5LB4A

Apo-structure of humanised rada-mutant humrada14
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
229
structure length
211
Chain Sequence
TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSAMYIDTENTFRPERIREIAQNRGLDPDEVLKHIAYARAFNSNHQMQLLYQASAMMVESLNTDRPYKLLIVDSLTSHFRSEYAERQQKLARFLAMLHRLANEFDIAVFVTNQATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein RadA
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Hydrolase
total genus 74
structure length 211
sequence length 229
ec nomenclature
pdb deposition date 2016-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5lb4A00
2XNDD 2X19A 1ELOA 1QZXA 1X8LA 1ZD1A 3DZ8A 1KSFX 2ZAMA 2ZAOA 3H0KA 5H1YA 1DBSA 2NO7A 2VP2A 2AX4A 3E2IA 3SYNA 4EPTA 4RZ2A 2J1LA 2O0JA 3VR2A 2V54A 4FMDF 1JR3D 3CB4A 3BB4A 2ZE7A 5EUQB 2CK3D 4L9WA 3TK1A 4C2UA 2WMNB 4I1VA 4JYBA 4NYIQ 1Q1QA 1TUEA 2LCFA 1ZNZA 1OB2A 3U2QA 1XEXA 4HB3A 3AVXA 2HXYA 3L2OB 2FFQA 4MYTA 4LYJA 1UBEA 1OXTA 4Q7MB 5L3VA 4NE2A 4IOJA 1XTJA 1CKEA 5C2JB 2FNAA 5JSZA 2J87A 1OFUX 4PQYA 2KBFA 4M9QA 4X8HA 2NGRA 3B5JA 3CZQA 5KSPA 3UIEA 4DLWA 1P73A 4LC1A 1E2JA 3N2EA 4FCWA 3KB2A 3VNUA 2F7SA 2A78A 1RPZA 2DFNA 3B6EA 1FMJA 1Q12A 2KWIA 1XB2A 3FHOA 4CW7A 2WWFA 2VF7A 3DM9B 5IT5A 5JCPA 4PPFA 4P32A 3RSOA 2OZEA 2QMHA 3QKRA 4N0EA 4Q4JB 2HYDA 3BS4A 2W2XA 4P33A 1E1RD 2FEMA 1AM4D 5FFMA 1TEXA 4OI4A 5EE9A 4MYHA 3Q85A 4UXJA 4V0OA 3G82C 3T5GA 1XRJA 1Z28A 2IYTA 1W0JD 2V6JA 3CX8A 3I8XA 3NVAA 4AWXA 2WICA 3I5YA 3IBYA 2Q9AA 1FQKA 2VSOA 2PZEA 4IDNA 4IOLA 4XVRA 1V5WA 1R2QA 4FWIB 3AVWA 2ZU0C 1NNEA 3RANA 1WBBA 3A37A 3LX8A 2YHSA 2OCYC 4ZO4A 3CRMA 5BWMA 1AK2A 4QC2A 5E7IA 3AKDA 1Z0IA 1N6RA 4EJSA 1TADA 4GBMA 3OAAA 4B2LA 4WBSA 1AA9A 1NBME 1E2GA 3SBDA 2N46A 1BKDR 2J45A 3IIMA 2G0TA 2JASA 4LUCA 1KNQA 2EU8A 3E70C 3TBKA 4H9GA 1P62B 2WAYA 2IEYA 1AQUA 2IUSA 2NOAA 2PCJA 2P5TB 1PJRA 1LFDB 5BXQC 1JALA 2QBYB 3KQUA 4MKHA 1ZINA 2LKCA 3SS8A 1NLZA 4A8JC 4R9UC 4JL6A 4B34A 3VX4A 1W46A 1EFTA 3UPUA 1OKKD 2OAQ1 3RRMA 5IDVA 4A82A 2WZQA 3U7GA 1RRFA 3RS3A 3TR0A 2GZHA 5HE8A 1DARA 3GLIB 4ZDJA 3ECCA 3LWNA 2WM9B 3U61B 4DEYA 3AF4A 2V4ZA 3WMGA 2CXXA 1IXRC 4GL2A 5DHFA 4C0LA 3NWJA 4TMVA 2FEOA 4GNKA 1II0A 4UXHA 2QAJA 4QBIA 4QJ3A 4UQOA 2AXPA 4EIWA 3U44A 4W5HA 5G41A 2WJYA 4XH9B 4JKYA 5M04A 2XJ9A 1S8FA 3BJIC 5KYKA 2IYXA 3K8YA 2QM7A 1T4GA 4P4UA 4EDHA 3ZD7A 5K8IA 2MMGA 1J2JA 3OIYA 5AWFC 2F55A 3MSXA 1YVDA 5JEEA 2VTKA 4A0GA 3K70D 3WNCA 3THOA 1T0HB 4KFSA 4BZXA 2BC9A 1ONBA 4PHFA 4C0QC 2REXB 4CRWB 1MRNA 2DWOA 2ANCA 4QBHA 2PX3A 3B9QA 1L7VC 1MO3A 3LAWA 4TLDA 1G20E 1KAOA 2ZR7A 4TT3D 1YZKA 4MQBA 4PANA 5J47A 3KXKA 1W36C 4JVLA 2A5JA 2ZRAA 4TQAA 4R71A 1VG9B 4BZPA 1MR3F 1Z0KA 1U2RA 421PA 1S4QA 1WP9A 4EJSC 1TEVA 3SFZA 4JLNA 3ZGXA 5B57C 3LW7A 3EWSA 4LYFA 4PC6A 3HR7A 2FSHA 2YJTD 4D4KA 5JFGA 2ZYVX 2HEIA 2QQEA 5FBRB 621PA 1ZU4A 4B73A 1Z63A 4HZUA 4TMKA 1UKZA 2QAGA 1U8AA 1SVWA 2H8KA 1HYQA 2P65A 2QSZA 2ZANA 2XZPA 2GEVA 1D2NA 1ZIPA 3FFBA 2WKPA 3EC2A 3ADDA 3LX5A 1VIYA 2WWXA 4DUGA 3TMKA 4W7SA 1IN5A 4UNQA 4A0HA 2KSQA 5B64A 1AS0A 4GZLA 4X8LA 2JA1A 5ANRB 1JPNA 3GCGA 3P20A 2ZM5A 3T1VA 3MG9A 1U8ZA 3T12A 5CB6A 1AKEA 1GKIA 2W0MA 1E98A 3B2EA 3L0IB 3GJ7A 4LV8B 5JBQA 5EP4A 3UXMA 2QGNA 3TUZC 1QF9A 3GD7A 2HT1A 1HT1E 4TTQA 2BCGY 3PCRB 1DAGA 4K81B 3LV8A 3LVRE 3SZRA 3TW4A 2FX3A 4MRNA 1O3YA 1NMYA 2ZYWX 1YKSA 3QF4A 3RS5A 1EFCA 2QGZA 1HEIA 2WSMA 5FL7A 4L8GA 4NHOA 4TLCA 5CDFA 4A9AA 4MUBA 1Z0FA 3AUXA 1E0AA 4Y0VA 5FOTA 5LBIA 1ANKA 5CM8B 4E09A 3OFNA 3SJAA 1UDWA 1ZRHA 5DYGA 4KJZA 1HE1C 1U90A 4URYR 4A1FA 2X2FA 3AP3A 3RRYA 3GLGA 2IYVA 4GP7A 4DSTA 5L3QB 3BAFA 4RD6A 4UXIA 2H57A 4JVMA 4RKFA 4OJQA 1FP7A 3FGNA 3H1TA 3MWKA 2OBNA 2D62A 2JJ2D 2ZR0A 2D74A 4JL8A 4OQLA 1JI0A 3U4QA 4GDFA 3S1AA 4JLAA 3EAQA 4TZ6A 2CJWA 1W2HA 2PMKA 4PZYA 2CEAA 3MRSA 1NBMD 1G21E 2NPFA 2WOOA 1NJFA 1P6XA 3SN6A 4B2IA 4DSOA 2DHRA 5KO2A 3W6PA 3X1DA 3HJNA 4HUTA 2QAGC 1AGRA 3T1OA 4KVGA 3GJ8A 4IDQA 4V02A 2GZDA 1VCMA 2VP5A 4NU0A 3F5FA 1SKYE 5FOSA 2VSFA 2ZS7A 1MH1A 1G8PA 4OQXA 4LBYA 4E22A 1E9DA 4ZKEA 4X8OA 1M34E 4ZPXA 2RGNA 3NBXX 2V8OA 1GZSA 1AN0A 3FKSD 2XITA 1DAFA 3WHLA 1AS2A 4Q4HB 2GXAA 3WP1B 5D3QA 2GF9A 3PUWA 4XD7A 4GPTA 4D81A 2YOHA 4WZAE 1KK3A 4HEJA 1XTRA 3ZS8A 3PUVA 2HT6A 3CWQA 4A92A 3EPHA 3U6BA 2QP9X 3CRRA 4ASUA 2PX0A 3OEEA 2R8RA 4LZZA 5EXXA 1L4YA 4QRHA 4D6PA 3MJHA 1AJEA 1K5GA 3U7FB 4U00A 1SKYB 1EG7A 1R0WA 2ATVA 1AS3A 3SJBA 4BPBA 1WE2A 3QPVA 2CCKA 3L82B 3LXXA 1EGAA 3VR1A 2JIZA 2FSIA 5F3WB 4JSYA 4FN5A 4LK2A 4BLRA 4NYJR 4FMCF 3B85A 1XD2A 3QKSA 3FVQA 2VHQA 4XWKA 2W6JD 2QRNA 4URUR 2IF0A 1UF9A 3GJ3A 4YXWA 2JAQA 4LBZA 5FTNA 1F60A 1PZNA 3Q72A 3X1ZA 1KSJA 3PUYA 3VQTA 4TTPA 4OI2A 2K5UA 2B7BA 1PUIA 2FSGA 4E5UA 1HY3A 4Z1MA 5CIWA 5KU1A 2EYQA 1Q21A 1DG3A 1ZUNB 2H1LA 2P3SA 5EQTA 3EASA 4D0LB 2IS4A 3PUZA 5FPHA 3GLIE 5FPKA 2O8FA 5KSYA 4FWTA 1TTTA 3U7EB 4FI3C 5JJKA 4QBGB 2J7KA 1UFQA 2CLDX 1E9AA 4TTRA 1OHHA 4HLDA 5AR1A 3R9IA 1ZM2A 5J4YA 3AVTA 2DFTA 1TF2A 1DAEA 2OCAA 5GJVC 2FOLA 4RCYA 4NDZA 2QRZA 4Q1CA 4MH0R 4Z51A 3X1YA 4Q7KA 4JT2A 5F9FA 1XMJA 2RGEA 3LNCA 3VKGA 4QNRA 5B30A 2C78A 2ZJZA 2EQBA 4LJ8A 4QJ4A 4DT1A 5FOWA 1ZNWA 3ZLJA 1JR6A 1R4AA 1KK2A 1H8HA 2IHYA 1IM2A 2ZVQX 1QBKC 3I72A 1E9SA 1U99A 3PIRA 4ZIRB 3OEHA 4A15A 2O8BA 1GM5A 3GLHA 3AEZA 3ADCA 1KJWA 1IN8A 3CZPA 4N0DA 2VHTA 4IOMA 4UJ3A 2ZQ5A 2QTHA 5CM9C 2P0EA 4A0FA 2A3RA 2BDTA 2BEKA 3D6TB 1SVLA 2VP6A 3NG1A 1OLOA 3CO5A 5IK2D 4DXAA 5LD2B 2UKDA 4MKFA 2BWJA 3W6OA 2OLJA 3PG5A 2Q9CA 2BCJQ 2RHDA 2PT7A 5G40A 2X8AA 3UWKA 1JNYA 3WYFA 3VNVA 2F3TA 2GCOB 2ODEA 4AY2A 1CR1A 4PHGA 1XJQA 3LY5A 3CBQA 3K0AB 2MSDB 3VU9B 4ZV4A 2CE2X 1XCGB 1KGDA 3ZZTA 1J8YF 2QROA 4FD2A 3ZZUA 1ZUIA 2QSYA 1E9EA 2V7QD 2ZJAA 5JWOA 4JBWA 3IBGA 2IYRA 2JDID 3A4NA 2IYUA 3I1FA 1P2UA 3BRWD 3EA0A 5TDHA 1W44A 5BYKA 4YDSA 1BYIA 1H8EA 2D2EA 4Q4LA 4GOKA 4PFSA 4A2WA 1WXQA 2LKDA 1DAHA 2CNWA 1NKSA 4HUQA 4D4JA 5JEDA 3THWB 1T8TA 1W49A 2ZREA 3J81k 1Z6AA 2QI9C 4Q19A 4B32A 1R5BA 2OXRA 4JYCA 1CS4C 4Q4JA 1HURA 5DI3A 3CPJB 1OXVA 5DHAA 3NBYC 4I1UA 1E2FA 1TUIA 3IQWA 4DIDA 1OYYA 1FUKA 3KZ1E 1VCNA 1E0KA 3Q8XB 2BHRA 1QHIA 3REFA 4P3YA 3ND9A 2PZFA 5C4GB 1P2VA 3A1VA 1MV5A 4TSFA 3BORA 2NQ2C 3I92A 2OUKA 2EWVA 4LC0A 4NYJQ 3TVDA 1JAIA 1JEEA 5DE3A 3CUEF 3GLFE 2ZSBA 1KK0A 4IRUB 2VHUA 4L5BA 2OCPA 1LF5A 1FPMA 3REGA 3W34A 5E95A 1DAMA 1E9BA 2FFBA 4QJ5A 3MLEA 4BRWA 3GPLA 5GJCA 4JKIA 4JIMA 3QEOA 4KO8A 4IVQA 4C0JA 1U0JA 5EP1A 4U02A 4UNNA 3PR1A 3R7WB 1WB9A 3TVTA 2XXAB 1IJEA 3BXZA 3MUFA 2GF0A 4F92B 3T5DA 3LBHA 1J8MF 4EPWA 2J5XA 3I61A 1M7GA 1XWIA 4DDUA 4NP6A 4RJLA 1KMHA 5CJ2A 5K8UA 1X1RA 1Z06A 4EAQA 1NVVR 1ZNXA 1FFHA 4F93B 1IONA 3Q5DA 2J3EA 2JJ8A 4R98A 4KFRA 4B3XA 3SJZA 1Q57A 5J4LA 3EPJA 4KFUA 5E7JA 4MRRA 3RABA 1Z08A 1KO8A 3T35A 4NKRA 3TAHA 3GJXC 3MWJA 2Z4RA 4NYMR 5EJEA 2JLSA 3GLIA 3AM1A 1P9RA 2OAP1 2QUZA 3FKQA 4J0QA 2BOVA 1QHYA 2GCPA 2Q3MA 2BMJA 1D5CA 1IN4A 1OXSC 2AHOA 4KLZA 1SVIA 2RGDA 5HTKA 1KI6B 1G7CA 2PEZA 2V1UA 4HDCA 2A5YB 4Q1EA 3RYTC 1E9CA 1UEJA 3K1JA 2QP3A 2QORA 3G5UA 4HLCA 3EIEA 1KK1A 1M8PA 2BMEA 2QP4A 5IRCD 1BYUA 3L0OA 4BLOA 3VHLB 2ZPTX 4FINA 3MGCA 3SI7A 2JLRA 2WJHA 3A4LA 3GJ4A 4PAQA 1E32A 1YE8A 4LRWA 4G5QA 1CR2A 3W5JA 2VEDA 2ONJA 1AZSC 3CNOA 3TLXA 3LBNA 4TYNA 4U7DA 2J0QA 5EE1A 4QGGA 3RWOA 1T8UA 3DEFA 3HP1A 1U0HC 4DUGD 4TMWA 1E0JA 2JLZA 4ZCIA 1VYTA 1PLJA 1ZW6A 5F9HA 1SHKA 4CT4B 1GILA 2CDNA 4LHVA 4QG7A 1RW4A 1RJ9A 2J46A 5FR2A 4YMTA 3X1XA 1OFIA 2GETA 4E07A 1GNRA 4G01B 4H1UA 2ZE5A 2DYKA 3EPLA 4H1VA 1E1QD 3FE2A 3I32A 6Q21A 3V4RA 4HDOB 1SXJC 4OHXA 2AK3A 3R9WA 2BBSA 5FR1A 3P32A 4Z54A 4L9SA 3KKNA 4M21A 1DELA 2J0UB 4KSCA 4DJTA 4GOXA 1NN5A 2QL6A 3ZQ6A 1T91A 3EIHA 5B2ZA 2HF9A 1XCMA 1X3SA 4OQFA 1ZCBA 2O8CA 3N5CA 3QENA 2C2HA 4PHHA 3PEUA 1DO2A 4Z8YA 2ORIA 2YC2C 4LV5B 4ESVA 1QHHA 2CBZA 2GRJA 4LCBA 1F2TB 3M1IA 1MRSA 1IBRA 2FH5B 4GI7A 5EP3A 1O87A 5LB2A 3O8CA 4CEJB 4C0HA 3KQNA 3DDCA 3A1SA 4DLRA 2AL7A 3FPAA 3DOFA 1J90A 3I73A 4OQMA 1NVXQ 2WIBA 4ACBA 1T3LA 1SHZA 2XB2A 1J7KA 1GSIA 1DPFA 2GXUA 3K70B 2YWEA 1RRCA 1F6BA 4AYWA 1TQ4A 5DYIA 5J4KA 1CJVC 4YDHB 1YU9A 3C15C 1KTVA 2D06A 3CF2A 1E69A 1G16A 2WTUA 4JBXA 2F9MA 1C4OA 2AR7A 3CM0A 3T1TA 3A1WA 1NVUQ 4HATA 1YR9A 2FPKA 5DN6A 5GVRA 1QHNA 2G1JA 2GTPA 3KTAA 4M22A 2IS6A 1II8B 3VR5A 5G3ZA 1KI1A 1CXZA 2G0NA 1XD8A 1NL3A 2J41A 3TAUA 3ZVRA 1WCV1 3JVVA 3W3AA 5EXPA 1TU4A 4PZZA 521PA 1BOFA 2UVQA 2OV2A 1OYWA 3VTKA 1N6OA 1GIAA 3CRVA 5FUXA 4MRSA 1E79A 1KO1A 3VMFA 1NN0A 2NO0A 4N1AA 3R8FA 2C04A 2ZVPX 2YWGA 3U3KA 1NVVQ 1XD9A 2EFEB 5FL3A 1T3SA 2BIFA 2GJSA 2J7PA 4IVRA 2XAUA 1VCOA 3X2SA 1OF1A 4PC2A 4G5OA 4XD7D 3PUXA 4DSNA 2JLXA 2AFHE 2Z83A 4ON9A 1IXZA 1FOEB 1ZC3A 2NZJA 1ODFA 5FPTA 3QI2A 5EUMA 5TMPA 4WZBE 2XOKA 2D2FA 2NG1A 4NYMQ 2Q6TA 3WY9A 1ZM4A 3DPUA 4B6FA 4V0MA 2CHGA 5AJYA 2TMKA 4AI6A 3U3OA 1EXMA 1US8B 3EZ6A 1W0KA 1J70A 1KO5A 1N0UA 4KYUA 4URWR 4DWJA 2KJQA 3ND8A 1R0ZA 4C30A 1CR4A 2DR3A 1N6KA 4IEEA 1IY0A 1XPUA 3THXA 1XJ0A 1N6IA 4Q47A 1M74A 1EFHA 3AKYA 1W4CA 1EWRA 1NSFA 2JJ1A 4EFLA 4EPVA 4P31A 5BN4A 2IX3A 2JLYA 3AF2A 2ERYA 2CVFA 1SXJE 3JZAA 3QG5A 5EXSA 4ARZB 1S3SA 2F3RA 3SC3A 4C0SA 3MJRA 4W5WA 4LI0A 5FTJA 3UATA 2ZRPA 3V9PA 1U0LA 1GKYA 1F3OA 2NPIA 3AGQA 5KTYA 4LGMA 4TYYA 4Q18A 4HSEA 5G53C 4NTZA 1UKVY 2L0XA 3K53A 2ZUDA 4UKDA 3TRFA 4B3FX 3DVLA 4HB2A 2YINC 4Q00A 4RZ3A 2WV9A 2ZRBA 1P75A 5KPJA 2DFKB 3FHTA 4BFZA 4XVUA 3EXAA 2OFXA 2ZUCA 4IHQA 3M4YA 2IXFA 1XXHE 5FTMA 2HUPA 3TSOA 3THYB 3QF7A 4DKXA 1OHHD 4Q1FA 1FMLA 3IO5A 1EFRD 1NJGA 2RGCA 1S0UA 3ZIAA 3P27A 4G0NA 3DKPA 2QG6A 1GTVA 1HH4A 4L4UA 2GDJA 3C8UA 2GXSA 3NC0C 1MABB 1KI2A 2B92A 1KI8A 2ZI7A 4XWOA 1E4YA 2EVWX 2FG5A 1X86B 2AWNA 4I1OA 2VPPA 4KAXA 1T9HA 1XTSA 2OXCA 3BWDD 3DHWC 4D25A 2GA8A 1YR6A 3NHAA 5LPNA 2WJGA 2A5FA 3B8HA 2P67A 2C9YA 3OIWA 2JGNA 4TL8A 4O25A 4EFMA 2OBLA 2OM2A 2ZYUX 4B3CA 3HU2A 2OLKA 2QMUA 2ORWA 2PEYA 4BGDA 1II9A 4KFTA 5LDDC 3DMDA 3DM5A 3JZMA 3QNUA 5D3MA 3ZJYA 4AK9A 1CU1A 1E9RA 1OIWA 4BEBA 3A1TA 5EZ5A 3QXJA 1HE8B 4I81A 1G41A 2XSZA 4EPXA 4D4MA 2FJUA 4F7WA 5GVSA 4GZMA 2H16A 4CF7A 1P3JA 2IWRA 4YQFA 2HLDA 2UZIR 3A1UA 1W4RA 4FMBB 4XJXA 3CX6A 5A0FA 3WXMA 1Q20A 2ZJ2A 4QKQA 3WYGA 1HT2E 5JI3E 4BECA 1SULA 4GT1A 3GEIA 3ZS9A 3TR5A 1P72A 4KSBA 3UK6A 3AKCA 2ATXA 3DOEA 3HPRA 2HCBA 1G18A 1XTIA 8OHMA 4OHYA 1W5SA 4D0NA 4K46A 1LF0A 4URVR 2GEDA 4US1R 1G8GA 4JLVA 1RYHA 5DISB 1W48A 4DLSA 5CB8A 3LBIA 1E2PA 2ZJBA 1KDRA 4IXNA 4OK5A 1K6MA 2ZRNA 2ZYTX 3AVVA 3AGPA 4HAYA 3NEJA 2FZ4A 1E0SA 1JAHA 4PO8A 4OKSA 4BFUA 3BOSA 4EQ6B 2ANBA 5FPSA 2GBLA 1HUQA 5HKKA 3O8RA 4JMPA 5CK4A 1A82A 1FX0B 1Q3HA 3C41J 2YYZA 3K0AA 3VX3A 2MSEB 3VU9A 1D2EA 1JQJC 1DOAA 1QRAA 1RE0A 4PR0A 4TQ9A 4B43A 3OE7D 4AKIA 2ZROA 3RWMB 4HYYA 4AKEA 1WQ1R 3ONWA 4M9XA 3AF1A 1D6JA 1YR8A 5G3YA 2FF7A 4CEHB 4JLJA 1A2BA 4PPQA 4QFMA 4O3MA 1E9FA 4EPYA 2FPLA 1XFAA 1CJMA 4WIAA 3EG5A 3TSZA 3IPXA 4ERNA 4G5SA 3RRNA 2VP9A 2WIAA 1F2UB 2ZE6A 5L3RA 2XGJA 4B74A 1G19A 4FCVA 4AYTA 1BMFD 3WRYC 3K0FA 4WXPA 3THWA 3QPWA 2V55B 4V03A 4FW9A 4RY2A 1WBDA 2WPDD 3M6AA 1G5TA 3LH5A 3TUIC 2C98A 3NIBA 5TB5A 4C7OA 1T0JB 1XNJA 2W6ID 4C4PA 2WWGA 3HU1A 2FSFA 1LS6A 4A8JB 1VDZA 4G5RA 2W2TA 1EX6A 1XEXB 1X1SA 2WBLC 3PQCA 3SYLA 4LPSA 1SXJD 1TMKA 3BB1A 5CLLA 2ZRDA 4GFDA 2IC5A 1PVOA 1KKLA 1WMSA 5JSZB 5CJPA 3P1JA 4D26A 1FP6A 3BK7A 2AXNA 2XNDA 3NBZC 1MT0A 5KOYA 1W4AA 3TSWA 1Y3AA 3IEVA 2FFAA 1SVKA 1JR3A 1GL9B 4M0LA 4BWYA 3QXHA 2GCNA 2Z4SA 3QSYA 2CK3A 4B75A 1XZPA 2WAXA 2ZJOA 2GJ8A 3R7WA 1R6BX 2XXAA 2Z5FA 2AD5A 4DDVA 1DADA 4F38A 3I3SR 1KZGB 2W83A 4TYQA 2WSSD 1JECA 4QHTA 2H7VA 2IYWA 4IDHA 2F1JA 2BVNA 2QM8A 1PV4A 3DZDA 2V6IA 2NMVA 1E96A 4KCGA 4DRZA 1FQJA 1YRBA 4OL0A 2R6GA 4JS0A 2CL6X 1G3MA 2P6RA 4IKEA 1FUUA 3W8RA 4EKDA 2C96A 1CEEA 1N5JA 1AGPA 3LRPA 1W36B 1S9HA 4NCNA 5FI1B 3HR8A 5HPYB 1OPXA 4TLAA 4DSUA 5DNYB 1NLYA 1OXXK 4GRAA 3RSLA 2IXGA 3UMSA 4PO9A 4RD4A 4A6PA 3SNHA 1G1MA 4P4SA 3HWSA 4EJSB 5KNCA 3UWOA 2ZE8A 3LW8A 3V4FA 1PLLA 1KI6A 1R0XA 2RGBA 3EZ9A 1XTKA 721PA 3PEWA 4JVSB 4HLQB 3MWYW 1BIFA 4PC1A 1XCPA 1YZLA 1Z07A 1E6CA 4JZKA 4AC9A 4QHYA 1W0JA 2YVUA 3T06B 4HB4A 2Q9BA 3RNLA 2YOFA 5JJLA 1KDPA 3Q5EA 4MA4A 3K9HA 3RS4A 1UBGA 4PXAA 2NO9A 1ESMA 2O8DB 2O0KA 2JLWA 2D3WA 2ODBA 1UPTA 1OFTA 3BIFA 3QXXA 3KQLA 2XX3A 2VP4A 3KUDA 1CRQA 2ZS8A 1ZYUA 2P5SA 4WAUA 2DPXA 3U6KA 2BMDA 4AYXA 2R62A 4MUAA 3HYRA 1DG1G 1UBCA 2G9NA 1DEKA 4HLUA 2WKQA 3T61A 1OXUA 3IO3A 4S2EA 1YZTA 4RZUA 3NDBB 3UG6A 3EC1A 2CHQA 2SHKA 5FBQB 2IWHA 3W90A 2DCUA 4QOSA 3K0EA 4LHXA 5F98A 1RRGA 2FWRA 1G7SA 3B9PA 2RGNC 4LBWA 2ZJ8A 4RCZA 4B35A 3SHWA 4QL3A 2IUTA 1JBKA 5TVKA 5AJWA 3NDPA 5DIFA 1KDOA 1P5ZB 4M9ZA 1OKKA 4DLUA 2IT1A 4XSHA 1KMQA 4DCVA 3F3YA 3F0TA 2J0UA 3PV0A 3C5HA 2PJRA 2A30A 2R6FA 1WDTA 2OFWA 2WWIA 1CRPA 1KNXA 3KQKA 1X8KA 2VBCA 5JS7A 1R7RA 1OIXA 2Q0HA 3E5HA 1B0UA 5JECA 4JLMA 3Q7QA 1OIVA 4Q66C 4OHZA 4LOAA 4BLTA 1LV7A 4XSGA 3QEJA 1F2TA 1XX6A 4G3XA 5AJXA 3SJCA 5TARA 4CEJA 3SBEA 4NBSA 4URXR 1E2QA 4E03A 3QXCA 3W3ZB 3AP2A 4K8OA 1G8HA 4LWZA 3SFVA 5TV2A 4LJYA 4Q1DA 3ADBA 3LDAA 4FXPA 3P4XA 3T1QA 1GL7A 1OJLA 1Z0JA 3B60A 3RS2A 2G83A 1ZCAA 3T34A 3D31A 5BN5A 1ETUA 5BN3A 2QAGB 4RSGA 3VR4A 4Q9IA 5CDFE 3KDSE 4XWAA 3K09A 3TIFA 2NIPA 3CPEA 4BLSA 4TT3A 4LDJA 4DHEA 2EFDB 1SVMA 1I4TD 3BC1A 1CJTC 1EFUA 4NMMA 1P2TA 1TAGA 3K0CA 4U5XA 2X2EA 1T5LA 2PMDA 2B8WA 3FB4A 4I99A 4LV6A 4LHYA 3WNDA 1KYIA 1GAJA 1E2EA 1W0KD 1GKUB 4F91B 3BH7A 4Q1AA 3GLGE 3DKVA 3ZD6A 1XBTA 4W5JA 3EWAA 1U9IA 5JRJA 2FFHA 3IDQA 3UG7A 1DVRA 1W36D 5KDDA 2DB3A 2I1QA 3SE0A 3QF4B 3CIOA 4JJZA 4R2IA 4PAOA 5JWRA 1XJCA 5BYJA 4NH0A 4PPNA 4Q9HA 3OAAD 3CWZA 3E1SA 1ZVQA 3D7MA 4ZDIA 3WRXC 2OT3B 1Z83A 2FGKA 2RGGA 3BGWA 3CRQA 3PVSA 1FTNA 3LQRA 5KSOA 4HAVA 4I4LA 1A4RA 3BERA 4UJ5A 3TE6A 3OIUA 1P9NA 3AF3A 4NPHA 2ZTSA 1RC8A 1UDXA 2KI5A 3EA5A 2PLRA 3GLGB 1NG1A 1NIJA 1UEIA 1F5NA 4EPRA 2DFLA 5FBLB 1GRNA 1G64A 4IFEA 1UADA 2BBOA 2Q3HA 1LW7A 2CJWB 4D2IA 4RKEA 5JMTA 2PBRA 2NTYC 1KSHA 4KI0A 1N2CE 3GJ6A 2IA5A 4ZKDA 2EFGA 4R2HA 5HCIA 2YWHA 4MDFA 4LJ9A 2IXEA 2ECKA 4ZI2A 2BBTA 2A9KA 1LVGA 1UBFA 3CH4B 2CMKA 3RS0A 4UNRA 2ZI4A 2ZXUA 2QBYA 3AVYA 3H4MA 4YMUA 4DCSA 1KHTA 2WWWA 3TNFA 4S35A 1OH6A 4L16A 3QE0A 2F1HA 4P0TA 2BM1A 2QTFA 3B1XA 3FWYA 1E2IA 2LWIA 1NVWQ 4IFBA 2ERXA 4YLGA 2JJ2A 3GLFB 1HA3A 3B1YA 1NKTA 2WMOB 3PJRA 3KX2A 2ZEJA 1OW3B 2IF2A 1XTQA 3ZVNA 1R5NA 1SQ5A 1G8YA 4DB2A 2OCBA 4NCJA 4C0KA 1NBMA 1U9IC 4DLVA 3CH5A 1VECA 1XMSA 4DCNA 2BM0A 3MWLA 4Q9JA 1MABA 1MKYA 4NL4H 1NP6A 3SQWA 2QT1A 1U8YA 2HJGA 5DH9A 4ESHA 4PHTA 4B44A 3X1WA 2RCNA 4JSTA 3TJZA 1AQYA 3EPKA 2IW3A 4XVQA 1VG0B 3CX7A 2OEPA 4RD3A 4TL7A 1E2MA 4ZI3A 3FKSA 4IVPA 2H5EA 3TGPA 4D82A 3AVOA 1ZIOA 2AD1A 2A5GA 2YKGA 1ZP6A 5IHPA 4LPKA 3EZ7A 3KFXA 5JCZA 2XB4A 3QKSB 2ZUBA 3BD9A 4PAMA 1F48A 2OESA 5FUVA 5JHHB 4PSAA 1TF5A 2QMEA 5C4MA 1XPRA 2GJAA 2E87A 1GRRA 3OF5A 3W9YA 4PO1A 3AB3A 3CF6R 3CW2A 3FHCB 1N6LA 1G3RA 3D3QA 4TYPA 1P2SA 1WF3A 1VCIA 4BFXA 1U98A 3GQBA 3CPHA 4NCKA 1N5KA 2GK6A 2ZI9A 3FTQA 4DEXA 4QBFA 4YMSA 2DBYA 4A2QA 4R7ZA 1L8QA 2REBA 5JWHA 2ZI3A 3GLHE 5FBVB 1YHNA 2O8FB 4HI0E 1QG2A 2B8TA 1GWNA 1DS6A 2QPTA 4UNSA 1DAIA 1GRQA 3FMPB 5FL7D 4DVGA 4HB0A 4O0MA 2I3BA 5H8WA 3RLFA 3SOPA 2W6JA 2WOJA 3BFKA 3BH0A 4DIEA 5SZJA 4A4DA 1N0WA 3Q9LA 1D9ZA 4HDQB 2GILA 4Q4AB 2VO1A 3OFND 3U3JA 1R8SA 3TH5A 4F4IA 1NLFA 3SHFA 4IOKA 4QXAA 2XNSA 2ZSAA 4EQ6A 1ZBDA 1E2KA 3NHBA 4AKGA 2D4HA 3D8BA 3WMEA 1X6VA 4UNPA 5GADl 4IXMA 3ZVLA 3QOFA 1LB1B 3QXSA 1IY1A 3PEVA 5SZIA 2ZRIA 1ZMXA 1TX4B 3GLHB 2QA5A 3LXRA 2ZETA 3B7GA 2E1RA 4MITA 2EW1A 3AQ4A 1NN1A 1Z22A 2G1KA 4M1MA 3R8CA 3C14C 1GVNB 3AKEA 5IF9A 4LHZA 3H2YA 1IOZA 2ZRCA 3KJEA 1F2UA 1I2MA 1TU3A 2MSCB 5EE5B 4W9MC 1M1YE 1Y63A 4TMTA 3SQXA 1MOZA 4DDTA 2RGAA 2YWFA 3WP0A 5L3QA 1X8JA 5AUOB 1NF3A 2AWOA 4OHWA 3RDPA 4DZZA 1JXOA 3GFTA 3TQCA 1OFHA 1UKYA 3O47A 4PX9A 1QG4A 3NXSA 1GUAA 5TXGA 3ADKA 4A8JA 1Q0UA 4YMVA 1CR0A 1TQ2A 2XEXA 4PQRA 4GMXA 1RYFA 3L0SA 1QVRA 4KV9A 4Y0AA 2XTZA 4AG5A 4IW3B 1G17A 1T6NA 1W1WA 2R6DA 1CIPA 1W2GA 2OSBA 2ZU6A 3GFOA 2QPOA 4A6XA 2H17A 5IK2A 1S1CA 4TL9A 4ASUD 1G8FA 2QNRA 3Q3JB 4Q7JB 3OEED 1XF9A 1L4UA 4BFYA 1K8RA 3LA6A 4CEIB 2P6NA 1EWQA 2HCJB 2P6UA 4B2PA 4DLXA 4Q5IA 3V00A 4BRUA 3IIKA 1NMZA 2AKYA 2F9LA 4HUQB 5SZKB 1UM8A 1IAQA 4ACAA 2WJJA 5J40A 3NBFA 1R5OA 4Q4HA 1MO4A 2FN4A 3VKWA 2JIZD 4MGIR 5DI3B 1GITA 2XZOA 5KNDA 1KI4A 2R6AA 1AZTA 2F43B 2QMOA 1J99A 3GMTA 1WRBA 1DTSA 2V7QA 5C46F 2JDIA 5HCNA 3KQHA 4Q9KA 3B1VA 4YXWD 1G4AE 2VF8A 3DMNA 1W47A 3L8YA 4A0RA 1VYUA 4OQNA 5JS8A 3QKUA 4JLOA 3PFIA 2AK2A 4XIGS 2C5LA 2ZSDA 1A5TA 2OE2A 1SZPA 2W0SA 3KB1A 2PLFA 5FUYA 1R8QA 4Q02A 4Z1MD 1UJ2A 3NEYA 1H65A 3KJIA 2IYYA 3NKVA 4HAWA 4HAZA 3RS7A 4CIDA 1M6NA 2G77B 5F2EA 1CJUC 2IYLD 3PEYA 1ZU5A 3GP8A 2GAOA 3A58B 2OHFA 1QHGA 1P60A 3DL0A 2JLVA 1EK0A 1TQDA 4RD0A 1AIPA 4RD2A 4M9SA 3RAPR 1Z0DA 3MCAA 3SEAA 3WBJA 5JI2E 1P7CA 1SXJB 1ZNYA 1NSTA 3VHXA 1OE0A 3KJHA 4WZ6A 1P61B 1Z29A 1HQCA 1IXSB 1QHXA 1KMHB 2O8EB 4Q03A 3LQQA 2GZAA 2HJVA 2PCLA 2O8DA 4C9BA 4RFSB 1Z6GA 1S2MA 5DO9A 2I4IA 3FYHA 4QHSA 4C3ZA 2B21A 2C9OA 2JATA 1M7HA 4FCTA 1KO7A 1H8HD 4JLKA 1YZNA 1IHUA 1N6PA 2IEZA 2GK7A 2O52A 3EIQA 3OEHD 2BMFA 4B3BA 3RRZA 4CYMA 2OO7A 1ZUHA 2PJZA 3FDIA 4KODA 2RAPA 4YC7A 2ZJYA 3SR0A 2D7CA 1XXHB 1NN3A 3IQXA 5EZ6B 2ZRFA 2IBMA 4BQSA 4A36A 3OESA 2GAAA 4LHWA 3U3RA 2J9RA 1N5LA 4EUNA 2VIIA 3VKHA 2X1VA 1ZM7A 3AV0B 4NCIA 5J5CA 1VIAA 5FOVA 2QY9A 1OH8A 2BV3A 1NIPA 4MYUA 1Z2CA 4RFVA 1D9XA 2ZI5A 1VPLA 3FFAA 4L15A 4B3GA 1L2TA 2ZR9A 1QHSA 4ZIRA 2VA8A 4M1YA 1IY2A 2VH5R 4B47A 2G3YA 4B48A 3H86A 4BZQA 5L3SB 1KDTA 2AFIE 4TQUS 4V0NA 4BEJA 1CTQA 2N42A 3P26A 3ZDQA 4KLNA 2MMCA 3N70A 2D7DA 2RGXA 1G3QA 4M1TA 1IQPA 2KBEA 2VRWA 2R2AA 3W5IA 1RJ9B 1E94E 1SKQA 4FIDA 1G9XA 1KY2A 5KSZA 2PL3A 2UZ3A 4M2LA 1CULC 4C2TA 3QBVA 1H8ED 3H84A 2F6RA 1XMIA 2C95A 3A36A 3CRW1 4A2PA 4DCTA 3QJYA 4DCUA 121PA 3WMFA 3UMRA 1CF4A 4HAUA 2CNWD 1GDDA 1N6NA 2C8VA 2GCOA 3FMOB 4BUJA 2VHCA 1XEWX 4F4CA 3R9XA 4ILEA 2R65A 3BB3A 2WKRA 4MGZR 3I4LA 4IDPA 2FPMA 1Q22A 3EW9A 3TKLA 2ODNA 5BW8A 3U5ZB 2O8CB 1AKYA 3OZXA 1Q3TA 4BFVA 3HU3A 4GOJA 3KKQA 1YRAA 1KJYA 1QHHB 4FMDB 4MDEA 2QE7A 2W2VA 3C7KA 2ZRJA 1XDBA 4TSFD 4CVNA 2R44A 2IYQA 3IILA 4IDOA 5GJWC 4CT5A 1S3GA 1E1QA 3IHLA 1S9DA 2C03A 1Z6TA 4LYHA 1YZQA 1FW6A 1BS1A 5KDLA 2R6CA 3C4JA 5A5GA 2QU8A 4B6EA 2FA9A 2HDNB 4JT4A 5HZKA 4PSKA 4C0AC 1COWA 2OG2A 1DO0A 3BFVA 1FTSA 2F1IA 2BKUA 2CCJA 2GXQA 4MGKR 2ASEA 5DGXA 3FMFA 2N1BA 3GFPA 2VP0A 4WVFA 1TPZA 2P2LA 4V0ME 1N0VC 3MMPA 1ZJ6A 1SGWA 2ONKA 1VHLA 2B7CA 2QEQA 3LO5A 2QQ0A 4XTCS 3KTAB 3WYAA 4JL5A 4BFWA 4LJ7A 1JQLB 2CHVA 3PENA 4M53A 2BEJA 4MRVA 1RZ3A 3CLVA 1G3UA 1QVAA 5ELXA 4URZR 4DLZA 2FDCA 3B13B 1ZAKA 4DLTA 3IUYA 4AURA 2GVZC 4GP6A 2YC4C 3RHFA 2CL7X 2JEOA 5CLQA 3HDTA 1KZ7B 2FMXA 3L43A 3O8DA 4YONB 2FGJA 5CIQA 3UKDA 2WJIA 3VR6A 3U3MA 3K9NA 5JHGB 2ZS9A 1PLKA 4BLQA 3KUCA 1A2KC 4LSGA 5LD2C 4AIIA 4IEIA 2XJ4A 2IYSA 3EZ2A 5P21A 2HV8A 1A7JA 1N6HA 3QKRB 4JJKA 4MKIA 2BJWA 3B1ZA 4LY6A 2YZ2A 1TNDA 3KJGA 4V0LA 2CL0X 2ZIAA 3WNBA 4AD8A 2GBLC 4PZLA 5JJIA 1NI3A 4ZDWA 4EFNA 4LJAA 3BFXA 4LX0A 4C0BA 4LJ6A 2JCSA 5K8LA 1JB1A 4OK3A 4TLEA 3NH9A 3RC8A 2ZITA 4HAXA 2OILA 1VKJA 1XZQA 4BLPA 3IHWA 3THXB 4JLBA 3GLFA 1GG2A 3LD9A 1YZGA 1KJZA 2ZSEA 2NZ8A 1BO6A 2YNMA 1QDEA 2QT0A 2XZLA 5B58C 1TF7A 2BJVA 3ETLA 4LBVA 3ZVMA 4KXFB 2DWPA 1MO6A 1I2DA 3IKJA 1JJ7A 2IHBA 3EARA 3NC1C 1VG8A 1E1RA 2AKAB 1FNMA 2Z0MA 4Q21A 3IPYA 1E4VA 1YR7A 4OHVA 4OJKA 1YQTA 2PT5A 2KE5A 3CONA 2V3CC 2IS1A 4Q01A 1GNPA 3K9LA 5DI9A 3DO6A 4DLYA 3T15A 4B3DA 3GJ5A 3RC3A 1K5DA 2REOA 4HZIA 2RHMA 1XEWY 3QG1A 5AUQA 2IUUA 4KBFA 1G6HA 1JPJA 1KKMA 1FL9A 5LB4A 2ZRHA 4DC9A 1LTQA 2QTVB 4DB4A 2R9VA 1U81A 3UMFA 1S96A 2FE4A 2H92A 4PTLA 1E3MA 5DLQC 1Z3IX 2DY1A 5AJVB 1IN7A 2Z43A 2CVHA 2FV8A 4PC7A 4TL6A 1B23P 821PA 1VHTA 1BH2A 3QY0A 1GFIA 5FOXA 5HZHA 4ZCLA 3U7HB 5TY0A 4Q9LA 5HE9A 1KY3A 2J59A 2GESA 4JBYA 2WWHA 4PC3A 5K8TA 3U44B 2GNOA 2Q3FA 3A4MA 1OSNA 3GEHA 1G7RA 2C9CA 4BFSA 4JLPA 3F8TA 5H68A 4TN1A 3ZH9B 4TZ0A 1P4SA 3AVPA 4PPGA 1Z0AA 1ESNA 1S1MA 2IYZA 2NO1A 3LLMA 3LVQE 5E3HA 2EYUA 5CYOA 2CLCX 2OFOA 4DBLC 1EFRA 5D3MB 2J0SA 1G3IA 4B33A 1M2OB 2Q21A 2GKSA 2ODWA 3NTUA 4Q4AA 5JLJA 1OV4A 3Q7PA 5DN6D 1UAAA 3ASZA 3A6PC 2CCGA 4P4TA 2RH5A 5C1BA 4CGZA 1NY6A 2FU5C 1Q1EA 1OH7A 2HXSA 4D4LA 2ZRMA 3QBTA 3PXGA 3VR3A 1KSGA 2CE7A 3JVUA 1ZM3A 3EZFA 3SU8A 4G1UC 2VL7A 1KIMA 2G88A 1GL6A 1KI7A 1E79D 1Z2AA 4QNMA 5J4HA 4HZUB 4PSVA 3QPUA 2VLIA 2J7PD 5C18A 1XP8A 1CBUA 4D80A 4OI1A 1TQ6A 4TYWA 4CZ2A 4M1SA 2F1RA 2XTMA 4BFTA 1ZM9A 2ZRGA 1JEDA 2XOKD 4LJ5A 4TWZA 5GJBA 3WHKA 2NO6A 2BBWA 2OBMA 3KFVA 1II8A 1LS1A 4O2RA 3BE4A 1E2NA 4ITRC 1EESA 4US2R 1Q1ZA 5JZVA 3ZYCA 2GWHA 2QPAA 1LY1A 1OB5A 3VFDA 4HLUC 5FBWB 5EE3A 5H70A 3QVUA 3WBKA 5AK0A 3QKTA 2XTNA 2RKOA 5FPYA 1XEFA 2JJ1D 1T3HA 1NY5A 4TMXA 4BASA 2VHJA 1VMAA 3AUYA 1Z6YA 4OBEA 3G0HA 3GEEA 4D0GA 1Q44A 4AKHA 3K9GA 3BH6A 1E2LA 1XU4A 2A2ZA 4RZXA 3VAAA 4BE7B 3TQFA 3UANA 2VSXA 4ZCMA 2E9SA 5HR5A 1VYVA 2V1XA 1Z8FA 3AP1A 5FI0B 5FOUA 4OI0A 3ZQJA 1US8A 1UKEA 4CEIA 2YOGA 1RRPA 1OT3A 5KDOA 1JR3E 1IJFA 1JXMA 4Z8XA 4M4SA 3K0FB 2B6HA 5A4JA 1G5RA 1N3BA 3C16C 2KB0A 5E7MA 4B76A 3FOZA 3ICEA 3AVUA 1G4UR 5DSZA 4AG6A 4KBGA 4QGFA 4C7OB 2Y8EA 2C77A 3MD0A 3IGFA 3OE7A 4ARZA 2F43A 3O8BA 4YMWA 4Q7LA 2JLUA 4RD1A 3U4QB 3QUSA 1FZQA 4G5GA 3FMIA 4PQFA 3S1AB 3U60B 2AN9A 1N5IA 2QZ4A 3C5CA 4MKGA 4NZYA 3K0SA 2C99A 5EXTA 3K70C 3ZIAD 3GJ0A 1CP2A 4DDWA 1I4DD 3B78A 1N25A 4TLBA 4OYHA 3MFYA 4JLDA 3TW8B 1EX7A 1R10A 1T5IA 1TL7C 1ZC4A 2HF8A 1W7AA 2O0HA 4NYIR 3AVQA 1XPOA 3K09C 1BMFA 2IL1A 4M8NE 4B71A 4WOPA 2VYFA 5CITA 5J4VA 4KVAA 4M1KA 4KHZA 2WPDA 2VQSA 1G7TA 1P9WA 3A8TA 3LFUA 4CDGA 1RVDA 1I4LD 3B82A 1YZUA 3K0CC 5CK5A 2O5VA 2W6IA 4XOIA 3CNNA 1Q1BA 4GMDA 1HQYE 4M1OA 1WA5A 2PZGA 5FTLA 2JLQA 3QIAA 3THYA 1W5TA 2V9PA 5E4FA 5FTKA 3NH6A 1SXJA 3CF0A 1ZD8A 221PA 5EP2A 5UKDA 2W00A 1E2HA 2PH1A 4WW0A 1ZD9A 3I5XA 1SVOA 3W8NA 2GVDC 4ABYA 3CR8A 2O8EA 4V0KA 3QVVA 2XSZD 1Z6XA 4MRPA 3PITA 2WWYA 2GEUA 4RFSA 1M7BA 2IK8A 1R0YA 2G6BA 2QN6A 3KKPA 5JRZA 5AUPB 2X77A 4II7A 2HLDD 3L8ZA 1U94A 1DE0A 4FMCB 1C9KA 4QGAA 2EFCB 5EE0A 3W6NA 1D2MA 3B1WA 2J0VA 2QENA 3KKMA 3IIJA 4P4SB 1KAGA 2GJKA 2H18A 3OIVA 2WSSA 1FNNA 2WHXA 1Z5ZA 3SDZA 4MYCA 1XXHA 1D8TA 1V43A 4QM7A 1E99A 1KI3A 1MO5A 1NRJB 1VG1A 1C1YA 2GJ9A 4NCHA 1XD2B 1YJ5A 3ASYA 4X8MA 3RVBA 1NMXA 2CLSA 4ZDKA 1XMVA 1HTWA 3MAAC 4KITB 2ZRKA 1G291 2ZRLA 2ORVA 3BBPA 5BQ5A 1A1VA 3KXLA 4I1SA 2EWWA 4GSYA 1W4BA 3EX7C 2I1VB 1PUJA 3R20A 5AJZA 3SYKA 4Q48A 1LNZA 5SZHB 4XTRA 5HKKD 3KL4A 5KNBA 3KXIA 1KI9A 4KU4A 1RFLA 3TUJC 1GP2A 5L3SA 1G5PA 5L8VA 2ZJ5A 1CLUA 2FZLA 2EFHB 2ZSFA 3KKOA 4MGYR 4TMZA 4F4JA 5FH9A 3OHMA 4N3NA 1KO4A 3HYTA 3IEUA 2QE7D 2YV5A 3ZZ0A 1DAKA 3CR7A 4WA7A 3HPQA 2GHIA 1VTKA 4IJMA 5CYPA 1OH5A 3I62A 1Z47A 1G6OA 3AH8A 4US0R 2DWQA 4Q1BA 4JVNA 4WXRA 1GOTA 1JJVA 2IS2A 4LYAA 4OK6A 2WVJA 2RB4A 3AF0A 1HV8A 2WJVA 4DT1B 2W58A 4LJ4A 1CJKC 1RKBA 1FX0A 4O2LA 2A5DA 2HYIC 1COWD 3N2IA 4KYIB 3QQ5A 2BKEA 2O8BB 3LLUA 1IN6A 4RVCA 5FUWA 1E2DA 5KPDA 3L0PA 5KHOC 2RMKA 2ZI6A 3P4YA 2Z6VA 2A7QA 3CNLA 4QGHA 3CKLA 5AUNB 3I8SA 4CEHA 1GNQA 1NG9A 4M1WA 1SVSA 4NONA 1KOFA 4QM6A 3M0EA 5KUTA 1RIFA 4POAA 3ICQB
chains in the Genus database with same CATH superfamily
3WOHA 3CLKA 1C7QA 1KS9A 4P0QB 1X8LA 5JNRA 3H0KA 2Z8ZA 2JIQA 4EDFA 2XUKA 2NO7A 1HMYA 2QN1A 3J7TA 3EVBA 1HI9A 3KHTA 1J20A 4FTWA 2WJWA 3E2IA 4KH0A 4EPTA 4FFBB 1JFVA 2J1LA 2O0JA 4KAFA 2WM3A 4FMDF 3LK6A 3B6MA 4BXOB 4WCFB 3FB1A 2IIVA 4MVJF 5DULA 3SC6A 1YFZA 1JNXX 2AEMA 4L9WA 3VPAA 3ZHZA 3TK1A 1UFVA 3VYVA 3KSAC 1R0SA 3BMQA 4I1VA 3EDOA 4MLZA 4C2UA 1G1AA 1C5KA 2LCFA 4RIGA 5ALFA 4H1WA 1RHKA 3R3YA 4HXEB 3U2QA 3UJBA 4Q24A 1HETA 3AVXA 2HXYA 5KTRA 4MYTA 4LYJA 1CETA 1MBZA 4Q7MB 4IOJA 1XTJA 1CKEA 3RKUA 4UTZA 2FP4A 3VPDA 3AEQB 2FOXA 2J87A 1NHGA 4ZOEA 4EF4A 3CE6A 4IUCS 2KBFA 2ZWMA 4M9QA 2NGRA 3B5JA 3CZQA 4MMYB 3PIIA 4UUAA 3QYAA 4BLWA 2W37A 4BB0A 3GXBA 4K9KA 1SY7A 3VDRA 1E2JA 3ZY4A 2AN5A 5LZ9A 1VCHA 3KB2A 3A4TA 5DJ5A 2A78A 3F49S 4MUJA 1DRWA 1TM4E 2EP5A 3TKAA 3B6EA 3QX8A 5J59A 3FUXA 3WIEA 5JYEA 5LQJA 4BTEA 1U2SA 4KWIA 4RS4A 2ROQA 2WJPA 2WWFA 2ZB2A 1SEVA 3LYHA 3IXLA 2VHEA 5KNCD 2HREA 2OZEA 3QKRA 2OG1A 2V7XA 4N01A 2BELA 3C5EA 4K2HA 2HDHA 1K98A 4RTQA 3VPSA 1E1RD 4L4YA 2PS0A 2A0KA 2HSEA 3FLAA 3I6QA 4OI4A 4MYHA 5EE9A 5TEVA 3QFTA 3T5GA 4UXJA 5LMUB 4ALIA 3S2ZA 2AXEA 1TJ5A 2CNDA 2BGLA 2EFYA 3G9ZA 1QHFA 3VRHA 1OX6A 1I2CA 4BNVA 3I8XA 1W0JD 3FSGD 3BL5A 3IBYA 1UDRA 4PTZA 4XA8A 1V5WA 2WFZA 4TTTS 5BR1A 3O92A 1XU7A 4Y98A 5KQMA 5ITWA 4DCMA 3AVWA 5JZMA 3D7SA 1NNEA 1EQUA 1W76A 1IAVA 2INGX 2YHSA 3LX8A 4GMKA 4ZO4A 5BWMA 4ODIA 1H4VB 3UJNA 2BGJA 3NJ4A 2QX7A 1N6RA 1T10A 1TADA 1XXLA 3NFYA 4GBMA 4LRSB 1X1BA 2FG6C 4BP9A 3BF8A 1PJBA 4P83A 5EJ9A 1WSDA 2G0TA 2MOKA 4FFLA 4EEKA 3V46A 1DDGA 2EU8A 4YAJA 3GDWA 4H9GA 1XLTA 1P62B 4YUWA 3MBIA 4IHJA 2EBFX 5K4HA 4YX9A 1T15A 1JHZA 4BAZA 3CTMA 1NOIA 2PCJA 2VPXA 1PJRA 2X9VA 1I51A 3OY7A 5CNJA 1CVRA 4NU8X 5BXQC 3WIOA 3LOPA 1P80A 4A8JC 2LKCA 2AX3A 4ENQA 1WV0A 3TTVA 2Y1GA 3L5OA 1TI7A 1E4OA 5AM2A 3LWZA 3QPCA 3AXSA 1DB3A 3VNBA 1T2AA 3GDGA 4CE6A 4LW8A 3T7DA 4CMGA 3RRMA 2OAQ1 5LXTB 1SQGA 5IDVA 3V7UA 3KAPA 1U1EA 1B8VA 3GGDA 5H3CA 3RS3A 3DCJA 1W88B 2FN9A 1DARA 3JQCA 3JZIA 5HJ2A 3ZX5A 1GU0A 4F7DA 4B40A 3U61B 4ZVTA 5FWXA 4X91A 3AF4A 2BZGA 2V4ZA 3M6VA 5JSKA 1IXRC 1VL6A 2ZYIA 4JFRA 1M76A 3JTMA 2GYWA 1JHYA 4C0LA 4UEOA 3DVRX 4TMVA 4KO4S 4J43A 2C7RA 1VFNA 2IZ0A 4QBIA 1JDTA 2AC2A 4QJ3A 2AXPA 5K20A 4S04A 4EIWA 3BWCA 5A4DA 5G41A 4XH9B 5DBEX 4ZO7A 2XJ9A 4AN4A 4XJTA 3GX1A 3IP7A 2HSDA 4FC7A 2IYXA 5J23A 4EG3A 1ZEMA 4RTMA 1WV1A 3IBFA 2F55A 1N5MA 1YVDA 3FWZA 1J00A 3K70D 4FLEA 3JRWA 3EXEA 1RBQA 1L8XA 1T0HB 3AR4A 2FPRA 4R9SA 4N9QA 3ZWOA 4COOA 4XVCA 4S05A 1JGTA 4BJHB 4BZXA 2FKAA 2G36A 1ONBA 3FFWA 4O4HF 3LQ2A 1JPVA 2I29A 3HDHA 4OBBA 5CLIA 1WUKS 2DWOA 2QDKA 1G6Q1 3FBTA 4GLLA 1I80A 2HK9A 2PX3A 2VYCA 3B9QA 1W29A 4ENUA 5JQWA 2RKBA 3LAWA 1J2UA 1PTKA 3C85A 3LYLA 4MQBA 4DG5A 2HJHA 4JVLA 2O5RA 1MEEA 1FDTA 1V2HE 1VG9B 2GN0A 1PWHA 5F2KA 1MQ9A 3DHEA 1U2RA 1I5EA 1EGHA 1IN1A 2O06A 5H80A 1TEVA 4B4VA 5B57C 5JH7A 4CM8A 3K5PA 1QCCA 4DR3B 4PC6A 3B5EA 4O33A 3SK0A 3HR7A 1K9SA 2ADOA 4M1QA 4BKQA 1GPKA 5FBZA 2ZYVX 4UAUA 3JQ7A 2ZIEA 1FNBA 1TT5B 2HEIA 1QZZA 3WL7A 4DIBA 621PA 3H2GA 3S44A 4AECA 2EF0A 4TMKA 3WADA 3I05A 5J9FA 2XWQA 1HYQA 1X7YA 1YZVA 2WMYA 4M0MA 2Z56A 2H4FA 4B46A 4YT2A 2RHBA 7AT1A 1D2NA 1MQSA 3FFBA 2PQ2A 2FN3A 1PFGA 2Q4EA 3LX5A 1YOVB 3G02A 4EYEA 4IMJB 3LCVB 4IF6A 1LXCA 3OG9A 4GUDA 1IN5A 4FKBA 3PHLA 5DNCA 4MWZA 1JMVA 1U9YA 3LHFA 3OCUA 2KSQA 1AS0A 3G0DA 4G8BA 5T8KC 4YV0A 3FTEA 5DWQA 2V58A 3CZMA 3NGLA 2JA1A 5BN1A 1V7PC 3EPPA 3VSDA 3TOXA 5IZCC 2O7VA 1JWAB 1MTZA 1EXNA 3E4CA 1XF1A 3T12A 1AKEA 5CB6A 4LV8B 2RC6A 3GJ7A 2P90A 5FBHA 3CKMA 5EP4A 1AG9A 1JHAA 4UBLA 3T95A 3VR4H 5EIXA 2ZKLA 1GTSA 2GN4A 3KE9A 3L93A 1L5QA 4ALLA 1RBMA 1VKOA 3LV8A 4H3HB 4K81B 1JA1A 2HMVA 2HHAA 3KJZA 4KG7A 3N2ZB 1O3YA 4IRMA 1QOPB 3U9SA 2ZYWX 1YKSA 5CB4F 3H16A 4P3NA 5T4EA 5ICEA 1DQNA 1L7XA 2ZYDA 1HEIA 4W9RA 2BUAA 3UWMA 4N5LA 5ARCA 5J2UA 4U7GA 4MJ3A 3SYRA 1XDSA 4MUBA 2BFEB 4PGMA 3QVTA 2O1XA 1GKKA 3IRVA 3ZEIA 1E0AA 2QW1A 2OY0A 3IVRA 5LBIA 1ANKA 2I6TA 3OC0A 3DNMA 3MB8A 2GN9A 1UDWA 2A1TS 3OLCX 5D1HA 4AL4A 1QQAA 3LLCA 2E3JA 2IHZA 5H3HA 1K5PA 1CRZA 2VK1A 4URYR 3ELYA 3LP6A 4A1FA 2OZKA 1YRQA 3WBFA 2X2FA 3E5NA 4MROA 3W79A 3I9LA 4GLFA 4GP7A 5AW5A 1YB2A 1I2ZA 3BAFA 4MO9A 2H57A 2WKSA 5F7JA 4JVMA 2JCXA 4OXQA 2JC3A 1FP7A 2I6XA 1V1MB 1A2QA 2JLBA 2OBNA 2D62A 3MWKA 3PK0A 5EIBD 4BP8A 3PGA1 3SE7A 5JUWA 4OQLA 2D74A 1RWNA 1JI0A 4QTXA 3AEYA 3HJGA 4JLAA 5B1HA 4TZ6A 3EGOA 1XCOA 1MOSA 3E03A 2Q27A 4PZYA 4LOLA 1Y5RA 5DLDA 2XCSB 2VCEA 3I28A 4W8OA 4NSNA 3FI0A 1P6XA 2Q2VA 1N9KA 3HGMA 1MC5A 5AVKA 1W2WB 2CBGA 4L7QA 3TD2A 5KO2A 3W6PA 3HJNA 5IJWA 3T6KA 4PONA 3GGSA 3L7BA 4U63A 3MOIA 4J3FA 3L8DA 3OQIB 5HMMA 4EF5A 2EWMA 2FJPA 2OV8A 4XFKA 1WP4A 1T9BA 4K3UA 3TZCA 1MH1A 2Y1DA 1NM5A 1SK8A 3D3NA 1NAHA 1FTGA 3KB6A 5FX2A 2XT6A 1BA3A 1O94A 1BZYA 4PCVA 1M34E 3ON5A 4X8OA 2AG6A 4C88A 5IVPA 2F17A 1AN0A 3E9QA 4ZI7B 1B93A 2DX7A 3N8DA 3WHLA 1AS2A 2C2YA 3P96A 4JROA 2GXAA 3DBVO 5BN4B 5H59A 1WZUA 1PQ4A 3VOTA 2FYTA 4CETA 3PNMA 4GPTA 3KUUA 5E1DA 4ZGGA 2C7OA 4PZAA 1CE8A 1LDGA 3A6EA 4B7UA 4ZHQF 3UNXA 2ETXA 2JA2A 4FKZA 3COVA 1Y9EA 2JGJA 3U6BA 2HHCA 5K0FA 1DQPA 1Q17A 4KNYA 4OXXA 2QP9X 2PWZA 4H1TA 1JJBA 4UEJA 3ZJUA 2GZ3A 3OEEA 4IDGA 2FR1A 5DLYA 5TGDA 3H2KA 3PPIA 1UWLA 3EG9B 4QRHA 5LKAA 4KE8A 2VZEA 5CYFA 1NU8A 3EVEA 1HDXA 2RHLA 4U00A 2WD7A 5HK9A 3FNEA 4HN2A 2BKXA 3EZYA 3PWTA 4OJYA 2GPYA 3A2KA 2HPAA 3O2NA 3SJBA 3QPVA 4FB5A 5ES4B 1DGQA 4OX9B 3T4UA 2JIZA 1GQSA 1UWCA 3R5SA 1NW7A 3ZXIA 2FRDC 2Y0DA 2Q8QA 2AQIA 4Y9TA 3I6YA 4U2CA 3PT5A 1EFVA 2BGMA 4ESEA 1R6DA 1Y5MA 5ILOA 4C4YA 2O05A 1YDHA 2JAQA 2PKXA 1F60A 3NKFA 2GN1A 3OMLA 4LBZA 1PF7E 3OOHA 4I6JA 2NUPA 3X1ZA 1CQWA 3VQTA 4I7EA 3I6BA 2GBFA 1CERA 1YRYE 2BFPA 1EI9A 3MWDB 4MGEA 4O4HB 2FSGA 3HM2A 4TWJA 4D9IA 4Z1MA 4D9EA 5KU1A 2EYQA 1AUQA 3PUHA 1LNSA 2P7IA 3EAGA 3INRA 4ZREA 5A4IS 4D0LB 1X0XA 1AH2A 1YZHA 3EASA 2R1VA 5GOTA 5FPHA 2PVSA 3JW8A 1DX6A 2P9JA 3AB8A 2D1FA 4UVHA 1PYGA 5HK8A 1W8IA 4FZVA 1NYQA 3U7EB 1U3TA 5JJKA 3L77A 2J7KA 3VTZA 1UFQA 3N3AC 2YN4A 1AGXA 4YS6A 3NUZA 2CLDX 1OHHA 1DX4A 5J4YA 4V0QA 4DOMA 3T3PB 5NULA 1A1SA 1E1KA 4MS1B 1GTL1 1ZOSA 1I1OA 3AETA 3GOQA 5GJVC 2FOLA 3WGYA 3TQTA 3WICA 4YP1A 3ZZNA 1L8AA 4C78A 5CTJA 3A27A 4A2CA 3FLEA 2Q1UA 7REQB 3KLBA 1K6EA 4Q7KA 4JT2A 1IQUA 2C4MA 2QTBA 4ZVLA 3UM9A 3WRXA 3VKGA 4QNRA 5B30A 2EQBA 4S1OA 4R01A 1N8SA 2EJWA 3BWXA 1XRMA 1NPDA 4UAJA 1R4AA 3AR7A 3DBRA 1H8HA 3GP3A 5JCOC 1NC1A 1IM2A 3CPSA 3I72A 2NU9B 4DCGA 1E9SA 4EO7A 5LOVA 3PIRA 1GPJA 3UAYA 4A15A 2WK1A 3R8XA 3TFOA 2PS9A 1G5HA 2W2NA 4OJNA 1KJWA 1IN8A 3FPJA 5E2AA 2QTHA 1KFBB 2GHTA 3IDZA 3FXAA 3IVMA 1EZ4A 3AUFA 3IMEA 1U6JA 2P0EA 3IELA 3H9GA 1PT6A 2BDTA 3JQEA 4FSXA 4Q9NA 4WKNA 2DUUA 5ILGA 2VHVA 3R9KA 1SVLA 4UDOA 2I3DA 1FDOA 2PO5A 5DPMA 4OHKA 4DXAA 1IBLB 2BWJA 1KU0A 3W6OA 2XRFA 1ZGAA 3PG5A 2X6QA 3N2NA 2BCJQ 1EZZA 2PT7A 2VJPA 4ZOLB 1N7IA 1F14A 4K9QA 3T0FA 4JU9A 2K87A 1OU0A 4JGGA 3O6VA 4RE5A 3UWKA 1JLHA 2F3TA 1K7YA 2ODEA 1CR1A 4W5QA 3ITDA 1R0LA 1HFJA 2HM7A 1XZHA 4F3KA 3CBQA 1V11B 2WU0A 2F67A 1FP2A 1Z2OX 2QRQA 3A9TA 3MJFA 3SZGA 2BUCA 2ST1A 1CUUA 1OBFO 1KMCA 1UQUA 1XCGB 2EFJA 3CUWA 1FP4B 2VJCA 3RR2A 5JFOA 1TE2A 2EEPA 3BUSA 1OR8A 4QOFA 5E9QA 4LISA 1Y4UA 4NV1A 1SC6A 3D5QA 4JBWA 5B55A 3OJOA 5AW4A 4AZWA 4EA9A 1P2UA 1NRIA 5TDHA 1W44A 4FDUA 4FYYA 4YDSA 5K8CA 4R54A 1WJGA 3FZGA 1ES9A 3B3FA 4H7KA 4QYTA 5TQVA 3DE0X 1MJGA 4PFSA 3SIWA 4AY3A 2AVDA 5BUQA 3ZK8A 1DAHA 5J2TA 5KX5B 4MWSA 1YB5A 1MB3A 3G59A 3GT3A 5ALTA 2R8ZA 1R5BA 2OXRA 2RC5A 3C1UA 4B32A 2TYSB 3JQQA 1CWUA 1NFQA 4JBNA 4MVJG 5JAOA 3ETHA 1AZLA 3UJDA 4E15A 2Q99A 4NJEB 4BMSA 1NULA 3VC7A 3IQWA 4I5FA 3N58A 3NT5A 4DIDA 1VE9A 4N76A 1GYRA 1OYYA 1D2RA 1TCBA 4ER5A 3BWBA 4HCJA 5IJ9A 3CINA 2XLCA 1E0KA 1RCTE 2C59A 3Q8XB 1I5OA 1IJBA 4F8YA 5BSKA 1TXGA 3OOWA 5C4GB 2PZFA 3U7RA 1P2VA 4TSFA 4LF8B 4D0RA 3BORA 4FYJA 2OUKA 3DE3X 2JAHA 3PGVA 3W8FA 2NW6A 4WNAA 5C34B 3TVDA 3WXBA 3CUEF 2AMJA 1KK0A 3WLFA 1U04A 1V39A 5F3RA 2FK7A 2XUDA 3D7NA 5E95A 3PEFA 2ZZMA 4R8SA 4BRWA 4Z3OA 1Z4JA 4JKIA 4JIMA 1EZ1A 2ORED 3CJTA 3NBQA 4PLVA 5BW4A 2FQ1A 3DLCA 3KOYA 4WCVA 4C0JA 2YHIA 4Z0NA 4UNNA 3PR1A 2ZXFA 3H2BA 5DWDA 1M1ZA 3R7WB 3UHPA 1IJEA 1S3FA 3BXZA 4P8RA 5CBKA 2XWBF 3K35A 2OV6A 5TEWA 3A9VA 1EGMB 2QX8A 1X9HA 3QU9A 4LWOA 3MCWA 2W7TA 4JR1A 3RRBA 1J8MF 1GL3A 2Q5LA 4RUKA 3WQQA 5AXBA 3WWZA 4DDUA 3KWFA 2WFLB 2JGRA 4FHEA 1VE1A 5DXJA 5CJ2A 1C3OB 5K8UA 3AFIA 1B74A 1XKLA 3N74A 3UT5B 1ZNXA 1FFHA 2H08A 3MINA 4G0VA 1YS2X 1NV8A 4Z9XA 4C3VA 5B6JA 3UFXA 1X1TA 1JIJA 4RJJA 4D74A 3NHWA 4BQEA 5J4LA 4IQGA 3O4RA 4OXNA 4KYTA 4EW6A 3D3KA 1KO8A 1OFVA 2XGMA 1L6RA 4HTAA 3NAQA 1Y5LA 4C4ZA 1OFUA 3WGHA 4IJKA 5FRDA 1Z4IA 1DI0A 2Z4RA 4ZXPA 5EJEA 3ROGA 4EHDA 3SX2A 4Z4QA 1I30A 3GLIA 3GY0A 3MGKA 4IL5A 3AM1A 2Q50A 2QUZA 2ID7A 3GW8A 3HU5A 4J0QA 3M1LA 5K99A 2ID9A 3SZOA 2ZUTA 1I13A 4HPWA 1IN4A 1HTBA 1R6VA 2AHOA 1SVIA 3L84A 3LKBA 3N2KA 1WTCA 4P4GA 4YRFA 4CKBB 3GIDA 1WKBA 2ZIWB 4QJBA 3SVTA 3G2HA 4Q1EA 4ENTA 3RYTC 1UINA 1IHDA 1E9CA 3F8SA 1MG0A 2D3TA 1JG3A 2BP7B 4LJLA 2Z6QA 2PKWA 3KZXA 4RK5A 2EKPA 5K8VA 3C7TA 4JCCA 4DDMA 5CCBA 4BVFA 1W8DA 1FFGA 3DSRA 2WJHA 4PAQA 5JE8A 1SC3A 3IALA 1JYEA 1W9HA 1OWMA 2OHVA 4IRXA 4MW0A 3WGQA 3WS7A 4AQDA 1Z0UA 5EJAA 1AZSC 3ZIUA 2GFHA 3ONNA 2REQA 1TZJA 4I36A 1STOA 5IN5A 3VV3A 1ZNQO 1BQEA 2OECA 5GP1A 4H60A 3DEFA 3LT1A 5CD1A 2BFFA 4JC8A 1D2AA 4GP9A 4EKEA 3N7TA 2Z3ZA 2SKEA 4GR9A 3FY4A 4DV4B 3FDZB 3EXIB 4IXDA 1C0EA 1GZ3A 2VJMB 2ZDGA 2QGFA 2YJ3A 1SHKA 2IY8A 1NVFA 3O1IC 5ENZA 1OZGA 5B6IA 2V8BA 2IV7A 1RJ9A 2J46A 1V41E 2I2BA 4MXDA 4NAHA 3E7PA 5FR2A 3NTVA 1EP1B 1OFIA 4OGKA 1C1DB 1J33A 1ECGA 2Q4TA 4Q37A 2OZLB 4DNQA 4ER0A 5JPDA 1UFOA 2ZE5A 3AHDA 1BX1A 1EX9A 1J56A 1RJFA 2O2IA 4H1VA 2W6CX 1YAHA 1RHRA 3I32A 4KN6A 2A35A 4HDOB 1SXJC 4OHXA 4Z86A 4IQ8A 2Z2XA 4UUNA 2HPVA 4NENB 4EHJA 3EXFA 2BBSA 3GFQA 4Z54A 5CA1F 3FUUA 2FFRA 5BVHB 2W11A 1JZSA 2NVBA 1DELA 4LWQA 1QAQA 1W35A 2FETA 3DH0A 3NHRA 4PO3X 3V8EA 3VH2A 1T91A 3QSGA 2JFPA 1I1NA 5FAXA 4D9KA 3WJ1A 1X3SA 2LIVA 3OO1A 1OUMA 4OQFA 4DM3A 3N5CA 4TSRA 3QENA 2HWWA 2HJ9A 1ZN9A 4PHHA 5B7GA 1SCQA 1PVVA 2AFIA 3WKBA 4BO0A 1DO2A 1T8SA 4Z8YA 3S28A 3V8NA 1C0PA 2P9ZA 5CPBA 5CT9A 4BEWA 1JEQB 5EP3A 5HEKA 1MRSA 4MQFB 3OPYA 3V7WA 4EGCB 5LB2A 3O8CA 3KETA 4C0HA 1Y82A 4L4XA 5ILQA 3A1SA 1LCIA 1NMSA 2UZ4A 2PSSA 1J90A 2B82A 3JVDA 5DT2A 1TJNA 2XMSA 2OOSA 4R8RA 1UP7A 1VRWA 2WIBA 3BF7A 3IP1A 5BVGA 3SDBA 4RTRA 1N8TA 2XB2A 1DPFA 3OE1A 1FYDA 2XVZA 3E27A 2VDPB 2YASA 4YCCA 4NE9A 1RRCA 1DKLA 3O2SB 2VI5A 3OX3A 4BYGA 1ISMA 2C4VA 4K0RA 3LKVA 3NEPX 1TQ4A 3EQZA 4A8PA 5J4KA 5HDQA 1V16B 3K9BA 3C8ZA 4F1KA 3EQ9A 2D06A 3OZ7A 4MI1A 2QN2A 3IAXA 3CM0A 4U9UA 2PZLA 1SUIA 2VRCA 1QKJA 3QFSA 1X0VA 4QYWA 1YR9A 2O2GA 2RBGA 5GVRA 1CS0A 1GZUA 3FVTA 3QPBA 3M4JA 1W75A 5F9MA 4WMLA 2WQ7A 1CXZA 4CKWB 1NL3A 2V6FA 3ZU3A 5EXPA 5B4UA 1MORA 2WE7A 1AU9A 1MLDA 3IOYA 4HJRA 3TS1A 9ABPA 1KYQA 521PA 2OV2A 4ZT4A 2GEFA 2NV6A 2Z4TA 1GIAA 4KWCA 2BTOA 1Y5IA 1C2TA 5KC8A 2Y76A 4CM4B 5LDHA 1NN0A 4G0OA 1BOOA 1T2VA 3A06A 3ITEA 3F6SA 4N1AA 5CVEA 2YWGA 1NVVQ 2R1ZA 5FL3A 1LC0A 1YNOA 5D1NA 3PUXA 3EEFA 3RHTA 2AFHE 1U9JA 2PD6A 2PJUA 3Q11A 4LVCA 3IULA 1IWBB 4WZBE 2G5PA 2GFIA 3PF8A 2F3PA 4NYMQ 3U1TA 5EJFA 3WY9A 3D7KA 1RPAA 3HMQA 2BFBA 1ZLYA 2TMKA 4AI6A 3EQ7A 3HKCB 3DMFA 3ZWWA 1W0KA 2WU1A 3R5JA 1N0UA 5H83A 2AJLI 3NB0A 4URWR 2KJQA 3SXJA 1R0ZA 4C30A 3H2JA 1Y0BA 5GONF 1N6KA 2ACEA 4IEEA 4H6XA 3RIMA 3ZBUA 5AIBA 1CDZA 5I51A 4AUNA 1M74A 1G8MA 1U7TA 1YQWA 2FW6A 2WI8A 3JATA 4L5YA 4RKWA 3LC7O 5ALZA 1GTMA 1IYZA 1O7JA 1IB0A 3EFOB 3CCFA 2IX3A 4IFTA 4TTSA 2CSUA 2JLYA 4NBNA 1W9MA 4RK1A 4RYDA 5EXSA 1A88A 3HLKA 1QO9A 2IPMA 3FR7A 3MBKA 4NOKA 3FI9A 1XZBA 3SC3A 4O1IA 3ZW7A 3UATA 4AN1A 4E51A 4PYJA 4MV6A 1SMKA 1GKYA 2BHTA 1Y6GA 3H13A 5HBGA 4CN8A 5K0ZA 1EM8B 2HOQA 4DCPA 4BVGA 2X2OA 2VTBB 1RI2A 4BX9A 1PEDA 2W9XA 4GXTA 4EO4A 1J2YA 4ZMRA 2H3EA 5ESWA 5JPIA 2L0XA 4UKDA 1Q77A 1YR3A 2JFWA 3RYCB 1GAQA 3NYWA 3DVLA 5TQ2B 4FEGA 2YINC 4HB2A 2GPAA 5CNMA 1K2WA 2ATCA 3DQQA 3H65A 4XM2A 3UO8B 1P75A 1SHJA 1PW7A 2HWKA 2ZPUA 4XVUA 1DJMA 4YUYA 2OFXA 1LX7A 2OCGA 2ZUCA 1Y7TA 5GY7A 5I8PA 2V74B 5LLDA 4B4DA 1FYVA 5IBPA 2IXFA 5EKXA 2XUAA 2XYVA 2HUPA 1YZFA 1JTFA 3L7KA 4EY4A 1OHHD 3ANLA 4R6XA 1EFRD 3B6KA 1T4CB 3BX1A 5EGNA 2HRCA 1R00A 3TXAA 1MC4A 1WSAA 4G0NA 2V0NA 2W70A 3DKPA 1W25A 2Q2QA 2QR2A 3LPCA 4H7IA 2XCRB 1RM0A 3HFRA 1C9NA 2QQ5A 3D6FA 4GHWA 3SX0A 3T3OA 4KXWA 5EXEA 2AN1A 3JALA 1KI2A 2HQ1A 1V5EA 4QXQA 4DMGA 5D8DA 4XWOA 5CR9A 2AVNA 2AWNA 1NOKA 1T0IA 4ROTA 1NBIA 2QN8A 2GA8A 4UVGA 1ZUNA 1P4JA 1H1TA 5LPNA 1V9LA 2HEGA 3INYA 2JAUA 2PWPA 4YAGA 3MTJA 5GZ3A 1GR0A 2PUVA 2PXCA 2DC1A 3GHYA 3IXQA 1FVOA 4IMPA 4L8WB 3PNLA 1NVEA 4O25A 3QNMA 4XWYA 3HK2A 5EFOA 2OBLA 1CY8A 3HU2A 2OLKA 3S2UA 1DKQA 2PEYA 3E9EA 4BGDA 1E5DA 5K3AA 4IG9A 4NQRA 4AJJA 2DBZA 2QRJA 5BNTA 1U63A 2FAXA 2PUTA 2PSHA 3GOHA 1OIWA 1RPNA 4DQKA 3A1TA 1K8QA 3EVCA 4DC1A 2YYYA 2BFMA 1Z0SA 2PJDA 1F6DA 2XSZA 4HGNA 4KKVA 2CUKA 3H4VA 5FQNA 3TQSA 4EPXA 4UD2A 4F7WA 2HIMA 5LA6F 4GZMA 5CT6A 5K0EA 3Q9NA 1P3JA 4IWXA 2IWRA 3RIEA 4YQFA 4RJIA 2Q6LA 3A1UA 1A7KA 5I47A 4FMBB 1TCUA 1E5TA 5BNIA 3PFGA 4ZJYA 4IXWA 2OENG 5DM60 1WETA 3PXAA 4GPZA 5G1OA 1B16A 4D9FA 4ZT5A 2P27A 3TR5A 1P72A 5AK4A 3ZS9A 5HF6A 3KYBA 3HVJA 2ATXA 3BG5A 3DLPX 1XTIA 3WRWA 2RGUA 1QF6A 1W5SA 4LXHA 3NYQA 2JFOA 4H59A 4G4JA 1DCFA 4MNTA 4X1KB 4BNZA 1HL3A 2AUNA 1F51E 1LF0A 4G9GA 2GEDA 4X85A 1SH7A 2A7XA 2XTJA 2DBVO 2F48A 5L7WA 1E2PA 3CSDA 5IJXA 3QQPA 3URMA 4DIMA 1FSGA 2OPBA 2X15A 3UF0A 4YCSA 2YV2A 1E0SA 1JAHA 1XZFA 4K2AA 1ZONA 4OKSA 4PO8A 2Q3LA 2QX9A 2YIDA 2XLBA 3KLOA 4HVTA 2ANBA 5BSVA 2GBLA 1GSHA 5CDHA 1YTUA 3X1KA 1Z62A 2JBAB 2X3YA 3I58A 1FX0B 5TS2A 4I1PA 5I7RA 2A0YA 3PNKA 1JQJC 3VPFA 1JVNA 2HA4A 2HRRA 3DEZA 4TQ9A 3KT3A 2DQKA 3BMNA 2C2XA 4AKEA 4M9XA 4Y1RB 1FRFS 1YR8A 1U8TA 2XGGA 1XN4A 4L0QA 4UAGA 3OSZA 4RHCA 3WL6A 4ZJUA 3EEOA 4CEHB 4EHNA 1TYCA 4PPQA 4QYMA 1H9CA 1E9FA 3E9NA 4EPYA 5HP4A 1DC7A 3UOAB 2NVWA 3EG5A 1L5LA 3IPXA 3TSZA 4ERNA 3RRNA 1ZITA 5LJIA 4AB1A 4L50A 5H5JA 4Y7CA 5SY4A 1ZBQA 5J1SB 3RO7A 4UEWA 4INAA 5L3RA 1N4AA 3N07A 4EB8A 4AYTA 1BMFD 3R5XA 4FCCA 3OT1A 4R9NA 1U2GA 3ZDXB 3QVXA 4RY2A 1G5TA 1DBIA 1I7SB 5BSUA 2CFSA 4YUZA 5C1DA 1KOJA 3FPEA 1WQ4A 3C7DB 4CUZA 5C32A 3OCJA 1T2EA 1NPTO 1S4MA 3L7DA 1YRLA 2FSFA 3HU1A 2CNOA 2WJ3A 3AJ9A 3ILVA 4FHFA 4ZAVA 1EX6A 5FO0A 1DIGA 3TLZA 3WDSA 4BOYA 4LPSA 2VDRB 2YWJA 4JBLA 4MIKA 1I3NA 1LDNA 3BPSA 2OFFA 4RIHA 4DPKA 4ZT6A 1QGDA 2FZVA 1AKTA 4QUIA 1J2TA 1H05A 2AA3A 3Q6NA 3NHMA 2VTVA 3P1JA 1FP6A 1EVZA 2XNDA 4DWVA 5KQLA 3CX4A 3N2GA 3NBZC 5KREA 5A3JA 2J4FA 4WJZA 3JVEA 4L8LA 4XIFA 3TSWA 1Y3AA 1GGHA 3IEVA 1SELA 3HZRA 2FFAA 1SVKA 1VL2A 3LZ6A 4M0LA 2B3DA 2Z4SA 4Q9DA 4CXMA 5ER9A 3AUUA 3WNZA 1O54A 1ZOIA 2O54A 1E6LA 3F96A 3DE2X 2XXAA 3DTVD 3OUTA 4PBTA 1DADA 1O0SA 4E4RA 3WKEA 5ECWA 2VUUA 5DBIA 4BGVA 2X9QA 4ENVA 2LCIA 1B00A 1HDZA 4JELA 3L8CA 2VJAA 1MU0A 2XE8A 1PJLA 4RK6A 4AX4A 2QVLA 4QDUA 1PV4A 1DUSA 1VBMA 3H18A 3OFSA 3WLAA 3ZHTA 4IAOA 4OTZA 4DRZA 1ZKDA 3HXOA 1HDOA 4CCYB 4JS0A 1QMGA 1G3MA 3D8TA 2IZ7A 5CNIA 4Q05A 3FIUA 1WTAA 1AGPA 3ROKA 1CFZA 2RAFA 3IVXA 4MEAA 2NUAB 1S9HA 3JAWB 4GVLA 3NC4A 3Q4GA 4NCNA 2YWCA 4TLAA 1JKIA 1GADO 2X7XA 3CEJA 4FI3F 4LVOA 4RH0A 1OXXK 3LF1A 4GRAA 1CRLA 5H7XA 1V8DA 2J3QA 3BICA 4ND5A 3UMSA 3ZHOA 2J85A 4EFKA 5KNBD 1Z25A 4ZD6A 3DVQX 1YB4A 2ZE8A 3LW8A 4FX2A 4UVIA 4QGSA 1OMOA 3UMYA 3KRTA 4K6KA 3TI7A 1KI6A 2RGBA 1TFUA 5HUJA 3KTFA 1RRMA 1NBOA 2QUAA 4XCXA 5MN5A 4JGIA 3DUFA 4PC1A 4ZI5A 1XCPA 1Z07A 1E6CA 4PZ0A 1A96A 1G5QA 4QHYA 1O2DA 5KCMA 3SNKA 3BA6A 4O4LB 4BIIA 2UV8A 5KQRA 1JYSA 3AR2A 2FPPA 2YOFA 2R7LA 2Q5CA 5CG1A 4D43A 2YVQA 3Q5EA 1E62A 4ZCSA 1E1NA 3OWOA 7GPBA 4BGEA 2NO9A 3T3GA 5AVQA 4K6HA 1M5UA 2O0KA 2D3WA 5JD4A 1UPTA 1OFTA 3K1ZA 4KDFA 3BFJA 5CHEA 3WZMA 3BIFA 4EG7A 1U3FA 4EZBA 6YASA 3OQMA 1IHXA 3GZJA 4JUIA 3C48A 5B7QA 5ULLA 1R6AA 4FDLA 4MUAA 1A5AB 1P4AA 5IUNC 1NBEA 1UBCA 2FMKA 2FHSA 1TYDE 2D59A 5LZ5A 4CNBA 2W6OA 1EVYA 3OZRA 4IV5A 3SZ3A 4MR7B 4S2EA 5JAPA 5ALLA 1KVUA 4RZUA 3L46A 2IGTA 1U65A 3W90A 1PFVA 1YB1A 2C2OA 1GTJ1 3IERA 3EQ2A 4L57A 1JHOA 4QOSA 3SM9A 3ZPXA 4XLTA 2PKCA 2POCA 5F98A 1RRGA 2FWRA 2PTHA 1F8XA 3B9PA 3FRIA 3MT9A 4LBWA 1DKUA 4OB7A 2IUTA 3BM5A 1UWVA 3DD5A 4PTYA 5AHXA 3VC3A 5AJWA 1FVXA 5L4SA 1UBTS 2C5FA 3WIDA 3CRZA 4MCJA 4L5IA 4M9ZA 2IEIA 2XE6A 4Q3KA 4R7TA 4S1WA 4XPIA 1X7XA 4ZVSA 3HRIA 5JW6A 4H4CA 4DCVA 3K9FC 1CP3A 4ZOQI 3PV0A 4HWPA 3ACCA 1QV6A 1WPGA 3BZUA 5K9ZA 1T2CA 1CZHA 2QRGA 4CG1A 1WM1A 1CRPA 4TGLA 3HBAA 3K20A 3AEKB 3KAJA 4DW8A 4LXQA 1R7RA 2Q0HA 3E5HA 2OQ2A 1KP3A 4LHSA 4YREA 1YSCA 3ECAA 3GA7A 3LUBA 3Q7QA 4JLMA 3OQBA 1H66A 4LOAA 2AW5A 1LV7A 3FWPA 4Q66C 5AVJA 1YL6A 1NR7A 3RU2A 5LQNA 1HZZC 5AXCA 3AIIA 3NGXA 4J16C 2X23A 1D1SA 4YMLA 1Y4DE 4FBLA 1L7MA 3TOVA 4KR6A 3NLLA 3AM5A 4GC9A 4K8OA 1G8HA 4LWZA 5FFNA 4Z49A 5CDYA 4LJYA 2CV1A 3FLBA 3COWA 4FDAA 1SEPA 1YA8A 4GKBA 4HTFA 1Z0JA 2H4ZA 3RS2A 1I0IA 1VJRA 2NLOA 1CF2O 1ZCAA 3HVHA 4P7FA 3T34A 4UCWA 1ETUA 4CIBA 2G40A 2QAGB 4RSGA 3VR4A 4NNOA 4Q9IA 3P9IA 3NKLA 5LMCA 4DDHA 5CDFE 5K6AC 4N82A 1T3TA 1Y8ZA 3JWJA 3DEIA 3CPEA 3F9IA 1QGUB 2IU0A 1OBOA 3ET5A 1GN9A 3GUZA 4HR7A 2EFDB 4YWJA 4YROA 3BC1A 2B1RA 4BKOA 4MZDA 5JDIC 3FLMA 4UVEA 3WV5A 3P9YA 2EQ5A 4KFCA 3QKWA 2YRXA 4HWTA 4I99A 4RE6A 2QRKA 1TYZA 1EQAA 3V2IA 1EFLA 2QM0A 4I19A 1E2EA 3CZRA 4I9NA 1W0KD 2I0FA 2Z5GA 2WZDA 3P52A 4Q1AA 4JXXA 5CH5A 2X22A 2H2AA 4BBPA 1YCFA 1LSUA 3O0TA 3PNQA 1MAWA 4JI7B 4M86A 1YC2A 2FXIA 3UJAA 1YQXA 1X2EA 3H5IA 4YJ2A 2H85A 3CKYA 1AUXA 1EWYA 1UXOA 3WWEA 4L07A 1ACLA 4WBNA 1G9TA 3SE0A 3T4PA 2N1MA 4R3WA 3WDKA 1J1ZA 1XJCA 1WDMA 5BYJA 1MDBA 4PPNA 4BNHA 4YUAA 1A5SB 3CWZA 3E1SA 2JI8A 5KVCA 4UU1A 2F4VB 4ZDIA 4R1MA 2OT3B 3K92A 1DWUA 1W34A 4YVFA 1L7NA 4K6FA 1ZK4A 3MEQA 2DE0X 4XIIA 3QYPA 4OMDA 2QJWA 3LDHA 3KVOA 3TE6A 2DFPA 4QECA 3URKA 4YAIA 4E11A 8ADHA 2PPVA 3CY6A 3VMMA 2QL7A 4OV6B 3GB9A 2G1PA 1J2RA 3OE5A 3QFHA 4AKSA 1U0NA 1P5JA 1MJ5A 1UDXA 1JFRA 2GCEA 1XALA 2PLRA 4H0CA 2PAAA 5DX0A