5LB4A

Apo-structure of humanised rada-mutant humrada14
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
229
structure length
211
Chain Sequence
b'TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSAMYIDTENTFRPERIREIAQNRGLDPDEVLKHIAYARAFNSNHQMQLLYQASAMMVESLNTDRPYKLLIVDSLTSHFRSEYAERQQKLARFLAMLHRLANEFDIAVFVTNQATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein RadA
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Hydrolase
total genus 74
structure length 211
sequence length 229
ec nomenclature
pdb deposition date 2016-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5lb4A00
3THYB 1XF9A 3U2QA 1P72A 4OK3A 2OFWA 1E3MA 4I4LA 3RANA 1V5WA 1Q3HA 2E9SA 4LHWA 1XXHE 2G9NA 4C9BA 1SULA 2VF7A 4A36A 3OIYA 2IHBA 2GBLC 5FH9A 1KI7A 4EJSC 1UBEA 1ZUHA 1A2KC 2GHIA 4ITRC 1XCPA 3UWOA 1XCGB 3OEED 4TMZA 5FBQB 3VTKA 4NCKA 5JI2E 1KO7A 2XOKA 1QG4A 4QBGB 4Q02A 3U44B 1LF5A 2WJJA 1R8QA 3ADBA 1F2TA 4JVSB 3THXA 1YZGA 2JIZD 4MRNA 5EP4A 5B58C 2VPPA 2ZSAA 4WIAA 3FFBA 1X8JA 3PEUA 4GP6A 2ERYA 4LGMA 5KYKA 1XPRA 2F1JA 2CBZA 4N0EA 4AYWA 2WPDD 1E32A 5JBQA 2QTHA 2RHDA 3U3RA 2E87A 4N0DA 4UXHA 4ZKEA 1S96A 3B85A 4JKYA 1VCOA 2B8TA 4XSGA 1R0XA 2ERXA 2ZJAA 3DM9B 2FF7A 1N3BA 2IS2A 3OHMA 4Q19A 2PMKA 3BAFA 2VO1A 3UANA 1Z2CA 4OK6A 2IYRA 2N1BA 1LY1A 1VHLA 2N46A 3FMOB 3TSWA 1U94A 3QXHA 1U90A 4MKFA 1M7BA 2ZETA 3ZD7A 3PEYA 2ZRPA 1T8UA 2ZJBA 3TLXA 1OPXA 3PUVA 3VNVA 3T15A 2ZS7A 2HT6A 3CPEA 4OHZA 4A2QA 2G77B 4PO1A 1XXHA 3AKYA 2JLVA 4F93B 4IVPA 4I1UA 5L3VA 3LBNA 5ELXA 1Q1BA 1XD2B 3I4LA 3O8DA 1LTQA 4Q9JA 3V4RA 1ODFA 4TT3A 4PR0A 2PCJA 3A1SA 1OH6A 4X8MA 4ZDJA 1II8A 1P60A 1E94E 2C04A 3KKMA 4XTCS 1CJTC 3W3ZB 1SVKA 4ERNA 4NYMQ 5FTNA 4L4UA 3K9LA 4Q4HB 2H17A 3A1TA 1ZM2A 3T1OA 1BMFA 2BM0A 3RLFA 3EZ9A 4CF7A 1M1YE 1JBKA 1XMSA 4JIMA 4DSUA 1OXUA 3EASA 2WWIA 3CH4B 1H8EA 1E2JA 3KJEA 4PC7A 2J7PA 2NG1A 4HAXA 4M21A 1GRNA 4EAQA 5BW8A 5JS8A 5TVKA 3RRNA 4O2RA 1XD8A 4B44A 2CK3D 3G5UA 4D80A 1GITA 3AVYA 3O8BA 4P4SB 5HTKA 3IIKA 3GJXC 1WP9A 4HDOB 3W8NA 3SFZA 4UNRA 4G01B 3U3MA 4LCBA 2AHOA 3DMDA 4Q03A 2B6HA 4K8OA 2A3RA 1XZQA 4Z8XA 4AG5A 4FD2A 1GDDA 3MMPA 1I4DD 2QQ0A 4M1SA 4V0ME 5JRZA 3R9WA 2J46A 3KJIA 2GK6A 1NSTA 1VG8A 1KHTA 4X8OA 4BZQA 5JLJA 3KKOA 4PAQA 2IL1A 4H1UA 4NKRA 3K9NA 1DAGA 4QRHA 4L9SA 3Q8XB 1S3GA 2ZE6A 2GJ9A 3QVUA 5DLQC 1Y63A 5JEEA 4BFXA 2IYVA 3I72A 1G16A 2YYZA 1QVAA 4GOJA 4Q1FA 5DGXA 1SVWA 1QG2A 1CJMA 3B7GA 3JVUA 2XX3A 3AUXA 1DAFA 2NZ8A 1U0HC 2H57A 1KDRA 1YR8A 4PC6A 3ZJYA 1N6OA 1US8A 1OB5A 4K46A 1XMIA 3O8RA 3PUZA 4NCHA 3MWYW 1KSGA 3IEVA 2CDNA 5FI1B 2R2AA 2WWYA 2ZIAA 3GLGB 2Z43A 4QJ5A 2BBOA 4NCIA 2FPKA 2IWHA 2A5YB 3KX2A 2CNWD 2BBSA 2GESA 3LY5A 3O47A 2QM8A 1UM8A 3MWKA 1T6NA 4LV8B 4TL9A 4B2PA 4BEJA 3TW8B 4CRWB 2NTYC 1U8ZA 1PLKA 2AXPA 2ZJ5A 2G0TA 3VKGA 3BIFA 3FWYA 3MUFA 3U3KA 3BH7A 1KI1A 4NYIR 3T35A 4F38A 1SXJD 4KYIB 1G20E 2BCJQ 1W5TA 2EW1A 4XWKA 1OV4A 3NHAA 2ZUDA 1G3RA 3LDAA 4TYYA 3Q72A 1UEIA 1XRJA 1KI6A 2A5GA 2AFIE 3HPQA 5LBIA 4D4LA 3GLFE 3TUJC 4V0MA 2GKSA 2IF2A 2VYFA 4C0QC 5C2JB 3SYKA 2C9OA 2VHUA 3Q85A 1PLJA 3AVOA 5AJWA 5DI3A 4A82A 2VSFA 4TMTA 1J8MF 1YVDA 3DOEA 4FMDF 4EPXA 1NY6A 3E70C 3OE7A 3TMKA 1NMXA 3C5HA 2ZJZA 4M9QA 3B78A 4WOPA 4DEXA 3BH0A 1RYHA 5GJCA 3TK1A 2IT1A 2QEQA 2RAPA 4QGHA 5FUYA 1LW7A 5FR1A 3U4QB 4GDFA 1C9KA 3UPUA 2IUTA 4GP7A 1JJ7A 1L7VC 2AD1A 3C5CA 2YKGA 3L0PA 2QA5A 4FMCB 2HCJB 2R6DA 2AKYA 4TYQA 1E2DA 1KK2A 5D3MB 4D4KA 2NIPA 4IHQA 2O8BA 5F3WB 1D5CA 4OI2A 2RGEA 3WYFA 5A5GA 3HP1A 2NO1A 4RCZA 1TEXA 1Z0AA 1IJEA 5FPHA 1NMZA 4PPQA 3JZMA 2JEOA 4TL7A 3DO6A 3GJ7A 4D0GA 4FN5A 5AJXA 1XNJA 1XMVA 4R71A 1YZTA 2YWGA 4CEHB 3VR6A 3L43A 3TR0A 1E6CA 1Z6XA 1M74A 1FPMA 3SYLA 2ZXUA 2FEMA 1XEXA 2BC9A 3GFTA 2QU8A 3EAQA 1KJWA 1LFDB 1XTIA 1OHHA 2HF9A 2R6GA 2JLSA 1OKKA 2AR7A 3GLFA 2G1KA 1GRRA 3W5JA 1TAGA 5FOWA 3VR2A 2H5EA 1G7TA 4IXMA 5HZHA 1XZPA 4M1YA 3ZS9A 2G3YA 2GJSA 1KY2A 1G18A 4DLRA 1TQ6A 4JKIA 3X1YA 4QBFA 3FKSD 3X1XA 1R2QA 2Z5FA 1OYYA 2WKPA 2G0NA 1Q20A 2DPXA 5FFMA 2EYUA 1A1VA 3ZD6A 5JJKA 1QHHA 3QXSA 2YOHA 4MKGA 1G5PA 1KIMA 3B5JA 3I5XA 4C30A 3SN6A 4OBEA 1E1RD 3Q5EA 4HB2A 4Q00A 2QP4A 3OFND 5JWHA 4ZCIA 2MMGA 3PUWA 4B73A 4DXAA 3A1UA 4QXAA 5CLLA 4PC3A 1NKTA 1GIAA 2REOA 4GBMA 3RAPR 1U2RA 2QP3A 1GNQA 2JJ1D 1EK0A 2GZAA 3B1YA 3E1SA 4MRRA 5FR2A 3Q5DA 2H1LA 4LJ7A 5KU1A 3G82C 2D7DA 5P21A 2FZ4A 1HEIA 4Z54A 1JR6A 2Q21A 5FOVA 3I61A 4DLWA 3LVRE 2DBYA 2ZRNA 4DUGA 2QPAA 3BK7A 3QOFA 2BEJA 2OM2A 3Q9LA 2DWOA 3T1TA 1OJLA 4OQMA 3A58B 3C8UA 1TX4B 3BFXA 1D2EA 4LYJA 1E2KA 1D8TA 2OUKA 3A37A 4XJXA 1O3YA 1KO8A 3K0CC 4XWAA 4TTQA 1KI9A 2B92A 4Q7JB 5J4LA 1Z8FA 4BFWA 4B2IA 1C4OA 4XOIA 4GT1A 1NJGA 2OCPA 5GVRA 1KZ7B 3N5CA 2C77A 2P65A 3SS8A 3R20A 4JLOA 2HF8A 4CW7A 2FG5A 2XGJA 1VHTA 3K70B 4E09A 4F91B 1QHNA 2JJ2A 2WWXA 2YVUA 2PX3A 2FE4A 4CT4B 4DCVA 4FWTA 1BIFA 3BXZA 1OF1A 1H8HD 3VR5A 1G3UA 3EZ2A 4US0R 2ZSBA 1MH1A 1BOFA 3ECCA 1GKUB 1IN5A 4DB4A 5CK4A 5FUWA 4TYWA 1QVRA 4ON9A 3C7KA 3KTAA 4IOJA 1SGWA 5AJVB 2VHJA 4RY2A 4Q1DA 1KI2A 3CM0A 1G4AE 4DCSA 5GJBA 4G0NA 2ZS8A 3ZGXA 2D7CA 3RWOA 4HB4A 4GMDA 3IBGA 3O8CA 5JJLA 2VL7A 2R6FA 1D6JA 1OH7A 1G8PA 1GOTA 3F3YA 4BFUA 4YMSA 2XB2A 1T8TA 5G3ZA 4KFUA 1T3LA 1NLFA 2QMOA 4MYTA 3ASZA 3C4JA 4QHTA 1F2UB 1G8GA 2JATA 3RS7A 4N1AA 1SXJC 2FU5C 2VP6A 1IXZA 4TLDA 1JB1A 1UKZA 2W0SA 3A36A 4XD7D 5E4FA 1Z0KA 1E9CA 4CEIA 4MYUA 4QM7A 3FB4A 1RZ3A 3EC2A 4O0MA 4D2IA 6Q21A 3CR7A 2ZTSA 2C9CA 1G8HA 3FVQA 4LDJA 1ZUNB 3BBPA 3H4MA 4YDHB 2HEIA 4MGZR 3GJ6A 2XSZA 4KLNA 1XB2A 3EZ7A 5DNYB 2ZRKA 2Z83A 1XPUA 2XXAA 1N0UA 2G83A 2JDIA 3TBKA 1E2EA 2IYLD 3K1JA 2NO7A 1R5BA 2I4IA 3GLHA 1VECA 1FX0B 1GRQA 4UXIA 3H1TA 721PA 2QQEA 3C16C 4D25A 2JLUA 4AD8A 2A5JA 3EXAA 4OK5A 3QIAA 3RHFA 4URYR 4MGKR 1GP2A 1VIAA 1CULC 1J99A 3KQHA 1P7CA 5DYIA 3WHKA 4B3DA 2WKRA 3OAAD 4LHXA 2ODBA 4TL8A 5KNBA 1XTRA 1UAAA 2GCPA 2VP2A 4G5QA 3NTUA 4NZYA 1B23P 2ONJA 1F2TB 1XP8A 2J45A 1L2TA 2V1UA 2BM1A 3THXB 2EFDB 1DAEA 1KGDA 4JMPA 5KSZA 3NIBA 4AYXA 5KPJA 2VP5A 4DDWA 5KPDA 2GXUA 1EXMA 3PUYA 4MKHA 4B35A 4QBIA 4MDEA 3LD9A 4FMDB 3WYAA 2ZRIA 1R0ZA 3LV8A 4M4SA 1DPFA 3ZIAA 2AK2A 5DI9A 3WNBA 5TMPA 2XNDD 4UNQA 4DCUA 2VH5R 1KSFX 1RE0A 3C41J 3A4MA 2WWHA 4PC1A 1AIPA 5FTKA 5HKKA 2X1VA 4G3XA 4LBVA 3B2EA 4A4DA 2ZI4A 4GRAA 5G40A 2F9MA 2LWIA 1NVVR 1E2IA 2ZRMA 4RFSA 1P6XA 2X77A 3KL4A 4GI7A 2R65A 1T0JB 2ZVPX 2WJIA 1Z6AA 2VQSA 3L0IB 2PZFA 2A30A 1IAQA 3GJ5A 4A9AA 5L3SA 1COWA 1KYIA 3D8BA 3L0SA 4LUCA 5AR1A 2F43A 2V3CC 1U0JA 4JJKA 4PO8A 2V9PA 3HPRA 5K8UA 1DO2A 2GAAA 1XXHB 3L2OB 3MWJA 4H9GA 1DO0A 2YC2C 4OJQA 1Q0UA 3RS2A 1KO5A 3SE0A 1IOZA 2ZYTX 1JEDA 3EG5A 3EZFA 1E1QA 2P6NA 3DEFA 3ZS8A 5IK2D 4A8JA 2R44A 1MOZA 3TGPA 3LBIA 1II8B 4OI4A 1NBMD 3FFAA 3QG5A 3HYTA 3RS3A 4XIGS 1NNEA 2ZSEA 2F6RA 5IHPA 1OW3B 5F98A 1HYQA 5EE3A 2V8OA 2QAGC 3QJYA 2QBYB 3OF5A 3THWA 5IRCD 5EXPA 2OLKA 3WXMA 4Q9HA 3EPLA 3GCGA 4Q4AA 5HE9A 4LV6A 2IYQA 4HAVA 1TU3A 4IVRA 2DB3A 3FPAA 4C7OA 2WJGA 1VIYA 1P3JA 1DS6A 3H84A 3OEEA 4TQUS 2BOVA 3PEVA 3A8TA 3I8XA 2GNOA 4YMUA 1GFIA 4Q1BA 4KJZA 4Q48A 3WNDA 2JIZA 4P32A 3BWDD 1Z08A 2UZ3A 3TAHA 5FL3A 1S4QA 5HCNA 3EA5A 2VIIA 3H0KA 4DWJA 1CEEA 2F1IA 1E2QA 1DAKA 1OFUX 3IGFA 3EIQA 1NG9A 1PJRA 3VFDA 1WCV1 1BS1A 1E2FA 1RFLA 3FGNA 2DYKA 4KFSA 3KDSE 1WRBA 1Y3AA 1Z83A 2FMXA 3B6EA 3CRQA 1PV4A 2QPOA 1AM4D 3CX6A 3U3JA 5EP3A 2VP9A 4RD0A 1OB2A 2I1VB 1YZLA 1G41A 2D06A 2DFTA 5IDVA 4TSFA 3R7WA 1FQJA 1SVSA 4PQFA 3SJZA 4D4MA 3T5DA 4XVUA 2BV3A 2J7KA 4Q1AA 3CB4A 2D4HA 1E9SA 4FIDA 2EU8A 4QOSA 4D26A 4CGZA 2QTFA 3OEHD 1N0WA 3IQWA 3NC0C 3KKQA 2ZM5A 3SQWA 1FNMA 3SQXA 3EZ6A 1DTSA 1US8B 1KNXA 1ZD9A 1FFHA 2FEOA 4DVGA 1FW6A 1SVLA 2QRZA 5EXSA 4KITB 4BLRA 1OE0A 1W0KD 5KDDA 2QPTA 2AKAB 2QSZA 1X8KA 5EZ6B 3HR7A 2PJZA 1I4LD 2Y8EA 4FCTA 3WMEA 4LBYA 1VG9B 2IF0A 3EARA 3TNFA 1OIWA 2A78A 4KYUA 3THOA 5JS7A 1GL9B 5J4YA 4IDNA 2GETA 3KB2A 4LHYA 1KSJA 3V9PA 3BFKA 4DCNA 3KQUA 1QF9A 1KI6B 3PCRB 3PV0A 3IO5A 1NP6A 4TWZA 1ZJ6A 2O8EA 5KUTA 4O2LA 3JZAA 1PVOA 2VHCA 4M9SA 2DHRA 4NMMA 3T5GA 2AD5A 2C95A 5DI3B 4PZZA 4RZXA 5M04A 1MABA 3TE6A 3CIOA 1XTJA 3F8TA 2CK3A 3OZXA 5TB5A 4B6FA 3I32A 4HZUA 3RRZA 4LRWA 2OESA 1S0UA 4PHFA 1II0A 5FUVA 3TUIC 3U7EB 3ZVNA 1P4SA 1SXJE 3PVSA 4L9WA 4BWYA 3LNCA 1GSIA 2BMEA 5EUMA 4HAWA 4IRUB 5CB8A 5B2ZA 3P26A 5K8LA 1NRJB 4E5UA 1AN0A 4ESVA 4WZ6A 2PJRA 4LK2A 1GAJA 3A4NA 4LOAA 1Q57A 1T3SA 1VDZA 3KJHA 2O8BB 1E4YA 3WYGA 1XX6A 1KI8A 1AZTA 1RRGA 3GLIA 4B71A 3CNNA 3TQCA 3CW2A 1HT2E 2R6CA 5CJ2A 3T34A 3NBZC 2O8DA 1M2OB 1G7CA 1JQJC 3L8ZA 4P4TA 4AKIA 4JVMA 4GFDA 5EQTA 4PX9A 1VTKA 3V00A 4Q9LA 4P0TA 1OLOA 3TVDA 5B30A 1LV7A 4I1OA 3WNCA 1E96A 4NH0A 1XEXB 3NKVA 1K8RA 2OHFA 1Z28A 4BLSA 1G7SA 4B48A 1HTWA 2J87A 3LX5A 1BH2A 2KE5A 4JVLA 1JEEA 1W4BA 5EP2A 3GLFB 1Z6TA 1T5IA 3CWQA 4I99A 1M6NA 4B2LA 4B74A 2ASEA 4GZMA 3B1WA 4E03A 2VA8A 2PZEA 3LRPA 4BECA 3NC1C 2ORVA 4BEBA 5J4KA 3PEWA 2HLDA 2CNWA 4UKDA 2V6IA 4NYJQ 3VNUA 1DEKA 4TTRA 1KK0A 4NCJA 3TH5A 3LWNA 3VU9A 5JHGB 3ZH9B 3RC8A 1T91A 1R5OA 5J5CA 1XWIA 3I62A 1QHHB 3P27A 2W6ID 4KI0A 4PHTA 4EPYA 4ILEA 2GDJA 4RD1A 1GUAA 2IYUA 2JLYA 2EYQA 1GKYA 5A0FA 3FHCB 1WDTA 3M4YA 2P6UA 3RDPA 4YXWD 1R7RA 3QKTA 1ZNXA 4KODA 2ZS9A 4XH9B 2O8FA 1XTSA 1ZIPA 5KTYA 1E2HA 4JLVA 1E79A 3RS5A 1IY1A 2AK3A 3TR5A 2YOGA 5JCZA 1G7RA 2GXAA 5TY0A 4QKQA 3W90A 1KAGA 2QSYA 621PA 2QM7A 4LJAA 3TVTA 4DC9A 1FTNA 4W7SA 5BYKA 3PR1A 4F4JA 1SVMA 2OE2A 4URVR 1NN1A 2QRNA 1W2GA 3KQNA 4NCNA 1YQTA 4QJ3A 2FSHA 1G9XA 4XVQA 1Q1EA 1XDBA 4RD3A 1N0VC 1OIXA 3LAWA 2EFCB 2OFOA 2R62A 1OYWA 1N5LA 2AWNA 3IDQA 4IDHA 4V03A 2H8KA 1M34E 2VRWA 2EFHB 3EWSA 1DARA 1QRAA 1U8AA 5CYPA 3SC3A 4OJKA 2OCBA 5F9HA 1W36B 4DSTA 1XEWY 1X3SA 1TEVA 3W6PA 2IBMA 1YJ5A 5DSZA 1XJ0A 1NI3A 3UXMA 1OT3A 1QHXA 1IBRA 2BCGY 3HYRA 2IYSA 2ZE5A 4FXPA 4KSBA 2ZRHA 1Z63A 3B8HA 3K9GA 3A1VA 2R9VA 4JS0A 2AFHE 2R6AA 4C4PA 2ZR9A 2WWFA 3EX7C 3KKNA 5GJWC 2IUUA 1W0JA 3ZVRA 4GSYA 4LJ8A 2DFNA 3R9IA 4TLBA 2FSGA 5AUPB 3CNLA 1ZMXA 2NZJA 3UMRA 4FWIB 1U99A 4NE2A 2V4ZA 1N5IA 5EP1A 3LFUA 3LW7A 3SBEA 3KTAB 4G5RA 1AQYA 4HLUA 3QKRA 1NVXQ 4RFVA 1DE0A 4B3XA 2FGJA 4BLOA 2VLIA 3OFNA 1P9RA 2XJ9A 3BB4A 2OBLA 4LHZA 4B34A 4GOKA 421PA 5CIQA 1UBFA 3AVVA 4R2IA 2ZRLA 3I92A 221PA 2G1JA 3ZQ6A 1AS3A 3S1AA 2BBWA 2BDTA 4CEIB 3WP1B 4MGYR 3CNOA 4ARZA 2FZLA 5H70A 1PUJA 3VQTA 5TV2A 4XSHA 2HCBA 3DZDA 4G5GA 4LV5B 1P73A 2CL0X 2P5SA 1CRQA 2FFHA 5G41A 2FX3A 4KVAA 4L15A 2QZ4A 1LS6A 2ZR7A 3DVLA 3GPLA 2ZAOA 2ZJ8A 1KJYA 4AKGA 4ASUD 2H16A 2YZ2A 4LWZA 4IW3B 2XXAB 3VKHA 3QQ5A 1XCMA 2FFBA 1RIFA 1G8FA 3GLHB 5B57C 1R4AA 4IDQA 4EUNA 1P2SA 4PHGA 3T06B 1NIJA 2NO9A 2PLFA 2ZAMA 1ZD8A 3NH9A 2ANBA 3KB1A 4WZAE 5BYJA 2ZRAA 5J4VA 5CM9C 2V6JA 1S9HA 1Q1QA 3ZZTA 2ZYWX 2CJWA 2OXCA 4IEEA 1N6RA 2FDCA 1VCNA 3VAAA 4U5XA 3FDIA 3U5ZB 1VG1A 2ZQ5A 4Q7MB 1OFTA 3I1FA 3SI7A 2P6RA 3RWMB 2X19A 4UXJA 2HUPA 4M53A 2IX3A 3DKPA 3QSYA 2H18A 1HURA 4P33A 1G6OA 1KOFA 1N6HA 3BOSA 4B33A 1GVNB 4BE7B 4EFMA 3TQFA 3R8CA 1W2HA 4TT3D 1BKDR 1SHKA 5DHFA 4Z1MA 521PA 2QN6A 4D0NA 2WOJA 3DKVA 2GA8A 3P20A 2NPFA 1U9IC 1ZNWA 4LC0A 1BO6A 1H8HA 4OHWA 2IA5A 1E0JA 4DIDA 3BERA 4BGDA 3AVTA 2ZI9A 2CL7X 2OAQ1 5EE5B 4GMXA 4KFRA 3I73A 1L4UA 2FPMA 3BFVA 3CRW1 4KFTA 4MH0R 1IY2A 2NPIA 3K0AA 2JLZA 2ZE7A 2BHRA 1Z3IX 821PA 2WJYA 1H8ED 2GRJA 1G3IA 4KV9A 2J7PD 5FTMA 2OAP1 2J0UA 1HE1C 4RFSB 4HLQB 3U44A 5DH9A 2IYXA 3TAUA 5AUQA 1TF2A 3SJCA 4E07A 1U0LA 5L3SB 3QXCA 2F43B 4XD7A 4TYPA 3NH6A 3AF0A 3IPXA 2FV8A 4FI3C 3PUXA 1G3QA 1M8PA 3CF6R 3G0HA 5JFGA 4MUAA 4B3FX 5GJVC 4JT4A 4QG7A 1IXSB 4A8JB 1JJVA 5L3QA 2W6JA 5G3YA 1TQDA 1WMSA 3NWJA 1P9WA 2V7QA 1ESMA 2MMCA 2QE7A 1OXVA 2WJHA 2C78A 1IN6A 3AP2A 3K70C 1IY0A 4M0LA 3GEEA 2J1LA 2IHYA 4IFBA 4JSYA 4RZ2A 1HE8B 2LKCA 3FTQA 2OO7A 3AVWA 2MSCB 2PT5A 3UATA 1Q3TA 1ZP6A 2G88A 4LHVA 1WE2A 2ZI5A 3AM1A 1KDTA 4HEJA 4AURA 3THWB 1L4YA 4WW0A 2W0MA 3UKDA 3QE0A 5HPYB 4Q4AB 1JNYA 3VX4A 4B3CA 2HV8A 1KZGB 4US1R 1ZM4A 2RH5A 2DCUA 1OH5A 4C7OB 4GNKA 1DOAA 4JBXA 4YC7A 1EFCA 3K0FA 2KB0A 1N2CE 1NKSA 4B3GA 1GKIA 1NBME 2GBLA 4ACBA 4EJSA 3L82B 1CR2A 1KMHA 1JALA 1S2MA 5E7IA 1DVRA 1NN0A 2OILA 2OEPA 3C15C 4JBYA 4UQOA 4KBFA 1VYVA 5F2EA 4EKDA 4DRZA 1E9DA 2XNDA 5DN6A 4CEJA 2ZR0A 4IDOA 4QJ4A 2QORA 4N3NA 4IXNA 5KSPA 2GEUA 3CRVA 3LVQE 3DDCA 4A6XA 3PG5A 1GTVA 2GZHA 4C3ZA 4LSGA 1PUIA 4JLJA 3GLGE 3R7WB 3D31A 3OESA 2E1RA 4CZ2A 2CHQA 1S1CA 2ODEA 2JCSA 2PCLA 4DSOA 3CX7A 1BYIA 1WXQA 2YINC 2V55B 1E9FA 1AKEA 1JPJA 3BJIC 2IWRA 2ZI6A 4DT1A 1NN5A 1UKEA 4EPWA 3TKLA 4A15A 1R0WA 2KI5A 4AG6A 5HCIA 2F3TA 1SKYB 1WBBA 1QDEA 2BMFA 2WSMA 2WBLC 5E95A 4Y0VA 1P2TA 4UNPA 3NEJA 4W9MC 3K9HA 3CPJB 3EPKA 5IK2A 3CZQA 1SKQA 4A0HA 4PXAA 4YDSA 1R10A 4ZDKA 1NLZA 4TMWA 1C1YA 1XEWX 5BN4A 2Z6VA 1AS0A 1YU9A 2DY1A 2VBCA 2ZPTX 4L5BA 4AWXA 3DZ8A 4QNMA 4S2EA 2XTMA 5AJZA 2O8EB 3EIEA 4D4JA 4Q7LA 1W46A 3I5YA 2BWJA 3PIRA 2O5VA 1MABB 1P61B 2AXNA 4C0SA 1E2MA 1OKKD 4BFTA 3BORA 2JAQA 4HZUB 1BYUA 1E0KA 1QHGA 3ZDQA 1OXXK 5AUNB 3LLMA 4TQ9A 1N6KA 1E9RA 3SJAA 2TMKA 3LW8A 3MJHA 1NY5A 1Z6YA 4W5WA 5H1YA 5DHAA 1DG1G 3GFPA 5FTJA 3BRWD 1VYTA 2Q9CA 5C46F 1EFRD 4BZPA 3UIEA 2VF8A 5KDOA 5B64A 3QI2A 4DLZA 4NYIQ 3B82A 4AKEA 3GLIB 4L16A 4AC9A 4MYCA 2NQ2C 2V54A 1M7HA 2X2FA 2O8DB 1X8LA 4ZKDA 4WXPA 2UZIR 1W4CA 5D3QA 2MSDB 3DMNA 5FBLB 3QF4A 3MG9A 3RVBA 4DDVA 2QUZA 5ANRB 2WSSD 3OEHA 2BIFA 2ZEJA 4PANA 5LD2B 1CBUA 3AF1A 2REBA 1UEJA 1G4UR 3CRRA 2EWWA 4KO8A 1MR3F 1MT0A 3AP1A 3ZZUA 2LCFA 1XFAA 1W0KA 3EIHA 4V0NA 5DO9A 4DUGD 1G21E 2J0VA 1E2NA 3TUZC 1IM2A 3B60A 4FW9A 4PFSA 4TYNA 2NGRA 1J90A 1CIPA 3F5FA 2OBMA 3VU9B 2J3EA 5EUQB 1IONA 2ZREA 1G291 4W5HA 2CHGA 4BLPA 3K53A 2WKQA 1W36D 3AF4A 5JCPA 1CJUC 4BFYA 4EQ6A 4DKXA 3K0EA 1FQKA 1NG1A 4LX0A 5AUOB 4CEHA 2C2HA 1GILA 2NMVA 4Q5IA 2DWQA 2SHKA 2YWFA 2Z0MA 2YC4C 3DL0A 1NMYA 5JEDA 4LPKA 1GG2A 2ZITA 3U6KA 1Q12A 1JAHA 2CCJA 3QKSA 4MDFA 5JRJA 2LKDA 5JWRA 4HATA 4LY6A 3KXIA 4NYMR 2ZUCA 2ODNA 1XEFA 1P75A 2HJVA 2WZQA 2HYIC 3HJNA 4JLNA 3SR0A 1RKBA 1WBDA 2CCKA 2XEXA 3N2IA 4JLAA 1VG0B 3GJ0A 5FL7D 3IO3A 2XNSA 2Q9AA 1AQUA 1I2MA 4KU4A 3IHLA 3BGWA 4R2HA 4ZCLA 1W7AA 3PENA 3VR1A 4ZI3A 3GJ4A 4FCVA 3NBXX 1CS4C 1Q1ZA 2WIAA 1X1SA 2W00A 1S3SA 1XD9A 3N70A 1EG7A 3MD0A 1AZSC 3X1ZA 2RGBA 4JLMA 3CR8A 5KSOA 2PZGA 4LJ6A 1A4RA 1U9IA 1G8YA 3KJGA 2WPDA 5SZHB 3BC1A 1MV5A 4H1VA 4IOMA 1K6MA 3D6TB 4LPSA 2QGNA 2A9KA 1FZQA 4D81A 4BPBA 4OQXA 5DE3A 1ZCAA 1DAIA 2UVQA 3VKWA 3MWLA 4HZIA 4HDCA 3PXGA 3SHFA 2VSOA 5FTLA 1KK3A 2C8VA 1TMKA 1P2UA 5FPTA 1A5TA 2ZRBA 1WA5A 2XSZD 5AK0A 4F7WA 2FFAA 2GVDC 2H92A 3B9PA 1CP2A 3BE4A 2O52A 2GEDA 2JDID 3QENA 3IEUA 1ZIOA 1U98A 2ZSDA 2HDNB 5EZ5A 3U7FB 4PPFA 1EWRA 4QGGA 1FMLA 3EC1A 3QKRB 4B3BA 4RD6A 4KCGA 4M1KA 4Q4JA 3UK6A 3AVPA 2CLDX 1ONBA 2B8WA 3I3SR 1P5ZB 5EE0A 2EQBA 3PFIA 1LNZA 2RGAA 3PJRA 2A5DA 5CJPA 1KKMA 1KK1A 2OXRA 4TMXA 4PC2A 4U02A 121PA 4X8HA 5GADl 4G5OA 4YMTA 1ZAKA 2PEYA 3AF3A 5FBRB 2WHXA 1KKLA 3ASYA 3S1AB 2CE2X 2KBEA 4ZV4A 3MJRA 4ARZB 2FSFA 1AS2A 1Z0DA 2RGDA 2ZSFA 4HAYA 5J4HA 4JL8A 3X1DA 4NPHA 4JT2A 3JVVA 4KBGA 1AK2A 1II9A 5EXTA 1E98A 1NL3A 1NVUQ 3AKDA 1QZXA 4A6PA 1KSHA 1I2DA 4YONB 3TW4A 1UKVY 2YHSA 1K5GA 4PZLA 5FPSA 3VR4A 2AWOA 5C4MA 1G64A 5EXXA 5FPKA 1F60A 3LQRA 4JJZA 1AKYA 1ZM9A 4TLCA 2ZI7A 4LBZA 3AF2A 3H86A 3WRYC 3VHLB 4BZXA 4KLZA 4MKIA 1IXRC 4R9UC 2XZOA 3EPHA 2CJWB 2D74A 4MRPA 3FOZA 3M0EA 2P0EA 2ZE8A 1EFTA 2QNRA 3CONA 3K0CA 3KXLA 1E0SA 3KXKA 3ND8A 2J0SA 1LF0A 2IYTA 3D3QA 1ZM3A 5E7JA 5FOUA 3WP0A 2FFQA 4DLYA 2L0XA 1E1QD 2FSIA 1QHYA 2ORIA 3IQXA 3VR3A 2ZUBA 5GVSA 3LBHA 3KQLA 3GMTA 1CJVC 3CWZA 3ZQJA 4C0LA 1W47A 3CUEF 4RKFA 4LJYA 1KO1A 2O8CA 4WVFA 3RRMA 2IEZA 1J8YF 2GVZC 2RGXA 2WWWA 3RNLA 4A0GA 3UMFA 5E3HA 2QY9A 3K0AB 3ICQB 2JLXA 1CR0A 2YWEA 1SVOA 3QKUA 5F9FA 3L0OA 1UDWA 4KSCA 1ZM7A 3AVXA 2C99A 1ESNA 4A2PA 1DG3A 4KHZA 5JJIA 2O0HA 3CO5A 2ZROA 1SVIA 1ELOA 2J0UB 2NO6A 2VHQA 5E7MA 4EIWA 1HQCA 4P3YA 1HV8A 2GJAA 2GZDA 2AN9A 1JPNA 2EWVA 2R8RA 3CLVA 3THYA 1W36C 3AQ4A 2BJVA 2W2TA 3OIWA 3QBVA 2KJQA 1GM5A 2GCOA 5JZVA 2X8AA 1SXJA 3RRYA 4EPTA 2GK7A 1XPOA 1YZUA 3NEYA 2B21A 1AJEA 4UNNA 2IXGA 1HH4A 5L3QB 2RHMA 1ETUA 2CVHA 2GXQA 1RYFA 2IK8A 2WMNB 3N2EA 4TLAA 2DFKB 2P2LA 5JSZA 1RJ9A 4ASUA 4PHHA 1GNPA 1A82A 3CBQA 1R0YA 1RRPA 4F4CA 4TSFD 1JR3D 5J40A 1FP7A 4RCYA 3ZLJA 2IC5A 4M22A 4JSTA 1OFIA 3SHWA 3K70D 1G5TA 2JGNA 1DADA 3GEHA 4OHXA 4TMVA 3ZZ0A 4JLKA 3X1WA 4Q7KA 1HT1E 5JWOA 4IFEA 4MYHA 1NVVQ 3P1JA 1YKSA 2NOAA 2CEAA 4NTZA 4I1VA 3AGQA 1R8SA 4D82A 3QNUA 4OQNA 3IUYA 1DAHA 2EFEB 1S1MA 1IQPA 3SDZA 4I1SA 3RSOA 3K0FB 4ESHA 4ZIRA 2FN4A 1GL6A 2PT7A 4EJSB 1XBTA 3UMSA 1GL7A 1KMHB 1T0HB 4XVRA 1T4GA 3RSLA 2HXSA 5JI3E 1T9HA 3W6OA 2WM9B 4II7A 2ATXA 1VCMA 4CEJB 3LH5A 5IT5A 5EE9A 3ADCA 3IIMA 1D2MA 4JBWA 1B0UA 3I8SA 2OG2A 1EGAA 1TU4A 3REFA 3C14C 4QC2A 2QBYA 2JJ8A 2HT1A 2PMDA 2RMKA 3KFXA 4KXFB 3CPHA 4HUQA 4DLSA 1VCIA 3ICEA 3QBTA 2REXB 4M1MA 2OSBA 1WB9A 4Q9KA 1IN4A 3GJ3A 2F1RA 1FMJA 3EWAA 4DLUA 4QGAA 1LVGA 3AV0B 4X8LA 1JXOA 4M1OA 5FPYA 4C0HA 4QGFA 4BRUA 4DT1B 3FKSA 1E9EA 1Z47A 4FCWA 4TTPA 4V0KA 3MRSA 1E2LA 2WVJA 4WAUA 3U61B 4JLDA 2XAUA 4DJTA 4IOKA 1UFQA 2IYYA 4CVNA 3P32A 5TDHA 2GEVA 3KZ1E 4B43A 1OXSC 2CMKA 2IW3A 1JXMA 2D2EA 2IS6A 3QVVA 2PEZA 1E1RA 1E99A 1CU1A 1EWQA 2C03A 5A4JA 4M9ZA 5FI0B 3FYHA 2XTZA 2FOLA 1KNQA 4HAUA 4A2WA 5K8IA 5FUXA 4DDTA 4G5SA 1OH8A 1EFUA 2IYWA 1N6LA 2XOKD 4HSEA 4ZO4A 5CITA 2O0JA 1ZYUA 1NIPA 2JJ1A 4M8NE 4URWR 5LDDC 3AH8A 3HU2A 3T12A 3K0SA 4CYMA 2ZYVX 3ADKA 4JYBA 2OZEA 2CLCX 4P4UA 3HWSA 4AIIA 4EFNA 3RC3A 5HR5A 5L3RA 3IILA 2CLSA 2QAGA 2ZRFA 1YRAA 2AX4A 3M6AA 3BB3A 5KSYA 5C1BA 3TSZA 1ZD1A 2ZU0C 4Q47A 3RABA 5CLQA 4PSKA 1Q22A 2HLDD 1RW4A 3M1IA 3QUSA 1E9BA 1HY3A 2ZU6A 2FWRA 1E2PA 1W48A 4DLTA 3GFOA 4AY2A 3HDTA 4EFLA 1Z07A 2RGNC 1T5LA 1TADA 4Q4LA 2BEKA 3AVUA 4XWOA 5BXQC 3P4YA 1OSNA 1TUIA 2D3WA 3QG1A 4A8JC 4AYTA 3U7GA 1NSFA 3GD7A 3K09C 1E79D 4WA7A 2OCYC 2W83A 3CH5A 1CRPA 4BFVA 4DBLC 3QF4B 1S8FA 1VYUA 2KBFA 2B7BA 1NJFA 2GAOA 4DCTA 1G17A 2WICA 1XMJA 1YR9A 3WHLA 3SOPA 1Z0FA 1EX7A 1VPLA 2VHTA 1E4VA 3HU3A 4YLGA 1TF7A 3QXXA 2IS1A 1R5NA 4NDZA 1N6NA 3KKPA 2ZI3A 4C0JA 2ODWA 1KI3A 2ZRDA 1O87A 1F3OA 2V1XA 4B6EA 1BMFD 2RKOA 4M1WA 4NHOA 5SZIA 3FMPB 3FHTA 3DM5A 4U7DA 4A0FA 4RZUA 1E0AA 4GZLA 4DHEA 2IYZA 3PQCA 3T1VA 2FA9A 2MSEB 2PH1A 1QBKC 1EESA 3AGPA 3BS4A 4G1UC 5BN3A 2UKDA 1J7KA 1FUKA 5SZJA 3V4FA 2ZVQX 3DOFA 1YZNA 4POAA 4UJ5A 4D6PA 4EQ6B 2YOFA 4JYCA 1IN7A 1NLYA 1W5SA 1UJ2A 1G19A 4IKEA 2C98A 2KSQA 5KNCA 3AKCA 3J81k 5C18A 3HR8A 1ZNYA 1X86B 5CYOA 1AGRA 3QKSB 4C0KA 4C0BA 1CF4A 1XJQA 4PQRA 2G6BA 4KVGA 1Z0IA 3AKEA 2RGCA 1ZRHA 2BMDA 3T61A 3MFYA 4BFZA 1ZC4A 4GOXA 1A2BA 1W0JD 3FMFA 3R9XA 2WIBA 4OKSA 4LJ9A 4Y0AA 1V43A 3U7HB 4JZKA 2EVWX 3VX3A 3NDBB 1KDPA 4TQAA 2FPLA 3B1XA 3BH6A 4NONA 5FBVB 2ZJ2A 4M2LA 2F55A 1EFRA 4ZCMA 3UWKA 4OI0A 4BLQA 5J47A 1MKYA 1S9DA 2K5UA 3D7MA 3OAAA 1RVDA 1XTKA 2D2FA 2WWGA 4QFMA 4C2TA 4US2R 3WRXC 2RGGA 2F9LA 4BUJA 4M9XA 1CKEA 3X2SA 2GCNA 4HLDA 3RS0A 3CKLA 3MSXA 3NXSA 5KNDA 4HB0A 4Q18A 3NBFA 1XD2A 5LB4A 1P9NA 5JMTA 2WSSA 3LLUA 4W5JA 3IHWA 4OI1A 2BJWA 2C9YA 4NP6A 3LX8A 4YMWA 4HDQB 4F92B 4V0LA 5EJEA 3BD9A 5DISB 5JHHB 2QT1A 1GZSA 4LJ5A 1P2VA 2QL6A 4Z8YA 4R7ZA 3BB1A 4Q4HA 4AK9A 4MITA 1YRBA 4HI0E 4S35A 3A4LA 1CLUA 4TMKA 4B76A 1EX6A 4MRVA 2YV5A 5G53C 1NN3A 3CRMA 3E5HA 3SJBA 4ZDIA 2ZYUX 4TZ0A 2X2EA 1LB1B 4QM6A 4Z51A 1N5KA 2VP0A 5KOYA 3UG7A 1H65A 1E69A 1UBCA 4WZBE 4NU0A 5KDLA 1N6IA 3ZVLA 4DLVA 4B32A 1CJKC 2WMOB 3EW9A 3RS4A 3OE7D 1A7JA 2KWIA 4LYFA 3QEJA 4P4SA 4Q4JB 1SQ5A 3VMFA 1Z2AA 2WAXA 3SEAA 4RJLA 3IPYA 4LBWA 3K8YA 5JECA 3ND9A 4IDPA 2ZRCA 1TQ4A 2OBNA 4O3MA 2J41A 4E22A 3P4XA 2BKUA 1E2GA 4TL6A 2OFXA 3WBKA 1ZVQA 1KJZA 1X1RA 3R8FA 3NG1A 2Q9BA 2GF0A 1HUQA 1OXTA 3FMIA 3GLHE 4UNSA 5LPNA 4LI0A 1XJCA 1DBSA 3U3OA 2B7CA 1IHUA 4Z1MD 1Z06A 1NBMA 5EE1A 2Q0HA 4K81B 3ONWA 2CXXA 2O0KA 1DAMA 5SZKB 4DEYA 4UJ3A 5LD2C 3QEOA 4MGIR 3EPJA 1AA9A 1KO4A 4GL2A 5FL7A 2PBRA 1FTSA 2CL6X 4NL4H 3MAAC 1VMAA 1UF9A 4Q21A 2Q3MA 1OHHD 4GPTA 4PAMA 1LS1A 2QMUA 2CVFA 1JQLB 4EPRA 1IJFA 2QTVB 4A1FA 2FJUA 1AGPA 1JI0A 1NVWQ 4JVNA 2IS4A 3CF0A 3GLGA 4PTLA 3LA6A 1U81A 4RZ3A 1FNNA 4HB3A 1XTQA 3W6NA 1W4AA 1QHSA 4B75A 4HUTA 1JECA 5H8WA 1YE8A 3IKJA 1NF3A 3ZYCA 2IXFA 2H7VA 1K5DA 3GEIA 1GNRA 1PZNA 4PPGA 1WQ1R 4QNRA 3QPUA 2F1HA 2D62A 2GWHA 3KFVA 4DB2A 3AUYA 4ABYA 1PLLA 4Q66C 3SU8A 4QBHA 3QXJA 1ZBDA 4URUR 1RPZA 2ZRGA 2W6JD 1KAOA 2V7QD 2ANCA 2QE7D 1G6HA 4BQSA 1FL9A 2I3BA 4LJ4A 8OHMA 4OHYA 3NBYC 2O8CB 4C0AC 1HA3A 1J2JA 2BVNA 4FMBB 2XTNA 1XU4A 2HXYA 4LYHA 5HE8A 4TLEA 1JAIA 4U00A 3U6BA 2OT3B 1M7GA 3W8RA 1TNDA 1Z5ZA 2YJTD 5LB2A 3RYTC 3WY9A 5FOXA 2F7SA 2XZPA 1D2NA 4PPNA 1DELA 1ZUIA 1ZNZA 1MRSA 1UADA 1YR7A 2QP9X 2VP4A 2DR3A 2NO0A 3H2YA 4BFSA 3U4QA 1VKJA 2BBTA 1G1MA 2XITA 1KMQA 4DLXA 2QT0A 4NYJR 2QENA 3B9QA 3CX8A 1TPZA 3IIJA 4A0RA 3KUCA 1ZINA 4DIEA 2P5TB 4B47A 5D3MA 1UKYA 2QROA 2FGKA 4JLBA 1YZQA 2RCNA 2YWHA 2WV9A 1RC8A 4F4IA 2GCOB 3CZPA 4C2UA 2ZJYA 4YMVA 1SXJB 3UG6A 1F6BA 4IOLA 1KDOA 4Q1CA 5DN6D 1UDXA 4QL3A 2J9RA 3F0TA 3LQQA 1YHNA 2ATVA 3Q7PA 4HLCA 1T3HA 5JSZB 1RJ9B 2DFLA 1UBGA 5C4GB 2O8FB 2GJ8A 1TUEA 3SBDA 4ZDWA 2WTUA 2ECKA 4MUBA 4CT5A 3W9YA 4PAOA 1L8QA 4CDGA 2QGZA 1CXZA 4MQBA 3AB3A 5HZKA 1OFHA 3U60B 2ZANA 3PITA 2GJKA 4OQFA 2JJ2D 2JLQA 4HLUC 2OV2A 5UKDA 2IEYA 4IVQA 2OLJA 1UPTA 2WOOA 3FKQA 3W34A 1KTVA 4IEIA 5DIFA 2P3SA 3CF2A 2IUSA 2J5XA 3QPWA 1HQYE 2RGNA 4J0QA 4D0LB 1KY3A 2A7QA 4OHVA 2F3RA 4TZ6A 1TQ2A 5KO2A 4ZIRB 1RRCA 1SHZA 4DSNA 2QG6A 2QAJA 5H68A 4EDHA 5BQ5A 4AI6A 1JR3E 2ZJOA 4V02A 1WF3A 4Q9IA 4RSGA 4FINA 4Q01A 5FBWB 2JLWA 3K09A 1Z29A 4BRWA 3WBJA 4URXR 3SZRA 1FUUA 3HU1A 1W4RA 4A92A 4L8GA 2CCGA 4TN1A 4PSVA 4DDUA 3DPUA 3GJ8A 2JLRA 4HAZA 4P31A 4V0OA 1G5RA 1N6PA 3KUDA 2ONKA 1SKYE 2FNAA 2FH5B 3SFVA 5KHOC 1F5NA 5BWMA 1E9AA 3TJZA 1YR6A 4JLPA 3MLEA 4HUQB 4RD2A 4YQFA 3GQBA 5K8TA 4PSAA 4CIDA 3LXXA 1KI4A 4URZR 2VTKA 3A1WA 2BMJA 4WBSA 4PZYA 3MGCA 4PQYA 1MO3A 4QHSA 3WMFA 4OQLA 1OIVA 1ZC3A 3REGA 3QF7A 3NVAA 4LYAA 1N5JA 3VHXA 2CHVA 3FHOA 4RKEA 4O25A 5FOSA 3KQKA 4R98A 2ORWA 1Q44A 1Q21A 2DWPA 2WAYA 2W6IA 5BN5A 3AEZA 1W1WA 4OYHA 4QHYA 1U8YA 2XZLA 2VSXA 3OIUA 4KAXA 2W58A 4RD4A 5CB6A 4ZI2A 1TL7C 1TF5A 2W2XA 3B1ZA 4YXWA 2W2VA 2GXSA 3Q3JB 3QY0A 1IN8A 1QHIA 1N25A 1W49A 1YZKA 5L8VA 4IJMA 1W44A 3WMGA 1JR3A 4Q1EA 2XB4A 2VEDA 5DYGA 2RB4A 2OCAA 4ACAA 5CDFE 2IXEA 4PO9A 3FE2A 2J59A 2JA1A 1Z22A 1CTQA 1MO4A 4WXRA 3B13B 3B1VA 1P62B 3NHBA 3W5IA 2PLRA 3NDPA 3ZIAD 4LZZA 1MO6A 2J0QA 1GWNA 3SYNA 3OIVA 4HYYA 1TTTA 2QAGB 2GF9A 4JL5A 2ZRJA 1G3MA 2CE7A 1MO5A 5AWFC 3GLIE 2WJVA 4EPVA 2Q6TA 3QPVA 3TIFA 1ZU4A 5IF9A 3EA0A 5HKKD 2Z4RA 3Q7QA 2AL7A 1J70A 2A2ZA 4MA4A 4NBSA 5AJYA 3LO5A 1R6BX 1ZW6A 5TARA 5TXGA 3A6PC 1ANKA 3L8YA 2Q3FA 3GP8A 2I1QA 3IBYA 2JASA 4DZZA 4XTRA 4M1TA 3ETLA 2HYDA 3LXRA 3SNHA 1F48A 3AP3A 1F2UA 4RVCA 2EFGA 4OL0A 5FOTA 2Q3HA 3TSOA 1RRFA 2HJGA 2PX0A 1COWD 3TRFA 2XJ4A 3ADDA 1ZCBA 1CR4A 4FMCF 3T1QA 3E2IA 2C5LA 4I81A 3MCAA 4JL6A 1FOEB 1EFHA 1I4TD 4LC1A 3ZVMA 2QMHA 2QI9C 4ZPXA 3DHWC 2N42A 4MRSA 2C96A 1ZU5A 3AVQA 5CK5A 1D9XA 4BASA 4AKHA 1X6VA 5CM8B 1Z6GA 1MRNA 2A5FA 2Z4SA 5CIWA 1CR1A 5CDFA 2GILA 4BLTA 1D9ZA 1SZPA 1FX0A 1FP6A 1Z0JA 2P67A 2YNMA 2BKEA 3W3AA 2QMEA 2GTPA 2PL3A
chains in the Genus database with same CATH superfamily
1K0FA 4TWJA 1P72A 3Q2KA 4CKBA 4DPLA 5CVEA 3EMDA 3RANA 2MSNA 4NC9A 1V5WA 1KJJA 2E9SA 3H8JA 4GGPA 1V7CA 2X6RA 1G2OA 1SNYA 2OP1A 3K73O 1SULA 4OSOA 4PZEA 2GBLC 3F2IA 4GPZA 1UBEA 6PFKA 4C1NA 1A2KC 1XKXA 5BUZA 3UWOA 4W8GA 3W8DA 1ZPDA 3SQDA 3KEMA 5GVSA 4NCKA 5JI2E 1OH6A 1R8QA 3ADBA 2V8BA 1UXKA 4JVSB 4HG2A 1BE1A 4MW9A 2ZSAA 4OXKA 2DH5A 3FFBA 1XPRA 2EQAA 1VI6A 2ERYA 1YD7A 2GQ0A 3C3BA 3C6QA 2OA0A 1NJ6A 3GG9A 2QTHA 4DZRA 5K99A 3VU0A 2ADMA 3B48A 2PQ0A 4F2DA 4EVRA 4N0DA 4MZDA 1JF8A 5DGTA 1YMVA 1JDBC 4RPCA 4R1PA 1S96A 1M0SA 3KEOA 4PSDA 4NDNE 4GIBA 4JKYA 1IZYA 2B8TA 1NSYA 5ALJA 5K03A 3UAVA 1WETA 4E32A 3LCCA 3DM9B 3HCNA 4F8EA 1SKMA 2IDMA 3H4VA 4KR3A 2GM3A 2XMSA 4HFNA 1CRWG 1Z73A 2Q5QA 1WUTA 2EOAA 1E3JA 2VO1A 3PUKA 3R40A 4TV8A 3FMOB 1RYNA 1BXKA 1LY1A 2N1BA 3SXUB 2VN8A 1LH0A 2A0UA 1Q19A 5G02A 2X5XA 3M83A 3C7AA 4O2AB 4F97A 1ZZGA 1A8PA 3LTNC 4RS4A 5CEEA 4ZZ0A 2ZRPA 3SFTA 1YBHA 1T8UA 1U0FA 1K6EA 1RRVA 2ZJBA 4DMMA 3NJ4A 4JEUA 3UYKA 1OPXA 5FWYA 2LIPA 3IIIA 3VNVA 5HJ7A 4PLWA 3HDHA 2ZS7A 1UC4B 3MZ0A 1JSLA 4OHZA 4JJ8A 5ALRA 3SYMA 3O38A 1RS0A 4A2QA 5K20A 1XXHA 3TB4A 2J4DA 1I80A 2JLVA 2FWMX 1JQ5A 1K9VF 4L8LA 1W75A 5CLGA 3ILVA 1GUZA 1QNLA 2OP0A 2GFHA 3I4LA 1QGAA 2NACA 3M6MD 1LTQA 4MRAA 5FXMA 3ZCPA 3G59A 4DLKA 1ODFA 1INLA 5ECDA 3TZKA 4ZDJA 3GDFA 1P45A 3HSKA 1CJTC 1J24A 1GAQA 5G0UA 7REQA 4X66B 5ESDA 1RXSA 4R9SA 2AEFA 2GB4A 1SOUA 3K9LA 2G5CA 3FW1A 3QE2A 4PVCA 3P9QA 4DQXA 1C2TA 3QU2A 1BMFA 2BM0A 3K6SA 3EZ9A 1O5TA 3CVVA 2CHUA 3EVBA 2WTNA 1M1YE 2PGXA 2ZTHA 3WGVA 4F9TA 1M2WA 1OXUA 3EASA 3BXGA 1FDRA 4BAUA 1FXSA 3E7XA 1V45E 2OCIA 1MAVA 2J7PA 1JAYA 4PPYA 5BW8A 2O5EA 5TVKA 1KXZA 4AJ2A 1EVIA 4RH3A 4U7TB 2Q1SA 2P6PA 3G5UA 3WKEA 3CZRA 2DMRA 5ENVA 4D80A 2BFAA 1GITA 3O8BA 3TRHA 4D0LB 4ER3A 3E7PA 2AOTA 2EP8A 5CCXA 2N3ZA 5HTKA 5LOVF 4GKAA 4Y2JA 5LIPA 3ULKA 3PQ6A 2HRDA 3DNFA 4G0XA 3EZYA 4NCXA 4UNRA 3U3MA 1L3CA 4E2FA 5I7EA 1OY1A 3ORQA 1IHPA 2H7CA 4Q03A 4Z8XA 2VF5X 1TQHA 3PE3A 2E89A 2PS9A 4V0ME 1ULBA 3HQ4O 4NAUA 2J46A 1SN7A 5G4KA 1YO6A 3JATA 1BEUB 3KJIA 3OUTA 4X93A 1VG8A 1B0PA 4X8OA 4H1UA 16PKA 4AZSA 1O6FA 1CUHA 1DAGA 1ZOIA 3SGLA 1ISHA 2HLNA 5DPMA 4L9SA 3ZDEA 4AJLA 3NX4A 3AHGA 3IT3A 2EIXA 4AROA 5HRCA 1Y8CA 3QYFA 1ZEMA 4Q1FA 4LHEA 1KS2A 5DGXA 3RUAA 4OL9A 1PV2A 4JU9A 4KACA 2QTAA 1JR2A 2OENG 1KR2A 4FZ5A 1U7OA 1C3OB 3KHTA 2I78A 1OXMA 2C82A 3NV7A 3H8WA 5D1HA 3SC4A 2CYBA 1T1RA 4K46A 1XMIA 2GAJA 2W90A 1OBHA 2DE0X 4NCHA 3P2OA 2DKNA 1L3BA 2PVCA 3IEVA 5FI1B 1AGYA 2VUTA 2G67A 2BM8A 2RGUA 3FRIA 4OKNA 3FJ1A 5ECYA 4XAQA 3OMXA 1FSFA 3BL8A 4RPJA 2E5FA 1Z8NA 2JZCA 4QLOA 2ZIXA 3ND6A 2C2KA 2IWHA 3UF0A 2VJPA 3BL6A 4BEJA 2QM8A 3KAJA 1HT0A 3WZMA 4DMHA 3JY6A 3IR6A 2ZJ5A 2G0TA 4HH3C 4TKLA 3FWYA 2AR0A 4LSMA 4RDXA 1E7RA 1KI1A 2YUIA 3BH7A 2Z3WA 4F38A 1X9HA 4E51A 5TX7A 1W5TA 1W25A 4UOQA 1OV4A 4XRRA 2QVZX 2IYPA 3NHAA 4E5VA 1X7WB 3Q7TA 4EZIA 2I91A 3LDAA 2DJIA 3I0ZA 5JS6A 3WJ2A 3EYAA 2A5GA 2WV7A 3OZUA 3PNVA 5E1MA 3W5DA 1MFZA 4D4LA 5LQJA 3GLFE 4TVKA 1H0HA 2IF2A 2HWXA 3DOJA 2VDKB 4LJSA 5C1IA 4DSZA 1PLJA 4KLRA 5IZCA 2ZIZA 3PQ2A 2ZDGA 5JAIA 3UHFA 3DQQA 4ALLA 4CLHA 5CT5A 4RIIA 2AOUB 2I7CA 2XKJE 4GD3Q 1O0BA 2XT9A 1FNCA 3BD6A 3Q8LA 4RZIA 4MJ7A 4EZBA 4OHFA 4WOCA 3CNQS 1NMXA 3C5HA 2ZJZA 3GCXA 3B78A 4WOPA 4Z0NA 1HWYA 1HQDA 1X1TA 2NZVG 1LRLA 2FI1A 1TK2A 4N39A 5FUYA 4GHWA 1A2QA 4B6SA 3KVNA 2IUTA 3DKRA 4GP7A 5AK5A 1PFUA 4D9FA 3PD7A 4QRDA 1W93A 4R6XA 1MT3A 1E8DA 1PGQA 3L0PA 4FMCB 2HCJB 3O3NB 4TYQA 1G5FA 1YR1A 4XCQA 3KEFA 2D1RA 2ZUWA 3NMUF 2QLFA 4IHQA 2X5KO 1OV6A 2HB6A 4TV8F 3JQAD 1R15A 1P81A 2RG1A 5MF6A 4PRZA 1BRMA 3WYFA 4EFDA 2NO1A 2AUTA 3O93A 4RCZA 1Z0AA 3BUSA 4WTOA 3QH4A 3JZMA 2SCUA 2H08A 5ENZA 1L1QA 4WKBA 3DO6A 3GJ7A 3AL2A 4QREA 4FN5A 4WXHA 1U2DC 1YI1A 2C4WA 1CQPA 5CX1A 3AEQA 4CEHB 4YJFB 1M74A 1MJGA 3FWPA 3IVRA 4K6FA 5A6SA 5J43A 3PA6A 1HG0A 2AYZA 1RLMA 1XEXA 2BC9A 2ODAA 3EAQA 2QLBA 4FGJA 4HN2A 3TM4A 1OHHA 1EM6A 1TYCA 1U65A 1ZS9A 2IU3A 3O8QB 4LRTB 3DLTA 1A96A 5E2AA 4DUPA 2AFIA 2JLSA 2AR7A 1I2AA 1RLIA 2G1KA 1C9JA 5D7NA 4I5EA 3W5JA 1VLQA 3EEYA 5J2UB 1G66A 1FXUA 2OD7A 1MORA 1RBYA 4HN4B 2GBFA 1XZPA 2BHTA 2VDPB 2ZJ1A 1LWOA 3JR7A 1MB3A 3MXOA 3ZS9A 1G18A 3KOZA 3NNSA 4DLRA 5IT4A 3X1YA 4MVCA 1KZ4A 1AZLA 4XCVA 4JB3A 3FKSD 3X1XA 1ZKMA 1KP9A 4LZAA 1WDMA 2PZKA 4ENWA 2OOSA 1D2HA 2EKPA 4N3GA 2DPXA 5FFMA 1TKCA 2EYUA 3K8OE 1A1VA 4JP2A 1HDZA 2FEAA 2DUMA 3NIDB 3FF4A 2H1VA 3IULA 2HRZA 1G2PA 4GWLA 1U7UA 1KIMA 5MGNA 1E1RD 3AETB 4J7XA 5JWHA 2V6GA 4ZCIA 2AMFA 1B6GA 3VV3A 3KSZO 1NP7A 5LP6B 1GTJ1 3BM5A 3PRYA 3BMXA 4Q34A 3TPFA 5CLLA 4DXAA 2WHYA 1TA9A 3MW8A 3QIVA 3VPFA 2P0AA 1GIAA 5ELLA 4MO9A 1BH6A 4GBMA 2FJPA 3SMVA 1U2RA 1Y8RB 1YI8A 1EMDA 1DXYA 1GPWB 2PV7A 3LNTA 4JJGA 4QOGA 2BTQB 3G3EA 4K9LA 2F3PA 5FR2A 2EEPA 1J1UA 3Q5DA 4P7BA 2HO5A 5CM2Z 5K9ZA 4DCPA 4GLBA 1CDZA 3GRAA 2VRCA 3HDGA 2HHAA 4RPHA 2CXUA 1HEIA 1TTPB 2NU7A 2WFLB 3ZI4A 1R64A 4Y6QA 2II6A 1BKYA 2P79A 2Q21A 1O94D 2ZT6A 2BD0A 1UPCA 2QD4A 4JX9A 4N9WA 4TV9B 4TVOA 3WGNA 4ZFNA 1T4CA 3PXCX 3H83A 2ZIWB 1F1BA 2B9VA 3KCQA 3V5NA 1KRXA 4UHEA 3VHXB 1LK5A 2FZWA 2OM2A 3S27A 3Q9LA 2P35A 5T64A 3SYRA 1CJSA 2I5PO 3DC2A 3GYBA 1QGED 4NH4A 2I34A 4YRFA 2DETA 1CUEA 3BULA 3FPLA 1FQOA 1NDHA 2DKOA 2DR0A 3C8UA 2XB8A 2I4LA 1E2KA 1D8TA 4P7KA 3ZGOA 4NXMB 2F3QA 1ZWKA 2YFHA 3EISA 4L3VA 3V7YA 2W4MA 2O2HA 4XWAA 3ROGA 1V8DA 3WE7A 3H2HA 5HK9A 3C98A 5CRIA 1LSUA 3M9WA 4ID9A 1C4OA 5A9TA 4E5SA 4XOIA 3O5AA 4GT1A 4EFMA 4KQIA 4DR7B 4PYOA 2Z98A 2EL7A 5B5SA 3DZCA 4WVLA 1C1XA 4WUVA 3A05A 1YZHA 2GYWA 2UYOA 1M8KA 4KQFA 4MIOA 3CEHA 2I6FA 2YRXA 4LNUA 4LYDA 3S68A 4F91B 1SU7A 4X1YA 2XGJA 2YVUA 4TXNA 3MK31 4U9UA 2Q5JA 4EB0A 3W5AA 1KC3A 4B09A 4DCVA 4P80A 5CHYA 3VR5A 2JI7A 3RHSA 4IIXA 3P9RA 2BFWA 4DB4A 1QU2A 2Y0DA 4TYWA 3H0CA 2Q5OA 3C7KA 3KTAA 1PWXA 4LDRA 1ENOA 3RW9A 2XOXA 3ONDA 5IJZA 3QVOA 4L9AA 1S2NA 4RY2A 3WOHA 1ZCJA 4UFPA 2CL5A 4RK7A 1DWUA 4ZYVA 1LX6A 4DCSA 3KE9A 4FHEA 5ESXA 3ZK9A 2HBYA 2P4EA 2PR7A 1FUYB 2BGJA 4IRXA 4FD3A 4L5IA 3NNDA 4BFUA 4RESA 4EA7A 4KFUA 1DCTA 2DAPA 2HAEA 2QMOA 1MN6A 4RMIA 1FPQA 3ASZA 5BUQA 3HXMA 3WYCA 4R1QA 2DERA 3RS7A 4CXMA 3OQNA 5G0VA 1MB0A 2JGRA 3PGXA 3JAMA 1JB1A 1UKZA 5JE8A 1UBTS 4LXHA 5H3LA 4C05A 3R7FA 2PK3A 3T3DA 1NQUA 1W8IA 2XKBA 1Y9DA 1RZ3A 1Z0ZA 4PFJA 3V8EA 1AV7A 1SWWA 1U9JA 2HHHB 2E85A 5HOEA 3FUXA 2OGSA 5CW2A 5DBHX 4QG3A 3CR7A 3DDOA 2ZTSA 3Q8WA 2JAOA 4K9OA 4UVIA 2JA2A 4XWWA 1G8HA 2VDVE 3L7LA 4LDJA 4MVJM 4YDHB 2HQ1A 2HEIA 1ONPA 2WNSA 3S5JA 1GEGA 3ZHOA 1A2OA 4ZPJA 1GCGA 2VQ6A 4O8CA 3ESRA 4LMPA 4QSHA 5EIFA 4IRMA 2JDIA 3TBKA 4CKEB 1E2EA 2XYVA 1TMYA 1P8JA 5JXHA 2JFGA 3HJGA 1I7NA 4ZJYA 2R8OA 3B6IA 1IPFA 1BE0A 4INJA 4F2WA 1YIAA 2OVBA 3CLKA 1XL0A 3EXAA 4NZZA 1XU7A 1VB3A 4U8HA 3VAZA 1NVKA 2G4LA 2GZ2A 2PMBA 4ZC8A 1NHGA 2CLHB 3MINB 1GP2A 3DEJA 3H1BA 4X9XA 2FZGA 4RHYA 3L1UA 2FZ5A 1LC0A 3KD2A 4B3DA 2Q5FA 3T54A 2I03A 1QK5A 2ODBA 1AX9A 1KPHA 2QYOA 1V39A 1XTRA 1B0ZA 3A4VA 3MCTA 3SVZA 4ZEVA 2ZM6B 3AR2A 4G5QA 3NTUA 4OV6B 1YQEA 4TZTA 1L5ZA 2ONJA 2IU6A 3V7NA 3AO0B 3DCIA 1R9MA 1B6SA 3TS1A 5BR8B 2V1UA 4ZEMA 3THXB 2XBUA 3DAFA 2JFZA 3NFRA 3HZZA 3PUYA 1RWVA 4QBIA 3NQ41 3LD9A 4DR5B 4FYWA 4MUIA 3WWPA 3RUFA 5CDUA 1BA3A 2B6NA 1Y6FA 1DPFA 4RVSA 1EUCB 1T9AA 1WHTA 3WNBA 3OC6A 4U2CA 4UNQA 5L45A 3DG9A 3W5CA 4KDEA 1WMAA 4C29A 3V1MA 3ZR4B 3A0RB 2GM9A 3A11A 3BXOA 4O5AA 2EG5A 2WIKA 3A4MA 3WK8A 3MRXA 1D0VA 1GCUA 2ECQA 1SEPA 2C3OA 1AIPA 3GH1A 3PSHA 4HEQA 1YR2A 1U1DA 4K6CA 4R5HA 2P2YA 4TPKA 5F5LA 5DHPA 4N54A 2AVNA 3B2EA 5T57A 2PT9A 2ZI4A 4GRAA 2G72A 1SM4A 4BYGA 4CKWA 3BDIA 3DOHA 3OUZA 4KXQA 3GRFA 3H5TA 3HBNA 1HLFA 1XZDA 4J2OA 3UKOA 1JG3A 4LXIA 1CZNA 4RFSA 5TJ9A 2X77A 3K5PA 5TNXA 3W8EA 3H16A 3SK0A 2VF4X 2JANA 3L0IB 4JA2A 4QDKA 3CEPB 4WOBA 5HFAA 5GINE 4ATNA 1U63A 4D9JA 4XLTA 4OOFA 3GAFA 3AUKA 1FJ2A 2ETVA 5AR1A 2F43A 4Z0PA 4YO8A 4BN4A 2V9PA 3HPRA 3ANSA 2JEYA 1XZFA 1PQYA 3IV7A 5K8UA 3U09A 2YW2A 5FORA 3T3OA 1ZK0A 1Q0UA 1IOZA 4OB8A 3EZFA 1YQQA 2P6NA 5IK2D 4BX9A 3VU3A 4A8JA 4DV3B 4FVTA 4OHRA 5SY6A 4Z4EA 4ETWA 3AM3A 3DDHA 1KVRA 2J4FA 1Y3HA 1II8B 3G0IA 3FFAA 3SF0A 1T2NA 1OZAA 4XIGS 3T0IA 1RWBA 2VHZA 3W0LB 2F6RA 3RJTA 3A3PA 1DFIA 4XA8A 1HYQA 3ELWA 3TQIA 4F3YA 3EBOA 1J9GA 1HDRA 2EFYA 2FPIA 1T35A 4PLZA 3PNBA 4QT0A 4D9GA 4GI2A 3KQPA 4V3CA 2Q29A 1SCKA 4L0DA 4HAVA 4OXYA 2A0XA 4X6YA 2DB3A 3HCFA 3T7CA 3ISTA 5U9CA 2AVDA 4F86A 2PAFA 3H84A 1P3JA 3RUPA 1W88A 3H7AA 3NHJA 5HFNA 2LIVA 4K87A 5EKUA 2OB1A 3I01M 5I4IA 3ZDCA 4PYMA 4LZOA 4KJZA 4Q48A 3DBIA 3WNDA 5FUMA 2MT9A 4P32A 1X7ZA 1YVEI 2YJ3A 2RJNA 1Q95A 3FIJA 3H0KA 3I53A 1E2QA 1DAKA 1RI5A 5JYDA 1YV9A 2DUJA 3D59A 3COVA 1GZ6A 3MJCA 4CMEA 1FP4A 1NG9A 1YIDA 5JAPA 1PJRA 1LSSA 1L9KA 1BWPA 3L7KA 4KVFA 4E88A 3FGNA 3STYA 3NAGA 4KFSA 3LLSA 1F17A 2NUTB 3GX1A 2D5BA 4R8LA 3BFJA 2C5AA 4WFIA 2L82A 3LUCA 2I1VB 5KYYB 1J1ZA 1M6YA 1SA0A 5IDVA 1JHZA 2KPOA 4F6LA 2H0AA 4YIKA 4ZTBA 4D4MA 1FQJA 1XJWA 1TIKA 2GMWA 3E9QA 4I3HA 4GBED 5K0ZA 3TX2A 1ORDA 1N9KA 2XR1A 4Q1AA 5I9BA 1ZCZA 3ROZA 4KTVE 4A3SA 5IJ0B 3AEKB 2EU8A 2FR8C 4FIDA 5KVAA 1KC1A 4KMMA 4BO5A 5FNVB 1N0WA 3IQWA 4K28A 3KKQA 1B8VA 4IUDS 2C1XA 3U16A 1G5QA 1DTSA 1T5HX 3CW8X 1XZGA 1C29B 4G37A 5TEVA 1ZD9A 3RJZA 1FFHA 2FEOA 3VPCA 3ZWQA 2OZLB 5DV9A 3KAQA 4YCLA 1QTIA 1M0TA 2ZXFA 4X63A 5G2OA 2HMTA 1B26A 4KQ1A 1CD5A 2R4UA 4KITB 1OE0A 1S2OA 2POQX 2QPTA 2AKAB 4K3VA 1X8KA 3D5QA 4ZCPA 2B99A 3C3YA 3HR7A 1NNSA 1WLSA 1I4LD 1Y33E 2PJZA 4FCTA 4BC0A 3ETCA 3DPIA 5BPHA 2NXEA 1UMDB 4ND5A 3TNFA 2XVAA 1H0SA 4NK5A 3GRVA 3WRVA 3RVJA 5EPOA 2D3TA 3EF0A 1HTBA 2CSUA 4LHYA 1KSJA 4S0ZA 3V9PA 5FAXA 1UXOA 3EVGA 2W9XA 1CLEA 1QF9A 1KI6B 1J07A 3LJKA 3PV0A 3WIEA 3GZ4A 5AI9A 4EQZA 1YL5A 2XT6A 1PVOA 4I9GA 1AC5A 2VHCA 1RWNA 1SIWA 2OSVA 2DHRA 1K5PA 2G71A 3LM8A 1UBNA 4K6GA 1KAEA 1MIHA 2C2MA 4PZZA 3L46A 1MABA 3LDHA 5D86A 2GCIA 2SKEA 4WMLA 2PXAA 2P2GA 1Y5LA 1JHAA 1XTJA 3NAZA 3IKLA 3I6ZA 1M54A 5BWNA 1EWTA 1U0GA 1J2TA 4HZUA 1JDUA 1R4MA 3H1FA 3JQBA 5ARBA 3EY4A 2VJNA 2W37A 5IFLA 4QQRA 2EF0A 5LIRA 3TUIC 4EO9A 1UDRA 1PKEA 3ZVNA 1A1SA 1SXJE 3PVSA 3HKEA 3LKBA 1GSIA 4V38A 1GPDG 4HAWA 1BAPA 4D5GA 3OT1A 4H3VA 3R9KA 4IRUB 1ZICA 3P26A 1DXQA 4AKSA 2UYGA 2VXBA 5C8ZA 3RJ5A 3WL3A 2YDXA 2HMYB 5BXYA 2D2IA 2ENWA 1RJWA 1RXIA 1Q57A 2LVBA 3H13A 4HWOA 4A2CA 5DDIP 1E4YA 1LLFA 2QTLA 1XX6A 5AW2A 1G8KA 2WTXA 3UQZA 4DMFA 1OI7A 2XYHA 1EXVA 1SBCA 3LC7O 3I2IA 4RUKA 5D6NA 3ZJ5A 1P8AA 2Q5CA 4JCCA 5CJ2A 3DWGA 4M55A 4J1QA 2O8DA 2DQKA 3LP5A 5CVVA 3M4NA 2GPYA 4IVNA 4PX9A 1Q1GA 1VTKA 2BGKA 3LIIA 4DCCA 2CNLA 3EIOA 2W2OA 2FLVA 4Q0MA 1G55A 4TROA 1QB8A 3ESYA 3H9JA 3PQ5A 4I1OA 4UCWA 1E96A 2GD1O 3OWHA 3L8DA 5DBEX 2CMGA 5DF1A 3OUUA 1BEZA 4YJGA 1DFGA 2OHFA 1Z28A 4BZWA 2W48A 3GDHA 3VVLA 4B48A 4B3HA 5JVDA 5J3JA 4COKA 2XCRB 2JGAA 2DH6A 1LJUA 4ZV7A 3SIRA 1YACA 4C04A 1JEEA 2CD7A 5DLEA 3WGQA 1Z6TA 1N8SA 3OCZA 4G97A 1M6NA 2HL6A 4K6OA 4KDRA 4B74A 2O23A 3RC9A 5C5EA 3ADOA 4H7DA 2COKA 2PZEA 4MAAA 2VDQB 1OBCA 2D0OB 4V24A 3RIEA 3V8BA 1S7GA 1MNAA 4NBRA 5J4KA 3A3KA 5KX5B 4W1PA 4X95A 2IEAA 2V6IA 4RJJA 4JX8A 4NYJQ 4G0UA 4Q3CA 2OM6A 2FW0A 4S1OA 3LWNA 3ZH9B 1R5OA 4P8RA 3I62A 1QHHB 4CDNA 1NE7A 3VPSA 4KI0A 1RLOA 1P5RA 4D9KA 3SCZA 1EI9A 4X3PA 1GKYA 5CAEB 5A0FA 3SM9A 3DO5A 3FZGA 4QTUB 3M4YA 2HSZA 3HBLA 4K9NA 4YXWD 5KTRA 3GP3A 4N8SA 3H1EA 5B6JA 1PX0A 2PJUA 4BKPA 1E79A 4NX2A 1HR0B 3OICA 1V41E 3B3AA 5CNIA 2AK3A 1TZMA 2DUNA 2YOGA 2RK6A 2WHPB 3LUKA 4YRRA 1I6LA 3WIDA 4U7GA 4BY9E 1DKMA 5JNVA 4QIHA 4KGXA 3QLUC 3SQOA 3HL0A 5TY0A 1N5OX 3F8WA 2E1PA 4LJAA 4Y2XA 3WTBA 5KS2A 3QEBZ 4CM4A 2L18A 3GRUA 1Q7BA 3PR1A 4URVR 1SVMA 1BXRB 3KQNA 1NFFA 3MWEA 5DM4A 3GVHA 5IAOA 1YFJA 2PUFA 4RK4A 5T4BA 4BO3A 3DBLA 4G8JA 4XVQA 2BFBB 3LY9A 4MQ4A 3STUA 1UBKS 1A9TA 3LO8A 4RD3A 4CIBA 3UJ9A 5JH7B 1C0KA 3AY6A 4U2EA 2EFCB 2OFOA 4IQ8A 1P19A 1GNSA 3F1LA 3OLWA 1H1LB 4CQJA 5CT6A 4EM6A 1M34E 2PLAA 2VRWA 3EWSA 1DARA 3HKBB 3NBKA 2QDXA 4TQGA 2F8TA 2BE9A 4FX5A 1V11B 4HEA1 3KQMA 4MWTA 1QFJA 2F62A 2GAFA 1W36B 1VSUA 4YRNA 1TEVA 1KAHA 1FFDA 2IBMA 1YJ5A 2GDZA 3I6IA 4IS3A 3RS8A 5KWIA 5DSZA 2E48A 1QH8A 4X3CA 3CXUA 1V1JA 1ML3A 3HYRA 2G06A 3F5MA 4FYVA 2ZE5A 3JQ8A 1UBSB 3B89A 3B20A 1QVVA 2NP6A 1QFMA 2ZRHA 5IN5A 3GGOA 4QQ8A 2VK4A 3O8OA 1V8FA 5E7QA 4D8YA 1ADGA 3A1VA 3AC0A 1T1JA 3SNKA 4U4AA 1IQUA 2JVKA 9LDBA 3FPCA 4AG3A 2IUUA 3PE4A 4I46A 3ZWVA 2FSGA 13PKA 4TWRA 5PNTA 1L7NA 3UXHA 1ZMXA 3UMRA 4FWIB 3UUFA 3NM6B 1GG9A 4PO3X 2YNMD 1UP6A 2O2JA 3JSAA 5ALUA 5BNFA 5KWVA 2HJWA 5FBZA 3ZKWA 4E15A 3ZE0B 3WGIA 4I9UA 3ZDAA 1PZHA 4QSMA 1NVXQ 1YS1X 1DE0A 2YXEA 3AR9A 4HEHA 4M6WA 5EIAA 5E9QA 3T0GA 4COOA 3KD3A 2BISA 4QARA 4DFDA 3HB5X 4MVJD 4JGGA 4ZOAA 5GONB 5A05A 3F7NA 3OECA 4FE7A 3BZUA 4AY6A 3RGGA 2CXSA 5DT2A 1LRKA 1QGZA 4JYAB 3GDOA 3TAXA 2VYQA 3VO2A 3DMGA 5LYJB 3QW2A 1LSOA 4R7GA 4B34A 4WZBB 421PA 2JNWA 3FDZB 3D7LA 3JXEA 1PQPA 2ZRLA 3NBUA 4FNGA 3T7EA 1NASA 221PA 2YMMA 1AS3A 3ELBA 3ZQ6A 4BX3A 1Z2PX 3S1AA 3L40A 2BBWA 3NT4A 2BDTA 2EKDA 4IX9A 5G0WA 3RSCA 3S70A 1H0RA 4ARZA 5H70A 1XZMA 3OKFA 3SWWA 1BWRA 2M98A 3UPTA 1Y8QA 1FW8A 3VNRA 2AJ8A 2YWCA 5LZ8A 2W6NA 1CRQA 1RNLA 5JDCC 2FFHA 3OZEA 5G41A 2ZYRA 1O94A 1QP4A 2DSTA 2HKIA 3DBHA 4K9SA 5JQGB 3A9SA 4OIMA 1YF3A 2RKWA 3EULA 3D02A 1DO8A 4HQOA 4U0JA 4QPZA 2H16A 2YZ2A 2P1DA 2AFHA 2AN1A 1OR8A 5AM4A 2FFBA 2G9RA 4L0MA 2PZJA 3E03A 2VJCA 3MGGA 2V74B 1E7QA 4CQLA 2WFZA 4EUNA 2VTBB 4PHGA 3K6JA 1NIJA 3T06B 1X7GA 1ZD8A 3HFJA 3IDSA 4WZAE 3KB1A 4YCNA 1XF1A 4BJ3A 2B61A 5JVDF 1ND6A 2ZRAA 4HNRA 3OWOA 3UWMA 3A25A 1SCJA 5JS2A 3U1VA 5T8KA 4WNIA 4RXTA 1Q1QA 3HCRA 4QQFA 5A3QA 2WABA 1N6RA 1YFZA 4HJXA 2EL9A 3IDZA 4EA9A 3U5ZB 2P9YA 3DMRA 3DZJA 3SEFA 1OFTA 3OZRA 2JCGA 3DW3X 2X19A 4UXJA 3RWMB 1ODSA 5HZMA 2IX3A 4P33A 1TA4A 3BOSA 3CX3A 3OFKA 4BE7B 1PSWA 2YHAA 4B46A 4D0NA 3EB9A 4Z1MA 5DHFA 1QM5A 2B8JA 2QJWA 2WOJA 3OZBA 4I4CA 3RSFA 2WT9A 3TQTA 4C01A 4IFIA 1ZSNA 1U9IC 2ID4A 3AIIA 4OHWA 1EFKA 3U40A 4LJLA 5HG0A 1E0JA 3BERA 3AVTA 2PTHA 4M76B 5TQ0A 3E61A 1PZEA 1L8XA 4KFRA 2RGYA 3KKKA 4MH0R 4PICA 1E89A 1JILA 1IY2A 1L7XA 2NPIA 2OFPA 3I2FA 3K0AA 5E6SA 3AZPA 2JLZA 2BHRA 3EFOA 3NVDA 3VPDA 3A4TA 1S8OA 2GRJA 1G3IA 3NAQA 3K94A 5ALMA 1PDOA 1UMCB 1Q16A 4TWBA 1GN8A 5HBRA 1R0SA 1C3LA 3MMSA 1Y6ZA 5FTMA 4WADA 2NWQA 3LL4A 5F2OA 4BAZA 4CIXA 3CLUD 2YIJA 4DQLA 4PZCA 1L4GA 2LCIA 2NTVA 1VYHA 3IAXA 3K0KA 3NT2A 3PIIA 3I6MA 5DH9A 3TAUA 4LF7B 3NDJA 1TF2A 5CCDA 5L3SB 5LR6A 5EWMB 4CCAA 4G4GA 4U5QA 1WS6A 3PJFA 5C5IA 4FI3C 5CURA 1NXOA 3PUXA 1DQPA 3DT9A 1QCCA 3DOOA 3ZZ1A 4PLGA 1BD4A 3G0HA 2IPXA 4BEWA 4B3FX 4AJJA 2HA7A 4JT4A 2NU6A 4IXDA 1JJVA 4QG7A 4DM4A 2MYTA 3U81A 1TQDA 1O95A 1SCQA 5BR1A 4LXXA 1DJNA 3K16A 1OXVA 3RYIA 4P6VF 2F17A 3AP2A 3N8NA 3RRJA 2YW9A 4DDUA 4M0LA 2CUZA 5EKTA 4BO4A 3GEEA 1XRSB 2FKNA 1ZK2A 4IFBA 1VGRA 2ODTX 4RVNA 3P2JA 3AVWA 3U4CA 2PT5A 3UATA 2GASA 5IDYA 3AM1A 1KE1A 5LDGA 3OCXA 4WW0A 1IM5A 3MJFA 3HB9A 2WJWA 1FYFA 3QE0A 5E9WA 5HPYB 1CY8A 4CTKA 2HV8A 4US1R 4CLRB 1Y6JA 2RH5A 4YAKA 1OH5A 2O48X 4KPUA 5I5EA 2HJRA 1OWPA 1VE6A 4BVLA 4RKQA 4B3GA 1V8ZA 1NBME 3JAKA 3L82B 2QDKA 4EHNA 4I66A 3TD6A 4GL4A 2NAFA 4N6OA 5CH3A 3HA2A 1DC3A 3WGOA 1GT91 2NU8B 1OD6A 4UQOA 1NWHA 2Q7DA 1DIBA 4GSKA 1I10A 4JJ6A 5DN6A 2UYYA 3IKTA 1XLWA 4NE9A 5BSRA 3AKZA 3B8EA 3D81A 1BFKA 2ZIGA 2QORA 4QJ4A 1TVKB 3N39C 2WAMA 4MS1A 4F8JA 4XOUA 2ZIUB 5KSPA 2NM0A 3STTA 3VYRB 4UHCA 4A6XA 1DKPA 1P1BA 2OVFA 5F1OA 3ICVA 3FPEA 4I4TA 4C3ZA 4LSGA 1PUIA 2ZYDA 3GT7A 1MAHA 4FMPA 4QAQA 2WLSA 4FGSA 4YP0A 5ALGA 4IQGA 2E1RA 3BVPA 4OHBA 1UBMS 4BJ5A 2QX8A 3K9BA 2JCSA 3F7MA 2PCLA 2BUAA 3OVMA 1EWYA 3C3CA 2D2VA 3FDXA 3U1TA 3TZBA 1UBHS 2YNMC 3AUUA 1T43A 3L1KA 4F12A 2JS7A 4W63A 3ASVA 3BJIC 1N1GA 2ISQA 1CUWA 2ZI6A 2A9FA 1WKBA 4HQKA 2ZCJA 2X8JB 2QQFA 4LXGA 1FRVA 4HWGA 4EPWA 1WVMA 4A15A 2KI5A 2R96A 1SKYB 5DN9A 4XGIA 4REOA 1I4WA 1DC7A 1TK3A 2C2YA 4Y0VA 4EHBA 4PNEA 4UNPA 2C2GA 4RY8A 1EA7A 3K9HA 4W9MC 1IMJA 4BFLA 2DFPA 5IK2A 1NI5A 4OLHA 1YTUA 4BCCA 1VIVA 4C4RA 5B1DA 4A0HA 4KQKA 1OVGA 3C5WP 4ZDKA 2HIHA 1SUIA 4TMWA 1DOHA 2CSXA 3BGSA 3EVNA 1CVIA 1SFRA 2Z6VA 4IJ5A 3R2JA 3BE8A 1TT5B 1Z4MA 5AFSA 3UAYA 5J1SB 2H1CA 4H18A 3CB2A 4L5BA 3R3XA 1F2DA 3HCCA 2AT1A 5AQEA 5CDGA 3NCTA 4S2EA 3R3ZA 4BWVA 2K7FA 2O8EB 1NJSA 1POWA 3OFJA 4IQFA 5EIOA 1B43A 4MUGA 1WZCA 3A14A 5E9AA 2QIPA 2BWJA 1JHQA 4IX1A 4AZ0B 3Q3VA 4EO7A 2O54A 3GOQA 1T1GA 2XNJA 1U4NA 1OKKD 1D0SA 4BFTA 4Q9DA 2R66A 3IV6A 3PDHA 1DX6A 1OUMA 2A4KA 3KOUA 4F7WA 1E0KA 5JOQA 1KFEB 2PZBA 5AUNB 5BUSA 1KYYA 3LLMA 4P34A 3ZC3A 4B31A 4BXOB 4M7WA 3SJAA 1QS0B 4ZYZA 1JHUA 4R2KA 4AP6A 4IFTA 4E7OA 1OLXB 3IBCA 2QNIA 4IWNA 1EP9A 2RD2A 4NCBA 5FTJA 4R6WA 4R2WA 3WC4A 4BKMA 1PKXA 4OJTA 3V1TC 5CFMA 2AMYA 3I3OA 1MHTA 2IY8A 2HC9A 4FK8A 1PU2A 1FS4A 5F3DA 1VE5A 4FYYA 3CMMA 3QI2A 2A1IA 4EB6A 1THGA 2WYOA 3R77A 2PQ2A 4AKEA 2XUGA 4AC9A 3EGXB 1KVQA 4ALJA 3FNQA 2J9FA 3EODA 3MWDB 2IVZA 4XUCA 5I51A 2ID8A 2MSDB 4D43A 3TI7A 1NGSA 2AMJA 2BRUA 2N75A 2W6OA 4DDVA 2QUZA 4B40A 5HGXA 2QS9A 1YQWA 3E35A 2CD9A 1DRWA 2PWZA 2VYVA 2UVDA 2WSSD 3EXG2 2BIFA 3KPJA 4BTEA 2C4KA 5LD2B 1AHNA 4K8RB 4TYMA 4AYXA 1T2VA 1UEJA 1QYCA 1Y3BE 1NUUA 2EWWA 4WT7A 3G6WA 4AJKA 2VDRB 2PBLA 3ODPA 1MR3F 4ZOEA 1VSBA 1HSOA 1DEAA 2QD5A 5BW6B 5DX8A 4ZVOA 4FPXA 5HJ2A 1FK8A 3EIHA 3KAPA 5AM1A 1X9GA 4KWEA 4DUGD 1LPBB 1E2NA 2J0VA 2Q62A 3NKFA 4QEZA 2I4TA 3R6LA 3CLUC 4FW9A 1XZJA 2NGRA 3DF9A 3KSUA 3WSVA 1VP9A 3NHYA 2O3SA 4R8KA 4WBXC 3C0KA 4G0ZA 3TTTA 4DLBA 4N18A 1NOKA 3I64A 1G291 4RIFA 3CZAA 3M9LA 2AI1A 2IE0A 1E5VA 1RC0A 3GLKA 2CHGA 2I99A 3AF4A 3WRWA 1CJUC 1FLVA 4XRGA 4MRMA 6NULA 4WN9B 3K0EA 1NG1A 3R3UA 5AW7A 2V3VA 1GPLA 1V8OA 1QQ7A 3WLSA 3OCWA 3CUYA 2NLOA 1R27A 2YWFA 2Z0MA 2W6ZA 3ENZA 1NMYA 4LPKA 3QHPA 1EAMA 2CEKA 1K92A 1L5RA 1VE9A 5FWXB 4MDFA 4ZVKA 2C7PA 5D84A 4J1TC 1L5YA 4HATA 1OVMA 4LY6A 3TYXA 1PYGA 3DZIA 3LI2A 3WJAA 4AO6A 2H07A 2ODNA 5IKPA 4M1QA 4JNKA 1L8OA 4XJSA 2WU8A 3KQKA 5JS1A 4FUQA 4HAOA 2J48A 3C4QA 1UC5B 3D0RA 5JAMA 3PS9A 5B37A 3HJNA 5PGMA 5D3ZA 4JLNA 10MHA 4PG7A 2BEWB 3CLHA 1V6SA 3RIYA 4RV9A 1UMBB 2XEXA 3TLJA 4EF5A 5C52B 4JI2B 4KSYA 1GFZA