4XJVA

Crystal structure of human thioesterase 2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
216
Chain Sequence
ATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords S-acyl fatty acid synthase thioesterase, medium chain
publication title Crystal Structure and Substrate Specificity of Human Thioesterase 2: INSIGHTS INTO THE MOLECULAR BASIS FOR THE MODULATION OF FATTY ACID SYNTHASE.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 216
sequence length 241
ec nomenclature ec 3.1.2.14: Oleoyl-[acyl-carrier-protein] hydrolase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xjvA00
5CURA 2XQKA 4U2GA 2IIVA 1WB6A 1J07A 2PSFA 1EDDA 4O08A 1C7IA 1JFRA 1JI3A 3WQHA 2VT6A 1R4ZA 3GBSA 5FLKA 2XQFA 4PW0A 5H3HA 3LIIA 2HFJA 3WKCA 5CXUA 4W63A 1XRNA 4X95A 1MU0A 3GELA 1ZD2P 3QZUA 1EH5A 1CQZA 4CCWA 4M0MA 4PSCA 3FYUB 3MUOA 2WIKA 2XI4A 2OGSA 3CCCA 3QPAA 4FWBA 3HXKA 4BB0A 5AIAA 5AI5A 1QLWA 2Y6VA 5D7BA 3SC2A 3V1NA 3FYTA 2AJLI 3D3NA 4U2DA 3ESDA 2V9ZA 5JANA 1XZDA 1MX5A 4X94A 2AJBA 4OB7A 3WMRA 4BAUA 2Z3WA 3WZMA 3M3DA 3PDCA 1MJ5A 2OQVA 1ZD5A 2I03A 4FMPA 3FLEA 4H7JA 5E2IA 5ALOA 1A8QA 3DQZA 1EK1A 3WL6A 5A6VA 2IITA 2X76A 2RIPA 1XQXA 3S8YA 1IUOA 4C87A 3I2FA 5C8ZA 1IZ7A 4JNCA 2B20A 3IA2A 4X93A 3HACA 5CT9A 1K5PA 4HRYA 1MAAA 1ISPA 5LKAA 1W4LA 4QDXA 3EQ9A 3WKDA 2CBGA 4HVTA 4PNZA 3D2CA 3C43A 3A2LA 3IVMA 2HIHA 1H22A 4EY8A 2JGKA 1CUWA 2XQJA 1AKNA 1Q0RA 5CH5A 5CH3A 1BE0A 1EINA 1FJ2A 1MPXA 4WY5A 4KACA 3OPMA 2WKWA 4U2BA 3WA6A 4QE3A 1CUIA 4BC1A 5K3EA 3QVMA 1H2WA 2PSDA 1TK3A 4JYPA 5C7YA 4Y2XA 3TGLA 1LPSA 3EQ8A 5DNVA 4PSUA 1QIEA 4M0FA 3WWDA 3G0BA 4OPMA 4FLEA 5LLSA 2YH2A 1IMJA 4IO0A 4C89A 3VJMA 1GZ7A 4WDQA 3WKBA 1WPRA 3BF8A 2CMFA 1YCDA 3IDAA 3QMMA 3H04A 3WWEA 3QBJA 5AKJA 1HKHA 4GEGA 2Z8XA 4KAFA 4AZ3A 3ANTA 5K5EA 4OU5A 4FTWA 1VZ3A 1ZGBA 4B85A 1DT3A 1Y7HA 3G9ZA 3I6YA 1QIIA 3D59A 4DMHA 4H7IA 1UOPA 5DYTA 3TEJA 4RE6A 4B7ZA 5FV4A 2HRQA 1JJIA 1ACJA 4B0OA 4NMWA 2XQGA 4INZA 3VXKA 4WJLA 1U65A 1XKTA 4AO6A 5ALUA 2WIJA 3WLAA 3SX4A 2R8BA 1XFDA 4BAZA 5D3ZA 1R50A 4UPDA 3BL8A 2WUFA 2BUAA 1JJFA 1BROA 1GPNA 1P0IA 2HL6A 1K4YA 5DYWA 1BRTA 1HPLA 1VE6A 4GXNA 5ALFA 2WIDA 2XMDA 4QLAA 5AOAA 3ANSA 2JBWA 4HXGA 5FOQA 5IH7A 3I1IA 3HEAA 3ESAA 1LPAB 4X71A 3H0CA 4B82A 4J0GA 5A7GA 4B9AA 4MEAA 2RI6A 1W1IA 4BTVA 2J3QA 2ES4A 3PF9A 1CLEA 2BUBA 2JGIA 2PSEA 1CUSA 1IUNA 1ZIYA 2WUEA 4QDUA 4E15A 5HZGA 3VKFA 4EZIA 3D2AA 1IVYA 4LIPD 2OLEA 3W06A 5DJ5A 1QGED 4F21A 1LGYA 1TIBA 2RGUA 4P92A 1VE7A 2GZRA 4B83A 1HL7A 2GBCA 5HFAA 4A5SA 4KRXA 1AZWA 2EDAA 2OGZA 4C4ZA 3IB3A 3WJ2A 4IHAA 2ZJFA 1F8UA 2JGEA 2G63A 3B12A 5K3FB 2WUDA 4GHWA 4JUIA 1MTZA 3KWJA 5I8PA 3F8SA 4OSEA 3O9VA 4FHZA 1A7UA 4BZZA 5HK8A 4J0HA 5T4HA 3E0XA 2HFKA 4PSDA 3C45A 1AURA 3ESBA 3KWFA 1X70A 2CZQA 2XDWA 1THTA 1TCCA 3V1MA 1A88A 2GYWA 1UKAA 4OD0A 1D07A 1U2EA 3PF8A 4G9EA 2HA6A 1LNSA 2PSJA 3AJAA 1XRRA 3Q8WA 5AM1A 1DX6A 4HS9A 1B41A 5AM5A 5DYYA 1HQDA 5SYNA 3I2HA 2ZYHA 5CMLA 4AB1A 3LS2A 2QZPA 2BAGA 2I78A 3AUKA 4BCBA 4F60A 1XKLA 4BRSA 2HU5A 3ZLTA 3H2GA 2C7BA 5JZSA 1YB7A 2ZJ6A 1FFCA 4Y7DA 2PU7A 2D5LA 2WFLA 5JAPA 3I2GA 5FPPA 1GGVA 4MWSA 4OYYA 1XQWA 4UFPA 2XUHA 3FWHA 2WU3A 5AM0A 1E89A 5ALSA 3PUHA 1G5FA 2JGJA 2O7VA 3IUJA 2IX9A 3R0VA 3BXPA 1Q83A 4G4IA 4DNPA 5JAOA 4GW3A 3AZOA 1DWOA 1N5RA 3T52A 3KSRA 4BZWA 2WSLA 3M82A 3RLIA 2Y2VA 3DLTA 5CT8A 4X91A 4C01A 3WYNA 2EEPA 1XZLA 4KJXA 5FP0A 2HRRA 2E3JA 4H0CA 4RGYA 2OCIA 4YPVA 2XE4A 5IVIA 5AP9A 1L7AA 4M0EA 1OILA 1BS9A 1UXOA 5ALLA 1G4HA 5T4BA 1EXWA 4WDRA 4QWMA 3F98A 1LLFA 5AK5A 1EDBA 4UHBA 3LIPA 1QONA 2JGMA 1CUAA 3H18A 2PBLA 2VEOA 3STUA 3FAKA 1GQRA 1DQYA 4UHCA 4CFSA 3BJMA 1AGYA 1VOTA 5FRDA 1SOMA 3E3AA 3WJ1A 2J3DA 3AILA 4K2AA 1TQHA 5HF6A 2CJPA 1CRLA 2FJ0A 2HA4A 1TCBA 1BEZA 1BCRA 5IKXA 4H7EA 4MEBA 4QA9A 4OU4A 1J2EA 4H7KA 1EVQA 1GT6A 5C8VA 1XZGA 1UKCA 3EBLA 1XRMA 3NGMA 4XWGA 4DMKA 1VZ2A 5FUMA 2XUGA 2XUIA 1UK8A 5ALQA 3F67A 5AKLA 3MUNA 1PFQA 4BBZA 1XZMA 3KOOA 3HLKA 1TRHA 1GQSA 3BWXA 2BGRA 4JEIA 5ALRA 5JD5A 1BN6A 3HZOA 4ZREA 5BWBA 2JIDA 3ZV7A 1GKLA 3QM1A 1YAJA 1K6EA 4U2FA 2XLBA 3JWEA 4KYVA 1TKRA 4IH1A 2AJDA 1X2BA 2VAXA 5JASA 1K63A 4K5QA 4TVKA 5HF9A 4ZRDA 2QUBA 1SCIA 2ZVDA 2HU8A 3A6ZA 4BVJA 3L1IA 3G9UA 3V1KA 5C81A 1O6GA 2YYSA 2QOEA 4Q3LA 1N8SA 1FFBA 1XZCA 3R3ZA 4UBLA 4G8CA 4Y2JA 4JH0A 3PUIA 4FDMA 4CCYB 3K9BA 4H7HA 1XZAA 4CIBA 4UFOA 4EY7A 3STTA 2HHAA 1CPYA 1WHSA 3TRDA 4BP9A 3W9UA 4AN1A 3O0DA 2PL5A 2YASA 3VVLA 3R3WA 3ICVA 2OG1A 2CB9A 1QIKA 4Y2VA 3WYDA 3YASA 2JEZA 2VTVA 3ED1A 5KWIA 4J3JA 1CQWA 5CRIA 5DWDA 1XZHA 1YB6A 4C4XA 1AX9A 1ZIXA 2O7RA 4B0PA 3ZWQA 3DYIA 2JEYA 5HQ3B 2PM8A 2OGTA 2WFMA 5A62A 1WOMA 1HBJA 1CUHA 4IQ4A 1C7JA 1AQLA 3F9CA 3DD5A 4UHHA 1USWA 1QIFA 1BEEA 4OYLA 3R3YA 4AMZA 5LKRA 4I3FA 2XLCA 3WZLA 1CUZA 5AKXA 4H7DA 5KREA 2OQIA 4BCDA 5AI6A 2DQZA 3I6MA 3T4UA 3GROA 2XUFA 3PE6A 1U8EA 5ALYA 3RARA 1DINA 2JGLA 5CW2A 1ZJ5A 3R3XA 4KR0A 5AI8A 3FBWA 3I2KA 2XUKA 1VA5A 3VJKA 1XZKA 1FFAA 3HJUA 1RYYA 1EI9A 1CEXA 2H7XA 2Y1KA 2HADA 2OAEA 3GZJA 2FX5A 4B84A 1Y7IA 3G8YA 2WU4A 3GFFA 4UUQA 1ZD4A 3F97A 1E66A 1IUPA 5JARA 4OB6A 1ZGCA 4Y2PA 5AKHA 3IUMA 5ESRA 3CCBA 5FXMA 5BWCA 1DX4A 4H77A 3WK8A 3OC0A 3AINA 3D4LA 2WILA 1DWPA 1CUGA 4UBNA 3VJLA 4LYDA 3V9AA 1YS1X 2H9YA 2XMCA 2QJRA 5ALJA 1LPBB 1XZBA 3LCRA 3FSGA 4B6GA 1LPOA 2FUKA 4G9GA 4Q05A 4L0CA 1E8DA 1NU8A 4KAJA 2H7CA 3B5EA 1SCQA 3V48A 5LZ2A 4J03A 2I3ZA 3A2NA 2HA7A 1UKBA 5JD4A 3DYVA 4LXIA 4GDMA 1C4XA 3WWCA 2QT9A 3ILSA 1QIDA 1W76A 1EB9A 4W1QA 5JALA 4P9NA 2XUJA 3WL5A 2J4FA 5AI9A 1N1MA 1XQYA 1CUXA 2VT7A 1CV2A 3AZQA 3C6XA 3O4HA 3HYSA 1AC5A 2C0QA 1T2NA 2O2HA 5AO9A 2B4KA 3OOSA 4CG1A 1LPPA 4NVRA 1JU3A 1GPLA 5DTJA 1R3DA 5E4JA 1VXRA 4ZGBA 3AZPA 3DCNA 3W05A 5LYYA 4U2CA 4B81A 1JMKC 4RE5A 4DNQA 3C87A 2XMQA 4E46A 4L9AA 1YA4A 3IIIA 3BIWA 4GI1A 4B80A 1UFOA 5K3DA 1ZI9A 1VKHA 1UK9A 1YASA 2QVBA 1MX1A 4AX4A 4Z49A 4NZZA 2DHEA 3STWA 1F0NA 5ISMA 4J0IA 3FVTA 4BTLA 2VJBA 2XMZA 3G0GA 4AXBA 3K6KA 1MN6A 1DT5A 4Y2UA 1EK2A 1CR6A 1K8QA 5AI0A 4UHFA 5EIHA 2HA2A 1DWQA 4DSZA 4MQLA 4DTCA 1MX9A 1W6RA 2H1IA 2ACEA 4FNMA 1AUOA 1L7RA 1R9MA 2JGFA 4RNCA 4J0KA 3W2TA 2ONCA 4QZVA 2DHCA 5DLPA 3G02A 1GKKA 3BIXA 1H2XA 4MWTA 1R9NA 3DS8A 2OCGA 2EDCA 4ITVA 3R41A 3B3QA 3DDUA 2AXEA 4YASA 5AKYA 4F5ZA 3FYUA 2W6CX 4G4GA 3H17A 2QM0A 3STYA 1FFDA 1Y37A 2ZYRA 3FCXA 1NX9A 1UWCA 6YASA 3ZI7A 3H1AA 5AK3A 1H2ZA 2HA3A 2Y2UA 2DQYA 3W9BA 1CFJA 2WHRA 2RONA 1XZIA 2C4HA 4WFJA 1SC9A 5EFZA 3HSSA 4X90A 4ZI5A 5LP1A 3AIOA 2WFZA 2DFPA 2OAGA 1LBSA 5AKIA 1UZAA 3W04A 2UZ0A 3FCYA 1TCAA 1VA4A 4L3WA 4W1PA 1G66A 4X00A 3L1JA 3N2ZB 4AZ0A 2Z3ZA 5EGNA 4E11A 5AH0A 2FJPA 2XMSA 3UMJA 4ETWA 5HQ3A 3DKKA 1YAHA 3ESCA 1W75A 4MJ3A 4AMYA 5LZ8A 1CUJA 1LBTA 5A7HA 3G7NA 1JT2A 2BFNA 4Q3OA 1QE3A 3ZPXA 3AIMA 4LXGA 3R3UA 3IURA 4UBOA 5JZ9A 4FFWA 1ZI6A 1QJ4A 3G0DA 1QIGA 3O4IA 4X7BA 3K2IA 2XMRA 1X2EA 5CTAA 2XT0A 4P93A 1XRLA 4EUSA 2HU7A 3H2IA 2P8SA 1E3QA 2VJDA 1E5TA 2Y6UA 3D2BA 1PV1A 1Z68A 2WJ4A 4WFKA 2XQIA 1JU4A 1JMYA 3F96A 3VVMA 4BRZA 4U2EA 4Y2YA 3OURA 1H2YA 2JF0A 2RHWA 1M33A 1YS2X 5F4ZA 5ALHA 3LP5A 4PF1A 3WWOA 4Q1VA 2B9VA 4WCVA 2QJWA 5AKGA 1P0MA 4BYMA 3C6ZA 3ZLVA 4XX1A 1ZICA 3EF3A 1CUEA 1JJBA 1W52X 3WWPA 1QIHA 1XZFA 2XUQA 5JAHA 5AKKA 1ACLA 4X92A 3D5EA 5EI5A 3D0KA 3H2KA 1EX9A 1XZJA 1YA8A 5HF5A 1WB5A 4EA6A 1U4NA 3E1GA 3WK9A 2XUOA 2ZSHA 4UBJA 4DIUA 2ZYSA 5CBKA 3BDVA 1T4MA 4KRYA 1TAHA 3BDIA 3WL7A 4N5HX 4UBMA 5FKJA 2WG1A 5I9IA 5HF8A 5IVHA 4BVLA 4TPKA 4G8DA 3SK0A 3STVA 3CN9A 3A2MA 5HFNA 1WM1A 5LZ9A 5JYCA 3WIBA 4Y2TA 3MVEA 5ALNA 5JADA 1EDEA 2X5XA 3EIOA 4BAGA 5LZ5A 4RPCA 4DNFA 5ALWA 5A71A 4Y2SA 3VISA 2PU5A 2RHTA 5EHZA 3WK4A 4EBBA 1Q84A 3PFBA 3DOIA 2VSQA 3I6ZA 3WK5A 2I3DA 5K3CA 5ALMA 4B9EA 1RP1A 2ACKA 3PFCA 1CIJA 5A7FA 5HKBA 1UK6A 2C5FA 1UK7A 2QRUA 1WPXA 1HLGA 3C8DA 4AO7A 2Z8ZA 4D9JA 2AJCA 4FOLA 1PJAA 2ZSIA 3OG9A 1CVLA 4Y9SA 3C5WP 1VXOA 2HA0A 3L1HA 5JZBA 1UOQA 4PQEA 5IVKA 2O2GA 5CH8A 2R11A 1S8OA 5LZ7A 2OPHA 3EQ7A 4N8SA 2WQZA 4YX9A 2HA5A 2WFLB 4UBKA 5EHXA 4CG3A 3BF7A 1EVEA 3NOXA 1WCYA 4EY6A 3WL8A 2G5TA 4AQDA 2DCMA 4Q82A 1ZI8A 2K2QB 4DM7A 4KE9A 1UOOA 3WKEA 5CT4A 4QDOA 3RM3A 3LLCA 2W22A 3HI4A 3CXUA 1CUFA 5K3FA 2OCKA 2AJ8A 3JW8A 3I2IA 1OXMA 4GBGA 3RK4A 4AN0A 4DNOA 5FDFA 1G42A 1A8UA 2WHPB 2C58A 4EHBA 4S0XA 4DMCA 2WTNA 5AK6A 4OUKX 4UHDA 1J06A 4KE8A 3O4GA 4QEKA 3WA7A 4PO3X 2C0PA 5EHNA 3QPDA 4P08A 3G0IA 1CUYA 4G5XA 1O6FA 5HKAA 5AKZA 1IZ8A 4V2IA 3FLBA 5A2GA 1VJ5A 3WKAA 5K3AA 2QR5A 2GBIA 4ARBA 3AFIA 1L7QA 2HDWA 2BKLA 2VA9A 1XQVA 1EHYA 2GZSA 3ZLUA 4JYMA 2WIGA 4DSAA 2BJHA 4Q3KA 3BE8A 4QNNA 4H18A 3G0CA 3C6YA 1GXSA 1FSSA 3G9XA 3X3HA 5AM2A 5CXXA 2X8BA 3GUUA 4BVKA 1XRQA 5AHXA 4ZXFA 2B61A 4UBIA 3FVRA 2PUHA 1MT3A 4YK7A 3HC7A 4BATA 4F0JA 1YR2A 3KD2A 2WHQA 1ODSA 4OCZA 2WUGA 2J4CA 1I6WA 2WLSA 1EA5A 4G8BA 3M81A 4QDZA 1THGA 2PSHA 5KBYA 1QOZA 2QKYA 1CUDA 4CIAA 1ORWA 4GECA 4X97A 1ZOIA 4WFIA 3I28A 4C6HA 2ZYIA 3QPCA 4EB0A 1F0PA 3H2JA 5E4YA 3FOBA 3C70A 2V97A 1XROA 5ALZA 3E4DA 4XIIA 2OCLA 4KAAA 4BDTA 1AMNA 5ALDA 1LPNA 1XLUA 1WB4A 2DHDA 1SFRA 2QMQA 3QMWA 4LKOA 4X6YA 1QFSA 2VATA 3UUEA 4MYSA 5JD6A 3QMVA 5CT5A 3IULA 4OB8A 3IUQA 1CUBA 3N0TA 4MXDA 4MQMA 1BCSA 5AICA 1LPMA 4IH9A 3SWWA 3DOHA 4MYDA 5SYMA 3DL7A 3WK6A 1A8SA 3GA7A 4FBMA 2PUJA 1H23A 3TJMA 1VLQA 2XUDA 2HM7A 4HZGA 4L72A 2VAVA 3CN7A 1ORVA 4HTAA 4ZWNA 5JAUA 4BDSA 4C88A 1ODTC 4FBLA 5E4TA 1N5MA 3O9MA 2WG0A 2V98A 3KDAA 2CEKA 1BU8A 4UFNA 4QDTA 5AOBA 1SCKA 2GBFA 3I1YA 2H7YA 3FSGD 4X3CA 2C5GA 5AM4A 4LXHA 1XLVA 2BGNA 3DNMA 3O95A 3WIOA 2XMBA 1QFMA 4G4JA 4CI9A 1B6GA 5T4FA 4KE7A 5IVDA 2WIFA 3DKRA 1MAHA 4J0JA 2QTBA 2WG2A 1J1IA 1JKMA 2QS9A 1R88A 4UHEA 4QLOA 4X85A 2WTMA 3H1BA 5LIPA 2PPLA 3NWOA 2PX6A 1KU6A 3DEAA 3C5VA 2Q0XA 4QWWA 4A23A 4XVCA 2DR0A 2XB6A 1RWQA 1E8NA 5AK4A 5ALKA 1LZLA 1R1DA 3R40A 5DNWA 4H35A 5DNUA 5J3JA 2GYVA 2LIPA 3OTQA 3FNBA 3PI6A 3UUFA 5FPQA 5ALGA 3C8HA 4N5IX 3DL4A 1YSCA 1KEZA 2XUPA 5I7UA 2NW6A 4EY5A 4KE6A 4DGQA 5ALPA 4BC0A 5ALVA 3WK7A 1OCEA 2Z5GA 5JATA 3ICWA 4DYHA 3QYJA 5K3BA 4FKBA 4ZV9A 2ORYA 4X6UA 5ALEA 4CCYA 4NS4A 3RKSA 4XJVA 2WJ6A 1DU4A 4HXFB 2G5PA 1DQZA 2VJCA 2XMGA 3HRHA 3NUZA 1E8MA 3I2JA 4FNGA 4TGLA 3QH4A 4HXEB 4HRXA 4WY8A 3HABA 3OM8A 1ODCA 2WJ3A 1P0PA 4H7FA 5D6OA 5YASA 1BN7A 1ETHA 5C8XA 4DLNA 3H2HA 3JYHA 5AJHA 1P0QA 3H19A 4W1RA 3S2ZA 3Q0TA 4J7AA 1Q0ZA 2WHPA 5AIBA 3V1LA 1XRPA 4FLFA 1EB8A 1QIJA 2PVSA 1MO2A 2QXTA 5LZ4A 4KEAA 4BP8A 5JIBA 3C6BA 2CKMA 3U0VA 3WI7A 4FFVA 3IUNA 4Q34A 4A16A 5ALXA 2GBGA 3IBTA 4N8DA 4ROTA 1QTRA 2GYUA 5AOCA 3R3VA 5ALTA 4BE4A 4K6KA 4ZV7A 1QZ3A 5EIEA 2BUCA 4W1SA 5HK9A 2DSNA 1DTEA 2G4LA 2ZJ7A 4CG2A 1MNAA 4LHEA 4LYEA 4E14A 2PKYX 2YXPX 4GLBA 7YASA 5AKEA 1QO9A 5DTIA 1KU0A 5EIAA 4Y2RA 4J0DA 3MGAA 1XLWA 4X6XA 4K6GA 1CUVA 3FLAA 3A70A 5BV7A 5T4EA 5BOVA 4Y2QA 5EHQA 1WHTA 5AI4A 4DMFA 1UT6A 4I4CA 4HAIA 3DJYA 4IH4A 2WM2A 5AM3A 3FYUC 2QXUA 1FFEA 2V96A 3AIKA 5HCUA 3G9TA 1QTIA 4AO8A 2ROQA 4N8EA 4BE9A 4PV7A 3BJRA 4G1FA 1ZJ4A 4I19A 1HDEA 2VF2A 1NU6A 1LZKA 1CUUA 2OXEA 1XZEA 5KWJA 1QIMA 4ARAA 5D3KA 1CUCA 4K6HA 1F6WA 5CT6A 4W9RA 2XUAA 3O4JA 4C4YA 2D0DA 3VDXA 2O2IA 3P2MA 2CUTA 1GPKA 5ALIA 4EY4A 2RAUA 1QO7A 3PICA 2QUAA 4FLMA 1MNQA 2ECFA 2VJAA 3M83A 3STXA 2BCEA 4J0CA 3KXPA 1ZD3A 3D7RA 3U1TA 3QITA 4GWLA 2VQ6A 4BCCA
chains in the Genus database with same CATH superfamily
3VAAA 3P32A 2QP9X 1HI9A 3AEKA 1PHRA 2PSFA 3AFNA 1EDDA 3HXLA 5CM2Z 5BYBA 5JS2A 4CM1A 1C7IA 1JFRA 2B69A 2AD1A 3QF4B 4L3OA 5HVNA 5KNBH 2X0DA 5L6MB 4QGGA 2BBSA 1UBRS 4WD3A 1PZFA 3BE5A 4PLHA 2Y1EA 3GBSA 4LXXA 1RQGA 3LDFA 1FDRA 2Q5CA 4M98A 3AHIA 2P6MA 4AJKA 1G8MA 3EODA 4A6DA 1O3YA 4JSYA 1BE8A 1M34E 3WKCA 4JP1A 4W63A 5CXUA 1LLCA 1WZEA 1L7EA 1L4MA 1XRNA 3V4FA 1ORRA 3TKYA 4C76A 1E3EA 1MU0A 4DQVA 2EZUA 3FNFA 5IZ4A 4QO7A 4EGSA 1UJ2A 4L6AA 3EZ2A 4AY6A 3ABQB 3C0KA 1I2DA 2ODTX 2Z4SA 5COQA 4N03A 3B1XA 2FYTA 2IW3A 5HR5A 5TMDA 3CF6R 2HJWA 1LS1A 1BW9A 3AR2A 1V7QA 2OKGA 3REQA 3U31A 1M2VA 1T15A 4C3UA 4D5GA 5B4TA 4PGHA 5PNTA 5JRDS 5D84A 1Z4NA 1N3BA 1A9OA 2EFGA 2IGBA 1MJHA 3EZXA 3ZCPA 4YMGA 4CL3A 3S5JA 3WLKX 3H5WA 1VG1A 2WIKA 1OH6A 1P1IA 1JXMA 3IKMB 4GKJB 2H00A 4GAEA 4KI0A 1DEKA 1EEXB 1G7CA 3IIMA 3CVVA 4JLAA 3QPAA 4GKAA 4DS3A 1KI8A 3BCSA 5DHUA 4F3KA 2P2GA 7ADHA 3KTOA 3AJ9A 3ONDA 2ADOA 1KY5A 5GJBA 2CF6A 1TU4A 2P1DA 4I08A 1UIRA 4J0EA 2CHGA 1ZCJA 4KPFC 2CLSA 3DM9B 4TUYB 2IYVA 1KMIY 4ENTA 2WT8A 1EDZA 1KMQA 3IDZA 2RGXA 1T3ZA 3AR9A 4I1IA 3RWMB 2HMWA 3B38A 4MI1A 2QXYA 3FYTA 4RU1A 2C7PA 1E2LA 1KDOA 5G3ZA 4ZMRA 1NMXA 2DWCA 2L82A 4LXTA 3THSA 1NPYA 5J2UA 2UUAB 5EEHA 4NMLA 4I8DA 2J31A 3R7NA 2XCLA 2FKNA 4NTZA 5AQEA 1UWKA 2HR1A 2QSUA 4AZ0B 2GMWA 4IDCA 2XZDA 3HP1A 3UUGA 4MRMB 3LUPA 1B3RA 3GHHA 1CVIA 2FWJA 4J91A 3WZMA 4WADA 3NKLA 3M3DA 2D59A 4UEOA 3JTEA 3FZNA 5KNDA 2LDXA 4AM8A 1C50A 3GJSA 5FUBA 2OQVA 3FPHA 1I4EB 1W2WB 3OPYB 4BLWA 1ZD5A 1KNXA 1NRXA 2ZT5A 3RYIB 1WX1A 2R8EA 4FMPA 4OJKA 5JJIA 3N8HA 5C4GB 1L4UA 1ID1A 3EWNA 5DNDA 5A1JA 1SEVA 1XEFA 3FVQA 3HB5X 3G79A 4ND7A 3WICA 4AVYA 2TRSB 4C0WA 1RI2A 2ZRCA 1IEWA 1S2MA 4NZOA 1A8QA 1KP2A 1UDXA 2Q6OA 2VYNA 2AN4A 3DG9A 3E8MA 1EK1A 3GJ7A 4M49A 5GY7A 3K71B 4QTUB 5A6VA 1W581 2X76A 2PH5A 2RIPA 4HOYA 2BISA 1I14A 4DARA 4C87A 1NDQA 2CVZA 4C0KA 4JUAA 5GPBA 5C8ZA 4JNCA 4RA9A 7ABPA 2VJYA 4OQ4A 3L01A 4LJLA 3BEDA 5A1TA 1RWKA 1Z0SA 3PCRB 3RVSA 4EYEA 3DUWA 2HB6A 1P1KA 1YTLA 3M4YA 3LU1A 1VLLA 1II9A 1XV5A 2ZE5A 4K9DA 3M1AA 1L9XA 4R7TA 2NG1A 2ON6A 1ZJ6A 5LKAA 4PIPA 2VWGA 3CLRC 4B3SB 4QDXA 2VBCA 1DV1A 3BH0A 3DE2X 3WKDA 4ENUA 2N3ZA 5GJCA 1PV4A 2CBGA 3BX1A 2EWVA 3MCWA 5B4UA 1QKKA 1XXHE 4PNZA 2I9KA 4G0NA 5BNFA 1J00A 2RARA 3D2CA 1Q0QA 4ASUA 4G84A 4J2OA 4NFSA 2PH3A 2HIHA 1H22A 4OV6B 1JHRA 4P4NA 2OY0A 3D1VA 3UT5A 5LYJB 1ZC4A 4PHCA 1KZHA 3ZKAA 1G3IA 1MOPA 2H29A 3HY4A 4YJ2B 3RVKA 4G5HA 2VDPB 1H0RA 1CEQA 3D8TA 4X1YB 5CVVA 5HNKA 5CX1B 2AI1A 3KBBA 3TK1A 4D6XA 5GIPE 4EKDA 4OMDA 3LTNC 1Q0RA 2IPOA 3RVQA 3CRQA 1JHYA 4LVOA 3SNKA 1YA6A 3ZYZA 4WY5A 2R6AA 3ZKWA 5C7IO 3OPMA 1MEOA 2EX0A 2ZXEA 2GJKA 3WMGA 3DVQX 4QE3A 2PMCA 1ZJJA 4CLHA 2DLCX 3QA3E 1Q92A 2GHQA 1E1QA 2EBUA 1GV0A 2I2FA 2VUTA 4ZU3A 4CL0A 5FAKA 1N5JA 2JRCA 5K3EA 1H2WA 2Q3MA 3AF1A 2C4MA 2BGIA 3HYTA 4BKUA 2ZSFA 4JYPA 2C8JA 4KXUA 1M74A 3BXGA 2BZ1A 2JJ1A 5C4IA 3THRA 1JG7A 2QR3A 3QU9A 4IHJA 4KDCA 3ZGOA 3EQ8A 4K0KB 2QN6A 3JQ9A 3UWKA 2TMYA 3IP6A 2CNOA 4M0FA 3QXCA 1EXMA 4ZJZA 4W5RA 1A97A 3G0BA 1SQGA 1XNRB 5BN5B 4KOEC 2NAFA 3ES9A 1HLFA 2H0RA 5LP6B 1P61B 4B87A 1EKXA 3U0BA 2HYDA 3K9GA 4J94A 3DWFA 5ILGA 1CF2O 3TMKA 2PA0A 3WKBA 1F14A 1QLJA 1WPRA 3D0OA 3BCHA 2CMFA 5E3JA 5EP1A 2VHUA 5C37A 1E1NA 4ZYZA 2HMUA 4GI2A 4KAXA 1EVKA 1J0XO 4XX0A 3VZRA 1DNPA 5KO2A 1A7KA 2B21A 2J7PD 3CRMA 3VVBA 1WP4A 2J0EA 1N0VC 1T29A 3HGTA 1HKHA 1F2TB 2ECPA 5FTWA 3WV4A 4AZ3A 3HLYA 3UMFA 5JY6A 2I1VB 4FTWA 4JBLA 2P4HX 4N7MA 4AP9A 1VZ3A 4G85A 1ZGBA 2X5JO 3I4LA 2IYYA 2KX7A 1E1CB 1JBEA 1FU4A 1M2EA 1Y7HA 2VYVA 3I6YA 4ARIA 1JSLA 3LMKA 3D59A 4OBWA 4F3YA 4GP9A 4LK3A 4O8ZA 3ABSB 3DR3A 5FI0B 2E48A 5WRFA 5DO9A 3IXQA 5FO1A 3TEJA 3Q7SA 1YMQA 4TUYF 3OE5A 5FV4A 3CRZA 5EMLA 4L78A 3KKMA 5J59A 4XM1A 1P6UA 1KEEB 1CR2A 3EZ7A 4NMWA 4XPIA 2BFWA 4YYEA 1NLMA 4N18A 4B0OA 4EA8A 1NBIA 1CZUA 1ZXXA 3D3WA 4QLBA 4YUYA 2LE0A 2Q46A 3WDMA 4EB6A 4JYBA 3IHLA 4JT2A 1GRQA 2EX4A 3I1JA 5EOVA 4RHFA 1PT7A 5IULC 1T6ZA 1GN8A 4ACBA 4ZYLA 3NWJA 3IP7A 2GPYA 2M6RA 1JHAA 2C54A 1T6NA 4RPHA 1KYWA 4DSOA 3DBHB 1TM4E 3MTDA 2R8PA 4LECA 5J40A 1K5GA 2C8KA 2WUFA 1JJFA 2QL9A 3NHZA 3NU1A 3AU9A 3P27A 3EGEA 3P9CA 4FC7A 3GEBA 3WHPA 1YR3A 4JVNA 5E2AA 1K4YA 3OEHA 1GZVA 3FCSB 1SKQA 4EHIA 4IDHA 2QN7A 9LDBA 3HI6A 4HUTA 1WLSA 1XDWA 1Z62A 1TIKA 4QLAA 1OAKA 4W4TA 3OBIA 3OM9A 5EP4A 5I6DA 3ANSA 1SEPA 5F2OA 4MQBA 1OOEA 4ALNA 4BKRA 3N2EA 2HWYA 1SUCA 2P6NA 3DMYA 4TT3D 2QQGA 3I1IA 3TTSA 5BOSA 1LCIA 3EDMA 1YFJA 5C1PA 3O2NA 4RKYA 2JK0A 3AONB 1XPUA 1JEYA 4OXIA 3OT4A 2EBWA 3V46A 1NF9A 2GAIA 4MEAA 3FJ1A 3HB4X 2IV7A 5KTOA 4ARCA 1PT6A 4S04A 4XUDA 1WCV1 1SXJA 1N4DA 2Z04A 4OQLA 1DXOA 2EQBA 5FPTA 2VP5A 3L7CA 1MC8A 1Y3HA 4ENPA 5C5DA 1K8RA 4WOKA 3LUBA 5T6BA 1NNSA 1PBTA 1GNQA 5DNEA 4IXTA 1IBCA 5B3JA 1P9RA 1WP9A 2WJIA 1S1CA 3ZZ0A 4D44A 1LJLA 2QRNA 2PXAA 2ZYVX 4ONEA 5LYJF 2CFSA 3D54D 2WUEA 1E1RD 3EH1A 3DTTA 3OZSA 4US2R 3ZIDA 4MDFA 1YZ3A 1GA4A 4L8YA 4BNVA 4RFSB 4EZIA 1QNFA 3D2AA 1QGUB 3JQBA 2BFMA 1NRWA 1FYFA 3M1YA 3IKVA 3JVVA 3G2QA 4LIPD 2FX2A 3KQYA 1ZNQO 4R8RA 3W06A 2I4OA 3LDGA 2NU9B 5HE8A 4TWZA 2QJOA 2PJDA 3S27A 2D5IA 5L3QA 1RXUA 2PT5A 1ENOA 3ZGLA 1T3TA 1KI2A 1D7AA 3PD7A 3CS3A 1GR1A 3O26A 1B1AA 1XUOA 4JVSB 2AUTA 2BWJA 1H1LB 4KIUA 4KI7A 2XRMA 2Y71A 3CUSA 3RUPA 2AFIE 4H60A 5DBEX 4B83A 2V7QA 2YX1A 2WDZA 2GCGA 1H85A 2ZRFA 1E2UA 1SZJG 4LJKA 1VIYA 4AXXA 5IVHA 1BOFA 5HFAA 3UXHA 3CCFA 3KKQA 1QVZA 3KXKA 2HJ9A 2O14A 2IEAA 2EDAA 4HWSA 2YS7A 2CL5A 2OGZA 4KRXA 1XD9A 1M6VB 2O2ZA 2ZWVA 3TZKA 3WJ2A 1K8ZB 2BFEA 2ZJFA 3B3FA 3HE3A 3M9XA 2WPNA 2FN3A 3DFMA 4TN1A 5HYVA 2F1RA 1XMOB 3TW8B 1QH1B 1E98A 3DH0A 2XB2A 4C2BA 2G8NA 1W5TA 2H65A 4X8OA 3EC1A 2VPYA 3VC7A 3HKEA 2WUDA 3UCEA 1RWBA 2GBPA 1YQUA 2JATA 4GHWA 4LE1A 2PWBA 1L5HA 4NY1A 5TVGA 1MTZA 3ROKA 2WF5A 3NFYA 1E7SA 5K2OA 4X66B 3C3MA 1LWNA 3F8SA 3KVYA 1H1TA 1GG9A 1ONNA 2Y76A 1Y6FA 4FXOA 6CHYA 5FTJA 1S7CA 4G0VA 1Q2UA 1A7UA 3DL0A 4M36A 4WZBE 1XRSB 5HK8A 1JUDA 5LD2B 2GETA 5T4HA 2HFKA 4PLZA 5CK5A 4YRMA 1K7FB 2F8MA 2YICA 1PV2A 1DP4A 3C45A 5C5CA 3CBQA 4P6VF 4L5BA 4IVPA 5KKCA 4BEJA 2FPXA 2GAFA 3ZCRA 4ZAVA 1T5TA 8AT1A 1WXQA 2WAXA 4B73A 1J4AA 1LDYA 1S8AA 4HPJB 4YLGA 1P19A 3VR3D 3IJRA 4BFWA 2XDWA 1U7ZA 1JWBB 2IE0A 1KJQA 3LUAA 1THTA 4ND2A 3U37A 4E5NA 8ABPA 1PT8A 3QV1A 4PANA 4WXYB 1G8KA 4DRZA 1QRTA 3MG9A 4X1KB 3RW9A 4YRSA 3S2GA 5BV0A 2GYWA 1QQTA 3RYTC 3G5AA 2F9MA 3R0IA 2A5LA 2ILVA 5C80A 1USKA 1ZEMA 1D07A 3Q5GA 4J0QA 2F9LA 2JGDA 2ZBQA 2QD4A 3QF4A 1HX7A 2O8NA 3PF8A 2YFHA 3PPYA 1B0AA 2HA6A 1CJMA 2PSJA 2WE7A 3B6EA 3FVWA 3H9BA 4IV5A 4MVJG 5BSKA 2NVOA 5EYPA 2V0GA 2CJWA 4G1UC 2XBMA 3DVRX 3HXPA 3RU2A 5AM1A 5IT9A 2P6RA 1RJ9B 1HY3A 3RVPA 4HS9A 3SN6A 1B41A 2F6RA 1A69A 1MOZA 3TI9A 4GICA 5DYYA 1BXGA 1QYWA 5EZYB 3V1YA 1J2YA 5ADVA 1FP1D 2IHKA 1N5KA 1UDRA 1N5DA 5SYNA 3VPAA 3FWYA 3I2HA 1UJBA 4QQ8A 5D1HA 4F8YA 5CMLA 4AJLA 3RRXA 1YS7A 4F4FA 3W5HA 3TRHA 2X1HA 3E2PA 2WHYA 1Z6ZA 3Q15C 3VC1A 4BCBA 4US0R 5ICCA 4MWEA 1ZEJA 1R0KA 2HU5A 3C7AA 3EIWA 3H9JA 3HBLA 3K31A 3NXSA 3ORYA 4RVOA 2WD7B 1Z2NX 2Q4DA 4M6WA 4NU5A 3RO7A 2NOAA 2C7BA 3IEIA 5A3JA 2VDJA 2WJPA 3GRCA 5JZSA 1DMRA 2EFJA 4B48A 2ZJ6A 4LDAA 4MVJP 1QF6A 3LTEA 2Y0CA 1FFCA 3NATA 4WACA 3WLPA 5M5BA 5F3WB 1XEXB 3SG0A 3QNUA 4NZYA 1C0IA 3I2GA 5D8DA 2QVXX 4F96A 4EJFA 2PJRA 1NGSA 1N34B 1GGVA 3I9NA 3MHTA 2C9MA 3CZ4A 5GJWC 4BLOA 1Z33A 1WD7A 1WUYA 2Z8YA 4IMIB 4DIFA 4ZMSA 4MWSA 4UFPA 2FW9A 3VGPA 1FA9A 3A6JA 4BKMA 3IR7A 4TUYA 2LRHA 2QYSA 3TWOA 4IF4A 5TMPA 1K92A 4PY2A 3FNHA 2BKAA 2B30A 5B1HA 1GGHA 4JCOA 5AM0A 1E89A 1W44A 2FEOA 5ALSA 2PSSA 1SPBS 5CLLA 3G9QA 5EMHA 3GWGA 4MWDA 4ZVKA 1E2GA 1AB5A 2TS1A 2BFPA 3IUJA 2IX9A 3UO8B 5ITWA 4UHKA 3R0VA 4D25A 2ZRIA 4ND5A 2F00A 3GP8A 1Q83A 2ZRMA 4DNPA 4FFRA 4ZN6A 1C80A 3T9BA 3RKUA 3U9LA 4DRYA 2JLVA 4X1IB 3Q72A 4GW3A 3R8FA 4B3GA 1KL7A 1VKZA 3LECA 4KNVA 5CGZA 3UHAA 2DCUA 4CKEB 2Q7XA 2A57A 4MRMA 2DFKB 1E9EA 3WL4A 4PYQA 3JX9A 1MVLA 3B2QA 3M82A 1J97A 4JC0A 3DLTA 5CW1A 1ORDA 3DF7A 3PS9A 3SHFA 4ZT2A 5L3RA 5HUJA 5CT8A 3OPYA 1Z5VA 3TMYA 2R4QA 1PLJA 2E4XA 3QVOA 3RYIA 1LU9A 1D03A 4D98A 2P5TB 1NBMD 1RFLA 2BH9A 3JWHA 3PD0A 2RAVA 2EC5A 1N5OX 5P8WA 1KRHA 2I65A 4CF4A 3L4BA 4IOJA 1U1CA 1DAOA 1EK6A 1P9OA 2NTYC 1RYMA 3L7JA 3MBIA 4R2MA 3U7RA 4AJHA 1FJGB 4QU9A 1WUKS 7AT1A 1V1RB 2OCIA 3QYPA 4N6NA 4YPVA 2XE4A 1KR2A 1KEWA 1Q5PA 3CZAA 3L82B 5AP9A 4ABYA 4EGJA 4YRIA 5HQJA 1L7AA 4E4RA 5L8VA 1QC5B 4OK5A 3N1UA 3JZAA 2VXYA 2JHPA 2D1YA 3I39X 3IOMA 1IHUA 3P9YA 5ALLA 4IDGA 5DI3B 1UMDA 1G4HA 1EXWA 3IT2A 3H0KA 4GG1A 1L5GB 4YUVA 4EATA 3SS9X 5B36A 5JXWA 3GT0A 4R7ZA 2H11A 4CKWB 2XIJA 3T7SA 2E4VA 4XFJA 1VLHA 2CLIB 2Z98A 3Q6IA 1Z45A 5CCBA 3DPIA 3MEQA 3OIWA 6ADHA 3DQPA 1OH7A 1Y6ZA 2C9DA 3IVGA 1XA3A 2Q2QA 3LCCA 4R9NA 5DXJA 3RS2A 1VFPA 5GGYA 1J0CA 2G09A 3S1LA 5LYJA 4UNIA 2JGMA 3G68A 4HQKA 4LNUB 5ETJA 3H18A 1EQAA 4PYIA 4X1YA 5BVHA 4JB3A 5CX1A 3C5HA 2JI8A 2YN2A 3FAKA 4UULA 2DYKA 3ZK8A 5H83A 2B4RO 1GQRA 2EATA 4HL6A 3K1YA 5DW0A 1IQPA 5BSRA 3TGPA 3X1WA 3BMOB 4TMXA 1KSHA 4ZDJA 2BR5A 3VR0A 3ZWPA 5AMXA 4Z2YA 3DT6A 1R12A 2WJHA 1OBOA 2NZ2A 5IARA 4IILA 4YBRA 2PIDA 5IMSA 3FY4A 2P5SA 2IVZA 1R3UA 5CNKA 2J3DA 1XMXA 1J8YF 2FE4A 2OO3A 3KYIB 4NL4H 3PTAA 4JVMA 4RCZA 3EPKA 1LNZA 4QYXA 4MR7B 2JL1A 5KJ1A 4W9NA 3DKPA 4S1PA 3T7IA 3W2HA 4BGIA 3W4KA 5BMVB 5HF6A 4NJEB 3VH4A 4E4YA 2AX4A 2GEUA 1HORA 1JQKA 1CRLA 5EZYF 5BSGA 5BN5A 2AH5A 1PVOA 3HCNA 3I52A 1G21B 2OB1A 3ZJ4A 4BMVA 2H18A 3KHTA 4OHXA 4RZUA 4CM4B 5LP6A 4UARA 4FFLA 2Q4EA 4RVUA 1FYVA 1IM8A 1W1WA 2E2WA 1WS6A 3R7DA 1E2BA 2X3YA 2J32A 1U2DA 4LRSB 4NABA 3IQIX 4P3NA 5HCNA 4MEBA 4RY0A 3UJ6A 5BPFA 1YS4A 4OU4A 3RJ9A 3HU5A 1XVUA 1OLSB 2FHSA 3IRVA 1CZKA 3N28A 4LJ4A 5E9WA 1EVQA 2JVIA 3WGKA 3RAGA 1F2TA 4BJ6A 1AMOA 1XZGA 2CDCA 2ZCVA 2ZE6A 4JWTA 2C7QA 3NH9A 5AVTA 3NGMA 1ZM9A 1E1CA 2QN1A 3Q11A 4DMKA 5IDWA 3FPLA 4XWWA 4LWOA 1JIIA 2AI2A 4QVKA 4JZKA 2FWIA 3MFYA 3SF0A 4KWIA 4DWVA 1Y1TA 1UQUA 3OLCX 4MW6A 1L3IA 2ZI5A 2VXCA 1E6LA 4AY3A 2P30A 5KC9A 1D0SA 1MFZA 3RS5A 5K0BA 3QFCA 5IT5A 3SF8B 1Z38A 4CN9A 3HYNA 1AOXA 2FMIA 2HJHA 3PZRA 2Q0SA 2WSMA 4Q3NA 1GUYA 1TRHA 2PR7A 1GQSA 4KO3S 2PVCA 5H0IA 1YACA 3BWXA 1ZA1A 4HLUC 1P1FA 3LX4A 1ZP6A 2BGRA 2P2NA 4Z8XA 5FUYA 3N2LA 3ZR4B 5K20A 4FD2A 4FZJA 1CR0A 3D6NB 2JLQA 1Z47A 2FLVA 3NHRA 1XK7A 4PIVA 4H1UA 3S70A 5BVGB 2VPPA 4FI3F 1TZBA 3OCZA 1X80B 4NYJR 5B2ZA 1V16A 3TW6A 1BDIA 5HBRA 4Z54A 5HUQA 1YAJA 1K6EA 2XLBA 3DBHA 4L5JA 4PQFA 4R1MA 1G3RA 1OE0A 4MRSA 4KYVA 4UJ5A 5KQPA 2IZ7A 3D7SA 4DR3B 2BM8A 1BMFD 3PQ3A 4IH1A 2W43A 3WAKA 3HWX1 4BUZA 1U8ZA 4LW8A 1XO1A 8ADHA 4MWOA 4BOYA 4K5QA 4BFLA 5DI9A 1RXVA 1VL8A 2ZRNA 4GZ3A 5A5GA 2QTZA 4EHAA 5AVOA 3ZHQA 1DZ3A 1RKVA 3W5CA 3QJYA 1OYVA 4IIBA 4EF6A 4PZLA 3SICE 3R24A 4CQLB 2DUNA 5JBQA 2WYHA 1OC2A 3A6ZA 2VHWA 3VO2A 1GL3A 1F60A 3PE4A 4AJEA 1AKQA 3WMWA 4MUGA 2GT1A 5E1DA 2J1LA 2Q9BA 4DQDA 1R6XA 2XADA 3DAGA 5LM3A 1AGRA 4J7CA 3IUPA 4EL0A 1D6NA 2ZGVA 2JA2A 2ATXA 4GOOD 1WETA 5HMLA 2J6BA 2QOEA 4OAPA 4Q3LA 1FJHA 2P4EA 4IJKA 4PR0A 4WPGA 3T7RA 5A4KA 4U9UA 4C6RA 1Y80A 2BFDB 2OHXA 5TX7A 3R3ZA 5EESA 3AHEA 3OVMA 3MJ4A 1U0BB 2BZ0A 2UYGA 2WNIA 4G8JA 4JH0A 5FULA 3A05A 3R5JA 1YULA 2G9NA 4MWCA 4CIBA 1XC7A 1PDVA 4UFOA 4EY7A 4RFSA 1KOGA 2FH5B 1QGUA 2JVKA 2YY5A 3C3XA 2TECE 4HAYA 1SGWA 4R1NA 2CFOA 5EUCA 3SFVA 4EUNA 3F74A 2RGNA 5DGCA 3TRDA 4BP9A 2NU9A 3W9UA 3JYLA 1V9SA 4BQEA 1QV9A 4I6EA 4YMTA 4D41A 5EE3A 3MT0A 1BAPA 1H05A 1T34A 1Y4DE 1CK4A 1M6NA 4R9SA 5K01A 3HDJA 1YI0A 1DC7A 3B36A 1ZCAA 1H1LA 1QF7A 1TQDA 2GBLC 2EJUA 1QQ7A 4LWPA 4E33A 4WKBA 4G1CA 4F6RB 2VTVA 3GNTA 4FFPA 4R05A 3GN2A 2PGXA 1R0WA 2R44A 2PFKA 3DE5X 3OESA 2EW2A 2R47A 3LPAA 4NR0A 3F5MA 5CRIA 3DP9A 5JSZB 4L5YA 4EJSB 1DIRA 1M6VA 1K5DA 4IRUB 3TVTA 5GOTA 3ZV5A 1QPGA 2O7RA 1VLVA 4TTSA 2QP4A 3ZWQA 1XPOA 4A8HA 3HBFA 3VR4A 5K6AC 1BIFA 1DKUA 1QNLA 1FYDA 1U80A 1QH1A 3DVAB 3TW8A 4CGYA 1KVUA 3MS2A 4C6HA 4OLJA 3AW8A 5A62A 1SM4A 3GMTA 3C4JA 3LPLA 4PLCA 1P17A 2V6IA 3HRIA 3EWSA 3EBPA 4QJ4A 1LV8A 4M8KA 3VHRA 1DBPA 3QWBA 2H1OA 3KR9A 3DEYX 1O97D 1E92A 1IBRA 3N70A 1CJVC 3IQXA 5CBPA 1RSZA 2YCBA 2G4CA 2VDMB 4RYDA 2RC6A 1FPQA 3N7UA 4IQ4A 4V03A 4KO4S 4OUDA 2I80A 1R15A 3A25A 4GWGA 2VCHA 4KH0A 1Z13A 3UJBA 1ZJWA 4MOWA 1G5PA 1KDRA 3FBGA 3WNVA 1D4OA 4CL8A 4UTVA 3EPJA 3A2KA 1BEEA 2EW8A 3TKLA 3H9QA 3LAWA 3O21A 4IQGA 5ES4B 1BVYF 5LKRA 5CVJA 2W2LD 4I3FA 1W47A 2RHOA 3I92A 1E3IA 1CUZA 2C8VA 3EIUA 1YZQA 5TQ0B 3WWYA 2VSFA 3ILHA 2MWMA 2GK4A 3QMPA 4HTFB 2CVPA 4R6XA 3VNSA 5JYEA 1HZZC 3ZZNA 5TLSA 4BWGA 1ZW1A 2H1CA 1ZW6A 2OQIA 4WLUA 1KIAA 4Z53A 2FWNA 2QTNA 2IPXA 4X1KA 3R8XA 2VNSA 5F9HA 1UDCA 3MPUA 4MGZR 3I6MA 4Z99A 3GZNB 1QYCA 1EX1A 4RVDA 3QVXA 2WF9A 5LMNB 1DKMA 2XUFA 1W4AA 3TMAA 3OE1A 3DZHA 4URZR 1YR7A 4GXRA 4OKNA 5BV8A 2OZVA 2BMAA 1MABB 3G5MA 2R60A 4RLFA 3RI3A 1DINA 1U6IA 2I87A 2JGLA 1FUUA 3ZQJA 2R7AA 3ADDA 1PNTA 4UD6A 3GLQA 1RJ9A 4CMEA 4QTZA 5IAEA 1TVMA 1ODFA 3ZQ4A 1ZK3A 2R1VB 1EE2A 2Z6AA 4KR0A 4PFJA 5EZYA 3I2KA 2GJ4A 1YVRA 1U2PA 4IDDA 1T5OA 2YMMA 2HCTA 3HJUA 2B7LA 2H1HA 4PZ0A 1WXXA 2BMFA 4NHOA 2PMFA 4RL6A 5JT1A 2H7XA 1PTJA 1Z0ZA 2OAEA 3EMVA 2FX5A 3HMKA 3PXUA 1FP4B 4V02A 1XHFA 2WD7A 2ZIUB 4Q9KA 4NV0A 5IN5A 5HM8A 1JEEA 1JG1A 3ITNA 4V0NA 1JWLA 5B2EA 3GFFA 4I9HA 3DO5A 4UUQA 1N9GA 3N2GB 1DDIA 1DELA 1XEXA 3FN4A 3OTWA 5A04A 1LW7A 1EVYA 4QRHA 1DOZA 1RHRA 3OTOB 1EGVB 1F2VA 1UFQA 4PNHA 2W6ID 4QG3A 2P4QA 4ZO8A 5IUJC 3R5SA 3UICA 1UJ5A 3IUMA 2ZBGA 2XBUA 3UAWA 1E32A 5FXMA 3BWCA 1JPNA 3P19A 1XVLA 1CQJB 4RENA 1UJ6A 2R1TB 1OYWA 1UBOS 1YR1A 4ES6A 1OWMA 3NDRA 3NJRA 2VNKA 4L8FA 3HCDA 4YIKA 1EU1A 4I81A 3WGYA 3KSAC 3WK8A 3O1IC 3TF5A 3PXGA 2G3YA 3AINA 4Y9DA 3GJ8A 5E1BA 2HV8A 3D4LA 5C31A 1DWPA 1VLMA 1OZAA 3KQHA 1VJCA 4AKGA 2QMYA 1OZGA 4D92A 1JLMA 1CD5A 3JXEA 3TTWA 4X1IA 1AUVA 2HLPA 4HNVA 2UZ4A 3V9AA 4TTAA 2SBTA 2J9GA 4CKEA 2FWPA 2GN9A 2H9YA 4KTTE 2VJKA 4NS1A 4D45A 4PX5A 3T0IA 2EFDB 3G82C 4TM7A 2QRLA 4AL4A 4RPIA 2QRMA 5KTRA 4D9KA 1R6UA 2JFXA 3LCRA 2AG8A 3FSGA 3UAVA 1LPOA 1Z4KA 2GXAA 1SR8A 1VMEA 1DIOB 3KZ1E 3QUSA 2DEUA 1U2GC 3ZS9A 3AXSA 4E2XA 4PONA 2ODAA 2RB5A 2REBA 4QJIA 3MTAA 3EQ2A 4YCBA 4YHBA 5JNWA 3FHLA 2BDEA 2NYAA 4Y2HA 4NCHA 5ERGB 5KTKA 3ZWYA 1QDLB 1R4AA 5EJ6A 1NU8A 2C2YA 3TOVA 3GMIA 3CVYA 4RHUA 3TAHA 2VVTA 4GI7A 2I7CA 3V48A 3I5YA 5DK6A 1T2CA 5FWYB 5CCXA 4BNGA 1TMYA 1I36A 4JJ6A 4TXNA 5LZ2A 1OT3A 1GZHB 4D3DA 4ER3A 2P65A 3PWTA 5AHOA 2G88A 2BJWA 2UU9B 2WM9B 3CH4B 5EXTA 2HMTA 5HW0A 5GOZA 2O0HA 1XMJA 3RBXA 5EE5B 4YCJA 1KMNA 4HN4B 3TVDA 3U3RA 4Z1MD 2HA7A 3LOQA 3I9V6 1BWRA 1D0IA 1NSTA 2UZ1A 3VKVA 4CKWA 3OQMA 2RGAA 3NDPA 2ORWA 2VQSA 4GDMA 4IUBS 4ZZ2A 1QVRA 2CNKA 2H5LA 3TSYA 1V7PC 3RGGA 4R3NA 2ZBUA 3ILSA 5HZKA 2VN8A 1W76A 2PJZA 1OJ7A 2OWDA 4HADA 3P9SA 4TLLB 5ES3A 4KHPB 4N5NA 4W1QA 4L7VA 4LNUA 2EL7A 2XUJA 2A94A 1ZQ1A 4M0KA 1NFFA 3E9NA 3SPXA 3WL5A 4BL5A 4IOMA 5I9NA 1BDHA 1JG4A 2IXBA 3MELA 3DDCA 4F97A 1P5JA 3D7LA 1SBCA 3ETHA 2HF8A 1D4AA 1NVVQ 3BMOA 1W36C 2C0QA 1H93A 1WA5A 2O2HA 4RETA 4XB1A 4N6GA 1K2VN 3BRWA 3TUIC 3RFTA 1P2BA 2GERA 2B4KA 3FCUB 2C4NA 1N2IA 3C7KA 4N3AA 5F52A 4DVJA 1KO1A 1Y3DE 3OJLA 4CG1A 2JAHA 3JTMA 3C6KA 2BM0A 1RZ3A 2COUA 1GPLA 1Z4PX 1Z8HA 1VC2A 2YUTA 1KWKA 2OV2A 4MR7A 3C3AA 4X5OA 3WLQA 4P5EA 3VKGA 1HQKA 2G25A 4RF2A 1PU2A 1AQUA 1YJAA 5E4JA 5MN4A 1DCKA 4B5KA 4B3XA 4ZGBA 4NJEA 1POWA 3BFPA 3INGA 4P82A 1A8PA 4L7QA 2FWRA 4Q18A 2NIPA 3GVHA 1G21A 2RKWA 4CM4A 2IJGX 4BMZA 2BIFA 2O3TA 3RG2A 4D8XA 4MQUA 3HU1A 4G24A 2XMQA 5T8KC 1WXDA 3UJ9A 4ZAYA 2XOXA 1L8AA 1Z25A 2AOXA 3K0KA 1ENPA 3EA5A 4FW9A 1PVVA 1ZGGA 1LNQA 1Z37A 3UG7A 1WB9A 4B80A 5FOXA 1XDBA 3CNOA 4NFHA 4PYKA 4UUNA 5JU6A 1OLSA 3UQYS 4WGFA 1VMDA 1ZJYA 2O5VA 5LQDA 1GZ5A 3RDPA 2I8LA 1YR9A 4M46A 1GPYA 3ZY5A 5FL3A 5KNCH 4FZ5A 3ISTA 3KUKA 1U11A 2BVNA 2FFHA 2PG3A 4JITA 2HUNA 3A0RB 5D1NA 4WCDA 4MV4A 4QT0A 2PT9A 3AWIA 4JLOA 2ZPUA 4PZPA 5DPMA 3WYGA 4CCSA 3WGQA 3ZQ6A 2WABA 2GB4A 4DLWA 1YIDA 4NEHB 1NI5A 4H4DA 2BDUA 3FX2A 3PWZA 2CJYA 4WN9B 1EZZA 2LXNA 3DDHA 4MROA 2GAAA 1CDDA 3SF8A 1OLXA 1E0AA 5ISMA 2EZ9A 3FVTA 3QHAA 1V6CA 4RLSA 3SE0A 2V7UA 3CX3A 3NHKA 4JK3A 4U7JA 2VJBA 1KYVA 1GSOA 1NMEA 1BG6A 3U4GA 2HT6A 1MN6A 4RM3A 2F1HA 4UCFA 4M1WA 3OLWA 5E8RA 2NYUA 1MP0A 3DXYA 2WY2D 4R9VA 3PXXA 3BB3A 4W6ZA 3N9IA 2IQ5A 2GUWA 4ITUA 2JAPA 1WCIA 3OKPA 5TPWA 3LT4A 3T4XA 5BVGA 1GNTA 4MQLA 1X80A 4YRRA 4GX1A 4ECEA 1JPUA 4G86A 4AW9A 3NWEA 4JX9A 5L95A 1MX9A 4ME6A 3ZHVA 3TINA 1ZFNA 2G07A 2H1IA 3R6DA 1GD1O 1NW6A 3GG9A 2IZZA 4N82A 2X2PA 5EKSA 4BVBA 3EDRA 4YJGA 3IEMA 1FNDA 1QQ5A 2V0NA 4F6CA 1A4RA 1XAGA 1AUOA 2Z2JA 4LE2A 1N2JA 1RBMA 2C20A 2RHCA 2G72A 2L19A 2YWBA 3AOEC 3I9OA 3LPDA 4J0KA 1Q1EA 4PZUA 4EELA 5DN6D 3HJHA 1CIVA 1US8B 2DHCA 5BQFA 1BHO1 2ZYAA 3OLVA 2ZEJA 1Z74A 1K6IA 1R9NA 4WXMA 2GRUA 1BQEA 4GPZA 3P2OA 4AMBA 5FPKA 1WQ4A 4QGSA 1EJ2A 3DS8A 5TNXA 4CQLA 1UBGA 4QSMA 2C9ZA 2EDCA 4U39A 4E31A 3RHZA 4JL6A 3U3ZA 1XAJA 3BH6A 4E07A 2DR3A 3R41A 2AUNA 3E3OA 1HMPA 5HIKA 1SHLA 2QZ4A 3H3JA 1QO0D 4H31A 4REOA 1GFIA 1NJ2A 4JENA 4X54A 1PSWA 2FPOA 3H17A 3TI7A 4YR7A 1TYAE 4KSYA 2X40A 1SU7A 3B13B 2BTOA 3VTKA 1Z6QA 3WGLA 4D56A 3H97A 4B7AA 4EPYA 2NQTA 3VA7A 1NI4B 1BC5A 1X38A 4Z1OA 1Q1BA 4KHZA 1ADCA 1JPVA 3Q5DA 1V9CA 2BFDA 3ER8A 2VC2B 5AK3A 1ZOPA 2Y2UA 3IGFA 1XD8A 2DQYA 4TXMA 1CFJA 3W9BA 3M9LA 5FFMA 1TKBA 2QRKA 4I5GA 3R77A 4WXHA 1CB7A 1QG0A 1Y33E 2V6BA 2C4HA 3KCNA 4NMXB 3WLEA 4DLXA 1GCOA 5FBQB 3CWZA 3BG5A 3GAMA 3HSSA 3V55A 1GDDA 4ZI5A 2H0AA 4I50F 5KAPA 2P6OA 3NUGA 5G41A 5HZMA 2RSLA 3B3AA 4U63A 3PXDA 2W2VA 1CE8B 2NZJA 1LBSA 2PDAA 2RBEA 4YJ3F 3EVDA 5AKIA 1OPXA 4RH1A 4YQEA 1KEVA 1F3OA 3ZD7A 3S5UA 2VHQA 1ZRMA 5FBKA 1XK6A 1HFEL 4ZD6A 4KBYA 3OH8A 4Z0HO 3W04A 4PC1A 1E3SA 2UZ0A 1VCHA 1JIXA 3FCYA 5KVVA 3D4BA 4WNYA 1PT5A 3LKDA 3BE4A 1G66A 4GPEA 2YOGA 4PX9A 2B8TA 2J5RA 2L18A 2R96A 2BI4A 3O0TA 1M8KA 2ECQA 3QLTA 5AW5A 2RE8A 4EHFA 2OEPA 1C3XA 5EGNA 1XU7A 4B44A 1BKYA 4GNRA 1Y42X 2WAAA 1TMOA 3R23A 4JDPA 4E11A 3BWYA 2QD5A 4DLAA 5CYGA 3HUFA 3P9RA 3HP7A 2FJPA 2LBPA 2CD9A 4YRKA 1M2HA 1ZN8A 1C14A 1EPUA 2C57A 3UMJA 4MQFB 1ZHFA 4E6PA 2A1IA 4ETWA 5I4CA 3DVAA 4GF5A 4BFTA 3ESCA 3LBYA 3AETB 2KW5A 2SHKA 4D3YA 1E9VA 4AMYA 3FOEC 1D4FA 1SA0B 1DG1G 2IPMA 1X42A 2CE2X 5A7HA 1CWUA 4C07A 3HA2A 1JT2A 4O3FA 3ZIAA 3X1KA 2I2BA 1W1UA 4UQOA 1U7DA 2HTEA 3GMDA 1U3FA 3Q7TA 3I72A 4LXGA 1H3FA 2ATIA 4OXQA 4S2EA 4BJ5A 1TMKA 1PK8A 4KGVA 4L9RA 4MS3B 4RKEA 5LLDA 1X1RA 5DMHA 3UWSA 3G0DA 3O4IA 3ZH2A 3RTBA 3UN1A 4TVOA 5E4FA 1GAJA 3O1JC 3AM3A 3R7AA 1RABA 4R3WA 3WL3A 2DT5A 1S5PA 2FEPA 1MZPA 2XT0A 4M0PA 5LBTA 4ZTZB 4B79A 3OOYA 5TQ0A 3WP1B 4ECAA 2KYRA 1CRQA 2HU7A 3H2IA 3JQCA 3LSYA 1IN6A 1EFUA 4G0QA 4GOXA 2VK2A 5CLQA 1E3QA 4K9QA 4C7OB 3NRCA 4B46A 1ZU4A 2YIVX 4O2BB 3V8EA 5E9JA 3MUFA 1MAVA 1T26A 1RACA 1CHNA 3S4YA 4KDEA 4Q1FA 3RC9A 1N33B 3SFZA 1Z68A 2WJ4A 3GZNA 1HYQA 2GSWA 1WLYA 2GCIA 2I3AA 1DC5A 5J5CA 5I7AA 2GEBA 5H8WA 4BRZA 1MABA 4R1SA 1UC8A 5ANRB 1FRNA 1XJ5A 3OURA 1H2YA 2JF0A 3L0CA 1H0SA 3NTVA 4JJGA 2DUMA 1A9ZA 4OHRA 3N6VA 1XVTA 4OI4A 4ETIA 721PA 3LP5A 2HQSA 3SDBA 5LQMA 2R1VA 1QCDA 4Q1VA 2XCOA 4C0LA 3BK2A 1ZK2A 3TLGA 1NUSA 1SKAA 2B9VA 4IG9A 1GAQA 4GRDA 1IK6A 1XZQA 3ETCA 3HR4A 3QEKA 5AKGA 4RZXA 1E1DA 2HBQA 5A4FS 4BYMA 4W5QA 3QSGA 3ZJTA 4HQFA 1G8JA 3C6ZA 1A0OA 4QXAA 1K7CA 3S2UA 3MXOA 1ZM3A 2X77A 1WBBA 1WIWA 1E2NA 1FP4A 3THWB 2VP9A 1A95A 5REQB 1NN5A 1GL9B 4R8SA 4D1YA 3C6MA 9ABPA 4CV0A 5EI5A 1EUYA 4RO0A 2O1EA 1V41E 3D0KA 4J4TA 3KZCA 4XWTA 3LF1A 1L4BA 3N2GA 4ZFNA 1LBIA 4XIGS 3E1SA 4KPGA 4JOQA 3AUJB 3FNGA 5AVUA 1UXJA 3IIEA 4W9MC 3RV3A 1FBNA 4PO8A 4ER7A 1OXUA 1GV1A 4OJMX 2Q1SA 4YHHB 3KPWA 4DV5B 4MIEA 3TW0A 4JI2B 2X15A 1U4NA 3EW9A 2ZIGA 1R64A 4J6EA 5E3HA 2HV9A 3UCXA 4INAA 4TMTA 3ZLBA 1ZAYA 1CQJA 1JDVA 3EGWA 1WXHA 4UBJA 2ZYSA 4EKGA 2KPOA 2R1TA 1IHPA 2WV9A 4HZUB 5FA8A 1XKXA 5LXTB 3BDVA 3LUHA 2OFPA 1QYDA 4WQMA 1QR6A 2QW0X 4KRYA 1P18A 3ZE2B 3Q87B 3UV3A 4YH1A 5JWHA 5IAGA 1U5CA 4KR7A 3QIVA 1E1LA 4MCHA 4W5HA 2I6SA 3WL7A 1AKVA 2V7WA 2BI8A 2OP1A 2YNMD 4CWAA 5JS6A 1NVEA 5I9TA 2WM8A 3NOOA 5FKJA 4BMYA 2BGWA 3D3KA 4KQHA 2DTDA 3RSFA 1BVHA 5G0UA 3AMVA 5I9IA 5HF8A 3GLFB 4TVBA 4Y1FA 3FI0A 2BR3A 2R6HA 4G8DA 2XTJA 3SK0A 3CN9A 4DCUA 3A2MA 1KJWA 1Z0AA 2UZAA 3QHQA 4AYXA 1DAGA 5JZVA 2I2WA 3INTA 4MTCA 4XYBA 5EPOA 2AWNA 3GLKA 1WM1A 2GFQA 3FUTA 3KKKA 3VAYA 5JYCA 3IO3A 2F3QA 1BWPA 1Q0SA 1AN0A 5FHQA 1P44A 3H3XA 4I2NA 4LN1A 3M6FA 3DTVD 5ALNA 2GEKA 2Q3LA 3HBAA 4HRAA 1EDEA 2OCPA 1J8MF 3F3SA 3C4VA 4WA7A 4YCMA 3NZEA 2BGTA 3KZMA 1Y8QA 4Q3AA 5LZ5A 3TH5A 2UZ3A 1Z4MA 4DNFA 3VISA 4E1VA 2RHTA 5EHZA 1LI4A 5HQTA 1VMIA 4KWHA 3ZEIA 1QQAA 5JC8A 3TLBA 4GO1A 4YO8A 4ZT3A 3LHSA 4BBPA 3UBTA 1DAMA 2W4QA 3ASUA 2NADA 3I6ZA 3WK5A 2J30A 2QORA 1PX0A 2BFCB 1EM8B 2IYLD 3TTUA 3GY0A 4DPLA 2D06A 4Q9IA 3LOUA 3KSDO 2QENA 2O5CA 1QYXA 4P3KA 2FI1A 4QFBA 2N46A 4KQFA 1PS9A 4LZAA 2ZT8A 1CIJA 1Y9JA 5A7FA 5HKBA 3AO0B 4JLMA 4HWKA 1H3EA 1M2NA 4W5JA 4IVNA 2G8LA 3S68A 4L2IA 3OPYI 4IICA 1WPXA 1XQ6A 2BC9A 2CSUA 2GNPA 2OUKA 1W5FA 2QAGA 3DMNA 3KPVA 4HH0A 4AO7A 4BRWA 4BNXA 3KXDA 1Y7LA 3NHUA 4O2RA 3W5JA 2PANA 4QG7A 5FJIA 2O19A 1E0KA 1FX1A 1T0IA 3L6BA 2C4TA 2GILA 3OG9A 2YBDA 4PAWA 3CX8A 1ATIA 2C2GA 5LA6B 3JZIA 4JLNA 5TIIA 3VYWA 2VXBA 5CHYA 3MBKA 4HDSB 3SZMA 2PR2A 3NAGA 4D74A 5EZQA 1TVEA 2XYVA 5AR1A 3O31A 5J2TB 4JI0B 4ZVNA 2OD7A 3SM3A 1HYGA 3MHPA 1UOQA 1QG6A 3SJAA 3KEOA 5IVKA 3BAFA 2B4QA 4B75A 1OIVA 1TYDE 2E85A 4BB5A 1VL1A 4TT8A 3PSAA 4JUBA 2WB2A 2XD9A 5G1OA 4O4HB 3U16A 4TTQA 5A9SB 1O8CA 2RK4A 2OPHA 1JQBA 5TS3A 4KFRA 4IF6A 3KV3O 1E3DA 2PKRA 4RABA 1U7WA 1E94E 3B6IA 1PR9A 2BGLA 2B94A 2WFLB 4GSLA 4QBIA 4TRMA 4UBKA 5EHXA 4CG3A 2N1BA 3BF7A 5HJ2A 3B89A 1I2CA 4CM6A 5I7FA 5LMCA 5JMPA 2QX9A 5KAMA 1EBUA 3TTYA 1OXSC 1QR2A 5F5LA 2G5TA 1NPTO 1R0YA 1BSVA 4OK6A 1CZHA 2GXQA 1D04A 3K0CC 4LJ5A 4MVWA 5FQNA 2ZM5A 5JBNA 1B15A 1KEKA 1YO6A 3H13A 4QDOA 1NM5C 1BS2A 3G2OA 3LLCA 2W22A 1L5LA 3OCCA 5C51B 3CXUA 1CUFA 5K3FA 2AR9A 3G6KA 1V5GA 5DT9A 2NVUB 3JW8A 4GUAA 1G4AE 2X0EA 1L7NA 1N2XA 2QR2A 4A92A 3I2IA 1RHKA 2GHRA 3KLMX 4AN0A 3UK1A 4KXXA 4GOMD 4KC0A 4KLNA 5TPZD 1GARA 4BQFA 3GUYA 1XGKA 5D01A 1N7IA 4LV6A 3GJTA 2Z9BA 2FR8A 2CLCX 5JMWA 4NPAA 4EHBA 1GQYA 4LX8A 5EGSA 1YB2A 2J7PA 3KSMA 3NT2A 5HHTA 1UADA 2LD4A 3VR6D 2J08A 1Q17A 1TNDA 2IZOA 2JIMA 1MC1A 1OFHA 4XCVA 1LW6E 2V7GA 4PO3X 5K2MA 3X2FA 4A8PA 2UVQA 2P2DA 1NJGA 3VDMA 3QXGA 5IASA 4XA8A 1FS6A 1HSZA 3RSLA 3VU9A 2G1KA 4OP1A 1XQ1A 1HZJA 1P1BA 2Q45A 2PRZA 4PGMA 1Q7RA 1PG5A 1PD1A 2C3MA 5JZMA 4M1SA 3V7FA 3BRCA 3V7YA 4MMYB 1XL0A 1Z26A 1KZ6A 4HGRA 3URKA 4EKIA 2ADFA 4DTIA 1O6FA 1EFAA 4Z7JA 1E0SA 1Q44A 4II7A 4LBYA 1N57A 3JQAB 5AKZA 3WMEA 3T15A 1KYXA 2XZOA 5IAOA 4FMCB 3Q2OA 5I7OA 1VL2A 5JYDA 3D6AA 1V8PA 3FLBA 5JRJA 2OHGA 1US8A 4MWBA 3FUUA 3RUDA 4M22A 1CULC 1IDOA 2D13A 2JBAB 3EGOA 4MO9A 5DKFA 3DZKA 3UXYA 4E5PA 4ZI3A 2IDZA 1NWCA 2VJQA 1B8VA 4ND3A 1T8YA 3N76A 4QPJC 1LK5A 3V8BA 3D64A 3LC7O 4CI0B 1W4CA 1XEWY 5AJZA 3RVJA 2QIPA 4CJXA 1QRUA 3WP0A 4DSUA 3JCZA 4YNBA 2ZUDA 2ZJOA 4RTLA 5EHGA 2JJQA 4HH3C 1G9SA 3FUCA 2NNLD 2JRLA 3N0RA 3NCTA 3ZLUA 1X7GA 3ASYA 4POAA 4DBZA 4QM6A 1TCUA 4RWEA 2OZKA 1X7XA 4DR5B 2OSBA 4AZVA 3KB6A 4DSAA 2ZIXA 3QE4A 3TIFA 2R8RA 4LTDA 4MUJA 4QNNA 4LOAA 3TYXA 3GGOA 1NI4A 2OHJA 4G5OA 3EPLA 4GMDA 2KBFA 4KQGA 5AM2A 4CMIB 4TT3A 4BVKA 3F5DA 1XRQA 4LYGA 2ETVA 1KZ7B 4I1SA 4UBIA 1XTQA 4RV9A 3FVRA 2DU8A 1MT3A 2PUHA 3U9TA 3REFA 1EK0A 3WTBA 2AS0A 1Z4JA 3EXIB 2NACA 1ZS9A 1U8TA 2P1RA 3F6CA 1LY1A 3KD2A 5LA6F 1TUEA 2FEXA 2JD2A 2WHQA 5E9QA 4RD6A 3IEVA 1NLUA 1CE8A 4G0UA 2VUIB 3DNPA 2AEJA 2WFAA 1I6WA 1E6WA 2JLAA 2WLSA 5EP3A 5J2TF 3M81A 4CTMA 5F77A 4QDZA 1LKZA 3K73O 2GZ3A 4CFYA 4HK4A 4QM7A 5CYFA 4BX9A 4LF8B 1A4XA 4CV1A 4FOOA 5JSHA 5CPBA 1QOZA 2EL9A 2WWYA 1E1RA 1V6AA 3EFOB 3A9RA 3R6LA 3PRKE 2VHVA 4I8XA 1J5PA 3FHJA 3RADC 2M6SA 2XA9A 3I28A 4BJ3A 3WJ7A 4WBXC 1ESDA 4FKMA 1K7YA 1XJ0A 4EF5A 4EB0A 4XDHA 1F0PA 1AU9A 1I2BA 2WZDA 3BL6A 3C70A 3IJ5A 2HBZA 3EASA 4MQFA 3LQFA 3SQXA 4YT5A 3AETA 1JKXA 1WKVA 3ULKA 2AKEA 3EOAI 2MSEB 3G23A 5BPHA 1LJ8A 3QBDA 4B45A 1SA0A 1HSOA 5T5QA 3RF7A 5BXYA 1UDAA 1TW3A 4ND1A 1X8LA 3WHKA 3RK1A 3MCVA 2EIXA 4IJVA 1L7OA 2QMQA 3O3OB 3OBBA 5GMOA 1G18A 4LKOA 4LS3A 1ST3A 1W4ZA 2C95A 3NO4A 4N5MA 3FROA 4DR2B 2NVBA 1QFSA 1NUPA 4BIMA 4YPOA 2MTBA 4CLRB 4MS3A 4YLYA 2BMVA 2OO5A 4X24A 1EUCB 2CMHA 4QELA 4WH0A 2E1PA 4MAFA 1E2PA 3QUBA 3QMVA 2BHNA 4I36A 1TTPB 1NAHA 1MHTA 2OM2A 3PNYA 3IULA 4IQ8A 1Z5UA 3PPWA 5TT1A 1EDOA 3OMXA 4ZOQI 2EX1A 4KO8A 3W2IA 1WPQA 4BVAA 2HW8A 4EEXA 2FU5C 2CMKA 2FZKA 1LPMA 1Y3AA 3PGA1 4IH9A 1BFDA 3RVBA 3BT7A 2YJ3A 3L41A 4C7OA 4O2BA 1LBHA 4KBGA 4CV2A 4NDNE 4HDRB 2IV3A 3T0GA 2W48A 4QRDA 2XBLA 4G56A 5LC1A 1G6KA 1A04A 2EFEB 2PZGA 2X7JA 3TZBA 4RJIA 4WERA 1SU4A 4LVCA 4UCWA 1KZ9A 5K3OA 1H5NA 4U7HA 4D79A 2JAUA 1V4BA 1A3CA 1QRSA 2YY7A 3NEJA 3PEYA 1ZO8A 1ONSA 1SBIA 1NG1A 2HU2A 4OQMA 4XVRA 3TJMA 2CFTA 4BNYA 4D7AA 1KAEA 4BECA 2JLSA 2YRFA 4OJNA 1IAVA 5F3RA 5IH3A 1WQ3A 3VR3A 1BWQA 4HZGA 1YZNA 2C1XA 3FNEA 1M6EX 2ONJA 3NVDA 2O2CA 4GKVA 1GA6A 1KI4A 1C3OB 3CN7A 2B1QA 3FFTA 3GVPA 3KB8A 3WFIA 3E2IA 1ULBA 3IMKA 3A37A 3A9VA 2FSVA 3OZBA 3LJKA 4HTAA 4F7DA 3CJTA 4FMCF 4ZWNA 3BJEA 3BCRA 3TRKA 1M8FA 5SZJA 4FB5A 4Q4HB 4C4PA 1ODTC 4C7JA 1GP2A 3U6KA 4FW8A 1KI6B 4BNTA 3PGMA 2GVZC 2B1RA 1K8YB 2A9JA 2E82A 1T4CB 3IE0A 1L4FA 2H16A 2V98A 5DYGA 5IDQA 3THWA 3KDAA 1UAAA 2W2XA 5REQA 2CEKA 4KPUB 4BKOA 4TMKA 2FWBA 5BN1A 1YDFA 1TFRA 4PCVA 3L1KA 4LJ8A 5AOBA 3BH7A 1L1FA 4Z2AA 3F2IA 1SCKA 1YZKA 4GSYA 3UA3A 3I1YA 1JSRA 2H7YA 2QZSA 2WYWA 3C5EA 4W8HA 4WN3A 1O58A 1V71A 5EVJA 3V7NA 3X0DA 1IXKA 3GGGA 4DYVA 1R0ZA 4LXHA 2ZJ5A 3CF0A 3OU2A 4AKEA 3GX1A 3ZD9A 2A0FA 2BGNA 3C16C 2PX2A 2IL1A 4PAGA 3KP1A 4L08A 3K4HA 2OC9A 1I8TA 4IFBA 1WBDA 1IVNA 2C92A 2BMEA 2I2AA 2XMBA 2P78A 4HZUA 1T2AA 2PZ8A 3N8GA 4XR4A 3RSSA 3AUYA 1QZUA 5JNRA 1OFUA 1ZINA 4ZALA 4KE7A 5IVDA 3PXCX 2GTHA 3IV9A 5I9MA 1MAHA 4J0JA 1KORA 4NCAA 2CHFA 2YFYA 1UPUA 1B00A 3H5AA 3ODGA 2B25A 2YVQA 3TN7A 2D3TA 2COKA 4ZO9A 1H42A 4TZ6A 2BY4A 1FFSA 3LUFA 3LYHA 3EEOA 3GLFA 1W0JD 1C1HA 1Y9DA 2HF7A 1ELOA 2X1VA 3P4UA 4HEA1 1DIBA 4XD2A 1PBNA 3OETA 1X7HA 2Y3IA 3AG6A 3ISVA 3CRRA 5BSFA 3VZDA 4NATA 3RAPR 4QQKA 1V1MB 3HDYA 1T5SA 4HYQA 4Y6LA 4G07A 1SBQA 3OJCA 4BGUA 2WTUA 4YRAA 4KXVA 3NBYC 1OFVA 1IY8A 4PXAA 1C7RA 3F5SA 3I12A 5FWXB 3TZ6A 1ENYA 1XWWA 5AJXA 4DLKA 5HRCA 5KTYA 1U1DA 1PG0A 4FEYA 4OL0A 1WSDA 4R8KA 2D2FA 3AR3A 4A8TA 5FAXA 2G7ZA 4A23A 5KVCA 5D2CA 4JJ7A 4WJKB 1SKYE 1NXVA 2B2XA 3A11A 5CB4B 4P4GA 4OFXA 2WU8A 3ICPA 3EISA 1R1DA 4YCDA 1UODA 1XNGA 4XE5A 3UANA 1F4VA 1NMZA 2UVDA 3PGKA 1T1IA 2G76A 5BSWA 2GDJA 3ZHBA 5CFLA 5D5QA 3U7IA 1RZUA 2BFCA 3R0ZA 1EM8A 3QRWA 3AF6A 4FE7A 1Y4AE 3LCVB 1BQ4A 3QJ5A 4UMDA 3FNBA 1NBMA 1PRYA 4BLPA 4RD0A 2GCEA 3ZDDA 5ALGA 5C1BA 1QV7A 3E35A 4F84A 3VFDA 1BVUA 4N5IX 3JASB 4RSMA 4IGKA 2Q2OA 3U3OA 3IOBA 4FGUA 2FEWB 1KEZA 2P2LA 4JT8A 5I7UA 1M2KA 4RY9A 4D9MA 2DERA 1X0XA 3FGPA 1PQYA 3GC6A 4M9SA 3K1ZA 1T9ZA 4I4NA 1NNUA 2ZR7A 3HBNA 2VQDA 3BJIC 4DGQA 1WZIA 1CF9A 5ALPA 5KYGA 3S2YA 3EMBA 2IU6A 5ALVA 5M7EA 1NFRA 2W8ZA 3GRRA 2IP1A 4J1QA 4RD4A 3SS7X 2DQ4A 2EKPA 3JQ8A 2WWVD 5LA6A 5K3BA 1ZRNA 1T2FA 3ZTWA 4MAMA 2ORYA 5DV9A 4P4UA 3WTCA 5ALEA 4HDSA 3BK1A 3U9SA 3WLOA 4CCYA 4IOLA 1XMPA 5J2TA 3RKSA 4KBFA 3U7QB 3TVYA 1XVVA 1PUJA 2PKCA 1BEUB 1SXJC 4J90A 3P9KA 5EQFA 2V0CA 2WJ6A 3VO1A 5ICGA 4B3TB 4OI0A 4EH1A 5ICSA 5AYVA 3N8DA 3DMRA 4CRWB 2G5PA 4ZEXA 4Q37A 4H9GA 5C8YB 5HJEA 1QHXA 3C1UA 1CEEA 1H69A 3RFVA 4EY3A 2C00A 2RGCA 5B3JC 4LY9A 1ZHHA 1G6OA 3DE1X 3GFBA 1GQ2A 4IMJB 5BORA 3I2JA 2OCBA 2ZTLA 4E5DA 3QH4A 2IEGA 4BU0A 1FJXA 3GNSA 2ZYDA 3BN3A 4J1TA 5KNDH 3JQBC 3KPUA 1TEHA 3PL1A 4D0RA 1SELA 3I8OA 3UJCA 4IUYA 1ODCA 4W7SA 3I01A 3NR2A 1YL7A 3RNLA 4ZYUA 2OILA 5GTDA 3T3HA 1N4AA 4PU0A 2FFBA 4NAVA 1BN7A 1OLUB 4HQNA 4Z5XA 1CEYA 3QIAA 3FCOA 2HQRA 3D9QX 3OUZA 4FEGA 4ENSA 2O2YA 2GM5A 2WAYA 1ZGHA 2FSFA 2NVUA 1W5SA 3W1EA 1P0QA 4QU5A 3WO1A 3C3JA 3WQSB 1KJIA 2PZLA 2WWXA 3W6NA 1HEUA 4RTSA 1B6TA 4O5AA 4OQYA 4CMGA 1JHMA 1PNVA 3IVRA 1ECPA 4MV0A 2CN1A 1A1VA 4EGCB 3KZNA 4XUEA 4M1QA 4ZQGA 4YCLA 5FLXA 2QXTA 3FFWA 5EJFA 4CR6A 2D2VA 2D2XA 3KKNA 1V3TA 3HPRA 2VK1A 3LUCA 4ZI7B 3CUEF 3LQRA 5FB3A 4BZQA 3L1VA 3FMFA 3KEFA 4EYQA 3PDWA 2EG5A 2VZEA 4FFVA 2H2GA 1DADA 3EF0A 5FHRA 4LFCB 4DA7A 1ODLA 3U7EB 2GBGA 4N8DA 4C7MA 3N87A 2WR8A 4NV1A 4PC2A 4AX8A 4CM9D 3UPTA 4MVJM 3BSFA 1SXPA 2SICE 3O2JA 4XQ9A 4NBTA 4DLPA 4Y6RA 4F06A 3K4PA 5HK9A 4KTVE 1TB4A 1CQIB 2H31A 3G49A 4JBWA 2PNJA 2JH3A 2G4LA 3UMRA 4EHJA 2FRXA 2FSHA 3EBOA 1IDN1 3VM6A 2R2AA 4DLRA 2O3QA 2ZB2A 3K96A 3FFXA 4LHEA 2W4MA 1XPJA 3HXTA 1YE3A 4CN8A 3TIXB 5ITSA 3VU1A 3CY6A 1KYTA 1LVGA 3GD7A 3MUEA 2X13A 2W6NA 1ADFA 3KB1A 1RBZA 1DEOA 4GLBA 4B3HA 1O6ZA 2IXEA 1WW8A 2R3SA 4R16A 2W90A 4Y0AA 4CIWA 3OO1A 4DBLC 1E3TA 3B6KA 1QO9A 2REQB 3LGSA 1Z6XA 1T9HA 2H54A 2QI9F 4W5TA 1W19A 5CB4F 3RAEC 3EEBA 4OA5A 5SY9A 4YS6A 1TF2A 1UH5A 4WFQA 5KSPA 1UANA 2P9CA 4KDFA 4J0DA 1U3VA 4HAUA 3MS4A 2AZDA 1VPDA 1DRWA 2KLHA 3MGAA 3MMXA 3Q3GE 3RNOA 4RULA 1BMFA 3E22B 4KOAA 3AEUB 2X5OA 2AT1A 4X6XA 3RRFA 4K6GA 1QKJA 2ZRJA 1FDIA 4QVGA 2E9SA 4CDMA 2YN0A 4FM9A 1ISSA 4PFKA 5AI4A 1UINA 4JKIA 2WSYB 2I6TA 3PEVA 4DMFA 4OI1A 1TQ2A 2IF0A 4IJ6A 4XQGA 1SXGA 1I6MA 2WRZA 3OC6A 3RUFA 4CMIA 2NSLA 2PRIA 2QM3A 3CJQA 1ILWA 4RADA 1M0EA 7MDHA 4A36A 2WOJA 4PX2A 4KR2A 2J5BA 3C39A 4OEHA 1KY4A 1K3UB 5FLYA 5CLJA 3SCZA 4D26A 4NAUA 4N47A 4E94A 4F4HA 2G40A 2QXUA 3EXIA 1NR5A 4QJBA 2UUCB 3P8ZA 2V96A 1O9HA 2OE2A 4DF3A 4DDVA 5L4NA 2QYOA 2BV3A 1NN3A 2FZLA 3PB3A 3EWAA 4G1FA 1E2EA 5CYPA 1ZJ4A 3FTNA 1HDEA 4LRQA 4LXUA 2O9JA 1XELA 1M73E 3COZA 3PCXA 1SJ9A 2LCIA 4I46A 3OLZA 4LHXA 3ST7A 2D6FA 1A71A 1Z8DA 1ZDMA 2PKWA 3PUZA 3QUQA 4H6WA 5C8YF 1XZEA 3DCIA 3K4QA 4ZV4A 2PXHA 3EFOA 4UZEA 2AOWA 4HDNB 4KFCA 4ZTBA 3UTDA 4MGHA 3JAWB 5HX7A 3NONA 1KRWA 1QV6A 2CHQA 1CRWG 1F6WA 2AFVA 4LSWA 2F3RA 3L79A 2J9YB 3HPQA 4NENB 3A9WA 1SCNE 2HXGA 3I34X 3LHKA 2ZSJ