5LB4A

Apo-structure of humanised rada-mutant humrada14
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
229
structure length
211
Chain Sequence
b'TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSAMYIDTENTFRPERIREIAQNRGLDPDEVLKHIAYARAFNSNHQMQLLYQASAMMVESLNTDRPYKLLIVDSLTSHFRSEYAERQQKLARFLAMLHRLANEFDIAVFVTNQATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein RadA
molecule tags Hydrolase
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
total genus 74
structure length 211
sequence length 229
ec nomenclature
pdb deposition date 2016-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5lb4A00
3CRRA 3LAWA 2IS1A 4K46A 3TGPA 2IYQA 1XDBA 1ZUNB 4TLCA 4MH0R 2B7BA 4QNRA 4C0SA 4XOIA 4C7OB 1PV4A 3O47A 4DCUA 2IC5A 1PZNA 2VSOA 3SQWA 4A6PA 5D3MB 4HAZA 3ZS9A 2J0UA 2R65A 3PITA 3K53A 5FPTA 2QTHA 1IONA 1DVRA 1YZKA 3CNOA 3N2IA 4PO9A 4M1YA 2MMGA 4UXIA 4B35A 1EX7A 2J1LA 4XWOA 4I81A 4JBWA 2ZRIA 3NEYA 1NBME 3X1WA 1WF3A 4BFUA 2DWQA 3VX3A 2F3TA 3RS7A 1Q21A 2CHVA 2Q6TA 2GJ8A 2BMJA 3CW2A 3LFUA 1W1WA 2QAGB 3KXIA 4LHVA 1AS2A 2A5JA 1FP7A 1QHHA 4B43A 3UKDA 1AK2A 2DWOA 4BWYA 3BBPA 2VSFA 3WYGA 1FNMA 1WP9A 1AQYA 1EWQA 4A82A 2ONJA 3PENA 2FSGA 1K6MA 2VO1A 3IEUA 4Q01A 1Z6GA 2ZJAA 4N0EA 1BMFA 2EWWA 1S3GA 4LBWA 1P72A 1US8B 1Z5ZA 4JIMA 4NHOA 1M7HA 1ZNWA 3I8XA 4LJ4A 4A6XA 4V02A 3ZDQA 3VR4A 1AGRA 4Q18A 4RD2A 4XIGS 2PBRA 4JLOA 3AP3A 2FNAA 3KJHA 4LGMA 4M1MA 4D0NA 3ZZTA 3B7GA 3K0AB 3W90A 1YHNA 4ASUD 2G9NA 5AJYA 5DIFA 4URUR 2QBYB 4G5SA 1CR1A 5JI3E 3KQUA 4E09A 4Q4AB 5DN6A 5AUOB 3ADBA 3B13B 4OK3A 1ZUIA 3KKMA 3EZFA 1D2MA 2RAPA 2RMKA 3I3SR 2V54A 3AKDA 2WJJA 3MAAC 4LWZA 4PAMA 3I32A 4R2HA 4TMXA 2VIIA 2O8DB 1Q20A 3EG5A 3SHFA 5A0FA 1M74A 1RYHA 5G53C 3C14C 4RCZA 4US2R 3EXAA 4B73A 2XZPA 3ZIAD 1ZM3A 4PQFA 1DELA 1IY1A 4ZV4A 1PJRA 2QROA 3BB3A 1NLYA 2AKAB 1CR0A 1G5RA 3A1VA 5P21A 5JECA 2CCJA 2VP6A 4QJ5A 1I4TD 2YINC 3LVQE 2C04A 3LH5A 4P32A 1XPOA 3AVYA 1XBTA 4QBHA 4J0QA 1KJZA 4Q1BA 4D6PA 2JASA 2AD5A 4Q1CA 4QOSA 4LX0A 1MR3F 1T4GA 1HT2E 4NCJA 2OG2A 2IYTA 4KLZA 2ZVPX 4U7DA 4DLTA 4GMDA 5JEEA 2PJRA 2IK8A 1L4YA 3OE7A 2D3WA 2GKSA 3AF4A 2CJWB 3KL4A 2GEVA 4JLNA 2EFHB 2KE5A 4PZLA 4TL7A 1QRAA 1ZNZA 2WIBA 1GILA 2JLRA 1D5CA 2XTMA 2N1BA 1EFUA 2RGNA 3CF0A 2EQBA 2IYYA 1Z06A 5IHPA 1S9DA 2WTUA 2PH1A 2PZFA 2FX3A 2X1VA 4FMCF 1EX6A 4IDOA 1XD2B 3BOSA 3TBKA 2WKRA 4I4LA 1D6JA 4QC2A 2FA9A 4OKSA 2ZYTX 1F48A 3WRYC 2AFIE 2OUKA 3BFKA 3PV0A 3B1ZA 4ZIRB 3MJRA 4IHQA 4IRUB 4WVFA 1W49A 3B85A 2IF0A 1CLUA 3QKRA 2EFDB 4WZ6A 1KO5A 1S1MA 2RGNC 2CVHA 3CZQA 2W0SA 1YZUA 2OZEA 4Q7KA 3UG7A 5CYPA 1P9NA 4P4UA 4P4TA 2ZRNA 2QE7D 1E98A 4GI7A 5JSZA 3TKLA 3DEFA 1SXJE 2IX3A 4EFNA 4RZUA 1IN8A 5HE8A 1ZAKA 4QHSA 4IOKA 1T0JB 4TT3A 2V7QA 1XTIA 1CXZA 2VEDA 4DSUA 1DAGA 4JJZA 1N6KA 1UBEA 1E0KA 3GFPA 3THOA 2CLSA 4IVQA 3KB2A 1BO6A 4WOPA 3T1TA 2KWIA 5FUVA 1ETUA 3IIMA 4A8JA 2J0SA 5L8VA 4PXAA 5AUNB 4Z8XA 4PFSA 3QG1A 2FGJA 4XWAA 5FTMA 4QJ4A 2H7VA 4UNQA 4TTPA 2ATXA 1KMHA 2KJQA 3AH8A 5H1YA 4JLJA 3WMEA 2NO1A 2ZRAA 4HLUA 2UZ3A 3MSXA 3CWQA 4Q19A 1G9XA 2V4ZA 2RHMA 1TADA 1W4CA 4AKGA 2YWEA 1RFLA 2PEZA 2F1IA 4TZ6A 2WMOB 4MRPA 5EE0A 4JBYA 1GAJA 5ANRB 4LCBA 3MFYA 2Z4RA 2HF8A 3BD9A 4YDHB 4BEJA 5JWOA 4A0RA 3T34A 4JLVA 2GEUA 4HB2A 3BAFA 3P4YA 4HATA 2ZRLA 1N2CE 4C3ZA 4IOMA 2IYRA 3LO5A 3EIHA 1UFQA 1XTKA 3UANA 1JI0A 1FPMA 1W0KD 2ZRFA 4JT2A 4M1TA 4JVMA 1Q57A 2C9OA 2XITA 3AF1A 1JNYA 4JL5A 4NPHA 1FX0A 2O8BB 3WYAA 1P9WA 3VQTA 3B9PA 4ACAA 4JKYA 3G5UA 1P3JA 4WAUA 2ZI4A 1RRCA 1RRPA 4LSGA 3M4YA 1CULC 2O8EB 2P6NA 5DYIA 4RVCA 1ZCBA 2GTPA 2ZI6A 2ZE6A 3OZXA 5B57C 5CK5A 5CM9C 3SI7A 1W36C 1Q12A 4GBMA 3W5JA 5EXTA 3AVQA 5FTNA 1JECA 2OXRA 4TQUS 1IXZA 2OFWA 4M9XA 5LBIA 2VA8A 1EWRA 2R2AA 2IYVA 1G8HA 1D9ZA 1YR9A 1VG1A 2AFHE 4M2LA 5EE9A 4Q9LA 4TT3D 3SJCA 4F4CA 2WJGA 5EE3A 1VYUA 3AVUA 4FMDF 3HPRA 1N5IA 4JL6A 3EPLA 4NCHA 2FH5B 2V55B 2BEJA 2GCOB 2WSSD 2VP5A 1J99A 2WWXA 3TSOA 1W5TA 1W4RA 1VHLA 3HR8A 1OXTA 3AV0B 2RGBA 4HUQA 1S0UA 2C8VA 2DFNA 3IBGA 5DHFA 1OHHA 3I62A 3Q7QA 3ZS8A 3UIEA 3SFVA 1F60A 2BV3A 4LZZA 4RZXA 3ONWA 1NJGA 2DFLA 4F4IA 3QKSA 1CJKC 4BFXA 4MYHA 2B92A 1DO0A 1W36B 4ZCMA 1UEJA 4HZUB 3IQWA 2REOA 4XWKA 5AJVB 1AS3A 2E87A 4Z1MA 1G41A 3PJRA 5LD2C 3ZVMA 4DLVA 1E4YA 3BIFA 5TY0A 1E4VA 5J4YA 5JCZA 5CLQA 1S1CA 3TSWA 3CRQA 1ZCAA 2QGZA 3U61B 3GLGA 5TMPA 4RFSB 4XVRA 3U3RA 5SZJA 2OAP1 5FOVA 1Z2CA 1IJEA 1ZM7A 5IF9A 3WY9A 4BUJA 1W0KA 1OXSC 1HQYE 2FWRA 3AM1A 5A4JA 3IHLA 1VDZA 1Z0AA 2QQ0A 5BYKA 5HZKA 1G64A 3PEWA 1LY1A 1E0AA 2H17A 2G0NA 2IHYA 3BC1A 5FOUA 1RE0A 4B3FX 3OIWA 2JLUA 5JFGA 1HE8B 1YZQA 2C77A 3CNLA 2QENA 4OHZA 2JLQA 1G3MA 4LYAA 1NMYA 3GJ4A 3CPJB 3EIEA 4OQLA 3W8RA 1J8YF 1E2JA 3O8RA 1JB1A 3M1IA 2D7CA 4LDJA 1ZC3A 2PL3A 1SKQA 4S35A 3Q7PA 4NYIQ 3FHCB 4GOKA 4TMKA 3Q9LA 2B7CA 2IUSA 2PMKA 1MRSA 1Z28A 1P2SA 3AB3A 2GZDA 4LV6A 5J47A 3AKEA 3A36A 1E32A 3TK1A 2CLDX 4RD1A 3DPUA 1OXVA 2F9MA 3EWSA 3KKOA 1ONBA 3PUXA 4HB4A 1TF2A 3D7MA 4LK2A 2HXSA 2ZI7A 3NDPA 1OJLA 4GP7A 1RC8A 1VIAA 1XXHA 2KSQA 1Y3AA 3AVOA 3KJIA 3S1AB 2ODWA 4PHHA 3R9WA 2OESA 5KSZA 1ZRHA 4Q4HB 2Q21A 2FPLA 3OEHD 4G3XA 5AJXA 1XEWX 4KFRA 5FR2A 3MWJA 2IEYA 4CGZA 2XTZA 4ON9A 1NKSA 1R0WA 2CMKA 3CH5A 1NY5A 2ZRHA 1OHHD 3WBKA 2O8CB 1NVWQ 1ZU5A 2HJGA 4DLUA 2XJ9A 4M9ZA 4BE7B 1CKEA 3BS4A 3AVVA 3B1VA 3GCGA 4LJ9A 2RGCA 2A5GA 2XX3A 2AXNA 3GLFA 4CYMA 2BKUA 3KB1A 4RKEA 1HY3A 3L8YA 1E99A 2HV8A 2G77B 4M9QA 1G6HA 4XVUA 1NF3A 2VF8A 3U3KA 2E9SA 4EJSA 1CR4A 2IYSA 5FFMA 1VCMA 3KTAA 3L0PA 3WHLA 2GBLC 2W6JA 3K0FB 3U6KA 4R7ZA 4AC9A 4BGDA 1OFHA 2BCJQ 4KBFA 1R0XA 1SVLA 2ZRJA 3DKVA 3MMPA 1E2KA 2WOOA 4A0FA 1U8AA 4QGAA 5C1BA 3A1WA 3U44A 4L5BA 4AYTA 3KKQA 4PPGA 4B71A 3V4RA 4R71A 1KTVA 2QP4A 3CKLA 3Q5EA 1IOZA 2ZS8A 3D3QA 3EARA 5DI9A 1QDEA 4WW0A 4TQ9A 2ZYWX 3CRMA 5GADl 1UM8A 1RVDA 2KB0A 1G17A 4LPSA 4EJSC 1NSFA 3EC1A 2BBSA 1OB2A 2NZJA 3U7HB 1NMXA 1XD8A 2FZLA 1YQTA 3K9HA 3VX4A 3AVWA 1A4RA 1W0JD 1WE2A 4YXWD 2GK6A 3PXGA 4OK6A 5H8WA 5TDHA 4QBFA 1COWD 2BMDA 5ELXA 1G3IA 3AGPA 4W7SA 4ESVA 1XXHB 2I1VB 4DCSA 3MGCA 5J4HA 2ERXA 4HDCA 2IW3A 1SKYB 3RANA 4TYPA 1VYTA 2UVQA 1N6IA 1NVXQ 4AYXA 1FQJA 1XEWY 3PCRB 3QQ5A 4IEIA 4LC1A 4I1VA 2A2ZA 3C16C 3VR5A 3TJZA 5JI2E 1AQUA 4C2TA 2QRZA 1G6OA 1XB2A 3KJEA 1YR8A 4M4SA 2QMUA 4MYTA 5KYKA 3N5CA 1U94A 1U81A 4TL8A 1ZVQA 4BFZA 4OI0A 1N0VC 3DZDA 2YZ2A 4UXHA 3TAHA 3HR7A 2J3EA 2ZXUA 2AN9A 2ZUDA 1Z47A 4FCTA 4OYHA 3UMFA 1AN0A 2DB3A 1T5LA 2QPAA 1DARA 1Y63A 3OF5A 1LNZA 1NRJB 4KFSA 1QG4A 4LJ6A 4WBSA 3LBHA 2W6ID 4M9SA 1XJ0A 4PQRA 3ADCA 4IXNA 1AA9A 2B8TA 4HLCA 5E7JA 1SKYE 4DT1B 1NBMD 1ZJ6A 2F1JA 3OIUA 1F2UB 5J5CA 2JJ2A 1P62B 2ODBA 2CE2X 1OLOA 4OL0A 5HE9A 3GLIB 1U9IC 4QBGB 4NTZA 5G41A 4DWJA 3TR5A 1GITA 5LB2A 1YRAA 1F6BA 3LW7A 1W5SA 4A4DA 2OHFA 1G18A 2F3RA 2DHRA 2W6JD 4GSYA 4WA7A 1VPLA 2ATVA 4DT1A 3EX7C 4Q48A 4IKEA 4Q4JB 5AUPB 5BN4A 4MRSA 4URXR 3CX7A 3WP1B 5JHGB 2YOFA 1PLJA 2WICA 3B1WA 2IS6A 1XZPA 1KY3A 2BKEA 4ZDJA 4A2PA 3SU8A 4BRWA 1U90A 5H68A 3IHWA 5C18A 3FB4A 1E2LA 4UXJA 4HLQB 2ZI9A 1TPZA 2W58A 2J45A 4MGIR 3JZMA 4R9UC 4DLXA 2OCBA 3LV8A 2AHOA 2XTNA 4IVPA 2DBYA 1FQKA 2ZUBA 2AL7A 1MABB 4KSBA 2GXSA 2NG1A 4GP6A 4E22A 2JLYA 1FL9A 5EUMA 3MWYW 4AK9A 3U4QA 1M34E 2D7DA 5JZVA 1GL7A 1TU4A 5KNDA 5LDDC 2OBMA 4EPTA 1Z63A 4NYJQ 1Z0IA 1T5IA 1GRQA 3FMOB 2GJAA 3QPWA 4M22A 3EA5A 4O25A 4TLDA 4CRWB 1Z0KA 1ZC4A 5KPDA 3T1QA 1KI8A 4EFMA 1P61B 3SS8A 3KQKA 2QORA 2W2VA 3KKPA 4BECA 5F3WB 3BFXA 1T3LA 3WXMA 2Q0HA 5DGXA 4KSCA 3ECCA 3H0KA 2BCGY 4RD4A 3PEYA 3I1FA 1H8HD 4FN5A 1OE0A 2WBLC 3CH4B 4N0DA 5G40A 4QBIA 1TUIA 2CNWA 3K09A 1TQ6A 3LXXA 1LS1A 5KOYA 5K8UA 2JJ1A 3U44B 4C2UA 3FFBA 1AJEA 4JVLA 5JMTA 1SXJB 4TYYA 2WKQA 2ZJZA 5KDLA 1MH1A 2XAUA 3JZAA 3EA0A 3BRWD 3GJ7A 1NBMA 6Q21A 5B30A 2IYWA 4JLDA 3K0FA 2ZIAA 1KDRA 3QI2A 1R0YA 3REFA 3P20A 1BYUA 5E7MA 3KTAB 4QXAA 2GF0A 5CDFA 1XTJA 1H65A 1Z8FA 5JRJA 1Q22A 5JWRA 1L4UA 3GJ0A 2XOKA 2XSZD 2XB2A 2GILA 4H9GA 3U7GA 4TSFA 5AR1A 1NN1A 3CF6R 1NIJA 4Q1FA 2ZSBA 4A15A 3FOZA 2BBWA 3A8TA 3GLFB 4TMVA 3L0SA 4D80A 3OEEA 3Q72A 1W36D 2Q3FA 3GLHB 4B33A 3WNBA 4BASA 1JPNA 2OCAA 4CEHB 5AK0A 4HZIA 2IXFA 4AG6A 4OK5A 1KY2A 1U9IA 1ZD8A 4LC0A 3BWDD 2ZPTX 2BVNA 2R9VA 3HYTA 1X86B 2ZRDA 4F92B 3U7FB 4M1OA 2IYLD 4RKFA 2PT5A 2RHDA 1GKUB 1ZM2A 1P2TA 1KI6B 1U8YA 5L3SA 1NG1A 3OAAA 5JWHA 1DE0A 4C30A 1G8GA 3GMTA 3TNFA 4GT1A 4G5RA 4Q9KA 2G6BA 5B2ZA 4C0AC 2IUTA 1GFIA 5FOWA 5K8LA 1MKYA 2RGGA 2WM9B 2HT6A 4PC3A 4TMZA 1G3UA 5JRZA 3T35A 5HZHA 2ZU0C 3EW9A 1E9CA 1ZD1A 4LV8B 2BC9A 4PHTA 5GVRA 5HKKD 3MG9A 2FF7A 3BJIC 3KXLA 5SZIA 4GPTA 4BLSA 2WJVA 2YNMA 3DO6A 5CIWA 4YLGA 5IRCD 5E7IA 1CRQA 1YR6A 1PUIA 1E9EA 2BHRA 1IN6A 4B3BA 3IGFA 1H8HA 2ZRBA 4C0QC 2G3YA 2JLWA 4DDTA 4IXMA 1OYWA 2EVWX 3VR2A 1HH4A 1TQ2A 4I1SA 3UG6A 3AQ4A 3SDZA 3THXB 3AF3A 2IBMA 3LRPA 4KVAA 4HI0E 2AWOA 4B74A 5IT5A 1KI7A 4DLZA 1IJFA 1UDWA 2AD1A 1SVOA 4BFSA 4BLPA 1PLLA 1W47A 4B3GA 2IWRA 4E5UA 2WOJA 3DHWC 2WIAA 3VR3A 3ZZUA 4M1WA 1TNDA 3UK6A 4IJMA 2CVFA 1LW7A 3GLIE 4W5JA 4OI2A 1G21E 2ZROA 4AWXA 4HZUA 4YMSA 1G291 1U0LA 2OM2A 3FPAA 3QKSB 2ZJBA 1BMFD 4Q9IA 1KSHA 2EFEB 3RABA 3C41J 3PQCA 2YC2C 4N1AA 1HTWA 3SE0A 4HEJA 1X6VA 3X1XA 2FEOA 2BM1A 1S3SA 3ICEA 4LJ8A 4LJAA 3ZQ6A 4LJ5A 3QXHA 1OYYA 3ZJYA 3DL0A 3FHTA 5LPNA 5EXXA 3FFAA 3EPJA 2RGEA 4TTQA 1OSNA 1SVSA 2O8FB 4UNPA 1DBSA 1II8B 2EWVA 2GESA 1UEIA 3DMNA 4D2IA 3CF2A 3FKSD 1GKYA 4OHYA 4MKFA 4D4MA 1KK3A 4NCIA 3EZ9A 3AKCA 3B5JA 5BQ5A 3T06B 4DEXA 4G5QA 3BXZA 1KZGB 2BBTA 4QM6A 3H4MA 5LD2B 3ZIAA 3F8TA 3SHWA 2YKGA 1JJ7A 5FL3A 5CB8A 1Z83A 2Z0MA 4XTCS 2W83A 1SVMA 3SEAA 4LYJA 3DKPA 3LQRA 3GJ6A 2HCJB 4L15A 1TQ4A 1YE8A 2C99A 2OEPA 1OV4A 4RCYA 2ZUCA 4WZAE 1KZ7B 2JIZA 4OJQA 1OH8A 1FX0B 4W9MC 4D82A 5EXPA 4ESHA 3IIKA 2ZJ8A 4Q66C 4MKHA 4X8OA 4LHXA 1OB5A 2VL7A 3MCAA 2OLKA 2PCJA 2GZHA 4B2PA 4JBXA 1H8ED 2GCPA 2VF7A 1FFHA 4UKDA 4II7A 1AM4D 2QMOA 3DDCA 4QHYA 3EAQA 1E2FA 4A0GA 1EG7A 2DFTA 1QHHB 5FOXA 1RKBA 1XMVA 2D06A 2QAGA 1JR3E 2W0MA 4NBSA 1E2IA 4P31A 1KKLA 2L0XA 3IILA 3UMRA 4NZYA 3CB4A 4MUAA 2V3CC 4F93B 5FPYA 2QSYA 1X3SA 3IQXA 2WWFA 4PR0A 1G7SA 1OFIA 4GZLA 3A6PC 1E6CA 3Q8XB 1QVAA 1Z6TA 4OQNA 3LXRA 2BBOA 3KQLA 4DB2A 3QF4A 2VYFA 3JVVA 3D31A 2EW1A 1KHTA 5FPSA 1CJVC 4I1UA 5D3MA 3I5XA 3X1YA 5CK4A 5F98A 3RNLA 4DSOA 2ZRPA 2CDNA 1A2BA 3RS2A 4XH9B 2OAQ1 2HJVA 2QE7A 4CF7A 1JALA 4NYIR 3SJAA 2ZR9A 2HLDA 3AVTA 3QBTA 1KO8A 4Z8YA 2IYUA 1W4AA 4UJ5A 1FW6A 4CEJA 3FKSA 3QVUA 4D81A 3O8DA 1KNXA 3CZPA 1G1MA 3CX8A 1JAIA 1ANKA 5KSYA 2HYIC 2X19A 4A8JC 1AS0A 1QHNA 2XXAA 4AKIA 1DAKA 1II8A 5KHOC 2RGDA 2Q3HA 4M1SA 1BS1A 3AP1A 5CYOA 1SQ5A 1XFAA 4C0BA 3UATA 1M8PA 4Y0AA 2WVJA 3TAUA 4DUGA 4P33A 1GWNA 4L4UA 4OQXA 5GVSA 1XF9A 5JS8A 2QN6A 2ZANA 2G83A 1AGPA 3VR6A 1FUUA 2BOVA 1D9XA 3TVTA 2OBNA 5J4KA 3E2IA 2WKPA 3VTKA 2VHUA 4V0MA 1B23P 2IEZA 2REXB 1H8EA 2GXQA 3X1DA 1EXMA 2ZTSA 5L3RA 2AKYA 1KKMA 4QFMA 2A5FA 2A78A 1G5PA 1KK0A 2BDTA 3C15C 1GRNA 3VNUA 5F2EA 1M6NA 3GLGE 4D0GA 2HUPA 1S96A 2QI9C 4HAVA 2BEKA 4US0R 5E4FA 3QKTA 3T1VA 2AX4A 4GMXA 3AP2A 1EK0A 3REGA 2J0VA 1XP8A 1T8TA 1T91A 3A37A 3DZ8A 3GEIA 1GIAA 2ZJYA 3THXA 1F3OA 1FMLA 1KSJA 3VKWA 2BJVA 5DE3A 2V6JA 4N3NA 4PQYA 1TEVA 4LRWA 2YWGA 4TLEA 2H92A 3IPXA 1E1RA 3I72A 1TMKA 3DM5A 2C98A 1BIFA 5E3HA 3C8UA 2XXAB 3FYHA 3QBVA 4DCVA 2QA5A 4XD7A 2OSBA 3IEVA 4PC6A 3RDPA 1Z29A 1XTRA 2B8WA 4BFYA 2R6GA 3UXMA 4Q5IA 4B44A 4CEJB 2XEXA 3KFXA 4Q4AA 3U3JA 3BK7A 4C0HA 3KX2A 2CCKA 2JCSA 2QSZA 4LUCA 2IUUA 1CJUC 2ZU6A 1Z08A 3B1YA 4EPYA 2QBYA 1OIWA 1NLZA 3K70D 3KQNA 1ODFA 1MO5A 3CNNA 1CU1A 4P0TA 4CZ2A 1UKYA 2OILA 3EZ6A 3IUYA 2MMCA 2Q9CA 2IXEA 3MUFA 1G7CA 1N6LA 1UBFA 3T61A 1LV7A 1W48A 4PPFA 3FWYA 1JR6A 4EPWA 3TRFA 4DUGD 4YMUA 3QF4B 2NO6A 4BLQA 3LA6A 4ITRC 2FOLA 3TUZC 1G16A 2J5XA 1G19A 4KXFB 1NN0A 3IO3A 4KYUA 3NDBB 4OI1A 3K9LA 4C4PA 2GJSA 4WZBE 3C7KA 3NXSA 2DCUA 3R9IA 5DISB 1QHIA 3RHFA 2WV9A 4Z1MD 1NVVR 2IS2A 2H1LA 4AURA 3P27A 4FMDB 3SOPA 2D2EA 3MD0A 2REBA 3FTQA 4ZDWA 1F2TA 1MRNA 4DB4A 4UQOA 1E0SA 1I2MA 4KV9A 3MRSA 4BLOA 2JATA 5G3YA 3A4MA 2ONKA 5FPKA 1C4OA 2W2XA 2C78A 3EIQA 1DOAA 1UKEA 3F3YA 4JSTA 3DOEA 3MWKA 1JXOA 4PX9A 5IK2A 3TUJC 1R7RA 4QKQA 3CR8A 4D0LB 2VSXA 2ZE8A 3K8YA 4QM7A 2FG5A 3ASYA 4GL2A 2J0UB 2JDIA 4OQMA 3CR7A 4FCWA 3SYNA 4DIDA 1CP2A 2ZSFA 3CO5A 4DKXA 4L9WA 4C7OA 2OCYC 1OFTA 4EUNA 5JLJA 1II0A 4D26A 4A2QA 1LB1B 1Q1BA 1KI2A 2J87A 5AWFC 1E1RD 1JEDA 1NG9A 4NP6A 2O52A 5B64A 1P5ZB 2I3BA 1E0JA 5EZ6B 1Z0FA 4PPNA 2GDJA 3CRVA 3LX8A 3AGQA 4DCNA 4XD7D 1XCPA 1U98A 4UNNA 3W6PA 1A1VA 2YJTD 1E2EA 4TLBA 1ESNA 1J90A 1N3BA 5G3ZA 3FGNA 2IL1A 1YKSA 3RS5A 4L8GA 2D62A 4OI4A 5FTJA 1JJVA 4ZKEA 4ZI2A 3ZVRA 2MSEB 2CHQA 5EUQB 2O8FA 1RJ9B 1B0UA 1XCMA 2OV2A 1LF5A 2NGRA 3NKVA 3DOFA 1E3MA 2XZOA 1KAOA 3TMKA 4AY2A 1N6NA 1KDPA 4TWZA 1GKIA 5L3QB 3R7WB 5L3VA 2GNOA 1IY2A 1KYIA 3RRZA 4TZ0A 1OW3B 1HT1E 1XEXB 2WMNB 4YMWA 4ARZB 3DMDA 2SHKA 1EGAA 4EAQA 3FMPB 4IDPA 2GAOA 2PEYA 2CXXA 3ZZ0A 2GCNA 3QXXA 2CL6X 3LLMA 3IDQA 3QUSA 3ZQJA 3NVAA 2A30A 1KDTA 2JLVA 2VBCA 3D6TB 3MJHA 4MA4A 3HPQA 2IXGA 4L9SA 1SXJD 1R4AA 3GLIA 3CRW1 1TAGA 1DPFA 4KFUA 5EE5B 2IS4A 3B9QA 2QNRA 1E94E 5IK2D 2HT1A 4POAA 2XJ4A 4TMWA 1U99A 3NC1C 2IHBA 2DPXA 5J4LA 3ETLA 1FTNA 4I1OA 4KITB 2HYDA 4KI0A 3PUVA 2VHTA 2PX0A 4ERNA 4OBEA 3C5HA 4JYBA 4AIIA 1IXRC 2AK2A 3QOFA 3SR0A 1L8QA 1N6PA 2FGKA 1RRGA 2A5YB 1QZXA 3K70C 2IA5A 5AJZA 4US1R 3BGWA 3NG1A 1COWA 1U8ZA 4BRUA 3MWLA 1RYFA 3E1SA 1E2GA 1NIPA 3N70A 3RS0A 1I2DA 4LBVA 1NSTA 1KI1A 3QEOA 3TSZA 2N42A 1K5DA 3G82C 4NCNA 4XSGA 4B3CA 2XGJA 5KPJA 4YONB 4EFLA 4URZR 3GFOA 1KI6A 2EFGA 2CL7X 2Z83A 5L3SB 3CUEF 2O0JA 4OHVA 3TIFA 2F7SA 3VR1A 2MSCB 1N6RA 3VFDA 2QQEA 5A5GA 3BH6A 5EZ5A 2ZE7A 3RC8A 3PR1A 5FL7A 1JBKA 4HDOB 3W3AA 2YOHA 4PHFA 1HURA 2NMVA 4CEHA 1AKEA 3IBYA 3GLHA 2QT1A 4FWTA 1SXJC 1GNPA 1TEXA 4BLTA 4JLMA 3TQFA 3RC3A 4G01B 4BZXA 1CJMA 3FKQA 2QM8A 3BH0A 1OKKA 4Q7MB 2WPDD 1E9RA 2RGXA 2BJWA 4RJLA 4RD0A 2I1QA 2AK3A 2TMKA 4KO8A 5FBLB 4M8NE 4DDVA 2RCNA 4GNKA 4Q1DA 3V4FA 2P5TB 3TUIC 1T0HB 4CDGA 2GVZC 3A1TA 1G3QA 4D4JA 1GTVA 4C0LA 4DIEA 4GZMA 4O2RA 4EKDA 3U60B 4UNSA 1TTTA 1JR3A 1MT0A 2OFXA 1ZD9A 4EJSB 4Q1EA 1P4SA 1SHZA 2AWNA 2VTKA 2QRNA 1SXJA 4O2LA 1CF4A 1CBUA 3HJNA 4FWIB 5FUYA 1ZP6A 3U3OA 2ZITA 3LDAA 1NY6A 1I4LD 2JGNA 3NH6A 5CJPA 3WRXC 1XEFA 4B32A 1XPUA 1X8LA 4KYIB 4QGGA 5BN5A 1VCOA 3GPLA 1HE1C 5SZHB 4PSKA 4KAXA 3PUYA 5EQTA 4D4LA 4IDQA 1HYQA 4V0LA 1XJQA 4O0MA 3QEJA 2NPFA 1LF0A 3E5HA 4IDHA 1GVNB 2EYUA 3NHAA 2JA1A 5GJVC 1QHSA 1W7AA 3VMFA 1G4AE 4OHXA 4JJKA 2CK3A 2CE7A 4DSNA 5HPYB 1GDDA 1SGWA 2BMEA 4HAUA 2QTFA 4DHEA 3SYLA 3U4QB 3L2OB 2GRJA 4IOLA 4MITA 1A82A 2ZETA 3H2YA 1E2DA 2XZLA 3L43A 3B60A 1CIPA 4JVSB 4W5HA 1XX6A 3SNHA 4ZCIA 1N0UA 1MABA 2G0TA 1IAQA 5HCIA 3PIRA 1QG2A 3GQBA 5DI3B 1E1QA 1VHTA 3I5YA 1SVWA 1GL9B 4PTLA 3GFTA 2FFQA 2JLXA 1NP6A 5K8IA 4PZZA 1P75A 1YZTA 4TN1A 1AKYA 4A36A 3KXKA 3OFND 2CNWD 4JS0A 5FBWB 1IN5A 4Q4LA 3NBXX 4CVNA 1G8FA 5AUQA 2ZVQX 4XVQA 1M7BA 2FJUA 3M6AA 4JZKA 1N5JA 4Q4JA 2H57A 1W2GA 1IXSB 4KHZA 2IYXA 2WPDA 2QZ4A 1IN4A 821PA 3ADDA 4E07A 1NJFA 3SC3A 5F9FA 3KZ1E 3R9XA 2V6IA 5BYJA 521PA 4FW9A 3RYTC 1W2HA 3RSOA 3U6BA 1W46A 1Z3IX 4ILEA 3GLGB 2ZJ2A 4URVR 2IYZA 2XOKD 2P5SA 5EXSA 1R6BX 3VHLB 2R8RA 2GXUA 1KDOA 1XTSA 2OLJA 3C4JA 4TSFD 4M1KA 4ZO4A 4A9AA 1F2UA 2XNDA 621PA 4KLNA 1BH2A 4B76A 3NBFA 1ZUHA 2WJIA 1QHGA 1EFCA 1JQLB 1E9BA 1X1SA 721PA 2C9YA 2RB4A 2QEQA 3ZVLA 4F91B 3L82B 3EZ2A 2YYZA 4HAWA 4MGKR 1GOTA 3THYB 3QY0A 1UAAA 4DBLC 1SVKA 1KO1A 2F55A 2A9KA 5FOTA 3A4LA 1R10A 3IIJA 3ADKA 3DM9B 3NH9A 4HUQB 2PMDA 3AF0A 3KFVA 3VAAA 2H5EA 2VHJA 3QVVA 3HDTA 3MLEA 2GCOA 3LD9A 1G7RA 1KMQA 3OAAD 2ZQ5A 5KNBA 4K8OA 2CK3D 2LWIA 3IPYA 1FMJA 4G1UC 4MRVA 3EPHA 4XTRA 4AYWA 5DYGA 4EPVA 2Q3MA 2FZ4A 5HTKA 1S4QA 2PLFA 2QUZA 2PLRA 4TMTA 3HU2A 1P2VA 4JT4A 4YMTA 4KU4A 2ECKA 3R20A 4DSTA 3UPUA 4WXPA 2ANBA 5JEDA 5HKKA 3W9YA 4CEIB 5LB4A 4LHWA 1E1QD 5J40A 1ELOA 3RRYA 1K8RA 1GM5A 2IF2A 1LS6A 4LYHA 2FPMA 4TQAA 3PVSA 2O8EA 2RKOA 3ZD6A 1XRJA 5C2JB 1A2KC 1DEKA 3OFNA 2B21A 4Q02A 1E9FA 2J0QA 1GG2A 2P2LA 4URWR 3FE2A 4GRAA 4LHYA 3WYFA 2P0EA 2K5UA 2GVDC 1T6NA 3H86A 4LBYA 4YDSA 2Z4SA 4AG5A 3QSYA 2O8BA 1R8QA 1ZW6A 1NVUQ 1ZIPA 4BLRA 4U5XA 1FOEB 4FI3C 4MRNA 5EP1A 5F9HA 1Q1QA 1YRBA 4A1FA 3GEEA 3THWB 1KOFA 4UNRA 2F9LA 1F5NA 2C9CA 5KTYA 2DR3A 3Q3JB 4R2IA 1EESA 2VH5R 4RZ3A 2EYQA 2WSMA 1D2NA 3BE4A 3E70C 4V0OA 4MDFA 3I73A 3WP0A 4MGYR 1XPRA 3P1JA 2V9PA 1ZYUA 2XNDD 3FHOA 4Q9HA 1Q0UA 2GETA 2FSFA 1X8KA 2I4IA 2WWWA 3QKUA 2ZSDA 3LVRE 2ORVA 3CIOA 3K1JA 3QIAA 5DN6D 1WRBA 1VMAA 2N46A 2D2FA 3M0EA 3VU9B 5FI1B 1XCGB 3LQQA 2O8CA 2J59A 1KK2A 2F6RA 2FMXA 4GDFA 3KUCA 5BXQC 3A1UA 2E1RA 1KMHB 3RRMA 4RSGA 5CITA 1OH7A 1XXHE 3CX6A 4Q4HA 4EDHA 1DG3A 1R0ZA 4IOJA 3TW4A 5EJEA 3QXCA 3S1AA 1M2OB 3CONA 3N2EA 2JEOA 1CRPA 1RPZA 3TQCA 2GHIA 1AZTA 4G5OA 3OIYA 2ZRGA 4A2WA 2KBEA 1G5TA 4ZPXA 4JVNA 1WBDA 1XMIA 4TL9A 4DEYA 1SVIA 1P73A 5BW8A 3BB4A 3RVBA 1FP6A 3T15A 4AKEA 3TW8B 2BWJA 3CM0A 3AVXA 3GJXC 4NL4H 1A7JA 1RZ3A 2Q9AA 3OE7D 1KIMA 2C5LA 4DDUA 4FMCB 1VYVA 3I8SA 4M21A 1HQCA 1IBRA 2LCFA 1KI3A 2D4HA 4F38A 2Q9BA 1GL6A 5KUTA 2JIZD 1N6HA 1CTQA 2YV5A 2VP9A 3QKRB 4OJKA 4C9BA 2FFBA 2G1KA 1KJYA 1R5OA 1OH5A 4CW7A 1HA3A 3K0CA 3LW8A 1TF5A 4ZIRA 2GA8A 3B2EA 1SZPA 4PSVA 5EP2A 5TV2A 4B3XA 5E95A 2C2HA 2WAYA 1R5BA 4A92A 4RFSA 1V43A 1AIPA 2OE2A 1QHYA 1UPTA 1XD2A 1XMSA 3NHBA 3Q85A 4IEEA 3QXSA 4LOAA 4DZZA 1C1YA 1JQJC 4LBZA 3NWJA 1L2TA 4HUTA 1UF9A 3W8NA 2CCGA 4Q1AA 2F1HA 3SJBA 1PVOA 2ZYVX 4ZI3A 1XNJA 2LKCA 4PO8A 3NEJA 2PCLA 2FPKA 1JAHA 1QHXA 4HYYA 4AD8A 3U7EB 1CR2A 5CB6A 3GJ3A 3R8FA 4CEIA 4B47A 4B2IA 2CJWA 5TVKA 3TR0A 3B6EA 1KSFX 2IWHA 1UBGA 1Q1ZA 3K0CC 1WQ1R 2A5DA 4PC1A 3WNCA 2QT0A 2WWYA 2PJZA 1HV8A 2QP3A 3QG5A 4LV5B 1Z07A 1ZMXA 3SQXA 3U3MA 2DWPA 3KUDA 4ZDKA 2V7QD 5TARA 4E03A 1E2PA 3WBJA 2NOAA 1VG0B 1W4BA 4ZKDA 2ZR7A 2F43A 2WHXA 3SBDA 3AF2A 3T12A 421PA 5SZKB 2AXPA 2NO7A 1U0JA 2V8OA 1ZM9A 1TX4B 2ZS7A 3QE0A 5BWMA 1UJ2A 2F43B 2KBFA 2HXYA 3AUYA 1Z22A 5DSZA 1IHUA 4URYR 3EPKA 2P67A 1P60A 2HLDD 2ODNA 1FZQA 2PX3A 4B34A 1Z6YA 1YZNA 1CJTC 1DAFA 2OFOA 4Z54A 4TYNA 1XTQA 1XU4A 2O8DA 1TL7C 1N0WA 3EZ7A 4QL3A 4KVGA 4LYFA 3A1SA 3RLFA 3H84A 5B58C 5HR5A 3UWKA 2QMHA 1WMSA 4ZDIA 3P32A 4I99A 2GBLA 2GJKA 3BORA 2ZI3A 2ZM5A 2A3RA 1II9A 3U5ZB 1M1YE 4YQFA 2UKDA 1WBBA 5FBQB 5AJWA 1T8UA 1KO4A 2HEIA 4BZPA 2P65A 3P4XA 8OHMA 4Q7LA 3SJZA 2LKDA 4A0HA 2ZI5A 2ZSAA 2W00A 1US8A 2FU5C 4NYMR 3GLHE 3T1OA 2EFCB 4U00A 1TF7A 2VP0A 4FD2A 4X8HA 1R8SA 2FE4A 3JVUA 3B78A 1UKZA 2VHQA 3KQHA 2NQ2C 1E9SA 3KKNA 4MKGA 1VKJA 4XSHA 5IDVA 2OCPA 4DLSA 1KGDA 2GJ9A 4HLDA 1E2NA 2YOGA 2W2TA 5KSPA 3AEZA 4NMMA 1R2QA 2WJHA 2IT1A 2NZ8A 5JCPA 1IM2A 4HSEA 221PA 2Z6VA 4IFBA 5DI3A 1NLFA 2D74A 2JAQA 3I92A 1IY0A 4B3DA 4NH0A 1EFRA 1NN3A 2ZYUX 3NBZC 5C4GB 2QP9X 1OXUA 1E2QA 3TH5A 4JLAA 1DG1G 3TLXA 1UKVY 1RW4A 5KDOA 1OXXK 4Q21A 2V1XA 4HB3A 4A8JB 2BMFA 4PAQA 1YR7A 3KDSE 2WSSA 2ODEA 3QNUA 1NN5A 4YMVA 4L16A 4PZYA 4QGHA 3G0HA 1YU9A 2QL6A 2AR7A 4B2LA 1KAGA 3GP8A 4KCGA 1A5TA 2NIPA 1E2MA 2CHGA 2KI5A 3W6OA 2XB4A 1OPXA 3ZYCA 4DVGA 5KO2A 2QPTA 3BH7A 3VU9A 5FH9A 2YHSA 1ZU4A 2YC4C 4DLRA 3Q5DA 2FSHA 3QJYA 5JSZB 4DJTA 3ZGXA 3QPVA 1FNNA 5H70A 4QGFA 3B82A 3RWMB 1YZLA 2NTYC 1BKDR 5FBRB 1YZGA 3HU1A 4PO1A 4CIDA 1W44A 2XNSA 1M7GA 4GFDA 4NDZA 3FDIA 4V0KA 2ZRMA 4X8LA 1DO2A 3VHXA 2UZIR 3O8CA 4TLAA 4B48A 3GJ5A 3B1XA 2C95A 4DLYA 4LJYA 3RRNA 4BFVA 4HB0A 2VP2A 3HYRA 1XWIA 3THWA 1S9HA 3CWZA 3KJGA 1U0HC 1NMZA 4MYUA 4JMPA 3SZRA 4CT5A 4G0NA 2O5VA 1DADA 4PHGA 2GZAA 4DLWA 4XJXA 1AZSC 1PUJA 4RY2A 1NKTA 4WXRA 1KNQA 4RD6A 2FN4A 1WXQA 4RFVA 3L8ZA 1DAEA 1GSIA 4DC9A 1RIFA 4QHTA 4V03A 3SBEA 4U02A 1KSGA 4IFEA 1MO3A 4FMBB 3LNCA 3WNDA 1OH6A 1G7TA 4Q9JA 1JXMA 4UJ3A 2HCBA 4IDNA 4QG7A 2QAGC 2QU8A 2R6DA 3X2SA 1X8JA 5CM8B 2RGAA 3PUWA 1VIYA 4JLKA 1P7CA 2R62A 3O8BA 5DO9A 3C5CA 3GEHA 2ZAOA 3PUZA 3W5IA 2JLSA 2X2FA 2P6UA 1EFRD 4GOXA 4JKIA 2GAAA 4H1VA 5GJBA 2JDID 3BFVA 1E9DA 4LI0A 1FTSA 1ZNXA 2H16A 1S2MA 2GK7A 4MYCA 4TL6A 1TQDA 2FDCA 1DTSA 4BZQA 3SYKA 4FIDA 5EE1A 4BFTA 3ND8A 1BYIA 2J7PA 3BERA 1XZQA 2R6AA 3AKYA 2G88A 4DRZA 4CT4B 3AUXA 2WJYA 1QVRA 5EP3A 2P6RA 2RH5A 3OEHA 1XMJA 1L7VC 3T5GA 5C46F 3THYA 4H1UA 1UBCA 1XJCA 4HDQB 2G1JA 1J70A 2VHCA 4ZCLA 4ABYA 2ZREA 3L0OA 2VLIA 4MDEA 1MO6A 2QG6A 2JLZA 4P4SB 3W3ZB 2PZEA 2VRWA 5TXGA 3CPEA 1N6OA 4W5WA 1P6XA 1D8TA 3ZH9B 1MOZA 4EPXA 2DFKB 3WMFA 3K0AA 5JS7A 5D3QA 3NBYC 4V0ME 3IO5A 4LY6A 4IVRA 3W34A 3PFIA 5FTLA 5FTKA 3I4LA 5EP4A 3PG5A 5J4VA 1BOFA 2QGNA 1N5LA 2YWFA 4Q00A 2V1UA 1Z0JA 3F5FA 1GNQA 3HWSA 5GJWC 2FEMA 3HP1A 3VKHA 2Z5FA 3LY5A 1HEIA 1E79D 2BM0A 4HAXA 4JL8A 2OBLA 4BPBA 4DDWA 3D8BA 2FSIA 2QM7A 1JEEA 3LLUA 1QF9A 2HDNB 5JJLA 4Q03A 2JJ8A 2GF9A 1ZNYA 2R6FA 4ARZA 4NCKA 4TYWA 2DYKA 3TE6A 2VPPA 1G8PA 1E96A 1O87A 4Q47A 1GRRA 3R7WA 5L3QA 1HUQA 2ZSEA 4M53A 2VP4A 5GJCA 4KJZA 1J8MF 1Z6AA 1LTQA 1W0JA 1G8YA 2CBZA 3AVPA 4NE2A 2P3SA 4YXWA 1VCIA 4EPRA 5DH9A 4PSAA 3U2QA 4QRHA 1SULA 1OIXA 1RJ9A 3RSLA 1FUKA 3QXJA 2EU8A 2OT3B 3NIBA 3FVQA 3RAPR 4TYQA 2FFAA 4B75A 4IW3B 1J2JA 3H1TA 121PA 3PEVA 1P9RA 2GXAA 3QF7A 3GJ8A 2J46A 2FFHA 4JLBA 4AI6A 2ZEJA 1DAMA 2GWHA 2J7PD 1IQPA 3F0TA 1ZINA 3NTUA 4RZ2A 4QJ3A 4K81B 4ACBA 2PZGA 3VKGA 1N5KA 2ZE5A 4MQBA 4O3MA 1Z6XA 1Z0DA 3SN6A 4F7WA 5KU1A 2ZAMA 1MO4A 2X8AA 2YWHA 4F4JA 3ZVNA 4NONA 4FXPA 1LFDB 2HF9A 3CBQA 1LVGA 3EWAA 3V00A 1SHKA 2DY1A 1E9AA 3RS4A 5CIQA 2W6IA 2Z43A 3I61A 1Z2AA 5DLQC 3EC2A 4JLPA 1NI3A 1VECA 1YJ5A 4WIAA 2BIFA 1KJWA 3WHKA 3K0SA 1CEEA 2J7KA 2QPOA 4TTRA 3GLFE 3ZLJA 2ZRCA 1KI9A 5FR1A 5FPHA 4B6FA 1DAIA 4EIWA 1RRFA 2JJ2D 2WWHA 3ASZA 3BB1A 1O3YA 3K0EA 2WAXA 3RWOA 5DNYB 5C4MA 5FL7D 3R8CA 2H8KA 2ASEA 4NKRA 5FUWA 2R6CA 1IN7A 1F2TB 1I4DD 2ZS9A 1GZSA 4GOJA 1WB9A 1J7KA 1E79A 1KI4A 4Z51A 1EFTA 5DHAA 1NL3A 4PAOA 3WMGA 4D25A 5FBVB 5K8TA 1UDXA 2Y8EA 3IKJA 1OFUX 1OKKD 3PEUA 4FINA 1E2HA 4B6EA 1ZBDA 4P3YA 1T9HA 5JJIA 5BN3A 1VTKA 4EQ6B 3QENA 1T3SA 5FUXA 2FV8A 5UKDA 3FMIA 1OIVA 4MGZR 5KNCA 4BEBA 4NYJR 4KFTA 4BQSA 1OT3A 4G5GA 3A4NA 3FMFA 1ESMA 1GNRA 3UWOA 3K09C 3SFZA 4NYMQ 4KBGA 1JR3D 1DS6A 5KSOA 3ZD7A 2CEAA 2ANCA 2OXCA 1WCV1 4PPQA 4S2EA 2QTVB 2ZR0A 4HAYA 3OESA 1G3RA 5JBQA 1Q44A 2J41A 1GP2A 1KO7A 2NO9A 4P4SA 4LHZA 3EASA 2ZJ5A 2ORIA 3J81k 3LBIA 4QNMA 1JPJA 1GUAA 1KK1A 1VCNA 3GD7A 4PANA 5HCNA 3RS3A 3ND9A 2R44A 4D4KA 1Q3HA 1ZM4A 2WZQA 1K5GA 2H18A 3B8HA 3X1ZA 2OO7A 3K9GA 3T5DA 1C9KA 2CL0X 5CDFE 1Q1EA 1TUEA 2X2EA 3W6NA 1UADA 2B6HA 1G20E 3CPHA 1E69A 3LX5A 4MKIA 1PLKA 2VQSA 2JJ1D 4AKHA 2NPIA 3LWNA 5CLLA 4FCVA 2ORWA 1Q3TA 4RD3A 1U2RA 3TVDA 4C0JA 1N25A 1NNEA 1V5WA 2J9RA 3CLVA 1CS4C 1X1RA 3OHMA 4LJ7A 4PC7A 2WWGA 3NC0C 5FOSA 1OF1A 4PC2A 1VG9B 1DAHA 2XSZA 3UMSA 2YVUA 2C03A 3A58B 3L0IB 1VG8A 4EQ6A 2NO0A 3HU3A 4HLUC 1YVDA 1D2EA 4MUBA 2GEDA 4MRRA 3DVLA 1TU3A 1R5NA 4R98A 4DCTA 3OIVA 1XEXA 3K9NA 5TB5A 1EFHA 4JSYA 4JYCA 5CJ2A 2QMEA 3LBNA 2ERYA 3OEED 3ICQB 3P26A 3VNVA 1XD9A 2O0KA 4OHWA 3V9PA 5KDDA 2X77A 4M0LA 1ZIOA 5M04A 1G4UR 1WDTA 4X8MA 2QY9A 1P2UA 4DXAA 2O0HA 2C96A 2MSDB 4NU0A 4OQFA 2QAJA 4ASUA 4V0NA 1WA5A 4Y0VA 4C0KA 2CLCX 1MV5A 2F1RA 3K70B 2WWIA 4LPKA 4Q7JB 5JHHB 4YC7A 2ZJOA 2PT7A 4BFWA 1T3HA 5JJKA 1S8FA 5FI0B 4KODA 2ZRKA 2A7QA 1NVVQ 3QPUA 1QBKC
chains in the Genus database with same CATH superfamily
2IS1A 1GNVA 3EK2A 5ICMA 2XWQA 1C1XB 3L1HA 4URHA 3V3KA 1UBKS 4TLCA 2B7BA 1QKJA 4QNRA 1CSEE 4Q3EA 3SLKA 5JV5A 3ZZMA 1NC3A 3BGOS 3NHUA 3O47A 4PZAA 4MMYB 4DCUA 4F5WA 5K3SA 3KTOA 2PJUA 3BULA 1CZNA 3J81A 2UDPA 4I8XA 1BDJA 4R1PA 1QB7A 3VR2D 5HQJA 1IONA 1EJ6A 1Y8CA 3N2YA 3N2IA 4R0VA 3EISA 4S24A 2C42A 3IV7A 4C03A 1EX7A 5K0TA 3H2SA 5DYWA 1DTWA 5JARA 3R3XA 2ZRIA 1V7ZA 4LISA 5FB3A 1OVMA 3A6KA 4YCCA 4LZOA 4W82A 4JJEA 4LGCA 4WKPA 2D1TA 4E70A 5EPUA 4H27A 3FF1A 3QWAA 2FPRA 2DC1A 2Z2KA 4IH1A 2AG8A 1QKKA 4ZQCB 1KHHA 3A70A 1D2GA 2WD8A 4OQQA 3BGVA 3LUBA 4G0MA 3KXIA 5ARDA 2A5JA 4YRPA 2V7WA 4RVNA 2RCYA 5JCJA 3SP1A 1JW9B 2DWOA 1A88A 2J6BA 1LBHA 1XQVA 4BWYA 3BBPA 1N5RA 2VSFA 1FNMA 4OB6A 4W7IA 1H93A 3UT0A 3WYGA 1NOIA 3A6FA 6GPBA 4Z4GA 3BKWA 2ONJA 3NCTA 3PENA 5IN4A 1K6MA 5KVVA 4V39A 1BVUA 4QUHA 2HR1A 2C29D 1J4AA 2O48X 2PD4A 1LLFA 1S3GA 3G5MA 1KY4A 3PQ8A 3NOOA 2HBQA 2VK4A 4GZ6A 3HBNA 3V8BA 4HFMA 3KDPA 2D8MA 3M6XA 4NHOA 5H4HA 5SICE 3ZHXA 2JKZA 1ZNWA 4KPFC 2E3JA 4K87A 4HS9A 3LP8A 3UENA 4XDGA 4A6XA 4JUDX 4V02A 5IAGA 2FZGA 3VR4A 4DLAA 3AJAA 4LJRA 3GBPA 1DJPA 3KAQA 2ERCA 2BKVA 5E6SA 4D0NA 3KJHA 4Q3NA 4MW9A 2NTEA 4OHFA 1Z7EA 3DAGA 5KC8A 4PICA 4URUR 4JODA 3VPSA 4YV0A 4PLPA 3MINB 2GCEA 1Z35A 2J6HA 2VSQA 1C2TA 2QRHA 3MXTA 3OPXA 5DN6A 2WIFA 3KKZA 4M9RA 2P9QA 1L0BA 4J0JA 3M3PA 3B13B 3UHAA 3NVDA 1ZUIA 3FROA 2JS7A 2Y2VA 1T4BA 5G4KB 2RAPA 1EH5A 5DHSA 4C7BA 3AKDA 2VNJA 1G20B 4R2HA 4EFKA 1FYFA 1T8PA 3I32A 2VIIA 4GLOA 3N0XA 4KYVA 2XDWA 4MROA 4JFAA 4JLUA 5A0FA 4F5ZA 1UWKA 2BZ0A 3ELBA 4PEVA 4DA9A 4YRIA 2JBAA 5DLDA 4US2R 4BBPA 4M8IA 4B73A 1VJRA 3VGPA 2YV1A 3ZIAD 3O4FA 4BX8A 1DELA 1IY1A 2BFAA 3BB3A 5DP1A 1CR0A 3WKCA 1XAGA 2VP6A 3TQTA 3LVQE 2IYOA 3IR5A 3C0KA 3NUQA 3BMNB 3W1WA 3IV9A 5KKAA 4HTFA 4AJPA 1FRVA 2UXDB 1GT91 4N9QA 3G49A 1KJZA 1EFVA 1EG2A 5KWEA 4R0MA 3ND6A 1DJNA 3F8SA 2ZVPX 4E94A 5E1MA 5CB4F 5JEEA 3HU5A 2H4YA 2JIOA 1JRLA 1P29A 1L4YA 2D3WA 1XCOA 1K8YB 1LK0A 4G5HA 1LDMA 2CZCA 3QVGB 3QVSA 4GEKA 4PZLA 3OZ7A 1YD7A 3PP8A 4MGEA 1FDTA 4TL7A 1XU7A 4X7MA 1QRAA 1NXWA 3OURA 1GILA 1HEYA 5IH7A 2N1BA 3HP7A 5TS2A 1HK7A 1CP3A 2WVAA 1H1LA 3O9ZA 3NYWA 1FY2A 4PF1A 3MRVA 3ABSB 3AI1A 1WDMA 4KGZA 3GUUA 2ZDHA 1F12A 1JG3A 1QFSA 2EP5A 1DKNA 2H4HA 2X1VA 5JJBA 1XD2B 2WKRA 3PUKA 5AI9A 1QAQA 3LOQA 3UFXA 1U3FA 1R4MA 5D8DA 2FA9A 4OKSA 4INOA 2Z3ZA 3CW9A 1TVKA 2OUKA 3BFKA 2IHNA 3HNRA 2IP1A 3Q0TA 3B1ZA 4XYMA 2YVQA 2IYPA 4RHEA 1EMDA 3ZHQA 4ZIRB 5HIKA 2WT4A 3AV3A 3F7OA 4IRUB 4IIJF 1W49A 3BD7A 2QOEA 3AG5A 4FFSA 4CLOB 1C7QA 1CLUA 1FSZA 2ATEA 3D8SA 3HFRA 5B1HA 3SX2A 1V16B 4KTVE 4WZ6A 4CLDA 1INLA 1HNWB 2CVHA 2HJRA 2W0SA 4KPUB 3M8KA 4JXKA 2ENWA 1ZK1A 5K03A 2OO5A 1F8YA 1K66A 4FW8A 4MVWA 1P9NA 3CNBA 4TMFA 1N2CA 2ZRNA 5C51B 1LZLA 2XWJI 4GI7A 2JBHA 3TKLA 3DEFA 3NWPA 1SXJE 3E9RA 4BO9A 2XMSA 1IN8A 1BFUA 4ZFNA 1F6WA 3TW8A 3PDJA 1CXZA 3ANMA 1OI7A 2YYSA 4CBVA 4O8CA 4DCOA 3QKWA 1E0KA 1VQ1A 3SG0A 3THOA 3D6HA 4PYLA 2FP4B 4WOPA 1G6KA 1SCUA 3HG7A 3SXPA 5KMGB 1DRKA 2KWIA 4ZVNA 3U7QB 3ZBPA 3E2PA 3GFRA 1UC9A 4RH0A 4A8JA 2HMUA 2J0SA 1M2OA 3K30A 3PQ3A 2XUAA 1P2DA 2XTJA 3WK8A 3KPWA 1JEAA 1I3LA 5ADHA 2H7VA 4DZTA 4TTPA 4OJMX 5LN1A 1IY9A 1ULZA 5DGTA 4UOEA 3AH8A 1XCBA 2YJ6A 5T4HA 3WMEA 4B80A 1ZRMA 1JUDA 1N1GA 3JQGB 5I4CA 4HLUA 2UZ3A 3KNZA 4Y2PA 5KVQA 2RK4A 4JT9A 3FTNA 3ZY2A 4NIMA 2G70A 4WKNA 3KR0A 4WECA 3VOSA 2V4ZA 2AVDA 3QX9A 3F97A 4E2YA 2F1IA 3KHTA 1KZHA 3MERA 4JBYA 3H5LA 2Z4RA 5LQDA 3VI4B 2HF8A 2HJ9A 1L4BA 3GGOA 1LSUA 1UPXA 2BD0A 3T34A 2VZLA 4ND5A 2KM1A 2BSQA 4XCVA 3UJBA 2GEUA 5BQOA 3BAFA 1AXEA 5AI0A 5T3UA 5DNCA 2NAPA 3A31A 4UASA 1NLUA 1ZGZA 4WVLA 3BMOA 2HOQA 3EIHA 3Q10A 1HZZC 1UFQA 3FN4A 1JHDA 5TEVA 3TXXA 4YX9A 2PXCA 2UUBB 2G76A 3E0XA 4F1JA 1EKXA 1FPMA 2C1EA 1IMOA 4K6CA 2GVNA 2DCMA 4FOLA 4MMXB 2HCRA 3ZW7A 4BQRA 5CIYA 1XKXA 4JI8B 3N39C 3WYAA 2XXBA 1GSAA 3N8NA 3VQTA 2X15A 5JQGF 3JQ8B 2ABWA 3ZHUA 1UT5A 1Y6QA 2FLVA 2QJTA 1DTEA 3GUCA 5HYVA 1O94D 5FQOA 2NSYA 2QD3A 2HLPA 3HVRA 1V25A 2Q1UA 3OWXA 4FE4A 4Y9UA 1B2LA 4NNPA 2Y1KA 4OLFA 5I7HA 3SXUB 5EHXA 2DBVO 2FZWA 2ZI6A 5CCDA 4N12A 2O3UA 1TVEA 1T0IA 2CJFA 3JYOA 1NNLA 3SI7A 4X7PA 1Q12A 4GBMA 2B4YA 4OQPA 5FTNA 2JJQA 3M9LA 5LMNB 1JECA 5LXTB 1TAQA 4FR2A 3ED5A 5F4ZA 1D3AA 2VA8A 1G8HA 1YR9A 1ZK4A 2AFHE 4M2LA 4YWJA 4R7TA 4QT4A 4F4CA 3AVUA 2WJGA 4FSXA 5EE3A 2ADOA 2IPMA 2Y27A 4O4IB 1U7PA 1THMA 4JL6A 5ITZB 1N5IA 5BSRA 1BFKA 4MVJG 1L4LA 3L7YA 1B8NA 5CUQA 3PNSA 2GCOB 4OOFA 1CFJA 2RJOA 2QN3A 2OYRA 4BMVA 3FWNA 3DT6A 2WWXA 2J9YB 2Z2XA 3MT8A 1W4RA 4HRAA 4LN1A 2AEFA 4W99A 1WQ3A 4RA6B 2JK0A 2RGBA 2ID7A 5EL0A 1S0UA 3WO0A 3HRHA 2C8VA 1OHHA 5G2OA 3U9SA 5K3AA 3PNMA 4O6VA 3VZSA 2N75A 2XOEA 2BV3A 2NQ8A 1UKBA 4R5HA 3PQ5A 5JY1A 3DDSA 1ZEJA 2DH6A 5C7IO 4EY3A 3GF4A 4WJKB 2ZYAA 2B92A 5CAEA 1C3LA 4TQGA 3U31A 2YIJA 1Z9BA 4XPIA 1U7XA 2LW7A 2C57A 1K6IA 4W5TA 1U02A 1R27A 3OWOA 2VR1A 3ZVMA 4DLVA 1E4YA 3GGJA 4Z7NB 3VPDA 3HXQA 1YS1X 2GO1A 1ZCAA 3GDFA 2CDRA 2QGZA 4W5QA 1TYAE 1VDMA 4RFSB 2J9FB 4MJ7A 4P6VF 4XVRA 2MINB 3GGGA 3U3RA 4D92A 4ENQA 2OAP1 1D0SA 2G5TA 4YY3B 1N0HA 1RM4A 2YL2A 3JZDA 1NW3A 1HQYE 1I13A 2FWRA 1DEHA 4ZI5A 4CFYA 3AM1A 1Z4PX 3IHLA 5E2BA 2P40A 5IMBA 5HZKA 2VAVA 1E8NA 3OQMA 4HGZA 1LY1A 3HCNA 3FSJX 2G0NA 1N9ZA 4ENTA 1DMRA 1H6DA 2IHYA 4Z3OA 2DUMA 1MZVA 1RE0A 4QWMA 1E59A 3H4TA 1V7QA 4JU8A 4P0QB 3CNLA 2QENA 2UYGA 4ZGWA 1PZGA 5ICCA 2Q1XA 3GJ4A 1LBSA 3CLKA 4U0JA 3EIEA 5BRAA 1E2JA 4AJHA 4UU1A 1WCYA 3ODPA 4HVCA 2FUG6 3D3EA 5FWYB 1SKQA 3IKTA 3Q7PA 1LV8A 3H9UA 1CZKA 1XLVA 3O2NA 3C6ZA 3FHCB 3O73A 1ZEMA 4HH1A 4TMKA 5CA1A 5HW0A 3OZTA 2CNKA 4CM9A 1P2SA 4LV6A 5AHKA 3RC9A 5HFAA 3GG9A 2OO3A 3AKEA 1XTTA 4U2GA 3UCXA 3KKEA 5ALVA 1PT9A 5EHQA 1BEEA 3ZTTA 2D4AA 2HBRA 2CLDX 3I61A 1D09A 4RD1A 1D1QA 4BJ3A 2R8BA 3RAEC 2F9MA 3M5WA 3WC4A 3BE8A 3BFPA 2IUYA 3VDMA 4G85A 1RC8A 1BRMA 2KSQA 1XXHA 1Y3AA 4PS1A 3WWDA 3R9WA 3FH0A 5KSZA 4FONA 1DIRA 4HN2A 4QYTA 2Q21A 4EP1A 2OTCA 2ZBVA 1RKVA 4WOJA 3V7WA 1EVJA 1Y7IA 4D98A 4KFRA 1U3CA 3A0RB 3C70A 3E3LA 3MWJA 2IEYA 1VXOA 4OMUA 1YRWA 4QVKA 3UUWA 5KTPA 3CH5A 4GSKA 3SICE 1NY5A 4NEGA 2O8CB 4DLUA 1E89A 4J16A 3MJSA 1E5DA 5PNTA 3IP8A 1H9CA 2ZYIA 4I5IA 1A8IA 3B1VA 3GCGA 5F51A 4DCGA 5DASA 2AXNA 4IWYA 1CB7A 3MTBA 4KTTE 4H08A 2R47A 3E53A 4RKEA 4RV5A 4AJLA 3B5IA 3JYNA 1K98A 3L8YA 4IMJB 4OYLA 4XCXA 2G77B 1M6YA 4IJKA 4DARA 5I7UA 1D4ZA 4HQFA 4UVHA 3ZE9A 4B4WA 2CB9A 4XVUA 3Q7TA 3PFHA 1KRXA 1P0CA 3U3KA 2J3IA 3ZR4B 2XWSA 1PHPA 2WT9A 1BXZA 1VCMA 4O2AA 1L4MA 1L8AA 2BEUA 4RSHA 2DQKA 5T7BA 3NOVA 4AC9A 2QLLA 1OFHA 2BCJQ 4TPKA 3SHOA 4DC0A 3I05A 4EWLA 4C4SA 4A0FA 4QGAA 3JASB 2WRZA 4J16C 3NFYA 4BAZA 1IWPB 2AJBA 4W9RA 2OBBA 4B3SB 4L5BA 1RC0A 4RYLA 4AYTA 4LF8B 4B71A 4XGQA 4R71A 4YRNA 2ZS8A 1AF7A 3EARA 5HMLA 5DI9A 1M8KA 4TQ9A 3CRMA 1QZZA 2KB0A 1RVDA 3BXEA 1G17A 3HXMA 2JBWA 3EC1A 3TLAA 1YOVA 2BBSA 1OB2A 1NMXA 4MQMA 2W7TA 3VX4A 4ZJPA 1W0JD 3WJAA 5KWJA 2RG7A 2GK6A 1U2EA 3V4VB 2ZK7A 5C8YF 1R6UA 5LQRA 4RK4A 1L8OA 2YMQA 2Z4TA 4MUXA 1FJHA 4OFZA 1Q0QA 4UU8A 5L4LA 5EJ2A 3OCVA 5C9ZA 5K6AC 2FX2A 3AF6A 2REQB 4IMPA 4EGCB 1CY2A 2H65A 3ANNA 3RANA 3VPCA 4D99A 3AJ9A 3QFSA 3JV7A 3IP7A 4AYXA 1XEWY 1ARZA 2NX2A 3U4HA 3V4SA 2DMRA 4GPD1 2MYNA 1W73A 4D9HA 5A3QA 4BN4A 4YAWA 1UXIA 3BDIA 5L7YA 2D5AA 3KJEA 4MS1B 1F9AA 1W88B 2V97A 3FTFA 4RULA 3AW8A 4U2EA 1U81A 4TL8A 1ZVQA 1EHYA 2XMGA 3DZDA 1EXVA 3QITA 3KSMA 1SHTX 4N5LA 4UXHA 1G5HA 1SHLA 4XYGA 2Y71A 5IBQA 1Z47A 4P7GA 4FPXA 1R15A 4RQBA 3Q8WA 4QU0A 2X8WA 1EUYA 2DB3A 4QX6A 1T5LA 3LLCA 1DUVG 3MMZA 5DOZA 5E3IA 3U81A 1DJQA 4ENVA 5DNEA 2GH1A 2G9RA 1P33A 1R4NA 2GFQA 3AU8A 3UAYA 4YT2A 1NFRA 3P94A 3F5DA 1E7YA 4PQRA 4MUIA 3OFVA 3NTQA 2W48A 1U2SA 3W5DA 5E7JA 3S2GA 2B34A 2DU8A 3OIUA 1F2UB 3ZTYA 2DJ5A 3MS7A 1P62B 3B12A 2CNLA 3HZHA 4OL0A 4ZVQA 3VU1A 2F67A 1PL0A 1E18A 2HQOA 5EFZA 4LY3A 4DWJA 4QEKA 4NEQA 5LB2A 1P91A 3VVMA 1F6BA 2HRBA 4A4DA 5J3JA 1BX1A 3COYA 4DOMA 13PKA 4YO8A 2I6FA 2OHFA 3QPDA 1FZTA 4GSYA 2E4UA 3LFTA 1VBMA 3R0ZA 2B2CA 2XBUA 1VPLA 2A0WA 2XA1A 3TDKA 4E12A 1IOLA 4PG5A 3U80A 4RWZA 3E3MA 5JU6A 2WNSA 4Q48A 3F6EX 2CWDA 4IKEA 3DA8A 4MRSA 4O2BA 3O92A 3LPCA 1QLJA 3LQ4A 3CX7A 4Q12A 2YVAA 3JU3A 3NHKA 1MA3A 2BKEA 2ENUA 1AGNA 3NGMA 5F4BA 3ZHTA 3MN1A 2QNBA 4UXJA 4N5IX 4RW0A 2JVJA 2V3VA 4ZQFA 4AN4A 4G0PA 4IVNA 4ENRA 1RTKA 3CUUA 1JG6A 4W8GA 2BFFB 5TVGA 4MYSA 2NVWA 4KXUA 3WZ2A 3ZDFA 3LK6A 3LV8A 1COZA 1H0HA 1X7YB 1YMUA 2AHOA 3UFBA 1GSOA 1M9NA 1V9CA 1FQKA 4KSBA 1MABB 4GP6A 1QH8B 2NG1A 2JLYA 4JDUA 5FXMA 1DWUA 1SG0A 1W6RA 2HF7A 2HA2A 3U19A 1GQQA 1HDYA 1KVQA 2A0FA 3K35A 4QDTA 3U4QA 3HK2A 5JZVA 3UWDA 3ONEA 1N0IA 1Z0IA 1T5IA 2GTIA 4JYZA 2GJAA 1VA5A 4PVDA 2GI4A 4KK3A 4A8PA 1KDYA 5HIAA 4TLDA 4HDSA 4ZGBA 4XIIA 5AHRA 1DBWA 4YJFA 4YCBA 5HS4A 5KPDA 4QPDA 2P8JA 3KQKA 3RKRA 2W2VA 1V41E 3BFXA 1T3LA 5EHGA 1I3KA 3LT1A 3UC9A 5DGXA 1EZZA 1TC1A 1YOVB 4MWOA 2BCGY 3S6JA 1R0SA 4DJDC 5LP6B 1CEXA 2FPUA 4LXIA 1H8HD 2XCTB 1GCUA 4FN5A 1GDHA 1GLNA 3CH4B 4L50A 3W4IA 2FOIA 4NU6A 1KKUA 1TQ6A 2JFZA 5IARA 2G8NA 3LXXA 3ROGA 4CL8A 1GQSA 4OJYA 4V2UA 4LRTB 1DINA 1P0FA 5JMTA 4L95C 4C2UA 4YCDA 2G4CA 5GM1A 3SY8A 2ZJZA 3FVRA 1MH1A 2CYAA 3DVAB 1LDGA 1SOVA 3BRWD 2QF7A 3L4BC 4GI3A 3ZCQA 4HPWA 1JF8A 4B5KA 5CW1A 5G0UA 2FAXA 4BNGA 4LI3X 1X74A 2CLIB 2ZIAA 4C4XA 1OZAA 3P20A 3KTAB 2KLBA 2FEWB 3RKUA 1T2NA 2JKYA 1Q22A 4WCFB 1SZDA 2OQIA 5BNFA 3SYTA 2XOKA 4QBKA 2EZ4A 3U5TA 3C43A 2XB2A 2GILA 4KO3S 3ZE8A 4QYIA 1P4HA 3U7GA 4MCAA 2J9XB 4RTPA 1NBOA 4QUIA 1NN1A 4RLFA 1NIJA 1PJBA 2ZSBA 4A15A 2B35A 1OBOA 4BO5A 1TM5E 1KYQA 5U4XA 2QN9A 4X6YA 2C4MA 2XECA 1CVIA 1SA0B 3WGUA 2JIMA 5HJ7A 3H04A 1YOBA 3GLHB 3WNBA 1MXHA 1JPNA 1VL6A 3R5SA 3DBOB 4YJGB 5KJFA 5AKZA 3PD1A 2G40A 3OOWA 5EWMA 2I7CA 3VAZA 1ZQ9A 4AG6A 4OK5A 3RQSA 4I8IA 1U9IA 4IG9A 4KQMA 1ZD5A 2V5VA 3PXXA 3DMTA 3G02A 5IWAB 1V45E 1P2FA 1I2AA 4F92B 4M1OA 3I37X 1LLQA 2G9VA 1B8PA 2MYTA 2GD1O 5I3CA 5T4EA 4BO4A 4ZQHA 2WYWA 4GYKA 3EJWA 1KI6B 1U8YA 2QUAA 1NG1A 2NU6A 5KNBD 2F8LA 1DE0A 3WGQA 1EK5A 1RFGE 2FZCA 2GTHA 4HDMA 1NZDA 2W4IA 4KFCA 5LJLA 3GMTA 1R64A 1SKAA 4G5RA 3R9KA 5ADVA 5LUAA 1LI7A 4V1CI 4JROA 5KNDD 4JKOA 4G4SO 3E27A 5K8LA 4BQOA 2ACWA 2RGGA 3IEIA 4ZXFA 5H5JA 4PC3A 2ZR8A 2RHOA 3AEKA 1IMJA 3B48A 4KNVA 4GX0A 3WTBA 3DO5A 4E08A 1E9CA 3LCMA 3C6BA 2BC9A 3I04M 5BOVA 5AVXA 5LKRA 2AEMA 4TSKA 3MG9A 4M36A 1RYYA 3DCIA 4RMNA 2Q5OA 2W2PA 4UPVA 3ZIDA 7MDHA 3L04A 2YNMA 1QAOA 5I9MA 3MWEB 5IRCD 4DIOA 2Q6LA 1A9SA 5JJ5A 3DZHA 1PUIA 1E9EA 1RHJA 4CLXA 1ZKDA 3B3FA 1A2OA 2RHHA 1QK5A 4UBOA 1OU0A 5AH0A 5HXAA 2EVWX 1TRKA 3G2NA 2ZT7A 4PLHA 1CUEA 1WHSA 2VJOA 4MQUA 3TFOA 1U0RA 3QPCA 3LUCA 1WY5A 3E9CA 4HP8A 3UYKA 4B6JA 2F90A 5KYWB 5CB4A 4DUPA 2YHBA 2NVUB 1ESCA 3O7MA 1YZ3A 3LRPA 4UPEA 4NJOA 3WQBA 5D2CA 1NF2A 2XY4A 1IJFA 3C4VA 1BS2A 2AD1A 1XVTA 2DE0X 2SICE 1PLLA 2WM3A 4BFSA 1ZZEA 5EMHA 4E5UA 3OLVA 3VR3A 5U9CA 1O5IA 1TNDA 4PTZA 2WYOA 4G5XA 5DK4A 1UFRA 1V8OA 1LW7A 3KTFA 4MR7A 2VDUE 4ND2A 1GZ7A 4OI2A 3A6EA 1HDIA 1PO7A 3ZY3A 2GX6A 1JA0A 2C2MA 2D0IA 1KFJB 1KAQA 2PMWB 3CBGA 4YMSA 1JLKA 2OA0A 2Q7OE 1DNPA 4DMFA 3NDRA 2P5YA 4KPGA 4CKWB 2ZJBA 4BB0A 2FUEA 1PGPA 4W1RA 4NZOA 2NYUA 2X8BA 1N1DA 4DSZA 4LQDA 2BTQB 5CNJA 4BNXA 3WBBA 1K3UB 4G9BA 3X1XA 4IXWA 3ICEA 3ZQ6A 3TTUA 1C9MA 1WDLA 1OYYA 2Y99A 3DL0A 3ZJYA 5FWNA 2JLAA 2PGAA 3FHTA 3NRJA 1CQWA 4K9SA 3M82A 3EPJA 4QA9A 2BAGA 5AFSA 5LM3A 1OSNA 5K0JA 2Y93A 3GNQA 2D5LA 4IH9A 4R1LA 4UNPA 4Q7QA 1II8B 1LRJA 4UE2A 1MLDA 4BKUA 1V11B 2QTZA 1GKYA 1TK3A 3UHPA 2G17A 2PBLA 3IUQA 4U6NA 2DPGA 3EZ9A 4NMXB 4DEXA 4F8JA 2R8EA 1HXHA 1TD9A 2ADFA 1JEJA 5LQMA 1LC0A 3H4MA 1Y5MA 3HB1A 5A1JA 5LD2B 2VHYA 4MPJA 3D59A 2WYIA 4ICIA 2K7FA 2AB0A 5JCOC 4CF5A 3QV2A 1LVUA 4L57A 4AO8A 4XWYA 4NOLA 5L4NA 3EVBA 4XWTA 4H6WA 4CDNA 2WSBA 3GJ6A 3PT5A 4L15A 3PF8A 1KEEB 4HMOA 3ZWNA 1C3OB 1TE2A 1YQGA 1D2RA 4RCYA 3SDBA 4EKIA 3KPJA 3WIBA 1OH8A 1SEPA 4F6CA 3BF7A 3CXUA 4M86A 3QW2A 3N87A 1EUZA 3GQVA 4JU9A 3IIKA 5EFOA 4O63O 2C2GA 4MKHA 4MI3A 2ILTA 2C82A 4X8OA 1H3EA 1I33A 5JAOA 2GZHA 2A0UA 3K6RA 3TX2A 2CFIA 2BGWA 3RUPA 3S2EA 4Y2VA 3LTEA 3LT0A 3MRTA 2VF7A 1FFHA 3BMOB 3IBTA 4EBBA 5C1PA 4PRYA 1JEOA 1Q7BA 2QMOA 3PL5A 2VWGA 4EB6A 3KE9A 2WEKA 3HWRA 1E2FA 4A0GA 1JHXA 2GK4A 1IBCA 4RTKA 3TZKA 3NHPA 2VPWA 5AOAA 2QAGA 3LPLA 1JR3E 3FR7A 4LZPA 4NBSA 3QLEA 2H2AA 2L0XA 3A27A 4ANFA 5JH7B 2J07A 1T9CA 3ABRB 4YGXB 3VSCA 1GRVA 4U3JB 3PDIA 5FPYA 2QSYA 2DLDA 1I9GA 1X3SA 1WNFA 1XA3A 2D59A 2OWDA 3QTTA 4L2IA 2NQTA 4OHKA 1EP9A 1HTBA 5A06A 1PTKA 4PR0A 4ER3A 5CVTA 5AVSA 1N78A 1G7SA 1NC1A 3BD8A 3H16A 1OFIA 4C6TA 2R2GA 1SD1A 1NJ8A 3ZWVA 5HK8A 3COWA 1QVAA 5JSYA 5C81A 1Z6TA 3EEQA 2DULA 2JAUA 4AN1A 1MD9A 4BO0A 1N5DA 2BBOA 4J3FA 2G07A 3TRHA 4Y1FA 4DB2A 2ZUFA 3K32A 1G21B 3D31A 3JVVA 5JFOA 1KHTA 3Q15C 4F7DA 5D3MA 1DC5A 3NYQA 1LNSA 5CCBA 1EA7A 1ESZA 5C1OA 1RZVA 1K7SN 2ZRPA 1NOKA 3C1TA 4CMGA 3S2ZA 1K4KA 5IC5A 2O7NA 1KC1A 4DXDA 4NYIR 4ZQBA 1VJ1A 4PU0A 2PX6A 3Q7IA 2HLDA 1S2OA 3PQ6A 4R9VA 2IYUA 4IXTA 5EINA 3TEFA 1W4AA 4CEJA 1FW6A 3FKSA 4ZQIA 1RCUA 3GLKA 2W2QA 3ZW8A 1EPUA 5BVGB 1ECFA 3CX8A 4MVJM 4RABA 4XFDA 3NIWA 4DMRA 3H5IA 1UUFA 2BM9A 2PQMA 4UCQA 4CI0B 4F4UA 2HWXA 2HYIC 2HHHB 2NXJA 4UFNA 4YRBA 1U2TA 4ZVTA 1AS0A 2W5UA 4QOFA 4PGAA 1ZI9A 2V7UA 2WD9A 1II8A 3AM5A 2Q3HA 3UPDA 2D6FA 2WK1A 4FYWA 1WR8A 1TJPB 1QP4A 1Y1TA 1DHRA 5CD9A 1F3LA 1XFAA 1YIAA 4JENA 3FETA 1J2RA 2C5HA 4C0BA 5A4IS 1RE1A 4PTYA 2VATA 4L4UA 5A4MS 3D7SA 4ETWA 1O6ZA 2XVMA 3L1JA 1FUUA 5K0EA 3OLCX 4CLRA 1AKMA 2JH9A 1QE3A 2PH5A 1B2RA 3NNNA 1CZOA 1EWTA 3G2MA 4DKJA 3IUMA 2MYPA 1H3FA 2M6KA 4JP1A 4V0MA 1JIJA 1VIVA 4RTMA 3IQFA 3T7SA 2AKEA 3DKIA 1HYEA 4V38A 1ZOIA 1H8EA 1I6WA 2E5WA 3AYZB 3F5MA 4FSHA 4NV0A 4ZT2A 1H1LB 3NEAA 3K15A 2A5FA 3KSDO 1O4VA 2BDTA 3PHJA 3L7MA 2NN3C 1GRNA 2HGSA 3VOAA 5CG2A 1GA4A 4MARA 4D0GA 3E8MA 2HUPA 3K3PA 3WIDA 2VQEB 3WHPA 1WB6A 2AI2A 2V7GA 4JLSA 3VM6A 5JCXA 3T1VA 2AEJA 4KZKA 4BKQA 2COUA 1FQWA 2J0VA 1TA4A 1XCJA 3JQDA 3RSCA 4QXQA 2XCIA 4M0DA 1HO3A 1T91A 2VDNB 3OPYA 1PFKA 3ELWA 5KYWA 3LL7A 3WK5A 1FMLA 1RPJA 1JH8A 4L07A 5JXJA 3CNHA 1UXJA 2BJVA 5DE3A 4M38A 4DPLA 1DXYA 2IELA 5DSTA 3AY0A 4LRWA 2VVTA 2YWGA 3VPFA 2H92A 3EAFA 1O0BA 3GP3A 3IPXA 3DKRA 4AZ0B 1E1RA 1QCYA 2PIAA 3I72A 4DMCA 1LQTA 4N7JA 1TYBE 3G7UA 1BIFA 3RR2A 4U8GA 4YMHA 3H8SA 3FYHA 2EKLA 1Z2NX 3GUYA 2FR0A 4TXLA 4AVYA 4DCVA 3USES 5FKJA 1E5VA 1OZ0A 3P45A 2PS1A 4MPPA 4PC6A 3DMFA 2NTVA 3GRKA 3CVVA 3IEVA 4FFMA 2Q5CA 4P4GA 4BFYA 3BWVA 4F5YA 3KETA 3DUFA 5F35A 1CETA 3KIPA 1OLSB 4Q5IA 4AJNA 3MILA 2P9JA 3I76A 3KFXA 4AIRA 2YVKA 3U3JA 1FNSA 5K99A 2JJYA 3MINA 4KYTA 2G28A 4L3VA 2R97A 1W5FA 3B1YA 1WZ2A 2CVOA 3ZY4A 3CEPB 1V1MA 2QNIA 3I28A 3K70D 1M8FA 3AIIA 4EGSA 3KQNA 1N5OX 1RWNA 2BEVA 2W90A 1L4FA 4AZ3A 4CCAA 2O6LA 4C6HA 2OILA 5IJ0A 4ZAFA 1SCKA 3EVTA 4C29A 3F9CA 3MUFA 1MTOA 1N6LA 2BLNA 2PA3A 1W48A 4UQLA 3FWYA 4C08A 1JR6A 2GASA 1FRZA 3PHIA 1VA4A 4QUAA 3W7AA 1NE2A 1BD3A 4BZZA 3LA6A 1J21A 1LSJA 3UV6A 2I9PA 1IH8A 4E88A 4C4PA 2GJSA 1KYXA 3AL2A 1MB2A 2DX7A 3H1AA 1IFXA 4JUAA 5LWHA 1Z75A 1QM5A 5JD3A 1J8DA 2WV9A 1NVVR 3WO1A 3NT2A 1UBSB 4E46A 2VUUA 4HH4A 4MR8B 1MEJA 3GDOA 2N0SA 1EWKA 3DGFC 3P27A 4BP1A 3SOPA 1GZDA 1Z7BA 2D2EA 4Y98A 4R9SA 2LZ0A 2WAAA 2ZIWB 4LFBB 4KWTA 1MRNA 3OCUA 3GOQA 4UQOA 3C6YA 4FHEA 3MRSA 4BLOA 4C3VA 2OV8A 1GN9A 2VJQA 4RIHA 4OL9A 5C8YA 2FKNA 3HI6A 3L0DA 4DF3A 4Z7QB 2BTEA 3D9QX 4QIHA 2C78A 3TGWA 5AM1A 4PX9A 2VCYA 1JXOA 3DEYX 1LLUA 4BV8A 1FYWA 3DVAA 3K8YA 4P93A 4BX9A 3O4JA 3CR3C 2PYDA 4JHXA 1NBWB 2J0UB 4JOSA 1RKQA 4XEUA 5EUCA 4OQMA 4D8UA 3CR7A 1LDNA 2CKDA 3EVCA 1B43A 3OT5A 3JPWA 4FCWA 2EWMA 4CF3A 5ABPA 3CO5A 6NULA 3C6XA 4KXYA 1OFTA 1P0PA 4EUNA 3NBAA 1II0A 1DIAA 2R1TB 2EX1A 1XZEA 4FK8A 5AWFC 3UW1A 2R7KA 1NG9A 1HGXA 3A7EA 3TZCA 2I3BA 1Z0FA 2PWAA 2FN3A 3BMQA 1B41A 3PVZA 2BF7A 1EGMB 2ISSD 2Y1FA 4PPNA 2GDJA 3ZV5A 3IDFA 2Y66A 1OGYA 4I6GA 3AGQA 3DBHB 1K3TA 3II6X 1XCPA 2M1ZA 4XD7D 1A95A 1MPTA 1U2DA 3W6PA 1A1VA 2B8NA 1ZAYA 1C41A 5J5VA 1E2EA 4TLBA 1RZUA 4FE3A 1JIUA 1WD7A 1DAOA 5GONF 5HF6A 4Y1GA 4L8FA 5G3ZA 1KDZA 3WDKA 2CY0A 3A3OA 2WM8A 5D1NA 3WWCA 3IP3A 4BLVA 4ZI2A 4KN9S 3RIYA 1EB8A 2W2OA 3C7AA 3KLBA 2NUTB 2P35A 2IDZA 3H6HA 1RJ9B 5A9TA 1ULTA 2CFTA 3PD7A 2QJWA 4O2BF 4OGFA 3DE3X 2ISCA 4KIWA 3SLGA 2VNKA 4ABTA 4MWTA 3O74A 2OV2A 4RXMA 4PYIA 8MHTA 2BGMA 4ZOAA 5KJEA 4QSHA 1KE2A 5C1DA 4UQPA 1KAOA 3TMKA 4QAQA 2XZOA 5B55A 3KT6A 1KDPA 2BFFA 2PT6A 3D2CA 3OTWA 1O9BA 4FM9A 1JGTA 3S2IA 3DCYA 4I1IA 4ZV9A 1YA6A 1KYIA 3DWFA 4LYYA 1EI9A 3L9XA 2QK4A 2WMNB 4FB5A 3ZU6A 3O84A 5G0VA 3ICCA 4HY3A 5ICFA 1CUAA 4JXXA 3KC2A 1DEAA 4EAQA 3C6MA 3VKVA 1O08A 1YAHA 2Z5VA 3ZWKA 2WUVA 3QXXA 3SGLA 5KNCH 3DLBA 5DNDA 1UC5B 4UBLA 3LLMA 5G1NA 5T8KA 5KSWB 3WGZA 3DQZA 1KDTA 4PY2A 3SOZA 1SNYA 2JVIA 3PF9A 4JBNA 1UOPA 5CMLA 2Y1LA 4G41A 4IIUA 1H2BA 3D6TB 3D0KA 1PS9A 4JJ4A 3T4XA 4D6XA 2CN1A 4TV8F 4I0WB 1NXXA 1A04A 3CRW1 1DPFA 4C5CA 3KYIB 1E94E 1WKVA 4TUYF 3HFSA 4FJ1A 4E4YA 4TMWA 1U99A 1A27A 2R7AA 3PGXA 1H23A 3LPNA 2WVHA 5FO0A 1YJQA 5YASA 4Y1EA 3K0HA 2GEBA 1IG3A 3PUVA 4FFBA 3WA7A 1NVMB 1EFPB 3C5HA 5A3JA 2RAVA 3F49S 2DR0A 1L8QA 3EXFB 3OKCA 2DH5A 3R6TA 1CZRA 2A5YB 4EYQA 4DAOA 1QZXA 1AO3A 3DB2A 2PO5A 3AHDA 4H1TA 3OP4A 1YFKA 1BKSB 1MNQA 3IAM1 1FYEA 4I50B 1COWA 3R7SA 5EIEA 4N49A 1JP7A 3IT1A 1LPNA 1ADYA 4DCPA 1RJFA 4G84A 1VSUA 1YTLA 3ESXA 2DZDA 4LMAA 1UFVA 1NSTA 1OGJA 2GPJA 1BG6A 1XHEA 2QVLA 3DV0A 4PLYA 1Y98A 3LGAA 4MI9A 2AYZA 3VR5D 3FYSA 4NU5A 1YKFA 3PKIA 5G0SA 3OE1A 3VOBA 3VTZA 4RTSA 2XMZA 4AZTA 2VPYA 2EFGA 2CL7X 2Z83A 1X7ZB 5L3SB 1MJGA 1KEKA 5HJ5A 1LW6E 1A97A 2ZBRA 4YMGA 3VFDA 5AVOA 1Z8HA 2WZBA 3U0BA 1DDGA 2R3SA 3I5MA 1H94A 3FWZA 2C3YA 2EZTA 3DP7A 3BA6A 5IG2A 3QTLA 5KOIA 4WGFA 4KRFA 3T3PB 4KIJA 1YJBA 4TWBA 1JBKA 3E81A 4XVQA 5KTRA 3WL6A 1PNOA 2J3LA 4PG4A 8AT1A 1QGYA 3ASUA 1RVV1 1UK9A 3FI0A 4B81A 5LYJB 3R3WA 1SXJC 4KX5A 4XR4A 1GNPA 1TEXA 2ZYRA 3JPYA 2VJKA 3OM1A 1ST2A 1TO2E 1YQ9A 4GECA 4MVJF 4BZXA 5IASA 3BH0A 4Q7MB 1OKKA 2QJFA 5LCXA 3GGCA 4EJFA 4YHHB 2MTBA 2ZSIA 2FW8A 2PN1A 3DBLB 1J2EA 4RD0A 4HQOA 4P35A 2ZAIA 3D5EA 5ERGB 2PZ8A