3SIPA

Crystal structure of drice and diap1-bir1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
ALGSVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase
publication title Structural mechanisms of DIAP1 auto-inhibition and DIAP1-mediated inhibition of drICE.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase/ligase/hydrolase
total genus 42
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sipA00
1SC3A 5IASA 3NKFA 4QUDA 1I4OA 1RHJA 5LUBA 4EJFA 4FDLA 2HBQA 3GJSA 4FGUA 3H13A 4EHNA 1KMCA 3DEKA 3GJRA 4QULA 3V6LA 2J32A 1RWNA 4ZVOA 3V4LA 4AW9A 4QU9A 5LU8A 4QTYA 2AR9A 3UOAB 1NW9B 2QL7A 2CNNA 4FEAA 4ZVPA 4ZVUA 2FQQA 2QL9A 3KJFA 4JJ7A 3R6LA 4EHAA 3S8EA 3DEHA 1RWMA 4EHHA 3EDRA 1QTNA 2FP3A 2QLBA 3ITNA 4LSZA 5IBRA 4PRZA 5IAKA 4D3XA 1BMQA 5LUAA 4JR1A 2WDPA 1RWKA 1SHJA 2DKOA 4QUHA 4NOJA 4ZVTA 4FXOA 1ICEA 4JR0A 4ZVRA 2NN3C 1I4EB 5IC4A 4QUEA 2XYHA 2CNOA 4I1RA 2QLJA 4N7MA 5I9TA 1RHUA 1F1JA 1PAUA 5IABA 3DEJA 4JB8A 5IAEA 2H48A 1CP3A 3RJMA 3SIRA 4HQ0A 4I1PA 1NMEA 1CVRA 4DCOA 3R5KA 1K86A 4IYRA 1RWVA 1RWWA 4QUBA 4QUIA 3S70A 3V3KA 3V6MA 3UO8B 1F9EA 3V55A 2QL5A 2HBYA 2J30A 2H4YA 5H0IA 5IBPA 3R6GA 3SIPA 4QU5A 3E4CA 4QU0A 3R7BA 4JJ8A 3R7NA 1GFWA 2H51A 3H1PA 3PD1A 3H0EA 4JQZA 3D6HA 4NBKA 3H11B 3P4UA 2XZTA 5IARA 4AWBA 4D3YA 4QU8A 4JJEA 2CNKA 4NOKA 4NOMA 4N7JA 3NR2A 4QUGA 5K20A 1SC1A 4NBNA 1RHQA 5IAJA 1RWPA 3NS7A 4EHLA 3BIJA 3IBFA 4ZVQA 3R7SA 3DEIA 2H54A 2Y1LA 1NMSA 5IAGA 1GQFA 1QDUA 1RHMA 4NBLA 2CJXA 3H11A 2CDRA 5IC6A 2XYGA 4N6NA 1NMQA 5IANA 1RHRA 4HQRA 2FUNB 4EHKA 4N6OA 4IEFB 2P2CA 4N6GA 3K7EA 4PS1A 4AWAA 3P45A 4QUAA 2HBRA 2C2OA 4PS0A 4EHDA 1SHLA 3PD0A 4QUJA 4N5DA 1PYOA 3EDQA 4ZVSA 4JR2A 2C2KA 2CJYA 1JXQA 3GJTA 1RWOA 4PRYA 4DCPA 2XYPA 2H65A 4NOLA 2C2ZA 3D6FA 3R5JA 2J33A 5JFTA 2C1EA 1QX3A 4DCJA 2H5JA 3PCXA 4HVAA 4JQYA 2H5IA 2H4WA 2K7ZA 4QTXA 5IBCA 1RWXA 3GJQA 1RHKA 2C2MA 1RE1A 2J31A 2XZDA 3V4OA 4EHFA 5I9BA 1K88A 2HBZA 1M72A 1SC4A 3KJNA 5LU9A 2QLFA 4M9RA 2CNLA 3QNWA 2Y0BA 3D6MA 3OD5A 3IBCA 1I3OA 1IBCA 1I51A 4D3ZA 3KJQA
chains in the Genus database with same CATH superfamily
3EY4A 3K6SB 3R0IA 1GO2A 1QONA 3HCDA 1F3LA 2C20A 5C7YA 2YMPA 3D5EA 4WOCA 3PHGA 5HEKA 3TQSA 3PZBA 4EJFA 2YIJA 3VV2A 1UQTA 3I9V6 4V3CA 5BRJA 3W9YA 1H3NA 1KQ3A 1U3TA 1J5XA 2EFHB 1Y3BE 2H7CA 3NWBA 1PJTA 4RY0A 1OAKA 1VG9B 5CYFA 5FL3A 3T99A 5BV1A 1UH5A 1HYBA 4L4RA 2X76A 1M2KA 4UAJA 5FA6A 3RC3A 4LYHA 3INNA 3DL7A 4BKUA 2CJFA 2JI4A 2GJKA 4MIEA 2JBWA 4AY4A 4CMGA 3DEHA 5FIUA 4ZKEA 4F2WA 1C4KA 1GLGA 16PKA 2PX2A 4QQRA 2PJDA 1TJNA 3N76A 1DRJA 1MVNA 3KAJA 4KFUA 5EQJB 1IOWA 5JAZA 1W4CA 4WZBB 3T52A 1N0UA 5JAIA 2DFNA 1LLFA 2VRWA 1ZUIA 3AV0B 3S0JA 1YRBA 2ZBGA 4D5EA 2ODBA 2GN2A 1P1BA 2OFXA 4GOXA 4W6QA 3Q8LA 4OBWA 1E8NA 3OZUA 1N6RA 1KYVA 1XVIA 4PHTA 1WQ4A 3DE4X 3AINA 5CR9A 2OOSA 4RH3A 4EY6A 4R3WA 4PXSA 2GILA 2VJBA 3GNLA 3KB8A 4EI7A 4OBXA 4DM7A 2I2AA 4ARZB 3PFNA 4W6ZA 2Z0MA 3DHVA 3L77A 1A8IA 2LCFA 1FXSA 2OO5C 4XX0B 1H1LA 1SQ6A 1SKMA 3BKWA 1G21E 4FFNA 1J0AA 2PK3A 1NZJA 3COZA 1Q3HA 2QM7A 4GKVA 3D7LA 5CDTA 1QHHB 1I24A 1MX3A 3C7KA 1E4EB 4R8LA 2GAOA 1X0VA 4N7JA 3RBAA 2VSOA 2QTHA 3FLAA 1R10A 2Q6IA 3A9TA 3DVAB 1RLUA 1OT5A 2GN1A 3QVGA 4K6FA 5JG7A 4BQNA 4MGEA 2ID7A 3L5OA 1IG3A 2VAVA 4ZEOA 1WB5A 4HH0A 3STTA 3SDSA 4BEJA 3JQ9A 4IZ6A 3JQBC 3AUAA 4HS9A 1HURA 2I6TA 3WDSA 1U7DA 2YCBA 3TIVA 1P7PA 2VSXA 4DCCA 4EHKA 5JC1A 3ZHQA 5E8RA 3P2EA 3CEMA 1JKXA 1X9IA 4GP7A 2WD7A 4YAGA 3RVQA 3PRYA 1I0LA 3DDNA 4PYQA 3AKZA 2CCKA 3W2TA 2J3QA 2WUFA 3RTAA 3O4IA 4ZHQB 1TIKA 5KYYB 5HRUA 2DKNA 4M9CA 2VHQA 1B7GO 2ZJ4A 2AL7A 4C3UA 4ID3A 3BQNB 4O4HF 4XTRA 3SNKA 5A3RA 3U09A 4EW6A 3FZQA 4DOMA 1R50A 3V33A 1MIOB 3OY7A 3T3HA 1ZXLA 2XBUA 1ZAKA 2O8FB 1JIUA 1VBFA 1GL9B 3B38A 1ORTA 4CM8A 1W0KD 1NYQA 1IE3A 1XEWY 1XTJA 2EJBA 3G2MA 1E9RA 3CEJA 5BUSA 2GFIA 3O8BA 5J1SB 2Z6QA 2IU6A 5BRNA 1VJ5A 1A9YA 3DFIA 1ZO8A 2G07A 2Z9DA 5AKHA 1B8PA 5DNAA 1Z7WA 3B5IA 4Z0NA 1XJWA 1XZGA 2YXLA 3RCBA 1NF3A 4B71A 5EZ6B 5U1PA 2OHXA 1CDOA 5JNWA 1LPOA 5TX7A 1E1RA 4F93B 3SFZA 4PN3A 2VYNA 1RABA 1SA0B 5K4HA 5LQAA 1D0IA 3LUJA 4TZ0A 3T1NA 3W5HA 2XXBA 3GRCA 1W36B 3EXHB 5CHEA 5KTTA 5I3ZA 2G5TA 3IMCA 4KLRA 4LV5B 4G0MA 1NASA 1TW2A 2O2SA 2WWGA 4DEYA 2B2NA 2Q3FA 2H0RA 3F90A 1XBTA 1MHPA 1GD1O 4OH7A 2BTEA 2FW0A 1DELA 1XB2A 1N7GA 1JALA 3FYCA 5FQOA 4MVWA 3C6YA 1MP0A 3WS7A 2X19A 4GZ6A 3ZVRA 5DGHA 2OXFA 1WB6A 1BH6A 1MQSA 2BELA 2DSTA 3OX4A 4GO1A 4GXTA 5FWAA 3RBVA 1DEOA 1FU7A 4J3NA 3Q8MA 2BHTA 1Y1SA 3GZNB 3SR4A 4PZCA 4UUOA 2ZIAA 4RESA 1FTNA 2IYXA 2IV3A 1BDIA 3NWPA 1Y9ZA 4XEHA 3OJEA 3DEJA 1GM5A 2ZM6B 4ZO7A 4IG4A 1R6XA 3M81A 3ML1A 4KAJA 2I7CA 4UD6A 5U9CA 4HB3A 4FC7A 3B9QA 1RFLA 2FSGA 1NUHA 2CBZA 1YJ8A 2OK7A 4WACA 1O4VA 4JT9A 3T41A 5EPOA 4I6EA 2J9YB 1QH9A 1GSHA 1HBJA 3KZ1E 1DOHA 1OLXB 3W8EA 4DJEC 3ED1A 2GMWA 4DJJA 4HC4A 4U1RA 3HM2A 3RIEA 1EM8A 2QU8A 2PUGA 4BMCA 4AWBA 2LDBA 4NOKA 2HU7A 1M8FA 3GROA 4OMCA 4WOKA 4WK6A 1N6KA 1CYEA 2B25A 2QUJA 2ZITA 1MNAA 4TSKA 2HQOA 1EVYA 1OFHA 1RXSA 2UZ4A 1XROA 1XLWA 1ZGHA 1SD5A 4YJ2B 3HJUA 4EX7A 3I2YX 4YP9A 4AMVA 2PUDA 1U98A 3WYEA 2WBLC 4XVQA 3MUOA 4GE0A 4MQBA 4KUGA 2WMDA 1NMQA 1NURA 1Z83A 1UBLS 4J07A 1L7OA 5HF9A 4R2MA 1ZVVA 2PVSA 4LFAB 1KO7A 2KB0A 1U9ZA 3CE9A 4E15A 3UWPA 2WTXA 2WYHA 3BRQA 4P4SB 2Q49A 1NA5A 1TCVA 3P45A 5DVZA 2M1XA 1GUBA 3QLVC 3VVCA 4R0VA 3RYTC 4PINA 1E1NA 3JX9A 4K5QA 2ZE6A 4YMLA 2JAPA 3L6OO 1E0AA 3I9V1 1H2FA 1MB9A 5COBA 2I9KA 2BKAA 1IAQA 2R7MA 2PSDA 2VWGA 4LYAA 5A5EA 4IAOA 5K8VA 4DLAA 1U7PA 3KSZO 2XQKA 2VAPA 1VJTA 2OCKA 1JG3A 3BIOA 2CKMA 5C51B 4RVUA 4O1IA 2WG0A 3DVRX 4GT1A 3H4TA 3GJQA 1TUBA 4P7GA 1IN5A 3FG9A 1AU9A 1E9EA 2CYAA 1SCIA 3CLKA 1P6UA 5D1NA 2M6SA 3QF4A 4HGYA 1VJRA 2XNSA 5G4KA 3ACBA 2QRVA 1KP9A 2YN2A 4CZ2A 2PSSA 3WK5A 1T35A 2FUEA 2XUPA 1CJTC 5SY6A 3PXUA 4QYIB 2H4ZA 3S2IA 3WIUA 2X3UA 3DH0A 4KJXA 3TG2A 1TQDA 4A6DA 4YJGA 4PC7A 1JHMA 1OI7A 1FJ2A 3B8HA 3F6SA 2D62A 3TOZA 4F2HA 1KDOA 1VGRA 4BMZA 4I5EA 4MUKA 2VSYA 2QJFA 3A7EA 4PAOA 3V4LA 2DFLA 2AZDA 1FFDA 4FCVA 3W4IA 1PWHA 2VJAA 2O0MA 4TV8F 3G8CA 1JEEA 4ZV9A 3W2IA 1DKRA 2ZBVA 3I76A 1YQGA 1Z17A 2FSHA 4C03A 3C5VA 3R1IA 4KZPA 5ITZA 4X71A 4IZIA 4I8IA 2D0PB 2P4QA 3BCSA 3C43A 1E2NA 3JATB 5AXDA 1PNOA 4PSDA 4OI1A 4ZOLF 2F3PA 3IJEB 5FTWA 4ARCA 3IMGA 3NC0C 1X94A 4H59A 4F9TA 5CA1F 5LUAA 1XL1A 4C7OB 1GYRA 2EP5A 2P1ZA 1J7JA 2QVYX 3P96A 5KWJA 5KQRA 2EV9A 3NC1C 3DLCA 4X54A 3ZW8A 1EM6A 3L7NA 2ZI3A 3N8DA 2IUFA 1U2GA 1HK7A 5FNVB 4EATA 5HQ3A 3ABQB 2I0FA 3INYA 1L5NA 2NZWA 3FZGA 1NLYA 3KWJA 1JU3A 2OESA 2Y9MB 2ZTHA 4OV6B 4XCXA 4W9MC 1CFJA 2A94A 5JBNA 1SC9A 4QJIA 3V6MA 3DVSX 4MWBA 4HLQB 2Q1TA 4LSWA 2J5RA 1U28A 4RFSB 1VYHA 1P91A 4GBJA 1PNRA 2GM3A 5IC5A 2WWXA 1GY8A 3FROA 1L8LA 1L9KA 3BG5A 5HKOA 3AEKA 5JCOA 3D5TA 5ALOA 3IUSA 5A2QA 1EVLA 2ZAIA 2VNHA 2HSWA 3MAJA 1Q1BA 4OP3A 1UAYA 2WAMA 2ZTUA 4UNSA 3WJAA 1Z28A 5ANRB 5ER9A 4HH4A 1N8TA 1KA9H 2IX3A 1MAUA 2FI1A 2W2LD 1FX0B 1WXFA 5K3DA 1XZHA 5FADA 3SKXA 2Z56A 2ID8A 2W90A 2QRJA 1QBGA 1SQ0A 3IKLA 4GOKA 3TOCA 3VC1A 1X2EA 5HF8A 4Z49A 1H8HA 4X1OA 5EEHA 2RIPA 1XFAA 1QHFA 2VYVD 5GJVC 1B6TA 3LPAA 4BO2A 1ODJA 3K9GA 1BGWA 4J1NA 4WA7A 1KDVA 1W0JD 2C2BA 5KOIA 2VSNA 4NS4A 3H2GA 1C2YA 2X7XA 3KT6A 4DLNA 2XNDA 1MG5A 3HZRA 2HN9A 4QNMA 3PXGA 3PUXA 2R6DA 4OYRA 2A5JA 3MZ0A 3BIXA 3DOJA 1T8YA 5D2CA 5F4BA 3DE7X 2G8LA 5CAEA 1NKVA 1Y6JA 3DDOA 4WLVA 2PL5A 3IGFA 4I5FA 2CMKA 1UP7A 3BWBA 4G5HA 1T4BA 3OEEA 5JQGA 2HJWA 1P7ZA 1DTEA 2I3ZA 3B3GA 3F5FA 3EIFA 3PQ7A 5JNVA 1M2VA 3I0MA 1CUEA 1QCZA 1BEEA 4KMMA 1RYDA 2V7QD 3MMZA 5MN6A 5KYWA 2K7ZA 3AI7A 3FAKA 3V1NA 4R1SA 5IHPA 3CX7A 1J7KA 2PU5A 2XT0A 3WVNA 5A0FA 1RLTA 1JIIA 3HFSA 2Z5VA 2VLIA 2JAHA 1H69A 3VYRB 2WJGA 3R3YA 2ZI6A 1U81A 4FFWA 3T4EA 3VTZA 2Z2JA 4R8RA 4GAEA 5E4TA 4O25A 5HWSA 4YAIA 2PZEA 821PA 2ACKA 3F7NA 3HKCA 3NTRA 1S2NA 5G53C 1I4OA 2QRQA 2AN9A 3DF7A 3PHCA 1ACLA 4JLAA 4KSBA 4JUAA 4LZJA 1V41E 4GD3Q 1AO3A 5KNCD 1MFPA 1K3FA 2EDAA 4F97A 2QRLA 3LWBA 2AQKA 1ETHA 1N8SA 3D3QA 1KVUA 4E11A 1LBIA 3LNTA 2QR2A 4OU4A 5TDHA 2YW9A 4H6PA 3WI7A 2DWOA 5E4YA 1WR8A 4QTYA 1WZ2A 1OI4A 3BORA 1MJNA 2H1RA 3QFCA 1I7PA 1ZP6A 2PAAA 1WXHA 2H4XA 2SKCA 3FNHA 4FKBA 4NG4A 5JWOA 4CDMA 1UEXC 4MQMA 1EXWA 2C4KA 1RJFA 3HU2A 4FI3F 4AKIA 2BM0A 3JVDA 2SBTA 3SP1A 1C1HA 2CEKA 3OHMA 3GT3A 3IOMA 5A2GA 1XT6A 1XNQB 4B6GA 4MGHA 1E1LA 4MVJH 3D4LA 2V9ZA 4BRZA 1BS2A 1NNI1 5A4KA 4BO9A 2ZR8A 1WHTA 3K5WA 4KX3A 4FBLA 4D3DA 2F48A 1G8KA 3NEJA 4XUGB 3UT5B 1O9GA 2PS1A 4A8JA 4K9QA 2PUVA 2DWCA 4I1PA 1VDMA 4MDYA 1XWWA 2L69A 3ABRB 1JHZA 4CMAA 2N0SA 3IIKA 5KYUA 4OQDA 2NYRA 1OBOA 3HA2A 4WLFA 3B53X 1GPNA 1GADO 4WN3A 4A8PA 2C4TA 1QV6A 2LKDA 3UHPA 5LMUB 3ESBA 1VE3A 4G5GA 1MJFA 1GTVA 3K70C 3I52A 3OWHA 3LA8A 1GG8A 2CZCA 4P92A 2XF8A 2ZJAA 4NFLA 2QBYA 2E6KA 4Y2UA 1J2EA 4KVFA 2WJ4A 1KQNA 1ISMA 2WILA 3EFEA 4FQ5A 2GBLA 4QQNA 3HJHA 2JFHA 3O4JA 1K8YB 3H1FA 2YNMC 4Q82A 5LMCA 4K6HA 3UWDA 1Y82A 1E59A 3I04M 4EHLA 4L8LA 2FR8C 1QLHA 1DKNA 3H97A 1I36A 4UDOA 4N18A 1P77A 2O5EA 1I7LA 4YHHB 2VA8A 1R27A 4IJ5A 1QR6A 3BSYA 2HQSA 1TGVA 3KYCA 2VHCA 4L85A 4HGPA 4MJ7A 4OTZA 4TV8A 1EVKA 3UHFA 3AQ4A 4RIHA 4QKQA 3CLUC 4Y2SA 1QDEA 1LVUA 3H16A 2WF9A 3ZUGA 4GYYA 1ZESA 2WUVA 3AI2A 4BJ6A 4ENSA 3GLFE 3R77A 3Q8KA 4CQMA 1LLQA 3OVMA 4ZOLA 6LDHA 2AEFA 3UAZA 3EVTA 4RZSA 3ZD8A 2J0QA 4N0MA 4PLVA 1MB3A 4KO2S 4E1BA 4ZI7A 1MT3A 4DCJA 5F7OA 3A9UA 4JQYA 3R5HA 1IZZA 4MIYA 3LUGA 4BQPA 3I5YA 1JH9A 2CT8A 1N2OA 3PL1A 3OD1A 1JEYA 2DQYA 5ALYA 5EHIA 1BGVA 2QG9A 4Q6WA 3SHTA 4ALIA 3OCVA 1T4CA 2R96A 1N2EA 2VZLA 2UZIR 3P1JA 1K1EA 3N2LA 4FFBB 2CB0A 3FCAA 2CNLA 2RGEA 3WWYA 2MIIA 4BNHA 3HXTA 4DARA 2X15A 5LUBA 1RYFA 1F2UA 5B64A 3T9AA 4NYIR 5BVHA 2HA5A 3IAEA 2AUMA 1BXKA 2ZQYA 3E03A 3EPLA 3PGJA 3RYCA 3OOWA 5EQTA 4AKHA 3BM5A 4Y6OA 1RAFA 2CF5A 3T61A 2YJNA 3TVDA 5DHQA 2G0TA 2FPOA 4C0JA 4D9EA 1NLMA 2JJ8A 4GNRA 1BRMA 1U7UA 3LQFA 4FMBB 4WZBE 3ITEA 3LO5A 3BZUA 5AUNB 1XQ6A 5HIKA 2R60A 1J70A 1QIKA 3AP3A 4B33A 4WY5A 2IA5A 4JKYA 4EUFA 3RTCA 2J9RA 5L9AA 1U5AA 4M1WA 9GPBA 1XMVA 1NTOA 4YQFA 2HF8A 4UTZA 3V9AA 1JKIA 1Z25A 3UPTA 2ZRKA 4LK2A 4E1VA 1O96B 4EB6A 2AQHA 4EA6A 4F12A 2P9JA 2QRZA 1CSEE 3E9QA 3VU3A 5BWNA 2B98A 1ZJJA 3UA4A 1JJFA 3EIOA 5CVTA 1KP2A 1ACMA 1ZD9A 3OA0A 2OHIA 3ENQA 1Z5VA 3LDGA 1K66A 2J9FA 5LZ2A 4RTJA 2WUGA 2OB1A 3USZA 5HBRA 4CKYA 4ZQFA 5C32A 1EBBA 4V3BA 1TM7E 3REGA 2NU7A 4BGIA 1N7HA 1XKLA 1EM8B 2EFEB 3U4GA 5CB6A 1JMKC 2BLLA 3I73A 4MEJA 4PV7A 5M04A 4N3NA 3QWFA 2FPSA 3AHEA 3EY9A 1CS0B 2FSVA 4RPHA 5CURA 5F4ZA 3EA5A 3L7MA 3DZHA 3RKRA 2ZSUA 4B0OA 2H4YA 1A27A 3CNQS 1VGVA 1E66A 2K6GA 5JTUA 5EGNA 3BWMA 5DNYB 3ASUA 1D9ZA 4YRMA 1A7AA 1ISSA 5IEJA 2CLHB 1A5BB 2CEAA 1JECA 2DT5A 3OCWA 3R6TA 5KZMB 1HM5A 3PDHA 3VPDA 1VJGA 3OSZA 3X1JA 4ZOAA 5KYKA 3H9QA 2YN4A 3L8DA 4KR9A 2V4UA 3LLVA 3RS8A 1BJKA 1GXSA 3ZQKA 5L3VA 4HLUA 3SQDA 2I2DA 2FPMA 2W6CX 4RANA 1EINA 4ABYA 5BXYA 3AEQB 4B82A 3CH4B 2P9TA 2CVHA 3VKWA 2C2OA 1X15A 1EGVB 2C3OA 3GZ4A 4QG7A 3CN7A 3LYHA 3P71T 1O7JA 2YWEA 4BATA 5TMDA 2FDXA 2VVTA 1VIAA 5AK5A 5EY5B 5FFFA 1DMRA 4IIUA 2A58A 3PUHA 4BWFB 2YHSA 4UDYX 5EZ5A 1LI5A 1AKQA 4G1VA 1CUZA 3ESQA 4ZRDA 1EG2A 1AV7A 2BY4A 2G9VA 3T0GA 5EXDA 3CX3A 1SVSA 4UBIA 4IDGA 1K88A 5ALNA 4EO9A 2A8YA 4IF4A 3OC0A 4MYSA 4Z7OB 1U1GA 3FHJA 3TCXB 3IFSA 4OQFA 3WLPA 1JVSA 1KJNA 3AZPA 1PGQA 3CPSA 4DPKA 1OWMA 2EYUA 4L75A 3ZDEA 2XTZA 3Q2OA 3ZGOA 5BUCA 3IMEA 4JITA 3KK0A 1N5JA 4IWYA 3NT2A 1ZKMA 3V6LA 5HZMA 1KEPA 3K1TA 2P91A 1JU9A 2J3KA 3EF0A 1H2EA 3MAAC 3C8UA 5GZ6A 1W5SA 3P9CA 1E4VA 2FWRA 1E63A 4YR9A 1JHRA 4F96A 1IXYA 1XMOB 2RGNA 4Q18A 4H18A 2YJ3A 3A1NA 3ACDA 2A1IA 4CIAA 1GWNA 1PT5A 4FFDA 2O0JA 1VG0B 5I7VA 4RS3A 1TA9A 1PR6A 3WKEA 3FJOA 1PU2A 4Z4CA 4O4HB 3CZ4A 3TMKA 3VYUB 3WG9A 1MJHA 1R7RA 3U2QA 1QIDA 4U2BA 2R4QA 2VDJA 2J3DA 4BPRA 2IW1A 2O59A 3AESB 3BH6A 3OEHA 2FCAA 4ZIRB 5FBHA 4YHBA 2GT1A 3Q0IA 2XRMA 3AEKB 3D8HA 1D6NA 1XC7A 4EKDA 4HHEA 4UHFA 2FPPA 4HBGA 1PR2A 4JFRA 1W25A 4XSGA 5JJBA 5JJ5A 1PNVA 2CLLB 4FBGA 3EDOA 5B6PA 2GHQA 1GAWA 2FZLA 1N7JA 3W8FA 1UUFA 1UZUA 3IVRA 3NNNA 4HATA 5CDSA 4Q93A 3AR5A 3TEMA 1SIOA 3OIDA 4PQRA 3SEAA 3EQ9A 4UD2A 1O6ZA 3IIEA 3GDGA 5JNSA 1AKYA 3QX7A 1GLNA 3G88A 5LB4A 1R1DA 2PSEA 4DWWA 1RWBA 1R12A 1PKXA 1ZOIA 3OFND 3IHTA 1EVJA 2IIVA 2YFYA 4ND7A 3HVKA 4BCDA 1G20B 1SUCA 1MH9A 2B99A 2I2CA 4WZAE 5HOQA 2BTQA 5A7FA 5CAEB 4Q9NA 3V4FA 3AOEC 3OE7A 2YBDA 3BMOA 1J9ZA 1XWFA 3IELA 4NBLA 5IW8A 3O21A 1QMGA 2FPGA 2JFNA 1JEQB 5JQGB 1R0BA 2LE0A 3B9PA 2Q3DA 3EIWA 2J46A 1V2GA 1RBYA 1J2YA 1M2VB 3EQ8A 4MTLA 4YRCA 4QXOA 3U26A 3ZCUA 4YV7A 3DAGA 5A1TA 4D26A 4YX9A 1KY4A 2L42A 3JVVA 1VIYA 4WA8A 3M9XA 2VHJA 4CMCA 2VYFA 3HEMA 4HI0E 1VXRA 4Z2YA 1GG9A 1EVQA 2CJYA 1G6KA 1R16A 1HNXB 1J8FA 2AOVA 1Y9DA 3QKWA 4W1QA 1VI2A 3NB0A 5JY1A 2D5CA 1EXMA 1NONA 4WFIA 3B3JA 5JPDA 1J2JA 3H1EA 2VN8A 4RX1A 5KKNB 1E6KA 1SU8A 4KE9A 1I7DA 4R3UC 4JZKA 3FVTA 2OB2A 1ULTA 1ZCZA 3VYTB 3PE3A 1PEKE 3FSGA 4M4SA 4C3ZA 1FLAA 3OFKA 1JLLA 2QE6A 4J2TA 3UK1A 1OIVA 3QNWA 3DC2A 3B52X 1M34A 3TRFA 3M9WA 4RA9B 2PRJA 2H1VA 2JIPA 3B6IA 4ARSA 4PLTA 1M0TA 2ZTLA 4LBYA 1HYGA 1XKXA 4FIZA 1Y42X 1N34B 5FPTA 3QFSA 1WZCA 3GDFA 3GUVA 2OA0A 1T9KA 3BKXA 5AT1A 4KYTA 3ENNA 3GT0A 3OIYA 3S6JA 1QB8A 4P82A 3R3JA 5LD2B 3ECSA 4AP6A 2QHXA 1TMKA 4FE7A 4AZSA 4ZTZB 3TRKA 2FWMX 5HP4A 3BE5A 2QL7A 4URWR 1YF3A 1ZD8A 1DAIA 1WHTB 3U80A 3C7CB 3CC8A 4HV4A 1YJ5A 5ALJA 2GK3A 1TZKA 2A67A 4A8JB 1GVNB 1UANA 3NQ41 2GX6A 3G8BA 2IT1A 1ADGA 4HQ6A 4IHJA 1Z4QA 4OLHA 2JNWA 4HJRA 4QNNA 3G02A 4M0DA 3GFQA 4MVJA 3O84A 5IAKA 3V9PA 1OX6A 4FFPA 3WQHA 5T7BA 4TQUS 2FV8A 5EPUA 5KYUB 1H4VB 4H3VA 1G3UA 5D7NA 5JWHA 1DBSA 3VJKA 1V25A 5F9FA 2XYHA 3V4ZA 3Q8WA 5KNDH 3ZVMA 5I9TA 1GVHA 3FY4A 1A9XA 1XU7A 1U8EA 2A9VA 2WSBA 3U4QA 5BOVA 2ZUSA 1QYXA 5AUPB 1D8TA 2GERA 2OFWA 2V58A 2XQJA 1VCOA 1A2BA 3BK2A 4M21A 4Q9AA 4RZUA 3UH0A 2IYYA 3FMVA 1A98A 1G291 2F1OA 2GVZC 2JZCA 1UT6A 3L8MA 3MWDB 4GSLA 2OCPA 8ABPA 3R23A 4Y6QA 3KOOA 2NM0A 2X41A 1SUBA 3EZGA 2AK2A 3OHPA 4J0QA 2HDNB 1R5OA 1LH0A 2PTGA 3U4DA 2G5CA 4FE4A 4H1UA 3JQGB 3D2AA 2Q8QA 3R0QA 3UBTA 1F2DA 4AG6A 4MKIA 1QC5A 5ILGA 3KKZA 1ZGAA 1O5TA 5FR2A 3U31A 2YYSA 3QHPA 1N92A 4RQUA 3KYCB 2XA1A 3MFYA 4TV8B 4ZVVA 3T1YB 2AJDA 3SJCA 3KZKA 1WETA 5HGXA 4F3CA 2LIVA 2H11A 1TYCA 3BIJA 3K9BA 5DSXA 2B8NA 2E55A 2QQ5A 3WLMA 5IKEA 3DFFA 1Z4LA 1GTRA 2IH4A 3D4IA 3EF1A 1CY8A 1ULZA 1WEKA 4L8VA 4JJKA 4LRUA 5J2UA 4W5TA 3VPGA 3Q6MA 4FZ5A 2QJWA 2ZRCA 1JQ5A 2AMJA 2BR4A 2BWJA 2VT2A 4JP1A 3JVIA 3N3AC 4ZOLB 5FKJA 1YZGA 5KVVA 3BULA 5FI1B 3U7QB 1K0UA 1U9IA 3HCCA 5FULA 4XWKA 1MX5A 3TH5A 2H18A 1FIUA 3NUZA 3A6GA 1WLSA 5HRAA 3ORSA 3VR6D 5HM6A 1QIGA 1EJ0A 1FNMA 4FNAA 1CKEA 1JEYB 3PQ3A 1T4CB 1BTOA 1ENZA 1FJHA 2NO6A 4L74A 4ONEA 4RIFA 1LV8A 4Z9AA 5I9SA 1KEEA 1RWOA 3WGOA 2G28A 4DQUA 2UUAB 2PX4A 4HAXA 3ZDDA 3RIMA 4OQPA 1LSOA 3A1WA 3ILVA 4UULA 1F2UB 3DCIA 3VR2D 4NCJA 1HLFA 4DEVA 5I45A 4O2RA 4XOIA 3M7IA 3LGXA 2JGAA 1UK9A 4RA6A 4B3CA 5JALA 2A5GA 5JAPA 2H7VA 2C2MA 4MUAA 3KALA 3V4OA 1ABEA 3ZLVA 1AGNA 1KR5A 3Q3EA 5JD4A 3ZIAA 2J48A 1W47A 2J0SA 3P0FA 2GPAA 3AV3A 1FVXA 4OHWA 3ISVA 1ZNQO 3H5WA 4ZT3A 3OUTA 1GAJA 3WAGA 2JH3A 4QOIA 2UYCA 3RI3A 1ZIYA 2FOIA 2WHPB 5BW8A 1XK6A 4JJZA 3CNHA 1WO8A 3SZUA 4K9LA 3DDSA 3NTUA 4G97A 5E6SA 3U7EB 1C3EA 3AR3A 4DLVA 3ZGVA 3JPYA 1Q2UA 1KYYA 3UMJA 3EVBA 4KB5A 4ND8B 4X61A 2PWYA 5F1PA 1XTPA 3P2IA 5BWOA 4DSUA 4ZAFA 3WK8A 3PWKA 5HG0A 3HDTA 3PCTA 5FH9A 1J0CA 3OTGA 4RKQA 2F64A 5REQA 3CLTC 2J9FB 3WFJA 2FPXA 3CV3A 4F56A 1VG8A 3A6KA 3G2NA 5F9MA 5JR3A 6ABPA 2Y1DA 3IBTA 3UW3A 2NU7B 3W6ZA 3SQXA 1PJ8A 2FMUA 4F4HA 5CYGA 3QE3A 3W5BA 1HFKA 1XJQA 3QE4A 4A10A 1QANA 3HU3A 4J43A 3HCAA 1LLUA 2AS0A 5FORA 3GEHA 5T4BA 4LDAA 4ENWA 2I3DA 4IDBA 2Z9BA 4NQRA 4TTRA 5JS7A 2AF3C 2NXEA 3QBJA 4KQHA 1V2HE 1VL6A 1QIHA 4DJDC 5HQTA 1IM5A 1OLSA 2QLNA 1CP3A 4ND6A 4H3HB 3SXJA 4DDKA 1BKYA 2EBFX 2WU8A 4OHOA 4QGHA 3D4BA 1O95D 1FQOA 2RK3A 5K0NA 1E2HA 1Z74A 3R0JA 3DPSA 3PC7A 1J2UA 1YZ3A 4NZZA 2EKZA 3B1VA 4XLTA 4OIFA 5FI0B 2QL5A 2Q4DA 1D1QA 3MJHA 3KDSE 1LBEA 3VBEA 3C97A 4BEVA 4DR6B 5AI4A 2GZ1A 1QG6A 3AVPA 4PZAA 2ANBA 4BS9A 5I4IA 4OLBA 2P1DA 3CW8X 3QUQA 2HCJB 2ZIEA 2KLBA 4NBVA 1C4WA 4DMLA 2IYPA 3AJDA 3PEYA 1VSBA 2FGJA 3NHZA 1NVGA 3PIDA 4OJQA 2PIAA 1WG8A 5HIMA 1Z0IA 4CVNA 5KTPA 1DBQA 1E1KA 1VTKA 4O02B 2NUAB 1DC8A 3BF7A 3GGOA 1PV2A 1NWCA 3K0HA 3GJ0A 3OQNA 1SUPA 3Q9SA 4JLUA 1B1CA 3QELB 3T5PA 1RJWA 2CFTA 3M5DA 4FMPA 4BGVA 3E2IA 4JBNA 1ABBA 4O4JF 4X94A 1SCUA 2JARA 2YV2A 4EP1A 1M6EX 4BB9A 2WZCA 3O3MB 2WYOA 2K4MA 4KV7A 4TTQA 3JRWA 3R0VA 4KZKA 4WKGA 2JFZA 5J59A 2BJHA 2QUAA 1JHDA 4XARA 1LWNA 3ZDXB 4I4TA 4OO3A 2YMMA 2ZRHA 3E3MA 5NLLA 4TMYA 1S6YA 4I55F 4NESA 3FWKA 4GOLD 4OREX 4F3YA 1N6PA 5C5EA 2BR3A 3U6BA 4HX9A 3OJLA 3QV2A 4GLBA 1K5HA 2VIIA 4RK6A 1U11A 4G0XA 3RYHA 4FYMA 4I2VA 3R75A 2X9LA 4HAUA 3E05A 1UMDA 3EC1A 4L22A 5DYWA 3D6AA 3IESA 1I0ZA 1URPA 1ZNYA 5AMXA 4Q4HB 3WMRA 1AHNA 4BIMA 3U3XA 5JNRA 4W5NA 3TSZA 1T6BY 3T1VA 4GLFA 2EFJA 4KIGA 4QDTA 2G83A 1HEIA 2MT9A 2P2YA 3DLBA 5FL7D 2QZPA 4TKLA 1FTWA 3ANNA 2Q7XA 3ASYA 4YRJA 2JF0A 4I8DA 2IYNA 4EYQA 4XI9A 4RWEA 2CXRA 2GYWA 4GI5A 1PZNA 3N70A 4ZO6A 4BX2A 3OZGA 2GRUA 3ZHOA 1BVRA 4J1QA 3G68A 4JBGA 2R8RA 3OQOA 2GBCA 4K0KB 3CGWA 2AI2A 1Q3KA 3PNMA 1MC8A 1B0PA 3JCZA 1ZGGA 2BRUC 2GXSA 4GR9A 4JDUA 4WERA 4OAPA 1YR2A 5FTKA 2PNJA 1XQ1A 2BKVA 3UJ6A 3VC7A 1CRZA 2C07A 3ETHA 3HABA 1JAHA 5AVVA 3RU3A 5DN6D 1Y8ZA 4TRMA 5DJ5A 1BS1A 1O94A 4G84A 2VDMB 4ZCIA 1LI7A 1TF2A 2DEUA 4ZC8A 4IFBA 3H84A 3WOVA 4E94A 1FYEA 2QLBA 1T1EA 4KL8S 3C1OA 2Z3ZA 1RQ7A 4KYIB 2C2YA 2NU6A 1TK3A 3NHWA 2G04A 1A77A 5AIBA 2Q5LA 3HRIA 4LQLA 1U8UA 1P0CA 2QYSA 2ZSDA 4EM6A 2TMDA 2DJ5A 1F5NA 1I6LA 1G8PA 3CSDA 4HJXA 5BURA 3L1HA 4M9QA 3OM1A 3PK0A 4WEQA 3JWIA 3WK9A 5GIPE 2D1SA 1QQAA 1DWUA 1GG5A 4QFMA 1W4BA 4DV6B 2BV3A 2I7XA 1ISJA 3SIXA 5KSZA 2J45A 3NYRA 3G2IA 5TQ2B 5I7HA 5E8JA 3BAZA 2Q2NA 1WP4A 1P8JA 4MRNA 1INLA 1BCRA 3SZGA 2XA2A 3VYWA 4POAA 3DAHA 2DHCA 1X70A 2VXYA 2Z95A 2NVUA 4KLZA 1DKUA 1L1FA 4DW8A 3T38A 2BTQB 1K7YA 4CIYA 4TUYF 5JE8A 3A6JA 3AT1A 2H1CA 1T0IA 2HA2A 3H1PA 1D6MA 3QLEA 2QR5A 4OAQA 1CVLA 2IIQA 3OM9A 4EDHA 4DV4B 3RVKA 2AC4A 2GKOA 8AT1A 1PCXA 2D2XA 4PPGA 3SX0A 3CM0A 3L5KA 4IGFA 4IJUA 3SVLA 1G7RA 3U1VA 2BP7B 2E4AA 2FR1A 1UP4A 1ZWKA 5EE1A 3UJAA 1XA4A 2WA2A 1EUQA 3LLUA 2RFLA 3OA2A 1Q1NA 1VOTA 3E53A 3MOIA 4YT2A 2WU3A 5A4DA 2Y4NA 2NZUG 3IEIA 1YHYA 1Y5IA 3H6HA 4G0PA 3UGKA 1YGYA 3J81k 1FSSA 1KBZA 1SQGA 2A0WA 1E79A 3KSRA 3RYIB 1V5IA 2X6TA 2V6IA 1Q83A 4PG6A 5AM5A 1QP4A 3R44A 3ZZTA 3B70A 3BXXA 1WDWB 5EIFA 2C9YA 2GFHA 4X8LA 3DMFA 4ZAVA 2OV4A 3BGSA 2FJ0A 3DFUA 1DB3A 3Q87B 1JLLB 2GF0A 3D3EA 1KZ1A 2OM6A 1G41A 4CDGA 4EYOA 3BX1A 1M34B 4Q9HA 4LV6A 3U44A 3R7WB 1LPNA 3AHDA 2W2KB 4V39A 3QU5A 4C20A 1DUSA 1YB4A 4MRMA 2B2XA 1GA6A 3BJZA 1BXGB 3T7AA 4L9WA 2KBEA 1PVDA 2A5YB 4QOSA 1HSOA 3HB9A 2QLTA 3NIGB 3OU6A 5CJPA 2HO5A 2ODAA 1E96A 3A7DA 4GXNA 2QAGB 4MW6A 4OGFA 1A7KA 4P3PA 5CPFA 3TN7A 4ALLA 4DBLE 4I1IA 1DG9A 4KRXA 2CDCA 5IXJA 2IQ5A 4I2NA 2XGOA 3WP0A 1Y5MA 5LQRA 3G59A 3WRYA 2JJQA 1GQOA 2GASA 2JJYA 3QSGA 1JJ7A 1XQYA 3H13A 3SSNA 1WU8A 2ZB7A 3MWFA 2WOJA 4HH3C 5AYVA 1Q50A 1ESNA 4E12A 4QYWA 5IDVA 4LGYA 1RT9A 1YZUA 5KCZA 1MU0A 4RY8A 6YASA 4C7KA 3MMPA 2CDAA 4K9MA 4ZOCA 1NULA 3GB9A 4IF6A 2HD4A 2UDPA 3PZRA 4HWSA 4KQ6A 4N5IX 3R8CA 4QRIA 1C3VA 2Q4TA 3LC7O 1TUGA 3R3WA 5E9JA 5LZ8A 2C58A 2I71A 1ZCJA 4OCZA 4L78A 3AM4A 5AHOA 5TRTA 3RARA 3SQMA 1OLUB 2PYIA 3IQDB 1FU4A 3UK0A 4G0VA 3LUPA 3MGBA 3CH7A 2HWXA 3BE4A 1C3OA 3M6AA 5EJFA 3PICA 3I1IA 4O4JA 1DWOA 1P6QA 2BUAA 4A2CA 4DG9A 2PQ0A 4K26A 1XF1A 2ADOA 1FLDA 3E7XA 3FSJX 3HYLA 4TWJA 2XYVA 4ZT7A 5C8VA 5K0GA 4AIRA 2CLSA 5KNDA 1I4EB 1IWPB 1NT2A 5HCIA 3JALA 3ZXUB 4CTNA 4MWGA 2EFCB 3HKEA 5K0SA 1HNZB 1RRMA 2WKRA 5HFJA 3FKQA 2FPRA 5FV7A 3TL3A 3TIIA 3V7FA 4I55A 5JV5A 4XYLA 1GFSA 2PL9A 1EB9A 4LJ7A 1T1IA 1QC5B 2PS9A 1CVRA 1VE1A 2N1BA 3MWYW 1P62B 1SBCA 2EG9A 3KPVA 2FPIB 2HQ1A 4KP7A 2HY7A 4CCYA 5FV4A 1EEXB 2Z43A 3ZGNA 3NASA 5KOJA 4CM9D 2RHGB 1NVUQ 2WJ6A 2Y76A 3O1IC 4NEGA 5JEEA 4LZZA 4MQEA 4WEOA 1G20E 2ESRA 2FPLA 4OM7A 4IHQA 5J2UB 1SUEA 5CCDA 4YMHA 3JYNA 3PD1A 5F5XA 4MGKR 2NNLD 1WY5A 3EQ2A 2AI3A 1J33A 1PDOA 3CX6A 2R66A 3HXOA 3VZRA 4MR9A 1QPZA 1BQ3A 5LIPA 1TZBA 5E2AA 1YQTA 2XQFA 1MRNA 1MX9A 3H87A 5DBHX 1PFYA 3M6XA 2VTKA 4Z86A 5DW0A 2R47A 3ZVKA 1E5TA 1W49A 4GX1A 4AROA 5C52B 5K3FB 5BSFA 3B6ZA 4N0DA 2V65A 1O3YA 4MKGA 3ZG6A 3I1YA 4F2DA 4IIFA 2ZSEA 4R69A 3HFRA 4KUHA 5TR9A 2YV4A 1KU6A 1QB7A 3GO4A 2UZ1A 5BQ5A 5IM4A 3S2SA 3LY8A 2GN8A 1F60A 3FLEA 3H2JA 4GYWA 4S1NA 1YVPA 3IH5A 4RNCA 5EIBD 1KZ6A 2B0JA 3PKJA 1X7WB 2D2EA 1D07A 1JXQA 3GJYA 2OZKA 2XD9A 2ZVPX 3AJ8A 4F6RB 3T5TA 5A7GA 5A04A 1ZW1A 2CHEA 3G2JA 1GSOA 3R5JA 4JP3A 2AZTA 4MLDA 4UDNA 4JOCA 5I9IA 2C61A 1SO8A 2UVDA 3LM8A 1ORVA 5EC8A 2XB2A 3WIOA 3BT7A 5EE0A 4MH0R 2ZPUA 3I4LA 3C2QA 5E6SB 4KUEA 2HLHA 2JKVA 1GUYA 5LU9A 4JLOA 3K2EA 1DXHA 3KKNA 1OJ7A 2HA4A 3CKKA 4YCMA 3C8MA 2P2SA 3WLNA 3ZCPA 4RTNA 1OVGA 4PX5A 1AKUA 1VIMA 4NE7A 3ETJA 1CQWA 4LZWA 3DTTA 2OO5A 4RHCA 2DQ4A 3L4KA 5REQB 2OENG 1QCCA 4PCAA 1WUYA 5BYKA 3IIMA 4BB5A 1NXSA 3K3PA 1J0DA 4E51A 3GARA 2QMEA 2CBGA 2XY4A 3C3MA 4IV8A 4OK6A 4PY2A 4REOA 2FN3A 2AR9A 4C4XA 1D2GA 3IIIA 1EFRD 4IJKA 4RFVA 3V2GA 4QDZA 2YXPX 1MABB 3M0EA 3LF2A 1A9RA 3HDHA 4UVEA 5CMLA 2XRFA 1A9OA 3DJYA 1PZFA 3NUQA 4FHZA 3FFBA 4ZCTA 1OPRA 2QXUA 3SDBA 1OLSB 2PH1A 3MTIA 1Q74A 3JQBA 4CM4A 3HJRA 1L5QA 1H2ZA 5IF3A 4GC5A 2DC1A 2E49A 3I9FA 1KS2A 2RAPA 3ZHYA 1DO8A 1UIMA 1QX4A 3OPYI 2AV6A 1EFUA 1XVLA 4F5WA 3HO1A 3WLHA 4A73A 2ZUUA 1W35A 2ZIGA 3ZIDA 3O1JC 4HXEB 5EKSA 4MUBA 3K53A 2X9VA 5AHXA 1PUXA 3ZQUA 4DLLA 1UJ5A 4BZXA 4P1ZA 1TUIA 1WHSB 1H85A 4FUTA 5L3RA 1ZJ5A 2WI8A 3VH3A 4B4WA 3NP9A 3L8YA 1IPHA 1PQYA 5DP1A 3DKVA 4WBNA 1P3DA 4E03A 3UOGA 2NP6A 4LRWA 2W6IA 5FOTA 3VH1A 5B1DA 1UAAA 1Z2EA 4RMJA 4Q48A 4AXBA 3FPGA 4B3BA 1WPRA 3BBPA 3R7BA 1Z4MA 2TECE 5B6IA 4ZI3A 1H6CA 1VJ0A 1NY6A 3OJFA 4LDZA 1QGED 4B0PA 4E5PA 4KR6A 1XP8A 3TIFA 1RVDA 4A0GA 2DZDA 2DETA 1XOIA 4KIJA 1FUIA 3ZE1B 3GLHA 4HEJA 4TN5A 1P19A 4D82A 5JNTA 4L6CA 2QM0A 2I6XA 4DRXB 3A11A 1KFKB 3DE2X 1DQSA 4ESHA 3VJLA 1JIJA 4QZVA 3EEOA 2YINC 3Q88A 2EFDB 3MCTA 3FTCA 4MYTA 3ZY5A 5BNTA 4HDMA 2AH5A 3MGKA 2JVKA 3PB3A 4HADA 4CTMA 3U60B 2JGIA 3H4MA 4TS9A 1OLOA 1UMDB 3LK7A 2BM1A 4N1AA 3KHTA 4O3FA 1O6GA 4AY3A 1X7YA 2IOYA 3IRUA 5LP6F 2RGRA 1ADJA 1TCCA 3AEZA 4CG2A 1HTWA 1RW4A 4IGIA 4TXNA 3X44A 1WJGA 2IEAA 1YAJA 2PUWA 3VFDA 1XP5A 3ROXA 2AN5A 2JGFA 3T15A 2ZR9A 1R9MA 4L6AA 4MEAA 3VMFA 3FLMA 1NSTA 1JV2B 5F33A 3UWMA 2ACEA 2PLRA 2QVBA 4IY1A 4YAJA 3PCXA 3GL9A 1T9HA 3HO6A 1FNBA 3VHXB 2Q4EA 2FN7A 5IT5A 2J6CA 4KQ9A 3ZHRA 4AECA 1ZK2A 1UPXA 2MSKA 2ZSBA 2V7UA 5EP1A 1JJAA 1EFKA 4RZXA 4D9GA 1B16A 5BN5B 1CPYA 2J7PA 1Z8NA 3H9GA 4LCEA 4UPDA 3GMTA 4LHZA 3S68A 3SE7A 4LBZA 2F2TA 2H3EA 4KQWA 3I5UA 1G19A 2CYCA 2NG1A 4ZJZA 5CLFA 1DOAA 3E27A 5FBLB 2VAMA 1MC4A 3PQFA 2HPHA 2YWBA 1FUEA 5ERYA 5LR6A 5TPWB 3TKLA 3UV3A 4UNPA 1CZUA 1GCUA 3LP6A 3X0DA 5KJFA 4TYNA 4IJQA 1NU8A 4OXXA 5K2MA 1JNXX 2W2TA 3IPCA 4O63O 1SGWA 4RF5A 1TF5A 3LSTA 4KBGA 2W98A 3Q1LA 4J0KA 1QP7A 2OCDA 3UEOA 1LDMA 2P5UA 5T5QA 5BNIA 2BMWA 3M4NA 1C4XA 3I05A 2IJGX 1FFCA 3LIIA 1ZA2A 4QRDA 4HXGA 1UJBA 4Z0PA 1KAEA 5G2OA 3GCWA 4HDAA 4XUEA 2P4UA 4QODA 5KIAA 3R5FA 3U7GA 2HT6A 3T5AA 2AHRA 3DB2A 4H35A 3MOSA 3DEYX 5IPFA 1PG2A 3AIMA 4O2AF 1R8SA 3A25A 2V7PA 1ZMOA 3V1MA 5CB0A 4MI3A 1XN1A 4UUAA 4YPVA 4HGQA 2DF8A 2PVPA 3C6QA 3X1KA 5J4VA 2PKQP 2AF4C 4JJFA 1YI0A 3B36A 3R5SA 3O47A 4GVXA 1MT0A 2QLJA 2IEIA 3CZCA 2BCEA 4KFSA 3QLVA 1DJOA 2I1WA 1VLVA 1TAQA 4A23A 4ZN6A 3V46A 5EZYF 2H48A 2REOA 4W7SA 2F90A 2G77B 4UXJA 3AF6A 1KK3A 4RETA 3AEXA 3GP5A 1FFEA 2HGZA 2JJMA 2WZBA 4RTPA 1RZRA 2VDLB 3FWYA 3FNQA 1XI2A 3GIWA 2OV1A 4GG1A 3AHGA 4NCAA 4XD7A 2XBLA 1DO2A 1M7GA 1XRMA 2ZB4A 1V95A 4H60A 1KH3A 4TMFA 3DHEA 5HJ2A 4C4PA 2UYHA 1LLDA 4CQMB 2Q3MA 5CM8B 4X20A 5EJ5A 3S1AA 1R0XA 2XZTA 1NBOA 4GM0A 2OCIA 3D3WB 3LS2A 1ZGJA 1P5RA 2ZRIA 4LTMA 4CV2A 2CUNA 1C50A 1KU0A 3AQIA 2JK0A 2VJMB 2PD3A 4LMBA 3QY9A 3UVEA 3RC1A 5ALPA 3JQDA 2I33A 4G5YA 3EVAA 3HG7A 1Z0DA 1WKCA 3AJRA 3O75A 1LDBA 2Z5FA 4G5FA 2QD3A 3ZDFA 3Q7RA 4M9UA 4D9NA 1BE8A 1YB6A 4UASA 3U13A 4MW0A 1KDZA 5K2OA 1T8PA 3PWTA 3MYRA 3UM9A 4BVJA 4XFKA 1C29B 4V0MA 1YD7A 4FHFA 5H02A 4YMTA 1ZOOA 4RUKA 3OZXA 4PBSA 3RUPA 5L4SA 3U44B 3X2FA 1CF9A 5A0TA 1ZK1A 3T06B 3DOHA 2IUTA 1YS1X 2R751 1JDSA 1TU0A 2HDWA 2ZCVA 3EDQA 4I4IA 4P86A 4RHTA 3IERA 2JFWA 4JR2A 3MNFA 3TLGA 3QFTA 3JQFC 1H22A 5KOHA 1KGSA 3L06A 4KIWA 4OXIA 3ITDA 4OJNA 1OKKD 4UEWA 2HADA 3MUNA 2QXYA 4CKBA 3U1TA 2R8PA 3HCWA 5K7SA 1BE1A 1SMKA 2JJ2D 3SZLA 3S44A 4HY3A 4EG1A 1DDIA 2QV0A 3DMPA 4JMLA 2YL2A 3DLAA 1G4HA 4HGZA 4MYHA 2DWUA 4X91A 4DLWA 4DMMA 3PBKA 3KSBC 3V8BA 1WM1A 3QVKA 4BAUA 2FPUA 2NO0A 3CN9A 4XE5A 3D81A 1TCBA 3FVRA 4XDHA 5JD6A 1GN9A 5HMMA 2HSZA 2VNIA 3MJCA 5H70A 4AO8A 3NYIA 1E69A 3FF4A 3IDOA 4AYTA 1VKHA 1K75A 1ZVQA 2QG4A 2UXCB 5CBPA 1IDOA 1VZ3A 4EARA 5K01A 4JHXA 4D4HA 3SC4A 1PP4A 1P9OA 3QJ5A 2J59A 1O8BA 3HA3A 4YAWA 3T9FA 2EJUA 1LKZA 1YKFA 5AJYA 2BI7A 3WIBA 2ZZKA 1C3OB 1CVIA 4ZDWA 1AHHA 4O4JB 3PLAE 5SZJA 1GZ5A 1QLWA 4TLCA 2G70A 1XG5A 2JGDB 2AOXA 1A4RA 3G9XA 3Q3VA 1RRPA 4FT2A 4MKXA 1R9GA 4P3KA 4RM2A 5CFZA 5FAKA 1SH7A 3L01A 3O4RA 4EGSA 3JALB 4S1PA 2MTBA 1QVVA 4YMGA 4NTZA 4RVOA 5K45A 4GF5A 1HA3A 1G4UR 4I55B 1AY0A 1V7PC 1TM5E 3NBUA 1Q0QA 1IVNA 3LXXA 3RVSA 4WXPA 4AQYB 4RVGA 3FPLA 4LYEA 1O5OA 1Q1EA 3DHYA 1EFVB 2OXEA 4OP2A 2GZRA 2NV2B 3D9QX 3FCXA 4H1WA 3J81A 1DCTA 3GV0A 1R18A 1U0OC 3VSCA 2IS1A 2DFPA 3WGJA 3PUVA 1AMNA 1Z6QA 3WYFA 1J00A 2BBWA 4MQEB 3AIIA 4NR0A 1IY2A 1H8EA 4RMHA 4DLBA 4EUNA 3KLMX 1R37A 2H17A 3IT0A 4BVAA 5ICSA 2OP0A 2IS6A 4TM8A 5EOVA 2VQ3A 5A0VA 1L8QA 3DQQA 3H8JA 3QOYA 2B30A 2QM8A 1L7EA 1QTIA 4WASA 3NH9A 2WT9A 3GLGB 2JEYA 4XXHA 3MGGA 3TJMA 2BOVA 3B85A 4S04A 3MJVA 4UAGA 3ZVLA 4K05A 4OJKA 4BIIA 3RO7A 1IOLA 3EXEA 1JSZA 1J1ZA 1JEOA 1NJFA 1RRVA 2OXRA 3NEPX 3QPVA 4LXXA 4ER0A 4B7UA 5EERA 1TXGA 3EZNA 2DMRA 2O3TA 1JA9A 4M1OA 2BEWB 3LY7A 3V1KA 3ZE8A 2X3YA 2WIAA 2EJTA 1BWPA 3EVGA 1HDIA 3MTGA 4MUNA 1ISFA 2W93A 2WABA 1RWPA 4JI1B 4J16C 1KSFX 4BP9A 3LVBA 6NULA 1FMJA 1M1YE 4LQ4A 4R05A 5IDXA 3NO4A 4PIVA 3L40A 1T2CA 3H2ZA 4KIFA 1WW8A 2BFFA 2W43A 5LQDA 2Y4OA 2H5EA 4X65B 1ENPA 1SC6A 2CZQA 4MB0A 2D1YA 3VKVA 4CDNA 2WPNA 2CNWA 2PWZA 3ZX5A 4EOGA 3B1YA 1MV8A 5AP9A 3VVMA 2O05A 3VHQA 1E2LA 4Z4IA 2O9JA 2VBCA 5TT0A 1KXZA 5A71A 4GI2A 4X3PA 1T0PA 1HT2E 1L7BA 1V48A 3FPAA 2RBGA 1XQ9A 3MQFA 2DPLA 3KCNA 5H83A 3NBYC 3HYCA 4QLAA 4DR1B 1PVOA 2FUKA 5I9MA 2ECKA 4MQFA 4EHJA 1DAMA 1GEEA 1T3TA 2QN6A 3D6TB 3DZ8A 3GAZA 1NR1A 3MGAA 1XALA 2H92A 5BSEA 3AK4A 2PMFA 2PX5A 1YS6A 5LLTA 3NIFB 1WSAA 1KI3A 2PS0A 2G63A 2VEDA 4H08A 3WQBA 3GJ7A 2IUEA 4TUYB 1CR1A 4YDSA 3OZTA 3J80A 2Y8EA 4XJVA 1XTZA 1YCGA 2FK7A 1WPQA 3AGPA 1YK0A 1CEYA 1JLHA 4UFOA 2Y0BA 1WDTA 3NYWA 4XFDA 4ZAZA 4NBRA 2GD0A 2D4HA 2JLBA 3ESYA 4ND1A 2YCLA 3QLJA 2WF8A 4OK5A 1JFLA 1KP3A 1RTKA 4D9IA 3N9IA 1OAOC 4TXHA 1H6BA 3NU1A 2X4IA 1JSRA 2O7SA 1Y0BA 2UVPB 3ZI0A 5FPYA 5LN1A 2REXB 4DC0A 3UOWA 4WNAA 2C7VA 3SWWA 4HF7A 4CM4B 5F5NA 3O31A 2WKSA 3CINA 3PDJA 4S12A 4EK9A 4WFKA 4LMAA 4E6EA 5EE5B 3S8MA 2AFIB 2FR8A 3OUUA 1BNCA 4RD3A 3VRHA 1Q6ZA 1VYTA 2K5UA 2CSXA 1A8QA 1DUIA 1XYGA 3ETDA 4GW3A 3SC3A 1T29A 2X13A 3LUAA 3RADC 5E4JA 4ENPA 4CIDA 5M7EA 1BHJA 1YB2A 3LCRA 3M5WA 4XLLA 3RBXA 4IQ8A 3BB4A 3T3PB 4UAVA 3FX2A 3UJHA 2YZNA 1UEJA 3KFLA 4IO1A 3FOEC 2C4UA 2IGBA 2ZWOA 5EGSA 4Y6RA 3UICA 4O0MA 4CIBA 3ACCA 4D9MA 1UBMS 4MOWA 4Z3KA 2ZYRA 3V34A 1HQYE 4RIIA 4XWAA 1EUZA 1U99A 3REFA 3WNZA 1KO5A 3K5PA 1QFYA 2QPOA 2C5FA 3B6EA 4UEOA 1GCGA 2FX5A 2X5NA 3NHMA 4IYRA 2B6HA 4LJ6A 4MYUA 2ZRFA 1IN7A 3EZ2A 1NN5A 5AW9A 1HYQA 3F6PA 2EJVA 4DG8A 2VJPA 2JH9A 3IJPA 1VHLA 3R24A 4LXIA 4IILA 2O5CA 1P2SA 5AXAA 3OSUA 1YBMA 4QBFA 4X1IA 2M6KA 2HHAA 3CSUA 2I55A 1TTTA 1FFGA 1N6OA 4HDRA 4JA2A 4YWHA 4BX3A 1OUMA 1JR6A 5DXJA 2EKBA 5BORA 1N2HA 4L4XA 1G6HA 1ZSNA 1X7YB 2J41A 1BX1A 5EMJA 5JPCA 3TDKA 1I30A 1U5CA 2X4GA 1CNFA 2JFBA 1ODLA 4EELA 3FI9A 4YRBA 4N8EA 5HZGA 1OQAA 2MMCA 3L05A 3UHJA 1YDGA 5DB4A 3WDLA 1DG1G 1JHVA 1KH2A 4UFNA 1R3UA 4XEUA 2P78A 2X1VA 4DCNA 1SVWA 3B9BA 2WA1A 4YRQA 5JATA 2XAAA 3B1JA 3IOBA 3F97A 3OU2A 4C43A 3W6PA 2W48A 3IAS6 4ZJYA 2ZYTX 1TAHA 2GGSA 2HA3A 5CEFA 4BLSA 3CR8A 1O0CA 4RE5A 1FCJA 2TYSB 1P18A 1OFUA 3RAPR 4C05A 1FYFA 1O89A 4DANA 2OORC 2I6UA 1JE1A 1ONNA 4QICA 2NT3A 4I46A 1EB8A 1T6ZA 1BKDR 1E3QA 1WRBA 3H2SA 4CCWA 2E7ZA 3N0VA 4DA4A 1ZKDA 2QAIA 4GFDA 1U4SA 2P3SA 1EVZA 3K72B 1GV1A 3UMCA 1ZW6A 2MOKA 1GNLA 1ZICA 4G81A 4CEIA 4Q3CA 5WRFA 3VH4A 3E23A 4OQ4A 1XRLA 4R2XA 1CS4C 5JXHA 1U1FA 2PRZA 1F17A 1QZ3A 2EWWA 2Z2YA 3D64A 1A7JA 3BTUA 3JXEA 3TW4A 1VIDA 1FDSA 1GZUA 2XDQA 1XZBA 3UANA 3PFWO 2IHTA 1M73E 3P9KA 1Y48E 4Q1EA 3M6LA 1GQYA 1V6CA 3EJWA 5JAUA 4E33A 2KE5A 2WSLA 1USGA 4IWNA 2EX4A 3ORYA 2I8CA 3IKJA 4IO0A 5I7FA 3COVA 1V7QA 4IJ6A 3CMCO 1IBSA 1GR0A 1YA8A 1B8NA 1CUBA 3SEQA 1CQIA 3QU7A 2OM2A 1XCLA 1JDBC 4P32A 1P2DA 1NW9B 1XDDA 2BFEB 5DPMA 5HX7A 1ZG3A 1Z26A 2W6PA 3AW8A 3FETA 5AHKA 3UFBA 3T3MB 1HFJA 2ECPA 2RGYA 1OIXA 1Z7GA 2VK1A 3ZWAA 4C2AA 3RQSA 1OILA 3M1LA 2NQ8A 3PGKA 4LOLA 4PLFA 4E14A 4B6SA 1OTXA 2D00A 1C0KA 2V97A 1DWPA 1CUVA 3JQEA 5AKJA 1NMYA 4JUDX 4ZI5A 4QUHA 4AUMA 1JKFA 1L4HA 3GU3A 4BQEA 1DXYA 3N7AA 1AQLA 4XRRA 5FWYB 2CNOA 2JASA 3EGOA 4DWOA 2W6ZA 1TAUA 2G17A 3CGGA 1PD1A 4EY8A 2WPDD 4MI6A 4G65A 2FSPA 3ZWDA 4YP0A 1JTEA 1QIJA 3GEPA 1WZIA 2W2MA 2C4MA 4OQMA 4PZ9A 2FEMA 4JLMA 4CMEC 4MO9A 4EEZA 2N47A 2WWTA 4YP5A 1U63A 3TD6A 3E22A 4FFMA 4BNUA 1UOEA 3FGNA 1VIVA 4RY9A 1KZGB 2CDNA 4X9XA 3BTSA 1L5ZA 1YR1A 1G8GA 2IYZA 1NZFA 2Y9PB 3M70A 2OGUA 4R2IA 4WKPA 5EEGA 3TGPA 2Y0EA 4OGLA 1NVVR 2HJSA 4Q9KA 1L5MA 5FOVA 2BUCA 4RJLA 1G9TA 1RIFA 3MT9A 2JLWA 3QBTA 4NBUA 3D8BA 3RUEA 4I5GA 3E5NA 4JVSB 3OPNA 3DLIA 5KS2A 1LSJA 3H9BA 5J40A 5IAJA 3QRWA 1IK6A 4LF7B 4Q3BA 1JTFA 4YPFA 5C7OO 5IRCD 3LT2A 3UJ8A 2CL0X 3CXUA 3KZMA 2AJ8A 3FGZA 3OF2A 4EQ6A 2EZUA 1L0BA 3R74A 3ADCA 1R8YA 2F3UA 2I54A 2CFCA 3TLGB 2XE7A 2B78A 3CB2A 3QEJA 1JN0A 1W8IA 3LZCA 3D7KA 3WKAA 4MQ5A 3WY9A 3HYTA 4BDTA 4G5OA 5KOHB 2QBYB 2ZQ5A 2BMFA 3RREA 5JU6A 2IHYA 1A72A 1PW7A 1Z0JA 4HQRA 4ZV4A 3MJ4A 3A4IA 3G2KA 2HMWA 4Q24A 5DI3B 2HPZA 4P53A 3W8NA 2WTMA 3DFMA 3H1TA 1W1UA 1XZJA 2A2ZA 2ZBUA 2ET6A 4KWEA 3U39A 1JHXA 5DYIA 5EMKA 3PR2B 3I0ZA 5A1JA 4CMJA 1H1TA 1OHHA 1XRJA 4CN9A 4EJ6A 5AQ1A 3I12A 3FIUA 1WPGA 1GL3A 3EQZA 3BFXA 2CB9A 3UMVA 4M87A 4NFHA 3CUKA 3ZGYA 1ISGA 4LYYA 4AJ9A 3PR3A 4IH1A 2BDTA 1PZXA 2VPWA 1D5CA 2ATVA 4X84A 5MGNA 3EC7A 4MW1A 1GYPA 2QI9C 2FZ5A 1SVKA 4KGDA 2GF9A 1VHQA 3GC6A 1WE2A 4RTRA 3L6EA 1A3CA 2QUZA 4HCJA 1DRWA 4IPTA 1NOJA 1SUIA 4DAEA 4RWZA 5KNBH 1BSVA 1NW5A 2A9KA 3F98A 4BVKA 4JBXA 1EK5A 3AETA 1EXVA 4BQIA 1Z6TA 1HF3A 1TO2E 1V1MB 3FB1A 4H0CA 4M6WA 1VZ2A 3WYBA 3ZU3A 4EGCB 3HU5A 4OF4A 2I3GA 1OYWA 2PD4A 5TPZD 1G8FA 4QVGA 4RXTA 4AW9A 5KWSA 3BC1A 3GR6A 1RFGE 1I2BA 2VDQB 4JX9A 1JYEA 1BMDA 5BV7A 2ZWVA 2V0NA 2WHYA 1ONBA 3S40A 4ZVPA 4R1PA 4TZTA 3FTEA 4XTCS 4R81A 5BR4A 3N8KA 4Y1GA 2XNCA 5LP6B 5BSHA 4FEYA 4DMCA 1QRDA 1NYTA 5K3CA 3AOEA 5C5CA 1C9NA 3SMQA 1UJMA 2B94A 3L8HA 3VVLA 3ZWWA 1OGJA 2JCYA 2FAXA 2XMPA 1H8HD 5E9AA 3WIVA 2WDPA 1KO8A 1NHGA 5JEDA 3K1YA 4D2IA 3DZCA 2O8NA 4Q00A 2IZOA 2H1HA 5B7PA 4GX5A 1X86B 2FZVA 1Z5WA 3EXEB 3PUWA 3OLXA 3I9LA 1NJ8A 1UEIA 2IVFA 3N5CA 4XIGS 4MUGA 4FOSA 2D7JA 5PGMA 4NAVA 1QO0D 1DBWA 1NMEA 4XOUA 1FB5A 1KYQA 2AQ8A 5GV7A 2G6TA 4ZTBA 3OHSX 5FEUA 1UOOA 1E58A 2YASA 3ZDQA 1YASA 2BKEA 3PFGA 4WY8A 4DYDA 3AR9A 3DGEC 3NTLA 3SSAA 3IAS1 5I7OA 3I6QA 4YGXB 1JA1A 1ZY2A 2HRBA 5HM8A 1G9SA 1NE2A 2QTBA 4Y1RA 1O8CA 2WT4A 4MV3A 4CJXA 3KVVA 4E4YA 3FGPA 1GFWA 2IUUA 1XGKA 2BFFB 2FWPA 2OMKA 4HYYA 1F6DA 4UW9A 4UVIA 5C8DA 1FSGA 3IVXA 3JAMA 3MT7A 3WL7A 1E9FA 1TLFA 5JISA 3W05A 4MXDA 5KVSA 4MS4B 3P9YA 2QSYA 3MS7A 4UNQA 1G1MA 1PV1A 2OZVA 3RD5A 2HK9A 5DI9A 5KHLB 3M3PA 1PWEA 3VKUA 3A1FA 4C4SA 4RPKA 2VPYA 2QRMA 1NLZA 4Q01A 3TZBA 3DBRA 1THTA 4PZUA 2CHFA 3O9MA 5FLKA 4O2AB 3VU8A 1FSZA 3GEIA 3HE3A 4G4JA 3WGMA 1MA0A 2FEOA 1T8SA 1J56A 3IAUA 4AULA 1JVNA 1S3FA 2VUHB 3HHPA 4FFSA 3Q1KA 3C6MA 4DB4A 2VS1A 1YMUA 1VBNA 4GBED 4JB2A 1KZ4A 1W8DA 1XAIA 3BUSA 3BSWA 3QIAA 2DHRA 1NHWA 1O97D 1M5RA 4JBHA 3NVKI 1XLTC 3EZXA 4BLWA 1HOTA 4N01A 1YZKA 1YU9A 4TZKA 5I9NA 4DMRA 1XSEA 1T4DA 1KDPA 2ODQA 5D1HA 1UMCA 4PYJA 1L5OA 1P2FA 3M4ZA 4XM2A 5JIBA 1NUTA 5GPBA 4CQLA 2O52A 1RWXA 5BNWA 1LEHA 4YO8A 4N65A 1MZPA 1CY1A 1A9ZA 1U65A 4PQGA 4CU2A 4IVQA 1I7NA 1UK6A 1W9MA 3K9QO 4MUIA 4XJTA 5CPBA 4WNAB 1JE0A 5CLGA 2Z9CA 5EFZA 5K09A 2Z6UA 3EG9A 1PT9A 1QFSA 2CUZA 4BV8A 4LJKA 2GTIA 2VUTA 2CHUA 4FILA 2AOUA 3ZWYA 4N03A 4MULA 1MOZA 1RZVA 4U2KA 2W00A 3RSQA 4EI8A 1E4YA 4IZHA 2GCPA 2VJQA 3UENA 1M8GA 3HKDA 1HQDA 4ZWNA 5AKYA 3U9TA 4F4FA 1E5DA 2CXQA 5FR1A 2F4VB 4OK3A 3CVJA 4QU9A 1T2FA 5CCXA 2ZUDA 1VLLA 4JQSA 1E92A 2PL1A 2PU7A 4HDSB 4IDNA 3NT4A 4UE6A 2OXTA 1QQBA 2OQRA 3W7AA 4RF4A 4DT1A 4EKGA 4HVLA 3V8MA 1BFKA 4TMKA 1YO6A 5AKGA 1LJ8A 2C31A 2HLPA 2OV2A 4JVOA 4TKZA 4B47A 4DIKA 4DSTA 3THYA 2QORA 5I7RA 2BCGY 2OY0A 1XJ0A 3PGVA 3Q7PA 3MRVA 4N3CA 2VHYA 2FYTA 2J67A 1PZMA 3FUCA 4BMYA 4Z4GA 1TTHA 1P1KA 1X2BA 1QFZA 2DLNA 2Z5GA 2Z6VA 3ABZA 3V4RA 4ZVRA 4Q21A 1UR5A 1A5AB 3MAGA 4C6TB 1I80A 1JDVA 3GLGE 1W75A 5CVDA 3KJGA 4NV1A 4YP7A 3EGCA 3PP8A 1AS3A 1X7ZA 1MW9X 1ZK0A 1TUEA 4X1IB 1T34A 1L1RA 1USKA 4QDJA 3AR7A 1DT3A 3BIFA 3LZ6A 1M1YA 3PQ4A 3DBVO 4HDRB 1T9AA 4HRXA 2X4DA 1S1CA 4R01A 5FFMA 5TV2A 3DXYA 4XYGA 4AYXA 5CXUA 4ESVA 2J3EA 3FPSA 2IC5A 4IIGA 4F04A 3VPXA 1NOIA 1NI4B 1E3IA 3DMGA 3AF2A 1JMYA 3NI2A 4QU0A 4B4OA 1B8VA 4RK4A 3P4UA 5BW5A 5HKKA 4RK7A 2DLCX 4CLOA 4E3ZA 1AKTA 2GJ8A 2NYVA 1P0MA 3BHIA 3FWZA 5TB5A 2BDEA 1C8BA 4OFBA 1C14A 3IP8A 5HKAA 1YR3A 2BH2A 3MWLA 4GR5A 4CNQA 1FFAA 3LL7A 4DV2B 5A9RA 3CA8A 2WUWE 2DTXA 1UKVY 3MD0A 4KNWA 4PYRA 4RULA 1A1SA 2BH9A 3ST7A 4DY6A 2JA1A 4CR8A 2PZ8A 4F9GA 2ATEA 4G0NA 1LPBB 4WBSA 5IYZF 1C2TA 4REQA 1JNYA 3UAGA 4GZ5A 4C87A 3NFRA 5SY9A 2R11A 4NX2A 1UPFA 5BQXA 4PS1A 4Q9IA 2GBIA 2Q9CA 2EF1A 4ZT4A 1W85A 3HCFA 2X5XA 4KXVA 4PNZA 2YDXA 2IIBA 4MI9A 1E94E 2WM3A 5F3DA 2O0HA 3MIIA 4TTPA 1X7DA 2OPBA 3RSFA 5JW6A 4NU6A 3N8IA 5KTYA 3PWSA 4OFXA 3G1TA 2IELA 1EU1A 1C0EA 1U7WA 1Z6AA 2V96A 3P9ZA 5EMNA 3EAQA 1KNXA 1H2XA 2XDQB 3TLYA 4ENRA 3I09A 4PPYA 4TWRA 1RHKA 3K0FA 4KVGA 3FYUC 1NM5A 3HWSA 2J31A 4L28A 5FUMA 3GLVA 4R9NA 1OXMA 3KBOA 1CEXA 4MWTA 2QW1A 2QS9A 3WGYA 1VM6A 5E0KB 4D3ZA 1H2BA 3CRZA 3IKTA 3N2GA 1CQIB 2Q1XA 1CY6A 1U94A 1M7BA 2PCLA 3HY6A 4AIIA 1Z2AA 2YIDA 2ZROA 4X8OA 1TPZA 3I5MA 4PONA 5J4YA 1GAQA 4UNNA 2OTCA 1D2CA 3TDNA 2VAXA 3HHEA 2AFIE 3CU5A 4HZUA 4LJAA 4TQGA 5TQ0B 2IS4A 3IYLW 2QD5A 1UXJA 4CR7A 2QRGA 1U3WA 3IS3A 3SE0A 4CG0A 1NXPA 1S2GA 2SKDA 5FP0A 3A6DA 2WQ7A 3DMHA 5IJAA 3F1KA 3KVYA 3A9VA 2PT5A 4JU9A 1D4FA 2GH1A 5THQA 1L3BA 4I50F 5B6JA 1E2QA 1SHUX 2GM9A 5KWIA 3DEZA 4TVBA 4Y8VA 4H0FA 1EI9A 5JMPA 3K31A 1DT5A 3KVNA 3WFIA 5FPKA 1EDEA 1G5FA 3MTEA 2XQVA 1GKKA 2LV8A 3BK1A 3CLRD 5ED4A 4EG3A 1USIA 3TLEA 3SF0A 4C0SA 1IB6A 5FHQA 2CHQA 3E22B 2NZYA 3BEDA 4YCBA 5JCJA 3VC2A 4DXDA 2GJ4A 3KEQA 5J4LA 2C00A 3S7TA 1L5FA 1QE0A 1XRSB 2H4FA 3HJCA 2IDJA 2B34A 3MBKA 4M54A 4TYQA 4OKNA 2Q7DA 3AF3A 4RQTA 3MIZA 2CNBA 3ELBA 3AUTA 3IDQA 5G0TA 1SIWA 3I28A 3SIRA 3DTYA 3Q4GA 4MPTA 3TFWA 3QNUA 3ZE2B 4C7JA 3TNLA 2XLBA 5HKBA 4QGAA 3ICQB 1OR8A 4PC2A 3RANA 1KFEB 4L5AA 4P2BA 4P4LA 3G85A 2P2LA 4JBLA 3EZ9A 3W7VA 3BAFA 4AU1A 5IJ9B 2E82A 1EG7A 3LUHA 5K3BA 1P7WA 4EJ0A 1FP2A 2Q1YA 1I5RA 2WZDA 4MVJI 4EQ6B 1ZYUA 2WP8J 4P34A 4BNTA 1MW8X 2XUKA 2DX7A 2DRIA 4Y3UA 1OA1A 1Z22A 1P4RA 5D3QA 3W5CA 4E5YA 3WLLA 3P2JA 4QSMA 3F78A 3P0RA 3P5BA 2ZWIA 1C80A 3GCZA 2HPAA 4LXGA 3UUWA 4P98A 4B3IA 1NVXQ 3DZBA 5DX1A 5AVYA 5A6SA 1DJPA 4PZDA 4LX8A 1RVV1 3TX2A 4L15A 4MQUA 2ZXEA 3ZDZB 4F3RA 3GQVA 3QVUA 2QY6A 2AK3A 4WCFB 2GWHA 4R7TA 1B42A 4WUVA 5EHXA 1Z62A 1M6YA 4ND2A 2C7PA 4JASB 1IQUA 3H2BA 4NZYA 2QOEA 2UYGA 2BRUA 5F5LA 5L7WA 1BD3A 2AIRA 1E3WA 1YRYE 5ALKA 4KDEA 4Q4CA 5JZOA 4CPDA 4KGZA 3F6BX 3B8EA 4FOOA 5LKRA 2C97A 1Y34E 5C3UA 4EHDA 5LNK6 1V96A 3OH8A 1N5IA 5ALEA 5KU7A 2AFHA 4Q7KA 3IUNA 2R68A 1ZCBA 2CLFB 2W6JA 1YQEA 3BB1A 4J9UE 4YRFA 2GB4A 3NAZA 1BE6A 4BGEA 4DREA 3UPUA 5BMVF 1C0PA 2UUCB 4MAFA 2H7XA 1GIAA 3IVGA 4GPD1 1IONA 2X0RA 2X5OA 3AETB 1RXEA 3I1JA 3KD2A 3R0XA 3RQIA 3TBFA 3ANSA 1V11A 3N5KA 4ZHSA 1GQSA 4P9NA 5PNTA 3KOYA 2E21A 2QZZA 4DV7B 1TOAA 1R6UA 3DT8A 5DTQA 1LJLA 3VU0A 4ZKDA 4PGGA 3GNSA 2WD8A 4UCXA 1CFZA 2NO7A 5KNBA 1D0SA 5TVKA 1U6JA 1PNTA 4DMKA 3KUCA 3A3KA 4KR3A 1LZLA 1O5IA 2DAPA 1XZLA 5JBIA 3FOFC 1IVYA 1HE3A 5A9SB 3FA2A 1T3SA 3NCHA 1A9TA 1JQDA 3OZIA 2C94A 4EHNA 2PN1A 2PR7A 2NV0A 2A0UA 1D6SA 2XVMA 3G6KA 4JC0A 3W8RA 4E32A 4J9VA 3LBFA 3WGUA 3TUZC 4BKMA 1T2AA 3C3KA 4PGAA 3VOAA 3ZN2A 1M2OB 2D74A 2GAFA 3JZAA 5CDGA 2XSZA 1RLOA 1I1QB 4C3VA 3IXQA 5FPHA 3DP9A 1VJ1A 4YRPA 1G2PA 1I14A 1RI2A 2ZT6A 3F49S 4WGGA 4C7BA 2WG1A 4NJEA 4Q0MA 1IXZA 3FDFA 4AZ0A 1IOVA 3IQZA 5GIOE 1QV9A 3LTEA 2WMNB 2GYUA 3ZWQA 3E48A 4JB3A 4MCAA 5DTRA 1L5YA 4DLSA 5I01A 1IM8A 3PITA 3PRJA 3T7DA 1BGXT 3N87A 1NXOA 1WEHA 4WKCA 3CVXA 2AUNA 4WESA 1SVUA 4AM8A 2PXHA 2PYZA 1XNJA 4V0LA 5IBQA 3WAKA 4E08A 1F0KA 3T3GA 2C04A 4R98A 4CETA 4TKVA 1YVDA 2DCMA 2JZNA 3L46A 1T4GA 1X1DA 2DSNA 2GN4A 2J9GA 3B2EA 3G89A 3I92A 1UKBA 3A6HA 1Y6GA 1ZJZA 2IYOA 4EL5A 5AVSA 5CD9A 3OKCA 1BX0A 4P7JA 3REQA 3QYFA 3WV5A 2A9QA 1JQKA 3AUXA 4JGIA 2G6BA 4EFLA 1WTAA 2FEXA 2NUPA 2P2GA 2P9HA 4F4UA 1WB4A 1H2AS 1RYHA 2MWMA 2N75A 3MEQA 1CV2A 3DBRB 2BF4A 3KBBA 1QZTA 2PX6A 1BE0A 2V6FA 2VFAA 1KHHA 1G0OA 1RYBA 1V9CA 2R8BA 3FSGD 1KQOA 4KCGA 5D5HA 3UXYA 4DQKA 1BW9B 4LXUA 1AK1A 5FTJA 4G5SA 4K9SA 1RBQA 3KNZA 2A86A 1J1IA 4BOYA 4CU5A 1WB9A 5EWLA 4ZO8A 1L5SA 3EWSA 3ON5A 2V1XA 4FEEA 3RGGA 4MKHA 1EFPB 2X5KO 4ND5A 2NV6A 4XGRA 1IEXA 4YRRA 3H8SA 1VB3A 4O0LA 4B84A 3X1DA 2JVJA 2B8JA 2ZUFA 4CQLB 4I50A 2O0KA 4PO1A 4BVBA 2A88A 1DQRA 3VPCA 1MENA 3EBPA 2OYCA 2C5BA 3C16C 4FYHA 4D97A 2DBVO 5L6MB 4B80A 4ZAYA 3LCUA 3RT9A 3RIHA 2FU5C 2XOEA 1IXSB 1HLGA 1WUTA 3EG9B 1DC7A 1H3FA 2Z04A 4YREA 3WV4A 2AOUB 2Q0XA 1W9HA 3WYNA 4CBVA 1FP1D 2A0KA 2OXCA 4S0ZA 4V02A 2ZR0A 3OM8A 3G9TA 4M1ZA 3FTDA 4LRXA 4ZU6X 2PXCA 1ISIA 2EW2A 1P1RA 2XNHA 2MDTA 5DCWA 3R8FA 3HKDB 1CJBA 4BJ1A 4NDNE 3EULA 2B35A 5K3EA 5K6AC 1GPLA 3OD5A 4ZCPA 3VR4D 2FZEA 3WLEA 1NP7A 1TFUA 2C5AA 2TRSB 1OBCA 4NLLA 4LOHA 3KX2A 5B4TA 4XQCA 2Q41A 1Z5ZA 2H2HA 2GOYA 2JLVA 2B8TA 2PV0A 4GKBA 3D4OA 3G5UA 1FP4A 3RS4A 1TLLA 3FCCA 1C7FA 3QEMB 3IP6A 4LE2A 4AJOA 5B7NA 2I5PO 2JIMA 3SZRA 1R5NA 2JGEA 4B3SB 2HDOA 2CLMB 2GUGA 2H2AA 3DLPX 3QGMA 1MOPA 1IN8A 3QIVA 3O3OB 4BMVA 2GEUA 2ZBRA 1PEAA 5DNUA 2CDBA 2RJOA 3OIWA 4C29A 3RR2A 1NBMA 1SEVA 4D0SA 3AXSA 1EVIA 3OQIA 4UM7A 3CTPA 4M1QA 5DX8A 1T3LA 5HFNA 1QGYA 3D8TA 2O8BA 3SYTA 2JAQA 1NJ6A 3EDRA 2P4EA 1I4TD 1T5LA 2BD0A 5JMTA 1RKBA 1A88A 1X7ZB 4IIHA 1ZAYA 3TQTA 4RVDA 4WX2B 1NJ2A 5E7IA 4RIEA 4URYR 5BSKA 4RCVA 4GL2A 2DUWA 1XCOA 4JGBA 2JFVA 5DBFA 1FP6A 1U7XA 2IHJA 3AL2A 1R5JA 1AB5A 1IEVA 3RSOA 4FCWA 5K3OA 3ZGZA 1KBQA 5ISMA 1KNQA 4QVIA 3TZHA 3N8HA 2A3RA 2HA7A 3SVTA 4ZPXA 3QMMA 3ZLUA 1N0VC 3QP9A 2NUBA 1JF8A 2HI0A 2QUKA 1WNTA 3B9RA 4AJPA 1AUXA 1K5DA 4V0OA 4CLOB 3AVVA 3DMRA 1I2AA 2A9PA 4A4DA 1XEAA 2AMFA 3LDAA 2XCQA 4DHEA 4BFSA 2HLDA 2GPBA 3KOMA 1NG1A 1RJ9A 3ICPA 1XTBA 1YR6A 3DJFA 3QWBA 4LYGA 5ILOA 1QFJA 1VL0A 2Q8NA 5LNK1 1HL7A 1YI8A 3OQHA 3IPLA 3DAYA 2Z8YM 3BA6A 1NQ5A 2OSVA 1AN0A 2G0NA 3KQSA 4NFYA 4ERXA 4G3XA 3OMXA 4PHFA 4QFBA 2PFKA 4MV4A 3ZIAD 3IUBA 3GWGA 4HL6A 4KYUA 3MCZA 5AXCA 1KDRA 2MSWA 3A32A 3ZCRA 2PGXA 5AOCA 4BBAA 4EEKA 4UHEA 1K7EB 2GPSA 4B6JA 4ETNA 2NO4A 1FU8A 2GYYA 1XN4A 3L3BA 3MYYA 2WMOB 3P0EA 2QTVB 3GRVA 1W85B 2WYWA 4BMPB 4NRDA 4AY5A 3FUTA 4GDFA 3H8WA 3A9CA 1C9EA 1QE5A 1YJAA 3EIXA 3H11A 4MR8A 4P22A 4JP8A 4N6NA 3EAGA 3JYHA 1XLVA 4M22A 4MW4A 3H8VA 4MWZA 5M2QA 1GU1A 5CDFE 1BU5A 4J1TC 3HC7A 2RONA 1FTQA 4I19A 4I6GA 4F6LA 2O2EA 1YGPA 4ZYZA 4HFMA 1NYLA 3QI7A 3K0FB 1DEKA 5JROA 2B1QA 2XMQA 3PCRB 1N1MA 3INTA 4AQDA 1WDMA 3NETA 4ES6A 4B3GA 5FB3A 1IB0A 1SQ5A 3ZHVA 3P32A 2MYUA 2R6GA 5IUKC 1P1IA 5KQLA 5JJCA 3JQAA 5K0LA 3CUVA 3N2GB 3NFYA 4FHCA 3ZY2A 1QAOA 1OCEA 5IH7A 1HG0A 4OD0A 2XBMA 1M75A 3QXGA 1RKUA 3JD3A 1VMKA 1IMOA 3F5QA 2NSDA 3MCUA 2IU0A 4B7ZA 4KW7A 2O2CA 1WX1A 6REQA 4R1UA 5FA8A 1KPIA 4M9RA 1BVYF 1RXCA 4UOQA 3C1TA 3A3PA 4BO4A 1Y37A 4X6LA 4HPWA 5KJ1A 4TQAA 4X1KB 3ELUA 1XD2A 4M7WA 4QEDA 2EDCA 5T4HA 2HH9A 4ZRNA 2I4RA 1P6XA 2YXDA 2ZRAA 1O58A 4OAOA 5I5GA 1D4ZA 1HG1A 2H2WA 2WWHA 4Z99A 2HF7A 1RI1A 5G3ZA 2QM3A 3THYB 2R2AA 3ZDAA 2PFGA 3CRRA 3D6VA 1GKLA 2CW5A 5GONA 4P36A 5DRTA 1FC0A 3DKKA 5TC4A 3CX8A 1U2QA 3DEFA 1BAPA 2QDXA 4WAUA 2ERXA 3CFYA 1V45E 2OGWA 3E0XA 2ENWA 3LGAA 5J5VA 4EYGA 4P0PB 3H3XA 2RGAA 4URZR 2TMGA 3GRKA 3V8PA 3ZWVA 3GEBA 1F7VA 1F4PA 4E07A 3W34A 3RVPA 4DQVA 2E6UX 3WNDA 3QVOA 4O59O 4YNBA 1VL8A 3TLKA 4C4OA 5HVNA 1QXSA 1XRNA 1XRRA 2BM8A 4KQ2A 1YFLA 1X13A 4Q3NA 1DKMA 1ZFNA 4FYPA 1R74A 4RH1A 3LW8A 3MFQA 3ZLBA 4BWGA 4EF6A 4FC6A 1RZUA 2DUMA 3OPXA 4JN6B