3SIPA

Crystal structure of drice and diap1-bir1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
ALGSVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of DIAP1 auto-inhibition and DIAP1-mediated inhibition of drICE.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase/ligase/hydrolase
molecule keywords Caspase
total genus 42
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sipA00
3H11A 4NOKA 1ICEA 2H5JA 2WDPA 4QU9A 5JFTA 4D3XA 1JXQA 1QDUA 3DEKA 4NOMA 5IAEA 4QUEA 3P45A 3R5JA 2XZTA 3S8EA 2H54A 1GFWA 4PS0A 2CDRA 4JR2A 1SHLA 4QUJA 3SIPA 3QNWA 3GJTA 2XYPA 5H0IA 2CJXA 5LUAA 3DEHA 3V3KA 2H5IA 2CNLA 5IAJA 4QU0A 1NMSA 4N6OA 4DCOA 3PD0A 3R5KA 5IC6A 1SHJA 1M72A 4QU5A 4JJ8A 5IABA 4ZVPA 1RWWA 5IASA 4JQZA 4N6GA 4QTYA 3UO8B 3DEIA 1GQFA 2CNOA 3GJSA 3SIRA 3PCXA 2J32A 3IBCA 3V6MA 2XYGA 3D6HA 2CJYA 1RWOA 5LU9A 4NOJA 4NBKA 1RWVA 5I9TA 3OD5A 2J33A 3EDRA 4JB8A 3IBFA 3PD1A 3V4OA 1F9EA 1SC1A 2CNKA 1F1JA 1SC3A 1RHUA 2AR9A 3D6MA 4QUDA 4ZVOA 1PYOA 3H13A 1I51A 1QTNA 3R6GA 4N6NA 1NMQA 3KJFA 2H4YA 2QL5A 4JJEA 4QUBA 4FGUA 4QULA 3R7BA 4EHAA 5IC4A 3V4LA 1RHQA 4FXOA 4PRZA 1RWNA 3KJNA 2XYHA 1RHRA 5IAKA 3V55A 2Y1LA 4N7MA 4NOLA 3DEJA 2C2KA 3S70A 4JR1A 4FEAA 4AWAA 4EJFA 1NW9B 5LU8A 4EHHA 2J31A 3H0EA 5IARA 4JQYA 1CP3A 1RHMA 1K86A 1PAUA 3UOAB 5IBCA 4AW9A 5I9BA 4ZVRA 3E4CA 3KJQA 3V6LA 2HBRA 1QX3A 2P2CA 2NN3C 2QLJA 1RHJA 3K7EA 2DKOA 2C2OA 3R6LA 4PRYA 5IBRA 4JR0A 2H4WA 1IBCA 4M9RA 1I3OA 3H11B 2H51A 4HQ0A 2C2MA 2QLFA 4EHFA 4I1PA 2FP3A 3BIJA 4NBLA 1BMQA 2HBQA 4ZVQA 4EHLA 2HBYA 2QL7A 1I4EB 4N5DA 3GJRA 2XZDA 2C2ZA 2C1EA 4IEFB 3RJMA 3NS7A 4I1RA 4PS1A 5LUBA 2HBZA 4D3YA 1RWXA 4QUAA 1K88A 1RWKA 3P4UA 4FDLA 2CNNA 4HQRA 3D6FA 3EDQA 4ZVTA 3R7SA 4DCPA 1RHKA 2FUNB 4QU8A 3GJQA 5IBPA 3R7NA 4QTXA 1I4OA 1RWMA 4IYRA 1RWPA 5K20A 5IANA 2FQQA 2J30A 4ZVUA 4AWBA 4D3ZA 4ZVSA 4JJ7A 4QUGA 3H1PA 2K7ZA 4HVAA 4LSZA 4NBNA 2Y0BA 3NKFA 4QUIA 1KMCA 4QUHA 3ITNA 2QL9A 1CVRA 2H48A 5IAGA 1RE1A 2H65A 4EHKA 3NR2A 4EHNA 1SC4A 4EHDA 1NMEA 2QLBA 4DCJA 4N7JA
chains in the Genus database with same CATH superfamily
4NOKA 1XMXA 3PT9A 1F0YA 4G41A 3ESXA 2ZS7A 3TQQA 1FC0A 4K2AA 4UMDA 1WIWA 5B53A 1YJ5A 3RUIA 3BSSA 3ZCVA 3SSAA 2X4LA 4FNOA 2W8BA 2AKAB 4HJRA 4OKIA 3FCAA 2J3EA 3VTFA 4A0RA 3I9V6 5LUAA 4ZO6A 1E5XA 1NF8A 1KS2A 1NUSA 3GB9A 4KHZA 4BMSA 3B7WA 1WDWB 3HGQA 2XWPA 3KLNA 4U9UA 4L9RA 1SQSA 2C77A 2IFTA 4R0NA 2VCYA 1LTKA 1CIJA 3BK7A 2HDOA 1YDGA 1YRYE 3AZOA 3P9XA 4H6XA 1SVWA 4NMMA 5DM4A 4D02A 3VA7A 1TECE 1YULA 4LI0A 3M4JA 3D1JA 1EAMA 5BQXA 2H06A 3RABA 1DIGA 3L77A 4LMPA 1WPGA 2VNHA 3JQ8A 3AHHA 1TKBA 1N5KA 4DCCA 4C4AA 2P41A 1VIMA 3GLGE 4I9UA 2GERA 2YVUA 5IAAA 4V0SA 5A4MS 5DTQA 1KZ7B 3PA8A 5HK8A 5LB4A 1U99A 2XNDA 3LO8A 3RTAA 3IE1A 1NWCA 3TZEA 3OT4A 4W63A 2VRCA 4MW0A 3A1UA 4HYTA 1SD1A 4K3UA 4NAHA 4V02A 2H4YA 4JH0A 1DXYA 1FYDA 2CFOA 4KLCA 3OX4A 4EENA 3L0YA 4QXAA 2FPSA 2JJ2D 2YW2A 3K9LA 4UUMA 3N5KA 3D64A 2VNJA 4LOKA 1JEEA 2CCGA 3SHWA 2XYHA 4RANA 4ZJYA 1XL0A 2RIPA 2PYIA 1LBHA 2Z5FA 4MVJF 1CYDA 1QAQA 2VP9A 1E6MA 5GM2A 3BD7A 3OBBA 4MVJA 3DYIA 5DISB 1T3HA 1U81A 5KNCH 2WKQA 4Q48A 3ND6A 2DQSA 4QWMA 5CIWA 2F8MA 3PQ6A 4CM8A 5BP7A 1K06A 3KB8A 1YR3A 1MJFA 4L28A 3VJRA 1CUGA 1W46A 2R6JA 2CV2A 3GPBA 1XKLA 1KQPA 3BIFA 2GYWA 1IWOA 1CY2A 1IBCA 5GADl 2VDWB 1X2EA 2HLDA 4A0HA 5AJYA 4XSGA 3CLTD 5A3JA 1QKKA 2P90A 3ZZTA 4O59O 4N5DA 4A8JA 1K3UB 2EHDA 4FT4A 3QVJA 2JC3A 4KVFA 3BQNB 1LSUA 3PGA1 1VJDA 2QD4A 4AY4A 3K5WA 1X0VA 3NTQA 1K3FA 2AFHA 2A5LA 3GDGA 1VKHA 2BHSA 4FZJA 4CIVA 5I7EA 1DDGA 3AJAA 3KXKA 2J08A 4O2BA 2GAIA 5EQTA 4ZI7F 4ZCRA 1RXWA 4OQYA 2AUNA 4D3ZA 1C3OB 3CUWA 2SHKA 3PUKA 2PSFA 3LHFA 4QXPA 4G5QA 1UEIA 4JJGA 3MBKA 1ZJZA 3WGZA 4EL0A 5BQFA 1U7PA 5F2NA 4B3RB 3NV7A 1J8VA 1GPLA 2FGKA 4X00A 4ML3A 5ISMA 1XZAA 2XXBA 3G79A 3WDMA 5JG7A 4YAGA 1J97A 2OQIA 4MAFA 1PNTA 3RBVA 1ZGCA 3CNBA 1O96A 3SD7A 2AUTA 3UQZA 1OFVA 4QGSA 5L3QA 3KOOA 1I30A 2NTEA 5TQ0A 4HPJB 4IUYA 4NY1A 4DQVA 3TDNA 2CXRA 4AO6A 4TV8B 1WVIA 1OJ7A 2C99A 3LBAA 4J91A 4N65A 3BRSA 2CNLA 1ID1A 2F1JA 3G0CA 1ZVMA 1A27A 3BMQA 3DG9A 4K6MA 5AIAA 2C57A 3E9NA 3TG8A 3HZRA 5IUJC 1Q6ZA 1GNPA 3VBEA 4GOND 4BVBA 1EGQA 4Z9YA 4EPXA 3U4MA 1XD2A 2XA9A 4FBMA 1OAOC 1ZH6A 4EB3A 3NM4A 3TFOA 1TVKB 2CB9A 2WU4A 4OHCA 5JD3A 1A9OA 4OOFA 1SUAA 3PCTA 1UP7A 4M7RA 2HX1A 1RI1A 2R6FA 2WM9B 4RHFA 3R7FA 3PHJA 4B1FA 3CCFA 2PGNA 1C0KA 4PGHA 4RCYA 4NBKA 4OP2A 1WU8A 4MUYA 4B17A 5K0ZA 1RLTA 4FVTA 4OQNA 5FB3A 3VPGA 3RBZA 1OI3A 2DPHA 5LBUA 1QR2A 5KQLA 1YUNA 1PR1A 2Y92A 3SC6A 3BMQB 5BNTA 1ST2A 1T5HX 1Y5IA 3IVMA 4FGJA 4HAUA 1I51A 4NSNA 2J9ZB 4RM2A 5FTJA 1GZ5A 2ZTLA 3E84A 3S2IA 3TI9A 1MW9X 1UBSB 1UMCB 4BNJA 3NWPA 3T1VA 1FDOA 5JCPA 1YNSA 2QR5A 4IS2A 1RRMA 3H3JA 2PIAA 4QFDA 3VZRA 1O03A 3THXB 4PCVA 1II8A 2RK4A 2JJQA 1WPRA 3M6UA 3WYAA 4O08A 4EG6A 3USCS 1E1YA 5HIIA 4GBMA 2OBBA 1GA6A 3L8GA 4HNRA 3EB9A 5H7XA 5TX7A 1E2MA 3X1YA 1XQWA 5E7IA 1ZKMA 1VBKA 2VRWA 3EH1A 2ZTMA 3CUVA 2JVKA 3O1IC 4E1BA 5CJJA 1USGA 3D0QA 1PWXA 3OZVA 1NN0A 2B4RO 4WN9B 2IWRA 5JFOA 5LXTA 4FZVA 4K9DA 1NVKA 4C7VA 1L8OA 1J1IA 1R0WA 3VR3A 3WRWA 2XMGA 1S7CA 5KX5A 4MDYA 5C18A 1U0LA 1E69A 5DXAA 2JHCA 2BGKA 4HZUB 1HYQA 3GNQA 1FNNA 1P7WA 5E9JA 5THXA 3TQFA 1M7GA 1NVAA 2CB0A 5KTNA 5EYPB 4XIJA 1V9CA 1JDZA 4E5PA 1PUXA 3IAHA 3PKIA 1WABA 1N8TA 2YS6A 5CVJA 5A5VA 1KYZA 3UXEA 1YMQA 4KW7A 3WK9A 1SKYE 5TMEA 4BJ1A 1FXWA 2FLWA 3SP1A 3KVYA 4D56A 3HB7A 3BTSA 4B34A 2E5LB 1PJLA 2PUFA 2X2EA 2XTJA 4RJ2A 4ZYXA 4FMPA 3I76A 3G2MA 4Q3NA 2QRMA 5CTAA 1GCAA 1KZHA 3PUYA 3JRNA 1LB1B 4EF6A 4EHDA 3F78A 2IKQA 3DWIA 4KFTA 1M2NA 2GM5A 2JHPA 3OHSX 1A5AB 2H4HA 1KTIA 3TOVA 4OSPA 4C4YA 5DTRA 1G6KA 2Z2ZA 2ZSJA 5AKYA 1RZRD 1QC5A 3UA3A 3A14A 3AR4A 2O5EA 1B42A 2BM1A 4ZPJA 4LDQA 3KOWA 5BO5A 4OYLA 4RH0A 4DA6A 5C1DA 1WVMA 4MQ4A 3QPAA 5IFLA 5KMGA 2LIVA 4MGIR 1Y9AA 3M1IA 3R7WA 3ISVA 4ZI7B 3CEPB 1LDNA 3REGA 3T7AA 4EGSA 3GAFA 3LBIA 2W8BB 3R74A 2BEUB 2XNKA 4IXNA 3GUVA 1LS1A 4MUNA 1QF6A 3IEVA 2P2ZA 3RVPA 1JR4A 3CB4A 4WOCA 2JB9A 4D44A 1HDEA 2PDAA 3JRXA 5FR1A 2D7DA 2BGGA 1H6DA 3EOZA 2RBKA 3FRIA 2NU6B 2POCA 4QTTB 2WMYA 3ZIAA 4B6OA 1CRPA 1U1EA 1V47A 4Q9HA 4X5OA 2JHFA 1I1OA 1R4MB 1YASA 1PUIA 3KZMA 3CE9A 1AF4A 4ZQEA 2EFHB 2HUPA 5AI6A 1XO1A 1G8PA 2HXSA 3P2YA 2VQFB 2H1RA 2JAPA 2PKEA 3FMFA 2JCGA 4R3WA 4HATA 1ECBA 4QUKA 3COJA 2DR2A 5IW8A 4P0PB 3TE6A 1OSNA 2OB2A 1ZEJA 1GN9A 1BQEA 1JQJC 3ETEA 1E3WA 3HKCB 3AERA 3BD6A 4FXOA 1OXUA 4LCBA 4ID9A 4DB4A 2M6SA 5AVZA 3MRTA 2AD5A 4L8LA 2QJOA 3CSDA 4GMDA 4DGSA 1Y1LA 3E48A 3FAKA 3Q7SA 3JASA 3OJ0A 2HA5A 3DOFA 4HDCA 2GYUA 4ZRNA 3RBXA 3TK1A 3WK4A 4FOTA 2DECA 3HABA 4C0AC 1N5RA 2X8LA 3NHMA 3LUPA 2JDIA 5B3KA 1QZZA 4UBKA 4Y67A 1IZ9A 5GMOA 3SOPA 2AXEA 4JYCA 1N9ZA 2B7CA 3K0AB 2DWUA 5JYEA 5T3YA 2Y9MB 3KJQA 1MIOA 4MUHA 3ROQA 4KG7A 4YUWA 3TLGB 4KUHA 1G5IA 4ETIA 4LXHA 1FTGA 3GJ7A 4Y1GA 1QHHB 4JELA 5HS4A 3PS9A 4FZ3A 2PD4A 5H5JA 4L4RA 1XRRA 3IRUA 1N6IA 2WWVD 3GU3A 2WD7A 2B94A 5K9ZA 4YS6A 2QGZA 3K0HA 1AE1A 3VR2D 4DQXA 4CEJB 2GTIA 4JLMA 1X9HA 1J99A 4MA5A 3A1CA 4E3ZA 2W6JD 5IXYA 1BA3A 1EZ1A 3RRNA 3ZLVA 4WUTA 3L9XA 4E2YA 4G97A 1JAIA 2ADMA 3UWDA 2WI8A 3D3NA 3R3JA 1FLVA 4HAYA 1K68A 1EGAA 1C3XA 1WX1A 3JYOA 4NHEA 4H15A 2W5UA 2XT9A 4NBNA 4S3MA 2WYIA 2VJQA 4BUZA 1WD7A 1D2RA 1HY3A 1ESCA 1P1HA 2EYUA 4MV3A 2D1QA 3UB4A 2PUEA 1M33A 3JXEA 5BN3B 2FEKA 4QXOA 1OI4A 1GP2A 2B99A 3ORFA 3UOWA 1XCBA 2GZ3A 3H05A 1GN8A 3A9VA 3ITEA 5EXDA 3S1AB 1FP7A 3F3MA 2VNKA 5BQ5A 2PCLA 1NDQA 2R2AA 2AR7A 4LDRA 1HPLA 1I0IA 2ZSUA 3E1SA 5U4QA 2XMZA 2XKJE 2ZQ5A 1G6Q1 4BEVA 4CF3A 2Y1XA 4CFYA 1T13A 3TW8B 5HRCA 5IJ0B 3MWLA 2E55A 3EZYA 4KREA 3RC2A 2CLIB 1ZSVA 4WECA 5DXFA 3AIKA 1VL0A 3WVNA 4KE8A 1MX9A 5LA6B 4DILA 1I7QB 2O8FA 1YRWA 4JKYA 5HF6A 2IYAA 2YH2A 3CVOA 4RVNA 4LTMA 3R6DA 3I30X 2VP5A 5KOHB 3PXEA 4N6OA 3PD0A 1KF0A 5EKUA 3FF1A 5B7PA 1USKA 2QF7A 2BM0A 2XUHA 3PC4A 2XGMA 4NK5A 5MF6A 1XVVA 3CW9A 3KB1A 5F77A 2GZ1A 2GEFA 4B3SB 2IWHA 2XE6A 4GE3A 4PYKA 2EP7A 3U6KA 2IVFA 4GMFA 3AHEA 1M6WA 3CRQA 4XQEA 1RT9A 4TMVA 2P6UA 3DR3A 4DHWA 1U4NA 3L7KA 3SEAA 1EZ4A 2VP0A 1P2SA 4F5EA 5KNLA 1Z9BA 1N2OA 3A25A 1KA9H 4Q1AA 5AHWA 1XD8A 1D0VA 2GYVA 1JPJA 4KUEA 2LP4Y 3RCBA 3SBOA 3V32A 1A2QA 3AEZA 5J4HA 1J39A 5EFZA 4DZTA 2C5BA 2R1TB 5E7QA 4DIKA 1FBTA 4P4GA 2QN3A 5BY2A 4FMCF 4M9ZA 5C7LO 5EPEA 4ETNA 3PDJA 5AXAA 5JSZB 4LS3A 1C4WA 5CCEA 4UM7A 2FPRA 4QFMA 3W1VA 1P5HA 4BWGA 3OOSA 4Y1FA 1K2VN 1MN6A 5TPZD 2IS2A 1NX6A 2VYVA 5I7RA 4P86A 2Z6QA 3CRZA 4DANA 3KHKA 3QPVA 2OAGA 3FMOB 3TTSA 3LUJA 3F3YA 4GPD1 4LXIA 2YIVX 4JKOA 5EZQA 3MLEA 3S2GA 4LC0A 5ED0A 2A8YA 5FFMA 4DADA 1GTSA 2XMDA 1IDN1 3KL4A 1TJ5A 3A3KA 3VKVA 2DAPA 2OWDA 4YP5A 3BGVA 4YI5A 4CDGA 1UZLA 2ISQA 1FL9A 3WRVA 4FR2A 2A0UA 2I3BA 2IL1A 2YXBA 3KKMA 2X9QA 4MUKA 5K0JA 3SZUA 3CBQA 2JIDA 4GBGA 1PO7A 2QNIA 1FNSA 3SS7X 2JJ8A 2Z9DA 3K1AB 5I5GA 3SG0A 3RAFC 3IDZA 2XQIA 1EDZA 1G8JA 4YJGA 4BMVA 3KSBC 3UH1A 2ZM6B 2JAQA 4QPJC 4Y2PA 1ES9A 1FRZA 2VTDA 2XADA 4IJUA 1RBZA 3LHSA 3MVEA 1HNZB 4NBSA 3WB0A 3T99A 3IQDB 1CQWA 3VVBA 1L6RA 3U3JA 2JFHA 1AGRA 1T6NA 3NHRA 4GU5A 4MCJA 1CHDA 5EHXA 4J16C 3MJCA 5JPDA 1KY3A 3ANNA 1RM3A 3H18A 4MVCA 1EK1A 4I4TF 2QORA 1NKTA 3VNSA 3FF4A 3IMKA 3I04A 1HNWB 3B5IA 3O7WA 1Z83A 1C0EA 2QWXA 1CETA 1DBWA 4J49A 4K9MA 3ZCRA 4D6PA 4QELA 1MO5A 5FBHA 3K0SA 3QHQA 3WFZA 2BTQA 2RGAA 3I6BA 5IF9A 1OOEA 3ZY2A 1CRLA 3SNKA 2C7BA 1GTZA 1IPEA 1K7CA 1NX9A 1Y89A 3DP9A 2I3GA 2HWKA 3HWRA 3JQDA 4ENUA 2WIKA 3OE5A 2GWHA 3LA6A 2Z6UA 1KI7A 3OPYI 2C82A 4MAMA 2I2WA 1ZM7A 4MIEA 1L7XA 3M2PA 2C3OA 5EP1A 4D8VA 4ER7A 1ZK1A 2I1VB 1AX9A 2HHHB 1R0CA 4CGYA 4G8JA 4GNKA 4Y9SA 1WM1A 4A92A 4BQPA 4JDUA 4H1WA 3T35A 1ODTC 3E03A 1BU5A 3L41A 4J75A 2IT1A 3SM3A 1MIHA 3EEIA 5CYFA 5KNBA 1GNQA 4M1EA 2H2WA 2YMLA 4GP6A 5KTTA 4PNHA 4GRIA 4XH9B 2ETVA 3R3HA 4YWJA 1SWWA 1F0PA 3MERA 2WT8A 4MWDA 3AL2A 4NCJA 4QU5A 5D2CA 1PT5A 1KJWA 2UYOA 3SFVA 3TW0A 3UUGA 4FGLA 5B4VA 2O3TA 1YJ8A 3JYQA 3RFCA 3CVUA 1HFWA 3N0TA 2BIFA 4L0QA 1ZGBA 2QG6A 4HNAB 3SU8A 3VSBA 2CNOA 4Q3KA 5IH7A 3IQFA 3ZJVA 3AUTA 3VYWA 3GVCA 1Z2NX 1G8GA 4HF7A 4XWGA 1FEZA 4U7DA 3H5VA 1IJFA 1EA7A 3C98A 2R8ZA 3DH0A 3CWQA 2VAMA 4LAFA 3GCXA 4QX6A 4ZV7A 2C9DA 1J56A 2EJVA 1Y4ZA 4LOIA 5B6PA 1LQTA 5FPKA 1R9GA 3AFIA 3FVQA 4XPIB 4BVLA 5EUBA 3FDFA 2A4KA 2VAPA 3OA0A 1Y8QA 2HRRA 4YP6A 1U2GA 3RVSA 2JI9A 3PFFA 4B75A 2QQ0A 3PJFA 4JITA 4R9VA 1R9JA 3JU3A 5WRFA 1E9BA 3BB1A 3DBLB 3JQAB 4XM0A 5LZ8A 1CDEA 4ZGWA 1KY5A 1XDUA 3EDYA 1QO0A 5FUMA 2F43A 3L4KA 2FJUA 4NK4A 2GBLC 1Q7EA 4K6HA 4F1JA 4X9XA 4D26A 2W71A 2QLTA 2VSXA 2BISA 4DIUA 1EUDB 1MH9A 4TSFA 3T7SA 3R41A 1GZSA 4EFNA 5JXHA 3O0DA 3SYLA 1KR2A 1BW9A 2HLDD 1CF2O 3A9CA 2ERXA 4EVSA 4X95A 4RTLA 2V98A 1TF7A 4YFYA 2FPOA 4FLFA 2FI1A 1ESZA 1DUIA 1UT6A 4ND8B 2BEVB 2Y9PB 3AMVA 5DN6D 3CO0S 4M0UA 3WB1A 3ESYA 1KQ3A 1NNLA 1ZP6A 4RUKA 1BMTA 1QIFA 4JI4B 1Y6QA 4WNIA 3VDMA 5F3WB 1C29B 5SY9A 1DIHA 5CXSA 3NIBA 1MJGM 3HVRA 3HL0A 4F2GA 1T34A 2P5SA 2FPPB 5KJ1A 2PZLA 2VJYA 4KX5A 3PFIA 1OFTA 4MPRA 1A9XB 4E4YA 1SKQA 3R0VA 1C3VA 1LDGA 1QTIA 3NZEA 3RUEA 4YCLA 4Y9UA 5K03A 2Q0XA 3ITNA 1M5TA 3B1KA 4WKBA 1MOPA 3MQ4A 5AHXA 2FE1A 4AG3A 1UJ6A 3ANMA 4WA7A 3UCFA 1SIWA 2GJ9A 2P3OA 4TS4A 3ZWKA 4IZIA 3SIWA 1OB5A 1O89A 5BW6B 3QBVA 4N5MA 3ZXSA 4CG0A 1Z2AA 2O6LA 3LM8A 4MW4A 4O4LF 3FUVA 3AX6A 1D1TA 1Z88A 2GM9A 4LJ7A 2XMSA 4OQPA 4ERXA 1NY5A 1WUJS 1RM0A 2AN1A 3A6ZA 2CDRA 1FNCA 1GCIA 3IT3A 4YK7A 3L43A 4P3KA 1XTPA 3MZ0A 4C3UA 1Y8RA 3DXYA 4HAZA 3FYHA 3GARA 2VQSA 3LIIA 1RPJA 2C88A 2ID8A 2PO7A 3QEBZ 1CZNA 1XP8A 4FEEA 2R79A 3T7EA 1XVLA 3D3JA 1EVZA 2UU9B 1UADA 1ZSYA 1OFGA 2YZNA 4KQ9A 2CLDX 3LBFA 3PR2B 2J5RA 2OXCA 5LN1A 1BJRE 1UBEA 5J4YA 4O4HF 4RK5A 3ZZMA 1RPZA 3L46A 4BLTA 5ALMA 5AK0A 1QHGA 1V8PA 4FJ1A 3K5PA 1JFFB 5LYJF 5HOEA 3SSOA 9GPBA 1M76A 1Z39A 3ANXA 2O2SA 5ICMA 3NM6B 1TF5A 1YBHA 3R8FA 4GO1A 4NHOA 2ZUUA 4PQFA 4R5MA 4E7PA 4M99A 1FVHA 5CX1B 5J1TB 4EHIA 5E2BA 3D0RA 3V7FA 5AXDA 3VR4H 1H65A 4C7OB 5CUQA 2I7XA 4KWIA 4NE9A 4Q19A 3SR3A 1JLLA 4ES6A 2QE7A 1BGVA 1J2EA 1YHZA 2INGX 1QTNA 2QV7A 4NAVA 3ENZA 3UQYS 4CQMD 1R8QA 2IUEA 3HCEA 4O33A 4XASA 4YJHB 1NLMA 2J67A 3CLUC 2YWGA 2OZLB 2YWHA 3U3OA 4ESOA 5FX2A 2DKNA 2IHVA 3MAJA 5DI3B 4C0LA 1J24A 2QM0A 1YXMA 2HZ7A 4V3CA 4PQGA 2JBAB 5TR9A 1Z35A 4BL5A 3BXEA 2GOYA 3D8HA 3KLOA 4KIWA 2O8DB 1QHEA 4R1MA 3IMCA 3QFRA 3MD0A 1ISGA 1QGUA 5M04A 4MA0A 5C9ZA 4MP3A 1UCFA 5CNKA 4WVLA 5FUYA 1LGYA 3ECSA 4MJLA 2P1DA 3ZHXA 4IGEA 3PX2A 2D1YA 4R01A 3N7TA 3LVFO 3RC1A 4OG2A 1HLGA 3MTQA 1G0OA 2BC9A 2I2BA 1FS6A 1V0JA 3I8OA 1E0KA 1YO6A 1R0SA 2O0KA 4BKUA 2NTJA 1G5FA 5CX1A 3NHFA 2W2KB 4CKZA 1NWHA 3WWOA 1M5RA 3FNGA 4ZYVA 2JH8A 5KYVA 4F5WA 2B69A 1C8BA 1PZMA 1Y48E 1X0XA 4PGFA 2ZUCA 1LLDA 4GQBA 2YZKA 3D5QA 3TUZC 1IN5A 2VPYA 4GDMA 1H9AA 5FOWA 4FT2A 3BILA 2GRJA 2HT6A 2ZEJA 1V37A 2CNNA 3F7NA 3GMDA 3QKUA 2A0XA 1V3QE 5AKHA 4JI5B 3R9XB 3QU2A 3OT5A 4UMVA 2W6PA 2A35A 1VIAA 2XCRB 3SN6A 1I4OA 3A1SA 4D96A 2PRKA 1AD2A 1NDUA 2W6ID 4DLKA 3VI4B 1UT8A 4K88A 5JO0A 4YUZA 1XQYA 3NCTA 3U49A 3F73A 2IQIA 1MG5A 3E2PA 1OTHA 3PFHA 4PBSA 3OTWA 1PS9A 3CGWA 1Z8DA 3UWPA 1PL8A 5JH7A 4XVCA 4C76A 4DEVA 2H63A 1W73A 4J6EA 4AZ0A 5INTA 2GF0A 1ISPA 1GYRA 1U0RA 1V4VA 3DT8A 3H9QA 4B45A 3KUKA 5K3AA 4CEHB 4GYJA 3EF0A 3QE2A 1EGHA 3IEMA 2XTAA 1UDAA 1UM8A 3TZHA 1RI5A 1HRDA 1OFUA 3S8MA 4ASUA 4G0UA 4CLRA 1EFLA 2Q8NA 1Z6PA 4J0DA 4P38A 4ZU1X 4EI7A 2BEUA 1IN1A 4L4YA 3T06B 4IXTA 2XOKD 3KLPX 4H18A 4YJFA 1H6CA 2OXRA 5F33A 3UN1A 3VR3D 4M38A 4X63A 1FUUA 4OL9A 4A8JC 4CPDA 2HMYB 1IHUA 3OCJA 1KYIA 4LMAA 1IDOA 4HH4A 4I5IA 4K6KA 5G2OA 3ZH9B 4MDEA 1U7ZA 2HHLA 2ZWIA 4Q1BA 1P7YA 4QGHA 4RFSA 3DOUA 3PNPA 2DQ4A 1QH9A 2Z04A 4ZEVA 1KYQA 3EGXB 1EK6A 2UVDA 3AJ8A 2W42A 1MEJA 5EJEA 1Y33E 2HR1A 2JG3A 1VKNA 1LI7A 3RC7A 1AHIA 3NG1A 5GJBA 4UUBA 3RQSA 1QZXA 4B40A 3G68A 4UE2A 3SICE 2HPAA 3EZ9A 2OHOA 4N8DA 1DFIA 1L5WA 4XEUA 4XUCA 1I6WA 3LP8A 5B1DA 5A5GA 1BW9B 3BKXA 2RB4A 1QHNA 2B92A 3VDXA 2W2LD 5E1MA 5B55A 3Q7PA 4PXSA 4FX2A 3F6RA 1KXZA 3ZDEA 2UYCA 1VA5A 3TN7A 4JXZA 4LSWA 4QDUA 1YMVA 5FIUA 4AJ4A 1N5MA 4BIIA 4H35A 2OUKA 2GN0A 2CNWA 2QX8A 2WWWA 2JW5A 1Q1BA 2HADA 1JHZA 3KZ1E 3L7DA 2QI9F 5HQ3A 1DQPA 4M21A 4O1IA 3WK6A 4U3JA 3T9AA 2ZBFA 4TUYB 2Z3VA 4CCSA 2GK7A 1JFFA 2G9VA 3SR0A 4G65A 4TQAA 2IZOA 1B6TA 3OKAA 4U0JA 3W2FA 2H2FA 5DNUA 4JFAA 1KRXA 2CNDA 1ZA2A 5IBCA 1FBNA 3LG2A 2WG0A 2G8LA 3OJWA 4NDNE 4A2WA 2X9GA 4C4SA 4B2IA 3BEDA 3LKDA 1YVEI 4HX5A 5KWJA 4KP7A 1QQAA 3K53A 3UAOA 1JEOA 4Q4CA 2BTEA 3VNVA 1H2HA 5J3JA 2AG1A 1TAGA 3KJEA 4J03A 5T8KA 1M6NA 3K7EA 2C2OA 4DXAA 4OOEA 4HLDA 4HX2A 1PR4A 4LRUA 4AVYA 5AVKA 1E2HA 2D5CA 4QICA 5FUQA 1ZMOA 1HKHA 5ER6A 1O9GA 2ZJBA 4FYXA 3HNRA 2ZT8A 3KNZA 2O8NA 3VJKA 4BKRA 4NZMA 1B73A 3ZE0B 1YZ3A 3L6BA 3TOCA 4OHXA 1LC3A 2ZPTX 4ZT5A 1VE5A 2GMWA 1KPGA 2ZJ1A 2R00A 7ADHA 5LLTA 3DJYA 3MBIA 1RHKA 3KC2A 5TGDA 1F8GA 2XI4A 2Z4SA 3C39A 3DXZA 3ZEAA 4E4TA 4R4JA 3U7IA 4EFKA 5JZOA 1M2HA 2XMBA 3SE7A 1RMQA 2B2XA 1I6LA 1COZA 3L0PA 4LEIA 3TPFA 4FSHA 2HMUA 3BVPA 1OHHA 4LDAA 2EFGA 3DEAA 4QOFA 4YI3A 4G09A 5IJWA 5KQSA 2HA7A 3F1LA 1IY8A 4C9BA 5FBLB 2F43B 3TWOA 2WEKA 1CUHA 1ZUNA 2QMHA 1Z0KA 4NMWA 4LKOA 1IM2A 2H52A 3Q3VA 5CLIA 3N6VA 4ACBA 1N78A 1KEEA 2NYAA 4AKGA 1SG6A 1I2AA 3SVLA 1CQPA 1O77A 3BKWA 4L50A 1XHFA 5ALLA 3TDMA 3GN1A 1B43A 3HP7A 3QVGA 4NEHB 2YV5A 2O8EB 1A1SA 1CQIA 2J85A 1SXIA 1EA5A 4WMLA 3PDHA 5FTKA 4IX1A 1RXUA 1EEXB 1JJBA 2P3QA 1JKJA 1ENOA 1GLGA 3WQBA 1MH1A 1E5TA 1EZZA 4GI1A 1P2UA 1XV5A 2P35A 5BYKA 3R9XA 1W2WB 3JQAD 4O3FA 3U1VA 1EVQA 4MQMA 1GSAA 2WAYA 1SHUX 1VYVA 2X6QA 4MITA 2NXNA 1OXMA 1P1JA 2ZR9A 2R96A 3JAKB 3MJDA 2Q3DA 2JGNA 5FORA 4BNFA 5J1SB 2H18A 2E4AA 3KFXA 1O87A 1Z7EA 3CJRA 4RTNA 4N82A 1W0JD 1IHOA 1O95A 4HP8A 1F4PA 4KQKA 4ND4A 3QNMA 3EASA 3KOXA 2VXCA 2VJOA 3TH5A 4DMUB 3J80A 2V3CC 2JFFA 3SYMA 5LQRA 3DDNA 4BBAA 1PF7E 3RREA 5HKBA 4F1WA 4I9HA 3UJ6A 4MDFA 2ZIXA 5B58T 1MQSA 4XB1A 4WBNB 2QPAA 2FW6A 4QM6A 4LF4B 3K3PA 5A0VA 3G17A 4PG4A 2P68A 4AKEA 1E8MA 1AKQA 1NAHA 5EGNA 3GFGA 2QPLA 4KGDA 4OMCA 5DTEA 1IXRC 1HG1A 1H23A 1THTA 2W6NA 1R7RA 1UBOS 2DWOA 2PGOA 4G5HA 5KEIA 4BP3A 3AFMA 3RIYA 3F4LA 2FSUA 4L3OA 4DGQA 3GLHE 4F5YA 2XVXA 1EYZA 3RS4A 1IL0A 3JSXA 3X1JA 1V5IA 2HIAA 5BR8B 2QG9A 3O8RA 4UVHA 1IBLB 1TUBA 1LRKA 3FGZA 1SU7A 3FVWA 3GA5A 1JQDA 1FSGA 3PI7A 2CL6X 3QI7A 2R3SA 2GN8A 1GRQA 3Q8MA 2V7WA 4AMZA 4E13A 3MQ2A 4DHEA 1JYFA 1KIFA 1MZVA 1N2XA 3WIOA 3ESCA 5DW0A 1SA0A 3WJ7A 4E2XA 3DWFA 3EIFA 2FG7C 3H5NA 3OIGA 4HWOA 2WG1A 4O2AB 3EVAA 4ICIA 3FTFA 2DPGA 2NXEA 4WRRA 5J5AA 4RTKA 3HE3A 4G0ZA 1MT3A 2QNBA 3I9MA 1MLDA 1N33B 2VDRB 1Z56C 2XIQA 1TEVA 1GZHB 1S0UA 2QS9A 4RVGA 3AFOA 2PQ0A 5IDQA 1T5OA 4CKWB 2WHPA 1X7ZA 1G21A 5A1JA 4S2UA 4K9SA 4F45A 3D1LA 3BJEA 3FCXA 3H17A 1H3NA 2HBZA 4BECA 3QVWA 1T1EA 3PPWA 4D98A 3DCJA 4B4DA 2BFEB 4WKCA 1Z2EA 1ZZGA 4OATA 1U7OA 3STYA 3AU8A 5B12A 1NQUA 2I76A 4OLHA 5A4IS 4D42A 1UT5A 3T9DA 1T9DA 4ALNA 2CXQA 4L4UA 4RVUA 3P96A 3U4IA 4UVDA 4ENQA 1N32B 1FIUA 2WPNA 4BNXA 2YWCA 1KC3A 4M1TA 2VHUA 3DLTA 1R5BA 1H8HA 2V5UA 1EB9A 4BFYA 2ECOA 1NI4A 1SVMA 2XF2A 3REQB 2FFJA 1BOFA 4IS3A 1QFSA 2FG6C 3TF5A 2FFBA 4WXMA 4M98A 4Q15A 5DHQA 4H7IA 4R2LA 5H82A 3VR2A 4BAUA 3K71B 2ZYTX 3U7GA 1P7PA 1KP3A 1O9HA 4TLAA 3GBSA 4QBKA 3O4HA 3OEHA 4BNTA 4KQFA 2G80A 4QLOA 2QXTA 3KR9A 1C7QA 2HRBA 3FETA 1N57A 4FEGA 4MKXA 3LXRA 1XTSA 4C78A 4UOZA 4B76A 4EW6A 4L73A 2CZQA 2CCKA 1XA0A 1A4IA 3SK0A 1KK1A 2ZJAA 3H5TA 4GQIA 4J0FA 4LJYA 4BFUA 2XCIA 3MILA 2JFQA 2H1VA 1Z7WA 3CR7A 4YY3B 1EI9A 2ZJ2A 4HRAA 4J4BA 3QE3A 2K87A 3M4NA 1MOQA 4INAA 3TEFA 4BBJA 1NTRA 1NBIA 1YC5A 5EZYB 1XEFA 2C9MA 4Y2VA 3GJSA 3L1KA 3KXLA 3ZXIA 2JCYA 3IE0A 4I14A 4JVLA 1IJKA 4KRYA 3QSYA 2JBWA 3L49A 4X60A 1XGKA 3MFQA 3QEMA 2E4VA 1HDRA 5DB4A 2HYIC 3GGPA 4LV8B 2RHTA 5MGBA 2WOOA 5D51S 3HCCA 2MINB 2IOFA 1JAXA 4MQEB 4RWZA 1XYYA 3WA7A 1PQWA 4LXUA 3SBEA 4YLGA 2DFKB 4C22A 3ZK9A 1QYDA 3H13A 3N3AC 5HOQA 1NLZA 2J4CA 1NMQA 3FMIA 4XEHA 5HPYB 1X1QA 1D6MA 3L1HA 1GZVA 2WC1A 5GVRA 4IKPA 3UK2A 5CLGA 1FQKA 2ZBDA 4RZ2A 2GQ0A 3A9TA 3ZHBA 4RTOA 1P73A 1B0PA 1VLZA 4KVGA 5HF9A 5BVHA 3CNNA 3NBKA 3S70A 4DNXA 4M0KA 1LRLA 4N3CA 1ODSA 4IOJA 1PK8A 1DELA 4B6PA 4R2JA 1QCCA 3DWEX 3FLEA 4MQ6A 4ENVA 1Q1ZA 1SFRA 2A9PA 5J40A 2ZBGA 2JLCA 2GEVA 3H5LA 4JT2A 1CUDA 2O8CA 3DDUA 1Y42X 2IHBA 4IV5A 1RQ7A 1MNAA 4YRRA 2D4AA 1F17A 4DKXA 1J5EB 4S05A 1OD6A 1QH1A 2KLHA 2ZYAA 1MABB 4M6WB 1S8NA 4D5EA 4Z5XA 5KNBD 3OF5A 4OX9B 2C4NA 3BRWA 3ZWMA 4MVJG 2BDEA 2PRJA 3GMTA 2GAFA 3II6X 4K87A 2IC5A 3A3PA 2VHCA 2A0YA 4L3WA 4DCGA 1MAWA 4MS3A 1CDZA 1PQYA 4JROA 1N0VC 3GRVA 3NGLA 1FFXB 1I4EB 1Q1GA 3KFVA 4CQLA 5LOVB 1A7JA 2Q4OA 2Q8QA 1YWGO 4WXHA 4TZTA 1XTBA 2PZAA 3ESQA 4TMZA 1SU8A 3DJFA 1A2OA 1KEZA 1M6YA 1R9MA 5L3ZA 1FP6A 2FFHA 5A5EA 5JAPA 3CJQA 2VS1A 1UODA 1TUBB 1WCIB 3MHPA 1G7TA 3OWOA 4YJ3B 3TM5A 3D2CA 2Y67A 4KAJA 4IYRA 2QTVA 2XD9A 2Z5GA 3WGHA 1ILEA 3QIAA 1ANKA 1L9KA 1W7AA 3W2IA 4EWLA 4MWZA 4XQCA 3INRA 3DCIA 2BM9A 4DLAA 1O08A 1DB3A 1ZDMA 4QEZA 4MUMA 5GONA 2X5JO 4AURA 2BH9A 2CBXA 4DMFA 5I9MA 5I7WA 1XZLA 1Z26A 2RKWA 2EX1A 2FP4A 2ILTA 4Q02A 3DC7A 3UGJA 1S3IA 3K6SA 3ORRA 4II3A 4MV6A 5HJ7A 1S1MA 1YCFA 4F72A 1OU0A 2GWRA 3HCOA 5DK6A 3PNMA 4I81A 1E3WB 4IH1A 2C04A 4BQFA 4TTQA 3N2EA 1U9IA 4M55A 4YGXB 3SJ7A 3ZU4A 3U26A 4JVMA 4ARUA 5JARA 1BYIA 4OX9Y 2J59A 5DM70 2Q1YA 1CUFA 4JSRA 5IASA 2ZI9A 2QA5A 2N0SA 2WWTA 2IYQA 1LSSA 3B6JA 1O5IA 1RM4A 3DM9B 1VE6A 3G8BA 4TYWA 1R74A 1K8YB 3KQPA 3TRDA 2V7QD 3TD9A 3ZCUA 3ER8A 1F0NA 5KC9A 2ID9A 5KNDD 1JPUA 4RACA 2IYFA 2NUPA 2Y8EA 4Q4HB 2GEDA 4G9EA 2M9MA 3I92A 4MYSA 4QTZA 1UEJA 4XCVA 4R9SA 5CHYA 1SC3A 4FMCB 1KO1A 4OGWA 4UU8A 1NKVA 1U6JA 3S99A 3SF8B 2AS0A 4IRUB 4OQDA 5HP4A 3WHKA 4NE2A 2HA6A 3F74A 5T7BA 3OPMA 1I13A 2XV1A 1XYVA 3ETJA 3PE4A 4NNPA 5LBTA 3KV3O 3H2GA 4FSXA 4Y0VA 3URKA 3VUFA 1PR9A 1DC7A 3K1JA 1OGYA 2OGWA 3G8CA 2Q3EA 1A4UA 1T2VA 3LBNA 3P19A 5B6IA 4HLUA 1N4DA 3E0XA 4X6XA 4Y2SA 5CW2A 2VWGA 2XTZA 2BMVA 4KACA 2QENA 3NJ4A 4MR8B 2NADA 1W1UA 5ALKA 4HNUA 4ZDWA 4YAUA 3E70C 3UKJA 4WQMA 4RVSA 5AD1A 5BRJA 2VDNB 1NVWQ 4I1YA 1BD3A 2G88A 2WJPA 4V0KA 4YO8A 4K05A 1C7ZA 1KZ1A 2C3YA 2WF8A 3GLIB 4PLHA 2BZ1A 2Q5FA 4GC9A 1FXUA 5FOVA 1CSEE 2LCIA 4YAWA 1JXOA 1SCJA 3EVZA 1VHDA 1K6MA 2ZYVX 2VDMB 1DKUA 2CFSA 2B98A 4PZYA 2FPGA 4RMJA 1TEZA 2IUTA 1Q6YA 3DPSA 1WY5A 2FPXA 3G0GA 3RKRA 3UKDA 1M2OA 3AKZA 2UKDA 1DBVO 1UC9A 1A9ZA 2ZWAA 1WZ2A 3HKBB 3ZJUA 4TMTA 1ZI6A 1JG6A 3V34A 1M67A 1JEYA 3W7AA 2QLMA 2ORVA 1WULS 2H6EA 3CIFA 5K8CA 5JROA 4IIDA 5KTKA 3ONFA 6ADHA 3ZWXA 1BDJA 1OU4A 4IIBA 3B7PA 5AI4A 3EDQA 1HORA 3WNZA 4D81A 4I8XA 3C97A 3ADKA 1GLNA 1U65A 1QRUA 1XK7A 1GZ6A 3WLPA 3EMVA 1T8PA 2FSGA 3MF4A 4MHOA 2Q45A 2PX3A 3Q40A 4XWOA 3ZCSA 3QEOA 4BJ6A 5HVNA 1XG5A 1ZH2A 1WEKA 1ZN2A 4TTJA 4ZTUB 3KM0A 2PUHA 3B2NA 4FU0A 2O8VA 1E2EA 2WJIA 4MZXA 3JWGA 3ENQA 4YPFA 3RVLA 5J4LA 5JNLA 4LFBB 3P9YA 1XDDA 1UWCA 2D2FA 4UAVA 3H99A 2P65A 4K26A 1G98A 2FEXA 3G9ZA 4I5DA 1TQDA 1K0UA 4U7FA 2PYZA 1XZKA 2JLZA 4E7OA 3A3NA 4YJFB 4NOMA 4FFPA 2XUJA 3OQIB 1VLJA 3KYCB 1MB3A 1NF9A 3GLRA 3PT5A 4QPPA 3UAZA 1T0BA 3KJIA 2C92A 4FFSA 1M1NA 1P4HA 2H54A 2G4CA 2JFPA 2OYCA 2FDCA 1MENA 3MHTA 4O0LA 1WETA 2AJLI 3ETCA 1AU9A 2RCYA 2M6RA 1D6SA 5FNVA 1FMTA 4TYMA 4QJBA 1FJGB 1STOA 4V1CI 2CL5A 4RESA 1I14A 3EDMA 1HX7A 2GM3A 2K4MA 1YQUA 3N8DA 3NFRA 3KO8A 1Y5LA 3O8LA 2WNHA 4HWPA 3JTEA 3RAPR 1TYDE 2Q2VA 4RXTA 4GZ6A 2Y93A 2OLJA 5TQVA 4I1VA 1A3CA 5IVIA 2FPKA 4HTFB 3ONWA 2ZIAA 1G64A 4E5KA 3B6MA 2B61A 5CB6A 2LR0A 4ON9A 1UPAA 4UUOA 3OY2A 3BL8A 3T1NA 3TZQA 5BSHA 5M5BA 3PLAE 2CUNA 4GX1A 5DBEX 3W2HA 4GHWA 2I5PO 3IB3A 4XIGS 5BR4A 3TAHA 1BCRA 3G3EA 3RYCB 1TM5E 1C0IA 3VMMA 3DNFA 4AZWA 4K9LA 1A9PA 3VZSA 1L5OA 1KRHA 1W5BA 2JLRA 4FDTA 3MOGA 3HV0A 2X9NA 3NBUA 2UV8A 4G2NA 2SCUA 5K1ZA 3BE8A 2AWNA 2DHCA 4FQ7A 3G6KA 1RQLA 3QKSB 3HVJA 4FFOA 4KYIB 2FDXA 2DUMA 4NC9A 1MQ8B 1FYEA 3V4FA 1VYHA 4REMA 4BO8A 1V45E 1P1BA 2XECA 4XGRA 4RMHA 5JBQA 1L5HB 1DVRA 3V4PB 4N7RA 4M3NA 4BV3A 2QYOA 3B6EA 1R6TA 3JV7A 1LC0A 2D1RA 2O59A 3HVUA 4LQCA 5DLEA 5HZKA 2JI6A 1DPFA 3GZNB 1XCMA 4PPNA 1L3IA 4G0VA 3FPEA 3RVJA 3SOZA 4B32A 621PA 1Z5ZA 2V8OA 2WE8A 4JV5B 2V7GA 3JQ9A 3V2HA 4NABA 3EGVA 2AOUB 3VISA 2VRCD 3TYXA 5JJ5A 2CDNA 5CH8A 1NU6A 1RTKA 1ZNWA 3IHWA 4PZAA 5E1BA 1M1NB 4DLSA 4D3FA 1W36C 3KT6A 2HOQA 1DEOA 3D31A 2I6TA 2IPLA 2QUZA 2G4LA 1U6IA 1Z0UA 3RYIA 4C07A 2CLEB 1TLLA 1EINA 1NPDA 4J0QA 4JC0A 1T3TA 2HPHA 3BMNA 2OM2A 4OQXA 5J63A 4A1OA 5LJLA 5B37A 1AK9A 1NZJA 1PNVA 2OFOA 1SN7A 1FXSA 1ZD2P 4GAEA 1Z0ZA 2X9VA 4RNCA 4ZCQA 1FRVA 4F12A 1E7MA 4EA6A 2D3WA 2WT4A 3PQ7A 4IFEA 1BVUA 3JATB 1U0TA 3LVRE 2ZB2A 3SHFA 2RAVA 3WSTA 2I2AA 4GH5A 1IXSB 5HKAA 1X6VA 1QV9A 2W6QA 4ZZ3A 4AX4A 2VXOA 1C4XA 4EY8A 2F3QA 4YRTA 1EK0A 1N34B 4ND8A 1WQ3A 3WLLA 5K3DA 2AIRA 4ZI5A 3W04A 2I8AA 2PH7A 4GI3A 4ZOAA 4GF5A 5CAEB 3TL6A 5ADUS 1VBMA 1EGMB 1BS9A 2WUGA 3FUXA 4ECEA 1GU7A 3EPKA 2JK1A 2GF2A 1CT9A 1S2GA 1CVLA 1XZMA 2GN2A 2W0SA 1K9SA 2AL7A 2ZXUA 4IJ6A 3HKBA 1LV8A 4IXWA 1H6AA 2P62A 4Z1OA 1E58A 3IPRA 4DEXA 2PE5A 2YN0A 3AR2A 1N1MA 2HJSA 1FFYA 2ZBUA 5EIWA 3FRHA 3GGSA 1P4RA 2OBXA 5DT9A 2GESA 2BELA 2BKVA 2YZ2A 4MS1A 1TF2A 3EDOA 3USES 3ZCXA 1BWPA 1U1GA 1ZD8A 1JJIA 2O2XA 2PBRA 3R4CA 5JAMA 2I3DA 4XKJA 1RZUA 3A37A 1JALA 1FS5A 5SICE 2CNWD 3WL7A 1UP4A 1EP3B 3FYUC 2GNOA 3WSWA 5KNBH 2GPAA 1N0IA 2RGYA 5DYTA 1SUIA 1SRRA 2QN1A 3O38A 5LQCA 1ZIXA 1NRJB 2PUWA 5AH0A 2VZ9A 4AJLA 5JWHA 4DTCA 1U7UA 3D4IA 3P0FA 4CF4A 3FSGA 1VFNA 3D0OA 3HA2A 4MUFA 1KFJB 1AQ6A 4UVIA 1PR5A 1DCTA 2P27A 2FW7A 4CEHA 2W22A 3D7MA 4RFSB 3U3KA 2XVAA 3QMWA 4PPGA 1VZ3A 5DM60 3VR5D 1QFYA 1KETA 3JD0A 3HN6A 2F8LA 3CNHA 3MMZA 2WAXA 1UJMA 3PLRA 2QTFA 4WK2B 3DL0A 2YQZA 3QJGA 1MRSA 4MR8A 3QW2A 4OIMA 2O2HA 1TVKA 4PHHA 1CUAA 2XOXA 4B9AA 4LYAA 4FFMA 4HTAA 2KW5A 3FYUA 3S1SA 2IOHA 3GL9A 1KI6B 4N8SA 2QVGA 4XIIA 2AYZA 3WC4A 5FPYA 4M1SA 4MVYA 4BB9A 2PEYA 4XWYA 1SH7A 3W3AD 1C4KA 1PBNA 4NENA 2ARKA 4CN9A 4BEBA 1NUHA 4PIMA 4QE3A 1UOQA 4YRQA 2PX8A 2CEKA 2ZIGA 4FCTA 3ZWAA 3ZV5A 4CL8A 1FXWF 2CWDA 3PNSA 1OX5A 1RBMA 3GUZA 1BHQ1 2CJPA 3OQJA 4LWZA 1V48A 1H0RA 1SBCA 3C45A 3IAUA 3VHXA 1NLFA 1NUUA 1RQPA 2HF9A 4WOPA 1Y81A 4U7HA 4MW6A 5DHFA 3VAAA 2NYRA 3WJ2A 2ERYA 1RBQA 1WF3A 1Z4MA 4TV8F 4A10A 2J6HA 1JLKA 5I6DA 1JSLA 5HFAA 4YDQA 1SUSA 3OE7D 1E3JA 3HXTA 2BUAA 1I3MA 2DTDA 1KVQA 2JATA 4KIGA 4HNTA 5FEMA 2RAUA 3ZDQA 1J9EA 3SZLA 3PC6A 4ZT2A 1B8NA 3OOHA 2X3YA 3MW8A 1V2GA 4ZEXA 1Y1PA 3U7RA 3GVPA 2HMTA 3C5VA 3P0HA 3OESA 5EA2A 1R0RE 5GINE 2C5EA 3C1UA 1G8SA 3RSZA 3LRPA 4BP1A 1Z68A 2B3DA 3W6NA 4H3HB 4PX5A 4BU0A 4G1MB 1ONBA 2YQ4A 1E0AA 3IA7A 4UMFA 3KXIA 2FSPA 2O3RA 3AI3A 1Q15A 3B1YA 4BLSA 2QMZA 4ND3A 5JCZA 4C2TA 3T7RA 2R6CA 1PWHA 1D2AA 1X1EA 2B78A 2QIPA 2Y0BA 3LUCA 1OY1A 1R4NB 1T36A 3HYSA 1OKKA 3NKFA 4FNAA 4BQIA 5LMUB 4H4CA 2QMQA 1LCIA 2UYYA 2OM6A 4EHNA 2JLXA 5DLYA 2AR0A 4A0SA 4Q12A 3PEWA 3DM5A 3DCNA 5MFZA 5CFQA 2VZEA 5A4KA 3M1YA 2GXSA 2BL4A 2OVFA 4V0ME 3N5CA 3LTEA 1F51E 3IAFA 4OB8A 1F48A 3LD9A 4RIEA 1WNTA 2GDZA 2VHEA 4IUBS 4ZAVA 3X44A 2CZCA 3RHSA 2IXAA 2VDLB 1AS2A 3V8VA 4LYGA 4F6LA 3AI1A 1F8FA 1P8JA 2GKSA 4QOGA 2F3RA 4QOSA 3V8NA 4D9CA 4EPVA 1F20A 3RUDA 2FMTA 2JLSA 1L4LA 3P2JA 2P7IA 4U9IS 4ZAYA 3TNDA 3VRHA 1WXGA 3TR0A 4MP8A 4LNUB 4EBFA 2H31A 3MLBA 4JEUA 4X7RA 2EGHA 2VF5X 5HCNA 5BUQA 2WYUA 1EDDA 3RANA 5I4BA 5CFRA 1HURA 4FP9A 5C51B 1JQ3A 2JAWA 3L0IB 4TLMB 1JUDA 1DC4A 5TF0A 2GBPA 4X8LA 4Z4EA 4FR5A 4BRZA 3UATA 2CXOA 1FLDA 1NVEA 3TBKA 4DQ0A 1TQ4A 2C5FA 3KHUA 4IVQA 5A2GA 4FYHA 1ZC3A 5JV5A 3JVIA 2I0FA 1JW9B 3E1GA 2F8SA 1U5BB 2EYQA 3MINB 4BLRA 1PKEA 2ZREA 3G89A 5DGDA 1ZH0A 2CKDA 3HUEA 3DV2A 3EAFA 1H93A 5AI8A 4BX8A 4D4JA 4I5GA 1FFBA 4OXRA 2XE4A 4PGMA 5GY7A 4KCGA 1QB8A 3LCUA 1Q5PA 5EHIA 4Q3CA 5H3HA 5BWMA 6CHYA 3OM8A 1TU3A 4X61A 2H11A 521PA 3GRPA 2Q7DA 3E9EA 3VNUA 1R5NA 4YT5A 3PX7A 5JJLA 4S04A 1LKZA 5ERXA 1NURA 2L0XA 1ZONA 3EUAA 4UVGA 3RB8A 1IB6A 4M0MA 4EKDA 4N7MA 1UBGA 4IBOA 4PVCA 3RF7A 4LWOA 1X1RA 4FFWA 4HH3C 4R2MA 2VHYA 1S4QA 1U4SA 2FJPA 1B6RA 1SXPA 1F2VA 1LBTA 4BZPA 4MRVA 2WOJA 3NDPA 3EIXA 3PFGA 4CQJA 1ZA1A 2BJHA 3QKIA 5B36A 5IX8A 2JLYA 4BPBA 3LYUA 5HUHA 1BHO1 3OZEA 4YN3A 1ZI9A 1R9NA 3IR5A 4D43A 5AR1A 3IRVA 4C0SA 2ASVA 3Q8LA 1DT3A 2OP1A 3N8GA 1NPTO 2QKYA 2DCUA 3A1NA 1E7WA 2IEGA 1XZPA 2SECE 2QAJA 3E9YA 4OUDB 4ZDJA 5H8WA 2QGNA 1RKXA 1Y6JA 1E9RA 1LRJA 2LBPA 1MBZA 3W7BA 1EWVA 5IKPA 5LC1A 3B5EA 4ARZA 2R4UA 3FUWA 2ZRHA 2F59A 2QVXX 1UPXA 3P97A 4A6XA 2EL9A 1S02A 1ZVKA 2C2ZA 4QATA 2JASA 2QQGA 2CYCA 1V1RB 4EYQA 1XTUA 1W9HA 4IRXA 1N2CE 1NC1A 1QIHA 3KPJA 2CJFA 3DE5X 1NG1A 2BEVA 3LC1O 4MV4A 4AIRA 1AGPA 4NI5A 5JYBA 4NCBA 4F2DA 2NXCA 5FPHA 1JHYA 3QG1A 4LHVA 3N76A 3W2GA 3Q3HA 2UXCB 2FP4B 4CETA 4PFJA 3OU2A 2QM8A 1N1GA 1E2LA 1TJ4A 1SJ9A 3L7JA 1N77A 1RJ9A 4U7JA 4ZOBA 3TQRA 1Q2XA 3OQOA 4PLYA 2A30A 2H65A 3ET5A 2WTNA 3WGQA 5ALQA 5A06A 2HEGA 3BIWA 5BV0A 4PHGA 3CEJA 3UXYA 3NHPA 3S27A 1DMSA 2VK4A 2R1TA 1Q17A 3LWDA 3FZYA 3H5OA 4LHSA 3TVYA 1GAEO 4ISBA 5FV4A 3G1WA 5IS2A 5IUNC 3ADBA 1I7DA 2O1WA 2ZIWB 3R5JA 4YMIA 4FOPA 1H2RS 1RMTA 1AKYA 4NDZA 1N6RA 1F7VA 4P3OA 5G3ZA 2FWBA 1W5EA 1YDWA 2PLNA 1YAJA 4IO1A 1OZ0A 1ZI8A 2XR1A 4GC5A 4YRIA 5IZCC 2V97A 4B5LA 5LM3A 2FSHA 3M34A 2YYSA 4Y6GB 4DCOA 3AERB 4DIDA 2I65A 4BNVA 3NRJA 4S12A 4JJ8A 3OF3A 4JCOA 1Z8HA 3VKHA 3DCYA 2AWOA 2YC4C 3C70A 2B6NA 3KWFA 4GPEA 2BFPA 4K46A 4YYEA 2HCJB 1KU6A 2G07A 4U1RA 1YB1A 2JH9A 1GQFA 3I5MA 4RPCA 1TGVA 1DADA 3VDNB 2O8BB 3SYTA 2ENUA 4MVJD 4R3UC 2BFCB 2FQWA 1U3UA 3IHKA 4JLKA 2FLKA 4QEKA 4IEIA 5E38A 1QH1B 1QNLA 3JQRA 4ZI3A 1WBBA 2VPXA 3HJUA 1UZMA 4QECA 4Q4AA 5CG1A 1XDZA 1XD9A 4QTUB 1U2SA 3PGJA 1OGIA 4BZQA 1YTLA 3CX8A 3VPHA 4D4LA 1O94C 1V5EA 1KTVA 1DRVA 2BSXA 2GETA 2WJJA 2H07A 4UNPA 1JR6A 2A57A 2GK3A 3ICPA 3QVSA 5FLKA 4EKYA 3ONNA 1TDJA 3U4CA 5IF3A 4O4IB 3FYDA 4RK6A 4YYZA 3R7WB 4AMGA 4KUGA 2XEDA 3EGIA 3WWCA 1J2UA 3C8UA 5IDVA 1SCAA 4YQFA 2MJLA 2QRVB 3PNYA 3QFHA 2HK7A 4JR1A 5DX1A 2ZRMA 4V3BA 4EJFA 2GT1A 4EFDA 1H6BA 3RS9A 4JHLA 1X7HA 1P3JA 1PS8A 1GQ2A 3M7IA 3SZRA 4JJZA 1F2TB 3ZQJA 4FE3A 1J8QA 2R1VB 1KZ6A 5ITZB 3SWWA 3J81A 2C2WA 1T2UA 1YJXA 2VBIA 1PV4A 2IF2A 4HUTA 2E48A 5K7SA 3UJ3X 4P4LA 3SLKA 4AY3A 4BMYA 2VJCA 2I80A 2PA3A 3AOEC 5E8JA 4M9SA 1KJQA 3CZRA 3TS1A 4KYVA 1DWOA 1C8KA 4YAIA 1J07A 4L02A 5FXMA 1MOSA 2GVDC 3WADA 5LMZA 3CH7A 2C2MA 4Q9AA 2V8BA 1D2NA 5I7SA 1GJRA 2J9FA 1SUFA 1R15A 3DDZX 1J21A 1EEHA 3EODA 4Y9TA 4EA8A 5FWXB 5JW6A 1NP7A 1SEPA 1L1FA 2L2QA 3TR5A 1T4BA 3CTPA 3IERA 4LHWA 3BSWA 5SYNA 4CU5A 2ZVJA 3MA0A 5CDYA 5C52B 2XB2A 3SI7A 4JUIA 1AURA 3JAKA 5LWHA 3EPLA 3CZAA 3F8SA 1E1QA 2R85A 3UK1A 4PU0A 1GNLA 1E2KA 1RAAA 1YQEA 4LZLA 3CN7A 3WLJA 5K20A 3MJHA 4UAUA 4GUDA 3V9PA 1L1RA 3S81A 2CL0X 1RYEA 2QP9X 4KSYA 1OH5A 3ROMA 3AVXA 1E1CA 4AZVA 5KTMA 3H87A 1KMCA 4L5AA 4JYPA 4W5NA 4PR0A 3UZUA 1AKMA 1UBFA 3DZGA 3KQKA 2XUFA 5AM2A 4DLXA 1QKIA 1O7JA 1XDBA 4IIGA 2I67A 3KAKA 5ALJA 1DNPA 1M54A 2RE8A 4B79A 5AUQA 2P6RA 1ZIOA 2Q6VA 1LF5A 5IC5A 2UYHA 3R3SA 2IHYA 3MCTA 4GR9A 1AKTA 2A1UA 5IVDA 5B4UA 4U5XA 2WNIA 1G2IA 1BSVA 3DL2A 3HBAA 2CUZA 1ADJA 3DF9A 5GM1A 4RHXA 5BYAA 3NVDA 2PLWA 1P29A 1V16B 3VHRA 3ZKWA 4F04A 4OHUA 2ZK7A 3AHJA 3H9UA 4MPJA 5ES3A 1P0QA 5BQ3A 1Z38A 3OLQA 4I5EA 4P5DA 4ZGGA 1GRNA 2Q28A 1DIBA 1UXIA 1NW7A 4HS4A 3TLMA 5GV8A 2GUGA 1FRQA 3FPBA 3OZUA 1QM5A 4YV1A 2G82A 2BR3A 2SKEA 4ZZIA 4US2R 3GEEA 2W6OA 2CHQA 5LIRA 4JQZA 1CNFA 1MMFB 2IS6A 3BDVA 3AF6A 1BJTA 4U6QA 3GLFB 1U7TA 4I5FA 3LNCA 4RABA 5DEOA 1DJPA 5KMGB 1O2DA 3GW8A 4J1TC 3RC8A 3QVKA 2R44A 4LHZA 2VQDA 3QQPA 1JHXA 3KEOA 2XYGA 2BUBA 5FR2A 1H8EA 2MU1A 5KZMB 1ZBQA 3G7SA 1RJGA 1QIEA 4EMBA 4GPBA 1HLFA 1KEPA 2ZITA 1QRTA 1NBOA 1XXHE 3NQ41 3SXUA 1DXOA 2X1LA 4AZSA 1YSCA 2X5XA 3QYFA 4MK4A 4GYWA 4HQNA 3WWYA 5I47A 4MI9A 5JDIA 4UOEA 2DXIA 1M3SA 3EVTA 4JQOA 2HMSA 4YIHA 2ASEA 5EY5B 5K0BA 1ABFA 1GLVA 2A1TS 1D2CA 2P3SA 2PS1A 3L0CA 4DRYA 2OV4A 1M0SA 4YRFA 5GJCA 2W8ZA 4KBFA 2D2VA 3ZJYA 1GUDA 2YJZA 3Q2OA 3PTAA 3V1MA 1ECPA 2OOKA 2Q5JA 4WVFA 2WTBA 3RJ5A 5JNRA 9LDBA 4OLBA 2WPDD 3L8ZA 4L16A 3RSLA 1KZ9A 2ZSFA 3JSAA 3O31A 1R6AA 3COZA 1J49A 1Z4NA 2ID4A 4IMRA 4KR0A 4ZVRA 2R62A 2WB4A 3E22B 3MLAA 1AK1A 2ZIUB 3HXPA 3DVLA 3KIPA 4BVHA 3UAWA 1CEXA 4MKHA 1NIPA 4JCCA 1KS9A 3HO6A 2H4WA 1CX9B 5K0GA 1M8JA 3RTCA 5JCXA 5LZ2A 1HDIA 2HQ1A 4RKWA 4KO1S 2Q49A 1PP4A 1KJYA 4QNRA 1MORA 4O5OA 5HKLA 2A1IA 3C6QA 7MHTA 4L6CA 1YIDA 4IPTA 2VKQA 3BFKA 4XUGB 4E07A 4HWKA 3JYNA 1O8CA 1ZGJA 5H80A 2B6HA 1YGPA 4E2FA 4LDJA 4AQYB 4Z4QA 4C6TB 2QRLA 1CIVA 3EIUA 2RK3A 3ORHA 1PL7A 4YDRA 1MQ9A 1J1ZA 4MLCA 4QVGA 8AT1A 2W6JA 4B8YA 4JI0B 4M1KA 1RWPA 1L3CA 5IANA 3DBHA 3PRKE 3I1FA 5AKKA 1TZMA 4ALLA 4UASA 3TCKA 3C3EA 1DJMA 2ZKLA 1ZUD1 4GKVA 2SKDA 3BL5A 4H6VA 5DW3A 2GTHA 4P9NA 4XIYA 1CY0A 5D1NA 1X7YB 4CQMA 5IWCA 3HCRA 3O4RA 3ZLJA 2YWFA 3K0KA 3U13A 3IKLA 2FZLA 3WDLA 4FS3A 1YB2A 4Y2TA 3IULA 3C7TA 3L18A 3AZQA 1YU6A 4FQ5A 4W8OA 1C3LA 1PJCA 4GOMD 4BNKA 1EFDN 3Q41A 1P31A 4YXFA 3A1EA 2IIBA 2IJGX 2BY4A 2NUTB 2WIGA 4OKSA 1T9BA 4IZHA 4KPUB 1WG8A 2XVZA 3O8OB 3ORSA 1YMUA 2QLNA 2NO6A 4H3SA 2AX4A 5JHHB 4GX0A 5DT2A 1GTRA 2DFPA 1Z63A 3Q88A 5A7HA 3D8NA 3WDKA 4K9PA 2G77B 4IMPA 3ILHA 3W1EA 3GOQA 2PKRA 1PVOA 2JJ1A 1QGUB 5AP9A 4Z0HO 1Q1NA 4BO4A 1VXOA 4UTZA 1XPJA 3U7QA 1U90A 2W2VA 2W43A 4L75A 2HK6A 3M6FA 1W0KA 2RGNC 1OZAA 2V45A 3ZWNA 2GD6A 1GL9B 4D25A 3JZFA 3FYUB 1NV8A 2YTZA 4KMRA 1QHXA 1WUHS 5FBWB 3LLUA 3M6AA 2JF0A 2F17A 3TLCA 3OQIA 4G3XA 5HCUA 4DA9A 3D3EA 5A3QA 3DKRA 1H8ED 2JD2A 2DBVO 1NYRA 1EFAA 1RHUA 5D01A 3LGSA 2XB8A 4MV5A 3MYYA 4KX3A 2RI6A 3CZCA 3SQLA 3K2QA 5AJZA 5EPUA 1R6XA 1QZUA 5JPIA 2PGXA 3RTBA 4YRGA 1M8GA 4M4SA 3NDBB 2JLBA 3DNMA 4WKGA 3TO5A 3U48A 4EPTA 4GLLA 1BDBA 1P2DA 2YJ3A 2YOGA 4IIJF 3PWTA 4P81A 2DETA 1UBJS 2PMKA 1K63A 2X77A 4FMDF 1VGQA 2IDJA 1V4BA 3CZ5A 1WHSB 2WHRA 2RGNA 3QVLA 4DF3A 3CC8A 3F71A 3BICA 4B3GA 3M6WA 1EJ2A 4KLRA 4RPKA 1YAHA 3ABZA 2YIMA 2IEDA 1QYWA 1CF9A 3EFHA 4DM7A 1CPYA 1OXBB 3FDZA 2OHFA 4H3KB 4KKXB 3MFYA 4DV2B 3P0IA 4J3JA 1JHVA 5J5VA 3FLMA 2I9KA 3PHGA 3G7UA 2DWCA 3FX2A 5F9MA 1B6GA 5HTKA 5CCDA 4R8MA 3CPJB 4HAXA 1H2EA 4W5RA 1UJNA 3WB2A 3RHTA 3K9CA 2RARA 3UYKA 1EWKA 2ODQA 5D1HA 1JDTA 4DBZA 3WK7A 3CPSA 4KR9A 5FCDA 4DC0A 5DLDA 2NV2B 3CRMA 2P5YA 5ENZA 3T9FA 3DD5A 3B20A 3I52A 3RC9A 1RWXA 3G5UA 1SUCA 1XZFA 3UMBA 5D6NA 3FOAA 2FE4A 4M83A 3K4HA 1W4ZA 4FMBB 3M81A 4QHTA 3GBVA 4O8CA 3HUDA 4WBXC 5CM8B 3GNTA 5GGYA 3UFXA 2YFHA 4X64B 1CEYA 3AY6A 3ZHRA 1AMNA 2Z9BA 1X8JA 4BFZA 2G5GX 1YDHA 2GILA 2Y1CA 1CUZA 1CXZA 3B2QA 1RW4A 2YWDA 3KUDA 2FW9A 3D43A 3MJVA 3OP1A 4Q37A 5CLJA 2TECE 1J7JA 3R76A 3U2QA 2WILA 2GEBA 3GF4A 2VJMA 1RYFA 4AP5A 4DA8A 4N76A 2WTUA 3E5MA 2AJCA 4J4TA 5AHOA 3FGNA 3HN2A 2ZTHA 5LLSA 4LBWA 3GFSA 4JLPA 2XF8A 1UR5A 3SEQA 2AG0A 1A69A 4IJ5A 3FDXA 4R8SA 3AFGA 5KVQA 5EJ9A 1GFWA 5COQA 4JB3A 4ALMA 1VRVA 2C8JA 4Q34A 3F6BX 1BCSA 4EATA 3SVZA 3PUVA 5ESXA 4DNFA 1FJXA 3RVKA 2CVQA 4TTSA 2REXB 3PNBA 3EGOA 3PENA 4OK6A 2C0PA 4AL4A 4F38A 3NH6A 1UF9A 2Q6IA 3IP9A 4TN5A 4HN9A 3AY0A 4QJ3A 5L3VA 3ESRA 4MPTA 2BHTA 4DS3A 3VMFA 4IMJB 3AP3A 1E7YA 1OPXA 2GBLA 3IQIX 4FQ8A 4MR7B 3UMJA 1W9MA 2JVIA 2Z4RA 3B36A 3S2ZA 3S44A 4UPEA 4ZHQB 1CE8B 3FAZA 5I9TA 5DVZA 4BO7A 5KTYA 3D8RA 5JEDA 2TMGA 1QFXA 1Y1QA 1ZX1A 4X0EA 3WMFA 3ZI7A 1H1LA 3QKRA 3O5AA 2EQ5A 1NQXA 5LYYA 3FKSD 1W30A 5HJ2A 1BDIA 1Z0IA 3ENWA 1G1AA 2ILVA 2N46A 2VFAA 4ZT4A 3JR7A 1E3LA 1TAHA 3QUAA 4ZC8A 2ZIEA 3DAFA 1BEUB 2IHJA 2EDAA 1EFPA 2AOTA 3K31A 1CUUA 3L3BA 2BFFA 2CVFA 4MGEA 1HNXB 2VT6A 5TQ0B 2PWPA 1RC0A 3OF2A 3QY9A 3NDJA 2RKBA 1OPRA 5DF1A 3MEQA 4B3FX 1ISJA 1Y3FE 5HEKA 3GQBA 2AGVA 4L2IA 1J6UA 5ALWA 4ARVA 2APJA 1QANA 4U39A 1QYXA 2ON6A 4B7ZA 3TRKA 4BLWA 4PY2A 1OGJA 2E87A 2NSJA 4FYJA 4LGMA 4PBTA 5CFLA 2DPMA 1W1IA 2P7HA 1K8QA 2HD4A 1JR3E 1Q14A 2J87A 5BPHA 3C6XA 4LRXA 4Q9LA 1GPDG 2YRFA 2KYRA 4KNWA 3OICA 1P0MA 4IDHA 4JWKA 5AUNB 2ZS9A 1PEYA 4C05A 5C5IA 1YR1A 4KZPA 4NV3A 4HJXA 1SKMA 1UZAA 3AHGA 3HEMA 4P2BA 1ZJWA 3FMVA 3IMEA 3G0BA 4I6JA 5G0UA 1D7AA 2IU6A 3N8KA 4I1PA 2CSUA 2R6ZA 3EVCA 4IV8A 2V59A 1R0BA 3FHLA 3A4MA 3TRFA 3N2GB 3OZAA 1YHNA 3SEFA 2PH5A 1VSVA 7REQA 2PNFA 4RK7A 2HTEA 3WY9A 2HJWA 4F0JA 1FDVA 1XHLA 2JFUA 1G5QA 3MTGA 1BWQA 1OVGA 3S2UA 2QTNA 4BO6A 1GSIA 1OC4A 1K0FA 3KR2A 4ZVSA 1A9YA 2P9GA 2PSHA 1XR3A 4GPZA 4REQA 1F9AA 2AYYA 2QSYA 4BNIA 4XB6B 4DA7A 2WG2A 4HVLA 3DTVA 3P9PA 4B6SA 2WZQA 1P4SA 2DLNA 1BXRB 3R3VA 3RYHB 1IOWA 5LKAA 1N9KA 1SC4A 3VR4A 1ZAYA 4G4JA 1VL8A 1XLVA 3DLAA 3E35A 3G8DA 1U0OC 3VAZA 1M1XB 1WA5A 2YZMA 2R7MA 3KOYA 3K73O 5KYUB 5LMCA 4REOA 5AKGA 1WWKA 4IQ0A 4JXXA 2OWEA 4WASA 4F3YA 3CISA 4RF4A 4JLNA 2O4UX 3R3XA 4WERA 4IGKA 3O26A 1RRFA 2F6RA 3KG2A 4BP8A 4D8TA 2CXTA 1R8YA 2XGGA 2FR1A 3IYLW 3PV0A 2XRZA 4Z4HA 2H57A 3ENVA 4RIFA 1HFKA 1VCHA 1YRLA 5J4KA 1L8XA 1NQAO 4POOA 2IS4A 4YMHA 3KL2A 3SXJA 1RAIA 5CDUA 3NBFA 4ZMSA 2NUPB 3WV5A 3LHIA 3C5WP 1YF3A 2OCBA 4U9HS 4IY1A 3SJCA 1YBAA 2BW0A 3S1LA 1NE2A 2PUJA 5C37A 1D2GA 1XBTA 1EH5A 4G9BA 2C03A 3GFOA 3KKLA 3GZ4A 2HA4A 4LY6A 5TC4A 3LDUA 3VC7A 3W5VA 1RWOA 2RK6A 2XLCA 3FJYA 4HB0A 5JPCA 5LU9A 2NMVA 1SCBA 4UUNA 4HDRA 3DAGA 3W5BA 1HM5A 1VE7A 2J33A 2R6DA 1F2UB 4TMYA 5K6RA 3PNLA 5EE1A 1SC1A 1FDTA 3MJSA 2C2XA 4FYIA 1UINA 2V7PA 3AGPA 2EWVA 2O3SA 3L4SO 3PGXA 1XTKA 3HCAA 2HNAA 2PQ6A 2YHIB 3ZE1B 1V5WA 2XJ9A 1KVUA 3C1OA 1IHYA 4OLFA 2YJ4A 3DAOA 4PIPA 1SG0A 4R9RA 1EBFA 2UZ3A 1CR0A 3WGMA 1Y1RA 2V7EA 3EQ7A 3VR1A 5HKKA 1AVTA 5LU8A 3ENKA 1PI3A 2OG1A 2QDKA 2R6AA 3GUYA 3CCCA 1E98A 5I9IA 3OZDA 3OLYA 4EO4A 5JE8A 2CFIA 3CINA 3JS5A 3VU3A 5KAMA 3S8YA 4QXRA 2B83A 2C97A 3KQNA 5F9HA 2WD8A 2FQ1A 3G8AA 1J5PA 1EXNA 1TPYA 2VSNA 1XAGA 4P3NA 1JLHA 4FHDA 3A04A 3TAXA 2V6MA 1ZNZA 4OI0A 3IODA 3TRIA 2NGRA 5EOVA 2JIZA 1ZQ1A 3GRYA 3P9QA 1N2GA 3KTOA 3ZDYB 1HEUA 1KSJA 3GFVA 5ALGA 2ZULA 9ABPA 4WCFB 4CM6A 3GT7A 1JQBA 3GJRA 1FW8A 4NMXB 5BN1A 2Q29A 4O4LA 3EMKA 1LJLA 3E3OA 1NVTA 3ZNNA 1PK9A 13PKA 5AW2A 1G2QA 3HPRA 5BR7A 5KVAA 3F5QA 1L6IA 5JD5A 3DF7A 3SJZA 1VP3A 1K7XB 1I3LA 1I5RA 3GEHA 3SDBA 4D4HA 1E79A 3V46A 1Y3HA 3EC2A 3B12A 1DAMA 4HB3A 3RG8A 3QEKA 2BFWA 2G1KA 4KXWA 3R09A 3UNXA 2FXVA 4Q0MA 1IAVA 1POXA 1M34B 2FEWB 4AP6A 2EZ9A 3E23A 3L4BA 5DNCA 3WV4A 5JI3E 4YCDA 3PF9A 2NM0A 2RFLA 4KXVA 2ZYWX 3QA3E 4PO8A 2Q2NA 1WKVA 5CD1A 1KFKB 3KB2A 5HMLA 3OMWA 2OCIA 1XZ8A 4TVBA 2LKDA 2FQYA 1YJAA 3IAS6 5LD2C 1KKLA 4E11A 5CG2A 1SCNE 2B1QA 2D5IA 1LLCA 3D81A 1QRAA 1U4OA 2C31A 4URWR 2H3EA 1E6WA 3HJRA 3O94A 4PTYA 5MN5A 1U04A 2QX6A 4QIHA 3DSRA 2FETA 4IW3B 4AJJA 3BGDA 5LZ9A 2Z8YA 2WSSA 4XJSA 4ZVKA 1HT1E 3BX1A 5D85A 3KFLA 1UQRA 2A88A 3GPDG 4WADA 2G40A 1COWD 1T1JA 2VEDA 2G0AA 3IH5A 2ADOA 1PWEA 2HQBA 3IDSA 3PPXA 1W0CA 2A4MA 1SR8A 4JOCA 3OJCA 1Q7TA 1NW3A 3K32A 1NHGA 3PFBA 1KP9A 5ELLA 3GCGA 4H1HA 3EC7A 4QDXA 5A9TA 1G8MA 4P6VF 5IN4A 3EXHC 4BXOA 1B0AA 2QM7A 3QGMA 3EG9A 1VGRA 3M6IA 2I4OA 4J76A 4YB8A 4R71A 2X8JA 4RD6A 4J8PA 1TEXA 3FUCA 1NN5A 3C4VA 4JDPA 4M7PA 4ER0A 3PSAA 3IE2A 4MQUA 1T9GR 4PYLA 3ZV3A 4A6DA 4IWYA 4WX2B 1EPUA 1GL7A 4NPHA 4BO1A 3ROKA 2I66A 1VIVA 2Q46A 2IU3A 2QTLA 4PCLA 5FUWA 1Y6FA 3UC9A 4G01B 5DWDA 3H2KA 4OSEA 3LT2A 3PYMA 3ICOA 5IMBA 5A5FA 1B1CA 2Y0EA 4QWWA 4U00A 1GSOA 3JVUA 1XMPA 4X24A 1KEWA 1DZIA 1XL1A 1O95D 4LHEA 1NQTA 2IELA 1E9AA 1WMDA 2D7JA 1PFUA 2B8JA 3NC0C 2OQRA 2BGMA 2J4DA 1WDMA 4G63A 2CKMA 3SF8A 1TA4A 4QXQA 1FP1D 1TK9A 3B6KA 3DB2A 5ESWA 3L1VA 4ALJA 2ET6A 2IIVA 4RHCA 3ZY4A 3ZHUA 2ZR0A 2REQA 4PZEA 2IY7A 4AXBA 5JZVA 4MWBA 4QDOA 2FN9A 1CQJA 3CF6R 1QC5B 2H2GA 3F67A 3IP5A 4CI9A 3X3HA 4WZ6A 1ZUWA 3K09C 1QQ7A 1WTAA 3W8DA 4KPYA 2QLFA 1B8VA 2OTCA 4NEGA 4RSMA 5ILGA 3VV3A 1Q44A 4DA0A 1JSXA 4AJOA 4AZ3B 1GPYA 2WE7A 2HWWA 2OSBA 2R65A 3LPCA 5KOHA 1Z29A 3DVRX 3I0NA 1S4MA 2FPIB 1XA3A 3TW6A 4MTCA 4ILEA 1T9GS 3BSFA 4DDHA 5C5DA 2J9FB 4RENA 1W29A 1KC1A 2YDYA 3H83A 2RBEA 5LQAA 3ZDRA 5JLJA 4FTWA 4BLPA 4HRYA 4N03A 1CC1S 4TWJA 2NYUA 3W05A 2RIRA 5F5NA 2QVLA 4WJLA 3WGIA 1P80A 4M1WA 1GUZA 2GVNA 2V4UA 1H5QA 1OHHD 3WNVA 4YMVA 3CSUA 1I8TA 2F62A 2QDXA 1E3DA 1NJ1A 3DOOA 3RV4A 4HBZA 2ZWVA 1FLAA 1WRBA 3E58A 3AUFA 3ES9A 3PVCA 3A4LA 2KBEA 3PEVA 4LX0A 1R8XA 2NZYA 2GZDA 2HSGA 4DLRA 4TUYF 1JXAA 1WSWA 2I4NA 1EVLA 2JGDA 3EW9A 3L0DA 4OH7A 1JIVA 5B1SA 2VDQB 4JBHA 2RDMA 2Y0CA 3J7TA 5NLLA 3DR5A 1S9DA 4C5AA 1QAMA 1O6CA 4GZMA 2F1RA 3T5PA 5FA5A 3OTIA 1IN4A 1F12A 3M5CA 5FUBA 3VZCA 2ZUTA 3PE6A 1OX6A 2HCTA 2ICAA 2H7VA 4BJHB 5A4JA 4QOJA 4CV3A 4QNMA 2BD0A 3NHBA 1J42A 1N3YA 2WSSD 3DFUA 3F5FA 3EA0A 5G4LA 4W7SA 1Z0SA 2I87A 1M72A 2JD0A 3REFA 3ZK7A 3OCYA 1COWA 2YXPX 3PPIA 2E6KA 1JFVA 5EXPA 4DUZB 4V0MA 1KJNA 4CM7A 1Y3AA 1R4NA 1A2KC 1H8HD 1O4WA 1YJCA 2XYQA 4QO7A 1RD4A 2ZJ0A 1XLWA 5DX8A 4DLLA 3DO8A 1UJ4A 4MHSA 1QFMA 4BNWA 4FS8A 5I8ZA 2WFLA 1MFZA 2CVOA 2J3JA 3QVOA 3RODA 2BF4A 1VDMA 1KH3A 2Y1OA 1EDOA 4ZVVA 4A0FA 1WNFA 3ZDAA 2EKLA 2ZR8A 3LP6A 1X3SA 5E7JA 4CMAA 1M0EA 3KKZA 2AA3A 2AW5A 1MRZA 1W85A 2HNBA 1O0SA 3NTVA 3OP4A 4IL5A 4TLCA 4ZO8A 2D00A 2OCPA 3LX5A 1XCLA 4UCQA 3SC2B 2H5EA 2A84A 4LY9A 5BOSA 1XNRB 1V11B 2ZSBA 3Q6IA 3NJ8A 3NAMA 2XD4A 2Z0MA 4FGUA 2WJAA 5KSPA 1JU3A 4J1QA 5BURA 3FTDA 4HEQA 1RE0A 1WTCA 3KS9A 5ABPA 2J07A 4RC9A 3P94A 4K81B 1F2DA 2YFYA 5FWDA 4CCYA 2AZ4A 3DYVA 1OR8A 4QGFA 1YGYA 3GT4A 1OROA 2XNHA 3IOYA 4NMHA 1JEDA 3R7DA 4BGVA 4EJ0A 4JN6B 1ACLA 2GEJA 1NJ5A 1RAFA 3HI6A 3HO8A 2QI9C 3TZ6A 1TA0A 1QGOA 3PNKA 1BQ3A 1KJ9A 1FX0B 4UBMA 4DG9A 4OHBA 1P4AA 2JZCA 4TYNA 1EWTA 4OGLA 4R1QA 3VR5H 3L6OO 1MC8A 3V6LA 2IYYA 3WLRA 3DVAB 3G1UA 3RIXA 5KYWA 3QYPA 1JFSA 1NVVR 2Z6VA 4TWIA 2BJWA 1HT2E 2JRCA 2MIIA 3HJTA 1CBUA 3R6LA 3WRYA 4ZGBA 5JAIA 2PAAA 4PTZA 1B7GO 1RLOA 2JJ1D 3IESA 3N0XA 4K9RA 3HDVA 1A76A 4UJ3A 3Q7IA 4URUR 2FZ5A 5HGJA 1ZITA 3O9MA 4WGFA 1TAQA 1DJLA 4S24A 2AN3A 4A82A 1OLSA 3MJ4A 4ZYUA 1O97C 2ISCA 4MAAA 4CLHA 2AG5A 4BQEA 2AXQA 3QF4B 3WKAA 1PX0A 1U1IA 4HEA1 4IJWA 4WE3A 1MFPA 1GQRA 1Z0FA 1Z18A 3K6RA 4NCNA 5DGXA 4ZRMA 2GCIA 2OKGA 5JDIC 5L51A 3ZJTA 3WFIA 5CFOA 1Y3CE 2FUNB 1E0JA 1WKCA 2H0RA 2YHBA 3PRJA 5LP6C 3UT5A 5BWOA 2DJIA 2X0KA 4J0IA 4JP8A 3ZOKA 4M9XA 2UUBB 2X7XA 3NYQA 3I5AA 4YAJA 4EMTA 2C61A 1I0LA 4OUDA 3ZWVA 4AS1A 2ZRKA 2BFNA 4DKJA 2YYZA 4NBWA 3PSHA 3VPDA 4TXHA 5A3VA 3HRHA 4IHJB 2IYXA 3MB8A 2WUDA 3NOXA 4P7JA 2R2GA 1T24A 5CH3A 2G1AA 2QN9A 4FYMA 4M0FA 2ZYUX 1K8RA 2IPMA 1YB6A 3IJEB 3UMMA 4PYIA 121PA 2FX5A 1D2HA 3PYLA 4NCHA 3H84A 3EHDA 3JD1A 3PJEA 2OMKA 5LOVF 4CFSA 4OVKA 2XZTA 3BFJA 1A5SB 3AHDA 5EIBC 821PA 3BK1A 4JUDX 3MCVA 1H4VB 3V4RA 1A88A 5IVKA 4HZIA 2CCJA 1QPZA 3U4HA 3ZDFA 1CS4C 1HA3A 3I72A 2XB9A 1JJVA 4LVCA 3WGYA 4UQOA 3TGWA 3GJYA 1TK3A 4Y2YA 5L6MB 5E7MA 5F4BA 3RK4A 4WK0B 5IC6A 2QGFA 1KYXA 1MC4A 2G5CA 1RPNA 1XZIA 5EVCA 3AOEA 2EW2A 2ECKA 2F67A 4FWIB 3UH0A 1TUIA 2QMYA 3VTZA 2QN7A 4JASB 4P54A 5FA8A 1P6QA 1JMVA 2QMOA 5HFJA 4GOJA 1UPFA 2IUYA 3B48A 4DIOA 4W5OA 4L8WB 1WP9A 3T5AA 2ZWPA 1PDOA 3RRBA 3KDSE 1UC5B 1EFUA 3I1IA 3OIDA 3KP1A 4Q3DA 5KYXA 3LU1A 4FILA 1NASA 3LSTA 2EW8A 4U7WA 1RQNA 2AQKA 5FH9A 5FNVF 2PUCA 3O9ZA 1FB5A 1XJ5A 2NTVA 1JIQA 2NV6A 2IU0A 5H16A 2GD1O 1I6MA 1CY7A 4E46A 5LNK6 2WWRA 3LECA 4PC7A 5HUJA 1RVDA 1VDZA 3ZGXA 3ED5A 3U5TA 4RV5A 1JSZA 4CW7A 4Q1DA 4EY5A 2ZRCA 1E6LA 4XB2A 4BZZA