4XJVA

Crystal structure of human thioesterase 2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
216
Chain Sequence
ATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-acyl fatty acid synthase thioesterase, medium chain
publication title Crystal Structure and Substrate Specificity of Human Thioesterase 2: INSIGHTS INTO THE MOLECULAR BASIS FOR THE MODULATION OF FATTY ACID SYNTHASE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 216
sequence length 241
ec nomenclature ec 3.1.2.14: Oleoyl-[acyl-carrier-protein] hydrolase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xjvA00
3W05A 1XRLA 2Z8ZA 5J3JA 5JASA 4AO6A 4BC1A 1XZLA 2CKMA 1AURA 3I2KA 5A7FA 3WQHA 3GROA 2QUAA 4UBMA 3O0DA 5EHXA 3IB3A 2AXEA 2H7YA 4CIBA 4MWSA 4L9AA 5JALA 3OPMA 2RIPA 2XUDA 4J0GA 1GGVA 1P0QA 4DNQA 4WFIA 2GBCA 1VZ3A 2Y6UA 3KDAA 1Z68A 2V9ZA 2BKLA 2EDAA 4MEAA 5AIAA 1L7RA 2G5TA 3V1LA 3ZV7A 2Q0XA 2VJAA 4OB6A 4DMCA 2QR5A 5AM0A 3VVMA 5D7BA 3AIOA 2WG1A 1Y7HA 1E8NA 2Y2UA 4K2AA 1CUJA 4A5SA 5ALGA 4OB8A 4Z49A 3BJMA 1QIIA 2X76A 4Y2RA 1RP1A 2WIFA 3OM8A 3HI4A 4KAAA 2PUJA 2PUHA 5HF5A 1CR6A 3S2ZA 3OOSA 3ZPXA 1ORVA 5DNVA 4KR0A 2XUFA 3HC7A 3I6ZA 5JANA 4P08A 3QM1A 3G02A 5K3EA 2DR0A 2YH2A 2XMRA 5T4FA 5I8PA 1OCEA 2ZYHA 1ZD2P 3EQ8A 3O4IA 2RHWA 3WK8A 1ETHA 1CVLA 4QDZA 4X7BA 4U2BA 1CEXA 5T4EA 3D7RA 3T52A 3ANSA 3BDIA 3OC0A 5ALNA 4X90A 2PM8A 4QLOA 4G5XA 1JI3A 4BRZA 4J0HA 3ZWQA 2FX5A 4BDSA 4Y2SA 4KACA 4H35A 5AIBA 1CRLA 2J4FA 4K5QA 4DM7A 3C5WP 1CUUA 2O7VA 5BWBA 1R1DA 2JF0A 1GXSA 2JEYA 3WL5A 2WUFA 3F9CA 4QDUA 1CLEA 4BCCA 1Q0ZA 5EFZA 1E8MA 5AK6A 4I3FA 4PSUA 3WZLA 4KE9A 3CXUA 3AZOA 2XMQA 5DNUA 4ZWNA 1H2YA 4QE3A 2XMSA 4WY5A 3ESDA 4GXNA 2RI6A 1XZBA 5HF6A 4B0PA 3W2TA 1Q83A 3I2IA 1CFJA 4ETWA 4CFSA 2HIHA 4ARAA 2HFKA 1IZ7A 2QM0A 1XRMA 3LIIA 3DKRA 3A2LA 2WUEA 1TRHA 3AIKA 6YASA 1C7IA 3KOOA 1EINA 5AI9A 5AH0A 1YSCA 3U0VA 1GT6A 5AKKA 2IX9A 4J0KA 3R40A 2WFLA 1DX4A 1XFDA 1CUVA 3WKAA 1J2EA 1K6EA 4OPMA 5JZBA 1XZMA 1EHYA 2HADA 3PICA 4H0CA 2XUAA 5DNWA 3WK5A 4AZ3A 4W1SA 1W4LA 2OLEA 1DTEA 4IH4A 4QNNA 4LHEA 1CUCA 1FFDA 1BS9A 7YASA 4Y9SA 4E14A 1LPBB 1XRPA 5BV7A 3ED1A 3DOHA 3OURA 5IVDA 4BAGA 4MEBA 1A8QA 1IVYA 4PW0A 2ACEA 5LP1A 3FVTA 1DU4A 4C6HA 3QPDA 1MAAA 5CW2A 4BDTA 2CEKA 4H7FA 3BL8A 2VJBA 4WJLA 3F8SA 4FBMA 2O2HA 4X3CA 1QTRA 3QZUA 4MYDA 5KBYA 4UHEA 4Q34A 2WG2A 4B0OA 2JGEA 5A62A 4BB0A 1MN6A 1YA8A 3MUOA 2OGZA 1E3QA 2XMGA 3STVA 4MJ3A 2QOEA 1ZGBA 4HZGA 1T4MA 5JYCA 1IUOA 2DQYA 3O4JA 2PL5A 2ZJ7A 3V9AA 4ITVA 1GKKA 2GZRA 5HFNA 3I6MA 4HXEB 3QPAA 4F60A 2QVBA 2QTBA 2XB6A 5ALYA 3G7NA 5AKYA 3FBWA 3D4LA 3DLTA 1YS2X 5ESRA 2JGFA 5AKEA 4YK7A 5K3FA 3FYTA 4O08A 1FJ2A 1UOQA 3FLBA 2WM2A 5ALOA 3C8HA 3HYSA 1CIJA 2H1IA 4UBJA 2ZJ6A 4K6GA 4DSZA 1QIMA 3QPCA 4HRYA 3BF8A 1ISPA 2HM7A 3H2IA 4EZIA 5ISMA 4B82A 2JEZA 5ALRA 2DSNA 1RWQA 5CXUA 5BOVA 3BWXA 1JJFA 2JGLA 3HEAA 1FFAA 1WM1A 2PSDA 4CG1A 3ESBA 2QMQA 4FLEA 2FJ0A 3EQ7A 2WHPA 3G8YA 2QZPA 4JH0A 1JJBA 5EIAA 1XZFA 1B6GA 1WHSA 5HF9A 1U2EA 3AJAA 1HQDA 3A2MA 4B83A 1LPAB 1WCYA 5E4YA 2ECFA 1XZJA 2XMCA 4A23A 3M83A 5EI5A 2BUAA 4X95A 1K8QA 1XRRA 3WJ1A 5LZ7A 4Q1VA 3BF7A 1N5MA 1U65A 4DMHA 2WFMA 1VJ5A 3EQ9A 5JATA 1NX9A 5ALWA 4C87A 4Y2PA 5AOCA 1XZIA 4B85A 2CJPA 2VF2A 3AZPA 4X93A 1EDBA 5DTJA 2XLCA 3R3WA 1XLWA 1EK2A 4GDMA 1ZJ4A 1XKLA 3FYUC 5CT5A 5JARA 5EHZA 2WKWA 2Z3ZA 4G4GA 2WQZA 2I3DA 2I78A 3D2BA 2VATA 4M0EA 2DHEA 2XUKA 1AMNA 5HF8A 2QJRA 2VEOA 4DNFA 2XQKA 3FSGA 1W75A 4N5IX 3WI7A 2HU5A 2CB9A 4KRYA 2DCMA 4U2GA 3WK7A 5FPQA 2C5FA 5K3FB 1GPNA 2XUIA 3FYUA 1VXRA 5AI6A 1SC9A 4NS4A 2OAEA 1G4HA 4BCBA 5KWJA 3DL4A 2E3JA 2QXUA 3DNMA 4OYYA 3WWDA 3DKKA 1THGA 5LZ2A 1EA5A 2FJPA 1QO7A 2WLSA 4FNMA 1P0MA 2OCIA 3H2GA 3GUUA 2EEPA 4KJXA 5AKIA 1QIFA 3D59A 5BWCA 4DNOA 4LYEA 4YX9A 2AJ8A 2VT6A 4EY6A 1DWQA 2HFJA 4ROTA 3PFCA 3ILSA 1AKNA 5ALQA 3GFFA 3VDXA 2PU5A 4OSEA 4X97A 2XQFA 1EXWA 2BJHA 3STWA 3O9VA 1XZGA 4D9JA 3JW8A 5SYNA 1DINA 1BEZA 2C0PA 4X94A 5C81A 5LZ5A 4W1RA 1F0NA 4JYMA 4NVRA 5ALFA 3PE6A 3QITA 3LIPA 3SWWA 1R9MA 2JGKA 1EK1A 2O2GA 2GYWA 1LZKA 4Y2TA 2O2IA 2XUOA 3WL7A 5HZGA 1XZAA 1YB7A 2JGIA 3PF8A 1QE3A 1TKRA 3DOIA 5CH8A 4X6XA 1MNAA 3H18A 1QIJA 3CCBA 4EY5A 2WHRA 4M0MA 3YASA 5EIEA 1E5TA 5JAUA 3FSGD 5AM1A 4HVTA 3MGAA 5FKJA 3PUIA 2WILA 3H2HA 5ALLA 3CN9A 1VZ2A 4N8SA 5CMLA 2Y6VA 5AI8A 1GQRA 1YA4A 2PKYX 4UBLA 5AKHA 2EDCA 2ORYA 2PSJA 3E4DA 3FYUB 3DJYA 3STYA 1H2XA 1XZKA 1BROA 5LZ9A 1DX6A 1E8DA 1F8UA 1QIDA 2HRQA 3DEAA 2GYVA 5AK4A 3L1JA 4KE8A 4S0XA 3E1GA 4FDMA 3D2CA 1RYYA 1ORWA 2VSQA 5HFAA 2QT9A 2HA2A 5IH7A 1LLFA 2PX6A 3QVMA 5FDFA 2ES4A 2JBWA 4BC0A 3WWOA 2OCKA 4KYVA 3C5VA 5IVKA 2VJCA 4Y7DA 1S8OA 3NGMA 4CCYB 5LZ8A 4OYLA 4QWWA 1GKLA 2XMBA 1XQXA 1W1IA 2HU7A 1QGED 1WB6A 3WKBA 1BU8A 1MX5A 5JZSA 2G4LA 2J4CA 4WDRA 4AO8A 3B12A 3I1IA 2GBIA 2ZSHA 2XDWA 1UK8A 1XZDA 4UBKA 1VA5A 1QLWA 2CZQA 4PO3X 4EY8A 4U2CA 2HA6A 1U4NA 4ZRDA 3V1KA 1QONA 4U2DA 4FWBA 3GBSA 1X2EA 5K3DA 5LKRA 5DYWA 1XQYA 3FNBA 3A2NA 1QFMA 3FAKA 5IKXA 3KXPA 5FP0A 5C8VA 4W63A 3AILA 3JYHA 2WJ6A 2IITA 4H7IA 1IZ8A 1O6FA 3B3QA 5DJ5A 4HS9A 3W9BA 1DQYA 1J1IA 2PSHA 1HLGA 4EA6A 3D0KA 5ALZA 1CQZA 2HDWA 2J3QA 3AIMA 3R3YA 3WWPA 1CUAA 4GECA 5ALMA 1GPLA 2BUBA 1TAHA 4UBIA 3WIBA 4C01A 1H23A 5SYMA 4Y2JA 4AN0A 1TK3A 4K6KA 3GZJA 3R41A 2V97A 5IVHA 2HHAA 2DFPA 3ICWA 4UPDA 5FOQA 2XT0A 3RM3A 5D3ZA 2C58A 2QS9A 5AM3A 5D3KA 5ALXA 3C43A 2PSEA 4GEGA 4N5HX 4XWGA 5CURA 3I2FA 1LZLA 3W04A 3I2JA 3C87A 1TIBA 3F98A 1QFSA 1UKAA 1CUGA 5AOAA 4WFJA 1WOMA 4XIIA 4BATA 5LKAA 2VT7A 5CT6A 4LXIA 2QJWA 3I6YA 4ZXFA 5AK5A 1W76A 2YXPX 1CUIA 3PI6A 5AI4A 4EUSA 1PV1A 3ESAA 4KAJA 2WU3A 3EIOA 3KWFA 4BVKA 5JD6A 3FOBA 2C4HA 1JU4A 3B5EA 5JADA 4G8DA 2BCEA 4PF1A 3CCCA 5DLPA 4PQEA 3TRDA 2XI4A 2WIDA 1UOOA 2VQ6A 4OB7A 4QDOA 1P0IA 4UHCA 1MPXA 3ICVA 3U1TA 4B84A 3R3ZA 1LPPA 2ONCA 1MJ5A 3QMVA 1R88A 1JFRA 5YASA 4CCWA 3G0CA 3DQZA 4LXGA 4P9NA 2XQJA 1D07A 1XRNA 4BBZA 5JD4A 1BN7A 4KEAA 5ALDA 2CBGA 3C6ZA 4W1QA 5EHNA 2XUPA 2ZYSA 3FVRA 2I3ZA 3ANTA 4X00A 4MQLA 1XQWA 1L7QA 1XLUA 2QKYA 2PPLA 2DHCA 2QRUA 2HRRA 3AZQA 3K2IA 5FRDA 2OQVA 4C4YA 4DLNA 1XRQA 5AOBA 1TCAA 2WJ4A 4BYMA 4JEIA 5CH3A 1ODSA 3HABA 1HDEA 2XQIA 1H2ZA 2P8SA 1QTIA 1T2NA 1JJIA 3PFBA 3R3UA 5KWIA 3RK4A 4LYDA 2D5LA 3HRHA 1ZIXA 3WZMA 4F0JA 2PU7A 1A88A 4H77A 4QEKA 1JKMA 1MNQA 5LZ4A 1WHTA 1WB5A 4BE4A 1C7JA 5DYTA 3FLAA 2W6CX 1J07A 2RAUA 3WL8A 1DT3A 1E89A 1ZI6A 4LIPD 1H22A 2H7XA 5AKJA 2GYUA 3KD2A 4FLMA 3G0GA 1SCQA 1VE7A 3WK6A 3WKEA 3WL6A 4MQMA 5ALSA 4UFOA 5JZ9A 3WKDA 3D2AA 3C8DA 5HCUA 1A7UA 4C4ZA 3L1HA 4BVLA 1UKBA 1TCBA 5AM2A 2JGMA 1XZEA 1M33A 5LIPA 1XZHA 3IUNA 4KE6A 2RHTA 2G5PA 5ALTA 4DNPA 1ZI8A 5CT4A 3RLIA 1H2WA 3WYNA 1LBTA 4GHWA 4FLFA 3ESCA 1CPYA 3EBLA 1YASA 5AKGA 5JD5A 4Y2XA 1LGYA 2H7CA 1G66A 3LP5A 3I28A 2XMDA 4EB0A 4G8CA 3G9UA 5CXXA 4OCZA 4FNGA 3H2JA 2QUBA 1K4YA 5FV4A 4KE7A 2BGRA 1FSSA 2VA9A 1I6WA 4RGYA 2WHQA 2ZVDA 2OGSA 1UOPA 2HA4A 1UK6A 3F67A 3D3NA 3C6YA 1F0PA 2WIKA 3WLAA 1ZI9A 4G4JA 3WYDA 5K3AA 1SCIA 4GWLA 5FUMA 1SFRA 3H17A 1CUWA 5K5EA 2BGNA 3IVMA 3TEJA 1YAHA 3UUEA 1PJAA 1R4ZA 4GW3A 3VJKA 3P2MA 4L3WA 4L72A 2VAXA 4GLBA 2VJDA 5DWDA 5ALHA 2WUDA 1DT5A 1UT6A 4FBLA 1Y7IA 3BIXA 1QIKA 3I2GA 4AO7A 3A6ZA 1XLVA 4M0FA 1TCCA 4DIUA 2RGUA 2GBGA 5AKLA 1KU6A 2C5GA 4LXHA 2WSLA 3C45A 3NOXA 4J0IA 1UXOA 1Y37A 4U2EA 2XE4A 4G8BA 3EF3A 4C88A 5T4HA 3DYVA 4MWTA 4XVCA 5FPPA 2G63A 3WWCA 4FFVA 4J3JA 4UBOA 1B41A 4CCYA 4BE9A 2X8BA 3ZLUA 4GBGA 4X92A 2B20A 1A8UA 3WK4A 4DMFA 4E15A 1EVQA 2QXTA 4CI9A 2WTNA 1VKHA 3IUQA 2BAGA 3SC2A 4AZ0A 5AP9A 4AN1A 4X71A 4V2IA 1BE0A 3BJRA 3RKSA 4P92A 3K6KA 1NU6A 1AUOA 4KRXA 1PFQA 1N8SA 1FFEA 1DWPA 4X6UA 4P93A 3G0DA 3WJ2A 2XUHA 3WKCA 3H19A 3LS2A 1Q84A 2PBLA 2XUJA 3WWEA 4B7ZA 5C8ZA 3PF9A 2OCGA 1N1MA 2OPHA 4AQDA 1YCDA 1EI9A 1SCKA 4E11A 4NMWA 4RPCA 1JU3A 3L1IA 1OILA 1YB6A 4DYHA 1IUPA 4UFPA 4RE6A 1UWCA 5CT9A 3F97A 3V48A 1HPLA 4UHBA 1J06A 2OCLA 1K5PA 4W1PA 2X5XA 3TGLA 1CUXA 3BXPA 3STXA 2HA3A 5E4TA 3BDVA 1YAJA 2FUKA 5AO9A 3G9TA 4ARBA 4UHFA 1EB9A 4HRXA 4QDXA 1FFBA 5EGNA 4HTAA 4ZGBA 3DL7A 4BVJA 2WIGA 3GELA 4DMKA 3G9XA 3SX4A 4A16A 4TVKA 4F5ZA 4MXDA 2PVSA 1QIGA 2RONA 4N8EA 1QJ4A 3H0CA 3O95A 1Q0RA 2OG1A 4G4IA 4YASA 1E66A 4KAFA 4BP8A 4W9RA 4XX1A 4Y2QA 5I9IA 1DWOA 2BFNA 4CG3A 2AJCA 1JMKC 5ALPA 1BRTA 5AK3A 3FCYA 3O4GA 5AHXA 4FMPA 2OQIA 1CUYA 2YASA 5AM5A 4ZV7A 1TQHA 4ZI5A 4H18A 5I7UA 1UK7A 2B4KA 4IH9A 1UZAA 1X2BA 4X6YA 4BZZA 2Y1KA 2XUQA 4G9GA 1A8SA 2CMFA 4AX4A 3DDUA 5E4JA 5F4ZA 4FOLA 5E2IA 3IULA 3HSSA 2GZSA 5DYYA 2B61A 5FXMA 1ACJA 1CQWA 2C0QA 4H7HA 4AMZA 2ZSIA 3K9BA 4Q3LA 1BCSA 4N8DA 4H7KA 2CUTA 5FLKA 1MO2A 3LCRA 5C8XA 4JNCA 1NU8A 3M3DA 4J7AA 1HKHA 2XMZA 5JAPA 1P0PA 5A71A 1EDDA 2OXEA 1N5RA 4BCDA 4Y2YA 4OU5A 5AKXA 5CH5A 1LBSA 4RNCA 3E3AA 1VOTA 1JT2A 2Z3WA 4FKBA 3NUZA 1EX9A 1K63A 1GQSA 1SOMA 3AUKA 1W52X 3IUJA 4Q82A 1MTZA 5AI5A 5A7HA 1XKTA 3O4HA 5ALVA 3MVEA 3PDCA 3Q0TA 4DTCA 2HA5A 1LPMA 3ZLTA 4TGLA 5D6OA 4HAIA 3NWOA 1CV2A 2R11A 2D0DA 3WIOA 3I1YA 4IO0A 4I4CA 1ZD3A 2V96A 2AJBA 4B80A 3C6XA 2Z5GA 4EBBA 1KU0A 1G42A 3FLEA 2DQZA 4UBNA 2V98A 1UK9A 3I2HA 3DD5A 4BAZA 1CUEA 3JWEA 2ZYIA 2OGTA 1C4XA 3VISA 1HL7A 1F6WA 4FHZA 2C7BA 2WU4A 3E0XA 4DSAA 1O6GA 5ALKA 5AM4A 1QO9A 2NW6A 2J3DA 4H7EA 1MX9A 1GZ7A 2LIPA 3BE8A 1AC5A 3OTQA 4Q3KA 4Q3OA 3V1MA 1UFOA 3AINA 5JIBA 3HJUA 1ZICA 3V1NA 3IDAA 4ZREA 4AMYA 4E46A 1IMJA 4UHHA 1XZCA 4EY4A 1AX9A 2ZYRA 4J0DA 4B81A 3HLKA 4PNZA 4QDTA 2IIVA 1LPSA 2VAVA 3AFIA 2HU8A 3IUMA 4G9EA 2WJ3A 3ZI7A 1X70A 2PSFA 3A70A 4G1FA 5HKBA 5K3CA 1FFCA 1YR2A 1USWA 5A7GA 2K2QB 1W6RA 3CN7A 1OXMA 4K6HA 3WK9A 5ALJA 3HACA 4INZA 3X3HA 1ZIYA 3UUFA 2AJDA 4PSDA 3KWJA 3M81A 4X91A 1CUFA 2O7RA 1LPOA 3G9ZA 5HQ3A 1LPNA 1AQLA 2WIJA 4HXFB 3QMMA 4H7DA 1EVEA 1IUNA 2ZJFA 3DYIA 5A6VA 1ZGCA 3R3VA 2DHDA 4AXBA 4XJVA 3H04A 4Y2VA 5K3BA 3HZOA 2R8BA 3PUHA 4Q05A 4BP9A 2WFLB 1VXOA 2HA0A 4F21A 1QZ3A 2GBFA 3VJLA 1R9NA 2H9YA 3T4UA 5ALEA 5AICA 3Q8WA 3SK0A 4BRSA 3H2KA 2WTMA 4BZWA 4EHBA 4JYPA 1EH5A 1QOZA 3LLCA 4H7JA 4PSCA 4PV7A 4IH1A 5JAOA 3S8YA 1ACLA 3VJMA 4U2FA 5DTIA 5A2GA 5CBKA 3VVLA 1CUHA 4QZVA 3DCNA 4EY7A 1VA4A 4HXGA 5H3HA 5LYYA 5AKZA 4AB1A 1QIEA 1ZOIA 3VKFA 4DGQA 1G5FA 2Z8XA 1WB4A 1ZD4A 3ZLVA 4LKOA 1THTA 1ODTC 3W9UA 2OAGA 1CUZA 4BAUA 1BCRA 1CUBA 3G0IA 4CIAA 4MYSA 4WFKA 1EB8A 5AI0A 1XROA 3MUNA 3N2ZB 5JAHA 3O9MA 2XLBA 1UKCA 4OU4A 1L7AA 3H1BA 5IVIA 4QA9A 4WDQA 1EDEA 3GA7A 5LLSA 2B9VA 3OG9A 3DS8A 4I19A 2UZ0A 4Y2UA 4X85A 4YPVA 3W06A 1MX1A 2AJLI 4J0CA 1MU0A 1ZD5A 3FWHA 2VTVA 3WMRA 4B6GA 1GPKA 1VE6A 2WUGA 3STUA 1JMYA 3G0BA 4J0JA 2W22A 2YYSA 4OUKX 5EHQA 4GI1A 2JIDA 5CTAA 3FCXA 5HK8A 1R3DA 3R3XA 2WFZA 1CUSA 3IURA 4B9AA 2I03A 2XUGA 5HQ3B 5EIHA 4TPKA 5CT8A 3C70A 1KEZA 1U8EA 3QH4A 3IBTA 4L0CA 5ALUA 3C6BA 1WPXA 4NZZA 1WPRA 4BTLA 3N0TA 2HA7A 3BIWA 3D5EA 3RARA 3HXKA 4UFNA 4JUIA 4J03A 1AGYA 4C4XA 3VXKA 1LNSA 5HKAA 4B9EA 5HK9A 2Y2VA 3F96A 5AJHA 5CRIA 4WY8A 1R50A 3QBJA 4OD0A 1BEEA 1MAHA 2XQGA 1BN6A 2BUCA 4WCVA 2WHPB 1MT3A 1XQVA 4RE5A 1ZJ5A 4QLAA 4CG2A 1AZWA 5ALIA 3R0VA 4FTWA 2JGJA 3UMJA 3WA6A 1CUDA 1ODCA 3IIIA 1VLQA 1QIHA 3WA7A 4C89A 4FFWA 4BTVA 3QMWA 4ZV9A 3H1AA 3TJMA 3IA2A 2WG0A 1DQZA 3M82A 2HL6A 4QWMA 2ROQA 3QYJA 4IHAA 4UHDA 1YS1X 4UUQA 3KSRA 1HBJA 5C7YA 2ACKA 5KREA 5T4BA 3STTA 4IQ4A
chains in the Genus database with same CATH superfamily
3CRMA 2Z8ZA 2IEGA 3DR5A 4TMYA 1YO6A 1QB7A 1UPUA 1CE8A 3BQ9A 3B3AA 3GU3A 4IFTA 5IKEA 4BC1A 2OCPA 5ADHA 2J32A 1VGQA 3IP5A 3ZU5A 1KYWA 4EPYA 2DTEA 4DMRA 3HEBA 3I2KA 1IY9A 4MYRA 3BHNA 3T95A 2ZJ8A 3NS7A 2EJCA 3UQYS 1U28A 2ZUEA 3GROA 3H9QA 1RWWA 2XZLA 1LDBA 5EHXA 1JHVA 2C4UA 4L5BA 4M0DA 3ENWA 4QYIA 2VO1A 1NSTA 3OMLA 4B5KA 1N2CE 2ZU0C 4RV4A 5F64A 4JX9A 1FS4A 3ZXYA 3O4FA 2IJGX 2NVUA 1A72A 4J2OA 2HMYB 1L1EA 2JI4A 4QG3A 4L9AA 4P7KA 3T3GA 3UH1A 5JALA 2XVZA 2YXBA 3SR0A 2GS9A 3A9UA 2RIPA 2XUDA 3T5PA 4UULA 2IUSA 2NU6B 2G83A 4HMPA 1Y3CE 2IDKA 2PA0A 4RZHA 3MT0A 5TQJA 3ZWCA 1PJTA 1NUPA 3T9AA 1W48A 3ABZA 2M6RA 3FLMA 3KDAA 2OZKA 1Z68A 5BT9A 4JLSA 4O4IA 4HUQA 1I6LA 5F78A 5LA6B 4KO8A 2G5TA 4FB5A 2CDAA 3K94A 3SHTA 3V1LA 3ZV7A 3JR3A 1JTVA 2B4AA 3J7TA 3KZCA 3QBEA 3GXOA 5EWLB 3CUSA 2Q3EA 1VPEA 1I3NA 2CGEA 5D7BA 1KGSA 5E38A 3RFXA 3SGLA 4DF3A 4ECAA 1MIOB 5AW4A 1K4KA 3ENQA 1OZFA 5E3JA 2K4MA 1B3BA 3DUFA 2FQ1A 1PZEA 1D7AA 4P53A 2JIBA 4NATA 5K0EA 1TXGA 1E8NA 1N5KA 1TMYA 3GR6A 3HLYA 2GCIA 4K2AA 3RB8A 2KYRA 4A5SA 1GG9A 3AP2A 4LRSB 2W00A 3FRHA 2C3MA 2I55A 2J5XA 2CUZA 4P4NA 1EFHA 4DFDA 1E1LA 1DEOA 3OCZA 2IYRA 4DMUB 1U8CB 2F17A 3S68A 4NBNA 4WA8A 1OBCA 1U3DA 4WW0A 3UCEA 4H16A 3PNYA 4LGMA 4EYOA 4Y2RA 3T6KA 1RC8A 5JT1A 5BWLA 4KSYA 3OE7D 3UTCA 1ND5A 3DBHA 4Q4AA 3FNGA 3TQSA 2VPXA 1PQYA 5HQTA 4Z9XA 1N1GA 4TKVB 4AJIA 5C5IA 1J2RA 5LQAA 2J48A 3JRWA 2B4YA 1XU7A 2XA9A 3ZPXA 2QRHA 2AHRA 5CW1A 3IO3A 5F7ZA 3ZIUA 5KSZA 3DW3X 3EPLA 4KR0A 3FVVA 4DLVA 1PWXA 4YAFA 4CL3A 3BUSA 2Z83A 2ZSKA 1SG9A 3O73A 1QGAA 1N7IA 2RHBA 4P08A 5K3EA 2YRXA 3LHDA 4RTMA 3EIWA 3LWZA 2DR0A 3P71T 1M2OB 2BF7A 2XMRA 5T4FA 2MSWA 1VB3A 3H8SA 3LL7A 3B3FA 3LFUA 3VR6D 4DB4A 4FOPA 1C0KA 1EFVB 1NZDA 1UBCA 2ZI3A 4LI0A 3INYA 4C20A 1F7UA 2A33A 2Y92A 1AHIA 1XDUA 2FW0A 4OMCA 4YROA 1ETHA 4I36A 3I0NA 1JG7A 4KREA 3W8DA 4Z54A 3EOBI 5TPZA 3OETA 3PUVA 2RJ3A 2FSUA 5ALNA 3TMYA 3ZTWA 1C3XA 1ORDA 2Q5JA 3N2EA 4GPAA 1LD3A 1C9KA 1JJ7A 4IDGA 2HJHA 4J0HA 3RAJA 4BDSA 4FGLA 1P5ZB 3QV2A 3TXAA 4KACA 4JI2B 4K0KB 4JEMA 3S2UA 2GKSA 1CRLA 3FCEA 4MRAA 1NUQA 2G3YA 5JSZB 2BZSA 4BMNA 3ZGYA 4EVSA 5I3CA 5DGCA 1N2CA 3NWBA 4CT0A 4XM0A 2YXLA 2UVQA 2BY4A 1EKXA 1R1DA 5DPMA 3VNRA 1XTSA 2JJQA 4CFYA 2JF0A 3VNBA 1NWHA 2LDXA 2JEYA 4TVSA 2WYWA 3AERA 5KDOA 2QMHA 4CM1A 2VQ3A 3ZD6A 3IIEA 3QPVA 4G0QA 1Q15A 3IQDB 4WXPA 4V1CB 4NDAA 1JXOA 4BFZA 4PG7A 1MXFA 1CLEA 3OKAA 3RT1A 2C5HA 3TNFA 4ZGWA 5EFZA 5EEHA 5GOTA 3KSMA 2EV9A 2YYYA 5U4QA 2K5UA 1Y33E 4RVNA 4KBYA 3L06A 4NIMA 3KKEA 1NMEA 4YDHB 2OHHA 1NQXA 4FDVA 5JMTA 1AJEA 2E4AA 2JJYA 4U6QA 3RFUA 3FPLA 1Y89A 2PVPA 3KHTA 2PXHA 2ZFUA 3AZOA 3CXUA 3N05A 4IF6A 3VTAA 2PAAA 5HP4A 1BMQA 2OC4A 4MS1B 4YFVA 1SD1A 1H2YA 2JAQA 4HNAB 1NVVR 1RYNA 4IXNA 4P31A 4UEJA 4UNSA 3JQCA 4L85A 1EVKA 2BFFB 2REQB 3PNKA 3QG1A 3TBHA 4B34A 3FOFC 4Y0NA 2ZJ0A 5BWNA 2VSYA 4NH0A 5E7IA 1JKJA 3AHCA 3IMCA 3HXMA 5KYXA 5EMHA 2NPOA 3B1YA 3PNBA 1W5EA 4DJTA 5KTMA 2RAFA 1CYEA 4EA9A 2FZWA 3SC3A 3O83A 3PX2A 2HIHA 5KC8A 1T4GA 3QVSA 3RC7A 4ARAA 2VXYA 3N0RA 2WV9A 4QPCA 3V34A 4DV5B 3NRCA 4DV1B 4UUAA 3K0CC 1RCTE 3GFVA 4O1MA 4P2GA 4TZ6A 3IT2A 4CKCA 1IH8A 1TFUA 2AGVA 4KPGA 3LOQA 3H2SA 4O2LA 3P9PA 4F93B 4HQFA 4MMXB 1KI1A 5LDDC 1AY0A 2D2EA 3DKRA 2ZIAA 3E4CA 4XLTA 2AYZA 4B7UA 1MPTA 2FFHA 1J8DA 2XE7A 3PP8A 3V1UA 2QBYA 3PPWA 3AB7A 3AIKA 1H05A 2E7ZA 3ZWXA 4DLRA 3F4BA 2V7XA 3V4ZA 5BNIA 1V3UA 3IODA 5GP1A 3EOZA 2NPIA 3PQ2A 4F9TA 4JC4A 3P96A 4JOSA 1FYEA 4OG2A 4KLRA 1F6BA 1TT5B 3FKJA 4G9BA 2GZ3A 3T34A 2TRSB 3D43A 3GCXA 2XD4A 4ALJA 3JQFC 1QYWA 5DM1A 5JROA 2AFHA 3B1KA 1CY6A 1ZLXA 1NQTA 4DARA 1E7SA 5KTSA 4G97A 1U8ZA 3FF1A 4PAOA 2RGGA 2RIRA 5FYDA 4FYWA 4L15A 1X8KA 4KQ6A 1CX9B 4BO6A 3OQIA 3IXQA 3UWOA 1A98A 1E4EA 2YJ4A 3WKAA 2Q50A 2VRWA 5JZBA 2CNWA 1NSFA 1SU4A 1TA9A 4FT2A 3KHSA 1JIXA 3ROQA 1HMYA 1E9CA 1EDZA 1SJ9A 4YMIA 2XUAA 5DNWA 4ETNA 1ZM9A 5KSOA 2Y1XA 4M89A 3AU8A 4AZ3A 4O4HA 2INGX 2OLEA 4G01B 4UXHA 1UJ2A 5LUAA 1EQUA 2YMLA 4QNNA 4URUR 4YO7A 1AQJA 1CUCA 4WZ6A 4LDZA 4EUHA 2AMVA 1U6KA 1BWRA 1JQBA 1DPFA 1O1YA 2A9PA 4GUAA 4E5UA 2CC2A 2NQ2C 3DBOB 3LUDA 2H4YA 1V5EA 3GGDA 3HCCA 3PFIA 2QT0A 3L7AA 1OTYA 2QPOA 1VMKA 5HOQA 4GDFA 4M38A 4PPYA 4Y9SA 3JASB 4E14A 4J8PA 4JXZA 5IVPA 1RRCA 2BHSA 3KV3O 3JQFA 1M2FA 1WD7A 2R8ZA 4MIEA 5IVDA 4JJZA 3R7LA 3GEBA 4BAGA 5HWSA 3LQKA 4M83A 2OVFA 2I29A 3MERA 1U7ZA 4HDCA 1LH0A 2ZK7A 4EF5A 4TVOA 3GQBA 4R6WA 2ONJA 4PW0A 4Z0TA 1UPXA 2GJSA 2R65A 4WOBA 4ITRC 1E3TA 5LP1A 4NG5A 2AN5A 2OWEA 3R4VA 3OZTA 4CT5A 1SG6A 3ZLJA 1PS0A 4GGPA 3QNUA 3QPDA 4MV1A 3HZZA 4F6LA 3WLOA 1C3VA 2HO5A 1S2GA 1K6JA 1GO2A 1Z56C 3HCWA 3IAXA 3NEJA 1YVRA 4IJKA 3KTFA 3LHIA 1PSWA 4KGVA 1FF9A 2A1IA 1Q5PA 4BDTA 4LTMA 2CEKA 3H2YA 2P9CA 2V4UA 3RYTC 4D9KA 5B36A 2FSSA 5K0BA 4O2AB 4YMGA 3F8SA 1FDSA 5L3RA 4AICA 2HKIA 3NNSA 1E1CA 2R7NA 3AXTA 3HB9A 4YCBA 2ISQA 4ISBA 2H29A 1NTOA 3BQNB 2RGXA 4JLWA 1H6BA 3SP1A 1A8PA 2AG5A 3QWIA 4ON9A 5CITA 3GAZA 4HAOA 3P9ZA 3R7DA 1J70A 3N39C 4Q34A 3AYXB 2BM0A 5D7NA 3HO8A 4QPDA 2JFNA 8MHTA 4B0OA 4EB8A 2ZLBA 2PXCA 5TDHA 4XDGA 3RGWS 3UWMA 5ELMA 5KYWB 3N53A 1F2TB 4WESA 1ZHHA 4BB0A 1MN6A 1KAOA 1YA8A 3JQAA 1SA0B 3MUOA 2EEZA 2P9JA 4FW9A 5DWQA 3K5PA 3UM9A 3LUHA 3QWAA 2RKOA 4YONB 5F77A 1Y8RA 3U81A 4HWSA 2IHYA 4C5AA 3K0AA 2X8JA 1E3QA 4J90A 1BW9B 3I9NA 2DPXA 1Z88A 3ERCA 3LT4A 3M6XA 3STVA 3HXTA 1JIIA 2FLKA 2ZTHA 3AX6A 5JYCA 3RYCA 5LQCA 5HTOA 1E7RA 2PL5A 2WQ6A 1HE5A 1ULSA 3R09A 3V9AA 4RZIA 3FTFA 1GKKA 1BJRE 1V9SA 1Y5RA 3AUJB 4MOWA 2PMKA 1HK7A 3IP7A 4GX1A 1NLUA 1C14A 2KWIA 1X1SA 1YZFA 4LJ9A 4LNAA 4CDMA 4CEJB 4CV1A 3EWNA 1A9PA 4L74A 1DKMA 1YQQA 3BE4A 3UCXA 2A0KA 3OLWA 3L7JA 4WZBE 1Z83A 3RR2A 1RXCA 2W2KA 5AUNB 2QVBA 3TLXA 4YAUA 5E8JA 4B76A 3L7LA 5KU7A 2QTBA 2XJ9A 2XJ4A 5ALYA 3H4TA 2UZIR 3G7NA 2V1XA 3OMWA 3OHPA 2FLVA 1C0PA 1XK7A 4L8GA 1E2EA 5F3RA 3KQHA 1QAOA 4QEDA 1G5IA 2A4MA 3M4JA 4K81B 4CR6A 1AHPA 2ALJA 1GTJ1 2WAOA 1ENZA 4G0YA 3WDSA 5IJXA 1WQ1R 2A5LA 3ILVA 4OI4A 5K3FA 3FYTA 2ZBVA 2WJAA 1SXPA 4IG9A 2G1JA 2ZBGA 2Y67A 2CNKA 3EZNA 4MWCA 3KLOA 4RTLA 2IZ0A 2P6MA 3DXZA 1EK0A 1NRWA 1OLUA 1U3TA 1YQUA 2VH1A 4R8LA 2B8JA 3ZNPA 3KNZA 4O4LB 2H1OA 5EMNA 2AMJA 4QPZA 1XVUA 5C4IA 5LR6A 3ZDZB 4HQLA 1QKJA 2QPAA 1E4VA 2R6DA 1NJ6A 4RA9A 1CIJA 4IEEA 1XCLA 2JATA 3O91A 5AXBA 2C3UA 1BYIA 2XXJA 1ZMOA 2BP7A 1WXQA 4K6GA 1EBBA 1QIMA 3QPCA 4U7JA 2GCOB 1FQKA 2GHRA 4F3CA 3BF8A 2H0RA 5TMDA 3R7WA 2HM7A 5C35A 3TG2A 1CNFA 2QXYA 3PDJA 1G5RA 2OFWA 3DMTC 4Q1FA 2NLOA 4EZIA 3CUKA 5FNVF 3KKQA 4N6OA 2I8AA 4UM9D 821PA 5ALRA 2D59A 3AEYA 3I04M 5JBIA 4D74A 1S3IA 2DSNA 3E3NA 3NTRA 1QXSA 1SY7A 3IP8A 4TKUA 2DECA 5FPYA 2HLDD 4M9QA 1DBIA 3UJHA 2Y0PA 1GKYA 1JJFA 4P4UA 2XNCA 2FUCA 3MJVA 1G0NA 3A32A 4G5HA 4ZO4A 1L3CA 3TF5A 1GRQA 3II6X 4YJGA 1NN0A 4IG4A 4OP1A 3RK0A 3UIEA 3B6ZA 4ER6A 4X44A 1GTVA 1N0UA 1WM1A 1YQDA 2VUIB 2WR8A 2AH5A 3AW9A 1NN3A 3MWDA 3RBXA 3ST7A 4LF5B 2LRHA 1DDOA 4B6RA 4DEVA 5CCXA 3OA0A 4L8VA 3I73A 1Y42X 3IALA 3GZNA 3EQ7A 4ND4A 4XEHA 1T0IA 1R3UA 4DSNA 5IF9A 1PNTA 2HLHA 4KO2S 2WF9A 2YHIB 4XOIA 4YRAA 2SECE 5LJLA 3FNHA 1TEHA 3EJWA 5EIAA 1N8TA 1B6GA 3RYIA 3SCZA 1LF0A 1RQLA 2XGSA 2PT9A 2GNPA 1G60A 1H85A 1Q0HA 2QE7D 3BZWA 4IWXA 3OQOA 2FMIA 1Z2CA 3G7UA 1HQDA 4GRDA 2DWCA 4B7CA 3A2MA 2VDLB 2DULA 1LPAB 4H17A 4WH0A 5HE9A 3DMTA 3TD9A 5E4YA 3A4IA 5BSWA 1JYFA 2F9LA 4IDOA 2ECFA 2ZTVA 3EAFA 3C7CB 1YNOA 4P2BA 4RDCA 1E2IA 1GKIA 4EGSA 3VDMA 3DV0A 4TKZA 4A23A 3CLUD 3HTXA 1KJYA 3SHOA 4MGIR 3OT1B 1V1JA 5A0VA 1L5SA 2ATVA 3LT5A 4DG8A 1FMTA 1RWXA 1YBHA 1CZKA 1MJHA 4NSNA 4H1UA 3ZDYB 2PUDA 4MUHA 3TQTA 4D96A 2H2GA 1XRRA 4WZBA 2UUPA 3TQHA 2BRUC 2GO7A 4HPWA 3TZLA 3C48A 3UG7A 1XTVA 3WJ1A 4F2PA 3GP8A 5LZ7A 3RGGA 3WQBA 4YMVA 1F8YA 1E1DA 3FSJX 3AVTA 1ZQ9A 1U9ZA 2WSYB 2W6ID 3BULA 4NONA 3PC7A 4DMHA 3B7WA 1M66A 2WFMA 1TK9A 2V7QA 3GDGA 1GUZA 4LJ8A 4OAQA 2ZUBA 2NVWA 2J6IA 3EOAI 3SPXA 3MS7A 2CXHA 2X4LA 3TIVA 2WUVA 2ORED 2UUOA 2EJUA 1J09A 3MGGA 1N5LA 1TTHA 2CJPA 2V5VA 2VF2A 2ZTSA 2W8BB 3TN7A 3IV6A 1LSUA 4IM7A 1L7PA 1KYVA 3E9MA 3M9WA 4C4SA 1RW4A 3O74A 4N7JA 3W5CA 1SVNA 4ZTBA 1Y8QB 2EQ5A 4G24A 3W7VA 4RTRA 2IPNA 2IOHA 5AVKA 2IYVA 4ZJZA 1K66A 1KSHA 2A9JA 4UCFA 5LN1A 5GV8A 2C1EA 3J80A 3EVZA 3W78A 3FDFA 2VYND 3MT8A 4KW7A 4M8LA 2OK7A 3CT6A 3IMFA 4IFIA 2WIAA 1BEUB 4YB8A 3UHPA 2FLWA 5FEUA 5EZYA 3TAUA 4EPXA 3AESB 2W6PA 3UW3A 4PE5B 1V41E 3NBMA 4F91B 3A8TA 3U56A 5FL7D 4M0EA 2DHEA 3SVZA 2FOLA 2I65A 5A4DA 1G1AA 4TMTA 3GNTA 5HBGA 4C0JA 3IDFA 1AMNA 2QJRA 3Q4GA 1UBOS 1W29A 2R1TA 3PDWA 4LYFA 4DNFA 5B2EA 1C7EA 1SVWA 3KKKA 3N5CA 2JJ1A 3N28A 5HEKA 4TTVA 4IIHA 4NWIA 1W75A 4N5IX 1XNGA 2XSZD 4MWBA 3WI7A 3H99A 5GWXA 3SJ7A 4XGQA 1ORTA 3JZMA 3WG9A 1K4MA 2H8KA 1SZDA 2VDOB 3IMKA 2H00A 4QQKA 3OCUA 3WK7A 2B2NA 3I34X 1ZXBA 2OORA 3CEHA 4HY3A 3HCRA 4MARA 4TM8A 3F78A 4B6EA 1SC9A 1ZNZA 1FFWA 1JHUA 4JEHA 1H4SA 2IXTA 3HNOA 3W34A 2VDWB 4NS4A 3OZCA 3RQIA 3T3NA 1YL5A 3D2LA 3HS3A 2ODQA 3DL4A 3O4VA 1R8XA 2ON6A 2GJ4A 3R6DA 4OOEA 5K8TA 3HYRA 1QHGA 1N6OA 4AY5A 2DLNA 3FUUA 3FDXA 1BVYF 1QJCA 3D6AA 3QA9A 4HTFA 4KUGA 1OLSA 2HF8A 4XH9B 5F9FA 1P77A 1SCAA 4MJLA 1K92A 2M2IA 5K9ZA 3OOJA 1KDTA 1TCUA 1Z0FA 1Z7WA 2D2VA 1WB9A 1WVGA 3LT2A 2QF7A 3PPVA 3WWDA 4Z51A 1NLMA 5BYKA 1T6XA 4BLOA 1L5KA 3N8IA 4DYVA 5AVSA 1Z3CA 1E20A 1O89A 3EEYA 4F1JA 3R0QA 2JGAA 4AL4A 5HA5A 3EA0A 1WVIA 4AS3A 2UU9B 4BXOB 2TS1A 4M9RA 2IHTA 1KZ6A 5ES4B 1NJ1A 3EVTA 2HIMA 2AW3A 2QX8A 4ZICA 4MCIA 1Z2NX 2R5FA 5LP6B 3VHRA 2WLSA 3PHJA 1LF5A 2H1VA 1ZC4A 1VCIA 4O3FA 5JXJA 4L6IA 1EQ2A 4V38A 2DQKA 2X5OA 4R1MA 4EZBA 1V7CA 3HVIA 1NX6A 3VPSA 3X2FA 1FDTA 4WKBA 1CEEA 5EIWA 1WZIA 2IWHA 2LV8A 4BZXA 5IJWA 2PWPA 3K6JA 4L02A 1RXYA 4HNGA 1G3IA 3QKUA 1ZHOA 4Q7EA 1RSZA 3N2YA 3OJWA 4Y1RB 3GUUA 1Y6FA 2IXAA 1B1CA 4HKTA 2ZREA 4KLNA 3LDUA 2DM6A 3GEGA 1O0BA 2I4IA 4WY2A 5JAQA 4PONA 3A6JA 1U2PA 1PR2A 4CQMD 4ZGGA 5LYJB 2PJUA 1OAAA 4DNOA 4NBSA 4PVDA 2VT6A 3NYWA 1DWQA 2QTCA 3HADA 1BX3A 4PHFA 1DP4A 4G5FA 2I2BA 5IX8A 4M37A 3MXTA 2FP4A 3UICA 4UE2A 3ILSA 5TLSA 3IR6A 1KRXA 1AKNA 4GP6A 2ENUA 5DP2A 4NJEA 4KR3A 4PN7A 1I3LA 4LMAA 1AD2A 2AOWA 3QFFA 3V4VB 3IAM1 5AW9A 4C05A 2PLAA 4LNHA 2FEKA 2R0QC 4JA2A 4XCXA 1DAFA 1NE2A 1R4MA 1UXHA 5K8UA 2WKPA 4R40A 1XAIA 3PVZA 3W4JA 1Q1QA 4DS3A 2Q9UA 1OYWA 1XZGA 2QN7A 1ZH0A 5CP8A 5JXWA 2VJYA 3LFTA 2C2HA 3E8SA 4D9JA 1E64A 4D6PA 2GXQA 2CLSA 1NZJA 3IPYA 5SYNA 3O3MB 3TQQA 1RI4A 1BEZA 3NASA 4GRIA 4TN5A 2RK6A 3ZTTA 1F0NA 1NLZA 1QQ5A 4NBKA 3DNPA 2EGGA 3IOCA 4NVRA 3CWCA 4B45A 4DLZA 3U4QB 1JDUA 2P9QA 2XVMA 4MYUA 2ATXA 4ABYA 3GFQA 1UMBA 1RP7A 1W96A 4R98A 3F5DA 1Z26A 1D2AA 2DUJA 3GT0A 5ECGC 3SWWA 2CFIA 4MI6A 1EK1A 3VSCA 1N2HA 2O2GA 3S1AB 4IHJF 2GK3A 2GYWA 1U3GA 4JCCA 3UZUA 4IDPA 3SSAA 2H63A 1IXSB 1OTXA 4JI0B 3E61A 3UT0A 1YJ5A 1CK4A 4YQFA 2FKAA 3I9V1 5EINA 4RHEA 3WL7A 4J4TA 2PL3A 5HZGA 1SC4A 3Q8MA 2YMMA 3SYLA 1RPJA 2VUSA 5HUHA 3IP1A 3IIKA 1Z0IA 3ESRA 2FWNA 3A4VA 3U4AA 2JGIA 3TOZA 5M04A 2G82A 3PF8A 3BHJA 1ANKA 1ZCFA 1ADBA 4HPJB 1SQGA 4KFTA 3L4BC 2FRVA 2I2CA 3NCHA 4G8JA 1A2QA 2OFOA 2PA3A 4X6XA 1E9VA 2IW1A 3K2EA 4PLHA 3H18A 2LPMA 3OF2A 3HFGA 1MOPA 1G8MA 4WZAA 1X1RA 2PJRA 1KJ9A 2ODAA 1Z0ZA 3EG5A 1RWVA 3QE4A 1HRDA 4YCAA 2IV3A 3YASA 3RSLA 3KJXA 3PGXA 5B55A 1TZBA 2PYZA 3AVXA 5JAUA 3PNVA 3RYHA 3A10A 1HWYA 1VBNA 2JGDA 5FADA 1Z6ZA 4HVTA 4L9RA 4BNDA 4WD3A 1M74A 3VR5H 3PUIA 2CNDA 1VHWA 2WILA 4A8TA 3BD6A 4UVGA 3QEBZ 3OQHA 4EUFA 2PEYA 1NURA 1F17A 3BMQB 4Q9DA 2OCXA 5DTMA 2V74B 3EC7A 3AR6A 5EQFA 1V1RA 3RSZA 3ND6A 3PS9A 1W30A 3W5UA 3RHZA 3QKSB 4Q7QA 1GG2A 3M70A 3DT6A 2A1UB 4OMDA 4E5PA 2XCUA 1ZN2A 1G6HA 2EDCA 4JT2A 1VMDA 2PZMA 4ZOLA 2OVBA 1DXOA 3FYUB 3DJYA 4AFNA 4Z2YA 4OHMA 1PG0A 1JFLA 3L4BA 4QPPA 2G25A 1F8UA 1QIDA 3D3KA 3HCAA 2NVOA 4OHUA 1IK4A 2LTAA 3AETA 1G38A 5KQGA 3O03A 1LI4A 5F2NA 4YALA 4BRWA 5JH7A 3SHQA 3UT5B 2JFOA 4B1FA 1VI2A 1KZHA 2HH9A 3IP3A 1JX6A 2AUMA 1A2BA 3K5WA 3C1UA 1BSVA 2OO5C 3E1GA 5FWDA 4FE4A 1IN6A 2BOVA 1CP2A 3SFZA 4RACA 3B7GA 1HDZA 1RYYA 4FE3A 4WACA 3PC8C 1IM8A 1EXMA 3GPIA 2EHDA 5JZVA 1ORWA 2W6JA 3TR6A 1ST2A 3DL2A 4GI5A 3SZRA 2HQ1A 3O8RA 3K70B 4DM3A 3QSYA 5L7YA 1N6NA 3K92A 4LGVA 3RVKA 1GV0A 4FI3F 4KQHA 4LEIA 2PX6A 3UG6A 5FDFA 1YFJA 4IICA 1KMCA 1YZTA 4BC0A 1KJZA 5CDSA 4Y67A 3F6CA 4HBZA 3WWOA 3JU3A 4C43A 2D5IA 1H8HA 4KRFA 3TYXA 5HM8A 4RENA 1UC8A 2O7QA 1NYQA 4Q1DA 1HV8A 4KK3A 3FHLA 4WI1A 1ORIA 2E4XA 1G20E 5EIBC 3CUWA 2GN9A 2XGGA 1VTKA 2WAAA 4P98A 3RUHA 1C4OA 5BQ3A 4IQGA 4LQDA 4UDXX 1Y6QA 4IR7A 1QFJA 1PF7E 3REOA 5KINB 4GKKB 2PT6A 1OZ0A 2ASEA 3CJRA 2Q28A 4PS1A 1ENPA 2G0AA 1MRZA 4JJ8A 1GKLA 2MSEB 2V1UA 2OO5A 3D4OA 2BKVA 3E7DA 3NHUA 2QORA 2B6NA 1NVAA 2H4HA 3LYAA 3AY0A 4TWRA 4OREX 3WKBA 4BECA 1ECPA 3PHCA 3PC8A 4WDRA 5EE1A 3A9SA 1LW6E 4AO8A 1KI2A 2IUFA 4YQEA 4NCBA 1EHCA 1PFGA 1WUIS 1QM5A 1XCMA 3CNNA 1DO8A 1KH1A 1Y1KE 2GBIA 3HBNA 5FHRA 3TL2A 1EHIA 4GL4A 2VYVD 4TMZA 4QGFA 4H3VA 1KGDA 1C30A 1T13A 2QP9X 3LBNA 4M7OA 3CPJB 1PWHA 3NVMB 2YRFA 4JHLA 4GF5A 4LPSA 1XZDA 2IEIA 5AVOA 2HF2A 1GPJA 4KN8A 4P54A 3B3JA 4I50B 5LDGA 1LVGA 4EY8A 1K7FB 2J9FB 4DIOA 5AUPB 3B1VA 3PR3A 3D5QA 1SUAA 2HA6A 4U2CA 4BS9A 3OIDA 4G0UA 1T5HX 1JAXA 1O2DA 4DIMA 1RTKA 3OZFA 2O8FA 1ZP6A 3I92A 3B20A 3I8SA 1EFLA 4K9OA 2H9IA 2OGWA 1NASA 2H3HA 4LK3A 5HIIA 2PX5A 2QD5A 1SBHA 3IESA 3THYA 5DYWA 4RZSA 2QRKA 1JG4A 4PC2A 3KKPA 3KHKA 1ZXXA 3A2NA 3OPXA 4N0EA 4RSGA 2B69A 5A4AA 3BTSA 5D51S 1KO8A 4IV8A 4O63O 1YJQA 3FDIA 3EIXA 3I9JA 1Z4MA 1BMFD 2I67A 1ULTA 2ILVA 1IMOA 2GSDA 3W2HA 1Z4JA 2YWRA 3V33A 4PLFA 4F96A 4ZYWA 3EYAA 3G6WA 2CXUA 1QC5B 2JPDA 3NORA 3AK4A 4LOKA 1DLJA 2BE7A 1Y4ZA 2MINA 2JB9A 1T2UA 2QD1A 1KNQA 3VR5D 5TVGA 2X4IA 4RPHA 3RQSA 3O31A 1O9HA 1DXQA 4MQUA 1SEVA 4QIHA 1QCCA 2FYTA 1L2TA 1JWAB 4IDCA 4H15A 4YRLA 4GOLD 3JWHA 2QTWB 1Z5UA 4Q9IA 1XJWA 3ENZA 4Q9LA 4AECA 1HLGA 4EA6A 5LYJF 3AVWA 4LNUA 4YAIA 1HA3A 2YZ2A 3D0KA 2C5LA 3R1IA 5AVYA 2PKCA 3ED5A 3LLVA 5EXXA 2P75A 1CQZA 1E1QD 1HFWA 1KZYC 1RCFA 3R3YA 1SR8A 5ALMA 1NM5A 4XEUA 4EHIA 4Y7CA 4XA8A 1AK2A 1JH9A 1TO2E 3U7GA 3ZVMA 1T25A 4RQUA 1OX6A 1UFQA 2ESRA 3GVPA 4JC8A 4P4SB 4PHCA 4WXYB 5K2MA 5LMUB 1TAHA 1YR9A 4EJMA 1SG0A 1JDVA 1ZUIA 3UJ6A 4FK8A 3U3ZA 5ADWA 1IZ0A 4E5YA 1RMYA 4OQ4A 3ZDQA 2RDMA 3NOVA 3OO1A 4PXYA 4JB0A 2F64A 1N2GA 2ATEA 4PZCA 3RUCA 2CFRA 1UPTA 1HLPA 3HJHA 3L1VA 1TK3A 5F2OA 3ZBTA 5L3SB 1BA2A 3FUVA 2VT3A 1O4VA 2V97A 1VJDA 1XD2B 2HHAA 4BJ6A 3J81A 4D3YA 4UEOA 4GM1A 5AHOA 1ZBDA 1GL6A 2IY8A 1M75A 1ETUA 3ICWA 4OAPA 4UMDA 4RMJA 1OZHA 3RTBA 3L6UA 4LRXA 1IWBB 2AXQA 1XRJA 3ZH2A 3RS7A 5LVAA 4C0KA 2ZBPA 1S8NA 2QRZA 1SXHA 1DBWA 3C8ZA 2OM2A 2NUBA 3AR8A 4RKWA 1KOGA 1WCXA 3T7EA 1CTQA 1PUJA 2Q5EA 5D3KA 2ZI4A 5KTRA 1X7YB 3VZCA 1LK0A 1YL7A 3N0WA 4GKAA 5EGSA 3PWSA 2CN1A 2YY7A 2VP5A 1VYUA 3W5VA 7MDHA 2AWOA 3DEFA 4KDEA 3IP9A 4LXYA 3VZBA 1CD5A 4Q4DA 2ZTUA 5IW8A 2W8ZA 4GS5A 3NM6B 1EVYA 3W04A 2MSDB 3NVAA 4O2RA 4TKMA 1TIBA 3SJUA 2J5BA 4C6RA 4RVUA 1AKQA 1NSYA 3URKA 4B32A 3CJTA 1UKAA 1B00A 1W85B 5LKAA 5SY9A 3LRPA 1FEZA 2AIRA 3ORQA 5TJHA 4DT1A 1RZUA 5LDHA 1FJXA 2SNIE 5B12A 4HNSA 1NKTA 5CT6A 5I9NA 1E2LA 1QHHA 1AF4A 1SOAA 2WAYA 3R7BA 4BN0A 3X44A 3R9XA 3EEOA 3I6YA 1YACA 3KPWA 1IPEA 2VUHB 3QHQA 3UJDA 1CR4A 5IWCA 3TNLA 3RKRA 2QUIA 4YJHB 1U99A 4Q24A 4B44A 3L6DA 2I2FA 4CKZA 2PD4A 3TSYA 1VE1A 1YONA 2OAQ1 2ZB7A 4R2MA 2JLUA 5KIAA 4CCAA 1W4BA 5JD6A 1XQ6A 3HJAA 2SICE 3LNTA 4QOFA 1ZJZA 3UVEA 4NV3A 4QUAA 1ZH8A 2CD9A 2KQUA 3H6HA 2AI3A 3NWPA 5AVUA 1P4HA 2AVDA 1DKOA 4C14A 1VYTA 1V5FA 1GTL1 3CCCA 1JEJA 1GARA 4LVCA 2HPAA 3NBXX 4PQEA 4BQSA 4WBNB 1VE9A 1YBVA 2K6GA 1KZGB 1Q1ZA 4TTRA 1ZM4A 3IEXA 2J08A 1ODJA 1UEIA 2A0XA 2PGDA 2ZCUA 4NYIQ 1KAMA 3ZY3A 3MJRA 5JHGB 2HIGA 4OB7A 4QDOA 4DCUA 3OUUA 3GNSA 1X7WB 1MC1A 5KNCH 3DKPA 1IWPB 4UHCA 1VL8A 4ASUA 2PH3A 3BB3A 1XBTA 3L04A 4KHPB 1CFZA 2A0YA 1VDZA 1E2GA 3DZCA 1MJ5A 2AC7A 2VBGA 2ZT8A 3SU8A 4G1VA 4DCNA 2UKDA 3QVLA 4QL3A 4MH0R 3IQFA 4TTSA 2RGDA 4IVRA 2GAAA 3I61A 4FGJA 1W5TA 4Z1MA 3ER8A 2BWJA 2EWWA 1SVIA 1T36B 2G5CA 2F1JA 3M4XA 4RCYA 4UHKA 1WLSA 4RTNA 1SIUA 2X86A 3KEFA 4JBNA 4PRKA 2HZBA 1QGUB 1R4NB 2O2ZA 3HP1A 3DOOA 2CBGA 5BMOA 1FU4A 4A6XA 4ZU3A 3T3DA 2FWAA 2I3ZA 2AX3A 4P35A 5DLQC 4G5RA 1LJ8A 1L7QA 1NIPA 2WUWE 2W7TA 1QYIA 3LSTA 1SWVA 1FUYB 2XRMA 1MZVA 4NDZA 3VYVA 3ZQUA 1Z4PX 2NUPA 3BRCA 1GAXA 2ZRDA 5JSKA 4JGIA 2PPLA 3HB7A 4YBZA 4IHKA 3S99A 3Q7TA 2PGAA 3ZE2B 4EI2A 2NZVG 1V3QE 4G0MA 4HGRA 3EG9A 5B1YA 3V2GA 3K2IA 5LQRA 1S2MA 2DPYA 1PNQA 2IYWA 4YJFA 1I1HA 2J8ZA 5AJYA 4UNIA 1ZAYA 1NUSA 3M3HA 3EIUA 1BD3A 3U39A 3A6PC 3IEVA 1MOQA 1ULBA 2WJ4A 4PZPA 4BYMA 5IT4A 4CQNA 1BVRA 1ZSNA 1ULZA 5FBRB 3JYNA 3ZU6A 2C9CA 5AHWA 1NR5A 3MS2A 4KV9A 2ZWIA 1HOTA 4ZALA 3V9PA 3P2KA 3A3OA 1GZ4A 1PLLA 2V0GA 4DQ0A 1WD5A 2B30A 1OYVA 2Z2YA 3KRTA 5FWYB 4CNQA 1CB0A 3HJGA 3QJYA 1T2NA 3FD8A 4PLGA 1GGMA 4JT4A 2R6ZA 1WOYA 3I8XA 3ZWDA 1Q11A 4UC0A 4ZCTA 4NH4A 2D5BA 3R3UA 1UBGA 1MFZA 1EFRD 1V7PC 2QROA 2X13A 2OB2A 4I6GA 1NW7A 3MGKA 4JOBA 1A2OA 5FAXA 5AMXA 4KVZA 4F2HA 4DILA 5L95A 2V65A 3WLIA 2HJWA 2MJLA 3HKEA 4JBLA 3G8BA 2V0NA 2MSLA 2G4VA 3I4LA 3EGVA 2FWIA 2PU7A 2WV7A 2PUFA 4Q02A 1MV8A 1ZM2A 3C24A 4LRTB 4CT4B 2I1QA 5MFZA 1VC2A 5J63A 1FYDA 3ZE1B 4BE4A 5DYTA 4CHGA 5GJBA 1ZESA 3NJ4A 3PNMA 4TT3A 3RHSA 2XCQA 3IQEA 4X1IB 5D5HA 3A11A 4B3TB 1BXGA 2VUUA 2FUG1 2W6CX 1AGNA 2JLWA 2DWUA 1NJGA 3IAM6 3HV2A 2XA1A 4II3A 5M34A 2RAUA 4R2KA 2WTUA 4O3MA 1SQFA 3WYBA 4DLKA 1WP9A 3OLQA 4D4MA 3Q3EA 1DT3A 1J0CA 1BRMA 4LIPD 2QP4A 3V55A 2B6HA 4MRMA 5AKJA 4XYLA 3KD2A 4I9GA 3D31A 2IHJA 1IQRA 3IKJA 4A03A 2AFIE 4FJ1A 1PR4A 4L50A 3THOA 1IHOA 3Q10A 1Y8AA 3O47A 5CNKA 3WL6A 3K53A 3HJCA 2A35A 1UJMA 3VR6A 4RK6A 3BGDA 3Q85A 1NXOA 4Z2AA 5HOEA 2QLBA 3A4LA 3FSEA 4Z8XA 1UINA 3CKKA 3D2AA 3IRVA 5EJ5A 1EFAA 5BUZA 2M98A 3EGEA 4KMMA 3MRXA 4LCJA 1N3BA 3EZ9A 2Z3VA 4NABA 5JECA 2HHCA 3L1HA 4BVLA 2WBLC 4HLQB 4GI3A 1UKBA 4KIWA 5AM2A 4KPEC 2QMOA 2Q1TA 2AI1A 3LVRE 4JOQA 1NJ2A 3IUNA 1WJGA 4LWQA 4DKXA 2QYTA 2ZB2A 3OOHA 1OB2A 5JE8A 4I9FA 2VJMB 1QPGA 2OUKA 4BBJA 1L1QA 3I9V6 3NFRA 3NU1A 1RT9A 1HM5A 2BDEA 2IYOA 4FD2A 5BSVA 2PUVA 2FF5A 4LTNA 3FCUB 5KNCD 1FYFA 2CB0A 2WHYA 1UDBA 5BOSA 4HQOA 4E12A 1XDWA 5CT4A 4Z4FA 3AWIA 2FFRA 2G8LA 1J9ZA 2PH7A 1G2IA 3F6RA 4Y6SA 2QYHA 3MPUA 4GHWA 3OKFA 2VLBA 4FLFA 3UMGA 2EZ4A 3MJEA 4NU0A 2AC4A 2IY7A 2A5GA 2PCLA 4LJ5A 3TKAA 2F8LA 3EBLA 5K0TA 1XPOA 2PV7A 3PWZA 3K9GA 4WECA 5JXHA 2WEKA 3JRNA 1V8DA 3AI1A 3UV7A 3HL4A 1LGYA 3I6BA 4OV6B 3LXRA 1DTSA 2VG8A 2H7CA 4C1NA 4HDRA 1PQUA 1HTWA 3EDMA 4LJ7A 1PJCA 1VI6A 4O4IF 1G66A 4MYCA 4L7VA 5J5AA 2BGUA 4Z0HO 1A8HA 4XJXA 4BLWA 4OH1A 3W4KA 4G8CA 2A0UA 2R6HA 4LHSA 3QJGA 1JXAA 1TUBB 2IYUA 2V8BA 4OCZA 1WKCA 5BQ5A 2I4MA 3T1VA 5HW0A 3WJAA 4R9RA 5C8YF 4JIMA 4YQZA 4DLXA 2CWDA 2VAPA 3WE7A 2WWFA 1X77A 1QDUA 2X6RA 1D0VA 2BMVA 2PMDA 3D6FA 1B73A 1XTRA 1JIQA 4L1KA 2BGRA 4Q37A 4LW8A 3X1YA 1Z16A 3FWKA 3QSGA 3GJ5A 3K9NA 1I6WA 2C03A 3OJOA 3DTVA 4H3KB 1ONPA 4K1XA 3OFND 5I01A 3ASVA 3D3JA 4P7FA 2OGSA 1UOPA 4G0PA 3ZS9A 3G13A 1UK6A 2ZB3A 2W70A 3WBKA 2P3QA 3RF6A 1OXXK 3CPEA 4QGSA 4UCXA 3DC7A 4LJYA 2IU4A 4QELA 2WIKA 3WLAA 3OHMA 4WUTA 1T4CA 2GPTA 3NHSA 4WK4B 3OU2A 2GD6A 2L2QA 1JXQA 4DYDA 1N9ZA 4HFJA 1IEQA 3WVNA 1SFRA 3DZFA 1TYCA 4BKMA 1KMMA 4TXNA 2EW2A 1V25A 2MOKA 2QAGB 1Z2OX 2GRUA 5ULLA 3ZS8A 2HMWA 2BGNA 2P0YA 3TTVA 3TEJA 2PKXA 1YAHA 3JARB 3ZDFA 1LUAA 2JW5A 2MIIA 3CRW1 4V2UA 1ZCJA 3NGLA 3ROZA 3VJKA 5BSFA 4KMOA 1MUUA 3QUCA 5AW7A 1PEKE 5LQMA 1KQFA 5F1PA 2JLVA 4YN3A 5PNTA 4L72A 2QK4A 1OXSC 3B8HA 3LWNA 4FEAA 4GBED 5DWDA 1MAUA 4FR2A 2YMPA 2A0WA 3NANA 1F51E 1Q1EA 1PR3A 4I2VA 3UK2A 5KHOC 4XGIA 4H59A 3N2LA 3WO1A 4UFPA 1QDLB 3BICA 1X1BA 1O96A 3A6ZA 4FCCA 4OJKA 3EPJA 2XXAA 5IC4A 3THWA 1G8PA 1TCCA 1I1OA 2AWNA 3U4CA 2HCRA 3MWGA 2C5GA 1HEYA 4GXRA 5TSDA 1U9IC 2A30A 2ZS7A 4MUKA 3C45A 4Z4CA 3LC0A 1XL1A 1YUBA 3K05A 4X60A 2DQ4A 3E48A 1SAYA 1Y37A 1PIWA 1G21B 3N1UA 1DEAA 2WYOA 3UWSA 1ID8A 2BHNA 1HZJA 1XEFA 1Y4DE 1F48A 3E5RA 1MZPA 2AKYA 3GD5A 2XVXA 4MWTA 1U8TA 3HXQA 3IAUA 2JAPA 1BHO1 2FEMA 2L0XA 4Q6WA 2Q1UA 4NJMB 1QGDA 1YS9A 5SZIA 3W3ZB 4Q4CA 2GYYA 1AKVA 1PFKA 1JVSA 1UDAA 1WHTB 3CU5A 3DDSA 2CBZA 1GZSA 4RSHA 2AN1A 4ZZ2A 3HKCB 4HRVA 4OGFA 1DPGA 1OYYA 3AUSA 3G7SA 1TJ5A 2FMFA 1JU9A 3O21A 4FZ3A 3FOZA 1OI3A 2ADOA 1YZNA 3H16A 4LYAA 3GRPA 1W88B 4L4SA 1B41A 3TCNA 1PR1A 4ZCMA 5DYIA 1O87A 1H3EA 3DOEA 1V0JA 7GPBA 4K1LA 2AX4A 4X24A 1RAHA 1R2QA 5JYDA 1BS2A 3AQ4A 3ILYA 4YRIA 4NHOA 4QGAA 3LFHA 1L4GA 2B20A 1UMKA 3CEMA 3MJDA 4PGFA 5FFNA 3WSWA 3L41A 3RRXA 2DPLA 4BEVA 4DMFA 1GGHA 1AK1A 2D7JA 1IM2A 4BN5A 4D4LA 4CI9A 4O2BB 5EP4A 4YT4A 1H3NA 1U9IA 3OC6A 1FPQA 3MD0A 4HSEA 4CRWB 5JCOC 1E6KA 3L7KA 1LQ2A 1C2TA 3GAMA 3NATA 4G1UC 1BE0A 1RI5A 1G5QA 1I10A 2EFGA 2L18A 3BJRA 1U3CA 3N8NA 1KQGA 1JWLA 4P92A 3K6KA 4TT8A 5FPTA 3ZHOA 1QQAA 3PHGA 2ZCJA 2X7JA 5CLQA 3D6NB 1Y5NA 3E9RA 4Z7OB 2Z8YA 4WN9B 3U7HB 2QG9A 3INTA 1ISFA 1BH2A 1C41A 2FTKE 1IVNA 2H18A 4QJBA 2WJZB 3H9UA 2H1CA 1N2IA 2X6QA 3G0DA 4P93A 3ZXSA 2GFIA 3UMVA 3UYKA 3VU9A 3WJ2A 5BV0A 3WKCA 1WCIA 2VNKA 4CI0B 3F6YA 5T67A 1BWQA 4BNNA 3VNUA 1MABA 1N9GA 2PWYA 2RBEA 1E62A 2HUPA 1KYYA 3RTAA 1Q84A 2O8DA 1AS2A 4US1R 2V6FA 2CVOA 5GPBA 2N9UA 4PZAA 4QBHA 4G5YA 1JECA 3IILA 4RNDB 1VL0A 3L8GA 1CJUC 3EGWA 4CF4A 4U2GA 1MHPA 1FP4B 5EXEA 5PGMA 3RRMA 4F2GA 4ENRA 2C1XA 2V7BA 5AJWA 3TUJC 1UADA 2BMAA 2OCGA 2B2CA 5JCOA 1E99A 5B5SA 1N1MA 3LUBA 4RZXA 3T3EA 5KNBA 5IAAA 4ZQIA 4ZAXA 3QKWA 4MMYB 1LSOA 4YUAA 3MRTA 2BFWA 3MWYW 5HFJA 1HYBA 3NNDA 3FGZA 3NTOA 1AUQA 1XA0A 1K2VN 2A5JA 3A27A 1Q1GA 5KYKA 2FSFA 1FNNA 3VMMA 3VPGA 4JFAA 3RWOA 2BMFA 2Q2WA 1YB6A 3RYFB 1IUPA 1CEQA 1KDYA 1UWCA 5FO0A 2PRKA 5CT9A 4O4HF 4WKNA 3DXYA 2CKDA 4ZA2A 1KE2A 2W9XA 3REQB 1FQOA 2FVYA 1ST3A 1G19A 2JANA 2WD9A 3F97A 1GA6A 2HN9A 1HPLA 1N3LA 4R7ZA 4HYYA 1BX1A 1J06A 4MKRA 1NN1A 3A26A 2D0OB 3IV7A 1KDOA 4ILEA 1DIOB 3NIFB 5F1KA 1OT5A 1Z6XA 4Q01A 4D3XA 3EVBA 3KR1A 1K86A 3I5MA 1QH1B 1F4VA 5E4TA 3NYQA 5EG5A 5BNWA 5BN5B 4B3FX 1YAJA 3B6EA 1TB4A 4YY3B 5LOVB 1SBQA 4HHEA 2OT3B 3G9TA 5C3UA 1XTIA 3OEHD 3S3TA 2CFSA 3FHJA 4EJFA 4YJ2A 4HRXA 1SD2A 4A0SA 3FW1A 4KXMA 2Q9AA 1YZHA 3LCUA 1JEOA 2D0IA 3HXPA 2CSXA 3S7ZA 5LL6P 5ERYA 3FMPB 1OVMA 4ZEOA 3ER9A 3ZWVA 1WG8A 1KVTA 3FOCA 4A8PA 2WIGA 4OL9A 1ISSA 1C1DB 3SQDA 2ZE6A 4W7SA 3W6UA 3K70D 2VQDA 4TVKA 4P8RA 4LF7B 4WOPA 4MXDA 1ZVKA 4YI3A 2PVSA 1L5VA 3QUAA 3SM3A 1QIGA 2RONA 3EQZA 2GVZC 3H8VA 5KJEA 3ULKA 2C3YA 3ACBA 5DLDA 4EA8A 1HT3A 3GLGB 5BVHB 1A2KC 2AZXA 1J39A 1V9CA 2GJ9A 3H0CA 1Y3DE 4F5EA 3A4MA 1YK0A 1Q0RA 1KBZA 1MP0A 4G4IA 4HDSA 4U7GA 1JQ3A 1MOSA 2JFYA 5BW5A 2WKQA 2F1OA 5EE3A 1QH8B 2O7NA 3N07A 1RAGA 1WXDA 4XX1A 3L0CA 5G4LA 2EBWA 5H3CA 3WFIA 1VKJA 9MHTA 5F9HA 4D42A 1CF4A 2GD0A 3MHTA 3AOEC 4EI7A 2AOTB 5A4MS 2EXXA 2HCJB 1EZ4A 3DZGA 1YS4A 3TCKA 5KX5B 5ANRB 1MRSA 3V7UA 3NB0A 4UD2A 4Q7KA 3DCYA 3H3FA 4F3KA 3L92A 4XUGB 2IYPA 2OCBA 1U8UA 3JAWB 3ZDXB 1TQ6A 2NYAA 2NVBA 2BBOA 1J56A 2AEJA 5AK3A 4DL9A 1FSPA 2OQ2A 1G41A 3VR4H 1GNVA 1QQ6A 1FBTA 1OKKA 2ABWA 3EAGA 3FCYA 3LUJA 5FUBA 2EW8A 2QQGA 4F38A 5KDDA 2Q2NA 4V0SA 3QLUC 4Q21A 3RSOA 4FMPA 3FRIA 1CIPA 2FFBA 1JTEA 2OQIA 1HL3A 3MHPA 4PC7A 5JV5A 2X0DA 5B4TA 3LDAA 1EM8A 4J1QA 2BGKA 3MWKA 4ZV7A 3T1QA 1HDIA 1G5HA 4HDKB 4ZI5A 1DQNA 3BG5A 2WK1A 5HKKA 4XQGA 3H5WA 1G0OA 3B70A 3NH9A 1A96A 1KMHA 1KP9A 4H18A 3BXZA 4MKIA 5DB4A 1FNCA 1LVHA 1N2ZA 2AG0A 3DF9A 3M3PA 2H5EA 4MA4A 3QW2A 1K9SA 3K6RA 1ZEJA 2M6KA 3OVMA 2GEVA 4X6YA 4KFCA 1MQ9A 2DVMA 3AOEA 1L3IA 4UPVA 4CM8A 3DBVO 3MJSA 2Y1KA 4WEOA 5BPHA 2DKOA 3ZHTA 1A8SA 1UJCA 1VJ1A 5F4ZA 1KO5A 5H4HA 2WNIA 4DIEA 1YZKA 3QU4A 4KZPA 1ZPDA 2VK8A 1R8YA 4NMXB 3O2JA 2C83A 4M1OA 4ZAYA 4M76B 5IYZA 4WCFC 1X9HA 5EXPA 2B61A 4UQPA 3GT4A 4RPIA 2HX1A 5KVAA 4IOMA 3BGVA 1L5LA 4KYIB 4H7HA 5JS2A 1NT2A 2HCBA 2AR9A 2IXDA 4NCHA 2AD5A 3ZD9A 4FS3A 2OP0A 3VZQA 1T3GA 1CDEA 1W5FA 4EW1A 3QLUA 4H27A 2B1IA 2RBKA 4L4RA 2J5KA 1S0UA 1K75A 1NXSA 3LP8A 1GQOA 4Q3LA 3GEHA 3TUZC 3GEMA 1DBVO 1OD6A 3JQGB 4FFDA 4JVSB 4RJ2A 1OH7A 3N2KB 5C37A 2XCLA 1O97C 3F5QA 1KAGA 2NYVA 3VZSA 5A02A 1ZMBA 5FLKA 4JBHA 4S12A 1XVIA 4QICA 4WBXC 2RGBA 3MTDA 1C4KA 1IWOA 5FCDA 2DLCX 1JLLB 2P6NA 4KBFA 3WBFA 1FRNA 2RKWA 4XKJA 1Z2PX 1QHYA 4PSAA 1T8TA 2XF8A 4BMOB 1NU8A 3M3DA 4J7AA 4BVAA 1AKUA 3FPJA 2WOJA 2OXIA 2NU9B 1YQGA 4DBLC 3OJCA 2E49A 3E05A 2Z9CA 1XKXA 1NBOA 2ZRKA 3G8AA 2YWXA 3ZWMA 2Y99A 4QC2A 1Z38A 4JIGA 4ZQBA 2PS9A 3UOGA 4ZD6A 5ITZA 2N0SA 3BMCA 2GRAA 3I9KA 2DWPA 2YNMC 1D09A 2OTCA 2PR7A 3KYJB 4O2BF 2G9RA 2CHUA 2SKEA 5KNDA 1P39A 3QF4B 1Z5WA 4GLJA 4Y2YA 1YVEI 3LAWA 1RRVA 4QU5A 4BCDA 3TFOA 1G2OA 3K0BA 1GAWA 3LC1O 5F3WB 3FH0A 4N6NA 3U09A 3M6WA 5JPIA 3DPIA 3E3AA 1OA0A 2FSPA 3HRKA 4NR0A 4W6ZA 5J23A 1NVKA 2Z3WA 2WAMA 4CTMA 4HAUA 3G2HA 3OJ0A 1O08A 4HX5A 4KO4S 3ZXXA 4Q6BA 3DMHA 3JD3A 3MOIA 3L3BA 3RUPA 2AD1A 5ERXA 1K63A 2FW8A 2A67A 1BVUA 2DR2A 2E4UA 2QMYA 5FUXA 5BQFA 3V7WA 5FPKA 1M73E 1J33A 4PHTA 4KXNA 3HBMA 4QXOA 2BM1A 3RVQA 5JRJA 1M8PA 3SJAA 3TLJA 3EQ2A 3N2NA 5ELLA 2AQ8A 2QSJA 2CXSA 4JX8A 2R7MA 2X5KO 1O5TA 3RC2A 3VTKA 1LVUA 2DMRA 1RJWA 3PDCA 3Q0TA 3ZUPA 1B76A 1GM5A 1HURA 1XQ1A 3COPA 4MWDA 4TGLA 4WL0A 4EDFA 1DS6A 2JHCA 3CLSC 2NU7B 1JSXA 2QN2A 1PX2A 2CF6A 2OOKA 3MILA 3PGLA 2YNMA 4FZJA 3UPDA 1T2FA 4DWOA 2F62A 2JNWA 2WPDA 5DCWA 2ZRNA 2O20A 3ZGZA 1EAMA 3IYLW 4K9NA 1V7QA 3V8MA 2D0DA 4WQMA 5KYTA 3PK0A 4FW8A 3TKLA 4P3XA 2SCUA 2V96A 1EWYA 1PRYA 1DIRA 1IAQA 1MQ8B 2E4VA 3E22B 1L4BA 1NBAA 1CC1S 3G2QA 1OHHA 1T0BA 3GFRA 3K20A 4ZVTA 1RHJA 1BXRB 2Z5GA 1P2BA 5H0IA 1JPJA 2BMJA 3GLUA 5KQSA 1ZUHA 3RC1A 3W5SA 2PJZA 1L1FA 1YI8A 2FFAA 3FI0A 3HPQA 1FNMA 3K35A 4Z53A 3C7DB 4AKIA 1I33A 1KZ7B 4UBNA 2V98A 4EJSC 2CZCA 1IJFA 3HY3A 3RC3A 5C9ZA 2JHPA 2QL9A 3JWEA 5K6AC 2ZYIA 1C1YA 2X2OA 4C07A 5JS1A 1E0JA 4J94A 1EWKA 2YV2A 2O1XA 5I4BA 1Q2XA 1V11B 3EEFA 2C7BA 4OJQA 4C7VA 4L3OA 1HE2A 2IUTA 1X1TA 2JIRA 4NMMA 4YRPA 4BE7B 1Z8NA 1T6ZA 2WU4A 3GDHA 2I6GA 1JJAA 1SKQA 2OA0A 1NP3A 1ONSA 5ALKA 4JUFA 4P4LA 3EXG1 1UT5A 4V0QA 5J2UB 1ZBQA 3E1SA 5CYOA 5BWOA 3G5MA 3PKJA 1VLLA 1D1PA 1WSAA 3VRHA 3GCDA 4JMPA 2H31A 4MR7B 4PX5A 4B43A 1UMDA 3EVCA 2ZETA 2XH8A 1R8SA 3OZ7A 1J90A 4UATA 2BFBB 2C29D 1GTMA 3ETCA 4R8RA 5JFOA 4PBSA 2G4CA 4CLOB 4PWZA 4ND5A 3X2EA 2QU8A 2IZZA 4CTKA 5FBWB 5KTNA 3LY5A 3NQ41 1H2FA 3LF2A 1IMJA 1ZGZA 1M2HA 3O84A 3QKRB 2ECKA 5B7NA 2B3TA 4TXMA 1XZCA 4YCNA 1GXSB 2E37A 3PX3A 4KU4A 1P45A 1A9XB 4EJSA 2YYAA 3GNLA 3LPDA 5A6SA 1O9GA 5K6AA 4U7FA 2XTZA 3ESQA 4LQCA 5IZ4A 3QE0A 1HEIA 1TFRA 1SUEA 1T1EA 3QEMB 2P69A 4EVQA 4NYJR 3HLKA 3F8WA 5M5BA 3ONNA 3GVHA 1ADCA 1EZZA 3I53A 4NZYA 5HSGA 3TVDA 3V80A 1Y6GA 1GTRA 3OBBA 5CA0B 3GUHA 4PTYA 4XB6B 5A0FA 4AUMA 5ERGB 3HHEA 1CHNA 2ZRJA 1KKUA 3PEFA 4A6DA 5I8WA 1BDJA 4QYWA 2XTNA 4ZCIA 5DMXA 4BKOA 1PO7A 4B7XA 4BJ1A 4Q15A 1T34A 1TTTA 1B43A 4AKHA 2RC6A 3EVFA 5CB6A 4B6OA 2KM1A 2YWBA 1FFCA 2WJWA 4JT9A 4OQNA 2ECPA 2YZNA 4F4HA 1TM3E 2DEUA 1W0CA 1W6RA 4GE0A 1RABA 2J3EA 2P1DA 2Z4TA 4UU8A 3ADDA 2ERXA 2IS4A 1ISMA 3DT9A 4ZOBA 1BQEA 3VKUA 4K6HA 4DCMA 2GM3A 4MR9A 3FM9A 2IZ5A 4U0JA 2XWBF 2X5NA 4INZA 3ROFA 2J3LA 4FDUA 2HK7A 3IPCA 4L16A 4GLLA 5BT8A 4BJHB 2FQXA 2BFCB 1WW8A 4MO2A 3OOWA 2GPBA 1RPZA 1I4EB 3NZEA 5CDFE 2G70A 4B4WA 1MDBA 1P1CA 3PWTA 5HZKA 2YVQA 4I1RA 5IDQA 1LPOA 1RKQA 3G9ZA 3HKDA 4IDNA 3L4KA 3W3AD 1LPNA 3ZVRA 2DBVO 4YCSA 5AVVA 3NHPA 2ZP1A 1Z13A 2XHEA 2B82A 4HXFB 1EJ2A 1P4JA 1J7KA 2FK7A 2FPGB 1X9GA 5C1BA 1QTQA 3J7AC 5DW3A 1UDXA 2IU6A 4L4XA 4IRUB 3DYIA 1I6KA 5A6VA 5DIZA 1HNXB 2GT1A 3SIWA 2LKCA 2GHTA 3PCXA 1EPUA 3X1XA 2Q0SA 2YV3A 3I2YX 4XGRA 4Y2VA 3VU8A 4M8KA 3THXB 3PUHA 3B1ZA 1V26A 3EWSA 2A59A 1NJ8A 3HCPA 4WNAA 5IC6A 2PWZA 4WCDA 2WFLB 1E2UA 4BO1A 3QXCA 3AUUA 4QFBA 5D87A 4BLSA 3KO8A 2Q6KA 3TRKA 4BYGA 4FDTA 1DI0A 3KVOA 2VOJA 2H9YA 3DZKA 2NXNA 1BXZA 2CMKA 5AICA 2O6HA 2PZ8A 4QBGB 1XEXB 4MCAA 1W8DA 3UMRA 4PYMA 5C18A 2PD3A 1QVVA 3KEOA 1ATZA 1EH5A 1QOZA 2YL2A 3KJEA 4TLLB 1ECFA 1WRBA 4B4VA 3I5XA 3KS9A 1IBSA 2LGJA 2PRYA 2VUTA 1USIA 2O2CA 3CY6A 3IC5A 4YAJA 1AV6A 1NN5A 1QFXA 1CBUA 4LV8B 5D2CA 3WLMA 1K6MA 1NC3A 4EO7A 3QUBA 1XF9A 1U04A 4MB0A 4X1KB 2OQVA 5JXGA 4F4DA 1B8PA 1R0CA 2UZ3A 3PEEA 2R6R1 4FHEA 3DCNA 3TIIA 2F1IA 3C3PA 4E7PA 3LBHA 2IK8A 4HXGA 4YC7A 4AURA 1IHUA 5FUQA 5A9SB 4HGYA 2V9CA 4ARZA 4O25A 4C6TB 2DFLA 2VXOA 3IR5A 4M1ZA 3I39X 2QN8A 3DHNA 3PD0A 5ER6A 5B3KA 5EZQA 3VKFA 1KY4A 2EU8A 2ZRIA 4XVHA 4OA8A 5JCXA 1Z5GA 1U7TA 3P9YA 1Z5NA 2NO9A 2QRVA 2RK4A 1RE0A 2VZLA 4R2HA 1VFNA 2JLXA 3KEQA 5BUQA 3RVOA 2WA1A 4GOOD 4ZI2A 1JG3A 2Z8XA 3FB4A 2E1RA 1WB4A 5I4CA 5DXJA 4RJIA 2GB4A 3ZLVA 4UTPA 1XP8A 3FUXA 4GUDA 4JQZA 3WS7A 3EN0A 1ODTC 1BMTA 4YEDA 3TMAA 4QVGA 3W9UA 1ESMA 1T9KA 3KYDA 4L75A 4KXLA 4M1KA 5H8WA 5KKAA 4UXJA 3AWDA 1CUZA 4Q9JA 2Q2VA 1DC4A 4DLTA 1BKYA 2FI1A 2ERYA 2IHUA 1ADJA 2CLIB 1Y8CA 3TLAA 2AVNA 1FJGB 4RUKA 1Z08A 4Y9DA 3SXUA 3BSYA 3NT4A 1JHMA 3V6MA 3PC3A 3VH2A 5ICGA 3KG2A 2G8NA 5JAHA 2FN4A 4LYHA 4CEHB 2XLBA 2JIZA 3JZFA 3SKXA 5ABPA 4AJ1A 4OU4A 4HXYA 3HWSA 4CM7A 4EOGA 2PZFA 4DJFC 3IL2A 4YHBA 4EB3A 3A14A 4WDQA 4FX5A 4HT3B 3KCQA 2RGRA 4RFSA 4XQCA 5I5EA 4XYMA 2C97A 3K2QA 4ND1A 3PD1A 5H81A 5CDFA 3U3RA 2DBRA 1MB0A 1DKPA 1QPZA 1W44A 3A1NA 1KHTA 3DFKA 1U3WA 4FHDA 4GOXA 5EJ6A 3PQ4A 3H3XA 2B94A 4N40A 1ZVMA 2JD0A 4KKXB 3B9PA 4AXXA 3BB4A 3I64A 4X85A 2PX4A 3NHFA 1J23A 4R84A 4ZOLF 2YN2A 4JU8A 3G2IA 3RJTA 5C5EA 3PJEA 4QOIA 1ZOPA 3NT2A 3N6XA 4GQBA 4NARA 4REQB 5TGDA 3UY4A 4RK1A 4LK2A 2ASVA 1IHDA 5DW0A 4ES6A 4ZIRA 3A0UA 4JBGA 1NQ5A 5DK4A 4CM3A 4ND6A 5JH7F 4J2TA 4B6GA 1UOEA 3AUFA 2QLMA 4DIBA 5TXGA 5I7WA 1L5HA 4BO2A 2QYOA 3B2QA 4I55A 1PZFA 1RIIA 3KZXA 3N7AA 4IMIB 2G9UA 3I9OA 4XASA 3RVDA 1JRLA 1MO4A 2HF9A 3IDSA 5DHSA 3ZU3A 1E59A 5IS2A 4HYTA 2I66A 1ZNYA 1W581 3DE0X 4FSDA 2W22A 5E6SA 2B5OA 1SUBA 1Y1LA 2ACWA 4YBRA 2ZRMA 2CE7A 3JVEA 1NDQA 1P2DA 4LRUA 1WF6A 2Y0EA 3ZC3A 3MCZA 4B3XA 4DWWA 4FHCA 3M5WA 4P86A 2NADA 3FZNA 5KYYA 4CKBA 1IIBA 1GQQA 4YMLA 1S89A 4EFMA 1Q0TA 2BGJA 3ZOZA 5ARCA 3GDWA 4QJ3A 2AK2A 3DTTA 1YL6A 3ZY6A 4ZK2A 5J2UF 1D1QA 2P91A