3S8YA

Bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
277
structure length
277
Chain Sequence
SIENLSSNKSFGGWHKQYSHVSNTLNCAMRFAIYLPPQASTGAKVPVLYWLSGLTCSDENFMQKAGAQRLAAELGIAIVAPDTSPRGEGVADDEGYDLGQGAGFYVNATQAPWNRHYQMYDYVVNELPELIESMFPVSDKRAIAGHSMGGHGALTIALRNPERYQSVSAFSPINNPVNCPWGQKAFTAYLGKDTDTWREYDASLLMRAAKQYVPALVDQGEADNFLAEQLKPEVLEAAASSNNYPLELRSHEGYDHSYYFIASFIEDHLRFHSNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase APC40077
publication title Structure and activity of the cold-active and anion-activated carboxyl esterase OLEI01171 from the oil-degrading marine bacterium Oleispira antarctica.
pubmed doi rcsb
source organism Oleispira antarctica
molecule tags Hydrolase
total genus 92
structure length 277
sequence length 277
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s8yA00
1VE7A 4JYMA 5HQ3A 4UBIA 3ZLVA 4B0PA 1H23A 3DKRA 4FLFA 4DMKA 4DNPA 2QMQA 1AUOA 5AKXA 3H2IA 2WQZA 4QDTA 3O9MA 5JD4A 4E15A 3HC7A 3ANSA 2B4KA 2X5XA 1GGVA 3ESCA 4BTVA 3FYUB 4AZ3A 2IIVA 1VZ3A 5AM0A 5EIEA 3V1NA 1LPOA 2QKYA 1DTEA 4Y2TA 4MEAA 4GHWA 2VEOA 1AURA 4HXGA 1HPLA 1AGYA 3DS8A 4Y7DA 3G9XA 4QLOA 4Q1VA 1ODTC 3AFIA 4G8DA 1CV2A 5A7GA 1H2XA 4K6HA 3PUHA 3BWXA 4HRXA 4UHHA 3WL6A 4X00A 4C88A 1W76A 1A8UA 4V2IA 1K8QA 2OGZA 3K2IA 4JEIA 3PFCA 4Q3OA 5HF6A 1K5PA 1WM1A 1BCRA 1JI3A 4BE4A 1P0QA 4BYMA 2DHCA 4QA9A 1U2EA 3WQHA 4EB0A 1W75A 2GYUA 3R3XA 4X92A 1EDDA 1C7JA 1E89A 5ALJA 2RHTA 3IA2A 2HFJA 2FUKA 3C8HA 3AZPA 5T4EA 4X90A 3E1GA 4QWWA 4IHAA 2VF2A 1XZJA 2QRUA 4J0HA 2Z8XA 5EHNA 4K6GA 3T4UA 3WK5A 4FMPA 3I2JA 4ZV7A 2HL6A 3WKCA 1CUDA 1XRQA 4J0GA 4DMCA 3NOXA 2HRQA 5CXXA 3X3HA 2H7CA 1EHYA 3TGLA 2G5TA 1E8DA 5AKYA 4B80A 3QVMA 1H22A 2FX5A 7YASA 5E4JA 3K9BA 3OC0A 1WHSA 5JALA 4LIPD 5HF9A 1QGED 1Q83A 1YCDA 4GW3A 1W52X 4DTCA 2V97A 5DNVA 1R4ZA 2PUJA 2XUPA 1YR2A 1JKMA 5AI5A 4UFOA 4G8CA 1XZEA 4CCYA 1CR6A 1K4YA 2XQIA 4Y2JA 1LZKA 5K3DA 2WUGA 4B83A 1ORVA 1H2ZA 3FYTA 4GLBA 2J4CA 4X97A 1YASA 4KAFA 1HLGA 4EZIA 4ETWA 1UZAA 5IVHA 3AZOA 1UOQA 3DLTA 4J0KA 1HQDA 4PO3X 2WUFA 1MU0A 1QONA 1PJAA 1TRHA 3DYVA 4XJVA 2CUTA 1CRLA 2V9ZA 1G4HA 4XX1A 5ALUA 1G66A 5SYNA 4EHBA 3DKKA 4CIBA 5JATA 1CUFA 4AO6A 2C0PA 1ZD3A 4I3FA 3F8SA 3V9AA 5FDFA 3QH4A 1BU8A 2Y1KA 4YPVA 5BOVA 5LLSA 2I03A 1PV1A 2XUFA 4H7EA 1XQYA 5ALVA 1MNAA 2HADA 3QZUA 3FBWA 3A2MA 2NW6A 3QMVA 3FCXA 2CEKA 1HDEA 5A2GA 1E3QA 1HKHA 4HTAA 1D07A 1VOTA 1DQZA 4BAUA 3HSSA 3MVEA 2XLCA 3CCCA 3WZLA 4Z49A 4P08A 3HABA 3DD5A 3R3UA 3IB3A 4QE3A 1QTIA 1UOOA 1XRLA 3I6MA 3QBJA 5I8PA 2HU5A 1QIDA 4OSEA 4MYSA 5KWJA 3SX4A 4N8SA 4U2GA 4DM7A 1QOZA 4M0MA 5JAPA 3F98A 3ICVA 1EVEA 3KDAA 4Y2QA 2ACKA 3DQZA 1H2YA 1A8QA 5ALWA 1UKAA 4CFSA 2EEPA 5AK6A 1YS2X 3STXA 3WKBA 3C45A 1ZD2P 1UKCA 4X71A 4N5HX 5T4HA 5HFAA 5LZ5A 3CCBA 3IULA 3VJMA 4DNQA 4J0JA 4LXGA 4FBMA 1EH5A 2WUEA 1UK7A 1TK3A 3SWWA 2GBCA 5T4FA 5JAOA 4G9EA 3UUEA 3QPDA 3BDVA 5AI4A 1Y37A 1VJ5A 4MJ3A 2WLSA 4C87A 2H7XA 4NMWA 2Z3WA 4CG1A 1MX9A 4W1PA 4ZRDA 2VQ6A 4EUSA 5AP9A 3ZWQA 3G8YA 2XMZA 3BDIA 3LCRA 1GKLA 2ZJ7A 3M3DA 2VJBA 5FPPA 4C4YA 2XUGA 2WFLA 2GYWA 3ZLUA 1AKNA 1BN6A 4H7FA 1QLWA 2GZRA 3TRDA 5ESRA 2C5GA 4KE7A 2C5FA 5C7YA 1TIBA 4F60A 1VZ2A 4MEBA 3BJMA 1EK1A 1IMJA 1AMNA 2GBFA 1R88A 1CQZA 1YA8A 4GECA 3R3ZA 1DX6A 4M0EA 2RIPA 1P0IA 3EQ9A 3DDUA 1UK6A 3ILSA 2JF0A 3HI4A 4AO8A 2WIGA 4Q3LA 5KREA 1CIJA 2BKLA 4DYHA 2XUJA 4FFWA 5ALXA 3FAKA 2PSDA 1ZIYA 2W6CX 2ZSIA 2AJBA 1W4LA 1ZD4A 4MWSA 3O4JA 3WWCA 2XUHA 1OCEA 4PQEA 3I2GA 5HFNA 2B61A 3PFBA 5EFZA 1WB4A 3KXPA 3VVMA 1Y7IA 1CVLA 4BC0A 3WL5A 4J3JA 1ZGCA 5ALPA 5FV4A 3QMMA 3C5WP 4D9JA 3HXKA 4Y2YA 2O7RA 4E11A 3LLCA 1DT5A 4IQ4A 4P92A 3STTA 3HJUA 3OTQA 4X93A 5K3BA 4A16A 3D2CA 3I2FA 5DYYA 1N1MA 3AJAA 5T4BA 4OYYA 4A5SA 4DNOA 1CUAA 3FOBA 2RGUA 1GQRA 1XFDA 5DYWA 2PSJA 1E8NA 3O4GA 1LNSA 2WJ3A 4FLMA 4GI1A 4QZVA 3K6KA 2ZYRA 2JGLA 3PICA 4UBJA 1G42A 4FDMA 3U1TA 5AI0A 2PPLA 4YX9A 3F9CA 1J1IA 3G9TA 2WKWA 1BE0A 5HZGA 1QFSA 2C58A 3STUA 5AK4A 3I28A 2C0QA 5AKIA 2XDWA 1SCQA 3T52A 3I2HA 4BB0A 1K6EA 4UHEA 5CH5A 1QTRA 1FFBA 4GXNA 3G0GA 4EBBA 4PF1A 3C6YA 4J0DA 2QM0A 3FNBA 5AI9A 1THTA 5DYTA 5LYYA 1CUIA 4UBOA 2G5PA 2OCKA 1JU4A 2IX9A 4TPKA 4BATA 1RP1A 4QWMA 4OU5A 2WHPA 3L1HA 2DR0A 4X95A 4LXIA 5DTJA 3MGAA 4Y2PA 5BWCA 5ALMA 3H2KA 4NS4A 2UZ0A 1DINA 3WIBA 3VJLA 4BDTA 1JMKC 3Q8WA 1P0PA 5JZ9A 4W1QA 1BCSA 1QE3A 4PSCA 4UHDA 4HAIA 5JASA 2FJPA 1TCCA 3DOHA 2JGMA 3WK6A 5JZSA 4ARAA 4Y2SA 4J0IA 3D4LA 1QIIA 3NGMA 5AM2A 5EIAA 5CTAA 2PUHA 4FBLA 4FHZA 5CBKA 1LPMA 1LPSA 3MUOA 4IO0A 4MWTA 2QOEA 1ZJ5A 3MUNA 4BP9A 1FJ2A 3I1IA 4EY4A 1SC9A 4YK7A 4JUIA 1IUNA 3FLAA 2G4LA 3G0DA 3W05A 5LZ9A 1CUZA 4CCYB 2CZQA 2QXUA 5K5EA 1CUCA 1BS9A 2HA5A 1TQHA 3WA7A 2K2QB 1UT6A 1XRRA 3OURA 3WLAA 4BTLA 2BUCA 3I6YA 5AKKA 4U2EA 3WMRA 5KBYA 5CT5A 2AJ8A 1W1IA 5FXMA 4OUKX 2XT0A 5AH0A 1GT6A 3LS2A 4I4CA 5AOCA 3B12A 5FUMA 2WU3A 1XLWA 4JYPA 3A6ZA 1MPXA 1LZLA 2DSNA 4XVCA 1ZI8A 2HHAA 4NZZA 2ORYA 4M0FA 4HS9A 1K63A 1U4NA 1SFRA 1QFMA 4X7BA 4JH0A 4FFVA 2OG1A 2XMSA 4BAZA 5H3HA 2HA3A 4AMZA 4B81A 3A2LA 1N8SA 2OAGA 2XMCA 2J4FA 1QO9A 2XMDA 4X94A 3F97A 2WTMA 4B0OA 1MAHA 4UFNA 5F4ZA 3PUIA 5CH3A 1FFAA 5ALRA 2JGFA 3V1LA 4OU4A 4BVKA 1AQLA 5CXUA 2XMQA 1AZWA 3PF8A 4RNCA 1XZMA 4PSUA 3N2ZB 1HL7A 1XQWA 3LIPA 5LZ4A 4FNMA 3O4IA 4H0CA 1CUHA 5DLPA 3DEAA 3PDCA 2EDAA 2VT7A 2OAEA 5JAUA 3BE8A 3RARA 5LZ8A 1XROA 3JW8A 3WA6A 4WDQA 3D2BA 5K3FA 3GA7A 1ZOIA 4ARBA 3UMJA 1DQYA 4QNNA 5LKRA 1LBSA 5AI6A 3A2NA 1XRNA 1CUUA 2WIJA 2WIKA 5ALHA 3FSGD 5AICA 4KR0A 4C4ZA 3E4DA 4AX4A 5AK3A 3ESAA 1FSSA 3L1IA 3IVMA 4G5XA 4C4XA 2V98A 4XIIA 1CUSA 2P8SA 4L3WA 5D6OA 3WK7A 4NVRA 5I7UA 4OB7A 3WZMA 1EA5A 1DX4A 3KSRA 4UUQA 3KOOA 1XZFA 2OQIA 3KWJA 2BUAA 1LGYA 3WK9A 4BC1A 4HVTA 4ROTA 3SK0A 3C6XA 1SCKA 3V1MA 1RWQA 4N8EA 4BVJA 5JD5A 4FOLA 5KWIA 3G02A 2BCEA 4UPDA 3RM3A 4X6UA 1ORWA 2PU5A 3STVA 1DU4A 1XZCA 3V48A 5J3JA 1XZBA 3BJRA 1CUGA 1XZDA 3OG9A 4LHEA 5LKAA 2QT9A 5C8ZA 3Q0TA 2VAVA 1WB6A 3G9UA 2VAXA 4XWGA 1IUOA 3WKDA 2ZYHA 3QMWA 1MX1A 3KD2A 2Z8ZA 4O08A 1X2BA 1ZD5A 3H1AA 2XB6A 4ZI5A 5CT8A 1JT2A 3JYHA 1XRPA 1JJFA 4BRSA 2VJAA 3HZOA 2RONA 2DQZA 3TEJA 2XUQA 4WDRA 1IUPA 3VXKA 4J7AA 5EIHA 4QEKA 2HA4A 2PVSA 3CN7A 1QIKA 4E14A 5C81A 4KACA 4KEAA 3C5VA 4KYVA 2XQGA 4PSDA 5DJ5A 2CKMA 3RKSA 3H19A 3EQ7A 1GKKA 1EXWA 2XMRA 1OXMA 2O2GA 2PBLA 4KE9A 4G8BA 4PW0A 4WY5A 3W06A 3STWA 3WI7A 3WKAA 3AZQA 5ALYA 1O6GA 3ED1A 3AIKA 4OB8A 2W22A 1MX5A 3M83A 3NWOA 3O0DA 1JFRA 5AKZA 1L7RA 3IDAA 3PF9A 1BEZA 5ISMA 2G63A 1GPNA 1VLQA 3W04A 3HACA 6YASA 4KE8A 1CLEA 3NUZA 2HRRA 2ZJ6A 2V96A 4OCZA 5AIAA 1ACLA 5K3EA 3E3AA 5IH7A 4S0XA 3ICWA 2OPHA 3HEAA 5CT9A 3WL7A 1FFCA 1N5RA 2JEZA 5C8XA 2OCLA 4Q82A 3M82A 1F0PA 1XZLA 2B20A 3O9VA 4DSAA 3IURA 1Q84A 5C8VA 4E46A 2R11A 1TCBA 1MNQA 4U2CA 2HM7A 5DNWA 1ZI6A 2JGKA 2VJDA 3D3NA 1BRTA 3OOSA 4DIUA 4H7IA 2WFMA 1CUVA 1CQWA 4IH9A 3E0XA 1CEXA 2WIDA 1QZ3A 4HXFB 4IH4A 1MTZA 1YSCA 4UBLA 3I6ZA 2DHEA 5HK8A 2WTNA 4K5QA 1Y7HA 1A88A 1EDEA 5AOBA 3ESDA 2DQYA 1XKTA 2AXEA 2B9VA 3STYA 5BWBA 4BVLA 4WCVA 2C7BA 2DHDA 3DJYA 5DWDA 2HIHA 2QUBA 1LPAB 1AC5A 4W1RA 2XUKA 1F0NA 3YASA 4UBMA 2OQVA 3VJKA 1USWA 1QIMA 4H35A 1ZIXA 4H7KA 1EINA 2BJHA 2QJWA 2QR5A 5HQ3B 4C01A 3B5EA 4Y2RA 4J03A 2WJ4A 1XKLA 4P93A 3I2KA 4UHBA 1EK2A 1VA5A 4P9NA 3R3WA 4INZA 4OB6A 1DWQA 2OLEA 5IVDA 1Z68A 3GFFA 2O2HA 4W63A 3ZV7A 2ZSHA 2Z3ZA 3IBTA 5JIBA 4LKOA 3WWDA 3GUUA 4UHFA 3WK4A 5A7FA 2VT6A 3R3YA 3PE6A 5AOAA 2BGRA 3KWFA 1WPXA 4Q3KA 1LBTA 1S8OA 5AO9A 3W2TA 3R0VA 3C70A 3C6ZA 1CUBA 4AZ0A 5HCUA 2Y2UA 3BF8A 4FNGA 1J2EA 3IIIA 3AIOA 4BZWA 2RI6A 3EIOA 1CFJA 3W9BA 4Y9SA 2XUAA 1VXRA 5AI8A 4ZXFA 2JGJA 5D7BA 1QIJA 3QPAA 4BBZA 3BIXA 5AHXA 3D59A 5HKAA 3WWEA 3HYSA 5CW2A 2XI4A 2Z5GA 5JAHA 1CUYA 3D7RA 5AJHA 4CI9A 1EB9A 4BCBA 3L1JA 5LP1A 1J07A 3C43A 5ALNA 4QDXA 1XRMA 2X8BA 1KU6A 3D5EA 1R9NA 5IVKA 4W1SA 1UK9A 1A7UA 1R1DA 1EI9A 4UFPA 1J06A 4Y2VA 1C4XA 4B9AA 2X76A 5HK9A 1E5TA 3ZLTA 4HZGA 4U2FA 3FLBA 1UK8A 4JNCA 1NX9A 4FKBA 4BAGA 2WG0A 4A23A 2H7YA 1XQXA 4ZGBA 4L0CA 5FRDA 2E3JA 5K3AA 2JIDA 4WFJA 1U8EA 4BCDA 1KEZA 1VXOA 1EX9A 1MAAA 2XQFA 3QM1A 2LIPA 5AIBA 2PSHA 4EA6A 4AN1A 1R9MA 5D3ZA 2I3DA 4G4GA 3WKEA 1JMYA 4DSZA 1NU6A 1Q0RA 1LPBB 3DCNA 5ALSA 5DNUA 2BAGA 4G9GA 4X6XA 1BN7A 3D2AA 1B6GA 1QIHA 2PSEA 4ZV9A 4QLAA 1T4MA 2HU7A 1YB7A 1TAHA 4HXEB 5JD6A 3HLKA 5A7HA 4EY8A 2ZJFA 3VKFA 1W6RA 1ZGBA 2YASA 5ALEA 1FFDA 2HDWA 3WIOA 1XLVA 3AIMA 4DGQA 3PI6A 4I19A 2PL5A 4DMHA 1X2EA 1JJBA 2ECFA 5FLKA 2JGIA 4TGLA 1C7IA 3R41A 2OGTA 3FSGA 4ZWNA 3G9ZA 4B7ZA 5FP0A 4H7HA 1MJ5A 4YASA 4C6HA 3G0BA 1DT3A 2XMBA 4L9AA 1YAJA 1VA4A 1P0MA 1U65A 2VA9A 3WK8A 2WU4A 4FTWA 2HA2A 5LZ2A 3ESBA 4OYLA 1XZKA 1YB6A 5ALGA 3I1YA 2CBGA 5BV7A 3V1KA 5EGNA 1DWOA 4B84A 3TJMA 3B3QA 3FYUC 3FWHA 2J3QA 3VVLA 5EI5A 1L7QA 4UBNA 4Q34A 4F0JA 4PV7A 2J3DA 2FJ0A 3SC2A 4GDMA 1T2NA 1WB5A 5E2IA 4DLNA 5ALTA 2R8BA 2Y6UA 3F96A 1UWCA 4QDOA 3DYIA 2VTVA 1HBJA 5AKEA 2AJDA 4BE9A 4DMFA 2PU7A 3GROA 5ALDA 2ZVDA 3WJ2A 3RLIA 3R40A 4GEGA 5D3KA 3ZI7A 4X6YA 1N5MA 2GYVA 5AM1A 5HF8A 1QIFA 2ZYIA 2O2IA 2PSFA 5JZBA 2CMFA 3FYUA 2WG1A 2IITA 1ZICA 2QTBA 1EB8A 4X91A 2XQKA 2WJ6A 4X3CA 1IVYA 4CG3A 3LIIA 4KRYA 4CG2A 3IUNA 1WCYA 4DNFA 2D5LA 3H2JA 3N0TA 1EVQA 2WFLB 5AK5A 2GZSA 1NU8A 1F6WA 2Q0XA 1XZIA 4H7DA 3F67A 2ACEA 1MT3A 4B82A 3C87A 1XZHA 4WFKA 2OGSA 3QPCA 5HKBA 3BIWA 4C89A 2WHQA 5A71A 5ALIA 2WILA 2HA0A 1IZ7A 1CPYA 1MN6A 1YS1X 1ISPA 4G4IA 3DL7A 5ALZA 4G4JA 2AJCA 2BGNA 1ETHA 1F8UA 2VATA 4U2BA 4WY8A 4RE6A 2OXEA 1QJ4A 3VISA 5AM5A 3DNMA 2YXPX 3OM8A 4KRXA 2C4HA 1TKRA 3BF7A 1L7AA 2XUIA 3WWPA 3H04A 4AN0A 2XUDA 3C8DA 2PM8A 2HA6A 4H7JA 4ITVA 3GZJA 4LYDA 1BEEA 1BROA 3O4HA 3H1BA 4HRYA 5CRIA 1XZGA 4BDSA 1VKHA 3FVRA 5CURA 4ZREA 5EHZA 4RPCA 2QXTA 2YH2A 1XQVA 1YA4A 1CUJA 1ZI9A 4EY6A 2QVBA 1GXSA 2H1IA 4H77A 5A62A 1GQSA 5E4TA 2PKYX 4F21A 2DCMA 4QDZA 1OILA 3DOIA 4N8DA 4B85A 1RYYA 3EQ8A 3I2IA 3QITA 1VE6A 5IVIA 3FVTA 5EHQA 3AUKA 1X70A 3JWEA 4J0CA 4WFIA 5ALOA 2JEYA 3WYNA 1GPKA 5FKJA 5I9IA 1ACJA 5FPQA 2PX6A 4Y2UA 3H17A 5AKLA 1JJIA 3A70A 2ROQA 5CMLA 2RAUA 5AKHA 5SYMA 5JYCA 2CB9A 3EBLA 3WL8A 4CCWA 4KE6A 4MQLA 4WJLA 5ALLA 5AM3A 2HU8A 2GBIA 5CT6A 3S2ZA 5CH8A 4G1FA 4EY7A 4UHCA 3UUFA 4X85A 4MYDA 4AQDA 1YAHA 1M33A 4L72A 3G0IA 5AKGA 1DWPA 3AINA 1E66A 2OCGA 1QIEA 5ALQA 1UFOA 1IZ8A 3P2MA 5ALKA 1UOPA 1CUEA 2RHWA 1GZ7A 4PNZA 3CN9A 3S8YA 1I6WA 2WHPB 1LPNA 3BXPA 4AO7A 1O6FA 3M81A 5JADA 3EF3A 2AJLI 4OPMA 1UXOA 2QS9A 3IUJA 5JANA 3C6BA 4FWBA 4UBKA 5LIPA 2XMGA 4BCCA 1JU3A 3O95A 3H0CA 3D0KA 2VSQA 4RE5A 2WIFA 4B6GA 5AKJA 4AB1A 4H18A 2JGEA 3LP5A 1H2WA 1B41A 3DL4A 2HA7A 4GWLA 2QJRA 4EY5A 1FFEA 2HFKA 1QO7A 4MQMA 2XQJA 1PFQA 2XE4A 5IKXA 1LPPA 4AXBA 3WJ1A 2ES4A 3OPMA 2ONCA 1EDBA 4B9EA 1WOMA 3FLEA 2I78A 5A6VA 2JBWA 5EHXA 4KJXA 2Y2VA 1XZAA 3IUQA 4BZZA 5CT4A 1XLUA 5YASA 3H2GA 3G7NA 2EDCA 5AM4A 4KAAA 1GPLA 4IH1A 4TVKA 2ZYSA 1CUWA 4QDUA 4F5ZA 2Y6VA 1E8MA 4LYEA 2BFNA 4W9RA 1SCIA 4U2DA 1WHTA 2OCIA 5HF5A 2WUDA 3FCYA 1A8SA 1MO2A 1WPRA 2DFPA 3VDXA 3H18A 3BL8A 4BP8A 3ANTA 2WSLA 3GBSA 2D0DA 3WYDA 2VJCA 1Q0ZA 2BUBA 4FLEA 4CIAA 2GBGA 1UKBA 1KU0A 1TCAA 4KAJA 4BRZA 2XLBA 3IUMA 1G5FA 4N5IX 2YYSA 1SOMA 2O7VA 3WWOA 1CUXA 4OD0A 3W9UA 2QZPA 5FOQA 3HRHA 3U0VA 1AX9A 2WFZA 4K6KA 3GELA 5E4YA 4Y2XA 1R3DA 3CXUA 1ZJ4A 2CJPA 5LZ7A 5DTIA 2XUOA 2QUAA 1R50A 4GBGA 3R3VA 3G0CA 2H9YA 2WM2A 5K3FB 4Q05A 4MXDA 3AILA 1THGA 4LXHA 3RK4A 1QIGA 1LLFA 1ODCA 4AMYA 3ZPXA 2WHRA 1ODSA 5JARA 2WG2A 3QYJA 5K3CA 4K2AA 2I3ZA 3H2HA 5ALFA 4RGYA
chains in the Genus database with same CATH superfamily
4JJ4A 4CMJA 3M3HA 5EZYF 1FPQA 1GKIA 2PT5A 2Z6VA 1W46A 3GHHA 5AW6A 1ENPA 3BMNB 2A5LA 1M1YA 2YQZA 3MCWA 2DR2A 4DV3B 1NVVR 1E1QD 1N0VC 1W9MA 2NZ2A 2IHKA 3EIFA 1H23A 1YBFA 4UVEA 3N86A 3WGMA 5E3JA 1BS2A 2Q41A 4JYCA 5T67A 2EHJA 2H4JA 5C1PA 4AG3A 1WZUA 2HQOA 2WQZA 3U60B 1CBUA 1EJ2A 1TQ2A 3SDBA 4QDTA 3O9MA 4FU0A 4W5WA 5JD4A 2W6OA 3DEFA 3LK6A 4L85A 1RRGA 3AEQB 2XY4A 2GD1O 3D4BA 1PFVA 3DZCA 3EXG1 1QO0A 2B4KA 1M1NA 3GRCA 3LXRA 1P5HA 4ZPJA 4W8GA 5GGYA 4BTVA 1ZH0A 2CT8A 3FYUB 3K2EA 1GGFA 4DLXA 1UBLS 1P75A 1SUSA 2WJGA 1IK4A 4EJMA 2AYXA 4ZEWA 4EUHA 1LW7A 4ZVNA 4KIWA 3AK4A 2JAHA 2O23A 3JVIA 3ZZNA 1V5IA 3MOSA 2ZW9A 1SCAA 3PUWA 1F8FA 2EWWA 3UGTA 3RIMA 1LPOA 4ZT5A 3H3FA 3E9MA 3KB1A 3O4RA 1FFYA 3TW8B 4JI2B 2QKYA 1DTEA 2COEA 1SBZA 1M2KA 2JA2A 3BMXA 5BT9A 3P4YA 3AVVA 1C3LA 3OC6A 3F49S 2H48A 4BNVA 1RQGA 4LQCA 4Y7DA 4Q1VA 4BBAA 4EELA 2ZWIA 1JHXA 1A3CA 2XWQA 2R6JA 3BD7A 3C3MA 1YB4A 1OH5A 3K7EA 1E1KA 3OJ0A 3HKEB 5FJIA 1DB3A 1Y80A 4NFHA 4CL8A 2B25A 4DQLA 3R4CA 2FE4A 5COBA 1JSRA 3WL6A 4C88A 4MUIA 3I9MA 1W44A 4V2IA 1Z6AA 2DU8A 1YS6A 3IOCA 2NSLA 4J90A 4FB5A 1YK1A 2PT6A 1G20B 4RLSA 2CLFB 4Q3OA 3HA5A 4JGIA 4XYEA 3ELDA 4NYMR 5AXAA 2D1TA 2V4MA 5DF1A 2HREA 1KKUA 5DTMA 3BK7A 1G6Q1 1Q92A 2VSOA 1K5PA 4KAXA 5GGXA 1NVUQ 5GINE 2Q1XA 5DTQA 3WDLA 2QRHA 3K53A 4B3HA 5JH7A 3W8DA 1JI3A 3UFXA 4BE4A 4EI2A 3CMCO 4G37A 1D2HA 2EFEB 2DHCA 3SXUA 3UJHA 4EGSA 1YGPA 2JHFA 3WQHA 4D0RA 4IGEA 2ISSD 3T5DA 4EB0A 3K5WA 3QJGA 3GF4A 4C06A 1KPIA 1PFWA 2GYUA 2OZVA 2XOEA 4L8WB 4P83A 4P38A 3IVCA 3QKUA 4N0DA 4A1OA 3LUCA 3OO1A 1C7JA 4IJVA 3MBOA 4CM1A 4KQCA 2IYUA 2DQKA 2ONYA 5ALJA 2HR1A 1QLHA 4D4HA 1NNLA 4P35A 1SXPA 3K70B 3PEYA 4PFJA 3CW2A 1X0VA 3X44A 3AC0A 3O90A 4A2QA 1YRHA 2IYYA 5CUQA 3D3QA 2HWYA 3C8HA 3ORRA 3P9CA 4HN2A 5DTRA 3T54A 1SKMA 5T4EA 2ZUSA 1OXSC 3UK7A 4R3WA 1UPXA 4X90A 4R6XA 4FINA 5T6BA 3DO5A 4FYYA 1K8ZB 3V8QA 3E1GA 1Z4OA 4ESVA 1ORHA 3M1IA 4QWWA 4IHAA 3T9AA 2W43A 3TIXB 1R37A 4WINA 1O9HA 4F3YA 5L4NA 1Z4KA 1U0BB 3FD8A 2ZUEA 2O4CA 4A8TA 4CKWA 5BN5B 5EHNA 4PQFA 2JCSA 2XWSA 5BVGB 3MRVA 3G0OA 1KO4A 4G67A 4H6WA 2E18A 4IVRA 2GBLC 3OT1A 5KTPA 2AEMA 2PKQP 1LDGA 1T5SA 1X42A 2JASA 4H1UA 5ARCA 1U31A 1XRQA 3IDZA 4MKGA 3K8OE 1VECA 1KDYA 1F48A 1BSVA 3UB3A 3SMQA 1ULBA 4F97A 5FEMA 4GP6A 4ND8B 1IN7A 4BNGA 3P2YA 2FPXA 4PXAA 4GT1A 4YJ3A 5SICE 3U9SA 3F71A 5D84A 2ZP1A 4YCMA 1NAIA 1PX0A 3IXQA 3HKBA 2WYVA 2ICAA 2Q3BA 5IRCD 2Z2XA 3EOBI 1JKIA 4I4TF 3UW1A 1EKXA 1YMVA 2V3VA 3PC7A 3QVMA 3ST7A 3TE6A 3TZLA 3KDPA 2QVYX 3IRUA 3KOXA 4TXLA 4NBLA 1TMKA 2FX5A 4GSKA 2P40A 3DGEC 1ZYUA 3WTBA 1OZFA 5HM6A 1QK4A 3H4IA 2CKDA 5JALA 1B7GO 4LIPD 1YIAA 4IIJF 3ZQUA 4UUOA 2MSDB 5DLYA 4AWBA 4TXNA 4S12A 5EE0A 3UEOA 3WLMA 2Y4OA 3K73O 4ITRC 4JT9A 1DCTA 1OY1A 1NQXA 2D8MA 2O57A 2MINA 1GLGA 4EGFA 4Z2AA 1YGYA 4I4LA 2XUPA 2ZYAA 3VPXA 1SHKA 1G5RA 1JKMA 2FF5A 1ENOA 3NORA 2ZB7A 1G0NA 3TI9A 3V8MA 3KKMA 1PQUA 4GSLA 4NC9A 2B1QA 4Q1EA 5BRJA 3I9FA 4RA6B 3MAGA 1PS9A 3A6DA 4UFOA 1S7CA 3ZI0A 3B7GA 1XZEA 1OBOA 2WDPA 3B1ZA 4BJ6A 4CCYA 2BM8A 1JEDA 1CR6A 4HNQA 4DNXA 5CDSA 5KU7A 2FSVC 1QU3A 4ZYTA 1MO4A 3D64A 4Y2JA 2GEUA 3G1WA 1JAHA 1F4PA 3EULA 3P2EA 1LZKA 1M2VB 2GBLA 4CRWB 5KYWB 1F7VA 3ZJYA 1GQYA 4DDTA 4JJ6A 1T4CA 4YP5A 1SKYB 2Q7OE 2O1SA 3WS7A 1NXOA 1ESEA 1NYRA 2ATIA 2F3SA 1WXEA 3IX7A 1P7WA 4GRDA 4TV8B 5BPHA 1JQ5A 1TQDA 1ULAA 2TRSB 5JO0A 1D6SA 4TMYA 2VRWA 3VU1A 3OU6A 1L5KA 2VNIA 4ZT2A 1YZ3A 2DULA 3P9RA 5FPTA 4BJHB 5IVHA 1AS2A 1Z74A 4BXOA 4J0KA 3MFQA 4ZJPA 1YJ5A 3BMOB 1TIPA 4J94A 1C1HA 4EJ0A 2I7XA 2H85A 3ES9A 3LLVA 4GZ3A 3HVRA 2HMAA 2CVZA 3O47A 4L8LA 5KDOA 2X0JA 4A0SA 4PLTA 3PT9A 1NT4A 4PC1A 3ZCXA 1AKTA 1FDRA 2MR6A 1IONA 2AQHA 2HT6A 3X1XA 1WTCA 1CRLA 2V9ZA 2WDZA 4I9GA 5ITWA 3D1JA 1G4HA 5FO1A 4QECA 1DRKA 1D4OA 1JA0A 2OLJA 1MXHA 3GNLA 5JATA 4LWPA 2R4TA 1I5EA 4RJTA 3HXQA 3VNRA 5AW1A 3U7IA 3O3NB 1QMPA 1ZD3A 2QX9A 4YCAA 3LOUA 4DDUA 3GRUA 1YXMA 2XRZA 1AGPA 2ZFUA 1BU8A 1Z6TA 3LPLA 5FTWA 4D0GA 1C3OB 3AVOA 1I8TA 1DCMA 1YBMA 5LLSA 4ME6A 5HPYB 2AXNA 4IX1A 4H7EA 1QTQA 2DYKA 1P7ZA 1VSTA 1XQYA 4JL6A 4RXMA 1MNAA 4NPAA 2HADA 1J33A 3QZUA 4NFYA 3RVOA 1RQRA 2FSVA 3ZD9A 1IVSA 1SIOA 1KJIA 4MK4A 2X58A 1P77A 3NHKA 5K1ZA 5G0TA 5AUOB 1O96B 2ZRIA 3ECSA 1DCKA 3CQ9A 3QEMA 5A2GA 5TQ0B 3WLHA 1HKHA 2QRMA 4D9EA 2JCVA 5GJBA 1RXIA 3EDRA 5FWAA 4JJZA 1VOTA 3COZA 1OA0A 1IB0A 1UQTA 4GKKB 3DBRB 3ZDZB 4FE4A 3RUHA 4PHHA 4CUJA 4HAZA 1TUBA 1WO8A 3NLLA 4BEJA 5C51B 4P08A 4GOXA 4WBNB 1MJNA 4RK1A 4BNJA 1I94B 2LPMA 4QUKA 1G3UA 3DD5A 4RCZA 4A6PA 2H4FA 3IP5A 4A36A 1T9KA 1OHHA 2QU7A 2F8LA 3GVXA 3UMSA 3VO8A 4Z53A 4KREA 2B6NA 4HBZA 1UOOA 3I6MA 1H69A 3OLCX 3QTLA 1E4OA 1U3TA 4Q15A 1OQAA 1Q57A 1W0KD 2J9ZB 2KI5A 2Z5VA 2YIVX 4OJTA 4OSEA 4WZBB 5E7JA 3UC9A 4CKEB 3D3WB 3SX4A 3UGQA 3E5HA 2VF7A 3L04A 5K0NA 4YP1A 2G1KA 5E9QA 2GM4A 4IQFA 4U2GA 3ZHVA 3WMGA 1HC7A 3I3SR 4AT1A 1JQBA 4ERXA 3R6GA 4FCWA 1SXGA 2X0EA 2G72A 2FN9A 1TADA 3A1DA 1EA7A 4EJSC 3RJ9A 1H42A 1OGIA 1DTSA 3SE0A 5GONF 3RYHB 4B4VA 5I7VA 2I8AA 3PGA1 3NO4A 3PFKA 2ZAIA 1MH1A 1N2IA 3A4TA 3R7SA 3DQZA 5ED0A 3N74A 2P2NA 4MRMB 3GGJA 2JI4A 4Q9HA 1UKAA 4NU6A 1N4DA 1QOPB 5AK6A 5JXHA 2XB2A 5DNAA 4QPDA 1DC8A 3AHGA 2EFCB 2VDWB 1DAFA 4QG7A 1V25A 1UKYA 3PNQA 5LZ5A 3RBZA 1IXRC 2ZS8A 4W5RA 4KR7A 3KOMA 3L93A 1NKTA 5DXFA 3MQFA 3VJMA 3N8IA 4O4JA 3CZPA 3K1JA 4ENSA 1GLNA 1XDUA 3ACBA 3H42B 3ZQKA 2WUEA 2JIMA 3RS3A 1TK3A 3AR8A 4EBFA 2VK1A 3JRXA 1Z6PA 3F78A 2ZQYA 3VH4A 2F59A 1BA2A 2IVFA 5DHTA 5T4FA 1GILA 4E3WA 3SMVA 1W34A 2YDXA 4DXAA 4EG5A 1C2YA 3HWSA 4EYGA 1WUJS 2D2XA 2D1RA 1KMIY 2W83A 3L0BA 3BCUA 3PHLA 4FHEA 1OU4A 2GARA 1F20A 3TN7A 3TZ6A 2NUAA 4BNZA 4BQNA 1PS8A 1Z33A 4C87A 1GTMA 5BV8A 3HCCA 3DTVB 4I4IA 2BE7A 2I4TA 3WWEA 4MR9B 3RSFA 4A0RA 1JH9A 1OFVA 3K70D 1SWVA 3DOJA 5DHRA 1AK2A 1Z0AA 2BP7B 3UAZA 3VMMA 1CY7A 1MX9A 1WNTA 1J49A 1U4OA 2C84A 2IEYA 3BRSA 3KV1A 4UNSA 5CYPA 3SEFA 2V0NA 2VQ6A 4G86A 4EUSA 2E5LB 4UATA 1PS0A 1I01A 2R8XA 5IN4A 1CF4A 2QUZA 3B85A 1JQAA 3VQTA 3ZDRA 3ZWQA 2BHNA 4PBRA 1X1TA 1XFAA 4EJSA 3A6JA 3G8YA 3R74A 5JJ5A 3BDIA 3LCRA 1CE8A 4CEJB 3GU3A 3V8EA 4FP9A 5MFZA 2ZJ7A 5DTEA 3IR5A 2ZE5A 4UEKA 3NMUF 3TMAA 3M3DA 4WXRA 2NO4A 1QHXA 2O2ZA 2PMBA 2YY7A 3NYWA 1W4BA 4RL4A 4F96A 2O54A 2ZRBA 1JHUA 4ZCLA 4DUGD 1R5BA 2XUGA 2WFLA 4G89A 4Q4JB 1BXRA 4ESOA 3N07A 4CT4B 1QH9A 1RWBA 2JJYA 2TS1A 2ZB2A 3ZLUA 2F3UA 3FRJA 1ISFA 5FORA 4OI0A 3B6KA 3VNSA 2P9ZA 3FDXA 3WDKA 2YMQA 3PTZA 4L7QA 4BFTA 1B14A 1YZQA 5BR7A 2K6GA 4UEJA 3DBHB 8GPBA 4KE7A 4U7TB 2C5FA 4F04A 1TIBA 4J2OA 3HZRA 5G1OA 5K8IA 1E1CB 4V3CA 4B7CA 4F6LA 1XVAA 2R47A 4IIXA 4L1KA 4CYMA 2VG8A 4DLKA 2VYQA 4NAUA 4Q18A 5CNJA 3H9JA 1N8KA 2EX4A 4IDEA 4ITUA 1KF0A 2NSJA 2W93A 3I1FA 4QGFA 1AMNA 1SXJD 2GBFA 2J3JA 1YDEA 1R88A 4Z4HA 1DE0A 5KAMA 1CR4A 3JVEA 4BECA 3TQFA 1YA8A 4NU5A 3PD7A 5CD9A 3PNLA 1X7HA 4ZHSA 4KPYA 1S2NA 2XBLA 4ENPA 1AH2A 1D2NA 2AG6A 4M0EA 1VIYA 4HNGA 1YFKA 1PHRA 1TZBA 2WVJA 3CISA 2A84A 1FX0A 1NL3A 3LAWA 3RTBA 4F5DA 5JXGA 2A1TS 2EKZA 4JI3B 2AVDA 1E2GA 3M7IA 5FPYA 1U11A 3K0EA 1F9AA 3P5BA 1VTKA 4MQBA 4AO8A 1EVZA 2Q9AA 3K5IA 3JU3A 2EGHA 4FZVA 4BWYA 4XVHA 1TF2A 3TTTA 2QBYB 1P9LA 4M99A 4YO8A 3NUGA 4URWR 2FFAA 2C94A 5LBIA 3H3JA 3TL3A 3RVBA 3O8CA 1T4BA 2WYOA 1F38A 4FFPA 4RTSA 5SZJA 3Q5DA 2XUJA 3EZFA 4PYOA 5ALXA 5JO9A 4BVGA 2PSDA 3UJ3X 2UAGA 3ND7A 3RB8A 5DBOA 5B55A 3THYA 1I7DA 3A1VA 4EGCB 1YZVA 5HCIA 3KTFA 4O2BB 2EVWX 2D0PB 3EFHA 3PNBA 1IBSA 4QPZA 4DLAA 2XUHA 4QAQA 4TZ0A 2VXYA 3CLTC 4DIDA 1C7RA 3GR6A 4GX5A 4KU4A 3N3AC 1HO3A 2IZ0A 1AHHA 4B4KA 1WB4A 2WF8A 3OF2A 4DUZB 1CRPA 1ZBQA 3VVMA 5IMBA 3NOVA 1FQOA 3WNZA 1B23P 3GPIA 4D8TA 1NPDA 4OOEA 1E1NA 2XYQA 2HMSA 3K30A 3GIDA 2QL9A 2B98A 2JCXA 3GDFA 1H0RA 4K9RA 4TTJA 3P4UA 4QELA 4KH0A 3EEOA 2W90A 4E11A 3LLCA 1EX6A 1Q3HA 1P4HA 2FFBA 1J7KA 1DT5A 3IAS6 2ZULA 4GR4A 1RABA 3JQ6A 3I5MA 3ONDA 4R8KA 4DKXA 4DLTA 4P92A 3STTA 1FEZA 3K8QA 3N75A 3OTQA 2R79A 1C4OA 4TKUA 1Y6GA 1UM8A 5HA5A 4PLCA 5K3BA 4Y1EA 4CHGA 2FHPA 3HG7A 2CLSA 1NBMD 3T41A 1WXWA 2DGDA 2N3ZA 4B3TB 2WWVD 3FTFA 2B36A 3BQMB 1FQWA 3PUXA 1TTQB 4R9VA 3WX0A 4ZGGA 5KYGA 3KU1A 2BL4A 3DHWC 4KXLA 5JD3A 4C0KA 5DYYA 5BW4A 2GNPA 1CF9A 3HBMA 3L7BA 3OZXA 2QTZA 1PGJA 1UAGA 1V8BA 2ODNA 4OYYA 1BHSA 3FJ1A 4X61A 5I5EA 4XIJA 1UKVY 4FGSA 4UVGA 1XELA 2JVKA 3FOBA 2WTBA 4E7OA 3W8RA 2DWUA 4HLQB 3Q3GE 5IKEA 2QQ5A 1U1IA 4ZO9A 5J63A 3UVEA 2X9VA 3UK6A 1WPGA 1ZH4A 4WASA 2VNKA 2WICA 3WMWA 1C8BA 1E9SA 3IEIA 2AFHA 4QOHA 4WUTA 3R3JA 4NOJA 3RK1A 3IJRA 5AMXA 4DAEA 2QV7A 2GHQA 2IZ5A 4PFQA 5CB4B 3OKAA 4GI1A 4MRPA 3MNFA 1ULZA 4H3KB 1VPEA 4QZVA 2XNDD 4PBTA 2C00A 3JVVA 3MPOA 4Q48A 3U17A 1R9GA 4ZICA 1JGTA 2P77A 3NU1A 2DBYA 3GLGE 4KXQA 3MM4A 4HZUA 2QQFA 2NUPB 3PICA 4ZI7A 2DPYA 1JHZA 3Q9NA 3E70C 4UBJA 4WOJA 1G42A 2VYCA 4WY2A 3WYFA 5EE9A 1V45E 3GEHA 2GA8A 1OYOA 2PPLA 1J70A 2FN7A 1Y8QA 3JWJA 4KQ9A 1DARA 3URKA 3U3DA 2YY6A 3WP0A 2BH9A 3F9CA 5L7WA 4BGEA 1BCRB 2AOTA 3AR5A 4UHKA 2RGCA 5E0KB 1OLSA 1VIVA 3P9IA 1T2AA 1QFSA 3EG5A 5DISB 4DPLA 3LOQA 4YXWA 1KH3A 1M1YE 2W2LD 2Q4RA 1BS1A 2YUIA 3Q6IA 4RAOA 3GDOA 3BBLA 1RE1A 2UV8A 4RGQA 2WVAA 3L0OA 3S7ZA 4XDZA 5LNK6 4RDIA 4C20A 1X86B 3W3AD 1BW9B 3T52A 2C8LA 1ZNQO 1E3DA 4MTLA 4HDKB 4I4TA 2YC2C 3RUIA 2MCFA 1I4LD 2J8ZA 3MSXA 4GXNA 4XX0A 2GUGA 3H9BA 3QA3E 4J1TA 3HXLA 4ZDWA 5IAOA 1E2LA 3VKHA 4CU2A 1E1YA 1XHLA 4PF1A 1ZXXA 3FDJA 2HLNA 3FPEA 3H1GA 4FM9A 3AFGA 4DDMA 1T36B 4JLNA 2C9YA 2YFKA 1THTA 2C61A 2GZ3A 3LBYA 4MP3A 4OMUA 5DYTA 3M1LA 3K0KA 1R0RE 4RM3A 5FOVA 2PQMA 4IIJA 4QDKA 5A9SA 2ZB4A 2CZCA 4UBOA 2G5PA 1Z62A 4RCYA 1GIAA 2WU8A 2J5BA 1CP3A 1N2OA 2WFAA 3AY6A 2SNIE 3P0RA 4ZVLA 1D6MA 1MUUA 1L5VA 3SC2B 4D9NA 1QCYA 4QUIA 4QWMA 1VE3A 4JSYA 4TSKA 4JROA 4UEOA 2WJJA 3V4ZA 1GITA 4AMVA 5AQ1A 3L1HA 3LW7A 2DR0A 4FR2A 3W6NA 1Y8CA 1SUPA 5LOVB 2D0IA 3P0EA 4X95A 4OHRA 1XD9A 4IXNA 3MGAA 4DCSA 4YRRA 1NWCA 2DT5A 2KE5A 2LRHA 4UTZA 2K2WA 4P80A 1PK7A 1Z4LA 1P62B 3FG9A 3DTVD 3GPCA 3QVSA 4GOLD 1DINA 3E9CA 4NS4A 2FP4B 2XNJA 4MVJM 4X0EA 3BHIA 3VJLA 4EKYA 5CR9A 4UTPA 2PANA 3FFBA 5EXSA 4BNDB 3RADC 1AS3A 1FX1A 3MAAC 3PXCX 4W1QA 1TF5A 1VE5A 1QSGA 2PVCA 5ECYA 4R2WA 2YZ2A 1RM3A 1QE3A 1X7GA 3H2SA 2PZFA 4UHDA 4UQPA 1DKOA 3OA2A 4J3FA 3ISTA 4E1VA 3HZZA 4WMLA 2JGMA 3SX2A 1X94A 2H1HA 3JRWA 4P5DA 3NWJA 5JI3E 2YVAA 4J0IA 2FZGA 4KO1S 2QX4A 1W36B 1G8JA 4RTLA 4EGQA 4FN4A 1XKXA 3FZEA 2H31A 1U9IC 2P0AA 2Z58A 3BC1A 3D4LA 2PWBA 4I5DA 4XD2A 1QYVA 4FHZA 4OVKA 3TD9A 1PDOA 4TWZA 1LPSA 2FSHA 1YDHA 2JLAA 3OT5A 4OJQA 3MUOA 5CA1A 1XTJA 3CUWA 2PH1A 4TM7A 2QOEA 4ZU1X 3EZ2A 3ZJUA 1DXYA 5ICMA 4PTZA 2EFDB 1ZJ5A 1XL0A 4UUPA 3CYFA 4K87A 4BP9A 1MVLA 3CUEF 5D86A 1T1RA 3R9KA 5D8DA 3BGDA 1FTWA 2PCLA 1USKA 3FLAA 4WBXC 4MYUA 5E6RA 2CZQA 4OGGA 4EO7A 1DLIA 2C4MA 4MVCA 1W73A 4QVGA 3GP3A 4YQFA 1PW5A 5KNDA 4F9FA 1TEXA 4DR5B 1TQHA 2GNAA 1ZCJA 3AXTA 4N5LA 2YWFA 2H2GA 1FJXA 4P3KA 3WLEA 3ZDEA 1P8JA 1ID1A 3GWGA 4Y98A 3KLMX 4FCVA 3K94A 1JSZA 3MGKA 4J0FA 3O8BA 1OV6A 4IG9A 5LUAA 3CKYA 4L27A 3L0DA 4PR0A 3WLJA 1X80A 1UINA 3V4OA 1ZS9A 1UFQA 4I4CA 3SYNA 5EJ4A 3ETHA 5ICCA 3HXOA 2ONKA 2WU3A 1XLWA 1I6MA 3PXGA 1MPXA 2HK6A 4DC1A 3QFSA 5HG0A 1WV0A 3BJZA 1A2QA 4ZVSA 2UUOA 1FDWA 3RSSA 4YAGA 4OQ4A 4D6PA 3P2OA 1C0KA 1VPVA 1FYFA 3E61A 4BB5A 3O2SB 1HYQA 1K63A 1U4NA 2VNHA 3GFPA 3JAKA 3S70A 4ZJUA 3R3SA 3KYDB 3LQ1A 2FOLA 1U9IA 2YWHA 3DPIA 3O8LA 4A5OA 1JFTA 1T5LA 4CNBA 5KEIA 2BRUA 3VZQA 2OG1A 2QZ9A 1M5UA 3KKKA 1FLVA 5A05A 1G6OA 1EFVB 4EA7A 3BAFA 3SQLA 3R9XB 1CC1S 3T34A 4AU1A 4BP3A 3U4MA 4YCBA 4YDRA 2RHRA 2XKJE 5IUNC 1P7CA 4ILEA 3E18A 1R0YA 3IUPA 3PJDA 4GMGA 2W6QA 5LBUA 3KSMA 3FDZA 4PHCA 3VR5H 1KRWA 5L4LA 3QEAZ 3A2LA 4RD0A 3KCNA 4RD1A 1N8SA 1KMHA 1C7EA 2J3KA 2OV3A 3P8ZA 1K7SN 1JFSA 4EHDA 2PXXA 1WDWB 1QO9A 2XMDA 4AS2A 2OM6A 4X94A 4LJKA 4PC6A 4B0OA 5GONA 5ADWA 1KEVA 5F4ZA 1LBHA 3THWA 4TSFD 2DFDA 1KEWA 2JJMA 4MNTA 3V1LA 3P9KA 4K6CA 1YUBA 4KPUB 1WVMA 3LA6A 1B6TA 3UA3A 2O06A 1Z5NA 4U7WA 3FTDA 1NSTA 1GGEA 2DECA 2VTEA 1Z0DA 1IQUA 3TJZA 1EGVB 5EJFA 2H9IA 1RXEA 1E7SA 1XZPA 4M98A 3QLTA 2GUWA 3RIHA 4EL5A 4OAPA 2QF7A 3R7LA 2NU8A 4Q3AA 4H0CA 1CUHA 2DZDA 5EG5A 3NBXX 1J56A 3CKLA 2QLJA 1E69A 2CF5A 5M3BA 5KTRA 2IGTA 3DEAA 2D5AA 1MRNA 2NZYA 3Q3CA 3I5YA 1NY5A 2WZCA 1PKEA 2AB0A 3ZGZA 1YDMA 2V74B 4MUJA 2ETXA 4F5WA 1SQ0A 4UOQA 5JZOA 4B1FA 4MO9A 3UXHA 1C1XB 1PN3A 3SVTA 4YRDA 4XVQA 1WY7A 1XROA 4AS3A 4DZRA 2QY9A 2WSSD 1LNQA 3AM1A 4CTKA 1OZGA 4K28A 2XYVA 3DULA 3DZFA 2DLCX 1V8PA 2FF7A 5FJJA 1UZNA 1GXSB 4ARBA 4NECA 2O50A 3K0SA 1K1EA 4K9KA 1GUZA 1D1QA 4I5EA 4Z4IA 3GEMA 2VUIB 1DBVO 4KFUA 2J48A 5FNVF 4XEUA 2Y68A 4U9HS 1NYQA 1DBWA 3NHJA 3MS4A 4FC6A 4RW0A 5AI6A 1V3VA 3S28A 3HR8A 3W5IA 1WJGA 1CEQA 4ZDKA 4W8OA 2FWRA 2GSDA 3A2NA 3PI7A 3V1TC 3LUPA 3I9JA 3IKMB 2QQ0A 3IVGA 4NIMA 4TZTA 3E05A 3WE7A 2GN6A 4D3SA 2AIRA 2J9FA 4D82A 3VR2A 3D6JA 2L0XA 3MTAA 1KFBB 3W6UA 2PLFA 4IJ6A 4RFSB 2D7CA 4LK2A 1Y6FA 1CNMA 1RTKA 3L7YA 1JG7A 3PGJA 3LI2A 1G8MA 3BFJA 4W8HA 2QVCA 1RFLA 1E61A 3IUBA 4RZIA 4FD2A 3ZGYA 4RAQA 2P2SA 3GZ4A 3KT3A 5AVZA 5IDWA 3EH2A 1XPUA 1GNQA 4JBLA 4WIAA 4Z99A 1KVSA 5F1YA 3L1IA 1NBEA 3OCWA 4AI6A 3DZKA 3TNDA 1NOJA 2V98A 1UZUA 3WIVA 3C1AA 1OPXA 5DT9A 4NS1A 3DJFA 3X0DA 3EA5A 3SM9A 1CUSA 4NYIQ 3RT1A 2P8SA 3T9BA 3CUVA 4XGQA 4HT3B 2ZUVA 5JQGA 3HEMA 1L4BA 1HDCA 3IT2A 4US0R 2K87A 3T38A 3WK7A 4MOWA 1EVYA 3LCVB 4J1SA 3PNVA 1XZ8A 4II7A 4U3JA 2WZDA 4URYR 5A5DA 5B5SA 3A36A 3TDKA 4NVRA 3LGXA 3ZHOA 5I7UA 4G5RA 5F2KA 4BLQA 1EMDA 3Q1KA 4OB7A 1QP4A 1EA5A 4B6JA 1COWA 1ZD8A 2WC1A 1I14A 4BLOA 1UMKA 4G5YA 1XZFA 2OQIA 1Z35A 4AJKA 3Q0IA 3RSGA 4MVJH 5D5QA 2Q0SA 4HWKA 5DSZA 5C8YB 1PG0A 3ELYA 3G1TA 3G8AA 2BUAA 1LGYA 3A0RB 4GMFA 3WK9A 4B71A 3K71B 1WXGA 3RGWS 2C2OA 2V7GA 4C22A 3PXBA 3N0WA 4ROTA 3IPXA 2JKYA 4G25A 4X65B 4WERA 1N3BA 1OLXB 1CJBA 3V1MA 1E1LA 5UKDA 5K20A 4KB5A 4RQAA 5B1HA 1DC3A 4BVJA 5JD5A 2BBTA 1GTZA 4FOLA 2WQ6A 3OT4A 1CEEA 4UPDA 5DX1A 2G83A 5F9MA 1VGQA 2GK6A 2ZRMA 2SBTA 1DAGA 5T64A 5ITVA 5JWOA 1FDVA 2ZIFA 1TFUA 5B2FA 1Y3AA 1PW7A 3M8KA 5FD8A 1ORWA 2RH4A 2TSYB 2V58A 4ZARA 3ZCUA 1TZKA 1JIQA 1V6SA 2IYPA 1ADCA 1ZK2A 4HDSA 5DEIA 4TXJA 3EZ7A 4E5DA 1A8HA 3OU2A 5JXJA 3E35A 4NF2A 1HLFA 4QFCA 3ELUA 1VLHA 1XZDA 4BO4A 2QT9A 3SQNA 4LY3A 2M6RA 5IBQA 2O3JA 1MXFA 3VSCA 3USZA 3C98A 2H2AA 2YFYA 3O92A 3VHLB 2X42A 1UMDB 1FPMA 1R9JA 5FLXA 5FFNA 3H9GA 2WAXA 4WLEA 3OWXA 4X8HA 5DCYA 4N5MA 4E70A 1AHIA 1JHAA 4B2LA 3WKDA 3CU5A 1M75A 1P3JA 1GDTA 3NAMA 4PWYA 5JPIA 1X2BA 2IHYA 4CLRA 5ADVA 3NDBB 3OCUA 1GRCA 1T0UA 3K4PA 2BMAA 4KZKA 3KQNA 3QE4A 2EKQA 4V03A 4QBKA 1YH3A 4JI7B 1HFEL 1UJ2A 2Y67A 4JLMA 5CT8A 1JT2A 2NUTA 3HKDA 4D0SA 5DU2A 3H5TA 4G56A 4Z8XA 4BRSA 4YCDA 4BVBA 1E6UA 2ZRJA 3M5PA 3HZOA 5GIOE 1Z3CA 4G2NA 3TEJA 4Z3DA 4WDRA 4I55F 1KOJA 3GAFA 5EJGA 3DGFC 5JAIA 3KKPA 3F6SA 3E2PA 1MTOA 2G77B 3Q3VA 1SVMA 3OKFA 2HA4A 3FMFA 2NZVG 4IZ6A 2PVSA 3FCOA 3ZHUA 2JLUA 3COWA 4HATA 3W34A 2V0GA 5KJEA 4C3UA 3NKFA 4BTEA 4V1CI 4JD5A 4D57A 2NMVA 4J91A 4E31A 2XQGA 1KSJA 1MGOA 3L0SA 3QEKA 2X2EA 4RV9A 2JL1A 3W9SA 1EXWA 1WXIA 5EKDA 4YT4A 5JSQA 1DBRA 2EFYA 1QR2A 3HZHA 2FUG1 4DMGA 2O2GA 1GGJA 2C5SA 1YR9A 2OO5C 1A7AA 3I12A 3NNSA 2XW6A 1ZNZA 4LYGA 4WY5A 1GZ3A 2G76A 2JIOA 2X7HA 3VYTB 2QJFA 3WI7A 4ZZ1A 5I4IA 3EWNA 1SOAA 4MWDA 3RE1A 3SHVA 1NVMB 3AUAA 5DM60 3H2YA 3MXTA 5FT9A 4F3RA 1GCIA 3K4HA 1QDEA 4V38A 1O6GA 2ZYGA 3AIKA 5ES3A 1Z5UA 1MX5A 2X40A 2J6HA 2JAOA 4P0QB 3BE5A 1N2BA 3BBPA 4HDQB 3NC4A 4OJYA 4PZPA 1ZCBA 2PL1A 3ESQA 3NWOA 1VL8A 3O0DA 4AICA 1EWQA 3GPBA 3LUAA 4NI5A 2GLXA 1FU4A 1WEKA 4M6WA 4HGOA 2I6XA 3OZUA 3ZTWA 2IY8A 3A4VA 1TZCA 4R51A 2AZXA 1BEZA 4IDNA 5ISMA 3EC2A 3D5QA 2A1IA 4WXYB 1VLQA 4HGRA 4BVHA 3HBJA 3KELA 3OPYB 3AFNA 3UAVA 3AHHA 3VU9B 5A06A 3MBKA 4REQB 4EKEA 2BGKA 1IG0A 4M76B 2O7NA 2VP2A 3C48A 4PNEA 3JSXA 3NUZA 4WA8A 3L06A 1ZUWA 3V97A 1Z39A 2NXJA 3E8SA 1R6AA 4JJEA 4PIMA 4EB6B 3TSYA 1L5QA 1VBMA 4JR2A 3QP9A 4FW9A 5EWJB 3W2FA 4C0XA 1YRQA 3K0BA 4PGMA 3ZWAA 3DZDA 1SN7A 3ICWA 1XXHA 3MQ4A 4Q12A 5M04A 3VOSA 4NDNE 4IUCS 4F8YA 1GARA 3JWIA 4AZSA 4WK2B 1C1DA 3OD5A 4LRXA 3VO1A 1YQDA 2J5QA 4NONA 4L22A 1GRNA 1FFCA 1N5RA 2OGUA 4DW8A 2FH5B 3ZDFA 2HF8A 2XADA 4UCWA 1T3TA 2OCLA 1IVNA 1KJ9A 1G8SA 2G3YA 4C6HA 3M82A 1IY9A 1R3UA 2UZ1B 2MYPA 2J5RA 1KAQA 5H1YA 1GZHB 4ZVRA 3GZNA 3VC7A 2XGSA 3O8DA 3MJVA 4AF7A 1QGOA 1J5PA 5LSAA 1T1EA 1UODA 1ATIA 3QEBZ 2FB9A 1E94E 5E1BA 4KO4S 1SUCA 2ZJZA 2IYTA 3N5KA 5JE8A 5JCZA 4PLZA 3DBLB 1MNQA 4QUGA 2OOSA 3H13A 2NXEA 4LWOA 3LT0A 1KH1A 3ZHQA 1G8KA 3CX4A 2ATVA 4K40A 5B57C 4ZCSA 2NVOA 1R00A 3OOSA 3E9QA 4NCXA 5FUVA 3T7DA 2FK8A 4XAQA 3V9PA 4H7IA 2FOXA 5IULC 1LCIA 3IT1A 5F73A 3HBNA 5DM2A 3SVLA 4L3OA 4TYMA 4OTZA 2GD6A 2N42A 4QGGA 3LYAA 3VHQA 3W2HA 3V33A 5ARBA 1L4YA 1YJXA 1JIJA 3E0XA 3KPUA 8MHTA 1OAKA 2WIDA 5CHYA 3IDSA 4JB8A 5FF9A 4JBHA 1YSCA 4UC0A 1MAVA 1T6BY 2QRZA 1DHRA 1D2GA 2WTNA 2AWOA 3EMDA 1VBFA 1E0SA 4TUYF 1XEFA 1NXQA 1PGQA 3BGOS 5AOBA 2C7QA 5C1DA 2W2QA 2F7SA 4LGCA 4IVQA 4AJOA 4ENTA 2I2DA 1NPYA 1IN5A 2ZT6A 1N2CE 4L8FA 1SBHA 1RVV1 1NHGA 4GM4A 4LOKA 4OQPA 4EUFA 1UPCA 2AMLA 3IRVA 4JLUA 2E2WA 2RFLA 1JECA 3DTTA 3RC9A 3MBIA 4FN5A 3LWBA 3Q15C 3DJYA 3IEPA 3LECA 3OP4A 2QUBA 3B20A 4LNHA 4UQOA 1CVIA 4C1NA 1T9HA 3CNLA 3D2LA 3W77A 1N1DA 2I2WA 4OQQA 5FHQA 4W1RA 3GHYA 5KKCA 1QGUA 1T1SA 4URXR 5TB5A 5BW8A 1QB7A 2GRJA 2OFWA 4KLRA 5TJ9A 1NPTO 5JW6A 1W8IA 1IPHA 1UPBA 3ZWBA 2AFHE 2UYOA 5AYVA 4C7BA 5JUWA 3DL0A 4C2AA 4NU0A 1NFFA 5CLGA 2OQVA 3GLGB 4MX8A 4O25A 2Y66A 4RLQA 3DBIA 1WF3A 1Z34A 2Q7XA 2WV9A 4H9GA 5THQA 5TQVA 3WL3A 3WVNA 1TQ6A 4XFDA 5KIAA 1MEOA 4BZQA 1OBFO 1SC6A 4L6AA 3HVUA 1EINA 3G2JA 1M1ZA 3O1IC 4DSOA 2YR0A 5AW5A 1FK8A 4AY3A 3KD3A 1NNEA 1DQPA 3V34A 4AKTA 4KCGA 4C01A 3Q4GA 1EAYA 3BX1A 1J8YF 4J03A 1EYZA 1LS6A 2WJ4A 3FGZA 2Z2ZA 1WU7A 3S5JA 1M1YB 1CVRA 2DBQA 2NZWA 3OPYI 4G0YA 4P93A 3PXEA 1EK2A 2PA0A 2G9RA 4CWAA 2ZWAA 3V80A 1FVFA 5ENVA 1DWQA 2OLEA 1VFNA 3DNPA 3ZE6A 3ZDBA 1ZY2A 5AJUA 1JIXA 4YRBA 3ZXXA 2C29D 4CLDA 5LU9A 1GG5A 1UBMS 1W49A 3C7DB 4KODA 4N3CA 3P2JA 1CWUA 4CNQA 1E4VA 1M1NB 5E4FA 3ZV7A 5CNMA 3NPAA 4OHBA 4F84A 1N1EA 5BSHA 4ALIA 1U2ZA 2JFNA 1E62A 2F6RA 2O1WA 2QWXA 1EHCA 2WNIA 2GFHA 2ZROA 4MTCA 4UAJA 5DOVA 4YUAA 3UJ8A 2IW1A 3MTIA 3DLAA 3AW9A 1BDMA 3K6JA 4JVNA 3L01A 3LRPA 1TJPB 2O0HA 1HYGA 2OO3A 4E4TA 1FUIA 2ZWPA 3WK4A 4DSUA 3ICPA 5BR4A 4ETMA 2PA3A 1T2FA 2FN3A 4QO8A 5GQSA 1LK7A 4UNNA 1GNPA 3I30X 2JJ8A 4JZKA 4UU8A 4L0MA 3PRKE 5ECDA 3OE7D 3ZWVA 1ZBDA 2BGRA 4U5XA 4ZMRA 3GD7A 5J1TB 1S5PA 2AQKA 1DPGA 4HCJA 2CJWA 3CJQA 2BM9A 1LBTA 1S8OA 3OWHA 4BKPA 2O52A 3ADKA 1O08A 4YEDA 4HAWA 2EZ8A 5AO9A 5HP4A 3GJ8A 4K0KB 1RCTE 3WFJA 3G7SA 1W5BA 2ECQA 1T9AA 2Q1YA 2JKVA 2AEFA 2WW8A 4C0SA 4GOJA 2G1AA 1EFPA 2OBBA 4CMKA 2PS3A 5L3QA 3TDMA 2Q6IA 1NJ6A 2W48A 2HEIA 3BF8A 3C3KA 4PANA 1EBBA 1MO3A 1NI3A 4PRKA 2GETA 2P9FA 3DM5A 4A16A 3QWHA 2QVLA 5MGBA 4ZAWA 4BZWA 3EEQA 3R09A 3QKSA 1Q77A 2ZJYA 3EUEA 1R7RA 1E3JA 2RI6A 3S1SA 3W9BA 4LOLA 4WRRA 2P2GA 4Y9SA 2V7EA 3KB2A 1VXRA 5EY5B 2VS1A 4RQBA 4F92B 3SJAA 5KYTA 3KR9A 3I01A 1LWOA 3LBFA 3DT6A 1B15A 1RRVA 3IPRA 4MWZA 5D7BA 4L08A 3QPAA 1TECE 3OQHA 5HUHA 2QP9X 5JH7B 4LC0A 3D1VA 4HNUA 3B8HA 3HYSA 4JQSA 2JKZA 2H4ZA 4W82A 3UFXB 2J0QA 2DH5A 3SD7A 2Z5GA 1DJPA 4HMPA 2VJQA 3SXUB 3PDUA 1GAJA 1K7CA 3JQ9A 1PL6A 3MHPA 3ORYA 2YXDA 2NX2A 3E2IA 2CFRA 4HQ0A 5AJHA 5DM0A 3A31A 3ROMA 3SI7A 1YFZA 4RD6A 3T7TA 4CI9A 4HAUA 1GTJ1 4NCHA 1HNXB 1MIOA 3L1JA 3LC1O 2ZXFA 3MLAA 5E3IA 3ZX5A 1J07A 2MSLA 4D5GA 4DLWA 3PX7A 3RRYA 3JD4A 2UYHA 1PR6A 3CWZA 3OQOA 2Y92A 3ORFA 2CB0A 3TRKA 2R8PA 3WGVA 1V9SA 4FX2A 2F55A 4BV9A 2O0KA 5I9TA 2AZDA 1FP2A 2B2NA 2V7PA 4QUDA 2CSXA 3GCWA 2QG6A 2BD0A 3IKLA 2AR9A 5HRCA 4HRAA 4EA9A 3HNRA 1R1DA 5J2UA 5I51A 3OFND 4W5QA 1NQUA 4HQOA 4X7RA 2OECA 2N1BA 2YBDA 1CX9B 1CW2B 2PN1A 2G4VA 2W11A 3BVPA 3L07A 4NMLA 2WNHA 4QPCA 3PP8A 1QHGA 4TLAA 2HDHA 1P4AA 4CKWB 1QHEA 4B5LA 2GJ9A 3EWIA 1E2QA 4JGGA 2C4VA 2HNAA 4KWHA 3UPDA 3FRIA 3OT1B 1OWNA 1E2BA 4DV6B 4B3GA 1J90A 4BQQA 4OX9Y 4R41A 2LCQA 1ZZGA 2G0AA 4X3OA 2VHTA 4X6LA 5TS3A 1OV4A 5CA0A 2VUUA 1U0OC 4MVJG 1KZHA 1Y8RA 3WDMA 3DUFA 1MHPA 1H2FA 2XAAA 3G79A 3L43A 4X20A 4YJ3B 4J76A 4GOMD 1H6CA 3NI2A 1W4ZA 2WG0A 1ZRNA 4K8RB 3OE5A 2WSMA 1GNSA 3QF4A 4B6PA 1TJ4A 2FPPA 1E7YA 2Y93A 4JZYA 5FRDA 3EDQA 1AO3A 1U04A 2JIDA 4GOOD 4M8IA 4N40A 1ZL0A 2I0FA 4UVHA 4UOZA 2FOIA 4R2HA 3MRXA 3FSJX 1VXOA 2EOAA 4LEIA 1EGQA 1Z4NA 2F1JA 2W2XA 2C5LA 2EJTA 1MAAA 2X3FA 2I2CA 4RIFA 3B13B 3EE6A 3RVSA 1R8YA 5IH3A 2BFBA 3AM3A 3NBYC 3QFHA 4KV7A 1SY7A 3PC8C 4CM8A 4XOUA 2EFJA 2NV6A 5AIBA 3QLJA 2OWDA 3LQQA 1P7YA 5CEEA 2LD4A 2MINB 5DN6A 1UDXA 5D3ZA 2YOFA 1OTYA 1V2GA 4YQEA 1BGXT 3NAGA 1JF8A 3WR5A 1ZK1A 2IOHA 2FZ4A 1WDLA 2AMJA 2GX6A 4B3RB 1DTWA 1Z0KA 3HYCA 4H6VA 4EAAA 2J5XA 2VAMA 5LB4A 2ENUA 1KIFA 3WSVA 3TG2A 1V37A 1JMYA 2GXAA 1O89A 1PYOA 3EZGA 3T3DA 1ZAKA 2FPOA 3TFWA 2XVZA 1O97D 2J3EA 3NBKA 5FFFA 2XKAA 1Q0RA 3VYVA 2C7VA 1M3SA 1LPBB 1IAVA 2OG2A 5E9AA 1G2QA 3BIJA 2M6KA 2BAGA 1XMQB 3U6KA 1V3TA 4WKPA 1BN7A 1NSFA 4NCAA 1KETA 1N6OA 2CVQA 1EUCA 2FGJA 3G8BA 4P82A 1DMSA 1QG6A 5FTNA 3VX4A 1KJJA 2PD3A 2PSEA 1R6DA 2XSZA 3QBEA 2OE2A 3UXYA 3ZBPA 4LRSB 1JBEA 2BTQB 2C95A 3ZWXA 5H4HA 1ZH6A 3IEVA 3R7WA 4NNPA 1AQNA 2BEUA 4CT5A 1JFVA 2DTDA 2NADA 4EEKA 2WJVA 2FEOA 1M73E 2KSQA 1VGVA 1SBQA 1NW8A 2QN1A 4V0NA 5CEFA 3MWYW 5JD6A 1KE2A 3RS7A 3HSYA 3FROA 1AU9A 3WHIA 5TSDA 1RMQA 2A9VA 1YQQA 3RHSA 5TLSA 4PU0A 1QZTA 1JQEA 5LCXA 4BLVA 3QSGA 3CBQA 1A82A 5GY7A 4BFSA 2CNWD 4UCFA 2GCNA 4EI8A 3NXKA 4DA9A 3OEED 3F2VA 1OH8A 1FFDA 2A0FA 4I55A 1YCHA 3HCOA 4JP2A 2QLLA 2VO1A 3NBQA 3H7IA 1ZRSA 1KORA 1RI1A 4Q66C 3W2IA 5KYXA 4LPKA 1CS4C 2FDRA 3KALA 4DDWA 4Z4FA 2PL5A 1Q7TA 4DFDA 2MWMA 3E48A 2IRWA 1A9YA 3CZAA 4GXTA 1X2EA 3DSRA 1JJBA 3RCBA 1T24A 3MQ2A 2XX3A 4REOA 2H6EA 1OIVA 4QTYA 1J5EB 3ORQA 3W1WA 1FQKA 1Y48E 1U1CA 1KYQA 2VTKA 1RZ3A 5KCMA 1YTLA 2MSWA 3TZQA 2C7OA 1Z16A 2P2DA 1KOGA 1DFGA 4D9BA 4BQEA 2DRIA 3I64A 2OGTA 3CPHA 3FSGA 3E03A 3E7WA 4F1KA 1W25A 1LTKA 3CM0A 3AH8A 4R1TA 1K4KA 4GE0A 3QEMB 4IP0A 1LVGA 3EAGA 1R5NA 5EMHA 4N6GA 5IAKA 2O3RA 1EGHA 2J7KA 4PLYA 3UB2A 4PTLA 3HTXA 4RMIA 4E5NA 1W0JD 1MJ5A 1P6UA 3A4LA 1NQ5A 2XTAA 1YR6A 1ZD9A 2XMBA 2ZM6B 1NP3A 2Y0PA 1VA4A 1E9CA 2FWNA 3CPJB 3G2KA 4J8PA 3ZD8A 3CNHA 3ETLA 3UK1A 1U65A 2GOYA 1U1EA 2GEVA 1S1MA 3WK8A 2ODAA 2WABA 2WU4A 3G7UA 4R98A 4DCTA 1XWFA 4GPD1 2B2CA 1GN9A 1Z6ZA 1VKJA 1ZJWA 1M9NA 1TXGA 1XZKA 4OYLA 1YB6A 3S8MA 2OXCA 4TQUS 1GG2A 3OQBA 3E7DA 1C0IA 1I2BA 3KHUA 4R9SA 1K7EB 4JJ7A 3KVYA 3O1LA 3OQIA 1MRSA 3QVTA 3FCUB 1KYVA 5GM1A 1Z82A 1J2TA 1PJ3A 5EQJB 4B84A 4BNNA 4YMGA 2A3RA 2PJDA 2IU4A 3CT4A 3FWHA 2C4WA 2QT1A 1DEHA 2RBKA 1CQJA 3E1SA 3OHMA 2FWIA 3M4XA 1MT0A 3FETA 2F9MA 3RVDA 5HX7A 1XJ5A 3OX1A 4CTNA 2VBFA 2P79A 1M6VA 3NC0C 2J3DA 4PV7A 4F0JA 3P9YA 2FJ0A 2FWAA 3GRAA 4GDMA 4BVLA 4YR9A 4A2WA 4W6QA 1NXSA 3K09A 1ZGJA 4F2HA 1SIUA 1T9ZA 5CAEA 4NHEA 3SICE 1RU3A 4DV4B 4TKZA 3EFEA 4WV3A 1XEWX 1YS7A 5F3RA 5LJIA 4GXQA 2JGNA 3DYIA 4PG5A 5FPHA 2JLRA 4Y1RA 1JB1A 1P2TA 3EMVA 2ZXEA 1P9RA 4ILKA 4L8VA 4LMBA 3OFVA 4MW4A 2C78A 1U7XA 3A4IA 4N18A 3DAHA 4ESEA 1X1AA 3Q85A 1WF6A 2YWCA 1DVRA 2NAFA 1Z5GA 2NIPA 5IHPA 1NGSA 1T5IA 2JI8A 2YXNA 2GEJA 4GNKA 4HH0A 3C74A 3RBVA 4ZGBA 2J33A 4CQLA 2GJKA 2C7RA 1ZDMA 2GMWA 3E5NA 2MMGA 4ARVA 3CSUA 3TKLA 4U63A 1Z0FA 1T6XA 1F2TA 1QHFA 1U2RA 2E48A 2KPOA 3WJ2A 2Q45A 1UC5B 4RYDA 2H5JA 4JBXA 5ULLA 1QYWA 2HSDA 2NUAB 4FWIB 2MSCB 4MV7A 2I33A 5CHEA 3H9QA 4TYPA 4HFMA 2A9KA 2GCPA 2ZYIA 2G0NA 2B7LA 2GRAA 3UK0A 1G7CA 3OOWA 2AWNA 2DHRA 4L4YA 2PSFA 4MINA 4POAA 7REQA 1D9ZA 2PZJA 3UJAA 1E2NA 4HPXB 3VR6H 3LT2A 4JXKA 4UDXX 2R1VA 2WG1A 1F12A 1PO7A 2IITA 4D9KA 4Q00A 2VLBA 2A88A 2QTBA 3GLHA 4TUYA 2IHVA 2NACA 5JPDA 4EJSB 5FTMA 4QODA 1D7AA 1EB8A 2CXOA 4X91A 1CE8B 1IVYA 2FV8A 3L02A 5HKOA 3L6EA 4CF6A 2VBCA 4I46A 1I32A 4KLZA 3U4QA 2YJTD 1L8LA 4KRYA 2R7KA 1ORIA 1HE2A 2QZJA 1M5RA 4JA0A 4PY2A 3UJ6A 2XWJI 3BSSA 3IUNA 4CMIA 1HORA 3FKSA 3NKVA 3DMDA 5JCXA 4DNFA 5JISA 1IQRA 4X45A 3KYBA 2WFLB 1GZUA 3WISA 3WYCA 1BXRB 2R62A 1EZZA 2CUKA 2VK8A 4OFZA 2ZJ2A 3SYMA 1U7ZA 1XA3A 3GGPA 5CM9C 2YYYA 2E6KA 2X5KO 2C04A 2EJCA 4ZOLF 3IXLA 3ZHSA 1L7XA 4MMZB 2G9ZA 1EX1A 4ZEMA 2VWGA 1F6WA 2W4IA 2NNWB 3FFAA 3GUYA 3DV2A 2IIBA 4IMRA 5LBTA 4E12A 1GQFA 2V7BA 3C87A 5P8WA 1GDHA 6CHYA 5KVVA 3KKQA 2CHEA 3QPCA 3BIWA 1RRMA 2WHQA 1XDSA 2I3AA 5A71A 1JPNA 2CGEA 3CLRC 3P19A 3WIEA 2EU8A 2RHMA 4OBWA 5FX2A 5F3DA 2XWBF 2O5CA 5CEJA 2HA0A 2FEPA 4DLBA 5JCJA 5I45A 4MVJF 4XVRA 3TSOA 2VDMB 3ZDXB 1FSGA 4GPBA 2I91A 3QV1A 1A9TA 3NM5A 1PL8A 1I9CA 1TMYA 2VNAA 5DN9A 5B4TA 4GDFA 1ISPA 3ZCSA 4R2XA 2VN8A 1B4DA 1FX0B 1XIVA 1X0XA 4RMNA 2Q29A 4DV1B 1FY2A 3IJPA 4G4JA 1W1WA 4OQFA 4KWTA 4GEKA 1ETHA 4DYDA 3PXXA 1ZK0A 2ZJ0A 4ZAVA 1L3CA 4RTKA 1XXHE 3GW8A 3T4PA 1VCIA 2OXEA 2KB0A 2PZBA 1QJ4A 3F8TA 3DR3A 4RE6A 4EYOA 4EARA 2IHBA 1GSOA 2J0EA 3I76A 3UCXA 1NV8A 3AG5A 3ESXA 4YRAA 1X6VA 1W5AA 1DDGA 1QCCA 3TE7A 4EG7A 1TKRA 3UJ7A 4HLUC 1NXWA 2HBYA 1A69A 1KI6A 2UKDA 3THYB 3ROGA 4CM9A 3H04A 2VT3A 4JS0A 1NBOA 2XUDA 4AAYA 3MF4A 3N3BC 3T35A 4ML3A 3KUCA 4NWIA 4RVUA 3FFWA 1D7OA 2BMJA 4DZTA 5G53C 2G7MC 1LLQA 1P61B 3HVKA 3I4FA 2ZRFA 4ITVA 2ZUDA 4E4YA 1QKJA 2ISCA 4C2BA 4B7XA 2ODWA 2I7TA 1FC0A 1MORA 2D62A 2VH1A 3E53A 3O4HA 2KJQA 2ZR0A 4N9QA 1JNYA 1OI4A 1SZPA 3BXXA 4EPXA 1YIOA 2FPSA 5ELMA 3VAAA 4EG4A 4JXJA 3H1BA 4HRYA 4IIEA 1A8PA 2IGBA 5G3YA 2CNKA 1EX7A 3HRIA 3F3MA 3FVRA 3TXAA 3LPCA 1EP9A 3QOYA 3F5QA 4ZREA 4E2ZA 4IQGA 2QI9F 2VCHA 4DZZA 5M29A 2R48A 3ZVMA 4L5BA 4QATA 1U0GA 2QXTA 1ZM7A 5IAGA 1M83A 3HJHA 3W5CA 2OVFA 2HLHA 2LXNA 3OOJA 1XQVA 3SJZA 3OQNA 4JT8A 3WIUA 1JYSA 2XH8A 1ZI9A 4PFKA 1C9JA 1Z73A 3BFPA 5EVJA 1IZ0A 3GRZA 5IT0A 3PU6A 2CV0A 3IV6A 1U8UA 3EA0A 3NTVA 4H77A 4NEHB 4U7FA 4W7HA 1ZH2A 1RCUA 4L4RA 5IWAB 5E4TA 3JSAA 4MYTA 4F21A 4GGMX 1K5DA 3NT4A 1L5LA 3EFBA 3DOIA 3ILVA 1OMOA 4B85A 3MWDA 2MSEB 1X3SA 4F4UA 3LQYA 3RT7A 3ZOZA 1T15A 3GCDA 4DN6A 3CWCA 3RK0A 4DJDC 2IYRA 3EQ8A 1IY2A 1E92A 2QR3A 5D5HA 1VE6A 2EX1A 3FNIA 3SC6A 5IJZA 1CJCA 2I66A 2J9YB 3OE4A 3GIWA 2GYYA 1EDZA 4FHDA 4HLUA 3HRKA 1K7YA 4DC0A 4ZA2A 1N0HA 3KEMA 2AFHB 4Q1AA 3PDWA 2Z4TA 5FADA 5HIMA 2V7WA 2Q5OA 4HL6A 3KYJB 2KLHA 4HB0A 1MX3A 4QSMA 2R0QC 1WZEA 3A9TA 5I9IA 1OFHA 3B51X 5HJEA 3TAUA 1R4NB 4IF6A 1M7BA 1OXTA 3WO1A 2Y0DA 2DC1A 1OHHD 2YHAA 3HL4A 3K05A 3LUBA 1JJIA 3PSHA 2Q4TA 4HZUB 4ZI7B 4B79A 5JFGA 1X1QA 4UM9B 3OA0A 4HFNA 2YHBA 3EGXA 1Y8QB 1C5KA 2J9XB 2ZUFA 4D46A 1ID8A 1KDZA 1A4UA 2PMEA 3PNKA 4C04A 1VHTA 2AOTB 4K7JA 1OLSB 1EFUA 3ZCQA 2VR1A 4G63A 5C0OE 3JQQA 1GAWA 4JCOA 1O95A 2P4SA 4CUKA 2VJLA 4H31A 2V9CA 3ASZA 4MB2A 5DIFA 1UJBA 2WTEA 3KJHA 4MQLA 4I2NA 1RJ9B 4DLZA 2I1VB 1H4QA 2CVHA 3WLRA 5AM3A 4EK9A 2ZSEA 5CT6A 4FFBB 1BIFA 1JFFA 1XL1A 3WNBA 1Y42X 1KO1A 2QG9A 1RXYA 3EVTA 4BMZA 4UHCA 3QKWA 3HP7A 4L95C 3UUFA 2VJKA 1BE1A 1PJLA 2PT9A 2RARA 4N9WA 9ABPA 5K01A 1MJFA 1NMXA 2KYRA 3EZXA 3VZPA 1K9VF 4MR7A 5FQOA 1FLAA 1OYWA 3SP1A 3FPKA 5ILOA 1L4MA 1BX1A 1E66A 3AINA 3WL4A 5ALQA 1YNSA 4UCXA 1G64A 2N0SA 5B2ZA 4E03A 5THXA 2FG7C 5ALKA 4F06A 221PA 5E8RA 5EL0A 3RS8A 4EQ6A 3ICQB 5A9SB 3I23A 1M2EA 1P9WA 3K1YA 3K9HA 3T9CA 4PNZA 1P3Y1 2FSIA 1BFDA 4YBZA 2DFVA 1A96A 5DDIP 1QE5A 1XCMA 5C3UA 1T8TA 5JHGB 2FG6C 4PTYA 3VKGA 1RBZA 1B76A 1VKRA 2Q3FA 3F5MA 4MIOA 5L7YA 13PKA 4WBSA 1AHNA 2JFFA 1XJ0A 1KI1A 1KOFA 2GPYA 3EIQA 4H0FA 4B47A 3VNQA 4QU0A 2P90A 5A5EA 2D1YA 1Q0SA 3G8CA 4XJTA 3FYHA 4RF3A 3HCAA 3IP9A 2H4WA 3JYLA 3QHAA 4UCQA 2COUA 3GT7A 3ZYCA 1N7GA 2FPUA 3SOPA 2OCXA 4FDUA 2VP4A 3E81A 4OH1A 1R74A 2ZJAA 3VUEA 4QUEA 2BY4A 4I50B 3ZW7A 2O9JA 1G5IA 2HJVA 4RXUA 1M2HA 2H52A 2X6QA 1FRQA 4PHFA 3F47A 4D02A 4HDNA 1RLTA 3P9ZA 3OJXA 3WGHA 1Q12A 1CR0A 2O8DB 4A0GA 3A3KA 5CU7A 2WMDA 2C9DA 3WDSA 3IL2A 2JBAA 4C7OB 4N39A 2XGGA 5F78A 4H18A 2B1JA 2X8WA 3A37A 4OHWA 2JGEA 3LP5A 2FPLA 2K5UA 3P0HA 1Y9AA 3UJPA 3FHCB 2I8CA 4PSAA 4YB8A 5CA1B 1DOAA 1ONPA 2HA7A 4FDAA 1YOBA 4LJYA 3IR7A 4FDLA 1O5OA 2PNJA 2BKXA 2EKPA 4R1OA 2F48A 4QL3A 3DUWA 2XE4A 3O38A 4KXFB 4HI0E 3KTAA 3MCVA 2XCRB 2OCPA 3AEUA 4AXBA 3FYDA 4EZEA 1YQGA 3F6BX 3H84A 3SZ3A 2K7FA 2ONCA 5ECGC 5E6RB 2PT7A 3ECCA 2ZU0C 4LY9A 4CM5A 2X5OA 2BOVA 1WOMA 5TQ2A 2FLVA 1ILWA 1D6NA 1VG1A 2A0KA 2I78A 2PS9A 1L7EA 2JBWA 3DM9B 3KKZA 3LC2O 3LPNA 5A6VA 5GOTA 3GUVA 3Q3IA 2GCIA 3GJSA 5LDGA 4JFAA 3B3AA 4GPZA 4KFTA 4LZLA 4V39A 3IUQA 2OV4A 4MYCA 4TRNA 1X7DA 2Q6TA 4QU8A 2CN1A 2W37A 3H2GA 1ZO8A 3A7EA 1CQXA 4PPYA 1ECJA 3D54D 5L6LB 1NXXA 1XT6A 1DEXA 1S2LA 1MFPA 5AM4A 4E7PA 4QGSA 4KAAA 1WDKA 4IXMA 1GPLA 3T5BA 4MI6A 1X80B 3F7NA 621PA 2ZUBA 4MUNA 1PJ4A 4F5ZA 2H08A 4UREA 4L5AA 4NPHA 5JCOC 4GLJA 1WB9A 1FCJA 4QT0A 5FB3A 4RMHA 1Z12A 5ABPA 3RFTA 4D6XA 1O58A 1DV2A 1C0EA 1USUA 3JQFC 1CZUA 5L51A 1C29B 5ITSA 5LQJA 4U2DA 5ETJA 2OCIA 5HF5A 3AUFA 2GA9A 3RFXA 1P33A 3SQOA 5A0VA 4M86A 4C0WA 4XUEA 3L9XA 4NBVA 1KA9H 4DC9A 3JAKB 4FX5A 4NZPA 2DFPA 1Y9EA 3RJ5A 2VH2A 3VDXA 3C2QA 2HUNA 3R6LA 1PFYA 1VYUA 3FUVA 4B48A 1RWWA 3KT8A 1U1FA 4WZZA 5T8KC 1RP7A 4BLRA 3HVIA 4R5HA 4IQ8A 1FBNA 3TD6A 1Q2UA 2OHIA 3UC5A 3ANTA 4HDCA 2LTAA 2WSLA 3L7NA 3ZV5A 3QPWA 1IATA 3F46A 4WOBA 2CXXA 4KK4A 1DBPA 1Q0ZA 5F76A 1KMHB 2C99A 2Q9BA 3PR3A 4E0BA 2JIZA 2GBGA 1NT2A 1YC5A 4B3DA 3W78A 1TCAA 3GFTA 2FUG6 4QIHA 5A3SA 4NMMA 1RI5A 3WAJA 1Q1EA 5GONB 4BRZA 5FWDA 3IUMA 4DJAA 4IV0A 4DRXB 4YROA 3THWB 1BQ3A 4RFVA 4IILA 4KYTA 3WMEA 4EG3A 4F4JA 4YRPA 3DOUA 1S3IA 4G6ZA 3W6ZA 4W5TA 3PQ6A 1I5RA 3F7OA 3ZWWA 5DCLA 2O7VA 4XD7A 5J4LA 4HVAA 1Y1TA 4E3ZA 1NZJA 3Q10A 3AR7A 2V7TA 3KSZO 2CCKA 2HWXA 1XD8A 4R1SA 5C31A 4KQKA 4DSTA 4ETIA 4XWAA 3W9UA 3L2OB 1NJGA 2O8FA 4D41A 5J4YA 2Y27A 3TTSA 1VPWA 2IUTA 1TU3A 4RJJA 5JCOA 1AK9A 1ZUHA 2NU8B 4OYRA 4Z1OA 2ZQ5A 1SHZA 4K6KA 1TU4A 2IP2A 4AJ2A 3ZWMA 3IEMA 5AW4A 3U7FB 3LNTA 1CHDA 1UFKA 1ZIDA 1ZJ4A 2JLSA 3CXUA 3OKCA 2Y1OA 5H4GA 2QRKA 4R1QA 5DTIA 1M5TA 2BIFA 3DLHA 1G5QA 4RHEA 2DETA 3AP1A 5KSPA 4PZ0A 3ACCA 4ID3A 3T7IA 4ZC1A 3X2EA 4B43A 3Q8XB 3OTOB 5M5BA 5BO5A 1YZUA