5LQMA

Structure of quinolinate synthase y21f mutant in complex with citrate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
303
structure length
303
Chain Sequence
HHHHHMVDEILKLKKEKGYIILAHNFQIPELQDIADFVGDSLQLARKAMELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYREKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFELMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Quinolinate synthase A
publication title Crystal Structures of Quinolinate Synthase in Complex with a Substrate Analogue, the Condensation Intermediate, and Substrate-Derived Product.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
total genus 116
structure length 303
sequence length 303
ec nomenclature ec 2.5.1.72: Quinolinate synthase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02445 NadA Quinolinate synthetase A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA02
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA03
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA01
4ZK6A 5LQMA 5F33A 5KTSA 5KTRA 5LQSA 5KTTA 5KTPA 5KTOA 5F35A 5KTMA 5F3DA 1WZUA 4P3XA 5KTNA 4HHEA
chains in the Genus database with same CATH superfamily
4NFYA 1ZD5A 1II9A 2IYZA 2ZETA 4XFJA 1HA3A 1Z2OX 2G17A 1E5DA 2R85A 4JC0A 3KQWA 4HGOA 1XTTA 1J6UA 5JBQA 2G09A 1A5ZA 1CEEA 1DBQA 2WUDA 1FUIA 1OYOA 3PFWO 1XJWA 3R6GA 3UC9A 5EHIA 5HW0A 4Z4IA 2FCRA 1XWIA 5AW3A 3BL6A 2BEUA 2HL6A 1T5LA 3QKRA 2OLKA 3ENQA 1U3DA 5CB4B 3C8UA 2CXPA 4REQB 13PKA 1M1UA 1XCLA 2WIKA 1O8BA 1D09A 3GWZA 3QVGB 3RWOA 1TZBA 1FY2A 5ICSA 2PGLA 2R11A 2PH1A 2DH5A 3EMVA 1EFUA 1YMVA 3SZRA 2J3EA 1T5TA 2HRCA 4C88A 1YCDA 1ST3A 2EWMA 2EQ5A 3E48A 4RACA 1EK6A 1XZJA 2VP9A 3HJAA 5C2JB 5KVSA 1L4KA 4I08A 1VPDA 1JPNA 2JGRA 2DT5A 3EJWA 3PEVA 4CQLA 1AY0A 4WNYA 5B7PA 7MDHA 5K03A 2PPVA 2ZFUA 1MENA 1NFRA 3RIHA 1I2MA 4F7DA 5HKKD 5EJ9A 2GA9A 2CCGA 3BIXA 3DHEA 4NOLA 3L4KA 4U6SA 2Q2NA 1R12A 1VLJA 4L50A 3U9TA 1FDOA 2PX2A 4CKXA 1FXWF 3PFCA 1GITA 2XYPA 2W4MA 1HYEA 1HE4A 1YBFA 5LXTF 1Z13A 3SEAA 4O4LB 5DN6A 2YV2A 2FN7A 2BV3A 3AG5A 3IFSA 4ER7A 4G8DA 2X8JB 1B6SA 2JIZA 4PVDA 4BX9A 3A10A 5FTLA 1QRRA 3EZXA 2BMAA 1M2EA 1Y9JA 1G6KA 3FDFA 4FQ7A 4HNGA 4M88A 3WYDA 2FSSA 1T9DA 1RQGA 1XRPA 1XT6A 1ACMA 1GU7A 2I80A 3F8WA 3GEEA 3L93A 4LJ6A 3ZH9B 1Z08A 3N5KA 1GPJA 4FMPA 1NV8A 1RI4A 5FR1A 3PVSA 3TR5A 3IP1A 1EFPA 2DLDA 3L8ZA 3T7AA 3L0BA 3ZZMA 2HA0A 3L1UA 1CJKC 2UYOA 1VL2A 2B3TA 2QSUA 4TQ9A 3FI9A 4ERNA 4LXQA 4MRNA 3GT7A 5LZ5A 3B3AA 5JSFA 2Y1OA 3BFKA 5FWAA 3AYZB 4F4JA 1R6VA 2BBTA 3RFTA 2QR3A 1Z2AA 4XYMA 1VMIA 4QRHA 4GKVA 2X41A 3VAZA 5JLJA 2G7ZA 4DYDA 4E0BA 4OFZA 2YJNA 2ZW9A 3L8DA 1SHJA 4JR0A 3MGKA 4F86A 9ABPA 5K0ZA 1IJKA 1H2ZA 2Q99A 3KU4A 4G1UC 5JSKA 2Z6QA 2OAP1 1I30A 3L6CA 3KUDA 4MKFA 5LYJA 2JFPA 3ED1A 3LPLA 2HU5A 1J2YA 3AKZA 3HXMA 4DMFA 1D4ZA 3N3AC 1UZUA 2MDTA 3G23A 3J7TA 5F12A 1WSBA 1S2GA 3WG9A 1CFJA 3PGLA 5CDGA 1YB1A 1YS4A 3BXHA 3L79A 3WLIA 2R8PA 1KMHB 5JJCA 3FM9A 2YZKA 1KOLA 3OJFA 3T4UA 4ZGGA 3QFFA 3FIUA 3VR3A 5DNAA 2ACEA 2CYCA 1AIPA 2NADA 4HAOA 4C7JA 2EG9A 5F76A 3LZ6A 3QX7A 4HUTA 3FTNA 3A32A 3REQA 4RGQA 4MPDA 1P18A 5K4GA 3VR2A 2YW2A 4RD1A 4ZV9A 4B32A 2OCIA 3FCAA 1TQ4A 2C96A 2J45A 5BSRA 5T3YA 5T8KC 1FMFA 3ASZA 4W1RA 2RHHA 5LIPA 1YCGA 3GAMA 4HLQB 3RBAA 5BMVA 1FDUA 3FJYA 4BGEA 2A1TS 4RIEA 2R4UA 4RNCA 2EARA 2JFUA 4GEGA 1UP4A 1O0CA 1IBLB 1JJ7A 3D5EA 3FCUB 4K3VA 2F7SA 3WLKX 4OHKA 3C4QA 2QUKA 3PNBA 3NU1A 3TKYA 2WAMA 3W9UA 3FN4A 2H2HA 5BV1A 5EE5B 4FN4A 4D8WA 3G5MA 2PUFA 3IKTA 5EG5A 4E70A 2QN8A 3GVCA 5AHRA 5JDCA 3C3EA 3QELB 5HK9A 4AJOA 1RWBA 2FP4B 3CZPA 1TL7C 3JQAA 4LJ9A 4F6RA 1R9JA 2CDCA 4PX9A 2COUA 3LT4A 3LT2A 4OYYA 1KPIA 4Y6GB 2A0XA 4DVGA 4Q5IA 3SC2B 1DQPA 3WV4A 2BKEA 2Y1WA 3ILXA 1WQ3A 4TTVA 5LQRA 1MABA 1A9XA 1V1RA 4MYTA 3NYWA 4YACA 2YFKA 3PCTA 1ZOIA 3KR1A 4PLWA 1XB2A 3R3ZA 4E4YA 1F2VA 3A1TA 4CJXA 4NCIA 5LKRA 3G9ZA 1SXGA 1X6VA 1DG9A 2GD0A 2GNOA 2JH9A 3FFTA 4IPTA 4LDJA 3IAS1 4NFSA 3RBZA 3KB1A 1U2ZA 3LUDA 4ESOA 5J2TB 2P2DA 3M6WA 3GT0A 1FBTA 4RV5A 2AYYA 3K9CA 2EJBA 2FZLA 2HN9A 4N9QA 2ZLBA 2H5EA 2CXOA 1KQFA 2P90A 5JWOA 4GQAA 3I52A 3KQLA 5H70A 1H8ED 2WVHA 1PFQA 1YMQA 2DFDA 3BJZA 4Z8XA 1PKEA 3ZZ1A 2ZYTX 4JJKA 4WADA 2UUBB 1IRIA 2HYDA 5JRZA 3HCBA 2IP2A 1QHHA 5LA6F 1KYTA 3H5TA 3RF6A 2WA1A 1AUVA 2GN0A 4JJ8A 4YQFA 3AZPA 3JZMA 2YIDA 3RYCB 1SIWA 3H87A 5EIBD 2CLFB 2HDNB 4MR8B 1V8PA 5LB2A 3IOMA 2I76A 5K0TA 5C1BA 4G56A 2LDBA 1JNYA 1DWUA 3P2KA 4MS1B 4N01A 5FADA 5C5DA 1L7QA 1MG5A 3PJDA 1Y82A 1QONA 2K2WA 2Q3HA 1Z8DA 2EEPA 3IDOA 3PJGA 2QU8A 4HEQA 1CY4A 2KLBA 4N1AA 5HTOA 5F21A 1OX5A 1P45A 3HRIA 1YJXA 3DOJA 2PN1A 2D3TA 4DCMA 1D1SA 4B48A 1C0EA 4HGPA 4RK6A 4EUKA 2LR0A 5AIAA 3VDRA 2QP4A 3NP9A 3IBTA 4WI1A 5E6RA 4CE6A 4EYGA 1LFAA 2BCEA 4OATA 5CBPB 2YV3A 5K8UA 1E2PA 4BQFA 3OPXA 2EGUA 4CMBA 2VZ8A 4RVGA 1BVHA 3A0UA 2BVNA 3CRMA 1D2GA 3EPRA 1E3DA 3SQDA 4CDGA 4EB3A 4G5YA 2IPAB 3AMVA 3KJXA 1ZW1A 3KTAA 4J0GA 4M8IA 3SR3A 3HC7A 4YO7A 1IAQA 3VR5A 1H23A 1QP7A 4P4LA 1Z2CA 2F2TA 3UV7A 5ES4B 3D7KA 3VNSA 3U44A 3DCYA 1AVTA 2C3YA 3X3HA 4FC6A 4DLPA 1U94A 4TRJA 1KDVA 3ZG6A 1JR3D 3C43A 5K0GA 3E3NA 2FY8A 5KYKA 3AVYA 4EPYA 1GGFA 1I6WA 1R0XA 2FSFA 3F6SA 1JJFA 3HL4A 3HPRA 3L7YA 1XEXA 3KQQA 1UBJS 3H1AA 4LBZA 3G68A 4GGMX 2C04A 5D3KA 4OF4A 3JQGA 4LJKA 1DRKA 1XJQA 4UPVA 4DV3B 1VMEA 1ICEA 2CZCA 2C3PA 2PEZA 3H5RA 3HUEA 4JUAA 4BVHA 2BF7A 2RH8A 3KCQA 3ZR4B 1YOVB 2VXBA 1MC5A 3KDAA 4BLOA 5E2BA 3OJ0A 1OBFO 1L1RA 1GZHB 2ODEA 3C45A 5JZVA 4ASUA 2ACKA 4FS3A 5EMNA 4B40A 4C0LA 1PWXA 4E07A 3A3NA 1NXTA 4PM4A 3Q0IA 5C34B 1EFRD 2QW1A 3E5MA 3KV3O 4C05A 1MQAA 4DDMA 4ZMRA 3RS8A 2GPBA 4OXNA 3EGOA 5ESWA 4DANA 4MV6A 1I3LA 3CNNA 4RX1A 4CUZA 1E5XA 4HR7A 1RVV1 3TPFA 5ALIA 1BMDA 4FYKA 1D5CA 4AY3A 1KI6A 2VBCA 4QDZA 4EFNA 4BLUA 2PRKA 4UMFA 2P3SA 4G4GA 2G07A 4NULA 1QJCA 1WOYA 4KDRA 2B4TO 1COWD 2SKEA 1EX1A 3IP3A 5EHGA 3W2EA 1CZKA 2JJMA 4NICA 3W0LB 4L74A 5BR7A 1CSEE 1G8YA 4GP6A 1R4NA 4FILA 1NPDA 3OFSA 3ZDQA 1JQ3A 2ZVQX 4DAOA 4XFDA 1DWPA 1TTPB 5BSKA 4ALKA 3MRXA 4KQXA 5JANA 3HO1A 2W2KA 2W5UA 1PRYA 3OOJA 4OBXA 2CLIB 2XUPA 1NX6A 1Z17A 2XIQA 3H4MA 3JAWA 1H9BA 3IPLA 1RU3A 3LV8A 5DISB 3I32A 1KHHA 1V0JA 3JPWA 3ZCRA 1LNSA 2BFBB 2WM3A 2EDCA 2X8LA 3I05A 1HDZA 1C5KA 3WRXA 5JYBA 3VRHA 5BV2P 1DTWB 5KVQA 2HUPA 1KAMA 2VCEA 2PYIA 1F3OA 2V7GA 3CRQA 1JEOA 3Q7TA 5J59A 4C4XA 3GRFA 1DIAA 1JEYA 2VK2A 1C3EA 2DYKA 2O2IA 5AJVB 2AG1A 3I9V6 1NL3A 1Z7WA 4KDCA 4UAGA 4ZU3A 4F3NA 1C9KA 5BV7A 4BIMA 3DUWA 2C8LA 3EY4A 1O0SA 3UTDA 4H18A 4QU8A 5DKFA 1WNFA 2VHQA 3FPFA 4MYDA 1OJLA 2RKOA 3RUIA 1DWQA 3QNWA 3PVCA 3FUTA 2AKYA 4QG7A 5J4KA 3C5EA 4BN5A 4EG5A 5JAIA 4LBVA 2BFPA 2CZQA 2F1OA 3O92A 3TBHA 1BJKA 3D3WB 1PTJA 1N78A 3MC1A 3DEJA 4X8OA 1UBMS 2ABWA 2CFIA 2HXSA 3UMCA 4WBNB 3LGAA 2HSDA 3PR2B 4ZQIA 5J1SB 1ZH2A 4C01A 2WYVA 4F1KA 1GP2A 1SVNA 2QOEA 1DTSA 1OILA 3KV1A 2YW9A 3SS7X 4L2IA 2QTAA 4Q12A 5D00A 3D1VA 2QG4A 1IBMB 3HMQA 1IHYA 2BD0A 1URPA 5IUNC 1NZDA 4DLSA 2WD8A 2WHXA 1HFKA 2V5AA 4HDAA 4P0TA 4K9NA 4JI6B 1X1AA 4PO8A 2FPIA 1RQPA 2A9QA 2LIVA 4EB6B 5IT9A 4FD2A 4R84A 3AEQB 3P9NA 5AKEA 5A03A 2IYYA 3IALA 3VOTA 3I4CA 1XDGA 3I92A 5H4HA 5TGTA 5AI9A 4GECA 2GOYA 2PZBA 1SY7A 4KE7A 5D86A 1DB3A 3ZW9A 3L05A 1B41A 2RAFA 1L5WA 1GNTA 2D1FA 2AQKA 2D1TA 4XGNA 4QXPA 2JIQA 5CNKA 3HJBA 4Y0VA 4WNIA 4MPPA 2CJXA 2FUG6 1I94B 3A9VA 4ZT3A 2AMYA 5AOVA 1GJRA 3EEFA 2W2MA 1A9TA 2YC4C 1RJ9B 4D4GA 3J81A 3EVBA 2ZXEA 4RF3A 4ATNA 2XBMA 2O7VA 4HG2A 5GADl 4HH4A 2FEWB 2NVUA 3USES 1SBYA 1F0NA 3HNOA 2B2XA 1ZM4A 1JHDA 3L1KA 3OIGA 1OUMA 1QQ7A 1TFRA 2ZE5A 4CF7A 1U9JA 3I73A 4D9KA 3THSA 1EP1B 3G2OA 3NXSA 4RSHA 4YDSA 4BRZA 2ZQYA 3CE6A 2PX8A 1Z0SA 3FHCB 4WZAB 1JFSA 1TUBB 1QBKC 4C4SA 2Q6LA 1CR6A 2WFAA 5J5CA 4WY5A 4JYZA 1KJ9A 3MF4A 3RC2A 3DL2A 1TQ6A 5KTSA 1KMMA 4KBGA 5IC6A 2YRWA 3D31A 5JG7A 2Y66A 3W7VA 3VHLB 3WSVA 4ISCA 2VUHB 3KJEA 5IT4A 1JG3A 3JWHA 4GNRA 2H51A 1W0JD 3N2YA 1SVOA 2YVUA 4R2LA 3UJ3X 4EECA 4UUBA 5I7WA 2GBCA 2BE7A 3RTAA 1SU4A 4L7VA 4NTZA 4V02A 4IOJA 3P19A 1XG5A 2QAGA 4FEGA 4OU5A 2VDMB 3A6KA 1MHPA 1M8GA 1NVVR 1N6HA 3IVGA 4HYEA 3U7QA 3ASYA 4Z86A 5B2ZA 4M1YA 3C5CA 4MK4A 4YT5A 1IK4A 2IYPA 2PGJA 3FUXA 4JJ6A 5DEIA 2V96A 1B00A 1LZKA 1FLNA 3OM1A 1IZ9A 1AQIA 1U1CA 2ZU6A 4FLFA 1C1XB 2YVQA 3HJHA 4TV8A 4XDZA 2X19A 4I50A 3PQEA 1ZMOA 1NATA 1PDOA 2DQSA 3VO2A 3DAYA 3LMKA 2ZSUA 3RC3A 3ZVNA 1Y1PA 2JLQA 4BBJA 3HTXA 2FR8A 1JG4A 3IYLW 3MLEA 1NXVA 3O8CA 2V7WA 5AVRA 4ETMA 1YE3A 3AUAA 3USZA 2HRDA 2YHBA 1T0PA 2K7ZA 3FJOA 4ML3A 3BGSA 1MQ8B 3DC7A 1CNFA 4O1HA 4XE5A 5CITA 1MA3A 2O0HA 3CUWA 3R8XA 1JP7A 4RHEA 3V9PA 5FPPA 2WYWA 1PZXA 3IAHA 2ASVA 4CRWB 2I6XA 3OEYA 3ZWNA 4H1TA 4KSBA 5AKYA 5G0TA 5EQJB 2GYYA 4TYYA 3PLAE 2WWFA 3T3HA 1AUPA 3COZA 3AKYA 4E4TA 5L6MB 1JUDA 3L92A 4D4KA 3AWIA 1RPNA 2VZLA 2BI4A 3LF2A 1KJZA 3V33A 4L85A 1BN7A 2HZBA 1SK8A 4HOYA 1ZXXA 1KMNA 4UCXA 4A0FA 1KDOA 3OT1A 3DBRA 1I3NA 3IGFA 3P0EA 4AJ4A 1L7NA 5AVVA 2AZTA 2DBVO 1Y80A 3S27A 1NUPA 2PRYA 3ETHA 5C35A 3EUEA 1ZN7A 2H17A 3FROA 1KI8A 2HQSA 2NWQA 1NMYA 3R76A 2FUCA 4TS4A 5CIYA 2OM6A 2Z5VA 5HQ3A 1AJEA 1BWRA 5FEMA 5TARA 1P9NA 2B3DA 3WLAA 3TPZA 3PTAA 1KIMA 1KVUA 1P0CA 3ANSA 1XCGB 2NTYC 3A4TA 1ND6A 1TKBA 3MWYW 3UPTA 3DZFA 2VDJA 3H6KA 1DJLA 3CLRD 2VAVA 1IY8A 5C46F 3TJMA 3WNQA 2FX5A 4FHEA 4V39A 4YDQA 4KC0A 1LA2A 3ITEA 3R23A 4BNDB 3GLGE 1ZK1A 2XCOA 3H97A 2GVDC 3NTLA 4JT8A 5EJFA 5TPWB 3I6MA 4UUPA 3CEPB 5FYDA 3RI3A 3SFZA 5K6RA 2JEYA 2QX9A 3IEKA 2J31A 1C7IA 1HZZA 3A37A 4J0CA 1W19A 3LXUX 5FOTA 3BK7A 1OTYA 5HSGA 4LGCA 5FL7D 3CLUC 1Y3CE 4A0GA 2WJJA 5B3LA 1TW3A 4LFBB 1R00A 4B87A 4LXGA 2BHLA 4AMZA 1I7PA 1QIEA 4HO1X 1B76A 2YXNA 3J81k 4FU0A 2WOJA 3MTJA 1SCJA 4KOAA 4QZVA 5ANRB 3PFNA 2DGDA 2ISCA 2AGVA 3D7SA 3U1VA 2O0MA 1AD2A 2W0SA 4P7KA 3PXXA 3F1LA 2JHCA 1TYAE 1YBMA 2FE1A 4C7KA 2M2IA 4YRTA 1GYQA 5ALEA 1ESMA 2WZDA 1I2AA 2XB8A 2CBGA 3ELDA 3G5UA 4CL8A 4E21A 1G1MA 2ERYA 1IATA 5LMZA 5ALXA 2NSLA 1P29A 4Q1VA 2XRYA 2C95A 5KOHA 2P79A 3G2KA 4QLAA 4JX8A 1OBHA 1R74A 3THRA 2IS2A 2P7HA 3I53A 3VTZA 3W6UA 1KO1A 4H77A 1XKQA 3H19A 3IC5A 4BOYA 3X1YA 3AKEA 3I72A 1I51A 4UD6A 2Q4TA 2QTGA 3B1ZA 1AS2A 4JBGA 3IXLA 5TQ2B 2HIAA 2XF2A 3BD9A 4LYHA 1S89A 1FP2A 3IQXA 2EKLA 1U3GA 1CULC 1I4LD 2ZIEA 4JEUA 4TSFA 3SY8A 4E1VA 5D84A 5JJ5A 3DE5X 4CM3A 4XPIA 3K8YA 5F3DA 5FA6A 3KAJA 1B73A 1Z22A 2TYSB 2XD9A 1TUIA 1IM5A 1ZAYA 1U0FA 5AKXA 3TZ6A 1E3TA 4I8IA 4R3WA 3A4IA 3LA8A 2GRJA 3V1TC 2Q7OE 5L8VA 1WA5A 3DMHA 1ML4A 3FBTA 4OQXA 2ZUTA 1TVKA 2XA9A 1GWNA 1EJ0A 2J7PA 2Q1TA 4LE0A 2GD6A 1YUMA 3H75A 4JJ7A 3ZY2A 3DE0X 5DHSA 2OD2A 1A8IA 2GR9A 2Q0HA 4PPYA 4QVKA 4E5DA 3PJRA 3I6YA 4BXOB 1N5IA 1WW2A 1UBKS 2GJAA 2L18A 2PDAA 5DM70 2SHKA 3RJMA 4UEQA 2AZDA 3LSTA 3GP5A 4YONB 3OFKA 4QHTA 1PBTA 3W3ZB 1SM4A 3PCXA 4K8RB 5GINE 1PS8A 3EIFA 3ZE6A 1BHJA 1IHOA 1PEAA 2Q1SA 4EKYA 3I9V1 1UADA 1CUGA 3LVRE 5DE3A 4XYLA 4JXZA 5KTYA 2XWSA 1SZJG 1M66A 2G5PA 4BNXA 2QXUA 4KGVA 1UKVY 3A6EA 3GJ7A 4UQOA 3VM6A 5AM5A 5LA6B 2P9BA 4BWGA 4HDCA 4Z3DA 3ZIDA 1GG5A 2OP0A 2X0FA 3T0FA 4EUHA 1XZMA 1EFAA 3Q72A 1E18A 3SE7A 4HB3A 4RIGA 3VVBA 3Q8XB 1SU6A 2O3TA 4HYTA 1G21B 4KLAA 2Q5EA 1O6ZA 5ECYA 3PIRA 3NHPA 5IARA 2G88A 3VPAA 5DHUA 2BFCB 5D87A 2DWOA 4H1WA 1NGSA 4MWZA 4C4RA 4QUGA 1GFZA 2GN1A 4RK5A 4YFYA 4R3UC 5E8RA 1C4XA 5EWMA 3ZU4A 1H5NA 1TZMA 4CBVA 1QS0B 4CYMA 1E1DA 1GQQA 3VHRA 4ILEA 1RIFA 2OAGA 3G88A 1VIVA 1C9MA 2KSQA 4OB7A 3RIMA 1OX6A 2AR9A 5JD5A 4LXTA 2VAXA 4YWJA 3L7KA 4EQZA 3QE0A 3TQRA 1Y0BA 3PFGA 3GC6A 4W6QA 1E99A 4DUYB 4O5AA 1TTQB 4I5DA 4FD3A 5ALHA 3DE6X 3VKHA 3K20A 3L8FA 3RU9A 4XYBA 1V35A 2WP0A 1S2NA 3AERA 5D01A 4MINA 3SZOA 3TSCA 3HB0A 1LVGA 3RUDA 2IVFA 3S2FA 3PJFA 4GZ5A 2YV5A 1ZD3A 1NRJB 2AE1A 4UNSA 3RBVA 1DVRA 4KGZA 1JGTA 2EATA 4HS4A 2OWDA 1R6XA 4FDLA 4JGIA 4TWZA 4B3GA 3D6AA 1I33A 4JB2A 4N3GA 5ARCA 5H4GA 3C8HA 5FLKA 2GN4A 4TZTA 3K4HA 1U9ZA 3BILA 2N47A 4G1VA 2FSIA 2O19A 4BRWA 4YP9A 1M76A 1ZHFA 2GBFA 2J9YB 4LV8B 3VOBA 4BX8A 1QG6A 2GPNA 1XFDA 2GPWA 2DR0A 3AKDA 4S1PA 4RKYA 4E6EA 5C37A 2GJ8A 3D1JA 4YRDA 3RIEA 4EJSA 3QY0A 1K7YA 3OMXA 4R6XA 1Q7RA 3QBVA 1WBJB 1QKIA 5KAPA 3UB4A 5IH7A 4N76A 2FWIA 1U5BA 2Q6VA 4OJQA 4GI1A 4MZXA 3ZVMA 1XZPA 3H11B 1XRNA 3HBLA 4FDTA 2BFEB 4ISBA 1ZM2A 3Q8LA 4EY7A 2OFXA 5CVEA 5DGIA 4PGFA 5B3KA 4W5TA 1T36B 2QZ4A 1FX0B 3DFKA 4U2EA 2ZAMA 4LJ8A 5I48A 3IVAA 4BJ1A 2CJPA 2IKSA 1OBOA 5DK6A 1YFKA 2IGTA 2XSZA 3SC6A 3ABOB 4AZTA 4J3FA 3QTTA 2QE7A 1IU9A 4OXIA 3OTGA 1F38A 3JZAA 3SC2A 3AR6A 4JI0B 2WF5A 4LCBA 4E13A 4I5GA 1SVSA 2QTNA 2R86A 3DYVA 2NUPB 3WIBA 2OOSA 4RENA 3E53A 4A6EA 2YOFA 4EB8A 2SCUA 5JNWA 1J97A 2FJUA 5JDIA 4KQGA 4CF3A 5KWSA 4UU8A 5AI5A 5T4BA 4AY4A 5JADA 1DKNA 1JF8A 5DX1A 1CLUA 4JL8A 5T4FA 1IXZA 2VJAA 3GLHE 2QMEA 2WUGA 3PFIA 4U7HA 2WC1A 3AM1A 5EYPA 4OLBA 2NP7A 3EIUA 4WXMA 2PJRA 1MEEA 1ESCA 1U90A 3FPSA 1FUYB 4Y2JA 4Z0TA 5DBEX 1SCQA 3CLTD 1II0A 5CFZA 4POAA 4RK1A 4LHEA 4Y6OA 1P5JA 2ZIZA 1FUUA 4RQTA 1T8WA 4R31A 1DG3A 4U7WA 2VLIA 4LE1A 1KAHA 1BWSA 2IHZA 4BYGA 4K2AA 4S1VA 2RMKA 1F8GA 1DJQA 1KERA 1Z5OA 4B17A 2BMEA 4HDMA 2CLLB 2NYVA 3KB2A 2F64A 4K2HA 4FB4A 2PZJA 3C6QA 4PRZA 4KMMA 3STXA 3ZDYB 5BQ3A 1IXYA 2ODQA 3NDBB 5IJWA 3LJKA 3IP9A 4V0QA 4UU0A 3T34A 5BSHA 3BZWA 1EUYA 4D81A 1KYWA 3AETB 4IMPA 1EWKA 1UDRA 2B1IA 4R2XA 1KSGA 2PS9A 3F3YA 1F20A 1G7SA 4N41A 1X7YB 1K06A 1LWOA 5CM8B 3MBOA 5I9BA 3UHJA 4KQ6A 3M6AA 2QRLA 2BFWA 2BWJA 3PQ3A 3V8RA 1X1DA 3WWPA 4AJHA 4QGSA 3NPAA 2DFVA 3CIOA 2IP1A 3FLAA 3EPHA 1O8CA 4R1SA 3JSXA 1CUDA 3U9SA 2GD2A 2FF5A 3WBKA 4F93B 5KYTA 3ANTA 2P0YA 3F9IA 1MV5A 1Z75A 2UKDA 2B0JA 4YC7A 1OTHA 2W83A 3KXLA 3PX2A 4N3BA 1GVHA 1E66A 3BWMA 5EEHA 2IOHA 3DLIA 2HFJA 2LCIA 3ONDA 2IPNA 4Q47A 3TFOA 3EFBA 4ZIRA 2IZ6A 4EARA 1JTFA 1WAMA 2GBPA 3AK4A 2PMDA 4UBIA 2R1UA 5H0IA 3TSWA 3GF4A 4JT9A 3NW9A 3V4OA 3LHKA 4FN5A 1TC2A 4F6LA 1FNDA 2W2XA 2CKMA 2IYOA 4MO9A 1GCIA 1OMOA 1OROA 3ULKA 4JJAA 2RC6A 2Q21A 4TLCA 4W5JA 5BYBA 1BKYA 2ZCVA 1OLUA 2WHYA 3QKTA 5K6AC 5C7LO 5IHPA 4DW8A 2V7PA 5CDYA 1CZUA 1M1XB 2YZGA 3PYMA 2EP8A 4V0MA 3T52A 1X8LA 3L46A 3TL6A 3WYAA 2Y93A 1Q7TA 4MIYA 1NLMA 4MUGA 3WKAA 3ZS9A 1DO8A 2AXEA 3OP1A 2M98A 2DHRA 1VHJA 5IULC 5JSQA 2FPGA 2WT9A 3UN1A 4X41A 3WBJA 1VLHA 2H2GA 3I01A 4GMHA 5EQTA 3E22A 4BKUA 1NVXQ 4HNVA 5C31A 4JSRA 1FP1D 2CFOA 3DTTA 3JD4A 3OCUA 3R3YA 1G9TA 3JWPA 3L7BA 1EU1A 1LJ8A 4W4TA 1G3IA 4ZU1X 1R66A 1P72A 2DUMA 1T9AA 2IIVA 3C87A 4FTWA 1FS4A 4G0NA 4KN9S 2BEUB 4AJEA 3RG8A 1GA4A 3S8EA 3QKRB 4F72A 3K31A 4MLZA 3HY4A 2G9ZA 2R97A 1JPVA 2V45A 5EIWA 4H15A 2XZTA 3P2IA 4JC8A 1Z5WA 3CZQA 2DUNA 2VT2A 3HJCA 1KF0A 2V7XA 4B3HA 1BEEA 2IC5A 1XDBA 4UBKA 2ORYA 4DWVA 2H6EA 1U2GC 2HWKA 4GMXA 3QRWA 2FH5B 1MX1A 2AJTA 2AUNA 3GMTA 3U5ZB 2C4NA 1XV5A 1T5DX 3I6ZA 3OEEA 4GOMD 4CQLB 2IYTA 1MB4A 3HI4A 3IIMA 3O9ZA 3LUFA 5AKJA 3GRVA 1G2PA 2PU7A 3JCZA 4F3RA 3SJ7A 3TTUA 5D7BA 2WFLB 5B1IA 2PGIA 3PYLA 1F06A 3RROA 6YASA 1NRIA 1NW3A 2I8AA 1P0MA 2O8DB 4HNRA 3O3CA 5D51S 1FTWA 1VBNA 1DSSG 5G1OA 1G18A 5SYAA 5HPYB 3EQ7A 5LMCA 3I09A 4G9BA 2VJOA 3FG9A 2HM7A 4HFJA 2GXSA 5P21A 3EGDA 2IUUA 3PDCA 3ZK8A 1M6EX 1KI3A 4S1TA 1YS2X 1Q0RA 4TXLA 1P91A 1JMVA 1U04A 5AT1A 3ZS8A 1ZN8A 3HNRA 4YJHB 2EL9A 3BHMA 1GUFA 1H6AA 4L95C 2DFKB 3M1AA 4QNRA 4BNNA 2WHPA 1EFPB 4ICIA 1DO0A 3CKLA 6CHYA 5K09A 2DU8A 4P86A 1I24A 1XCOA 2ZBVA 3A1FA 4B43A 2IITA 2UZ4A 1JJAA 3NDPA 3TQSA 1Z8FA 4EG3A 2COKA 2FLWA 5GAJA 3IVXA 1Q7BA 3AGPA 3DCJA 4E32A 4M9XA 2C94A 2FMHA 2ZITA 4B4DA 1FMTA 3KSBC 1P80A 4QC2A 1QC5A 1TZKA 2DPLA 3HFSA 3PPVA 5AMXA 2AWNA 3VYUB 1SRQA 4C20A 2W8BB 2BMWA 2CMHA 3THXA 1ZINA 1CB0A 1FJGB 1YK1A 2BM0A 3U56A 4EG7A 2NUAA 2E21A 1KARA 2AC2A 5LYJB 1UFQA 5DYGA 3PGKA 3CPEA 4BHTA 2ZM5A 3AFNA 4TL6A 1M8KA 3I9KA 5K3BA 4HXGA 4I6EA 4TYWA 2LD4A 2BE9A 1PGOA 4KBFA 5F23A 1XNJA 4PYNA 1MIOB 1QLWA 1E20A 3DQPA 1ZH6A 1A7AA 2QTVA 4XX1A 3IPXA 3DZHA 2C5SA 1CVRA 2HO5A 2IE0A 2X5JO 4X3PA 4ZOLF 1KIFA 1DC6A 3IHLA 3QPCA 1FYDA 1JEJA 1G0NA 2J87A 3TMYA 4MWTA 5E6SA 3UB2A 4MV0A 3D3NA 3REQB 1ZI9A 3Q98A 3T4XA 4CR6A 1VQ1A 4PG4A 3TLMA 3B3FA 4EHLA 3AHCA 1RQ7A 3F6YA 3SDZA 2EIHA 4IDQA 3UCXA 5HF6A 3CZ4A 1GDTA 4AKSA 1OXMA 1R5BA 1P2SA 2DJ5A 2OCKA 2VWQA 4JITA 4HSGA 3B1YA 4KO2S 1B8UA 1XCPA 2HK6A 3MWEA 2B30A 4DQLA 2Q9BA 1TVCA 3C5WP 3NHUA 2JD0A 4I46A 1UBLS 5AJZA 3WKCA 2GJKA 2V6BA 3FSGA 4KV7A 2WY2D 4RTRA 4MGKR 4QJ4A 1O6CA 1WEHA 2MYUA 3I6QA 4WUVA 3B6ZA 4XCXA 3SP1A 5LCXA 5K3CA 4RSRA 3L6RA 2JBAB 3DMTA 3NKLA 2QMOA 1P9OA 2WAAA 1EFVA 4DM4A 4KFRA 1E58A 4AXBA 2OM2A 1DXOA 3JQAB 3PWZA 3IQEA 4C0KA 3O26A 1K88A 4F6RB 5HQJA 4Q21A 1JEQB 2C1XA 2N75A 4OP3A 4HQRA 1OZ0A 4EG0A 4XVCA 4R8LA 1N25A 3FMIA 3RK0A 2WM9B 1MABB 2RFLA 1KZGB 3IURA 1V1RB 3KHKA 2P6UA 4BNJA 1NN1A 3VVLA 4EI9A 2BTQA 4OLHA 2H59A 2IYUA 2H48A 4Q16A 1ISMA 4WZ6A 5E38A 3JVVA 6LDHA 3IMFA 5K0EA 1FJXA 5T6MA 2ZTSA 5IH3A 2GBLA 2BFMA 2VJQA 3SR4A 4NWIA 3LC7O 4D0LB 2O1SA 3IQHX 5TT0A 3KALA 2VSYA 4IHAA 1MCZA 4KEAA 3DYBA 1J2JA 1PJQA 2WKQA 3BHNA 3LF1A 3WICA 1D1TA 1PT9A 1XHEA 3DXYA 2BFDA 3C8DA 3IR7A 3BQ9A 4D3ZA 3ZI7A 1GFSA 1N7JA 1BQEA 3D2BA 3EG9A 3RASA 2HPZA 4G86A 1ARZA 1FFDA 1USKA 1PSZA 2PIDA 1A5BB 4JVMA 3MXTA 4EYKA 1AZLA 3IUMA 3UB3A 1Z7GA 3VH4A 2GLXA 1RYFA 2B35A 1Q14A 2FI1A 2XDQB 4CF5A 5CLHA 1V48A 3C7AA 2HSEA 2OCXA 4DSNA 1FSSA 1IHPA 4JXKA 3A31A 3VR0A 1NQOA 2KS6A 1U3VA 2QRVA 4ILKA 3K92A 1X9HA 2FZCA 1T4BA 1USWA 3SXPA 1MHTA 2V6MA 4XVHA 1K7EB 1QXSA 3AHHA 4PC1A 1U1FA 2ORVA 4D9IA 2H2WA 1YV9A 4C76A 1YDFA 3LKVA 4CTOA 4FBLA 1PZHA 3RS3A 5LZ9A 1FSGA 3I2KA 1IOLA 1RAAA 1JHRA 1E64A 1BXGA 1VLQA 2RHRA 2OZEA 4W8HA 2IELA 2JAOA 4AIRA 4D26A 4KAJA 5E6RB 2PNFA 5C80A 2R66A 1A7UA 1Z7BA 2PZKA 4WCFC 2CNLA 5C52B 1Z0JA 3C4JA 4NU6A 2EF1A 3CWZA 4XIYA 5M7EA 1NP7A 1JHQA 2D0OB 4OJNA 3SKXA 3T9BA 4ZJPA 1F51E 5KINB 3KTAB 5BNIA 3OESA 2BJWA 2F8MA 3PWSA 4L0CA 2ZBQA 4BO6A 5JH7A 3GLGA 1VLVA 1Z4QA 2G28A 1LW6E 5CT5A 2QJWA 3U60B 3CXUA 3LVFO 5CCEA 2PKRA 1EK5A 2Q28A 3Q3JB 4E30A 3PG5A 2VH5R 1GNSA 2B37A 4GPD1 4TVKA 1AKTA 4X1YA 4G23A 1H3NA 1XEXB 1ML3A 2AF4C 4KH1A 4PBRA 1RKBA 3MMSA 2V6FA 1WG8A 3C1TA 1OXXK 1IEVA 1RRKA 1XHLA 2O2HA 4EDHA 4LI3X 2SICE 1EX6A 2H5JA 3A4LA 3H65A 4AN0A 3O4IA 1XROA 2X7XA 1WUHS 4JLDA 1X1TA 3IDAA 2PUCA 2QVLA 4ZYVA 1XMPA 2EX1A 3KKNA 4MROA 3KTOA 3SAJA 3PDIA 3ZHCA 3DE1X 2QBYA 3CF6R 1AK9A 1ODKA 3G17A 3B7WA 4UD2A 4NKRA 1G16A 2P2ZA 1A96A 4PHFA 1ISIA 1QWSA 1VPTA 3CPHA 5EAIA 4AS3A 1CTQA 2I3BA 2PKQP 4Z7QB 2QNBA 5DM4A 5JCOA 5D2CA 2OV1A 2A1IA 2RBKA 2A5DA 1YI0A 2ZJBA 3ROQA 4Q7QA 2H2DA 5K0SA 2ZIUB 2BISA 3INRA 3NQ41 4KX5A 3B89A 1RKVA 2XMRA 4MUHA 1ZRSA 5DM60 1UMKA 4TZKA 1R4NB 3HBNA 3DV0A 4AJKA 1C7ZA 2P4UA 3HA2A 2N9UA 2KMLA 2QYOA 3RRFA 2W2KB 4QPZA 5H7XA 2MCFA 2VJMA 4Q3KA 4FM9A 3B1FA 1L4UA 1NAHA 3FOAA 1P1CA 4R54A 1WMAA 4IIGA 2WT8A 3IEIA 4ND7A 3LBHA 3BDVA 2WW8A 5DGDA 1BQ3A 3V1MA 1KXJA 3CUEF 2WNSA 3HA5A 3UA4A 2RHBA 4JB0A 1XDWA 4BNTA 4X66B 3BCRA 1T2NA 1JEYB 1JT2A 4BB0A 4RHUA 5LUBA 1M1YA 4J1SA 3FTFA 2AV6A 4WNCA 1WMBA 1LK7A 1RWVA 2D5AA 4ROTA 2C5BA 4ZXPA 2P0AA 3HBAA 1HC7A 3K9LA 1GKUB 1I7NA 1Z6YA 9GPBA 4RKFA 4D4HA 4CVNA 3LU1A 2P8JA 5DSZA 3ZE8A 4OFBA 4EVSA 1ZJYA 3C6KA 3IRUA 3KUKA 3VYWA 5KX5A 3R9KA 1N57A 1T9CA 5EE0A 4BLRA 1FDRA 4AYTA 1YHNA 1C1YA 1RBMA 2F4VB 1AB6A 3RYHA 3AVTA 4XDHA 3DDSA 4DLXA 3OFNA 4EY3A 3E82A 4AKHA 4YJFA 5EL0A 2B1QA 2XB6A 4R16A 1TF7A 3AHIA 3BXGA 4U3JA 3TW6A 5C1DA 1N6LA 2RAVA 4R05A 3MQFA 4AY2A 1RNLA 3HM9A 1CZNA 1AQYA 2XRMA 2HWYA 3EIWA 4HDRA 3W8DA 3WE7A 1XK7A 1A5AB 2PSFA 1YT5A 4AMBA 4L2IB 5DHFA 3SLKA 2WI8A 1NC3A 1U3TA 3JQBC 2OXTA 5BWLA 5JSUA 5JXJA 3EUWA 4CU5A 3X0DA 1NU8A 1OH5A 1OAAA 4NBLA 1XCJA 3O90A 5CGZA 3VYSB 3S99A 2P6NA 1F2UB 2FPIB 3QITA 3PXCX 2YCBA 5CJJA 4O1MA 4EVRA 3LP6A 2RD2A 2GZSA 2CNWA 2IQ5A 2YYSA 2ZSKA 3O3OB 1TK9A 1CBUA 3DBHA 2OCYC 3KYIB 1E4YA 1R0WA 4PG6A 2G70A 4YMTA 5JQGF 1SC1A 2A1UA 1Y6GA 1X13A 2HO4A 1T9BA 2P30A 4MOWA 1OLXA 5C8ZA 4NH4A 3MEQA 5JCPA 3V4VB 1VLZA 3OBIA 2P35A 3IQDB 4Q02A 3EFOA 4EI2A 4HQFA 4JYCA 4PYQA 1QK3A 2WU8A 4KQJA 4EA7A 3IAFA 4Q9JA 3MNFA 4JJFA 3R75A 4A1FA 4BQNA 1MX3A 2NVUB 1NLUA 2XZLA 3UJAA 4F2GA 3ZEAA 1LX6A 3KWLA 3V80A 4GX0A 2D4AA 5F52A 3M9WA 2XF8A 1KKLA 3WLRA 4RLSA 1I3KA 3OEHA 1HYHA 3V3TA 3OKAA 5CPFA 1MO2A 4Y9DA 3D3QA 1KEVA 1U8CB 2A0UA 1R88A 3KE8A 1JJVA 2WMYA 4FDMA 4GLOA 4LY6A 4RS4A 2KQUA 2VDWA 2OORA 4K9QA 3FPGA 2DSNA 1MJGA 2I71A 2C78A 4WCVA 3H5VA 4W6ZA 3ROKA 4OQMA 4BAGA 3ZTWA 2A8YA 3QM1A 3GLFE 4G5HA 3WNVA 4C6HA 3RT7A 2VRWA 4H17A 3RJ9A 4ZHQA 2PWAA 4BTEA 1N3LA 4CMJA 3HYTA 4OHPA 4QBHA 1Y1RA 1W1IA 4JUFA 3EA0A 4N8EA 4P93A 3ET5A 5LNK1 2IS1A 2XAUA 3UK7A 5BPHA 2XMGA 3C41J 3U7QB 4KI0A 1L5NA 2AHRA 2Z9BA 4RZSA 4BMVA 5A5DA 4JY7A 1DQYA 4I1OA 4JP3A 2XUIA 2Z58A 3QVWA 4S1NA 5JEDA 1SXQA 2WWHA 2AOTA 5HTKA 1L4HA 2O3QA 3A1CA 4I50B 1E2NA 2NZXA 4L8LA 1HK7A 4QDKA 2JKZA 3O84A 4CTMA 3CEHA 4KV9A 3IESA 2BIFA 4EB0A 1UQRA 2C57A 4FYYA 2RC5A 2JI4A 3TB4A 3BBLA 4CMHA 1MA0A 4Q37A 4F21A 4H0NA 1AN9A 2QWXA 2QJFA 2X22A 4PFSA 2WVGA 1YDGA 4WJZA 3FDIA 4B4WA 1ZJ4A 4H60A 1RZ3A 1NN0A 4N39A 4ZZ1A 3OZRA 3CA8A 2QN7A 1U0JA 1R0CA 2YV4A 4YIKA 3UJ7A 4FMDF 2Q5HA 4CM8B 4XQGA 3NJRA 2PL1A 2WF7A 1KOFA 1YDEA 3KR0A 3KWFA 2L0XA 5PGMA 4DA8A 3GBVA 1XCMA 2J6HA 2VSFA 1Z6XA 3FSEA 4G81A 2EZTA 2AA3A 5TJHA 3ORHA 4LZAA 2JLBA 4YRKA 3B1WA 2FW9A 3OT1B 3WLTA 3DBRB 1U5AA 4RF5A 4NEQA 1H1LA 5E9JA 4REOA 3NBAA 1Z38A 2PXCA 1P0QA 3UH1A 1NMXA 4EW2A 1EVEA 5HIMA 3K0EA 2NXWA 5G2OA 8ADHA 3JVIA 4BNFA 4JEMA 5KHLB 5MN4A 5IJAA 5J1TB 1UK7A 2L17A 1P3Y1 4K3UA 3TTXA 1IRXA 3D2LA 4MQ4A 4G5QA 1E1LA 4GI7A 4UE6A 1WB9A 3HZRA 1QGAA 1T2EA 1EUZA 3DCNA 3IUYA 2QRZA 1BXKA 1XDZA 3ZY5A 2WTMA 3X1DA 2D2IA 1P6UA 4KNVA 3KK0A 4PSAA 2G6TA 4MTLA 5TT1A 2VH1A 4CR8A 2D0DA 2ZJZA 2Q3MA 4Y2QA 3VGPA 3OPVA 2VSXA 1QHNA 1Y3IA 2KW5A 1W93A 2GFHA 1HE8B 2WAYA 5KQPA 4Y2HA 3AVWA 4J94A 5EKUA 3NTUA 4HAZA 2GFQA 1ZJJA 1SBNE 3PC4A 2FSVC 1SU8A 3NGMA 2XNCA 1U99A 3I8SA 3R0ZA 2RGRA 3WGIA 4LRQA 2BHNA 4YROA 1Z56C 3RUAA 5IS2A 2G71A 3SC4A 2D1SA 3A14A 1SVLA 4YUYA 2PR7A 3E1KA 1NONA 3NHWA 5KTPA 2AOUB 3FVQA 3O4RA 4ZAGA 1MO3A 2EEZA 1J90A 1VL5A 4YV1A 4WESA 4PTZA 1PT6A 4PR0A 4RGVA 5I9SA 1QG0A 3TZKA 1J0AA 2GEJA 2JFGA 2WNHA 4FONA 1P0PA 1BX3A 1T0BA 1WZUA 3A70A 4FDAA 4DIOA 2GUGA 3GAAA 4JJEA 1QH9A 5GZ3A 3GJRA 1AQLA 1SQFA 1LUAA 3K0CC 1XWFA 5C8XA 2QS9A 4TSKA 4CGZA 1XYYA 5KOHB 1QIDA 3UNXA 1OXSC 2ECFA 1EX9A 1DIHA 2WF6A 4HAUA 5M29A 2JANA 3HCEA 1EWVA 5ALFA 1JQKA 1UBSB 1YHYA 3PPXA 1G8MA 3U9LA 3QFTA 1B8VA 1JSZA 4RUKA 3G5AA 4RELA 4GLFA 3FCXA 4EA9A 3IS3A 4QX6A 3T0IA 4B3SB 5EJ7A 3GDOA 4XPIB 4YRGA 1TF2A 2YJ6A 4OJTA 4UXIA 3SKYA 4L8VA 2XDWA 3NONA 4DGQA 2B9VA 2MOKA 1CJSA 2R9VA 2ZGVA 3G2QA 3QXSA 2O3SA 4A9AA 2YY6A 1XP8A 4QFDA 2IY7A 1PJ4A 4MB2A 4WV3A 3WK7A 1IB0A 1TVKB 4UVEA 3D0RA 4P31A 2PHZA 1GN9A 1UK9A 2KLHA 2OCLA 3IE2A 5JD3A 4M60A 3QEAZ 4ZAVA 2DPYA 2R68A 1BE0A 4PIPA 5CNJA 4EHJA 4QQRA 2HJSA 2QX4A 1FEZA 1USIA 5THXA 4FSXA 2I6FA 4QYSA 2PQ2A 2MHCA 5IUKC 3AR8A 4J76A 1JT9A 1GKKA 4RO0A 2XTNA 2VC2B 1MX5A 1JSLA 3CT6A 5E1BA 1EJ2A 1KTIA 2DC1A 2P1ZA 2R4TA 4D6PA 1BCRA 2ZUSA 4K9OA 1PWEA 3W1WA 4K9MA 1Z6AA 2EZ9A 3GY0A 1GADO 1UBHS 1Y7HA 3JWGA 3U61B 4GR9A 3DGFC 3ILSA 2BGLA 2QN3A 3IPCA 1H42A 1O94D 4WZBE 3CZRA 3FMPB 3S7ZA 4CKEA 1RWMA 2LW7A 3SBEA 2ISQA 3BZBA 1G8GA 1N9GB 2NT4A 1SUPA 2C2ZA 5B7NA 3VOAA 2ZRIA 3GYBA 4RTLA 1M73E 3IH5A 5TB5A 4GKJB 3OJCA 4BKPA 2Z5LA 1HPLA 2JGDA 3E2PA 4U2KA 4JBHA 5AM1A 2JK1A 1M2VA 4CM1A 3EXAA 4IDAA 3KQSA 4P1ZA 4DF3A 3D5TA 1AT1A 4D9EA 3T5DA 5JH7F 4DCUA 1GG2A 4M1QA 3B8EA 1HO3A 4FNGA 3GT3A 4L6IA 3X43A 4DVJA 2Q3FA 2Z57A 1PS0A 2C1EA 5JCJA 4O29A 2NT3A 3PDHA 2VSNA 3DEZA 1FU4A 3GZ4A 4C0AC 5MGNA 4R0VA 4BO8A 3HYSA 4NARA 1VM6A 5FI5A 2RK6A 4OSOA 4C22A 1Q2XA 3B3JA 3U4HA 3HRHA 4DCGA 1ULHA 4MR9A 3V4LA 1NURA 1XZCA 2AR0A 1OFVA 1UQTA 2CLKB 2J32A 1OF1A 1IG3A 2E5FA 3CW2A 4GOXA 5JR3A 1JDZA 3O91A 2NNWB 3TECE 2WSSD 1IBRA 2YZMA 3CISA 4KXLA 3CM0A 3AERB 4X1IB 3LT1A 4YALA 3NEPX 4Y6LA 1G6HA 3R6TA 1PDVA 5AQ1A 5JAHA 1Q1BA 4RTNA 1TVMA 1FSZA 2X6TA 4HD8A 4HEJA 1JVNA 2FW1A 1ZONA 4WKOA 3BCHA 4UM9D 2VDVE 4INJA 2VNSA 2LTAA 1W2WB 1I3MA 3SDBA 3D7NA 3I9OA 2FEXA 1Z5GA 1M67A 5JC1A 1DXHA 1CQJB 1CIPA 2D7DA 2WTEA 1NMSA 3H2GA 3PU6A 4E12A 3WV5A 4EJSB 5BOSB 1FNBA 1KAOA 1I14A 4MARA 3QENA 4XCQA 5F7JA 5TPZA 1B8OA 3QLTA 5JXGA 4KFCA 2R1TA 1NBWB 3RSCA 3UPUA 1SHTX 4AB1A 1J0CA 1RWNA 4LW8A 5HHTA 1H6CA 1L1QA 5AJUA 2VPQA 3D4OA 1SKYE 2JGJA 1XN4A 3PPYA 1RT9A 4QATA 3I83A 3EIOA 1VP3A 2OG2A 3NEJA 5AJHA 1TEHA 3BK1A 3R0JA 4P38A 4A8JA 2JFOA 4EPRA 3PC8C 1N6NA 2J3IA 3N05A 2YQ4A 3NBZC 3G0IA 2EYUA 3ZU2A 1J9EA 1IQRA 1MGPA 4AD8A 4D41A 2PGDA 1YZNA 3EMBA 3QMPA 3KR9A 2QTFA 1F9EA 1THMA 5GOZA 3O2QB 1JLKA 1ID1A 1K6XA 2W11A 4I9HA 3P9YA 4WLUA 2B1JA 2PWYA 3RKRA 3KB6A 5LC1A 1DBRA 2HA3A 5FULA 3TD9A 1RRCA 3AU8A 3ETCA 2RJ3A 5ALVA 3IAUA 1JR4A 1L9XA 1PV2A 1SCNE 2SCUB 3LBFA 4RJTA 3T5MA 1L3CA 4UCWA 4YI5A 1ZNYA 1HETA 4IGKA 1YU9A 1NXQA 3M0EA 4ZT7A 2NQTA 5LOVF 3DHVA 4IX1A 4G01B 3K53A 2CWDA 1T3SA 5EYPB 5TMBA 4MQFB 2I1LA 2PBZA 2YWXA 5BT9A 3TSZA 2V0GA 2ZSBA 2J85A 1R6DA 3MG9A 1NXWA 3K9HA 2HV8A 2JVJA 3G8DA 2IU4A 3ZI4A 4B7CA 1AC5A 1EI9A 1PYDA 5FYQA 1XLTC 3DEIA 3FHJA 1TJYA 4Y1EA 3X2EA 5HGXA 2DFNA 1SG6A 4HH1A 2ICAA 5D3MA 3GCZA 1JHZA 3L4JA 4HDMB 1TYCA 3AHDA 2R7NA 5BN1A 1J23A 1DP4A 3CX7A 4NBWA 3STTA 2FZKA 3L4EA 5K0CA 2ZS7A 1DXQA 5DF1A 1YDHA 3HJUA 2BY4A 1Y8QB 2PRZA 3PHHA 4CG0A 4D99A 1ORHA 3ZQJA 3EZFA 3LO8A 1HNXB 1DAPA 4KB5A 1DZ3A 3IOBA 2FHSA 2I5PO 3QVVA 4K81B 2PG3A 3FGZA 3OZDA 4BASA 5C0OE 1EQUA 5TE9A 4QOGA 1KFBB 1O5TA 4XIIA 4N5LA 1WIWA 4PLTA 3IOCA 5GIPE 2IYNA 1BS2A 2W58A 5KJ6A 4N5MA 3WLEA 4ENSA 5FIUA 1CEQA 1P39A 3PI7A 3FVTA 2ZJYA 3GFQA 3O2NA 4EGCB 1Z88A 3FVVA 2XWPA 3D6HA 1A2OA 3EZGA 2WJIA 3DAHA 2Q5LA 3PA6A 3AHFA 2Y0EA 2PXHA 1NDUA 1YSCA 3UJBA 4MW2A 2LIPA 5ETJA 4ZIRB 4RZ2A 3O94A 3OLXA 5AUOB 1DBWA 2VHVA 1CERA 1DE0A 2P2YA 3DXZA 1M2HA 3T94A 3D0QA 5KEIA 5EJ4A 1X8KA 4JAVC 5DHQA 1TQ8A 3DOIA 4RXMA 5JROA 1L7BA 3O8RA 3DDZX 1UP7A 2KE5A 1OLSA 5GONA 2OK8A 5JLAA 2L42A 3FCYA 1RWKA 5C3UA 1RABA 5JQGB 2PLFA 3VQTA 3EAFA 4BV9A 1H0KA 1GZ3A 3D43A 2P2GA 3LWBA 4W5HA 1MJFA 2PZMA 4FT4A 5CK4A 5BV8A 3H4IA 1DIOB 1GL3A 1OLUB 2XMDA 2YUTA 3KL2A 4GXNA 5HGJA 1ZJ6A 3QOWA 4N6NA 2QLLA 4E5NA 4X7MA 1EZ1A 4I6JA 3TGWA 2VP0A 1YRWA 3FWHA 4PLFA 4CLRB 1VSVA 1HDIA 2PA3A 2CBXA 2CZGA 2X3FA 3DDWA 3ILHA 4II2A 2WKRA 1AQUA 3FZQA 4BVEA 4YGYA 2FFBA 4F0JA 2K4MA 3AEYA 3ABZA 3LQKA 3R9WA 5A62A 3MWLA 1DBSA 1WVGA 2R44A 3E22B 4Z0HO 1ZU4A 2V4UA 3CBGA 4UNRA 2ZTMA 4ZHQF 4FW9A 4B79A 4EFDA 4D80A 1GV1A 2XUJA 3MTAA 3QV1A 3CLSD 5G0WA 1PV1A 2HLDD 1VTKA 1NNSA 3Q6NA 1U8ZA 4M2LA 1HDOA 2UVQA 2EFCB 1V7PC 1ZM9A 3H0KA 3AJRA 1D0IA 3WQBA 1J7JA 4PZYA 2FN3A 4LNHA 4PBSA 2Y9MB 5JVDA 2ZU0C 1VCNA 4A03A 4D3SA 1W8DA 1M34A 4EFLA 2PEYA 3PBKA 4UTZA 4UZFA 4M1EA 1XLWA 3WK5A 4XIFA 1KGDA 2I2BA 4E2YA 4AO6A 1YRQA 4CMAA 4PVCA 4H7EA 1N8TA 5HIIA 1FSPA 2DFLA 2ERCA 4O2AF 3V4SA 4JUDX 4AMUA 4DNXA 3WGUA 4CV0A 1D0SA 2C2OA 5D7NA 1A4IA 5TNXA 4BNUA 3U4QB 3GNSA 4L5CA 3W5AA 1QIHA 3E1SA 4GE3A 4V0OA 3D6VA 4WOBA 5AK4A 1I1HA 4DKXA 4LN1A 1TM7E 4RSGA 3RB8A 5LFAA 2YX1A 5GV7A 2PUWA 1VL0A 4CV2A 1H66A 3OQBA 3K9BA 5AI8A 2PD3A 4ZOBA 1YF3A 3QFRA 2I67A 4TMYA 5DM2A 1O95A 3KOWA 1F12A 4FFRA 3VU3A 5IX8A 5A7GA 2FLVA 3CNHA 5LU9A 3H1PA 1QKJA 4L5YA 1PD0A 1SB9A 2ZAGA 3PC2A 4H7DA 4NH0A 4B46A 4NYMQ 1EKXA 1MD9A 2QT0A 4WN3A 1H2WA 1Y33E 4RTSA 3WL6A 2ZJ3A 2IZOA 3V8PA 2VA8A 5I3ZA 2WD7A 1RYBA 3GJQA 2XYRA 4L3OA 1GQFA 2WHPB 4IGAA 4FMDB 3PCRB 1BE1A 1E1CB 4JUIA 5CLGA 3V7UA 5LQAA 1RLUA 1U7OA 1V6AA 3CF4A 3IAEA 2I3DA 1QOPB 4HVLA 4P22A 3OICA 1Z15A 1SC4A 1U2QA 2H5LA 2RI0A 4HHEA 3QPAA 3K1JA 3H2JA 2VPXA 4PLGA 3SS8A 2VP2A 2ORED 1OX4B 4JLJA 3W2GA 3BFJA 3TGLA 1GRRA 3DFZA 2JHAA 1RVDA 4PY2A 4XWYA 2B7CA 2RONA 3UT6A 5CFLA 1QC5B 3M3PA 2IBTA 4NCNA 2MSWA 1JKXA 3DT8A 1J09A 3OZVA 2AIRA 4RMHA 3M81A 1I4EB 5AM0A 2CXHA 5DXAA 3W1EA 2PYDA 1GOTA 4S1WA 1AQNA 4DM3A 4R8MA 3THXB 4EHKA 1TZCA 2R87A 2QA5A 2JD2A 1QLHA 4U7TB 1GQSA 4B3DA 5DYNA 1O94A 1PK8A 3QVXA 2OCBA 2WVJA 4A2WA 2RKWA 4UXHA 3DOCA 4J4HA 4V0SA 5AUPB 2NM0A 3KJIA 4LYJA 4JP1A 2ZDHA 4HLUC 1GAWA 4Y2GA 1UPUA 5KYVA 3U3ZA 1AKRA 4Y2SA 5IDVA 2QEQA 3AF0A 2OFOA 2ZULA 1N6IA 3KCNA 2B99A 1W76A 5CUQA 5ES3A 3AV3A 1MDBA 3KUUA 4N82A 1E77A 3DS8A 4JBWA 3ORQA 3PUWA 4DJTA 2XCSB 5E6SB 2DLCX 4KPUB 2FDRA 2W71A 3TNJA 4CCSA 3ZD9A 1Y7IA 5DNYB 1D07A 3GUHA 1C7QA 1CJCA 1VI2A 3NIWA 1RLOA 4JSYA 4UHEA 2P62A 1GUZA 5IBQA 3MUEA 1F6DA 3ZJTA 2O7SA 3MWEB 2BM8A 2ZRNA 2JH3A 2P68A 1J8YF 1FPQA 2C42A 2ZTHA 4UZEA 3K6SA 3AHGA 3ROFA 3UHAA 3V5NA 4MUXA 3WIDA 3E9YA 2REQA 3V4PB 4UQLA 3RRXA 1OXTA 2PS0A 4CUKA 1FNMA 3M33A 3ZC3A 4F9TA 1JHYA 1GPUA 5HF5A 2J6IA 4FNMA 4OXKA 4PFQA 2RARA 4FZ5A 3W2TA 1T0IA 4TSRA 4BV3A 2MU1A 1FL9A 3GLFA 4AI6A 3DMRA 1EFVB 3F8SA 1W36C 2KBEA 2C5EA 1I32A 1LZLA 4K86A 2GCPA 1QQ5A 2OBMA 1UPAA 4X93A 4Z2AA 2VPPA 1SOMA 2AN5A 2BGUA 3TTWA 1X7XB 4ZXFA 4BFXA 5A0TA 1AKQA 2ATEA 4RS3A 5KS2A 3RFUA 5JSZA 1TVEA 1D2EA 2X1LA 4ZDWA 3N0WA 2BTQB 4PSCA 1KMQA 2FQYA 4IIJA 5EGNA 2XYQA 2DXIA 1GSAA 1DKUA 3H0CA 3ZXUB 3ODGA 1Z0ZA 3ND8A 4FEEA 1B93A 1D2CA 1Q95A 2RI1A 3E7XA 5HE9A 3WGHA 2JIPA 1NQXA 5JBNA 1Z74A 2BFOA 1NBHA 4WY2A 4WE3A 3GHHA 3OC6A 2I54A 1JXMA 2ZIGA 2BFDB 3DSRA 2I4NA 4Y0NA 3T5BA 3S2GA 1ADFA 2O1XA 2PVSA 3F6CA 2P2CA 3EG9B 3AVUA 1E32A 3CR8A 3MS7A 2NNLD 4R8SA 3X1MA 3CR7A 4OHOA 4G4SO 3OZIA 5FQNA 4FHZA 3TQCA 2BUCA 5EEGA 1SG0A 1I0IA 5IF9A 2B8JA 2WB4A 5HK8A 1SBCA 3BGIA 7MHTA 4URYR 1W4LA 3ORYA 3LLSA 3MERA 3JTMA 1YRBA 2WG2A 2I2CA 2F9MA 3PNMA 1ZD1A 3QV2A 3EOAI 3RS9A 4KLNA 1CY1A 1V1MA 2CXRA 1KSHA 1S7GA 1UMBB 2NQ2C 5DBFA 5M3BA 2JLSA 1GIAA 2FG5A 4YRLA 4JXXA 1J07A 4BQIA 3MT7A 2EHDA 5BWBA 4LXXA 4M6WB 1WMDA 4DJ5X 2RB4A 2A9PA 3STUA 4GVPA 1XQ9A 3M6UA 1UWCA 4Q1BA 4AG5A 1HG0A 5INTA 4DG8A 3NDRA 4MVJA 4JLBA 5KTRA 1YA6A 1C0LA 1Q16A 1YO6A 2IY9A 1P3JA 3IVMA 4G67A 4IF4A 4TXJA 1YZKA 3TRIA 1W4CA 4PICA 2MSDB 3WI7A 2TECE 1Q1GA 5JH7B 3RNLA 5MN6A 1UOQA 2OESA 2GT1A 4I4TA 3GLGB 3Q41A 1T25A 3WMXA 1VA4A 3C7CB 1CNMA 4PGMA 4YAIA 4AMVA 1OHHD 2CL7X 2JAWA 1YWGO 3EUFA 1JYSA 2IL1A 3K0FA 4D45A 4JYPA 4X1YB 2P3LA 3OA2A 4O02B 5KQRA 1Z6TA 2ADMA 1MB3A 4LYAA 1GAQA 3PX3A 4A92A 1PHRA 4BB6A 1ILEA 3ZJUA 4N3AA 1SBTA 1ZL2A 2V7QD 4D43A 2Q8PA 1GILA 2ZI4A 4I5EA 1TEZA 1CUUA 5J40A 1OI4A 3AEKA 3K9GA 1E7RA 2B1RA 4UOQA 1PR2A 2CLEB 3HP7A 2OVBA 3L49A 5CNMA 4CLDA 1U1GA 1YBAA 2JAUA 3HVKA 1VE1A 4KYTA 1U65A 2II6A 3LLUA 3OJEA 3QXXA 1BEZA 2A9KA 3MT8A 5K2MA 2BTOA 2ZBGA 3RRYA 3PDIB 4F92B 3D3JA 3P32A 1YJ8A 3QHQA 2QBYB 2O14A 1N2CE 2MIIA 1W581 2VOEA 1IY9A 2I4TA 3F4BA 4IFIA 1R0LA 2QGZA 4D2IA 4DQVA 2WKSA 2O6LA 3DD5A 2VBFA 2DUJA 5B4VA 3X1XA 5CA1F 3L7MA 2OBNA 4K6CA 1JLMA 3WWZA 3LTNC 3MWDB 2J9XB 1TX4B 4I66A 2GX6A 4EVQA 2X5NA 5KYWA 2FPMA 2PV7A 5HKAA 4M7PA 2QLNA 4EYSA 1SAYA 1UZNA 4BNYA 2JZNA 1Y6JA 4J0KA 4Q3AA 1T15A 5G4LA 4TOIA 2ZYRA 4DT1A 721PA 2ECOA 2HT6A 5FBHA 3C6ZA 3DV0B 1O9GA 4CEJB 3OMWA 1GY8A 2ZJFA 4UCFA 1MLDA 4RD0A 5TC4A 3CZ9A 5C81A 1PLLA 1SEVA 4FHFA 2P9YA 4KGXA 1CY8A 1JDVA 1GG9A 2D5LA 4EHDA 5HJ5A 2R6R1 2VJMB 1BYIA 1YB4A 4TTJA 1PFYA 3H5IA 3B2EA 2HHLA 4QUHA 4CKCA 4HEA6 4X3CA 4LJ7A 3DBOB 5SY4A 1FMLA 4ECAA 4MW6A 4CIAA 4JT2A 4BMYA 2FDCA 5LLTA 4YASA 1E7SA 2XUKA 2WMOB 2YINC 4RY9A 4AT1A 5LLDA 1EUCA 4DYHA 1KQPA 2I78A 4GOLD 1P7YA 3CY6A 2WKWA 4JEHA 1UBRS 1BWQA 5IZCA 4OVKA 3KEMA 5CHEA 1U7XA 1P33A 4M1MA 4QHSA 3BOSA 5LOVB 5TV2A 1Z0AA 3BT7A 3BGVA 1O5IA 1P9LA 3ZWKA 2X9NA 1P1HA 3L8CA 2CVOA 1NWHA 3DLTA 1C81A 2XIJA 2PS1A 3A36A 3TK1A 2M1XA 5BSGA 1Q19A 2J0EA 4MKGA 4ZCSA 3RYHB 4DLAA 4KYUA 5F5XA 2JJ2A 4N8SA 3BWBA 2XH8A 4YJFB 1NBEA 2I65A 4U3JB 5ARBA 3R0VA 5E95A 5FJIA 2HJHA 3O4FA 1M0SA 5AJWA 4ZQBA 5B37A 2FZ4A 2PZFA 2FYTA 5ICFA 5HRCA 1UH5A 5JPDA 2FAXA 2ESRA 2H1HA 4HDRB 1UDWA 1JJIA 4PZAA 1J42A 1E5LA 2ILVA 2RHJA 4LYFA 2J5RA 3DBLA 1SCIA 4LTNA 5EC8A 4ZZIA 3HI6A 3OY2A 4FR5A 1Y5MA 1XL1A 2WA2A 4BNIA 3VSEA 3GNLA 2FQXA 3PGJA 1KEKA 1JXAA 1OVGA 2V9CA 5DTRA 2PJUA 4X20A 3ZD7A 2E6KA 2OO7A 3FETA 3D59A 4KSCA 1NTOA 3KVOA 4ZC1A 4P5EA 4ZOEA 3BFVA 3ZHUA 2NTNA 1W4BA 4CTNA 2DFTA 1PNRA 2OHOA 1W4RA 1IN5A 4YCDA 4YPOA 2WJHA 2XCLA 1T5IA 4UJ5A 3UJDA 3D8UA 1CUEA 2ANBA 4G2TA 2A1UB 3TI7A 1XCBA 5IXSA 1M54A 4RZQA 2FEAA 3M6LA 4IVPA 5B6PA 1OLXB 5FBKA 4BMDA 3Q3VA 2JZCA 3P9KA 4JJ4A 1K2VN 4OMFG 2F3SA 2AMJA 1BS1A 3GRCA 4LVNA 4WH0A 3UGKA 4D8UA 1SUWA 1UC8A 4EM6A 5CG2A 4UARA 2OHGA 2OV2A 3EFOB 4IEIA 3B48A 1L5SA 4WJKB 3A1EA 1FU8A 1K0UA 1N0VC 5G0UA 2H2FA 3BMQA 2X1HA 4FFWA 5ALDA 3U48A 2MINA 4IFEA 4B8ZA 4M49A 4PV7A 4X54A 3UJHA 1Q20A 2HXYA 1ZIDA 2WF8A 3LAWA 2ZT6A 1K8ZB 4GICA 2C92A 2YCLA 2ZTLA 2YWJA 3DA8A 4Q19A 1VXOA 4XJXA 3I0MA 3HYLA 4LAFA 1FFGA 1TKRA 4GS5A 1ZRMA 1T8TA 2GO1A 1DC7A 2IOYA 3IOEA 3DVSX 3R09A 4J49A 3KE9A 1NDQA 1W4AA 2VJBA 2FVXA 3UHPA 4A23A 1I2BA 4UVGA 3NNDA 2VDWB 4R6WA 4EL5A 5LP6A 2QVYX 1JBQA 2FWAA 2FJ0A 3O4GA 5B6JA 2D5IA 2OXCA 1R15A 3D02A 1CC1S 5B5SA 1W5AA 3GGOA 5A4AA 2I2FA 5CYOA 3WGTA 4BKMA 2F1RA 3N6RA 5EY5B 4U4AA 4ZHQB 3BMCA 4OB8A 2QN6A 1NMQA 2FPUA 3BD7A 1AGYA 1Y6ZA 3M6IA 4IR7A 3FAZA 1O6BA 3ESRA 4C5AA 3G7SA 3TXAA 2ZANA 1V8DA 3EVGA 3N6VA 4Z6KA 3AJAA 4RTOA 3P97A 5KBYA 3T3NA 5JJKA 4BMPB 4Z4EA 1OJ7A 1T24A 2BGTA 3PD1A 3HZOA 1P5ZB 5DB4A 4KQIA 4B71A 4YRFA 4CQNA 4EHIA 5LWQA 3GEDA 4PG5A 2AOTB 5D85A 2WKPA 5DXJA 2X4LA 4F4FA 2BGIA 4R1NA 4A26A 2NACA 3A6LA 4YT4A 1MO4A 3U4GA 4O2AB 1MAWA 1TNDA 1NI3A 4HQ6A 3ZHTA 2PBFA 4F4UA 5JFGA 2HA5A 3GLHB 4I1UA 2JEOA 3QPVA 3AIKA 4B47A 5DHTA 4L76A 2Q5QA 3ITKA 4RTJA 1MAUA 2VQ3A 5IAEA 4HXYA 1YXMA 1GSIA 2AEFA 1PN3A 1T4CA 4D9CA 5J43A 5KDDA 1YQTA 1ISRA 1VKRA 3KDSE 4O4JA 4KVFA 4CTKA 5L3VA 1SUIA 3EEQA 3V48A 3TJZA 1E9FA 1T3TA 1OFUA 1UUFA 4GVLA 1B6RA 7YASA 3RFXA 1VYUA 3R8FA 2YHIA 5J4HA 3F7NA 5BWCA 2Z04A 2H4HA 1CV2A 4L27A 4MR7A 4X84A 3OQ1A 1E3LA 1G4UR 2V3WA 1LPAB 3FYUC 1ISJA 5CFPA 3TTYA 3RFCA 3IQZA 3MJDA 1Q74A 3UQYS 3VNQA 3VH2A 1XTBA 1H1LB 1QCCA 1VG1A 4ZI2A 4QELA 3LGXA 4KUEA 3ADDA 4U02A 3B20A 5L3SA 3BYZA 4EY6A 1JZTA 1OWOA 1RS0A 1EBBA 3DMPA 4AX4A 3NEYA 4BU1A 1NF9A 1YZHA 2QORA 3OD1A 3NJ4A 2XNDA 4L57A 1LTKA 2R79A 1WHTA 1RBYA 2XKAA 2FSPA 3OTQA 4X71A 1L4NA 1N75A 2A9JA 4C4ZA 5KNDA 1RI3A 3PEFA 4EAAA 1S02A 5TIIA 1S2LA 1SUCA 1DEHA 1SVIA 2Z3VA 4PZUA 1U3FA 4X45A 2ZB7A 3V8VA 3R7DA 4C5CA 1EZ4A 1W5FA 3OOYA 3BERA 2B5OA 1E60A 3DOOA 4ZCTA 1HNZB 4A0RA 1Q2UA 3MXOA 2ORWA 4H59A 2I9PA 2W6JD 3FLEA 1QV7A 2O2EA 3DPSA 3JR7A 3S1AA 4CNQA 4E3ZA 1UMCA 1JAYA 1MP0A 2HTFA 5HWSA 1P19A 1P4SA 2QAIA 1A4XA 4B85A 1U28A 2H1OA 2BR4A 4I3HA 3CURA 1M2FA 2HHJA 4KLZA 4FI3C 2BH2A 4NAHA 3FZNA 2BGJA 4L16A 2HEGA 1NJ2A 2RBEA 2BF4A 2FFQA 4OSPA 1QV6A 1YJ5A 4LFCB 3UXEA 1WZIA 4EHHA 1SQGA 2GARA 2H7XA 1KZ6A 2Z1DA 4J16A 1GM5A 3A2KA 1LVUA 1BROA 3PC7A 5E0KB 1MF7A 4H35A 2O7RA 1EVQA 2O5VA 2BC9A 2GJ9A 3BDAA 3ND6A 4DIDA 1S2MA 3KZMA 4ZQCB 1N8SA 4RHYA 3ZX4A 1WCIB 5U4XA 2BBWA 4V1CA 3GUYA 3R24A 4MTCA 3J80A 4TWBA 3GA0A 4I5FA 2OILA 3H9UA 1N2OA 2VI5A 3L5OA 1HGXA 4QDTA 3TW8A 4RW0A 3L77A 4WW0A 4QQKA 3CUUA 2GM9A 4QD3A 4CMIA 2VWGA 3GVPA 3CSUA 1UBFA 5LBUA 1DCKA 1EDDA 1GEEA 1P7WA 2Q9CA 2ZSIA 4P54A 1ISGA 1WV0A 7ABPA 2G77B 2J9GA 3DC2A 2IHBA 2GF2A 2V6JA 4J0FA 2XDAA 3QUTA 1DI0A 4IIJF 4R2KA 4DDKA 5A3JA 2AVDA 5JC8A 4ABTA 3LY9A 4JUBA 3DKVA 3DD1A 4PCUA 4TMTA 1XMSA 4B7AA 1NN3A 5FOWA 3FBWA 2YMMA 4D8TA 1NUUA 1PGNA 2OO5A 2RHDA 3C85A 1VJTA 1XVAA 3K3PA 1ESDA 4PAOA 4CG1A 5A0FA 5M2QA 1YAHA 2P9FA 1K97A 3CLKA 1L5MA 1CQIB 1ZJZA 1ODSA 4A0SA 4C5BA 2YXPX 1CLEA 1RRMA 1DAFA 1I3CA 3DZCA 3K2IA 1QIGA 4HMPA 4KP7A 3VZBA 4M37A 4XLZA 2EBFX 5TQ0A 4ZVOA 5TQVA 4ZVNA 1G8PA 3WL3A 1M8PA 5BO5A 3MGBA 4B6RA 3K70B 4P98A 2HHAA 3E9QA 1HM5A 2H54A 4NDZA 1OZAA 1X7HA 2X3YA 5CMLA 1T43A 4RK0A 3WLSA 3N76A 3OM0A 4AY6A 1CPYA 2XOKD 4DG9A 1BCRB 1PNTA 2AW3A 3SF8B 5CIQA 1E3JA 1NU6A 4CKWA 4MUJA 5I7UA 3JAKB 1J2EA 4Z9BA 4NXNB 1KPHA 4CKEB 1QK4A 5J2UA 1WDMA 4KQEA 4LQDA 5K3FA 3LDUA 3FPLA 1UBTS 3KOZA 1DL5A 1ORTA 1XU4A 2C03A 3NV7A 1V8FA 2JCSA 3EVZA 3HABA 3I4FA 2O3JA 3MUNA 1U2DA 5DNDA 2VBIA 4HQNA 5J5VA 3UF0A 3IUBA 1MEOA 4ZTBA 2JGDB 3IT3A 1ZSVA 4MJ7A 1M2VB 1FVHA 1Q15A 4FYMA 4KK4A 3STVA 1GL6A 4K9RA 3VDMA 1O7JA 2UYHA 1QVVA 4LDRA 3O6VA 3D54D 1XTZA 4FSDA 4C08A 4N5HX 1T13A 2AQ8A 2UDPA 4MVJG 4Z53A 3FKSA 2ATCA 3BXZA 4Y2RA 3PK0A 1PVVA 5FEUA 1E7MA 3MK31 3FKQA 2BEJA 4G5GA 1CETA 1M6VB 3DV2A 1K5HA 5F7OA 1PI3A 1CUSA 1UXIA 2X86A 4MR9B 3OG9A 4YBZA 4EFKA 1KH3A 4H08A 5CDTA 4MPRA 1F0KA 1ONSA 2E55A 4B3IA 2CMDA 2BGMA 4OXQA 1M5UA 1E79D 3I2HA 4MWGA 3OZXA 1BXZA 5K0NA 5CEEA 4YMWA 1JR2A 3AUKA 1XD8A 2AG5A 1PL8A 1W6UA 3VO8A 3GLKA 4HJRA 5HMLA 3S55A 3QNMA 5GWXA 3MINA 4ZYTA 2O8FB 4LOAA 2X23A 3HCAA 2F6RA 1G8JA 2Z98A 4XCVA 2JRCA 2NVOA 3ND7A 4G8BA 3GJ5A 4X90A 4E46A 4EK9A 2OBBA 4FIZA 1WXXA 1N5OX 2Q9AA 1J8MF 1JBEA 4IYRA 5EXDA 3PR1A 1NV9A 1THZA 3WLFA 1UZAA 3GLRA 3M70A 4P82A 2R8ZA 3EXEA 3CW9A 1Q1AA 3KOYA 4OLJA 2IHTA 4UAJA 1PG0A 4J9VA 4LJSA 2WWVD 4LSGA 2UZIR 2EFJA 1SUSA 2O8VA 2OENG 3M3DA 1KFKB 3QW4B 4WIAA 1IM2A 2XE8A 1ZIYA 3NHBA 1RQNA 3FWZA 1ZMBA 3FUUA 3HDGA 3MD9A 4L4ZA 5NULA 1IOZA 1XQYA 4TQAA 3U40A 3ISVA 3HV2A 4AMGA 1PVDA 2ZE8A 1R0ZA 4IOKA 5HJEA 3FFBA 1K27A 1YE8A 2R8EA 1HBJA 3W5BA 3AFHA 3OECA 4OIFA 5C1OA 4A8JB 1TLTA 1X14A 2C2MA 2ZAOA 4KLCA 2VPIA 3FH0A 4KXMA 4EGJA 4EAQA 4Y1RA 2AX3A 1GDHA 10MHA 1CP2A 2OWEA 1L8AA 2ZSEA 1Z39A 1YCFA 3UO8B 3S5UA 5HOQA 3KZCA 1J06A 3HA7A 4RK7A 4PSUA 3S81A 1OGIA 3SICE 3G9TA 1SKQA 3I1JA 1WQ4A 2IYRA 2H4ZA 3BAZA 2PLAA 2KX7A 3AW8A 1ZGAA 3FAKA 3NHJA 4ZVPA 3RUEA 3RIGA 4F96A 3CZCA 4Q3BA 1DOHA 3ZJYA 1NBME 3A26A 5DP1A 3OFJA 3ANYB 3ZCSA 3U6BA 3B6IA 3P9RA 2VQDA 3WX0A 2FRDA 3BICA 3ZQ4A 1CQPA 1RFGE 1BJRE 5KNBD 5A4IS 1V25A 2Y1CA 4ZPXA 1XPRA 5JD6A 1H8HA 1VJ1A 4ZCLA 4OYHA 5CFNA 3SBDA 2AZMA 5B7GA 3UAYA 4DXAA 1DC5A 1SR8A 3G0HA 4PQRA 3RO7A 2Q6TA 2C5GA 4UVHA 4BLVA 1J0DA 2XCTB 4UQPA 3PP8A 3TQIA 4OYLA 4Y2XA 3RM3A 2ZJ5A 1T4GA 2E5WA 2IF0A 4M8NE 2IZ1A 4UE2A 5D3MB 4YPFA 2CJWA 3QX8A 3RGGA 2VYCA 3TO5A 3TTSA 1WLYA 4MI9A 2JLXA 1LPOA 3WMFA 4K9DA 3AEXA 1YQDA 2PZLA 1WBDA 3EIEA 5I9TA 2Z8ZA 5B1EA 4MRMA 2JBWA 3TUZC 1O4WA 1RE1A 1DU4A 3ZD8A 4Y6PA 5SY6A 1IWOA 3KXPA 2JB9A 1PGJA 1RE0A 1DRJA 4FYIA 3LYHA 1ND5A 2LNDA 2BMJA 4L8FA 3IRVA 3FOEC 2NSYA 5DNVA 4P4SA 3T4EA 3U13A 1C8LA 5H83A 1Z7EA 4LYEA 1VECA 3HSKA 1RXSA 2V58A 4PYRA 1NVFA 4CF6A 3OURA 4MP6A 5FNVA 5BQ5A 1XYGA 5K8TA 2IXEA 2QD2A 1ODCA 3LGSA 2JG3A 4X65B 1HRKA 1K6EA 3KC2A 4YPVA 4M0KA 2EZ8A 2OK7A 4QU5A 5EXSA 3WQHA 3EN0A 3K6RA 2HSWA 3B7PA 1CE8A 4KQ1A 2JLZA 4E03A 2HHCA 4ARVA 4LHWA 1OLSB 5GONB 1OGJA 4CL3A 1NQAO 1W29A 2XT6A 5AOCA 4DLKA 3VPHA 1LV8A 2CEKA 1UIMA 3UUFA 1VGVA 1PSWA 1W34A 3I76A 4TV9A 4R0MA 5K5EA 4NJMA 1JXQA 4QGHA 4YJ3A 4DQ0A 4F71A 3IXMA 5D5PA 1FYFA 1PL0A 2FPLA 1J0EA 3JATA 1TM5E 3CRZA 1N8NA 1ACJA 4WT7A 1J9GA 1VB3A 3L06A 4C0SA 4YUWA 5FWYB 5LP6F 5GVSA 1G5PA 4QFBA 1ZK4A 1P3DA 2V97A 1MB2A 1N2CA 4YI3A 1G41A 5CJPA 5GPBA 4J1TC 5AW4A 1G8FA 3VYTB 1WW8A 2Q07A 3ETDA 4MQBA 3WO0A 1YR7A 1AE1A 4B3XA 5A02A 4YA6A 3RTGA 3UH0A 1JFLA 1CUYA 1PD1A 4WERA 3PITA 4RD2A 3VO9A 4QNNA 2AKEA 1L4FA 2Q62A 3TB6A 4H7IA 3ELYA 3QI2A 3DB2A 4AS2A 2XCUA 1JDJA 3TQHA 5AVSA 4KR7A 1IL0A 5DNUA 1M34B 2AR7A 4PYIA 1T2UA 3F7OA 1DELA 1MAVA 1UC4B 3INNA 2E37A 1Q91A 3MM4A 4J2OA 4Q4AA 4ZI5A 3CRW1 3E5NA 1FRVA 3T7KA 5FH9A 4DUGA 3TW4A 1VBFA 4OAPA 1UCFA 4I3GA 4JVLA 4XUDA 3VV3A 4HH0A 2J0UA 2GPJA 1L5VA 1GAXA 1IOWA 1V3QE 2FEOA 4FC7A 4K1LA 2GKSA 5CXSA 1TGYA 1IZ7A 3DE7X 4WBSA 4EPXA 1P2VA 1WF6A 2TMKA 1YI8A 1ZVKA 1JDPA 3PQ5A 1U1DA 4W9MC 4QIHA 4ZI3A 5CLJA 3O4HA 5IJ0A 3AUXA 3LBNA 3B3QA 1ORWA 3ZDZB 3C3BA 2DBZA 4GVXA 2BKXA 1K66A 3PPWA 4YVFA 1W44A 1Z0UA 1EK2A 2B36A 5CFRA 3JWEA 2OBFA 2G36A 3O1IC 2E1RA 5AUNB 3OJOA 4HB4A 2RGBA 1RKXA 2CEAA 2YWRA 4ND8A 2AOXA 3HRKA 4NEHB 1L1FA 3MJHA 4LDAA 4MZDA 9LDTA 2A0KA 1WB6A 2DBYA 1SURA 3U31A 2MSNA 2EFHB 2JD1A 4ZEVA 2ZSHA 2I6QA 4EKGA 1QO0A 4XTRA 3DKPA 2WG1A 3EQZA 4FCVA 1PQ4A 4FR0A 4C3VA 5AP9A 4RHFA 4FOSA 2ZXUA 4XWTA 3LFUA 3HU3A 4NF2A 5CYPA 2ZVPX 1H5UA 1P5RA 2FFJA 2PTGA 2VHJA 5G0SA 3TZBA 2M32A 2XOKA 4DV4B 2BGKA 3KFVA 3W8RA 1FRNA 2IDKA 3FFAA 2P4HX 2C5HA 3WK8A 4MQMA 1P2FA 1UM8A 4NYIR 5SICE 3S8MA 3T1QA 1E3WB 2FW7A 5B12A 4D6XA 3IE0A 1PJCA 4RKRA 3JQ9C 4P8RA 1ZHOA 1TJNA 3U37A 4HZUB 2I1WA 1US8A 4M4SA 4RETA 4EH1A 4B76A 1E1MA 1E89A 4PG8A 3N9IA 2C8KA 3BRSA 1TO2E 3W5IA 4LDNA 1N9KA 4P3YA 2ZSAA 2Z8YM 2JJQA 1ZUIA 4D46A 3DL7A 4UHBA 1AB5A 3U6KA 5C4GB 1CS0A 1RLIA 2ONCA 1NW5A 2I4LA 4GT1A 4HBGA 2VKTA 5FPTA 3S68A 2IPLA 4CGYA 3V00A 3SIPA 1SBIA 1RYMA 3C7KA 1XRMA 2H4WA 2YXDA 3IKVA 5CD1A 1OH8A 1OWLA 2Y2VA 1A76A 3G13A 2WWRA 3L8MA 3LUGA 3QYJA 4UFOA 5FOSA 4KDFA 4N18A 4NBSA 5DHAA 1KBZA 1ZBQA 1J99A 2CLMB 2HNBA 4U2FA 5F5NA 1F9AA 4QBFA 2PFSA 3I8XA 3B1XA 2WPDD 3NVMB 2ZQZA 2X42A 4G0VA 1KU6A 4FB5A 3HG7A 4DE5A 4DRXA 3NVDA 4LJLA 4LRSB 3K6SB 3TH5A 4HB0A 3DAFA 3EC1A 5FJJA 3ZGXA 3DT9A 2REQB 3NTVA 1MW9X 1RI2A 3BRCA 4FFPA 4FX2A 4OK3A 3M6XA 4NY1A 3V55A 3AHEA 3VDQA 3GQBA 1R4MA 5JJLA 2PMBA 3OZBA 4YUXA 4Q24A 4TS9A 3NX4A 1I8TA 4MUFA 1U98A 4MVJP 3H9BA 3GLFB 4QU0A 1J56A 2OAQ1 3RUFA 2GZ3A 2R1VA 4MPTA 5EE1A 4BLSA 4EYOA 3F73A 1XNQB 4F3YA 4GOJA 3PDUA 4ZOQI 2W8ZA 1AH2A 1CF4A 3RYIA 1UPXA 2CDAA 5DW3A 1TQ2A 4G4JA 2BBSA 2JIBA 1WWKA 3OM9A 5G02A 1IC6A 5AW9A 4BBPA 1CR2A 4C43A 2NV6A 3PXUA 3OCCA 1BS9A 5B64A 3OVMA 1OU4A 1G5TA 5JSZB 3ZUPA 3RVPA 1BHQ1 4MA0A 5KSPA 1A4RA 1ZFNA 1O9HA 4IIJB 3WGVA 4EOGA 5MFPA 4ZHSA 1C8BA 1Q0ZA 2NO7A 3C48A 5EZ5A 3MT0A 3NV9A 4DIFA 4GP9A 1DT3A 2IOFA 4H2DA 3I28A 1HYBA 3P8ZA 4U2CA 1N3BA 2CXNA 1JA9A 3EWNA 1II8B 1G59A 2BKUA 3N2IA 4CUJA 1Q3HA 3D6NB 3W79A 2DHCA 1BE6A 4DB4A 3OEWA 2LPMA 1U8FO 2KHZA 3HDYA 5DTQA 3FUCA 4QAJA 1JYEA 1LS1A 1ZESA 2BL4A 3OCYA 5E4TA 1IEQA 1W49A 3R1IA 5E4JA 3IQFA 4N4AA 3I5YA 3DH0A 5J2UF 1QU3A 1WZEA 1NNLA 3N58A 1NSFA 1A4UA 3N07A 4Y6RA 1TAUA 3C98A 5IYZF 4B80A 3GRKA 4YP7A 2PD4A 3KQUA 2ZJ4A 4JI5B 1U8EA 1NN5A