2QTMA

Crystal structure of nicotinate mononucleotide adenylyltransferase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
189
structure length
189
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
publication title Kinetic and X-ray structural evidence for negative cooperativity in substrate binding to nicotinate mononucleotide adenylyltransferase (NMAT) from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 49
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qtmA00
3D6VA 1ULHA 3IMCA 4ZCRA 1XNJA 1NUQA 3IVCA 5DEOA 5HUHA 4JFAA 2J5BA 2QJFA 4EG1A 4KR9A 3CLUD 1YUNA 3F3MA 1WJGA 3MUEA 4WSOA 1WQ4A 3QE4A 1F7VA 1O0CA 1IQ0A 1GTSA 1MOPA 4E1AA 1OBCA 2HMAA 5HUJA 3ZIUA 1DNPA 4NAUA 3SP1A 2G36A 1ZUNA 1PFWA 3COVA 3VU8A 3SEZA 1MAUA 1MB9A 5IHXA 3TS1A 2JAXA 1EFPA 4NATA 1OBHA 1NZJA 1QJCA 4R0NA 1NYLA 4U8HA 2DUMA 2PZ8A 4JXXA 3C8ZA 2A86A 4OUDA 3SZGA 1WXFA 3PXUA 1IH8A 4KKVA 1T6ZA 3X1JA 4EG6A 4EF6A 1COZA 4L2IB 4MW4A 4MUFA 1O97D 4ZCTA 2PXHA 1TYAE 1JZSA 3CLRD 1PFUA 1I6MA 1U7XA 1FFYA 1U7DA 2PFSA 2TS1A 3IDFA 4QREA 3L92A 4ARIA 4MW5A 1IRXA 3HGMA 4NAHA 4MAFA 1M8JA 1GLNA 3DO8A 3K9WA 1MJHA 3KT6A 4MWDA 1KH3A 4HJXA 4MVCA 3ND6A 4KR7A 1O0BA 1QRTA 2WB2A 4CQNA 1WQ3A 4Q93A 1N75A 5FO0A 4MWBA 1IQUA 3Q12A 3LOQA 3LE8A 1YIAA 4RUKA 1OWPA 2AG6A 4MUGA 5J58A 4G5YA 3IMGA 5TGTA 2XRYA 2J08A 3ELBA 4MW1A 2H2AA 2VXOA 5LLTA 1MRZA 4WNYA 2A1UA 1OD6A 4YBRA 4G5FA 4JYZA 4JXZA 1R6TA 2A1TR 1G8HA 4EG4A 3HMQA 3CLSD 1NURA 2DETA 4J76A 2GM3A 3UK2A 2QUIA 4MW7A 1O96B 3FIUA 3AG5A 3MMXA 1KAQA 5J5AA 1IFXA 3KT0A 2IJGX 4OJMX 1G8FA 2Z08A 2D5BA 4MUHA 1N78A 3I05A 3A2KA 3HZRA 4ND7A 2DERA 2QJTA 1TFUA 3NBAA 3N2YA 3PNYA 4ZCSA 2A1TS 1NI5A 1TYDE 3D6UA 4DDMA 2O8VA 3ZGZA 1QU3A 5TS2A 4MULA 4QRDA 1O5TA 1LI7A 4X0EA 3GMIA 5F23A 3OTWA 5K0TA 1EUYA 1F9AA 4J75A 1T9GS 3NV7A 5KCMA 3CVWA 1QQTA 2J4DA 4K03A 4U63A 3GUZA 2CV0A 4MWEA 1KH2A 1N2BA 4P2BA 3TQIA 2A88A 2OV4A 4CDMA 5DB4A 4DDKA 4CT0A 3CR8A 1JHDA 4K0RA 1IQRA 1N2JA 1XJQA 2D54A 4MUNA 5FO1A 3AIIA 4KPUA 3RJZA 2CV2A 3HFJA 2E89A 2NZ2A 1U3DA 2X3FA 2ZUEA 4ZT6A 3FNRA 1EJ2A 4MW6A 1J1UA 1H1TA 1H3EA 4ZT7A 3SDBA 1Q77A 4EG5A 1QRSA 2DR2A 1GPMA 1VLHA 3A04A 3P0IA 1H3NA 3Q10A 4MUJA 1I2DA 3SYTA 1ZJWA 1EFVA 4I6JA 4Q16A 2DLCX 3RHSA 4DLPA 2PG3A 1F7UA 1M8KA 2EL7A 5TEWA 1EFPB 2D13A 3MLBA 3IODA 3ZJTA 4NX2A 2Z3VA 4JZYA 3INNA 1LW7A 1MBZA 4NDAA 2IELA 5HG0A 1QRUA 1KKUA 3HV0A 1K4KA 2CT8A 1O95C 2DPLA 2WSIA 4MUKA 5J59A 2J09A 4EG3A 4MW0A 3CLTD 3FG9A 3RK1A 5LFAA 3U1VA 2I1LA 3GLVA 3AKZA 1GZUA 3S3TA 2YY5A 3OP1A 1PFVA 4RPIA 1ILEA 4PBTA 1S4MA 3A05A 3VRHA 5JBNA 2X1LA 1JZQA 3N05A 4EFKA 1XNHA 1HYBA 4HK4A 1T6XA 2YWBA 2VTBB 4MUIA 1KAMA 1K92A 4F3RA 1O94C 3FOCA 5KHAA 4DE5A 1UFVA 1MB2A 3FETA 4ZT3A 3FY4A 1LI5A 1M1ZA 3FI0A 3MLAA 3K32A 1RQGA 4F4HA 1IHOA 4PBRA 2A1UB 4MVWA 2DEUA 2RE8A 2H29A 3COZA 3G59A 4R2MA 2QUJA 1IVSA 4MVXA 1N2HA 3CLUC 3KT8A 5BNZA 2V0GA 3DLAA 2AKEA 1ZH0A 1F4LA 1P7PA 2A84A 1B6TA 3COYA 4YMIA 4DNXA 1VBNA 1KP3A 2X1MA 1ZH6A 3H99A 1OWNA 4FZJA 2BYTA 3FDXA 1O96A 1PG2A 3AG6A 3X1KA 1JIIA 3IVXA 1QU2A 3G6KA 1PG0A 4TS1A 1JIKA 4KR6A 1TQ8A 4G6ZA 1G59A 4YP6A 1O95D 2JANA 3ZXIA 3ZUGA 1QNFA 1R6XA 1WXHA 1WZ2A 4S1OA 3CVYA 1SURA 3JXEA 1GN8A 1J21A 4NZPA 4EG7A 3CVXA 1QTQA 1TYCA 1JEEA 1CT9A 1EXDA 5DK4A 3FWKA 1U0BB 4QBTA 3G5AA 1M83A 3H97A 3UOWA 4AS1A 1N2OA 3UC5A 1T6YA 1EE1A 1JECA 1JGTA 1M8GA 1O6BA 1MAWA 2XRZA 1V8FA 2PZAA 3QTTA 2QUHA 1MC1A 3HL4A 1R6UA 1N1DA 4I6GA 3N9IA 4I6EA 1OWMA 3KT3A 3ND5A 3UMVA 1K97A 1J70A 3FH0A 1NUUA 2HZ7A 2J07A 3H9BA 4KPUB 2E18A 2HGZA 3IVGA 3FHJA 4MUEA 4ZCPA 4U7JA 2PZBA 4UZFA 1KR2A 2X0KA 1YIDA 1J09A 3DV2A 3P52A 3CVVA 3TQOA 1V47A 1J20A 4GU5A 2JA2A 2EJCA 3ND7A 1EUQA 1OWLA 4R2LA 2ZUFA 3BL5A 4OUDB 3RBAA 1EFVB 1U3CA 2CFOA 3CLSC 4MWCA 3TZEA 4XFDA 3ZJVA 5LM3A 1NUSA 2WQ6A 2YXNA 1WXIA 1A8HA 3SEQA 3ZXSA 1M8FA 1KP2A 2QTMA 5K0SA 1N2EA 3P0JA 2NSYA 4L2IA 4MLPA 4YP5A 5FNZA 2E21A 1H3FA 3N8HA 1GTRA 3CA8A 2QTRA 3ISJA 4GRIA 5DASA 3AFHA 1WXGA 1K4MA 1N3LA 1X8XA 4PBSA 3LCJA 2CV1A 2A4MA 3CVUA 3TNJA 3E27A 3NBKA 3H05A 3PNBA 3ZJUA 3IH5A 1XNGA 2CUZA 1N77A 3IMEA 4ZT2A 2C5SA 4DJAA 4DDHA 5H16A 3A4IA 3RK0A 1YULA 2GOYA 3SZ3A 1Q15A 1NSYA 2V0CA 5EKDA 1NUPA 2CSXA 1FYDA 1G8GA 4YP7A 1OWOA 1VL2A 5KWVA 1WXEA 4XFJA 2VTBA 1JEDA 3L93A 2WQ7A 2CYBA 1D2RA 1Q19A 3IUEA 1KQNA 2O5RA 2QUKA 1NUTA 3IOEA 4XSVA 3P0HA 1JIJA 2B7LA 3X1MA 2QTNA 4ND6A 4AQ7A 2AZXA 4HPWA 2YWCA 4UZEA 1Q11A 5IJXA 3ILVA 2ZP1A 1KQOA 1WKBA 3QTBA 2RD2A 2GKSA 4EG8A 1TYBE 1GAXA 1I6KA 1I6LA 1Y42X 4MQ6A 1PFYA 1VBKA 2CYAA 2Z09A 3IOCA 3UY4A 3IUBA 3VGJA 1M8PA 4MW2A 5H7XA 3PNVA 3Q4GA 4PY2A 1WY5A 4MW9A 3COWA 1KH1A 1T9GR 4ZT5A 1O97C 3M5WA 3CLRC 1YUMA 2PIDA 4CDNA 1BS2A 2CYCA 4MVYA 4A91A 2BTEA 3AL0C 4ARCA 1VBMA 2QJOA 2R5WA 4ZCQA 3PRHA 1KORA 3IOBA 1J1ZA 3TZLA 2IP1A 5AHWA 1NP7A 2E0IA 1JMVA 1WOYA 1N2IA 3CLTC 3DPIA 3H9CA 1N2GA 3KFLA 3MXTA 2A7XA 4H3SA 5TEVA 4BWVA 1O94D 1JILA 1TEZA 1KQPA 1YI8A 4ZT4A 2DXIA 2OQ2A 4HJRA 3RFFA 4EGAA 1X6VA
chains in the Genus database with same CATH superfamily
1D1QA 3CF6R 2PT9A 2V0NA 1BH6A 3IVCA 3ESCA 2H4YA 3OZXA 5HUHA 1CYEA 1E1QA 2ZEJA 4KUHA 1GG8A 1U3VA 1PW7A 3JR3A 2PBZA 3NETA 4YH1A 4L95C 4C03A 5BXQC 2HMYB 1GFIA 3DL2A 5DVZA 4ZT2A 1CQIB 2RHRA 4Z3OA 4TWAA 1P61B 1J39A 3BIWA 3G8YA 1AURA 3FOAA 3IIMA 4UUPA 4ZVMA 3A37A 3JPWA 1BCSA 4J07A 5DU2A 3RYIB 2WTUA 3A7EA 1NJ5A 1M5RA 3CG4A 1U7PA 3OQVA 3ENZA 1MOPA 1KAGA 4E15A 1HBJA 1W29A 3PWKA 3QE3A 3FOWA 3ZIUA 3PXXA 1DCMA 1SZJG 4E07A 4MS1A 5D1HA 1ORWA 2AEFA 1PFWA 2B4QA 3MUOA 4O29A 4RANA 1MQAA 4ZOLA 3OUUA 2EF1A 3S81A 4OQYA 2OD2A 4P7FA 1OVGA 2J7PA 1NYLA 4U8HA 1IBKB 1ECFA 2DUMA 2WV9A 2WF8A 3H6KA 3OCWA 2IY8A 1VJ1A 3BC1A 5FWXA 3TPFA 1CUYA 3JASA 5CTJA 1DFIA 3AY0A 3IHKA 1O97D 1TD9A 5BV2P 4C7OB 1KYIA 1ZBDA 3X1WA 1JZSA 2F3UA 3O8QA 4D9IA 1F2TA 4FEAA 5AW4A 2R62A 4B82A 1IRIA 1GNVA 3K92A 3R9IA 5AM4A 3RTBA 2W93A 3ZX5A 1UKCA 4ZJYA 1TJPB 3W04A 1IRXA 2I7TA 5KKCA 4YO7A 4P8RA 1YZTA 3EW9A 4CM7A 1MJHA 3V42A 4M0KA 4DRXB 5LL6P 3L0SA 3QEMA 1IUNA 1QOQB 3A6HA 1RYFA 4FFMA 4KR7A 5FPPA 1J0CA 1JG4A 4L07A 1NVMB 4AJ9A 4MIEA 4FR0A 4PYJA 2R7AA 3U7HB 1GA6A 2WB2A 4LOIA 1TIBA 2Y2VA 2D7JA 5I9LA 2CJXA 3BA1A 4N5NA 3RAGA 4FOSA 1N5MA 3Q12A 4ZMSA 1MA0A 4Z54A 2B4TO 2F17A 1IOVA 3IULA 4HN4B 4FJ0A 1V43A 5EE3A 1AQYA 1WMSA 3IA7A 1VPLA 4GXNA 2O2ZA 2REQB 3DEAA 2PWYA 4RD1A 1FUKA 4OHFA 2ID4A 4ZQEA 2XKAA 3U3RA 4BMXA 5KOJB 2OM2A 4RQAA 3BUSA 1XA3A 2VHXA 3DEZA 3PNMA 5IAJA 4DCOA 2ZJ6A 3AR5A 3U19A 3OPNA 4WNYA 1K8XB 1KZ9A 1M6YA 4J91A 3SVTA 4DCSA 1AA9A 4XGRA 1BWPA 3ORQA 4B3MB 4WBSA 5FI3A 1QS0A 1CDDA 1HYQA 1THTA 3M1YA 5F3DA 4EAAA 1ZKMA 3DUFB 2QTCA 3F9IA 3A1WA 3PA6A 4IDBA 2AW3A 3EPRA 4NV1A 3UMFA 4BE9A 3RIYA 5D87A 5A4AA 5I7VA 3S8YA 3JARB 3OE5A 4TXLA 2IYWA 3L02A 1KJ8A 1R9GA 1IYZA 2QD2A 4HNAB 4URUR 4RETA 5EXPA 3OZAA 1YBHA 4ZI5A 4UCFA 2HRZA 4KU4A 1Y8CA 2GRAA 2V98A 1KAQA 1X7XB 3LTEA 3LW7A 1KE2A 3S2SA 2C2HA 1TUIA 4WBXC 2BGRA 5HR5A 1L2TA 1TGVA 1BFDA 1C3OA 1T1SA 4IZ6A 5I9BA 4GQIA 1DHRA 3PRYA 2CMGA 1XQ1A 4LBZA 4FZVA 1FLVA 3M4ZA 3MCZA 1UK6A 2OKCA 2VFAA 1TEHA 2JB9A 1GT6A 1D2EA 3HCBA 4ZCSA 3VR2A 2UYQA 5ABPA 3ANSA 4YDQA 3IKLA 4D56A 4V1CB 2C07A 5J4HA 4X62B 1AV6A 3SXJA 4Y2JA 5C2JB 4AKHA 2R00A 3LT0A 3OZ7A 3PKJA 2IUSA 4KC0A 1T3TA 1NC1A 4Y3UA 4HDKB 2HIMA 1O5TA 2EWMA 2OHOA 4G5RA 4O0MA 4QELA 4UMFA 3UW1A 3ZWAA 3ZQJA 4YCMA 1JUDA 2BH2A 2VPYA 1GUYA 4YXFA 2A9VA 3QWHA 1RM3A 3M6MD 2WOJA 4PGFA 2P0EA 2XD9A 3RRJA 4E4TA 3Q41A 3DO5A 3MT7A 1ZCZA 4QNMA 2HHHB 4D4IA 3R3VA 2H3EA 2VDMB 3EJWA 3SYMA 3UUGA 2REOA 4NFHA 2GPJA 2TYSB 3R0VA 8ATCA 1RLMA 2R1VB 5HTKA 5BN3A 4CFYA 4CMAA 1OIWA 1DX6A 4X6LA 2CHUA 2ICAA 1V8BA 2QMZA 4EJMA 1WMAA 2K7FA 1H6DA 1ZWLA 4OQZA 4FR2A 5U4XA 1QGUA 5BW8A 3BD8A 2CNWD 4EFDA 4D80A 2C98A 3MN1A 3PDIB 4ARZB 5MN6A 3HJHA 1FDSA 2JI8A 5BV1A 1C8LA 1L1RA 1E3IA 2EP5A 4J0EA 1G3IA 2H4ZA 2H5EA 2O1XA 1L8LA 4EI9A 2RB4A 4DYVA 5TQ0A 1T2EA 4NOLA 4MUMA 4OO3A 4OKNA 3P26A 1T0BA 4TOIA 4X65B 1E2NA 4EPWA 1PBTA 1H3NA 1LS1A 4M0EA 1QSGA 2ZUWA 4B3HA 4YR7A 1X7WA 3HXOA 1I2DA 5GQSA 3PDWA 4WXPA 3W34A 4RTMA 4K3UA 4LZZA 1E1RA 4DLPA 5CM8B 5AW1A 4P08A 1RWMA 2EL7A 2AG5A 1PUIA 2QTFA 3OM9A 5E3IA 3C1TA 5EHZA 1M2EA 4EL5A 4NJEA 3ZDZB 1TDJA 1WPGA 3BHMA 4HDNA 3GJ7A 4MVJG 3TINA 5FOUA 1PR2A 3CNOA 2UYCA 3WXBA 2B0CA 3SNHA 1ADCA 3V8EA 1T2AA 1DQPA 4L6CA 1QONA 2C7BA 2F4VB 1FJ2A 2QL5A 1C7FA 3OT4A 4RENA 2OGTA 5FULA 2HLHA 2UYOA 3IKJA 3WP1B 4ZU6X 1CUVA 1T9CA 3L0YA 5DGCA 1PZHA 2E5FA 4PZUA 4RHFA 2IC5A 1U5BA 1CUIA 2IUFA 4I9NA 4K9LA 1ST2A 1USVA 2XMGA 3AVTA 1CIJA 1CC1S 2J3KA 3KWLA 3EOBI 3NHYA 4ND8B 2I1LA 3WV5A 1NXVA 2QX4A 1H1LB 4PICA 1QFZA 2AC7A 4RC9A 3SCZA 1NFFA 5IKPA 2YRFA 2RAFA 2ZPTX 3GEMA 1V3TA 1AMUA 4F2HA 3C3MA 4NOJA 4AMBA 3LQRA 3PGVA 3O0TA 1Q0SA 1XEFA 2QLFA 4EFKA 3SQDA 2B8NA 3ETLA 2QVZX 4CJXA 2PN1A 4S1PA 3O3NB 1A72A 4N5IX 2YS6A 4UM9D 2XYVA 2QSZA 4HK4A 2H48A 3INGA 5FOTA 3O8RA 1LX6A 4AULA 2J4CA 2ZTHA 4A6EA 2ATEA 3F5FA 5JZ9A 3AM1A 2GT1A 2Z56A 3CYFA 1HDGO 5IT4A 2C3MA 5M34A 1SUBA 2Z2XA 3UVEA 2PTGA 1UC9A 3HR8A 1JDBB 1VZ3A 4JP5A 4KSYA 1KWGA 1YC2A 1NP3A 4LK3A 4UASA 1E2GA 4WNIA 2X4DA 5JW6A 1RZRD 1RTTA 3K32A 3UUEA 1AD2A 3GPLA 1P4JA 2R8RA 2HCJB 2NPFA 2PRZA 7REQA 1LGYA 1U9CA 1UFKA 4LXTA 3D81A 5CM2Z 3MWJA 1KSHA 2EZTA 3ACCA 4YJFA 3HY6A 4ITVA 2YW9A 4ZI2A 1FP4B 1SNYA 1X9IA 5AHKA 2IHVA 3BIJA 1M34E 2O05A 1T25A 1Z5WA 3EG9B 3HDTA 4BUCA 1HETA 1XTBA 3EZ7A 3QVWA 4UBIA 3ICQB 1TNDA 3H5WA 1CUHA 3PC4A 1GZSA 4B76A 2RBEA 3O1HB 1P3JA 1P2TA 4O63O 3ADPA 4GMXA 5C5DA 3S8EA 1GU7A 2GEDA 3FMOB 3E9NA 3GJ8A 2HK6A 3G6KA 4MA4A 4XLLA 4ZIRA 4DR3B 1WCXA 1R9MA 1YZLA 5TC4A 1NMEA 5KOIA 8ABPA 1EU1A 1XIVA 1E1LA 4IQ4A 2JLRA 2XRMA 1YJ8A 2FNAA 3LF1A 4P3XA 5DTMA 1OT3A 1W75A 2R11A 3KLMX 3MWYW 3RQSA 4D97A 4O3MA 1MDFA 2DHDA 2O57A 2Q1TA 3KKNA 5F1YA 2P2YA 2JZOA 2PNJA 1KY2A 3I2YX 4D8UA 3L6DA 3CVYA 3PXCX 4L0CA 4NE9A 4RFSB 3QQPA 4DLTA 5LMZA 1YZYA 3OICA 5AHRA 3BWBA 1VI6A 3CKKA 4QYMA 2LXNA 3DW3X 2ZAYA 5DW3A 3A10A 5CDFE 4QBTA 4GE0A 5CXSA 1OLXA 2AC4A 4ISBA 4DYDA 3ANLA 2WTEA 3OA2A 3O74A 1JR3E 1H2RS 5CFPA 5ALSA 1T6YA 4DAEA 7MDHA 1ACLA 1JECA 1F2UB 1RJ9A 4TLEA 4YCJA 1I7QB 1IY8A 1HG1A 4WW0A 2IU3A 4IDCA 4WXMA 2XUJA 3QF4A 1TUBB 1F1JA 1FVXA 1R7RA 4RV4A 5JZMA 2R0QC 5IT9A 1I36A 2II6A 2OZVA 2J87A 1K7EB 1E2HA 3N9IA 4J43A 1KKLA 5D85A 2WJYA 3LQFA 1GG9A 3SF0A 4DDUA 3HO1A 1K97A 5L95A 2SICE 4M9SA 2QLBA 2PDAA 4A3SA 2J07A 3SFTA 1LQUA 3H42B 4OK6A 1O03A 3DD1A 4KB5A 5L8VA 4TYPA 1L4NA 2UUAB 3O0DA 5L3SA 3DZBA 5HZGA 1HT2E 5CB4A 5CDGA 3TFOA 5JC1A 4G01B 3T38A 4OYRA 1WBJB 2IYSA 3H2YA 1II8B 4TV9F 1OXXK 2PZKA 2O54A 2D1TA 1SCKA 1KVTA 2ZATA 2FDRA 4F6LA 5CCBA 3IL2A 1XVLA 1J20A 2ISSD 3TDNA 3HJFA 1MZVA 1U1FA 4M2LA 3ZU6A 2YIMA 2E4UA 2WBLC 5IYZB 1WXIA 2AE1A 2XSZD 1TZMA 1Z39A 4FS3A 4G4GA 2Q3MA 3TB6A 1A5TA 3AR9A 1J90A 2F3TA 2AB0A 1N2EA 2AMYA 4PSDA 4H0FA 4AWAA 3DTNA 4BO4A 2PRYA 3ZWBA 2Q3LA 2DSNA 2E21A 3MWEA 2C2YA 3LDGA 3VJLA 4X20A 2ODEA 5M7EA 3SQXA 4V0LA 4KN6A 5CH8A 5A4MS 1OBOA 5IBCA 1QQBA 2HPVA 1JHPA 1THGA 2IQIA 2H9YA 2WUDA 3ECSA 3S99A 3GH1A 5DN6A 3HBJA 3PD1A 1JV2B 1BX1A 4U7PB 2G40A 3BK2A 3EZFA 3MPOA 3WTBA 4QYTA 1ZEMA 3VO2A 3HY3A 3B1ZA 1V8DA 1G2QA 3T7JA 2O48X 4LZNA 4M9ZA 5EJ8A 4MLCA 1K6MA 1OZ0A 2JH3A 3BQNB 3FMPB 1E7RA 1B2LA 3B48A 2COEA 2I9PA 3H17A 3MGKA 4I1RA 3L7NA 3LUGA 3NWJA 5KTSA 2XB9A 1OX4B 2GOYA 2PU5A 1IBSA 5E4TA 1G20B 2Y66A 2E49A 4AKTA 4LA4A 4IZHA 3VPHA 3DDUA 3ZWKA 2ESRA 4F1KA 3FKSD 3DA8A 1APBA 5HKLA 4JLBA 4YQYA 3AERA 2W22A 2WSSA 2YC2C 3AOEC 3MT8A 1JHRA 3EFEA 1C4OA 4L75A 3VR4A 4AURA 5CXQA 3A25A 4CIAA 1MFPA 1P4SA 5IK2D 1XPOA 1NV8A 1EIZA 2VJAA 4HZGA 3CQ9A 4N7JA 4DCGA 1BSVA 2NXWA 4RZ3A 2WUEA 5FP0A 1A4RA 1H05A 4MJ7A 3C0KA 1YGYA 1T2UA 2VF4X 3WGGA 1PGOA 1A7AA 3OD5A 4KO1S 5IZCA 1R0CA 1QQ5A 3EXEA 4XOUA 4RNCA 4HSEA 1KMIY 3FMIA 1PJCA 3ZQKA 1OC4A 1QIGA 1RWVA 2QROA 5AYVA 1E5DA 5JTUA 4GWKA 5J2UF 3KHTA 2QVBA 4G8CA 3GGSA 4ZTUB 4KO8A 3FNGA 3SSOA 2O8DA 2WJAA 1HEYA 4PIPA 1IOWA 1PFYA 4EKEA 2QG9A 4FCCA 2CYAA 1OAOA 2QV0A 5AI9A 1X0XA 4XDGA 4YALA 3EXG2 1Z6YA 2CZCA 3JX9A 4B71A 5H7XA 4Q21A 2JEZA 1D1SA 1Q3HA 4LC1A 4YAEA 3K0FA 2YQZA 2G63A 3TTYA 5P8WA 1JRLA 1SVMA 1L6RA 4GOXA 1M6VB 2EX4A 3V7YA 3I2HA 2P62A 8ADHA 1JHUA 4ZGWA 2RAPA 1IDN1 2W5UA 2AYYA 4S2UA 5DLYA 5ECYA 4CEHB 1NXSA 1Q1ZA 4HHEA 1NWHA 3GO4A 4MV1A 1SEPA 3TBKA 4L15A 1L4KA 5IG2A 1IEVA 1ZHHA 4DM3A 3DLIA 4DTIA 4ZFNA 5DSTA 5LN1A 4CDNA 1ISIA 3NTUA 1L3IA 3CTMA 5HQ3A 1HMPA 1VE5A 4ZU3A 4ZZ1A 4ARCA 3UAYA 3EWNA 4FFPA 1KORA 3FYHA 4YRZA 4MSUA 4RLFA 3ZCVA 3TZLA 3WGOA 5DGHA 4LHZA 5DXFA 1Y6FA 1JU9A 1BXZA 5DTQA 3SXUA 1CUFA 3H18A 4RPCA 3EEQA 1KDPA 3ZZUA 1VA5A 4FC6A 4TT3D 3SJ7A 4RW0A 1WOYA 1E9SA 3Q40A 4JLNA 3A0RB 3AUSA 3T94A 1F0NA 3N70A 5JROA 5CJPA 1U0FA 2F9FA 5K0JA 3FGZA 4YJ2F 1EK5A 4QOIA 3WGHA 3OI7A 1UZNA 4ZVRA 4U6QA 4QL3A 4HTFA 3UAOA 2OQ2A 2HZBA 1SD1A 1GYPA 1X6VA 2FP4B 2P9HA 2RGAA 2XDQA 3BQMB 4MRMB 3L6OO 2ZUUA 1LTQA 1Z08A 1F06A 2GCNA 3WGMA 1R6DA 4YRDA 3IMCA 3W9YA 1JLMA 5LVAA 1QGED 2ABWA 2FZVA 1NBEA 1Q0UA 2JIZA 5HF9A 1KFEB 3I73A 5IAGA 3V4VB 4HYQA 4IMPA 1QFXA 4OU4A 1K3TA 3VYVA 1FX1A 2CN1A 2FV8A 1B00A 2NU6A 2X76A 2Z2JA 4QTUB 1HE2A 5G41A 3QUQA 3E82A 3GP5A 5JQGF 4EYGA 2C5LA 2ODAA 2AEJA 4LZOA 4FCWA 5SYAA 2EATA 4IWNA 2KS6A 4X90A 3WWEA 1MJ5A 1GA1A 2PR7A 2XXJA 3P9XA 2OC9A 2GLXA 4IZOA 3CGWA 3SQMA 2C2KA 4EKDA 3PX7A 4FIZA 4DB2A 1SZCA 1WCV1 1EFDN 3B3GA 3T3IA 4EMBA 4GX1A 2QM7A 4M22A 2PGJA 1U7TA 2VQEB 1EFAA 3VU8A 5BW5A 3I45A 3KSDO 4WD3A 3WBFA 4CKWA 4IVNA 2XT0A 4H4CA 5D3ZA 1THMA 2QM8A 1JQBA 5HRCA 2QZZA 3A1VA 2C4HA 4ZDWA 5CT6A 1ZUIA 1DIBA 2HCFA 4X45A 1YS7A 3RYCA 1OJ7A 1XK7A 2BHTA 3CB4A 5BN4A 3C5VA 1DQYA 2GRJA 1S1CA 2P6NA 5DBOA 5HCUA 4DUZB 1SQGA 1Y7HA 1ISHA 1J23A 5HBRA 3V1MA 4DHWA 1XMIA 4E08A 1JFTA 2Q99A 3CKLA 1P9WA 4Y6SA 3AGQA 4E5KA 4IJQA 4I2NA 5JXJA 1TYAE 4RA6A 4XUGB 3E70C 1XF9A 1N7HA 4LHYA 3HJGA 5K6RA 1M2KA 4WXHA 4KAXA 3O47A 4DG8A 1AO3A 3F6CA 4C89A 2G0AA 3MMSA 4O4IF 2IEDA 3TZHA 2R6DA 1A7KA 4YJHA 5AVZA 4JGIA 1XCPA 5ELXA 4PPNA 3PQ5A 2AK3A 2LCQA 1X1DA 3URKA 2F4NA 1NM5C 3D3WA 4HC4A 5EEHA 1H0KA 1YI0A 2HMSA 1E2DA 4HD8A 1ZIXA 1IY2A 1JR4A 1ZXXA 3MJCA 1OH7A 3KPUA 4DKJA 3LP5A 1U8AA 2FYTA 1QCYA 3EZGA 4J0DA 2HOQA 4NBLA 1QM5A 1SY7A 2GN8A 2J9GA 3OZDA 1D9ZA 5CA0A 1LPSA 4N76A 4AY3A 2QTVB 3G2JA 3SBEA 3PGLA 2ZIFA 1ZRHA 2R9VA 1MEJA 2EOAA 5G0VA 5A3JA 5ED0A 1GPKA 1YCFA 3QVUA 5GM1A 3IVMA 1KFBB 1RPAA 2BFEB 3NUGA 3WL6A 1JFLA 4WKPA 1KDZA 1SCNE 3FB1A 2WSYB 4JYZA 1RC1A 1UM9B 4F60A 1GNSA 3WSWA 1NASA 1SCBA 3VPGA 4EG4A 3DV9A 4JNKA 4Y6GB 1WMDA 5IN5A 4J76A 4BTLA 4PGMA 1OXBB 4X8LA 1TXGA 5EVJA 3AXSA 4EUNA 4LYYA 4D4HA 5I5EA 2ZIAA 4CQMB 1ZC4A 3G1WA 1A9OA 5HNKA 3HKBA 1AQUA 1YB6A 3FHTA 3O90A 3E35A 3DT9A 4O6VA 2NGRA 3R3SA 3QUCA 1IXKA 2FPUA 1IOZA 1G8FA 4LXUA 4Q47A 5E8RA 5A6SA 2I2FA 2JJ2A 4MUHA 4NYMR 3KKQA 4LTNA 1UXKA 4ZI7A 1TQ2A 3LT2A 1F4PA 1LDMA 2H2FA 2W2QA 1X1QA 3HI6A 4LBYA 2EQBA 4GVLA 4KXMA 2I3GA 3I01A 1J97A 3A3NA 1Q7BA 4RORA 3U2QA 3Q3VA 1L5LA 4NCIA 1MENA 4G37A 4KUEA 1TA4A 1GTG1 1IN6A 1LFDB 4V2IA 5FUQA 4ENRA 2NVBA 1E4OA 2GZSA 3PPWA 2JAQA 1XXLA 5AK0A 4LV8B 4QRIA 1NLFA 1E0SA 4BOYA 5DHSA 1SKYE 1TC1A 1U2GA 3KALA 3KKPA 5JZOA 5KMGB 1I4TD 3EVNA 1KEKA 1T8TA 4X1YA 3HJNA 5TX7A 2Z5LA 4UUMA 3TOCA 4D74A 2XODA 5EMMA 3N0XA 5G53C 2A88A 1ZHOA 3DVAB 4S12A 1OU4A 4OA5A 5AI5A 4DDKA 1REQB 5JH7F 4LX8A 5EWJB 5LMNB 4AICA 1Y5LA 3KPWA 1NRWA 2BY4A 2QR2A 4I5FA 3ASYA 1I3MA 2D54A 4S05A 1FMJA 3BWMA 5C3UA 3ZH9B 3U6KA 2ZRBA 3AIIA 3L0OA 4PLVA 5GIOE 1S6YA 2JGEA 4LOJA 2X3FA 1D0SA 1YA4A 2FJPA 3P4XA 5HILA 2I76A 1E79A 2V5AA 2IL1A 3M33A 2V7EA 3UJ7A 1DDGA 3DE3X 2GPTA 1CYDA 4U2GA 4LF7B 1A9RA 2BCEA 3RUCA 1OJLA 1IXRC 4NZYA 1GDHA 1ARZA 1W5SA 4WACA 1SGWA 1Z4MA 1J8FA 2GI4A 5F2KA 1N2SA 3JU3A 2X9QA 3QF7A 2PX6A 1KC3A 4O02B 3N0WA 4TWRA 2C3PA 3TL2A 4UNIA 2P7IA 4H59A 3SMQA 4BGDA 1D09A 3V4OA 4E6EA 4YRCA 1Z2NX 4KKXB 3EH2A 1FDUA 1ECJA 3L7LA 4B3SB 3W2TA 1M8KA 5D7NA 4JL8A 3GP3A 3ITNA 2VO1A 3W6UA 1VYTA 1UJMA 3K5WA 1PR4A 2GBCA 5T41A 1CBUA 3L49A 3T3HA 3W1EA 3WLQA 4F04A 4F21A 3AI1A 4G2TA 1RJGA 1T8SA 3AEQA 4NX2A 5U4QA 4EL0A 4EJSB 1OB2A 3K0KA 1EINA 4AYTA 3PR3A 4WADA 4YUZA 5JAHA 4BNDA 4LJ6A 1SA0B 1QPGA 3BEOA 2JK1A 4LJ4A 1K4KA 1UBKS 4NOMA 3S6JA 2E6UX 1IONA 3V46A 3WQQA 4C7MA 1MHTA 2ZI3A 1AC5A 2AJTA 2XOXA 2X19A 5J59A 3TTWA 5KPDA 2E87A 1YVPA 5H70A 3OZSA 3OH8A 3ESRA 1OH8A 5K0NA 1N8SA 4RKEA 4PQFA 5BSKA 1FW6A 4KQ9A 2EVWX 2J85A 2ZXEA 1JXMA 2UZ1B 1YUBA 1BJKA 1KIAA 1LPMA 3TEFA 3TTTA 2I6TA 2WNSA 2UZIR 2XUAA 2ZIXA 3STTA 3EIUA 3OFJA 4EKYA 2QVXX 3M82A 4HZIA 4KQFA 3BG5A 3ED5A 5GP1A 2XD4A 2ZJZA 4M9XA 2NTYC 4PRLA 3ZV4A 1G1MA 1HOXA 2ZT8A 3VRHA 3ORFA 1AN0A 1XG5A 2Q27A 1FP6A 5TE9A 3W7VA 2UUBB 3HDGA 3ZGOA 4EUFA 3SEAA 4YRRA 1RPJA 2MSCB 1YDWA 3VPXA 3AEZA 2PUHA 1YVRA 4GXRA 3AUYA 3CNEA 3QHPA 4CBVA 1V9CA 2JLSA 1CUBA 5JS1A 2C4MA 2I6QA 3ESYA 3I1IA 2PYDA 5DYTA 3STHA 2QD3A 1KOFA 3PTLA 1ZBQA 3O4FA 2FWIA 2FFRA 2I3ZA 5JMWA 1I24A 2F6RA 4QOGA 4NYJR 1YDGA 2DP4E 3JRNA 2HTFA 3R3HA 3DEIA 3GFOA 5L7WA 5FPYA 3K1ZA 2HRCA 4CUZA 2ECPA 3A1CA 3DBHA 2D7DA 2HA6A 3RWBA 1G21B 5DCLA 3ZWMA 5DTEA 4YPFA 4ENVA 1FBTA 3NGMA 5IAKA 1XRQA 4IG4A 2OOKA 4XD7A 4REQB 1F4LA 1ESEA 3GRAA 4LDQA 1M1UA 2OV8A 2YNMD 4KXWA 1NXQA 3HEAA 4JQYA 4MTCA 1G17A 4NHEA 1MFZA 1NSFA 2Y4NA 1RYYA 3DYBA 1R5OA 1IVNA 4TYYA 1MUUA 3K1AA 1L6IA 5C3MA 4CU2A 4MV5A 1W6RA 4MVJH 3DF7A 2PWPA 1CR4A 3U81A 3CUWA 1JIIA 4AJ2A 1E58A 5HJEA 3JSXA 2RGUA 1M2NA 2A7QA 4TS1A 2WJWA 2XGSA 2Z2YA 3HO6A 3O31A 4LZLA 4N4AA 4E46A 5TPZA 4ZHQF 1TQ8A 2ZIUB 3EIFA 1KJQA 1NBMA 5KYKA 4DC0A 2V55B 1LPPA 2VK8A 1DWOA 3BRSA 4LKOA 3L9WA 4R31A 1XZJA 2GK3A 2RH4A 3QW4B 4YRNA 2ZZMA 2R8YA 1HG0A 3IXMA 5AXDA 4CG3A 2C82A 4OY3A 5T64A 3UK0A 4HEHA 2H16A 4QECA 3ADDA 4CQLA 5CVDA 4I5GA 1EXDA 1C8BA 1SBZA 2Q5HA 3KQKA 1RBZA 1M83A 1T9KA 1TB4A 2O23A 3F46A 3I32A 2PV0A 1VIDA 2PUEA 1I4LD 2JGDB 3H2JA 4W5NA 3V8PA 2IH5A 5F78A 2QM0A 4NDNE 4D26A 3PC3A 1YT5A 5GMOA 3IB3A 1XAIA 3NONA 4YT8A 5BXYA 3QVMA 4C1BA 4KTTE 3QA9A 2BLLA 4QPPA 3AIMA 4OMCA 1YKFA 4PZAA 2JEYA 3RROA 1IN8A 3VR5A 4DV1B 3CX4A 2GD1O 3KT3A 3P2MA 4Y2TA 1Q91A 4LJSA 1SM4A 1EUDB 2AN1A 4WKCA 4EYQA 2DLDA 1JI0A 2OFPA 2CCJA 2ZRIA 4G67A 5J43A 1CF2O 3V48A 3QEBZ 3QEAZ 2ZK7A 3OQBA 3THXA 2IP2A 2VPXA 4DDWA 2W2KA 2WF6A 3QX8A 1JMKC 3C74A 2GBIA 4A82A 2BKEA 2FMUA 1C0KA 4MUYA 4C6TA 4NNPA 1WLYA 3CVVA 5SY6A 1PS9A 4YB8A 4PYIA 3T3MB 4P36A 2HX1A 3V4RA 2ZJ0A 4PYQA 5IT0A 3ZE7A 1DGQA 2ZWVA 3ILSA 2GDJA 3V8RA 2NV0A 2ZUDA 4GU5A 3ZI7A 4AMZA 3RODA 2CBXA 4V02A 4M9CA 2ZUFA 4H4DA 5LJLA 1B76A 2P8JA 3DTTA 1USKA 2W4IA 4KRFA 2AG1A 4QU5A 3ZHTA 3QSYA 5LM3A 2WQ6A 3Q3IA 4U2DA 2NO4A 1RHUA 4RH1A 3WISA 3GRKA 4Z7OB 5A02A 4N5HX 1ZMTA 3MS7A 1TKBA 5BNIA 3NYQA 4BNLA 4A2QA 3KVVA 4WXYB 2A94A 1LXCA 2QN6A 2XTNA 1RJEA 3P0EA 4BZWA 1U02A 4TRMA 2XZLA 3NJ4A 4RLQA 1L7PA 2OG2A 3S27A 3VYWA 4M1TA 3O38A 1OPXA 2PS1A 3LCJA 4KAJA 1E2MA 5AKLA 4C4OA 1M5TA 1LF5A 5LOVA 5TMPA 1ETHA 4N3AA 4QXRA 3QUAA 3O4VA 4K0KB 3G13A 1WEHA 1RVV1 3CPHA 3E22A 4KQEA 2BW0A 2HJSA 5I7AA 5A1TA 3GFFA 5KTPA 1H5QA 3EWSA 1UPFA 2BTQB 2XTZA 1GQ2A 2OENG 3L77A 1SBNE 3OLQA 4QPCA 1KEPA 4ZO6A 3S7TA 5CDSA 3FCCA 2FETA 1TO6A 4I5DA 4XARA 2PT6A 4ACAA 1SBYA 3JD1A 3P0FA 3R0QA 4WFIA 4YC7A 4EZIA 4IFIA 1F14A 1GKUB 1O9BA 2W37A 4FJ1A 2ZDGA 4X1KA 5EIBD 5D5QA 3T3EA 1XDZA 1Q6YA 1VHWA 2ODWA 2OD9A 3PSAA 4JB3A 4KXNA 3BRQA 3UYLA 621PA 3MFQA 1D2GA 3KYDB 3JWIA 3M81A 2ZDHA 4GZLA 3K0EA 4YMSA 1NVTA 2PJZA 3OJXA 5LIRA 5LBUA 2AN3A 3J81A 2N46A 2QG4A 3RW9A 1UWLA 1P31A 3L40A 3LP8A 1D0VA 2CYBA 5DLQC 1O7JA 2FWJA 2QLLA 3DBVO 1KQNA 2M6KA 3AH8A 1C7IA 1ISFA 2RIPA 4WHMA 3P0HA 2BM8A 4I19A 5FHRA 3A6JA 3V7WA 3GT3A 3VR6A 5CG2A 4EHBA 4JBYA 3AETB 2GFHA 2PZEA 2WJ6A 3HC7A 4YY3B 3BA6A 3W2IA 3ZUPA 1IPEA 2IP4A 2ZBQA 1L5SA 3A6DA 2YXDA 3OFNA 2WR8A 4EG8A 5A5VA 1TYBE 2VJLA 1C9MA 1A1SA 1JKMA 1JHMA 1I6KA 3FAKA 3NKLA 3PCXA 3W6NA 4C0KA 1UJNA 5SY9A 2IU4A 2WINI 3W3AD 1Y8AA 3ZHZA 4RKWA 4ZJPA 3OZBA 2PUAA 3CRZA 4E5PA 2BPOA 4GT1A 1X7HA 4U2CA 4W5QA 4KPYA 3FYSA 3TSOA 3A1TA 3VI3B 3E23A 1N4DA 4IH4A 5CBPB 5J4LA 3OF2A 4PQEA 3U7FB 1XZPA 4RCVA 2FPOA 2XDYA 2GWRA 4RE6A 2JIOA 4H1HA 3KPJA 2CB0A 3OIWA 1GPWB 1O97C 1B6GA 2QXYA 4NCHA 1JPVA 3DEFA 1GRVA 3OCJA 2SKDA 5JCZA 3WHKA 1ZHFA 4A0SA 1LLQA 3HU5A 1P7ZA 3C85A 2PSHA 4HLNA 1EM8A 3RJ5A 3Q88A 3MIZA 4CGYA 1BFKA 1NVXQ 2IYZA 4MKXA 1U2EA 3ZCRA 5ADUS 4QYSA 1XHFA 1ULBA 1G38A 4WASA 3ZOZA 1RAAA 3EVBA 1CJKC 1HT0A 4P1ZA 4B3JA 4EHJA 4JOCA 2NUTB 4TKZA 2JF0A 3CUTA 3TQTA 3Q87B 2V9PA 4GEGA 2IYUA 2NX2A 5EZYA 1E7YA 1PEDA 1N4AA 2PGIA 3H9CA 2D8AA 4C01A 5C46F 2QPAA 3LM8A 4JJ4A 2D5LA 4URYR 5EXDA 2HV9A 5IM5A 3R5SA 1K3UB 3OQPA 4J4TA 4Z1OA 1ES9A 2ZROA 3OQIA 3M4XA 4G1UC 5CUQA 2WJVA 4X6UA 1IG0A 1ECCA 1SXJE 3N6XA 2Y0DA 2Y1WA 2ZTVA 4I3GA 4NMLA 3TZ6A 4B3BA 4TYNA 1HE1C 2QY9A 2PLRA 5ECWA 4KIJA 1Z2EA 3HBNA 1NOIA 4ENWA 1L7XA 2ZSEA 5K09A 1KY3A 1QIJA 3HABA 5AKHA 3RLFA 4MCAA 4ZZ3A 1YB7A 3FPFA 3SYRA 1QO0D 4RMHA 3YASA 1TIPA 4NCNA 3AHGA 3CLUD 5DCYA 5KNDD 2IHTA 5TIIA 1SU7A 2HCTA 5FQOA 4CTKA 1FVOA 2BT4A 2ZRKA 4Q05A 3QHAA 1KJIA 1ZEJA 2YV2A 3VU9A 2M1XA 1P1JA 4PPFA 3N2IA 3WYFA 1ITZA 4NAUA 3V4ZA 1GXSB 1KJZA 3SP1A 4HBGA 4I7EA 6PFKA 3PQ8A 5IM4A 3TB4A 5JECA 5LBTA 1NZJA 1XWWA 2BKVA 1UXGA 1QIFA 2YR0A 4HO1X 3MILA 4BLPA 2CNKA 3C8ZA 1H9AA 4EH1A 3PUKA 4JXXA 1L7AA 3SQWA 5ALKA 5KYUB 5IJ0B 4LS3A 1LBEA 1UPXA 3AOEA 3DEKA 4PNZA 4DMRA 1L4GA 4NESA 1R5NA 4L2IB 4POAA 2WAMA 3CE6A 2V7PA 2VHVA 5ER9A 4Z7NB 1JHQA 3I8SA 4BBPA 3KJXA 1U81A 1ZCAA 4I4TA 4G81A 5LYJF 3IX7A 5BN5A 2P9ZA 3C98A 3OFVA 3IDFA 3ACDA 4GKBA 3L92A 4MO9A 4ZV9A 5LP6F 4X85A 4ARIA 2IXAA 2YN2A 1T91A 3D4IA 1KDOA 1J0DA 3ZBTA 1IIRA 3ABIA 2IPXA 4HDMB 3FZGA 1UKAA 1A9ZA 3LXXA 1GM5A 4Q7MB 1PV1A 4R2WA 4B0PA 1RS0A 2QTBA 1V1MA 3QWBA 5FWYA 5HYVA 2Z95A 4UNNA 5A0FA 1GT91 3ZYZA 4F5YA 3R6LA 3FF4A 1SVNA 1WULS 1G8KA 1Z4IA 2D74A 4IY1A 4TUYA 5AM5A 4YUAA 3J80A 3QK7A 4CTJA 3VZBA 4HDQB 1EJBA 1LB1B 4QBFA 5EGSA 1YIAA 2JGNA 4UFPA 1OWPA 4HMPA 3GJ0A 3HB5X 5DM0A 3FXAA 2JK0A 2EJWA 3EZNA 1KOJA 1UMBA 3PQ2A 2VJBA 5B1YA 2KSQA 2P3QA 4NE7A 5ESRA 3V2IA 4LCEA 4JC0A 4EKIA 1XZFA 1NV9A 4QUKA 5D5PA 5K4GA 4Z5XA 2PVPA 3O7MA 4NHOA 5K6AC 1SEVA 1DMRA 3BWYA 2E37A 4II2A 2VXOA 2EW8A 1TZBA 2PMCA 2G72A 3KUDA 1IXZA 2PXCA 2ZI4A 4WVLA 5ARCA 3MTQA 1N6LA 4F38A 2ZREA 1BE1A 3BB3A 1YZFA 4B0OA 5IU6A 3JY6A 3ZVKA 1J33A 3X44A 1ZKDA 5BMVA 2OZLB 4EB6B 1QVAA 4BU0A 1PQPA 3KJQA 1MO4A 1R4MA 3INTA 5JUWA 3QBDA 2GD2A 4R54A 1SQFA 4BWYA 2W2VA 3N5KA 4JEIA 4II3A 4OHMA 3W7BA 3VR0A 3FLBA 4WNAA 3ZE0B 4C14A 1JDVA 1IUPA 1M10A 5DTIA 4TWZA 4OREX 5A7HA 3ZU3A 2CMHA 2C9BA 2FN8A 3QU4A 1K63A 4NG5A 1XB2A 4H1VA 2AMFA 3OIDA 4XYGA 3OBIA 4M88A 4DQVA 1BD3A 4AZ0B 2YYSA 3VKVA 1IPFA 4C9BA 3VOBA 1BDHA 2PD6A 1AS0A 1QJ4A 1ZGAA 4OPMA 5I4CA 3ZVMA 1EBBA 3SYLA 1Z73A 5EUMA 3ZH2A 3N2NA 4D3XA 3DCNA 3CF4A 3WYCA 1JAYA 4QDXA 4QRDA 2AC2A 1DUVG 3W6OA 1N7IA 4FFOA 4B8ZA 2GNPA 5TJHA 5F21A 4M1WA 2IRWA 4J75A 1Q0PA 3FNIA 1PQ4A 4F3NA 3ASUA 4XH9B 1SOWA 1W46A 3UUWA 2VPZA 4G4SP 4DHEA 3NT4A 1W85B 1SG0A 1VRVA 2HPHA 2MJLA 3HA5A 4GOLD 5AJTA 2OV4A 3MYYA 2VXCA 4DG9A 2HMTA 4F9TA 3V1LA 3OCUA 2RG7A 1HXHA 1PDOA 3QQ5A 1H9BA 4NH0A 1YB5A 3G0DA 4Y0NA 1KZ1A 3RVOA 4CKZA 3RVRA 2A0FA 4MUNA 1W2WB 4C88A 3Q7EA 1H8EA 1T43A 4BNWA 5BY2A 5GIPE 5LMUB 1ZNQO 3KYBA 4N9WA 2Z1DA 1BJTA 2NZ2A 3OZIA 4D8YA 1R1DA 4MW6A 5TMBA 2ZBUA 3WLIA 1J1UA 1KAOA 2ZTMA 2FPRA 4WKGA 2CUTA 1XZAA 4IVQA 1JS1X 2XNSA 2MSEB 2X6QA 3ME5A 2GJAA 1G7CA 3FGNA 5D01A 2H51A 1MC8A 3DTYA 4PLHA 4DCTA 1QDUA 2FW1A 1BYIA 2K2WA 2PZFA 2OQRA 1O58A 1M75A 3CE9A 3HHEA 3M0EA 2Z2KA 4RA9B 1Y1QA 4RGYA 3R6DA 1HMYA 1XDBA 2IOFA 2R1UA 2YRWA 2ODNA 1RWNA 3L8GA 4L5JA 4PLTA 1NM5A 1O9HA 4E13A 5A2QA 5MN5A 5DCWA 2D13A 1WV0A 1T2CA 4Y2HA 4CLRA 2FTKE 5TGDA 2JATA 3ZWQA 1S8FA 1MF7A 4ZO9A 5I45A 4CMCA 4D02A 3E8XA 1KO7A 1B7GO 4JLVA 2XGOA 3JALA 4HS9A 2QQEA 5KNBD 4DN6A 3UJPA 2HREA 4AUMA 4RH3A 4XVUA 2NT4A 1KQFA 4BEWA 1LH0A 1V8ZA 1V1RA 1QTRA 3IAUA 5C8DA 3WZ2A 3QP9A 3TLYA 2YIDA 2X5XA 3HBMA 3RT9A 4B6RA 4D5EA 3RK1A 5LFAA 3W90A 1J8MF 2ZXFA 4F6RA 1RPNA 1ID1A 5HGJA 1R4NA 4JI1B 3SFZA 2F7SA 2R6AA 1ILEA 3GLFA 5KTYA 2KI5A 4IO1A 3L7KA 1I0ZA 2YWGA 4JASB 1C3EA 4W1RA 2BEVA 3WBBA 4WMLA 3Q2KA 3W05A 2QP3A 2QRLA 1P5HA 2BKUA 1A97A 1JKFA 2OXCA 4MGZR 3IP5A 1PCXA 3RF7A 3RAJA 2DM6A 4JT2A 1H9CA 4C08A 1M2VB 1T6XA 2AEMA 2AWOA 3QENA 3I52A 3A6PC 2JBAA 3DMTC 1VLZA 5CHEA 4F3KA 1XMJA 3IUYA 3THYA 3I9OA 2FUEA 2ZTSA 1Q2XA 2P2LA 4NSNA 2O7VA 3FHCB 3LYUA 3M89A 2RBGA 1E1CB 1ZU4A 3SPXA 2VDUE 3F98A 1RZUA 4ZT3A 2E6KA 4O2LA 1QFJA 5HA5A 1BGWA 3VH3A 5FTWA 5LD2B 1I4EB 4C4AA 2Q5JA 2FEAA 1CY0A 1IHOA 4YNBA 4Q7QA 1WO8A 1O5IA 2YWXA 2X9NA 1NW3A 3SYKA 3VJMA 3K70B 2ZRFA 4BKOA 4EWLA 4YMVA 3WICA 1IK6A 2B83A 5BPFA 3MRTA 4FYMA 3S2IA 4TV8A 4K5QA 4AN1A 5ITZA 2X8WA 4F84A 4YCLA 2UZ3A 1ZQ9A 4KXXA 3UWSA 1DTWA 5KREA 2DULA 2FFHA 1LI4A 4LNUB 1KTIA 3WLAA 4E0BA 4TYWA 1IAVA 1VL8A 1B6TA 1R3DA 1YJQA 3N75A 3RS9A 3WOVA 4BVKA 3WNDA 4F4JA 5C51B 1N9KA 1Q7TA 2FR8C 2HIHA 1Z6ZA 2JHFA 5LDHA 4LJAA 1F3OA 3HO8A 4KR2A 1FRQA 1N3YA 1S96A 3FDXA 5TRTA 3R9XA 1P1BA 3LYHA 4GMFA 2G88A 4B73A 4INZA 1JR6A 1OFGA 1QU2A 2XMRA 3RT1A 4QTXA 2QYHA 3BD9A 1DG1G 3C1UA 2XNCA 2B34A 3ANMA 4PLGA 4IKPA 5CT9A 4RYDA 4FJ2A 5FOSA 4CF7A 1SFRA 4S04A 3T5MA 1T5SA 2XOEA 3GN2A 4AVYA 1M1XB 1YO6A 4KNVA 1E59A 3REFA 3STUA 1BG6A 2IHUA 1R6XA 4IP0A 4YJ3F 4ESHA 4AQDA 1KPHA 3M34A 3EFOA 1TMOA 5CBKA 1AJEA 1TYCA 4K6KA 1CEEA 1YR8A 3BMOA 3GVCA 1RHJA 4JELA 2MCFA 2HT6A 2IIPA 3EFHA 3LVFO 4HADA 4DV3B 3THWB 2W2LA 1I7DA 2FPWA 3QYAA 4TKUB 2I54A 3B60A 2NQ8A 3TMKA 1M73E 4L50A 4PGAA 4RMNA 4BL5A 3BQ9A 1QTNA 3D43A 3BGDA 3KR9A 1X3SA 4Q3LA 5K0CA 2CDAA 1P1FA 1FNNA 4TTJA 4L73A 3TOZA 3GIWA 3HPQA 5IHPA 2VJMA 1A8IA 3RVDA 4JYAB 4CYMA 1F5NA 4ZAXA 3C3DA 5HE8A 1AMOA 2ZVPX 4IDEA 1OI4A 2P35A 4B81A 4DJJA 1JAIA 4Y8VA 5IABA 1ZL0A 1QZTA 3KIPA 4KPUB 4M7WA 5LJIA 4KQMA 3ZDEA 3NRJA 2FOIA 3FCEA 4GC9A 1NXWA 5C80A 3FGOA 4HDAA 1WNTA 1LX7A 2C4KA 4JQOA 1T4CB 2HK8A 1FUYB 1WKVA 5LZ5A 3BIOA 3AR8A 3TAUA 2QZPA 4L08A 2YUTA 2WJHA 3G88A 3T52A 4LTMA 4M0UA 3R8XA 4MYRA 3HY4A 3QMPA 2B35A 1KRXA 1V47A 2OXFA 2MOKA 5EIAA 3REQA 4CE6A 1DWUA 3K16A 2YFKA 1OWLA 1LS6A 1UPAA 5A7GA 3ROFA 3TI9A 1K08A 1RDFA 1EFVB 1IY9A 1UJ4A 4MWCA 5CM9C 5M3BA 5IAAA 1PJTA 3ER6A 1HFWA 1JEQA 4I55B 2JI9A 4G5HA 4TS3A 4MCJA 5JVDA 4BTVA 3AJEA 2WHYA 5AKEA 1AB6A 1DRWA 2Q5OA 3D5EA 1S01A 2JRLA 2QTMA 4G9GA 3WDSA 2E48A 4ESEA 2HYIC 3TZQA 2FRVA 2ZIGA 4ZDIA 2C3YA 4CKCA 3IUMA 3VDMA 4PZLA 3W8EA 2FLKA 4IAOA 4R3NA 4GRIA 3KSZO 3A4LA 1Z6QA 3CXUA 5IKOA 1H66A 1X38A 4J3JA 1PT6A 3E7WA 3PFGA 2X0FA 5AW8A 4YYZA 2Z57A 2CV1A 1RQ2A 5CX1B 4ZEXA 1X7YA 3EASA 4N18A 5EPUA 4Q02A 1UCFA 1UKBA 4EO4A 3SR4A 1SU8A 5EIEA 1MB4A 1VL6A 3LI2A 1XUOA 1NL3A 3H1FA 2J3DA 4JYCA 2IZ7A 4UU8A 4LWZA 3EIWA 3P20A 3Q9UA 1YULA 5BSTA 4RWZA 1DT5A 1V16A 5I3CA 3IILA 4W6ZA 5B3AA 5GAJA 1SUWA 3P8ZA 3RWMB 3ZC3A 4K2AA 5BT8A 4L9WA 1KZ6A 1N8KA 3NPMA 4D5GA 1DKLA 3B9BA 2BVNA 3WLOA 3EGOA 4ETNA 3ICPA 4FXPA 3VQTA 1UT5A 4DCUA 2I67A 2ACEA 5ICMA 1Z5NA 3FSGD 3P9RA 1QHSA 2V9CA 4G4IA 4BP9A 4LXQA 1DADA 4MS3B 3BXXA 2G5PA 1N5OX 3A26A 3PWSA 5DM70 1GV1A 3IUEA 1EE2A 1VPDA 3H04A 3RIMA 3BL6A 4OSPA 3KSBC 1BJRE 1PK7A 5SV2A 3B1XA 2VJKA 1AQNA 1VMIA 1QX3A 4AXBA 4BO0A 1RACA 2ZGVA 2ZIZA 5BSRA 5KDDA 4Y2VA 3FWHA 4N54A 1GGMA 2XUZA 4ZOAA 4DV7B 3BCHA 2XCUA 3WB9A 3PWZA 4YAKA 2C54A 2DVMA 4H0CA 1O4WA 4MYHA 4XIIA 1FVHA 3V32A 1EFTA 1GL7A 3HKCA 4PLCA 4CEIB 1XX6A 4PGHA 2ZUCA 2O8FA 1T1RA 3P9QA 4AW9A 1UQTA 2XGGA 4PZYA 4R51A 5E38A 1TTTA 3BF7A 3K9LA 4HGNA 1YKGA 1Z5GA 4A1OA 2Z1NA 4MUXA 1MC5A 4M0FA 4NIMA 2V59A 3BWVA 2XCRB 1QH9A 2IE0A 1ZN9A 2QF7A 4XJXA 3ZLJA 1WPQA 3UT6A 4O2AA 4XIFA 1JIVA 1A9PA 3AUAA 3RBXA 2VYVA 5LKAA 1EA5A 3WB1A 3WWPA 2FHSA 3KQHA 1ZA2A 3D6AA 4EQZA 1E6KA 2FUKA 4NFYA 4O4LA 1R9JA 3R5FA 5SYMA 3GROA 1L7NA 3AI3A 1TO2E 1KP9A 2QJOA 3KB8A 4TWIA 2PXAA 3P5SA 4G0VA 3PRHA 1M7HA 2J0EA 4WY2A 2O07A 2NG1A 2F8SA 2W6OA 1ORDA 3KE8A 5K0ZA 2WFLB 3LUDA 2XNKA 3QG5A 4EVSA 2BV3A 2NXNA 1YS1X 4MARA 4HAOA 1A4UA 1N2IA 3CLTC 3ZWDA 4IM7A 4C22A 5J4KA 3MD9A 1P2SA 2ZRHA 4EY5A 3U16A 4B2LA 2CFTA 3DJFA 3LX8A 4RPJA 2XA1A 1XMOB 4DG5A 3RSGA 2P5TB 1O94D 1I2CA 2I2AA 2VTDA 3LYLA 4QJ3A 3OOSA 2LP4Y 2HF7A 3HWX1 4PG5A 3CX8A 1BHO1 3PFWO 1FE8A 1OXTA 2VPWA 1CD5A 5A62A 2VF7A 1R4ZA 2ILVA 3A9UA 3IERA 4U7TB 4F5EA 5DT2A 3HWRA 2GPAA 2YJGA 5GJCA 4I36A 2IKSA 2QLJA 2X4GA 1SC9A 1NJ1A 3FRIA 4TKVA 3EQ2A 4EG0A 2OFFA 4OGKA 3WWCA 4IFEA 5KC9A 4ZRNA 4I1SA 1IU9A 5I9SA 1A76A 4JMPA 3EWIA 3MTDA 3O93A 2B3DA 1T9BA 1P8AA 2VTKA 3BMCB 2P8SA 1F7VA 3IIKA 5AW9A 3Q8MA 3MVEA 3M5DA 5EXEA 5ED4A 1L4BA 4ZCMA 3QPUA 3AF6A 1AIPA 2PH5A 1N0WA 1PZEA 4KMOA 2H9IA 1TO1E 4NF2A 4OFZA 5LXTA 3ZS8A 3OEEA 1P5ZB 2OO5C 1AQLA 1EXNA 4AKGA 4YP1A 4R9NA 3KOXA 1G66A 3MHPA 2ZULA 3DDZX 4HL6A 3K9HA 4UULA 1E0AA 5DYIA 4PC3A 2PEYA 4MPPA 4URWR 3NNSA 1TM3E 2WTXA 3GLGA 3B8EA 4NENA 1X80B 4NCKA 3C45A 1QFSA 3U7EB 4PPYA 1V7CA 3W2FA 5CCEA 9LDBA 3DC2A 1U7DA 4FWBA 4WT7A 1K7FB 1KI9A 4D42A 3KEMA 1FP2A 4LRWA 4QDUA 5FL3A 2XQJA 6NULA 4WUVA 5KBYA 5DH9A 4RXTA 1CY6A 3HGMA 3VFDA 3K0SA 2IYOA 2OQIA 3R09A 5L7YA 3V7FA 3R0IA 1CETA 4AIIA 1I1NA 4H7KA 3FW1A 2CNOA 2UXCB 3Q6MA 1G2OA 1XQYA 4BQNA 3ND6A 1E7WA 1ODJA 2VK4A 1VQ1A 2PD3A 2HMWA 4Z9XA 3RFCA 3I92A 2HHAA 4CCSA 1A50B 5L3RA 1N75A 1PT8A 3LNTA 1IQUA 2P75A 1ODLA 1JDUA 2HU7A 2RK3A 1D4AA 2Q8PA 3AFNA 2WMDA 4EO7A 4IDFA 8MHTA 2RGBA 1SG6A 4RPHA 2ZYRA 5EKXA 5KPJA 3Q8KA 1GDDA 2BFCA 4XX0B 4YMHA 3I2JA 4D57A 2CHGA 5B36A 5CA1B 1BXRB 2VAWA 5BV8A 4MW1A 2GN9A 2ZE6A 1QHHB 2RJ3A 4IX1A 1AS2A 1NN0A 5LC1A 1E3MA 3NOXA 2IYEA 4DIUA 4UE6A 3NHBA 1IPHA 3RSSA 3GEEA 4WK6A 3O92A 2C00A 1YU6A 1OD6A 2GA9A 5L6MB 1ZAKA 2H59A 1U28C 5BWMA 3DHNA 2Y0CA 1RE0A 3QMVA 1GY8A 2R4QA 3RVLA 4DQUA 3D0KA 1CZHA 4IXNA 4MNTA 5AW2A 4QBIA 4G97A 4Q4JA 2X9VA 4BNNA 1VLQA 2AF3C 2ZSUA 3FVVA 3QV2A 5EMKA 5IXSA 1RWXA 4MW7A 1UP6A 3QE0A 2NSJA 4HOYA 1B8OA 1EUCB 4XOIA 2DPXA 4EABA 2OPBA 2IS1A 4NDZA 1C1DB 4YT4A 3U7GA 2VUUA 4G5QA 2EJTA 3NHFA 4IOMA 3ZLUA 3ZIAA 2WE7A 3GJYA 3BK7A 3D8UA 3KBOA 2CLKB 5EIWA 1W5AA 1Z6AA 2NTNA 3H65A 2GX6A 3KT0A 4MO2A 4NZZA 3OBBA 3CFYA 4KG7A 4NU8X 4E5UA 1UPCA 1AKWA 2D4AA 1UADA 3I05A 2DFVA 1FQWA 4Y2QA 5DOZA 5CDFA 5CGQB 2KLHA 4JBGA 5M2QA 2GF0A 2C2GA 2P5UA 4EFLA 1JR3A 1US8A 1Z29A 3SC2A 2P30A 1ZUWA 3TNDA 3PXAA 4NCJA 4C3OB 4RHUA 3UT0A 1L8OA 3OZUA 4LZPA 4OSOA 1VG9B 2FFQA 5TT0A 4X0EA 5G1NA 4ON9A 3F2VA 4M83A 3WZMA 4V03A 1T5DX 2NVUA 4FMDF 1FS4A 4XB2A 1FXUA 5D3MB 2CLCX 5TB5A 4DSOA 1R64A 4XVCA 1VMKA 1VPWA 3Q9LA 1ADFA 2QB5A 2V6JA 3W6ZA 4KNWA 4REMA 4BFXA 5LNK1 2Q3BA 4P2BA 1U2TA 3CS3A 2OCAA 5EN4A 1NA5A 3DAYA 4JA0A 5DNCA 5L3QA 4IDAA 4UARA 3LKZA 1HLFA 4KXFB 4XJSA 3DAFA 1PS8A 5IBQA 1NJ6A 3RHZA 2LCIA 2ZU6A 1YBMA 5E6SA 5GONF 2AXEA 3OSZA 4INPA 4O59O 3DE7X 4O2RA 4M60A 3RJZA 4BKPA 4IIUA 2GAJA 5KWSA 4MPJA 1GQSA 4OXIA 4X93A 5A3QA 4Z53A 5FHQA 4G0ZA 1L5ZA 3E9DA 1N34B 1GGFA 1KZ4A 4CEJA 3QIAA 4HEQA 5GGYA 4EBFA 4AX8A 5FPKA 3LP6A 5AVVA 2YHAA 3OOJA 1U0JA 1CY1A 3DV0B 3S7ZA 1QE5A 1VTKA 1I51A 1QAOA 3AFIA 1JVNA 1L8QA 5TXGA 3UMRA 2NU8A 2AJLI 4G5GA 3I6MA 2YNMC 2GK4A 2C03A 2WVJA 2X8JA 4EX7A 4ZYLA 2DR3A 2WRZA 3JZFA 4KR0A 4RFVA 1NVGA 3UXMA 1F20A 4HXFB 4Y1EA 1XMQB 1P1IA 4U9UA 4IMRA 4OKIA 4P5PA 3TIGA 1V6AA 2QN3A 3LY7A 1NJ8A 4Q7JB 2O2IA 1VRWA 3V6LA 5LUAA 1GO2A 2VRCD 1L5YA 3I5AA 2I2CA 1I3LA 4AN0A 4JZYA 3SICE 2C1XA 1ZYUA 2A5DA 2AR7A 3O1JC 4NDAA 3T54A 1MV8A 1XTVA 3Q3JB 1FSPA 4BNHA 2IVFA 2CT8A 1AQIA 4EECA 1YRYE 4IH1A 4RK1A 3RANA 4FDTA 2CNWA 2EARA 2O59A 4EG3A 5F1KA 3DZDA 5K6AA 1HDCA 2CUNA 1U8FO 3ZNNA 2EC5A 2QTTA 2O20A 1CZLA 3KELA 3WO0A 3GGPA 4F2DA 4N39A 1Z83A 3IAFA 2G6TA 1DAKA 4OHXA 2YY5A 5C8VA 4BX0A 4M55A 3OP1A 1BN7A 3OY7A 4MV4A 1DRVA 7AT1A 1N1MA 2OMKA 4RDCA 4U02A 3EXFA 4P4SA 3JYQA 1GZ4A 1OPRA 1QYCA 3KQYA 5BORA 1EHYA 1R74A 1XC7A 2ZPAA 3I28A 5A4DA 4FX5A 5IJ0A 3CWCA 5CLJA 3O7WA 3L1HA 2BFFB 4PCVA 2IU0A 4C6RA 1RTKA 5CD1A 5JLAA 2QP9X 4G86A 4KN9S 3I0ZA 5ERXA 1FQJA 1CTQA 2GETA 4Z2YA 5KTKA 4X6YA 1VCMA 1B0UA 4F3RA 1OCEA 2LDXA 3UMMA 5JFGA 6REQB 2O1EA 1N8NA 3JPYA 4IIVA 4O8CA 4XGIA 3NIBA 4GLBA 3ONNA 4B8WA 4K2HA 3IAM1 4N82A 4BVFA 2R97A 3UMCA 2IDZA 4B9EA 2DU8A 2QOEA 1AH2A 1XEWX 5LA6F 2NUAB 2I3AA 4KK4A 1GNLA 3KOMA 4NTZA 2HLNA 2AKAB 4R8KA 2B7BA 1U2RA 2XNHA 1BU8A 2A1UB 4TVBA 2MR6A 4H3HB 4EA6A 1HE5A 2VNHA 1MNQA 3SKVA 1U8TA 1ZW6A 3NGLA 3TLXA 2HSDA 3DHWC 3AHHA 3KT8A 4I50A 1BYUA 3ZW9A 1RP1A 1W5EA 1GZVA 2WNHA 1N6IA 3NNDA 4IS3A 3FTNA 4FSHA 1MG0A 4D43A 4KMRA 4Z51A 3PGXA 1R0KA 4L0MA 3ZY4A 3COYA 1T1GA 4BMOB 3DM9B 4AMUA 2X1MA 1H6AA 1R0RE 2BR5A 4L4UA 4HNRA 1FJGB 1JE0A 2ZETA 4N5MA 4DTCA 3LG2A 1BD4A 5CLLA 3CT4A 4RS3A 3D7NA 5ALDA 1ABBA 4LIPD 2VH5R 1DC6A 3GCXA 4TN5A 1H2ZA 3CW9A 1QVWA 2DGDA 4B75A 1C1XB 4L28A 5DISB 1WUHS 1RFLA 2Z4RA 2ZBPA 3ML1A 3VVBA 4D4JA 5JJ5A 1ZD5A 2D7CA 1PI3A 3W4KA 4D45A 1PNVA 1UKVY 1KAHA 3U4AA 3DE0X 3X2SA 2XB4A 4JP2A 5DLDA 2X13A 3OPYI 2IPAB 3Q7QA 1FY2A 3LLSA 1WXHA 1U0SY 4W7IA 4W7SA 3RVJA 2AFHB 4YIHA 1C7JA 1NAIA 1O6ZA 3NVKI 2BGIA 1QGOA 4WFJA 4UBJA 3CEAA 4D3ZA 2QLNA 1RQRA 1Y5IA 4M0DA 3F4KA 4J2HA 3V2GA 4J0IA 4JS0A 1T5OA 2HRQA 3G7NA 1D2NA 2BFNA 3ROXA 5DM1A 2EBWA 2Z0MA 4JENA 3VPAA 4P80A 1HDRA 1CU1A 1TQHA 4KFTA 4OLHA 3IV7A 3GNQA 1SUEA 2X5JO 4A9AA 1S9HA 4CRWB 1VHJA 2ZAMA 1GADO 3RJTA 1OB5A 3OEHD 3NAGA 1G5PA 2FN3A 1NI3A 3KETA 2VQDA 4FYYA 4PC7A 4AUKA 3UMVA 5F7ZA 4BLQA 1PEKE 2IDJA 1BOFA 3KVRA 3NPAA 2G17A 1PV2A 3LZ6A 4ZO7A 3OQMA 9MHTA 2BE9A 5JMPA 4UZFA 3O5AA 1U04A 1XAHA 4C6SA 3VO1A 3VPBA 2P6RA 1FQOA 1GQRA 4F4IA 2IWRA 1UMCB 2XI4A 4UD6A 3PI7A 1MNAA 1SJ9A 3VR6H 3T1YB 1W5BA 4N40A 1NXXA 5BV0A 2I4RA 3WLHA 2YC4C 1A8PA 3EXIA 2V03A 1CB7A 4MQFB 1WDLA 2NZ8A 3U9LA 1YZQA 2CLEB 3AYXB 2VZLA 4IJ5A 1HKHA 3VC2A 2OGWA 2ACWA 3JASB 1O77A 2UVPA 3AEXA 1BU5A 3NHWA 5EJEA 3NT5A 2R5NA 5EE9A 5BNFA 3LCRA 3I5YA 1U2DC 3DONA 2YJ3A 2VP2A 3LSYA 3DMTA 3SI7A 1BGXT 3PSHA 5SY4A 1NYTA 1A7UA 2ZRPA 3A6LA 1WSWA 3FWNA 4HGZA 3BVPA 3QSGA 4G1VA 1QIMA 3AFHA 4PS1A 2PY6A 3IT2A 1KEZA 4PYRA 4B79A 4D41A 1N3LA 5LWQA 2JBWA 2R6R1 3WKAA 1VFNA 1IULA 3TOXA 4Q48A 1EFHA 4DL9A 4HB4A 4CIYA 4H7FA 5KYYA 3P7MA 4O4HA 4GI3A 3DYVA 5AVTA 1Q1NA 1TJ5A 2ZRDA 3C3CA 5J23A 2C7VA 2ZKIA 3QEMB 5LU8A 3NDBB 3IH5A 4NH4A 1JZTA 5KNCA 3L01A 3IE1A 1BHSA 2Q4BA 5EHIA 4DDHA 5DPMA 5A3SA 2GN2A 1UOOA 2BBSA 3A32A 5DNWA 2H4XA 2AI3A 1XTSA 1DWQA 5I7HA 2FAXA 1YS6A 4PR3A 1PHRA 3HZZA 2UXDB 2Z58A 2NUPB 4YUVA 3CJQA 2VT7A 4QUHA 4YV0A 1VHLA 1JIQA 2BCJQ 5FV7A 2PKWA 1KI6A 3C24A 4ZQHA 5JSYA 3U0BA 3FPJA 5DYNA 3BTUA 1UP7A 2X1VA 2PJRA 4LFAB 4BRSA 1JEYA 1ZC3A 1GGEA 2H17A 3NGXA 4Y6LA 2AYXA 5C8XA 1DQRA 3FR7A 5IKEA 3AF2A 3LRPA 1E98A 1HZJA 4PXSA 4ZEWA 1HDXA 5F9MA 1NUTA 1N7JA 2XPCA 3GT4A 2HLDA 4C30A 1BEEA 1XDDA 3QPDA 1F5SA 1LDNA 1A88A 3E2IA 4NBKA 3SJZA 4AQ7A 3M3HA 1TW3A 3PVZA 3HVKA 4UZEA 4DMHA 1FIUA 1C9YA 3B7PA 3S4YA 4YMWA 2JKYA 2FMTA 3ZWVA 3QU2A 4LQDA 5BYJA 1YGPA 3WHIA 2G1PA 5B6IA 3M6VA 1GUAA 5EUBA 5FUBA 1BW9B 2DBRA 2WAOA 3UY4A 1CDZA 5DX8A 3C1AA 1T2VA 4D99A 2GKGA 2XKBA 2YJ5A 2P9QA 3PNVA 1FS5A 3H3JA 1ZVMA 1LKZA 2F90A 2X7JA 4ROTA 4HNQA 2P5YA 2XQIA 3RNLA 4TTRA 3G17A 4RKFA 1GEEA 4A8JB 4ICIA 5HIAA 1VHTA 3G8AA 3GFPA 4JCCA 3SLGA 1T35A 3PNQA 4UTVA 2VDJA 4RD4A 5I48A 2O50A 5LMCA 4EVRA 1RABA 1ZJZA 1SCQA 2ZQZA 2E4VA 3I62A 3K0HA 3L41A 2RARA 3DLHA 5EWLB 1YR9A 5E6UB 3TGLA 3U5TA 3BTVA 3DH0A 3ABOB 1QR6A 1ZSYA 4HVTA 3RVBA 4TLAA 2V45A 3B89A 4DARA 2J6CA 3NYRA 3FPBA 4FHCA 1GILA 1P2DA 2JGKA 5U9CA 1W0KD 3Q15C 1Y8QA 3IEVA 2BUCA 1FTQA 1YJCA 3DTVD 3A6FA 1VL5A 1M7BA 2FSIA 3K72B 3PVSA 4MAMA 3H86A 2W2OA 5IUKC 5F4ZA 3ZGNA 4D6YA 3I6IA 4YTEA 3WGYA 2AN4A 5BN3B 4CLDA 2HO4A 2QL6A 3ENKA 3OKCA 2WICA 3ZYCA 5B37A 3IEXA 2Y0BA 4GS5A 3R20A 3N2GB 3VBEA 5K0GA 2PS0A 4Q9HA 4MA5A 4O4JF 3CUUA 3JQ7B 5SZJA 3QEKA 2PGOA 221PA 1NUQA 3KR2A 1JSLA 1Z68A 2GR9A 1M0SA 2Y99A 5DEOA 2GCOA 5BQOA 3T3PB 4H17A 2I1VB 3OE7A 4KPFC 1U3TA 3SIPA 1D6SA 2WF9A 2WOOA 4O0LA 3JQGB 5HEKA 2VF2A 2CK3A 4C0QC 5TQ0B 1FMCA 1V9SA 3EGEA 5DBIA 4II7A 1A5AB 3VZQA 3VHLB 2D2EA 1CG6A 1X7ZB 4D0SA 4YCSA 3PA8A 5B1SA 2G1JA 1C9EA 1NBWB 5F2OA 4NBVA 4F3TA 1IQ0A 1J0XO 1GTSA 4QLAA 2VXBA 4JITA 3RWOA 3DMRA 3OEYA 4E1AA 4JJGA 1OBCA 2WUFA 1Y4SA 3PQ7A 4PZPA 4JKYA 4XWTA 5DT9A 1XQWA 1M66A 2O7QA 1HTTA 5TF0A 4DJTA 3UM9A 2FJ0A 3C97A 4REOA 4W1QA 4LWQA 5BN1A 2H54A 3DCYA 3AYZB 1L8XA 3VYUB 2IXBA 2FPPB 3LMKA 3GA5A 1MLDA 3TK1A 1WUJS 4HX9A 3TL6A 1Y9EA 3KQLA 4RKQA 1QP7A 1IH8A 4QEKA 3TJRA 2X0NA 1FUEA 4EG6A 1N2CA 3GQBB 3IP9A 3JQ9C 4OFWA 5MF6A 3A3KA 3WNZA 3I9NA 3WGVA 2OLEA 4M87A 1FFYA 1L7MA 3OT1B 3IELA 1P0PA 3SOZA 4W9MC 1ZS9A 1WE2A 1I2AA 2QDXA 1VDZA 2JFVA 5CJJA 2W6ZA 4MW5A 4LE0A 3VHRA 5JNSA 1D5WA 1EH5A 2O4CA 3FUWA 3P32A 1ZGZA 3DO8A 3AR4A 1G8SA 3AEUA 4F5ZA 1J4AA 3E9YA 4U6NA 1ELOA 1ZLXA 5J4VA 1O0BA 1S2NA 2ADMA 2YV5A 4D2IA 1ULAA 2PMBA 4QTTB 1HKUA 4UUBA 3QE2A 2X0EA 5JYBA 3R3JA 4PLPA 1SB8A 1U0GA 4YRIA 1SHUX 3ZE9A 1KYQA 2HBYA 4BJ1A 5CDYA 3KKLA 1WU8A 3QXSA 3A1UA 3M4JA 3KYJB 2G0TA 3FFAA 3JQFC 4M0MA 2WC1A 1C4XA 3MF4A 3RC2A 3UJ3X 5AVWA 5E4YA 2D0OB 4FK8A 5BR4A 1IJBA 2O06A 2JI4A 3N7AA 2HHJA 2JGFA 2AXQA 5HF5A 5MHTA 3EBPA 4KN8A 2X0RA 1PBNA 2ZJ5A 4INAA 3ZE6A 3DL4A 4F3CA 5ALPA 3K20A 1R6TA 1QCCA 1A04A 4D1YA 3W3AH 4ENUA 1Q6ZA 1UBUS 4NABA 1LTHR 3E5NA 4Z99A 1P80A 1FSZA 4X97A 4RVFA 4NMXB 4PSUA 3KQNA 4XR9A 5JJBA 1OQAA 4UAVA 3UK2A 1ZD3A 1ABFA 4BB0A 4X7BA 3A6KA 3RABA 1BWRA 1Q0RA 1FB5A 1DKPA 1JG2A 4ZAWA 3ZBQA 1J2EA 3OQHA 3OU2A 2OBLA 1CLUA 5J5AA 2JLYA 2HJ9A 3VNQA 1CVLA 2MMGA 4RIGA 4ZMBA 3E7PA 4HNTA 2Z08A 4D4KA 5JEDA 1FC0A 3WAKA 2HY7A 4TL8A 3ZR4B 4DWVA 2YH2A 2QJTA 1B26A 3BGOS 4B7AA 1GOTA 1N3BA 4C2TA 1YNOA 3T6KA 4PNPA 3UTDA 4TQAA 2FPLA 1W9MA 5IKMA 2UZ4A 1Q0HA 4KITB 3PIDA 1G3MA 4HDOB 2W6PA 4F4CA 2GAAA 3GZTB 2BBTA 2XWPA 2A4KA 2TMYA 1TK2A 1VE3A 3GLQA 4G23A 5TF4A 4F92B 5JD3A 3ENQA 1E1YA 1MW9X 1TOAA 3CF2A 3OZTA 4BB6A 2J7KA 3KXDA 4F71A 2H1RA 4K03A 5L40A 3DQZA 1XRMA 3A8TA 1E2IA 1NN5A 2OO5A 3C6YA 5J1SB 4Y2RA 4C78A 1GRRA 2VPTA 4EYEA 5I9TA 3KP1A 1Z0ZA 1Y6QA 1Z5OA 1PL0A 4K88A 1IHYA 4UTZA 1Z38A 3SVZA 3KDSE 3FOZA 3OD1A 5E7JA 2AG8A 2X6TA 3JATA 1QYVA 4LXIA 1YRQA 1CB0A 2VZEA 1JFFA 5CGZA 3UPTA 2JG3A 5KNDH 4TLLB 1P33A 2I9KA 4QXAA 2BM0A 3ZCXA 2Q45A 1IZ7A 1IZ8A 2PGLA 1RWBA 2JHCA 3DE1X 3DPSA 2HA0A 2QW0X 3T9CA 3UXHA 1LU9A 4IUCS 4HY3A 2GKOA 2IYTA 4M9QA 4OBEA 1FP1D 2PSDA 3VKUA 1PS0A 1XOIA 3KZOA 1GCOA 1I3CA 4IF4A 4ND2A 1KOLA 1H8HA 2W2MA 3GZ4A 3MOGA 3RTAA 3P96A 4PSAA 3T1TA 1VLHA 1YD7A 1VSBA 2L19A 2QN9A 3TRFA 5L53A 1UZAA 3QLJA 2WWYA 4NR0A 1XEXB 2CMDA 4M9RA 5FV4A 2XGJA 3JYPA 2GTIA 3CZCA 2IY7A 3QX9A 2PG3A 2QIOA 4UCWA 4PINA 4NV3A 3OQ6A 1NE7A 5FBQB 5KINB 2WU8A 4HAIA 1Y8ZA 4LJ7A 1NX6A 1QVVA 1MH9A 5ES4B 4PWYA 3MWEB 4BFYA 3F0TA 5BNTA 5A9RA 4JAVC 1RI2A 1PHPA 2Q0QA 4O25A 2ZCUA 2OUIA 5ALWA 4TV9B 1G98A 2IELA 3OLVA 4QX6A 5B1IA 1NIPA 1BCRA 1DJMA 3CC8A 1SG9A 4OJQA 4DQDA 1BMTA 3HCRA 2ETVA 3UHFA 2GBGA 3PHLA 1DXOA 4GICA 4N65A 2JJ1D 3IV9A 4XCQA 3WGQA 2W6JA 3OCVA 4WZBB 4R41A 4ASUD 4KFRA 1AHNA 3QTLA 3WYNA 1TM2A 4ALMA 5DMHA 1NZDA 2P2NA 3AW8A 1LSUA 3BWEA 3TW8A 1RADA 5JOQA 1VKNA 3BHIA 3O84A 4DV0B 2NU9A 4K6OA 3TAHA 5BRNA 4K6GA 3D4LA 3R7WB 3EDYA 2GNOA 4IEEA 3S28A 1JZQA 3I9MA 3GRPA 4UM7A 2P3SA 3QFTA 4CKEA 4DCJA 5KX5F 5DHPA 5KYXA 2HF9A 2APJA 2ZWMA 1T0PA 1T2NA 2R66A 1WAMA 3DBOB 2JHPA 5KTOA 3Q9NA 3IBTA 1QE3A 4WY5A 1UBSB 3ET5A 4GAEA 4U9IS 1RP7A 2WEKA 2ZUBA 3ZHOA 9LDTA 4RABA 1EX6A 1E96A 2WDPA 4ZHSA 2FW9A 4OTZA 1A8UA 2AR9A 3EMDA 1IJEA 4K9QA 4B6FA 3PDUA 1OKKA 5FCDA 2C61A 3HJBA 3FPSA 3ITEA 1Z4KA 1DDOA 3F8SA 4LXXA 3MWGA 1BXGB 1J49A 2IZZA 4AYXA 3MLAA 4I0WB 5JSKA 4Y7DA 2NO0A 2WV7A 4XDYA 4F9FA 4I9HA 2GAFA 1IMJA 4KO3S 3KR1A 3MNFA 2PGXA 2E5WA 4RKRA 1E20A 2QUJA 3JD2A 4MVXA 5K8VA 1MVLA 1DCFA 1RYHA 3AVPA 2QX6A 4PS0A 2ZB3A 3F9RA 1RWWA 3FR8A 1K06A 4MWTA 1VXOA 4KXYA 3RU9A 5I8WA 4X71A 2DFTA 2FEXA 2XMBA 4TTAA 1P7PA 4KSBA 3OO0A 2FP3A 1FF9A 4MUBA 4PZ9A 4Y6PA 5GZ3A 4JYBA 5SICE 3NM6B 1RYNA 3ZLBA 5EOVA 4GP9A 3RB8A 5B3LA 4BNXA 3I61A 4RS4A 1OX6A 2NPOA 4IOJA 1NRXA 1PG2A 4KWEA 2OYSA 3SX2A 1G21E 5J2UB 5DXAA 3C3BA 3I0MA 1WUIS 4KTVE 4QEDA 2AOWA 1C14A 3VO9A 4K7JA 4TRNA 1D7OA 1KNQA 1L4UA 4X8HA 1IZZA 5JSFA 3SIXA 3PHJA 5ELLA 1G6OA 3ROZA 4G6ZA 2XQKA 3O26A 3OM1A 1IM8A 2CJYA 1O95D 1Z45A 2Q5QA 2BI4A 1XLUA 1K2VN 4UM9B 5CDTA 3ZXIA 3ZUGA 5EJ5A 1QNFA 4CN9A 3SXUB 1TVMA 2O0LA 1QV7A 3VSEA 4O2BF 3DWFA 2CDNA 4RJLA 3K94A 2X3UA 4H16A 1BKSB 4GSKA 1YFZA 3TMYA 3EUWA 3TG2A 3BFVA 3TPCA 1SXJA 4X92A 2H1LA 2H65A 4L5BA 4Q39A 4FN4A 1BS9A 4CLXA 2HMUA 2EDAA 4NU5A 4QDTA 5E1BA 4OHVA 3FWKA 4ZVLA 2B21A 2R6CA 3TBFA 3TZBA 3ORYA 1YA6A 2H2GA 3SOPA 1SHLA 3T7CA 1CR2A 5IEJA 2EFCB 4D9HA 2GYYA 2RGDA 2YNMA 4JVOA 2ECQA 1XT6A 4GG1A 4P4LA 4RY9A 1IBCA 1HL7A 3G0BA 1YHZA 2FX2A 4CMEC 2H08A 2FLWA 3HL4A 4BVHA 1WU7A 4Y6RA 3SG0A 4Q6BA 1LK7A 4I6EA 4ME6A 5PGMA 5C8YF 5CLFA 4Q00A 4LSZA 4PTZA 2HNBA 3GELA 4EUKA 1RHKA 3N8GA 1PQYA 2VUHB 2E18A 4IOLA 3BCRA 4QC2A 3UN1A 4YJ2B 5IVPA 1XD8A 4XJTA 3A11A 4OHZA 4BLOA 2EEZA 1ODKA 3FPGA 3GUYA 3NZEA 1I5EA 2JIDA 1YIDA 3DV2A 5H1YA 1QYIA 3KB1A 5FWAA 5THKA 1DWPA 5LQCA 3H5TA 5IFLA 1OLSB 2PD4A 2Z8YM 1P7VA 2M32A 2WVGA 4PRZA 3VTAA 3UWMA 4ANFA 4MVJM 2I4IA 2C5GA 2WD7A 4MS4B 1PJ3A 1YR1A 3PDCA 4R1PA 5FLYA 1J0BA 2FSSA 5F12A 2I1QA 1I01A 3LJKA 3WNBA 1R00A 1XZQA 3H6HA 4OA8A 2VZ0A 1MN6A 2WWTA 1CXZA 2RMKA 1V48A 2CFOA 2JFUA 3CJTA 3CLSC 3RBAA 4AU1A 1GZ5A 3BSFA