5LQMA

Structure of quinolinate synthase y21f mutant in complex with citrate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
303
structure length
303
Chain Sequence
b'HHHHHMVDEILKLKKEKGYIILAHNFQIPELQDIADFVGDSLQLARKAMELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYREKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFELMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinolinate synthase A
publication title Crystal Structures of Quinolinate Synthase in Complex with a Substrate Analogue, the Condensation Intermediate, and Substrate-Derived Product.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 116
structure length 303
sequence length 303
ec nomenclature ec 2.5.1.72: Quinolinate synthase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02445 NadA Quinolinate synthetase A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA02
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA03
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqmA01
5KTRA 1WZUA 4ZK6A 5KTNA 5F33A 5LQMA 4P3XA 5KTPA 5KTMA 5LQSA 5KTOA 5KTSA 5KTTA 5F3DA 5F35A 4HHEA
chains in the Genus database with same CATH superfamily
3CLHA 4MHSA 1CJTC 3VSDA 1YACA 5LSAA 1U2SA 4C6SA 3JAKA 4PZPA 3K9FC 2E5LB 2O8VA 2QNRA 2VZLA 3LP8A 3GJXC 3MG9A 2EVWX 3U9SA 4BN5A 3BVPA 4FOSA 2VF2A 3M4ZA 5ER6A 5B1IA 1GEGA 5ABPA 1J00A 2UXBB 1M6NA 3NAQA 3P4XA 4HB3A 1OH7A 3N0WA 4JC0A 5CLLA 3S29A 4JBHA 2PGAA 1LRKA 4ZU3A 4BE4A 2V0CA 2AJ8A 2IEDA 4ZODA 4HDOB 1KU0A 2ZJZA 1LS6A 2QMZA 2RHOA 1TCUA 1L5KA 3AZPA 3OLVA 5FLXA 2PX8A 3EJ6A 1Y3FE 2QW8A 3T6KA 2A5DA 4D3XA 3QOWA 1EUZA 4MI6A 2PA0A 4CL3A 1DCFA 2VNHA 1Z4PX 1SCQA 2FPIA 2YIMA 4R41A 2DBZA 1N2GA 1ZI9A 3HXTA 5JS7A 4NQZA 4Y2UA 2BGTA 2AE2A 3W3ZB 1WMDA 2B2XA 1KC1A 5AJVB 3WBJA 2F1JA 2Q8QA 4PBSA 1XKLA 2VLIA 5KQSA 3U31A 3WZLA 2FQXA 4L1KA 1Z7GA 4TWJA 1W36D 3NHLA 1QIKA 4AS1A 9MHTA 1J2EA 4B17A 1ZH6A 1A3CA 4TM7A 1GGKA 1X92A 2GHRA 1XPJA 2ZRHA 3LQ2A 4LX0A 5K1ZA 1IMJA 3KUDA 4PZAA 2BM8A 5CVJA 4WDRA 1NRWA 1WDWB 1YI0A 1VE9A 3OO1A 5I9TA 1UBSB 3OIUA 4CLHA 2D62A 2O0JA 4JR0A 4JZKA 2CWWA 1GT6A 4Q9IA 2C3OA 1GZ6A 2WWIA 2G7MC 2XWPA 5I9LA 5IHPA 4ZICA 1T4MA 3WNBA 2OHGA 4OQLA 3EGCA 1HQDA 2AN3A 3FCUB 1RWOA 1Z82A 3KDPA 1E2IA 3L7CA 5LLSA 5K0BA 1JTVA 221PA 1M54A 5KJFA 2IS1A 2FZEA 4E5VA 1GPAA 3R5FA 5DI9A 5ENDA 3WYCA 2PMCA 3DEYX 2PSFA 1LK7A 4DILA 2FK7A 1QKIA 2OB2A 4BV2A 5KTNA 3MUOA 1K89A 4QXPA 6AT1A 1BAPA 1J2RA 4ZAFA 1CKEA 5MN5A 4KQ2A 5HX7A 2VEOA 3T7JA 3PICA 1TEXA 3LBHA 1AY0A 4HN9A 5ARBA 1ODKA 4AO7A 1SJ9A 2PT7A 1TU3A 4B81A 4BVAA 4BLOA 4OHBA 2XGJA 1B8VA 1LEHA 1FTNA 2PK3A 2R6CA 1CJCA 2C99A 2QRMA 1TF5A 3LFTA 3QK7A 3KXPA 1IU9A 1NMYA 1PBTA 2LIVA 1LF0A 2QZ4A 2XNKA 4IDDA 2Y1CA 5G0UA 1IZ8A 4LPSA 1CPYA 2FRDC 3RS3A 1A2BA 1U7DA 2FFJA 2A6PA 4I5GA 3ZHTA 4AZ0B 2C77A 1YBFA 2G71A 3LT1A 5BMVA 1C1DB 2WD7B 4ISBA 5A4JA 3R5JA 4HNVA 2V3VA 1N3IA 3IBTA 1FFSA 2XRYA 1K7XB 2JG3A 4J6FA 4IMPA 4DUGD 5H4HA 2P90A 4FINA 3CF6R 1GHTA 3PZBA 3Q9UA 3S3TA 1O6GA 5K03A 1FFXA 1DOHA 3D1VA 2QTLA 4KH0A 1CNEA 2VBGA 5E9AA 3RAFC 1Z63A 3MK31 1KJIA 2BC9A 3GX1A 3E22A 2VNSA 4KUEA 4LOLA 4MMZB 3RPEA 3W6UA 3AVQA 3GPLA 3OT4A 1GGMA 3F6EX 5IUKC 1MO5A 1KR2A 1WKVA 1AKMA 5K51A 1XEXB 1L4MA 1NW4A 3T3GA 2K2QB 4NCBA 4FX5A 4ITVA 4IY1A 1N9ZA 1VMDA 5IDQA 1BS1A 1HZZC 3ASYA 1IM2A 3FKJA 3OMLA 3TPCA 3HB5X 4QVKA 4FB5A 3GLGA 4MDEA 2G82A 1ADJA 4LBZA 2FMTA 3DL2A 1W34A 2QYSA 3I9MA 5H83A 2X42A 3RNLA 1SK9A 4P83A 4PYKA 4UUBA 3WGYA 1TT5B 3MCTA 4AVYA 4BLUA 5EAIA 5EP3A 2AB0A 2I1LA 1C7FA 4NPCA 4YMUA 3ZJUA 5CBPB 1UMKA 1KDYA 1U2PA 4L0MA 5CDGA 5EWJB 3O4RA 2FW1A 1GN9A 4QO8A 5LBUA 5LUAA 3ND5A 4LXIA 3RHZA 3UMJA 4Y6GB 5CK5A 1O6FA 2EQ5A 5AW0A 4B80A 4MWEA 1A8IA 2H0AA 2OFWA 4NBRA 4ME6A 5GJWC 4B74A 4G37A 1CQZA 1FXSA 1RQ2A 4ZVNA 2IW1A 2Y6UA 1VLHA 3IB6A 1Y37A 4HDNA 1G21A 3QWHA 3SI7A 1XU4A 1ZUD1 3JQ9C 2PHZA 1W49A 1WV1A 3GLIE 2Q29A 3BWCA 3G8DA 3C16C 3PWTA 5AK6A 1H4TA 1NDQA 1UM9B 1VKOA 5SV2A 3U37A 4CNQA 2QL5A 2VYVA 5SZKB 3TRFA 4F21A 2A0XA 4YUXA 1QF7A 3ZGVA 3ZXSA 3HK2A 3UT5A 2ZTMA 4DB4A 3F7NA 1F4PA 4JEIA 5LPNA 1TNDA 4K81B 3TGPA 4CF5A 5KNDA 1M2OA 3JQ8B 2DQ4A 4MGHA 1WB6A 4AJHA 2A5GA 2I91A 2C5EA 4OHOA 4C7OA 1V5FA 1LDNA 2AFIB 1LC3A 1S7GA 4FMBB 5U4XA 3DDUA 1W36C 1OXUA 3ETGA 3O8QA 1GPWB 1LWNA 3FTNA 3PT9A 4IBOA 3G23A 4Z0TA 1M2NA 1XZHA 3M6LA 4AZSA 4A10A 3SU8A 3KYDB 4TTRA 4JOSA 3R5HA 1A9SA 1HT0A 1DU4A 4P7GA 1EAMA 5CVDA 1AZSC 4ARZA 5EHIA 3IVMA 3IXMA 4ZAVA 2NUAB 1ZGBA 2BV3A 3M9XA 3X1DA 2FPSA 5E4TA 1S2MA 3GBVA 3W1VA 2OO5A 1GCUA 4L27A 3K0BA 4JJZA 5A5EA 4KKVA 2WTEA 5LYJF 4YRJA 1FLVA 2VK1A 3AUUA 3HJUA 4GMFA 4D56A 2AOUB 3HYCA 6PFKA 3VR4D 3K71B 4GBJA 2AR7A 2D2VA 1E0KA 2FW6A 4LOAA 5EHNA 3QU7A 1ETHA 4OQQA 4PX9A 4XD7D 2BHLA 1JAXA 4P5EA 1M5UA 4M8IA 5BWLA 1YE5A 2BWJA 3E2MA 4KOAA 2V74B 3A1FA 1E9VA 1OREA 3L05A 5I7UA 4DV6B 3DPUA 4DGQA 5K2MA 2NUTB 3UANA 4CYMA 3CX4A 3GOHA 3Q7IA 4FILA 2AQHA 2VJKA 5HRAA 4H18A 3OZDA 1FRFS 4CLRA 5A6SA 3E05A 1XEAA 3CVOA 4KO3S 4TL7A 1T2FA 3H3XA 3LNTA 5K3OA 1Z8HA 1BMTA 1U2GA 3NI2A 4I1UA 1SIUA 1T2DA 3ACBA 1H3NA 1YFJA 4RTRA 4AAYA 3EAFA 4BKMA 1CNFA 1S96A 4W1QA 1FNSA 4Q5IA 1AGRA 1EXMA 1F60A 2H51A 1ESMA 2PBFA 2YNMC 3FVWA 4LHEA 3LIPA 4OQPA 1ZX1A 2BUCA 4YP9A 3N2IA 3JZMA 2GTPA 1R6VA 2A8YA 1YZVA 3FCOA 2ZUWA 2RH5A 3P2OA 4AURA 3N8KA 3WICA 4ERXA 5KMGB 4ZCPA 4LSGA 1Q6YA 1JHAA 1D04A 1JI3A 2AYXA 4EIWA 3G7UA 3KSUA 3K30A 2H1CA 2B8NA 1C0IA 2PRYA 2RI0A 4RK0A 4RESA 3RC3A 4DMUB 3FZEA 4E7OA 4ZARA 5EZYA 1FJGB 4C7MA 2HCFA 2VUUA 4UDXX 2VBFA 2ZCUA 2P1DA 3BJMA 3NM4A 2C5SA 2VSXA 1WLYA 4C5CA 8LDHA 1F1JA 3I4FA 1JQJC 3D9QX 5E2BA 5E6UB 2G76A 4QBHA 2GVNA 3AOGA 2GCOB 3I9V6 3PJDA 4UBJA 4C3OB 3X2FA 1QH8B 3AUKA 5TC4A 4LY3A 1H4SA 2VT2A 4HDQB 1YKFA 2VDPB 1ZINA 2C9YA 1R8XA 4RIFA 4C04A 1FP4B 4J1QA 2BEUA 1KI6B 3W2TA 4KVFA 1RWKA 1GTJ1 4FZ3A 2OMEA 5DT2A 3BS4A 3V7WA 1IEVA 1AG9A 4Q4DA 2FR8C 4LXTA 2P3OA 1H1LA 3BG5A 1T0IA 2X0RA 5IM4A 1OW3B 1E0AA 1SAYA 3N05A 3U3MA 2RHWA 3FPLA 2I4RA 3L6RA 2WFLA 2ODEA 5BYAA 2NO5A 2JIPA 4MB2A 2VSOA 4XYBA 2D2XA 2KM1A 1P9WA 1Z0DA 1GLNA 4LJ4A 1Y80A 4V2UA 4EX7A 2C3UA 2JCBA 4QODA 1UMCA 2IDKA 4MKHA 3PDIB 3CUEF 4BGVA 3HMQA 4EHAA 3GLHE 5HJEA 4BJ1A 1YVEI 4KPFC 3NR2A 4RDHA 3HG7A 3L6CA 4L4RA 4LNUA 3I6BA 3LTNC 4JI7B 1GRVA 3FPSA 4YROA 5I7OA 1I3CA 3LQ1A 2C7QA 4M1KA 3QTLA 1L7EA 3H83A 2G08A 3IAHA 5LDDC 4ZAWA 3T3PB 1FTSA 1UBCA 2IJGX 4W6ZA 1ORRA 3NDRA 4E2YA 3KXLA 1SZJG 1YUMA 5D3KA 3WWYA 3HA7A 5T4EA 3QA9A 2CLHB 4Q18A 4K9QA 1XDBA 4M2LA 4LVCA 2FEOA 2AGVA 2HBRA 5JZ9A 1RQ7A 2O2EA 3PSAA 1KFBB 3ED5A 2PCLA 2I78A 3BHJA 2O3JA 4MZDA 4QTZA 1GP2A 4V2IA 4GT1A 2KJQA 4FFMA 1B1AA 1TLTA 4LXGA 1ND5A 1VL6A 2HO4A 2QSUA 4QD3A 2B82A 4MS3A 1EWRA 2J6IA 1DPFA 1KJ8A 3NZEA 3THYA 3AHFA 1K0FA 2WSMA 3U60B 3QNUA 4X97A 1SGWA 1DI0A 5CH5A 4MMXB 2BJHA 1GDDA 3H11B 2K2WA 4WKNA 4RK5A 3HA3A 5AKKA 5K3CA 1WKBA 2ACVA 2B4YA 3PYLA 1L5LA 2OA0A 3GJ4A 3P9QA 3B5EA 3TW0A 3DDSA 2RGRA 1G8FA 2VCHA 4M1WA 4XX0B 3G2QA 2FE4A 3FETA 3SMVA 4BBZA 3QSGA 1XTRA 2R84A 3LUGA 1S8NA 2FVYA 4N6NA 4KSBA 1R74A 3QVGA 3LHSA 4NJOA 4A2CA 1DC6A 1XTBA 2WUVA 1CJUC 2GZ2A 4NDZA 4W9RA 3FOEC 2RSLA 5DNYB 2G9VA 4LMAA 4UMFA 5JYBA 5AT1A 1Z88A 3QSYA 1OIVA 1NZDA 2I3ZA 3ZIAA 4RIGA 1KMHA 1ZIOA 1UL1X 4XEUA 1R0XA 4ZO4A 5ITWA 3RRNA 1C7EA 2AFHA 1TYEB 2A33A 2ZI6A 1O0BA 1XL1A 2DPGA 1F9AA 1B93A 5CCXA 4FU0A 4KDFA 4EATA 1NV8A 4ZZ1A 5HS6A 2VK8A 1E6CA 2VP4A 4YJFA 2VDMB 1YGYA 4MYRA 5J1TB 4YB8A 1VJGA 2FYTA 1R27A 1ZA2A 1KAOA 4LYDA 3OZSA 3U61B 2BP7B 3GFTA 1LBHA 2F3TA 3H9EO 4FPXA 4AG3A 2QI9F 4KAAA 3R0IA 5DHFA 2W6JD 1D2HA 4MW2A 3ZX5A 1JMVA 3TSAA 2YQ4A 3MWEA 1XI2A 1NBEA 4WKPA 3GRAA 4IXDA 4GZ6A 4IL5A 3GPCA 3UY4A 2TRSB 2BPOA 1XBTA 2Y2VA 3L82B 4LXXA 4OMFG 1H2XA 2BIFA 5TF0A 3H16A 1Y5LA 3NWPA 2B1QA 4L0QA 1CV2A 3ZE7A 5JECA 3VPXA 1P2DA 4REQA 3EC7A 4QUBA 1EGAA 3UIEA 4BKQA 1R88A 2AI2A 3VISA 2QNIA 3Q9SA 4G4GA 1IN5A 1UXKA 2WIJA 5JS6A 5L6LB 4GZ3A 4DWVA 4H2DA 1F0KA 3B7GA 1P2TA 3TFQA 3UPDA 4WW0A 3LQKA 2UU9B 3N6XA 4LSMA 5JXWA 3VPCA 1MW9X 1U63A 3HC7A 1TRHA 4JDPA 2QM3A 2RDMA 4KFUA 5A62A 4TTQA 3WL3A 4OQZA 4B3SB 4KMSA 4M9RA 1G2PA 4MHOA 1XZLA 1DC7A 5AHXA 2OHJA 4TRJA 1U1CA 3DBLB 1Q83A 2C88A 1FCJA 3HJHA 4ND3A 1JB1A 4RPKA 1UPCA 2XNHA 3CINA 3ZCXA 1EGVB 1M2GA 1KPIA 2AXNA 3QKIA 3HJAA 2FZVA 3TTWA 3W2GA 3ZWQA 5IJZA 4RZHA 1QP4A 1RXEA 1YRQA 4PO3X 1FE8A 4Q66C 1KFEB 3CGGA 2H3EA 4EMTA 5HOQA 2HPHA 1E9RA 3IV7A 5JWOA 4HWOA 4CI0B 1EAYA 1U0JA 4ZYLA 3LC1O 3VC2A 2MSEB 3IT0A 4D82A 1W96A 1NBME 2DWCA 2VUSA 4I4TA 4CM8A 5BRAA 4M9SA 4J1TA 1O97C 1RZVA 4K8OA 2ZB4A 5CHYA 4YP1A 1ESEA 3BZWA 3M2PA 4RJTA 5B5SA 1PR6A 3OAAA 1W5BA 2BGGA 4BJHB 4NBVA 3DBOB 2JARA 4BJ5A 1CWUA 5I4BA 2WTBA 1J9ZA 1DKUA 4GI7A 3PL1A 5EE1A 2IXGA 2PU5A 2X1LA 2IP1A 5BW4A 1JN0A 1Y6JA 2E89A 2GX6A 2XD4A 1V8PA 2C9DA 2ZQYA 2BMEA 4RS4A 1L4LA 2JAQA 4EG6A 4ND4A 5CFQA 4UMEA 5IULC 5JMTA 2YMQA 4Z0NA 4PG7A 3JU3A 4JI4B 2QUHA 3BGDA 3TZCA 1E7YA 1J0BA 1H05A 3M1YA 3A6JA 1QG6A 1N0UA 2HU8A 4BO8A 3WC4A 1VFNA 5KVQA 2X0NA 4HOYA 4I3FA 4X3OA 5L3QB 1GL6A 1NURA 2AK2A 1OB2A 3WLSA 3J7AC 1IAQA 1G8HA 1A1VA 1E60A 2EFEB 3HKBB 1SEVA 2ASVA 2VTEA 1Z16A 4MKFA 2CDCA 2P68A 1T5OA 3D54D 1M1XB 3DCNA 1C0EA 3ILXA 3AL3A 1RLUA 4OYRA 4PLWA 3R74A 1IIRA 3R7NA 4EPRA 4OXKA 3TOCA 4H7EA 4B3FX 3OE7D 1VCHA 3PUZA 3UGQA 2A57A 2ZWMA 3ADDA 3FJYA 4B6PA 5LXTB 5DM0A 1M0SA 3PI6A 4G36A 1E1CA 1WJGA 4RL4A 5HKKD 2XNDA 3DDOA 2OFFA 5C9ZA 1Y7PA 4YP6A 2FJ0A 4NH0A 1RYNA 3NJRA 3H2HA 5FR2A 5HM6A 1U3TA 2V6GA 4G26A 4PLPA 1C80A 2OAP1 2QS9A 3H75A 1QPGA 2WV9A 3KJHA 2EFGA 2QEQA 3F3KA 5IMBA 4M1OA 1SH7A 3WXMA 4D9CA 4JI2B 3PRYA 1SELA 3JZDA 1SC3A 2Z43A 2IRWA 2NAPA 2FZCA 3G2OA 4UDOA 4DQXA 3PFGA 2ZRBA 3KXDA 2Z57A 4CV0A 3I5MA 1SPXA 3V8NA 3EDCA 4KZPA 3EXG2 2X6TA 3L1UA 2PBLA 5JH7F 1PJQA 1PF7E 3HCDA 4TL9A 2RHHA 1KJ9A 3KT3A 5FLKA 4FE7A 4BGIA 2QPOA 4IDEA 3LIIA 3EFEA 5JXGA 3REQB 4R9NA 3ZGXA 1VP3A 3HP1A 1I6LA 3MPOA 2VJBA 3AR3A 1NOIA 5EJ5A 1JDNA 1M75A 2QVZX 4YRTA 3KYIB 2UYQA 2PCJA 1PL7A 4PPGA 5B7NA 4TYMA 5T3UA 2QD4A 4G9EA 1NJ5A 1KEUA 5IH3A 4DY6A 5ALQA 5HK9A 1KWKA 3QVUA 2FLWA 2V97A 4DJFC 4DLLA 4JROA 3VBEA 1YVRA 1SBQA 1EFVA 3KLBA 3SMQA 4H7IA 1ENYA 4MI9A 2PSHA 2W2VA 3CEJA 2HT6A 1ANKA 3INGA 3O2SB 5TJ9A 2DEUA 1QE5A 3FLAA 4R0VA 5DKFA 1U7TA 2GEJA 3BGSA 4JI8B 1RC0A 2UVPA 3P7MA 4N0EA 1CQIA 2QTAA 3LL7A 1CB7A 5AKXA 4ENWA 4TKLA 2JLWA 2OCKA 2RKBA 1D0SA 2Z2ZA 3GQVA 4Z9BA 3T1QA 2VT7A 2ES4A 4MKGA 5K3FB 3GRFA 3GEIA 3I37X 5JSQA 3CNEA 1P0FA 3B3FA 3RIGA 1N6IA 2QI9C 3A8TA 4PC7A 3KYCB 4F4FA 3O8OB 4F5DA 4IUYA 2X9QA 3U7RA 1JXOA 3Q7SA 2BKLA 4HTFB 1TU4A 4NRDA 4MK4A 3ZG6A 4QEKA 1DKPA 4LVUA 4FIZA 4O0LA 1QONA 3IUSA 3WIBA 1E9DA 4OKIA 3FJOA 1XLTA 1UFOA 5K3EA 1XPOA 2P5UA 5FOWA 2OB1A 3NDJA 3F7MA 3PDWA 3VU1A 5AVOA 4WVFA 1UR5A 4MR7B 2IBMA 2BFMA 4MR9A 4KFCA 4PXAA 1G19A 1JNYA 1NXXA 1G42A 4ROTA 4BMXA 3PRJA 4XIGS 1JXAA 3B6MA 4C4OA 2JKYA 3THSA 5KYXA 2WKWA 4BNJA 2IW3A 4XPIA 2A3RA 4CG3A 1TF2A 3HV2A 3OLQA 3SC2B 2XR1A 3GGCA 2VDOB 4WV3A 3AR2A 3GDOA 4E94A 1G8KA 1W29A 2JFFA 2CFIA 3AWIA 4M76B 1LVGA 2FE1A 4O4JA 5DHQA 5KKAA 3RTEA 4Y18A 5T6MA 1S2GA 3SCZA 4Q3BA 3UPUA 1XVVA 4ZI7A 5F9HA 1OZFA 1NF8A 4BWVA 3MGKA 1P2GA 2C4HA 4PG5A 4D3FA 1P8AA 3PKZA 4IRMA 4G0XA 1K92A 4OL0A 1BKSB 5G0TA 4MRSA 4CQMA 4CTNA 1FZTA 1MABA 2CEAA 2JBAA 5IVHA 4DC9A 4Z7OB 3AR7A 1A4XA 3FW1A 4I4IA 4KWHA 4Q1CA 5K0NA 4W5OA 2PUVA 2SECE 3IJ5A 4MV1A 3RKSA 1Z9BA 1EVIA 4U4AA 2OKCA 4LX8A 2I03A 3I2HA 1SHZA 2H85A 2QIPA 5BO5A 4NU6A 4O1HA 4R51A 2AD5A 4RVGA 2O3RA 3VA7A 4QOIA 2F8TA 2HSDA 4MAFA 5CFOA 4LDZA 2A4KA 4JJ4A 2EJVA 5HZHA 2JLZA 1NU8A 3EASA 3CGWA 4I66A 3T9EA 1KDOA 2KQUA 3O1IC 1T3HA 1IC6A 3PQ3A 4Y1RA 1O8BA 4FIDA 2J85A 3S2EA 3U7JA 4AQDA 2YICA 3UM9A 3DEIA 1I4TD 1P4SA 2IUFA 2VSNA 3OHSX 3EXAA 4WUTA 5K5EA 4JXKA 1TVKA 2JCXA 2NU7A 3JQCA 3FJ1A 5U4QA 2JHAA 3RBVA 4AO8A 1CHNA 4B3GA 3GA5A 1Z8DA 3PFWO 1JDBC 3CW2A 4U02A 3NHKA 3TI7A 4N76A 2AE1A 3IUQA 3CTMA 1Y1QA 1J8VA 2PKRA 1LDGA 4KRGA 4DARA 1VCIA 3CF2A 4WKCA 1Z6TA 5DLEA 3VYSB 3WZ2A 4MPTA 3A3PA 3O8RA 1Y3BE 4HH0A 3U4MA 1I0ZA 1R66A 3TDKA 5K0FA 3L9WA 1Q19A 1JQEA 2JF0A 4EHIA 4WGGA 1OYYA 3E18A 3IAFA 3RYCB 4RK4A 1X3LA 4LE1A 1JSRA 4P4TA 4UFOA 3UXEA 2IQ5A 3ZD9A 1JJAA 1GZDA 1STOA 4LK3A 3FPEA 3NWOA 2V7QA 3OIGA 5JUWA 3FF1A 3A9WA 2ILVA 1U31A 4IZHA 2GNPA 2NVBA 4YJ2B 4MRVA 3I5XA 1E32A 1ZNXA 2DFKB 3C3DA 4UHKA 4M55A 2DU8A 1QP7A 1DG3A 1QFYA 1YHNA 2I4MA 2ZWOA 3K1TA 3GZTB 4P7JA 4DTIA 3EOZA 4EITA 3E9YA 4COKA 3H84A 4M0FA 1X7DA 4XGQA 1CFJA 3BUSA 1QOPB 3ZGYA 2YWGA 1NR1A 4R71A 1HQCA 1U2DC 1SB8A 2YJ4A 3R0JA 4WNAB 3UAVA 5HQ3B 3Q8MA 2P5TB 3IUPA 1OFGA 4KI7A 4HQKA 1RJGA 2AOXA 4R98A 4JLKA 2P2CA 4IO0A 2BKAA 2WTNA 2P3QA 1LW6E 3EN0A 4AY4A 2IODA 2H4HA 1SQGA 5IK2D 4J6EA 2E49A 2M6SA 3TQQA 4HNTA 1GZ4A 2QX6A 3QPDA 5J4VA 4YLGA 1V8ZA 1YVPA 5FPQA 1BDMA 5EMHA 3T7IA 4RH1A 5B3AA 3HVJA 3BMQA 4GX0A 1K9VF 1X2BA 1GUFA 3OTOB 1VRWA 2Z2XA 3S68A 4Z3DA 1YGPA 1WS6A 3KU1A 4MUBA 1RABA 2R48A 3KQSA 2QQFA 4OHCA 4RVSA 3ASUA 3GEBA 4DLZA 1QC5A 1DJNA 2ZXEA 4IKOA 4JNKA 2G5GX 3W2EA 2IA5A 2RHRA 2H3HA 4EFLA 1IVSA 3QX3A 1C29B 1F7UA 3UJDA 5KHAA 2V0GA 2VHYA 1UXJA 1NQTA 3C7KA 3L40A 1FK8A 5CM9C 4Z2YA 3LUAA 4NJMB 1QVRA 5CD9A 2OGUA 3RIHA 3Q9LA 1EWTA 5THKA 2GK7A 3E4CA 2DBYA 2BEWB 3BQ9A 3PQ6A 4GMDA 1P1KA 4JDUA 1N92A 2EL7A 1OBCA 4LHSA 5TMEA 4CG0A 1GGEA 4HNRA 4EW2A 2GCGA 3IXQA 2NADA 4G0UA 5F3WB 1GGVA 5FUYA 4MH0R 1XZMA 2GHQA 2V4ZA 1UQRA 4QFDA 3L7YA 5DCUA 4US2R 2BFDB 2C3MA 4XQCA 5TS2A 1QYRA 4H1UA 1OHHA 2E3JA 3CURA 3M3PA 1T9GS 4RSRA 1O77A 3LRPA 3VJRA 4LVNA 1GM5A 4JBYA 1EFRA 2VWGA 2VP3A 4H31A 1UINA 2JGKA 1WXWA 4EPWA 5ADHA 3L8GA 1Y98A 2BSXA 2O8DB 1HYEA 3TWOA 5EJ6A 4JVOA 2JK1A 5MFZA 1E1YA 1JVNA 2MR6A 3AUJB 4EI8A 3CZRA 2J3KA 3W6PA 2XRMA 3BKWA 4BMCA 4XIJA 1JNXX 3RVKA 1PL6A 1LLDA 1PWZA 4MI3A 4UZEA 4XM2A 4D8UA 5CA0F 3B6EA 1OTHA 3GI1A 1LQTA 2HA5A 5F64A 3EGIA 1PVDA 3T7TA 4PQRA 4F9EA 1KZYC 4PHGA 3NGMA 2IXBA 1L3CA 1ZWLA 4RELA 4GW3A 3MQ4A 3NTXA 2WF5A 4P08A 3BWXA 1NJ2A 4ND8A 4K9DA 4ZI3A 1TA9A 1XZGA 4LQCA 3ACCA 1TIKA 3B3AA 4R9UC 2X58A 3TQHA 2Z08A 4R0NA 3RNOA 5E3HA 2CMFA 3IP8A 4HYQA 2FI1A 5AKHA 3DZDA 1J90A 3QGMA 5IKEA 4NE9A 4ZEWA 1T8SA 1Z06A 2H2FA 3SDSA 4OOEA 4RV9A 2ZQ5A 1Z0AA 1P1JA 2UZ1B 1IDOA 4C0LA 5E6RA 2G88A 2AKAB 3C24A 4FKBA 4PX5A 2N3ZA 1UBLS 1ZHFA 2YHSA 3NJ8A 1ECFA 5HMMA 3VJLA 4DMFA 721PA 2AD1A 3P20A 3D0RA 4K1LA 1YZ3A 1A2KC 2HN9A 2OSBA 2IYYA 4LJSA 4RGBA 4G1FA 3I2FA 3FUTA 1ZCJA 1P60A 4QULA 5FLYA 5COQA 2NV2B 1EUCB 4H1VA 4PQFA 3JD2A 3TE7A 7ABPA 2P9HA 3C4JA 3QUSA 4NR0A 4KJXA 4FDUA 4JN6B 1QU3A 1ZA1A 1ATZA 4NTZA 3SAJA 2NMVA 1AK2A 1JFVA 1OF1A 2FPOA 2WZCA 5ECWA 2ZYRA 3GJ3A 1DV1A 2HEGA 5DO9A 3BXGA 3T3HA 5KYUA 5D7NA 2RK3A 2WZQA 4CG2A 1SU8A 1L1QA 3F3SA 3L4KA 2FG6C 2JH8A 1U02A 2LD4A 1S2OA 2REOA 3F5FA 1GTL1 5FQNA 5EHZA 1T2VA 3QWIA 4ZC8A 1P18A 5EGNA 3OPVA 1NONA 4WA7A 4RKRA 1BCSB 3NBQA 2CHFA 3CS3A 3O91A 4FBLA 5UKDA 4BVGA 2GRJA 3F71A 2AN5A 1PJ8A 1YVDA 3L7IA 3GLRA 3OA0A 3RCBA 3B85A 2GN8A 2KI5A 2Z5GA 1CU1A 1SKAA 4NONA 1H4QA 2VRCA 1QOZA 5FR1A 3IMKA 2P2ZA 4DIMA 5CEJA 2HRDA 3BXHA 3OPNA 1R7RA 1RYBA 4FSHA 5P8WA 3UHJA 2QVGA 2SICE 1IHXA 3I2IA 4GVLA 4RULA 2EQAA 3PC3A 1IJEA 3L8MA 4BIMA 2HC9A 3LVBA 4MGZR 1E4OA 3FDXA 4CR7A 3WDSA 1LUAA 3H2YA 4OK6A 2Y1KA 2M6KA 1EK5A 1SIOA 1ZMTA 2JATA 2XEXA 4HDKA 4I9NA 2GRUA 4NFHA 4O29A 4Q3NA 5AP9A 2MSNA 3QELA 3WQHA 5A4AA 1JS1X 4D8TA 5JW6A 4MCJA 3EZ2A 4OP3A 1POWA 2MYNA 3K5PA 2J6HA 3GFBA 4AB1A 1XEWX 2XBMA 2H1OA 3ZCRA 4G2TA 5AI8A 1AO3A 4DG9A 3TZEA 3I30X 2B20A 1FEZA 2AG0A 2E37A 4XFJA 1ABEA 4RNDB 3ZWYA 2Q5IA 1MFPA 3PDCA 1GGHA 3H5OA 3WTBA 4B2LA 4V1CB 3WRWA 5B30A 1YFLA 3K09C 1QHGA 1YOVA 3DTYA 3FR7A 4I3HA 4ACBA 4BUCA 1VPLA 2W2TA 3KTDA 3D1JA 3DMGA 3ZIDA 5HS4A 2AT1A 2E9SA 2DGDA 4HDAA 1N9GA 5FTLA 3O4VA 4NATA 2ZBFA 2WNHA 4BJ6A 2JLCA 3V4OA 1L5YA 3L8HA 2GZ1A 2QUBA 2G9NA 3ITEA 5B2FA 1NNSA 1FX0B 2QLNA 2Z3ZA 1HYHA 3GAMA 2AEEA 2F6RA 1K27A 1UC8A 3KOWA 4QT0A 4AF6A 2F8SA 4B7ZA 5JANA 3KQWA 1YS9A 2WHRA 2EP5A 1PG2A 2LUOA 2GN0A 3MTDA 5A7HA 3KKPA 3ZGLA 1CRLA 2HMWA 3INRA 3SHOA 4C03A 3SIRA 3KSRA 1T91A 4DJJA 2VJCA 3C3BA 4E6PA 4WE3A 2FEMA 3FH0A 3EGXA 1ZI6A 5BNTA 2ZG6A 1UPFA 4KLZA 1O54A 2HU2A 3BJIC 5JBQA 4CDGA 1G3IA 3Q6IA 5BUZA 2H18A 5M3BA 1PV4A 4XDGA 2D00A 5BOSA 2FX5A 2VI5A 4JL8A 3LKDA 5HQTA 3H42B 2JANA 1TK3A 4RL6A 5AW9A 5JI3E 2VL7A 4L9AA 3G5MA 3FHCB 2GJ9A 1KZ7B 2NQ2C 2Q6IA 3PFIA 2QT1A 4RCYA 4IQ8A 3KT0A 4XH9B 5EEGA 3MXTA 1KDVA 3SK0A 5IJWA 3KX2A 1Z0SA 3P45A 1F51E 4BOYA 4FGUA 2OZEA 1Q1ZA 2QZPA 5IARA 1VXRA 3HJTA 4E5UA 5JDIA 3ILVA 4YMTA 5JASA 3FFTA 2C1EA 4WT7A 4R05A 2B8EA 2J67A 3NKLA 3BH6A 4DR5B 2BBTA 2CUZA 5NLLA 3RUAA 2ZWIA 4ZI2A 3IAS1 3CSUA 1I4OA 1PEYA 2PRJA 1J56A 3HABA 3KQQA 3HP7A 3F9RA 3IBCA 3DMTA 3F47A 3Q8WA 1NDHA 2P4UA 1V41E 2VJPA 3KWLA 1EFUA 3F98A 1A2OA 2X23A 4L8YA 1NUAA 1OY1A 3QA3E 4Q93A 5DXAA 2IT1A 2WWRA 2R8EA 4Y7DA 1D0IA 3OX4A 3L4SO 3RSSA 4P3YA 4UMVA 4QATA 2GFQA 1KOJA 2VJOA 4CM3A 2J0EA 5ALUA 1HDYA 2CVZA 3G8YA 3C1OA 1BN7A 2XCOA 4DSUA 3AF0A 3QHAA 1QP8A 3HEAA 3JARB 5HVNA 3VTAA 2P1ZA 3ZV3A 4OU4A 4CFZA 1IN4A 1P7PA 3OEED 1P1IA 1U5BB 5IF3A 2VAMA 3HCNA 1ISIA 3I2JA 3OPYB 4EWLA 5CU7A 4TYYA 4A0RA 1ORHA 2FX2A 3E7XA 1CZRA 5FH9A 1J1UA 5DM70 4KR3A 3ZOZA 2MSLA 1GILA 1K97A 4RXTA 1W0KA 4LMBA 3FNIA 3N7UA 4UU0A 3O7WA 3H1PA 4Q7JB 2OV2A 3FLMA 3TGWA 4B44A 5BSGA 1D2NA 2P9GA 3RIYA 1LX7A 2JGLA 4N8EA 5JVDB 1KVUA 1N6HA 4Q7KA 1RAAA 1VL2A 1M6EX 3R7AA 1XCMA 5FFNA 3U62A 3AF6A 3MJ4A 1P80A 2CL6X 3JALB 3EGVA 1R4MB 1NT4A 1YVUA 2ZBRA 3I28A 4HLNA 1ZUHA 2Z5VA 3T3IA 3ZVLA 3VVCA 1GPMA 4FE4A 1FQWA 2L18A 3KIPA 4IZOA 4X00A 3RSCA 4KNVA 5JNVA 4MHTA 4PSUA 4J2OA 3QVVA 1RXYA 5EJ8A 4IV0A 3UKOA 1XQ9A 1L1EA 3VGPA 1NVWQ 3FTQA 5AJTA 2OQRA 1NLMA 4AROA 3E9MA 4IV5A 2OCBA 3IVGA 1N2SA 5LU9A 3SQNA 3CR7A 1T43A 2IHUA 1Z38A 1P4GA 4BQIA 4EYOA 3A0RB 5DCLA 3THXB 1ZPDA 3L04A 2PKYX 1NY5A 4ALIA 3LUDA 2GRAA 5G4KA 3ADBA 1NVFA 1RFGE 4RVOA 2G6TA 5ESWA 4AJOA 3KDAA 1E69A 2BTOA 3LOPA 3V6MA 1I4WA 2QD1A 2WSSA 3PUXA 1XG5A 3QU9A 3RODA 3IEVA 1Y4ZA 2HXYA 4RPIA 5IJAA 2XMZA 2OCXA 3LBAA 1P7CA 1T1SA 5FBHA 3CTPA 3V1UA 2ONYA 2Z6UA 3N0XA 1NULA 3BTSA 3H9JA 1MEOA 1QH9A 3BHMA 3JQ7A 4JYPA 1GIAA 2J0UB 4KE6A 4BDTA 4HWTA 1R8YA 4PSVA 4N48A 4BFLA 2LR0A 4MRPA 2VKQA 1MAUA 3M6VA 1CF4A 2BFBB 4FR2A 2D5CA 2XDAA 5TX7A 4TSFD 3SVZA 2Q3LA 2PSSA 4O4HA 1F06A 3H5TA 3OESA 3QEKA 2WI8A 2D0DA 3HKDA 1R0RE 1K5GA 1DTWA 2WDZA 1M2WA 4X0EA 2OYSA 4I9UA 3QJGA 2PD3A 1TCAA 3OQPA 4DCMA 3OQNA 1OAOA 1NXWA 2QR3A 3PS9A 4FOPA 4LS3A 5F5XA 5ERYA 3JYHA 2CEKA 4FHDA 2F48A 4G0WA 3MCWA 3WOHA 1K63A 3GELA 4RHYA 1T1GA 3K8YA 4HL6A 3LC0A 4FFDA 1ZHOA 4I50A 4KE9A 4KO2S 4Y6PA 1VKNA 2GAIA 3EDOA 4N5DA 2XMBA 5BMVF 4CUJA 2AMVA 2EZ8A 1XWIA 3F4LA 2EBWA 2V9CA 4IQ0A 4Q16A 1JH9A 3SKXA 1OX6A 4C2UA 3IMFA 4WWHA 1RXUA 2HMSA 1XVIA 2RAVA 3A1WA 1YB1A 3DVAA 3GLHA 4J0FA 4S1OA 4TVOA 2ZRGA 3NTOA 1GGFA 4FGKA 4D9HA 1T5SA 4CTMA 2J3QA 4UEKA 3VZCA 1R64A 3GBSA 3LCCA 4L08A 3FPKA 4J3JA 4A0GA 3KSAC 1N33B 3JPWA 3S5JA 5BWNA 1MOSA 1ULZA 3TZQA 1NTOA 1NMQA 4KK4A 4LXHA 1Q1GA 4CN9A 1RI5A 1TGYA 4CHGA 1N1MA 3R40A 4B2IA 4R68A 1KJZA 4R7GA 1J24A 1NWHA 1AHPA 2G5PA 2OVBA 3ROGA 3UAWA 3S1SA 1XALA 1Y3CE 5BRNA 2VP5A 1AK1A 2AYYA 4I8XA 2QAJA 3FZNA 1JZQA 2C31A 2XMDA 4LDNA 1MB0A 1ZMOA 3FDJA 2QL7A 1XF1A 1FJ2A 4WKBA 4GBED 1ADCA 1OX4B 3OIFA 1J33A 1DWUA 3M4YA 3DVQX 5ECYA 4L4ZA 4NXMB 2B92A 1E6LA 2EWMA 3A05A 5ERGB 2YMLA 5KTYA 3MCAA 4NBUA 3WGOA 4EFNA 5JDCA 3IO5A 3B5IA 4CM6A 4P8RA 4B3HA 1V3QE 1NXOA 3N58A 3F78A 1REQB 2X2PA 4CV3A 5C52B 5ALFA 2DPXA 4KN6A 2YJGA 5KWJA 1J07A 3T95A 5DB4A 1WNTA 2JAXA 1YRBA 5BMOA 1D4OA 5BW5A 4KXQA 4CKBA 3GT3A 1R16A 5F1YA 3FPHA 5K99A 3NYIA 1K9SA 1HORA 1C9DB 4QOHA 4L5JA 4AY2A 2NZJA 3I8OA 1O6ZA 5EKXA 6NULA 3ITNA 4V39A 1WQ4A 1XAGA 2QM8A 3AFOA 1GCGA 3DJFA 2NZ2A 2JI7A 2VQ3A 5CEEA 1QHNA 1ID8A 4QECA 1P77A 1VTKA 2BMAA 2PIAA 3EPLA 3TAXA 4NULA 2C2OA 1GKYA 1SKMA 1NVTA 3K5IA 1DMRA 1H0RA 2R6FA 1N6OA 4WZBA 2XXJA 4C0KA 3A9VA 4RY8A 1OPXA 3G9XA 2WU0A 4WFQA 3S27A 1GTSA 1LV8A 3OCWA 4RHUA 4ZZ0A 3IOYA 3VR5D 3B2NA 1IYZA 4BE9A 3U19A 2QW0X 1B2RA 3CXUA 3WFJA 1PGJA 4IJQA 3CRZA 5K3AA 5K0JA 3K70B 2VHTA 3JTEA 3UV3A 2XJ4A 1QIFA 2QMOA 2O6HA 3EH1A 3L41A 1FFWA 4ARAA 4YJKA 3R1IA 4MV7A 1IN7A 3GLFB 4BFXA 5IYZB 4AY6A 2AEMA 3R6WA 4P98A 2H2IA 1N2XA 3TOZA 4ZEMA 5B4VA 1QV6A 3FKSA 1RBQA 3ESRA 4CUKA 2QN2A 5AK3A 3H5AA 4K9RA 1LD3A 2WSIA 3PNLA 5MDHA 3EEOA 4DNXA 1QTRA 1Z5PA 3KCNA 3ON5A 5FLEX 1ZKDA 2QMHA 3JS5A 4KGDA 2BR3A 1EESA 2FMIA 1U0FA 3FVVA 3GLUA 5MFPA 5GIOE 2X8JA 1Z68A 2ERXA 4W1PA 5K2OA 1TAUA 1NJFA 1F2UB 1ODCA 3BCSA 3GLQA 3FWHA 1K2WA 3HBAA 4M88A 1ODIA 2SKCA 4I5FA 4A7PA 3SX2A 3T3MB 3PA6A 1WV0A 2EJTA 3V8EA 2HBYA 4OXNA 2FF7A 1L8LA 1RI1A 1D8AA 2X5NA 2R4QA 2B1JA 2WIFA 3O8LA 4NESA 2DE0X 3N75A 4XQ9A 5JFTA 4IUCS 4AKGA 4FNMA 4XASA 5IDVA 1N0WA 2HXGA 1CP2A 2QRVB 2WFZA 3L7DA 4Q9JA 5FF9A 2FUNB 4BFYA 4M0CA 4NS1A 2EJWA 3AEKA 4L2IB 4YI5A 4O4IB 3RROA 2JIZD 4X7MA 3ZXXA 4C0HA 2DB3A 2GPWA 4B4DA 2O20A 3ICVA 4TX1A 4JJFA 5JAHA 4CEIB 2GK6A 1NBMA 3KAQA 2CD9A 4BNYA 4NAVA 2J3JA 5CB6A 2O8NA 3DT6A 5H68A 5AJWA 2YWBA 3TJRA 3GQBA 1GPLA 4FHCA 3J81A 3E5MA 4M99A 4B6EA 3KB8A 3JX9A 2JJ8A 3D4BA 4MEAA 4UBIA 2RGCA 3P9NA 3F7OA 1R2QA 1AV6A 3EGDB 2BEVA 3SIXA 2BHTA 2Q28A 1BC5A 4JLBA 3HUEA 2DLCX 1QUFA 5CFLA 4OXIA 2FR0A 4PLHA 1ULAA 1HOXA 5KAPA 4DLXA 1EP1B 1UXHA 5BSMA 3FROA 5D5HA 4MUNA 1X7XB 1P8JA 5A0FA 5BSRA 3A1UA 3RD5A 3WL6A 5FDFA 1QYIA 4GGMX 1FF9A 1DG9A 4KOEC 3I05A 4HXYA 1R1DA 4BNDB 3KOYA 3L8ZA 1TYBE 4NENA 1WZIA 5B58C 5IM4F 1JEYA 1YUBA 4HMPA 3DH0A 2CE7A 1UK7A 2NU9A 2HMVA 2I2DA 3DV9A 4X1IA 3VDMA 2ABWA 3QBJA 1Y1RA 4KIFA 4RV5A 1L6RA 5IAKA 3RS2A 1WXEA 1BDBA 5C34B 4FXOA 4XJTA 1M0TA 2NU8A 4W7SA 1EX1A 1L5OA 2FRVA 3ZWDA 1C3OA 3LUBA 3ND9A 3QEMB 2AK3A 1HFWA 3UMSA 3Q15C 2H2HA 2J48A 2BGIA 3ILSA 3OCZA 3KB2A 4TMYA 4X8MA 621PA 2HD4A 3S4YA 4Q3AA 3C6XA 3BCUA 3H1GA 2JI8A 4QGAA 4TTJA 3T9BA 1J7KA 4B31A 4E5PA 2PKQO 4M37A 5A4FS 3VTZA 3ZOKA 3N2KB 4FFLA 3MMZA 2Z4SA 4Q4HA 3O9ZA 4BLRA 4ETWA 2YIJA 1I5RA 1GSOA 2AH5A 1VMEA 2YS6A 1PNVA 4UATA 1PLJA 4CKXA 4MYCA 1N6RA 4OIFA 3DD5A 1GPBA 2VWHA 1XVAA 3IQWA 3KHUA 3STXA 3T4XA 4JA0A 5E1BA 1PRYA 3OE4A 1P19A 3C70A 4Q9AA 1AIPA 1AZLA 5EIEA 4XFKA 4KWEA 2VT3A 2XLBA 3AEZA 3AV0B 5DTQA 1C9MA 2P7IA 3ICCA 2Z0MA 4J0IA 4KQFA 4GLBA 4EG7A 5J47A 3GP8A 1G4AE 4HD8A 1G64A 1RWBA 4WNIA 4D4IA 3LFHA 3VQTA 4WEQA 3H0CA 3QYFA 2NT4A 1TGVA 2R1TB 3OCUA 1EDDA 1VYUA 3BD8A 4FZRA 1XTUA 4G0NA 1M5TA 3DMNA 1NNEA 4TWAA 2WIDA 4I1PA 3JYQA 4XDYA 1K5PA 3FYTA 1GL3A 2FSUA 4KXFB 4YJ3B 4Z8XA 5KQGA 1D6JA 2WPDA 4U6QA 1T1JA 1PUIA 2CXQA 3DTVA 4YNBA 4D81A 3H6HA 3K20A 1ZK2A 3I58A 2RHLA 4G5RA 5LOVA 4J0HA 3RADC 3TH5A 3CBQA 4C0WA 2IP2A 4FMCF 1ZCFA 4LYHA 1VPVA 4PFJA 3USES 2KE5A 1XD9A 4QBIA 3RTBA 3VPSA 3DE3X 4LY6A 4YRAA 3SC3A 1GZ3A 1R9JA 3PPWA 4BO9A 4E08A 4F71A 2V6JA 2IS6A 1R10A 4MUFA 3WI7A 4Y3UA 2IIVA 3BIOA 1TX4B 1E94E 3T54A 3BFVA 4YQFA 4EY7A 4WEOA 2AR9A 2X0JA 3GLKA 4LK2A 2ZTVA 3RARA 1XSEA 3ZKWA 4BKOA 1X1QA 3HFGA 1E89A 1RJWA 3EK2A 4DQVA 2PWZA 2E2WA 2F3UA 2H65A 5CT9A 4DC1A 1BTOA 2WT4A 2X3YA 4YASA 4E14A 3L1VA 1E3QA 4XQEA 4QTYA 3DZCA 3G1WA 1ZRNA 3ONNA 4CR6A 2R6HA 2TMYA 2HQRA 3SE0A 3QUAA 2Y1OA 5G3YA 3FAZA 1I4EB 2IKSA 1ORIA 4M7WA 1EDBA 4K6KA 4KIUA 4C1NA 2B7CA 4L9WA 4ARUA 2VC2B 4RA6B 1BOFA 3O1HB 5HPYB 3FDIA 1E1QD 3C1UA 4P82A 4RKFA 5I01A 2WWHA 1KDPA 1WETA 4MV3A 3FB4A 3ZS8A 1KO5A 4I14A 1EBBA 2Q0SA 1USWA 2HKIA 2ZJ0A 3K31A 3W1EA 3W9BA 2EKLA 3UAGA 4LVOA 1U2GC 2YV2A 2I2AA 3QFTA 1XFAA 4ZA2A 3R8XA 4MVWA 4G63A 3RG8A 5H81A 1WULS 5CM2Z 2I2BA 4MR8B 2J32A 4XM1A 1ZSNA 2D0OB 2XGGA 2IV2X 2C83A 1GPUA 3VDXA 4QFBA 1CVLA 3ESBA 4QPNA 1VE6A 1YA8A 3GLVA 1K6MA 3ZU6A 5B6IA 1Z4IA 3SZGA 1GYPA 3H1TA 1AN9A 2XCSB 3ND8A 4KODA 3N5CA 2FUG6 1LSJA 1FYEA 3CBGA 5JARA 3Q2OA 2JHCA 1UMDA 3CW8X 5EERA 2Z5LA 1H9CA 1XR3A 1MTOA 4I81A 2DKFA 2CLMB 4PSCA 2B4RO 3C48A 1JLMA 2C4TA 2BRUA 1VHJA 4I3GA 3TD2A 5LZ8A 5K6TA 4CT4B 1KI2A 4YMSA 4LXQA 4JYZA 2D7JA 3OOSA 3SJBA 3EXEB 1N6PA 2CK3A 1PWXA 2GJSA 2WUEA 5CDHA 4PYMA 1QUEA 4I4TF 4JQCA 8ADHA 2ZAOA 3O0TA 2IYXA 3L8YA 2MYUA 3ELUA 2I5PO 2LWIA 4P58A 4RD3A 5KWVA 5EFZA 4YRLA 2IBSA 2OHXA 1U94A 4REOA 4UTOA 4TV8B 5TRTA 1KC3A 4FDMA 5CXSA 3AY0A 1B16A 1L7DA 2ATXA 3V00A 4O2AA 2QTMA 3OTHA 1QF9A 3MWGA 4IMJB 4JQSA 2YJZA 3P4UA 4BFTA 4GSLA 4UJ3A 1UAGA 3OZTA 1GKLA 3MWDA 4RV4A 4YBRA 5B6JA 3NFRA 3EIWA 1UPAA 2M1ZA 2R6JA 1PE0A 4TKZA 4DTCA 4W5TA 1K68A 1NW7A 5K3SA 2O9JA 3FPCA 2VK2A 1B6RA 3MTBA 1H8HD 2EBFX 2VDWA 4MX8A 1Y9AA 2BFEB 2GF0A 3OCXA 4P33A 4UAUA 2DUJA 2QPAA 3WRYA 2O0MA 4CCYA 3IERA 1YR9A 5DX1A 1OE0A 3K70D 3VNRA 4DCVA 4TMFA 5EG5A 4LCEA 3ZHBA 1D1PA 4EH1A 1TKRA 5IDWA 3M3DA 3AB8A 5AKLA 4BS9A 1X70A 2E5FA 5C3UA 3AFNA 4BVHA 1DBPA 2JEYA 3EXIA 2FP4A 4FHFA 2V5UA 1J6UA 3F3MA 4DLBA 4JEMA 5INTA 5K9ZA 2QRPA 3AXSA 5DYNA 2Y0PA 3DW1X 1FSGA 1VI5A 3RQIA 5TS3A 2O2GA 1Z5ZA 2OG1A 3MERA 1HLFA 2O1EA 3OF2A 4LBYA 1VGVA 3K9BA 3F1KA 2AF3C 1D4FA 2ZROA 3NQ41 3Q7QA 4LHVA 4P3KA 3KELA 3B9PA 2JH9A 2EDCA 5KSOA 5F2KA 3TZ6A 2PMFA 3IB3A 1WP4A 2YXLA 2BGWA 5JY1A 1XCJA 3WV4A 1HMPA 1M1ZA 2RAUA 3KP1A 2QGZA 3T7AA 2W6CX 3UC9A 2XY4A 1PKXA 5BN4B 4BX9A 5CX4A 2QXYA 4CDMA 3R0XA 3SG0A 4AZ3A 4AMGA 2B30A 3N8GA 1JFLA 5CT8A 1G3UA 3A1TA 3BH7A 3AC0A 5A3VA 1EFAA 3QOYA 4L28A 1FYVA 1Q57A 1ZITA 1UKBA 2O59A 1NI4B 1UBTS 4MPPA 1HA3A 2XDQB 2CZCA 3HPRA 3CEMA 4IDOA 3QM1A 2FB9A 3P2KA 5BXYA 2JHPA 4FMPA 3P9CA 3DCYA 4B8YA 4Y2RA 1YE8A 1J06A 3I32A 4BYGA 2X5OA 3NHBA 1VIDA 2ZT5A 5AKIA 2QGFA 4PWZA 1PD1A 3SVTA 2VCEA 5EZSA 1R0CA 3JRWA 3QVXA 1WMEA 3K2BA 4YEDA 4CKZA 5KYNA 1DDOA 2FMKA 3A1SA 5K8LA 3EEYA 4GP9A 4KR7A 4XCXA 10MHA 3HKCB 3RSGA 4ID9A 2AL7A 4NMXB 1ECCA 1RMYA 2AG6A 1CEQA 1PR0A 3V97A 2JB9A 2UUOA 2EIXA 2VQFB 5F52A 2YC4C 5TGTA 4Q3LA 4KR0A 4ARBA 3ZIUA 3DE5X 4EI2A 3DWIA 1XZAA 4F4UA 2ZR9A 5D5PA 4XR4A 3WQQA 3RREA 3L9XA 5A05A 2C03A 2ZT6A 4I1OA 1ULBA 4Z3KA 1D09A 3R44A 2Q3DA 5EIWA 1TEZA 4JENA 2XZDA 3NDPA 1SOWA 4FZ5A 4ITUA 1YR2A 4NJEB 4KX3A 1K3FA 4MCIA 3L7LA 5IUNC 5FJJA 5I9MA 5BQ5A 4BCDA 3MCUA 4IH1A 1QIDA 2PJUA 3L8CA 3HY3A 3MJHA 1TD1A 3QP9A 3TIGA 4GOJA 1PK7A 3A3KA 4GRAA 5FNVA 3E0XA 2I7XA 4INOA 2XD9A 3JAWB 3M6XA 4BX0A 2IIPA 1A72A 3LBIA 3FIJA 1E6EA 3JRNA 4NBKA 1WPGA 1U8CB 2RARA 3NHAA 1OAAA 4N4AA 3U1TA 4F72A 2K7FA 2UV8A 9LDTA 4TYWA 2H5JA 3PR1A 3ZHYA 4RGVA 4CM4B 2R62A 5JXJA 4H3VA 2OAEA 4EB6B 1VJ1A 5BYKA 4L7VA 1X3SA 5ALRA 3CVXA 3Q1KA 1XPUA 3AYXB 1SQ5A 4M7RA 1X7ZA 1GVHA 2F2TA 2JFOA 1AZTA 2ON6A 3JYPA 1C4XA 3DUWA 2XVMA 1NNUA 2DMRA 5LFAA 4KUGA 1LLQA 4DJDC 1V9LA 2DF8A 5AD1A 4JNCA 4LF9B 2HCRA 3F6SA 1A9XA 5I7EA 2A2ZA 2HUPA 3IT1A 4B9EA 5AUPB 3FPFA 5K8JB 2OXRA 2QPLA 4O4JF 4N7JA 3Q7RA 2R3SA 2ZBUA 4XTCS 2MIIA 1SB9A 4BBPA 4ZI7F 5J4YA 2Z1MA 4R1PA 1XZJA 4GOMD 4IQ4A 2QUJA 3LDAA 3A06A 1SKQA 3KUKA 4N7MA 4RW0A 5ICCA 5JAIA 2J9XB 2JCYA 8ATCA 3D8NA 4TN1A 3MD9A 1D3AA 5FI3A 4TKUA 1IJKA 5EJMA 4EP1A 3KOXA 1OBOA 3WB9A 4DUGA 4F38A 4M22A 3QHPA 2IX9A 4J1TC 2O8CA 2FFRA 2WHYA 4EAQA 1MX5A 3VSEA 3OZCA 3LP6A 3ONDA 3A31A 2GO1A 1XC7A 2XB9A 2YJNA 3TFOA 1FY2A 1KKMA 1C50A 1FUIA 4KB5A 4HXEB 1MVLA 3ROPA 1LNZA 1E62A 3QWBA 2I34A 3PQ4A 3WWCA 4W1RA 2CJXA 2K4MA 3CLVA 4FCCA 4Q4AB 5IFKA 4IIJA 4DCTA 3TIIA 5HK8A 5M04A 2PKWA 1NVXQ 2AC4A 3S8YA 3H13A 5AKYA 3QMMA 1EZ4A 3C2QA 3WK6A 1P5RA 2HLPA 4Q6WA 4JU8A 5E3JA 5DM60 1Y5RA 5A5GA 2Q07A 3L1KA 1XX6A 2DT8A 3BILA 4LXUA 5LP6A 3RS9A 3CVVA 5B36A 1DAIA 5BVGA 2FHSA 4MJ7A 4HFNA 5JU6A 1XFDA 4D6YA 8GPBA 1ZESA 2AMFA 2YVKA 3D8SA 4U0JA 5D51S 3L79A 1PQWA 3Q9NA 5B53A 1WB9A 4K3UA 1JDJA 1WXQA 4KFSA 3K9HA 1RPTA 1KP3A 1W5EA 1V9CA 2CVFA 2NUBA 3GUHA 4KWTA 1L5GB 4Z99A 3VO9A 3RBZA 4P84A 2ZDGA 5KYYA 3QF4A 1SCDA 1RCUA 3G7NA 3LC2O 3LBNA 1BCRB 4R2KA 4QAJA 3V2GA 1RZUA 1H0SA 4YAGA 1I0IA 4DLSA 2A0YA 3WA7A 4I5DA 2CFTA 4ZU1X 2W2NA 3FGNA 1NN0A 2BHRA 3EFHA 2Q3FA 2OG2A 4IEEA 2PR7A 2IYPA 4IQFA 4MUHA 4ZZIA 3BL6A 2ZSAA 4ZWNA 2XYGA 1EGQA 3VUEA 1L7NA 4D45A 4E31A 2GHIA 4AZVA 4GIBA 2O1SA 4RETA 5TQJA 2ID7A 2ZJ5A 3IC5A 3IP1A 3GXBA 1F8YA 2QNBA 2ZVPX 2AQIA 1L5ZA 4YPFA 3RDPA 3HN2A 3RHTA 4ZJUA 1IXZA 4C7KA 5KOHA 2CVOA 4WOBA 5AICA 2E7ZA 4YCJA 1EEXB 2X15A 3ID6C 4F4JA 1QK3A 3A6ZA 1Q0TA 4C4ZA 2XMQA 1BJKA 4QOSA 4B6FA 3OU2A 2G9ZA 1K8QA 1H1DA 1T5HX 2Z56A 1PQYA 1UUFA 5FUBA 1I94B 4UKDA 4JI6B 3V8MA 1Q3KA 3R5SA 1WE2A 3N2GA 1GUZA 3I9OA 3MT0A 4W5QA 1YASA 2ZOSA 1Z75A 1ZN2A 2ZIZA 1VECA 2GZSA 2QG9A 3AP2A 3L8FA 1YZFA 4KGXA 5H16A 3T34A 3VR4A 2OENG 5L51A 2X0KA 3C5WP 3I01M 4F3TA 1C0LA 3AEYA 4L5BA 4ZDWA 1MGOA 5F51A 5AUQA 2H5EA 3DXYA 5BORA 3WYGA 2OHVA 4IXMA 2QDKA 1BDIA 5DM1A 4FGWA 3U4IA 3SVLA 1N5DA 1ODLA 1G2OA 1GPH1 2GPAA 5DGDA 4AZTA 1FNNA 4CVNA 5GINE 1CRPA 1DAFA 4OAPA 3UOWA 3HNOA 1W75A 1IHYA 2G1AA 4WLEA 2OHHA 2CXUA 4TTVA 4EJ6A 3KKNA 2NPIA 3ZDCA 3AUTA 3O92A 3UJ9A 1A8HA 4X85A 4EMUA 4DVGA 3HU1A 4TYNA 3DM9B 5E4YA 4BNTA 3ASZA 1MORA 1YH3A 2R1VB 4V0OA 5TPZD 3L6EA 2J6BA 3RLFA 4OQFA 2PTHA 4Y6LA 3ZZTA 4BCCA 1EJBA 1ENPA 3OEHA 4IUBS 3ZNOA 1D0VA 1NUSA 3UK7A 3SZ3A 1CE8A 1Q12A 5JAMA 3GEDA 2VG8A 4MS1B 2JZCA 1YCDA 2C5AA 5MGBA 2BFCA 1JTFA 1XLWA 1NN5A 3DE2X 2YWHA 3TB4A 1XLTC 1G8GA 1JRLA 4HLUA 1TC1A 2QR5A 2XVZA 2ZSFA 4M0MA 4NNJA 5E1OA 4B3BA 1NI5A 1QFXA 3CXRA 1PLKA 1RBMA 1XJWA 2Q3CA 1Q11A 2V3WA 1FFBA 2BE7A 3AVWA 4IIDA 4LAFA 1CUWA 3KAKA 4QXRA 3VKWA 2Q7XA 4L07A 4GE3A 2VJYA 2R4UA 5H80A 2GZRA 1HDZA 1AGPA 1S9DA 3ZHUA 3OPMA 4RQTA 2N0SA 2VNKA 2AZDA 2IF2A 1H2EA 4DWOA 3WLEA 2F67A 5COBA 1DX4A 1ZHHA 5L3ZA 2OZVA 3AK4A 4Z7NB 4KZKA 1O0SA 1XNJA 3LI2A 3IHTA 3V6LA 2WMOB 5KCZA 2WJHA 3W5SA 1J23A 4D0SA 5EI5A 1J70A 3LJKA 4BNNA 2LIPA 4HAUA 2BF4A 4TSRA 1BE6A 3NTUA 3BQNB 5KHLB 4NPHA 4Y9TA 4ON9A 1WUTA 4OK3A 1KQ3A 2H08A 3T5TA 4CKWB 3I8XA 1Z2OX 5BSWA 1BGWA 1MZVA 3LBFA 3OQJA 4C4TA 2PYDA 3QKSB 4ZQEA 4O1MA 1L4UA 3SM9A 4F4CA 1W93A 1NG1A 2J4DA 5KYGA 4OMDA 1KY2A 2VRNA 3DYBA 1KMIY 2ST1A 5AVRA 2P5SA 1CY8A 3G0BA 2FPKA 1P3Y1 3PB3A 4RU1A 4Y9SA 2JDID 3V8VA 2GERA 1CDZA 2H63A 4WINA 5HDBB 3HA2A 3VC3A 1RW4A 1VLJA 5E9JA 1QYCA 3WK9A 4K46A 1KE2A 1N1GA 4FLEA 4C7JA 1TTTA 1A77A 4Q3EA 1P0QA 3CHYA 1YMUA 2DWOA 4M9UA 4ZT6A 4G1UC 4ZYYA 1GCAA 1XTIA 2GQ0A 2P2LA 1N5IA 3GFPA 5EMNA 2GM3A 4ZKEA 5LU8A 1UT8A 1ZISA 2G3YA 5HW0A 2DHDA 2TYSB 3JATB 3P1JA 3KQYA 4FP9A 4HFJA 3GCXA 4DDMA 4K1XA 4ND7A 2A0WA 4K40A 3N07A 2PLFA 5EZ6B 2DUNA 2BM9A 3RUDA 4TXHA 5L6MB 1NRXA 5FTJA 4UZSA 5L45A 3ZVMA 1FVXA 1KAMA 1NYRA 1L7XA 2JD0A 2I6TA 2OL4A 2WJ4A 2W6ID 4G25A 4JLOA 2HJWA 4IJUA 1OU0A 5D6NA 1AQNA 2BCEA 1FP1D 2QQ0A 4NMHA 5AXAA 3NLLA 4K9MA 5E7QA 2VFAA 4OSOA 5AKZA 5K8TA 2CNWD 1XKTA 4H0CA 2BR4A 3BHNA 4FWIB 5AVYA 3FNBA 1Z2AA 4E32A 2NSJA 4WBXC 1BE8A 3UA3A 2VAXA 1S0UA 1PT5A 3O3OB 5CX1B 5KKNB 4L5YA 1DO8A 1II0A 1UDXA 2EERA 2AS0A 4QYXA 3ZJVA 3NVKI 1E2KA 1Z5WA 1UEJA 3CN7A 1CJVC 1W47A 1ZCBA 2GB4A 2Y0DA 4CU2A 3QE2A 1GTVA 1VG9B 3BSWA 4IZ6A 4UUQA 3LUFA 3OM1A 1F3LA 1RYHA 3HXPA 3UICA 2ZUVA 4BP1A 1QM5A 4TVBA 2BMFA 1UXGA 2H1IA 2PYZA 2WHEA 4G5HA 1B23P 1GPJA 4RE5A 1U2RA 1Z17A 3QMPA 4DDKA 1NN1A 3WBFA 3LLCA 3QLEA 3NH6A 2V7BA 3CWQA 4TM8A 4U3JB 5DEIA 3WL8A 3ZLVA 3HGQA 1NPDA 1RKQA 3UUFA 1U2ZA 3V7UA 5KX5B 1DRKA 3AVUA 2XNCA 3GEEA 3LG2A 3HJRA 1ZU4A 2RI6A 5LBIA 4IHJB 2BW0A 1B7GO 2IXDA 2Z6VA 3SHQA 5JS2A 5LQCA 4ER3A 3HDQA 5B1YA 1SVLA 4EZBA 1LF5A 1L7VC 2GD2A 2DTDA 2YXBA 5AI9A 2HSGA 1Z5UA 3NT4A 3GP5A 3VR2D 4AZ0A 2DP4E 3ZWNA 1C1DA 1OSNA 2WD7A 3I6YA 3KSMA 2JLUA 2FN7A 3MAJA 1WB4A 2ZWAA 1XDWA 2HY7A 4U8HA 2FWNA 1IBSA 2Q5HA 4K9LA 3VPFA 3JQDA 4M7PA 3VR0A 4YP7A 4X63A 3SZOA 1C14A 2GVZC 4ND2A 1PU2A 1R8QA 2OYRA 4NC9A 4RFSA 3L0YA 1E2QA 3I6MA 1EWVA 4GDMA 4IXTA 4XOIA 2AZTA 1NXVA 1K7SN 2WOJA 5BT8A 7AT1A 2FPXA 3NHWA 4WX2B 2XF2A 3AG5A 1M34B 3DW3X 2B0CA 4IIHA 1U7ZA 1EVLA 2HREA 4ZVUA 4DLWA 3VZSA 2NO0A 1YRLA 1IEXA 1LFDB 4TV9A 1LZKA 1KXJA 2KSQA 4XTRA 5HILA 4HJRA 1R37A 4O2LA 1CUJA 1XEXA 2Z58A 2PU7A 2IK8A 2GK3A 3PCRB 4PBRA 2VH2A 2DUMA 2PFKA 3IQGX 4BLSA 2VHQA 1LC0A 2ADFA 3GUUA 5KOJB 2HB6A 2E18A 3HU3A 3LRTA 1KSFX 4GMKA 4R2HA 4TWBA 4WK4B 4BQSA 1FSPA 1Q0HA 3GIDA 3DE6X 3PG5A 3WHLA 3ZHQA 2NTYC 5JSZA 3FNEA 1TT5A 2D7CA 1CRZA 2PPLA 1O95C 4DJTA 5LC1A 4ER6A 4ALLA 5EXXA 4FK8A 4OI4A 2V58A 5JD3A 5LN1A 5LD2C 5CBPA 2OD2A 4O4LB 1V8BA 1JHZA 1L4KA 3D4OA 1QS0B 5FCDA 2IL1A 2DCUA 2WHPA 1TJ5A 3BWBA 3SQDA 4BKRA 5TSDA 4IH4A 1FBNA 4L8FA 4YJHB 5CLHA 3TLKA 4B9AA 4AMBA 3BL8A 3UPTA 4AMZA 1JG7A 4BLWA 3BIXA 2K6GA 4UTXA 1LB1B 4YRZA 5FPHA 2DFTA 1NMZA 1V7ZA 1W9MA 4ECEA 1UDRA 3RS5A 1PFUA 4DOMA 4A0FA 2VJNA 1UM9A 3RFFA 2Q3JA 4DKXA 1UBRS 3K8ZA 2DYKA 4DZTA 1ZVJA 3I72A 1COWD 2PSEA 2PA3A 121PA 1C8KA 4DQKA 4YX9A 3JWGA 2XEDA 2VZEA 2ZS7A 3EUFA 2VZ0A 3FMOB 3JQ8A 4K9OA 2QJFA 3VKFA 3ZJ5A 1C9YA 2OILA 4AX4A 4E3WA 2ISCA 2AFIA 3D6NB 2ZETA 3LQQA 3LYUA 2XB2A 2YVUA 3UMCA 3GJ8A 5EIOA 1O5IA 2H5LA 3KLMX 4JIMA 4M36A 1ZOSA 1WD5A 3O9VA 2CMKA 3ZWVA 5LJIA 4EVSA 3KYDA 4DHEA 3U09A 2D8AA 4L50A 3G5AA 2CXSA 2WK1A 1TKCA 2W37A 1SN7A 2NUAA 5AXBA 1PZMA 2R97A 1IN6A 3DT8A 4RIIA 5GONA 2NSDA 1MJNA 2PS0A 2HWUA 2W48A 3BD6A 3EAGA 1XTPA 3Q5DA 3QKRB 3R2JA 4JUBA 1I6MA 2GKSA 5HCNA 4BKUA 1XNGA 3TZHA 3T7CA 1N75A 1NQXA 1OYOA 1S5PA 1Z3IX 2PO7A 4WLVA 3PXGA 2JBHA 4ZU6X 5JEEA 2XTAA 5JWHA 2GXSA 1U5AA 3FRIA 1TRKA 1X8LA 1ZD4A 1CC1S 4HDMB 3OE7A 4UVHA 1H6DA 5JE8A 2TMKA 5F21A 1NL3A 5B57C 5IH7A 1PFKA 2Z8ZA 2CBZA 3SHFA 3U9LA 4FGLA 1UBJS 2WSLA 5DEOA 3L0OA 1UJ4A 5GQSA 1HE4A 5H5JA 3DR3A 4KYVA 4WOJA 5HKKA 2QRKA 2CUNA 3PQEA 1O08A 3H8VA 2ETXA 4OSPA 2PVPA 2NUTA 1PZEA 3HBLA 3T12A 2V55B 3G59A 4MINA 1O9GA 4KPYA 1U3CA 1KHTA 2VJLA 3EIEA 3H05A 3FYSA 3I01A 1NC1A 1Y4AE 3MJSA 1SM4A 4M46A 4QFCA 5JNLA 4YTEA 4CIWA 1VA4A 1V2HE 2FG5A 5CTAA 1Z8NA 3A1DA 3ER9A 3DXFA 4OLJA 1E99A 3UJNA 3UMRA 2HHLA 4JK3A 4W5WA 4L02A 4KTVE 1X13A 2ZZMA 2G9RA 1NJ8A 4PO8A 4BVEA 4CL0A 1C8BA 2JAHA 1I7LA 3M6UA 4X64B 5DASA 3LECA 1DOAA 3DMHA 4O4HF 5CG2A 2HF8A 3R5KA 4S0XA 1BRMA 2GA9A 2Q4RA 3KYJB 2Q2WA 2DJIA 4NZOA 1KPHA 1M6HA 2FWRA 5F1PA 3TKLA 1HE5A 5I4CA 1RXCA 2QVXX 1HEUA 3FHOA 2WWVD 5L3SA 2XKKA 1C1XB 4JXJA 2ZANA 1ACLA 4FLFA 1QSGA 1ZC3A 2R7AA 3OQ1A 3GHYA 4MJXA 4ZT3A 1EM6A 1BQ4A 2PX2A 4C14A 4B82A 4ZGBA 4G81A 1SG0A 5E6UA 3JR7A 2P2NA 2FETA 1J0XO 3LO5A 3ECSA 4GPTA 4I50F 3O7MA 2A7QA 4IJWA 1QIMA 2OP1A 4D97A 1FP4A 1KRXA 1QK4A 1KI6A 4DABA 4YRKA 3SX0A 4H7DA 3T99A 2ZWVA 4F7WA 5EKSA 1M0EA 2PRZA 2UUBB 3W9UA 1WBJB 3D8BA 4L9RA 4CZ2A 4N5IX 1HL3A 1KMCA 1RYYA 2G72A 3MWJA 2ATCA 2BFWA 3A1EA 3P9IA 2PXXA 2XQFA 1KBQA 5DDIP 1ZZEA 5AM0A 5HCUA 3PHJA 2BJVA 2NYRA 1KY4A 3B6ZA 4E13A 1OZGA 2GZDA 3GG2A 3ABOB 3NYRA 3P9KA 3UCXA 4B3IA 4S1TA 4BGDA 3OT5A 5KQLA 2RGGA 3DF9A 4WN9B 2LW7A 4O2BA 4Q3KA 4BBJA 4MVJG 1EFHA 3F6RA 5F98A 4HAZA 5AVSA 1N2JA 3DVLA 1PHPA 4PHFA 2RB5A 2D5IA 2Y1GA 3DMFA 4GHWA 3RASA 3IT2A 5BVHB 4BQNA 3L4JA 3MB8A 5CLFA 3HDYA 2L19A 3WHKA 1QBGA 3EZFA 3ZZ1A 3LO8A 5EKDA 5FFMA 3B78A 5JDIC 1DRUA 1A7AA 3RS7A 4H6WA 4I99A 4UBLA 1W2HA 1UWCA 2F1OA 2J5XA 3K8OE 2ZTLA 3LAWA 2XCLA 5L3RA 2GAAA 3PU6A 3DQZA 3V34A 1UZLA 2YYSA 3PUVA 3DMTC 3PQ8A 1C41A 2O5VA 2GBIA 1YJXA 2IYRA 3Q88A 3FYCA 3RWBA 4D5EA 3E1KA 4BC0A 1U8UA 2RAPA 1YR8A 5THQA 1JR3D 1X94A 2J4FA 1O57A 3CB4A 4GPBA 4MIEA 2R7NA 4V3CA 4XW2A 5FP0A 5JAZA 4M60A 2Q0HA 2BY4A 4WXMA 3U40A 1DHTA 1KXZA 1SCBA 3PRKE 3S2GA 2KB0A 3WJ2A 4AMUA 1BOOA 4C6HA 1KAHA 5FOUA 4HMQA 3KB6A 3H11A 4RMGA 3D7MA 2OT3B 4RIEA 3VX3A 2DFNA 3GCZA 2HRRA 1Z0ZA 2HRBA 3NEJA 1NX6A 2DLNA 3SLGA 1HBJA 4QHSA 1WX1A 1C4OA 2KLHA 1JIJA 2WA2A 3O26A 3WGHA 4XX0A 4WBSA 5CB4B 5H8WA 4M1YA 1SBZA 3T1YB 5KTKA 2BKEA 2RI1A 3AR9A 1EG7A 4RFLA 5FBLB 1RAEA 4PZEA 7REQB 3EXFB 4F2PA 1NZFA 3QVKA 4BQEA 5K0CA 3KQUA 3NAZA 3K9CA 2PH5A 2WPNA 3IKLA 4R8VA 1PK9A 1PQUA 1TLFA 2GPTA 2OCYC 5HIAA 5KVAA 4YV1A 1GQRA 2BLLA 2FUKA 5ALIA 5FQOA 4L7QA 1RLIA 3U44B 3ORFA 1L9XA 3NEAA 1IY9A 4FD2A 1UXOA 4YYEA 5ICMA 3PL5A 1OI3A 3F73A 3TFWA 1LW7A 3IBGA 3JQAB 2I6FA 3EYAA 1R0YA 2YYZA 2YN2A 2PGLA 1G18A 3C0KA 1EB9A 3IJEB 3TTVA 4CLOA 1IY2A 3Q3HA 4BZQA 1PSDA 2HZ7A 1P2VA 4BNHA 4D3ZA 5BUSA 2GD1O 3DAHA 3ZWCA 4UNQA 2VHJA 4KUHA 3JD0A 1SHLA 1JLLA 1VG0B 3OWXA 2OZLA 2VF7A 3COYA 5LZ5A 5FWNA 1W1IA 2BP7A 5KNDH 5AM4A 3A27A 1UF9A 3F97A 1RCTE 4RPGA 1T3ZA 4ZVSA 4AN0A 3OTQA 4JUFA 2UXCB 2IELA 3GCDA 1MPTA 3KOOA 4CMEA 1FDIA 3CJRA 4EFKA 5AOBA 3ZYCA 2CV0A 2EZ4A 3A58B 3DONA 4DMCA 3B1JA 1L5WA 1HSZA 3VZRA 4DE5A 2J5BA 3U6BA 3W6NA 1EGHA 3HM9A 1MG5A 3KZXA 4QQFA 4BO6A 3OC6A 5LA6B 1N3LA 1CQJB 4CIDA 3FM9A 5TT0A 1KERA 5CB8A 1WBBA 1LJUA 2OLKA 1T8UA 1Q84A 1MCZA 1D2RA 2PUHA 4YCSA 1T9DA 4QXMA 4G4SP 3WGKA 1YA4A 3LK6A 3OIVA 3UNXA 3NM5A 5KTPA 5EP1A 2W2OA 3RWOA 5IK2A 4G5QA 2WYVA 1C3VA 3DCIA 3OFSA 2UDPA 4IO1A 1GPNA 1JIVA 3LQFA 3M4JA 5E95A 4HH3C 3PKJA 2PDAA 1H9BA 4HAWA 1ZLYA 5FL7D 5I47A 1JDZA 1QTIA 1ZOPA 1JBQA 5EEHA 2G17A 4GX2A 5IAGA 2VHWA 1G9XA 3D5EA 3FMGA 4TT8A 1RKBA 2XB8A 1S89A 3ITDA 3LZ6A 4OQDA 1OAOC 3TJMA 4KN5A 5KYTA 1HEYA 3D59A 3H9CA 3GZNB 2W2KB 2Q1SA 1E7QA 2Z98A 2C4VA 2RGWA 2ZP1A 2PPVA 5AQ1A 1SC4A 4F4IA 4UAGA 2REXB 4FONA 3VU9B 5M2QA 3WNZA 1HO3A 2QUIA 5DX8A 5BSTA 4MA4A 1DQSA 5TLSA 1JXQA 1Z15A 2CZGA 2VP6A 3GJZA 2I29A 4S0ZA 3V7NA 3TTTA 4FEAA 3IAEA 3A6KA 1JR6A 1U04A 1WXXA 1E3EA 1K4YA 4I2VA 3WOVA 1NVVQ 4K6HA 2BDUA 1WW3A 1OLXB 3NDIA 3R3UA 4LJKA 3WA6A 4ZQBA 2XW6A 5H0IA 3A6EA 3C43A 3K6SB 2XB4A 2OAGA 2VLBA 4KWCA 1N7GA 4KSCA 3L1JA 4YFVA 3UENA 3FF4A 4M6WB 3W8DA 4B3TB 3K1ZA 2QN1A 4GYYA 4URUR 3DZJA 3H7IA 4E2WA 2IU4A 2J07A 4BB0A 1HG1A 5JLJA 3F96A 1BFKA 2BTQB 1E3DA 4E09A 3CRVA 4LCJA 1AB6A 3C8ZA 2GH1A 5FX2A 5L3QA 5HUHA 1EJ2A 1JIXA 1WP9A 1Y6FA 5TV2A 3G0HA 2ONJA 3CN9A 3ZNNA 1AJEA 3PNMA 1ZR2A 4ACAA 2D0IA 3HKBA 2CF6A 4JBNA 3V4PB 3IP9A 3O1LA 5P21A 4J90A 4YN3A 3H7AA 3DAOA 3DMDA 2X9VA 1KI9A 4KQJA 1VE3A 5EUQB 3TEMA 3QLTA 5F7OA 2V6IA 3DUFB 5CFNA 2N1MA 4D8WA 1J0AA 1IUOA 1N0IA 3NBZC 2DPYA 1WAMA 4L3WA 4X6UA 2JVIA 1KH2A 2FWJA 2FMHA 4N01A 2CHQA 3OI7A 5B1HA 1KAEA 3ROKA 5LXTA 5JDCC 2BVNA 3N2EA 4DUZB 1TB4A 4D6PA 4DCOA 3AEQB 2ZJ6A 3LGAA 1GVNB 2P6OA 2J3LA 3CSDA 1QVAA 3OUUA 1RKUA 3CLRC 1G1AA 1EIZA 3GV0A 3HCFA 4MEJA 4PPYA 4LFCB 2J7PA 3UWPA 1CQWA 4EQ6B 3TGLA 4WK0B 4ER5A 1QOQB 4WZAB 2PH3A 1CBUA 3L01A 4L5AA 2CD7A 2ZM5A 4R8RA 1JF8A 3VC1A 2H4ZA 1CZHA 2EGGA 2VO1A 2P8SA 3CCFA 2BHNA 2LE0A 2ZRAA 3UYLA 5I7VA 5IKXA 3S8EA 3KZ1E 1COZA 5CJJA 3RLIA 5IASA 5LOVF 1V3VA 3REQA 4RD1A 5GOZA 1EU1A 3BF8A 3CVWA 1GG9A 2FG7C 4L6IA 3CLKA 1EP2B 2W8BB 3JWJA 4FYKA 4U39A 4BIIA 3H99A 4YUYA 2H16A 1NRIA 1A1SA 3UV6A 4KHPB 1O4WA 4KO8A 1E3MA 4D99A 3Q3GE 2WJGA 4ZYVA 1V47A 1BXRB 4CQNA 4OQNA 3TXAA 4Y2HA 1PL8A 4IXWA 3A4TA 2C2BA 4LRUA 1SVOA 5LCXA 5CURA 1U1EA 4D96A 5J4KA 1EFPB 5HNKA 2HJHA 3PNYA 5JROA 3U7QB 2ATVA 1BWSA 1ORTA 3F2IA 4JUAA 2FUCA 3EZNA 1IWOA 4UU1A 5G02A 1M2EA 2Q4EA 2DHEA 4A8HA 4TRNA 5IXJA 2XRZA 4ER7A 3DKKA 1JJIA 2EJBA 1MB2A 2D4HA 2GILA 3VOTA 4L95C 4EYKA 3QBEA 4I9FA 3RRYA 2BBOA 2AJDA 4MQUA 1JE1A 1CB0A 3GNSA 5LQMA 4QPDA 2GHTA 1B3RA 1N5KA 2CSUA 4TQUS 1MH9A 1N5RA 3KPYA 3I9FA 5B1SA 1X1AA 4YP0A 5K3FA 2IHZA 3HXMA 2ZU0C 3SFVA 2X0FA 3W2HA 3WGLA 2NIPA 3U49A 4JVSB 1MIOB 1TEVA 3LP5A 3KYCA 4TT3A 2NW6A 3O8OA 1YT5A 2IXEA 4Y2PA 2RGUA 4HTFA 1CZLA 4M0UA 2NTEA 2W90A 4ALNA 1E18A 1C1YA 4JOCA 1UBNA 4BQFA 1QZ3A 1X7GA 5C8ZA 4YV7A 3GD7A 3HZZA 3L4BA 3PGJA 3TLAA 1UBEA 1ESNA 3AG6A 3CPJB 2CW5A 1EUDB 4MYDA 1TVMA 2PANA 3I53A 3ZVRA 4Q37A 2B36A 2NGRA 5HIMA 2VQ6A 2ZJ7A 1J8QA 4MR7A 5F33A 5ARCA 1QMGA 2QJOA 3FCYA 3LZDA 2Y9PB 2ZYDA 1U0GA 2JVJA 4QNRA 3VOSA 2O1XA 5J2UB 3AM1A 2ZE6A 2YJ6A 1ONBA 1Y1PA 3A6DA 1IMOA 3FUVA 1TYAE 2Q5JA 4AKHA 5HIJA 2LCQA 3T5GA 1C8LA 4TLLB 4AW9A 1XMJA 2ACKA 3BXFA 3SC2A 1TYDE 1HF3A 1JP7A 1G20E 4QPPA 4G8DA 3OQHA 6YASA 1TAHA 1UK8A 3I39X 5A3QA 4KFTA 5A9TA 1JKMA 3NBYC 1KI3A 5AOVA 4ADSG 5ITZB 2GWRA 3SOZA 4X90A 2VYND 3AY7A 3F5DA 2QJWA 3TTUA 1QO7A 3DF7A 4CJXA 4CFSA 5I5GA 5BSKA 3QFSA 3TTXA 3GD5A 3PQFA 5IT9A 5EMMA 1OR8A 1WNFA 1Q50A 2ZI3A 3V9AA 2YWDA 3MIZA 2G40A 5KQRA 1GTMA 4QPJC 1ZONA 1LPNA 3GF4A 2FZWA 4A36A 1MRNA 5DZSA 1GTRA 2QTBA 3R3XA 1T2CA 2C5GA 5CNMA 1TYZA 4DIFA 2VKTA 5KAMA 5ISMA 2IDMA 4JIGA 1X39A 3BBLA 3V4FA 3B82A 4MV4A 4XQGA 3WLAA 1H2HA 1QVWA 4ZHSA 3CQ9A 3KK0A 3IH5A 4LQDA 2YW9A 3N86A 2BFAA 2CXTA 1DO2A 1BX0A 1N2BA 2WWWA 2XE7A 2Q2OA 4CCAA 5KC8A 3HYRA 3H4IA 3RFCA 5EE3A 4P5DA 1YSCA 1KE1A 4YP5A 2J4CA 1UDWA 5J4LA 4DQDA 2CYCA 4U6NA 3OFJA 2ANCA 2O05A 4Z7QB 1QHIA 1DEHA 3Q3IA 3JAMA 1IHOA 1X77A 2YFKA 3ETEA 4D8YA 2VSFA 1NYQA 2P0EA 3PV0A 3VAYA 1MBZA 5C53B 1G0OA 1TQHA 2P9YA 3JQAD 1V5IA 3JCZA 4EB8A 1WY7A 2HWKA 2WC1A 3SQXA 1CY0A 1J20A 3N8NA 2WJ3A 2YVLA 5KQMA 1GD1O 3SEZA 1LI7A 4MJLA 3IMEA 7GPBA 1VPDA 4XWYA 3RYCA 1XWFA 2BCGY 2WE7A 1QGOA 3UFXA 4B7CA 2O54A 1EYZA 2JJYA 3T0FA 3IIKA 2ZT7A 4M0KA 1UIMA 1USIA 2GPYA 3SEFA 3OJOA 3NB0A 2C94A 4K6FA 1RPJA 2QRNA 3E48A 4RD2A 4MQ6A 4YJ2A 1DDIA 5BWCA 3CUSA 3IEXA 5EESA 1NP6A 5BQPA 3WLRA 4B85A 3PQDA 3HBFA 1QU2A 3OEEA 3CCBA 3U4GA 1EFDN 1G5HA 2RHJA 2HIAA 3KT8A 4FN4A 4BNKA 4P31A 1KKLA 5DYYA 4BWGA 1APBA 2EKQA 2HWWA 4FHEA 2X1MA 2H92A 1RKXA 2HA3A 3NVMB 4LI0A 3UHOA 1GLGA 2P5YA 1I8TA 2ZDHA 5E0KB 1F6BA 4FC7A 3D4PA 4WPGA 4WNAA 2BGNA 3ZE8A 5J1SB 1EXWA 3MHPA 3RJ5A 2GM9A 4ZHQB 1YOBA 1QWOA 5EMJA 3ZCPA 1HYQA 1DC5A 2I9KA 1OXMA 4RF3A 3SR0A 3AQIA 4HGNA 1D9ZA 3AUAA 3QU4A 2NSLA 2P27A 3D2BA 4UFNA 5LYJA 5M29A 4H7HA 3COSA 2E4ZA 3CZAA 4UNSA 5CDYA 1CF2O 3ZR4B 3IKTA 4HVLA 2VDKB 1XQ6A 2NNLD 3OIWA 4BNZA 3OOHA 4B3DA 1XYYA 3GLSA 5HKLA 3AETB 3D3QA 1PFVA 3M6WA 1JEEA 1UDBA 3JYOA 2P69A 1GWNA 4ND5A 5GZ6A 3UF0A 2WE8A 3HDTA 1E0JA 2WD8A 3E2IA 1HDCA 4UD6A 4YA6A 2QYHA 4ZK2A 4YCNA 2Y77A 3WWDA 4GOOD 1JPUA 1SUIA 3D4LA 3C7DB 4J7CA 3WAJA 1XB2A 4KACA 4NJMA 3SYTA 3WB2A 1CIJA 4CTJA 4F9GA 3LX6A 2VT6A 1VQ1A 2H5IA 2F62A 3KKEA 4UNNA 2HLHA 4V03A 1BE0A 4E5DA 4CDRA 1U7PA 4OYYA 2O2HA 3D6FA 2UYOA 2XT0A 5FNVF 3CIFA 3ROQA 4AWBA 4C5BA 1YDMA 1KI1A 1L4BA 3CMMA 2DY1A 3EVDA 2WF9A 2WINI 5A1JA 3LVQE 2Q6TA 4LDJA 1TO2E 2BFDA 2BSAA 3DHNA 3LUKA 4GMXA 4JB0A 1W4ZA 4LY0A 3W8FA 1PEAA