4XJVA

Crystal structure of human thioesterase 2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
216
Chain Sequence
ATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Substrate Specificity of Human Thioesterase 2: INSIGHTS INTO THE MOLECULAR BASIS FOR THE MODULATION OF FATTY ACID SYNTHASE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords S-acyl fatty acid synthase thioesterase, medium chain
total genus 61
structure length 216
sequence length 241
ec nomenclature ec 3.1.2.14: Oleoyl-[acyl-carrier-protein] hydrolase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xjvA00
5AKIA 3ICVA 2WFLB 1IUOA 2IIVA 4JNCA 2QTBA 4KYVA 4UBKA 1QIDA 1VLQA 3LIIA 3W9BA 4DGQA 5DYWA 5DWDA 1UK6A 2AJ8A 3AFIA 4AN1A 4K6KA 3PUHA 2XMRA 3NGMA 4MWTA 3LIPA 3FWHA 2BGNA 3OM8A 2Z8XA 4G9GA 3R3XA 5JD5A 1AX9A 1BU8A 3N0TA 1TIBA 3IUMA 1G4HA 4J0KA 3RLIA 1HKHA 2XQGA 1UKBA 1XZLA 4G8DA 3ESDA 4IH9A 3O4GA 5JATA 3X3HA 3R3ZA 4TPKA 2I03A 4QE3A 2ZJFA 5DTJA 5FV4A 3FNBA 3BDVA 3PE6A 2RIPA 3TEJA 1LGYA 1WHSA 3D2BA 4UHDA 5CMLA 3RK4A 3WKCA 5ALUA 5YASA 2XUDA 2WHPA 2OAEA 4Y2YA 1O6FA 4UBNA 2R11A 3STWA 1F8UA 1WB5A 5EHQA 1K6EA 1MAAA 2WIJA 1PV1A 5BOVA 2QR5A 4Q1VA 3PF9A 1EXWA 2BUCA 3QM1A 2ACEA 3FVRA 2XUIA 4AXBA 5ALWA 3DL4A 2WKWA 3DEAA 3I28A 3VKFA 5DYYA 1Q0ZA 4CCWA 4C4ZA 3FYUA 1AKNA 3VXKA 4Q3OA 5A7GA 4BP8A 4JEIA 3YASA 3H2JA 2X8BA 3C43A 4B80A 5JZ9A 5AKHA 2OCLA 1E8NA 3DLTA 4KAFA 5FP0A 5FOQA 1ZIXA 3KOOA 3DDUA 3SK0A 4MJ3A 1UT6A 2CEKA 3EIOA 4UHCA 4ZV7A 4FLEA 1MT3A 1PJAA 1ODTC 2WIKA 3H1AA 3ICWA 4FNGA 1CUEA 1OXMA 2JEYA 4EA6A 5CT4A 5JALA 5KWJA 1ZIYA 1J06A 5AK5A 1F6WA 1AC5A 5CH3A 3KWJA 4ARAA 2V9ZA 2VEOA 3F98A 1XQWA 1LPPA 1XFDA 4UBOA 3G7NA 4EHBA 2XUOA 1JU3A 1L7AA 4FLMA 3FLBA 5CURA 2WUFA 5IVIA 2XUFA 3QYJA 1XZCA 5K3EA 2Y2VA 4X6YA 2O2GA 1XZMA 5C8ZA 5CBKA 4B84A 4PSUA 4EY6A 3MGAA 1OCEA 4Q05A 3HXKA 4BE9A 4Z49A 4HXEB 1H23A 2ZYIA 2H7CA 4BZZA 1T4MA 5LP1A 3UUEA 4MEAA 3B3QA 3B12A 1CQZA 3N2ZB 1B41A 3O4HA 1IMJA 2HIHA 2WG0A 3DKKA 1EI9A 1T2NA 5CT6A 3WL7A 5SYMA 3W05A 5ALZA 2DHEA 4H7EA 4N8EA 3I2KA 4L0CA 4N8SA 2XMGA 1ZICA 5AKGA 3UMJA 4L72A 2HFKA 5AI0A 2JIDA 3I6MA 4QLOA 5JARA 4W9RA 3ZLVA 1GT6A 3TGLA 3U1TA 5ALMA 4DSAA 1RWQA 4HXGA 3PFBA 3D59A 3BDIA 4WJLA 4J0DA 3OPMA 4GEGA 5HFNA 5K3FB 2WFLA 3B5EA 5AO9A 2JGLA 3AUKA 1EDDA 1FSSA 4B81A 4FNMA 2XMCA 4FWBA 1OILA 3WQHA 3MUOA 4WY5A 3JWEA 2DQYA 1ORWA 4X94A 2HFJA 3O9MA 3AILA 1MO2A 2XMZA 1NU8A 1CIJA 3S8YA 1ODCA 1VZ3A 5AKJA 5HF9A 1R88A 3EBLA 1P0QA 1XZGA 1QFSA 5EHXA 3ANSA 1GKLA 4BCDA 3R40A 4P92A 2XQFA 1MJ5A 5EI5A 3WL6A 3WMRA 3P2MA 1CUJA 1CUUA 1XRMA 1XZEA 3G0CA 1QJ4A 1NU6A 5HK9A 2YH2A 4GBGA 2OCGA 5CXXA 1ZOIA 1IZ8A 1CUBA 4U2DA 4W63A 2I3ZA 1DWQA 3WYNA 3STXA 4LHEA 3BE8A 5HF5A 3MUNA 1AMNA 3G0IA 4DMCA 4UBIA 3VVLA 1GPLA 1YB7A 3HLKA 4HAIA 1P0IA 2HU5A 4H7FA 3WK8A 3CXUA 4Y2RA 3SC2A 1WB6A 2JGFA 1CUVA 3IIIA 4MYDA 3S2ZA 3EQ9A 1N5MA 5A6VA 1VA4A 5SYNA 4X91A 2XUAA 2EDAA 4BBZA 3ZWQA 1EINA 5AM5A 1Q83A 1THTA 4GW3A 3C5WP 4TGLA 3D2CA 4BCBA 5AI9A 1VOTA 5AM1A 2OLEA 3I2JA 3FBWA 3DJYA 1XZKA 5AI5A 5ALSA 2XLBA 5ALEA 4U2GA 4KE7A 3L1IA 4KEAA 1F0PA 4MXDA 5AK6A 5ALGA 1XQYA 4QZVA 3K6KA 1IVYA 2BGRA 3WLAA 4CG3A 3PI6A 1QTIA 1UFOA 2FJ0A 1TCCA 2XMSA 1TK3A 2ZYSA 1CFJA 1XKLA 2XDWA 2WM2A 1CUAA 4MQLA 4J03A 3STTA 2FUKA 4L9AA 3FAKA 2GBFA 2GYVA 4Q34A 3BXPA 4AZ3A 2C5GA 5AIBA 2HU8A 1UK8A 1XKTA 2HA7A 2ECFA 2ONCA 2QXTA 4W1QA 2B61A 4X92A 1YS2X 5DLPA 1IUNA 4UFPA 3O0DA 4OU5A 5AOAA 4PF1A 2VF2A 5F4ZA 2V96A 3R41A 1QTRA 3ESCA 5HKAA 3GROA 2HL6A 4BCCA 1CUGA 4HS9A 4FMPA 1EVQA 2PKYX 1U2EA 2PSJA 2QRUA 4C6HA 2OXEA 5AI8A 2IITA 1TRHA 1GPKA 4AMZA 4CG1A 3E3AA 4H7DA 2HA0A 2O2HA 3ZLTA 1MX5A 2UZ0A 4LKOA 2VJAA 2WUGA 2I3DA 1EDBA 1JFRA 4UBMA 1XZJA 3T52A 2O2IA 3GZJA 5FDFA 2JGMA 4CIBA 2VT6A 3HABA 2WJ3A 2Y2UA 3GUUA 3JYHA 3F67A 2XE4A 3WJ2A 3G9ZA 3Q8WA 4J0JA 3DOHA 5JAOA 4KAAA 2WTNA 4RPCA 5K3DA 3G0GA 4Y2TA 3OURA 4O08A 2QJRA 1XRQA 1MX9A 1UOQA 3FYTA 1EB8A 4G4GA 2QUBA 1CR6A 4IO0A 3D3NA 3HJUA 2XUGA 4OB6A 2CJPA 1UZAA 1H2XA 4Y2VA 2P8SA 1JJBA 3WK4A 1DT3A 2AJLI 2PUJA 2QJWA 3O4IA 3ANTA 4J3JA 4QDZA 4DSZA 4RE6A 5T4HA 2JEZA 2XQKA 5DTIA 4UHBA 2PPLA 1C7IA 2CUTA 1JU4A 1NX9A 1XLUA 4D9JA 4H35A 4A16A 5I8PA 1XQVA 1FFBA 4KRYA 1LNSA 1G66A 2CZQA 5KREA 3ZPXA 3I2GA 4OYLA 1J07A 4DNQA 4H7JA 3HEAA 2OAGA 2I78A 5LZ5A 3RM3A 3EQ7A 1U4NA 1E8MA 4DNOA 4N5IX 2HDWA 5D7BA 5AM4A 1N5RA 3T4UA 4DM7A 2HA2A 1CVLA 3HACA 5A7HA 4BTLA 5HK8A 2EEPA 2WG1A 4W1PA 3V9AA 5KBYA 3FLEA 1CUHA 3D7RA 2C0PA 2WQZA 4DYHA 3I2IA 1LPMA 1YCDA 1W75A 1KU0A 5EIAA 2V97A 3H2HA 3QITA 4GXNA 1TCAA 3FSGA 3DNMA 2XUKA 3WKAA 4E15A 3HZOA 1JJFA 4J0GA 3QBJA 2GZRA 4H7IA 1CLEA 4JH0A 2RHTA 4PV7A 2Y1KA 2DCMA 1WPXA 4FOLA 3AZPA 1FFCA 4G5XA 3H0CA 5ALYA 1P0PA 2JBWA 2VJCA 3QH4A 1EHYA 5AK4A 4U2FA 3EF3A 3IB3A 1LBSA 2PSHA 3QZUA 1CEXA 2WLSA 3WA7A 3Q0TA 4NVRA 2J3DA 3GELA 4IHAA 1W1IA 2YYSA 2QS9A 5AM0A 2D0DA 1F0NA 1JMKC 3C6YA 3V48A 4E14A 2ZVDA 5DNUA 1YASA 3ZLUA 4X97A 4UHFA 2Z3WA 1ZD4A 1E5TA 4A23A 4EUSA 1U65A 2C7BA 2PBLA 5JAUA 2G5PA 4DNFA 3WL5A 4WFJA 3AIKA 4P9NA 3M3DA 5K3CA 3A2NA 5CW2A 3VJLA 1HBJA 4DMFA 1ZI6A 3G0BA 3WK5A 2BKLA 2PM8A 3PFCA 2Q0XA 2O7RA 3R3VA 1L7QA 2VATA 4AZ0A 2R8BA 3IVMA 1LZLA 5CT5A 1A7UA 4EB0A 3ED1A 2XMBA 2XUHA 2LIPA 1J2EA 2DHCA 4G8CA 4CFSA 3IURA 2XLCA 1HLGA 3A6ZA 1KEZA 4OB7A 1MAHA 2OG1A 1ZD2P 4RGYA 5IVDA 2PSDA 3WIBA 3LCRA 4GDMA 4M0EA 3WI7A 4FKBA 5DNVA 5D3KA 1AZWA 5HCUA 1XRNA 4OU4A 1CUIA 2HM7A 2QT9A 5JAHA 5C8VA 3W9UA 4G8BA 2BUBA 2VJDA 5LKAA 5FLKA 3OC0A 4JUIA 3R3WA 2HU7A 4UPDA 4QWWA 5LZ2A 2CMFA 3I1IA 5I7UA 4S0XA 2PVSA 5AIAA 4DIUA 1MNQA 2QUAA 3NOXA 4F0JA 4H0CA 2JF0A 1Z68A 3W04A 1UOPA 5LZ8A 1E3QA 1EX9A 1VA5A 4H77A 4BDSA 4DLNA 5CRIA 3C6BA 3WWCA 1VJ5A 2RAUA 5K5EA 5LZ7A 3WA6A 2PU5A 4BVKA 1H2ZA 2GZSA 1MN6A 4BTVA 3IUJA 4MWSA 1SOMA 4OYYA 5AKZA 4QNNA 1MU0A 2ROQA 3NUZA 4J0HA 3ESAA 4HVTA 1TAHA 3D5EA 4ZREA 3BJMA 1GZ7A 1A8QA 2VJBA 4MEBA 3C87A 3WYDA 4KE9A 4G9EA 2WU4A 1GGVA 2G4LA 4QDUA 4OCZA 2D5LA 3RKSA 5HQ3A 2DQZA 4FDMA 5CTAA 2HA4A 1C4XA 4UBJA 4WDRA 2VQ6A 1CRLA 4AO7A 1R50A 1ZD3A 3V1LA 5A71A 4F21A 5IVHA 4PNZA 1XZAA 2HRRA 1XZHA 2DHDA 1ACJA 2OPHA 5HKBA 2OCIA 1BE0A 3H18A 1H22A 3V1MA 1YA4A 3PF8A 2ZSHA 2H1IA 3DCNA 4XVCA 1DX4A 2Z3ZA 4J0IA 2VAXA 4X00A 3WKBA 4W1SA 3E1GA 1R3DA 1A88A 2AXEA 2QOEA 1QOZA 4NS4A 1BRTA 4P08A 2WHPB 4CG2A 1ISPA 1UK9A 4KRXA 2GBCA 5DJ5A 3FYUC 4UBLA 4K6HA 1C7JA 3EQ8A 2AJDA 2WUDA 5J3JA 3KWFA 4H7KA 3ZV7A 1ORVA 4LXHA 4GI1A 1ZD5A 5FUMA 3V1KA 5FPQA 4AQDA 1O6GA 3IUQA 1CPYA 5E4TA 3QPCA 1TCBA 4BAUA 4EZIA 1CUYA 5A62A 3QVMA 5JIBA 1DU4A 3D0KA 5CT9A 2RONA 2ZJ6A 4X90A 3BIWA 5ALLA 2WHRA 2IX9A 3WJ1A 1LPNA 4HRXA 2BFNA 1K63A 1CUZA 1UWCA 1WHTA 5I9IA 5T4FA 2VSQA 4C87A 3H2KA 4WDQA 5JD6A 4C88A 3H17A 5ALPA 1E66A 1PFQA 3DQZA 5C7YA 4CIAA 5LLSA 2X76A 3G9UA 3CN7A 3HI4A 1W6RA 1JKMA 5JASA 2CKMA 2C58A 3DS8A 5LIPA 4BC0A 4KJXA 4X93A 2PU7A 1E8DA 1CUXA 5AKEA 4AN0A 4LYEA 3C70A 3FLAA 3MVEA 3H2GA 1XRRA 5AKYA 2HRQA 4OUKX 5JZSA 2OGZA 3A70A 3HC7A 2Z5GA 1AQLA 1E89A 1R9MA 4GECA 4LIPD 4EY7A 4PSCA 1AGYA 3AZQA 4U2EA 4C89A 2GYWA 2FX5A 1QIGA 5JANA 3WZMA 1A8SA 5E4YA 4NMWA 2G63A 2HADA 3AIMA 5ALNA 2WHQA 1MPXA 3AJAA 5T4EA 3AZOA 5FXMA 5ALJA 1GPNA 1ZI9A 1CV2A 1UOOA 3SWWA 1EB9A 4KACA 4B9EA 2XMDA 1VE7A 3CCBA 3G9TA 2WJ6A 4WCVA 2XT0A 4AX4A 2W22A 3L1HA 5K3BA 4X7BA 3DL7A 3W2TA 1DWPA 1QIHA 1QE3A 4E11A 1SC9A 3F96A 5HQ3B 2O7VA 4BB0A 5ISMA 5CH5A 4AB1A 2CBGA 1VE6A 4TVKA 4QWMA 4PW0A 1WCYA 1LPOA 1WOMA 4E46A 1JI3A 2DR0A 1RYYA 3TRDA 1LPAB 2PSFA 2OGTA 4FFWA 5HF8A 4ZWNA 5FKJA 1H2WA 4B7ZA 1EVEA 1QIIA 3KDAA 4KR0A 4W1RA 3OTQA 1FFEA 2J3QA 1N8SA 4F60A 4UFNA 3FCYA 5FRDA 2HA6A 5BV7A 1QIMA 4OPMA 4BE4A 4K5QA 4CCYB 4N8DA 4ETWA 1THGA 4UFOA 1VXOA 4ZRDA 5A2GA 3FCXA 4XIIA 4K2AA 5FPPA 4OB8A 2C4HA 2XQJA 4BZWA 4ZV9A 3IULA 1LPSA 5ALKA 4AO6A 4ZGBA 1QO9A 2HHAA 3ILSA 5D6OA 3C5VA 1W52X 1HQDA 3M82A 1JMYA 1YAHA 1X2BA 4BVJA 4BATA 1HPLA 1BCRA 1KU6A 2QM0A 4C01A 4X6XA 5DYTA 4LYDA 1QLWA 3ZI7A 2CB9A 3K9BA 1HDEA 2EDCA 4Y2UA 3VDXA 4GLBA 3WIOA 2PUHA 4B0OA 3CCCA 4MQMA 2XUJA 1EDEA 3GA7A 4BDTA 5JAPA 2HA5A 4F5ZA 3WWEA 3E0XA 3TJMA 3C8HA 4G1FA 5ALVA 3WK6A 2BCEA 2ZJ7A 4Y2PA 3I6ZA 1BN7A 3STVA 4KAJA 1LLFA 1YR2A 1MX1A 3O95A 4N5HX 2Y6UA 1XLVA 4OD0A 3QPAA 4QA9A 2H9YA 2ES4A 3I2HA 4JYPA 1B6GA 2JGIA 5AOBA 3K2IA 4HZGA 5JYCA 5DNWA 1Q84A 4DNPA 2WIGA 5ALXA 2PSEA 1EK1A 2OQVA 4CI9A 4XWGA 2XUQA 3LLCA 4JYMA 3M83A 4I19A 1XZBA 2ACKA 4GHWA 2QVBA 1DINA 2V98A 1WB4A 1UKCA 3C45A 1WM1A 1G5FA 4X95A 1R1DA 1WPRA 1EK2A 5AI6A 3D2AA 5AP9A 3G0DA 3LS2A 3H04A 1M33A 5ALTA 3PICA 3C6XA 4HRYA 5IH7A 4BAZA 4K6GA 4Q82A 4UUQA 5T4BA 1UXOA 2JGJA 4RNCA 3PUIA 3VJKA 3KXPA 1YS1X 5K3AA 4B82A 3AIOA 3R3YA 3FSGD 4X85A 4X6UA 1RP1A 1EH5A 2GBGA 2VTVA 3PDCA 4XJVA 4FBLA 1GXSA 5EIEA 4WY8A 3WWPA 2NW6A 3F97A 2XB6A 3I2FA 1BEZA 1W4LA 1J1IA 4X3CA 4C4YA 5ALOA 5JADA 3VJMA 1GQSA 5IKXA 4DTCA 4OSEA 1N1MA 4CCYA 3DKRA 3OOSA 5ALRA 1X2EA 1YAJA 4QDTA 5AKKA 4WFIA 1MNAA 3W06A 4G4IA 4Y2XA 3WWOA 2JGEA 3STYA 2XQIA 5AH0A 3WL8A 1LBTA 1FFDA 2ORYA 2K2QB 4IH4A 2AJBA 3R3UA 4V2IA 4BRZA 4FHZA 4KE6A 3R0VA 1G42A 1AURA 4XX1A 2WSLA 3G9XA 4EY5A 1DT5A 4FFVA 1IZ7A 1U8EA 4EBBA 2QZPA 1Q0RA 4Y9SA 4GWLA 1SCIA 3QMWA 5ESRA 2J4CA 5HF6A 2ZYHA 1CUCA 4Q3KA 3V1NA 5CXUA 4J7AA 3FYUB 1LZKA 4ARBA 4BAGA 1SCKA 1QZ3A 3STUA 2J4FA 2QMQA 2BAGA 5AK3A 4L3WA 3C6ZA 4Q3LA 6YASA 3DD5A 5AM3A 1I6WA 2AJCA 1USWA 4B0PA 3WKDA 1ZGCA 2WU3A 4M0FA 3OG9A 1QIKA 1CQWA 3D4LA 2W6CX 2QXUA 2QKYA 1X70A 1QFMA 1DX6A 1GKKA 5AM2A 5LZ4A 5IVKA 5LKRA 1K8QA 2H7XA 4P93A 1LPBB 3CN9A 3BF7A 2OQIA 4QLAA 1IUPA 3L1JA 4A5SA 4ZI5A 4BC1A 5ALHA 3BL8A 3AINA 5KWIA 1XLWA 5AKLA 3DOIA 4X71A 3HYSA 5C8XA 3H19A 5AKXA 4BVLA 5AHXA 4BRSA 2WTMA 5JZBA 1Y7IA 1S8OA 1ZJ4A 3FOBA 2B20A 3IBTA 2VT7A 4C4XA 4BP9A 2OCKA 4INZA 2ZSIA 4HXFB 5CH8A 2PX6A 4I3FA 3I6YA 3DYIA 1UKAA 4PQEA 1K4YA 3UUFA 4DMKA 5LYYA 1W76A 3WKEA 2RGUA 1BS9A 3H1BA 5EGNA 1CUWA 5LZ9A 3I1YA 1DWOA 3FVTA 1ETHA 5K3FA 5HFAA 2Y6VA 4RE5A 4B6GA 2WFMA 1P0MA 1ZI8A 4M0MA 4HTAA 1DQZA 2E3JA 4AO8A 2C0QA 1MTZA 1QGED 2DFPA 3A2LA 4I4CA 1JJIA 2WJ4A 1ZGBA 1XRPA 3WWDA 2OGSA 3KSRA 2XMQA 1BN6A 4YK7A 1A8UA 1QO7A 3VVMA 1XZIA 1AUOA 2BJHA 1QIJA 4H18A 3KD2A 2G5TA 4UHHA 7YASA 5D3ZA 2GBIA 3WK9A 4YASA 2RI6A 5AI4A 4IQ4A 3U0VA 2B4KA 3O4JA 4B85A 3HRHA 4DMHA 4UHEA 2C5FA 4H7HA 3GFFA 1VXRA 4QDXA 1YB6A 2XUPA 3IA2A 5C81A 1ZJ5A 3IUNA 4U2BA 3SX4A 2GYUA 3DYVA 3E4DA 4B9AA 3H2IA 3NWOA 5EIHA 1QIEA 3F9CA 1QONA 4FLFA 1TKRA 1VZ2A 5AOCA 5E4JA 1XZFA 4U2CA 3LP5A 5A7FA 3O9VA 3G02A 5CT8A 1FJ2A 1D07A 3BF8A 4Y7DA 3BJRA 1BEEA 2FJPA 4BYMA 1SFRA 4QEKA 2XI4A 3BWXA 2H7YA 3QMVA 4QDOA 1BROA 1YA8A 4WFKA 4PO3X 1QIFA 1EA5A 1XROA 5ALDA 2WFZA 4YX9A 1TQHA 5EFZA 5BWCA 2B9VA 4PSDA 4LXGA 3RARA 2WG2A 2BUAA 2YXPX 3HSSA 2PL5A 2DSNA 5E2IA 5AJHA 1CUDA 4LXIA 1HL7A 4B83A 2RHWA 1R9NA 4AMYA 1UK7A 1CUFA 1BCSA 2Z8ZA 5HZGA 1XZDA 5H3HA 1L7RA 4MYSA 1R4ZA 3BIXA 1VKHA 2WIFA 2YASA 3ESBA 3M81A 1ODSA 5ALQA 2X5XA 1H2YA 2VA9A 5EHZA 4IH1A 3VISA 1CUSA 3F8SA 3WZLA 4FTWA 4NZZA 4Y2SA 1Y37A 2ZYRA 4EY4A 3G8YA 3A2MA 4Y2QA 3IDAA 2WILA 1SCQA 5ALFA 1FFAA 4FBMA 1XRLA 3C8DA 4EY8A 1DQYA 4YPVA 4ITVA 1XQXA 5BWBA 3JW8A 4ZXFA 3WK7A 4ROTA 2WUEA 4KE8A 2WIDA 2HA3A 2JGKA 1DTEA 4J0CA 3GBSA 5JD4A 5AICA 1ACLA 5EHNA 1JT2A 1Y7HA 1K5PA 2VAVA 3QMMA 3QPDA 4Y2JA 1YSCA 5ALIA 1GQRA 4G4JA
chains in the Genus database with same CATH superfamily
3RWOA 4IIBA 5JH7F 1M1YE 5NLLA 4HB3A 5H5JA 4RPLA 1XQ1A 4IVNA 4XYLA 3M1IA 1CC1S 3RYFA 2IIVA 3QEKA 1KMHA 4U7PB 3T41A 2VI5A 4IX9A 1ZO8A 2Y4OA 3CF4A 4IDAA 2QTBA 1Y9DA 1IM5A 4KYVA 3UF0A 1QIDA 2IS1A 4MUJA 4E5MA 3IEXA 3IRUA 3E3MA 3LIIA 3UOGA 3E15A 5IARA 5DWDA 4DC9A 1W581 3QPWA 4DGQA 4DPKA 4F9FA 3R7WA 2A9QA 4C0XA 1Z83A 2YL2A 3AFIA 1L3BA 1PEKE 2CLKB 2H4XA 3P9YA 3PFWO 4QYIA 2B37A 3WDLA 4E3ZA 3PUHA 4KXVA 3BBLA 3L0CA 4JDPA 5JCOA 2WAYA 4W4TA 5AJUA 3RT9A 1L4UA 2PTHA 4MMYB 4NYMR 2J87A 3NGMA 3KO8A 3NHLA 3IV6A 4HPXB 2C9MA 5J2TA 1TZKA 4RQAA 1SOAA 4PXAA 2JG3A 3UVEA 3P2EA 4TTVA 2FFJA 5K0CA 3C48A 3GRKA 4RY9A 3RH0A 3FUTA 3G85A 1N9GA 5JRJA 4EEKA 4JWTA 3I30X 2PUDA 5KTRA 1W8DA 2RH9B 5BYJA 4BLUA 2SKCA 4JJ8A 2FUG6 2RH8A 1L9KA 3CUVA 1JDPA 1ZXBA 1WQ3A 4ZRMA 3VPCA 4BEBA 5T57A 2O8FA 3FF4A 4PU0A 1AM4D 4E2FA 1W0JD 3B60A 4Y30A 3SYTA 1PE0A 3EA5A 4PAQA 2O0KA 1HKHA 1ZGJA 2X9NA 1XK6A 2XQGA 1UKBA 2DUMA 1XZLA 1RQ2A 3INTA 1GVNB 1X8KA 4R41A 4BGVA 4UCQA 3H8VA 3O4GA 4IH9A 4ARZB 1QPZA 1GPWB 1Y8QA 2HV8A 4Y6SA 2EHJA 4MUBA 2OWDA 4ZCQA 1RHQA 4KHZA 4LSWA 4QE3A 5ITVA 4OQXA 2E5FA 2ZJFA 3ZGXA 2QU8A 3HJRA 3NOVA 1U0OC 3GYBA 5KIAA 3FNBA 2EJBA 2YZGA 1UL1X 3R74A 5KVSA 3NFRA 1TA0A 1JKJA 4C2TA 3G9QA 4HDRB 1AQNA 5LQNA 4KODA 2LVBA 3S7ZA 1YFKA 1X38A 3FY4A 4MUHA 4Q9AA 1MF7A 1U1IA 1GLVA 1UPCA 1WHSA 2BN4A 2G4VA 4G85A 4XJTA 5L51A 3ZW9A 4UHDA 2Y71A 5HKAA 2C42A 2C4TA 2BBTA 1JLLB 3FFXA 5CMLA 3WKCA 3RTDA 1Q7RA 3NS7A 4CJXA 5I9SA 5HKOA 4HEQA 3IHKA 1G60A 4Y2YA 2AXNA 3KYJB 4L6IA 3DC2A 4FT2A 3A31A 1BQ4A 2X13A 2H5EA 1C3EA 4GNKA 2XWQA 3NDIA 4L0MA 3GLRA 4MVJP 4JBGA 1VFPA 5CHEA 4DF3A 1FOEB 2QR5A 3OUTA 4BGDA 3PF9A 4N5NA 4U6NA 2WPDA 2BUCA 3N3BC 1QKIA 4CF3A 5AVZA 4FDTA 2R4UA 1TU4A 1UBNA 1VPEA 3BFKA 4KXXA 4WNYA 3TO5A 3WQSB 2ADMA 2ACEA 4C08A 3MT8A 5D1NA 1E0AA 3RUPA 4TKLA 4LDJA 4U6SA 2P4UA 1Z0KA 3TB6A 1QOQB 1G7TA 4I4TF 1S9DA 2GCGA 5HS4A 1IM8A 1LU9A 4NBUA 1NJ2A 3UT5A 4ER7A 2ZR9A 4RVHA 1TKCA 3GO4A 1H5UA 1ZM7A 2X42A 5FTNA 2PUBA 3LCVB 1Q0ZA 4GX1A 1BD4A 3V7FA 3OPNA 1YQUA 1FB5A 4NFYA 3AEKA 4OLBA 4UTPA 1W0KD 2QNBA 2Z4SA 5LYJF 1F38A 1IBMB 3PGVA 2I1WA 1SUEA 3SS8A 4R1LA 2FPLA 3ZXIA 2Z6AA 4Y1RB 2WMOB 3CG4A 3HN2A 3SIWA 3A14A 4JUCA 4UEJA 3YASA 4B2IA 3M4XA 3WADA 5C1OA 1C4WA 4QYSA 4B80A 3IL2A 3C7AA 4AC9A 3PEYA 1P0CA 5TNXA 1UBTS 1SCUA 2RHOA 2VYNA 4MNTA 1GGHA 4N01A 1W4CA 1EFDN 4GMFA 1KAQA 1PT7A 4P38A 5FP0A 3FZYA 1E2PA 3T3PB 1QZTA 2OXRA 3GRVA 4XDZA 5E2BA 3VTAA 2AOUB 4JSTA 2RGYA 1OLOA 1ZIXA 2FF5A 3KOOA 5IN5A 1PQPA 3ZQKA 3GFOA 5L8VA 3CVJA 1Y1SA 2ABWA 3K9NA 2CEKA 1TYAE 1CJTC 2YRWA 4GE0A 2C1ZA 1UM9B 4HDMB 2JLSA 2YN0A 2VBGA 1BO6A 2ZBQA 2ZYAA 4U7WA 4V0OA 2OM6A 1E9RA 4MCIA 4B1FA 1JEAA 4RSGA 1L7EA 4YC7A 3FIUA 5F64A 1CZKA 1J33A 2JHPA 4FNGA 4YUAA 4JX9A 3U26A 1IVSA 1H9BA 4N7JA 2X1VA 5FTKA 1SURA 4D80A 5FBVB 1ZIYA 7REQB 1GLGA 3JQPA 5CITA 3PDIA 3OLXA 4MWDA 1J06A 1Q0SA 4OP1A 4QT0A 3CZPA 1ZL0A 1NE2A 4H6XA 1Z7WA 3ZIUA 1L1FA 2PYZA 3E48A 1E1LA 3Q72A 4ARAA 2V9ZA 4MOWA 6REQB 2J0UA 5B2EA 1TK9A 3ZJUA 3L8CA 2XD4A 1SVSA 1E1KA 4D9NA 3DZKA 1UXGA 3O8QA 1XFDA 4JVMA 3SFZA 2VTKA 4OHRA 4UBOA 1X0VA 2ZUUA 5GONA 2G80A 4ZCSA 2ZCUA 2W8BA 2XUOA 4HLQB 5SY6A 1JU3A 1L7AA 5TLSA 3T1HB 4K86A 4P83A 2GPTA 4RABA 5CURA 5AT1A 3M6LA 3VKGA 3TB4A 3I0NA 1RQNA 2VZLA 2IRWA 1GR0A 5A03A 4OHVA 4L15A 3HJFA 4BQNA 4A10A 1P74A 4D4IA 1QWOA 2GWRA 3BWVA 1XZCA 3N74A 4JHXA 3WGZA 4U9IS 1HYBA 1Y48E 2IYEA 4MWBA 1M9NA 2G82A 2Q46A 1IQRA 3KJFA 1XZMA 2A94A 2EKZA 3GAAA 4HWKA 5KQSA 5C8ZA 1RMYA 5F9HA 1T8TA 3GNSA 4HUQA 4B84A 1ZNZA 1M2WA 1JDNA 2GEKA 2VC2B 3F3YA 3KSBC 4Q05A 3L4KA 1M6YA 3GGSA 3WR5A 2CLEB 2ZBGA 3B13B 3HUDA 4AIIA 4BKRA 4GR5A 1XWWA 3UJPA 5KTMA 4J4TA 1N5IA 3OTOB 4BZZA 2R6AA 4TLCA 3ZNPA 4GMKA 1T4MA 2P1DA 1CQIB 2WF9A 4MEAA 2BFCB 3B3QA 1RAFA 1CR1A 3O1JC 1TM4E 4ZQIA 4C0BA 1G6OA 3GT7A 4BJHB 2QAGC 1KNQA 2Z5FA 1MP0A 1CQZA 4G0MA 2VNKA 1IMJA 3K0FB 2HIHA 2X41A 3KQVA 4IJQA 3ZWKA 2X0RA 2FR8C 4NBLA 4B5KA 1GNLA 2KI5A 5JS8A 5IK2A 4F56A 2O8DB 2O50A 2A92A 4ARUA 2CHEA 3ELBA 5DOVA 2R1VB 2HXYA 5LP6C 1ZH4A 1GDDA 1UF9A 3NEPX 1LX7A 3EUAA 3VI3B 4BNDA 1P61B 5JJLA 3K9CA 2WNHA 3ZUPA 3NU1A 5BT8A 1J0XO 1J8QA 4NONA 4XA8A 3V7UA 2ERYA 2IXGA 4M2LA 5DBFA 4CKCB 1KY3A 2GMWA 3BJZA 4ME6A 4J29A 3ISJA 3ZEIA 5AKGA 3MEQA 2VZ8A 3TDMA 4N3BA 4R1NA 4L72A 5CNIA 3CZ4A 5EE3A 5EVCA 4PYRA 3IJ5A 2QGNA 5EXDA 1BKDR 5JARA 1GCIA 2FEXA 3OPYI 5IJXA 1JPJA 3FFAA 1TKAA 3PFIA 1UP6A 1VMAA 1P33A 3GZNB 4I8XA 5ALMA 1KDVA 2V8OA 3VDMA 1RWQA 1H8EA 5UKDA 2O7NA 4DA8A 4E03A 4A0HA 3D59A 1XDBA 3BDIA 4DY4A 3VRHA 3DLBA 1ZEJA 2ZE8A 3QI7A 1SBQA 1Z07A 2F67A 3PIRA 4CIVA 5JHHB 4FFSA 1GZUA 1JHYA 1KMHB 2FW6A 1TZ2A 1S2NA 3PDJA 1Y7TA 2DJ5A 4OBBA 5CYPA 1GCAA 3SU8A 3CX6A 1W29A 5EJIA 4K0RA 1WIWA 5FJJA 3WFZA 4JA2A 1E61A 3SXUA 3TGPA 3KYDB 1AVTA 2RCNA 4NOLA 4P3PA 2MU1A 5A5FA 4C7OB 3WQRA 4L78A 1T9DA 3SQLA 4F3TA 1DPGA 4LZLA 2OORC 2VKTA 2YY5A 1Z75A 5AQ1A 4B81A 5CA1A 3VHLB 4ZCRA 4QPJC 1RWBA 2C2KA 1G0OA 2IA5A 4LGMA 4ZOEA 4MJ7A 2ZUSA 4K46A 1UWLA 3TDNA 1K5GA 3DUWA 1WMAA 3MUOA 3R7BA 4J0EA 3D3EA 4WTOA 3BXXA 4N5MA 2CXNA 4ESOA 1JB9A 5BWLA 1GARA 3AHHA 5C5IA 1Z62A 4CEHB 5ICCA 2QEQA 1N6HA 2DQYA 2VYND 1I94B 4OHKA 4AJHA 2C5BA 2Q3DA 1DAIA 2R60A 4DN6A 4E0BA 2IYXA 3SM3A 2O3JA 4ZO6A 2FPGB 2C03A 4DKJA 3TG2A 3VDNB 1E0JA 2ATXA 2OK8A 1VHJA 1GAWA 4BUJA 4N4AA 3WMGA 3R4VA 1NU8A 2AR9A 4INJA 2ZWAA 4Q6BA 3SHQA 3F3SA 4MLPA 1GA6A 1NJ8A 3HYTA 3N2IA 3PPYA 3TTTA 1BX0A 1QZUA 2ZDQA 2CL5A 2GHQA 1ODCA 1VZ3A 4UU8A 3T94A 5B3KA 2C59A 4DEYA 4DCPA 4TLAA 4QYXA 1Q3TA 4Z7JA 4J4HA 5BR8B 2M1ZA 5FX2A 1V7QA 1M1NB 3IDZA 1PNQA 3ANSA 4HDOB 3R40A 4H0FA 3CEPB 4P92A 4BZPA 4PLZA 3FROA 4HX2A 2GARA 4TUYF 3T5GA 1GZ4A 3G1TA 1DIOB 4JI0B 4OV6B 1CUUA 1XRMA 1XZEA 2TECE 3G0CA 3EAFA 1W4AA 3NKFA 2OCGA 3PRHA 1YJ5A 3MUEA 1IZ8A 4OH7A 2NO1A 3AP2A 5DP2A 4GKKB 2X40A 1FXUA 2EARA 2ZLBA 3DAOA 3FGOA 3UENA 3UWOA 2IZ6A 4QJ4A 2J3MA 3V3TA 1U7TA 4GOJA 2NSLA 4I9NA 5HF5A 4F84A 5F2NA 1QGUA 3GYGA 1R2QA 1W0KA 3K72B 4HKTA 2ZXEA 1MDFA 2YHIA 4JDUA 1SQGA 3OE7A 2V7PA 4EVIA 2ZKLA 1MC4A 4E1VA 3OICA 4XX0A 1YB7A 3AKEA 2Y1FA 3BX1A 4Y0VA 2DU8A 3U3OA 1IULA 2BR4A 3L6UA 3MAAC 3L6OO 4MDYA 3WK8A 4O3MA 1XD9A 3VAAA 2GM9A 4E4YA 1XN1A 1MLDA 2B7CA 2JGFA 5TEWA 3IIIA 2W43A 3E2MA 2DQKA 1SUSA 1QUEA 4L8YA 3TIIA 2XWBF 4WXYB 4JLNA 4JOQA 5AVUA 1MB3A 2OB1A 1WW8A 5IYZF 1VA4A 1P45A 1CY4A 5AJXA 1M3SA 5DHAA 4IIGA 1OXTA 4UM8B 4RJ2A 4G0XA 1L2TA 1NMZA 2F8MA 3EIHA 2EDAA 4N1AA 2VNIA 3MT0A 4IDFA 3GP8A 1NN1A 1ZH8A 3ZWQA 4R2JA 4ZU1X 5BN5A 1PW7A 3P9QA 2XNJA 5AM5A 2P69A 5C5CA 2DC1A 1Q83A 2P1RA 3C1OA 3DMTA 1ARZA 1IG3A 5ARBA 1XD2A 1MIOA 2BEUB 4TGLA 4KQJA 4UQLA 3AR7A 2WYUA 3RCBA 1TL7C 1PL7A 5DHSA 4YAWA 4BY9E 3EJ6A 3I2JA 3KKPA 2OCDA 4O33A 2ONZA 1XZKA 3QELB 2QP9X 2YRXA 1ULAA 2B1IA 3VA7A 2QP3A 1PT5A 2H7VA 2W2LD 2GXAA 3KB8A 1VG8A 3W0LB 1QFYA 3N6VA 3R0JA 3IGFA 5K99A 2AVNA 5IK2D 1NZDA 2X5JO 4DA0A 1JQ3A 1TGYA 1P72A 2FDRA 3CEHA 2ICAA 4ZT6A 4ZT5A 5K0SA 2RK6A 5HMLA 1UBGA 4NFLA 1CR0A 2IDJA 2P9FA 4QSHA 3K6KA 2PGOA 3GLHE 2ZOSA 1L8LA 1L5OA 4IAOA 3PI6A 1U6JA 4M54A 2C7QA 1MV5A 2GS9A 3UK0A 5CDHA 5DNEA 2C9DA 1TK3A 3KFXA 3HJAA 4HG2A 4FJ2A 2HRCA 3P2KA 2FFHA 1CFJA 3MJ4A 4L4SA 2FEAA 2X0EA 1OLSB 3ZHCA 4Z3OA 3NYWA 5LYJB 3WXBA 5FA8A 4RTQA 3IQWA 1XMQB 1W5AA 5CVEA 1FUEA 1MEOA 2WAOA 4JZKA 1KDRA 4A4DA 3FZGA 3STTA 4JBWA 1H05A 3NVMB 4S12A 1SU6A 2DT8A 1X6VA 4PIPA 4S1NA 4QUJA 4RL6A 1NM5A 3FUXA 4OGLA 1DO0A 1E7SA 1OTYA 2OAP1 4RSRA 3A10A 5J5AA 1KDZA 3WRYC 1Y63A 2HU8A 3F5DA 2ZSAA 1XKTA 2HWKA 2ECFA 3KVNA 4KXUA 4REQB 2CVFA 2QWXA 3OM0A 4U6QA 1NVTA 1C7QA 4YT8A 4CQNA 2B61A 1LDEA 4XEUA 4DWVA 4R1OA 4BFWA 5ITZB 4FDVA 3IIEA 3ZCPA 1YS2X 4R54A 2XAUA 1V8ZA 2UYQA 1BDBA 4NNPA 5B58T 5LQUA 3TZHA 4PLHA 4MGIR 3HK2A 3CX4A 3PLNA 3CSDA 4OLAA 1A8HA 1KGSA 3Q7IA 4OFBA 3T9FA 2QUZA 1L7VC 1P4GA 2F1RA 3TLAA 3O0DA 4XR4A 3AG5A 4WKNA 4ZYVA 3IHWA 4PF1A 1NQXA 3F2IA 1JS1X 2WPDD 2ATIA 4LCBA 1X7ZA 2PL3A 4DG8A 3R41A 4BMDA 4B3SB 2XTNA 3ONDA 2QN3A 2Y05A 3CB2A 5EHGA 2WD7B 4BCCA 3RBVA 2ILTA 1CUGA 2HLDD 4JP1A 3UW1A 1IEWA 5AJVB 1Z4IA 3K3PA 4BNHA 5HQTA 5JBQA 5J4VA 4UNRA 1L3CA 4MZXA 1COZA 2ZSJA 1EVQA 2WYVA 5J4HA 3TQRA 3R3SA 2QRUA 2IUUA 1EFRD 1ZM2A 4H6WA 2IITA 1JLMA 3D8UA 3UMBA 5FWYA 4UARA 3UKDA 2YVQA 2PMCA 1DLJA 2HA0A 3D7LA 5DX1A 3TRIA 4HDSB 5EZYB 3RFUA 4DY6A 2OO7A 4B3XA 4FCVA 3LK7A 1E62A 4DARA 2PV7A 1PSDA 4QU0A 5G0WA 1KETA 2VJAA 3RU3A 5BSEA 5EZYA 3WAGA 1TQ2A 3GLIB 3H3JA 1JFRA 1SPXA 3I9LA 4HDKB 4LGVA 3WVNA 1G3QA 5LYJA 1E1MA 3T52A 4LISA 1JHAA 3VOTA 4OXNA 1NR7A 5JYBA 3SNKA 3OZBA 3GZJA 5DX0A 5FDFA 1JEQA 2K4MA 4K88A 1ZHHA 3NAMA 2X4LA 4CMJA 4F4IA 1YE3A 5CCXA 3HABA 5DWVA 5CNMA 2WJ3A 1IB0A 1PYOA 2WZQA 4LOIA 2QZ9A 1T0IA 4RHFA 3F67A 4LV5B 2M6SA 1QVRA 3LQYA 3CEJA 3R44A 5FJIA 3Q8WA 1J2YA 4WBXC 1W5SA 4KAAA 3HBFA 5JAOA 3OA2A 4NJEA 1SRQA 2G8NA 5LB2A 4ER0A 3LRXA 3IQDB 1BDIA 4HAXA 1WZUA 3IV9A 3K0KA 3MINB 2Q9CA 4NZMA 1F9AA 1M73E 1Z06A 2QJRA 1K2VN 4NE7A 4OQDA 4A0FA 3IDSA 2ZS9A 3GX1A 1XVIA 3CW9A 4OYHA 1QU3A 1PEDA 3AB7A 4G4GA 4Z4QA 1E2GA 4DV1B 1LC3A 4QOGA 3DDHA 1I4DD 1YONA 4GQBA 4H1VA 2QUBA 4EARA 5DTQA 3DHWC 1CR6A 3NEAA 1W96A 1UXHA 3REQB 4IO0A 2QN7A 1XPUA 1VL0A 4HPJB 4PGFA 4CT4B 1T2EA 5BXQC 7AT1A 1F0YA 3ILHA 4WW0A 5AHOA 4DV0B 1NVMB 4MJXA 1UZAA 3E9MA 3QXGA 3BWEA 1GNRA 3CW8X 3E5MA 1DT3A 4CHTA 2IYUA 4ES6A 3T7DA 3LHDA 3CINA 3UJ8A 1ZGAA 1TNDA 5BUZA 4D8UA 3BQMB 3AY3A 1AZLA 5CA1B 1GUYA 1WS6A 2EXXA 2QN8A 2VF8A 2HJGA 2Q29A 2QR3A 4DQ0A 1MQSA 2OORA 1ACMA 4MR8B 1EESA 1TMOA 3QFSA 4XVHA 2BW0A 3A1DA 2QIPA 5DTIA 4BP3A 2BJWA 4C22A 1BE1A 4X5OA 2YWFA 2VF7A 2G88A 4WVLA 1GCGA 3JU3A 4X7PA 2PPLA 1EU1A 3VR3D 3AFMA 3RUHA 1XT6A 3HRIA 1Z47A 3LPDA 4KN6A 4RFSB 1CX9B 1W5BA 2JHAA 1CEYA 1TA9A 3GVIA 4D9JA 3DA8A 1PI3A 2H1WA 2OBFA 4P2BA 1T15A 2H16A 4H35A 3TOSA 3UJBA 1CETA 4A16A 5I8PA 3AM1A 4TWAA 5IUNC 3AFOA 1TEZA 3TTUA 3W5DA 1G18A 4IYRA 1T8PA 3M1AA 3ZPXA 4DUGD 1LS1A 4LJKA 1WOYA 4L5IA 3OIYA 2H92A 2GCNA 4H7JA 1NQAO 1VLZA 4BNVA 5K05A 2O1WA 3ASZA 3KHSA 4TWBA 1N32B 1TZMA 1Y1LA 2OAGA 4MKHA 1CY8A 3MMXA 4UE3S 3IBGA 4L50A 4OHWA 3TI9A 1UZLA 4D9HA 3SC2B 2B7LA 2A1TS 1EWTA 3WGGA 2FK8A 3EGVA 5LZ7A 2XTZA 3SNHA 2YUIA 4YP7A 2VP3A 3HTXA 2B6NA 3OY2A 5EYPB 3PGA1 3ZI0A 5AM4A 1I9GA 1CNMA 2GFIA 5JU6A 4G0QA 3T4UA 3S2FA 3IUEA 1V26A 5C8DA 2I6XA 3GDWA 1T8WA 1Z2OX 3IVAA 3SBDA 4BTLA 3HDYA 4IJWA 3I73A 3UGKA 1GLNA 2FEMA 3GDHA 3V9AA 4BUCA 3VFDA 1B7GO 4JY7A 2JFOA 3HI6A 1TADA 4JBLA 3HADA 2VWHA 5E1MA 1UPBA 4MQFB 2PRZA 4PINA 3ZGVA 2VPTA 4RK7A 2SNIE 4DYHA 3IQHX 3IQEA 1ECFA 3CHYA 4IDDA 4RADA 1W75A 1M0TA 1YL5A 2D74A 4FINA 4IMIB 2V97A 4NP6A 1PEAA 3ZHOA 4COKA 3KETA 5KOIA 4WZAE 3A25A 3U4QB 1SXPA 1JWLA 3DLPX 4GXNA 1NF2A 1TCAA 3FSGA 2V9PA 3MG9A 3C3DA 3QIVA 3COZA 3HA7A 4EW1A 2LRHA 3E84A 1GRNA 1JJFA 5T64A 1XZPA 4J0GA 2O07A 3HKDB 3QXHA 1I5EA 3K6RA 3QBJA 1E99A 4G07A 4XWYA 3MPOA 1D6NA 2R65A 2EBWA 3P0JA 4JXXA 4JH0A 4G97A 3GFRA 2DY0A 3O91A 5B1EA 1EX1A 2GESA 4KSYA 5JAQA 1IY2A 3RYTC 1TYCA 2JIZD 1OZFA 3F6RA 1VI6A 4UNNA 3CW2A 2A7XA 2Q8PA 2W6PA 3DE0X 5T3UA 3CLUC 4FOLA 2ODTX 3AZPA 1DPFA 3FD8A 2HMWA 3ANXA 4JMPA 3DD1A 3DLCA 2L0XA 4MEJA 5IBCA 1HDZA 1YOBA 1JG6A 1GVHA 3E9DA 1DHRA 3KR9A 2LXNA 3CUTA 1Z6ZA 3PL5A 4GPIB 3T99A 5CFPA 3AHJA 3ZHSA 5BORA 2H2GA 4A26A 5KYUA 4DCJA 2CNLA 5KYTA 1BFKA 1AQUA 5IXSA 5JSZB 3IPCA 5LIRA 3L9XA 4JUFA 3PHGA 2VJCA 1NULA 2Q1SA 1YR7A 4TMVA 4C3VA 1SUBA 3OKPA 1ZC4A 1T5TA 4DLAA 4DYDA 4QSMA 4RKYA 2WV7A 2QX8A 4LY3A 2XXAB 2C2WA 4FILA 4JU8A 4UE6A 3J81A 1XCJA 2AOXA 2FU5C 1HDCA 1VIYA 3GT0A 3KUXA 3WE7A 3V6LA 3HP1A 3VO1A 3ZWMA 3B6KA 4YJ3B 1DGQA 3DWEX 1SG0A 4HMQA 5F7ZA 3I01M 1W1IA 2I67A 2PL9A 1JIKA 2YYSA 1NXWA 2Q0QA 2QS9A 1VMIA 1IM2A 4HWRA 4TS9A 1ZM9A 3SJCA 2B4AA 2ZT8A 3L7IA 5CB4F 1UFKA 1SVUA 1SU8A 5DGXA 1U99A 1RP7A 1UPTA 3OOEA 4URWR 1GNPA 5DNUA 1H0KA 1TW3A 3ZLUA 1OBVA 5FA6A 2GTIA 1ML3A 4KDEA 3ONFA 5U4XA 3R9WA 1ZD4A 1EZ1A 3PPVA 4PPFA 5ER9A 1L7MA 4JL8A 3P4UA 1EXVA 1WETA 5BW6B 2C7BA 3ORHA 3U6KA 3VPBA 2D4HA 1E7YA 1GL9B 1M76A 3BTSA 3GG2A 4DNFA 3EPJA 1KY4A 1SCJA 2NXCA 2Q5QA 3GLQA 1ID1A 4P9NA 4Q12A 4US1R 2HMUA 5EWLB 1NXOA 2W71A 5HR5A 3BGDA 1T0BA 3DZGA 3QPVA 4HN4B 4G0OA 3ZTTA 2C5LA 5CG2A 4DMFA 1JYEA 3FOCA 4N39A 4TV9B 1CZRA 1ZI6A 3G0BA 3WK5A 3BA6A 3K1AA 2BKLA 4BN4A 4EF5A 3NTRA 3V00A 3SDZA 2ISSD 3IEIA 4PR0A 4R6WA 3IA7A 1NJ5A 3HB4X 3HCEA 4MW5A 5ESDA 3R3VA 2Q0XA 2V7UA 4KYTA 5EP1A 4Z7QB 1MV8A 2HF8A 2VATA 3H3FA 3HKBA 2O14A 5JECA 4RAOA 4I3HA 1BRMA 4CQJA 3D9QX 3ZGZA 1VSUA 3FKSD 3I9KA 1LFAA 1T36A 4EB0A 4M60A 3QY0A 4L1KA 4QATA 3H2BA 1ABEA 4G2TA 4BLWA 1K8XB 2F90A 3H5AA 3REFA 3CKLA 4G8CA 5ELXA 1HETA 2V7QA 3B8HA 4C1BA 3IURA 3FPJA 3A4MA 2XLCA 4CMHA 3QVWA 4GYWA 1HLGA 1VKZA 3A6ZA 2FWJA 3BREA 3DFIA 3ZTYA 5C1DA 3OKFA 3JATA 1MB2A 4BKMA 1C1DA 5SY4A 2PXHA 1HNZB 5JNTA 2IZ1A 4QGFA 3WIBA 1DB3A 5GMOA 4DPLA 1TPYA 3WI7A 4H6PA 4FKBA 1AZWA 1K0FA 1C9YA 3G8CA 2GN0A 3S2IA 3V8MA 3DMNA 2XBUA 3C5EA 3CF6R 4C04A 4OU4A 1VTKA 3JAKB 4M9UA 1CUIA 1K66A 1QVZA 2HM7A 3PXDA 3H8WA 1SBYA 2XCOA 4FYVA 4KMMA 4LG1A 2CGEA 4RHXA 2C29D 2GZ2A 4FU0A 4IXTA 1RFLA 1SD2A 2C3MA 4Q4LA 5MGBA 2FV8A 1H6DA 3B1JA 3GNLA 2GZDA 3U4QA 2IP2A 4K7JA 5LZ2A 4FSHA 1SEVA 4MRVA 3TCXB 3QUTA 4GSYA 3AY7A 4Q3EA 2YIDA 4AVYA 3I5UA 3IVXA 2CL0X 4DIUA 3Q10A 4F0JA 2ZYDA 5EQTA 4JI3B 1V0JA 1SIWA 2XVZA 3K1TA 5FUWA 3RADC 1XCLA 1VIAA 3W04A 1KI3A 4F6RA 3C5HA 3L06A 4YHHB 1XYGA 5F3RA 5C2JB 4CU5A 2GR9A 3DPUA 4GMGA 4NMLA 4LF7B 1YMQA 1Z38A 3VR5A 4H77A 4BQEA 3GC6A 3VZDA 3QUSA 2IHVA 2JFZA 4HZUB 2MSWA 1NZJA 1CEQA 2P6NA 1E64A 1QQBA 3VNVA 1G8SA 3EVZA 4MLDA 2WQ7A 2I6SA 4L8FA 1CJSA 2C2BA 2WKQA 2RAUA 4B09A 1R5JA 2PHZA 4HDMA 4L08A 1P6UA 4I8DA 4IMJB 3A9TA 4OI4A 1BSVA 4S2UA 5CEEA 1WUTA 5FUBA 2PU5A 3WA6A 4YCCA 3ZK8A 4MW4A 2X86A 2GZSA 1JQKA 4KQWA 4MKRA 4K3UA 5T3YA 3S1LA 3W78A 5CA0B 3ZDQA 1ZJ6A 2QLFA 4BTVA 3VR3A 4DLBA 2F1HA 3EWSA 3UPTA 1X77A 2AG0A 2BBSA 1F14A 1HG1A 2QUJA 3QEMB 4MWSA 1IOZA 1OX6A 2EKQA 4OYYA 5AKZA 4ZAFA 5BW8A 4DV3B 4LUCA 4BFLA 4OIFA 3ESAA 1O9BA 4AZ0B 1PN3A 5K0JA 3W2GA 5A0VA 1ANKA 1QAMA 1AIPA 3NBQA 2XNDA 3BJMA 4GPZA 2XZPA 4GBJA 1Y5IA 2QMYA 4I81A 5CFRA 4F91B 4MEBA 3IERA 5EJGA 3X1KA 3WYDA 3BZWA 1URPA 2YZMA 3DGFC 1O6ZA 2JFFA 4I3GA 1GGVA 3KUUA 3F5SA 1NBME 4JVNA 1K5HA 4B71A 1S3FA 1Y8CA 5DLDA 4D0LB 4JI2B 4OCZA 2D5LA 4QPCA 2PN1A 2I2XB 4Z99A 5BRJA 3UEOA 3U4HA 3VR2D 2ZUEA 2GJ4A 4Q7MB 2XZDA 4O1MA 1XZQA 3K70D 2DQZA 5CHYA 3NNSA 3HVRA 4FDMA 3OFKA 2A4MA 1D4OA 1N7IA 3A4NA 5CTAA 1KOJA 2RHDA 3AGQA 4ZOLA 3CB4A 4OTZA 4ERXA 2VQ6A 1T2DA 2ZIZA 4N0PA 4X65B 1PHRA 5JSHA 4A1FA 2V1UA 5BUQA 5AW3A 1YRAA 3AR9A 1K6JA 5F12A 2F3SA 1NVVQ 2C9BA 2EJUA 2FSVA 1PV2A 2Q28A 2RGXA 2VBFA 3OEYA 1M8GA 3QKWA 4HDNA 1FMLA 3PA8A 3Q1LA 4X3OA 3OT1A 2IHZA 1EM6A 2JJ1A 4M7OA 3EEQA 2OCIA 2QLTA 3W4JA 1BE0A 3BD6A 3MA0A 4RTSA 1O5TA 1U8CB 1A9PA 2H1IA 1K68A 4DSZA 4IOLA 2YMMA 4HYEA 4GRDA 4KGVA 1S02A 2ATCA 3AHIA 1YJQA 3TFOA 1E3WA 3SZRA 2ZJ0A 3KEFA 3WGVA 1DBRA 3A8TA 4B3IA 3KU4A 3B48A 3NAGA 1H2BA 4PO9A 4P1ZA 1E5QA 4WMLA 4ASUA 5JSKA 1UOEA 1NOIA 3ZW8A 1CJBA 2IEZA 3EMKA 4LDAA 2FUCA 1WXEA 4TXMA 4RPKA 4NS1A 4BQSA 3IVCA 2IHYA 3NTOA 4BBPA 4P7KA 2QOEA 2M2IA 4AZVA 2YXLA 3QQPA 5KTOA 4QXQA 3KPYA 1XHLA 2NV0A 2CUZA 1QE5A 1UK9A 2V59A 2W9XA 3I1JA 2ZM6B 4OI1A 4GM1A 2GBCA 1OGIA 5CUQA 5I7AA 3I0MA 4RIEA 3RYCB 1BXRB 3ML1A 3VC1A 4CU2A 1YBAA 5KTTA 1SA0A 4ISCA 1H0RA 5EIFA 4QREA 3UV3A 1T6NA 2HQOA 1T9GR 1H3EA 4AD8A 1P4AA 2VDOB 2V0GA 3VX4A 3CLSD 1DC6A 3A9SA 1DFGA 1WQ1R 3Q2KA 5ITWA 3TH5A 2B4RO 1OH7A 2VH1A 3QWIA 5EPOA 5EIBC 3V1KA 3L49A 4RHEA 3DTVD 4C21A 3KDSE 2OCBA 3LO5A 1RIFA 4MLZA 1TU3A 3MJCA 3ESYA 4IQ8A 5DXAA 5DVZA 5FPQA 5M3BA 4RK0A 2G77B 3QKTA 1ZN8A 1ECCA 5E4TA 2OXTA 4XM1A 4KSBA 1N6NA 1YKSA 5BMVA 1Z35A 4CR7A 4HCJA 1V45E 4RTLA 2VXYA 3JYOA 4ZA2A 4FKMA 5JS6A 4PRZA 4IRMA 1JDZA 1PYDA 4KQFA 4RMNA 4X45A 3ZCSA 4BWVA 3BQ9A 3BTUA 2Y68A 1X7XA 1DU4A 3OE7D 4S1WA 1ESDA 3WIUA 1TM5E 2W0SA 3QLJA 1PTJA 2ZUFA 1J22A 1R6VA 1YR9A 2QGZA 5BOSB 1PR2A 1NUSA 4PC6A 4A6XA 5BR1A 3RJTA 3ZWYA 2W6QA 3SYNA 2RONA 5J1TB 4CT0A 1B0AA 3RRXA 2FQ1A 3EXFA 4RVCA 2HUNA 2ZJ6A 3HPRA 5IG2A 1KMNA 3FIJA 3TLMA 4CIXA 4QTYA 3DPSA 3WAKA 1SUAA 5ANRB 1ATIA 4UNIA 3Q15C 2PV0A 4F8YA 4HZIA 4MVJF 4Z54A 1R0KA 1F2UA 3I05A 3TJRA 4TUYA 2BFNA 1XMXA 3BGWA 1XDGA 1SU7A 3T5MA 2H5IA 1CUZA 1WHTA 1YRHA 4K2HA 3KUDA 5DMHA 2KW5A 3ZWBA 4DDTA 4C87A 1Y4AE 2C1EA 2XVXA 1ZHFA 4G0ZA 4K6MA 2V5AA 1TD1A 1V39A 2C4VA 2CY0A 4ZVTA 1A7AA 4QUEA 1G291 3H17A 2HNAA 3RAPR 4B17A 3G5TA 4CWAA 3ZDAA 4WCFC 1Q74A 3DVSX 3DQZA 1N6RA 2XHEA 5LLSA 3PP8A 3K71B 1F7VA 2FMIA 1RR6A 3G9UA 4QGSA 1KSHA 1JDJA 4WESB 2ADOA 2ZJ2A 1ZK3A 3Q3JB 5EN4A 3QBTA 4CL0A 2CKMA 3DS8A 4R3UC 3T8YA 2AX4A 3PGXA 4X8OA 2IZ7A 2GNAA 3D6TB 1N2BA 1VJ1A 2Z57A 5J2TB 4X93A 2VDPB 2RK3A 2HMTA 1B76A 2P65A 2HQ1A 4FZRA 2D1TA 5H0IA 2WJHA 4KQMA 1CUXA 4IXDA 2HK8A 3UIEA 4AN0A 1JNXX 6LDHA 1P91A 2P91A 1CNFA 2GUWA 4ZV4A 3EQ2A 1FU4A 4II3A 1EWKA 4MUXA 4ZDWA 5JSYA 3LXMA 5KUTA 1O94D 3TAHA 4TUYB 3OQHA 2DXIA 3ZE2B 5AKYA 4EHHA 4HI0E 3QV1A 3VR5D 3RUEA 1KA9H 2XMPA 3WIDA 2AT1A 1JYSA 4D8WA 1YRYE 1FX1A 5JZSA 1PNOA 4EJSB 2EJVA 3A70A 4KDRA 1W94A 1R8YA 5CFNA 1DC4A 2Z5GA 3Q8MA 4WN9B 1U2RA 1E89A 4GECA 4LIPD 1I32A 4MB0A 4EY7A 1JQBA 1R9GA 4PSCA 5DNAA 3RRYA 3THRA 4LI3X 2PKEA 2IBSA 1KK3A 4I99A 4U2EA 3WBJA 4FYMA 4MIYA 3F7MA 3TIFA 1IPEA 3ZX4A 3BRQA 1G5QA 2B92A 2FX5A 5KKNB 4WZZA 1FPQA 5KDLA 5JTTA 4YALA 1QP7A 2J6CA 2VO1A 4NZYA 1QIGA 2HWXA 3QWFA 1ODIA 2GAJA 4YDRA 4PZDA 1HDRA 1USIA 2QVYX 3JALB 3WLPA 3QE4A 3L0PA 3IR7A 4DREA 4IQGA 1BXGA 2BZGA 2QX4A 1WX1A 3MRTA 1DXYA 3D54D 4B44A 1N9ZA 4ZN6A 3SR3A 3M9XA 3RVQA 3ULKA 3O4RA 2FPRA 2H29A 4HWGA 2GPJA 1M2FA 3MJHA 2Q62A 4RMGA 1ILEA 3N2GB 2FDXA 2D1QA 1ZVJA 3NKVA 3PNLA 5T6MA 1QYXA 3W2FA 4DR4B 1F4LA 1DCKA 1GPNA 1ZI9A 2WPNA 4BNGA 4KXFB 5LCXA 4TL7A 2XOEA 4KQEA 2HBRA 4B9EA 2AXPA 3OPYA 5DI3A 2AYXA 3MCWA 4B3JA 1EUYA 1NY5A 2PZFA 4BFCA 5GVSA 1KH2A 4LDRA 5PGMA 2FZ4A 4CEJB 1X7ZB 1G5HA 3PNPA 1NI5A 3D5QA 2FG7C 1UCFA 1ZQ1A 3HLYA 3R3JA 4R84A 1KC3A 3ET5A 3KQPA 4CM3A 1FRVA 2JHCA 3UJCA 3HYNA 4LK2A 5IM4A 5LDDC 4GZMA 1YCGA 1SAYA 5K3BA 1QR6A 5DYIA 3UKOA 1DBWA 1P6XA 1U9ZA 2Q3BA 1KTVA 3BERA 4MQ4A 3RAJA 3SYRA 1QMPA 3W2TA 4CKXA 1E2DA 4WKBA 3V1UA 1W25A 3HFGA 1E2IA 1GRVA 4CMIB 5C52B 4QAJA 3AT1A 3GCDA 3LOPA 2WYIA 3DLIA 2FG5A 5EXEA 3WGTA 3ADKA 3LCJA 4P3OA 1J6UA 1V9LA 2D00A 2I3AA 4B79A 3DT8A 4G5SA 1SKQA 4BEVA 1XB2A 4AF6A 1XAHA 3ETJA 3OMWA 2LTAA 2H1LA 1I3NA 5DBIA 5ISMA 1UJ4A 5A4FS 3LFUA 4MGZR 4OJMX 1EM8A 3R7DA 3T0GA 2E87A 5JH7A 1HNXB 2CMGA 2ZR8A 4MW0A 4BHTA 3LPCA 1N36B 1RRGA 5CYFA 5TT0A 1M2NA 1M8KA 5AW5A 1I7QB 1A4RA 2SICE 1UANA 4FVTA 1TUBB 3I9JA 1QPGA 1IY9A 2OHXA 4PW0A 2IXAA 4HAZA 3X0DA 4ZI2A 1NHWA 2DPLA 2N46A 2B4QA 1WCYA 3CTPA 1QHNA 2CHVA 2QW0X 4IUBS 4JT8A 4M1SA 2RI0A 2GYYA 1B1CA 2IE8A 2ZRIA 3RVBA 2DEUA 1KIMA 1JPNA 6AT1A 4J1TC 4DLTA 4E07A 3HP7A 4MIEA 3RVRA 3VSDA 5TQ0A 4D45A 1RYYA 1WZNA 2FNAA 2H1VA 4A0RA 1AV7A 3TRDA 4FHDA 3TVDA 1HURA 1V5IA 1YBFA 3IAUA 3OCVA 2DLCX 3THOA 3NHSA 4PC7A 1PX2A 2X0JA 5JSUA 3U0BA 4EPTA 4RYDA 3FTEA 3NONA 1XTUA 5HF8A 1E3JA 5ICFA 2DSTA 2AUNA 2VSXA 2X2OA 1UDWA 1L4EA 1FP1D 1EMDA 1LS6A 3OF3A 2WJVA 1D2AA 2TRSB 3QXCA 4S1PA 4TXNA 3DOEA 2P5TB 2EW1A 4ZAYA 1XI2A 2IX3A 3CF0A 1E9DA 1FRQA 1AY0A 1TO1E 4HEJA 4GZ5A 3ECCA 4FSXA 3KDAA 3NGLA 1UJBA 2HHCA 3RFCA 1Z08A 3LWDA 1U2PA 4YTEA 3N5CA 1BHSA 4KTVE 5H02A 1FE8A 3NBKA 5B7NA 3PUWA 2V7WA 5FRDA 4E51A 2PUEA 5I9NA 5BV7A 3NORA 1QH8B 1RPNA 1T4DA 3H6KA 1N1EA 4XIFA 4BE4A 4N8DA 3ZXSA 1I4TD 1YQDA 2VSYA 3Q7SA 3LA8A 2WTEA 5J2UB 4BV8A 4DIKA 3U44B 1D7AA 1GRRA 3DLAA 3GLIA 3GN1A 4LJRA 1CZHA 5L7TA 1NYTA 1ISFA 3M3PA 2O8CA 1MG0A 4K2AA 4HDSA 3VH3A 4FJ0A 221PA 1Y0BA 2QNIA 4S3MA 5FPPA 3ZU2A 2C4HA 4FM9A 4LI0A 3PITA 3QU4A 6NULA 2OZPA 1EK5A 2C84A 4BZWA 2V7BA 3IULA 5DEIA 3RD5A 4WN3A 1RE0A 5EERA 4AO6A 2XNKA 2DFKB 4ZGBA 5IVPA 4R68A 1QO9A 3T9CA 3C5VA 2BFDA 3WHLA 3CWCA 4K05A 1GG2A 1TMKA 1HQDA 1JMYA 1H8ED 5F77A 4D4MA 3VJRA 2H8GA 2F3QA 4JOCA 1X2BA 2M32A 2X8AA 1E6KA 4PPGA 1J5XA 3R5TA 1FDUA 4DCSA 4Z3DA 4WX2B 3OX4A 3R9IA 4EQ6A 3E61A 3PHCA 3E9NA 3NDJA 3W3ZB 4UDXX 1SCNE 1KU6A 2BKUA 3OEHD 2QGFA 2ZRGA 3D3WB 1LTKA 3PPWA 4JJAA 3NH6A 3WTCA 2QM8A 1HUQA 4KK3A 4RCYA 4D9MA 2ODEA 1C1XA 1WG8A 1QNFA 2I65A 3CG0A 2IOQA 2X2EA 3T4PA 1GXSB 4LYDA 4R69A 5JJKA 1F2VA 3UMGA 1C1DB 4G6ZA 1QLWA 1VL2A 4GBMA 4YQEA 4F7WA 4PZLA 3KQKA 1ZC3A 3LPNA 3JR3A 1UXKA 3CKKA 1NFRA 1QVWA 5GV8A 1HDEA 4TTQA 3AUTA 1GA4A 2I7CA 4HGNA 4UEKA 4CM6A 4W8HA 1X8JA 1XU7A 1P2VA 3KVYA 3TQTA 5EESA 3C0KA 4QGAA 4ER6A 1S89A 3A9UA 2I6QA 2VSNA 3WIOA 3RRMA 3OIDA 4L76A 3L6EA 3KZKA 3TDKA 3KT6A 3QNWA 2P5YA 4UUOA 3F2VA 3QJGA 2R4QA 3GA7A 5K1ZA 5JAPA 1XPOA 5EMHA 4UHJA 4DLKA 1U0JA 4EITA 3CLRC 4TT3D 1ZFNA 2GSWA 3WWEA 3DVQX 4TKVB 3E9RA 5A3JA 3FVQA 4RWEA 4WNAB 1FBNA 4KITB 2RBGA 1GG5A 3KXIA 2A3NA 2BCEA 3KDPA 4PLCA 3FCAA 4DA9A 3WJ7A 3BD8A 1BN7A 3AERA 4JT2A 4OJYA 2NN3C 3STVA 3L7DA 5KSYA 3C1TA 2QTNA 3L7YA 2I6TA 2P8JA 3R7LA 1YR2A 3O95A 2ISQA 2LR0A 1ISJA 2PBFA 1GQFA 4W5RA 5EE0A 3DDOA 3EODA 3L7BA 3O7MA 3P97A 1WTCA 2JVJA 3TLYA 2JEOA 4QA9A 5LP6F 1FS4A 1Z4OA 5HUHA 1B3BA 2CDNA 1R6BX 4HZUA 3ZV5A 1Z6GA 4FZVA 3CGGA 4MWGA 5F7JA 4ECEA 3RAEC 1BNCA 2BGGA 1LNQA 5DNWA 1Q7GA 1WF6A 1IDN1 4O4JA 1YZKA 2FN4A 3EGWA 4DNPA 2X3YA 2PSEA 4KXQA 5CA0F 2FTKE 3ONWA 3D8NA 1UPXA 3SIPA 1T0HB 2A0WA 3LVFO 2QSJA 3CX7A 4EG3A 5BQFA 5ITSA 3BTVA 2Z2YA 3IDOA 4CTOA 3BSWA 3MC1A 3R6GA 3MRXA 2FN8A 3WLJA 3M8KA 3PUXA 1OC2A 2V98A 1SUWA 4RWZA 4AROA 2PX5A 4ZAWA 1O94A 3LWNA 3LT4A 4ZVPA 2VUTA 3ZHZA 4YDQA 2JKZA 1R1DA 1DJNA 1WPRA 2R79A 3RHZA 1ZR4A 5GAJA 4B3FX 3Q3EA 5AI6A 2XD9A 1XMIA 2PH3A 3G0DA 1U2TA 4Z4FA 4HQKA 4R6XA 3AF3A 1DUSA 2RBEA 2HCTA 3WV4A 1C9KA 5ALTA 3S55A 2I2FA 3PICA 2AFIA 1Z0FA 4UZFA 1O0CA 3OIVA 4R3NA 1KI9A 5L95A 1U0SY 1P5RA 2I91A 1NBMA 4HNAB 4C7JA 1QH9A 1Z8NA 2GLTA 2WWXA 3JQ7A 4QXPA 4TV8F 4EMTA 3AKYA 3AL0C 1RLOA 1EBBA 3LVQE 1DAKA 1KZHA 2AEEA 3M4YA 1GPAA 2JJMA 3H9JA 4W5JA 2VFAA 5EP3A 3WHIA 4QBHA 5KS2A 2B83A 1QSGA 1U0RA 3OPVA 2KJQA 2OZEA 3IQZA 5T7BA 4RDXA 1JHPA 3N75A 4KTTE 3PUIA 4RNCA 1E2HA 121PA 1Y82A 3F49S 2HHHB 2GHRA 1DRVA 1JBQA 4OQPA 1DEAA 1QCCA 3C3JA 3OLZA 2QL7A 2GXQA 5HS6A 1S4MA 1WJGA 1NUPA 3DM5A 5E6UA 5BSMA 1BX3A 1O8BA 3OZSA 3EXEA 2HUPA 3QHAA 4LV6A 3MHPA 4RETA 5F1YA 2NPFA 3FSGD 3TXAA 4QKQA 2PRIA 2Q4EA 2H2DA 3M49A 4X6UA 2XE7A 3HJBA 2QTTA 5GM1A 4DIOA 2VTVA 2AZDA 1MABA 4BLOA 1M2EA 4JT4A 1XMPA 4I5EA 4HD8A 3JQRA 3LUGA 1S8AA 4CV3A 4V0LA 1HY3A 3RJZA 1CIPA 3X1ZA 1EXNA 3ME5A 5JBNA 1N34B 4URUR 4LZOA 5E6RA 4WV3A 1FDRA 1S3SA 2B5OA 2NW6A 4FFPA 2R1TB 5AVTA 2JLWA 3IOCA 3HY4A 5JQGB 1LK0A 4YFYA 2B2CA 1HYGA 1RABA 1UADA 4MS1A 3G7SA 2V6MA 1V5EA 4QRHA 2B30A 3DTYA 3PYLA 1MX3A 1R4MA 3A1VA 3FR8A 4BECA 1A3CA 2A3RA 1LRKA 1R3UA 2IEYA 2YZ7A 5ALOA 1GQSA 3JSXA 4YJKA 5IC6A 3VKWA 1LDNA 3UM9A 1KSGA 4CCYA 1UT5A 1PVDA 4EA8A 3LUAA 4II7A 3MXOA 2QENA 2NYRA 3MILA 3MWDB 4INPA 3KJIA 2NU9B 4I4TA 3ZHUA 1LTQA 4O4IA 1F12A 5I9BA 3RT1A 1F2TA 3BORA 1C9DB 1ZUHA 5IRCD 4FKZA 1OHHA 2AZMA 2DWPA 2XQVA 4IIFA 5G4KB 5U1PA 4LJSA 4Y2XA 4RTOA 4HT3B 1OH5A 3URMA 1QP8A 4UTVA 3HU5A 1L8QA 4TRMA 3KSDO 5JPIA 2RFLA 2X2PA 4WCDA 4A8JA 1S2GA 2PAAA 1LBTA 3FNFA 2W2XA 5ER6A 3JQFA 3HFRA 1JR3A 2K2QB 1KFBB 2RHCA 1B4DA 2BHRA 4IH4A 2FZ5A 4CF4A 5IDVA 2DM6A 3PC8C 1UM9A 1S6YA 4TQ9A 3LX4A 4BMPB 5EUQB 4PANA 4ALNA 2NSHA 1YZLA 3IX7A 3VU0A 2YWCA 1A2KC 2WY2D 1QZZA 1AURA 5EJ9A 2Q6OA 1VHLA 1K7FB 1AOXA 2WSLA 3F5FA 3LX5A 4CMAA 4ENQA 1JDBB 4RFVA 4S05A 3IAHA 4ZHSA 2ZPUA 4LTMA 1TC1A 1OYVA 4JI7B 2HDNB 1DT5A 3M4NA 3TTVA 1Y3HA 5L3SA 2NO9A 4GMDA 4UUBA 2W2TA 2IEGA 3LWZA 4KQHA 2XJ4A 4LQCA 1Q0RA 4BLPA 1NBWB 3C3PA 2QD3A 2ZTLA 4IY1A 1QHYA 4MVJA 3PTAA 2P3QA 2P41A 2V0NA 3KSZO 3N2LA 3NHYA 2CLCX 1LCIA 1ENPA 1XF9A 2OO5C 3BMCB 4I4NA 3T5TA 5ESRA 3V55A 4D0GA 4F8JA 2J4CA 2PX8A 2PJUA 5G4LA 2OTCA 1TFUA 2CVPA 1KS9A 3L6BA 4RH3A 1CU1A 2G83A 1EFTA 1U5BA 5IN4A 4E2WA 3GVCA 3OEWA 1B0PA 3WFJA 1LZKA 4BAGA 4JP2A 5ETJA 4KV9A 2Y0BA 2GLUA 3DZDA 5DX8A 4EG8A 2J0SA 3FCSB 1R00A 5AVKA 1UR5A 2CF5A 4PFJA 5T41A 2B36A 5BSWA 2P5SA 3WOVA 3JYQA 3O1HB 2D2VA 3PQFA 2ZI9A 1J0CA 4DE5A 1FDVA 4IIHA 1Y8RA 5DM0A 2I29A 1A2QA 4ZI3A 1DG9A 4MA0A 3T6KA 3VNAA 3K1ZA 4TZ0A 2QTAA 4MHOA 4CMEC 2W2VA 3R23A 1NQWA 2QTCA 5JWOA 2WU3A 2ZWVA 3KOWA 4TT8A 4F4JA 1E1DA 4LZZA 4HRVA 5JNVA 4ZIRA 1AXEA 2QRGA 1AKEA 2XVYA 4IXWA 1DEHA 1Z4NA 4FGUA 2PFKA 4J49A 4MWZA 1Z7GA 1JLRA 4PQGA 3EBOA 4EO9A 3ND7A 1ZY2A 1GQ2A 1DX6A 5AM2A 1E5DA 3KZCA 3RU9A 1S9HA 3KFLA 3NM6B 4CHGA 1N5LA 4P93A 1HLPA 3HGTA 4RPIA 5EKUA 4GKJB 3QF7A 4DZZA 3BF7A 5DXJA 5AUQA 5GJCA 3MK31 4QLAA 4J0FA 3GGDA 4UULA 5H16A 1IUPA 3RSLA 3MSXA 5BN3B 2WWWA 1PAUA 4Z8XA 2PKRA 4ZFNA 3VGPA 3FSEA 1XXLA 4QPDA 1D2CA 1QKJA 1VMKA 4UZSA 2OXIA 3FAZA 1TJNA 1AXGA 5DM60 2PLNA 2A78A 3NIWA 3UB2A 3AR5A 2VP4A 2IJGX 1Y8QB 2W6OA 3IFSA 3N70A 3T3DA 3EDYA 2AC7A 2CNKA 1C5KA 1S2IA 2WU1A 5FWAA 5CFLA 1I5RA 3DOIA 2YC2C 3HYSA 5CM2Z 4Q48A 3RASA 4BJ6A 2VT2A 2JLZA 4KMRA 3TOXA 1M7BA 1QR2A 1NLUA 4TSFA 1R0ZA 2COUA 4NMXB 4PPNA 5DI9A 4GC5A 3CC8A 3KQUA 2WTMA 2XGMA 1EGHA 1RRFA 2CB0A 1DRWA 3RHSA 2KE5A 1JYFA 4JQOA 2AMFA 3OT5A 5SV2A 1B8NA 2WAAA 3O38A 3BD9A 3E9QA 3LC7O 4P8RA 4PAMA 2UVQA 3KVOA 3OQVA 2MMCA 4OK3A 3CA8A 3FWPA 3MCZA 4C4XA 4ANFA 4BNMA 1IXZA 1Q19A 4C7VA 3R0QA 2K7ZA 3FPLA 2ET6A 1DRKA 2PIAA 3ABZA 4INZA 1PIWA 2C7VA 3VYWA 4YRBA 4LX8A 3BH7A 1Z5UA 5ESXA 5CX1A 1V25A 2QXYA 3AC0A 3ZY5A 4A6EA 2C61A 4XB2A 2AJTA 4Q21A 4CLXA 2GZ3A 2AFVA 2FPMA 4GVLA 3RIHA 1MRNA 2W6NA 1GL6A 1JR6A 3O1IC 4CMGA 2IKQA 1MG5A 4JHLA 1QRAA 4R2KA 1O6BA 4D81A 3OZ7A 3R7NA 3LFTA 1CCWA 4ZPJA 1U02A 1XYVA 4MPJA 3RU2A 4DDWA 3QUCA 1NNI1 3BD7A 4V02A 3UUFA 2NM0A 5LYYA 1W76A 2I4IA 4NENB 1ISSA 3ACDA 1BS9A 1E1NA 3NAQA 2V7QD 3H1BA 2C95A 4QPZA 5EGNA 4M4SA 3BIJA 5GOZA 1KQOA 1X9HA 4QELA 1IU9A 4RFLA 5LZ9A 5LD2C 3QUBA 4WVFA 4ZHQB 1DWOA 3CZCA 2BEWB 4ALMA 3SMVA 4K9PA 3CPJB 1LBIA 1ETHA 1GU1A 2CJFA 2N42A 4PHFA 3KNZA 3W8EA 3QVUA 4V0QA 3EGXB 1FFYA 4N18A 5HFAA 1P31A 1T35A 3R0IA 3ND6A 3QYFA 2A5FA 3V6MA 4LF5B 3GLUA 2XAAA 4I1OA 3W6UA 2OHJA 4YCMA 2FETA 4RPGA 1JAXA 1V1MA 5A6SA 1QUFA 4IIYA 5FWNA 1FLVA 4D6YA 1U2SA 1DQZA 3ANYB 1XSEA 4YRJA 4HNUA 5CDYA 1H2EA 2ZRAA 4AO8A 3ND9A 3S40A 1QGED 1FMCA 3MNFA 4YXFA 1M7GA 2DFPA 4R0NA 5DCWA 5B6PA 2VXCA 5C7IO 5DCLA 5TPZA 1JT9A 1DVRA 1JJIA 4E5VA 2X1LA 5LOVF 2C4WA 3K35A 1EYZA 1KI7A 4YROA 3RJ9A 3PT9A 1M2OA 4RA6A 2AR0A 4JYZA 1XRPA 4EG4A 3FMGA 5C1IA 3B20A 4Y8VA 4B4UA 3KSRA 4L73A 4F9GA 3RS8A 2XMQA 1RC0A 5IAKA 2YQ4A 3QVKA 1DC3A 1HOXA 1QO7A 4IJ6A 4LJ6A 4D0RA 1L4LA 1VM6A 3WGOA 3UG7A 3BM5A 4YV7A 2AQ8A 1T43A 2BJHA 3O0TA 1F8FA 2CNOA 3HSKA 2PDAA 3BXZA 3LKVA 4EJ6A 3AR3A 3WMWA 2XGJA 2UVDA 1SN7A 3BG5A 1YTUA 1SXIA 3I6QA 2G9ZA 1K4KA 3CONA 2BM8A 3KKQA 1VHWA 2R6JA 2RI6A 4GL4A 4UXJA 4IQ4A 1E94E 2VHZA 4KUHA 3PX2A 3U0VA 3ZDYB 1Z26A 4YYZA 1SG6A 1F4VA 1T3TA 4DTIA 1XTTA 4MUMA 1Z5ZA 4UHEA 4KFSA 4XOUA 3VZBA 2E85A 3KOMA 1V7CA 1T4CB 4M1QA 3WL3A 4AWXA 2QV7A 5L4SA 2PXXA 3GFFA 4J1SA 4RK4A 2X4DA 4FN4A 4IFTA 2XEDA 1UBOS 4QDXA 1XV5A 4HNSA 4Q01A 4YN3A 1JQ5A 1Y4UA 4D7AA 1ULTA 3VNUA 5J2UA 1ZJ5A 4ZVSA 3IUNA 3BCSA 3E8XA 3OTIA 1IBKB 2FKAA 3ZZ0A 5GJBA 1P0FA 4HUQB 2I2BA 4D3FA 3DYVA 3KQNA 1DJPA 2H9AA 2R48A 2QL5A 3NWOA 1SD1A 1YZNA 5EIHA 4B9AA 2Z9DA 1UBJS 4B32A 1ZK4A 2Q7DA 4RK5A 4EVRA 3U16A 1GYRA 2PZGA 1NN5A 3RAFC 3ZDEA 2O3SA 4KLCA 3NBZC 1X14A 3URKA 3DZJA 4EYGA 4KN8A 3MUFA 3ZGLA 6ADHA 4GP6A 3GL9A 5A5GA 1BYUA 4FLFA 4R1SA 1TKRA 3TW8A 1Y81A 4AZWA 4NH0A 5E4JA 1JFVA 1NQOA 3O2JA 1JKIA 1YUBA 3DMHA 1QWSA 2AD5A 2QG4A 3UT0A 3LP5A 2FI1A 4RMJA 4K8OA 5A7FA 3ADCA 3GFVA 2JI7A 5TGDA 1QFZA 4ZOAA 5G3ZA 5BR7A 3G02A 4WGFA 3ANNA 1FJ2A 3AKCA 3QOXA 3VU3A 3QBVA 2AYZA 4BVEA 1D07A 1QV7A 1YU6A 3D31A 2ATEA 1B8VA 1C9MA 4ZEOA 1S3IA 2GBLA 3OY7A 3TOCA 1NPYA 1RJWA 3ACBA 4JUBA 3AY6A 3GH3A 4KQ9A 5D3QA 1MQAA 2GD2A 3SEZA 2FPIA 1I0LA 2JA2A 3QI2A 3SS9X 5BQ5A 4O25A 4FHGA 5C37A 1DOHA 3I64A 4FGJA 4D5EA 4WZBA 3V5NA 3EZGA 4Z4CA 3L43A 1L5VA 2H7YA 4ARIA 3QMVA 4IOMA 4B35A 3USES 3ZCTA 1MDBA 3OF5A 1AQ6A 1G8YA 1FYDA 2ETVA 2JH9A 2SCUB 3DDCA 4KVAA 4MGYR 2DFVA 4C2UA 5FI1B 5KHAA 3GOQA 3QVVA 4PO3X 2F17A 2C88A 2I7VA 3I37X 4PIMA 3JD0A 3M3HA 5JVDA 4HQ0A 1ZIOA 5EFZA 4PSDA 4EHFA 1KERA 2NP6A 3FPKA 1V1RA 2FE4A 4GQIA 1FL9A 1QH1A 3RARA 3IALA 5SICE 1H94A 5E7QA 5IW8A 4X8MA 5JXWA 1JG4A 1I2DA 4IZIA 2HIGA 1SUDA 2PL5A 1KEPA 2JBAA 3HZZA 1K7YA 3S5JA 1YL7A 2AFIE 3Q85A 3IMGA 2WTBA 1PGNA 3H99A 3IO3A 3HJGA 4NK5A 2OUKA 1SZDA 2PKXA 3ZHBA 2XOKA 2OKGA 3I39X 1CUDA 1V5GA 1UBHS 4U9HS 4AK9A 3UBTA 1HL7A 3KK0A 1JKXA 4Y18A 3SVTA 4MDFA 1NL3A 4FNAA 1JHOA 4BPBA 1CJVC 1BCSA 1ODKA 2Z8ZA 2EX4A 2P9HA 2WAMA 3EXIB 3M6FA 1XZDA 2PX2A 3WGIA 1KYZA 1L7RA 1STOA 1TC2A 1NSFA 2JRCA 2OHVA 4IQFA 4US0R 5KINB 5JZOA 1S4QA 4GOMD 2RKBA 5HJEA 3B1FA 3JVDA 4QD3A 1U0NA 2W93A 2AW5A 4QOFA 4MRMA 2O0JA 3M6MD 3WRXA 4PCVA 2ZZNA 2XB9A 2YASA 2O2EA 3TE7A 2YWJA 1YRWA 3HVKA 3KT3A 1KOLA 3WSWA 2DERA 4JLKA 1Z34A 2JAQA 1D6MA 1RVDA 3CNHA 4MINA 2X5XA 4NX2A 5K8VA 2KSQA 5LQAA 3W5BA 2OZVA 1Z28A 2FRDC 2IU6A 3A1EA 4G41A 2EYQA 1PJRA 2D8AA 3DVAB 4EYSA 4AJNA 3C97A 1VJGA 2AOWA 1P9WA 4TXJA 4TVSA 1RRCA 2NO5A 2ZQ5A 3EY4A 4Q4DA 3ES9A 3W7AA 1GAXA 1Z18A 1H8HD 2GEJA 1RZRA 5LPNA 1YUNA 4MDEA 5EWMA 1P2SA 2HU2A 2YZKA 2W11A 1CE8A 4J75A 4XRRA 1GNSA 4EY4A 3DDSA 5E0KB 1LXCA 5I5EA 2VOJA 2PEYA 4G3XA 1KEUA 4MV7A 4Q1FA 3KFVA 5KQRA 3AEQA 1CZLA 1FFAA 1TW2A 1TB4A 4G89A 3NNDA 2AVDA 4AG5A 2K5UA 4JJEA 2ZVJA 5IP5A 3X1YA 5CVJA 4U2KA 2QLLA 3U7QB 5FBRB 1DKRA 2Y99A 2ZTHA 1I2ZA 3AP1A 4MVJG 3TQIA 3H1PA 3W2EA 5CXQA 3ER9A 4CM9A 5FHQA 4RXTA 1OXXK 3RIGA 1RLUA 2ZAOA 2BZ0A 3WLSA 5K0TA 1NVGA 2GFQA 1O7JA 2NYAA 4LDNA 4TSFD 4W8GA 5K0GA 3QSGA 5LXTB 3N53A 2Y0PA 4LW8A 1PR3A 1ZJZA 1VJDA 2VHQA 3WICA 2WUEA 4NLLA 2HA3A 4NBKA 5JCZA 1C4OA 1IH8A 2JGKA 2UVPB 4OXXA 5HIIA 1PFWA 2QB5A 1S96A 3RPEA 1FIUA 1EFHA 2X3FA 1M2OB 4RA6B 4G5GA 1ACLA 2PMFA 1TVEA 4YWJA 3VR6H 4D2IA 3LUPA 1YCHA 1K5PA 1OIXA 2MSEB 2ZIAA 1Q92A 1N2CA 1E3DA 2BIFA 4HBGA 3REQA 5B6IA 2JFGA 2WB2A 1GQRA 2ZU0C 1G3RA 3BYZA 3NBYC 4GPEA 4HEA6 1NW4A 1A7KA 2HN9A 1UMCB 2OESA <