4XJVA

Crystal structure of human thioesterase 2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
216
Chain Sequence
ATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-acyl fatty acid synthase thioesterase, medium chain
publication title Crystal Structure and Substrate Specificity of Human Thioesterase 2: INSIGHTS INTO THE MOLECULAR BASIS FOR THE MODULATION OF FATTY ACID SYNTHASE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 216
sequence length 241
ec nomenclature ec 3.1.2.14: Oleoyl-[acyl-carrier-protein] hydrolase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xjvA00
3VJKA 4XVCA 5EGNA 1SC9A 3DEAA 4MQMA 1P0PA 2OLEA 4OB6A 1T4MA 4JH0A 3WYNA 1H2XA 1XZBA 2YH2A 2XQKA 1CUXA 1BU8A 4G8CA 1RWQA 2WHRA 4P9NA 3DDUA 2D5LA 2I3DA 2WTMA 4FLFA 3BL8A 1L7AA 1VKHA 1SCIA 1PV1A 2PSHA 4XJVA 3TEJA 3BF8A 3C6XA 4AX4A 2CUTA 1CIJA 3R0VA 3RM3A 1WM1A 1CUDA 3I6MA 2AJDA 2JGJA 2PUJA 2VT7A 1CUZA 3IUMA 2Q0XA 2GBGA 4W9RA 2C58A 2BGNA 3VJMA 4K5QA 5ALQA 4WY8A 3I2IA 5I7UA 2IIVA 4ZREA 3AJAA 4Y2RA 5FDFA 3H18A 4LIPD 5CURA 4OB8A 1CUCA 3W05A 2XB6A 3STYA 4QZVA 3MVEA 4UBMA 1TCAA 3WKCA 4QWWA 3VKFA 4DGQA 3H19A 4GDMA 4WFJA 3FOBA 4K6GA 1ETHA 2WG1A 1O6GA 1WHSA 1MNAA 5JYCA 1GQSA 5SYNA 1CUEA 1CUYA 4YASA 1ZD2P 4TPKA 4JEIA 1BS9A 5BOVA 4FNMA 2PSEA 4UHHA 5ALNA 2HA7A 3O4JA 1MX5A 2V97A 4BDSA 4J0KA 1TCCA 3SC2A 4AMYA 1CUIA 5E4YA 1W52X 4B0OA 1CVLA 4KRXA 1Y7HA 4BCBA 4UHCA 1J1IA 2GBCA 2QUBA 2X5XA 2WU4A 5ALZA 3QH4A 3HSSA 1LGYA 5FPQA 1HLGA 4LXIA 4EY5A 3BWXA 4BBZA 1AZWA 1YS2X 1XZAA 1UZAA 1WCYA 4PO3X 5AP9A 1QIMA 2WJ3A 1UT6A 1O6FA 2Y1KA 1ACJA 1E89A 1XRMA 5C7YA 2DCMA 1LBSA 4UHFA 2PKYX 4KAAA 1F6WA 1A88A 3SWWA 5E4TA 2XUIA 2YYSA 1UWCA 1KU0A 3GELA 1VZ2A 5EHNA 3WKEA 2PX6A 4K2AA 2NW6A 1QZ3A 4ZGBA 1HDEA 2XMZA 4N8DA 3V1MA 3X3HA 4G9GA 5JD6A 1GGVA 1ZI9A 5FRDA 4BE9A 5A2GA 4CCYA 4H7FA 1P0QA 4G1FA 3FSGD 3AUKA 2WLSA 3I2HA 4S0XA 2CBGA 1AMNA 4PSDA 2LIPA 1F0PA 3R3YA 1FSSA 1EA5A 3BE8A 1GPLA 1JI3A 3PF9A 1IZ7A 1EDEA 1DX4A 2VQ6A 4G8BA 4OYLA 1CUUA 2XMBA 3MUOA 2WIJA 1L7RA 4AO6A 4I4CA 1MAHA 2QKYA 3G7NA 3RKSA 5ALPA 4Q34A 3V1LA 5CH3A 1C7JA 1ZD5A 1OCEA 4K6HA 2DHCA 2O2IA 2QTBA 3FYUB 4C87A 5CW2A 4M0MA 1AURA 2VSQA 5ALIA 4AN0A 4YK7A 4FWBA 5K3EA 1WB4A 4OUKX 3AFIA 1BCSA 2OGZA 5DYYA 4E46A 1T2NA 2WILA 2O7RA 4W1SA 1J06A 1CQWA 1XZEA 3B12A 3V48A 5AKZA 4TGLA 5HF8A 4AMZA 5ALRA 4DSAA 1LPSA 3QYJA 4YPVA 3QM1A 2WJ4A 2XUDA 3HJUA 1VJ5A 2WFLB 1EI9A 3FBWA 3F9CA 4KEAA 4QDOA 1N5MA 1SOMA 5HZGA 3M81A 4DSZA 1THGA 1A8SA 1JMKC 3D59A 5C8ZA 5HK8A 3VISA 1YSCA 3BJRA 4EB0A 1Q83A 3HC7A 2ROQA 1TCBA 1GPKA 5JADA 3A2MA 4AZ0A 4DNPA 1EX9A 4DMCA 1QIDA 4LXGA 2QJRA 2DQZA 5ALHA 1QIJA 2PPLA 3B3QA 3O4IA 4W1PA 4DIUA 4BTVA 3M83A 2HA6A 3G8YA 5CBKA 5D7BA 1CUAA 3BDIA 1A8UA 3IBTA 3IVMA 1YB7A 3DD5A 3CN7A 3F98A 3W06A 4U2FA 4CG1A 4ZWNA 4HVTA 3O4HA 5AKHA 1XFDA 4FOLA 3WA7A 4I19A 5D3KA 2OQIA 3WIBA 1JJFA 4CG3A 4HS9A 2ACKA 3EQ7A 4A23A 3QMMA 3HYSA 2G63A 2BKLA 2JGKA 3C6YA 4EZIA 2CMFA 2WFMA 2W6CX 3DS8A 4G4GA 2VATA 3KSRA 2XLCA 4B0PA 1EDDA 4KR0A 5HQ3B 1QIHA 3ANTA 4J3JA 4H7EA 4EHBA 4KE8A 1QO7A 1QOZA 5K3FA 3GFFA 1LPAB 1BRTA 5ALOA 3G0IA 2X76A 3ZLUA 3AIOA 4LYEA 3UMJA 3F96A 4KRYA 3A2LA 1KU6A 1QIKA 3WIOA 4DMHA 1U2EA 5DJ5A 2H1IA 3H04A 2I03A 2XUFA 3C87A 4BCCA 2C0QA 3MUNA 2WHPB 4X71A 5AKIA 2WIDA 3PUHA 4C4YA 5C8XA 2HDWA 3D5EA 1C4XA 3E1GA 3OPMA 2H7YA 2VJAA 1LBTA 1XRPA 1XZDA 4OCZA 2XE4A 3PUIA 3NUZA 3FCYA 4FLMA 1AC5A 4RE6A 2ZYIA 3QPDA 1W75A 1IVYA 3FWHA 1CUWA 4H7KA 4Y2VA 3WKBA 5LZ7A 5CT4A 3A6ZA 4DNQA 3NOXA 4X95A 3PFBA 2PSJA 4A5SA 4UBLA 2BFNA 3BF7A 2XMCA 3PICA 4H0CA 2XLBA 2ONCA 3TJMA 5IVHA 1LPOA 3ICVA 1YASA 3FLAA 2O2GA 4E11A 5CRIA 5DLPA 3R3ZA 3WLAA 2G5PA 1XQVA 3T4UA 1TRHA 4UHEA 1S8OA 3FLBA 1DQZA 3AIKA 1EXWA 1K63A 4JYMA 1GXSA 5CT5A 3EF3A 2V96A 2B61A 4U2BA 4UFOA 4NVRA 1IUNA 4XX1A 2RAUA 2ZSIA 3FCXA 5J3JA 2ZYSA 2AXEA 3I2KA 5HFAA 2BUCA 1CFJA 1XZKA 4ROTA 2OGTA 2HA4A 4WDQA 2Y6VA 1CLEA 1LLFA 2ES4A 1JU3A 1XRLA 2AJBA 4ETWA 2UZ0A 3EIOA 1NU6A 5HCUA 5CTAA 5ALLA 4X97A 1CPYA 1TIBA 3B5EA 4BCDA 5ALGA 5CMLA 1U65A 3D2BA 1MAAA 3ZI7A 5HKBA 2ZVDA 2BCEA 3LP5A 2PUHA 3ZWQA 1J2EA 4U2GA 2WUDA 1NU8A 5T4FA 2JEYA 5ALDA 3W9UA 2HU7A 4G4IA 3D0KA 4KAJA 4CI9A 2G5TA 1WOMA 1JKMA 5AOCA 1EINA 3C43A 5CXXA 4B82A 1XLVA 5LZ9A 1BN7A 1R1DA 3HABA 1H23A 1QIEA 4X00A 4Q1VA 4OSEA 3PF8A 5AI4A 2JGFA 3BDVA 1JJIA 3IULA 4PQEA 3KWFA 2GBFA 1XRNA 4PV7A 3DOIA 3N2ZB 3FNBA 5FLKA 4PSCA 4HXFB 3WWOA 3WK4A 4N8EA 4C88A 1UKBA 3EQ8A 2EDAA 2K2QB 2VJCA 1IUPA 2BGRA 1BEZA 1YAHA 5AI6A 4B85A 3I28A 5AM1A 3QMVA 2HRRA 2WFZA 5EHZA 1XQYA 2RIPA 4UBOA 5IVDA 3H2JA 2YXPX 5D3ZA 4B81A 4HTAA 4GLBA 4X91A 5AK6A 2WG0A 4NZZA 2HA3A 5LZ4A 1MT3A 4CG2A 1XQXA 1Z68A 4QEKA 5H3HA 4Y2TA 4UUQA 2ZJ7A 3V1KA 3HEAA 2P8SA 2I78A 3QPAA 2O7VA 1ODSA 1ZIXA 4QE3A 2QXTA 1GPNA 4ZRDA 4H7IA 3KOOA 1ZJ4A 3C8HA 4LKOA 4BP9A 2ORYA 2H9YA 4EY8A 4J0DA 1LPBB 4U2CA 5HF9A 5A7GA 5AK5A 1UK6A 5JARA 4UBIA 3C6ZA 1EH5A 2O2HA 4RE5A 1LZLA 1LZKA 1DINA 4E14A 3STTA 2DQYA 2HM7A 1A7UA 4H7JA 3WK6A 4Q3OA 1USWA 3DYVA 5BWBA 1Q0ZA 1K8QA 5AM4A 4WJLA 2XUPA 3WKAA 4KYVA 2HL6A 4OU5A 3WQHA 3LIPA 1DTEA 4Y2YA 4NMWA 2XMQA 4PW0A 1XLWA 4N5HX 3FYTA 4BC1A 3LCRA 4BVJA 3NGMA 2V9ZA 5AK3A 1TKRA 5AOBA 2Z8XA 4BE4A 3FVRA 2GYVA 4GWLA 1THTA 3Q8WA 1R4ZA 2W22A 5FV4A 2PSDA 5FUMA 1CRLA 3WWCA 3K6KA 3IA2A 2JGEA 1XRRA 4UFPA 3LLCA 4J7AA 2XQIA 3ZLVA 5JAPA 3D2AA 4GI1A 2X8BA 4H35A 1GQRA 1DU4A 4ZXFA 5EHXA 3OOSA 4X6UA 5T4HA 4X6YA 2VEOA 5CH8A 3GA7A 2E3JA 4JNCA 5JAUA 2J3DA 1B6GA 3AINA 3DQZA 3FSGA 2CEKA 2Y6UA 1H2WA 2DHEA 4MWTA 4A16A 5KWJA 3BXPA 3C70A 5AOAA 4X3CA 4B80A 2WHQA 3F8SA 3GROA 5A7HA 1ORWA 2JGMA 3DJYA 1X2EA 4BZZA 4QNNA 2R11A 3G9UA 4Y7DA 5IVKA 1CUFA 1BROA 1LNSA 2QXUA 2XUOA 1I6WA 1WB5A 5SYMA 5DNVA 3WJ1A 3WZLA 1UK8A 1D07A 3OC0A 4J0HA 3ZLTA 1MX1A 4J0GA 3L1HA 1YA8A 2RONA 3WJ2A 1ORVA 4L72A 5JD4A 5BWCA 2J4CA 3ILSA 3WK9A 5HF6A 3ESDA 1GKLA 4CFSA 4GEGA 2ECFA 1MJ5A 4C01A 3D2CA 3AZOA 4JUIA 3NWOA 5FPPA 2VT6A 2XUJA 1RP1A 5AM0A 4Y2QA 4G9EA 3LS2A 3W2TA 4GHWA 3KXPA 4QDXA 4RGYA 4F21A 4DMFA 1EK1A 3C5WP 4B6GA 4OU4A 4Q05A 1ZGCA 5JAHA 1BN6A 4OD0A 3LIIA 3KDAA 1M33A 5A71A 1XROA 3DKKA 2IITA 1QIGA 2VJDA 3ESAA 5I9IA 4BAZA 1E66A 4HRYA 1H2YA 5T4BA 3M3DA 1OILA 1K6EA 1HBJA 2OAGA 1EB9A 4KE6A 4DMKA 4Y2UA 1AX9A 4MXDA 3H2HA 3IUQA 5ISMA 1X70A 3OTQA 1GT6A 4P93A 1QIFA 1R50A 4ARAA 2PU5A 4B9EA 3H1BA 1Y7IA 4H77A 1KEZA 1YS1X 2R8BA 1WHTA 5AK4A 3WWPA 3YASA 1MX9A 3R3WA 5F4ZA 5K5EA 4IH9A 4U2EA 1W76A 4GBGA 3VDXA 4FFWA 1BEEA 1P0IA 3RARA 4D9JA 2PM8A 4O08A 3D4LA 3U1TA 2DFPA 1IMJA 1QLWA 1VXOA 4JYPA 5JZSA 5LZ2A 3G9TA 2GZSA 1YCDA 3R3VA 5JAOA 2PL5A 4P08A 4F5ZA 3AZQA 3GZJA 5DYWA 1UOQA 1FFBA 2XUKA 3H2KA 3QMWA 5HF5A 5LYYA 4B9AA 4BYMA 3OG9A 3O95A 4B7ZA 1B41A 4J0IA 3JW8A 1XZMA 1UFOA 1VA4A 3UUEA 3QVMA 1JMYA 3FYUA 3W04A 5AKJA 3HI4A 2CZQA 5C8VA 5AM2A 4OPMA 2XUAA 5AI9A 3ZV7A 3WYDA 4WFIA 1XZFA 4BTLA 1QFMA 4HZGA 1TAHA 3EBLA 3QPCA 2C7BA 3HRHA 1XQWA 1MNQA 3Q0TA 5FP0A 1IZ8A 3DL4A 1E8MA 5JIBA 2QS9A 1R9MA 3H2GA 5KWIA 1VZ3A 1F8UA 2WFLA 2XDWA 4X7BA 3A70A 2IX9A 3G9XA 2Z5GA 4Y9SA 2XMRA 1E8DA 4IH4A 5JALA 2PSFA 4YX9A 3IUNA 3HZOA 2OAEA 1YR2A 2JGIA 1H2ZA 5AHXA 1J07A 3PI6A 1RYYA 4BZWA 4IQ4A 5FKJA 5JZBA 4GW3A 4K6KA 1VE6A 5AKXA 1BCRA 5AKKA 3G0BA 2GBIA 3PE6A 5ALYA 3IIIA 1JU4A 4DNOA 5E4JA 2EDCA 3W9BA 3WZMA 3C8DA 1X2BA 4C6HA 3DCNA 2ZSHA 3STVA 5DTIA 2AJ8A 4DNFA 1CUSA 2XUGA 4IHAA 1CV2A 5LP1A 2WTNA 4X93A 5JD5A 2AJCA 1YB6A 4HAIA 5AKGA 4QDUA 3L1JA 1DWOA 3JWEA 3E4DA 3H2IA 3WKDA 2WG2A 2OG1A 4J03A 3H17A 3I2GA 5LKAA 1QIIA 5AKYA 1ZD4A 1YA4A 2XMGA 1CR6A 4HXEB 1XZGA 4MJ3A 3FYUC 2QR5A 2OPHA 4Q82A 1EVQA 1E8NA 4FDMA 4I3FA 2RI6A 5HQ3A 1K5PA 1CUHA 3ESCA 3TGLA 4QWMA 3SK0A 2ZYRA 4ZV9A 2DHDA 3CCBA 5JANA 1NX9A 1XZLA 5AIBA 3ED1A 1JJBA 3I2JA 1C7IA 2BUAA 3WI7A 5ALVA 1K4YA 1QFSA 1FJ2A 3AIMA 4LXHA 4MEAA 2PVSA 2RHTA 2VJBA 4BATA 3F97A 2BUBA 3K9BA 2H7CA 3STWA 5AICA 4AQDA 4QLAA 4H18A 4INZA 2CKMA 4CCYB 2ZYHA 4PNZA 4WDRA 4W1QA 5AKLA 4C89A 2WHPA 5K3BA 3D3NA 1SFRA 1EDBA 5ALKA 2WIGA 1N1MA 2YASA 3CXUA 1LPMA 2QVBA 4Q3LA 4G4JA 2B9VA 4X85A 2VAVA 2WUFA 4J0JA 2C4HA 4EUSA 1BE0A 3H1AA 5ALSA 3G0CA 4Y2PA 3G0GA 4Z49A 3L1IA 2JGLA 3TRDA 4X90A 4H7HA 1QJ4A 2HFKA 1UOPA 3UUFA 2GYWA 5DWDA 3GBSA 3K2IA 5JATA 1XKTA 3JYHA 1PJAA 4UHBA 2RGUA 1AQLA 2ZJFA 4UHDA 1G42A 3V1NA 5K3DA 3QBJA 2EEPA 1CUBA 5ALWA 4BRZA 5JASA 1QE3A 2GZRA 1A8QA 3BIXA 1G4HA 1P0MA 3WL5A 3V9AA 4GXNA 7YASA 4H7DA 5LKRA 1U4NA 3C6BA 1DT3A 4AN1A 1ZJ5A 5HFNA 3IUJA 3CN9A 2XMDA 4X92A 4AO8A 3HXKA 2OCLA 4Y2SA 1R9NA 4F0JA 2Y2VA 2OQVA 4PF1A 2QM0A 2HU5A 1UXOA 3OM8A 1LPNA 3F67A 1XKLA 3EQ9A 3O9MA 5AM3A 3ANSA 5CT8A 5IKXA 3OURA 5K3CA 1XZCA 4ZI5A 1FFDA 3R41A 1CUGA 3IDAA 3C45A 3WWEA 4L3WA 2XQGA 4RNCA 4FNGA 1TK3A 4L9AA 1ACLA 4BVLA 4OB7A 4Q3KA 2H7XA 3HLKA 1N8SA 1ZD3A 2B20A 1XLUA 2JIDA 4QLOA 1E3QA 2XUHA 1PFQA 1Q84A 4EBBA 1DT5A 1HPLA 3MGAA 2J3QA 5I8PA 2XT0A 2HA5A 2BJHA 2AJLI 2XQJA 4RPCA 2WQZA 2BAGA 2FJ0A 4W1RA 3SX4A 2FX5A 5EIAA 1IUOA 2WIFA 1GZ7A 5AIAA 4WCVA 5ALMA 4ARBA 2JEZA 3FVTA 1N5RA 3S2ZA 2JBWA 1VE7A 1QTRA 2HIHA 3DLTA 1EB8A 1ZI6A 3R3UA 4DYHA 3I6YA 1CQZA 1R3DA 1QONA 4UBKA 5K3FB 2V98A 3P2MA 5AJHA 6YASA 4FTWA 3O0DA 1UOOA 5IH7A 2HHAA 4M0FA 5D6OA 5FXMA 5A62A 4HRXA 3IURA 4Y2XA 4MEBA 4B83A 1MU0A 3E0XA 4IH1A 1DX6A 1UKCA 2Z3ZA 1FFEA 3O4GA 2WUGA 4XIIA 5A6VA 4UPDA 2WM2A 3DKRA 4FHZA 4EA6A 1JT2A 1F0NA 4TVKA 2CJPA 2XI4A 5LIPA 1LPPA 2QJWA 2C5GA 2DSNA 4FBMA 4EY4A 2G4LA 3C5VA 5AI8A 2FUKA 1W1IA 3STUA 4BB0A 1XRQA 4LHEA 4KE7A 1AKNA 3S8YA 2OCKA 4J0CA 4BRSA 4M0EA 5ALFA 3BJMA 3ICWA 3E3AA 4DM7A 3FLEA 4FFVA 4L0CA 2XQFA 2OCIA 1ZICA 5ESRA 5YASA 2C0PA 1Y37A 2HU8A 1FFAA 2OCGA 5CT6A 1VLQA 1WB6A 3H0CA 4QDZA 3PFCA 3STXA 1ODTC 2WU3A 4G5XA 4U2DA 3DL7A 3IB3A 2XUQA 5FOQA 1UK9A 2OXEA 2WKWA 2QOEA 4DLNA 3VVLA 1JFRA 4B84A 3HACA 3ZPXA 1ZI8A 4CIBA 5ALEA 2I3ZA 2VAXA 4BAUA 3WMRA 3G02A 2PBLA 1OXMA 4AB1A 3VXKA 3I1IA 4WY5A 5DNUA 4ZV7A 2Z3WA 3VVMA 1UK7A 3AILA 4KJXA 4WFKA 1MN6A 1AGYA 1SCKA 2QMQA 3T52A 5AM5A 5CH5A 5EIHA 4LYDA 4AXBA 3N0TA 4PSUA 4CCWA 2WUEA 1CUVA 4FMPA 5C81A 4BVKA 1DWQA 1YAJA 5JZ9A 2VTVA 3KD2A 5ALUA 1L7QA 2HA0A 1ZIYA 1R88A 2VF2A 3DNMA 2WIKA 3I2FA 2XMSA 3G0DA 4BAGA 2C5FA 4UBNA 4QA9A 4MQLA 2ZJ6A 1EVEA 5AO9A 4AZ3A 3WK5A 3O9VA 1VOTA 4FLEA 3R3XA 1XZHA 3PDCA 1G66A 2FJPA 4NS4A 2D0DA 2J4FA 2GYUA 1HL7A 1HKHA 1TQHA 2Z8ZA 4P92A 1ZOIA 1FFCA 3WK7A 2RHWA 2WSLA 4FBLA 3AZPA 1XZJA 1QTIA 1Q0RA 4MYDA 1MO2A 3FAKA 1GKKA 4DTCA 1U8EA 4E15A 5ALTA 2OGSA 1VXRA 2PU7A 1MPXA 2QRUA 1DQYA 4V2IA 5AKEA 3WL8A 4BDTA 3ESBA 5AI0A 5AI5A 1XZIA 5LLSA 3DOHA 2Y2UA 4MWSA 2JF0A 1ISPA 2QUAA 5K3AA 5A7FA 3WL7A 3R40A 3RK4A 1MTZA 5ALJA 5AH0A 3M82A 5CXUA 3D7RA 5EI5A 3WWDA 2HA2A 4BP8A 5EFZA 3GUUA 1HQDA 3VJLA 4UBJA 5BV7A 3G9ZA 4KACA 4BC0A 1W4LA 2B4KA 5DNWA 5KREA 1EHYA 4F60A 5LZ8A 5DTJA 3WL6A 4HXGA 4AO7A 3U0VA 5HKAA 4OYYA 1QGED 4XWGA 2VA9A 5KBYA 4CIAA 4KAFA 2HADA 5DYTA 4IO0A 5LZ5A 1ODCA 4UFNA 4N5IX 1CEXA 4C4XA 4EY6A 3RLIA 3CCCA 5ALXA 4EY7A 4N8SA 2DR0A 5IVIA 2HFJA 1DWPA 2ACEA 1W6RA 2QZPA 2HRQA 3DYIA 5EHQA 5T4EA 3I6ZA 1QO9A 3WK8A 1EK2A 1CUJA 4C4ZA 5CT9A 3A2NA 4GECA 4W63A 2WJ6A 1VA5A 3WA6A 3KWJA 1G5FA 1WPRA 1UKAA 1E5TA 4KE9A 1AUOA 3QITA 4Y2JA 5EIEA 4X94A 4MYSA 4G8DA 1SCQA 1H22A 1ZGBA 2CB9A 4FKBA 5HK9A 4QDTA 1WPXA 4X6XA 4ITVA 3I1YA 5E2IA 3QZUA 3BIWA 2QT9A
chains in the Genus database with same CATH superfamily
2QL9A 1L4BA 5ESXA 5T8KC 4KMSA 3VJKA 4AP9A 4NFYA 5EGNA 4CPDA 5CG1A 4ALNA 1H6DA 2AS0A 2FVXA 3L5KA 2IH5A 2E55A 4OB6A 1QKJA 2IYOA 2XX3A 1RJWA 2WIBA 4EPWA 4LGCA 3VHLB 3KOXA 4B3SB 1HUQA 4QQFA 1H2XA 3GP8A 3GRVA 5K0CA 2R96A 3OHPA 1TM2A 4U7FA 5JTTA 4GGMX 4ZT4A 3SYTA 5B1DA 4E5KA 3R5FA 3Q87B 2OV4A 1FVFA 1NIJA 1YIOA 4D44A 5IDXA 2EKDA 3DAFA 2VZ8A 1T1SA 4HQNA 1VDMA 3PG5A 3ICPA 2GARA 4H6VA 2YXBA 4A15A 2NUTB 3R24A 3UK1A 3NORA 5E0KB 3UXHA 2RGYA 3A1TA 3OZIA 1JHXA 3DE6X 4TWRA 4HBZA 4BX9A 3HCOA 1H1DA 2B1IA 2ZE8A 4GZLA 1NLFA 3CINA 4TROA 1DJNA 4AG5A 3A3YA 1E94E 1QYCA 4FGZA 4Q4HB 3L0IB 1U7ZA 4XJVA 4MQ5A 4A8JB 1M0EA 2H54A 2I71A 2QTCA 3IUSA 3I3SR 2P5UA 5J4VA 3AXSA 4ZT6A 1S02A 3B2EA 2GM9A 2FEMA 1T4DA 4MRMB 1C3OA 1WKCA 4JEHA 3D0RA 2CLFB 4KIUA 3FZQA 1T6BY 2FOIA 4G2TA 4TN5A 4XRRA 2X5OA 3N2LA 4QOGA 3ICCA 3RM3A 1Y4UA 3RVDA 2OO7A 4CGYA 2CL7X 2GVNA 2QLTA 4DJEC 5K8JB 4R98A 2PGDA 4LYHA 3TIXB 1PCXA 1NQUA 4BFUA 1PNQA 4N41A 3LPNA 1XNJA 5CW1A 4F2DA 1T9CA 3NRJA 4AKEA 2IVZA 3U81A 1O97C 2N42A 2V7EA 3AG5A 2FWAA 2J0QA 2EQBA 3GYGA 2Q07A 1GUDA 3HA7A 2YBDA 3PHHA 3QWHA 2SKEA 5GWXA 3UZUA 2R7NA 4M1QA 2C2HA 1KI1A 3IUMA 4PPNA 4TKZA 4F1KA 6REQB 2I67A 3J80A 3TQHA 1CJSA 3M6UA 3HU5A 4A27A 3KQPA 3LZDA 4ZCIA 1I32A 5MFPA 4KPFC 4R2MA 3CB4A 1ZK3A 1KFEB 1NN0A 2H9IA 3LLSA 3NEPX 1H0KA 2CJFA 4UMEA 2UAGA 2X40A 3NHPA 2MSNA 4R7TA 3NH6A 3LUFA 3I9JA 1HSOA 1BHSA 1S8FA 3TL3A 1V7CA 2ET6A 3TLGB 4AW9A 5DLDA 5DHPA 3P0JA 1KO8A 3DWIA 3K0SA 1LV8A 1GPUA 4KQIA 2H2FA 4XIJA 1OMOA 3HCCA 3WYAA 1EE2A 4D79A 1EWQA 2IIVA 2QQFA 3T9DA 4BO2A 2XW6A 4Z4QA 1O3YA 2NXJA 3JYPA 1H85A 4LDAA 1HG1A 3OZ7A 4PU0A 5JDCA 3WHLA 4TWBA 1PE0A 2D2FA 2WLTA 3NFYA 4DXDA 1FSFA 1QK5A 3QU9A 1B26A 3BTUA 3IEXA 2G1JA 2O7NA 3ON5A 1DZIA 2PGIA 3TQSA 1JWLA 1QHEA 4RDHA 5A4JA 1GGHA 1D7AA 3H2YA 3W4KA 1DOZA 3BB1A 3ZCPA 2Q4OA 3ZGLA 2ENUA 2F4NA 3HM2A 1U7OA 1RJFA 4FONA 1PIWA 1L5QA 3I9OA 4OQ4A 5E7JA 3AYZB 3RHSA 3VVCA 4DGQA 3K0BA 5M29A 2G72A 2PYIA 3FOBA 1SIBE 4K6GA 8ATCA 1Z2DA 2CDBA 5AXDA 3VYWA 1SHTX 2WG1A 1UEJA 4OM7A 3GCWA 1XMXA 4EJ0A 4LC0A 5F2OA 2FKAA 5AXCA 3MJDA 4EHJA 5SYNA 2D54A 3LKBA 1P8AA 1XL0A 3AIIA 4FINA 5AVWA 5KOHB 2EGUA 2PGNA 4L28A 4EUHA 1FTGA 1FYVA 2XQVA 4QFDA 2YN4A 4P58A 3IUEA 1ECGA 2DUWA 1ZD2P 2H1CA 2QUIA 4JR0A 2I1LA 1RRVA 2WYWA 3FPBA 4KWHA 4OGGA 4ZJYA 1GYPA 4DJ5X 1QGYA 1X39A 2ZW9A 3KPUA 5DE3A 1H1TA 2F1HA 2O20A 3CEAA 2D1FA 3HJAA 4UHHA 5CX4A 5JECA 4DIBA 1E1KA 1DKMA 1MF7A 1CHDA 1O9HA 1TCCA 2H3EA 4YUZA 2R65A 3OA0A 4WV3A 5EXSA 1CD5A 3WNVA 2H08A 3GFQA 3SY8A 1L5VA 5B4UA 4EW2A 4B0OA 4XOUA 2ZI3A 4ODIA 4CTMA 3NFRA 5K6AA 4BWYA 5ADVA 1YL6A 4PWZA 5MFZA 4F7DA 1MO6A 3D5TA 1E60A 4DADA 1LUAA 3WHKA 4RYLA 2GBCA 1GPYA 1Y8RA 2X5XA 5JROA 2ON6A 2XECA 4X3PA 3C6KA 1Q3HA 4IS3A 1YACA 3O8QA 1XPOA 4NICA 3EXEB 2NVOA 4BBZA 5C34B 3OZGA 1UP4A 4BNXA 2OHJA 1C0KA 2FPGA 2QRPA 5ERGB 1QVZA 5B30A 2B4AA 1UZAA 4MO2A 1AJEA 2QQGA 2G6TA 4EHNA 4F84A 1BE6A 4YROA 5AP9A 4MUBA 5CCDA 4MTLA 5DSTA 2ZJ0A 4OI1A 4I50F 3RYTC 1E9EA 1UT6A 2QRHA 4M22A 1T29A 1KAEA 2GCPA 2QTVB 1E89A 1XRMA 3G88A 4ZALA 1TLLA 1LBSA 4M7RA 4PFJA 2OYRA 3FHCB 1VG1A 3Q2OA 3GL9A 4NBRA 3MIIA 3T9BA 4PHHA 5D5QA 6ADHA 5J2UA 4GP6A 3N6XA 1XX6A 4HQLA 3ETGA 3O1LA 1DEOA 4KZPA 1SKYB 3S70A 5KTYA 5GZ1A 4DZTA 1KR5A 2ZJOA 4G5SA 5EHNA 4QU8A 2FRVA 1GNTA 3WKEA 3IJPA 4ZI7A 2ZRAA 4GL4A 4D4IA 5JC8A 1SQSA 3QEAZ 3AJDA 3OCUA 5FOTA 3DMGA 1N5OX 5J2TA 1QZ3A 2GK3A 4ZGBA 4C7VA 4N8DA 2VHQA 3U4IA 2ZR0A 1TECE 4G9GA 2EEZA 3AUJB 3GA5A 4L0MA 3DEYX 4LNUA 1BQ3A 3QEBZ 4I08A 4NULA 1DAIA 4RADA 2G77B 2P41A 3C3MA 5KOHA 3A4TA 1JDBB 1XDDA 2FUG1 2IP1A 2YW9A 3CPEA 3BXXA 5B37A 3VSBA 2P9ZA 3L4SO 3SZUA 1P4AA 3GUZA 4CCYA 3QXHA 5LDHA 3FVVA 3SSMA 3AUKA 3LBNA 4JT9A 4MVXA 1W49A 4S0XA 3UW3A 5KTSA 4C2TA 4JITA 1AMNA 1K9VF 4MRNA 2I2XB 2JS7A 2LXNA 3R3YA 1F0PA 4LVCA 5JEDA 4HMPA 2IQ5A 3OCCA 4G0PA 3ENNA 3SJCA 2RGEA 5GVRA 3PIDA 4J0EA 1JI3A 4G0MA 4I3HA 1HQKA 1PJBA 2OENG 1KNQA 3JQRA 4LXXA 2O1XA 2VQ6A 5GV7A 4D2IA 1UC5B 2RCNA 2GD6A 1N25A 2P3QA 3U60B 4MQEB 3DE4X 1L7RA 2QI9F 5F12A 3DF9A 2H59A 4I4CA 1SCJA 1H65A 4IBOA 1Q0SA 3THOA 1JEYB 1Z4LA 3EPPA 4WPGA 1KZ4A 3RKSA 4PEVA 3CCFA 1GRQA 3OQ6A 1XQ9A 3GFGA 3MMXA 4GSLA 1Z5UA 2C5BA 2HSZA 4C0JA 3GMIA 4Q9JA 2O19A 4YACA 3BILA 4MULA 5I7EA 2C29D 4QODA 4PGAA 3WRXA 5FL7A 3NT2A 3ZVLA 3FYUB 4UU8A 5IBRA 5AVKA 3RVKA 1AURA 2VSQA 4C87A 4D5EA 3IQHX 1T5BA 4AN0A 7REQB 2PH1A 3HCEA 4K0KB 1GFSA 4DA9A 2B7BA 3ORQA 2IBMA 1KEEB 1ZVJA 1DKUA 3QNUA 4YNBA 1W9HA 1EDOA 1SKBA 1XNGA 2GVDC 1R9JA 3A4YA 3QU4A 1OB5A 3P9PA 3GRKA 3A04A 4OXIA 4FU0A 3MPOA 4EIWA 3FW1A 4GGPA 3QLVC 4D4GA 2DXIA 3PCRB 3N05A 3KYDB 2OGZA 3VR5H 4L74A 4GM0A 1LNZA 4E46A 1TQ4A 1DP4A 4UNQA 1ZS9A 5F5NA 1T36A 1M7BA 1QS0A 2N47A 3KVNA 3AL0C 4AYXA 5CX1B 5IN4A 3K94A 4OREX 1MXHA 1U2TA 2QN1A 2YINC 3F6YA 4BVBA 3A3NA 4GZMA 2DG2A 2LR0A 3FNIA 4AMZA 1KGDA 1UBRS 4CZ2A 4N9WA 2FEKA 5SZJA 3VKGA 1AUQA 3QYJA 1GG5A 3UGQA 2Z4RA 2C97A 4YPVA 5C8DA 2WJ4A 4LGVA 2C03A 3VZRA 1SRRA 3DXYA 3GGDA 3WO1A 1CP3A 4K86A 4EW1A 3KUCA 1XYVA 1QH8A 1K5DA 1P1CA 2WRZA 3WV5A 3V9PA 4US2R 1YV9A 3SI7A 2VHWA 5C5IA 5AW6A 1Z35A 1STOA 1SOMA 2O1SA 1Y1SA 5ICEA 3WG9A 4D6XA 5HZGA 3KFLA 2BI7A 1IY2A 1RC8A 3N2GB 1FJGB 1UJ5A 1H0HA 3SS9X 2P2GA 4O4IA 2WSSD 2XADA 4M49A 3KUKA 1NX6A 4PC2A 4ZVPA 3CNOA 1UBHS 5ES3A 1LV7A 4BKOA 3FXAA 1H4VB 1WUKS 3BZUA 3EF1A 1PJ8A 3AUUA 4GO1A 2JLZA 2VP3A 1P74A 2O0JA 2VRCD 1CY6A 5JADA 3KKMA 5JS7A 3ZHRA 1X3SA 2VPTA 5LBTA 3RAFC 3U7JA 3TX2A 4M9CA 4DNPA 1JR3D 4ZO8A 5JDIC 3X1YA 2J7PA 4LXGA 2QJRA 2BVNA 2P9EA 2FCRA 2H1SA 3LVBA 2IY9A 3HDVA 4KMMA 1TAQA 2R44A 2RGNA 4PZUA 1UC9A 2RJNA 1Y3CE 3HCWA 2J3KA 2D7JA 2E7ZA 4FDTA 3VTAA 4DIUA 3MOSA 4HV4A 1KBQA 4FOOA 1AHNA 2ZYWX 5CBKA 1AV7A 1CUAA 3LWBA 2O8EA 3F6BX 3DLBA 1A8UA 2G04A 1Q7BA 3BD7A 1XHEA 5EXDA 3JQBA 1U0JA 4RORA 4BMOB 1DBPA 4M1SA 2WMOB 2VPQA 4E5PA 5HX7A 3Q3HA 1R66A 4RKWA 4ZQCB 4ZCQA 1EFDN 1WU7A 2CXXA 4GOND 4CEIB 5HP4A 2RHRA 1CJCA 4O2BB 4Q9DA 2PX4A 1GLVA 2B7LA 3BX1A 3WHPA 4BX2A 4EMUA 2C3PA 1BZYA 2I6QA 1YQQA 4Q47A 3H5LA 3HHEA 1T3GA 4BLQA 2J0UA 2AE1A 4FDAA 4GZ5A 5DHTA 1AQYA 2WKPA 4QBHA 1AH2A 1SA0B 3N2KB 1NVBA 2QT1A 1V7QA 1ECCA 2F9MA 1NHWA 1YQDA 4WXHA 1S7GA 3ADOA 4FNAA 1IY9A 2PFKA 1BXGB 2HMAA 2UVPB 3DAPA 3FWYA 3IQGX 2OQIA 2PSSA 1OLXB 2Z2IA 2N75A 4HEA1 4JL5A 4LE1A 4N5MA 5JZOA 2PUGA 4C30A 1JJFA 3DCJA 4CG3A 3ABQB 3ETHA 3PWSA 1YJXA 4S1TA 1AMUA 1TA0A 1HI9A 2IIPA 1XNRB 1GA1A 3B1WA 4FMCF 3RK0A 2ZVJA 2ZB4A 3BMCA 1HM5A 1KJ8A 1A1SA 2Q4EA 2ECOA 1ZYUA 3K1ZA 5CJJA 5FBHA 1S8NA 2WFMA 4DCOA 5THKA 4M8IA 2AC2A 2DP4E 5DX1A 3DS8A 1NDUA 4RH1A 4RABA 2QSYA 1NXSA 3IOMA 1ZSNA 2ODPA 2QRQA 2XLCA 4NV1A 4ZCSA 1ZO8A 2B1RA 3R8CA 4MH0R 4B0PA 3ERCA 4KR0A 4MKIA 1EHCA 1F6DA 2BH2A 3UK7A 3N86A 5JCOA 1Q12A 3E8XA 4O4LF 5JSHA 4DQUA 3GRFA 3GFOA 5LQJA 2A33A 1KDOA 1XVIA 2OBXA 3CRVA 3IIMA 4KE8A 3BMXA 1RZRA 1L5LA 2A9QA 3HR7A 5MN4A 1IWOA 2ZUWA 1XA0A 5LQUA 3G0IA 2HLPA 4ZQIA 2X76A 2CHUA 3AUXA 3QFCA 1BDMA 3PLRA 3RPEA 3ZV5A 4LYEA 2E5LB 3GI1A 5FOVA 4AKGA 5CFRA 4U00A 3EFHA 4MWOA 4KRYA 2Q8QA 1QDEA 1S2GA 2ZBPA 2F3SA 1XPRA 4UM5A 1QIKA 2CHGA 4CLDA 3OI7A 1OV4A 4I55A 5BPHA 3UHPA 3WIOA 1YJ8A 4OO3A 5TT1A 1H8ED 2QL5A 5GM2A 4NZOA 5FBKA 1EGMB 3ITKA 4XVUA 5G0SA 3CKLA 5GM1A 2H1IA 2PT5A 5CNMA 3NM5A 2F1JA 5GONF 1XCPA 3ZY2A 3OPYB 3V55A 3UXYA 4BB6A 4BFVA 2QW1A 4JVNA 3O8OA 3C7TA 4D45A 3MUNA 2F8SA 4R2WA 2ZULA 3G2OA 1R8JA 4MYTA 4CKCA 2WIDA 5K45A 3PDJA 3PUHA 1QGZA 3QI2A 4C4YA 5KINB 1DLIA 1KP3A 1GN9A 5K0TA 4NECA 5A04A 5EG5A 3RS3A 3IQIX 3L8DA 5CG2A 2FW7A 3L8EA 4HB4A 1K6IA 2CD7A 3JWHA 2GR9A 1LFAA 1NZFA 2QD3A 2PX8A 3E1GA 3OPMA 4URUR 2H7YA 1DC8A 2VJAA 2D2XA 3C7KA 3IE0A 5AVQA 1XRPA 2AYYA 3IEPA 4K9RA 1E2EA 1NW9B 4BN4A 3OP4A 3CX7A 3JXEA 1W35A 1G5HA 4NCNA 5DYGA 5IH3A 3PUIA 4ER5A 3F6SA 1BOOA 1GG8A 4L27A 3RRJA 3KTAA 5CCEA 5DKFA 3NUZA 2ZXFA 2NPFA 2FPLA 3OOJA 1TOAA 4E1VA 1V26A 5CB4F 1SOVA 2AFVA 4RE6A 4NYJR 4RXUA 1IDN1 5E1MA 2XOKD 4QATA 4EYOA 2Q3BA 3E03A 5FUXA 5KJFA 2J48A 4CKYA 1IVYA 3R77A 3MNFA 1LBQA 4CI0B 2H1HA 1PD1A 4HGOA 3MOIA 4EI7A 4DNQA 3WMEA 1OXTA 2P9QA 4DY4A 4X95A 3FJOA 3MTJA 1YJCA 3WVNA 3NONA 3ZZMA 4KXMA 3ULKA 1OB2A 2W0MA 1HDCA 2APJA 4UBLA 4JHXA 2XIQA 3MGKA 2XOKA 1E1RD 3QU5A 3HMKA 1UBUS 3BICA 3DL0A 3FN4A 2P3SA 3NAQA 3PICA 3V5NA 3ZXIA 5EMNA 2Q0QA 3SM9A 1Z38A 4JLPA 2WYHA 1A1VA 3RRMA 3A6HA 3BIFA 3C2QA 4YHBA 4ASUA 2WUVA 2XLBA 4F5DA 5KNLA 5JNRA 3U9SA 4X1KA 1LSSA 3QXJA 4JYZA 4Q1BA 4AU1A 4EJFA 3IFSA 2P35A 3M70A 1E0SA 1XRJA 2CLIB 3R3ZA 1R74A 1PZXA 2KPOA 1G7TA 4GOMD 4F6RA 4UDYX 4JJZA 3OU6A 3NBYC 1JEYA 3IRUA 5DIFA 1TVKB 5EWJA 4UHEA 1S8OA 1DKLA 3RJZA 4TTJA 2FPWA 1L4GA 1DAMA 4HSEA 1QQAA 1Z62A 4BLWA 2Q50A 1Y9EA 4GPZA 1YBMA 2RIRA 5LP6C 1GGNA 2CMHA 2O8DA 5SY4A 5I4IA 1R6UA 3K8YA 4IOKA 4OX9B 5CT5A 3U37A 4P32A 4UNIA 4I9FA 4DWJA 5JI2E 5F1PA 1NBIA 1IIRA 1JBKA 2ORWA 4KGZA 3IS3A 4U2BA 4DRXB 3HO8A 1IUNA 4PLTA 3L92A 3EQ6A 2F1OA 2EJVA 2WKRA 2OLKA 2Y1GA 3GEPA 2VLBA 1PT5A 5LD2B 4Y2HA 2L2QA 4YJHB 4MUGA 1JBEA 4OQEA 3TQQA 5K20A 2C04A 2JPDA 3I2KA 3IO3A 3C3XA 3FDIA 5HFAA 4O29A 2LE0A 2BPOA 2ZIVB 1P9LA 4TM8A 2RB5A 2FCAA 4L16A 5KHAA 3WQBA 3RUFA 1BVRA 3I05A 1KZ1A 1QYIA 2OGTA 2D00A 3FPLA 2HA4A 1U7TA 1UMCB 4HAYA 4O2AF 1GOTA 5BMVA 4WDQA 3Q3GE 1RDFA 3OZFA 2Y6VA 3C4VA 4V0NA 2GEJA 3PFNA 1HE1C 1CYDA 4NBTA 2NZJA 3WGUA 2XRZA 1IQ0A 1IZYA 3AF3A 3NHLA 5LOVF 4TYWA 2QZ4A 3ZCVA 1J8VA 4UDXX 1WOYA 2YVLA 1WCIA 2C5EA 3WGLA 1NU6A 4UKDA 4BS9A 3DFKA 3L4BC 5A4IS 3AR5A 1WD5A 5AMXA 4H7PA 1PFGA 1XA4A 1DOHA 2QN3A 2H85A 3CWCA 4ZO7A 3TSAA 2G5CA 3UOAB 4EYQA 4Y98A 1CF2O 1OXKB 4KTTE 3RYCB 3DMPA 1U0GA 2DWUA 4G1VA 2AR0A 2ZATA 3E53A 4YC7A 5A9SB 1PVDA 2VHCA 4JWTA 5CBPA 1D9ZA 4FNOA 4V1CB 2ID4A 3D2BA 3AOEA 3TM5A 3CNNA 1MAAA 3VNVA 3BREA 5DHFA 2IIQA 2O2XA 3SDSA 5MHTA 4GX5A 1ZN8A 2OAP1 3RG2A 2OP0A 3RJMA 4HP8A 1C8LA 2ZZNA 2V8OA 3UEOA 1W1WA 1N6RA 3PXDA 1GPBA 3PJDA 1J2EA 4U2GA 2WUDA 3RS9A 2P65A 5JRJA 1WV0A 3GEMA 3TN7A 3V8VA 4AP6A 4C5BA 1KDVA 1KA9H 1PAUA 4RESA 3V8EA 4LOJA 3R0IA 2WF7A 3W2HA 2QR2A 1CB0A 3FNGA 3HDQA 1XO1A 2QX7A 5AW1A 1XXLA 2JH9A 4XGQA 4G4IA 4QJ3A 1TXGA 3A32A 4KAJA 5K6TA 1IYZA 4FHGA 1IBSA 2ECPA 2I2FA 2A35A 3EFOB 3BMQB 2G9ZA 1NQAO 2MOKA 4PPFA 5AOCA 4R9VA 3EGEA 4JMLA 3PJEA 3Q2IA 2VXYA 2XJ9A 3PHLA 1XVUA 4HGRA 3NVMB 1KMHA 1O0SA 2CL0X 3AHEA 5LZ9A 2IXDA 3MSXA 1BN7A 4I5GA 1FSZA 2J9GA 3UANA 1TW2A 4G37A 4OQZA 1GPDG 2OB1A 4RJJA 1H23A 1P4HA 2AOVA 5FOSA 3G1TA 3T3MB 4CCAA 1S4MA 1MHTA 4LG1A 3DEFA 1IEWA 5FD8A 1IRXA 4NOJA 1OR8A 2AQKA 4OSEA 1E3IA 4MUIA 4HQFA 4KYIB 3X2SA 2DAPA 1RKVA 3TFWA 3VR2D 1L5GB 4C3OB 3KWFA 3EE6A 4WWHA 2GBFA 5KAPA 4PV7A 5REQB 1G7RA 3GJSA 2VSNA 4Y7CA 4FZ5A 3AV3A 1XCLA 3C3BA 3F74A 2RMKA 3GJ6A 2HOQA 2W93A 4JY7A 5IC5A 3ZTTA 1PWYE 1QDLB 2ZBVA 1I1HA 3B6IA 3F6CA 3V8QA 4EFMA 4Z8YA 2JFOA 5IUNC 3UTCA 2QSZA 3WIEA 3DDOA 2HT1A 3FETA 3ZIDA 3D8UA 1IQRA 1I2AA 3FNBA 4GLOA 3EIEA 4TOIA 1Z6XA 4TT3D 1TO2E 3UTDA 2ATVA 1C3XA 1VHJA 2Y9MB 4LVOA 1XD2A 1U9CA 1UDRA 4XD7D 5EXEA 3MS4A 4EHLA 2FEOA 3J7TA 4ZGGA 2KI5A 1F5NA 2Q2OA 2CK3D 3KEMA 2ONZA 3ISTA 4Q9NA 4EECA 3RB8A 3FX2A 3PNYA 2JIRA 3HJBA 1LRLA 3CLTC 3EQ8A 1YOVA 1E3DA 1GT91 2PHZA 1FX1A 4YMHA 1NVVQ 1SCBA 2EDAA 2IPXA 2YHSA 3F90A 5IC6A 3D6NB 2AMVA 2K2QB 4XDZA 5TR9A 3WISA 3WLRA 5KHOC 5A3RA 2XZDA 1F0KA 2Q3MA 4PZ9A 1BEZA 3DUFA 5H70A 4WZZA 2E87A 1M8PA 2HIGA 2HW8A 1M2OB 1XDSA 3KKOA 1M1YB 3QMVA 4MUJA 1PX2A 1Y1TA 1HETA 4I5IA 2YJNA 1XFAA 2FR1A 4U8HA 2MCFA 2Q3FA 1U8UA 1J2RA 2FSVC 4JJ4A 2QRKA 3G8CA 2X14A 3OZVA 4AJKA 1GPJA 1ZCAA 2ANBA 4RM2A 4A0HA 2GASA 3H2JA 2VOEA 1D1SA 1L4YA 2C4VA 2EG9A 4I9HA 1YRHA 4GLBA 3VNSA 3TDMA 4X91A 1J7KA 1VC2A 1DEKA 2VVTA 1YI8A 4TV9A 4Y2XA 3K8OE 4NCHA 4NLLA 3T3HA 1Y1RA 4JA2A 4TKVA 4KREA 3RIMA 2H0RA 1VKOA 2QGZA 4KFCA 3EB9A 1RAAA 3N8GA 4QGFA 4ZOCA 3OEED 2BFEB 4AK9A 3IP7A 1IAVA 1ZUD1 4KLRA 4YIHA 4R6XA 2HLHA 4KVGA 4QEKA 2ZJBA 1GUBA 4PZCA 1PEYA 2NZYA 2V54A 1DS6A 2X9VA 1P2GA 2GXUA 4WEQA 5DF1A 4CVNA 1SXJB 4TVSA 1VPTA 5T7BA 4TVOA 2V7XA 3QBTA 2FSPA 4Q3AA 2Z6VA 1JA9A 2ZJ7A 1ULUA 1UZMA 4RJKA 4DUZB 4A91A 3NMUF 1QRAA 2GLTA 2H1WA 3IVRA 3NC0C 4NYMR 2JLAA 5KYXB 3T38A 1N2CA 1QLHA 3EGOA 2QVZX 3OTWA 2CXQA 2OTCA 5FL3A 5B1SA 3DT8A 4CEJA 3IOCA 3KOOA 4JT4A 1RM3A 3B3AA 3C8HA 3OHSX 1JTEA 1ARZA 1Z6ZA 3F78A 1K8XB 3LM8A 1E4VA 2ORYA 1R6XA 4TTPA 1PLJA 3DE3X 3JZFA 4LXYA 1MDFA 1TYZA 4J0DA 4R83A 4X65B 2O5CA 1XCJA 1N57A 5EXTA 1K88A 2H92A 4W9NA 1QF9A 1YU9A 1OYWA 2X9NA 5AK5A 2OXFA 1DQSA 5TF4A 4E5UA 1N5DA 2CV0A 1UK6A 1II9A 3BYZA 5GAJA 1EKXA 3E8SA 5KOIA 2BHNA 2GRUA 3LUAA 2D8MA 1PI3A 3EGIA 1FMFA 2AUMA 1EH5A 3AJ9A 5JWOA 4QVKA 3OF2A 3EIXA 4EJ2A 2Q6VA 4QQKA 2XCQA 5F78A 4CQLB 1XOIA 3DO5A 1CZNA 3GARA 1N3YA 1SHUX 2WD7A 4IMRA 4K28A 4LHZA 4G4SP 4KXYA 4XFDA 1BWPA 3ZDXB 4E14A 2LZ0A 3HDGA 5CIWA 1Z0ZA 3ZBQA 1GFIA 4NU6A 2XT9A 4D8UA 5D1NA 1LSUA 3TECE 4A0GA 1B14A 3P0FA 5CDFE 2ZBEA 4ZOAA 4BJ3A 4ZRMA 4BU1A 4CMEC 4O4JF 2OESA 4I9UA 2NU9A 1HDOA 2BF4A 1BWSA 3FDZA 1IB6A 4ARIA 1ZQ1A 2ZJ5A 3BJEA 1YDGA 2BRUC 3ISVA 4JI7B 1J1UA 3DFIA 2A5DA 5H02A 5AM4A 2GSWA 2XUPA 2OV8A 4IIJF 4LUCA 2HL6A 3EGXB 4OU5A 1YIDA 3WQHA 1MA0A 3G8DA 1N6IA 4FXPA 3LBFA 3GLQA 4P2BA 2ZUCA 4RAQA 3NTXA 4TYMA 3RO7A 4YQFA 4CMKA 1QV6A 1FL9A 5ICGA 1U0OC 3RABA 4KQ1A 2ZRDA 3OLQA 3TUJC 5E6UB 1XLWA 4N5HX 1UJBA 4FGJA 1OUMA 4BC1A 3VR4D 4GOOD 3LCRA 3G8AA 3S6JA 5CDHA 2FZLA 3R7WA 2I9KA 3FNEA 1A82A 2LDXA 3QE3A 2FK8A 2P6MA 3EXHC 4RK4A 5EE1A 2UYOA 4KXUA 2Z8XA 3D3EA 1J33A 4HNAA 3A6PC 1SCAA 1W25A 5HMLA 1R0KA 2IV2X 1MOSA 1CZHA 1AXRA 4Q5IA 4BQEA 3RUIA 2PVPA 1FS5A 3EA0A 1YBHA 3ZXUB 4MTCA 1OFHA 1HF3A 3WWCA 2X19A 1JEQA 1VYVA 1FZQA 1SC6A 1P31A 1NJGA 1HWYA 5THXA 1QANA 3SDZA 2COEA 1N3IA 4ZT7A 1TADA 1TL7C 3L5OA 4I6JA 5IYZF 4CIVA 1DO0A 5JISA 3KETA 2HSGA 2YHAA 1OX5A 4RSGA 3ZHVA 1XRRA 3FRHA 2DYKA 4OHMA 4ERNA 2H4ZA 4X8LA 4M7PA 1ZNYA 1IHYA 2XTZA 4ILEA 3OPYI 4DWOA 2C3OA 1JAIA 3RH0A 3ZLVA 3UQZA 3JD2A 1YS9A 3GVXA 2X8BA 1GUFA 4Z8XA 2HC9A 2QRLA 4MCJA 4UM9D 3OOSA 2C95A 4X6UA 4PQFA 2B98A 5IAKA 2IE8A 2VXCA 3NG1A 2OG2A 3PVSA 5CH8A 4LFBB 3M6XA 2NYUA 2H4FA 4RQUA 4OL0A 3KT3A 1JHVA 4MAMA 4UVHA 1M3SA 4KLCA 2BISA 2FRDC 5JAUA 3DOFA 4FYIA 4PYJA 3WQSB 1J8QA 2NUAA 2JCXA 1UPFA 5TX7A 4F3NA 5BUQA 3EZ9A 3OQVA 4MINA 1H2WA 5DOZA 1PFYA 4IAOA 5F2NA 2DHEA 2UUAB 2V0GA 3F3SA 5LWQA 1BS2A 2HWWA 1KVSA 4RHXA 1I0LA 1MDBA 1Z16A 4B3JA 4GYYA 1SMKA 3CU5A 1R0SA 4JB0A 3T35A 3KZMA 2FEWB 2ZTSA 5DXJA 1OH8A 1W4ZA 3GROA 3JQFC 3MWDA 1PQWA 3K9CA 2JCSA 3PUJA 4QFMA 3R4VA 5A7HA 1ORWA 1YE8A 1M1UA 2ZRFA 4KXWA 2Y0CA 4KR7A 1LVHA 2PGLA 4ZQGA 1ORHA 3VKWA 4N3CA 4V02A 3LQFA 4DPKA 1G291 2BFAA 2QTGA 4AZVA 3DDCA 4BZZA 5J2UF 3P19A 1F60A 1U1IA 2HU2A 2R11A 2WJZB 3SICE 4C9BA 3LY9A 4JYBA 2FQ1A 4PG5A 1IY1A 2XB8A 4IVRA 3CRMA 1L4UA 3RT7A 2XUOA 1JEAA 3FZGA 3TVTA 2I4RA 4URVR 3U7HB 4BX0A 4YCNA 4W6ZA 3WAKA 5JPDA 3ER8A 2RGDA 4B3HA 3EDRA 1WB5A 1GPAA 2VSYA 2IYVA 1TFUA 4LQDA 3WZLA 2QMOA 1U04A 3P2IA 1S2IA 1T5HX 4NQZA 3KQSA 3OJLA 4FK8A 4KOEC 3OC0A 1L0BA 2ZXEA 3OCZA 2B92A 3R7FA 4EF5A 3IPLA 3Q88A 1J42A 5A6SB 2HHLA 3SU8A 5BWNA 2BZ1A 1OPRA 1MX1A 2R62A 3BGVA 3Q1LA 4RZIA 1QQBA 1QV7A 3GD5A 4L7QA 2R5WA 3PT5A 2VJKA 1HEYA 3HU2A 3RSFA 2J4CA 4QYIA 3UJ7A 1F8XA 3ZNPA 3D7SA 5HF6A 1GKLA 4DFDA 4GEGA 3WIUA 1XDWA 4DJJA 3IE1A 3LE8A 4OM8A 4IM7A 2V6FA 3D2CA 1D4ZA 2Q29A 4EB6B 3AZOA 3Q7TA 3IVXA 3TLMA 3ZHOA 4CUJA 4OLJA 3THYB 4NU0A 2OD7A 2XUZA 1RI2A 2B21A 5GV8A 5FPPA 1Z18A 3EUAA 4O02B 4TVBA 2IEDA 2VT6A 1O96B 1IBMB 1E5LA 1RP1A 1QH1A 3ZC3A 4M98A 3UHJA 3BWBA 4KOAA 3F9RA 2F43A 5HUJA 1GIAA 3Q8XB 4BUCA 4YXWD 1AF7A 1UH5A 1N0UA 5FHQA 1ZM4A 1UQTA 2QNBA 2GEKA 3B48A 4AJNA 1FOEB 3S3TA 3VR1A 2C9OA 2PL9A 4DZZA 4ESVA 1UZNA 1Z0DA 2OK8A 1Q17A 4R1OA 4U5XA 2C4MA 4OU4A 5AESA 4HFNA 5JV5A 3H7AA 2QYSA 3CM0A 3D4OA 4AJLA 2H2HA 3GGCA 3P8ZA 2XGJA 1UFRA 4HNQA 5B6PA 4LRSB 3AHCA 4R8LA 1GADO 2XEXA 4OD0A 4Z9BA 4LAFA 2KX7A 1U2GC 2F3PA 4AF6A 3LXXA 3PX2A 1P9OA 2GPJA 1JXOA 2QX4A 4YXWA 2E49A 5JNVA 4YR9A 4TWIA 1CQJB 4EG5A 3GLUA 2YWHA 2JFHA 4PFSA 2IITA 2R68A 2NO7A 3IT1A 5FT9A 3VSAA 2VJDA 2Q4BA 1KYZA 1EFHA 3LVFO 1VIVA 4I5EA 4PG4A 1DXYA 4CT5A 4KPYA 4PGHA 1HFWA 1LDEA 3MRVA 5T6MA 4KBYA 1N2IA 4TUYB 3TJZA 4B34A 4B4UA 4ERXA 1I7SB 3GUVA 3IBYA 2Q6KA 1CNFA 5KO2A 4CEHB 2RAVA 2P2CA 3ROMA 3NKFA 2RCYA 1BSVA 2ZUUA 1KVQA 3BD9A 2G08A 4U9UA 4JLAA 4XYEA 2ZBDA 1B6RA 4CU2A 5HMMA 2YYAA 4V1CI 4EGAA 5ISMA 5INTA 4DR6B 3A0UA 3DBVO 2X77A 1FDUA 3X1WA 5H0IA 4CF7A 5L45A 3THSA 3ZS8A 3A6EA 3AK4A 3FPFA 3F2VA 1LF0A 1R18A 3A1VA 3MC1A 4WZAE 4EENA 1G21B 1WF3A 1WSDA 4L4YA 3K1AB 1ADYA 1Y7IA 4KIWA 3WGKA 4A6XA 2D0OB 4H77A 5IZ4A 1K1EA 5HCNA 2R8BA 4YUAA 4N0EA 2OP1A 3OQIB 4GICA 4XYLA 1L5HB 3HKCA 4AKIA 1S8AA 1WHTA 4M1ZA 9LDBA 5AK4A 5C7IO 2P4EA 4BKQA 3FOCA 5BR1A 5K0JA 1CXZA 2DLDA 4NIMA 5EEHA 3WWPA 1SPXA 2VWQA 2OFXA 3AEUB 1MX9A 2G07A 3QJ5A 3SC3A 2JIZA 2O59A 3GMTA 4UOQA 4AD8A 2V3VA 4G41A 5K5EA 4JLOA 4C21A 5KTKA 4AECA 1UJNA 3JQ9C 2R1VB 4RFSA 3RVOA 1ZOPA 4NDNE 4G4SO 5GGXA 2R66A 4GVXA 1TM3E 1G8SA 1ML4A 1SQFA 1I13A 1QBKC 3NWEA 4FFWA 5DB4A 4JLBA 5IARA 4ENSA 4MO9A 4JI1B 4RKEA 2XVZA 1GKUB 5JU6A 1X13A 3RARA 5DRTA 4D9JA 1VSVA 2GPSA 2JI4A 4C1BA 5C53B 1L6RA 3VR3D 2CCJA 3QG5A 3BWYA 4LV5B 2NSLA 4TS3A 5DW3A 2PL3A 4XEUA 3U1TA 2DFTA 1G7CA 5K3OA 1BKYA 3TI9A 1OZHA 4BVAA 2AFHE 3TZQA 2PUDA 2HYDA 2JJYA 2Z3VA 2Z58A 3G9TA 1K8ZB 1COWD 1Z33A 2L0XA 3MM4A 4JQYA 4N54A 5ERXA 3OPQA 3H13A 1PZEA 4F5ZA 1JLMA 3QOWA 5I01A 1RHMA 1AK2A 2REQA 1X1QA 3HY6A 4KRFA 4MX8A 3MTQA 4DY6A 1P17A 4JA0A 1UOQA 3E1SA 1JXMA 4RVHA 4C6TA 1QYWA 1XVLA 5F5LA 1WABA 2XUKA 3MYYA 5C5CA 4XSHA 1DCFA 4DREA 3OPNA 3EVAA 1YO6A 3N7TA 4FEGA 2ATIA 1DAEA 4QD3A 3BAFA 3EVCA 3UYKA 4ZEVA 4B7ZA 4E13A 1JQAA 1E4OA 3BH7A 3QUSA 3EVDA 4WK6A 4IX1A 5LA6F 1OI2A 3UPUA 1NW4A 4PC3A 1RQGA 4AM8A 1C3OB 1U2QA 3CTPA 1RXCA 3TLYA 4OMCA 1L7DA 3DLCA 4JQOA 3ZI4A 1NVFA 4P4SA 2PD4A 1KS2A 3GEBA 2G9UA 1USKA 3UUEA 1PV2A 4II7A 2YQZA 5B3LA 3QVMA 4XTCS 2B82A 1Z36A 1XL1A 1HE4A 2ZUFA 1QP4A 4UU1A 4G0UA 2ZU6A 5KQPA 5JHHB 5JYEA 3I5AA 3NOOA 2PFGA 1EP9A 1MIHA 3A0RB 4F6LA 1NM5C 1YL7A 1ZITA 1ODFA 4F11A 4I99A 3ZNNA 2XUAA 3BHIA 1JMVA 1L4FA 1IXZA 3H5OA 1AQIA 3AHIA 3NJ4A 5LLTA 3ELUA 3SZLA 2XYPA 1JG4A 1DFHA 3W79A 2IF2A 4YV2A 4WFIA 1PTJA 1GITA 3AFNA 1XZFA 4M8LA 2ZJZA 1QFMA 3N0WA 4HZGA 1P1RA 3Q1KA 5CM2Z 3RS8A 1T26A 3EBLA 5J47A 4LC1A 4U63A 3TEMA 3VPHA 4QDKA 2VLIA 2PWZA 2W90A 5FP0A 4F12A 4RSHA 1QZUA 1MCZA 4D96A 3ITEA 3HXQA 1F17A 4B8ZA 4F2WA 3BXFA 3HKEA 3S2IA 1E8MA 3AW8A 1A7JA 1L8OA 1R9MA 5KWIA 3EZ6A 2R751 5JCJA 1F8UA 2WFLA 2XDWA 4XFKA 2OR3A 4WHMA 3S2UA 1P80A 1VLHA 1VPEA 2QK4A 1SUEA 2IX9A 3W8NA 3KVOA 4IGIA 1ZU4A 4KIFA 5LR6A 2L18A 3KQYA 2QX9A 1CP2A 5KJEA 4BXOA 2XKKA 3T1OA 4KKVA 3TSWA 4AXXA 1FQWA 1E8DA 4KGVA 4MIOA 4YQZA 5K0NA 1KOLA 1TF5A 5JALA 3U3RA 4YX9A 2WF6A 3IUNA 4Z4EA 2JJMA 3HZOA 3WYCA 4IQ0A 1KMCA 3HVIA 3TE7A 3Q5EA 4FGLA 4BO6A 5C1DA 4KXVA 1XDGA 5CM8B 1J0XO 3DBIA 3U6KA 1GNPA 1SZDA 1U1GA 1Z08A 3OOWA 3QBEA 1ZLXA 3BXOA 3F46A 3V7UA 4I46A 5JXGA 2QZ9A 3P9ZA 2QVCA 2ZKIA 4LJAA 3GJ8A 2W2LA 4UD2A 4BJ5A 5EJEA 1DTWA 2R4UA 3AUSA 1MEJA 1YQXA 3G2MA 2HLDD 3COZA 3L3BA 3PEFA 1F6BA 4I1RA 1ULBA 4JGGA 4Y6PA 5E9WA 1EU1A 1U6KA 1ZWLA 3BWMA 3HO6A 4BO4A 4DV0B 1A5AB 1V7PC 1BCRA 2GSDA 1GL9B 3D8HA 3G0BA 3QU2A 4L50A 3R23A 5F9FA 1KOJA 4Q00A 4JX8A 1S3IA 1WMAA 3PNQA 1EFPA 4QXOA 4CU5A 4FFBA 3NAMA 3H9EO 2PUBA 1QG6A 3C14C 4LRXA 2IOHA 4MITA 4RH3A 1DADA 2PS3A 3EA5A 3LHSA 1NMSA 1PV4A 1C9KA 4MI3A 1USUA 2EYUA 2KHZA 2NT3A 2G28A 3AF5A 3C8DA 4PSVA 2C42A 4C6HA 3BMNA 2QX8A 5TGTA 5DTIA 4L1KA 2X0EA 1M54A 3TZEA 2ZTMA 5LP1A 1ONOA 2WTNA 3OEHA 1Y9DA 4XEHA 4AF8A 4J0FA 3DZBA 4KJZA 4Q39A 4HADA 4R3UC 3RSGA 5JD5A 1IB0A 4K40A 1USVA 5L53A 1JG6A 3AFOA 2QPAA 2RHJA 5HZHA 4Z3DA 5GOTA 5LQCA 2E4UA 2CHQA 1RYBA 3JX9A 4HQRA 4EW3A 1DWOA 3PEWA 3LH5A 3MJ4A 1WXHA 2HIAA 3A6DA 2CZGA 3AWDA 4YAFA 2FA9A 2EX4A 5DNDA 1RKXA 4QBFA 5B1EA 1Y8RB 1GTVA 1Z29A 3H2IA 4OIMA 2AVDA 3P5BA 3DZJA 4PYNA 1ZC4A 2Q5HA 2OG1A 5E3HA 1T1RA 4ZQEA 3HBLA 3O8QB 2QAJA 1OBVA 4XASA 3QIAA 4DLKA 1SVIA 4RTLA 2BKVA 2NXEA 2FPGB 3P0RA 4FMDF 4JIMA 1XPJA 5AKYA 4ZT3A 2XOXA 5D51S 4X9XA 1GUZA 1J56A 1JE1A 3BHJA 1G4AE 1CR6A 2RKBA 4HXEB 5B7PA 3F8TA 3H2ZA 3CKYA 3LW8A 4ZD6A 4UAUA 1TLTA 2P4SA 1JFTA 1PJ4A 1OKKD 1U28C 3MJVA 5DCYA 1SUCA 4HDCA 3DVLA 3PENA 3HEBA 5A3VA 4FDMA 4I3FA 4LJRA 4H1UA 1CUHA 4X60A 1I5EA 5CLHA 5I4BA 3TGLA 1JR2A 2GKGA 4BLTA 1GM5A 4F6CA 3GCDA 3F5QA 2AFRA 3NNNA 2AZMA 3A06A 5J2UB 4QTXA 2FSHA 5EIXA 3CCBA 3JVEA 4BO1A 1VYTA 3CPSA 1L5MA 2P90A 5BYBA 4V3CA 1XHFA 1XPUA 3NHWA 2CW5A 1KI6A 1CQPA 3VR6H 4IJWA 2GK6A 3I2JA 1Z5GA 1H1LA 2GZ2A 2VNAA 1VGVA 3M8KA 1GYQA 1I4TD 5MGBA 3QUBA 4ZI7B 1K4YA 3BAZA 3SEAA 1QFSA 2Y0DA 3W9SA 1R6TA 3E2IA 3L41A 1E4EA 3VBCA 5J2TB 2JFYA 3LD9A 3FUTA 1YUBA 1KDRA 2RHTA 3W5JA 3IEMA 1DAGA 1HMYA 2VJBA 1PNTA 3ENKA 4JQZA 1ZSVA 3E7DA 4BATA 4OLFA 1S1MA 2DCUA 4GPEA 2QRMA 4ZAVA 5J1SB 4LNUB 3MLBA 4DIKA 5AICA 1FP7A 2P9TA 2P9FA 2K5UA 3I01A 1FRZA 1NW8A 3PPXA 4QLAA 1GQ2A 5B3AA 5BT9A 5GIOE 4HRAA 3FFWA 3T5TA 4CCYB 5BMOA 4PNZA 4LMAA 5EUQB 1T6NA 4RVUA 3FE2A 1Q1ZA 3IQEA 2JFNA 4EA7A 2QRJA 4O6VA 3ZBPA 2YWDA 4QEZA 3VOBA 4HB2A 3Q12A 4WESA 2AGVA 4A1FA 4LBWA 4FE3A 5LC1A 2ILVA 5FCDA 1ELOA 1L7XA 2P77A 4RTJA 4JEMA 2WIGA 1G3MA 1N1MA 2WKQA 4EGSA 4ICIA 1I3LA 4LY9A 1O8CA 2EV9A 2RARA 2AQHA 2G4CA 4ZHQA 1EK0A 1TM5E 5AQ1A 1E1QA 2HPZA 1X3LA 2DBVO 2QVBA 3GXBA 1ISFA 4V0RA 5FV7A 2OYCA 4EG0A 1LVUA 4Q3LA 4EUKA 4ZDIA 3LL4A 2FW9A 3FOEC 1XVVA 4MRRA 2BELA 2DLNA 1GGKA 2VAVA 1RJGA 4YALA 3QA3E 5DM0A 2W2NA 5AVOA 4B33A 1RW4A 1VIMA 1WL8A 2QAGA 3FZNA 4WOJA 1PZNA 2BHRA 3TIVA 4K8OA 1FP6A 2QUHA 4GX2A 4MMYB 2JKYA 1DBSA 2G06A 3PP8A 2GAFA 2JI7A 4R2JA 5ALSA 4AMVA 5BV1A 4RCYA 1V3VA 3EEOA 1TFRA 4CFZA 2GJ9A 2WFAA 2JGLA 4OUDA 4Q1EA 3TRDA 4E03A 2UXCB 4RJTA 1CJVC 1T10A 1JDUA 1QVAA 2VCYA 1QJCA 1R2QA 1UOPA 1U0SY 2HFKA 3NPMA 4UTVA 5C35A 2WTBA 1DARA 5DWDA 1AA6A 3CLUD 3GBSA 2AN1A 5AYVA 3NTUA 3BPSA 2B8TA 2AEMA 3HGTA 2SHKA 3P9NA 4KSYA 5I7AA 4DDVA 4CKXA 1W4AA 3EBPA 3PB3A 1ZX1A 2J9YB 3AQIA 1E9FA 1V4NA 1PJAA 2IKSA 3DV9A 4L0QA 1S2LA 1Z7BA 2BE7A 4H1VA 1T36B 3VU9A 1H0SA 1QS0B 3FPCA 5HE8A 5HOQA 1AQLA 2X5KO 3NYWA 1OAOA 1J2JA 2Y1EA 1P81A 1VL8A 2VK2A 1DAKA 4AVYA 1SBIA 4ZTUB 2Z5VA 4RA9A 3ZIUA 1QGDA 2GZRA 3C7CB 3OOHA 4DQ0A 5JASA 3THWA 1UM9A 3I0ZA 2V7UA 4JGIA 5C7LO 2BGGA 3BIXA 4X41A 3ZV6A 4JP3A 2BBTA 1G8FA 4GXTA 1S4QA 2X7XA 3VU8A 1QH8B 2VP4A 2IHVA 1Z2OX 2PR2A 2OZLA 2VDWA 3KQLA 2QGFA 2A0FA 1B8UA 1I1OA 4MGZR 2JFXA 5LKRA 4WLFA 1U4NA 1UPCA 3FUUA 3IX7A 9ATCA 2OD9A 3A1CA 3BH6A 1Y8QA 5IAGA 3CLSD 1ZJ5A 4O4IB 3T54A 2I7TA 1LRKA 2VNHA 1UBKS 4FSHA 1L3CA 1QP8A 2R5NA 2P5SA 2HGZA 4XI9A 1JLKA 1XN4A 1TAUA 2LNDA 2ODAA 4EPVA 4UW9A 4BPBA 4TXNA 2OCLA 1B7GO 3TZ6A 1MJFA 2D8AA 3H4IA 4UM8B 2J6HA 4F0JA 3MB5A 4UNNA 4M7OA 1P1FA 2LV8A 3JYLA 2VDUE 4PLCA 4PSAA 2Y77A 4ER7A 5A5GA 3C3WA 5KC8A 2A3NA 1ID1A 1QE0A 1WCWA 1QTNA 3DW1X 1LPNA 2REBA 4FD3A 4KNWA 1T24A 2I7VA 3F67A 4P34A 4D4JA 1K4KA 2G7MC 2OGUA 3ANSA 4YJGA 4D46A 5IM4F 3NJ8A 2I7CA 1O03A 1YZLA 2ZROA 2NQTA 5CT8A 1TJNA 1WU8A 4CT0A 2H4WA 4DDMA 4WCFA 3P9CA 4WOKA 4XZ3A 2M6SA 3EEFA 4IHKA 3NT4A 1FU7A 4IDNA 1SD2A 4ZI5A 2YNMD 4RU1A 1UMBA 3I9LA 2CXRA 3IDAA 3ZS9A 4XUGB 3T15A 1DLJA 2O8EB 3AUFA 2IU3A 1JAXA 1TGVA 3JVDA 3KYCA 4OJTA 4PX3A 1XWIA 4QXRA 4TV9F 4XR4A 3RYHA 3HXPA 4BKPA 5IBCA 3CGWA 4Q3KA 4ZU6X 3H9BA 2B20A 3EWSA 5H81A 1J0AA 2H00A 3WRVA 2P30A 5M3BA 2YYZA 3BSYA 4Q93A 2Q21A 2Q4DA 4P7BA 4LDNA 1C41A 2YNMA 3O73A 4AY4A 4BO0A 5SICE 4QLOA 2QVXX 4ZVTA 3ZD9A 3B8EA 3NM4A 2BEVA 2I9PA 3ABIA 4GMFA 1XEAA 4NHEA 2J0UB 2IGTA 2R7KA 1Q84A 4HAOA 4Y0NA 1DT5A 3MGAA 1QYRA 2V7BA 2XT0A 2I99A 3KKKA 4MVJD 5IC4A 1ICIA 1L7VC 2DPYA 2GH1A 1ZSYA 3PGXA 5B1HA 5BSRA 1M2EA 1N5JA 2WQZA 4KN5A 1Z7EA 2V5AA 1KJNA 2G83A 2K2WA 3E9RA 3IJEB 3L0ZA 4G07A 4IUBS 3O93A 2JATA 1UDAA 4G3XA 3RSHA 2AEEA 3SX4A 2P6RA 1BE1A 4QTTB 4Y6QA 3HYTA 2GKSA 3EDQA 4RCVA 4YV7A 2GZ1A 1OWOA 1Z47A 2FW6A 3P4YA 5DM60 5J4LA 3A27A 3BMCB 3LQ2A 4YFVA 5ALMA 5EZSA 2A57A 5JT1A 2II6A 4O59O 1WEHA 3EDOA 4RVDA 4M9XA 1HY3A 2PMDA 3QFHA 3SQOA 1UXHA 2R8ZA 2KLBA 4LOIA 1VE7A 4UJ5A 1QTRA 1XXHE 3TEFA 2VTEA 5K8IA 3C6QA 2BL4A 1V47A 2Z83A 2HIHA 5IDVA 3RK1A 3DLTA 1EB8A 5FAKA 2ASVA 5BR8B 3R3UA 2ZIWB 2XBLA 4P8RA 1Y1PA 3I6YA 1Z2PX 4PTZA 2DJIA 2X0IA 1GPWB 3IIEA 4GQBA 4R8MA 4UBKA 5DO9A 3RSQA 3NHJA 3UCXA 3ODPA 1GKIA 4WUTA 5IBPA 3K5HA 4H4CA 4N48A 4B7UA 2WHXA 3G2NA 6YASA 3ZDDA 1VKRA 3DHNA 3S2GA 2F2TA 1FYXA 2HHAA 5E1BA 4M0FA 1VECA 1LI7A 4AYTA 2D1TA 2C2OA 3GOQA 2HV8A 2C78A 5A62A 4BO8A 3TOZA 1Y9ZA 3IURA 4D4MA 4F4JA 4A6PA 3ZD6A 4KBGA 4TV8F 1VHQA 2B3DA 1JDPA 2ODQA 1AZSC 2ZTHA 3OKPA 4UDOA 5F33A 4B83A 4I55B 3OZTA 2JIPA 3BT7A 3E0XA 1YDHA 5FOUA 1JIXA 4RZ2A 2Z3ZA 3M2TA 4D26A 1A8PA 3EVNA 5BNFA 3MAAC 3RBXA 2AOTA 2C94A 2TRSB 3DHEA 5ERYA 4JYCA 3HCNA 5DBIA 1JX6A 1X7YA 5EFOA 5EQDA 3O8OB 3EUFA 4UE2A 4ZOLA 1FY2A 2PLRA 5BW4A 1DC3A 1ZM2A 3E18A 3WLPA 4CKCB 1IEQA 2JH8A 3KCQA 2PUVA 1HYEA 4TVKA 3SQMA 3BZWA 4LMRA 3KBBA 4IJKA 1TYDE 3UO8B 1E2MA 1JF8A 2X9QA 4ZKEA 2D2VA 3TQRA 1VTKA 1PFWA 4YFYA 1TGYA 4ZCLA 3SJUA 2QJWA 4BFXA 3SCZA 1BO6A 3A6FA 1W0JA 2I4LA 3TIGA 1G3IA 1ZVKA 8AT1A 1A95A 4OJQA 5EZQA 4S05A 1R5JA 1HYGA 3IKLA 2VQSA 1O95C 2PLWA 2F1IA 3KQTA 4MHOA 5P8WA 1X9GA 3KTAB 1K2WA 3MT7A 3OM9A 1P4SA 2VT3A 5FJIA 3T94A 3TE6A 1XCBA 4BKRA 1MOPA 2ZWPA 3K96A 3CLRD 2CNWA 1AKQA 2FUKA 3O75A 2MYUA 1N6NA 3KFVA 3STUA 2ZM6B 2LCFA 1TUEA 2QT0A 1QKKA 4LHEA 1MJGM 2I4NA 1ZXBA 1JIQA 4YRBA 2OCKA 3L6OO 1DO8A 2YDYA 2Z30A 1KZ9A 2NTYC 4GYKA 3V8NA 1KYTA 3WNZA 5CFOA 4O1HA 1T9HA 3B78A 3GBVA 5T6BA 1UIMA 2WSYB 4NONA 2RE8A 4NAVA 3VDMA 4JOQA 1HZZC 2JLQA 1NASA 3RRXA 2AOUA 2R6GA 4LSZA 2XNCA 1FMTA 5IP5A 1O94D 2GF0A 3NRCA 1V11A 3ICWA 4O33A 3OSZA 3ANXA 1T0IA 2JVJA 2PT9A 1UZUA 3DA8A 3QRWA 4MLPA 4B3FX 5LQMA 2WJJA 3SBXA 3I0MA 4Z4IA 4Y3UA 3QVUA 2OCIA 1SG6A 3FDJA 4NYIR 4TT8A 4UE3S 3COWA 2O5RA 2XDAA 3K32A 5DMHA 5YASA 5JH7F 1Q1AA 1Y37A 3N9IA 5COBA 2HU8A 1E2IA 5CT6A 3W1EA 1D2HA 1VJGA 4X1KB 4JWKA 3T9EA 1PL7A 1ZIDA 1ODTC 2ZBFA 3I92A 3Q7PA 5ARCA 2EFDB 3HE3A 1J4AA 3EXAA 4QAJA 5H1YA 4D9HA 4ZXPA 4YP7A 3CEHA 4F6RB 1DEAA 1E7WA 1JILA 4R4JA 1WO8A 1UK9A 1C9NA 1QORA 4PO1A 2CBXA 5EQJB 1MO4A 5EWJB 1E9VA 2WTXA 5F64A 3BXHA 4EF6A 1JFRA 2G9NA 1J0CA 4MYCA 5D1HA 2X22A 2YC2C 2X0DA 4WJKB 3UJBA 3I37X 4IV0A 1ZI8A 2RHCA 4OH1A 1U2ZA 3DMNA 4QQRA 4UXIA 4WGFA 4KSBA 4CIBA 2O8DB 3NDBB 1G16A 3QQ5A 3DAYA 2I3ZA 3K9HA 3GV0A 1OTHA 3LGAA 5EPEA 3WMRA 3DZCA 4N3AA 2BEWA 2DRIA 2V6IA 1Z0SA 4G25A 2FN3A 4MICA 4HYYA 2OBBA 3Q5DA 4MV9A 1CZRA 1N2JA 2Z2KA 1NF3A 2M1XA 2UYYA 2W2QA 3FR8A 5CDFA 1EPUA 4S04A 2ZWVA 5E7MA 1E63A 1UK7A 2QD4A 2SICE 3GA0A 3MFYA 2JI6A 1RQ2A 1U2DC 3AR4A 1L7OA 2Q27A 1MN6A 4IDEA 4PRZA 5HILA 2R87A 1IQUA 1IAQA 5IN5A 3U48A 1DJMA 3T52A 3PVZA 2C0CA 1P2BA 1VHWA 4PWYA 2XCOA 1Y4AE 3PCTA 3B38A 4YPOA 5BMVB 3L8HA 4LYDA 3DH0A 3N0TA 2DBRA 2O2ZA 4N6OA 4BEWA 5KPDA 3ADBA 5JCZA 3FM9A 3BHMA 1NP3A 5CA0A 3OQNA 5DLQC 5I9TA 1G0NA 5CA1F 3ZWYA 4KQ9A 3NP9A 2IS4A 4XVRA 3VYVA 1EVJA 4CCWA 1TJPB 1EYZA 2FQYA 4GKBA 4RVSA 1CUVA 5K05A 5C81A 1F3OA 1FS4A 3JAWA 3AHHA 1RJ9A 3NUGA 1EFUA 2QL6A 1WCIB 3QV1A 5KUTA 4EGFA 3JATA 5KX5F 1DRWA 4MLDA 5BQXA 3UMMA 4YECA 4Y6GB 1LJUA 4NNPA 1ODJA 4OMFG 3CF2A 4GE0A 3SHFA 3I1JA 4BNVA 5BW6B 4P3YA 1DAPA 3A1UA 4G26A 2GUGA 4LXQA 2R00A 3KQOA 3S8EA 2HA0A 1FFGA 2NPOA 3RSOA 1ZVQA 4B3DA 1R88A 1F2UA 2VF2A 3WGQA 3LTEA 4EITA 1GRNA 2PKRA 3DGEC 2E6KA 5CBPB 4LTMA 2R60A 3UMBA 5JS8A 2HK7A 4W4TA 4H9GA 4P6VF 4YP1A 4BO5A 4CIYA 1G6HA 3DB1A 3NB0A 2HLNA 1NRWA 2FN9A 2HY7A 3UAGA 4MI6A 3RKUA 1UFKA 1O57A 3UV7A 1MORA 1Y4SA 1UPBA 1TUGA 3SSOA 2G3YA 2EIHA 2VH1A 4GP9A 1V5IA 3QVXA 5IWAB 1NBHA 1XD8A 2VPPA 2ZQ5A 5F7JA 2RAFA 3FVQA 3HZZA 3TUIC 2BHTA 1F7UA 3EARA 3MINA 4F4DA 4IICA 1PR9A 1DKOA 3H5RA 4R9NA 4KPUA 4F4FA 2HBRA 2A9JA 2NVUA 3L7DA 4RFLA 3KM0A 3R3XA 3WNCA 1WV1A 1D7OA 1SC1A 2PMWB 3PDCA 3AR8A 4QHSA 3KOUA 1P9NA 3PNLA 3WOHA 2BKXA 3A4IA 4AL4A 3N2NA 3GLKA 1FC0A 1QZXA 1TQHA 4OBXA 1X9IA 3UVEA 4P92A 1W36C 1G9XA 3CO5A 4EG7A 4H17A 2B36A 1KMHB 3GJQA 4URYR 1JA1A 3T0IA 4AS3A 2JK1A 3WK7A 3CR3C 4Q12A 5KI6A 3WX0A 4F91B 1J70A 2EP8A 1FBTA 1LTKA 2H6EA 1HYHA 1GSOA 3KKEA 3O8DA 4AJEA 2WSLA 1DV1A 1HC7A 3B70A 3HWWA 1QTIA 2B99A 3JD3A 3OZEA 3L6BA 1MO2A 1ZMTA 2PKWA 2DPHA 4RTOA 2X4DA 3U31A 1DELA 3C39A 5IEBA 2OFFA 1DG3A 3T3OA 1ZH4A 1Y6FA 3PEYA 4J3FA 1Q0TA 3L7OA 1U8EA 3DAOA 2A94A 2FMKA 4FI3C 2YYYA 1SK8A 4TTIA 3T4EA 3D8NA 4YCDA 5FADA 1O6BA 4URZR 1HORA 1VXRA 1ZJJA 3RS4A 4X84A 4BNJA 4LJ8A 1T91A 1NUAA 1N1GA 3TL2A 3UIEA 2CFCA 1DQYA 3KPYA 1RP7A 1XD2B 3JCZA 3UJAA 3E70C 3F4LA 4I36A 2IOYA 1YDWA 3T3GA 3ESBA 1CDOA 1CK4A 4W5QA 5AI0A 3V7FA 4TWJA 5AXAA 4IKEA 1UT5A 1ONBA 1E7SA 2OFWA 4H1HA 3ZTYA 4YRSA 1JP7A 1YOVB 2CNOA 4YJKA 3W1WA 1VKJA 4YGXB 1Y8ZA 1NFFA 2YV2A 5T8KA 5ES4B 1PKXA 3WL7A 2J4DA 3DUFB 3WBFA 5L9AA 4A6EA 3SYKA 4HJXA 5F21A 2JHAA 1NVAA 3RK4A 5ALJA 3ICEA 1A9YA 5LB2A 4RVOA 1IBLB 1E99A 4CM4A 2P0YA 3AKCA 1H2FA 3U4DA 1OF1A 1RZUA 3B36A 3KZXA 3ZJYA 3D7RA 4NESA 3FWNA 3ZCUA 7GPBA 1NR5A 2ALJA 4KMRA 5BQ5A 2GZDA 3EW7A 2NAFA 4M9RA 3W9YA 3EH2A 1D0IA 2HHCA 4GQIA 1AF4A 1O77A 4G24A 1CW2B 5I3CA 2WJPA 4UBJA 2NPIA 5BV7A 2DFVA 2NX2A 2IK8A 1V5FA 2GBLC 2HK9A 2X2PA 4TV9B 2JLYA 1ITZA 4YO7A 4TKVB 3WR5A 3ETEA 4NL4H 5DCLA 1FRNA 2WJGA 2ZPAA 3GNQA 4BTEA 4FS3A 3B3FA 3SQNA 3ZQUA 2BJVA 2CBZA 1OYYA 5IMBA 1L8AA 2P3OA 3Q98A 3FCAA 3MSCA 4ON9A 5LZ8A 3L7KA 3ZWWA 4U7WA 4RY9A 3WL6A 5IKOA 3MJFA 4CN9A 5JXWA 3LC1O 1N78A 1DQRA 1XKQA 2VO1A 4GNKA 1V8PA 5F1OA 4Q18A 4M9QA 1KO4A 2V7GA 2Z9DA 4IXWA 2P4QA 2UVQA 1XMSA 3I9NA 5HKAA 1OXSC 1JLLA 1N2GA 2C07A 3DP7A 3KXDA 2D74A 4OYYA 3AU8A 1P7PA 3I4FA 2EATA 5KBYA 2NU8A 4DVJA 3TF5A 2GTIA 3RAGA 2O8BA 1I94B 5IDYA 1N2CB 4CEJB 3V7NA 2E9SA 4RPGA 3I4CA 4F96A 1Q1GA 5TIIA 2AUTA 3ZY6A 2W00A 2Z0MA 1JFLA 4UFNA 4EHHA 2OSBA 4F4IA 3DT6A 2ENWA 3Q72A 4BFTA 3PQ7A 2P0EA 3BTOA 4N5IX 3VPSA 2HSDA 1JHZA 2H17A 2QG6A 1BFKA 3I9V1 4XYMA 2VH2A 3EPHA 2JW5A 4OFWA 1JB9A 3EASA 3CUUA 4EG1A 2XD4A 4EY6A 1N0VC 4ARCA 1Q15A 4IIYA 3JSXA 5CLGA 1ULZA 3B7WA 3NBQA 1RAHA 2BI8A 4KH1A 3WQQA 4ZZ3A 4N8SA 1BDJA 4ENUA