4XJVA

Crystal structure of human thioesterase 2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
216
Chain Sequence
b'ATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-acyl fatty acid synthase thioesterase, medium chain
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal Structure and Substrate Specificity of Human Thioesterase 2: INSIGHTS INTO THE MOLECULAR BASIS FOR THE MODULATION OF FATTY ACID SYNTHASE.
pubmed doi rcsb
total genus 61
structure length 216
sequence length 241
ec nomenclature ec 3.1.2.14: Oleoyl-[acyl-carrier-protein] hydrolase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xjvA00
4EY7A 3HACA 3WL7A 5FV4A 1BROA 2OLEA 3LP5A 1A88A 5D3KA 2WHPB 3DYIA 2OGSA 3O4HA 2O7VA 4ARBA 4LXGA 3O4JA 2ZJ6A 2JGLA 3GROA 3YASA 3IB3A 4G8DA 4UFOA 1DQYA 3WWEA 5HF9A 2BJHA 2IX9A 3O95A 1YB6A 4H7DA 2XUFA 2B9VA 4KR0A 4OUKX 4H0CA 5ALMA 1QIJA 2O2IA 3D0KA 4EY6A 1BN7A 1QGED 5CW2A 4X97A 1XLUA 3NUZA 1UFOA 3GZJA 1U2EA 5H3HA 2DHDA 2PSDA 3C6ZA 1MX1A 1SOMA 1X70A 5ALGA 3GA7A 2BAGA 4QLOA 2HDWA 1CFJA 4KE9A 5D6OA 1QIDA 1Z68A 5ALHA 1CUHA 3DOIA 3DYVA 1N5MA 5SYNA 2VF2A 4IH1A 1CUCA 1XZDA 4NMWA 4RGYA 3C70A 2CUTA 2WHQA 4C4ZA 2RHWA 5DWDA 3ZPXA 2EDCA 1WB6A 2GZSA 4E14A 3NOXA 1GPNA 1CV2A 4K6HA 1VE7A 1LPOA 3I2GA 1VOTA 1YA8A 3QM1A 1E89A 2XMSA 2XMDA 3W06A 5AI9A 4W9RA 5AKYA 3RKSA 1Y7HA 3AZQA 4GLBA 3WK6A 1HKHA 1JT2A 4Y2RA 5ALTA 4UFNA 5KWIA 3F96A 4DMHA 4PQEA 4U2CA 1YAJA 2VSQA 4FLFA 5ALVA 3IVMA 3WWCA 1LPBB 2WSLA 4W1RA 3BWXA 3C45A 4KE8A 4C87A 1B41A 5DYTA 3D59A 3WK9A 1K5PA 1PV1A 3SWWA 3I1YA 2V97A 2AXEA 3DJYA 2B20A 1XZJA 3V1KA 2YASA 1W76A 4EZIA 5E4YA 1P0MA 3HABA 5CT9A 1HL7A 3AIMA 5C8XA 3PUHA 1MJ5A 4BDTA 4BRZA 2OQVA 2ACEA 4DMKA 1Y37A 3H2HA 4QZVA 2WUGA 4J3JA 4TVKA 5CTAA 3LLCA 1R9MA 3F9CA 4DGQA 4GECA 1AZWA 2CJPA 4LHEA 4P92A 4E46A 2VJAA 5AO9A 1EB9A 1JU3A 2HA4A 4FDMA 5E4TA 1XLWA 3HXKA 3V1LA 3R3ZA 1I6WA 2QMQA 3H04A 4GI1A 3HC7A 4DSZA 3HLKA 4YPVA 5ALZA 1A8QA 1ZI6A 1MN6A 2JBWA 4U2BA 1MAAA 2QOEA 3CXUA 4JUIA 1DWPA 4Q34A 4CFSA 3HRHA 3QZUA 1QIMA 1TCCA 3STXA 2DCMA 5ALEA 1WHSA 1SCQA 5BOVA 4HXEB 5YASA 4EB0A 4X95A 5C8VA 1IZ7A 5EI5A 2XQGA 3U0VA 4X92A 4WDRA 3I2KA 5K3FA 3E1GA 5A6VA 1Q83A 5LZ8A 1CUAA 1QIGA 4XJVA 1ZI8A 4F0JA 3QBJA 3VJKA 4PW0A 2HL6A 4J0GA 2PSHA 3VVLA 1T2NA 2OAGA 4W63A 5LZ9A 2RAUA 4FHZA 1XZKA 3I6MA 2I3ZA 4B82A 2I3DA 2FJ0A 3H19A 4U2EA 1EDBA 2DHCA 1GQSA 1XZGA 5AI8A 5EHNA 4WFIA 3EBLA 5HKBA 4I19A 1F0PA 3O4IA 1GQRA 3H1AA 1DINA 4BVLA 4FLMA 4IO0A 4UHHA 4C89A 3HEAA 5A7FA 1XZLA 5AM5A 4H7EA 2XUDA 2H7XA 3V1NA 3WIBA 4XWGA 2GBIA 4L72A 5AM4A 4Y2YA 3GFFA 1CR6A 3CCCA 3QITA 4J0CA 3A70A 4FBLA 3STUA 5K3AA 1AQLA 2GYVA 3DL7A 3EQ8A 5AIBA 2Y2VA 1BEEA 1EK1A 1FJ2A 5DYYA 4HRXA 2W6CX 2FUKA 1C7IA 1W4LA 3C5VA 1VLQA 3HYSA 5JD5A 1W6RA 2OCIA 1QFSA 1RYYA 2YH2A 4PV7A 1JJFA 5CT8A 1ZIXA 3R0VA 4H7KA 4NS4A 4P93A 3WJ2A 3M81A 2RIPA 4ZV9A 3WK7A 5CH3A 1GZ7A 4OYYA 2OXEA 1BE0A 3FCXA 3WL8A 5A62A 4X6YA 3WWOA 1LBSA 3VISA 1ORVA 1R88A 4QLAA 2XUQA 4F21A 4ZXFA 1H2WA 1QE3A 1MTZA 3BDVA 3FVRA 4DTCA 2ZJ7A 2XQKA 1E66A 1R4ZA 2VJDA 2WG1A 4BVJA 4HXFB 2G5PA 3STWA 1EDEA 5ALJA 3UUEA 4FWBA 4QDTA 1LPPA 3VDXA 3STVA 1RWQA 4CG2A 3WZMA 1QTIA 5LIPA 3K6KA 5D3ZA 1YASA 2HADA 4CG1A 2BUBA 4KRYA 1VJ5A 1G66A 3C8DA 2HA5A 1CRLA 3JWEA 4RE5A 3AINA 4WJLA 4GW3A 3Q0TA 4HAIA 4K6KA 3H2JA 4PO3X 2OPHA 2WIFA 2YXPX 4KE7A 3C87A 1EDDA 1DU4A 2WIKA 5ESRA 4UBNA 2XUOA 1JJIA 5DNWA 3FAKA 3BIWA 2OCKA 3N0TA 2C4HA 4MEBA 3SC2A 4WDQA 2WUEA 4M0FA 1WPXA 2OG1A 1QTRA 4BBZA 3ANSA 2XMRA 4BDSA 1CUZA 3ESDA 4OB8A 2JGEA 1GXSA 2AJDA 4X7BA 2H9YA 3AJAA 2HU7A 3DL4A 3FNBA 2JGKA 2WJ3A 1UT6A 3MVEA 2JGFA 4OU4A 4XVCA 1CUWA 4UHCA 1GT6A 1X2BA 1UOOA 5DNVA 4CIBA 3KDAA 4IHAA 3BIXA 1R50A 2WJ6A 2HA3A 3QPCA 1HBJA 5DTJA 1BCSA 1O6FA 5ALQA 2HA0A 2PU7A 1K63A 3KXPA 2WG0A 3QMVA 4OPMA 2BKLA 4S0XA 1PFQA 4BATA 3D2CA 1LZKA 4DMFA 1MNAA 5DYWA 1R3DA 5AHXA 5C8ZA 3K9BA 1TCBA 3HSSA 5DJ5A 4GHWA 4MYSA 2XUPA 1UK8A 3H2KA 1A7UA 5ALDA 2HU5A 2HA7A 5CURA 4H35A 1R9NA 1H22A 5CH8A 1YR2A 3G0CA 1WHTA 2ZVDA 4C01A 5AJHA 3UUFA 3F8SA 3G0IA 2QXTA 5AKGA 2ES4A 2ONCA 2QR5A 4H7HA 5HZGA 3R40A 3AZOA 4LXHA 4UHEA 1TCAA 2XUIA 2I78A 3V1MA 4M0EA 4EBBA 1N5RA 4Z49A 2QVBA 1K8QA 4PSDA 1JJBA 4FTWA 3ZLVA 1XZIA 2WILA 4G8BA 5HK9A 5LKRA 2QT9A 4H7IA 5FUMA 5ALRA 3QMMA 5EFZA 4B85A 3FYTA 1NU8A 1CUSA 4KYVA 4X6XA 4QA9A 4BAUA 3WKDA 2WFLB 2DR0A 2PSJA 1DX6A 5LKAA 5JALA 3EQ7A 3RARA 2VJBA 1XRNA 2I03A 2WFLA 1S8OA 3DOHA 4ZWNA 3BF7A 2C0QA 2RGUA 1THTA 2JGMA 1A8SA 4BYMA 4I3FA 3WMRA 3WI7A 2WM2A 1UOPA 2HFJA 3WJ1A 2QKYA 1YAHA 5ALUA 2JEYA 5FOQA 2VA9A 3DDUA 5AM3A 4GDMA 2Y2UA 3DCNA 3OTQA 4JH0A 5HFAA 4RE6A 1FFAA 5LZ5A 2VT7A 2JEZA 3M82A 5ALKA 3TGLA 4BTLA 5CXXA 5ALIA 3SK0A 4C6HA 5IVHA 4O08A 2ZYHA 2CKMA 2WFMA 3R3XA 4JYMA 4DNFA 4HS9A 5AI5A 3ILSA 4Q05A 1BEZA 1VXRA 3PICA 1JMYA 3H2IA 1XFDA 4H18A 2CZQA 1C4XA 1LPAB 1YA4A 5AICA 5AI4A 1J07A 4OYLA 3NGMA 5ALLA 1AMNA 4PF1A 2Z8XA 1IMJA 3L1IA 2O2GA 1QZ3A 2ROQA 3G0DA 1SC9A 4HRYA 2WHPA 4IH9A 4Y2SA 1IUPA 3WQHA 5CT5A 3WA7A 4HTAA 3STYA 5JD6A 1HDEA 1EINA 1R1DA 2HA6A 4KEAA 4UBKA 5K3CA 4CI9A 4PSCA 1TAHA 1C7JA 1AX9A 2HFKA 1D07A 2Z3WA 1J1IA 4QEKA 3G0GA 2HRRA 2ZJFA 3IULA 2Y6VA 5AKEA 1ACJA 2E3JA 4C88A 4YASA 2PSEA 1XZEA 2G4LA 1ZD2P 3EQ9A 2HHAA 1CIJA 4BRSA 5JARA 5LP1A 2BGNA 2P8SA 4B7ZA 3DKRA 5DNUA 4MJ3A 3R3UA 5JAOA 3DS8A 5CRIA 4JEIA 5AOCA 3RK4A 5FRDA 3PFBA 1F0NA 3R3YA 2PVSA 2WQZA 4IH4A 3H1BA 2PSFA 5JASA 1DWOA 4G9GA 4IQ4A 4QWMA 1B6GA 4F60A 1IZ8A 2WLSA 2GYUA 2Y6UA 2DSNA 2C7BA 5FKJA 2H7CA 1XQWA 5T4FA 5EHZA 2OCGA 5IVKA 4QDXA 4BE4A 1CUJA 2GBGA 2PL5A 2WUDA 2R11A 4EUSA 2OGTA 1LPSA 2CEKA 5AKZA 2OQIA 3ICWA 3OM8A 5ALWA 4ZREA 2QJRA 1QIKA 5IVIA 4Y2XA 3WYNA 3FSGA 4UHBA 4X00A 5ALNA 3NWOA 5FPQA 4E11A 3WL6A 1VE6A 3X3HA 3R3WA 3ZV7A 3SX4A 2OGZA 3W9BA 4FBMA 1ISPA 3IBTA 1Q0ZA 1CUXA 2J4CA 4J0KA 4QWWA 2B61A 4WY5A 1NU6A 1MNQA 4G1FA 3WKBA 2RHTA 3ZLUA 3FVTA 5EHQA 1XRPA 4AO7A 5HFNA 3C6XA 1WCYA 1LPNA 3V9AA 5IVDA 3DKKA 3DLTA 4BP9A 5HF8A 2QZPA 4RPCA 3HJUA 4X6UA 1EI9A 2VATA 4OCZA 5ALPA 1BN6A 1ZJ5A 5AKLA 3O9MA 4H7FA 3I6YA 5C7YA 1ZJ4A 1P0IA 5AOBA 1CUEA 4DSAA 1XROA 3OPMA 5AH0A 1CQWA 2BCEA 5IKXA 1VA4A 5AM1A 3G8YA 2X5XA 3TJMA 4X71A 2AJBA 4AZ0A 4INZA 7YASA 4X85A 3CN7A 1XLVA 5LZ2A 5K3FB 5AM2A 3JYHA 5A7HA 5BWBA 4ARAA 1TRHA 2HA2A 5EIHA 2XQIA 3I2FA 3IUQA 3A6ZA 2XUGA 2XT0A 2XQJA 3E0XA 5HF6A 1BS9A 4X93A 2J3QA 1FSSA 4Y2TA 1UKCA 5ALSA 1EX9A 4HZGA 4TGLA 3HI4A 1CUFA 1CPYA 4J0JA 4PSUA 1H23A 1ZICA 3QVMA 4J0HA 1CUGA 4C4YA 3AIOA 3EF3A 2JGIA 2V96A 1FFDA 2HM7A 5K3BA 4OSEA 3PI6A 2VQ6A 2Z8ZA 5JZSA 4FNGA 4BVKA 4UBIA 3ANTA 3WK5A 5JZBA 3D4LA 1J06A 3ESBA 3PFCA 3UMJA 1L7AA 5D7BA 4MWTA 2V9ZA 4ZGBA 2VJCA 3F97A 5AIAA 4BB0A 3PF9A 3WK4A 3WKAA 3H17A 3M3DA 3VKFA 4GXNA 2WG2A 1ZIYA 3IURA 3U1TA 5A71A 4Y2PA 4WFKA 5ALYA 3IA2A 4EY5A 1F8UA 5AK3A 1TK3A 2XMQA 4QDOA 4UUQA 3ZLTA 4W1SA 2D0DA 5CH5A 3FLBA 3I28A 4G4GA 5KREA 5JYCA 2VAXA 1GKKA 4Y2JA 5BV7A 3H0CA 1IUOA 2X8BA 1W52X 3TRDA 4EA6A 4QDUA 1O6GA 3QPDA 4YX9A 4DNQA 1THGA 3AFIA 5JZ9A 5FPPA 1XKLA 2JIDA 1P0QA 1DT3A 5AOAA 2WU4A 2GZRA 5LZ7A 4LYDA 1ZD5A 3FYUC 4KAFA 2B4KA 1KU0A 1CUUA 2QJWA 1QLWA 4A23A 3OOSA 3I2HA 3A2LA 4BCCA 4DMCA 1W75A 1EVEA 4BC0A 4N5HX 4DIUA 2O2HA 2PPLA 1E8DA 4AO8A 2XUAA 2G5TA 5AKJA 2QUAA 3O0DA 3MUOA 3IUJA 4B0PA 2WIGA 4OU5A 3BL8A 1H2XA 4KACA 1QONA 2UZ0A 5CT6A 5CBKA 3LS2A 4JNCA 4U2DA 4OB7A 4U2FA 4A16A 4AN1A 2OCLA 1EH5A 4BAZA 3IUNA 4AX4A 4ETWA 1LPMA 4CCWA 2K2QB 4B83A 4EY8A 2RI6A 4BCDA 5CT4A 3W2TA 4KAAA 2QS9A 3B5EA 1UKBA 3O4GA 3PDCA 2BGRA 3AIKA 3T4UA 5JAUA 4EY4A 2QTBA 4ZRDA 2WTNA 2YYSA 4BP8A 3KWJA 2FX5A 4HVTA 5LYYA 1E3QA 2FJPA 2C5FA 1E5TA 3QH4A 2O7RA 4XX1A 1EXWA 2GBCA 3BDIA 1VZ2A 1DT5A 2WHRA 3F98A 1UK9A 4BZWA 1X2EA 2VAVA 1XZAA 4DYHA 1SCIA 1LNSA 2BUAA 1MU0A 2Y1KA 1VZ3A 1WPRA 5T4BA 1P0PA 2VT6A 3MGAA 1U4NA 5FXMA 2J3DA 4Y2VA 4UFPA 1E8MA 4DNPA 3OURA 3OC0A 4ZV7A 4MXDA 3ZI7A 1TIBA 3R3VA 4FFVA 4BC1A 3FLAA 5FLKA 1ZI9A 3BJMA 1FFCA 1UK6A 3B3QA 4B80A 4BE9A 4BTVA 1MT3A 5ALXA 1XQYA 2Z3ZA 3JW8A 4AN0A 3G0BA 1AUOA 5A7GA 1CUIA 5I9IA 1XZCA 1MAHA 2PUHA 5K5EA 1QIFA 1H2ZA 2NW6A 2XMCA 1G5FA 2GYWA 3PF8A 2VEOA 4D9JA 3MUNA 1XZHA 2CB9A 2IIVA 1QO7A 3DEAA 3D7RA 2Z5GA 3GBSA 4A5SA 3BXPA 5ALFA 3VXKA 4G5XA 4WY8A 4K2AA 4LIPD 1QFMA 1ZOIA 3IIIA 1K6EA 1VXOA 2H1IA 1ZD4A 3C8HA 3G9ZA 3GELA 4Q82A 4CG3A 5KWJA 4AZ3A 1CUVA 4G9EA 5BWCA 1EK2A 2IITA 5DTIA 3WLAA 3FLEA 3DNMA 5HK8A 1MX5A 4GWLA 1YCDA 4F5ZA 4FKBA 4Q3LA 3EIOA 1JKMA 3W05A 3I1IA 4I4CA 3N2ZB 5AK6A 4KRXA 1KU6A 3WL5A 1FFEA 1LGYA 1OCEA 2WTMA 5HQ3B 2CBGA 1DTEA 1Y7IA 2PBLA 2Q0XA 4EHBA 3STTA 3WA6A 4G4IA 3ICVA 3FBWA 1DWQA 1YS2X 3KWFA 5HQ3A 4WFJA 2EEPA 3QMWA 3Q8WA 5A2GA 2XUKA 3D2BA 3G02A 1QOZA 4RNCA 1VA5A 4NZZA 4BAGA 1U65A 4UBOA 5AKKA 1XRMA 1ODSA 2DFPA 4BZZA 1XRRA 1U8EA 4LKOA 4B0OA 3CN9A 4Y2QA 2C0PA 3RM3A 3PE6A 5J3JA 4AXBA 2QXUA 5E2IA 3H18A 1WB5A 4P08A 4BCBA 2ORYA 3WK8A 5EHXA 5CXUA 1BCRA 1XQXA 2XE4A 1GKLA 1L7QA 2D5LA 2PKYX 4W1PA 5DLPA 3LIIA 2QM0A 5JD4A 1XQVA 3C6BA 5JANA 4MYDA 3LCRA 4E15A 3ED1A 5AI0A 4X90A 4B84A 1ORWA 3FYUA 4GBGA 3BE8A 5KBYA 2GBFA 4FFWA 1UKAA 3DD5A 4W1QA 1UK7A 1ODTC 5JAHA 3AZPA 5AM0A 4Q3KA 5EIEA 3WYDA 4UHFA 3IDAA 1LZLA 1FFBA 3KOOA 2BFNA 1IUNA 1WB4A 3QYJA 1UXOA 4L0CA 2QRUA 1F6WA 2EDAA 1Q84A 5AP9A 5ALOA 5SYMA 2R8BA 3AILA 2XUHA 4FMPA 4HXGA 2ZYIA 5AK4A 3T52A 4X91A 1GPKA 3WKCA 4N8DA 3P2MA 3R41A 5E4JA 2WIJA 4CCYA 2XQFA 1JFRA 1JI3A 4AO6A 3WKEA 4AMZA 1WOMA 3V48A 5T4EA 2JGJA 1W1IA 4PNZA 4N8SA 5I7UA 4LXIA 3C5WP 4MEAA 1VKHA 3E3AA 1MPXA 3LIPA 6YASA 2H7YA 1HQDA 2V98A 4AB1A 1EB8A 5EIAA 4WCVA 4G4JA 3GUUA 4Q3OA 3D5EA 3KSRA 3G9UA 3I2JA 4J7AA 3HZOA 5AI6A 3G7NA 2ZYSA 4B81A 2DQYA 3IUMA 1JU4A 1OILA 1TKRA 1USWA 3C43A 3E4DA 4GEGA 2XLCA 3ESAA 4XIIA 3TEJA 1IVYA 1BU8A 3S8YA 1ETHA 1QIEA 1A8UA 1T4MA 1AKNA 4L3WA 5JATA 2W22A 2VTVA 4UPDA 1LBTA 4P9NA 1SCKA 4LYEA 2PUJA 1QJ4A 3D3NA 4Y7DA 4MQMA 5CMLA 3L1HA 5AKXA 2XDWA 3FSGD 1HLGA 4AMYA 1CUYA 4K6GA 1CLEA 1PJAA 2G63A 2WIDA 3FWHA 1GGVA 5IH7A 2XMZA 2HIHA 2XMBA 1AGYA 4FLEA 4X94A 3PUIA 3B12A 3A2NA 2ECFA 4UBMA 1XRLA 2WFZA 2RONA 3G9XA 3K2IA 5HF5A 5JADA 5EGNA 1CVLA 3ZWQA 2AJCA 1SFRA 5K3EA 4FOLA 2PU5A 1RP1A 1EHYA 4H77A 4X3CA 5I8PA 4C4XA 3WIOA 5F4ZA 5LLSA 1LLFA 3WWPA 1XZFA 2JF0A 2WU3A 2C58A 1CQZA 4V2IA 4U2GA 1G42A 4DLNA 1YS1X 3VVMA 4J0IA 2WJ4A 1UOQA 2PM8A 1KEZA 4MQLA 3O9VA 3OG9A 1XRQA 2X76A 3BJRA 1UZAA 4QE3A 1EA5A 1N8SA 2QUBA 1L7RA 2AJLI 1YB7A 1UWCA 1YSCA 5C81A 3WZLA 1ZGCA 1H2YA 2WUFA 3F67A 4ZI5A 1XKTA 4Y2UA 1EVQA 1K4YA 4FNMA 5AKIA 3H2GA 1XZMA 1J2EA 4JYPA 3C6YA 1GPLA 2XLBA 4CIAA 1QIHA 1DX4A 1E8NA 2OAEA 2C5GA 1XZBA 3FYUB 4YK7A 5JAPA 2DQZA 4B6GA 1BRTA 1CUDA 5K3DA 5JIBA 1G4HA 3VJMA 1ODCA 4ROTA 2ZSHA 1WM1A 4M0MA 2J4FA 3FOBA 4NVRA 3I6ZA 4UHDA 1HPLA 1MX9A 1QIIA 2CMFA 3DQZA 4OB6A 4G8CA 3WWDA 2XI4A 4Y9SA 2BUCA 3A2MA 3W04A 1CUBA 4AQDA 4J03A 1ZGBA 4B9EA 2DHEA 4H7JA 3CCBA 3D2AA 1ACLA 1ZD3A 3I2IA 4KE6A 4MWSA 1TQHA 4KJXA 4Q1VA 5T4HA 4QDZA 4K5QA 5AKHA 1JMKC 2ZSIA 1N1MA 3BF8A 4ITVA 4TPKA 1CEXA 4DNOA 2WKWA 4CCYB 4N8EA 2XMGA 1DQZA 4KAJA 5FP0A 2LIPA 3ESCA 2HU8A 3AUKA 2ACKA 2ZYRA 3M83A 3L1JA 2XB6A 3S2ZA 1M33A 1QO9A 5HKAA 1OXMA 4QNNA 1Q0RA 4DM7A 3FCYA 1AURA 3RLIA 4N5IX 3W9UA 4UBJA 5AK5A 2AJ8A 4L9AA 4OD0A 5FDFA 1AC5A 5LZ4A 2HRQA 2PX6A 3G9TA 4J0DA 5ISMA 3KD2A 4UBLA 3QPAA 3VJLA 4B9AA 1MO2A 1NX9A 5HCUA 2XUJA
chains in the Genus database with same CATH superfamily
1YJQA 1YFJA 5K99A 5TGDA 3HACA 2DOKA 2SBTA 3WL7A 5FV4A 1BROA 2VYND 3DYBA 3PZBA 4FW8A 1A88A 1JHDA 4OJKA 4WD3A 4RTSA 3MJDA 5FWNA 1E3TA 3SE0A 1GLNA 3QKUA 4PYLA 4RXTA 4YRFA 5BXQC 1ZUIA 1WHTB 2ILTA 2Q6TA 2DQ4A 1DKOA 2OGSA 4YVFA 4JLAA 4ZTZB 3O4HA 2QTFA 2HRBA 2O7VA 3FB4A 4B3FX 4ARBA 2W2VA 2CL6X 1PFUA 4LXGA 4EK9A 1VRCA 1WXEA 3O4JA 2OXRA 3SS8A 3ZDXB 1CNFA 4OHPA 4U9IS 3GROA 3NIGB 4HB3A 3YASA 3IB3A 4U8GA 2RH9B 4IFEA 5IDYA 4LYGA 1DQYA 2P2YA 1MRSA 2VYCA 2FV8A 2ZWVA 3BAZA 3CF4A 4JJ7A 3WWEA 2Z2IA 3KS9A 1JHOA 3L9WA 4RHXA 4RTJA 3C98A 3QOYA 1EAYA 4IMIB 1X94A 1C81A 1E6EA 1IXKA 1V7PC 2FLWA 4KR0A 2X22A 4AXXA 3T41A 2J9FB 3RYIB 4PLYA 4ZO8A 1V1MA 2R4TA 5JWOA 3DBHA 1EWTA 4N7RA 4BP1A 5KO2A 2PBRA 4HUJA 4GXQA 4HOYA 3ICOA 1W30A 4K9QA 5ADHA 4ZN6A 2Z5VA 4EY6A 1SNYA 1RKUA 2BHLA 1Y3CE 1HE3A 2XWPA 3T15A 2ZRDA 1L0BA 3RSQA 3RTEA 2WE7A 1V1MB 1V6AA 3WGKA 5HR5A 1E2LA 1OI2A 5A9SB 4G23A 4GYWA 5EE0A 1UJBA 5DWQA 1L2TA 2NO1A 3DL0A 1TJPB 3EC1A 2I4LA 1TYBE 1UFOA 2IJGX 3F74A 5F3DA 1ECGA 1N5JA 2ZB4A 4KX5A 5H3HA 1VECA 1TLTA 5BSHA 2XH8A 4ZVKA 3MGCA 1E20A 3BK1A 1GCGA 2VP4A 1L1EA 2PSDA 2XNSA 1T26A 3C6ZA 1RP7A 1YU6A 2CBZA 2CCJA 1X70A 2ST1A 4QLOA 2XNKA 3X2FA 3EA4A 4UU1A 2HDWA 4CV1A 1CFJA 1N0HA 3W3AD 1KAEA 1QIDA 2V74B 4I6GA 1HE8B 2JDIA 3V8PA 1TK9A 3ABZA 3PXGA 3BG5A 3W79A 5C4MA 4M1ZA 1TCUA 2VF2A 2Z4RA 1DMRA 4IH1A 1CUCA 1KYTA 1PWHA 4AU1A 4XFKA 3VSEA 4RD6A 3IP1A 1OSNA 3DZBA 3P9CA 4NU8X 4WZAB 5LLDA 3WB2A 3DUFA 3FOCA 3RPEA 3N0VA 2XYRA 3LHIA 3ZGYA 3H2SA 2GM3A 4JB3A 4KVFA 1V8ZA 4LZOA 3VSCA 1LTQA 3JQ7B 4JLPA 4U6SA 3BS4A 1FU7A 3QVXA 3V4ZA 4DV5B 1XDWA 1WB6A 1NT2A 5DNAA 3U3DA 1N9GA 1CYDA 1YACA 2CE2X 3NOXA 4OBXA 1QYWA 3IV9A 4XVQA 3VGPA 1SBNE 3NEJA 2FSHA 4CLXA 4C4PA 1T9AA 2JBAB 5EKXA 3GDOA 1LJLA 5IYZB 4K6HA 3MS7A 5EEHA 3G8AA 4ILEA 1SUDA 1E5XA 3NNDA 4KWIA 1WLSA 1JFLA 4DYDA 5DX8A 2GPSA 1Q3TA 2CLMB 4AUKA 3QM1A 3M2TA 4QUJA 1E89A 3UT0A 4M8LA 5LYYA 4EATA 1N36B 2VQFB 3RKSA 4RF4A 2IUEA 5AKYA 2C5SA 4DCJA 1MGOA 1N2BA 3TIXB 1Y7HA 4OXYA 3VDQA 3NYRA 3RYHA 4JC0A 3VZPA 3JTMA 4KZKA 4ARVA 5KSZA 1AF4A 1XJQA 2WA2A 3NBFA 4Y2RA 4CLEA 1I5OA 3WLEA 3C16C 2RHGB 4I0WB 4E7OA 3WSTA 4UAJA 1CR4A 2GJ9A 5CIWA 1XXHB 2H2HA 3BXEA 4DABA 2J9RA 2OAP1 4AT1A 1P2FA 5CK5A 4MUGA 4EHIA 4PQEA 1C8LA 3AW9A 4U2CA 1RXYA 3H42B 3P97A 1PWXA 3HCNA 4NX2A 4DV3B 2JB9A 3K35A 5ALVA 3CT6A 3AL0C 1KEUA 1LDMA 3IVMA 4F04A 2QROA 4N3NA 2H0QA 1TZJA 2WSLA 4DCNA 2FW7A 2OG2A 1MUUA 3EXG1 2NVWA 3O2NA 2AZMA 5J43A 2ZU6A 1P7CA 5TIIA 3KQHA 3C45A 4C87A 3OF2A 1ECCA 1B41A 3TOXA 1Z0JA 2WZCA 4JJKA 4P4LA 3JQGB 5EZQA 1M5TA 4ZVRA 1O0CA 3IEVA 5JS6A 5BMVB 1JLKA 3IPLA 2XZDA 3DBOB 1KPIA 2OC4A 3HFGA 2GAFA 4MUHA 3WYEA 4PQGA 3SWWA 2AXEA 4BLUA 3KXIA 3REGA 4QUHA 2REBA 5JY1A 1RWXA 1JJ7A 3IRUA 4YV2A 1DL5A 4F84A 2B20A 1OREA 4IIJB 1T5TA 4MVWA 3MOIA 4HAWA 2Q7DA 1Y7TA 1P0MA 1L5ZA 1ZO8A 3KKOA 3M6FA 2X7XA 3HSKA 3L7AA 1E7QA 4JU9A 4Q1BA 5D1NA 4DLKA 1HL7A 3AIMA 1FFXA 3TINA 1A9YA 2A5FA 2UKDA 2X6TA 3H75A 4WY2A 4BDTA 3HH8A 4PLTA 2RGXA 2PZMA 2R8YA 4QGGA 2QNIA 1KXZA 4DY4A 5DHSA 4ZK6A 2C88A 3GLGA 2OQVA 4UVGA 4U7JA 4XXHA 3TI9A 2ACEA 2BRUA 3OD1A 1BO6A 4QAQA 4YT5A 5FAXA 2WVAA 4FYPA 1HFWA 5F2KA 4DMKA 3G5MA 5DP1A 1GG5A 1OU0A 3GNQA 2V7VA 3OE1A 2MDTA 5TQ2A 1KNXA 4J3JA 4QC2A 5DNEA 3TX2A 4YCCA 1JECA 3RIYA 4XZ3A 5I9NA 1XTPA 2AHOA 1R9MA 2GPAA 3EFEA 3LLCA 4WT7A 1DFIA 4X3OA 3QXJA 3ZBTA 4KPFC 2N1MA 5T6BA 3GPIA 3K15A 2PXHA 4P92A 2QLBA 4QYIA 4JKOA 2FF7A 4L6CA 1HMYA 1MW9X 4DA9A 3O26A 4FDMA 1VMIA 1N75A 1XLWA 4UPVA 1JIUA 2ZRBA 2DGDA 2JFWA 5GZ6A 5G2OA 1P7VA 1V39A 3DD1A 4G5HA 4HB4A 2IH5A 3N86A 4I5EA 1FIUA 1NT4A 2C97A 3SFZA 4TYQA 4D81A 3QUCA 4DLAA 2QMQA 1ATIA 1WUKS 3A31A 4BUCA 2ZJYA 3HLKA 5AK0A 4CVNA 1GSHA 2Q0QA 2HPZA 1I2MA 1VFPA 1RCTE 2EQAA 4U2BA 3TIVA 1G3RA 3C5HA 1ADBA 4GYKA 4FW9A 4MIOA 3FPEA 4PBRA 5C1PA 1OZ0A 2QN1A 4Q34A 3ACCA 5CU7A 2HYIC 2ZJ8A 4NXNB 4ZCMA 3OD5A 1FXWF 1UC4B 2DCMA 3ONEA 1WHSA 5ALEA 1JHXA 4Z3OA 5BOVA 4HXEB 1ZGZA 5B1DA 3BC1A 4I3HA 4MDHA 5YASA 1MX3A 2QQ5A 3MMZA 4PCVA 4RQBA 1S4MA 3ORSA 4ZCQA 4CQLB 4EB0A 2C8KA 1G2OA 2YHSA 4HGRA 4X95A 5K2MA 5C8VA 1F7UA 4H4DA 2A0KA 4Q1CA 4GLOA 1PR2A 5IJ0A 1VIMA 1S2IA 1D5CA 4N7MA 4J43A 4CV2A 3CHYA 1OA0A 4PAMA 4C3UA 3U0VA 3AKZA 2VVTA 1M75A 2PK3A 4GXTA 4TTPA 3IXQA 4WDRA 1EXVA 4GICA 4QXAA 4XLLA 3IBFA 1JIJA 4KGZA 2X4IA 4C5BA 4CM5A 2JLCA 3RHZA 1AQYA 1OMOA 3HMKA 3CG0A 4X9XA 1PBNA 4NFLA 1ZI8A 3WIUA 1GGEA 3G2QA 3TLGB 3VC7A 2QV0A 1Y42X 3A0UA 3CGWA 3GN1A 3ZDQA 1PL7A 2A5LA 1WUIS 2HDNB 2HL6A 2OP1A 4Z0HO 4Z54A 5JECA 2YFYA 3QXXA 4H08A 1F12A 4WOJA 3R74A 4UKDA 2PSHA 4MMZB 4E30A 3B3AA 2HF2A 1T2NA 1J7KA 3KT3A 4O1IA 2CLCX 3JAMA 5IBPA 4I8IA 4EHDA 4EKGA 1X0VA 3THSA 2EFEB 1M67A 1HM5A 1KP9A 1QKJA 3RBXA 2I3ZA 2VTKA 3DB1A 4BMPB 3KQTA 2I3DA 2FJ0A 4ZOCA 4EZEA 3H7IA 1LI4A 2WA1A 1OZGA 3TJRA 1VM6A 2W93A 1GQSA 3GB9A 4N82A 1D2EA 2X4GA 3O8OA 3FCOA 5EHNA 5TT0A 2CV1A 1GL6A 1I0IA 2F1JA 3HQ4O 4OJMX 1JQLB 1WABA 4RU1A 3QK7A 1BMFD 4WFIA 3GMTA 2G0TA 2J5RA 4DMLA 3QYAA 1U0TA 3EQZA 4M99A 3B1WA 5TB5A 4DSNA 2P4SA 1E94E 1TU0A 3AC0A 4HEJA 4O5OA 3UMSA 4I1YA 3HU3A 4GP6A 1Z8FA 3ZCUA 3IHLA 1XZLA 3W8NA 3P5SA 5KTTA 4E2WA 4R84A 3FTQA 2GBIA 2HXYA 1ODJA 5AM4A 1E3JA 4F5EA 3IT2A 4IIJF 4DZZA 4WLNA 1OF1A 2VPIA 1CR6A 3U1VA 3ADCA 1M83A 1R5NA 3KZ1E 4CF4A 2JGRA 3F4KA 2IU6A 5DHTA 4JL6A 4NZNA 5JSYA 2GTIA 2QIPA 1CZOA 2IK8A 2D1TA 3L0IB 3ZX4A 4ZKDA 2IY7A 2AI1A 1TUBB 2HD4A 5G3ZA 2JPDA 3T7DA 5HWSA 5INTA 5K3AA 3H6HA 1NXTA 2IGTA 4QBFA 4CR6A 2V58A 3OTHA 3P20A 4LK3A 4L6IA 3U4AA 3PC3A 1YCHA 3KKLA 2NZWA 1Z7WA 3CZCA 4H7PA 3LDFA 4HDQB 5E1DA 4Q7MB 2QZSA 3DBIA 4IIGA 1GZHB 1JFVA 2CVPA 1FJ2A 1DUSA 5DYYA 3OEHD 4HRXA 4Z3DA 1F2TB 3AJ8A 3TMKA 2FMUA 4BNKA 5EZ6B 4BNYA 4MGEA 1JG3A 3C5VA 1CJKC 2WWHA 2LPMA 3HYSA 4I4NA 1NE7A 5TMEA 3R8XA 5HCNA 4CLHA 2O0LA 1YIAA 4UNQA 3SJAA 3M6UA 1TO6A 2HGSA 4PV7A 3LPAA 4KPGA 2IT1A 2H6EA 1I24A 1S1CA 3AHFA 4HAUA 4J1TC 4HEQA 4CL8A 4F91B 3F5QA 3R6WA 4EUFA 2MYPA 4ZJPA 1ZIXA 4NHEA 4RVFA 1EKXA 2I1VB 1USKA 2OV4A 4P33A 3ZYZA 5F2OA 4HDCA 4DCTA 1N9GB 6NULA 1XFAA 2VYFA 2I6SA 1VCMA 2EGGA 3MIIA 2RJ3A 2C4TA 3R6GA 1P2GA 4FFNA 4P93A 3GFTA 2M2IA 1HO3A 3HB9A 4ZV9A 1B76A 1JR2A 3BRCA 3O38A 1WV0A 3UAVA 1JTEA 4DNXA 1OH6A 3PQ7A 3FPCA 5CH3A 3V2IA 1GZ7A 3BFKA 1JAXA 2WAMA 3LBHA 2WHXA 4N0MA 4QVGA 2FR1A 3VAYA 5J2UF 1TQ2A 1DC4A 1BSVA 4Q3BA 1EFRA 4WK0B 1H5UA 2V5AA 1HG1A 2GHTA 2DG2A 2QA5A 2QI9C 2VBGA 2YZGA 2K7ZA 4XB6B 3H84A 4W5JA 5HP4A 5HZKA 3PUKA 4QLAA 2AGVA 4F21A 3NDRA 4D9MA 1MT0A 3KR9A 1H2WA 2X5OA 3IELA 4V39A 2G8NA 3G68A 5BNZA 2P5YA 3PENA 2IXDA 2V7TA 2Q62A 5LMZA 1NBMD 3QVKA 3BDVA 3K9NA 3QHAA 4NPHA 2QRMA 3COYA 3I53A 4YV7A 4NCHA 2R6GA 3R77A 4KQFA 3USZA 1YDEA 1UDRA 1R4ZA 2WG1A 4BVJA 1Q0TA 3ZGZA 4MRSA 3BWEA 3KSZO 4D6PA 3SQXA 2ZPUA 1R27A 3OZXA 4KLCA 4C7BA 1F3LA 1TQDA 4FDTA 2XCTB 4V0RA 1VJDA 4FWBA 4U5QA 5TT1A 5HDBB 4PQYA 4IEEA 4EUHA 5EG5A 1SA0A 1CG6A 3PR1A 2B4YA 2XAAA 4ZO9A 3RTGA 1UZMA 2AKAB 4NESA 5C34B 4JSYA 5CLQA 2VCYA 2XBLA 1A7JA 2H3HA 1LTHR 1QFXA 2CFRA 3HYTA 1EVZA 3GVPA 4L5BA 4YJ2F 4ZO4A 3F7OA 3K0BA 4LHZA 1T5OA 1G66A 2A9FA 2Z95A 1QHEA 3CCFA 3A1DA 3C8DA 2HA5A 3GEHA 3JWEA 4BTEA 4Z4GA 3AINA 2A9QA 1FTWA 4DPKA 1JR6A 2C29D 3Q0TA 3FCAA 4I50A 1BA2A 2BBSA 1CF9A 3H2JA 2AR9A 3OQ1A 4I55F 2D54A 2B2CA 1G4UR 3EDMA 4LY3A 2AEMA 1BX1A 1ZN8A 3EFBA 4Q93A 2Q4BA 3W5AA 1AZTA 3HADA 1OIXA 1BFKA 3ZU3A 2IPAB 4MQ5A 5FTNA 3UWOA 5DYGA 3TZ6A 1IXYA 4FE4A 3ZCTA 2EKLA 4PHGA 1Y9AA 1M5RA 2FRDA 4F1JA 3CF6R 3ZHSA 1ORRA 2VK4A 4UBNA 2D0OB 3ESXA 1I7DA 4IVQA 4BECA 1JJIA 4L3VA 3FAKA 2GMWA 3BIWA 3L04A 2UZ1A 4KQEA 2FSPA 4KR7A 3GLHA 2PLFA 2AQKA 3ILXA 4CT4B 4KGXA 3R0XA 1LRJA 2A0YA 5LLTA 2C4HA 4RVNA 4MEBA 3SC2A 1C2YA 3P0FA 4LF4B 5DI3B 1AD2A 4IL5A 4B3GA 1WPXA 2OG1A 5B30A 1QTRA 3PGLA 4O4LA 3OLQA 4QU0A 3TLKA 4DA7A 3RYCA 4Q12A 4ZOEA 4I4IA 2EF0A 3C3KA 1RXEA 5H16A 2NSYA 1M3SA 3O7WA 3G13A 2PS9A 1J49A 1I33A 2ZBRA 3BWMA 5ES3A 1EWKA 2GHRA 4OHVA 1B15A 2NU7A 3DAGA 4M9QA 4BRUA 1E3IA 1NFQA 2JIMA 4I36A 4KBGA 5I4BA 5LQAA 2P0EA 3GRKA 4O33A 1EPUA 1FX1A 1I0LA 2HU7A 3DL4A 1QC5B 3FNBA 3WMFA 1MB9A 2FCAA 3BERA 2JGKA 4R5MA 5AVTA 5KTRA 2WJ3A 4DQLA 2B8TA 3QVGB 1VBFA 3NHKA 4DG5A 2IF2A 2JGFA 1Z36A 3QG5A 4AKSA 3ABIA 5K6AC 4L3OA 3E9EA 2IY8A 4WZZA 3ZZNA 3E7FA 3WIEA 2B1QA 2PJUA 4Z1MA 2M6KA 4YRBA 3RUAA 3HDGA 1G8AA 4JDPA 4XVRA 1GRRA 2Q1WA 2Y1CA 4ZYVA 3HBMA 3OOYA 3ERCA 3UQZA 1JR3A 3JQAA 4IW3B 3D4OA 4X1YA 5FBHA 4DQDA 2BL4A 2FPMA 4NCJA 1D2GA 1MHTA 4B5KA 1FTGA 3L8MA 2PT6A 2CV2A 3IXMA 1L3IA 4ESVA 3LZDA 2VWPA 3UA4A 2D2FA 2YBEA 4JU8A 1NBAA 4HH4A 4C4AA 1R37A 4NYMQ 2OKCA 5EYPB 1DADA 1KRHA 2P2GA 3BD7A 5ALQA 4ZDWA 1N4AA 3AR2A 2HA0A 4EM6A 1DTWB 3WB1A 4BBJA 2D8MA 3L8YA 1XTIA 4OPMA 3T1HB 3KT0A 4DZRA 2ZT5A 2WWFA 1NXSA 2JVJA 1DTWA 1GTMA 1KHTA 2I6FA 3LPNA 4PLVA 4BQEA 1T2AA 4IXNA 4RVHA 4S0XA 1PFQA 3N39C 4XEUA 4MVJI 3WIDA 3MIZA 1DJNA 4DMFA 2Y1EA 4XOIA 1T3LA 3C5EA 2P67A 3CZQA 4ZAFA 3TSZA 4ZJZA 4ZOQI 2VAPA 1R3DA 2GEJA 3GO4A 5HMLA 5JCPA 3MINA 5MF6A 2RD2A 1CNEA 1TCBA 5DJ5A 4PAQA 3BWBA 3PNLA 3ADKA 3MQFA 2HWXA 1QX3A 1X87A 2I4TA 3GUVA 1IQ0A 3L6UA 4TKZA 4UD2A 2Z43A 3EW7A 3NHAA 1WY7A 3C3DA 1MW8X 4QOIA 1I3NA 2IYYA 3AHEA 2EFHB 2F3TA 3BH6A 3OEED 4OJTA 2YHUA 3UAZA 5G0SA 4V1CI 4J1NA 1TUGA 3F5FA 5CURA 1GGHA 3JZMA 4QUIA 3HCAA 2GB4A 3WG9A 4OX9B 4ZT4A 3K1AB 4BVGA 1PJTA 1UJMA 3LT5A 3L2OB 5DWVA 1Q1NA 5JSFA 4HBGA 4I5GA 3HJHA 5G4KA 3TM5A 1EX6A 1RPAA 2P6NA 1LBQA 4XQEA 4C01A 5AJHA 3OX4A 4E4YA 1YIDA 1F9AA 1DG3A 3GGJA 4HPXB 2AFHB 2CUNA 3PUYA 4P4UA 2C92A 5EWJB 1SXJE 1Y5NA 1SVOA 1L5NA 1VYHA 3O91A 3A4IA 3NOQA 3NKLA 4Z51A 3CR8A 3I3SR 4KXXA 5H83A 3R40A 3RC8A 1YRLA 3AYZB 2IYUA 2YRWA 4MI6A 4PN7A 5IAKA 4LF7B 3FUUA 1FQOA 1II8B 2AW3A 4UVIA 3C3JA 4LZZA 5TQ0B 3MMPA 4BUZA 2F3UA 2JAPA 3ABOB 2A2ZA 2F00A 4NECA 2H63A 3BD8A 4ZTBA 1WJGA 4ES6A 2AYZA 4UHEA 1P6UA 1IM8A 1GNQA 1E3WA 1J8VA 1TCAA 3C6MA 2EWWA 1U5CA 5LP6A 1NNSA 3IAUA 3ZLBA 4LZPA 3JQGA 4QBKA 4XYMA 2I78A 3MWDB 1NV9A 4M76B 4K3VA 3ZUPA 3QPBA 4D4IA 4CIXA 1B2LA 3KPWA 1QQTA 3Q85A 3EXIA 4LOHA 3N87A 4CI0B 1SIWA 2B82A 5LM3A 1K8QA 3MRVA 4KO3S 3NDBB 3ZIUA 3NCHA 5HRAA 1DIGA 2P9BA 3GH1A 3HR8A 4HB0A 2QMOA 4IRUB 2PV0A 3CPHA 1STOA 1QHHA 2FP4B 3B38A 4Z9FA 1JNXX 1OZHA 4AX8A 3FCCA 3WGVA 3CNNA 4WBNB 2WILA 1ZINA 1NQTA 2BI4A 4CF6A 4LQLA 1KTVA 3LA8A 3O9ZA 2NUPB 2VJKA 1CVRA 3GGGA 5HK9A 5EKUA 2R7KA 2NXWA 3HUTA 4G1CA 3AIIA 1D04A 2UYOA 4AMBA 2WWWA 3FE2A 3AR8A 1C30A 5ALRA 3R1IA 1G9SA 3WBJA 3LY8A 2ZAIA 4XQ9A 4EGCB 3RSLA 1J2TA 3F1LA 4YI3A 1FRFS 1ZVQA 3LOQA 2UXDB 1F2UA 4XYEA 4GU5A 3ZK7A 4AKEA 5LQMA 4PFJA 3VV3A 1DGQA 2QEQA 2ZSFA 3JRXA 4UXHA 2FFHA 1P1JA 2RARA 2BR3A 3FR8A 3VAAA 1CEYA 3M1LA 1PKEA 2E4WA 2PKWA 4KYVA 1VLHA 2ATEA 4M7RA 4A4DA 4LC9A 3LKZA 5KWSA 4DR6B 3TOVA 4MUKA 3VR6D 4P5EA 5I4CA 4BAUA 4NCXA 1ZSVA 4AZTA 4FNOA 4Z4HA 2W2MA 1N4DA 1W4AA 4EJFA 1DX6A 4IIDA 3H2BA 5C37A 3Q9UA 3GFQA 5LKAA 3LT0A 4DKJA 3HCFA 1Q1AA 4EGAA 2BP7B 2PUDA 5K03A 5AQ1A 5IC4A 4JLNA 1TK2A 4ZI7A 1QF9A 2YRXA 1JQJC 1ZA2A 3FPAA 2O2ZA 1I30A 4WKOA 1PR5A 1JQAA 5GY7A 3PPXA 3ZD6A 2FHSA 1GGKA 3CRRA 2GGSA 1IWBB 1LY1A 4JLKA 4KYUA 4MPJA 5DYNA 3QOXA 4EITA 1EXNA 1A8SA 1NMZA 4I3FA 4LC0A 4X6LA 1NI3A 1GU7A 4Y0AA 4BYMA 5GTDA 3HA3A 3II6X 4RM3A 3W0LB 1CC1S 2NN3C 2LNDA 1TM7E 2PFSA 4I50B 2I3AA 3WI7A 3V7UA 1W9HA 2HFJA 3QJYA 3PX3A 4XJXA 1UPBA 2G17A 3WVNA 4YLYA 1N78A 1LS6A 4O2BA 1YAHA 4L8LA 1F9EA 5IT4A 4NCNA 3Q9NA 4YC7A 2O3TA 1J0EA 2F55A 5FOQA 1W59A 1BDMA 1QX4A 1RMQA 1X1QA 1MJNA 3D8UA 4Q4AA 1WD5A 3ROTA 1M6HA 4RD0A 4C2TA 1YVPA 3KETA 2R9VA 2VA9A 4KO1S 2X14A 4BGUA 1G7CA 4A92A 4GDMA 3EYAA 5HUHA 4WA8A 3R5TA 5EWMA 1DCFA 2V4UA 3DCNA 2IEAA 3OJ0A 3QY0A 5COQA 5FNVA 5TGTA 4E09A 5I9TA 4BEJA 5AXCA 5KQGA 3DF9A 1ST2A 4MW0A 4AC9A 3OT1A 1AF7A 1KKLA 2R4UA 3DE5X 4GSLA 1FFAA 4BNUA 4TRJA 2O3SA 4V2UA 4AFNA 1KY5A 4CKYA 1XRSB 2GN4A 3N6VA 4ZCRA 3MWGA 3WSWA 4IRMA 3X1JA 1R12A 2JHAA 2XD9A 4X0EA 3QEBZ 2IZ1A 1T1EA 2CLKB 4BTLA 2BLLA 4B43A 2D5BA 5ALIA 1QRDA 2HREA 1ZMOA 3SK0A 4C06A 4MGKR 3M6LA 1BC5A 2HJHA 2C2BA 2CKMA 4JYMA 4MUYA 4DNFA 3FWPA 3X0DA 1SBYA 1G18A 4FEEA 2D7CA 4LVCA 4Q05A 2K87A 5FWDA 2O1XA 4WBNF 4ND4A 3UB2A 4H18A 4DL9A 4IQ8A 2PX2A 4MQFB 4FI3F 1D4AA 1QG4A 4GF5A 1SBQA 1C4XA 1KGSA 1PSZA 3QE0A 2ZYUX 1C3EA 5AICA 3SHVA 4M3NA 5D3MA 4OYLA 1ZM2A 5B2EA 1Z82A 3UYKA 4LJ8A 1AMNA 1FFSA 3FTDA 3R6DA 4PF1A 4EQ6B 2G9QA 5IT9A 1A9QA 4Q3NA 3GLIE 1ZUNB 4IAOA 1OWNA 2C84A 1N1EA 3LL4A 4X8HA 2O2GA 3OQMA 1QZ3A 3BMXA 3EIQA 4E07A 4L78A 5BVGA 2FWIA 1Y5RA 3GEGA 5LDHA 1UMKA 3VNUA 1CEQA 1TZCA 5LXTB 2WM9B 1NJ6A 2IVFA 4Y2SA 5E7IA 3FOAA 3HPRA 4TTJA 2OC9A 2VDWA 5TVKA 2UZ4A 2HTEA 3I34X 2KLBA 3NV7A 2FMXA 4Y7CA 4REQB 3GOQA 4R1SA 3PNKA 3IXLA 1EYZA 4D9NA 4HSGA 1EINA 1I8TA 1KY2A 2C9YA 2HPVA 2JZCA 1PDWA 3MYYA 4OHCA 4R1LA 4Q00A 3RG2A 1QPZA 3HTXA 3AT1A 4M1EA 2A5DA 3R8CA 3OIWA 3MB8A 2Q5OA 1WQ4A 1N2XA 3HVIA 1TAHA 1C7JA 3PYMA 1QQBA 2H2IA 1S2DA 1C9MA 2HFKA 3L0OA 2Z3WA 4E21A 4ZIRA 3LPLA 5E2BA 3JQ8A 3G0GA 2FMIA 3PT5A 3IBYA 4FSDA 1NAIA 2F43A 4N0EA 4RGQA 3ZY5A 4BO1A 621PA 4D25A 3L6RA 5AKEA 4LAFA 5JRZA 2E3JA 1NV8A 1KQOA 1J8YF 2G36A 3M6AA 1TLFA 3TPCA 2I2WA 4NJMB 2IEBA 1COWA 4D8TA 3KBBA 3FVQA 1KYXA 3DXXA 3OZEA 2CDAA 3JQ8B 4KMRA 3VO9A 4CDGA 1FDIA 3L4JA 4WXHA 3V97A 4LMPA 1MB2A 2VHXA 3JQ7A 1JVBA 1SCBA 2HHAA 4MJ7A 4NK5A 5CNMA 1HEIA 2Z2KA 3E7XA 4UUNA 2Y93A 2BGNA 3ODGA 2QMYA 2P9HA 3DHVA 2Q3BA 4EECA 2CGEA 3JAWA 5FUBA 4CCAA 5KTPA 2IHKA 2A9KA 2W2QA 1D2NA 3DULA 4RADA 1NXXA 4HDSB 1FX0A 1PJ8A 1TE2A 3R3UA 3GOHA 2X3YA 1GUZA 2KM1A 1QO0D 3BTSA 1ISSA 1LK7A 4PPQA 4EGQA 4HX5A 1QANA 3LNCA 2ECPA 3RK4A 3O1HB 3RU2A 1L5RA 5FRDA 1OAOA 3WP0A 1F0NA 2WT4A 3G79A 3MT7A 2UXCB 3L8CA 3R3YA 2YCLA 2PVSA 2N75A 3IUPA 1VLLA 1DRUA 1EUDA 4YMGA 4RK0A 1Z5NA 4R8SA 2WQZA 2SKEA 1S01A 4LDJA 1GIAA 4DM4A 3H1BA 5FI5A 6Q21A 1JT9A 4HWRA 4F6RA 4ZQEA 3V6LA 1VHLA 5MN4A 1TZKA 4NBTA 4UMEA 3GV0A 4G9GA 4Q1AA 4REOA 1OLSB 4X66B 4ND8A 1UAAA 1XVLA 2HC9A 4QDKA 3TXYA 4B3CA 1Q12A 2YV4A 3OLXA 3TOZA 4WPGA 2QTAA 3PA8A 4QNMA 4TSFA 4F3RA 5K4GA 1NZFA 1H2HA 4PLGA 5FKJA 5BN4B 5K45A 2BEJA 1ZIOA 4FEGA 3E9ZA 1U90A 4ACAA 1WLYA 2WWGA 5EHZA 5EJIA 4GKBA 4EFNA 1NJFA 4WVLA 4TT3D 4KIJA 1RRVA 4F2WA 2GTHA 1ARZA 2EIXA 4BE4A 3P19A 1GCAA 4F9FA 3KR2A 4MDEA 1BG6A 4ZANA 4TYMA 2M1XA 1E1NA 2WUDA 3FDZA 3OU7A 4JZYA 2J3MA 3ANNA 5FPHA 2V7UA 3N07A 4EUSA 3AM4A 4X62B 3CVXA 1WUHS 1DAKA 4FE3A 4C03A 2H5IA 1YQWA 1GJRA 5HE9A 3VNBA 3ASVA 1OIVA 2P7IA 4JT4A 1EJ0A 2BFOA 1XP5A 1IBCA 3ICWA 4ZCPA 3FDZB 1CS0A 1G2QA 4L16A 5AXDA 2ZATA 1ZAKA 2H29A 4YMIA 4ZREA 3EPLA 1VCIA 1ES9A 1JR4A 4XTRA 1QIKA 6REQA 4JBIA 3FWNA 2W2LD 4LZNA 1EBBA 2A5JA 2NZJA 4Y2XA 5IVIA 3V1TC 1JSRA 2VNSA 1BXKA 2P3QA 2EGHA 1V9CA 3JR3A 3K9CA 4R0MA 1GYRA 3RRBA 2OZKA 3MPOA 1G8KA 5MGBA 2XIQA 5E0OA 1FFHA 2I8LA 2YX1A 1U1FA 4IVPA 4K9SA 1DG9A 4QUAA 2R1UA 1MZVA 2B4TO 4IIJA 5HA5A 2DXIA 4L74A 3VR4H 1TEHA 1U99A 3C3MA 3T1OA 4CMIB 3Q5DA 3KTDA 3CEAA 3FAZA 3WL6A 1F8XA 2F6RA 2CHUA 1VE6A 1Z2CA 4XCQA 5EL0A 4JI5B 3RVMA 3VU8A 3ABSB 3R3WA 4UXJA 5ILOA 3W9BA 2J46A 5CDFA 4EPXA 2X2FA 1TKCA 2IDMA 1ZLYA 1Q22A 1DTSA 4FI3C 1ISPA 1QCYA 4O3FA 3ZS8A 2X0NA 3IBTA 4JUDX 3NYWA 4LKRA 4G4SO 3CZMA 1TDJA 2GBLA 1GM5A 1CUXA 1ODIA 4LF6B 4L5AA 2J4CA 3TTWA 4DDMA 2J6IA 3UV7A 4CM8A 5B3KA 1QP4A 1NU6A 1P73A 1TMOA 1XL0A 1X8XA 1WDMA 1VBMA 3GRVA 2B35A 2VZ0A 1X1TA 3L02A 1D6JA 1G21B 5IDVA 2QORA 3H05A 1N92A 1DBVO 2HSZA 2Z1NA 4JELA 5EHQA 5L7TA 5LXTF 5F98A 2QLJA 1I36A 3ASZA 4QXQA 2A9JA 1CTQA 3ONFA 4MS3A 3E9YA 3TFQA 4M36A 3MTEA 2EHJA 4WJZA 4O02B 3V9AA 2H2GA 4INJA 1DJQA 3DLTA 1T4BA 1X7YB 2LRHA 1ULZA 4BP9A 1WDKA 4HNRA 2LW7A 1PG2A 2ZUSA 2QZPA 1Z88A 1VIDA 3LCMA 4BEVA 2XITA 3HJUA 2H8KA 1EI9A 4HATA 4OG2A 3AQ4A 2JATA 3BA6A 1DO2A 3RGWS 2R79A 4X7RA 1EGVB 1T25A 1UJ6A 2NSJA 3IUYA 1ZOOA 4AIIA 1SB8A 1RJ9B 3KB6A 4O4LF 4UJ3A 5DT2A 5L95A 1UP6A 4JI3B 3PDWA 1USUA 4IDPA 2IYEA 5FUWA 5BOSA 4PTYA 1CUEA 3L4BA 1O89A 2D06A 1JVNA 3W7VA 3D8RA 3L6BA 3PNOA 3ROZA 3X1ZA 2BC9A 5EXPA 2RHMA 5LB4A 1ZW1A 5HMMA 1P2BA 1A7KA 1OYWA 4I6JA 4K28A 3PDIB 2GSDA 4MPDA 1ZGJA 5AM1A 2NV6A 1M2WA 2X5XA 4O4IB 2GO1A 2OYCA 3T0FA 2A6PA 1AY0A 3GFBA 5T41A 2IHVA 1FC0A 3NVAA 3P0RA 3QFFA 3E82A 2WJVA 4HB2A 4WN3A 3V7FA 4E2YA 5IX8A 1MO3A 1OIWA 1S5PA 1F4VA 1CU1A 1KEKA 1YNOA 5ADVA 2XWQA 2YICA 3KM0A 1ZH8A 4Q9KA 4FYXA 2W8BB 3CN7A 1WXFA 1XLVA 4G01B 4NTZA 4MSUA 1VBKA 5ES4B 5GZ3A 3VHXB 2YJ5A 5K3FB 3PC4A 2NTEA 1LFAA 4BKRA 3NR2A 1ESDA 4LXYA 5A7HA 2WSSD 3LBNA 1A72A 1POWA 1U2SA 2X1HA 3ONNA 2HA2A 3LVRE 3GP8A 1JDNA 1SC4A 4HDMA 2XQIA 2UZ1B 4QQKA 3P9PA 4JOBA 4QO7A 2HIAA 1SKBA 1VGRA 2PANA 3I2FA 2V6IA 2Q4RA 2XECA 1I3OA 4U0JA 1CZRA 2AMFA 3H5IA 3PKZA 3K9LA 4EUEA 5CDFE 3D6JA 4U7DA 4GE0A 4YJHB 5HF6A 1RBYA 2GLTA 1PK9A 3R44A 4FOTA 3INNA 4V0NA 2R00C 1DOHA 4ZYYA 4KYIB 4IWNA 4WLVA 2J3QA 4NONA 4Y2TA 4HAZA 3HU5A 1UKCA 2OZPA 2QTZA 1Y9EA 3E61A 1EX9A 3HDVA 5ALSA 3RTAA 2ZJAA 3SEAA 1Q2UA 1SM4A 4ENUA 3HI4A 1AXGA 3INGA 2L18A 3QHPA 4HUQA 3AWIA 4DQUA 3LC0A 3NYIA 2IPOA 5HQTA 4MUBA 2R4QA 4J0JA 3B6IA 1ZICA 4OSPA 2Y0EA 1H0HA 3EIEA 3G2MA 4LZLA 2JFVA 3AIOA 1REQB 2JH8A 4G8JA 5EWLB 4DJDC 2CXSA 2H5LA 4JXZA 1SOAA 1IATA 1PW7A 5BR1A 4DR7B 1DI0A 2X0IA 8LDHA 3RU7A 1VGVA 1AKYA 3BWVA 3S0JA 3BMOA 2E48A 1J0CA 1CCWA 2RK4A 3EVEA 1RM5A 2V96A 1SUFA 3I45A 3MBIA 3PJFA 5F3RA 5JDCC 4HUTA 2ZDQA 1HETA 1E9RA 4OQDA 4D8YA 4DN6A 3RSZA 2ZIVB 4LA4A 1G6HA 2Z8ZA 2PZKA 3EPJA 3ANXA 1UWLA 2JCGA 3NBMA 2RGWA 4A0RA 2QXYA 4OYRA 1NTOA 3E70C 4IS3A 4QRHA 3U6BA 4B7CA 4ZEXA 1AKVA 1VPTA 2XKKA 3ZS9A 4LF9B 3NUGA 2I7XA 3ILVA 1ZNXA 4AYTA 3V1YA 3ANTA 3WK5A 1SOUA 2PD6A 3LC7O 1VSTA 3LY9A 1GPAA 3OFND 1HDRA 3UMJA 3GJ5A 4MV5A 1L7AA 1IY8A 2ZQYA 3TK1A 1XTRA 4ZGBA 4A5OA 2VJCA 4N39A 4PZ0A 5LC1A 1TD9A 1Z0KA 5AIAA 1T9CA 2PT7A 2XF2A 3NFYA 1W47A 4EYEA 3C2QA 3WKAA 4G0OA 721PA 4BLSA 3IB6A 3I23A 3ITNA 3H8SA 1KJIA 4U3JB 1ZIYA 1YMVA 4N5DA 4CM1A 3AI2A 4RDCA 2VNKA 4OQLA 1KAOA 3ZKAA 3U1TA 1CRQA 2GFQA 2R6CA 4OGFA 3AGPA 1Q19A 5KHLB 2XMQA 3M3HA 4Q7KA 5KIAA 3U7JA 4CEJB 1U7WA 1P39A 4UUQA 2ZJ2A 1E60A 2NV0A 1RHJA 1FP2A 3FCEA 1EX1A 1TVKB 3E7WA 2VP3A 2P68A 2GRAA 1PZGA 1YR8A 4YUYA 2Q9BA 4S1NA 4W4TA 4YAIA 3ZWKA 3U49A 4F2PA 3TNFA 3QX8A 2X2OA 3PR3A 1T1IA 1OB2A 4G4GA 3T7EA 3ZDFA 4CR8A 3NXSA 1YJAA 4FZVA 1L5GB 1JFSA 5LIRA 1F60A 3EPPA 1H2RS 2FEMA 2PWBA 2VAXA 3EFOA 4TMVA 4Y1FA 4YCJA 1JDBB 4TS1A 1Z62A 4DUGD 1BDHA 4NAHA 4FKZA 2PL1A 4M53A 2FUCA 4K40A 4KWTA 3H0CA 1J42A 1DAFA 1V11A 1XRJA 1PLLA 4GZ6A 5EN4A 1L5HA 1TYDE 5I45A 4CEIA 4BFTA 3JALB 2BEVB 3VMFA 4AYWA 1R4NB 2OV1A 1CRPA 1NQAO 3G3EA 3I09A 2BVNA 2AFIB 2DFLA 4I4TF 1E1KA 3MQ4A 3P2OA 1YWGO 1A4UA 2DVMA 3NPMA 4RLSA 1P9RA 4GXRA 1YS6A 3TLBA 1KJYA 1BJKA 5DH9A 2A84A 4K9KA 1PTJC 1BVHA 3HO8A 1KNQA 2WD8A 4ZKEA 4HMOA 2AQ8A 2WZDA 3JS5A 5EXDA 3V8MA 1R5BA 3OSZA 4M89A 1CQIA 3VZQA 2BBWA 2BGGA 2WY2D 3K1JA 2H4ZA 2F67A 2RGNA 3B9RA 1EM8A 1THMA 1ZD5A 3LHSA 3PDIA 2W2OA 4KAFA 2HHLA 2B4KA 3AJ9A 3NBYC 1ZC4A 1SIUA 3KFXA 3C39A 3HP1A 1YDFA 5M04A 4JB2A 1FRNA 1ZXLA 4PQFA 4AJ1A 4BCCA 1RQNA 2JIRA 2PXAA 2C2OA 3CF0A 5FBRB 3I9LA 1F8FA 2YHAA 4QRIA 2OHHA 4ENVA 5K3SA 1C8KA 2J41A 3WFJA 2F48A 2BSQA 2PT5A 2Y05A 3B52X 4G09A 3ZVNA 4ZT2A 4A03A 4N5HX 4P8RA 5KJEA 1AKWA 2FP4A 3EVZA 2CD7A 1MB3A 2G5TA 1ZKMA 3PA6A 2CWWA 1KIAA 3EVTA 4WASA 4FWTA 3O0DA 2Y0CA 4R9UC 4O2LA 3VR4D 1RQPA 1T43A 5CBKA 1AH2A 2QM8A 1WZEA 4I55B 3EXFA 5DULA 2PD3A 3H7AA 2JH3A 3WISA 1TW2A 4QEDA 3D1VA 1H2XA 3WK8A 4AZSA 3I5XA 3GUZA 3PIRA 1A76A 2Z6QA 4X20A 1J56A 1QNLA 2KHZA 4U2DA 3VR5D 3FKJA 1EZZA 4IHJB 4QBTA 5CYOA 1M2OB 1G21A 2PS0A 3KWMA 5JR3A 1C0IA 1QGZA 3TUZC 3HVHA 3K0HA 5CJ2A 5CNKA 3DZIA 3KKPA 2C9MA 4PG7A 5FEMA 4DBVO 2GF2A 4QYWA 4HYTA 4IHJA 1RABA 3WHIA 4D6YA 4D96A 2RB5A 1ENYA 1Y81A 3LX5A 3B70A 3GRCA 4EY8A 5IKPA 2RI6A 3ESYA 5LQJA 2HT1A 5ARCA 1TT5A 1INLA 4XPIB 1EJ6A 5A5DA 4DBZA 2FSVC 5FA5A 4KAAA 3NMUF 3MS2A 3LOUA 2ZSKA 2PXCA 5LOVA 2WBLC 3OLVA 4CMJA 4NYIR 4FUQA 3MYRA 3GVHA 4PZUA 5EIWA 4AP5A 3MD9A 5LMNB 2GVDC 4JAVC 3ZQ4A 4B3JA 1Y9ZA 4ATNA 4JQYA 5ELXA 3UTCA 4PRYA 1TQ8A 3KWJA 3E9DA 3I04M 3E48A 1NF2A 3TI7A 4PZEA 2LTAA 1A98A 5K9ZA 2FGKA 6GPBA 2FJPA 2C5FA 1JLLB 1Z2NX 3PTLA 5J59A 5J47A 1T91A 5HW0A 1NBIA 1T2UA 1Z4QA 3FDXA 4G37A 4NBKA 4FX2A 3M1YA 2F3PA 2B21A 4S1PA 5JCXA 1VZ2A 2ZSEA 5HUQA 3DNFA 2GUWA 3F98A 2LCFA 3T6KA 3ODPA 3F2IA 1U2DC 1Q6ZA 4I4TB 2REQA 4BNJA 1XVAA 1QGAA 1XYGA 1NVGA 5HJ5A 1WZUA 2RAPA 2W0SA 4ENRA 3TS1A 4LVUA 1IRIA 4Q4AB 1L7BA 1US8B 1XAHA 2XE8A 1EFVB 3M8KA 3VOBA 1H2EA 5K0EA 4BQRA 2Y1KA 2VL7A 2FDXA 4WE3A 3RVJA 4GIBA 4WNYA 4BNNA 1Z3CA 1QR2A 1VZ3A 2VUSA 2YINC 3GBPA 1UFQA 4PVDA 2G7ZA 1WPRA 5KINB 2NU9A 4F4UA 1WWKA 4IFBA 2LIVA 4LQ4A 1NFRA 4NE2A 5B3AA 2VDUE 2PUCA 4B74A 3WB0A 1U4NA 2I4OA 3DV0B 3KPYA 5FXMA 4RMHA 1GG2A 4FC6A 3KRTA 4BN0A 2G82A 4R71A 4MXDA 3ZI7A 3WRYC 3R3VA 1Z6QA 2QE7A 4NXMB 3FLAA 4WACA 2EBUA 3BJMA 4B80A 1XD9A 2WP8J 2XRMA 4Z53A 1BJTA 3B1XA 1DCKA 4QPPA 3NWJA 4NU5A 2TMDA 1C9DB 4N47A 1SKAA 2ZE6A 4GBED 3G0BA 3ZQKA 1Z8NA 4AN0A 3K0FB 1KJJA 1EAMA 1G16A 1KR2A 2XCQA 4HHEA 4RPGA 5EA2A 3HO1A 2XV1A 1E9FA 1N0WA 2CK3D 2O0KA 3NPAA 5EJAA 3WADA 1GA1A 5JNLA 1O77A 1GSOA 1M6VB 5K5EA 2AE2A 4LHWA 3TW0A 5A04A 2RKBA 1YOBA 1GL9B 2ZBDA 2ZKLA 1F5SA 2NW6A 1N25A 2BDTA 2XMCA 2QAGC 2BZGA 1E1QD 3OE7D 3QI7A 1G5FA 3UT5A 1UBOS 4NOJA 2GYWA 5AW8A 2WSMA 4E70A 3P4YA 1ECPA 1EFHA 4UNNA 2WJPA 3ORYA 1M8FA 4EGFA 3MT8A 3MJRA 2I4MA 3M6MD 3TNDA 1DJMA 1GUFA 5J1SB 3IQXA 2FUG6 1QCZA 1NKVA 1IOLA 2CL0X 4E0BA 1JF8A 1AQIA 3O5AA 1SHKA 4UCXA 4WZBA 2DWUA 5HFJA 3DEAA 3V1UA 1DAEA 3N8KA 3BMQB 2V03A 4LTNA 5JXGA 1EGHA 3OU2A 1M6YA 4Q9LA 3QJ5A 3S5JA 1VP9A 1QZTA 1Y89A 4HDNB 4REQA 1WXIA 2E6KA 2JA2A 4RVOA 3U9LA 2EZ8A 1SKYE 2P6RA 2AFHA 1RWMA 2KWIA 4IMPA 3UATA 1QFMA 4M0DA 2PH1A 4WGGA 1ZM9A 3MWJA 2JW5A 2CLOB 3CE9A 5LUBA 4CU2A 2C5BA 2OWEA 5BWLA 1I1QB 1VXOA 1XEWX 2O8VA 2DHRA 2QD4A 4BMDA 2A1TR 2C57A 1EMDA 2JRLA 2COUA 3QKIA 4PFSA 3R3HA 2PGLA 3NRCA 1VPDA 2VZEA 5A0FA 4YAWA 3QUTA 2H4FA 2ZRKA 3E58A 3ND6A 4BFVA 2BGTA 3BMCA 1N5IA 4Q82A 2KMLA 5F9MA 3C6KA 4H6PA 3SZMA 4CG3A 1OAKA 2ZSAA 1PG5A 4AZ3A 3QTLA 3IILA 4A0GA 3OJEA 3SXPA 2WJAA 1RCUA 2JK0A 2CZCA 3U3MA 4YCMA 5CXQA 5K6TA 4DAEA 1MVNA 3ZWMA 2NXNA 3QX9A 5FPSA 3FLEA 2JIZD 3WLAA 5HK8A 1MX5A 2XB9A 3H83A 3LDGA 3AM5A 3EIOA 4AJPA 1T9GS 4IDFA 4V3CA 4HQLA 1U0EA 1VB5A 5BQXA 4ML3A 3FG9A 4D92A 1ID8A 4KRXA 4DPMA 4CKXA 5FA8A 4TTVA 1QQ6A 3KLPX 1BA3A 3A6KA 4XCVA 3PFWO 1TVKA 4OLBA 3AR5A 1XL1A 2CFTA 1FFEA 4GYJA 3WL5A 1EIZA 2P9ZA 3EMVA 1LGYA 3QX3A 3HGMA 1VG9B 3NVKI 2WTMA 4J94A 4KSBA 2EZ9A 5CAEB 3K8QA 4BV3A 2L82A 3D1LA 1MD9A 4PFQA 3TW8B 1JIXA 5CG2A 2C99A 3L8ZA 4YQFA 1GV1A 3ECCA 4N6NA 1Y7IA 2PBLA 4WNCA 2ZETA 1EE9A 3LWBA 4LYFA 5ARDA 3STTA 3HL0A 2WT8A 4ID3A 1ISJA 1O9GA 4NZYA 1JWBB 4R68A 4CNQA 4G0QA 2GRJA 4WFJA 2O8EA 1COWD 4L27A 1RJEA 3Q8WA 1Z0FA 3PE4A 3ZC3A 2MTBA 2BTEA 3EZLA 3LBIA 2R2AA 3EE6A 3LKVA 2QRKA 5CXSA 5DLDA 1QRAA 5DI9A 1SKUA 1Q11A 2GJKA 1ZNZA 5A2GA 4R4JA 3AJDA 3MA0A 2VTBA 4MQ6A 3T12A 3G02A 4F38A 4IP0A 1U65A 1F5NA 3QKRB 4URWR 1N7GA 1HKUA 1Q7RA 1XELA 5AKKA 2P2ZA 3W6UA 5BV1A 1AHHA 3LCJA 2JANA 3ZHZA 4BWVA 4INOA 4JZKA 2DFPA 4QXRA 1E2MA 5TMBA 3UWMA 4EA8A 4EJSC 1NQ5A 3KJFA 1XDGA 4KG7A 4YRZA 5I8WA 2UYGA 1U8EA 4LKOA 5ECGC 4RSMA 4QD3A 5DSTA 2WSSA 3NXKA 1JLLA 1PJ2A 1YZVA 3C0KA 2CLFB 2XOXA 4GOKA 3S1LA 4AXBA 2ZUBA 2DCUA 2EVWX 1E1QA 2AN5A 4FPXA 3REOA 4FB4A 2M32A 3RVQA 2VHVA 1NMEA 1FP4A 2FZGA 2ISSD 4BASA 4B76A 3F6CA 5JNUA 2QTMA 4MKXA 4BX9A 1VL2A 5I4KA 5IP5A 1YV9A 1HRKA 2GBPA 1LW6E 1CY4A 1R0CA 1LQTA 2FPPB 2H4JA 3A14A 3IGFA 5DK4A 3G7UA 5EJ6A 5JUWA 1JPJA 1XQXA 2GN8A 4F2DA 4ZI2A 3QPVA 1RZVA 4J4HA 5HVNA 1Q15A 5FORA 4IM7A 1GKLA 1L7QA 1QSGA 4LFAB 2ZREA 1U3FA 4W1PA 1CF4A 4TMWA 3NH6A 5TR9A 4EMTA 3DLAA 4EYQA 1XTTA 4JS0A 4P54A 4KOEC 1EE2A 3KTAA 5D5QA 1R0KA 1I80A 4GRIA 4ZVLA 4E15A 2O1SA 3VDNB 4IS2A 5JANA 2GPBA 1IBLB 1U9ZA 2OTCA 3FETA 3JSXA 4B84A 1L5SA 2AG6A 3IQEA 1WL8A 2EOAA 4BKOA 3FYUA 3HBNA 2FPKA 6PFKA 2FWNA 3HY3A 4NC9A 2DKNA 2OM2A 3A3OA 1ODTC 5HG0A 1F6BA 4Q3KA 3LZCA 3RTDA 5EIEA 5K01A 1SY7A 4NV1A 5I8ZA 2PMEA 4D4LA 3UEOA 1HDCA 5DM70 3T34A 2HMUA 3K09C 3PXCX 4QODA 2A0WA 2IIQA 1HDIA 2CXPA 2HJWA 4JX9A 1IUNA 2G5CA 1GTZA 1K6IA 3PUWA 4AJEA 1YUMA 1X7YA 2P2DA 4QYTA 4HZUB 4D99A 4DUGA 2Y99A 3AUSA 2PLNA 1MJGA 4OKIA 3ZDYB 1SZDA 1Y1LA 5AP9A 2ENWA 2Q1TA 4EMUA 1VI2A 3PU6A 4AJJA 3W2IA 4FQ7A 2F62A 3AR9A 4MP3A 4U7FA 4GOLD 1ISHA 3N76A 2JJ8A 2X86A 2XRYA 1JHRA 3KJQA 1SCUA 2YZ2A 1HX7A 2PWZA 4PLHA 4FZ5A 4MS1A 3BTOA 3AHGA 3NHSA 2ZYIA 3EZNA 1NOKA 3IVGA 2EKQA 4FILA 3CLRD 2X0DA 2BJWA 1JMVA 2JASA 4LCJA 4X91A 1ADYA 1P74A 3QKSA 1DBSA 3A9WA 3R41A 1O97D 4GUDA 2GM5A 3LWDA 4ZPJA 4N5NA 1EFVA 1OJLA 1JDVA 2WIJA 3GPDG 4CCYA 4CMGA 2D7DA 4DIEA 2XQFA 4UZSA 4ZHSA 4MQ4A 4O29A 2HF7A 2BEUA 3WKEA 1ENZA 5EIOA 4EHNA 3IE0A 4FINA 3SHWA 2CN1A 3AI7A 3NHWA 4KQMA 3OKPA 2HCFA 2ZDHA 4PNZA 3PCXA 1KK2A 3EVAA 4RVCA 3WNBA 3H1PA 2ZJ1A 1NLFA 1VRWA 1JWAB 3QQPA 4R5HA 1QB8A 2HMTA 2XJ4A 3C5WP 2WJJA 3FHLA 1NF9A 1VKHA 4DEVA 1A5BB 4DLPA 2CYAA 2JFHA 3EBOA 4FGSA 3QVWA 5B58T 4NH0A 2WVJA 1E4YA 3RV4A 1U9IA 2NZYA 3ANLA 3AY0A 3Q7RA 3VU9B 4B75A 4ZFNA 1OH8A 3F5MA 3KE9A 5KB3A 1PI3A 2V98A 3ROQA 1B6TA 2OBYA 1OJ7A 2JIQA 5GM2A 2V45A 1RQGA 1W1UA 2J5KA 3NM4A 4YO8A 4KXLA 4RSGA 3TTXA 2Z1MA 5J4HA 5FLXA 1PYDA 3BSFA 4TN1A 4EAAA 2J7PD 2WVHA 1ZD8A 3OKFA 4G4JA 1L1RA 1ZHHA 3SBXA 1SCNE 2NTYC 3KSRA 3OQVA 3VKGA 3I2JA 4PRLA 1QUEA 4J7AA 4JSTA 3PCTA 2CT8A 4XCXA 1P75A 3I0NA 4OMUA 4Y6RA 2O1WA 5GPBA 2HB6A 4MV3A 2DQYA 4EGSA 2VR1A 3EGDA 3P2YA 3GJSA 1JHMA 2OCYC 1E7SA 2AJTA 2YFQA 1EG7A 2WIBA 3CBGA 3GFOA 3KYCA 4LFCB 3LL7A 3OICA 3RSHA 2JIPA 3E4DA 2NVOA 5A9TA 3AF3A 2I1LA 2Q4DA 3D6HA 5CUQA 4L9RA 4GEGA 2PLAA 3GCXA 3HDTA 1GXSB 5BYJA 1DUVG 1XQ6A 3BKWA 3HXTA 4J29A 2ZIFA 4CMAA 3AFOA 4MLCA 4DG9A 3GG2A 5AOVA 1K6JA 3Q2OA 4FHEA 3GLVA 3TAHA 1O58A 1QIEA 2UZ3A 2CNWA 3W5UA 1RM3A 3KAJA 1ZJYA 1ETUA 1XYVA 4HCJA 3IDSA 1C1XB 4U9HS 5F64A 2PUEA 4NBLA 2I80A 4FOSA 4O59O 2GM4A 3T5AA 3NOVA 3R5XA 4JN6B 4YAJA 2ZT7A 1J5XA 3V9PA 1QJ4A 2HX1A 2JHCA 4N65A 3NG1A 4QO8A 4Y7DA 1F17A 2AFIA 1RACA 5CMLA 2EL9A 1YR6A 2AMLA 2YQ4A 3IQDB 3FSJX 5AKXA 4B3DA 2XGJA 1ZSNA 2B98A 5FJIA 1X1BA 3PKJA 5DO9A 1YXMA 2FPWA 3T95A 2GJSA 5ELLA 4TYWA 3QUSA 3AJEA 2E49A 1Y34E 1U1CA 1D1PA 2G63A 1BVRA 3P9KA 4B6EA 4YT4A 3NC4A 2JZOA 5F1YA 1FQJA 5EP4A 4DG8A 2XMZA 2HIHA 4M1QA 3QFRA 4ZT5A 4FC7A 5DF1A 3S2YA 5JC8A 4RV9A 2QN7A 2XSZD 1BE6A 3M3PA 3KL2A 4BZPA 3PUIA 4NP6A 1O95D 2WWIA 4QUEA 5TX7A 4MULA 4RZXA 3QW2A 3GUHA 1DBIA 3L93A 4PYRA 3TLYA 1DBWA 2WFZA 2RONA 3K2IA 5HF5A 2JKYA 1VRVA 2W43A 1V37A 3JZDA 4MPRA 4ALNA 4JITA 4NFHA 4WZ6A 3EIUA 5EGNA 4AUNA 1CVLA 1YDHA 4JB0A 5G3YA 5CFPA 1ZH2A 3O75A 3DOCA 3TN7A 3BBPA 4X8OA 2ZLBA 3SJCA 2GJ8A 2PU5A 3FGOA 4EYGA 5SICE 5KYGA 1LXCA 3U4IA 4K03A 2XRFA 4FXOA 2G9NA 1UQTA 3QG1A 3JQCA 4L2IA 1JKJA 2PL3A 1FMTA 5DHRA 4D74A 2I2FA 1OLXA 1BVYF 1XZFA 4WEQA 1U7PA 3B9PA 4YMUA 2NZ8A 1E5QA 2EJTA 2PZJA 2OFXA 3B1KA 3CLKA 4XQCA 5T8KC 5EIHA 2CLDX 4MGYR 4TYPA 4U39A 3VKUA 5TF4A 2X9LA 3QBVA 3A4VA 4U2GA 1PR1A 3AEYA 3OCJA 1NR1A 4ENSA 3URKA 1WF6A 2OECA 1YCGA 1HORA 4Y9DA 4DLNA 4DB2A 1FDSA 3IKMB 3G5TA 1W5BA 4BYGA 4M0CA 2NYRA 4A7PA 3SQDA 3T1YB 1K97A 2W8ZA 4HLNA 2EQ5A 1UOQA 1ZLXA 2PM8A 4TXMA 5H1YA 4KWEA 1D2CA 1KEZA 2BOVA 3T35A 4S05A 1I14A 4OAQA 4IJUA 5BOSB 3CMMA 3ZWWA 4ZPXA 5L4SA 2C5EA 1E6LA 4DF3A 4YEDA 1JSZA 1OZFA 3OA0A 3PK0A 4RXMA 1BXRB 5HM6A 4D7AA 5EY5B 5JI2E 1ZYUA 4OAOA 1KHHA 1XRQA 2X77A 3D6MA 3NT2A 5I4IA 1QH1A 3AMVA 2PT9A 2QLNA 3IEPA 4F8JA 2PTHA 3F8WA 4HDKA 5LJIA 1B3RA 1ULAA 3JR7A 3L0ZA 4QJ3A 5A3JA 2POQX 2B5VA 2WUWE 3I9OA 3KB8A 3QSGA 3WNVA 5FTLA 1A82A 3WMXA 4PYNA 2O7SA 3L77A 1OFVA 1PWEA 2AJLI 1K4MA 5IS2A 1OZAA 2FEWB 2E4ZA 4GPD1 3EJ6A 4V0ME 2PUAA 3S5UA 4NOKA 2C1ZA 5C81A 3BSWA 4FKMA 3GG9A 3AL3A 4IHKA 4OTZA 3WZLA 1SXJB 1ZGCA 5GQSA 2ZM6B 3FVWA 2GK3A 1CNMA 4Z4CA 3KOMA 1CQPA 1PR6A 2IPXA 1OX5A 5EUCA 1EWQA 1EVQA 1VL5A 4XD7D 4C7OA 3HP4A 3UGJA 1MTOA 3AY6A 3MGGA 4RORA 1TB4A 4M7PA 1JAYA 2VNHA 3H2GA 3KSUA 4JYPA 1AGPA 5CR9A 3TZCA 1KE2A 1B3BA 1GPLA 4RGVA 2XLBA 3A28A 2WNIA 3LTEA 3PX2A 4CIAA 3IOEA 3LX4A 1YK1A 4BGEA 4UULA 3FH0A 4HZIA 4MWCA 3AVVA 3LGXA 4BQIA 2AN4A 2PQ6A 3TM4A 5E38A 1WS6A 2C9DA 4TLDA 2DQZA 3TUIC 1SQ5A 1GTL1 2R66A 2QE6A 4B6GA 1Z0SA 2R1TB 4LSZA 3C7CB 3O83A 3B5IA 3C3PA 3GLFB 2YC2C 4DQVA 3OZDA 1HTBA 1YR3A 4CHTA 4OFZA 4M0MA 2HR1A 1L4KA 3M4ZA 1KO4A 3CYFA 5GMOA 4CBVA 2HNKA 1LQ2A 2B36A 4JC5A 2DWPA 3O2SB 1ULBA 1BXGA 1WO8A 3LA6A 5GONB 4MW5A 4YJ3F 3VOAA 2VSFA 4PTZA 4XB1A 2J3HA 2A4MA 4A8PA 2D6FA 4LQDA 4UJ5A 2A8YA 1GN9A 4PBTA 1VG0B 2W70A 8AT1A 3G8CA 4KQHA 4OB6A 3JQ9A 3FRHA 3SQLA 4G8CA 1ONNA 5FQNA 3KAQA 1UKYA 2OZLB 2VDKB 2XI4A 3N1UA 5J9FA 4Y9SA 3LD9A 1ADFA 4GEKA 3B51X 1VG8A 1E64A 3KEFA 1CUBA 1WAMA 4BNIA 2YJ4A 4J03A 4B79A 2YY6A 5MFPA 5U1PA 3SS7X 1B74A 2BW0A 2IZ0A 2CK3A 2NU6B 4XAQA 1TI7A 4EFLA 2OMKA 5LUAA 1P1IA 4CXMA 2XQVA 1G3QA 3QVJA 5L9AA 3H65A 3H8VA 3HRKA 3MWEA 3LF2A 3TPZA 2JAHA 4ITUA 4E2XA 1P3Y1 3CCBA 4P4TA 1SG9A 3D2AA 5DHAA 4B2YA 5C3MA 5AW1A 4I1RA 4NZOA 1RXWA 1OXSC 1NJ5A 1OVGA 3Q7SA 1Z6TA 3SGLA 1E3MA 5BW5A 2H52A 3W77A 4TRRA 1VL0A 1ZWLA 2FE4A 3W4JA 4NDZA 1TVCA 1XZQA 5T4HA 1H6CA 4A3SA 2GCPA 2C9BA 3JQAB 2ZW9A 1YI0A 4IDEA 2E7ZA 3DKVA 1GA6A 4BQOA 1W5SA 1JMKC 3K9WA 3DFIA 3GJ6A 1N1MA 1TLLA 3K73O 3BF8A 4GBMA 4DNOA 5CD1A 4CCYB 3EODA 1NLUA 3D7SA 4ESOA 2XOKD 4ZTUB 4KAJA 2CLIB 1L6RA 1S02A 4IVRA 5F35A 3OX3A 4C2UA 2Q8PA 3ESCA 3I4FA 4I46A 2BELA 2HU8A 4S2UA 1VBNA 3ZE2B 1ZUWA 3AUKA 3O4RA 4PFKA 4DRZA 2GAIA 3M83A 4KX3A 4B4WA 4FT2A 1C0KA 5A1JA 1UQRA 3FNHA 3R7WB 4JYCA 3N9IA 3GLKA 1H3NA 1LUAA 2C9OA 1M54A 2IP4A 2W2KB 1O94A 2WPNA 4EB6A 1QG6A 4QASA 1XPRA 4PHHA 1U2RA 2VNJA 4ZZ1A 3HA2A 2AN9A 2G6TA 1QO9A 4BIMA 3PHGA 2QX9A 4NJEB 2MINA 2YN2A 1H65A 4AZ3B 1M6EX 5JDCA 1FX0B 3ZVMA 3ORHA 4JP2A 4R7GA 1U6IA 4MCIA 3MMNA 2FVXA 3ZJ4A 2PV7A 4D44A 5FTMA 1G5RA 1XTBA 1V9LA 2C3YA 5AUQA 1HYQA 4MWGA 4CLDA 4MGZR 4D02A 4LF5B 1ZOPA 3FCYA 1CDDA 2UU9B 4IIBA 1AKQA 3RLIA 4OF4A 1QHGA 3WRVA 2XKJE 5IPFA 3EGOA 4W5HA 3SR0A 3ZU5A 4DUPA 9ABPA 3BL6A 4UBJA 4C3ZA 1S3GA 4OUDA 3WQQA 3VDMA 1JYEA