5LQMA

Structure of quinolinate synthase y21f mutant in complex with citrate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
303
structure length
303
Chain Sequence
b'HHHHHMVDEILKLKKEKGYIILAHNFQIPELQDIADFVGDSLQLARKAMELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYREKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFELMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinolinate synthase A
molecule tags Transferase
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
publication title Crystal Structures of Quinolinate Synthase in Complex with a Substrate Analogue, the Condensation Intermediate, and Substrate-Derived Product.
pubmed doi rcsb
total genus 116
structure length 303
sequence length 303
ec nomenclature ec 2.5.1.72: Quinolinate synthase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02445 NadA Quinolinate synthetase A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA02
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA03
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA01
5KTTA 5KTOA 4P3XA 4ZK6A 5KTNA 5KTPA 5LQSA 4HHEA 5KTRA 5F3DA 5KTSA 5LQMA 5F33A 1WZUA 5KTMA 5F35A
chains in the Genus database with same CATH superfamily
2YJNA 3ELBA 4OBWA 3TLXA 1Y6GA 3IR5A 2NW6A 4MV5A 2EV9A 5CIQA 1TA0A 4MRNA 4OM8A 1QCYA 4OF4A 5CH5A 3SF8B 5KHLB 2UUBB 2GD0A 4MQFB 1RLJA 2Y99A 4FHCA 3C8ZA 1Q3TA 2I4NA 4J76A 5F2EA 4YUVA 3CM0A 1WXDA 1QCDA 3VR4D 2O1XA 1XXHB 2JFZA 4WLNA 1MD9A 1LLDA 2BTEA 2IH2A 2A0YA 1Q1QA 2PKYX 5FWDA 1P4RA 1J0AA 2HTFA 3LT0A 3L8YA 3M6IA 1U7TA 4Z3DA 5CCDA 3UEOA 1OH8A 2Q28A 4BKOA 3L93A 4KYIB 2B4AA 2QPOA 3IAAA 1X92A 1L4HA 5JC8A 1CQJB 4FZJA 4J0FA 2FEOA 1HDOA 2HL6A 2XUHA 4UTPA 3V8NA 4JVNA 1P0QA 4YO7A 1VG0B 5AK0A 1VL6A 3U9LA 3BWYA 1I3NA 4OHCA 2QJFA 2MINA 3ZU2A 4IGFA 3AEKA 3B13B 2HNAA 2QSUA 4DT1B 3BCSA 2PYZA 2Q27A 4MH0R 1SXIA 2X8LA 3WJ7A 3WSTA 4EPXA 5LYJF 3SQWA 3ICPA 3BSWA 4PIMA 2PAAA 5K0LA 2IQ5A 3I52A 4NG5A 1QHSA 1CB0A 2Y6VA 1VIVA 2QAGB 2RJOA 5MN5A 3JYHA 4MP8A 3W6UA 4I1UA 4Y6GB 1FYDA 1L4GA 3FYCA 3P2OA 4HAOA 2JW5A 1T6NA 4QBFA 1IPEA 3A1DA 3VR1A 4F4IA 5DMHA 1OH6A 4EVIA 4YYZA 2AXNA 2EBFX 3DEKA 4FJ2A 5DTIA 3VH3A 2YWFA 4BGUA 5DCWA 4AJOA 4F2GA 2Z3WA 1C3VA 5E1OA 3H3JA 4B79A 4M98A 2O1EA 2FPGB 3QNUA 2DJIA 2BN4A 3AETA 1GR0A 2YINC 3E0XA 1HWYA 2XA1A 3ETJA 4G24A 2C00A 4GC5A 4TKVB 3ZCVA 1WUTA 3ENVA 2RI1A 3DCNA 3DV9A 4CLHA 1QU3A 4DWVA 1QX3A 1PJAA 4M55A 1E94E 1KL7A 4L22A 5DTQA 4BAZA 5IBRA 1KP9A 1MV5A 1MJFA 3D4LA 1FU4A 3U4IA 1JIJA 2NSYA 4W82A 3V32A 1JECA 3BXEA 4ISCA 2YVLA 3ZWPA 2PWPA 1QPGA 1H3FA 3H75A 3C3AA 3I4FA 1TK3A 3VDQA 3CIFA 4RZQA 2Z5FA 5HUHA 4PLFA 5SYNA 3OJFA 1E2DA 3UHOA 5IS2A 1MJGA 1VIMA 3G2PA 2OORC 2ZWOA 4AAYA 1ZJWA 4ZVLA 3WWPA 1FSFA 3OX2A 4GXQA 1SC6A 1TK2A 1ZGAA 4PO1A 4UDOA 1JKXA 4ZOLA 5IP5A 4MCHA 3KKZA 4G0WA 4R2MA 5THQA 5E7IA 3ZXXA 2IH4A 3SCZA 1UP7A 4OIFA 4CF7A 1JZTA 4M49A 1SCKA 4X9XA 1PT8A 4MGKR 2W4QA 2QMYA 1W76A 4JBGA 4MIEA 4NCKA 1F4LA 1Q15A 4Q48A 1EX1A 1LI5A 4FB4A 3KLPX 2D2IA 3MS7A 2DAPA 1QGYA 2CVFA 2H59A 1T1RA 5DCUA 5C4IA 2UYCA 3KU4A 3REGA 4KV7A 4GOJA 1NM5A 1QH8A 3QW2A 2F4VB 1KMIY 4NZ9A 3SD7A 3O92A 1A8SA 2R3SA 4EOGA 5LMUB 1OWMA 4WXPA 1R5JA 2JAWA 4ARZB 4A3SA 1U0LA 4BKRA 2C88A 4RDIA 1CUJA 3IDZA 1Y3HA 2A5LA 5C18A 4UUQA 4MX8A 4JBYA 4UM9D 4CUKA 4ZHQF 4YI3A 4DKJA 3LVRE 3ZCRA 3ESYA 4FDLA 2CWWA 3KYBA 4IFEA 4RJ2A 2JFBA 1GZ7A 3QBEA 3K0AB 3VPXA 4BMXA 3OFVA 5BP7A 1Z35A 2CNNA 4KO4S 4KVAA 1C1HA 4Q3BA 2PJRA 1UWVA 2G9ZA 2G9UA 1H94A 3VZQA 4BNHA 4MO2A 4RKQA 4GWGA 1MLDA 2VWPA 1BVUA 1RQ2A 2BKVA 1E9VA 2HB6A 4KSCA 3E2IA 3KVRA 1Q91A 1OLSA 1J0XO 4FM9A 2ACVA 4IJVA 3HSKA 3LZ6A 3ECSA 3EDCA 4HWPA 1W4ZA 2WB4A 1T4CB 1TUBA 3RHSA 4F5ZA 3LCRA 5EJ5A 1UT5A 1W4BA 1G21E 4GOLD 3ZWVA 2XRMA 4FE4A 5JD4A 1M7HA 4HAZA 1YQGA 4KMOA 3COPA 1J07A 3OZAA 2GETA 1UBTS 4P35A 5BR4A 1SKMA 4YHHB 5MFZA 1WV1A 5K45A 3OQNA 3RR2A 3LKVA 3OZIA 3JD2A 3PC3A 1G8HA 2D5AA 4L9SA 2KJQA 3BWCA 1VL5A 2RGEA 3H1BA 3BH0A 3PJDA 4L76A 4JI1B 2QRKA 2ZSFA 4FBMA 4HTFB 3QSGA 3OBIA 4GR9A 3HI4A 5LYYA 1PTJC 3OAAD 5CYFA 5L7WA 1U2TA 3P26A 4BRWA 5FCDA 1W36B 4GYJA 3FMOB 1PT9A 1XLWA 1PYDA 1SRRA 2DERA 3KL2A 2BFDB 4RFVA 4XEUA 3GCGA 1FFHA 4ESEA 1PNQA 2HSEA 2F48A 4S1TA 5CUQA 2HA7A 3FIJA 2WPNA 4QBIA 4ZCMA 3H9CA 4JLDA 1X7WA 1DC5A 1WHTB 4B2IA 2I2XB 2QTCA 3GDGA 1LU9A 1PL8A 3HP7A 3JVIA 2VYVA 3JQBA 4MIYA 4TMYA 4O2LA 4L78A 1K7YA 3A8TA 4GM4A 3SHTA 1L9KA 1PSWA 3WA7A 3KQVA 1VOTA 1OLUB 1X74A 5BV1A 2QRJA 3OIVA 2ZLBA 1Z8FA 3WMGA 3P5SA 1V8FA 3E1KA 4NPHA 4W9NA 1P91A 1YZLA 4R69A 5LC1A 2XBMA 4QXOA 4MUEA 4YGYA 2Z3ZA 4MEJA 1YXMA 3CUUA 1K63A 4TL6A 3RE1A 2P6UA 4PZPA 1ELOA 4FE7A 4B4UA 4BNMA 4CRWB 4U63A 4XWAA 2X8BA 1D2AA 1V4VA 3GT4A 4TS4A 1QB7A 3B1KA 1U1CA 3NC1C 3HDJA 2FMHA 2P4UA 2FW1A 4OKIA 4D98A 2OTCA 1TB4A 1C3LA 2Y1GA 4TTRA 5AKYA 1AX9A 1Y5NA 4HQNA 2FW7A 3LDGA 4QTUB 3UATA 4UHBA 4ZRNA 2QP3A 5BVGB 2AW3A 1XNRB 3RSGA 1NY6A 5LBIA 4TTTS 1AM4D 4PHFA 3HU1A 3KQPA 2J3IA 1RRKA 1BU5A 4MR9A 2EBHX 2Z0MA 3CNLA 1J8FA 3S2YA 4H1WA 3JRNA 3I34X 3FPGA 2WIBA 4PC2A 1GKYA 1PR6A 3R9WA 4K8OA 2OBFA 1TUBB 2ZU6A 4N0EA 4ARSA 3E7FA 3GFGA 4R40A 3A9SA 1M1NB 1W35A 5J58A 4OQ4A 2O0KA 1HY3A 4PHGA 5G3ZA 3ZX4A 2Y1OA 4MR9B 4QFBA 1JKMA 5FUQA 3K16A 1XG5A 3PEFA 4RKWA 1EPUA 5DBGA 4M1EA 4G2NA 2FQXA 1XJQA 2RIPA 3I30X 3NX4A 3BFXA 4FR0A 4IX1A 2Q1UA 3SXJA 3LW8A 2W11A 3RWOA 1MJHA 1OFUA 3RK1A 3A4MA 4CV0A 1QYRA 5L3SA 4XH9B 1B23P 1TKCA 1H2HA 3UMBA 5C8VA 4A8PA 5MFPA 1IXRC 3HZHA 1Y9JA 3JQAB 4M89A 4Y3UA 3QRWA 1L5LA 4BQOA 1FTSA 3UV3A 1E7YA 1T0UA 4JJ7A 5YASA 1F3OA 5SZIA 3PKZA 2D62A 5FO0A 3KJIA 3A6LA 4US0R 1R0SA 3K2EA 1YZVA 1T3LA 3CW2A 4Q9JA 5MHTA 2I22A 1MAWA 3GJ4A 4FGKA 3MJCA 4TOIA 3VO9A 5JJIA 5DRTA 5F3RA 1HFWA 3Q8KA 3PI7A 1IMJA 3DE0X 4AKSA 2HJGA 1CF2O 1OLUA 2O07A 3T5DA 3WOVA 4MKZA 1RCFA 5CP8A 1EG7A 1HEIA 1NW5A 2UYGA 1W9HA 4HNSA 3GMIA 3CE9A 1X1EA 1WQ4A 4LTDA 1YGYA 1BROA 4EUHA 3E58A 1WETA 3PRKE 1P81A 3DMDA 3GW8A 1QFXA 1G21A 2GXSA 1NRJB 5AESA 3VR4H 3K6JA 5ALPA 2R6GA 4CL0A 1W94A 3CZ5A 4QPCA 1Z2PX 1U0SY 2IEYA 1WW3A 4W8HA 2GNPA 1VIYA 4CU2A 4RTNA 1OVGA 1KYWA 4M0EA 1SIOA 2OSVA 2O2JA 3KLNA 3IIMA 3INYA 1SD1A 2JFNA 2FVXA 4V1CB 3U6KA 2OECA 1E8DA 3U3XA 2WVGA 4DCOA 2W83A 1QYIA 2FEAA 4FX2A 4UAUA 3ZBQA 4M0CA 4Q1CA 4BO2A 1PHPA 3CZQA 3V34A 2OVBA 1Y5MA 2BSQA 3ZDFA 1WL8A 2P5UA 4WUVA 3X1ZA 3FSEA 5JADA 3O38A 2BMWA 2ZS7A 3GJXC 4P3XA 4MYTA 3KJZA 2N42A 4GF5A 5KQGA 5EQTA 4PRKA 1CUYA 4LDQA 4ZQCB 1DINA 1R4MA 1JT9A 2X0NA 3AESA 3PGVA 1Z5WA 4IRXA 5CVVA 3W2TA 4BKPA 1U0EA 1DWOA 1KJWA 1LJLA 1XTBA 1R0LA 2R68A 3G0IA 3TM5A 5C8YF 3MWGA 4FQ8A 2P2ZA 3K30A 4LBYA 3UNXA 4X0EA 3DVAB 3JD1A 3OFJA 3RTDA 3ZLVA 3FFXA 1GM5A 2B82A 1HYQA 1X94A 1FP6A 4LQ4A 1Q7EA 2O8DB 4URFA 1GYQA 3LDAA 4GBMA 3E9RA 3OKPA 3W6PA 2ODWA 2WT9A 3VU9A 1FP4A 1RM3A 5CLJA 1JNXX 3N0XA 2P9FA 3IUEA 4DM4A 3W5BA 2DFLA 4BXOB 3QQPA 1X7ZA 1FUUA 1XN1A 3ETEA 3OUTA 1Z6QA 4XDZA 5CA0F 4Z0NA 1GITA 1WEHA 1YKFA 2NO5A 1L2TA 4OK5A 3HJUA 2XCQA 3RAJA 2AJBA 3AEKB 4IIXA 4BTVA 3HLYA 2PBZA 1J56A 3LPMA 3IVRA 3O0DA 3PWKA 4QFCA 4A27A 4CIDA 3HGQA 4YAJA 4HDRA 3WLSA 1MORA 1H1LA 3ZOKA 5EIWA 1CE8B 2WTNA 4URZR 2V6BA 4LJ5A 5FYQA 2QRQA 4KN5A 3I2YX 3B85A 4XFKA 4YJHA 1JRLA 5LQSA 3VKUA 2PV0A 4KQIA 3PQ2A 4YRTA 3N6VA 2GCOB 5FPKA 1AB5A 1RKQA 4QYIA 3RH0A 3OJEA 1XJ0A 2C57A 2PT9A 3NYRA 1AGRA 1KGSA 1WNTA 4HQOA 4MUNA 4W7SA 1UOOA 2AOWA 4AUKA 3FUCA 1GL9B 1QDLB 5KKNB 4KRXA 5CG2A 4PYRA 5BRNA 2D1YA 2HFJA 2DBYA 4OI4A 3C6YA 4PYNA 2KBEA 4ZANA 1R12A 5L51A 1DQNA 3WLQA 2CL7X 1TEXA 1F2DA 1T2NA 1YBFA 3NQ41 4L28A 2XYVA 3EQ8A 3DZJA 4BMOB 2PS1A 4MICA 4YV7A 2JGDA 1Q11A 4DMHA 1Y7LA 4BN0A 5BQPA 3BRWD 4TM7A 1EAMA 1T8PA 1NYLA 2G5PA 1ID1A 1ULBA 3B2NA 2G72A 1SVNA 1SKYB 3B1JA 4ZZ1A 1KJQA 4MVJG 4QWWA 5JNRA 1GNVA 4F45A 1R6TA 3FWKA 1NFRA 3L7YA 1G8YA 2XGSA 1I0LA 4JLJA 3LX6A 4G1UC 4Y9RA 3X2SA 3FHLA 1B15A 3RIMA 1DQPA 1O6GA 2DWOA 1UCFA 5CDHA 4UM7A 5A06A 4QUGA 2WVAA 2EJWA 5KIAA 4HH1A 3ME5A 2CSXA 5DM0A 4G4JA 2PCJA 2C2WA 3RU7A 2G17A 4REQB 3CFYA 3DQQA 2GRJA 4IQ8A 4XM1A 5DNYB 1SD5A 2EAUA 1NF2A 2XZTA 1ZIPA 4RANA 3F4KA 3NHUA 3OOJA 3W9UA 4HLNA 4MV7A 3AIIA 3W9SA 3A9WA 4KODA 2A0WA 3GQBA 3LZDA 1T6BY 1TVKB 3FUTA 1OFVA 2AVNA 521PA 4YEDA 3TZCA 1E9SA 3L0IB 2I4MA 4B2LA 1CSEE 1K8YB 2YZNA 2WM8A 4EF4A 3U4QB 1UKAA 2QRPA 3QWFA 4QJ3A 4HQRA 4AO8A 2IZ1A 5JD3A 3IO5A 1K0FA 1LLUA 2WYIA 4Q4JB 1WU8A 1FLDA 5A4KA 2B7BA 4B7CA 3ANNA 3GBSA 5LBUA 1QNLA 2RFLA 2J0QA 1LZLA 3GO4A 4DN6A 4DT1A 2OCKA 1MQ9A 4PFKA 4LCBA 2Y1DA 2BFFA 2JBWA 4KPUA 2HV9A 1QRDA 5EIXA 1YQDA 4MVJP 5CFOA 1SVOA 2IXDA 2WJ3A 4UOEA 5L4NA 1QP7A 4BASA 4MAAA 4WNAB 4EAQA 2IF2A 3SYKA 2WTEA 5B3AA 3BERA 1IXSB 1RFGE 3TSZA 3U6BA 1W2GA 5A4MS 4YH1A 3I83A 1XK6A 3EH1A 5FRDA 1UXJA 3D7SA 1WE2A 3B6ZA 3OCVA 5IVDA 5I7RA 2Z2XA 2FZLA 4E33A 1B2RA 2B99A 5BQFA 5LZ9A 3OCUA 1MFZA 4NS4A 1YL7A 2C9OA 1B7GO 5AI8A 4W5RA 1A50B 5EJ9A 2CNWA 3COJA 5IK2A 2YDYA 3DOEA 4QPZA 2DUUA 2PSSA 4ZQHA 1AGYA 2HU2A 2XT9A 4B9EA 4IQ0A 3O73A 3NM4A 3NP7A 3NOOA 3CJTA 4M7WA 2JCSA 1DKOA 3AHEA 2OSBA 2ZTMA 3C85A 3IPLA 3M4ZA 2XYHA 5AJWA 5GVRA 3T3GA 5JANA 2AG5A 1F2VA 2JIMA 5L9AA 1NXTA 4GYYA 5J4YA 4NABA 4TV8B 1ZH0A 5FNVF 2X6TA 4HDCA 4HYTA 2I6QA 3WWOA 1Z5PA 1ZA2A 1E1CA 1UZLA 1TQ2A 4M7OA 1GGFA 3ASZA 2BMAA 1CKEA 5LR6A 1GCGA 1TZCA 2FI1A 1WXQA 3H2SA 2ZU0C 5I7VA 3K0KA 3C3EA 2PG3A 3KQWA 3L79A 3M9WA 4H3KB 3MSXA 1YWGO 4LWQA 5D3MA 4XSHA 3EEIA 4MVYA 2B1RA 4TWIA 3T4UA 2ZI7A 1JHVA 5K8CA 2QPAA 5KVVA 3OLCX 1I10A 5PNTA 2OE2A 1AS0A 3IDQA 4E46A 4EA6A 3WISA 1Z5NA 4C0HA 2VXCA 4XCXA 4XYMA 1NW4A 2MYTA 3L1KA 4B80A 4RXMA 1QIIA 2VKTA 1WJGA 3H11A 3WFZA 4RTSA 5F9FA 1V6SA 4DSTA 1OKKD 3ISJA 1R2QA 1XMPA 1ZISA 4WA8A 2EDCA 3B1XA 1Y1SA 1M2KA 2X4LA 3I92A 4Q3OA 4ARAA 2C2HA 1T9CA 2E9SA 3E53A 4MXDA 4BO3A 3O03A 2QL7A 5CW2A 2J0UA 1N3BA 5HUJA 2EQBA 3RHFA 3H1EA 4IUCS 1G1AA 1XYGA 3WADA 2OWDA 2QR3A 3FBWA 3P2EA 4FC7A 1UEIA 4H9GA 4OXYA 1KVRA 4MWBA 5B4TA 5MN4A 3W5AA 1M2GA 4L5JA 3T1OA 1CDZA 1PDOA 4MMYB 2AG0A 1C4OA 1SHKA 1Y33E 1TAHA 1XRSB 3DPUA 2PIAA 1P9NA 3W3AA 1TVEA 1VPTA 1E2EA 5JS7A 4YAEA 4KE7A 4EB8A 2BI7A 1JJBA 5KNLA 4AG5A 4RY8A 2D8MA 2C1ZA 1NYRA 2BCJQ 4HDMB 1E9DA 2X0FA 1E1LA 3QV1A 4J4BA 3U9TA 3TFOA 3G5MA 4KEAA 1QH1B 1IHYA 1GKIA 3DMPA 5DM70 4BN4A 2C4VA 3UMSA 3I1JA 1WXFA 2VJPA 2OZLB 3LUPA 4INOA 2GPBA 3SF0A 3PNYA 3VGPA 1BWSA 1GL7A 1TM3E 3QPWA 2I3BA 2PGNA 3ETHA 2BJVA 1FDWA 1D8AA 3CNQS 2HC9A 3Q1KA 3DEIA 3H5TA 4LZJA 2BWJA 2OHIA 2X1MA 3HVHA 2RGNA 1O96B 2HN9A 3EF0A 4L4RA 3WLAA 2R47A 4CT4B 2L17A 2XOEA 3K96A 1Z0DA 1T8YA 3ZZUA 1B41A 1BU8A 4MA0A 4PRLA 5I7HA 5HFAA 2ARKA 5THKA 3M34A 4F3KA 1ONPA 2AC7A 4EGQA 1OC2A 2IXEA 2HMTA 4FU0A 3H87A 5JMPA 4AF7A 2OQIA 3ID6C 3KYCB 1B14A 1GPLA 1L7RA 1DXQA 2Y9MB 3VFDA 3P0JA 1I1NA 1SQ5A 4P80A 1A9YA 1H2WA 1LRLA 4NP6A 5TV2A 4TWRA 3ZGOA 5A5DA 1N2BA 3DXYA 4RHUA 2ZRNA 2Y0EA 3LQRA 3QMMA 4R9RA 4RSRA 4AJPA 121PA 1BMFA 3EVTA 2X77A 3W34A 1RXWA 1CVLA 4DB2A 1BEZA 1J4AA 1ZWLA 4GPEA 3EQ7A 3JQ7A 4KH0A 3UZUA 5JROA 2ZRPA 3PGA1 1EUZA 1RHJA 4ZO9A 5FUXA 1OX4B 3OE7A 2VG8A 3JTEA 2D1RA 3QXGA 3FNFA 4I9UA 4HS4A 1PFWA 4JP2A 3I3SR 3ZK8A 3GUYA 3LY8A 3UB4A 1GRVA 1QV7A 1YR6A 1DU4A 2BV3A 1JPNA 1QM5A 2GM5A 3BFVA 3JR7A 1EDEA 1RP1A 4KO3S 3QXSA 4LZLA 4MEBA 4Q18A 3O9VA 1DAMA 3CLTD 1L5OA 1W85A 1EGMB 1U5BB 4JLPA 3ZV3A 2FMFA 1NHWA 1J0DA 1Y8RB 3GOHA 5EPUA 2NYUA 3ZWCA 3AF2A 1OI4A 1VHQA 4L0DA 3IESA 4FKZA 5HJ2A 1BE1A 1FZQA 2PSDA 5F3DA 1SHZA 1K89A 4JJKA 3WFIA 1PL7A 1RC0A 3LQQA 1SEVA 3TVTA 2VSYA 1Z56C 3UK2A 5JWRA 1TC1A 1W5FA 3QI2A 3CGWA 2NZ2A 4GLJA 2X0IA 4AQDA 1BE0A 5A9TA 1EXNA 4JJGA 1BS2A 1TZJA 4D3ZA 1II0A 2FAXA 4KGZA 4WOCA 2OZVA 4Z51A 3GEHA 1WSBA 2GEUA 5BOSA 3MJRA 4YP0A 2ST1A 2AN9A 4N40A 5J5VA 5IJWA 5JCOA 4BNDA 4X90A 5HK8A 4L7VA 4JI8B 4UE2A 3EE6A 1MNAA 4EQZA 1PO7A 4Q3KA 4EGFA 3IAEA 1I7LA 1JTEA 4HYEA 4WZAB 2JB9A 3OIYA 5DN6A 5JOQA 4RTPA 4Y2GA 4JODA 4DLKA 5U4QA 3QOWA 5E3IA 3HJBA 1Y6QA 4RF2A 2P5YA 4EHAA 4BVBA 2O3RA 1Z33A 2OCYC 2PBRA 2W2XA 4HFMA 1EVLA 2QXTA 4NJEB 4O4JF 4P6VF 1ULHA 4O5AA 1FDOA 1XDBA 5IJ0A 3LLUA 1N6HA 5JS1A 5JH7F 2ETXA 2H1LA 1A5AB 1OTHA 2FN9A 2Y6UA 3WQQA 5IDWA 1BX1A 4LFCB 1K86A 1P4JA 1GD1O 2G1AA 3HPRA 1Z3IX 2JVIA 1YB7A 3F96A 2A33A 2JJYA 2XD4A 2VJQA 3KSZO 1JQLB 3OM8A 4I8DA 4TT3A 1JXMA 1X0VA 2Q07A 3JQFA 2LD4A 3MMPA 3AVVA 4ZJZA 4HDRB 1YMUA 4RDHA 1CG6A 3SC2A 1OXXK 3BEOA 3RAPR 4UPEA 3SP1A 3VR6H 5EJGA 4AZ3B 2FG7C 1I5OA 3EBLA 4G0VA 4IDGA 3N7AA 3U3ZA 2GA8A 4ZEOA 3DL0A 3TOCA 1JAYA 1MVOA 2UZIR 2OXIA 2NU6A 4AB1A 4EENA 5JMWA 1OZ0A 5AUQA 3RYIB 3PTLA 2VJNA 3CBQA 3QEJA 1IM2A 3HS3A 1CQIA 2I78A 1U8UA 1XC7A 5HFNA 2QW1A 3T3MB 3S3TA 3U37A 1YF3A 3D3EA 5BSWA 3DMFA 4GHWA 1LPPA 1XVTA 2PRIA 3KT0A 1CFJA 2GK3A 1PT6A 1BGXT 1I4OA 2NV2B 5F7ZA 3LYAA 4XKJA 3WDSA 1RKUA 2QG4A 1GFWA 5IYZA 3BK7A 3C6XA 4ZZ3A 4D9EA 2BISA 3TPZA 1P80A 5DEOA 5IYZB 1E4EB 5CB4F 2HDWA 2Q46A 3FOAA 3QNWA 5GZ1A 3HV2A 3GGJA 3ZV7A 1EJBA 1TCAA 1ZGJA 1ZMTA 2ZE7A 1ISHA 3GIWA 3PC8A 4CMIA 1MG5A 3SPXA 3WNDA 2R87A 2VHWA 1M1ZA 3AHFA 1D7OA 1PLJA 2FF7A 4CMGA 1A9TA 1NT2A 5B58T 2H4ZA 2WJAA 3KR2A 4X1KA 2UV8A 3GELA 3V8QA 3VUFA 3Q6MA 4KR2A 1N32B 3GDHA 4URVR 5IDQA 1KDPA 4DUGD 1TYBE 4ER5A 4C78A 1RP7A 2P6MA 3PYLA 5ARDA 2A9KA 3LQ2A 3NB0A 5TQ2B 3KQUA 1TCVA 1CIVA 4DCJA 5KSZA 1P6UA 2GPJA 1VLLA 3IX7A 3CWQA 3GA0A 1PT5A 2I76A 1KTVA 2NTJA 2ZWPA 1AK2A 3Q0TA 4HV4A 3FMVA 2Q6IA 3DPSA 1KHHA 3NHLA 3NI2A 1R37A 2FVYA 1NSYA 3S8YA 1LVUA 1U9IA 1EGAA 4J0JA 2DX7A 5BR8B 4PZCA 5AK5A 4D9FA 3KZOA 2RHGB 1ZLXA 2ZW9A 3I01A 3L8EA 4RELA 2ANCA 1MGPA 1RIFA 2BBTA 4C2BA 3HK2A 2B3TA 1BWRA 5KOHA 3MINB 3AONB 1QIHA 5LQUA 1QK3A 3AW9A 4LMRA 4EW2A 3JVEA 3W6OA 3L7MA 1KVUA 2OQ2A 1KYQA 3DAPA 4NBSA 3D6MA 2F17A 3SOPA 3A0RB 5IAAA 4JX9A 3BBLA 5DWQA 1XTIA 3EIHA 5K0CA 4JIGA 1CRLA 4XYBA 5IF3A 5FADA 3GLIA 1ZGHA 3V3KA 5HKKD 1GPUA 1TLTA 4UNRA 4IHQA 3K0FB 4P33A 3FSRA 1IB6A 4GDFA 3NAMA 4UTNA 4JLUA 3W1VA 2X5OA 2NU7B 5THXA 1T35A 3YASA 2IW1A 1LTQA 1VL2A 2OBMA 4WLVA 5LIPA 1JQDA 4K1LA 4PPGA 5JW6A 3A1FA 1T4GA 3HA7A 4FDMA 4FOTA 1XMJA 2PUFA 3MMSA 1VBNA 3Q1LA 3GH1A 5BUQA 5L6LB 4ZU1X 4FIZA 2K2WA 1OIWA 1PWYE 1E3QA 1J21A 2BGJA 2I6SA 1Z2AA 1EEHA 2PX4A 2WG2A 4PINA 4ZV9A 1N2CB 5AXBA 3WY9A 5A5VA 1ND5A 1ZK2A 5D1HA 1JR6A 2ZUBA 4R68A 4MVJI 3UB2A 4AMVA 5AKJA 3EXEA 3QKRA 1H66A 4OM7A 1MF7A 4BNNA 4NI5A 2X8JB 1NWCA 3MW8A 3RSHA 2ZJBA 4FS3A 3HXMA 2CGEA 3TQHA 5LVAA 2NXJA 2O8BB 1NRIA 1B4DA 1VE6A 2G76A 2VF8A 3R0ZA 1MEEA 3IP3A 1IY2A 2DUMA 1Z3CA 4Q00A 2QLLA 4ZI7A 4ETMA 1AKTA 1JFVA 1RJ9B 4U00A 1ZM4A 4OP2A 1W4AA 3IQEA 4RVHA 3QBTA 1JDVA 3CF4A 2H18A 5CGZA 5IAGA 4CFYA 4AXBA 3PNPA 3T94A 1KOJA 2I66A 4D8VA 5KQMA 2PQ6A 4F6RA 5JMOA 3GLHB 3KJNA 1ORHA 4MPPA 3OWXA 3VR4A 5KPJA 3WMFA 1J00A 2W6QA 2Q99A 3NT2A 1RJFA 5ALKA 5JDIA 1OZFA 1JKIA 1BHO1 2YL2A 2OBYA 1T2CA 1DHRA 1TYAE 2RGBA 3VNBA 5JAUA 3TTTA 2J3JA 3NMUF 1OAOA 2RHCA 3WAJA 1ZDMA 4RHTA 4UMEA 3UFBA 3HVRA 5ER6A 3Q3GE 4MROA 2VSOA 5D6OA 3I5YA 3VVCA 2AI1A 2SCUB 5BN5A 3B48A 2G83A 5A3QA 1WZUA 3ZJVA 1QHHA 2MSNA 2WV7A 3H0EA 4PR0A 3SYLA 3VZSA 1XXHA 4EUEA 4RTLA 2OUIA 1J1IA 2HWKA 3CINA 1E63A 3UPDA 2EFHB 1F20A 5DTMA 1VA4A 2FMKA 3K2IA 2UZ4A 4JLKA 2QX8A 5B1SA 5BSHA 4E22A 1JTVA 2X7XA 3JAKA 1RWWA 1X86B 2ZTSA 4LE0A 1ZJ6A 5IJ0B 1OT5A 2IVFA 5AM2A 4AJIA 1EE1A 4LNHA 1Z6TA 5ER9A 2BGIA 3T5BA 4CETA 4WDQA 1AUOA 3AEXA 4M22A 1EB9A 1U8CB 1X13A 2VDUE 3OWOA 2ZCVA 4WH0A 5KVQA 4DQXA 2B6NA 2C4TA 4UHFA 3GJ6A 1NBEA 4NBTA 4X24A 3R44A 1T5DX 3BD9A 4M1TA 5FIUA 3KZ1E 3LRPA 5IG2A 1D1TA 1G5HA 4Q7JB 2CNDA 2YV5A 1SU8A 4Q4LA 1GIAA 2X19A 3DDNA 4FPXA 4DZRA 4EUSA 1AXGA 3BXGA 4TTIA 4P4SB 3KBBA 5JSKA 2Q3FA 3DG9A 3GLTA 5CPFA 3RTAA 4DYDA 2CK3D 3IEPA 3DWIA 1PG5A 4CUJA 3DYIA 1F38A 4G86A 1P0MA 2YWBA 4YUAA 4FEAA 2ZUFA 4B82A 1Q1ZA 4ND4A 2QD3A 4NENA 5A0VA 1WHSA 1YQEA 2O9JA 4Q3EA 5BSUA 1XP8A 1LBTA 4FS8A 3PQDA 4G23A 4S1VA 3TYXA 1NVAA 2Y3IA 1FQWA 3HKBA 1XDUA 4QXPA 1C30A 1N5KA 2PZFA 4UDXX 4CLOA 4PN7A 4Y0AA 2NTEA 3HUDA 3HWX1 1O6BA 5EKXA 1CQWA 1I3MA 3OTQA 5CFMA 3B9QA 3NHMA 4L7QA 3AY0A 4NXMB 3CF6R 3TB6A 2ZIAA 4OYYA 2Z8YM 5IANA 4TN5A 1VLVA 2G77B 2PUJA 2P8SA 3IQHX 5GINE 3JWEA 1C7FA 3G17A 2ZJOA 4A15A 2NIPA 2A5GA 4HGPA 4GUAA 4QBHA 4UATA 3ZY2A 2QUBA 4X62B 2P30A 1XRQA 4Q6WA 2PZKA 4JP3A 1FP2A 2E85A 2AN4A 3N8NA 1FVXA 3I37X 3LGSA 5C32A 2ECFA 5EUQB 4JWTA 3DZBA 2ZRFA 3A2MA 1KY3A 4AZ3A 1Y3FE 3WQSB 1ZW1A 1L0BA 1SVKA 3PEVA 1A9PA 4JVOA 2PEZA 1N75A 5SZHB 2QN9A 4DLXA 3N1UA 1IUKA 1DC4A 5I9SA 1HYBA 1XCLA 3ZTYA 2GDJA 1PD1A 1UBEA 1V39A 3O9ZA 3CX3A 4BYMA 1R6XA 1X8XA 2WAYA 5F9MA 1TT5B 1ZCFA 3UAZA 1OYWA 3SQNA 1TVMA 2FN4A 3FPAA 2VTBB 4XR9A 4GKKB 3CF0A 3L8ZA 3SNKA 4K9NA 2G4VA 3ASVA 4WKNA 3ZE8A 1JE1A 5CFRA 4JLMA 5JD5A 1U6JA 1UPBA 2ID7A 3KKKA 1OKKA 1YZTA 2NVUA 3P0FA 2PLWA 3W8RA 4IY1A 2D1FA 4LE1A 4UDYX 3FDXA 5JDIC 3KR9A 1N2OA 5CTAA 5KVAA 3WJAA 5FR2A 3UJ9A 4XQCA 4RGYA 1QFMA 4S0ZA 2FXIA 3SZUA 2H2AA 2RHMA 3OY2A 4S2UA 1KEKA 3KSUA 2TMGA 3WZ2A 4CM3A 2ZRIA 1P3DA 4KITB 1A2KC 1MENA 1XIVA 2PU7A 3NHBA 1NKSA 5E0OA 3TLEA 1UKVY 1J8DA 1E2PA 4DJAA 3H1AA 1D5WA 1UQRA 1DJQA 4X8LA 1YZHA 4ZT7A 5FOQA 1FUKA 3HCEA 4JUIA 4UHCA 1SK8A 2H11A 5KTOA 1SUEA 3EUFA 1KAQA 4H7HA 2OKGA 4E5MA 2HWXA 4BFSA 4XGIA 3BQ9A 1YCGA 4GP9A 3KXDA 3L02A 4UHDA 1PX2A 3FVTA 4YWJA 1EX9A 3B2EA 1KMHA 3K9HA 4WKOA 1I3OA 3OZFA 4ILKA 5K3FA 2W9XA 1JG1A 2C2BA 4EUKA 5CJPA 2QTMA 5TGTA 3N2GB 1XXHE 1TMKA 3ETDA 1AK9A 1GUAA 1X1SA 2TECE 1C8LA 3DVQX 3HCDA 3GEDA 3MJVA 5G0UA 2JJ2D 1G6OA 1KEEB 1KZYC 2P2YA 2Q50A 3BTSA 2FR8A 3NETA 3RLIA 3RPEA 1VL8A 4WQMA 4C4XA 1P44A 5C46F 4DQVA 4BX0A 4R7TA 1YQ9A 5IBQA 1OXTA 5J5AA 2Z6AA 4NYMR 2I55A 4AN4A 1QAOA 5HG0A 1O9GA 4UVIA 1F4PA 1KXJA 2FUG1 4F92B 2CKDA 2H2HA 2W2MA 1DXYA 4LAFA 1CS4C 3AV0B 1ENZA 2JFWA 1G20A 5FL7D 4UMDA 4IIUA 4E4YA 2H4HA 2FY8A 5ALQA 1GTMA 1L7PA 3C7CB 4MYDA 2IHKA 2IV2X 2ZRGA 4DV0B 3GRZA 3SX2A 4E2FA 2P2LA 1UBNA 1Z63A 5D1NA 1QNFA 2GHIA 1NMSA 4O4HA 4RFSA 1L6IA 5F73A 3WK4A 4A2WA 3ZXIA 4Z4EA 5BSTA 4LOLA 5B2ZA 4ENQA 2V1XA 3LDHA 3GEIA 4NCBA 1FTNA 2B0JA 2BBSA 2VDWA 4G1CA 3SE7A 4N5LA 1T5TA 3T9DA 4X95A 4I6JA 2VP9A 2VYNA 2O8NA 2X41A 3A36A 3FFTA 1XF1A 1SQFA 4K7JA 4HRAA 2C2ZA 4MKIA 1PSDA 2OCGA 3D64A 4WY5A 1APBA 3UAGA 2WUFA 3SNHA 1PS9A 3UC5A 2HK6A 1KYIA 2LCIA 2WUGA 2VOJA 4QBGB 3BN3A 4CHGA 2OXTA 4YALA 2ZQYA 2VHVA 1QO0A 2A92A 4EL5A 1QHYA 2HMVA 3LNTA 4ENSA 5JFGA 3TXXA 1S0UA 2Q5CA 5L45A 3K9FC 3K92A 3OHSX 3Q87B 4MUKA 3THOA 4BGIA 3IT3A 2ZUUA 3LC0A 1ADGA 4NPAA 4W5NA 1NFQA 3ICWA 1KEWA 1XEWX 3U4GA 2JEYA 1LPNA 4F7WA 5A6VA 3OC6A 3SSNA 1BXGB 2H0AA 4BMCA 1KRWA 1EFHA 1EB8A 1AY0A 1U0NA 1XMVA 3C6QA 4NQZA 4ZOLF 5CA1A 1C9EA 2ZJ0A 4QRHA 1FNMA 4E70A 1HSZA 1GLGA 3WIBA 1DAHA 2YVAA 2ZRQA 4FFRA 2XT0A 4XVCA 4JEMA 1QE5A 4Q37A 2ZJ4A 3NUQA 2FPKA 1T9DA 4QU0A 4JXXA 4YCSA 4OH7A 5ICFA 4U2KA 4IUBS 4Q4HB 5L7YA 4ZKEA 4WJLA 1Q0RA 2FRDC 4JYPA 1NN3A 4DLTA 1PKEA 2HLNA 1NVVR 2H00A 4P4TA 4HDQB 5T8KA 4GX5A 1J5EB 2QN1A 2P77A 3QKSB 4X94A 2AG8A 3CWZA 4RK7A 5CVDA 2POCA 4N6NA 5TGZA 2O7RA 2GPTA 3GZNA 1NZJA 1T29A 4CM9A 2AFIB 3DL4A 1TM4E 3B12A 2C5GA 3CV3A 4YRLA 5FHQA 1DC8A 3PUXA 1DZ3A 3BE8A 4LJLA 4RVGA 3RS8A 4J0DA 4BCBA 4L4SA 3T1HB 1JE0A 1YNOA 4F1JA 5LD2B 3RAGA 1NP6A 1E99A 1MABB 4M8LA 3DL2A 1UMDA 4M0FA 1JDPA 8ATCA 3A3KA 3L1UA 1WABA 3LYHA 3BWEA 5LZ7A 5NLLA 2ZM6B 1NM5C 4IZIA 2PHZA 5CVCA 5JO0A 3JVUA 1N92A 4CN8A 1CERA 1G42A 2C92A 2Q3BA 2XYPA 4KQ1A 4P7GA 4I6EA 1Y8ZA 3KLOA 2RBKA 1B0UA 3IKVA 2IIBA 3PNSA 3LCMA 8AT1A 5J4VA 4XVRA 4Q9DA 1QO7A 4CM4A 4DZZA 3ET5A 1JJ7A 3PJEA 1TK9A 1N2SA 5B2EA 3V8VA 3HJNA 4YP9A 4F3YA 2XYRA 2YOGA 1W4CA 1CUWA 1J5XA 1JLSA 4DHEA 4UPVA 2HZ7A 3NBFA 2FJPA 5AI9A 4EG7A 3BRSA 1N4DA 2BHNA 4PXAA 3LY7A 4FHZA 3KEMA 4WKCA 1T26A 3BFPA 2E4VA 4JBHA 2H2WA 2Y68A 4UD2A 2VDWB 3KPWA 4E15A 3Q8LA 2BKUA 3S5JA 1HEUA 3CEHA 3KSDO 4X84A 1FFSA 2NTYC 4LV5B 4G0UA 1KO7A 2QLFA 4DHWA 5EG5A 4P9NA 3WL5A 4CMAA 1DBVO 4JKOA 5CPBA 1L4UA 2QTLA 4F5DA 2CDBA 3QMWA 5AVSA 2O50A 4MW1A 1Y7HA 3PS9A 4O2BF 4MKRA 4RQTA 1RW4A 4FVTA 3RGWS 4MQFA 1VYUA 3AFMA 3UAYA 4NKRA 2EIXA 3QFSA 3EGIA 4Q4JA 3A1WA 4B31A 3P94A 1GADO 3S81A 1DIGA 1U28C 2OAGA 1QWOA 2D5CA 3RRFA 7AT1A 3AU8A 4XWTA 5JZMA 2HEGA 4LVCA 1D0SA 1M76A 1TMOA 4C3ZA 1VKRA 3SLKA 3FMPB 2BYTA 2IE8A 4D81A 5LXTB 1FBNA 3IHLA 4G63A 2C96A 2YX1A 4I55B 1NXQA 4IMIB 1CTQA 4TLCA 3PUYA 5FKJA 3RQIA 1GWNA 2X8WA 2G0TA 3CNHA 4OHWA 4RPKA 3A6DA 3NGMA 1KQFA 1K1EA 1MAUA 2XW6A 4C07A 5GTDA 5C52B 1V0JA 4UCXA 1YFJA 4RA6B 2IYXA 3I6QA 4QX6A 2C5LA 4MMZB 2DBRA 1HYHA 4O4HF 4G0PA 1G8KA 3B7PA 1NN1A 1OV4A 1OZGA 3R7NA 2R6ZA 5DK4A 4QNRA 4WACA 1EFUA 5B3KA 1OYOA 1WB4A 1GFSA 2OLKA 5FJJA 2B5VA 3IAS1 3CCCA 3EX7C 4G1FA 3Q7QA 4B3RB 5JVDB 4B3CA 1IPHA 4GWLA 3HU5A 2PK3A 5FOTA 4I9NA 1S2GA 3LGAA 3BGWA 4LX0A 3X1MA 2JZOA 4L2IB 5FTMA 5BPFA 1V47A 1OLXB 1XMXA 3DBOB 2IWHA 2Z09A 2NUTB 4MB2A 4QPPA 3DZIA 1E0SA 1R0CA 1XD8A 3C45A 2AMLA 3GVPA 2XTMA 3OVMA 3QJYA 4KCGA 4KN9S 4NBVA 5L6MB 4F96A 4D9NA 3NIFB 1DAEA 1IOWA 4C0QC 4DC0A 1N34B 2JFUA 3DZDA 4RFSB 4Q34A 2VBIA 2AR9A 3QVMA 5B3JA 3SC3A 3EPHA 2IITA 1WTCA 4TTAA 3QMPA 3G9ZA 4L8VA 4YDRA 3LBHA 1KP3A 1T5LA 1GTSA 4Z9FA 2ATIA 1FUEA 2G1JA 3N75A 3I9V1 4M8NE 4Z9XA 3J81A 2VTBA 1ZA1A 5FAKA 1WNFA 1LC3A 1ZCZA 1J1UA 2Z9BA 3BGIA 4G0NA 4AG6A 2E6UX 2GHTA 3K9NA 1XCJA 3BIWA 4H3SA 4LHVA 1S8FA 4JHXA 1W36D 4B34A 3ESAA 4NPCA 3SEAA 3U1VA 3WB9A 3PL1A 1CY4A 5F52A 3MMZA 3R09A 4EELA 4GVPA 4IS3A 4A8JB 4GL4A 3PBKA 1JLMA 2BEVA 1A71A 4MVJM 1Y81A 1LZKA 1K6IA 5BWNA 4L3VA 4EX7A 4KWTA 2PZGA 3LNCA 2B20A 1U02A 1BN6A 4RKYA 1L5YA 2JBAA 3B7WA 1IHDA 3H8SA 3NH6A 1R0RE 4GI7A 3X1DA 1KETA 4B87A 5HK9A 1IVSA 1MOSA 2O8DA 2IS2A 2O0LA 4G5SA 3KDSE 3TQIA 5AM5A 3ACCA 2PLFA 4WZBB 4IINA 3VISA 2FE1A 4W1RA 5GADl 2PH7A 4V03A 4N5HX 4DEXA 2DPYA 1OXSC 2H6EA 3DDUA 3GVCA 5AJZA 5HHTA 3JX9A 1PFGA 1VE9A 2PX0A 3JAWA 3ETCA 4BVGA 1XTPA 4UJ3A 1XRRA 3C6MA 4JOCA 5EEGA 4P92A 3AP1A 5HGXA 3AKEA 1YB4A 2P4HX 3A6KA 3TTVA 1Y1KE 4D56A 1Z4KA 4FYIA 1QQAA 3TN7A 2OBNA 1PJZA 4OGFA 4FN5A 4KG7A 3SICE 4EY3A 1XTTA 1N57A 2VHZA 3DLPX 4FGJA 4YIKA 4M1ZA 1ECBA 4U6NA 3RYFB 1CUUA 1JR4A 1URPA 4UU8A 4F1WA 3F6EX 4XYLA 4J1NA 4F11A 3C3YA 2GPWA 4E21A 1VE7A 4RH1A 4ZCSA 4R0VA 3SYRA 4HATA 3DAFA 2PMCA 2O2EA 3A4IA 3HY6A 4PBSA 1N1DA 3TB4A 2V7PA 2QMQA 3AXTA 3RFVA 5ES4B 5LZ4A 3M9XA 1GNPA 2E3JA 2AVDA 1OE0A 1M6WA 3FZYA 4TV8F 3SZOA 1T10A 1V43A 1BCSB 1J9GA 1EP2B 2OCDA 2AV6A 1AO0A 2QZZA 4E1BA 3A1SA 4X7MA 1MO3A 3EVAA 4BNZA 4EZBA 5DWVA 1NVUQ 3ZIAD 3NEPX 4EY5A 4NESA 2IU6A 3L4JA 3V1NA 2Z04A 3CQ9A 4HUTA 1Y8CA 4GMGA 2IHNA 1UEJA 4EHDA 2RCYA 4CEIA 2IPXA 2RSLA 3CPEA 2OGSA 4G4GA 4U7WA 3B8HA 3DR5A 5U1PA 2PMWB 1HDZA 2M6KA 2ZBPA 4FOPA 4TYMA 4BNTA 1E3WB 2JGNA 4XUGB 2KB0A 2FFBA 2QWXA 5E9WA 4RPCA 4OKSA 4P98A 1GNSA 3WIEA 1P7VA 4GOMD 1I8TA 5DLQC 1KDYA 1QIMA 4DCSA 3FETA 1RAFA 2B8TA 3K5IA 5DYWA 5GY7A 1A3CA 2WKSA 1CZUA 1Y4UA 3QU2A 1KY5A 4KK3A 4PQEA 2ZI4A 2WBLC 4U2CA 4Q9HA 3IQXA 1M74A 3QPDA 4RESA 4JHLA 4UVGA 2QYHA 2YC2C 4G01B 4CLOB 1E89A 2X5KO 4HDSA 5KQLA 4FZVA 4JC0A 5B3JC 3M3HA 1D8TA 3HUTA 2GFQA 2PKRA 3BE4A 4KLZA 4D9GA 4Z8YA 3DHYA 4RHEA 2WWIA 2GUWA 2I6UA 2CCGA 2ZR7A 4A2PA 3L84A 5LU9A 2W4MA 4RK6A 4XJSA 2GJ9A 5LP6F 5JY1A 1C0PA 2ALJA 3L5KA 3UOGA 4DFDA 3QY0A 2Q1WA 3PLAE 4FN4A 2NMVA 2Z1NA 2UUPA 5K8LA 2O8BA 2P3OA 1M2NA 2Z9DA 3K09C 5B30A 1E1MA 1B93A 1CULC 3N2KB 1T1GA 4EF6A 1W29A 4CL3A 1P72A 2E5WA 4QBTA 5TLSA 4KQ9A 1E20A 2ZJAA 1M1XB 2WILA 3VJMA 2RAUA 2QLBA 2ZSEA 3MTIA 3KOZA 4YLGA 2FPPA 1XU7A 3PD1A 3G9TA 3OZUA 4IIVA 1Q16A 4HEQA 2XGMA 4XD7A 4BQNA 3MG9A 1HE8B 1X77A 2E4UA 5G1PA 3MGKA 4BQRA 3LM8A 1C0IA 2EVWX 3WIDA 1XQXA 3F2VA 3R3HA 4BB6A 3G0DA 2PZEA 4AL4A 1YSCA 3U60B 4CF6A 4XWOA 2CJYA 3CF4G 2YFHA 4JWKA 3RTBA 3F5DA 4NK4A 4Y2TA 4G5GA 1Z7YA 2O3JA 3DDHA 5JNTA 2O59A 4M8IA 3WMXA 1CUSA 1XROA 3CUSA 2JLVA 1BE6A 1HT2E 2ZDHA 4QREA 5AH0A 5BW4A 1D5CA 4TZ0A 4OB8A 1JXQA 2VFAA 3KV1A 3KG2A 4RKEA 5HIIA 2X76A 1T2UA 3TW8A 1BFKA 3DKPA 5B4VA 2H4WA 4JUDX 1Q7GA 4POAA 2FU5C 3Q3EA 3LSTA 1A04A 2O8FA 1GGNA 2GXAA 4OIMA 3JV7A 4RYDA 2HMAA 4J2HA 1EFKA 1NAIA 3BSSA 3FMFA 3UK6A 1DLIA 4LRUA 2F00A 2C8VA 1Z82A 2DXIA 3DO8A 4RD2A 3SR0A 4JYMA 3JQCA 3SKVA 1WHTA 4YQYA 1YS6A 2AZXA 5KNCD 3U80A 3F6YA 1EWTA 5EXSA 4LVNA 1JXAA 2JKVA 2CE2X 5BUSA 1MIOA 1V95A 2QRVB 3JR3A 1KMCA 1GXSB 3OSZA 3AP2A 2FKAA 2R6HA 2UZAA 3TCXB 5KOJB 3EPJA 4AMBA 3E3NA 3M70A 2QM0A 3MT7A 4U5XA 5KWVA 3E1SA 5CBPB 5EE1A 3BAFA 2XVYA 3VX3A 2PANA 2F3QA 1R8YA 1TADA 4UNPA 2P5SA 1T5OA 1D0IA 3C5EA 1E0DA 2LDXA 1TAQA 2V03A 2MYPA 3AHJA 4AUMA 4TLBA 4BBJA 1UWLA 5FO1A 5BXYA 1KO5A 2OHVA 1BMDA 1IMOA 2QUJA 2VP3A 1UFQA 3F6SA 1R74A 4CM7A 4BP1A 4IGEA 2I4LA 1EHYA 1GO2A 1V5WA 3KYDA 4KQJA 4NULA 1EM6A 1X3SA 1VSUA 2FX5A 4JJIA 4LY6A 1WLSA 2GR9A 1W19A 3WGMA 4F85A 4ZFNA 2NZVG 3CNOA 4CUZA 1CDDA 5DN6D 3STWA 1IHOA 4M76B 3NXKA 4BX9A 2GRAA 1O08A 1IK4A 2NOAA 1WUKS 2XCOA 2ISCA 5BQ5A 5HQ3A 5KS2A 4HR7A 1CJCA 3VAZA 3GJ7A 3ED5A 1JIQA 1SZCA 4QM7A 3HJFA 2IRWA 1OILA 1FYEA 1QQTA 3NFRA 2FN7A 3R6GA 4NMWA 1AQUA 2BGLA 2CFSA 1CY6A 1S8AA 1JLLB 2YZ2A 3LK7A 4X1YA 1N2XA 4F9EA 3EBPA 3KZCA 1JA1A 2AFRA 3T7IA 2RH5A 1M75A 2B25A 1QTQA 5DLYA 4NV0A 4COOA 3PWSA 1XMOB 1QHEA 3G85A 2E89A 4NE9A 1A7UA 2Q1XA 1CUXA 4KVFA 5B6IA 4IFBA 5AM4A 3GLFA 4NBRA 2B2CA 4F9TA 1DAGA 2HCJB 1UC9A 2DFNA 1E6CA 5AHXA 3UANA 2A5DA 4YJKA 3W7BA 1V2GA 5L8VA 1S89A 1ULZA 4MQ4A 4ZEVA 1GYPA 1F1BA 1PNRA 4A6EA 1S2MA 1BE8A 4P2GA 2HPVA 3M6AA 4U9UA 3T1NA 3OJLA 1QFZA 1M67A 2J32A 4NEHB 5SZJA 1X7XA 2AQ8A 4Y1RB 1DV1A 3ZY3A 3D0QA 3SKYA 2GVNA 2JJ1A 3O8BA 3CG0A 5ITZA 4A5SA 2FR8C 1QXSA 3CO0S 1MEJA 3I9NA 3THXB 1ZN7A 4RM3A 2OCBA 4OHPA 3ZHUA 4IWNA 3RU9A 3ZUPA 4GD3Q 2QOEA 3N2IA 4AJEA 2KM1A 4L51A 1DDOA 4OXRA 4QICA 4PPNA 3UFXB 2W6MA 3NANA 5HRAA 2AOVA 3C1UA 1XX6A 4C0JA 3HA2A 1NL3A 3P7MA 4AM8A 2YFKA 5MF6A 1N6KA 1BAPA 1FSZA 2VEOA 2QUZA 4K0RA 3VDMA 2BKAA 3JWJA 4ZEXA 4FFBB 5K3SA 4DIFA 1A4RA 1JFFA 3U4HA 1FMTA 1R9MA 1RXIA 3AEQB 4YCCA 2I6XA 2YWXA 1KAGA 1Z2OX 2GRUA 2R7KA 1P9RA 2YS7A 3MAAC 2GAAA 3LU1A 2HUNA 3LIIA 3NHKA 4NG4A 5GONF 1UFOA 3U62A 4E7PA 2DG2A 2JLCA 2OCPA 3ZYCA 3DE2X 4FMDB 1L7VC 5AKZA 1ZUNB 3KD2A 3LH5A 2Z5LA 3M5DA 1M5UA 2EHJA 3O83A 4RX1A 1EUCA 3FDZA 3MJSA 2KSQA 1O57A 2C4HA 2JHFA 2CLKB 2OV1A 2RKWA 3N2LA 4RO0A 3LBYA 4ZVMA 2OYCA 5A03A 4MWGA 1WOMA 2FSVA 2XMQA 4FYHA 3RC7A 4DQUA 1IATA 4YCNA 1YA4A 3GYBA 2GQ0A 3UH1A 1RD4A 2WAAA 1EA7A 1UMKA 2EGHA 2RK3A 3K6RA 3EFOB 3SZGA 2Y2VA 1QLJA 2H65A 3DBRA 3OT1B 3E23A 2QQ5A 3EIWA 1Q44A 1DRKA 5DYTA 4ZOBA 1T8WA 2FSFA 3B36A 1LEHA 4JQSA 3IQWA 3QE9Y 5K0BA 2C95A 5KSWB 2IKQA 2PH1A 2ZETA 3A1UA 1RCUA 4IJUA 2F1KA 4R98A 4DJTA 2GA9A 2EU8A 4R7ZA 4ZAFA 1AZWA 1UPFA 2NGRA 3E22B 3H9GA 4LGMA 4MB6A 2E4YA 2PXAA 4ZOEA 1XA4A 1F3LA 1KIFA 2R60A 3S55A 3GGDA 5IH3A 1EP9A 4OGKA 4G1VA 3RS5A 1E3SA 2W2LD 2XUGA 4LMPA 1KS2A 4BC0A 4Q1FA 1EVYA 2PRJA 3MWJA 5BUCA 2BJWA 2O4CA 5GJCA 1JQEA 1RRVA 5CH8A 1L4NA 2XMCA 3K8YA 1WS6A 1XD2B 3RUIA 2LWIA 1E5VA 2O2YA 3W90A 2NSJA 1AJEA 3UGKA 4IKPA 3WKBA 2NUPA 3TZ6A 2WM2A 3VAYA 3EPLA 2C1EA 4M1QA 1E92A 3EZ6A 5HF5A 1GA1A 1S9DA 4BJ6A 4F8EA 1UJ6A 3A1CA 3OY7A 5T41A 1B73A 3MIIA 1U8TA 1HNXB 2G1UA 2VXBA 4RBNA 1JBKA 5EMHA 2REQB 3H2ZA 2FSHA 2VHTA 4MRSA 4W4TA 1ZRHA 5C51B 1OOEA 4CYMA 1PP4A 4E5UA 3C3JA 4FBLA 2G9NA 5A0TA 1NI4A 3CNNA 1U4OA 4EB6A 2DM6A 3AOEC 2IIQA 4LMBA 4Z7JA 2UUAB 3ZDBA 3AHDA 3COZA 5TPZA 1NVVQ 4RE6A 4TRRA 5AQ1A 2H9YA 3JARA 4HX5A 5IUKC 2I03A 3WO0A 4Z7QB 1SK9A 4MPJA 1MJ5A 2CJWB 1Q2UA 2OHFA 3GPLA 1YB6A 1DXHA 4JP5A 1P4GA 4B6SA 2IBSA 4NNOA 1F06A 3FSGD 1S3FA 3R5SA 4FOSA 4I4TF 2YNMD 3Q5EA 4NOLA 3TNFA 3KUCA 5JVDF 4FSXA 3KFXA 2J0UB 2HA4A 2OA0A 1H5UA 3GLFE 2H54A 4UCWA 3D6HA 1UKCA 3T7DA 4D46A 1DO0A 4R1UA 5LP1A 4RU1A 1PYGA 1NMXA 1ENOA 3OOYA 2P9ZA 4M87A 4OG2A 2B4QA 2J09A 1CYEA 5K7SA 1IAVA 1DAOA 1G2QA 1G6HA 4DA7A 1P2BA 1AN9A 1P4AA 2ZCJA 2YDXA 3SFZA 4DBLC 5E8RA 5JI3E 3S29A 4LF7B 3I2JA 4U7FA 1D1QA 3JCZA 3JS5A 1VTKA 3BIFA 2DULA 4RPIA 1U1EA 5HGJA 2C3UA 4KZPA 2OXCA 1J2RA 4KW7A 4MS3B 4WKGA 4ZK2A 4MV8A 2P4SA 1QVRA 1EK0A 3F9RA 4BLSA 1DS6A 3ILYA 5B7GA 1YNSA 1DEXA 4OHXA 3Q9LA 1Y3CE 3ITNA 1E1CB 2WU1A 4P84A 4DILA 4EH1A 1Z47A 3V42A 2AOUA 4AJHA 4DDWA 2QL6A 2W2VA 2VHYA 3A6EA 2D5LA 2HLDA 3I61A 2P2NA 2RD2A 2JGDB 3HDYA 3DA8A 3KELA 4DIDA 2XJ9A 1QH1A 4PGGA 5EIEA 3ZHQA 3BBPA 4QXQA 2V7BA 2JAQA 4YS6A 5EKDA 3EN0A 3Q7IA 1K6XA 1ONSA 3MTQA 3RRBA 4ZMSA 3EGOA 5EPEA 5BN3A 4TS3A 2X2EA 1O77A 4FQ7A 4U6QA 2FWMX 3REQB 1KJNA 4ML3A 3DD5A 3LVBA 2IV7A 3B89A 3AJAA 3I2FA 4Y2RA 4ZAZA 2ZUSA 3QVGA 2EZUA 2EKPA 2P6RA 3CX8A 1UFVA 2Q1SA 1Y37A 3BFJA 2YHIB 1XZCA 4O4LA 5TMPA 3L7LA 1XJ5A 1FX0A 3E18A 1LI7A 1HLGA 3GWGA 4OOFA 1TE2A 3CO5A 3DBLA 4D6PA 5HKOA 1F8YA 2HX1A 4UBMA 1VKHA 1V16B 4X7RA 5C4MA 4UAJA 1T0JB 4QGAA 3FPCA 1E1RA 2IHUA 1RKVA 1PGQA 2QX6A 4CMEC 2VZ9A 2ODAA 1G41A 4CIXA 2YN0A 1AQIA 1HGXA 2YICA 5TB5A 4LWPA 3VTZA 3U09A 1UBUS 3E27A 1JJFA 3R7BA 2XDAA 2ZB3A 4EB3A 3AKCA 2J0SA 4CIVA 4J9UE 4BV9A 2WFZA 2X22A 3ZNQA 5BNFA 2FJ0A 4P4SA 4MEAA 2RGGA 3H4MA 1E7SA 2YNMC 1M5TA 2ON6A 1FP4B 4ENPA 5I8PA 3KSAC 2BGGA 1U1GA 4RMHA 3K0CA 5JPIA 1YJXA 4IFIA 1RABA 1HE1C 5FUBA 2X8JA 2PT5A 3ELWA 5ICMA 4Y18A 4HN4B 1K8RA 2GH1A 3EVGA 4X45A 5IFLA 1OXVA 1V9CA 2WHRA 2PN1A 2CJWA 3R9IA 3I0NA 4HT3B 1C9NA 3KXKA 4OQFA 5EHQA 4BP8A 1U99A 3N2GA 2KQUA 4YCLA 4Y0VA 3PPXA 1X1BA 4MWTA 5EKUA 3OF2A 1VBMA 1SRQA 3GRUA 4GNRA 5EZYB 3BZWA 4ASUD 3CURA 3RQSA 3GV0A 5AVJA 3RKUA 4ZYYA 2NP6A 5JG7A 1N8TA 1KJ8A 2IODA 3PUWA 1ZU4A 2C0CA 2HHAA 2Q29A 3DE1X 3LT1A 3Q7TA 4GWKA 3INGA 4NLLA 3SIPA 3C5CA 1P8JA 3GPCA 4OQEA 2IDJA 3UA3A 4E3ZA 1UPCA 4YPFA 3TIVA 1NJ2A 1YAHA 3B3GA 1RAHA 3H7AA 2ONJA 3T8YA 3Q11A 4AZWA 1H0HA 1XZHA 3CC8A 2B21A 2Q9UA 4JA0A 2GZ3A 2ILTA 2C8KA 2JVKA 3N2NA 4DEVA 3B6KA 1XTUA 4V3BA 2SCUA 5BN5B 5I4CA 1A9QA 3LQYA 3U7HB 3ICCA 4M4SA 3TVDA 4Q1VA 4YUWA 5BUZA 4QA9A 3TIFA 3N9IA 3VQTA 1DRUA 2AMYA 3DUWA 5DYIA 2BSAA 2EQAA 2OK8A 3Q2OA 4Q39A 1RYFA 4ZQBA 1KI3A 4G5YA 5EE3A 3OKFA 1ZXLA 2P6PA 2QDKA 5JBNA 5EEHA 2J5XA 3SLGA 5EQJB 4WBNB 1VJCA 3QBVA 1G21B 1QPZA 4CF5A 1UP4A 1BWQA 2ZPUA 2Y8EA 3QF4B 3RYCA 1X2EA 3OTOB 1U3FA 5DW3A 2HOQA 3IIIA 2H1OA 1Y42X 2QV0A 5BT8A 2YS6A 3I6MA 5IWAB 2PWAA 4B45A 2A88A 3WDKA 3A1VA 5FBKA 1K0UA 1MOQA 3OHPA 2XMZA 4ND8A 2CVQA 2PGLA 2Q4DA 3TD6A 4S1NA 3HACA 1SHTX 5SY9A 2XNJA 1ZD5A 2PNFA 1FNBA 4GL2A 3OU6A 1ZHFA 4AKHA 3AY7A 5F5LA 1XAJA 1ZCAA 2DQ4A 2PEYA 1DRWA 4UVEA 4X61A 3DQPA 4HNUA 3SQDA 4A0RA 2B3DA 1HV8A 2WU4A 1RYDA 1Y7PA 2QD4A 4YDHB 4PX9A 2QS9A 3RHTA 3OD5A 3OMLA 1G4UR 5HYVA 3G2QA 3NGLA 4PX2A 5A5EA 2IOQA 1VPVA 1EBBA 1T6ZA 3KB6A 3VU9B 5CD9A 1F8FA 3NOQA 2AG6A 1TTPB 1KYZA 3DHWC 1EEXB 4Y6RA 4CMIB 3T54A 3E7PA 4CFSA 1VP3A 2G08A 3F3SA 4BGVA 3BJIC 3NWJA 5C1DA 1G3RA 1KNXA 3BCUA 4LRXA 4ZODA 4ZDIA 5BV0A 5FL3A 2I0FA 1J5PA 1F6WA 4PO8A 4OXXA 2QG6A 3II6X 3IUYA 4NBWA 1YS7A 3RFXA 1RMYA 4BNYA 4BHTA 4WVFA 2JKYA 1YZ3A 2DC1A 2ERCA 2VPWA 4J16C 5JSYA 3FDIA 2X2OA 1NZDA 2D3WA 5FBZA 4NK5A 1UODA 5SZKB 4PSKA 3WLLA 5IM4F 5HM6A 1OHHD 4IP0A 5IT0A 3K9CA 2GLUA 2DSNA 2WYHA 3FPFA 3HU3A 1NYTA 3HO6A 3A28A 1GG2A 3IKMB 1OWNA 1D6NA 3G1TA 3UCXA 3UJ7A 1CY7A 5EGNA 5F35A 1RTTA 1FU7A 4CNBA 3V00A 1XNGA 1T1SA 4P3KA 1PR3A 4KFUA 1C5KA 3JZAA 4R81A 4BQQA 5DV9A 1KOGA 2RGCA 1L5VA 3BF8A 4JBXA 1EXDA 1GVHA 1YK0A 3ZKWB 2J4CA 3G1WA 3HE3A 5K4GA 1CNEA 1RMQA 1KWGA 3EB9A 4YR7A 3P9SA 1T8SA 4CKWA 1VJDA 3K8OE 4NOMA 4JJ4A 3TECE 3NWBA 3PX3A 4GSKA 4D74A 4IXMA 4DA4A 3K31A 2A94A 3P8ZA 2GEKA 2ID9A 2D2FA 2IX9A 5HTOA 2I3GA 3HNPA 4P82A 3AOEA 4G3XA 3ZWDA 1ZR2A 3U5TA 2ZAMA 3IAM1 4FYXA 3ZNNA 1GQSA 2Q5FA 5DU2A 4LOKA 3AFIA 4Q3CA 2V65A 4NHOA 4G67A 3R8FA 5EWLB 1TAGA 3SZLA 3RYCB 3CR8A 4KR6A 5EUMA 2JRCA 3PUJA 3K09A 1WMSA 4NVRA 2HU8A 2AF3C 2CXUA 3GLGE 3H1PA 3BMCA 4KIUA 1JEQA 4PM4A 4WEQA 3KFLA 2L69A 3OZXA 1QAMA 5CTJA 2PY6A 3AVTA 2VH5R 2PJZA 4GMDA 2I7DA 2BFBB 1DO2A 5K0SA 1A9OA 4PS0A 3IAXA 3OX3A 4ZAXA 5JJKA 3FJ1A 1NUTA 4CIBA 4KWEA 3UBTA 4C21A 4Y1GA 4MITA 4G9GA 2C54A 4PPYA 1K9SA 3RC2A 4GOND 1ZAYA 1NUPA 4OQMA 4XUDA 5LQDA 3L0ZA 4NYJR 3UIEA 5JSFA 2VPIA 3Q2KA 4AO7A 5M04A 3M3PA 1QUEA 1KYYA 2Q5IA 3EFBA 3FR7A 5HMLA 1V1RB 1GPWB 2M6LA 3PQEA 3TQRA 3WDMA 3PQ7A 1RYBA 4O2AB 4V0KA 4E7OA 4ZDKA 5E6SB 2DFVA 4CE6A 1S96A 3AF3A 1SXJB 4QU9A 2XWJI 3SZMA 3PZBA 2MT9A 2YY7A 5TS2A 1BDJA 1CIPA 2R7AA 2FPGA 4HFJA 4KU4A 4Y9TA 3QELA 5AICA 4D8XA 5CDTA 2B78A 1QMGA 4CFZA 1RDFA 4FFOA 4BQPA 3U3OA 4B3HA 1G64A 1JDBB 1S2IA 3IE1A 2A84A 1NUAA 2V3VA 4PG5A 4CKZA 4J29A 1H2FA 1VZ3A 3AILA 3UUWA 4CIAA 2IHVA 1EJ2A 2PWBA 3JQGB 3BL8A 5HM8A 4O3MA 3FUUA 5BYJA 3CNBA 2WUVA 4JC5A 2WP0A 4R84A 2J67A 1FW8A 4IMPA 721PA 1US8A 2LTAA 4WASA 3D4IA 1IHXA 2XB4A 3GAMA 4IIEA 2H08A 1JS1X 1C9DB 4HMOA 1FMFA 3DE3X 3FYUC 3PDUA 3I58A 3QPUA 4MK4A 5ERXA 4B8YA 3GN2A 1P2TA 3H19A 3IAHA 4OUKX 5FBQB 2O14A 4BFLA 4YUXA 3GVXA 2ZYAA 3DOIA 1PAUA 3SIXA 1DCFA 1JBEA 3AU9A 2X23A 3PVSA 4J3NA 4QHTA 5TIIA 2BJHA 5FI1B 1KDTA 3BCRA 2GCPA 4FT4A 1CDOA 4KQXA 3RDPA 3F7MA 1R4AA 1QTRA 5E4YA 1Q0SA 1XVUA 2FSSA 2X5XA 5T8KC 1P61B 2CUTA 3GGSA 3EZ9A 4DGQA 2E1RA 1AKVA 2NZWA 1H93A 2QAGC 4IQGA 2BP7B 4IHJB 1FB5A 3R3SA 4E94A 1DKPA 1QH8B 4PC3A 1TJNA 3DT8A 3LI2A 2V8BA 1O5IA 4KR0A 4MPDA 4RLHA 1JEQB 4RPGA 5EIHA 2YC4C 2HQBA 1F12A 5EHGA 5AXDA 1MH1A 2F3UA 4HX2A 4UHJA 4WINA 5DX0A 2XSZD 3ZS8A 4D0NA 1Z4MA 3A26A 4N3NA 3AH8A 4P7JA 1VI2A 1GG9A 2COKA 4HRXA 3GD7A 4DIKA 1K8XB 5A71A 1OC4A 2O05A 2QEQA 1G66A 1PNVA 3BH6A 4HEA1 1E9AA 4LE2A 5DVZA 1DZIA 5CA0B 3KQHA 3S4YA 2NT4A 2EKZA 4MV1A 4Z4HA 3H8JA 4ETNA 1JMVA 3CSUA 2UYOA 3CZAA 1IWPB 1R66A 2IX3A 2H1HA 1JHPA 1VHTA 1MRSA 2X13A 1YZNA 4MYHA 3SU8A 1EJ0A 1I7QB 1VKNA 2WM9B 3HXOA 3ASUA 5ANRB 3AQIA 1EXWA 3TR5A 4RZXA 4X1IB 2WJJA 3GT0A 2VP0A 1E7WA 3GRCA 4G5HA 4OO3A 5B37A 3QKSA 2O57A 3D8NA 4P36A 3QVLA 2WWVD 4ETWA 1K06A 5HRUA 3HP4A 3O4FA 3EPKA 4G6ZA 2VSQA 1ATIA 1GGJA 1Z0KA 1H23A 3UQYS 4OX9Y 1ZNQO 4HXEB 1O8CA 3V5NA 3Q0EA 3CH7A 2B1IA 5H0IA 4JJ8A 1BHSA 2W2LA 1R5OA 4O2AA 2Y4NA 4B85A 1DQZA 4RIEA 4EFDA 4QL3A 2VYFA 3LGXA 1B26A 2XZDA 1SHJA 1X38A 2J1LA 4FJ1A 1J2TA 2SICE 5FAXA 3EMDA 3E3OA 1BRMA 5AXCA 2IYNA 1P77A 1X3LA 4ED9A 5ICEA 2Z98A 3GLGA 4IZHA 1HDXA 4K6OA 3VPSA 1ZM9A 1IONA 2QRNA 2R5FA 3DFKA 2CHVA 1C3JA 4PO3X 5T4HA 1MX5A 5FWNA 4A2CA 3NIGB 4ZC8A 4MJ7A 1POWA 2ZJ5A 3IP8A 2SKDA 4AUNA 5I9NA 4PV7A 4TZKA 3KX2A 4TTJA 3NR2A 4BFWA 4MHSA 1UDWA 3IEKA 5D3ZA 2ZB8A 4LGCA 2E4AA 4DXAA 5FUMA 1KI2A 1MXFA 4K6MA 4BX8A 1NBOA 3B1YA 1CRPA 1A82A 4Q3NA 4LF6B 2D1QA 2CL5A 5IJZA 1NNUA 1KZ9A 1ZNZA 3ADBA 4CCSA 1RZRA 1ML3A 1RQ7A 2AOUB 2DMRA 2VK8A 2ZB4A 3DOHA 4MV0A 4ECAA 1ZUHA 3WDLA 2WWYA 5TDHA 2ZUEA 3ROEA 3FOWA 3AR6A 3KQQA 2R8ZA 1SNYA 1I14A 8LDHA 4CG2A 4X1OA 1N1GA 1TA4A 2OFOA 3FPEA 3FOBA 4I1VA 2A86A 4O4IF 2R5WA 3R3YA 3KKNA 2BR3A 4B4KA 1RM5A 4PG8A 4EHHA 1KI4A 4PGMA 4QAQA 4FR5A 2DY1A 1OI3A 1WDWB 2HYDA 1Z5GA 1T8TA 3BGSA 5BORA 4W1QA 3EUWA 2ZB7A 4X1KB 3A05A 5DOVA 3TLYA 4K2AA 5AFSA 1CQPA 2J0VA 2JLAA 1G8FA 3BA1A 4MI6A 5ESXA 2GPAA 2OPBA 1NUHA 3PC8C 1IQ0A 4BZXA 1OPXA 2CJPA 3ZQ4A 5BWLA 5KYUB 3U44A 2OV4A 5H02A 4HI0E 3EOAI 4RSHA 2XWPA 1XZFA 4TKUB 3V48A 2GYVA 3HFRA 2PPVA 4QT4A 2GUGA 3KPUA 4JROA 4CN9A 1E9CA 1I9CA 4M1YA 1N7GA 3B3JA 2FGKA 2FLKA 5LIRA 1Z15A 2R5NA 4FCVA 4DA0A 3U17A 2PUAA 3ZQJA 1E0JA 4M60A 2FRVA 3IP1A 2YYYA 4EMUA 5HZHA 1ISIA 1CVIA 3EGDA 2JAHA 3GARA 4DA6A 3THYB 3PNVA 2Z57A 2BFEB 2V0NA 2OQVA 4FIDA 1ZD4A 2NVWA 3IR6A 3O75A 2XQIA 3L1VA 3I12A 2BEWA 5TR9A 2G4CA 1YO6A 1DELA 1RPTA 3P4XA 1EXVA 3VNAA 2WU0A 2WWFA 4MVJH 1JHXA 1HO3A 2A1IA 3AM3A 3DV0B 5JWHA 4J7UA 4AWXA 1R27A 5FUYA 4YX9A 2B7CA 4CQMB 4GBJA 4ZK6A 2A0XA 1HE3A 1U98A 3NHJA 4QDUA 1EWYA 5EI5A 2POQX 1EA5A 2NXNA 1J99A 3BB4A 3OEYA 3HXPA 4I5GA 1FRZA 1XYYA 3S2FA 3DDOA 2D0PB 4OX9B 5DHTA 1IIBA 1V3UA 1C9JA 5I4IA 1FFXB 4WUTA 5EA2A 4ZZ2A 4R6WA 1W34A 1WDTA 1H69A 2IYWA 3B5IA 3LO5A 4C14A 5JYEA 1A8UA 1P7ZA 1ZNXA 3LECA 4B8WA 3F78A 2IPAB 2ZUWA 1RXVA 5H3HA 4ZHSA 1ZK0A 3Q88A 1N5MA 4CM6A 3RS3A 3RVOA 5K4HA 4OGLA 4I46A 4JT8A 2CHEA 2ZS9A 3FJOA 4KJZA 3BYZA 1DKRA 1JSXA 3IILA 3QU9A 5H82A 16PKA 1DWUA 2CY0A 3IDSA 4KXYA 5EKTA 3ZDRA 1IJKA 3PD7A 3VJRA 5AW1A 1ULAA 1OTXA 5H8WA 4TMTA 1G7SA 2GMWA 3NEJA 4HMQA 5E4JA 5A4DA 3KL4A 4PHCA 1NJSA 5A4FS 3DGEC 3T3DA 4HMPA 3DWGA 3C3MA 1MXHA 1Z0IA 2XTJA 1Q0ZA 4RQUA 1BA2A 4ZVSA 3HCNA 1Q57A 2F9MA 2LBPA 3OEHA 4M37A 4MUAA 3EIEA 1YJAA 5TQ0B 3WGJA 1Z7GA 4L07A 4ZVQA 4F97A 1XWIA 1V11A 2FUCA 3EA4A 5DX8A 5FLYA 2VAMA 4JI6B 2PH5A 2VAXA 2WC1A 5TS3A 4KR7A 4KDRA 3VBEA 3LT2A 4F46A 3PXUA 2NTNA 2W8BA 1TYDE 1OFHA 2IOFK 3IQIX 2V7EA 3BIOA 2BM1A 3OPXA 4M6WB 2GAOA 1RMTA 4WZ6A 1YH3A 2A9QA 4GQBA 4IVRA 5EXEA 5G0TA 1QQBA 1YZYA 1ETHA 1KAHA 5CCBA 4Z4FA 3ND6A 2ZI6A 3K2BA 4YRRA 5AJXA 3AUFA 3KWMA 5LU8A 1SEPA 3E15A 1P2UA 3NTLA 4MDFA 2NNWB 1PZXA 1E9EA 4QYSA 2GGSA 4EM6A 3FN4A 4BFVA 5KC8A 2EQ5A 3PGLA 4FINA 4PEVA 5LXTF 3K6SB 4F71A 1ZN8A 2QP9X 1MMFB 1V4NA 1NBME 5KJFA 2WV9A 3DHVA 3GFQA 4Y9SA 4ALLA 2XXAB 5FNVA 1YB5A 3RCBA 3AZQA 4HJRA 1RRMA 4KXWA 1VECA 4WLOA 1ISJA 3F67A 2LVBA 2P65A 1SOUA 4WFJA 1Z4OA 4C7XA 2F55A 4DJDC 2OR3A 1ZSVA 1YDWA 4YMHA 1BVYF 4HL6A 3O93A 2OHHA 2CE7A 5L3RA 4W5QA 3RHZA 1DTEA 1R6DA 4FTWA 1Q0PA 4BLOA 1LCIA 4DM7A 1FE8A 3WWCA 5KTMA 2QXYA 5FB3A 1R00A 5E7MA 1KJZA 5HIJA 1WBJB 3P9QA 5JAOA 2A1TR 3WL4A 4MJ3A 2TMYA 3ESQA 1KVQA 1ZK3A 2P41A 3UMRA 4OMUA 3D6TB 4XDHA 3UJ8A 3W5JA 3QUQA 3FVWA 3UTCA 4D43A 3UWDA 5A02A 5KCMA 1IU9A 5DBIA 4YRZA 5HEKA 2W2QA 4D4IA 3PJFA 3FDFA 5A1TA 1JEJA 1ZY2A 1IJFA 2WIAA 1A5TA 1IM8A 1USVA 2JJMA 4PZLA 3LCUA 2QT1A 3GQVA 5C7OO 4S0XA 2IKSA 3TLKA 1HRKA 1SOVA 1OFGA 2FYTA 5TQJA 1AO3A 3RAFC 3OQPA 3ZV5A 4HUQA 3KTAB 4MWZA 2NYRA 4HQ0A 4K6GA 3NLLA 2O06A 4K3UA 4R1MA 4RVCA 1G6Q1 1TTHA 3Q2IA 1UIMA 4IHJA 3V7WA 3SS9X 3FXAA 4NIMA 2GBFA 3PQ5A 2CZQA 5EHIA 1E6EA 1SUPA 1WDMA 5F76A 3W3AH 2XGJA 3EYWA 1B00A 4DA9A 3U49A 3OOHA 3A58B 5ALOA 5HTKA 2NPFA 1PRYA 2QTHA 3Q6IA 1W5EA 1P6XA 1JX6A 3GZNB 3WHPA 4H77A 2AZ4A 2I8LA 1NC3A 4Y9UA 4BIIA 4D0LB 1I2AA 1KPGA 1LBIA 3PLRA 3DBIA 4W8GA 1UBMS 5F1YA 1VGQA 4MQEA 4ZT5A 1JTFA 4IV5A 1DRJA 3TQOA 3ROGA 3DXFA 2V7UA 3ZIDA 3DCJA 4E09A 4I1PA 1UDBA 4NSNA 5FBWB 5CA1F 1E1NA 1EMDA 1I6MA 2R00A 1EQUA 3U13A 3ENWA 3U4AA 4LXIA 4Q9LA 1E66A 1PBTA 2DQZA 4F93B 1T0HB 4TN1A 3I1FA 2CD7A 4I1YA 3P9XA 1FLVA 2CC2A 3MT0A 4H35A 1E3DA 1U0FA 3DC7A 4ZOCA 5I7AA 1U1DA 4B09A 5TC4A 4BO7A 3EFOA 3EVEA 1NQOA 4HEHA 1CUZA 3PICA 5C7LO 1KJIA 1U4SA 3FRJA 3MUEA 5EQFA 4LV6A 1ZJ4A 3UOAB 2HXGA 3GN1A 2ZGVA 2JVJA 1VSQA 3SBXA 2R44A 3D3KA 3QEKA 3X44A 2F8SA 2MMGA 3JQ8B 4B7XA 1LNZA 1LDYA 2GKOA 1FFDA 1E4OA 3EGDB 2WR8A 1W88B 1JPVA 3HY3A 1L5HA 1N5JA 3LBAA 4MNTA 1KAEA 3H84A 3JAKB 1BZYA 3ABZA 3EIXA 2B9EA 1ULTA 2FOLA 1TQ4A 2BF4A 5LDDC 4MOWA 1XZMA 3WC4A 1LSSA 2Y1FA 3WGQA 3M6VA 2UUOA 3PYMA 1LLFA 2PRSA 4WJZA 9ATCA 4BAGA 5JSUA 3K70D 1KP2A 5LB4A 2LIPA 1ZI8A 3EY9A 3EWNA 2Q4TA 2X9VA 1N1MA 3F0TA 1CUGA 3L3BA 3L6UA 3R1IA 5JO9A 2JI7A 4F3NA 1ZVVA 4IDNA 4L5BA 5JBQA 1A8IA 3WYGA 4L3WA 1SC3A 4KK4A 3T9EA 4C0SA 3UYLA 1W6RA 4UTOA 2YJ4A 1V7QA 5FOVA 4HVLA 2QVCA 4MYUA 5LNK1 3N7UA 4IJQA 4NU0A 5CT5A 3FB1A 4B3GA 1I2BA 2QMUA 1SVWA 2WTMA 2WYOA 2FZVA 2YHUA 1P5JA 3NPAA 2WWWA 4GPAA 4OB6A 5K3EA 1AA6A 3PA6A 2P2GA 1TIKA 1XF9A 2RHLA 4E31A 1DJPA 2WMDA 4A5OA 3LQFA 4DQKA 3O8LA 2BR5A 1UOPA 4A0HA 5FWXA 1TEZA 3C2QA 2WRZA 2XNDD 3PWTA 2BE7A 1KA9H 4KAAA 2CXOA 4D5GA 5BW8A 4G85A 5G3YA 5JQGB 4M9UA 1W8DA 1KEPA 5FBHA 5AI6A 3T34A 3ZDEA 4HQKA 1C7IA 1BH2A 2XMDA 3UG7A 3QIAA 4RJKA 4XARA 3KJXA 1Z17A 1LPMA 3CSDA 4UOZA 1W59A 1GV0A 3O4IA 4CPDA 4JI3B 1GTRA 4RCZA 3QHAA 3RFUA 1PTKA 2QW8A 3MQ4A 3CZPA 4G37A 5C31A 3SS7X 1HT1E 3R5TA 3CX4A 1ZHOA 3KKOA 3PFKA 5FXMA 2IP1A 4D4JA 3USES 5FUVA 3PHIA 1UMCB 1JF8A 3EASA 2DU8A 2R7MA 3E0QA 1A5ZA 5A5FA 5ITZB 3A4TA 3HHEA 3MCUA 3NALA 1RYHA 2BUAA 4HFNA 3L0SA 2KHZA 4JLOA 4WD3A 4EG1A 4ETIA 3AR5A 4UE6A 3ESZA 1Z5UA 1KBQA 3MRTA 1GPYA 1OGJA 1ES9A 4D6YA 5CEFA 2ES4A 3O1JC 3OZGA 2DKFA 1KRXA 3AEZA 1E1KA 5CLHA 3IBFA 3Q5GA 2V5AA 5LDGA 1MQSA 1FL9A 3COYA 1FSSA 3FNQA 1R6AA 1XVAA 2J07A 4LXTA 3T7JA 3VPBA 4QUHA 1WKCA 3UMYA 1XTQA 1XU4A 1SCAA 2DTXA 3KEFA 3PTZA 4A2QA 1DQYA 2NYVA 3CEAA 1XL1A 3B8EA 5GZ3A 1DNPA 3B9BA 2YCLA 3GLHE 4KGVA 5CT4A 2CF5A 1DBRA 1RHUA 4EFKA 4KWHA 1ETUA 1ORRA 2H1RA 3GFVA 4RPHA 1DPFA 1Z68A 2WQZA 5F5NA 1X1AA 2JFXA 1CVRA 2Z5GA 3O91A 5T4EA 4EGCB 2BDEA 4OREX 2NSDA 1W36C 3AUAA 4UU7A 1JW9B 4JC4A 2ZBQA 1JFTA 3V8MA 1L4FA 2W0MA 3DP9A 3VKWA 1WUHS 4FE3A 5A5GA 2UYYA 1ZOSA 3FGOA 1OCEA 4RD3A 3HYLA 4B3FX 1PZNA 4GYWA 1ESEA 5IW8A 6PFKA 1G5TA 3GBVA 2HPAA 3ANSA 4ISBA 1PUXA 1C29B 4D2IA 2XKBA 4MGYR 2FR0A 2QUIA 5JSQA 2QD5A 3RVBA 3MIZA 3RRYA 3KOXA 5HMMA 3THWB 1F2TA 3ADCA 3FPBA 3I72A 1R15A 1XBTA 1QYVA 1L5NA 3KUUA 3CKMA 4NH4A 1OASA 4U2BA 3S8EA 4ZI3A 1HFJA 1WB6A 2JI6A 2IUYA 1Y6JA 2WOJA 2ZQZA 4XXHA 4F91B 3VO1A 3KOWA 1FK8A 4CT5A 1E6KA 3H18A 5E7QA 2WSSD 2YW9A 3QE4A 3T4XA 5ESDA 1SM4A 3A7DA 5FL7A 3WWZA 2YBDA 4PONA 4R2HA 5EZYA 3KYJB 5H3CA 4ZYZA 3UPUA 3NVKI 4RUKA 4D97A 5JYCA 1W85B 1XOIA 1MJNA 1SWWA 1DAIA 2WP8J 4IYRA 2VQ3A 3TDMA 4GLLA 1PCXA 1U2RA 4A8JA 4B6RA 2H4XA 2WJIA 3ILXA 1GCUA 1IOLA 2DOKA 2F43A 2CMKA 4QDOA 1J20A 4BX2A 2VDOB 2O2CA 4Y2HA 2QMZA 1EVZA 5IARA 4C89A 3CUEF 3FOZA 2GDZA 1OA0A 2QUHA 5CLFA 2DVMA 1QK5A 4KSYA 2QTVA 4Z49A 2HU5A 3D59A 4DSUA 1LBEA 3D6FA 2Q5JA 1OB2A 1AOXA 1ATZA 3FWHA 1U2PA 4YN3A 4D25A 4O29A 5LOVA 3IP9A 3O2SB 3X1KA 1EFVA 5JCJD 2N75A 1A88A 4FCWA 3ZE0B 2C83A 4AMGA 3RS9A 3UPTA 1YCFA 1J2YA 1MDFA 4RABA 2AKYA 4MS4A 4ITRC 2W37A 3DNFA 5TE9A 1N8NA 1TT7A 5G1OA 3OIDA 4AXXA 1P1JA 1NJGA 2HDHA 4KRGA 1QO0D 4LRSB 4YASA 4LSWA 3WKDA 3ND8A 2IP2A 3PPWA 1LPAB 2OWEA 1IY1A 3G3EA 3WNQA 1I4DD 4KP7A 1XWFA 5JXJA 4WKPA 1PFVA 1UZAA 1J25A 3JW8A 3KZKA 2V7XA 3NTUA 3QVGB 3QFRA 4P8RA 2I4TA 4D9KA 1UFRA 1I7PA 3QPCA 4GZLA 3VHQA 4LYAA 1WAMA 4OLBA 5AI5A 1JG7A 1I2ZA 1IC6A 2FWNA 2ZEJA 3E7DA 1Z0FA 5G0VA 3V6LA 4RY2A 2H51A 2RHDA 4O8CA 2PMDA 5DSTA 4XTCS 1OW3B 1DOAA 2CMDA 1VGRA 4P5DA 2QQ0A 2P3SA 3R5JA 2I54A 2PAFA 1T3ZA 3QUCA 4OOEA 1FDRA 1VRWA 3AZOA 1T6XA 3R0QA 4KNYA 4JOQA 1P5HA 4W63A 3GJSA