5LB4A

Apo-structure of humanised rada-mutant humrada14
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
229
structure length
211
Chain Sequence
TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSAMYIDTENTFRPERIREIAQNRGLDPDEVLKHIAYARAFNSNHQMQLLYQASAMMVESLNTDRPYKLLIVDSLTSHFRSEYAERQQKLARFLAMLHRLANEFDIAVFVTNQATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DNA repair and recombination protein RadA
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
total genus 74
structure length 211
sequence length 229
ec nomenclature
pdb deposition date 2016-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5lb4A00
1WB9A 2PEZA 3R8FA 4ZIRA 2IHBA 1NLZA 2P0EA 3FPAA 4PSAA 5E7JA 4D26A 4XOIA 1OFIA 3CPEA 2KE5A 2ZJ2A 4EPXA 4TN1A 2AK2A 2VHUA 621PA 1Z0FA 5AJYA 2RB4A 2CNWD 3MLEA 1GKIA 1MO6A 1T0HB 2YHSA 2O8FB 1B23P 3GD7A 3N2EA 4WXRA 2NPFA 3CX8A 3TVDA 3AKCA 4QRHA 3NWJA 2OG2A 4DWJA 3LDAA 1E94E 4FCVA 1Q3HA 2R8RA 3K0AB 3Q9LA 5EE1A 1P9RA 4DJTA 3QKRA 4DLSA 4EIWA 2ZI3A 4EQ6A 1J70A 3EZ7A 4P33A 1YRAA 1XXHA 3WYAA 4LJYA 3LX8A 2J5XA 4OI2A 4M1SA 1EWQA 3Q85A 1KDTA 3W8NA 2BBWA 4I4LA 3DEFA 1KI9A 2ZVPX 4ZCMA 1WE2A 4CVNA 1P2SA 1S9DA 4CDGA 1QHHA 1XJCA 5L3VA 1G6OA 2J7PA 3ZVRA 3ZIAA 3G82C 1KAOA 2PL3A 3SQWA 4TMTA 3WNCA 1E1QD 4EDHA 2CXXA 3WBJA 4DLZA 2ATXA 5FPKA 3QBVA 3VNUA 3QUSA 2P65A 4HLUC 1M7BA 4Q4HB 2J59A 4J0QA 1N5JA 3CR8A 1JR3A 1H8EA 2BM1A 4NL4H 4HSEA 4TL9A 1U94A 4R2IA 1H8HA 3OEED 2ANCA 1VECA 2PCLA 2X77A 1X8JA 2NO1A 3KL4A 2JEOA 2CMKA 2XJ9A 1G3RA 1VCIA 4LC0A 2PMKA 2G1JA 1DAHA 1ZM3A 4BRUA 3THWB 1DAMA 1YU9A 3AP2A 3FGNA 1Z29A 1G64A 4B73A 1XD8A 3P27A 3OZXA 1SKQA 2IC5A 3AM1A 3K9GA 1Z2AA 4GOKA 4EPRA 2BMDA 4NH0A 5DI3A 1KK2A 4W5JA 3GLIA 3WRXC 2IS6A 5FPSA 3V9PA 1YR9A 1K5DA 3SI7A 4TL6A 3T1VA 2DWPA 3SJAA 5FOWA 4FCTA 4CEJB 2ZU0C 2WJHA 4MGYR 4Q4AB 2GEUA 3W90A 2B8TA 1AKEA 4XVUA 1P4SA 5JHHB 1LVGA 1YZNA 3FHTA 2IYWA 2QZ4A 4YDHB 1E0KA 4ZI2A 4IOKA 4MGIR 5DLQC 3I3SR 4P32A 3BFXA 3CIOA 1GL7A 3BC1A 1KSJA 1DTSA 2FV8A 5L3SA 2Q21A 2FEOA 2HT1A 2JJ8A 1WMSA 1XP8A 3X1WA 1KKMA 1OH6A 4U02A 5A0FA 1SHKA 1E69A 4URYR 2BIFA 2C96A 5TXGA 5BN3A 3TR0A 3SYLA 5CB8A 1G17A 4UKDA 2KSQA 1UJ2A 2Q9BA 3FFAA 2ZRFA 2G77B 2QSZA 3TJZA 3TW8B 4W5HA 1KO1A 4XD7D 1EFUA 1SQ5A 5CYPA 2ZPTX 4B2LA 1ZRHA 1P5ZB 2WICA 4DLWA 5JRZA 4TQ9A 1XMVA 2PBRA 4ARZB 2DFNA 4B48A 4BPBA 3A1WA 3EAQA 4PANA 1RVDA 4GI7A 4R9UC 1XEXB 2DWOA 5FTKA 2YINC 4DRZA 4MQBA 2PH1A 4HYYA 2QP3A 3PUYA 4QHYA 1P9WA 2ZSFA 4LZZA 1MRNA 3PXGA 1LS1A 2QAJA 4BZPA 5LD2B 4Q7KA 1CEEA 2HJVA 4GMDA 2A9KA 4JYBA 2ZRGA 5FOUA 2WJYA 2XTZA 2DWQA 4OBEA 1Q22A 3NVAA 3HPQA 4BASA 2WAXA 4DT1B 1YZGA 4N3NA 2KI5A 1F2UB 2D3WA 3L8YA 4RZ3A 3KUDA 5CJ2A 3BD9A 4LYJA 1NSFA 5F3WB 1F2TA 2ZSAA 3T15A 5P21A 1TF7A 2OV2A 1E96A 5GJWC 1L7VC 4ESVA 2JLSA 5JRJA 1NKSA 4CT5A 2Q6TA 2Q3FA 1W1WA 4GNKA 3THYA 3A1UA 2AKAB 2CHQA 5HKKA 2B21A 2VP5A 1OYYA 5B30A 1ZAKA 2UZ3A 1AS0A 2RGNA 4KVAA 4KFRA 4BLRA 1UKYA 4DCVA 4B3CA 4MGKR 1X6VA 4BLSA 4TLCA 1G5PA 1P6XA 2IXEA 1EGAA 2YWGA 4AIIA 1GRRA 1TEXA 3M1IA 2CLCX 3R8CA 3TW4A 1KJWA 2OO7A 2WWHA 1BMFA 1NVWQ 2F3RA 4WXPA 3UWKA 4B34A 1GTVA 5J47A 1EFRD 1T5LA 1KDOA 1CJTC 3OEHA 2GTPA 4CF7A 1G18A 2OCAA 3DZ8A 1FQKA 4X8HA 4DSOA 4DLVA 1AGRA 2WMOB 1VYUA 5B2ZA 3DMDA 3EPKA 1BOFA 3WMFA 3BJIC 3TMKA 1II8B 3QKTA 3C15C 4L9WA 1G3UA 3LV8A 1KK3A 1P73A 1W0JD 5AJXA 3LO5A 4LYAA 2J0VA 3EIEA 2RGAA 4KI0A 4HZUB 2JLZA 1BKDR 1Q1BA 1V5WA 2XAUA 3B9PA 4R2HA 1HTWA 4M1KA 2GCOA 2W00A 2HYDA 1T3SA 4LJ9A 2OT3B 1JAHA 1TAGA 5CLLA 5FTLA 2NO9A 4FXPA 3KJHA 2JLRA 3CBQA 3AB3A 4DIDA 2XZLA 1RFLA 3NBXX 3S1AA 4MDFA 4AKHA 3GJ4A 2ZRLA 5JHGB 4JBYA 5JS7A 3RDPA 1NP6A 2W0SA 1T5IA 2WJIA 1F60A 2V9PA 1DBSA 3KQHA 1CR2A 4R98A 3K70B 1ZW6A 4KAXA 2ZRPA 4TMVA 2G0NA 3CF2A 3ND8A 2GEDA 2VSFA 3K0FA 4DEYA 1OPXA 2ZJAA 3PVSA 4TYQA 4OK3A 1T4GA 1Z6XA 2RKOA 3GFTA 3W5IA 4B44A 4DLRA 1ZUHA 1NVUQ 1ZUNB 4RJLA 3LQQA 1G16A 2FE4A 2VPPA 3NIBA 2AD5A 3UK6A 4AG6A 4MGZR 4HI0E 4ASUA 4A82A 2QUZA 5FL7A 5DGXA 2YNMA 4EFLA 1X8LA 2CVHA 3MWJA 4A2PA 5C1BA 3K70D 2PJZA 2RH5A 2A5FA 4D0LB 1U8YA 4LC1A 4IDQA 1P72A 1D9XA 1E1RA 3U3OA 3CKLA 4NDZA 2DFLA 1BYIA 5SZJA 2PMDA 1R10A 5G3ZA 1VPLA 4MDEA 4TZ6A 1HY3A 2JAQA 1PLJA 1VG1A 3OE7D 1SXJA 4N0EA 4BLQA 5FOTA 1XRJA 2ANBA 2G9NA 2V6JA 4F92B 3QG1A 2FA9A 2REBA 3OIVA 5FUXA 5KYKA 3K09A 1Z63A 3QXHA 4KO8A 4WW0A 1GM5A 2AHOA 3HPRA 1P75A 1Z3IX 2A5YB 1ZM2A 1K6MA 1KNXA 3CWZA 4KFSA 1NN0A 5FBLB 2P6NA 3V4FA 1NBMA 2W0MA 1XCGB 2ZE8A 1EG7A 3VFDA 2XSZD 3EARA 1E2QA 4O0MA 2H18A 4PSVA 1NNEA 1E2NA 4AD8A 4PPGA 2B8WA 1RE0A 2IYLD 2W2TA 3F5FA 5B58C 2FSGA 1OXTA 2NO6A 4XIGS 1JBKA 2JLUA 2ZI5A 4KYIB 2VSOA 2WAYA 1ZINA 2WOOA 1L4UA 2WPDA 2AN9A 3RVBA 1I2DA 1DAFA 1A7JA 1E4YA 1RYFA 2BJWA 2WIBA 3LAWA 5LPNA 4CGZA 5D3MB 2VF8A 4QJ4A 3REGA 2O8CA 1TUIA 3K9HA 1JQLB 3ZQ6A 2OBMA 5J40A 4IEIA 3C5CA 2IW3A 2OFOA 1RYHA 5KDDA 4PO1A 1MT0A 2OE2A 4JLDA 2HCJB 2CL7X 3VKGA 3GEHA 3P20A 2FPLA 1D2NA 2GXQA 2J3EA 3FKSD 4QC2A 2BKUA 2VRWA 1XCMA 3V00A 4C0AC 3ZVLA 3K0SA 2FX3A 3U3MA 5IK2D 4D2IA 1AKYA 2H5EA 3BBPA 3GJ7A 3AKDA 1N6PA 4P0TA 2REOA 3RAPR 3FE2A 1G21E 2ZR0A 3GLFE 4LWZA 5JCZA 1TF2A 3AVQA 3EWAA 2QMOA 4B3FX 1NIPA 4XTCS 2IUTA 2IEYA 3EZFA 4KHZA 4Q9IA 4NCIA 5CK5A 3H0KA 1CJUC 1UKVY 3JVVA 1Z6AA 1YZUA 2FSHA 3RS2A 3P32A 2GDJA 4KLZA 1N6IA 1SKYB 5BXQC 1ZNWA 2IK8A 4BFXA 1IXSB 4BFWA 3QQ5A 1PVOA 2IBMA 1VG9B 4FD2A 1CTQA 5HE8A 1W47A 4AI6A 2CL6X 1FNNA 2VBCA 1Z08A 1AM4D 5FI0B 5KTYA 2QENA 5HPYB 2QGNA 4PHHA 1E2FA 1FQJA 2WV9A 3AH8A 3B9QA 2IYTA 3QF4A 3IIMA 2J45A 1KZGB 4BUJA 2ORIA 1S1CA 2UVQA 3OFND 3EW9A 1BH2A 1ZIPA 3W3AA 5KNDA 3PFIA 4PQRA 4PQYA 3QPWA 1XMJA 2R6DA 3B5JA 4JLVA 3CW2A 3R7WB 3ADKA 4GP6A 2FNAA 2XX3A 5L3RA 3CRRA 4S35A 1RRPA 5ELXA 3K9LA 1G1MA 4H1VA 4JLOA 4LV6A 3TSZA 4OQMA 2ZREA 2ZRMA 4MRPA 1IXZA 2XNSA 2ZR7A 4JZKA 2WHXA 1E2GA 3L82B 2WWGA 1IAQA 2CNWA 3CF0A 2N46A 2FFAA 4RZUA 1EX6A 5JSZA 2O5VA 3MJHA 2VYFA 4OKSA 2EW1A 4F91B 3AV0B 2C2HA 1WBDA 1OB5A 2GVDC 2GF9A 4Q19A 3VR3A 2IYSA 1HEIA 1XWIA 3D6TB 4JL5A 1NMXA 1JR6A 2ONKA 3GJ0A 1AQUA 3GJXC 3MGCA 3THXA 3GEEA 4G5RA 3A8TA 4D0GA 3PIRA 1GDDA 4D4JA 4V0NA 4ACBA 4IDHA 2FGKA 1XTQA 2Q0HA 4OK5A 1FTSA 3NEYA 5TMPA 1OFHA 4WZAE 3FHCB 3NBFA 3U4QA 3N5CA 4US0R 5IHPA 2IYQA 2DHRA 5DIFA 2A5JA 1ELOA 4TT3D 2DR3A 1E1QA 1VCNA 4RFSB 5EZ6B 3DO6A 1DE0A 2FPKA 3FMFA 1SVIA 4MH0R 4NONA 1SHZA 1D6JA 3B6EA 3ICEA 2R44A 2OCYC 2ERYA 3Q5EA 4IVPA 3LLMA 2YWEA 2AL7A 3WY9A 1QHGA 3HR8A 3OEEA 2IWRA 3ADCA 2GBLC 3LQRA 2GJKA 2IS2A 2GJAA 1JXMA 3VTKA 2CDNA 3TUZC 1CJKC 1Y3AA 2JLYA 2AXNA 2EQBA 1KY2A 2GJ8A 4P3YA 1GWNA 1W0KD 2JLXA 3OIYA 2H17A 5TVKA 1FW6A 1E99A 5AUPB 3QSYA 3LVRE 5EXPA 4NYJR 3UATA 1E9EA 3VNVA 3LWNA 4QNMA 2G83A 2J7KA 1NN5A 4BWYA 4MUBA 5J4LA 4HEJA 1P3JA 4GT1A 4WVFA 2ZS7A 3L43A 3NH6A 2CCGA 2IA5A 3U44B 2BOVA 1Q1EA 1RKBA 1VYTA 5FPYA 5GVRA 1G8GA 2X1VA 2PZEA 3QPUA 2AK3A 4GBMA 2QU8A 2RHDA 2VH5R 2P6UA 3GLFB 2LWIA 1US8B 3QNUA 1QHSA 3T5GA 1Z6GA 1COWD 2GKSA 3IUYA 3THWA 4V0ME 3UMFA 4TYNA 3AGQA 2A78A 4NU0A 2A5DA 4EPVA 1G8YA 3CRW1 3E2IA 2Q3HA 1UKZA 4Z8YA 4Q1AA 3AVXA 1XZPA 2F1JA 3KKPA 4ERNA 1CLUA 4NYIQ 4OL0A 4Q47A 2QBYB 1KMHB 1Z28A 1MO4A 4CYMA 1Y63A 5LD2C 4XD7A 3BH6A 3QVVA 4OQNA 4OHWA 1P60A 4CEJA 1E9AA 4NP6A 1XPOA 2D7DA 2IEZA 4RVCA 1RC8A 4NYJQ 5B64A 4JSTA 3ZS8A 2V55B 2EVWX 1CIPA 2JJ1D 2GNOA 2QG6A 2Z4SA 3H1TA 1ZIOA 1GSIA 3K53A 3ECCA 2H7VA 1OSNA 1N0UA 5DYIA 4C0BA 3I5XA 4F4CA 4QBIA 1OW3B 5CLQA 1ESNA 2ODEA 4ABYA 4RSGA 1D2EA 3X2SA 2YZ2A 4UNQA 1MRSA 1OT3A 2OLJA 4KFTA 2F1IA 3DM5A 3PG5A 3Q7QA 1OIXA 1R5BA 3B82A 4B3XA 1CBUA 2VHQA 1VKJA 4M1MA 3VR2A 4CRWB 5BQ5A 3C5HA 4AKGA 4HUQB 1W44A 4AYXA 3QVUA 4A0HA 2YOGA 1F48A 2C9YA 4IRUB 4TYPA 4EKDA 1KZ7B 5FOSA 4D0NA 4PR0A 4X8LA 4ARZA 2DY1A 4I1SA 2EYQA 3AF1A 1I4DD 1XEXA 1ZD9A 3FHOA 3KKMA 3U6KA 2OAP1 1G6HA 3SEAA 4EPWA 3B2EA 2RHMA 1P7CA 4FIDA 5TB5A 3KQKA 1SVMA 3H86A 2AFHE 4KSBA 4IOJA 4M0LA 4PZLA 2CE2X 4LYFA 4Q7JB 4OHZA 2C9OA 4B71A 1XEWY 3GLHB 2QQ0A 4OYHA 2Z4RA 1AZSC 2GVZC 3BE4A 1E0AA 1FMLA 4TSFD 1OH8A 2ZI4A 1IM2A 4NCKA 4DT1A 4HAVA 3PCRB 4A15A 3NXSA 4KVGA 1R0WA 1VCOA 3MUFA 4US1R 2GZDA 3A58B 1GZSA 2C5LA 4MRNA 1EFRA 2KJQA 5LB4A 1A82A 1II0A 4ZKDA 1RIFA 1T8TA 2EWWA 4C0QC 2ASEA 2QRNA 1X1RA 2XJ4A 2IUSA 2VP0A 4OHVA 2BDTA 3A6PC 2VHJA 4UXJA 1OV4A 2W2VA 1W0JA 2YVUA 1JI0A 2HF9A 1E0JA 1XEFA 3K70C 5EE5B 2FSIA 2J87A 2FU5C 4DB2A 2V7QD 2CCKA 4CEIB 4B6EA 3QKSB 3MMPA 1N6LA 1XZQA 2QGZA 2WJVA 4TMKA 4C0HA 2QM7A 2OLKA 2C78A 5HCIA 4UNRA 1HE1C 4JVMA 2NIPA 1O3YA 4JL6A 3VAAA 1XTRA 5KHOC 4TYYA 2QQEA 4HAXA 5K8TA 2IS1A 4Q9KA 3WHLA 5F9FA 3DKVA 4TQAA 4PFSA 4ZDJA 1N3BA 1AS2A 4C7OA 1XXHE 4M21A 2K5UA 4BGDA 2F3TA 1UAAA 3SHWA 3FKQA 3HYRA 1NN3A 1II8A 4JT4A 4D81A 2JA1A 4U5XA 3QF7A 1ZP6A 1E9DA 1R2QA 2FG5A 3C4JA 3EZ6A 4CEHB 4HZUA 4MKIA 3CPHA 2O52A 1T3LA 2Z6VA 4DSNA 4TTQA 5EXSA 3MCAA 4BQSA 3FVQA 2XNDD 4NCHA 3LBIA 3O8DA 4BEJA 3U7HB 4M9ZA 1JR3E 1E9SA 4C2UA 1FX0B 4M1OA 1UDWA 2F1RA 1S1MA 3OESA 3LBHA 2X8AA 4NMMA 4DSUA 1TQDA 2ZVQX 3SE0A 5FR2A 3RC8A 4QKQA 4W5WA 5CIQA 2W83A 4V0KA 4MRRA 1OF1A 4PX9A 2QTVB 1M74A 4P4SA 3UG6A 2ZR9A 2PT5A 1Q21A 4H1UA 3H2YA 3B78A 1BYUA 4Q21A 5FFMA 1NN1A 3K0CC 3KJGA 2MSEB 1G8PA 3AUXA 2QA5A 5C4GB 2RAPA 2DFTA 3GLIE 1PV4A 3U7GA 1ZM7A 5EE3A 2YOFA 4RD6A 5FL3A 3OE7A 4LRWA 2EU8A 1MR3F 1X3SA 1E2LA 2AD1A 3LA6A 1WRBA 3GMTA 3KQNA 2QL6A 4Q03A 4IDOA 4HLUA 3SOPA 4E07A 3I5YA 4ZO4A 3KKQA 1DEKA 4HB2A 1E2KA 2AWOA 1QZXA 2XSZA 4O3MA 1M1YE 1TQ6A 2JJ2D 3AF4A 4LDJA 4DEXA 4YMVA 2C8VA 2GZAA 1KI6B 4JVLA 1CR4A 1I2MA 3KB2A 3I8SA 3W34A 2AXPA 3TRFA 5JI3E 1NG1A 1PUIA 4MA4A 3RS7A 3QPVA 3CWQA 3O47A 5AWFC 5H8WA 5E3HA 2ZRKA 1CULC 1WDTA 3SQXA 1WF3A 1E9RA 1OFTA 1NMYA 4Q7MB 3ZZ0A 5JMTA 1N6HA 1ZD1A 2Z0MA 3B13B 3O8RA 1G20E 3I62A 4XWOA 3L0PA 5J4YA 4ZDWA 4QGFA 3LY5A 1GKYA 5GJCA 1HQCA 3NEJA 2JCSA 4MKFA 1XCPA 4OI0A 5H1YA 3A37A 4PO8A 1JECA 4W7SA 4G01B 2H92A 5KSZA 3FKSA 5BWMA 3Q72A 4DDUA 2ZU6A 4LJ6A 4ZKEA 5IK2A 2RGDA 4TQUS 3AF3A 3EG5A 2FDCA 2GAOA 2Y8EA 1OH5A 1JB1A 3GEIA 4TMWA 1UDXA 2ZRCA 1NF3A 2W6JD 1JNYA 1ZMXA 2NQ2C 4JVNA 5JBQA 3CF6R 4X8MA 2OBLA 1KO7A 2WKQA 3V4RA 2OXRA 2FMXA 5D3MA 1FNMA 2F55A 4JLJA 3GJ3A 1XD2A 2R6CA 1CR1A 1L8QA 5FUWA 4FWTA 4QM6A 4JLPA 3NDBB 2BMJA 1XNJA 1CU1A 2BM0A 4A8JB 3T5DA 3U2QA 3X1XA 1HA3A 5E95A 3IEVA 4UXHA 1Z47A 3FB4A 5JFGA 3U60B 3TBKA 3GLGA 4AWXA 3LNCA 5HE9A 1UKEA 3RRYA 5G40A 1ZVQA 4QGAA 4LX0A 2C9CA 4FINA 1VTKA 3QKRB 1RRCA 2GWHA 1PLLA 2H1LA 4RCYA 4EQ6B 2VHCA 1XD9A 2ZANA 4FI3C 4N0DA 4DUGD 3HJNA 1YZQA 1XXHB 3WNDA 2G1KA 1PLKA 3DVLA 1XDBA 2GXSA 2ZRNA 1SULA 2AR7A 4G5GA 4Q01A 4LJ8A 4IW3B 4RFVA 4AKIA 3L0SA 2A3RA 3OFNA 4PPQA 4BFYA 1QHHB 2HDNB 1L2TA 3BB3A 1EFHA 1P62B 3Q8XB 4PPNA 5D3QA 3ZH9B 3KTAB 1IOZA 2VHTA 3Q3JB 4LBWA 5FTNA 2NO0A 4PAOA 4C3ZA 3REFA 3FMIA 1RJ9A 3K9NA 2GJSA 5GADl 2PCJA 3CR7A 5B57C 5F2EA 1Z0AA 3P4YA 4WBSA 4QM7A 4IFEA 2L0XA 4CZ2A 1G19A 1QHYA 1CRQA 1XTKA 1ZC4A 2E1RA 3CRMA 1Q1QA 4DCSA 1RRGA 3LRPA 2ODNA 4YMSA 1P2UA 2G88A 2BJVA 2BKEA 2QPOA 3AVYA 2WWWA 1KO4A 3C14C 3SBDA 5CYOA 5EJEA 1W2HA 2ZAMA 2J9RA 3TKLA 4HDCA 1VIYA 4L9SA 5JJKA 421PA 3CRVA 4TL7A 1HT1E 4MRVA 3L0IB 2LKDA 1I4TD 1TTTA 3R7WA 1SVKA 4MKGA 2HLDD 1W4BA 3BGWA 3X1ZA 2O0HA 5AJVB 3DM9B 6Q21A 3GLIB 5KOYA 4LOAA 4M8NE 1GL6A 4Z54A 5KU1A 3FMPB 1YZTA 3O8CA 4D4KA 2P6RA 4GFDA 1DOAA 2IYVA 2J0UA 2QAGB 2VTKA 3NH9A 1J8YF 1OIWA 4DLTA 2JDID 2QI9C 2ZJYA 4MUAA 3WRYC 1KIMA 3PUXA 3IIJA 1PUJA 3Q7PA 1MKYA 1ZNXA 4TT3A 1FTNA 3I72A 5TV2A 3VHLB 4E22A 3SBEA 1OYWA 2C99A 3CO5A 1J99A 5CK4A 2CL0X 3NDPA 5L3SB 2ZRAA 2FPMA 3PITA 1ODFA 3FFBA 4Q00A 2CJWB 1S96A 2GK7A 3IHLA 5GJVC 3RWMB 4B3BA 4RKEA 3ICQB 2HCBA 1LS6A 4M2LA 5EXXA 3VR5A 1S9HA 3U7FB 3SS8A 1N5IA 2OZEA 3AVTA 2ODWA 2O8EB 4XH9B 3SFZA 4PPFA 1DAIA 4X8OA 1IXRC 4NZYA 1RPZA 4B47A 1Z22A 1W0KA 4HATA 2DCUA 3I32A 4YMUA 2VSXA 3Q5DA 1KMQA 1AJEA 1ZJ6A 2GETA 1SXJE 3M4YA 1Q44A 2XXAB 3U61B 3T1QA 3DPUA 3OF5A 4AC9A 4EJSB 3VU9B 1FPMA 2ODBA 3T61A 1NBME 3PUZA 2HJGA 4LBVA 3IPXA 4KCGA 5AR1A 2CEAA 1JALA 1XBTA 5F98A 2WKRA 1G7TA 4PC7A 4BFZA 3P26A 2TMKA 2QE7D 1MO5A 2FN4A 1WBBA 1OXVA 2CHVA 1ONBA 1COWA 2AFIE 2WOJA 1JPNA 3A4NA 2J41A 3T34A 4BFVA 5G3YA 4M22A 1S3SA 1LF5A 2R6GA 1P2VA 4E09A 1IHUA 2VF7A 2XB4A 3MWYW 3DOFA 1HURA 4Q1DA 1G4UR 2P5SA 3KFXA 4A6XA 2WWXA 5HTKA 4LI0A 3THYB 1W36B 4URWR 4BFSA 1DO2A 3BRWD 2YYZA 3BS4A 3AQ4A 4QXAA 1NJFA 3PENA 1HYQA 4LK2A 3RRZA 1QBKC 1XJ0A 1AA9A 3IKJA 3DZDA 3W8RA 1A5TA 2I1QA 3BOSA 3OAAD 1XJQA 1UM8A 2JJ1A 2F9MA 1LNZA 4UXIA 2F9LA 2CBZA 3EZ9A 3SJBA 4ZV4A 1Z5ZA 1PJRA 4YMTA 3BWDD 4RY2A 5LBIA 3CZQA 3TAHA 2EFEB 2QRZA 3QBTA 2NO7A 5DSZA 5TDHA 3LD9A 2A7QA 5CB6A 3AVUA 1S8FA 2BCGY 1KTVA 1H65A 3TVTA 4B3DA 2PX0A 1NLFA 1KO5A 3U3RA 3RS4A 2IXFA 3W6OA 2CK3D 2R9VA 1NVVR 3GJ8A 3AKYA 1W36D 5IDVA 3U7EB 2WJGA 121PA 2P3SA 3R9IA 2FJUA 2GJ9A 2X2EA 2ZAOA 3F8TA 4QHTA 1MABB 4B43A 3R9XA 3DL0A 3SYNA 5K8LA 2GCOB 1DG3A 2ORWA 1J7KA 2RGEA 1ZUIA 4PO9A 4MYHA 4QJ3A 4IVQA 4URUR 1SVLA 3MRSA 2V8OA 2RMKA 2X19A 1UBGA 3D3QA 4KYUA 3HU2A 2ZS9A 5IRCD 3EA5A 4C0KA 1G7SA 2ZEJA 4TSFA 4XTRA 4NPHA 4G1UC 2OUKA 1KI1A 3CH4B 5FBWB 3K0FB 3NTUA 3SR0A 1AK2A 2OHFA 2HT6A 3QEOA 2WJJA 3VQTA 1KO8A 3K1JA 4L4UA 2ZTSA 4LSGA 3QI2A 1ZNZA 4PC6A 4D82A 1E0SA 1DAGA 1JEDA 5E4FA 1HE8B 2R6FA 5FUVA 3J81k 1JJ7A 2LCFA 3AF2A 4DXAA 2A2ZA 4QBHA 4M53A 2O8DB 1FL9A 4GL2A 4HDQB 1D9ZA 1CS4C 2CVFA 3AGPA 4C0LA 4V0LA 3GLHA 4Q1CA 4W9MC 4OK6A 1QG4A 4JLBA 4JSYA 2V7QA 4MYTA 1U0HC 2XOKD 4JBWA 2ZJBA 1OHHD 4L15A 5FH9A 2O8BB 2BEKA 1FP6A 1I4LD 4A1FA 4PAQA 4PHFA 4JLNA 4JLAA 5EQTA 2BMFA 3WHKA 4AY2A 2ZETA 1VDZA 1R7RA 4RD0A 2O8FA 1AN0A 1KSFX 4DIEA 2WZQA 3QOFA 3E1SA 2ORVA 1KSHA 1YR6A 3NKVA 5LDDC 3GQBA 2WWIA 1NIJA 4ITRC 5BYKA 1SVWA 1SXJB 2EFDB 1ZYUA 2WSSD 4EPYA 2H8KA 1XEWX 2W58A 3K0AA 4KITB 1AGPA 1KHTA 1TU4A 2C03A 2D7CA 1EFTA 3GJ6A 3EPLA 1IN6A 2F6RA 2YV5A 3L8ZA 3BB1A 3QKSA 4I1OA 3EC1A 4YXWD 4QBFA 1R8SA 4ILEA 2XNDA 4ZPXA 1CXZA 1DAKA 3ASZA 1E2EA 1MH1A 3MSXA 5EP2A 2WIAA 1Z0JA 3CPJB 1G8FA 4C4PA 1KJZA 3AVVA 1T6NA 4FWIB 2WTUA 1EFCA 3NBZC 2EFCB 1XFAA 4M1TA 4A4DA 4EAQA 4IFBA 1NY5A 1TEVA 3M6AA 2REXB 4WA7A 3EX7C 4R7ZA 4KBGA 4Q4JB 2VA8A 1AIPA 1WP9A 3QENA 4Q4HA 3IBYA 1KJYA 2ZSEA 1SVSA 2X2FA 1QHIA 3CLVA 1W5SA 2Z43A 1IN7A 1ANKA 1J8MF 3O8BA 2FEMA 5H68A 2J1LA 5SZIA 2ZROA 1MO3A 1VIAA 4M9SA 4HLQB 3RYTC 4R71A 5J4HA 1ZC3A 4B76A 4RZ2A 3AP3A 2MSDB 4NE2A 3EA0A 4Z51A 2VP6A 1CJVC 4LUCA 2RGCA 3SC3A 4GRAA 1FX0A 5A4JA 2MMGA 2WSMA 4P4UA 3QKUA 1M2OB 2IYUA 4PC2A 4BLOA 5CM8B 2DPXA 2D74A 2AKYA 2IS4A 4BLTA 4E03A 3U3JA 4LHXA 4DDVA 4BLPA 1R0ZA 3P1JA 4DZZA 4ZDKA 3FWYA 2GBLA 3SN6A 1TL7C 2I3BA 2JJ2A 3PQCA 4PAMA 1IJEA 4Q4AA 4GP7A 5DH9A 4NYMR 4EUNA 3FMOB 1GRQA 2B7BA 3PJRA 1E2PA 2IF2A 4B35A 3VMFA 2D4HA 1U90A 1DG1G 3ND9A 5HCNA 3SDZA 1A4RA 4FMDB 2OFXA 3T1TA 4FMCB 2DBYA 5C18A 4GOJA 1YKSA 1OIVA 2XEXA 2KB0A 4M4SA 2SHKA 4XVRA 2FWRA 3G5UA 2XB2A 4DDWA 4IDPA 4II7A 2ZYWX 4JIMA 1OB2A 1ZU5A 1OKKD 4OHYA 1LB1B 3ONWA 2BBSA 3K8YA 4A92A 2XZPA 2WVJA 1TUEA 4Q48A 1GOTA 2OESA 1GL9B 2WWYA 5KO2A 2ZUCA 1UBCA 3HDTA 2XTNA 1CJMA 3TUJC 3CH5A 1TQ2A 4XSGA 4A9AA 4A6PA 4MYUA 4U7DA 3I61A 2WWFA 3QF4B 3RWOA 1ZM4A 3ZVMA 4RD4A 1KI6A 4Q9LA 3SZRA 4A8JC 1KKLA 1U81A 1BIFA 3LH5A 2IYXA 1TNDA 1ZBDA 4V0OA 4Y0VA 4B3GA 3JZAA 1N0WA 2W6JA 4IHQA 4U00A 2VP4A 4CIDA 1NG9A 3A4MA 3TR5A 1XB2A 2P5TB 1R0YA 4NCNA 3PEYA 2YWHA 2OEPA 4A0RA 2EFHB 3AP1A 1UADA 1XTJA 4TWZA 3WP0A 4AKEA 4F7WA 1E2JA 4HAWA 5KDOA 2MSCB 2BBTA 4B2PA 3UPUA 2ZJ8A 3IBGA 4PZZA 221PA 1S3GA 3RANA 3VR4A 2W6ID 2GF0A 2KBFA 4FW9A 3C41J 1Z8FA 2LKCA 2I1VB 4KLNA 3RHFA 1F2UA 3B85A 4JKYA 5EP4A 4Q02A 3RLFA 3UKDA 3BXZA 1G7CA 1N5LA 5G53C 4C0JA 1R5NA 1KI7A 3KUCA 4OJKA 4XJXA 1K5GA 3KXIA 4TLAA 2ZI7A 2DB3A 3TSWA 2A5GA 1AQYA 4LHVA 4QJ5A 4IOMA 4OJQA 4DUGA 3THXB 4OQLA 3U3KA 4M9QA 3AF0A 5DE3A 4Y0AA 4L16A 1FOEB 5JI2E 3GFOA 5DHAA 4QGGA 1U8AA 3L2OB 1K8RA 2HF8A 3QE0A 1X1SA 4A2QA 5CITA 2ZS8A 3KXKA 4LJ4A 4DCNA 1JXOA 4Q9HA 3SU8A 3U4QB 3H4MA 3CNLA 4A8JA 4BEBA 2NPIA 3MG9A 1YQTA 1T91A 1J2JA 2PLFA 4LBYA 3IIKA 4C0SA 2HEIA 1E2IA 1VG0B 2E9SA 3BAFA 3NHAA 1O87A 4I1UA 3ZQJA 3PEWA 1FUUA 2ZRDA 1JAIA 2ZYUX 3ZLJA 2OFWA 2HYIC 4LHWA 2CE7A 2XGJA 1NL3A 1FMJA 1JJVA 5BYJA 3W9YA 4US2R 4LYHA 2QAGC 1OH7A 3BIFA 4GZLA 4I81A 3VKHA 2P67A 2C95A 3D8BA 5JWHA 1A1VA 4Q1FA 1RW4A 4JLMA 1KAGA 1Q3TA 2V3CC 4DKXA 4OHXA 3KTAA 1GP2A 1OFUX 4TMZA 4IVRA 1JPJA 3A1TA 5KNCA 3NG1A 2HLDA 2ZSDA 1IN8A 5FI1B 2A30A 4KFUA 3GCGA 2CCJA 4IDNA 2D06A 1NY6A 2CLSA 3C7KA 3CX6A 3MWLA 1WQ1R 2IXGA 3PEUA 2DFKB 1G5TA 4YLGA 4A36A 4UJ3A 5FTMA 4PXAA 2FF7A 2RGXA 4F38A 2F43B 2JDIA 1Z83A 4P4TA 3TUIC 1D8TA 4BECA 2C98A 1CRPA 1WXQA 2EYUA 2NTYC 4GOXA 521PA 3KQLA 3DMNA 3F0TA 4JL8A 1BO6A 3AVOA 3TQCA 3WBKA 2QY9A 5L3QB 3B8HA 1HV8A 3KFVA 3SHFA 3R9WA 5EP3A 2V1XA 3FYHA 4BZQA 5A5GA 5KSYA 3VR1A 3DHWC 4IEEA 4WIAA 1DS6A 4K81B 3KJEA 1G3IA 3M0EA 3OIWA 1M8PA 4EFMA 2F1HA 3NC1C 2G6BA 4UQOA 4EJSC 2NMVA 1HQYE 5C46F 5EE0A 4ESHA 4HUTA 4Z8XA 2GHIA 2ZJZA 5SZHB 4DLYA 1R0XA 3BFVA 2ZI9A 2HXYA 4PC1A 1MOZA 2QTHA 2QAGA 1UFQA 3HWSA 1GAJA 5KPDA 4RKFA 4DSTA 1G4AE 1YZKA 2JASA 5CM9C 5HZHA 4MRSA 2VLIA 1DADA 3AVPA 1SGWA 1E79D 5KSOA 3I1FA 1KDPA 3W3ZB 1TQ4A 2CJWA 5JWRA 4AURA 3I92A 3U5ZB 1W36C 3UMRA 3UIEA 2VP9A 1R8QA 2QE7A 4JVSB 3TGPA 1G7RA 4YMWA 2O8EA 2ZSBA 2R6AA 4B74A 3MWKA 1OE0A 2RGNC 1MV5A 5CDFA 4HDOB 2BC9A 2IYRA 3WNBA 2ZRHA 1B0UA 2BHRA 3CX7A 1E6CA 4M1WA 1KSGA 2QM8A 2Z5FA 2C77A 3RC3A 2PJRA 3KQUA 3K0CA 4A2WA 3JZMA 2HUPA 3OIUA 1FZQA 2B6HA 3HU1A 4QBGB 721PA 2ECKA 2BBOA 3WP1B 3B1ZA 4HAUA 2XXAA 3F3YA 4I1VA 2ERXA 2QORA 4LV5B 4RD1A 5ANRB 5CDFE 3THOA 1PZNA 1NMZA 5LB2A 5DN6D 3NBYC 4EJSA 5FPTA 4OI1A 3VU9A 3SJZA 2PZFA 5DI9A 1U8ZA 1OXUA 1S2MA 4ZIRB 3X1YA 3LLUA 3OAAA 3ADBA 5FOXA 4TMXA 2YKGA 3A1VA 1XTIA 2CLDX 3BERA 1CF4A 1E98A 2OXCA 2OCBA 3IDQA 3QEJA 1Q20A 3UMSA 2PEYA 4LJAA 2Q9AA 2BMEA 2G0TA 4LJ7A 3UWOA 2H57A 2JIZD 2QN6A 4TL8A 3GFPA 4G3XA 4JKIA 4Q18A 4GPTA 4IKEA 3RNLA 1E2DA 1T0JB 3A36A 2RCNA 1AS3A 1KDRA 1GKUB 1LFDB 2QP4A 3RSOA 4ACAA 3IQXA 1F6BA 2OILA 3TAUA 2CK3A 1G3MA 1W49A 5AJWA 2AX4A 1Z0KA 4MKHA 4Z1MD 3ZD6A 3B1VA 2VP2A 2XZOA 3TNFA 1DAEA 1E3MA 2WMNB 3IEUA 1UF9A 2XTMA 2G3YA 4IJMA 1GNPA 1NKTA 2BV3A 1BS1A 3AUYA 3QXXA 5TY0A 5AUOB 4PQFA 5KNBA 4CW7A 5FTJA 3GLGE 3BH7A 1XF9A 1W48A 5DISB 3JVUA 4UJ5A 2J46A 2YWFA 2QROA 1KGDA 1N6OA 5DO9A 4C30A 2BVNA 3ZDQA 1OLOA 3NHBA 4URVR 1GVNB 1ESMA 2B92A 3B7GA 4HB0A 1GUAA 4GSYA 4JBXA 2NOAA 4C7OB 1Z06A 1N5KA 1QDEA 5JS8A 2GRJA 1E9BA 3C8UA 3W5JA 4TZ0A 5GJBA 1M7HA 1OXXK 3LX5A 1C4OA 3QXCA 5JZVA 4Q66C 3C16C 1U9IC 3DKPA 1U0JA 1WA5A 1F5NA 2ZE7A 2FZ4A 1N6RA 1SKYE 4EFNA 4H9GA 1MABA 2GILA 1Q0UA 2IHYA 2VO1A 4AYWA 5JJIA 4BE7B 3TQFA 4UNSA 4JJZA 3WYGA 3N2IA 4Q5IA 4TTRA 3WMGA 4CT4B 4DHEA 2VIIA 3EASA 5JLJA 2V1UA 1GG2A 3KXLA 5AJZA 5KPJA 1Q1ZA 2J7PD 1NJGA 1NVXQ 4OQXA 5JWOA 4LGMA 1DPFA 1FUKA 2GZHA 2YJTD 5DI3B 3ZIAD 3ETLA 4GMXA 3SYKA 1SXJC 5EE9A 4KBFA 1L4YA 2XOKA 4KU4A 5SZKB 1OHHA 3CUEF 1ZNYA 4P4SB 2YC2C 3K09C 4BFUA 2CHGA 3CZPA 1XPRA 3UANA 3QIAA 4PC3A 4GZMA 2ZRJA 1JR3D 1H8ED 1IY2A 3E70C 3ZD7A 4NTZA 1H8HD 2C04A 2MMCA 1HT2E 4F93B 3HR7A 3IO5A 2HV8A 4N1AA 5EUMA 1TF5A 1DARA 4JS0A 1A2KC 4HB4A 1OJLA 1TU3A 1IJFA 1SZPA 3PUVA 1D5CA 1UBFA 2WSSA 4TLDA 2O8DA 1Q12A 4G5QA 2QNRA 4AYTA 3CB4A 1IBRA 3RRNA 1NLYA 1Z0DA 1TPZA 3CNOA 2B7CA 2GCNA 2IL1A 1EWRA 1U9IA 2KWIA 2UZIR 4O25A 4RD2A 1UBEA 1W4CA 2QEQA 3FOZA 4BRWA 5DHFA 3QJYA 3PEVA 4YXWA 2P2LA 2O8BA 3MJRA 3RS5A 1NI3A 5BN5A 5G41A 4G0NA 4D25A 1T8UA 2R65A 1YJ5A 1KYIA 1W4RA 4B2IA 1Q57A 5FPHA 2NG1A 3MFYA 4KV9A 3WXMA 2QMEA 1ETUA 5IT5A 2VEDA 1E9CA 4AK9A 3BH0A 2ZYTX 4XSHA 1M6NA 1CR0A 4RFSA 5FBRB 5L8VA 1E2MA 3DDCA 4Q1BA 2D2EA 1LV7A 4HLCA 4JJKA 4TYWA 3HYTA 3W6PA 3HU3A 4HB3A 4C9BA 2IX3A 1IN4A 1WCV1 1YE8A 2Q9CA 4QL3A 2JLWA 1G5RA 1FP7A 3EIHA 4KXFB 3RABA 3EIQA 1IY0A 3KZ1E 1YRBA 4YQFA 1IQPA 1DVRA 1F2TB 1QVAA 4WAUA 5FOVA 1GFIA 2FFBA 1N6KA 3IQWA 4D80A 2ZUBA 5JEDA 2NGRA 1TMKA 3CRQA 4WZBE 2BWJA 4NHOA 4XWKA 5KUTA 1XTSA 1N25A 1GIAA 4DLUA 4Q4JA 3LXRA 4FN5A 3A1SA 1G9XA 2QT1A 1CP2A 3U44A 1XD2B 2EFGA 2XITA 2FGJA 1P61B 4URXR 5K8IA 4LPKA 2Q3MA 3VR6A 2OBNA 1U0LA 2WM9B 3FDIA 4IXNA 2DYKA 2WBLC 2OSBA 3HP1A 2IUUA 3GLFA 1US8A 1KOFA 4C2TA 1KI2A 4ZCIA 5JECA 1W7AA 3LW8A 3I4LA 4URZR 4JMPA 2QTFA 3SNHA 1ZU4A 4DCTA 1Z6YA 2D2FA 2NZ8A 3QG5A 3GLGB 1VMAA 4MITA 3TSOA 4Q4LA 5K8UA 1LY1A 2F7SA 5UKDA 4TLEA 3ZZUA 1OKKA 4Q9JA 4JLKA 1T9HA 1U2RA 1XX6A 1NSTA 5AK0A 1KMHA 5DYGA 2QBYA 5EUQB 3ZZTA 1IN5A 3RSLA 1UEJA 2GXAA 1EK0A 2AWNA 5FUYA 3SJCA 4HLDA 3IGFA 2ZRBA 5HKKD 5JJLA 3LXXA 1U99A 4D4MA 1E32A 1OXSC 4PHGA 2YC4C 4G5SA 3TH5A 5AUQA 1KNQA 4YONB 3VKWA 2YOHA 5KSPA 1ZD8A 4LHYA 4RCZA 2JLVA 4OI4A 2ZI6A 1YZLA 3N70A 1CKEA 5KDLA 4BZXA 1EESA 1BMFD 3ZYCA 3EZ2A 2RGBA 3S1AB 1RJ9B 3UXMA 3OEHD 4DB4A 1P9NA 4B6FA 4OQFA 4POAA 3SFVA 2GXUA 2GA8A 4HUQA 5TARA 5FR1A 2ONJA 2D62A 2W6IA 3MAAC 4DLXA 3KJIA 4MYCA 4A0GA 2VQSA 8OHMA 1Z2CA 5AUNB 4GDFA 3D31A 1A2BA 5F9HA 1G3QA 4IXMA 3EC2A 3CM0A 3IO3A 4KJZA 1IONA 1NVVQ 2R2AA 3BB4A 3T1OA 1M34E 2V6IA 3B1XA 1QRAA 3I73A 4QHSA 1N2CE 3T35A 3R20A 2FFQA 4G5OA 2KBEA 3ASYA 4PTLA 3VX3A 2HXSA 1FFHA 1VG8A 1G8HA 2O0KA 4B75A 3LW7A 2PT7A 4YC7A 2OM2A 3W6NA 5J4KA 3PR1A 4WOPA 4DVGA 4M9XA 2J0UB 2W2XA 4DDTA 3QXJA 4LY6A 2QPAA 2JATA 1QHNA 3QXSA 3TLXA 3EPHA 3T12A 2GEVA 4E5UA 2GAAA 3AKEA 1F3OA 1KI8A 1XMIA 4K46A 2ZYVX 4Q7LA 1QF9A 4EPTA 2H16A 3AEZA 3GLHE 821PA 5J5CA 4TLBA 5GVSA 2FSFA 4NCJA 4I99A 4BFTA 1Z6TA 3KKOA 3TE6A 1XU4A 4XVQA 4YDSA 4KODA 5J4VA 5BW8A 1S4QA 3QY0A 4ASUD 5FL7D 1U98A 1DO0A 5HZKA 3U6BA 2E87A 5FBQB 3ZVNA 1KK0A 5JCPA 2GCPA 1YR7A 1QVRA 1KK1A 1JQJC 1G291 4WZ6A 4LHZA 2IF0A 3K0EA 1X86B 1YR8A 4D6PA 1KI3A 4CEIA 4QGHA 3PV0A 1KI4A 5EXTA 1HH4A 3EWSA 1Z0IA 3ZJYA 1D2MA 3LVQE 5H70A 4TTPA 2IYYA 3ZGXA 5IF9A 4DCUA 1E1RD 3NC0C 2QSYA 1EXMA 3PUWA 3LFUA 1XPUA 4FCWA 3GJ5A 3WYFA 1SVOA 3CNNA 4NKRA 2ZJOA 4RD3A 4PHTA 4D4LA 2QPTA 3KX2A 1SXJD 1S0UA 4L5BA 2O8CB 4NYIR 3BK7A 5EP1A 1E4VA 4L8GA 4Q1EA 2J0QA 1ZCAA 5CIWA 2R62A 4P31A 3X1DA 1KY3A 4FMBB 4CEHA 2ZXUA 5E7MA 5C4MA 3G0HA 1ZM9A 3KKNA 1UEIA 3IHWA 5EZ5A 2PZGA 1NBMD 3B1WA 4UNNA 2QMHA 4NBSA 2JGNA 2FFHA 4LV8B 4DC9A 4IOLA 1GNQA 4O2RA 3GP8A 3I8XA 2N1BA 4LJ5A 2I4IA 4V0MA 3EPJA 3ZS9A 4DBLC 1LF0A 2BCJQ 3ADDA 1W46A 2F43A 1QHXA 2WPDD 2ZE6A 3AVWA 3BORA 4O2LA 1DELA 1R4AA 1Z07A 3E5HA 3MD0A 2WKPA 3GPLA 3H84A 2PLRA 1G41A 3P4XA 3RS3A 1M7GA 5L3QA 1YHNA 1RRFA 1ZCBA 2N42A 3RRMA 2PX3A 1E79A 5DNYB 3BFKA 3KB1A 1VYVA 2ZJ5A 2J0SA 2FOLA 5HR5A 4JYCA 4LBZA 4ON9A 5JEEA 1W5TA 1II9A 3OHMA 1JEEA 4HAYA 2OAQ1 2O0JA 1GITA 2UKDA 1LTQA 1VHTA 1W2GA 3LBNA 3TIFA 1W4AA 3DOEA 1E2HA 1RZ3A 4KSCA 1N0VC 5BN4A 4QFMA 4M1YA 1E9FA 1C9KA 1TADA 2RGGA 1EX7A 3T06B 2IYZA 2Z83A 1GRNA 1NRJB 4PZYA 2ZIAA 1J90A 1V43A 4QG7A 4HAZA 1IY1A 1GNRA 1C1YA 2IWHA 1UPTA 4K8OA 3TK1A 4B32A 3B1YA 4LCBA 2ZM5A 4S2EA 5C2JB 2QT0A 2OCPA 4UNPA 2FH5B 4QOSA 2BEJA 1X8KA 2NZJA 4LPSA 4F4IA 5DN6A 1R5OA 3L0OA 4V03A 4XWAA 4HZIA 4F4JA 3FTQA 3IPYA 3WMEA 3IILA 2ZE5A 4JT2A 2QMUA 1VCMA 2ATVA 3CONA 3EXAA 1HUQA 3VX4A 1TX4B 1QG2A 1YVDA 4NYMQ 5E7IA 1R6BX 3UG7A 4V02A 3RS0A 4ZCLA 3KDSE 4FMDF 1GILA 4A0FA 2FZLA 2IT1A 4FMCF 4AG5A 2V54A 4PSKA 2JLQA 2QP9X 2JIZA 4QNRA 2GESA 3D7MA 5CJPA 3B60A 2GK6A 5JSZB 5FBVB 4B33A 2VL7A 1AZTA 4RZXA 3VHXA 2V4ZA 2ZITA 1T3HA 3A4LA 4ZDIA 4Z1MA 1P2TA 2EWVA 5M04A 1LW7A 4ZI3A 1XMSA 2ZRIA 2ZQ5A 1N6NA 2ZUDA 1VHLA
chains in the Genus database with same CATH superfamily
1WB9A 1TQ8A 1LSJA 1I7NA 2DBZA 4RIHA 5REQB 1DG9A 2GPSA 4L5IA 1QIIA 5E7JA 4HDNA 1JP7A 3CPEA 4CI0B 3RIMA 3TTVA 3WLHA 3QMMA 1GPWB 4LKOA 2AK2A 1XTPA 2VHUA 3EGDB 4IH4A 2EJWA 1QB7A 4UEOA 3UMGA 1C3OB 2C9DA 1HDGO 3LE8A 3ROZA 1JMVA 2O8FB 1C7ZA 1P81A 2OZLB 1EFPA 2FSPA 1YZ3A 1W1IA 3AFOA 3N2EA 4WXRA 1BWQA 3AKCA 3OOWA 4QRHA 1XDZA 3AI7A 2OBFA 3CEHA 3GK3A 5AKKA 3KSZO 4BYGA 4UTPA 3HXQA 3G13A 5DEIA 1OBCA 2C1EA 4P3KA 3EUFA 4ID3A 4LRSB 1BWRA 4QSHA 5T4FA 4EG0A 3K0AB 2G9RA 2C4WA 3Q9LA 2C5FA 1VA4A 1P9RA 5EE1A 5K5EA 4R6WA 3IERA 3QKRA 1J70A 1M5UA 2PU7A 2R1VB 4CQMD 2GERA 3D6HA 2B8JA 5F1YA 3WGJA 1ONNA 3KYDA 3LX8A 4MRMB 4RY0A 4A1OA 2APJA 1CY1A 4O2BB 3R74A 1NQAO 5BSMA 2DTDA 2PH5A 3HH8A 2AMFA 5AHRA 4ZCMA 4C20A 1WM1A 1DJMA 4MQEA 2XCOA 2E37A 4X63A 4B0OA 5KOHA 4Y6GB 4MYRA 4W5QA 2V0GA 1JHMA 3DVAA 3NYRA 3IS3A 2PL3A 4MWDA 2GTIA 4ZREA 3ZIAA 1TT5A 3AJ8A 2IP4A 2RAFA 3LKZA 4G0QA 4L0MA 4TMTA 2I34A 3WBJA 4EDHA 2V6BA 3F96A 2ATXA 2FSVC 5HUJA 1Z0UA 4K9RA 3LUBA 2P65A 3ELWA 2G17A 4Q4HB 1FFEA 2X41A 1N5JA 2P9ZA 4P82A 1JR3A 3LQ4A 1H8EA 2ZIEA 3R76A 1P1JA 4HSEA 2FWAA 4ZYLA 4XLLA 2R1UA 3CSDA 3LO8A 3QU9A 4R2IA 1SPXA 3OEED 1YVEI 2ANCA 2ORYA 1WXWA 1P77A 2DECA 1VECA 2P9YA 3A3PA 3O8QA 3T3DA 2Q3CA 2JEOA 4LC0A 2PMKA 1ZM3A 4V0QA 3USCS 5K3EA 1Z29A 1BN7A 3LWBA 1XD8A 1RQPA 2NUAB 1SKQA 3UT0A 3PR3A 3GP5A 4BXOA 3AY0A 4DL9A 1QM5A 3K9GA 1Z2AA 2XWSA 4XA8A 1Y7PA 3ND7A 1QO7A 5B1HA 2IDMA 2C2KA 2Q50A 2C1ZA 3BQMB 4W5JA 3NTQA 4PS0A 5FPSA 5LKRA 3M9XA 4K9DA 4CV3A 4EITA 1R4NA 2FRXA 3SI7A 3IOCA 1ZKDA 2IPMA 1PN3A 1Y7LA 2XMQA 3EOZA 3CFYA 1ZITA 2HWUA 3K0HA 3KELA 4FCTA 4BO6A 4CEJB 5K8CA 1GSAA 4Q4AB 2GEUA 1TFUA 4RABA 2VTVA 2B8TA 1UK6A 5JHHB 2JH3A 4BBPA 1FMCA 4CR7A 1E0KA 3DDWA 4ZI2A 5JZOA 1BQ3A 1SO8A 3L9WA 2I55A 1EFVA 2Q1SA 3A0RB 1TZMA 2PX2A 3BMCB 1DTSA 2FV8A 2GI4A 1DIBA 2VNIA 3V8VA 1ADYA 1M1YA 3FETA 3D8RA 4G85A 5CDSA 3PICA 2FSVA 4JHXA 4ZT6A 4MICA 5TIIA 3ANNA 3T3MB 1SELA 1E69A 4URYR 1J8QA 1CUSA 2C96A 3F6SA 5TXGA 2OGWA 2WFAA 1G17A 3QK7A 1UJ2A 1DCKA 2X9LA 5FQNA 2QSZA 5A05A 3FSGD 4JI3B 3TW8B 1KO1A 4GLFA 2NU9B 1EFUA 3UCXA 5CYPA 3MTGA 2ZPTX 5FLEX 4B2LA 2PKCA 2WICA 3SK0A 2VUTA 4KQHA 16PKA 2FMTA 2PX4A 2RDMA 1J0XO 2C7RA 1Z4JA 4FNGA 4RPLA 5KYUA 1ISRA 5JRZA 4AY6A 4OLBA 3SQDA 1BU5A 4HWTA 4PANA 5AD1A 2W42A 1RVDA 4GI7A 1DEOA 4YAGA 2QL5A 1Q7BA 4CKWB 3F4BA 5ADVA 4MQBA 2Z3VA 1P4JA 2PH1A 3GPDG 5BSGA 4G23A 4MEAA 1OLUA 2ZSFA 3PXGA 3W7BA 4S1NA 1GGNA 2AJCA 2WNHA 3UJ6A 1NLUA 1LXCA 4BNDB 1OXKB 2HJVA 3VR6H 3F6RA 2PMCA 3RBVA 1VB5A 4LNUB 4MVJA 2QZZA 4I46A 2WIDA 3VR2D 2W2QA 3AF6A 2P27A 2I3DA 2OHJA 1EZZA 1Q22A 5H81A 3HPQA 2I1LA 3H0CA 1YZGA 5BNZA 5BVHA 1W88A 4N3NA 5CD1A 1RBZA 4RZ3A 4GU5A 4FNMA 1RKXA 1CPYA 2JLAA 3AXSA 1Y1QA 5P21A 1DRVA 2OV2A 4CR8A 5GJWC 2J07A 2VNSA 3ZDCA 1WL8A 2WABA 5AK6A 3DNPA 1LPBB 2YV4A 1L4BA 2XB9A 2OAEA 4UVGA 4YJKA 2IZOA 2Q6TA 2X0DA 4CT5A 4JENA 2GR9A 3FPHA 3ACDA 1CZRA 1JF8A 4E5YA 3AFIA 2CHQA 5LIPA 5HKKA 4OXRA 4UZEA 3P9RA 5F5NA 5IKXA 5B30A 2QVZX 3AJEA 4IMIB 2UZ3A 1AS0A 1U0RA 2CUNA 3JQ9C 3ER9A 3B5EA 1YA4A 2JRCA 1YJ8A 4HH0A 4MGKR 1X6VA 4YTEA 1IPFA 4CF6A 2C00A 1CFJA 3PYLA 4C0WA 4ZAYA 4G65A 3OBIA 1KJWA 2WWHA 1A9OA 4WXPA 5F4BA 3UWKA 3OZVA 1P44A 1T26A 5FULA 1LTHR 4B34A 4PZCA 5K0FA 4Z53A 1KDOA 3OEHA 4NZ9A 2GTPA 1G18A 1VE1A 7MHTA 1K5PA 1JEQA 4CL2A 2ZG6A 4DLVA 1VYUA 3OEYA 4H6PA 2C2BA 2XMCA 2FF5A 1XI2A 3U31A 4O4IB 4C21A 1G3UA 1JLRA 1W0JD 1GQOA 1P73A 1SQGA 3H11A 4G09A 2PZBA 4NRDA 5DTRA 1GFWA 2HWYA 1QH0A 4YMGA 2YMLA 1X1AA 3EIEA 4MO2A 2I6UA 3P9SA 4DA0A 2JLZA 5JD6A 3S2IA 4WKNA 3GO4A 1NSYA 1BKDR 1JSRA 1V5WA 2V7XA 5F78A 4DQDA 4LF8B 1QSGA 2GCOA 2JFHA 4TWRA 4GW3A 5EPOA 1PZEA 5JANA 3D5EA 2DUJA 5CLLA 1OBHA 2NO9A 3TEFA 3ERCA 4JXZA 4XYGA 2PWPA 5EQFA 4WCFA 3G9QA 4FS8A 3O0DA 3NBQA 3DT6A 3E3AA 3FX2A 2LUOA 2Y1LA 3NBXX 4G0MA 3TVYA 3RJZA 2UYCA 4MDFA 3FR7A 1NF8A 2XODA 4L76A 3TZLA 1NP6A 4R8SA 3IUJA 5EHNA 5A7GA 4DE5A 4KO2S 4AUKA 2V9PA 5ESXA 3KQHA 1YCFA 3U7QA 3A06A 4C6TA 3DFMA 4BX9A 1JZQA 1UCFA 3R7DA 2G0NA 3NZEA 2WTAA 3WIDA 2WIGA 3PVSA 5HIMA 1U9YA 4L3OA 4TYQA 4P0QB 2PFGA 2H54A 2I6GA 2CC2A 4RM2A 2PX5A 5T57A 5AIBA 4H7HA 4L0CA 3RK1A 1ZUHA 1NVUQ 1ZUNB 1Y5NA 4I9HA 2TECE 3LQQA 1L5HB 2X8BA 3L4SO 2FE4A 2PVPA 1IU9A 2VPPA 3NIBA 1XNQB 5F2OA 4NE7A 2GZ2A 3HZZA 3IODA 1E3WA 1V9LA 2HTFA 3HGQA 1QVWA 1ZY2A 2DH5A 2P2GA 4UM7A 3W2HA 1TMYA 1PR9A 1WPXA 3G5MA 3ZQ4A 1UQRA 4B84A 1JFTA 4EFLA 1VLMA 1X8LA 3E7WA 2V7UA 1QPZA 2PUGA 1FFWA 3WQBA 5T6BA 2AOWA 4YP0A 2Y2UA 1VM6A 2VCEA 1P5HA 3KUKA 4PGHA 5EI5A 4A2PA 5C1BA 2BGWA 3C1UA 2WNSA 3TB4A 1K7CA 2OQRA 2A5FA 2RH5A 3VDNB 4I4NA 2VNHA 4LFAB 1CQXA 2IHUA 5A1TA 2D1YA 1RZVA 1ZK0A 3CEJA 4IDQA 1P72A 4PEVA 4BQFA 3SX0A 4FZVA 3R7NA 4KX3A 4MYSA 2QLBA 3BA6A 2QF7A 3PKIA 2DPYA 5SZJA 3LCRA 1T10A 2VZEA 1Y0BA 3HJTA 1SG6A 1VPLA 2CV1A 1PDWA 1RPAA 2JAQA 3D7NA 1N8KA 2CB9A 2EV9A 3A3KA 3IURA 5I9SA 1WABA 4P38A 4GVLA 4B6JA 4KHPB 4N0EA 4HSGA 1JHDA 3WKBA 1QFYA 1FVXA 3PDWA 4O02B 2V6JA 2FA9A 1U5AA 5FUXA 4EHFA 2C7GA 3OMLA 3QXHA 8ABPA 3HPRA 1QO0D 3MJFA 3PK0A 1OILA 1SU4A 1K6MA 2B78A 1KNXA 3AI1A 5CLIA 1X1EA 3CWZA 4F8EA 4RV5A 5D5HA 4CR6A 3RYCA 5FAXA 4E94A 3AW9A 4AJOA 1BW9A 3UW1A 1QE0A 4R2MA 1XCGB 1ENZA 2ZE8A 3ZZ1A 2XTJA 3MYRA 2XSZD 3M1AA 2V98A 4WNIA 3L0ZA 3PJFA 2NUPA 4IMJB 5EKUA 1YR1A 1RE0A 2G1AA 2PR7A 2AFIA 4JP1A 5B58C 3RGGA 3NM4A 3PWSA 1Y4ZA 2VSQA 2GN2A 1CUBA 2RC6A 5J23A 2QL9A 1HE5A 3PC4A 2VSOA 4IBOA 4IYRA 2WAYA 3RPEA 1V6SA 1B0ZA 4GF5A 4P9NA 5J59A 3RVBA 4AT1A 1QKJA 1X9IA 1PZMA 1RWBA 2WIBA 3DDOA 3PNSA 5LPNA 3LAWA 3ZW8A 2HO5A 1JJAA 2HK7A 2X23A 3KYCA 2O8CA 3REGA 4MS4B 4ZO6A 3RR2A 4JDPA 2PNJA 3K9HA 4D98A 3PYMA 1YDHA 4WZZA 2VF2A 3VDXA 2P6RA 3RGWS 4IXTA 3IAM1 1T2AA 4LRUA 4O29A 5EINA 5U9CA 1YO6A 3PQ6A 1MT0A 1V11A 2G28A 1XDSA 2HCJB 2CL7X 2HI0A 1B4DA 2OE2A 3GEHA 3NNNA 3CISA 2OBXA 2FPLA 2AYZA 3LC2O 1BVYF 3WKEA 4MVJF 2GXQA 2GS9A 1SA0A 2GT1A 4QC2A 3P7MA 4FZJA 2VRWA 1XCMA 1KYVA 4JN6B 3U3MA 2IYPA 1AXGA 2H5EA 3IKLA 2Y0PA 3VO2A 2JK0A 2QS9A 2WHYA 3PQ2A 3NW9A 3VVBA 3AKDA 4L4SA 1NMSA 3DZKA 5SYAA 1KAHA 3ZWKA 1EA5A 2ZR0A 4NS1A 4OAPA 2YZ7A 4MZDA 2GM3A 4FKZA 1JHVA 3T3HA 3UMJA 3NNDA 2CHFA 4K87A 4GOMD 2J8ZA 3EWAA 4FYXA 3ZDRA 1NIPA 3EEBA 1WULS 3RTCA 3G2QA 3UBTA 3KTDA 3A14A 3EZFA 3OZTA 4MS1A 4UREA 3V7UA 5CK5A 1Z35A 2XE8A 5A5DA 5CLJA 4RCVA 5JPCA 3BWBA 5J3JA 2I78A 1UXIA 1UJ4A 3O73A 3GXBA 3ONFA 4JUFA 4U2BA 4UW9A 3ID6C 5ALMA 2XT0A 2YHIB 2EQAA 3AUSA 3G89A 4J75A 4P3XA 3R3UA 3SAJA 3C3BA 3N0VA 1P5RA 2GDJA 3P32A 4KLZA 4XYBA 1RFGE 4FDTA 4HDSB 4ZP1A 2YDYA 4BVBA 5BXQC 2YV2A 5LYJA 3FW1A 5BV0A 3RAGA 2IK8A 3KKZA 2UYGA 5AW9A 2FUKA 2A0YA 2PUBA 4LDNA 2EGUA 4KQIA 2C3UA 2B61A 4BNGA 4KFCA 3FPKA 3G79A 5FXMA 3PQ8A 4YPOA 2F8TA 4D8VA 1FYDA 3C8DA 2VBCA 4K05A 3E5RA 3AOEC 1Z08A 4ZOLF 1AM4D 4E3WA 3IUBA 1YQ9A 1E2FA 2ID9A 5IBCA 2VJNA 4IZ6A 1GTRA 4AN1A 4KGVA 1SURA 3QF4A 1EPUA 1K0FA 4BUZA 2J45A 3VSCA 1PS9A 5EXDA 2ZSHA 5C80A 3OFND 1BH2A 1EBFA 5C81A 1WW3A 2XXJA 2B3DA 4F3KA 2ET6A 2Q6LA 1RACA 5IKEA 4HH4A 1GCIA 2YMPA 4PICA 3B5JA 4YT4A 1WSAA 4NV0A 3O91A 4A8PA 1PQPA 3LYLA 3NLLA 3OZBA 4Y3UA 2ZBRA 4GP6A 3G2PA 5AW5A 4UHDA 5L3RA 2QN8A 1RRPA 4F5YA 5ELXA 1RTTA 5AICA 5JPIA 5AKXA 2VJAA 4OQMA 2IUYA 2ZRMA 5D85A 4TRJA 2QLMA 4JZKA 2EDAA 2M2IA 2WHXA 3AHJA 1ORIA 1XR3A 1K7YA 3CNHA 2WWGA 1XG5A 2V8BA 3FTPA 1KJIA 4B3MB 1H85A 1N1DA 2AW5A 3CF0A 2E5FA 4PN3A 5I9NA 1QR6A 1BCSA 2LW7A 3MF4A 1V1MB 4RA6B 3W5BA 2F59A 2JFQA 4QDUA 2BP7B 4EFKA 4P4NA 4PU0A 2C2HA 2X5OA 3F97A 3O4IA 4RZSA 3SZ3A 1Z68A 3QFHA 4BKMA 4G37A 2IEGA 2GVDC 2HXGA 4WFKA 3H7IA 2B6NA 2IPAB 2ZVJA 3T3OA 4PBRA 1A72A 1HEIA 1Y33E 3D6TB 2DKFA 4WZAA 5E1DA 3KUXA 1NMXA 3OEWA 1JR6A 1Q83A 2HPAA 1E7RA 4CQMA 4HNSA 2CFIA 2P6PA 2VHXA 4QYSA 4XW2A 5TMDA 1GLNA 4D0GA 3PIRA 5CXXA 4OK5A 4C89A 4OQ4A 1FTSA 3ESCA 3NEYA 2VXYA 4K7JA 2B1RA 2IXBA 4QYWA 3BWMA 3EAGA 5AI0A 1ZXBA 1ULUA 4H7DA 1J2YA 1F9AA 5KYVA 4E1VA 4RIEA 5E6RA 2EKDA 3UGJA 4KPUA 3IA2A 1PVDA 2CV0A 4I1IA 2P2DA 3DGFC 2FHPA 4HCJA 3PQ4A 4KKXB 4BKUA 3FTCA 3EC7A 1RYYA 3OI7A 4LAFA 4MSUA 4ND7A 4EVIA 4IO0A 3DO8A 4E51A 2IXDA 1VGRA 3TRDA 2BJHA 4CKYA 1XLVA 1SVIA 3OQIA 5CIYA 2XB8A 2EKBA 4MH0R 2GOYA 2A9VA 3TLGB 1CDEA 1IEVA 3LLMA 2HIAA 2OV1A 3V1LA 1XU7A 4QO8A 1I14A 2O5CA 3OEEA 3EEOA 2UUCB 5T4HA 1RI1A 2GBLC 3LDFA 2GJKA 2HJ9A 3ESRA 4M0UA 3RSFA 3SSNA 2CD7A 1JXMA 5DYTA 3KZMA 5DNAA 1Y3AA 2UAGA 4MCIA 3Q9SA 2JLYA 2RIRA 2EQBA 3NGMA 5KHLB 4YJGB 3T5PA 1ZVVA 5IC6A 1W0KD 1Q77A 5SV2A 2ZUTA 1BNCA 2OKCA 2CXOA 4L07A 5AUPB 2OECA 2X0JA 4J2OA 4Y18A 5EXPA 1Q5PA 2X8LA 3QSYA 1T9AA 1E9EA 1IY9A 1TMGE 3HL0A 3QOXA 4QNMA 5CVJA 4DA4A 3BXGA 2J7KA 1V8FA 4KUHA 3TNLA 2WD7B 3AB8A 5DNVA 5J4LA 4XI9A 5JAMA 2YWRA 1FNDA 1VBFA 2CCGA 2C2MA 1C8BA 2BOVA 3GG2A 3U44B 3WDMA 4QM7A 1Q1EA 5FPYA 3TM5A 3NORA 1NVGA 5GVRA 1G8GA 5CG1A 4FC7A 3QPUA 1HSOA 2RHDA 5T4EA 2P6UA 4GP9A 5SICE 3GLFB 2LWIA 3K5WA 3T5GA 2H3EA 1L7MA 4MLPA 1COWD 4QRIA 4NMLA 3IUYA 5ES3A 3WSVA 1USGA 3EDOA 3EK2A 2X1LA 3UMFA 1PWXA 4GKAA 5DJ5A 2A5DA 3G9TA 5ADHA 3ELBA 3NONA 3CRW1 3V4ZA 5GV8A 4KWIA 2F1JA 2GCEA 4IIJF 5KX5A 1UBOS 2ZBGA 1TIBA 3CLRD 4Q47A 1QAMA 4CYMA 1Y63A 3DMGA 3FSGA 1EH5A 3BH6A 4B6PA 4BAUA 4BL5A 2JG3A 1E9AA 4I0WB 1G4HA 4NP6A 1E5XA 2DX7A 3STUA 3FB1A 4QWMA 4RVNA 3O0TA 4C07A 5KWEA 3O7MA 2VPQA 5LWHA 3DNMA 3OOHA 2VJBA 4P93A 2GCIA 1R6VA 2I2DA 2V55B 5K3FA 1DCFA 4Y2TA 1MXFA 2JJ1D 1UFRA 2E48A 2ISQA 3ESZA 1UXKA 1XAIA 2Z4SA 3O3CA 3W5HA 3EGXA 3BWCA 1M1ZA 2JC3A 4J29A 3ECCA 3JATB 2QB5A 5DYIA 1UR5A 3K0KA 4HY3A 3UGQA 1C9JA 2DR0A 2XWPA 4F4CA 3I5XA 2FJPA 4DNFA 4EDFA 3TM4A 4HQKA 1RWPA 4DV7B 4R2WA 4MVJH 4RSGA 1D2EA 4IJVA 1LBIA 2YZ2A 4EEKA 2OLJA 4G86A 1Z12A 4I5FA 4KFTA 3DM5A 3PG5A 1RP7A 3JQAD 2B8NA 5EZYB 2W5UA 1GHTA 4DLBA 4M1MA 2BGRA 1VKJA 5FKJA 1BA3A 3V46A 3VR2A 5K0NA 4N01A 3A9CA 4H0CA 3W1EA 1DIOB 4RZHA 5IU6A 4F3RA 5BW5A 2WRZA 3PFFA 1N2CB 2YOGA 2C9YA 2SKDA 3AMVA 3OPYI 4TYPA 4Y6PA 5CM2Z 4EP1A 1EUQA 3QP9A 4V38A 1DX6A 3F4LA 4A8HA 1QNFA 3HGMA 2Y4NA 3KG2A 4Y6OA 1ZOIA 2YL2A 2I2XB 2IDZA 4IQFA 1GDHA 1GU7A 4X8LA 4MZXA 4D9MA 4DBLE 1WMAA 5TGTA 3UK1A 4JQZA 5DM0A 1XEXA 3MOGA 3FHOA 5ABPA 3KKMA 3M3HA 3U6KA 1CEQA 1DTEA 1W6RA 3SEAA 4EPWA 3NHSA 5JO0A 3JD1A 1SVMA 1XXLA 2AFHE 2WMDA 4W6QA 4OHZA 5KTTA 3IEMA 4QOJA 4RGBA 5FUQA 2HWWA 2I3ZA 4MULA 3W6UA 4B71A 5IJ9A 4TUYA 2PMBA 5AO9A 4C6SA 5TX7A 4RTMA 2Z4RA 3C7CB 2BI4A 2GD0A 3SSMA 3L84A 1JHYA 3HXMA 2G09A 3E9DA 4A15A 3IUPA 3KCQA 3NXSA 5IZCA 2K4MA 1R0WA 3OCZA 1SBHA 3A58B 3IT2A 3N1UA 2Q29A 1KZ6A 2PBLA 3AJDA 1LGYA 2KJQA 3LT1A 3R6LA 1DC7A 1PJCA 4MJLA 1A82A 1II0A 1PFQA 1HRKA 1D7AA 2P91A 4ZKDA 2CMHA 4Y2UA 2V7EA 3D6AA 3PBKA 3HVUA 4QVIA 1W75A 2P90A 4RYDA 1X1RA 1A27A 3Q88A 5CXUA 5IDQA 1A5ZA 2YRWA 4YWHA 2VP0A 3L4KA 4OHVA 4F4FA 3OCWA 3A6PC 4QU8A 4N3CA 1N8TA 4ZYUA 1DXHA 1I7PA 1W0JA 2YVUA 3C5EA 4JLSA 1XEFA 4KIUA 4BY9E 3N3AC 3Q5GA 5EE5B 2FSIA 4DJEC 2J87A 4Y6LA 1NXSA 2FU5C 3EB9A 3MHPA 2CCKA 4GIBA 4KEAA 2OXIA 3IMEA 4B6EA 3UFXA 3MMPA 3SE7A 3F47A 5TEWA 1JKXA 2WJVA 2BGNA 2DHDA 1UWKA 1G5QA 4CG3A 5KJ6A 5HCIA 1VGQA 2BI7A 4UNRA 1HE1C 1WMBA 3SVLA 3L1KA 1JIVA 4IXWA 3RHSA 3SJUA 2EJTA 3NPMA 2QQEA 3O8OB 4HAXA 5LFAA 1U6IA 4MWTA 4TYYA 4H6XA 4ENRA 2IS1A 1U1DA 2NVUB 3G2LA 4GC5A 1I3LA 1C0KA 3MTAA 4YCNA 1VMDA 3S70A 5IJXA 4BGDA 2QE6A 2MYPA 4TV9B 3SHWA 4EY7A 1NN3A 4UU0A 1II8A 3TPFA 2D1TA 3AFGA 2JCXA 3D3NA 3JSXA 4JT4A 1RM3A 1V39A 4R4JA 3EFOB 4CJXA 4M46A 1GLGA 4Q05A 1WW8A 1LI7A 2AC2A 3L6BA 4M9RA 3RRFA 3RSGA 2BE7A 1R2QA 4HS9A 1FYWA 2JFYA 3RTGA 4JY7A 3EIXA 3MJTA 3O1JC 4HQ0A 1DNPA 4LQDA 1T3LA 4QO7A 1H42A 3BCUA 3H42B 4CUJA 3NNSA 3V1UA 2WLSA 4EG5A 4BQSA 4NCHA 4RK1A 3K2EA 3LBIA 1VE7A 5EVJA 5IG2A 3U7HB 1JR3E 4C2UA 1KGSA 2ZBQA 2HMSA 1S1MA 1JHQA 2X8AA 3JQCA 3WGKA 3LXMA 5KYXB 1DXYA 1TQDA 2ZVQX 3B48A 4QUEA 5FR2A 1E7WA 4W5WA 3JQ8B 5ENVA 4L9RA 2C31A 5DGDA 4BNFA 4MRRA 4QKQA 3QZUA 1GPH1 3UG6A 1ZCFA 1Q21A 3H2YA 3TTWA 1LSSA 2IY9A 3KD3A 3AEYA 1ZUWA 2MSEB 5C4GB 1P91A 3MPOA 4HWKA 1M2VB 1X9HA 3H2GA 3W9SA 3WGHA 4BQRA 3HYCA 1LQTA 2BGIA 2FW7A 3H19A 3R1IA 4TLMB 3WL4A 4QD3A 3GH3A 4BMDA 5FL3A 3GDFA 4PLVA 2EU8A 2I91A 2AD1A 4FFRA 4KH1A 3U39A 4ZN6A 2VT3A 4WERA 1ZWLA 1QO0A 4HLUA 1JZTA 5IFLA 2YCLA 4ZK2A 1ZHHA 3KKQA 3I5YA 1T4DA 2R48A 3DLAA 3SF8B 2PRIA 4D3XA 4E21A 1XUOA 4OJTA 4ZARA 2PSJA 3AM5A 3UJ3X 2AWOA 4U1RA 4QG3A 3ES9A 1FFDA 2XSZA 4IDDA 1S2GA 1M1YE 5KX5F 4NMXB 4OD0A 1O1YA 1QIJA 5D86A 3KVVA 2B2NA 2C8VA 3MCZA 3O4GA 4JVLA 1H6DA 2QDKA 3LCMA 3F3KA 3QVTA 2OV8A 2WA1A 4LMAA 2OTCA 3KB2A 3I8SA 1VBMA 3W34A 2HZBA 3ZV7A 1GTJ1 1U3UA 3PD0A 3W79A 2BGKA 1PR0A 1S01A 1PUIA 3RS7A 1BOOA 2OP0A 3CWQA 1YASA 3O47A 5BSVA 5H8WA 2A59A 4W1PA 1BMQA 1QCCA 2V7PA 1WF3A 1YI1A 1ZH6A 4JVOA 5M2QA 1E9RA 3CNQS 4X0EA 1NMYA 1T5SA 3EVZA 4K2HA 4Q7MB 1K5HA 1N6HA 1V25A 3B13B 3IC5A 4MDHA 1HDOA 3CZRA 1NUSA 5J4YA 5IASA 4UMEA 2AOVA 2EC5A 2RBEA 3B3AA 1IH8A 4QGFA 2HA7A 1HQCA 2ZW9A 3NEJA 1XEAA 1LEHA 5EIFA 4OI0A 1K0UA 4X1OA 5C1OA 1VMIA 3OE5A 4MTLA 1E7MA 3ZHOA 2XV1A 3AONB 2H92A 3ZHVA 4BCCA 3D6MA 3LVBA 1JDBC 3U37A 1HDEA 2JJYA 4EBFA 4XUDA 4DDUA 2RGRA 3JVDA 4JGBA 5K0JA 5CW1A 3OURA 4RTNA 5E38A 3ZWBA 1Y1KE 2VXOA 3EG5A 1GFZA 2PRSA 2GAOA 2Y8EA 3CTMA 4MVJE 1R9NA 5CX4A 5A3VA 4RHXA 3VTZA 1EB8A 1U7DA 2AG5A 2ID4A 3HDYA 3O4VA 1SKBA 2H1RA 5B1YA 1UDXA 4AIRA 4R5MA 2W6JD 3HUEA 3HVHA 1JNYA 4JGIA 4JVNA 5D8DA 3ABZA 3AXTA 4E5DA 4J0JA 1KBOA 3EDCA 1GFSA 2OBLA 2WKQA 3A9TA 5BQFA 1GPNA 1T15A 4HXYA 4AO8A 3V4RA 1YVPA 4JU8A 2OXRA 5D3MA 3FCEA 4EKYA 2F55A 4DQKA 3GJ3A 2DSNA 4TYMA 1Q7EA 1CE8A 5FUWA 3FYUB 1VJRA 1N36B 2AEMA 2GPJA 5HW0A 2ACEA 1CU1A 1OWLA 3IP3A 4JB2A 1BX0A 4UDXX 4UBOA 1HA3A 3N9IA 3VR4D 3WK9A 3RVJA 4B9AA 1B74A 1OOEA 5ALIA 3IRUA 5JFGA 1MFPA 4PY2A 5ILOA 4KZPA 3FYSA 4QPJC 5AW8A 4RZIA 3SPXA 4QT4A 2D00A 1A9YA 2PR2A 2IOFA 5HE9A 4G25A 1UKEA 4DJDC 3SHQA 1EVZA 5TQ2A 1QGAA 1QDLB 4FINA 2IGBA 1WXHA 3CINA 2TMDA 5JH7B 3LSYA 1PG5A 2JVKA 1PLLA 1UBHS 1ENPA 2PSSA 2VHCA 1IOLA 2ZTMA 3N05A 4AMVA 3G88A 3HJNA 3WLTA 1UT8A 4Z7QB 2UUOA 1YDEA 5JSHA 2G1KA 3ND6A 4PZAA 1XDBA 5B53A 4DARA 3MCWA 1SULA 3IDAA 4LJ8A 4PWZA 3BMNA 4P4LA 1XVIA 2XIJA 3L0SA 3G3EA 3OFNA 4JUIA 3RQSA 4ZJYA 2P4HX 5JD5A 2GBFA 1G98A 3T7CA 5HS4A 3WMRA 2R00C 1L2TA 1TC2A 4MB0A 3GX1A 4KDCA 1GQRA 3FBWA 3P9IA 2E4AA 3B6JA 3Q3JB 3MS4A 5ERXA 4LBWA 5AESA 4B6SA 1GPJA 1XZFA 1Y89A 1Y1LA 3REFA 4DA9A 1RJ9A 1NJ8A 1I4WA 4LOJA 2VQ6A 3T7RA 5GADl 3EXEA 4TKZA 2PCJA 5F2EA 3I6QA 1GCGA 4WBSA 3X44A 3SS7X 1H4TA 4CZ2A 5DHTA 1K7EB 3IMCA 4YUZA 1RRGA 1N9GA 1DJOA 1QTNA 2BMAA 3LRPA 2HRDA 3A9SA 3IAS1 4KXLA 2QPOA 3TZHA 1VE9A 2PYZA 1KOLA 3HSYA 3LA8A 1WVGA 3F3SA 3IIIA 2XT6A 1T9BA 4YP6A 4QEDA 2HREA 2ZWOA 4Y98A 3WGOA 3DMPA 1L8XA 4A27A 2ZAMA 5KMGB 4ARIA 2H9AA 1VIYA 2P69A 2GO7A 2ZR8A 4F6LA 3UJ7A 1GT91 4CG1A 2DCMA 3ZWAA 4TL7A 1HT1E 1QV7A 1SVKA 3FRJA 3JD2A 1L4FA 1W4BA 2QRHA 4W9NA 3DM9B 3BL8A 3HNPA 3WADA 1P5JA 4M8NE 1GL6A 2OCXA 1YRQA 4ZT5A 5KU1A 3CVXA 2IY8A 4CM3A 4HG2A 4GFDA 4D92A 1Z33A 2JK1A 3HCNA 4EKIA 3U16A 2VDQB 3F9IA 1DOAA 2JGDA 3FHJA 4DLTA 2VTKA 1OIWA 1GN9A 3LGAA 2OORC 4NICA 4V39A 2E4WA 1Q92A 4MUAA 5CT4A 2XYGA 3RFXA 3COZA 4N7JA 3D59A 1WHSA 2R00A 1C7QA 1ECBA 5AYVA 3WWYA 1IZZA 1WDLA 1XAHA 5L3SB 4RIIA 2ZRAA 3D8NA 3FFBA 2IZ5A 4PGGA 1PGNA 3GGDA 2OHVA 4ND3A 4QLBA 2R4QA 3ICQB 3CNEA 3K6KA 2P11A 1SUCA 3ZTYA 3U7FB 1O6CA 5H82A 4DAOA 4P1ZA 1FFXA 2VCHA 2YXDA 2OZEA 1ZGAA 3DWFA 2ODWA 2Q07A 4IGKA 2O8EB 3SFZA 1CUEA 2O48X 1F8UA 4L6AA 1TYEB 1RQGA 1IXRC 5TMEA 1CUGA 1OWNA 4B47A 1W0KA 3F49S 1E77A 1GGVA 1SK8A 1UK9A 2FMKA 2R97A 2XNKA 4Z86A 1KMQA 4QYXA 1H2WA 2GETA 2AUMA 3GA7A 4WEOA 4EBBA 3URMA 2VZ9A 5EJ5A 2XXAB 5T6MA 5BNTA 1FFAA 2PAFA 4YRIA 4R1QA 4M3NA 3KSBC 3T1QA 3IAS6 4HGQA 4YJHB 5JSQA 1LK0A 3ICWA 4CDRA 3B3GA 2ODBA 3T61A 3PUZA 4LBVA 2HJGA 3VV3A 3A1DA 4DY4A 2BW0A 2QQGA 2X4IA 4KLAA 2ZIZA 5AQEA 5AR1A 4HZGA 5F98A 1B3RA 1P17A 1YI8A 2TMKA 1NW4A 2QE7D 3DBIA 4LEIA 4W99A 1OGJA 4QUHA 1M3SA 1JDUA 5ICCA 4WZBA 1UDBA 3FOBA 1COWA 2AFIE 2WOJA 3KOZA 4TRNA 4TSRA 5LVAA 1M75A 1EM8B 3AIKA 3VJKA 4E4RA 3ADOA 3QWBA 1SHTX 2DC1A 2PZKA 2YWXA 3T1YB 3T34A 2C4VA 4B8WA 1S6YA 1XZAA 4AQ7A 4JEHA 2PLWA 1P2VA 4E09A 1IHUA 1ZGJA 5JXWA 1X0VA 4KQEA 1E7QA 1G4UR 3PPIA 3OX3A 5AI4A 3KFXA 1KC1A 3HDQA 4YT2A 1D3AA 4YFVA 3GBVA 4URWR 3HFRA 4CIAA 2UU9B 2YYZA 3BS4A 3UAZA 1JDSA 3DEHA 4Y1GA 1HYQA 2JFPA 4LK2A 5EZSA 1XJ0A 3BQNB 1Q15A 3H5LA 2Z1DA 3L0BA 2M32A 3O03A 3ZI7A 5A3RA 4MUIA 2PWZA 2Q3LA 1HFKA 3FZYA 1E1MA 1XJQA 1OA0A 1X1CA 2JJ1A 3OAAD 4J0KA 5C5IA 1LNZA 1Y48E 4DA6A 4EA8A 2CBZA 3NT2A 4RKRA 4ZV4A 3G1WA 1Z5ZA 2YZNA 3I1JA 1MOSA 1PJRA 3CJRA 3BWDD 4M99A 3MFQA 3WGYA 3WKCA 5JXIA 5LBIA 1XQVA 3UH0A 3HHEA 2EFEB 1JKJB 4GLBA 5DSZA 4C1NA 5L4SA 4I14A 1M5RA 1PQYA 3JQAA 1LH0A 4QOIA 3TVTA 4X65B 1KS2A 3HCCA 1N0HA 3WWEA 1CQJA 3QV2A 2VHWA 4RHUA 3GEPA 1EHIA 2O3JA 4NAVA 1ZI9A 3HB4X 3DEIA 3FGOA 1J21A 4J0IA 1TO2E 4B1FA 5IDVA 3TNJA 1V5EA 2X4DA 1RYNA 2WJGA 3KSDO 5AHKA 4A8TA 2OAGA 4BMCA 2QYOA 1JLLB 3RUPA 121PA 1U28C 5DNWA 3GI1A 3R9IA 3DW3X 2X2EA 2PXCA 4QHTA 3KETA 4B43A 3DL0A 3UMMA 3FSJX 4KAFA 1GQ2A 3H5IA 4KPEC 1DC5A 1LDGA 2XDAA 5DB4A 5EJGA 4ER3A 4HVTA 2ORWA 3PC2A 3FZGA 3OQVA 4X3CA 3JSAA 4IJWA 4PX3A 3ANTA 3DQQA 3I12A 3I9MA 1JB9A 3MINB 4HTAA 4AJJA 4C4XA 4DG9A 1RZRA 1DO8A 4CUKA 4F1WA 2X19A 2Z6UA 1T4CB 1NFFA 2GRAA 3N07A 4OKIA 2I6TA 2EZUA 4BWVA 4CMBA 2ZS9A 5IRCD 1B8VA 2J9FA 4XGIA 4R3UC 3S40A 4D4HA 5ES4B 5J2UA 4IWXA 1T9KA 2BFCB 1YRLA 3ORQA 5FBWB 2WUFA 3N7TA 3FLAA 3NTUA 1U2TA 1ZX1A 4C7KA 1R6TA 1QQBA 5HQ3A 4RAQA 3O1IC 5ER6A 3OJCA 3VQTA 4MVJI 4FGZA 3C70A 2FR8C 4L4UA 1IJBA 1LDNA 2BFBB 2F1KA 4PC6A 4ZD6A 2ARKA 3K4PA 4GPBA 5COBA 3WKDA 3AZOA 1R0BA 3FTNA 3HKCB 3MT0A 1RT9A 2C7QA 4CIYA 3QUBA 1LBSA 4QBHA 4C4SA 2JIDA 4X66B 3AWDA 1U5BA 4K40A 4ZQIA 1D9ZA 4ZVQA 4EAAA 4Q3DA 5DSXA 3VJRA 3COYA 3H18A 3AGPA 2WYIA 3MGAA 4C0LA 4V0LA 1JBEA 4Q1CA 4LYGA 5ERYA 4W9MC 3TMAA 1M0EA 4R1UA 4MYTA 5HG0A 1R16A 2QSUA 2YX1A 4FE4A 4QUBA 3C8MA 4KXNA 1E66A 1E7SA 3CLSC 2BEKA 3IVAA 4QASA 5REQA 2O8BB 3HMQA 2QIPA 1I4LD 3UUWA 3T7DA 1IATA 3R0ZA 3NHFA 3P5BA 2O4CA 2Q6KA 4A7PA 4RUKA 4JLAA 3VOAA 2XIQA 4NBVA 1AV6A 3LCJA 1CVLA 1C3OA 1QLWA 5J63A 3RT1A 3GFBA 4YQZA 4ZI5A 4AZWA 1I1QB 1AN0A