5LB4A

Apo-structure of humanised rada-mutant humrada14
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
229
structure length
211
Chain Sequence
TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSAMYIDTENTFRPERIREIAQNRGLDPDEVLKHIAYARAFNSNHQMQLLYQASAMMVESLNTDRPYKLLIVDSLTSHFRSEYAERQQKLARFLAMLHRLANEFDIAVFVTNQATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Hydrolase
molecule keywords DNA repair and recombination protein RadA
total genus 74
structure length 211
sequence length 229
ec nomenclature
pdb deposition date 2016-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5lb4A00
1E4YA 2NGRA 1GDDA 3OZXA 4QGFA 2QROA 3MD0A 5F9FA 2DFLA 1CBUA 4C30A 2GKSA 1JJVA 4DLZA 4D4LA 3EWSA 4OL0A 4B47A 3WHLA 4PHFA 1UF9A 1UKVY 1OIVA 2HCBA 4P4TA 5E7JA 4WA7A 2R44A 2FH5B 1MKYA 3FWYA 3VR4A 4U00A 1DAIA 3MJRA 3NC1C 5DN6D 2IT1A 4QM6A 2YJTD 1FP7A 4B3BA 1ETUA 2FEOA 2D7DA 2FA9A 3DOEA 1K5DA 4LJ4A 2OFOA 5EE9A 3UG7A 3HU1A 2W00A 1BYUA 4URUR 4NKRA 5JHHB 4Q1AA 4FCWA 4A2WA 3GLGE 2ZU6A 2GHIA 4TLEA 1E1RA 3K1JA 3IQWA 4F92B 1VTKA 3TW8B 4WZBE 2WWXA 3K09A 3K9HA 1COWD 5ELXA 1S4QA 2A3RA 4HI0E 5JFGA 1UDXA 1GM5A 2YHSA 1E79A 3KKPA 2ZRDA 5EE1A 4B2IA 5EXXA 2YWHA 1UDWA 1QF9A 3KL4A 4PPFA 4TLCA 5E3HA 5HZKA 1OB2A 2CL0X 2GJ8A 4LUCA 421PA 2CL6X 4M1SA 1WRBA 1VCIA 1K8RA 5CIQA 1XJCA 1Z6GA 3B1XA 3VAAA 2OCBA 3CX8A 2RGDA 4DXAA 2ZETA 2UZIR 1O3YA 3A4LA 1WBDA 5FUXA 3DKPA 3QXJA 2YKGA 2QM8A 2REXB 3TSOA 3VU9B 2P5SA 4JT2A 1RC8A 4P32A 1MABA 1K6MA 4CVNA 2PCJA 1FMJA 4ZI3A 2Y8EA 2IW3A 3QXCA 3U7FB 2AHOA 3D6TB 4Q02A 2PT7A 3T5GA 4BFYA 3U44B 1Y3AA 1ZVQA 4HLUC 1LTQA 2WWFA 3I4LA 1MRNA 2GEDA 2VTKA 5BXQC 4URVR 3R8FA 3VKHA 3CWQA 3PUWA 1W5TA 1E1QD 2EFHB 1I4DD 3PQCA 4WAUA 4D0GA 3WHKA 2A7QA 1WP9A 2DCUA 2RAPA 3EA0A 2CJWA 3BH7A 3U3RA 4Q4HB 4IFBA 3LXXA 1GRQA 4TTPA 1NIJA 4NYJQ 1R5BA 4RKFA 2QU8A 3ZVLA 3SYLA 3AB3A 2PZEA 2JGNA 1Q1EA 1R8QA 4MKFA 3K0AB 4XVRA 5BYKA 1R7RA 1IY1A 1ZUNB 3HR7A 1E99A 2IC5A 4GZLA 4NCNA 1HURA 3BOSA 5K8IA 2NIPA 1QG4A 2EFCB 4K46A 4BRWA 1G8HA 2QRNA 2YVUA 2XNDD 5JECA 3AF4A 3QSYA 3ZS8A 3QG5A 3BXZA 5DI3B 1SKYB 3K8YA 4II7A 4TYNA 2GJSA 4Q66C 3AM1A 2ZUDA 2BEKA 2VLIA 1ZINA 4W5WA 4BLSA 4DWJA 2HYDA 2ZSDA 4OHZA 4FCVA 1ESNA 4LHZA 4CT4B 4HYYA 4IFEA 2N46A 2W6JA 1PUIA 2R62A 2ZE7A 2IYUA 2QPTA 3NEYA 1CR4A 5GJCA 3P4XA 4V0OA 4ZDWA 4LHWA 4QJ3A 5KSZA 5HTKA 3W6OA 2D7CA 2OUKA 4OYHA 1S0UA 1XTQA 3NHAA 1KI6A 4G5QA 1LB1B 3IO3A 4HZUA 3KFXA 2ORWA 4AI6A 1E9RA 2ZRJA 2B7BA 1W7AA 4V0ME 1XTJA 4LRWA 1TUIA 4AD8A 2J0VA 1U8AA 4HLQB 3TR0A 3BK7A 4MYTA 4CYMA 5BQ5A 4NYMR 2REBA 2J0UB 3LRPA 2H16A 3A8TA 4JLAA 5P21A 1Z6AA 2KBFA 5FH9A 2NG1A 2ZPTX 4CF7A 1NSTA 3PR1A 2F9MA 3CR8A 1RFLA 2DWPA 2CVFA 2IYXA 5DYIA 4ZCLA 1JEEA 1HT2E 1XD2B 5J4VA 5E95A 4YMSA 2RGXA 1E9CA 1F2TA 1Z28A 5CDFA 4A82A 4BFZA 3AVVA 2KE5A 3T1OA 4AKHA 1CP2A 5DO9A 4BLRA 3L0SA 1E0KA 3FHCB 4GBMA 4W5HA 1PLJA 1G8FA 1KI8A 2PEZA 5EZ5A 3CX7A 4YMVA 2QP9X 4C7OA 1E2QA 4RZ2A 3S1AA 2K5UA 2CNWA 2WPDD 3I62A 3LWNA 5CJPA 1I4LD 2QNRA 4C9BA 2ASEA 1SXJE 2VH5R 4CEIA 1GG2A 1DEKA 2BM0A 2CK3D 4PO8A 1MO3A 4TQUS 4BZQA 3M4YA 3U7EB 2XXAB 3P32A 2ZJAA 1HUQA 3VX3A 5HE8A 1G3UA 1G4UR 5E7IA 5AUOB 1QG2A 2A5GA 4QHTA 3IHWA 2W6IA 3ONWA 4D2IA 4LZZA 5FOSA 1P9WA 2B7CA 2WIAA 2QG6A 2V4ZA 1NN0A 3MWLA 1P73A 2IYVA 4DDUA 1G8PA 2B92A 1F5NA 4JLBA 4C3ZA 3HDTA 1OH7A 2BC9A 1WE2A 1YZKA 2FGJA 1OKKD 3L0OA 1SXJD 1LVGA 2C9CA 2QMOA 3VR5A 2YINC 1SXJA 4TLBA 1PLKA 4JJKA 4N1AA 1E1QA 4F4IA 2AKYA 5KDOA 2DFNA 1B0UA 1OJLA 1JAHA 2WZQA 4I1VA 5B2ZA 4V02A 2DR3A 1FQJA 2ZRBA 2GXAA 1R2QA 4AYTA 4M9ZA 1HYQA 1XMVA 4IEIA 1T5IA 3CKLA 1R5NA 1GNPA 4LI0A 3A4MA 2ZJ5A 5EXPA 2HDNB 2J3EA 2NPIA 3LAWA 1IXRC 2P0EA 4PFSA 2CCKA 2GZHA 2OBLA 4B43A 2BCJQ 3RS2A 2WVJA 4C0SA 4LBYA 4V0NA 1IONA 1U94A 4DUGA 3EIEA 1OIWA 2A9KA 1CS4C 4QG7A 3FPAA 3B7GA 3KKOA 1QHGA 1XDBA 2QP4A 2CNWD 3ADDA 2IUTA 1G41A 3LW7A 4QGHA 5GVRA 1G3MA 3ICEA 1L4YA 1W49A 2F3RA 5F2EA 3GFPA 3CH5A 4KLNA 2A78A 1NI3A 2PLRA 3T61A 1KI4A 3FHOA 4EIWA 1HE1C 2XNSA 3HYTA 4C0LA 5KOYA 1N2CE 1T5LA 2A5YB 5EP4A 3UKDA 2W2TA 1XMJA 4TZ6A 1IN6A 1E2IA 5CB6A 4MKIA 4EUNA 4AG6A 4XTRA 4FXPA 2RGNC 1AGPA 3FOZA 3U3JA 4PZYA 1XBTA 3V00A 1TEXA 2OFWA 2CXXA 4OQFA 1TPZA 3GLFE 5KPJA 3AKDA 3ZLJA 2RGEA 3AVPA 3B5JA 1UKYA 2ECKA 3WNDA 1M6NA 1YZLA 2QAGB 1RRPA 1Z63A 1ZUHA 4O2RA 3DHWC 2AKAB 3EZ7A 4G3XA 1GSIA 4I4LA 4MUAA 4NL4H 1KJYA 1NKSA 1SXJB 1JR6A 4MITA 4ZDIA 2PZGA 2OCPA 4HAUA 2XB2A 1G21E 3LVRE 2XOKA 5C1BA 1FMLA 2H57A 2QAGC 4WXPA 2XZOA 1EX6A 1ZM3A 1F2UA 1OH8A 4G01B 1NVVR 1Z6TA 1AS3A 5HPYB 3IIKA 3B60A 2CVHA 1SVLA 4RD4A 2ODEA 4M1KA 1DELA 3ADBA 2G83A 3DPUA 3D3QA 4L4UA 3F8TA 1XMSA 3LV8A 4GRAA 1FQKA 4BFVA 2BIFA 1TX4B 2HXSA 4DCSA 4E09A 3CX6A 4BUJA 3DKVA 2A30A 1G20E 2WSSD 3ASYA 4KHZA 2JA1A 2OV2A 1XF9A 3SE0A 4EFNA 3SR0A 1T6NA 5JJIA 2PT5A 1HT1E 1IBRA 2GETA 2WJGA 5LB4A 4XWKA 4PTLA 5JMTA 2NMVA 3I92A 3CB4A 3AF0A 1MO5A 1KO4A 5FFMA 3ADCA 4X8OA 1F2UB 4DLRA 1OFHA 3NC0C 4PQYA 2QQ0A 1FX0A 2NO9A 1JEDA 4QGAA 4UNPA 2FPKA 4Q7MB 3QPWA 3IIMA 4JKYA 3DEFA 4JBWA 3THWB 1L7VC 4XH9B 4G5OA 1O87A 3UG6A 4EPWA 1IN4A 1E2GA 4FMDB 4ON9A 3CZQA 1N6HA 5L3VA 2WOJA 1OKKA 1NJFA 1BS1A 4I1OA 1OV4A 3CONA 1W46A 4DIEA 3G0HA 4P31A 1Z83A 2D2FA 2NTYC 4QXAA 4DLVA 3QPUA 2QT0A 1X6VA 4M1TA 1YQTA 1XEWY 2QZ4A 4Y0AA 2VO1A 2WAXA 4NCIA 1JAIA 4HB2A 4D80A 1J7KA 4LYJA 3B78A 2XOKD 4QBIA 3H0KA 3L0PA 1M7GA 4RD3A 2XTMA 4ESVA 4UJ5A 3NIBA 4OJQA 4LJAA 1VYVA 2IBMA 1A7JA 1XMIA 3CO5A 4FI3C 4B3GA 2CK3A 4Q03A 4U7DA 4M9XA 1HQYE 3JZMA 4CEHA 2VP0A 4R7ZA 2F43A 2C2HA 3THYB 2QTHA 4HLCA 3LQRA 1KGDA 2NZJA 2IUUA 2ZS8A 4B48A 5DH9A 4KCGA 2G3YA 1XCMA 1ZC3A 4TMTA 4E07A 4IVPA 2VQSA 2OG2A 1KYIA 3TNFA 1U9IA 1US8A 3VQTA 4Q00A 3K70C 2J46A 4OHVA 3W9YA 4Q1EA 1XXHA 3GLHB 4HB3A 4IVRA 3GLIB 4FIDA 2Q9BA 1E32A 5KNDA 3R9IA 1NF3A 4POAA 4ITRC 5IF9A 1PVOA 3F5FA 4MRVA 1N6PA 1SKQA 5JJKA 1E4VA 1W0KA 3DM9B 2VP9A 4ASUA 3FKQA 3BERA 1IN7A 4JT4A 3BORA 1AS2A 4A0GA 4JL6A 4MA4A 1SVKA 3DM5A 5F3WB 1J70A 8OHMA 2DB3A 3FVQA 4WZAE 3UMRA 2HEIA 2ZI6A 1R5OA 3BH6A 2O8DB 2HUPA 3TMKA 4GP7A 3M1IA 3FHTA 2J87A 3THWA 4IOLA 2ZJOA 3I32A 1BIFA 1T91A 3UMFA 1GTVA 3V4RA 2JIZD 3RWMB 1X8LA 2GF9A 1M2OB 2BMDA 3VHXA 3FMOB 2IA5A 1S9DA 1JXMA 2VRWA 3Q3JB 3LY5A 4I1UA 4RZUA 4Q4JA 4LV6A 4NYJR 4A8JC 1P72A 1NLFA 3AP2A 4WIAA 2Z0MA 3L2OB 2ERYA 2JDID 1L4UA 4I1SA 4XVQA 2PX3A 3U6BA 3U5ZB 4ESHA 3KQUA 4FCTA 1M7BA 2JJ1D 4P33A 4WBSA 3W6PA 3SYNA 1VECA 5SZHB 1S96A 1ZD1A 1P2TA 4OK5A 2Q3MA 1VYUA 2B8TA 3NXSA 3PUYA 1NSFA 3VNUA 2MSEB 5FTKA 1BYIA 2VP2A 4QJ5A 1EWQA 3K70B 3OEHA 4RZXA 1FZQA 2RCNA 2GCOA 1NN1A 2FNAA 3WMEA 1J2JA 2P5TB 4DDTA 2A5DA 3CF6R 2ZAMA 1R4AA 3CRMA 3FFBA 1KSGA 5EXTA 1CF4A 1T4GA 2EYQA 3SOPA 5JS8A 3W5IA 2VEDA 3GJ6A 4L5BA 1RE0A 4DEYA 4EPVA 3U44A 4YC7A 1P2UA 3U4QA 3QUSA 4BQSA 4CT5A 2RHDA 2J0SA 3QQ5A 4KVGA 3IKJA 1EFTA 1DAGA 2LWIA 2ZRAA 3AP3A 5EE5B 3AVWA 2TMKA 3RAPR 4R98A 121PA 1X86B 2WSSA 2ZVQX 4RY2A 3TGPA 5CYOA 4LYFA 2D06A 4ILEA 4KJZA 1W1WA 1G3RA 4IHQA 3FKSD 6Q21A 3CH4B 2JLYA 1ZD8A 4R71A 3FTQA 5C46F 1U0JA 3ZDQA 1YR8A 2CLDX 1CIPA 3LDAA 2MMGA 4DCNA 2WBLC 2YYZA 3QKSA 3OEED 3OF5A 2FSFA 4IXMA 4Q4AA 5D3MB 5G41A 1D6JA 5AUPB 3MWYW 5JEDA 3VKWA 1VDZA 1DO0A 5A0FA 3W8NA 1Q1ZA 3CR7A 4KO8A 1EG7A 2BVNA 1E0AA 3WMGA 2AN9A 4BFUA 1LFDB 2O0JA 1GZSA 3CNNA 4Q4LA 1OHHD 3SJCA 3X2SA 2EFGA 4ZV4A 4E22A 2BBOA 5EJEA 2JEOA 2V1UA 2G1KA 1Z0IA 3HP1A 4HAXA 1OIXA 1FW6A 2HT6A 3EG5A 2JLRA 4JLJA 4WW0A 1D2EA 3CF2A 1JPNA 5SZKB 1BOFA 1GILA 5JLJA 1VCMA 5M04A 1P61B 1JR3A 1ZM9A 1D2MA 4G1UC 4OK6A 1S3GA 4ASUD 5HKKA 2ZREA 1CRQA 1NBMA 1JJ7A 5FTJA 3WP1B 4DSOA 1N3BA 2DPXA 4L8GA 2O52A 1WF3A 3TW4A 5C2JB 2ZI5A 3N2EA 2AX4A 4MUBA 4WZ6A 1A1VA 5FBWB 5H1YA 4PZLA 2H92A 1W2GA 2RGCA 2ZI9A 4FD2A 4B34A 4EJSC 2C9OA 4A92A 1KZGB 2YOFA 4TN1A 2WAYA 2FF7A 2ZJ8A 2GEUA 3C41J 3ZVMA 4MGZR 4O3MA 1C1YA 5H68A 4M4SA 4AURA 821PA 3GLFB 2ERXA 1KY3A 1KAOA 2NO7A 2QM7A 1NL3A 1AZSC 1EFRA 1OXUA 1DAKA 1NBME 1XTKA 4M53A 4Q4HA 3VR2A 1G6OA 2ATVA 3WYGA 3SJAA 4TL6A 5J4HA 1A2KC 2C04A 1HH4A 2PBRA 1KO1A 2HLDD 1EXMA 2LKCA 2VHTA 1W36B 1GOTA 2J1LA 2GDJA 2QQEA 3TSWA 4RZ3A 5J4KA 4RSGA 1Z2AA 4NH0A 2PCLA 1EFCA 1AM4D 3V9PA 2QN6A 1XX6A 4KFRA 4S35A 1ZNYA 5KU1A 1E69A 1OXXK 2WJJA 1KAGA 4YDHB 1N6OA 2EW1A 4KYIB 3GJ7A 1F6BA 4C4PA 3PIRA 1Z6XA 3FB4A 5GJWC 5KO2A 3KQKA 4QHYA 3RRZA 3NVAA 5CM9C 4CIDA 3FKSA 4ZPXA 5CB8A 1KI2A 4UNRA 1AS0A 1YR9A 4IDNA 3S1AB 4DVGA 3C4JA 2ZS9A 3OHMA 1LW7A 3QBVA 3RLFA 1XPOA 2BMEA 2GVDC 2Z5FA 3I8XA 4CEIB 2CCJA 2ZANA 2G0TA 3DVLA 2Z83A 3EZFA 1GL6A 4PSKA 1Q3HA 3SJBA 4DCTA 1KKLA 2ZRNA 3BFXA 1TU3A 4X8HA 4GNKA 5FOTA 3QY0A 1YU9A 4C0BA 1E96A 2P67A 3RYTC 4JLMA 3TLXA 2CLSA 3WP0A 3HU2A 4MRSA 4D0NA 1CJTC 3FGNA 4ZIRA 3CNLA 3QNUA 4JLPA 2C77A 3LNCA 5TDHA 4GPTA 3R9WA 1Z6YA 2OLKA 4FN5A 4BLQA 2BMFA 2GCNA 2IYSA 1QHNA 2EWWA 2Q3HA 3QENA 3NDBB 2YOHA 2JASA 2Q9CA 2WMNB 3K0CA 3KKNA 1D5CA 4X8MA 2DFKB 4RFSB 3HPRA 2P6NA 2JJ1A 1S8FA 4XSGA 3ZH9B 4D6PA 5JEEA 4URZR 3U7GA 1Z06A 1TF7A 3T1QA 2FFAA 3GJ4A 4D82A 2FGKA 2IEZA 4AC9A 4H1UA 1OE0A 3UANA 3PEWA 1XD2A 3O47A 3RS3A 3U3OA 1X8JA 1IHUA 2KI5A 2R6GA 4IDHA 4Q9LA 4NCKA 4PO9A 1NBMD 1F2TB 3E2IA 3Q85A 2O8EB 4BFXA 2V54A 4MKHA 1PZNA 3K09C 3CRW1 4AY2A 5KSOA 2Q6TA 3SYKA 4N0EA 3SI7A 2E87A 4IDPA 4QL3A 2F43B 3RSOA 2J7PD 2PZFA 3MRSA 3ZVRA 4KI0A 3O8RA 1E9SA 1OHHA 3GEIA 4TMXA 1WQ1R 3CRVA 4YMTA 1XJQA 1BO6A 2IXEA 2QAJA 1CJKC 1V5WA 1D9ZA 1U81A 4WXRA 1W0KD 3WBJA 4Q21A 2IUSA 3BE4A 3A58B 1ZYUA 1G3QA 2XJ4A 4LBWA 2BCGY 2VL7A 4TL9A 5TV2A 3BH0A 3DMNA 1XCPA 3IHLA 1XXHB 3GLHA 2XTNA 2ZRHA 3BFKA 4PAMA 4CZ2A 5TARA 1N6LA 2ZYWX 2NO6A 1Z5ZA 5JWRA 4A36A 2LKDA 1G5PA 2BBWA 3BJIC 5JS7A 1GKUB 4IOMA 1KK0A 1E9AA 4EJSB 4D0LB 3P26A 5JCPA 4GSYA 3CWZA 3ZJYA 2GK6A 4B75A 3WYAA 3I72A 1RJ9A 4IVQA 3Q5EA 2ZS7A 2ODBA 3K0CC 1AJEA 5H8WA 2ZJYA 4KITB 5EZ6B 1FTSA 4EQ6A 4C0AC 3OIWA 4DJTA 1VG9B 2G1JA 4PPNA 1N6KA 3KXKA 5FTLA 5KYKA 1DOAA 5FBVB 1U2RA 3SNHA 5JI3E 1N0UA 3IEUA 1KDOA 5DHAA 2AXPA 2OCYC 3LBHA 5IK2D 2FFQA 3MGCA 3T1VA 4JVLA 1P3JA 2ZTSA 4FW9A 3KX2A 3GFTA 4JYBA 3H1TA 4Q5IA 2N42A 2VIIA 1G18A 1AN0A 4Q9IA 5L8VA 3GP8A 3X1ZA 5J5CA 3K0FA 3OEHD 5JCZA 2QGZA 3HYRA 1MABB 3OFND 4EFLA 4NZYA 4TT3D 2WICA 1NLZA 1UADA 2YNMA 3VR3A 1FNMA 1J99A 2CHQA 4Q7JB 1KMHB 4FMDF 2VSOA 2O8CA 1VG1A 2QRZA 4LDJA 1RYHA 4GOKA 1G5RA 4PR0A 3PUVA 3RVBA 1JI0A 1XWIA 4KODA 1VHTA 3TR5A 5IK2A 4EQ6B 1KO5A 2H5EA 1EFHA 3RRYA 4QBHA 2RGAA 1A2BA 3C15C 1V43A 1Z29A 4LPKA 4JLVA 4QBFA 4LY6A 2PLFA 3OIVA 1G5TA 2L0XA 2GTPA 5IHPA 3P4YA 5J4YA 1G1MA 4XWOA 3DMDA 3H86A 4OJKA 3E70C 2QMHA 3THXA 1GFIA 3GLGA 4TMWA 2E9SA 4Q9JA 5FBRB 1R0YA 1KSFX 5AK0A 3RC3A 2IYRA 3D8BA 1MO6A 3EASA 3Q8XB 4HATA 1K5GA 4HDOB 5SZIA 3UWOA 1MV5A 3B85A 1DS6A 1EFRD 2BEJA 3ZQ6A 2ZUCA 1C9KA 1LS1A 2P6UA 4P4SA 2RB4A 2ZXUA 2RGBA 4GFDA 4N0DA 4B76A 1NG9A 4JBYA 4BFSA 1CR0A 3NH9A 4HDCA 3SHFA 1IN5A 1VG0B 1XRJA 1GP2A 2R8RA 4LHVA 1KI1A 1IJEA 4M0LA 5JJLA 3OAAD 4QOSA 5FPSA 3WXMA 3C5HA 2DYKA 5AJZA 2EFDB 5AR1A 4YQFA 2ZYTX 1RKBA 1Z8FA 1YHNA 2HCJB 4CW7A 1DAMA 1E2JA 1NY5A 1QHSA 5A5GA 2GEVA 5FR1A 3GLIE 3KZ1E 3UMSA 4F38A 3K9LA 3M6AA 2O8BB 4HLDA 3BC1A 3AKCA 1Q22A 4EFMA 1R0XA 1ZNXA 3IDQA 4A6XA 4B74A 1E1RD 4XJXA 2QP3A 2GJAA 5FPYA 2QPAA 3J81k 3LX5A 2JJ8A 4DDWA 3CW2A 1E9EA 1YZQA 2CEAA 3AF2A 4OK3A 4UNSA 1QHXA 521PA 2QA5A 1HE8B 4XSHA 1Z22A 1NLYA 2O5VA 2Z6VA 5EP3A 4C0QC 1P5ZB 2P2LA 4BZPA 2BBSA 4DT1B 5LBIA 4XVUA 1Q44A 3TAUA 2O8FA 4A1FA 2ZUBA 2FZ4A 4ERNA 1OFUX 3SC3A 4JIMA 2AL7A 3H2YA 2B8WA 2O0KA 4DCUA 4KLZA 3B9PA 4YDSA 4OQNA 4QFMA 4JSTA 4B2LA 1DAEA 5K8UA 3O8DA 2BWJA 3LBIA 1OFTA 2R2AA 1HV8A 1Q21A 2JLVA 5FTNA 1DPFA 1T8UA 721PA 2P3SA 2YOGA 2FMXA 4BECA 1E2EA 2OXRA 4A2QA 2A5FA 2ZSEA 1XEWX 3FMIA 3KKMA 4IRUB 4BLPA 3VKGA 1Q20A 2NO1A 3K53A 1NG1A 3PUZA 2NZ8A 1XZQA 3ZS9A 1QRAA 4K8OA 1UAAA 3GJXC 1E98A 1R8SA 2IL1A 3PXGA 1ESMA 1P4SA 3EIHA 1H8ED 3MFYA 3AH8A 1HEIA 2AFHE 3AF3A 4OI0A 2XGJA 4URXR 4R9UC 4MYCA 2OHFA 4KAXA 2IHYA 4Y0VA 1ZJ6A 3P1JA 3W3AA 2OAQ1 4V0KA 2ONKA 4TMVA 2GXQA 4LYHA 3VTKA 1AZTA 4Q19A 4TWZA 3EC1A 4M1WA 3T35A 2N1BA 2C5LA 2ZRMA 4GMDA 3T15A 2H1LA 3W90A 1AQUA 2J59A 4F4CA 1ZIOA 4YXWD 1LNZA 3BWDD 1SQ5A 1UBCA 1MT0A 4M1OA 4UNNA 3SJZA 1U9IC 3VX4A 2H17A 5JRZA 4C0HA 1FUKA 1E94E 4KSBA 3REGA 3WRXC 1ZRHA 2V3CC 1ZU4A 4JZKA 2CLCX 2D74A 3NWJA 3IPXA 1M8PA 4B44A 2ZRFA 3GCGA 3TUZC 2D4HA 3O8BA 2QPOA 3RC8A 2X8AA 2FSGA 5J4LA 1SULA 4QGGA 4V0LA 3UK6A 4TL7A 4LJ5A 1QDEA 3GLFA 1YZTA 3LLMA 3AF1A 4G0NA 4Q1BA 1S3SA 2BHRA 3PG5A 2C98A 1DBSA 3R9XA 1W4AA 4YONB 1DG1G 2WV9A 4DSUA 5G53C 3CUEF 3MAAC 3ZIAA 2QT1A 4US1R 1GKIA 2NO0A 3G5UA 4B3XA 3KQLA 4G5RA 1NMXA 2QE7D 2WWHA 3NBZC 4IKEA 4NYIR 2IX3A 1TNDA 4LGMA 4Q4JB 2MSDB 3AVQA 5KNCA 1II8B 3Q7PA 1UEIA 4CDGA 2MMCA 5AWFC 4P0TA 4DLYA 4BGDA 2GBLC 2GESA 4PSVA 4ZCIA 3R20A 2PH1A 1BKDR 1NRJB 1R6BX 5EP2A 1OFIA 5CDFE 2OBMA 3B1ZA 1GL9B 2ZI3A 1N25A 5DYGA 2WWYA 3UPUA 1X8KA 2J45A 2VSXA 2GF0A 3OESA 3ZQJA 2O8EA 2Q21A 3LXRA 3I61A 1N0VC 1YZUA 3AKEA 4TYQA 1ZC4A 1YVDA 1G64A 2BM1A 2YWFA 4PXAA 1G7SA 2X19A 5G3ZA 2VP5A 2WJHA 4TSFD 3HWSA 2WWWA 1US8B 4BFTA 1N5LA 4AKIA 4UKDA 4FMCB 4KU4A 3B8HA 1JQLB 1WXQA 1N5JA 3MWJA 3IEVA 2ZITA 3EZ2A 2XZLA 1LF5A 1XD9A 3K9NA 2FN4A 2FSIA 2P65A 2JAQA 3QKRA 4LCBA 4O2LA 5KSYA 4CEJA 1JPJA 2F55A 3CBQA 4PC7A 4EPXA 3MWKA 1FNNA 2WMOB 2BKEA 3I3SR 4Z54A 2JJ2D 4IW3B 4B35A 1ZMXA 2PX0A 4RD2A 4Z1MA 4J0QA 3K70D 4DBLC 5DI3A 2JLUA 3CIOA 4A8JB 2W58A 1UBEA 4IDQA 3AGPA 3GJ3A 2R6FA 1RPZA 1VMAA 4MH0R 1KO8A 4JVNA 5FR2A 3EC2A 3QIAA 1W4BA 3W34A 1FFHA 5K8LA 3O8CA 1Y63A 1YKSA 3REFA 1FL9A 4UXHA 3UXMA 1XCGB 4GOJA 2FFHA 2BMJA 4HAVA 4Q4AB 4KFSA 1E0JA 5EQTA 2OAP1 1G16A 2W6ID 2Z4SA 1CULC 5KDDA 1GNRA 3IUYA 4IDOA 4EAQA 4PO1A 5CIWA 1II9A 2WKPA 2OXCA 1XTIA 1S1CA 1E9FA 4XTCS 3THOA 5IT5A 5JHGB 4QNMA 5FL3A 4M1MA 2VYFA 4O0MA 4KBFA 4Z8XA 1P2VA 2BKUA 3K0FB 4AKGA 1GVNB 1E2KA 1JECA 2R65A 4JBXA 5GADl 2ANCA 3AUXA 2ODNA 3BGWA 3U6KA 3AVUA 4PAQA 1PV4A 4TZ0A 5FOVA 4W7SA 3U4QB 1PUJA 1YRAA 2WWIA 1DAFA 2GNOA 4KFUA 2XSZD 4L16A 4PC6A 1I2DA 1KK1A 3NG1A 3KXIA 4RJLA 1TQ2A 2UVQA 1M34E 1JR3D 2F3TA 3IILA 5IRCD 2JLWA 2QAGA 4NDZA 2IYYA 2I4IA 5SZJA 2C99A 4C7OB 4ZKEA 1GKYA 4LJ6A 3VU9A 1XJ0A 3GPLA 3KJEA 4A9AA 1TQ4A 1G8YA 1KOFA 2QENA 2FDCA 1LF0A 4TYWA 4W5JA 1ONBA 3HJNA 3CRQA 3DZDA 3R7WB 2F9LA 2WWGA 3W8RA 3TJZA 3EPJA 3OIYA 1CLUA 5K8TA 2VA8A 2W2VA 2XSZA 2ZE5A 1ZNWA 3ZZUA 3TKLA 1OXSC 1W5SA 4B71A 2R9VA 2ZR9A 2GILA 4C0KA 4JLDA 3CF0A 4U02A 5DGXA 4AYXA 4A4DA 2F1RA 2C8VA 1IJFA 4EJSA 5HCIA 4GZMA 1N6IA 2A5JA 5FOXA 2JLSA 4QRHA 2BBTA 3SFVA 2CDNA 3QPVA 2I1QA 4DSNA 4GL2A 1COWA 4M2LA 1G17A 1B23P 5DE3A 1Z0FA 2OESA 1F3OA 4DUGD 3EPKA 4M9SA 2WM9B 3HU3A 2AK2A 2VHJA 1UKZA 1KNQA 4L15A 2XX3A 2EYUA 5DISB 4PX9A 1GNQA 3UATA 4YMUA 1UBFA 2AR7A 1UKEA 1XP8A 4I99A 1W4CA 1N0WA 1SHKA 5BN5A 2JLXA 1NP6A 2ZROA 3B6EA 4MRRA 4RKEA 1NVVQ 3GJ5A 2GZDA 4YMWA 4L9SA 5TB5A 4TMKA 1WBBA 2XJ9A 2OZEA 1YJ5A 4Q48A 3P27A 3X1YA 2EU8A 4DZZA 1QBKC 2ZYVX 1GRNA 4TTQA 3SDZA 2FPMA 2G88A 3LVQE 4GT1A 4AG5A 2DWOA 4Q18A 3E1SA 1H8HD 1ZP6A 2JJ2A 3L8YA 2V1XA 3W6NA 3KUCA 4A0HA 1CEEA 1F48A 4RFSA 3I1FA 1SXJC 4B3FX 1TF5A 4RD6A 1QZXA 1E6CA 2KB0A 2A2ZA 5BN4A 4TQAA 3TE6A 3ND8A 2ZRPA 2WOOA 5DLQC 1ELOA 2WKRA 3NBYC 1W0JA 4BEJA 4PQFA 2V8OA 5F98A 1NVUQ 2VHUA 1ANKA 1DG3A 3AGQA 1W44A 4LC0A 3GMTA 3QF4B 3RS7A 3EPLA 2GWHA 3EZ9A 4HAWA 4KFTA 1SVSA 4MDFA 4LC1A 4LPSA 3U7HB 1P2SA 3SQXA 1X1SA 1P9RA 3KB1A 2GA8A 3C14C 2G77B 2IWRA 3RABA 1NN3A 1U99A 3AVTA 2QSZA 1G19A 2FU5C 2ONJA 1E2PA 1Z0KA 2G9NA 4I81A 1G4AE 2IF2A 1GL7A 1CJVC 1ZW6A 3I5XA 4NMMA 1WMSA 1P60A 1U8ZA 2FV8A 2FWRA 2ZQ5A 2DWQA 5JI2E 621PA 4Q7KA 1G7CA 2HT1A 2IS6A 1JBKA 3AVYA 4US2R 2KWIA 1SVMA 4NBSA 3BAFA 4DRZA 5LD2B 3KTAB 4F7WA 4H9GA 2ORIA 1SKYE 3QI2A 1ZM2A 1ZM7A 4M22A 2XZPA 1SGWA 3BB1A 3QF7A 2IF0A 3SZRA 4LJYA 4S2EA 1NNEA 2CMKA 1OSNA 2GJ9A 2GXSA 1LV7A 2V6JA 4LYAA 4ARZA 3TVDA 2QTFA 4RD0A 3X1WA 3AQ4A 5GVSA 2BV3A 1W36C 1EGAA 1ODFA 1ZUIA 2G0NA 2FSHA 5FTMA 2PEYA 4E5UA 2F1HA 4URYR 5JBQA 2IS4A 1JQJC 1IN8A 4IJMA 1E2NA 2GCOB 3B82A 2GK7A 2OE2A 2I3BA 1CR1A 1VPLA 3KFVA 4WOPA 4OI1A 1W36D 3CZPA 1DAHA 3PVSA 4DDVA 5LPNA 5E7MA 4PSAA 1W47A 1N6NA 3U60B 2R6CA 2AXNA 5DN6A 4A2PA 4U5XA 4A15A 3A36A 4CEHB 2PMKA 3AEZA 4QJ4A 1E2MA 5TMPA 4HB0A 1P6XA 2VHQA 3B1VA 5CITA 3AUYA 5KUTA 1G6HA 1KSJA 1MO4A 1E2LA 1VCNA 3KQHA 4TYPA 5DHFA 3K0EA 3PFIA 3L82B 2FEMA 3DOFA 2RMKA 4RFVA 2ZJZA 3TUJC 3SQWA 1VIAA 1T8TA 2QEQA 3PEUA 2HJGA 2GRJA 2Q9AA 3L43A 1YZNA 4TTRA 1T9HA 1T0JB 1UFQA 2B21A 2XNDA 4HEJA 3TRFA 5BYJA 4HSEA 4F91B 2YV5A 4PANA 2QSYA 4MKGA 4YLGA 1CKEA 4BWYA 1LY1A 1M7HA 4Q01A 3ECCA 1TL7C 2XAUA 3B2EA 4HUTA 5A4JA 2VP4A 3K0SA 5D3MA 3ZZ0A 2LCFA 2IYWA 2OSBA 2ZI4A 3KB2A 1C4OA 4C2TA 3OE7A 4EPRA 3Q72A 4H1VA 2V7QA 3NBFA 4MYUA 3KQNA 4QBGB 3AVXA 3ICQB 3RHFA 4F93B 1GIAA 5JRJA 3QKRB 4P4UA 4LJ7A 1CU1A 3THXB 3ZD7A 2WJIA 4CEJB 3THYA 5G40A 1EK0A 1S9HA 3TBKA 4A0FA 4PC1A 2YWGA 3AV0B 5B64A 1TU4A 4Z1MD 2HV8A 3QXHA 1ZCBA 5CYPA 2Z4RA 3X1DA 1IQPA 2OFXA 2JATA 4B32A 2YWEA 2FFBA 2V7QD 5CLQA 4DLXA 4DLWA 4BLOA 1OW3B 3OE7D 2J7KA 1FPMA 1N6RA 1A4RA 1KI9A 3R7WA 3SBDA 4D4MA 1Z07A 1ZCAA 3N5CA 2JLZA 1HQCA 1I4TD 1VIYA 1DVRA 1G8GA 2D62A 3JZAA 4OQXA 2H18A 3B1YA 2F1JA 2YC2C 1P7CA 3LBNA 1SVIA 2OEPA 3C5CA 3U3MA 1RW4A 4QHSA 2GCPA 2AWOA 1Q12A 3KKQA 3A6PC 1XB2A 2ZSAA 1Q0UA 2B6HA 1J8YF 2O0HA 4HUQB 4OBEA 4EDHA 5KNBA 1NMZA 1QVRA 4KVAA 2WIBA 5FL7A 5C18A 2WTUA 4US0R 5J40A 1E3MA 5L3RA 3N70A 2MSCB 4D4KA 3SBEA 3NBXX 3TQCA 3ZYCA 3WNCA 3CM0A 3FMFA 3H84A 4R2IA 3EW9A 5DSZA 2V55B 2QUZA 1FP6A 2XTZA 5AJXA 1FUUA 2WHXA 5EXSA 3QKUA 1P75A 5FPTA 1W4RA 5JSZB 2VF8A 4JYCA 5L3QA 5EE3A 3BD9A 1KO7A 4GOXA 4K81B 3RS0A 1RRCA 3NTUA 5BWMA 1G7TA 1VYTA 5FPHA 2AWNA 4ACAA 3WMFA 2NPFA 1QHHA 1FX0B 4M1YA 3ETLA 4HUQA 4BEBA 1U98A 5KHOC 1E0SA 2REOA 3KJGA 4LX0A 2WSMA 1OPXA 4N3NA 1KDTA 2ZU0C 4JS0A 3Q9LA 1JR3E 1NJGA 1FTNA 3IPYA 4CRWB 2ZYUX 2HJVA 3KDSE 2E1RA 1NVWQ 1ZNZA 1RYFA 3MMPA 4LHXA 5EP1A 3U3KA 4UQOA 4GI7A 1Z0AA 4KYUA 4OQLA 2VBCA 1U90A 2ZSBA 1BMFD 2ZEJA 4IOKA 3GLIA 1NY6A 1YZGA 2QMEA 2F6RA 5LDDC 4V03A 2ZJ2A 4FMCF 3RDPA 1KHTA 1HTWA 1XEFA 4AWXA 5B30A 1OLOA 1CJUC 3OEEA 3UWKA 3M0EA 1IY2A 2IYTA 4AKEA 3FFAA 4PHGA 4QKQA 1KI7A 1DTSA 5FPKA 1I2MA 3LO5A 1XZPA 1NKTA 4JLNA 3OFNA 4QNRA 3GQBA 4LBVA 4PZZA 4GP6A 1KY2A 2HXYA 1AA9A 3LA6A 5AJWA 1KI3A 3T06B 2PJRA 3JVUA 3PJRA 3CPJB 4A0RA 4EKDA 4B3DA 4PC3A 1RRFA 1S1MA 4XWAA 3NEJA 1TTTA 2OT3B 1RZ3A 2CHGA 3MUFA 4IEEA 2BJVA 2Q0HA 1G9XA 3C16C 3EIQA 3QG1A 4FWIB 1W0JD 4QM7A 2V6IA 2XEXA 4Q9KA 2WJVA 1CJMA 5ANRB 3GLGB 2KSQA 4PQRA 2D3WA 3EPHA 2GJKA 3KJHA 4PC2A 3PV0A 1RVDA 1TMKA 1H8HA 1M1YE 3A1WA 1HA3A 3EXAA 2ZRGA 3EARA 4B2PA 3Q7QA 1DARA 1XXHE 2X77A 1XEXA 2GZAA 1E2DA 2AD1A 2WKQA 5AJYA 1EESA 2AFIE 4RVCA 1R0WA 1VCOA 1JALA 3F3YA 5AUQA 4NE2A 3I8SA 3L8ZA 1QHIA 4C0JA 2IYLD 1XU4A 4ZO4A 3BFVA 4P3YA 4Q9HA 2JDIA 3NH6A 4FMBB 1S2MA 1DE0A 1WDTA 4R2HA 1XPRA 5FI0B 1BMFA 3KJIA 4LBZA 5F9HA 2OBNA 4G5GA 3FE2A 1P9NA 1II0A 4NONA 4D4JA 5C4MA 4D25A 2KBEA 3GJ8A 1TQ6A 3BB4A 2JIZA 1PJRA 2EQBA 2ZM5A 3HPQA 2ZR0A 4PPQA 2P6RA 4GDFA 2IWHA 4B33A 1W48A 3E5HA 1UPTA 1RRGA 1MR3F 4AYWA 1J90A 1D8TA 5EUQB 2WPDA 5DIFA 5KTYA 1KK3A 3B13B 1VKJA 2HF9A 2RKOA 1DO2A 3EAQA 4ZCMA 1N5KA 2IXGA 4Z51A 3FMPB 2O8CB 1WCV1 1UBGA 1Z3IX 3C7KA 4TLAA 3TVTA 3P20A 1RJ9B 3QKSB 1Q1BA 2IYZA 4XD7A 5CK4A 5BW8A 2XXAA 4P4SB 3RS5A 4XIGS 5FOWA 1QHYA 2BOVA 4L9WA 1EX7A 4V0MA 3VNVA 5H70A 4FINA 2CCGA 3RNLA 2RGGA 1KKMA 3W5JA 4M8NE 2F7SA 2QE7A 1Q57A 2ZE6A 2QY9A 2ZI7A 3BIFA 4RCYA 4CGZA 5L3SA 2ODWA 2KJQA 1ZIPA 4QC2A 2QL6A 3CNOA 2FJUA 4KSCA 3T5DA 3TQFA 5FL7D 4PHHA 2FOLA 3ADKA 1Z47A 4RCZA 1MOZA 1Q1QA 2HF8A 3QVUA 2ZVPX 4DLSA 4OHXA 5AJVB 4FWTA 4MGIR 1ZBDA 1KJWA 1XNJA 2RH5A 3GLHE 5D3QA 3IIJA 4Z8YA 1UJ2A 4JMPA 1XPUA 3R8CA 2J0UA 3GFOA 1YE8A 1IM2A 3T12A 2QGNA 3PCRB 3DL0A 1KIMA 3QVVA 4NYMQ 3TUIC 2QI9C 1GITA 3IBGA 3Q5DA 1AKEA 2FE4A 5HZHA 3D31A 2JLQA 5DI9A 1IY0A 1EFUA 3B1WA 3C8UA 4C2UA 1IAQA 3RANA 5JZVA 4LSGA 1OYWA 2OILA 3LH5A 2FX3A 2W6JD 3OIUA 1AKYA 3RS4A 2IXFA 3LFUA 3PITA 1XTSA 2O8DA 1TEVA 4JJZA 4NU0A 2RGNA 5FBQB 4HB4A 2AK3A 4NCJA 5FUVA 1M74A 2W2XA 2QMUA 2GAOA 2D2EA 3RWOA 3BRWD 3GD7A 2ZJBA 5B58C 4JVSB 1GWNA 3T34A 4DLUA 1OXVA 4BPBA 2DFTA 4ZI2A 2C03A 3PENA 3VR1A 4BFWA 4WVFA 1T3SA 1Z08A 1Q3TA 5AUNB 3GJ0A 3SHWA 4DIDA 4DB2A 5KDLA 221PA 4JSYA 4G5SA 3BB3A 4GMXA 1X1RA 1DADA 3ND9A 3WYFA 5HE9A 1ZAKA 4UXJA 1IXSB 4DC9A 4ZKDA 1Z0JA 1D9XA 3U2QA 3LX8A 3N2IA 3QXXA 2HLDA 2ZR7A 3MLEA 1Z2CA 4TSFA 4MQBA 3EA5A 3F0TA 5L3SB 4B6EA 1MRSA 2OCAA 5FUWA 1SVWA 3AP1A 1YR7A 4ZDJA 4TMZA 1X3SA 5EE0A 2ZRCA 2GBLA 3SU8A 1JB1A 4RD1A 2H8KA 4KXFB 2C95A 3VFDA 2O8BA 3CPEA 4F4JA 4ABYA 2IS2A 3QKTA 3TH5A 4MGKR 4BRUA 3KTAA 3GEEA 5J47A 1J8MF 5TY0A 3RRMA 2YZ2A 2DBYA 2VHCA 3A1SA 4MRNA 5CLLA 4ZIRB 4HDQB 1U8YA 4EPYA 4XD7D 2EFEB 4JKIA 2DHRA 2EWVA 2J5XA 2XB4A 4ARZB 3ZIAD 2X1VA 2OO7A 3ZZTA 2IEYA 4NYIQ 4MRPA 1A5TA 1P62B 1AQYA 4BZXA 2BDTA 1KJZA 5GJBA 2ANBA 1NN5A 1KMHA 1OT3A 2UZ3A 3PUXA 1E9BA 2VSFA 2V9PA 3ASZA 4DSTA 5FI1B 2WJYA 4KV9A 4OHWA 3MG9A 1E2HA 4UXIA 2PMDA 5JWHA 4HZIA 1CR2A 2AD5A 5FBLB 4HAZA 3OAAA 1U0HC 1L8QA 3LD9A 4LV8B 4NHOA 3PEVA 3W3ZB 3MJHA 1SHZA 1FOEB 1KTVA 1TQDA 5JSZA 1JXOA 5UKDA 3X1XA 4B6FA 2QBYB 2W0SA 1Z0DA 2PJZA 2ZE8A 3QBTA 1E79D 4PHTA 4YXWA 2Q3FA 2CBZA 3B9QA 1BH2A 4TLDA 2UKDA 4A8JA 1UEJA 4NCHA 1OH6A 4W9MC 3MSXA 3JVVA 1YR6A 1G3IA 1KNXA 2FZLA 1AK2A 3VMFA 1T3LA 2ZIAA 1NVXQ 4O25A 4X8LA 4AK9A 4M21A 4TQ9A 4UNQA 3VR6A 2ZRIA 1R0ZA 2I1VB 2IHBA 4OI2A 5EUMA 3SN6A 3SFZA 4EPTA 3IBYA 3IGFA 3WBKA 1E2FA 1SVOA 5B57C 3MCAA 3NKVA 4DHEA 2J9RA 3T1TA 2CE2X 5DNYB 3EZ6A 3BBPA 5CK5A 3A37A 4BLTA 4DB4A 1OXTA 1EWRA 4NTZA 3TK1A 1GUAA 3NDPA 2DY1A 3FYHA 2W0MA 2OLJA 4B73A 2NQ2C 4M9QA 2VF7A 1A82A 1KDRA 2CE7A 3HR8A 2F1IA 4HAYA 2ZAOA 2CHVA 1CXZA 4PAOA 2X2EA 4KBGA 5CJ2A 4JL8A 5FOUA 1WA5A 1ZM4A 3DZ8A 3K9GA 1OH5A 4OQMA 1H65A 4JLOA 4XOIA 3QOFA 2QTVB 3FDIA 2W83A 4TYYA 1OF1A 1W2HA 3SS8A 1ZU5A 4BE7B 4A6PA 1II8A 3LQQA 4NPHA 3K0AA 1D2NA 2GVZC 4AIIA 1G7RA 4JLKA 2XITA 3AKYA 2IYQA 2ZRKA 4Q1CA 1OB5A 2X2FA 4MDEA 4E03A 3U61B 1KZ7B 2CJWB 2J41A 1QHHB 4IXNA 4NP6A 5GJVC 5LD2C 3RSLA 5E4FA 2HYIC 2QBYA 1VG8A 3AVOA 5KSPA 2H7VA 3WRYC 2VPPA 4BASA 5FUYA 4LV5B 4D26A 5HCNA 5TXGA 2Z43A 1E9DA 3G82C 4LK2A 1U0LA 4OKSA 3WY9A 3DDCA 4Q1FA 3QXSA 1GAJA 5TVKA 3IQXA 3I73A 3ZGXA 3PEYA 4IOJA 1KK2A 1IOZA 4LJ9A 2ATXA 3GEHA 1R10A 3CPHA 3DO6A 3V4FA 5HR5A 1JNYA 1N5IA 1UM8A 3A1UA 1XD8A 1XTRA 5HKKD 4OI4A 3H4MA 2ORVA 2FPLA 3RRNA 3TIFA 1TF2A 2SHKA 4URWR 1IXZA 2BJWA 4DCVA 3VHLB 3QE0A 3TAHA 1QVAA 2R6DA 2J7PA 2YC4C 3IO5A 4HLUA 3ZVNA 1ZD9A 2ZSFA 3UIEA 5LB2A 3EX7C 1MH1A 4JL5A 1OYYA 2C9YA 1XFAA 2PL3A 1TADA 3WNBA 2VP6A 2OM2A 2C96A 3A1VA 3KXLA 3CRRA 2JCSA 5CM8B 3ZD6A 5IDVA 2ZRLA 1LS6A 1KDPA 2RHMA 1SZPA 1TAGA 1PLLA 4DKXA 4DEXA 4ACBA 3A1TA 5G3YA 5L3QB 2R6AA 1L2TA 4Q1DA 1HY3A 1CRPA 1F60A 4TL8A 3L0IB 4MYHA 1VHLA 1NMYA 2GXUA 2GAAA 3NHBA 5C4GB 2IK8A 2NOAA 3EWAA 4MGYR 5BN3A 1GRRA 2CL7X 4PPGA 3QEOA 4B3CA 2FG5A 3BS4A 1AGRA 1CTQA 1TUEA 2C78A 5JWOA 4ZDKA 3CLVA 4UJ3A 3QJYA 3QEJA 1NIPA 1T3HA 2G6BA 1H8EA 1WB9A 4LHYA 4OHYA 4Q7LA 2IS1A 5KPDA 4D81A 1AIPA 2EVWX 2QORA 3I5YA 3QF4A 4LJ8A 3D7MA 4Q47A 4DT1A 1KSHA 3KUDA 2O8FB 1YRBA 3A4NA 4LOAA 4LWZA 1G291 3LW8A 4JVMA 1T0HB 1KMQA 3LLUA 4DLTA 1KI6B 4HZUB 3SEAA 2J0QA 1XEXB 3TSZA 4TT3A 1RIFA
chains in the Genus database with same CATH superfamily
2NGRA 1GDDA 1NE2A 3OJOA 2OBXA 2G80A 1W76A 1CBUA 5LJIA 1J1IA 2GKSA 5AVVA 4DLZA 3TL6A 3KLBA 2KS6A 3NVMB 4NEQA 1XAGA 4BC1A 2HCBA 4P4TA 2CJPA 1NR5A 2I66A 2IYOA 3IVXA 4FFSA 5EVCA 1ULZA 2DXIA 2FH5B 3FWYA 3BHJA 1DAIA 2IU6A 3ENZA 3MJRA 3ZW7A 4C4YA 1AQLA 1X7XA 4KQ1A 5K0ZA 2FDRA 2GWRA 3OZGA 4B3BA 3Q15C 2FEOA 3DMYA 3VYUB 3PNSA 5EZYA 3T95A 3N75A 3HXMA 4UHBA 1WPQA 1K5DA 3VPBA 4I1PA 2Z57A 2XRZA 1RCTE 4D9KA 3HCNA 1SG6A 2YL2A 5EE9A 3UG7A 2GEKA 1O4VA 1U8FO 4URUR 2PNFA 3G2JA 4UE3S 3EGWA 2O2HA 4A2WA 4WZZA 5BV2P 1L7EA 3E8SA 5IT9A 4CNQA 3IQWA 4F92B 3JQ9A 4WZBE 1N2CA 1COWD 4H1TA 3K6RA 1ORRA 1S4QA 2A3RA 4BZWA 4X6YA 2IY7A 5BN3B 1XAIA 2IP1A 4X62B 2PS3A 2RIPA 2XUIA 4L95C 2E48A 4YS6A 5BQOA 4B85A 5EXXA 3MT0A 3MJTA 3PC4A 1A8QA 4PPFA 4ZYLA 1POXA 1ZR2A 2CL6X 4M1SA 4F2HA 4MGEA 1IL0A 1ADYA 3OTWA 4INJA 5ICMA 2GM4A 4PVCA 3ME5A 4N18A 3GUZA 1MC8A 4NJMB 4HPXB 2IP4A 3NV7A 1Q14A 2O2EA 4DXAA 1O3YA 4NOLA 3ZJ5A 2LR0A 3AI1A 4NFLA 3DKPA 4ZVPA 1F7VA 2I91A 1NJSA 1EUDB 3D4PA 1OZGA 4P35A 3PNOA 1SCBA 1C81A 1JVSA 1MB9A 2A3NA 3ZHYA 3DL4A 1XMPA 3JPWA 3U0VA 4X3OA 3BXOA 1RC8A 2C9BA 2EJUA 2P2DA 4FE4A 2R8BA 1K6MA 2GPYA 3FWNA 3PR2B 1AMOA 1QWOA 3GWGA 3OWHA 4TVBA 4YREA 4AY4A 4ZI3A 4IIJA 5C80A 2AHOA 5E1DA 4JA0A 3GMDA 4WBNA 2G4VA 4Q02A 4JI3B 4AZ3B 2IX9A 4KMOA 3V8PA 3K8OE 2WM3A 3T5GA 2XKBA 1IYZA 4NQZA 5JISA 2WIJA 4UVGA 2C2BA 3LCMA 1ZVQA 1R4MB 1SCQA 2WWFA 3I4LA 1MRNA 1PNQA 1FMCA 4E5SA 1K7EB 2VTKA 4JN6B 4URVR 4LECA 1T29A 2B82A 4AZTA 4EYSA 5L7YA 1LCIA 4G36A 1J6UA 2EC5A 1E1QD 1J9GA 4RDIA 1VIVA 4AMUA 5GM2A 1I4DD 2PT9A 4HDNA 2IHVA 4M6WB 1A5AB 1TW3A 1W88A 2AUNA 3P9IA 3MOSA 1IOLA 1G20A 5B36A 3N8HA 4GX1A 5CW1A 5TT1A 4Q4HB 2NPOA 4ZHQF 4B3TB 3HB4X 3SZMA 4TTPA 5EL0A 2VDLB 2Q0SA 2V5AA 2A4KA 4BVFA 3R4CA 4DHWA 3G0DA 2VDKB 3MW8A 4UE6A 4CF4A 2ZIVB 4ZI7A 4N9QA 4WCFB 4XVRA 3WJ2A 3DOHA 1CX9B 5BYKA 1ZOLA 5DGHA 3HR7A 1YS2X 5IULC 1N34B 1Q0ZA 1C3LA 4GZLA 4NCNA 4MUJA 3WXMA 1BTOA 3BOSA 2NIPA 1ZVMA 2EFCB 1BCRB 2IE0A 1E1KA 4BRWA 2K7FA 1CPYA 3A1DA 2XNDD 3QSYA 2GZ1A 5EI5A 4MVJE 3WLMA 2XGSA 1JJBA 2AZTA 5CLGA 1Q6ZA 2C3PA 3W5SA 3BXZA 3JYPA 3MTJA 5DI3B 1X9GA 3OCVA 1JT2A 4H27A 3WK7A 2H5LA 3AC0A 3FPSA 1PDVA 2VLIA 1YB7A 2Q2OA 3IAS6 1Z26A 3LZ6A 3MB8A 3D7LA 4RLSA 4W5WA 4WINA 4DWJA 2Q3LA 3RT7A 4FCVA 4DBLE 1Z4PX 1JLHA 2HDOA 2ODPA 4IFEA 1XROA 4X24A 3JQBA 1D5WA 1N5RA 3F1KA 2IDZA 3LI2A 3I1JA 1EBBA 4JOQA 4EUHA 1NAHA 5DX8A 1KDVA 1NRIA 5AJTA 3UQZA 4MV1A 2WB4A 3S27A 4K05A 1AE1A 1FB5A 4LDPA 4UU7A 4YAGA 2HKIA 3P4XA 4V38A 4V0OA 1V3TA 3RYHB 1NGSA 4DYVA 5KSZA 3WGJA 4DJJA 1RM5A 5DWVA 2D7CA 3HCBA 3TCXB 1ARZA 3VU0A 2LTAA 3ZWNA 1KI6A 5H9VA 1GR0A 3SD7A 3EIWA 4F9EA 2YXBA 4ZMRA 1ST3A 4G5QA 4JI5B 1P81A 1F9EA 4NU8X 2ORWA 1OI4A 1SUEA 3KT0A 1H9BA 1E9RA 3OFSA 4GQAA 2B7BA 4XDHA 1QRSA 4DJFC 4YRFA 4LRWA 2G5GX 2F3QA 3OQPA 3FNQA 2BFDA 1CY1A 1DIRA 2J0VA 3WIBA 4GKBA 4ZYTA 3UWMA 4MYTA 1T8WA 2P77A 1ZGJA 4FZJA 1R88A 3O0TA 4DKJA 2IIPA 4DLBA 4MW7A 2GSDA 3LRPA 4BWGA 3A8TA 4CLRB 3EDCA 3KYCB 1JSLA 1ECPA 4RFLA 2BRUA 1EWTA 2DWPA 2QTNA 4J7CA 2QG4A 3HCEA 5K45A 3LCUA 5DYIA 3NP7A 1GQRA 1USWA 2G9RA 5KS2A 1HT2E 1RAEA 2KX7A 3WB0A 4E3ZA 1XD2B 3HM9A 4YMSA 3PDUA 3AFNA 1E9CA 1Z28A 4BFZA 3O9VA 3B6JA 2RKWA 1U7WA 3RPEA 3IAS1 4ZOLA 5DO9A 1TCUA 4F2WA 1EUCB 1VSBA 5E8JA 3LDGA 4W5HA 2PEZA 1KI8A 3HN7A 1AU9A 3CX7A 3JQ8B 4YMVA 4ZOLF 3HCWA 3K6SA 1E2QA 4QYTA 1K8ZB 1AXGA 1PIWA 2CNWA 2JS7A 1B14A 1TYZA 1WCIB 2AJBA 4X1IA 3LWNA 2QL9A 3O82A 2QNRA 3PPVA 1KEUA 2AI3A 1MCZA 2NAFA 2ASEA 2QVCA 4CEIA 4ZOCA 4YCLA 1N2ZA 3JRWA 5DSXA 3OECA 1XRQA 1MO3A 2FPOA 1K92A 4JBLA 2CKDA 2BGLA 5LZ7A 4HOYA 3P32A 2ZJAA 3THSA 1HUQA 2IH5A 3KPWA 2O1WA 5EWMA 3E8XA 1QGOA 4QOGA 1JLSA 2ZT7A 2XUJA 1G4UR 2ZDGA 5E7IA 3RRBA 3T9BA 1PZEA 1ZPDA 2NSDA 3CH7A 4WLOA 3ILVA 2GEFA 3GGCA 3ONWA 4NEGA 5CTJA 1P9WA 2WIAA 4Q4CA 3DA8A 1C7JA 1NN0A 1P73A 4AO8A 4MOWA 5ITZA 2B92A 1NVDA 2VUHB 4KTTE 3RRJA 3WWDA 4BTLA 4MI6A 1CZOA 4PLGA 1OH7A 5HDBB 1UMKA 3ZWKA 1WE2A 2QTBA 1RXUA 1YZKA 2FGJA 2I7XA 3TTUA 5GP1A 1LVGA 2VBGA 4ENVA 3EF0A 4W8OA 5BURA 1IEVA 1SXJA 1YACA 3LCRA 4OUDB 3WR5A 4X64B 1E1QA 3L6BA 5JCXA 3ZI7A 3D2LA 3S6JA 5KDOA 2IU4A 2WHYA 4MQ5A 2CWWA 1JZTA 2BM8A 2EAUA 3DNMA 4X7PA 1CT9A 1C1XB 4D8XA 3KWMA 3SHVA 4OMCA 1M72A 3VR5H 2E89A 3DYIA 1XMVA 1J2EA 1T5IA 3CKLA 2JD0A 3JD2A 4Q93A 1XTPA 2HDNB 2VKQA 1THGA 1ULSA 4M1QA 3LAWA 1IXRC 1SU6A 4PFSA 1VYHA 3NBQA 2GZHA 2OBLA 4NS4A 4OOFA 3S8MA 3INRA 4B43A 3RS2A 3VUFA 4WGGA 9ATCA 2OVBA 1FMFA 1B8UA 1XL1A 4V0NA 2GD0A 1P7WA 1IONA 5DHPA 3GJYA 4G07A 1PNTA 4QG7A 3FPAA 3B7GA 3E9DA 3KKOA 1DKQA 2ZYSA 3HCOA 1QHGA 3M9WA 2QP4A 5CH3A 3UUGA 3ZY3A 1UOPA 1G41A 1YS9A 2IUTA 4QGHA 5GVRA 5AM3A 3ADDA 1L4YA 1U7PA 2DTDA 1PWHA 2F3RA 3BF7A 3LT4A 5GOZA 1NQWA 4H7HA 1B73A 4I55B 4KLNA 3NCHA 3ZDFA 3ENNA 4MI3A 1W8IA 1NI3A 4XEHA 5IF3A 2IYNA 2YZMA 4JAVC 1YOBA 1YCGA 4EIWA 3I58A 1FF9A 3F67A 4ND7A 3B3QA 3RJTA 4ND6A 4K6KA 3ZU2A 5KOYA 2A5YB 3EUEA 2FMUA 4ICIA 5EP4A 2FEPA 4F7DA 1DJPA 2H7YA 4UHHA 4KRFA 2UUOA 1E7MA 5CP8A 1FFSA 2PK3A 1V3VA 1E2IA 5A7GA 4LZOA 4HQ0A 4EUNA 4JC0A 3OT1A 1DJLA 3EUWA 3ROKA 5H3CA 1A50B 1GCOA 1R6AA 2VK2A 1LPOA 1U5AA 3PVCA 2RGWA 2OFWA 3TLKA 1H5QA 3IUEA 1TPZA 2OB1A 4RU1A 1G5IA 2VPWA 2GLUA 5LYJA 4DXDA 5JH7A 5KPJA 3AVPA 2XUAA 3BWYA 2UYYA 3ZLJA 2ZYAA 4S1TA 4BV2A 2VNHA 4IGKA 4UMVA 1M6NA 1YZLA 1JKMA 1QS0A 4LGYA 4O2RA 4JJ8A 3DHWC 4POOA 4ZOQI 1JILA 1Z8DA 3EZ7A 3FNIA 4LY3A 5IJAA 4MUAA 4W63A 2DQKA 4YMTA 1SXJB 3WZLA 4JBNA 3ZZ1A 4REQB 2OCPA 3V80A 3GPCA 4XGIA 4MPJA 1E64A 2XZOA 1U0NA 5CT8A 1ZM3A 3EK2A 1PGQA 1NPDA 1X74A 3D81A 5I9BA 2RJOA 1OH8A 1EM8B 1Z6TA 2Q3JA 3IIKA 4CKCB 1NF9A 6REQB 1JG7A 1JU4A 1MOPA 3K4HA 2QJTA 3PCTA 2AEFA 3SYTA 2FMTA 4S3MA 2EJWA 3PL1A 2O2ZA 3GLSA 3DPUA 3D3QA 3WAKA 4GRAA 4A8HA 3LV8A 4CF6A 1KARA 1XXLA 2DBRA 3M5PA 2WUWE 1YDMA 2XQFA 3R0IA 3V8EA 4BFVA 4EMTA 4WNYA 4BU0A 1V41E 4CQJA 4E09A 1QTQA 2DJIA 1JG2A 1DUSA 2HQRA 3VNSA 3CZAA 3DXZA 4BUJA 2IHNA 3GG2A 4DCOA 5JDCC 3AR6A 5K4AA 2ATIA 4MUNA 1ZD2P 3ASYA 4KHZA 3IR6A 3ABQB 4LWPA 3IRVA 4C07A 4D8VA 3V2UA 3WGMA 4H35A 2Z8ZA 1H2FA 4EMSA 2BI7A 4L6CA 4DLKA 5LN1A 4W1SA 4Z0HO 2GETA 4CQMD 4XWKA 1HDZA 3LBAA 1DC6A 2XGOA 3BCHA 2YWRA 1JG4A 1NW5A 1EM8A 1JX6A 1ESZA 3CB4A 1MO5A 1KO4A 4LA4A 4X54A 3UMJA 2CNLA 3B52X 3LF1A 4RK0A 4X8OA 5KAMA 3WSVA 3NC0C 4DLRA 4DG8A 1UPCA 1HEYA 4BIMA 5AMXA 4WLEA 3FVRA 4UNPA 4PIVA 3RTAA 3GFGA 3MXOA 3WZMA 5A4DA 3ZV3A 1T8YA 2G36A 4JBWA 1RXCA 5ITVA 3L4KA 2ZYGA 4G5OA 3UG6A 2BTOA 4FQ8A 1F8UA 4FMDB 5HYVA 1DKNA 1N6HA 5L3VA 3JXEA 2XTJA 1E3JA 2WOJA 4QASA 4QOIA 5MFPA 1OKKA 4QWMA 3DEJA 1BU5A 3CONA 4NVRA 4KO2S 2G4CA 4Q15A 4B87A 1BWPA 4WLVA 4D9EA 4AJIA 4XR9A 1KU6A 5D6NA 1YZVA 4GIBA 4DPLA 1FP4A 2XCUA 2R6R1 1WO8A 1X6VA 2I3AA 3MERA 4M1TA 3X1KA 4UARA 4DLVA 2CC2A 2PKCA 3VU1A 4ATNA 5BN1A 4N3BA 3NJ8A 3PD7A 4D80A 4PBTA 1J7KA 4NULA 2XOKD 5LQRA 2BFPA 3H0KA 5KCMA 3U1BA 1M7GA 3GRVA 2VBIA 2AFVA 2DMRA 3O9ZA 4FFBB 4IICA 4TN5A 4UJ5A 1E7RA 5CCDA 4BX0A 2IBMA 5LMZA 4FI3C 4B3GA 4U7DA 2HU7A 4ZA2A 5FWYB 3UJPA 1LSOA 2VI5A 3KEOA 3RC9A 2C2HA 2ECQA 3IKMB 1DBWA 4HLCA 5GTDA 4HDRA 3LQRA 1KGDA 2MYPA 2NZJA 1HG0A 1BGWA 2WD7A 3H11B 5C9ZA 4LDQA 4LZNA 5DH9A 2G3YA 3AI3A 1XCMA 3QITA 3AUFA 1MJGM 1P4JA 3COWA 3F5DA 3BA1A 2OG2A 3R3HA 1LA2A 3PNMA 3QYPA 4JR0A 3TNFA 1K4MA 3U9TA 2B5WA 1THZA 3PF8A 5CA0A 4CHTA 4G8BA 3K70C 3TKYA 4Q1EA 3GLHB 1FTWA 2C4MA 4FIDA 4RK4A 4GPZA 5EIHA 5IMBA 3KJZA 4BB9A 5KNDA 3GLIB 5DKFA 1EG2A 4WN3A 4ITRC 3TE7A 5IF9A 2JK1A 2QVLA 4FW8A 1FLVA 2W37A 4FFBA 5HOQA 1E4VA 3W8FA 4REOA 1ZN7A 4ASUA 1IN7A 4JT4A 1JU9A 1QYIA 4IP0A 4MA4A 2QD1A 5FEMA 1X1EA 5JTUA 2N9UA 1J70A 2RK4A 1EVLA 2DB3A 4YJKA 4OMDA 5MHTA 1NRXA 1PTJA 1R5OA 2A35A 3ETEA 5AW8A 1QE3A 3M1IA 1VPWA 3F7OA 2DPHA 3UV3A 1WHTA 2YW9A 4IOLA 2ZJOA 3UMFA 1T91A 3AZQA 3V4RA 3LGAA 5BNZA 5BWNA 2WF7A 1XZIA 4YRIA 1PJZA 1ODKA 1M2OB 2DTEA 3CT4A 4HEHA 4PXYA 4U3JA 1A4UA 2MR5A 5FAXA 3RIHA 2XDQA 3PE4A 3IERA 3MPOA 4DWVA 3LY5A 4XAQA 4OXRA 2PUBA 1C80A 3PPXA 4Q4JA 4LV6A 1AO3A 2HSDA 3G8CA 3DWGA 2Z0MA 3AO0B 4QECA 1L4UA 4I1SA 3IB6A 3VA7A 1A7AA 3GYBA 3OX3A 4XVQA 2AMFA 3T9FA 3U5ZB 4AQ7A 4ESHA 3KQUA 4FCTA 1EHIA 4P33A 1X1BA 3SYNA 2ENWA 5SZHB 3M3PA 1JFLA 1P2TA 2BKAA 3C3EA 1OPRA 4BBAA 3PUYA 3ELYA 3OG9A 4DQLA 3TB6A 4QQ8A 1QFYA 3M6UA 3RBVA 3VNUA 4Y9SA 5IN5A 3M6MD 4UAUA 3ZH2A 3HYSA 1BYIA 2VP2A 1K6XA 4QJ5A 3UFXB 1HX7A 1ZRSA 3IMEA 1VLHA 3T5AA 1FZQA 1W581 4RSMA 3WMEA 3DJYA 1M2JA 4X20A 2Z98A 4KQKA 4TTIA 2V5VA 1XLTC 1Z25A 4UEWA 3K6JA 1ML4A 3Q2OA 2Y1CA 2VZ9A 4QGBA 2XYGA 3W5IA 2YJ5A 5JS8A 2PRSA 2V7VA 3U44A 1RE0A 4DEYA 1HXHA 2E1PA 1IRXA 3PE6A 4O4LA 1JBEA 2AW3A 2ECFA 2B3DA 2YBEA 3E9EA 1PR5A 5JG7A 2J3IA 3HVHA 2PUDA 2GKGA 4GOLD 3E3NA 4U7JA 3WGOA 2C29D 3IPLA 3D6UA 5EE5B 3MCTA 3RSQA 4LXTA 3RAPR 4R98A 2ZVQX 2DKFA 5JAMA 3BWXA 1O58A 4HGPA 3SXUA 3T3NA 4JDUA 3UWSA 4ILEA 3IXLA 1CF9A 1K0FA 3QYFA 3C6BA 4IHQA 3WIDA 5EHXA 3IH5A 6Q21A 4FFDA 1RADA 4PU0A 1F1BA 4R71A 3NTXA 4H7KA 3ZDQA 5BSWA 5H82A 1CIPA 3JAKB 1S2OA 3OPNA 3LDAA 4H4CA 2BLNA 1MB2A 3QKSA 3RNOA 3ZW8A 5EZYF 1ZK2A 2HBRA 3OEED 1QVVA 3QMWA 1DTWA 2A0KA 2JFVA 4MVJP 3SSMA 4D8YA 5GIOE 3WDMA 1EP9A 1WXIA 2FSFA 3HYNA 4IXMA 5JRDS 3MWYW 3U3XA 1E5DA 1PT9A 5I47A 1VDZA 1DO0A 1PR1A 3FAZA 4LRYA 1L3CA 2Y9PB 1M1YB 4ZAVA 4E70A 5JCJD 1B4DA 1Y4UA 1Q1ZA 1ZCZA 4DA6A 5I7VA 4GZ5A 1M33A 4ISBA 3WMGA 2AN9A 2ODAA 4QAJA 1A8IA 1L7BA 2O0JA 2Y0CA 3SBXA 3AUAA 2PLNA 4Q4LA 3DE4X 2J5BA 2EFGA 4E22A 3A9VA 4Q3NA 3QBDA 2JEOA 5EJEA 2V1UA 1V4VA 2C3MA 1NX6A 3HP1A 2HRDA 1OIXA 2JFQA 2C59A 5HS4A 3QTTA 3R7FA 1QO9A 1YZYA 4Z9BA 4D3FA 4LNUA 2P9GA 4EO7A 1PR9A 4R9NA 3CF2A 1BOFA 4KN9S 1LKZA 4RORA 5CEJA 3A3YA 4OK6A 1JR3A 3KSUA 3OJLA 1LI7A 4QYXA 1GT91 1JKJA 4IY1A 4X71A 2ZSJA 5HXAA 5ICCA 1CRQA 5FTJA 4DSOA 1K7YA 2DPXA 3TW4A 4ER0A 1WF3A 4UTNA 4WZ6A 2XODA 1Q95A 4LGCA 4PZLA 1N1MA 5E2BA 4B3SB 1BHSA 3B9BA 2OD2A 3N2GA 4YP9A 1U2ZA 2QTAA 1KZGB 2Y1XA 2OG1A 2YOFA 3D5TA 2ZJ8A 4M46A 4NR0A 4TN1A 1GTMA 3DVRX 4BNUA 4ZICA 2RHWA 2CUNA 4O3MA 1U0BB 4MYSA 1FIUA 4CM8B 4AP5A 1C1YA 821PA 3CEPB 4IH9A 4IJVA 1YBAA 3CHYA 2H4FA 1AZSC 3SKYA 4LWOA 1QLWA 1RI1A 4Y6GB 3KSRA 3VC2A 3BL6A 1U7DA 1MAHA 4IIUA 3P9CA 1XVAA 4G56A 4O33A 4LS3A 3TPFA 2C3YA 3UZUA 2J85A 2X2PA 3WYGA 1BRMA 5J4HA 1A9QA 2W2KB 5DNCA 1HH4A 3IXMA 4TXLA 2HLDD 3M1LA 1KEPA 4OAPA 4ZU6X 1EXMA 1K4KA 1GFWA 3CUKA 2X4IA 2G25A 4K9KA 2XT0A 3QV2A 4Y9DA 5HBGA 3K92A 2I9KA 4P2BA 1Q84A 1KVTA 3CZ4A 5J4KA 4NH0A 3W9BA 1Z5UA 2TSYB 1AM4D 3V9PA 1VKRA 1SUWA 4OPMA 1THTA 4KFRA 1UAGA 3CR3C 4GO1A 4YUVA 4AJNA 5JANA 2V4UA 1ZNYA 5KU1A 1IC6A 1DXQA 2HSZA 3Q3VA 4AZ3A 1LQUA 1VXRA 3L7LA 1QGYA 2XYRA 3GJ7A 3V8VA 4CM4A 1QONA 3OIFA 2VZLA 5GJWC 3AFMA 3C6ZA 5I7AA 3RRZA 4BUZA 4M9RA 4HTFA 2IV2X 1JA0A 4AJ9A 4D4JA 3FKSA 2HN9A 1C2TA 1VZ2A 2C0QA 3DEKA 3M4NA 4IDNA 5DYWA 1VBMA 1V11A 3D3KA 3HCFA 3LVBA 3S1AB 1I4WA 1DKMA 2X42A 3OZCA 2BMEA 2GVDC 4TYMA 2RH4A 3AUTA 4LE1A 4NESA 1JUDA 4CLEA 3VH1A 3IDAA 2K2QB 3B8EA 1EK5A 1OXMA 3DVLA 3JZFA 4BVHA 2EDAA 1FJ2A 1WJGA 3QELB 2C2MA 3MTIA 4I66A 1Q3HA 4DPKA 5BUCA 3IOCA 3R76A 5L9AA 3MF4A 7YASA 4GNKA 3RQIA 3RK1A 4J6FA 4HNGA 1Q0RA 3G17A 4WECA 1K1EA 4KEAA 4D41A 2I2BA 4MRSA 2XNJA 3TZKA 2HF7A 1FVOA 5ALNA 4M3NA 4ZYWA 1GPJA 5TDHA 2AOWA 3S2EA 3AMVA 1BC5A 5IUJC 3ANLA 4HADA 3LOPA 2BMFA 1NW6A 2IYSA 1QHNA 3UMCA 2OXEA 2VF5X 5BV0A 5EXDA 3PDIA 5CGQB 2YOHA 1R5JA 4RACA 5IX8A 3SMQA 3U9SA 3WIEA 2ATCA 1K5PA 3HPRA 2DC1A 2B78A 3T7KA 2JJ1A 4XSGA 4Z3OA 2VDQB 4GQIA 4D6PA 2X8WA 1LD3A 1TF7A 4BJ3A 3GJ4A 1OBOA 2JARA 3COYA 4YCBA 2IEZA 5K2OA 4GMFA 3W9SA 4AC9A 3PQ3A 1YCFA 1OE0A 5I5EA 1NW8A 3PEWA 1FSGA 2Q3DA 3ROPA 2E6UX 2P69A 3GR6A 2DFDA 2R6GA 4IDHA 1LBHA 4Y2RA 3JAWB 3KZCA 4NCKA 5EA2A 4BP8A 4TKZA 2Q1XA 4KO3S 4MI9A 4ANFA 1USUA 3TECE 4NOKA 1A4IA 5GGXA 2BMVA 1C0LA 5EMHA 4AY2A 3PJFA 3MXTA 4AZ0A 3AY6A 2UVPB 4IFIA 2FSVC 2IBSA 3DC7A 3SYKA 3MCWA 3QVKA 2Q62A 3FLBA 1XTTA 1X7DA 2ZCUA 3RSOA 4C4XA 3I9FA 4OKIA 4MDHA 3NVDA 4KI0A 4S0ZA 1XMQB 2QMQA 1E9SA 1OHHA 1RBZA 3GEIA 2OMEA 2SECE 3CRVA 4RPJA 3WIUA 5ELLA 4UOZA 1XJQA 3OD5A 4M55A 4KQJA 1TVEA 4G25A 1FVXA 2QRLA 4WXRA 3DDWA 1W0KD 2HO4A 3OLXA 4KACA 4Q21A 2IUSA 5DLDA 1NBEA 3A58B 1L1QA 1JSRA 3TCNA 5HKOA 3J80A 1OTYA 1A9XB 2XW6A 2NXEA 2BCGY 4TL9A 1NQ5A 2JC3A 3GFRA 3U4HA 4CM1A 4DS3A 4DVJA 3IHLA 4KVZA 4CF5A 3A2NA 2ZRHA 3H5IA 5DBOA 1R00A 1AB6A 1E18A 1IHDA 1N6LA 2LV8A 5TARA 3FPKA 5CDGA 1T1SA 2VRCD 2ZYWX 1Z5ZA 1LV8A 2GB4A 2Q07A 3D6FA 1WUTA 2LKDA 3SX4A 1GPLA 1LSUA 4C2BA 5JS7A 1M54A 2HBQA 3IEPA 1X0XA 3IVCA 2P30A 2HJHA 1V9LA 1FVHA 4Z86A 3P9ZA 3RG8A 3WL5A 2JI9A 4QICA 4KIGA 5JCPA 1BEZA 1J9EA 2FPGA 3A6JA 1PHPA 4JUBA 3HRIA 1FNSA 4MW2A 5F76A 1B1AA 5WRFA 3RUFA 3Q5EA 3S70A 4B75A 4L02A 1AJEA 4ETWA 1FNBA 2OB2A 1TYDE 4GEKA 4N5MA 4KITB 1S8NA 5IT4A 4AS2A 4KG7A 4RTKA 4DABA 2J3QA 3O03A 3GGPA 1DTWB 1U2RA 1J2RA 1ZICA 2I8AA 3HRKA 1VPTA 2CYBA 5CHYA 5DHAA 4A16A 5ABPA 5IK2D 1QYVA 5FHQA 3MGCA 1NNLA 5KYXB 1QO0D 1NNI1 4BB0A 3BTSA 2ZTSA 1BAPA 3PQEA 4H77A 3PJDA 3Q4GA 1N2SA 3FDZA 3TQHA 5EIEA 1XJ5A 2BFCA 3C6KA 2AC2A 2N42A 4PPYA 4Q5IA 4AO6A 4B6OA 1IEWA 2HSJA 5ADHA 5J5CA 3VH3A 2DQ4A 3QWFA 1SEPA 5JCZA 3JQDA 4K5QA 4JODA 4I9FA 4B7UA 1EUZA 4JB2A 3BD7A 2XAAA 3KWFA 4KIFA 4KYVA 3N8NA 4XUGB 1YC5A 4ZZ1A 2GSWA 2AC4A 4TT3D 5EQDA 4KR3A 1UADA 1N9GB 4YHHB 3OCUA 2E18A 3VR3A 3KE9A 4QYIA 2PH5A 1YDHA 1FNMA 4PZEA 1J99A 1YJCA 2FMFA 4Q7JB 2VSOA 4QYSA 1VG1A 4MTCA 4CLDA 3TS1A 1JLMA 2CVOA 3PUVA 1W5EA 3O21A 1XWIA 5BPHA 1VHTA 3GROA 1B42A 4LJLA 3ZOZA 4XYEA 4M1EA 2H5EA 4ZQCB 2RGAA 2UV8A 2Q1WA 3UUWA 1T4BA 4JLVA 2EWMA 4LY6A 3ZHBA 1G5TA 4O4IA 2L0XA 2HK8A 3FTCA 4EATA 5COBA 3TMAA 4XGQA 3FFWA 1ZOSA 2B34A 2FSPA 1G1MA 1I8TA 2I2WA 3GHYA 5ESDA 4XWOA 3FOEC 3ITKA 3E70C 5TQJA 2E9SA 1H2YA 2D1SA 2FPRA 3ZHUA 2G71A 1WXHA 1R0YA 2ZBQA 1OBVA 5KYWB 5EG5A 4G0PA 2ZUWA 5E2IA 3ZN2A 1P5JA 3DC2A 3C5WP 2EHJA 5IN4A 1HETA 1LPMA 2F3SA 3C3YA 4Z2YA 2YCLA 3GEGA 2I4LA 4HSGA 3JQAD 2P6UA 2JG3A 1UT6A 1AUQA 4IGAA 5LQNA 2X7HA 4PQEA 1YOVA 5DNUA 3IMGA 1HDIA 3S55A 4JBYA 1NOJA 3ANMA 5HJ2A 2OYRA 3Q8MA 2I2CA 5CXXA 4EJ0A 1BE6A 2PGOA 3F2IA 1VG0B 2CGEA 1GT6A 3VSEA 4HS9A 2IV3A 1OD6A 4YQZA 1ZCFA 2OZLB 3QOXA 2BFFB 4GUAA 1KI1A 1IJEA 2PWBA 1VPEA 5LSAA 2HA0A 4AN0A 3C5HA 2C58A 4YCJA 2G07A 4Q3CA 1RIIA 1ZVJA 3GH1A 4DUYB 4AF8A 1SBQA 2FFJA 1I80A 3OPYA 4I50F 1ZCJA 3KPYA 1RKBA 2HWWA 4MV0A 1YHNA 5E9JA 2OXIA 2HLHA 4LTMA 4F2PA 3AR2A 4CTJA 3H0EA 1QHSA 3GLIE 2GEVA 2YHUA 4B31A 3VU3A 4UHKA 1VQ1A 4YRDA 1Q0SA 2C97A 3KSDO 4X41A 3BZBA 3IIIA 1Q22A 5A1TA 2AE1A 1ZNXA 3KT8A 4A6XA 1YCDA 4B74A 4F6RA 3T7AA 5K0JA 2GJAA 5H3LA 3ONNA 1REQA 1M6VA 2JJ8A 3LX5A 1EXWA 3CW2A 1YZQA 3FSGA 3EMKA 1O97C 1NUAA 2GCGA 2GZRA 4YYZA 5BSHA 2VNJA 2QHXA 5JCJA 3U49A 2DUJA 2QA5A 4AMVA 2Z6VA 4J3JA 4C0QC 1E1LA 1PEKE 2P2LA 1JEYA 2VPTA 2IZ6A 2O8FA 3HL4A 2BF7A 3R0JA 4FYHA 4FVTA 1OFUX 2NV2B 3HJCA 3GGGA 2RBGA 2NU9B 2B8JA 5ADUS 3ZDBA 2Y05A 4XQGA 1VE5A 2AL7A 3H2YA 3LRTA 4YP7A 2PXCA 3WKCA 3JQ7A 2O0KA 4DCUA 1J0XO 5B1EA 4ITUA 4OQNA 3C5VA 2IPLA 4EJ6A 1CCWA 4HEQA 4MV7A 3LBIA 1GAWA 1HV8A 1Q21A 2MJLA 2BE7A 3EOAI 3GZJA 3HMKA 3II6X 3AOEA 3IPCA 4Y3UA 3TZEA 1E1CB 4PCAA 1A8UA 1WUJS 1IQRA 2J5KA 2P3SA 1YZ3A 2WJZB 4NV1A 4PIMA 4UASA 3S3TA 5LIPA 2O19A 2IXAA 4M37A 1I32A 4QDZA 5HEKA 4JASB 4ER3A 1UODA 2A5FA 3BMQA 3K9WA 3L40A 4IRUB 1QCZA 1Z8NA 2IHUA 3V1UA 2DE0X 1C30A 3OLWA 1VL1A 2OUIA 2RAUA 3VNRA 2PUEA 2A0XA 4K8OA 1UAAA 1R8SA 3PXGA 1ESMA 1ZKMA 4EHLA 1PJCA 2HGZA 2A33A 2BFEB 4M0FA 2GA9A 4MYCA 3P96A 2OHFA 1SBIA 3WGQA 4U9HS 3ZV7A 4LXHA 3RRXA 2GXQA 4K9SA 5DMXA 4HXFB 1JQEA 1Y1RA 3E9MA 2Y1FA 4M1WA 4YMGA 1W88B 3T35A 3W90A 1MLDA 3HWX1 3T15A 1AQUA 5E4YA 4QXMA 5I45A 2CF5A 1KORA 1ZK4A 3E22A 5BSUA 3VX4A 4IQFA 2RD2A 1MTZA 4LKOA 4RIFA 3TFQA 1N7JA 1TZJA 4Z0PA 4ZVSA 3JQBC 1SG0A 1DQYA 5JRZA 3IELA 1E94E 3REGA 2RSLA 4ZU3A 1ZRHA 1RI5A 3QA9A 1F5SA 2ZJ1A 1MX1A 1TKBA 2V58A 2X4DA 1XZBA 1EK2A 2ZRFA 3IPXA 3KD2A 3PKJA 5FD8A 5B58T 2XCOA 3VR6D 3DZFA 3JQFC 4JYAB 3OOJA 5A05A 3FLMA 4IIFA 2H51A 3UK6A 1PZXA 4M9CA 3AEUB 3OLVA 1MB3A 4TMFA 3KUKA 5LYJF 4OP3A 4Q1BA 4W6ZA 2BHRA 1EHYA 3W6UA 1X1QA 3WGLA 3GL9A 1UDBA 2MT9A 1W4AA 2CUTA 1DG1G 4OD0A 2F3PA 3COZA 4MR9B 3ZIAA 4US1R 3G5UA 5IC5A 2QTLA 3KQLA 1WX1A 1WU8A 2QE7D 2WJ3A 3NBZC 1Y1PA 2JCYA 4N5DA 4Z9YA 3WGYA 1LJUA 2EL9A 3Q7PA 3V7WA 4ED9A 1PHRA 3LXUX 4QWWA 3DDSA 3YASA 2GBLC 2NUAB 3MYYA 4LIPD 1MVNA 3LZDA 3R20A 2Z1NA 3RADC 1R6BX 5EP2A 4FYXA 1BS2A 4B7CA 5EKUA 1YXMA 1J56A 3B1ZA 1A7UA 1HO3A 3GZNA 2ZI3A 4P4NA 4UZEA 3UJNA 3NQ41 5K3FB 3V1MA 1X8KA 1QR6A 3GVIA 3T4UA 1SBCA 1V96A 4O29A 3MT9A 1E9VA 4Y2JA 1N0VC 1FS6A 2PLAA 1ODTC 3FM9A 1ZC4A 4HFMA 4B7XA 1XI2A 5A5VA 1G64A 5HWSA 2D54A 2BM1A 2YWFA 2RG7A 4TROA 1I7PA 1T1EA 2HNBA 5G3ZA 4QPZA 4EW6A 4ETNA 4O4HF 3P7MA 1RHKA 4NDAA 5JQWA 1FDTA 1WSWA 3K72B 2WWWA 4BFTA 1JG1A 2OTCA 4DNFA 2FZ5A 3OQOA 2D0PB 5FBKA 1JQLB 1N5JA 2QOEA 3AR4A 4ENRA 1HTTA 2XZLA 1L4HA 1L9XA 3KKKA 3V8RA 1Z4QA 3UFBA 3NUQA 5A0VA 2FSIA 1USKA 2JRLA 2BUBA 2JAQA 2FUEA 5KSYA 1H1LA 4OM8A 1GPWB 2UVPA 2D0DA 4D3YA 4FDAA 1JHQA 4PC7A 1JAYA 1B15A 1C1DB 4IJQA 3R3UA 2DHDA 4CM5A 5K3DA 1DV1A 4LSZA 2JF0A 3QBJA 3UA3A 4I4CA 1EUQA 2PX0A 4P83A 1O1YA 4RD2A 5GWXA 5B1SA 4DA8A 4LJRA 3U4MA 2NN3C 5F2NA 3PRYA 1V7CA 4I9HA 3S81A 3BN3A 3GCZA 4CV2A 2PUVA 1VMAA 4MH0R 3VO1A 3CNHA 1BHO1 4DBVO 4JVNA 5BYAA 1L5WA 2WR8A 3CJTA 1W4BA 3HA2A 3K4PA 5K8LA 4B6RA 2O2YA 3E82A 1Y63A 2DUNA 1AV6A 2JZOA 1RWVA 4WCVA 1E7YA 3UGQA 3UXMA 4GOJA 1FFGA 2IZOA 2BMJA 4HAVA 4YT8A 3KZXA 1IH8A 4XWTA 3ESZA 5EQTA 1NHWA 1SQ0A 3NEAA 1PT7A 4UTOA 5F64A 2I8LA 2ZT5A 1F17A 5AO9A 4LFAB 2AA3A 5HIAA 5C8VA 3WA7A 2SNIE 1K6IA 2I34A 1Z6ZA 1LQ2A 2WIGA 3GPDG 4N8EA 1GNRA 1CUHA 3RSHA 3U7RA 1VE6A 3IUYA 3KR9A 4IDOA 2W48A 4PO1A 2PMFA 1UJBA 3GLRA 4MJLA 1DJOA 3D9QX 4XM2A 4AWBA 3QVOA 1U4OA 3ZWOA 2QQFA 3BQNB 3THOA 2D00A 1E7QA 1H0HA 1KY4A 3HBNA 1L4EA 2VYFA 4M1MA 3KG2A 4WKGA 1C29B 3FYUB 3K0FB 4R1MA 4Z8XA 4WHMA 4AKGA 5ALMA 3KQMA 1SHLA 3TX2A 1USIA 2R65A 2AXQA 1YJQA 1A7KA 1OAOC 2O7SA 5HRUA 3HI6A 5GV7A 1DWPA 2ANCA 3QELA 2WMDA 2P41A 4HXGA 5FIUA 1O9GA 2Q28A 3U6KA 4OYLA 5SYMA 3AVUA 4KI7A 1R50A 1XZDA 4DY4A 4PAQA 3E4CA 4TZ0A 3E5MA 1CP3A 3DBRB 5FOVA 1FFXB 1QPGA 4ARVA 3K35