 4EJMA 4DLRA 2QMEA 5I6DA 5L6MB 5LIPA 3RG2A 3S27A 1DAEA 2WU8A 1PW7A 3VSEA 1L3CA 2VXYA 2I4IA 1L5ZA 4A2QA 4Y0NA 1T1IA 3RC3A 1A5SB 4QATA 4CG2A 4EQ6B 2GZHA 4GP6A 4F7DA 1S8OA 2R6CA 3CLSC 4PYOA 4V0ME 5E7IA 3WWEA 3O8DA 1RI2A 4JFRA 4P7BA 1L4EA 1LB1B 4TYYA 2B8EA 3WYGA 4DXDA 3IQEA 2G63A 4TXMA 3EA0A 2GESA 4EB6B 4PG6A 1Z4JA 3OIVA 1NM5C 1AZWA 1XELA 2BEJA 4N4AA 4X90A 3BG5A 5DNVA 5I4BA 1OU4A 1YBAA 3NTVA 3GVCA 5ESWA 1N2HA 3PPVA 4FMDF 1UBOS 4RVHA 4AMYA 5GZ1A 2UVDA 4P4NA 2WWYA 1V2HE 1DT3A 1X1BA 4PFKA 5AKIA 3BFVA 1XPOA 4I3GA 3O0TA 1MG0A 1GQFA 3H97A 4EAAA 2Q27A 3RYFB 3OCWA 1Z45A 1SGWA 2ZREA 4ARZA 5FO1A 3BL5A 5AKYA 4TLAA 1VQ1A 2WE7A 3DL0A 2IY8A 1Y5RA 4AF8A 5K0GA 1QP0A 2QTTA 1FY2A 4KN6A 3TKLA 4P08A 1KY4A 2IP1A 3N0VA 4DDVA 5JWRA 5IAKA 1NX6A 3ZD7A 3GP8A 4OB8A 1FK8A 4PLGA 1COWA 1XZNA 3UPTA 2V3CC 2PV0A 2RI0A 2VH5R 4BLPA 3QF4A 2WD8A 3G23A 4YCLA 2BEVA 1AKUA 1EWTA 2WVJA 4ALNA 2D4HA 3ON5A 1LPMA 3QKRB 4Z0HO 5FOTA 5LDDC 3AG6A 3W2FA 1DIBA 2WHPB 5AXBA 5CCDA 4AMZA 3SQWA 3E7XA 5IC4A 4R68A 1JWAB 1K5GA 3SZ3A 5HIAA 2ONKA 3TQTA 2ZXUA 1XXHB 2FFJA 2L17A 5J4KA 1IG3A 2ZVQX 3LFTA 4FOOA 4DLTA 1L5HA 1CZRA 3ZWAA 5KZMB 4DL9A 4AXBA 4LZZA 1XALA 4EG0A 1VCMA 3DKIA 5EZYB 3OQHA 1K8ZB 5FPPA 5F98A 3IKMB 4H6WA 4TL8A 1QMPA 4PHTA 2IV2X 5LBTA 4BE9A 4PHCA 3FYUC 2VRBA 4UZEA 3GJTA 1Y4DE 2I54A 3ZZ0A 3BFKA 3H04A 2OAEA 3C3DA 4RIIA 3LBHA 3GHHA 3QUBA 4FWIB 4FJ0A 2QUZA 5B4VA 4AYWA 3Q8KA 1BA2A 1KC3A 2Y1LA 2IXAA 3N58A 3QY9A 4TZTA 1C8LA 1X38A 2QMHA 2FZWA 1E64A 2L82A 2QP4A 2WE8A 3EIUA 4II2A 4NE7A 1VLMA 2FFHA 3OHPA 2FPGB 3GT3A 4G9EA 2EJVA 3DQQA 1R9NA 1DC8A 2A88A 3RUDA 3Q72A 1XCMA 4RF5A 4EY5A 4E88A 4P3OA 4EYEA 2VDJA 2GN8A 5ALPA 1AKMA 2H7VA 4YRZA 4E2XA 4MB2A 1RMQA 4A15A 3L93A 1FC0A 2WF9A 1WD5A 3ADOA 4ISCA 2JAWA 1I6MA 3CVXA 1RI4A 5A5FA 2Z95A 3NM4A 3I73A 4KR7A 1M33A 1KO1A 1R8JA 3KB6A 4JBNA 3VDNB 3K0HA 2VKTA 5HFJA 2GKSA 4FE3A 1MHPA 4NYJQ 1V5WA 1S2NA 2WLSA 1QZTA 5IDWA 1QGAA 2ERXA 1C81A 3AYXB 1GLNA 1HDGO 1XN4A 4A0SA 1CB0A 1WZEA 1SUAA 2DPGA 1AN9A 3WL8A 1NW5A 4ARUA 4JBYA 5A5VA 1F0KA 2EEPA 4YRSA 2X42A 3ZC3A 1ATIA 3GH1A 2JAOA 5M04A 1XTUA 1L4NA 3EQ9A 3AKDA 1NURA 1M72A 2DFKB 1KI6B 1QP8A 4Z7JA 2UXBB 2X5OA 1ZGAA 3N8GA 5DCYA 5DP1A 1TTQB 5INTA 3RRMA 4H16A 2J3DA 4TSFA 1T3GA 1WCYA 2JANA 2GERA 3QMVA 4EHFA 1K5DA 2HQOA 2WC1A 2ODTX 1DDGA 1IULA 4OXIA 3KQLA 3GR6A 2Q45A 3CE6A 3MTGA 4PO3X 4XTCS 3O8CA 1VG8A 4CVNA 2QNRA 3K6SA 3KKEA 1ND6A 1PAUA 4GGOA 1Z4IA 1ECGA 1HZJA 3D5QA 3OQIA 3VNQA 2QS9A 1R12A 1C8KA 1X7XB 3SS9X 4KQXA 5AYVA 4CTNA 5EAIA 2J3EA 3K5PA 1A96A 2X6QA 2MHCA 3KFXA 4LZOA 1DKNA 1YB5A 2I22A 3VKFA 3L6BA 5ILGA 2ZIXA 4GX2A 2WJHA 2ZB7A 3FPAA 4KDEA 1Z5PA 2AUTA 3AR6A 3ORFA 5GZ6A 2RGRA 4LYHA 2PX8A 4AUKA 1TUBB 2CLOB 5DHPA 4FQ5A 2NYUA 3JQFA 4KTVE 4EDHA 4P0QB 2NMVA 1H2HA 2IZOA 4ZP1A 1QS0B 3UWDA 3ZHYA 1QHIA 3M4YA 4CBVA 3NTUA 4I3FA 5JJKA 3NFRA 2NNLD 2CXXA 2GZAA 1ZK0A 2J5QA 3IDZA 4S0ZA 4KLRA 3H17A 4PZ0A 1HT0A 1JU4A 1P39A 1VKJA 1BJTA 4AX8A 4WXYB 5EEHA 5LOVF 5TEVA 2BBTA 3F6SA 2NW6A 4EO7A 4L27A 3LDGA 3W6OA 2XCTB 5A1JA 5BR1A 1SUWA 5TDHA 5AW7A 1Z8FA 1QP4A 1UZLA 1C3EA 1G2QA 2LIPA 3EWAA 1TEZA 3QIAA 4G5YA 1UAAA 1E3WA 3NMUF 1UBJS 5K3FA 1J8YF 3E35A 4R01A 5JWHA 1JX6A 3NHBA 4BO7A 3IR6A 1D1QA 3D5EA 3TYXA 5JQWA 2BR4A 1WUTA 5IKXA 3DAPA 1S8AA 3ZLVA 3C45A 3DOCA 4G9GA 2I3BA 5FFMA 3IPCA 5L95A 2Z0MA 2ZRGA 1Y5NA 2Q3MA 1XU4A 2OYRA 4CV3A 4MH0R 3ORYA 4CIBA 3KKQA 2BH2A 1USUA 4L4UA 2V7GA 2I3ZA 2CUNA 1W1UA 2Z83A 1U1GA 4MRSA 5DXAA 3WL6A 2HHHB 1HGXA 3ZY4A 5REQB 4ZHSA 1J2JA 2V6GA 1L4MA 3BXZA 2WWRA 4RVDA 2PH3A 5FR2A 1G291 3ODGA 3PQ2A 4FUTA 1T9AA 4ZGBA 3EEOA 2PGDA 3KTAA 3R5HA 1VKOA 4V0NA 5BVHA 2C78A 2VWQA 5G0VA 2ES4A 1KFJB 5DLQC 3L0SA 5TF4A 5A7FA 4KWEA 4OAPA 5BN5A 2BJVA 3WK5A 1J00A 4HVAA 3VPGA 3RNLA 3BPSA 5JSHA 1P19A 1SBTA 2QTZA 2XOKA 4HGPA 4IO0A 2QUKA 2Y1CA 3N3AC 4Y0AA 3HZHA 1G20B 4JI3B 4BUJA 3HM9A 3BTUA 2IUFA 1N5MA 1LBIA 2OGSA 4CF3A 3MPUA 3TW6A 4AURA 4OP2A 5LJIA 1GA6A 1VJ0A 4DIMA 4NH4A 1KTIA 3B1VA 4BVGA 1PFGA 4IHJB 2F2TA 3CNQS 1AF4A 4IF6A 4MUJA 4D8UA 4FGWA 3D0KA 4JP1A 4WXEA 4YWJA 1VXOA 1YZ3A 5AJWA 2E4WA 1OW3B 4NFLA 4AP5A 2GYWA 3K2IA 1KAGA 3KJQA 1TXGA 3B85A 1J8FA 2ZUSA 3PFBA 2Q1TA 3QA3E 1X7WB 4WXPA 1PG0A 2CFOA 5DN6A 3FLBA 4BV2A 1JALA 3AL3A 3KQUA 1SKYE 4B73A 1QCYA 3ZXSA 1E3LA 2A86A 3LT1A 2ZAYA 4HR7A 2CVZA 3GXOA 3L6CA 3QM1A 2Y1OA 2CMHA 2G3YA 1F12A 1H8HD 1LEHA 1EDOA 1NXSA 2GTHA 4UEJA 3REQA 1AB5A 1SUSA 3SY8A 1H6BA 2P9QA 4AKSA 3IJRA 1TJPB 2AZDA 5EPOA 4DCCA 1U3GA 1V3UA 5G3ZA 2F1RA 4DR2B 3DLPX 3L7YA 4S0XA 4B6FA 3RSLA 3GK3A 3PI7A 3IMEA 1J97A 1PWZA 4G5QA 4AZVA 4D9CA 1WPRA 1FUYB 1RHMA 4WLFA 1NJ1A 4QM7A 3IBCA 4ARAA 5LXTA 3I83A 1CF9A 4JKYA 4CV1A 2OKCA 2CY0A 4TYMA 1Z3CA 1UFQA 1VKZA 3NGLA 4IQ4A 3WG9A 4DCNA 4JEUA 1IEVA 1VHDA 2JATA 1VPDA 3GCGA 4XWYA 2IV3A 4G2TA 4OHVA 3SJUA 3KU4A 4LTMA 4WADA 2R1VA 4ZQHA 1Y1SA 4QECA 1L5KA 3CLVA 4B6QA 1ZI9A 3OHMA 4RHTA 4BVKA 4PRYA 1P7YA 1T35A 1YBMA 4OTZA 4B2IA 3UJAA 3QVGA 2OSVA 2GUGA 1E1CB 3ORQA 1ARZA 4KAJA 3TBFA 3LVRE 4MP8A 4E1VA 3P7MA 2XUGA 3K1AA 2GZDA 4RBNA 4MA5A 4CJXA 2C20A 3PWTA 4RM2A 3LV8A 3TOCA 1DOZA 3KE8A 1KYTA 4LSZA 3R9WA 2DUUA 2B4RO 2GFHA 4P5EA 2I80A 1CEQA 1N0IA 2O0HA 4MB6A 2XMCA 4M36A 3R7DA 1EIZA 3D7NA 2AYYA 3G8AA 3RSOA 1M2HA 4PPFA 5LN1A 4QKQA 4G0QA 4I4TA 4C06A 2E0IA 4IDQA 3RIGA 3T61A 2GAJA 1U2DC 3U9TA 4ZI7B 1I4LD 4MWTA 3MFQA 4YFVA 5IULC 5L7TA 3U3MA 1QVWA 1S6YA 2QX7A <