3SIPA

Crystal structure of drice and diap1-bir1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
ALGSVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/ligase/hydrolase
molecule keywords Caspase
publication title Structural mechanisms of DIAP1 auto-inhibition and DIAP1-mediated inhibition of drICE.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 42
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sipA00
2DKOA 2C2ZA 3OD5A 4N6GA 1M72A 4PRYA 3R7BA 3DEIA 3EDQA 4ZVQA 3IBFA 2C2MA 4ZVUA 2H5JA 1QX3A 4QTXA 4IYRA 4EHFA 3SIPA 5IAEA 1SC1A 4QUEA 1RWVA 4FDLA 4AW9A 4EHDA 5IBCA 4EHKA 2Y0BA 4QUAA 2QL7A 4QUBA 4NOMA 5I9TA 2J31A 1RWXA 4NBLA 3H11A 3V4LA 2FUNB 1RHQA 4N7MA 3GJSA 2XZTA 3NS7A 1QDUA 1ICEA 1I4OA 4HQ0A 4D3YA 1I51A 4ZVTA 1NMEA 1RWMA 1RWKA 2NN3C 3R6GA 2HBZA 3PD0A 4AWBA 1RHKA 3UO8B 1NMQA 2C1EA 5IC6A 1PAUA 2FQQA 3R5JA 3K7EA 4M9RA 4EHNA 2H4WA 5LU9A 5IABA 5JFTA 3PD1A 4JJ8A 4QUHA 2XYPA 1IBCA 4AWAA 3H13A 4QULA 1CVRA 4JB8A 4QUDA 4HQRA 3V3KA 5LU8A 1QTNA 5IANA 2CDRA 1NMSA 4ZVOA 1KMCA 2K7ZA 3H1PA 3ITNA 4JJEA 4QUIA 3H11B 1RWOA 2C2KA 4QU5A 5IARA 4NOLA 4ZVPA 5IAKA 5K20A 4JR2A 2P2CA 1RWNA 2WDPA 2CNKA 4DCPA 4PRZA 4D3XA 2J30A 5IASA 3P45A 2HBRA 3DEHA 5IAGA 3DEKA 1RHUA 2HBQA 2QLFA 1I4EB 4DCJA 3QNWA 1RHMA 4FGUA 4NOJA 1F9EA 4JQZA 2QLBA 2XZDA 4N5DA 4N7JA 4EHHA 2H4YA 4JR0A 4IEFB 1SHJA 1CP3A 4JJ7A 2H51A 1NW9B 2H5IA 1GQFA 2CNNA 2CNOA 2QL5A 4FXOA 5H0IA 1RHRA 3P4UA 4EHAA 2HBYA 4N6NA 1K88A 4QU0A 3R7NA 4QUGA 3UOAB 5LUAA 5IBRA 1I3OA 3BIJA 4QU9A 2XYGA 3NKFA 3SIRA 2CJXA 1F1JA 2XYHA 3V55A 4D3ZA 4I1PA 4PS0A 3V6MA 1RE1A 4QUJA 5LUBA 1PYOA 4QU8A 1SC3A 3KJNA 1RHJA 3NR2A 4ZVRA 3S70A 4PS1A 4ZVSA 4DCOA 4QTYA 3V6LA 3GJRA 4I1RA 4EJFA 2FP3A 3GJQA 4N6OA 3IBCA 2J32A 1BMQA 1SC4A 2C2OA 3R5KA 3V4OA 3R6LA 2H48A 2J33A 4HVAA 1JXQA 2QLJA 4NBNA 2Y1LA 3H0EA 4JQYA 2QL9A 4EHLA 4JR1A 4NOKA 3GJTA 2H65A 3S8EA 3KJFA 3D6FA 1RWPA 3RJMA 3EDRA 1SHLA 3E4CA 4FEAA 3R7SA 3D6HA 3D6MA 2H54A 1RWWA 1K86A 5IAJA 5IC4A 5I9BA 1GFWA 3PCXA 3DEJA 2AR9A 4NBKA 5IBPA 4LSZA 2CNLA 3KJQA 2CJYA
chains in the Genus database with same CATH superfamily
1GDTA 1TJNA 3ASUA 3HA7A 3Q9NA 1W34A 2PVCA 4MW6A 2N42A 2ODWA 4TKVB 2C95A 1X7WA 1EZ1A 2ECOA 2HEIA 3CX6A 2NXNA 3WMXA 3AETB 1IBRA 4JI7B 2WAYA 2E4ZA 1K4MA 3MRXA 2QXTA 3UK2A 2R1TA 3HZRA 1GGFA 3IEIA 1FNBA 4XB6B 3IEKA 3DYVA 4BNJA 2PA3A 4G1VA 1N77A 3I5AA 2IPNA 3TAUA 1H2EA 4QOJA 1D4OA 2ZRAA 3D8NA 5K3FA 4CZ2A 5BYBA 1A88A 3GVCA 1CQWA 4DR6B 4D9FA 1A5ZA 2AD5A 2P27A 3QFFA 1QF7A 3NV9A 3MCUA 2QRJA 3ZCQA 3EDYA 1KORA 3QEMB 4W4TA 1CR4A 1NVDA 3LYHA 1R27A 1Y81A 2AL7A 1TT7A 4DR4B 2SCUA 2QG6A 4BMPB 2E7ZA 3K7EA 4M1SA 4ARCA 3THWB 3BJZA 1KAMA 3MGKA 4XASA 5FEMA 2Y92A 5B3JA 4GPZA 3UF0A 3FNQA 1V5GA 2WTXA 4HFNA 4RF4A 5IAOA 4Y2XA 4E5DA 1U2ZA 1L1FA 5DLDA 3RS5A 3TXXA 3I0MA 3UPDA 5L45A 2VBGA 4RMJA 5HBGA 5I45A 2XCTB 1F6BA 3Q8XB 3AZPA 5KVAA 2GYWA 3TM4A 1RZRA 4R8LA 1MRSA 5HDQA 4V2IA 4JI6B 3TDKA 3TI7A 5KTRA 4G0OA 2X7JA 4PZ9A 4N47A 4DR7B 5E4JA 3JQQA 2PJUA 3EXHB 4OHBA 4F1KA 2L69A 3M49A 2FH5B 3ICPA 3HKBB 5HF8A 5BMVA 2HAEA 5A03A 5JU6A 4CMEA 3VM6A 3DZHA 3FD8A 2OCPA 5C35A 3BCRA 1ZMRA 5K0ZA 4PX5A 1OLSA 4WGFA 2A0XA 3EF0A 4NOJA 1MAHA 5HJ5A 2REBA 4ENQA 4X65B 1Z6PA 4JBYA 4QD3A 3ZUPA 2PZ8A 4KE9A 3JYOA 4F9EA 4Q4AB 2ZROA 5JSHA 5KJ1A 2FP4B 2GM5A 3JARA 4IJ5A 3E2MA 4JOCA 5F51A 5CFLA 1R0KA 3NI2A 3WGUA 2Q45A 4PCVA 5AW7A 3CKLA 4NJEB 2P9QA 4GEGA 3PDJA 3MJVA 1GZDA 1JT2A 2NUTA 4DBZA 5EIAA 1TUBA 1WZNA 1ZMBA 2IKSA 2P0EA 4KEAA 1EFRA 2LVBA 1LSJA 4Z8YA 4HUTA 2C9YA 4J2TA 4DSUA 1EEHA 2PH1A 1F2VA 3NOXA 1RXVA 2GYYA 4ZVRA 1A5TA 1JG7A 1Q0RA 5K8CA 1IUOA 1QG2A 4FHEA 1A71A 1VHTA 1YT5A 2GS9A 2I7DA 2Z9DA 5B12A 3D2AA 4RTLA 1GXSA 5HJEA 5EMLA 4UVDA 3EZFA 5KQRA 4AQ7A 3C8ZA 2ZJAA 5AXDA 3FVTA 1TRKA 1QBKC 2IYSA 4MUBA 1A8UA 1FUUA 2GZAA 2PD3A 2HPHA 2P67A 2QT1A 4KNYA 2O7QA 2ZQZA 3AERB 1YOVB 1ZCAA 1AQUA 2XY4A 2ZSFA 3B9QA 3F6PA 5IC5A 3WLRA 4BNLA 1XTVA 1VCOA 1ZVJA 3IA7A 3R5XA 5FPYA 5IK2D 5FBHA 4D0GA 2PKEA 3HDGA 4L5AA 4ZYYA 1VPEA 1GCIA 2NP7A 2VIIA 3IPYA 3R8FA 1HDGO 4WX2B 5BN3B 3BMOB 2O6LA 4MYTA 3KQYA 4JL8A 4LNAA 4QXMA 1E1QD 1NI3A 1JLMA 3NRCA 1GU7A 1WZEA 2QEQA 3WLNA 1QRTA 3ZU4A 2ZUWA 3M5DA 2B9VA 2Q4EA 2EWWA 2F1OA 2PQ6A 1JI3A 2PNFA 5DSXA 2JFQA 3SN6A 4C6SA 1X94A 4J0EA 2V0NA 3LRTA 1MO2A 1T9BA 5DKFA 1SU8A 5IZCA 1GZHB 5LYYA 2JBAA 2C57A 3IDAA 3T54A 3I5MA 3NBZC 3Q7RA 4J91A 5I3ZA 2GCNA 1DUVG 5JDCA 4OX9B 4I50B 3E48A 5BSTA 3ID6C 1TNDA 1YZVA 3SKXA 4O5OA 3L0BA 4B76A 4CQMA 1OYOA 5M34A 1U7PA 2XITA 3KB8A 3CRMA 3E81A 3PI7A 1PYGA 1QPGA 5D3KA 3O75A 3ROGA 2Q4TA 3WXMA 1B4DA 3ABZA 3RHSA 1AKTA 2IZ1A 4IDCA 3TTYA 2IUTA 13PKA 2CBZA 3EF1A 4C9BA 2QP3A 4REOA 4XIFA 3VI4B 1FW8A 2GJSA 4EELA 1T4MA 2C20A 4BLQA 3R1IA 2I99A 4P32A 4GS5A 4QXOA 1KYQA 1AQLA 1SC6A 1YA6A 1P1CA 3ACDA 2HJRA 4OBBA 1LI5A 3VR6H 1KO4A 1T6YA 1KRWA 1MXHA 1CZNA 1IM5A 2W2KB 2ZWOA 1OTYA 5DE3A 4YMVA 2NP6A 3ADCA 1AXEA 3B13B 2DY0A 1SXGA 2JIPA 1OLUA 4KR3A 3DE0X 5JATA 1N2CA 2C07A 4PG7A 3E3OA 4LV8B 4QTTB 1WCV1 3TZHA 3JQ7A 1JEQA 4TVBA 2PKXA 2CZCA 2ECKA 2SBTA 4RA6A 3FKJA 2Z8YA 1RLIA 3HJTA 1YCGA 5CBPA 4QM7A 1H2ZA 3DHVA 3HVJA 3RNLA 1QHYA 1IMOA 2G06A 1A4XA 4RIFA 4F4IA 2XVZA 3D1LA 3PC3A 3O2SB 1IRXA 5K01A 1ULTA 1H85A 1M2FA 3IT3A 3L8DA 2VZ8A 3OA0A 1VSTA 3HUFA 2FXIA 3IQEA 1B16A 1TJ4A 3DVRX 3FCYA 4AAYA 2G08A 3DVLA 4KIFA 4LQ4A 1XNHA 1BE8A 3UMCA 2C7PA 1Q74A 2VYNA 2AN4A 3HNPA 3G23A 1NMYA 3BEDA 4Y98A 3WWYA 4EB6A 2EX4A 1N9ZA 3NKFA 1T8UA 2V59A 3KL4A 5HR5A 3NAZA 1QOPB 5GAJA 1YU9A 3ZVKA 4QLBA 1YRLA 3H99A 3FWKA 2EW1A 1EK6A 3DFMA 3GGCA 1XZHA 4JDPA 2JFUA 4UHBA 4FDTA 4UUBA 5G4KB 4ZVSA 4KR9A 1H8EA 4D8VA 5LQAA 3N2YA 4O4LA 2ZJ4A 4IJVA 4QO7A 1T6BY 2QRQA 5F5XA 5F7JA 5IBQA 4B34A 3LPDA 1EX7A 3L7MA 3TQFA 4FFNA 3WLPA 4C88A 2QW0X 1QQAA 1JR2A 2YMMA 2GD6A 1X7XA 1KR2A 1DX9A 4MB0A 2BFWA 3OEED 3OZEA 4XUCA 5FFMA 5LYJB 4C0QC 4AMUA 1PV4A 1DCMA 2MYPA 5DSZA 2X0JA 1XCLA 2FWNA 4ENVA 1G5PA 3AVTA 3GJTA 4WIAA 3P9NA 3E4CA 1H0HA 1XDBA 1OXBB 2NU7B 4F96A 4LDQA 1PDVA 1ZK0A 1XPUA 3VPFA 2GM4A 4A91A 2R1UA 4L16A 1U8TA 3R9IA 5D84A 2DM6A 3SYTA 3UJ3X 1OH8A 3HY4A 2PE5A 4DIUA 3ICQB 4TRMA 2C2ZA 3B1VA 2YJ3A 3AFHA 4BN5A 1UFVA 3PQ5A 3AP2A 2PT7A 3HADA 3IALA 1KI7A 3T7EA 3OZGA 4MYRA 3BJEA 3V1MA 4CG3A 1YQTA 2H5JA 3EZYA 4GQAA 4XLTA 3RM3A 3UJ8A 2IC5A 3QENA 2ABWA 2IY8A 4EYSA 1U28C 1VHDA 3UPTA 1OH5A 2AN3A 2F1JA 2IELA 1M1ZA 5FL7A 4QUBA 3DLCA 4BVFA 1PL7A 2QN3A 2FWRA 1YQUA 1KAEA 2Z58A 3GEIA 4JB3A 1RZ3A 4L0MA 4NICA 4TS1A 5J4LA 1O94A 2AKEA 3A2KA 1T2FA 3KKNA 3OX4A 3H4MA 1OUMA 3FJ1A 3SX2A 2QENA 2HLHA 4MCAA 3AOEC 1AKVA 2XGGA 1YCHA 3WR5A 1M2GA 1VI5A 1ZOLA 5SZHB 4RDCA 1ZUD1 3VOTA 4EHBA 1GEEA 2C5HA 4XPIB 1VIMA 3KR0A 1KETA 3L43A 1IFXA 1IVYA 4GHWA 5IC6A 3RUHA 3TIVA 5JTUA 2QU7A 3UH1A 3C5EA 2C3PA 3LGSA 3UAGA 4FGLA 3H0CA 1FRVA 2BJVA 3KHUA 1WDWB 1FDIA 3FWPA 5CIYA 4ZO7A 1CHDA 1O7JA 2B7BA 4LEIA 2QRLA 4ZVOA 4CL0A 3AF6A 2F4VB 4M8IA 3TLGB 4HRAA 5K03A 4Q4DA 4DSZA 1R18A 2AJDA 2GLUA 5ICGA 2ZIWB 1T5HX 5GVRA 1CR6A 1R0YA 2HNKA 4LY3A 4KR6A 1SQ6A 4QDOA 1VE7A 1YBAA 3CVOA 4ZK6A 1MABB 4PLVA 1Y8RB 4TVOA 4Z0NA 2VA9A 3QW4B 2ZRNA 4C04A 3PDUA 1SULA 3LK7A 1N2JA 4JWTA 4MARA 3DEKA 3OJWA 1V1MB 1VIAA 4P3YA 1P5RA 2JCYA 4TMWA 2NVUA 2PS9A 1XELA 4K9LA 2VSXA 4EPRA 4F2PA 3DZDA 4J7UA 1GHTA 2AUNA 3LUPA 4QL3A 2JAHA 2GZ3A 2HHCA 3L4JA 1R5OA 3ZDXB 3HA3A 3AR7A 1L4NA 2GFQA 5EFOA 3FFBA 1JG4A 2ZRJA 3OQIA 1ZL0A 4OI2A 2PZFA 5CFZA 1REQB 1UOQA 3HNRA 3LWZA 4X3PA 5ES3A 2KMLA 1X1QA 4LE1A 1Y9AA 4W9MC 1HT1E 1ICIA 1X9HA 3OU6A 3QWAA 4FFLA 4J6FA 5H5JA 1NX6A 3WWEA 3WTCA 1BHJA 2P6MA 4A0HA 2DF8A 1KKUA 2OBMA 3AJAA 2CLKB 2OMEA 1TTQB 1DDGA 3I1JA 1DSSG 4MEAA 4W9NC 5A7HA 3U62A 1IBKB 1LBHA 3W2FA 3VKWA 3HSYA 5CGQB 4R8RA 3VPGA 2E87A 2WJVA 4LXIA 4UBLA 2LUOA 1Z2PX 1VSQA 3CW9A 3FF4A 4QG3A 3L7DA 4IDFA 4ID9A 1FQOA 3M6FA 4IY1A 4J7CA 1N0UA 1NBAA 3TFQA 3B85A 4WUTA 3T35A 4QX6A 4U7WA 1Q3HA 3KZXA 1WVIA 2A84A 3RS0A 4AK9A 3D3KA 3N74A 3OICA 4L2IB 4Q3OA 5EWMB 3QVTA 3HXKA 5C5CA 1CF9A 3G8DA 4HVCA 3KU4A 2FW0A 4PFKA 3VDRA 1HM5A 3U31A 1SUDA 1W581 3UAYA 3GEPA 4ZXPA 4GOND 3KNZA 3SHQA 4NECA 1RPJA 2W6PA 4A9AA 4EYEA 4LNHA 5A3SA 3TAHA 2UZAA 3LU1A 5DCLA 1TO1E 2IYFA 3QVVA 2J4DA 1WAMA 3Q9UA 4DV5B 5EFZA 4MR9B 1ZS9A 4NBVA 2YV5A 5T3YA 4D6XA 3LC7O 5A9TA 3OCZA 1DKRA 3LUJA 4TSRA 1YFLA 2A92A 3DLIA 3SDBA 4Q01A 3GLRA 3TNLA 4Y2TA 4CU2A 4YDHB 4RK6A 3DDUA 3D6AA 3DE4X 2M2IA 3OIGA 4ER3A 1Z34A 1C7QA 5EP2A 2QR3A 2J6BA 2Q4DA 3FUVA 4HDMA 5KWVA 5GADl 2MSNA 5DSTA 3HCPA 1M67A 2IPOA 1GSAA 1DEXA 3D4NA 3FCAA 4ZV7A 4BO7A 3GGPA 1MDFA 3AR3A 4JFAA 1L7DA 3Q88A 4P7JA 1PCXA 4S24A 5EE3A 5EE5B 2IOFK 4YRIA 1JHRA 1HNNA 4JBXA 4Y6LA 1I4OA 3NBFA 1YQ9A 3FMVA 2WPDA 4J0DA 3RD5A 1A82A 3LC0A 4R9VA 5AVUA 3S2GA 2GBGA 4FCCA 4JU8A 1ADGA 4LHYA 4Y6OA 4ZP1A 4BMVA 1Q20A 3RC8A 1PWXA 3D8SA 2PWZA 3RFCA 5DIZA 5EIBD 1FDUA 1KU0A 3PGJA 1DKPA 3LBIA 1N2CE 1XP5A 2ZJ0A 4NLLA 2B4QA 1Z83A 2D1YA 2I7CA 1ABEA 3UICA 4QTUB 3ZEIA 4K3UA 3HVKA 4M6WA 4DBLE 4DW8A 4HH3C 2B7CA 1FNMA 1RW4A 2AOTB 1COWD 2EG9A 2GBCA 3G02A 4ITVA 1X80A 2X8AA 4PR0A 4Y2VA 1DUSA 1NMSA 1KVQA 2V4MA 3H1BA 3K6RA 1S8FA 4N18A 1D0VA 2VFAA 1JSCA 3INTA 5A71A 4DSTA 4DWVA 2EHJA 3QV2A 4Y6RA 4W6ZA 2Q6TA 2YV2A 2GRJA 1A98A 1QK3A 3ZU2A 2C31A 4ARZA 4H6VA 4NAVA 3BXHA 4D3XA 1SRRA 5HS6A 3JATB 4BFCA 3CMCO 1T43A 3A4IA 1PWYE 4WWHA 1GYQA 3QHPA 1JKJA 2JJ1A 4RPKA 2NM0A 2QN1A 1SM4A 3LZDA 1Z6QA 3JD1A 4K88A 3SYRA 2OBNA 4R84A 1DC6A 5ETJA 4HV4A 1MNAA 1YCFA 1OBCA 3HDYA 1YXMA 2QS9A 4KPYA 2A88A 2GF0A 1N6RA 1N3IA 3PC7A 1RKBA 4E31A 1SZDA 1U7DA 3W3AA 3A1EA 4W9RA 4D9KA 5HRUA 5A06A 4G86A 1PEAA 2FYTA 3DLPX 5B2ZA 1QJ4A 2VDOB 3C6XA 1FFCA 4RJJA 1FXSA 4DNFA 3QXSA 3DBLA 4NDNE 4V0KA 5FPTA 2B98A 1P75A 4ACBA 1SIOA 4NE2A 1PYDA 2MR6A 5AQ1A 3HVUA 1E5TA 1M2JA 3V4SA 1S9DA 1IDOA 3OECA 3GZTB 3I8OA 3Q72A 3UK6A 1U9JA 2W2MA 4WTOA 1BSVA 3AR6A 3RI3A 1ZR4A 3IE2A 2JI6A 2H3HA 1NW7A 2O8NA 1IQRA 2H48A 2V8OA 2X5XA 2XVMA 5LQJA 4HH4A 1P2UA 4H3SA 3UW1A 4J0GA 3P0IA 4E46A 4IXNA 1N2XA 1P73A 5G0VA 1GPBA 1B2LA 2PXCA 1KZ7B 3EVEA 1TA9A 3D3QA 3UXMA 1LF0A 1Z0FA 1ZVQA 4KPUA 2YWGA 4DDWA 3QFSA 3GUYA 3LTEA 4A6EA 3RYIA 1R6VA 4B31A 1PFWA 2HYDA 5LZ5A 1F2TA 1U94A 3ANTA 2AVNA 4DOMA 1JG3A 1K8QA 3I5UA 2PO7A 4XFJA 4OHXA 2HMVA 3FAZA 2VT6A 3MERA 5BN4A 4NBKA 1LGYA 1HFEL 3Q3VA 1T6NA 4FHGA 7REQB 2JFNA 3I32A 5A7GA 5B1SA 3ZIAA 3D0RA 1TQDA 1K9VF 3ROPA 4C01A 1QGED 3ZJTA 3QYPA 1CZHA 2BH9A 2XKJE 4HDSA 1CB7A 3FPFA 4TXJA 1J5EB 2GCIA 1IAVA 4LXQA 4NU8X 1R0LA 3GPIA 4ZOLA 5AVOA 1U5BB 4ABTA 1B26A 1G6Q1 1KP3A 1RWVA 4LRWA 1KXZA 3MWYW 4GZMA 4P2GA 1N1GA 1T9HA 4QUAA 1I0LA 1TU3A 1R9MA 1Y3BE 2WKQA 1WCIA 2XQJA 2IHBA 1JAYA 1KO7A 2DEUA 2C82A 2PX0A 2JG3A 2NMVA 2BELA 1NLYA 3GMSA 1WEHA 1H9CA 2IZ0A 4DN6A 5M3BA 1E3WB 2IVZA 4MR7A 2BCJQ 3PWZA 3N8HA 1H1TA 2GEBA 3KOWA 3NCHA 1PJ4A 2V7PA 4CM5A 4IS3A 4OSOA 2VUUA 3O7WA 3WZLA 3VHLB 4EPYA 2IP1A 3IUNA 2JJ2D 3H04A 1ECJA 2A1UA 3MT8A 3O90A 1LLDA 4YA6A 5LJIA 1QTNA 1SCQA 4G25A 4NK5A 4OQDA 4QIHA 2J5XA 4WW0A 5EGSA 3L4KA 2CXNA 4JZYA 4XSGA 4Z3KA 3ZHBA 5FOTA 1IK4A 1PE0A 3U56A 1LTHR 2Z9BA 1X39A 4JVNA 3HLYA 3KXKA 3OE4A 4H15A 3DKRA 4X7BA 1HEIA 1MLDA 4FBGA 2GZ2A 2UYHA 3B36A 3FVRA 1WZIA 4KXXA 1V8BA 5IF3A 1CZUA 1B41A 1XTSA 2G5TA 1E1NA 2HLNA 3LFUA 4FIDA 4R81A 4LFCB 2WHPA 3DBIA 4IIEA 3SR3A 1O0SA 1ONBA 3DC7A 3P2KA 1RQ2A 2HSDA 2V5AA 1QB8A 4EMSA 1WHTB 4A73A 2A7QA 1FZQA 1KVSA 4M1OA 2EF0A 3H2BA 2XMPA 3PF8A 3L4BA 3M82A 4CIXA 4BECA 3D5TA 2Z0MA 2HJ9A 4PCUA 3IHKA 3KJEA 3JQAB 3E61A 1YU6A 1QSGA 1PWHA 3SIRA 3NMUF 3M9XA 4CEJB 1L9KA 3FYTA 2BEWB 3LXXA 2NV2B 3UT0A 4F5YA 4NCAA 4LSWA 5JQGB 3IKMB 1OXUA 1TIPA 3IVAA 4G56A 3S29A 4XYMA 4FFDA 4I1RA 2PX4A 2V7QA 1UQRA 3FFAA 2WB4A 3IFSA 1IWOA 2B4KA 3TDNA 3UQZA 2FFRA 2RI0A 4G5HA 4Y1EA 4GE3A 3WHIA 5FEUA 1CWUA 2HRDA 2QAJA 1SWVA 3BB3A 4E70A 5J2UA 4BX9A 4J1SA 2TYSB 3HB1A 1NNEA 1EVKA 1F8XA 2DYKA 4B6FA 2J5KA 3FOCA 3G2IA 4ZVLA 2FZVA 1GU1A 2RGXA 3UUFA 2Y0CA 2EHDA 3MAGA 4PGAA 3RIHA 2WD7A 1GITA 1CEQA 1TC2A 2C7BA 4HNGA 1UQUA 3RJMA 2WF6A 1DC3A 1MEOA 2P9YA 3FCEA 3ORSA 5F7XA 4C6TB 3HL4A 4FC6A 4XYBA 1E9SA 1G8PA 4RM3A 3OT1A 4MTCA 4B7AA 5JYCA 1Z6AA 1ZI9A 3K15A 4J1TC 3JD2A 3T3IA 1Q21A 4X8MA 1PSDA 3QSGA 4KFRA 2BJWA 3LDHA 4R83A 2E48A 3B51X 1D6JA 3TVYA 1H23A 4D6YA 1ZD8A 3CH7A 2QM0A 3I9FA 3QTBA 3IXLA 3OZFA 4QJ5A 1E7RA 4X3OA 4R1QA 3GNTA 1FFXA 1Q7RA 2RGAA 3TJZA 1YGYA 3BA1A 3BMNA 3L6RA 2DFLA 4L8LA 4NJMB 2W58A 1HDZA 2Q5EA 3U7QA 3AVWA 2XMSA 4ED9A 4CKWB 3K73O 4PONA 4Q4CA 3JVIA 4QO8A 5CGZA 5ALOA 3EGIA 2BM0A 5B2FA 2XZTA 5MFPA 1EFKA 1EK5A 1JHVA 2EFJA 3GDOA 4MMXB 2G4LA 2OUKA 3DO6A 1MJHA 3H2KA 1NYQA 2JZCA 5I7UA 3EMVA 4XLZA 3KR1A 1VJRA 2FW7A 1QLWA 1Y1TA 1W5TA 2QMZA 2VP2A 3CZMA 3LOPA 4MP8A 3UMBA 1PZNA 1SXJA 1B43A 1KS9A 5KYUA 3NG1A 2QBYA 2QJFA 4AKHA 2O2IA 2VUIB 5K2MA 1JFFA 1EUCB 3CE9A 1QK4A 4D3SA 4JXXA 5KKNB 2RGEA 4GLFA 3K8ZA 3OC6A 2MYTA 1TA0A 4KHZA 3BK7A 2CFTA 2XWPA 4EY6A 2PWBA 3SHWA 1WE2A 1WTCA 3L2OB 2HRCA 4H2DA 3O8LA 2H7CA 4JJEA 3GLKA 3E3MA 3JWHA 4B5KA 3QGMA 1DI0A 2H17A 2ZS8A 4X60A 1VL1A 4ZAGA 5AVSA 5AI4A 3D6NB 4PC3A 2XD4A 1NVKA 3MMPA 5DBOA 1W36C 4GZLA 3AZOA 5KCMA 5LP6B 2OGTA 4P54A 4RD1A 4WERA 4CUZA 3PKIA 2E5LB 2FX5A 2L42A 4R5MA 2VDPB 5EWJA 3DUFA 3JYLA 4FB4A 3AJRA 4DV6B 5L7TA 1YTLA 2NX2A 3KKZA 3DMHA 3WNZA 5K8UA 2OCKA 4GBJA 4FW9A 4BGUA 1RZUA 2DFVA 1DELA 4LWOA 1CJBA 3CRNA 4WK0B 2BMWA 3ITKA 1BTOA 5H68A 4OGFA 3R4CA 4Y0VA 4EG6A 4YI5A 5DNWA 2RCNA 2R79A 2VPYA 1ZXXA 2QAIA 5I47A 2Z5FA 3QJ5A 3M7IA 4PYJA 5CCXA 3DNMA 1DRJA 5CITA 3IBGA 4IQGA 4UM8B 3PPXA 5DI9A 3ON5A 4ZHSA 2QKYA 1T1IA 4DA4A 2QDKA 4OXKA 1GFSA 2B36A 3BK2A 2DQSA 3BRWA 1TM3E 2BR3A 4QVIA 1E9BA 3MWDB 5J63A 4P5DA 5EP4A 3EOBI 3E9MA 3RPEA 3QHQA 3Q3EA 3R7AA 1E77A 4IIFA 2WI8A 4BQNA 1P60A 3R7FA 1QUEA 3WB1A 2VHEA 2P40A 2YNMD 3NYRA 4IQ0A 2DHEA 1E9FA 2DPGA 3NQ41 1HNWB 1XWFA 1VIDA 4C4ZA 4UTZA 3KZOA 2H1WA 5BSWA 2GPWA 5A4JA 1HO3A 3DS8A 4HNHA 3WJ7A 3T1YB 3DT6A 1NVWQ 1KJJA 1N2OA 2FEWB 2OC9A 3BKWA 3ESRA 3K9GA 4G63A 4IDDA 4PHGA 4TL8A 3PDIB 4IWXA 3WL7A 4F6CA 5JHGB 4I3FA 3K30A 4RFSB 4WE3A 3SYLA 3ND8A 4G0PA 2JS7A 4LGVA 2YUTA 3P19A 4F2WA 3T0GA 3C3KA 4Y9SA 3PTAA 1WXDA 3VMMA 5J4YA 3NHFA 1MJGA 5K3DA 2PAFA 3FKSD 3GUCA 4ER7A 3LCMA 3ZIUA 3ZDAA 3HBLA 2IYLD 4RLQA 5AW6A 3P2IA 5IJZA 4NOMA 4O4JA 4RHEA 5CJ2A 5AJZA 4BXOB 1HDOA 1PKXA 4TMTA 4ONEA 3RUIA 2BBTA 4JKYA 4PN3A 4GH5A 2VP9A 2OHIA 2YWBA 3LT1A 3ZTYA 2M98A 2D4AA 2ATVA 2BGIA 2IXEA 3C4JA 5B7PA 1OZGA 4GX0A 2HSZA 2V7TA 2V3VA 4KLRA 5SYMA 4JP1A 2Z57A 1XRJA 5ADWA 4E33A 1BE0A 2Z8XA 3URMA 5JZ9A 4X20A 5K0FA 1KNQA 2QZPA 3EDOA 1IHDA 4QOSA 1PS0A 3CVVA 2J45A 1RQGA 1YB4A 1NASA 2EVWX 2XMCA 1D7OA 3JV7A 3PJEA 3QVLA 3B70A 5JS7A 3RROA 1VMEA 1XZJA 3OIUA 1MIOA 3OHMA 5K3CA 1Z8HA 1R5BA 1EDBA 2MOKA 2W4QA 1VI2A 1KVTA 1D6NA 1ND6A 1QLHA 2DCMA 1RD4A 2M6SA 4P53A 5FTWA 2QVLA 2ARKA 4UDOA 4B3RB 4ECEA 2YTZA 3T7IA 4DTIA 2BMFA 1GPH1 1RRGA 4Q03A 1XZMA 1JZQA 4POOA 2RBGA 5LSAA 2UVQA 3I45A 5C2JB 1Q0HA 3GJXC 2XT0A 2P2SA 2PK3A 1SGWA 3ETHA 4ZMRA 3E58A 2XADA 2V8BA 1GDDA 4LMBA 1TKAA 3CSSA 1Q1ZA 2WMYA 4Z86A 2X9GA 1ECBA 5KNCA 1AA9A 2DSTA 5HF6A 5TDHA 2F3QA 3M6IA 1XZEA 4DBVO 5SYAA 4WLOA 1EWVA 5JNVA 5HOQA 3K70B 2BGGA 2QSZA 3C5HA 2HWYA 4E94A 3DMDA 4QYMA 1JDJA 1NNUA 3OP4A 4WT7A 3E7PA 2GCEA 5CH5A 4R40A 3DV9A 5HF5A 2SHKA 1OMOA 4YHBA 4B87A 5JCXA 1UMCB 5DHRA 1DJLA 3U4QA 1Z0KA 2VNKA 4JNKA 1FVOA 3DZ8A 1WP9A 2TMGA 1G6HA 4RVUA 4MZXA 3RYHB 4I4TF 5F9MA 3D4PA 2RJ3A 3V7WA 3WYEA 1XZAA 2H18A 2Y77A 3L7AA 3WKEA 1NF2A 1DOHA 1YGPA 2H2DA 2WQZA 3NWEA 3PVZA 4J75A 3C8UA 4V0SA 1UZLA 3S2SA 4R8MA 1IZ9A 4EOGA 2FPRA 4CF6A 4C0AC 1EG2A 4YR9A 4TVSA 3T3EA 3R76A 1JTVA 4ZI7A 1TZBA 3RSOA 4CFSA 5BOSA 3CLVA 3MWGA 2WIKA 5LIRA 1N6HA 2W6OA 4KWTA 3B1ZA 1RWPA 3B8HA 4EF6A 2IYVA 2WU3A 4OJQA 4D9BA 4OD0A 1OB2A 1ZITA 1FTSA 1XRRA 1M54A 1N8NA 1XDGA 1P4AA 4NPAA 1R0RE 5DOZA 1MTOA 3NHLA 2YZ7A 3T94A 3CNNA 3NHYA 2LWIA 1UBOS 2SKDA 3NWBA 1P9LA 1AKWA 3K96A 4F56A 2QG9A 3D1JA 1XDUA 3WWDA 4PYLA 4K1LA 4NG4A 3DTVA 3X2EA 3KQQA 2ZUDA 3SG0A 3ZPXA 4TKVA 2ZBPA 2WSIA 2WDZA 3KHSA 4YBZA 3AETA 4BASA 5DV9A 3V80A 4ZHQB 2ONYA 4BAUA 3OPYA 2X3UA 5D3ZA 1LJUA 3PPVA 2VNAA 1MX1A 1Q1BA 4RK1A 1N25A 1X70A 1YJ5A 3CNQS 3RFUA 3K0CA 3H3XA 9ATCA 4YROA 2ZGVA 8LDHA 1GGHA 3PQ2A 1ODFA 1SXJE 3QA9A 5BN1A 3AQIA 1L9XA 2EIHA 1NM5C 5JJ5A 4B6JA 1N5IA 4EYGA 3GF4A 1QP8A 1QO0A 3L1HA 3QEMA 3ZCXA 3MM4A 4P7KA 2ANBA 2J59A 3AHIA 3ROEA 4C30A 4WAUA 5JQWA 5TLSA 1U2DC 3UW3A 3HG7A 4ARUA 5BP7A 3WAGA 3PF9A 2NPFA 2Y9PB 4YJ3F 3M3DA 1M33A 2P9EA 4IDEA 3M4YA 1AZWA 4ZN6A 1A2KC 5J5AA 4ZYZA 1QS0A 3OPYI 3Q1LA 2GUGA 3QWHA 1G291 2VSNA 3QMWA 4TWRA 4FEGA 4H1TA 4H18A 1G8HA 1ZNWA 4L6AA 1ZD5A 1SKBA 3HGTA 4N4AA 5DYIA 3S2YA 3HFRA 1JG1A 3ER8A 2DWOA 3T61A 4CMIA 2NTVA 4QUIA 4TUYB 4URFA 1YZHA 2C2KA 5G1OA 1JXAA 4M3NA 4JR2A 3HYSA 4X95A 3IOEA 4FLEA 1I94B 5JMPA 2ON6A 3EXHA 1H66A 4G26A 3ICOA 3PJGA 1JQLB 3ZI4A 4FJ0A 3HKBA 5LQSA 2ENUA 3DKVA 1OAAA 1Q95A 1E5VA 2X9LA 4WXHA 4D9GA 3BFPA 2R7LA 3EZ2A 1QH8B 2O3RA 5AW5A 1I3CA 3FPEA 4TXLA 3D6VA 1YC2A 1C7RA 2FQYA 2P9JA 2C77A 2PXHA 3EY4A 3L0PA 4B73A 1HYHA 3DDZX 4TPKA 4Q4AA 2FP4A 2Z83A 2EP8A 4ZAWA 2CNBA 2PMEA 5KHOC 3A14A 3M4JA 5JVDF 3TBKA 4NJEA 1WW3A 4JT2A 5HXAA 1Z0ZA 3I6BA 4LYAA 4P3KA 4ETWA 4Z4CA 1N2IA 1UAGA 1XHEA 1ZIDA 5HP4A 4EH1A 3VGJA 3EVNA 1JIXA 1FEZA 1LSSA 1DFIA 3ZTWA 4IV8A 4IICA 1HNXB 1HX7A 2PSDA 2ZE5A 4ZQGA 2JCXA 1NYRA 4HDAA 4B2IA 3WA6A 1WKVA 4DCOA 2IYEA 5AVXA 3G5AA 3V4ZA 1JHMA 1OA0A 1QTRA 2WWRA 2C7QA 4CM9D 1BKYA 3U9LA 3WLSA 1IULA 2HJSA 3BFKA 4URHA 2AS0A 4DV7B 1KPHA 1ODIA 4X63A 4XFKA 1T2NA 3SVTA 1Z06A 2P78A 3WRWA 2J33A 4RAOA 5J40A 1WBBA 1JIQA 1WMBA 3B6MA 2OWDA 3DEYX 3A1TA 3MLBA 1F17A 1PJZA 4G5YA 3AERA 1YOVA 1H3FA 4O1MA 4S1VA 1ORTA 3FHLA 1JEOA 4JX9A 1P0QA 1F0PA 5JCJA 1W44A 2ZUFA 1YZUA 3L01A 1WPRA 2WU1A 1DL5A 1BXZA 1J0DA 4R7TA 5BN3A 1Y98A 3BMOA 4BS9A 4G2NA 3G0DA 3QU5A 2EKQA 2NU8B 1PZGA 1C41A 1UOEA 1QG4A 4E4RA 3TRFA 4A8JC 2XRZA 3R9WA 3N39C 3D2BA 4NU5A 4RUKA 2AEMA 2WIGA 2D6FA 1FDVA 1L2TA 5L6LB 1BOFA 1K5DA 3HGMA 4OU4A 2QVGA 1JHAA 2WAAA 1P8JA 2HU7A 4P6VF 4ZVVA 4K26A 3TINA 5ENVA 1A2QA 4IJKA 4WN3A 3WSVA 1JDSA 1Q77A 3WXBA 4KRGA 1Y6GA 1WMDA 1X1BA 3QWFA 3BH6A 4X94A 3S1AB 5JMOA 3T12A 1OWMA 2UUCB 3LHSA 3KBOA 4Q4HA 4DHEA 3G0IA 5A4KA 4HNRA 1KEPA 1JLRA 1TM4E 3IXQA 4KQ9A 3MQ4A 2AI3A 4LY9A 5AM1A 4EO4A 1WS6A 3AR4A 1WXEA 4L51A 5LDGA 3UHPA 1RNLA 2C84A 1O9BA 1G21A 3AEYA 1QH0A 3B52X 3ASZA 2AMYA 4UM7A 3KQTA 4DWWA 1YDGA 1FUKA 3N7TA 5EMHA 4NATA 2OXCA 4Q1CA 5ER6A 4YP9A 2QR2A 2IEYA 3GYBA 5LU9A 4LZJA 2Q5HA 3VJKA 2M1XA 3BGIA 3KOOA 1VRVA 4JBLA 4MW2A 4ZAXA 2XMGA 3FUCA 4JLNA 4BMOB 5AKZA 2A5LA 2OV4A 2W2KA 3ML1A 4HATA 2NWQA 2BFNA 4URXR 2Q1TA 1B73A 3GRFA 5LBTA 3A37A 1CHNA 4CIYA 1SK8A 4F8JA 3I37X 3MOSA 5A5EA 2WHXA 5G4LA 1P4RA 4M54A 4EF5A 3Q85A 3QKUA 4NOLA 2OZVA 1KI6B 2YY7A 5A5FA 1XROA 2OCXA 1LI7A 1E3EA 4LWQA 4ISCA 2QRVA 1HETA 4O59O 4QFBA 4XH9B 5FYDA 3S8YA 3NYIA 5K0CA 1BQEA 2RGBA 1YL5A 5T41A 1TJ5A 1W49A 1R50A 2X14A 4AY5A 2YN4A 1ZBDA 4P4UA 1W76A 1RAAA 2QM8A 2JJQA 3UGQA 2VQ6A 4TM7A 5CEEA 2PQ0A 1OH6A 1XD9A 1GRRA 1JYFA 3CR8A 5IWAB 3ZD8A 5CLIA 4G5RA 3DMPA 1UZUA 2IS4A 3DFFA 1E0AA 1PJQA 3PJDA 2OFPA 3EWAA 4DREA 2CD7A 4WNAB 2A86A 1UPBA 3PGMA 5CA1F 3BXZA 3FTFA 4P3NA 5L4SA 2Z08A 2ZS9A 4K7JA 4Q7MB 5GM1A 3WLLA 4B84A 4F2GA 5F9FA 1QANA 4MS4B 4HQ6A 1O6GA 5E95A 3DBHB 3A4YA 2DC1A 3GFOA 3IT2A 4BGEA 1O97C 1KXJA 1XZKA 5AI0A 3THSA 4D9NA 5KINB 5M2QA 3MBOA 2IGTA 4GEKA 3RU2A 3KLOA 4KE7A 1W4LA 3LIIA 1EXNA 5G4KA 1IY8A 4M83A 2Y67A 2ZJ3A 1V7PC 1ISIA 3UANA 4NBRA 1BS1A 1U3WA 2O23A 4LTDA 2OY0A 1BD3A 4WN9B 3OQ6A 1DO0A 3LUCA 2CXRA 3QVKA 2V45A 1VSUA 1XTPA 2VJQA 1DZIA 4L0CA 5LYJA 2UZIR 4C2TA 3F6SA 2OENG 3TMYA 1S5PA 3P32A 1ZUNB 2BFDB 1E8NA 2I2DA 2O3UA 1KYVA 1M6YA 1B15A 4WACA 4IVQA 1R3UA 1XT6A 1Z0UA 3WLIA 3Q12A 4QRDA 1XMJA 2H1FA 1L5HB 4FE3A 2NU7A 4GBED 5BXQC 2A9KA 2XXJA 2VCYA 2Z6VA 1WM1A 4YAFA 5ESRA 5DLEA 3H7AA 2G1AA 1K08A 1O95A 4EHDA 2ZYAA 3T34A 1AB6A 5IF9A 2GR9A 4IIYA 5J1SB 4LGYA 2ZRMA 3VX3A 4DV3B 1ZLXA 2BTEA 1MZVA 3DQPA 1IK6A 1FU7A 3HKEA 3LK6A 1P7CA 3DG9A 3OLYA 5IBCA 4M1ZA 1VGQA 1P0FA 2WP0A 3IAHA 3L0CA 2AXNA 2PFKA 2PWAA 4ML3A 3IOBA 4NQRA 4Q6BA 1IB0A 2Q0HA 1X7ZB 4WL0A 4ILKA 1RHQA 3KLPX 4BNXA 4D4HA 3DEZA 1U8FO 4TWZA 3ZW8A 3IEVA 1EIWA 4AKGA 4URZR 2VP5A 3B2EA 1QJCA 3N05A 2XWBF 2Q3MA 1ZJZA 1ESDA 3KKQA 3A32A 3DOEA 4FHCA 5BSVA 5KDOA 3QE3A 3UEOA 2PIAA 2DFNA 1E6UA 3DR3A 4K6KA 1XVVA 1BVRA 1UL1X 2H9IA 1SD2A 1NVFA 2YQ4A 4XPIA 2EG5A 4UDXX 3NJRA 3B3QA 1QV9A 1A1SA 3IV6A 5ECGC 1L1EA 4LXGA 2OM6A 3AIKA 3W2IA 2IU0A 1R0WA 3ENWA 4IXWA 3ZI7A 2DTDA 3K31A 4X5OA 4ZKDA 3D3NA 3ECSA 1TMOA 4Z1OA 2CVQA 1G7CA 5KSWB 4FYPA 1GG5A 2D0DA 2LV8A 3KQWA 4LYYA 3TLGA 1HZZC 1WXHA 3K9BA 5EIXA 1LLCA 221PA 3N8KA 5KYGA 2J09A 3TZQA 5ALHA 1GARA 2KE5A 4XQEA 3QLVC 2OM2A 1XFDA 1E7YA 3HI4A 4EJ6A 1MABA 4WH0A 2V6BA 1RI4A 2WUFA 2OORC 1V1MA 3JQBA 1T1JA 5H9VA 2OZLB 4KV7A 4MEBA 2IUUA 2C7VA 3UZUA 1QR6A 3T5MA 2QI9F 4OPMA 3ZLTA 4YV7A 1FFDA 3B9RA 1UP6A 3JQ9C 4R3NA 4R9NA 4YGYA 3TLYA 2R8ZA 5L3QA 3PIIA 1NDQA 4L1KA 4GQIA 4FOSA 1LPNA 4I7EA 2IK8A 4ZOAA 1CDDA 1Y7HA 1DWOA 1REQA 5LXTA 2ZSJA 5IDWA 2FKNA 2WSSA 1RYFA 3AHDA 3JZFA 4IIBA 2YMQA 3CX3A 1YFJA 2AOWA 2Q2NA 4QYXA 1FFAA 2WIAA 2NU6B 3HB5X 3AP3A 4BY9E 4J2OA 4CQJA 2R00A 2GXQA 5IN4A 4JU9A 2O2XA 2OOSA 3NHZA 3ZHTA 3WL4A 5GOTA 1EJ2A 4TMKA 5IXSA 1WSWA 2YV3A 3INYA 2ZYUX 1G0OA 3LFTA 3QBVA 3SU8A 4B46A 3PFKA 2WY2D 3D7MA 1UJ4A 1V8OA 2A14A 1N7HA 2I6UA 3NATA 4B3XA 1ZCJA 1YZTA 2YWXA 1O9GA 1V5EA 2Z1DA 3CA8A 3CONA 3HWRA 3BN3A 3IEUA 3F2VA 3HM2A 3K9HA 2ZEJA 4JQSA 4ALMA 2IDKA 2RB5A 4HFRA 4N3AA 4L2IA 4OUDB 4FT2A 4HAVA 4WK2B 1LEHA 4TMYA 4BVAA 1IWBB 1EDZA 4W7SA 5JEDA 1RE0A 2C4UA 3PX7A 1T5DX 4KWIA 2JFHA 3NWPA 4D99A 2OQVA 1NW6A 2IYWA 1K86A 4RC9A 1JIJA 2D74A 4PX2A 3B48A 4RL4A 4UUPA 2DUJA 2CMKA 3AO0B 3HJGA 4YYZA 3MINA 4H1UA 4MR9A 1XKLA 4AN4A 1E1RA 1F51E 5PGMA 1TZCA 4RZQA 4HX9A 5CG2A 3T7DA 4IYRA 3C87A 3AVUA 5DHUA 1K8XB 1YE3A 4HTAA 5BVGB 3VC3A 4MEJA 1RFGE 2XXBA 4HQFA 3ET4A 1G21E 2R7NA 5I8WA 1G98A 1RPNA 4DABA 4H9GA 3H11A 4PGFA 3WHKA 4V02A 1UC8A 4P3XA 3NT2A 3NV7A 1E9VA 2ZAGA 4EA6A 2GPNA 5CM9C 3MTBA 3SI7A 2IUFA 3U4IA 2GBPA 3H2YA 1TPYA 3WB9A 1FLAA 2XUJA 3PT9A 4BUJA 3ILHA 1OTXA 3M5CA 4D82A 3ZLVA 5BQOA 4HAUA 5EIOA 3B78A 2YRXA 4E5MA 2R47A 5FT9A 1Q0UA 1VTKA 1X15A 2GN6A 4LX8A 2P1ZA 4MUGA 3BRQA 3H13A 2OXIA 3H2IA 2JLBA 1PJRA 2GM3A 4FINA 1EQ2A 2ZR0A 3U09A 3A10A 1NUSA 3FX2A 3P0JA 4Q3BA 5CUQA 3HB9A 1CFJA 4OXRA 3EGOA 3H9BA 1SOVA 1L7NA 4R8KA 1S2LA 4N48A 1J2TA 3DZJA 1GSIA 1Z4QA 1ZCFA 3PBKA 4PRKA 5EEGA 3SWWA 2QRGA 5IXJA 3BD9A 4GXRA 2DR3A 3JYHA 3GCGA 3P45A 1GTZA 5IDYA 5KNBD 4YHHB 1T0UA 5AHRA 2X4GA 2DSNA 1TEHA 5TPZD 4YXWD 3N3BC 2YOFA 3CVYA 1N7IA 3QX9A 4NPCA 2UUOA 4B4DA 3PNSA 1AZLA 2W6QA 5JCOC 3PQ4A 3S68A 1P6QA 3OIVA 2WE8A 3BCHA 1IXYA 3S44A 4UATA 2IFTA 5CTAA 2AR7A 2NTJA 2ZI5A 3C6ZA 3K09A 4GPIB 3REQB 4GLLA 2UVDA 3HCFA 2CNOA 5FLKA 5KOIA 2B8JA 4HEA1 4TYYA 2HR1A 4KDCA 3WGOA 3AUKA 3A6KA 1F3OA 3EGDA 4INZA 4KQ1A 4TL6A 3ZTTA 2FWPA 3N87A 4L3OA 1S8NA 4AJHA 2WAMA 4LI3X 2DUNA 2QLTA 3AWDA 3CU5A 2O1WA 4NL4H 4RVHA 4ZREA 4EKIA 2AG8A 2O3TA 2W5UA 1ONOA 2I54A 5A4IS 3A1DA 1AM4D 2YR0A 1L5GB 3TX6A 4Y7CA 2QQEA 3G49A 3LLCA 3RSQA 4G0QA 4PGHA 2WWWA 3DLHA 1RCFA 2H9YA 4D9IA 2Q9CA 1DWUA 6CHYA 2X6TA 3OZDA 2J3KA 1MOQA 2H2AA 5IM5A 1D9ZA 2FGKA 1GIAA 1WBDA 4Q39A 4JSTA 2O07A 2D1SA 2DFDA 1P6XA 2FI1A 2WVGA 4JR1A 4E5KA 4YECA 5BQFA 1GWNA 4K3VA 4YREA 2O2ZA 4XWOA 2H65A 4JBHA 4EJSC 2P62A 3FFWA 4V38A 3ZZ1A 2D54A 3NM4A 1D2NA 1YR8A 2IV3A 2BFPA 1DINA 3EEOA 2A94A 3M33A 1LTKA 4PQEA 1G8AA 1P62B 5I9BA 1KEWA 3WMWA 4CCSA 1ADBA 1CG6A 3KYCB 2YINC 2QE7D 3QVMA 3TQTA 3KVYA 3WQBA 2DTEA 2EBHX 1Q0QA 2FMXA 4Q9AA 3T3HA 5A5VA 1KEZA 3RH0A 1B6RA 4DMHA 4FWTA 1WRBA 3IAM6 1HBJA 2JAPA 3A9VA 3VR5A 1H6BA 4E4TA 5ENZA 3A6PC 3LWNA 1UWKA 3FAKA 3GL9A 1W48A 2CXSA 1U5BA 1RAFA 3UHFA 5A3RA 1NMZA 2Q21A 3ANXA 5HZGA 2OSVA 5HJ2A 1IBMB 2Z4TA 2JAQA 1N8KA 3AB8A 3AJDA 3C98A 1QE3A 5HCNA 4NZZA 3TE7A 5EJEA 1WW8A 1FNDA 2HA2A 4R2WA 3TR0A 3THXB 1CNMA 3GRYA 3GVXA 5CCDA 1E3WA 2KW5A 3TQHA 1CR1A 1F2DA 1CUXA 3F90A 1C4KA 4LCEA 1QVRA 2GVNA 1ENZA 3M6MD 4NBUA 4XWTA 4N8SA 3RT7A 3VTAA 1QIHA 2Y0DA 3CF2A 4FLMA 4OFBA 5C34B 2XOKA 5LZ2A 1TE2A 1B00A 1DPGA 4R69A 3Q87B 3O8OA 3RT9A 1ZHOA 2GBLC 4OXXA 3F97A 3ROTA 2B0CA 3IB3A 4DCNA 2PANA 1SQGA 3GT3A 5GIOE 5EZYB 2GJ4A 2ZB7A 4CM6A 3F6BX 4F93B 4ZHQF 1I7NA 4FYWA 4KG7A 2WYUA 4C29A 1S7CA 5IJ0A 3O8CA 3G0BA 2D5LA 2WA1A 3NVKI 2REXB 4URYR 2VS1A 3W5VA 4BE9A 5KYKA 1GD1O 1OH7A 5HK9A 1JQAA 1R6TA 3SXJA 1MQSA 3N0TA 4HDNB 3RBZA 5TARA 2OQIA 1P44A 4QPJC 2C8LA 3K0BA 5FOVA 3VV2A 5B1DA 1X1RA 3TF5A 3AG6A 2GPBA 4H17A 1U8EA 5U9CA 2YIVX 4M0DA 1L8XA 1O8CA 2MWMA 2X1MA 5LZ7A 5EJ9A 1IZ8A 3G2OA 1RZRD 3GDWA 4WNCA 3Q11A 5E4FA 3MTEA 3TD9A 3TQQA 4DUPA 3BGVA 2RE8A 5BSFA 1CP3A 5CH8A 4KXWA 1NZFA 2D00A 1NJ6A 1QO9A 3RTAA 1XL0A 4QYWA 1CRZA 4B9EA 4JEIA 5DF1A 1O89A 3RJTA 2XNSA 3AW9A 1IY0A 2Q9AA 3N58A 4QU0A 4ZGGA 3F98A 3IAXA 3JQAA 4LOKA 1RYNA 4PYRA 4CQNA 1B3BA 2Y9MB 2GAFA 5C8XA 2YZKA 1ZH6A 4MRMB 4QOFA 3KZCA 5J4KA 1EFCA 4CEJA 2BEWA 3P97A 2ZS7A 1FCJA 2FMHA 2J67A 5JQGA 2DPXA 2P6RA 1HYBA 2OXTA 2JATA 2CWDA 4QEKA 3USCS 4CG0A 1G4HA 1YQEA 3EJ6A 1SD5A 1XF1A 1KAGA 3GGOA 2QRHA 1WZ2A 2CF6A 1XEAA 4YV2A 5JBQA 1N0IA 1Y33E 4UARA 2WKPA 3LE8A 5EC8A 3LLMA 2MSCB 2XA1A 1Z73A 1RM3A 1KIMA 2AG0A 1EFRD 1YDEA 2FQXA 4N7RA 2O1EA 1AK9A 4MPTA 1RWBA 5AESA 2M6KA 2BGMA 3KD2A 4HH1A 4DJFC 3JD3A 2YVQA 1EX9A 2PWYA 1BXGA 1EX6A 3B5EA 5JTTA 1QGOA 3ZWWA 5FAKA 1LNZA 1QDLB 5F35A 3TK1A 4X24A 3RAGA 4MJXA 2VQFB 5B4VA 3QOXA 3T9AA 5JNTA 2IEIA 4MUIA 1WB9A 2YVAA 4ZT4A 2JBWA 3EA0A 3PNVA 1XCPA 3H18A 1U3TA 2D0PB 2OMKA 3ABOB 3LT2A 4MOWA 4EKDA 1NQOA 5LOVF 3ES9A 4BC0A 4U63A 4KLZA 1W88B 3Q0TA 4LYEA 4S1OA 1E5LA 1PVDA 1V95A 5DO9A 5AW9A 4YLEA 1A9QA 1Q0ZA 5TRTA 1KE2A 3W1VA 1JSLA 3F4KA 4UTPA 1BDMA 2FZEA 5CVEA 2I4RA 3B82A 1FFBA 3I1FA 3KOXA 4HX5A 3CXUA 3GLHA 5FKJA 4BB6A 2CHGA 3CNBA 2JH8A 4AL4A 3JR3A 4LI0A 3WP0A 3IV9A 3UMGA 4QXAA 3NH9A 1DAOA 3EODA 1O96B 4CKWA 2KBEA 1ZGJA 1TKBA 3CPHA 4IJMA 4BVGA 4AQDA 4OLJA 1T3ZA 1GTSA 3Q15C 2HPZA 4Y2RA 1HRDA 2PJZA 3K9LA 3L7YA 1JKXA 2A5FA 5CYOA 2Z09A 3L02A 1XP8A 2ACWA 4F11A 3E5NA 3E15A 4CDRA 4C5AA 3NPMA 1M6EX 2W2TA 3LA6A 4A15A 4A6PA 3LX6A 5FBVB 1NP6A 4K9NA 3K53A 5KJEA 3RB8A 4Z3DA 4CQMD 3ERCA 2WF5A 4FGZA 4UQOA 2SKCA 1PNQA 3I9V1 2C9BA 2GRUA 4TSKA 4YRJA 3KUXA 3WWZA 3DD5A 4W8OA 1VFPA 4JNCA 3OF3A 2C94A 3IAFA 4M22A 3RDPA 3O4JA 2GN0A 1WQ4A 1IPEA 3ME5A 4TQ9A 1T4CB 2DT5A 4HAZA 4GMGA 2NO5A 4UZEA 5K20A 4PG5A 3MQ2A 3ZK8A 3WLFA 3GELA 3F78A 2YS7A 2ZQ5A 1SVUA 2MSEB 3GU3A 4OM7A 4KRXA 1BEUB 5GP1A 5L7WA 3IUMA 5GJWC 1SJ9A 1T34A 3B38A 3P52A 4QC2A 5CIQA 1YRBA 4E51A 2ST1A 3SX4A 5AKHA 3L0SA 5JASA 1EE2A 1ZL2A 2RGNC 4HF7A 5JNUA 3BGOS 4YCAA 2JLAA 3CUTA 3F6EX 2R0QC 5DX0A 2PS0A 3A4MA 1WVGA 3ECAA 3RCBA 3MEQA 4H0CA 3CRRA 4YMTA 5AUPB 2NIPA 3HWX1 3I1YA 1QZTA 3R3UA 4YUZA 4V1CB 3HS3A 5LUAA 3Q7SA 3OZBA 3HSKA 5CB4F 5I6DA 3HB4X 1PEYA 1PDOA 4X84A 4GWKA 3GP3A 5AJVB 4BJ6A 2VXYA 4HKTA 4D9CA 2Q3BA 3A4VA 3IXMA 1MVLA 4EB8A 1BX1A 2BI7A 2ZDQA 1Z33A 2X1VA 6LDHA 3IT1A 3R9XB 1G5RA 2XDQA 4EQ6A 3I30X 5KYTA 1MDBA 2VYND 1UOOA 3MWDA 4NZOA 3SLRA 1B6GA 2WF7A 3P9CA 1MC4A 3PI6A 4LXXA 4CXMA 4QPPA 1M34B 1UBHS 2PDAA 2A59A 2UU9B 3H0EA 4QA9A 5H4HA 1R9JA 1SIUA 3UJCA 4B6EA 2AFHE 4DILA 1J4AA 2C0CA 4OH1A 1H8ED 5D5QA 3TTSA 2BUBA 2FZCA 2ZB4A 2HJHA 3IMCA 4RTPA 1Z82A 2YVLA 3EQ8A 2HF8A 4FN5A 4QAJA 3RSLA 3WNVA 4BV9A 5DM1A 2C61A 1YR6A 2IA5A 2VSQA 1QAMA 1CT9A 2YIDA 5IVPA 2OEPA 1DWPA 1GZ3A 1OZAA 2HDOA 3PCXA 3PDIA 3TNJA 1CJUC 4DS3A 4LHWA 4MA0A 4RFSA 2XE6A 5TMBA 5IKOA 2VL7A 1M72A 1SOWA 1Y1LA 2EFGA 3FWHA 4MWCA 3K8OE 2VO1A 4N65A 3KS9A 1P2BA 1HDCA 2R6JA 2RH8A 4NG5A 2V7VA 2XTNA 3T7CA 4QOIA 1DCKA 1KYXA 1Y6QA 2C59A 1MHPA 2VZ0A 4ND6A 5JNRA 3EY9A 4CNQA 2HLPA 1KQ3A 3STWA 3OJOA 4G4SP 4BXOA 3AY7A 1OXXK 2PHZA 1RRFA 3CMMA 3G3EA 4DY6A 2P69A 1U9IC 3CN9A 2JGMA 2A30A 2M1ZA 1DBRA 4GM1A 5KO2A 1VKRA 1FP4A 2Q5IA 3M6UA 4AICA 1IN8A 3ZQ4A 2V98A 4RVNA 2IS6A 1SOUA 3WK6A 3HP1A 2O1XA 2FA9A 2ZFUA 2A0WA 2XQFA 1W5EA 4Q9HA 5AK3A 1VG8A 3QVSA 4MJ7A 4WUVA 3EFHA 5AJYA 5FL7D 4DKXA 2JAOA 2V55B 4UD2A 4D8TA 3W5AA 3DDWA 2IYRA 2VDJA 2VYFA 3CLHA 1O94D 3T4UA 1MN6A 1P0CA 2UYCA 3OFKA 3OQ1A 3KWFA 3QE2A 2B99A 3AIIA 1I2DA 1IB6A 1Q7TA 5HA5A 1F14A 4O02B 5TSDA 4EJ2A 3PHBE 3TSZA 2VVTA 3LT0A 1LCIA 1SFRA 2FSHA 2GYUA 1Q92A 1ZN8A 3ICEA 5FI5A 3ZE2B 1EH5A 1P61B 3ESBA 3L05A 5EQTA 3AUXA 2IY7A 3UATA 3DF7A 2JLCA 4I4LA 1XVTA 5JAUA 5CDSA 1UKZA 5EJAA 2REOA 3R8XA 1F6DA 1OFGA 4Q1FA 3T7TA 2QG4A 3G85A 4F84A 4OCZA 4JYAB 4MYDA 1KOJA 1E3IA 1ZK1A 2NO9A 1WP4A 1ZPDA 3MS2A 3WGTA 4F6RB 4RTSA 2CYBA 4M9SA 2CV0A 3AXTA 3OTIA 4UCWA 4LJRA 4QQRA 1PJBA 1L4UA 2OYCA 4Z4GA 1ZRSA 2NLOA 1WSDA 2WVAA 2J6CA 4K6MA 4OLBA 3GY0A 5AW8A 3BT7A 1DAKA 1QYWA 1QV6A 3K9FC 5T8KA 4DUGA 4BU0A 3OTOB 3BH0A 3VU8A 5GJBA 4ZVKA 3R5FA 1XKXA 1EKXA 4NV0A 7AT1A 1D6MA 1ZXBA 2G8NA 4QSMA 1SZJG 4RK4A 2JH3A 5ICEA 2TRSB 2W42A 3LUHA 1D9XA 2ZB8A 3KG2A 1HSOA 3RYHA 1KSFX 1PR2A 1MH9A 1U04A 5I3CA 2A35A 5F76A 3OQJA 2IE0A 2H0AA 3DWGA 3TKLA 1T0JB 3T1OA 2FP3A 1KY5A 2PZBA 4UE2A 3UBMA 5JV5A 3WK7A 1XZBA 5G1PA 1UKEA 4GSLA 1RP1A 2VQSA 4FTWA 4A82A 4AS3A 3LECA 1G3UA 2CEKA 4C22A 1YJBA 2NZ8A 2ZTVA 4F4CA 1G3RA 3FVQA 4MWEA 5CURA 4YO8A 3PHHA 1YBFA 1J1UA 5T57A 2ZZNA 3UCEA 5AVZA 3H8WA 3PYXA 4ZZ0A 4XGRA 2DFPA 4OL0A 1XCGB 2XUAA 5GONF 3ZE0B 5DU2A 4KPEC 2GERA 1ETHA 1M2KA 4DLZA 4IHKA 3OZUA 1W30A 2L82A 4HNUA 3EXEB 3EGEA 2OCDA 2M6LA 2O5RA 4J16C 3FZYA 3GLHE 4BP1A 4JBWA 1E4VA 3MIIA 4MR8A 4MJLA 5EMJA 3K20A 3WGKA 2CJYA 4N39A 4W5JA 1GO2A 3HB7A 3AU9A 1OXTA 2PFSA 3PXDA 2PKRA 1B6SA 4DLSA 4ZICA 3RHTA 3AF5A 1LRKA 2J3JA 4ZHQA 2HWXA 5FPPA 1JDPA 3O4RA 1IZ7A 1Y6ZA 1DWQA 2AOVA 4MSUA 4B3SB 3TTUA 2VJKA 2G4VA 4D8UA 1M0EA 1LX6A 5EE0A 2EKLA 4TQAA 4R7ZA 3U4HA 1CLUA 2EV9A 3FN4A 4MIKA 4O29A 3PT5A 1EMDA 1YC5A 4ESHA 1G8MA 1SOMA 4PYKA 1QGYA 1U0BB 4U2DA 2W4MA 3DDHA 1RHKA 4E15A 4RETA 2ZYRA 4KKVA 1IY1A 1EFVB 1VLZA 2CXQA 1LPMA 2DMRA 4DLXA 2FFHA 1AN9A 2BR4A 2LD4A 2EBFX 3C1UA 4OMUA 2Z1MA 1DIHA 2ZE7A 1J0CA 3PIDA 5CJPA 4UKDA 5EY5B 3WGZA 2A9JA 4AIIA 1QYDA 2WPDD 3VR0A 2WTUA 3LBFA 4RKWA 3LZ6A 2VDWB 2GHIA 3ND5A 3DV0B 4OHWA 4CIVA 5K5EA 2ZCUA 5AIAA 4TUYA 3FCXA 3R23A 4GYKA 1FRNA 4B3DA 1QHNA 1CR0A 2MSWA 4BFZA 1QPZA 1U2PA 2MSKA 2WUDA 3C1OA 1PZXA 1V39A 1YKSA 5HUHA 4QBHA 1ADFA 1YL6A 3MTQA 2EWVA 2PD6A 1NVGA 4PV7A 1T25A 2KM1A 1TEXA 3NVDA 3V97A 1QH8A 2H4FA 3IDFA 1YHYA 3E8MA 1U7OA 2GK7A 3HBMA 2XR1A 4M99A 1R16A 3HZZA 3K0FA 3K16A 3NDRA 2JGAA 4GG1A 4XXHA 1LI4A 1QMGA 4AXXA 5LD2C 5DYYA 3SJBA 5H0IA 4V0QA 2BKVA 4UCXA 3ZWOA 4DC1A 4ZFNA 2JJ1D 2NNLD 4PZYA 3JRXA 4WKNA 3ZS9A 1JNXX 1TQ4A 2WUGA 2Z9CA 3LBNA 4YCCA 5KDDA 4OO3A 4EZIA 3OCYA 1KI3A 4MVJE 1QHXA 1KYZA 3VH2A 3BXXA 4MUYA 5LP6A 5BUQA 1ZK2A 3SM9A 5KQMA 4YJ2B 5DMXA 4RTJA 3OF2A 5KVCA 4XTCS 1MGOA 4Z8XA 1MAWA 1DEOA 2E37A 5E3JA 3W3AD 3W8NA 3ZQKA 3V8QA 5B57C 3B9BA 3V8RA 5C3MA 1TCCA 3PFGA 1TX4B 1PJTA 5DYGA 1C9DB 3W2EA 2OVBA 1NURA 3I34X 5HBRA 4FVTA 2X0KA 4TKUB 5AVRA 1SRQA 1TFUA 2VK4A 1GNTA 1MC1A 2BR5A 3KJFA 4FKZA 4X1KB 5D7NA 2ECFA 5U4XA 4F4DA 4DYVA 1FFGA 2PL9A 2BCGY 3H16A 2ATEA 4QGSA 4OJYA 2NU8A 1Z2CA 2X7HA 1NAHA 3DEJA 4MUHA 3LRXA 3IYLW 2WJGA 4XCQA 3UKJA 3FB4A 3H2HA 3UV7A 1E2EA 1S6YA 2C4MA 3EMKA 3VH4A 4OB6A 2VJLA 2I91A 3KOUA 1S1CA 1WJGA 3W6ZA 4JLUA 1E79A 3T7KA 2JIMA 3RYFA 1C7JA 1SC1A 5G0UA 2ZYDA 4FD2A 1W47A 2CDBA 1PJSA 1Z7EA 1K27A 2YBEA 1YF3A 3S1AA 1YK1A 3GBVA 1UJMA 3IDQA 3IR6A 2HSEA 2W43A 4OLHA 2OOKA 2VTVA 1XYVA 3W90A 3KCQA 3NIFB 1PQPA 3OAAA 4O0MA 4PHHA 5F1YA 1SKMA 5JH7F 1J97A 1S0UA 4HDRA 1UJCA 3PENA 3ZIAD 2YC2C 1AV7A 2O3JA 1H2HA 1F8FA 3F6YA 5FBQB 1OGJA 5JECA 2WWXA 1K6JA 3RTEA 3FE2A 1JF8A 3UO8B 1YI1A 5EP3A 1AURA 4QELA 3HNOA 1Z18A 2X15A 2ZIAA 2Z2XA 1HE8B 3AUAA 2A9VA 4N3BA 3N7AA 1WB5A 1LNQA 4RQTA 1KC1A 1CVLA 2HWWA 5I51A 2QT0A 4JUCA 3W4IA 2E6KA 4FYVA 2IH2A 4RTQA 3C85A 4UFPA 5LL6P 3IKTA 1NULA 2ZI3A 4HB4A 4OFWA 1KI6A 1XK7A 2GSWA 3FDZB 3G2JA 3NALA 3PUJA 1GUBA 4Z0PA 1WV0A 3G59A 2IYAA 4OQXA 4DCTA 5KQSA 2FMTA 3Q3GE 3A6HA 5J3JA 3NBMA 1TF5A 1QNFA 4W6QA 5BQPA 1JMYA 3HCBA 4Q3EA 4EKNB 5BYKA 4IDGA 4A8JB 1XTIA 2QLFA 1AQNA 3HHEA 2W2VA 4BEBA 1CE8B 2B4TO 2QTZA 1VMKA 1II0A 5DEOA 2WTEA 1NOIA 3CWCA 4Q48A 4HAIA 3O4GA 4F12A 3ZBUA 1R8QA 2GASA 2GXUA 4WNAA 1OFVA 1SB8A 1XO1A 1NNI1 3B1WA 3V1UA 1GFIA 4ZQHA 4FEYA 1SVMA 4I9GA 1KVUA 2G9UA 4NIMA 4YJFB 1W85B 1YAHA 2V7XA 4KX5A 4MYHA 3DBHA 4QUGA 5K0JA 2DP4E 3K2IA 2FSIA 2IYYA 3AUYA 3GEGA 4PS0A 4NYJR 5AHXA 4ZPXA 3AEKB 3DA8A 3GJ8A 1FJHA 4OHMA 1ISSA 1RQXA 2TMYA 3R6TA 4X1YB 2CFSA 3UBTA 4YRDA 3OT4A 3A27A 2EGUA 5TJ9A 1PGNA 3L0IB 3WNCA 2R4QA 3SCZA 1RMTA 1IU9A 3N3AC 2QVCA 3VPAA 3J81A 3Q3CA 1MXFA 1V43A 1Y4AE 3NXKA 4D9JA 2XNJA 5G0WA 3H3FA 2IH4A 4S0XA 4FFSA 4QDXA 4WN9A 3FUXA 1Q22A 1LDYA 1CUDA 1XRNA 2BOVA 4M60A 2GYVA 4XIJA 5FI0B 3E1GA 5AXCA 5JADA 5HQJA 3VH1A 5AW2A 2O14A 2HCJB 3CNHA 1ZUNA 3B1JA 4G8DA 2BFDA 2BFFA 2B2XA 3DLAA 1JDNA 1L5VA 1GSHA 1PGOA 3PLNA 2V7QD 3BFJA 4I4TB 1BDHA 1FTQA 1TC1A 3OJEA 1CZLA 2JI8A 3B20A 3UOGA 3HU3A 2ETVA 3B2NA 1C7EA 1L5HA 1NE7A 1T26A 2J07A 3RTBA 4DMFA 1LWNA 1RC8A 5A02A 3CIFA 5EZQA 4JLMA 1T1EA 1V47A 4FGKA 4AS1A 1UWCA 4GX5A 4JHLA 4NC9A 3F74A 3IKVA 2DULA 3IP8A 8OHMA 1QRSA 1OD6A 3ESZA 3S8MA 2QW8A 4BKMA 3C3CA 4QTXA 1OYVA 4UHFA 1IOZA 1N2HA 1GPKA 1U2GC 3GJ5A 4GVXA 3TM5A 1Y1SA 3V4FA 5L9AA 4NSNA 2Y0BA 3OCXA 3V8VA 1B0PA 4BFYA 4V0OA 3UJNA 2E3JA 1X7ZA 3NUQA 2IPXA 4FMCF 2HPAA 3EBLA 1WF6A 4XVHA 3STUA 3GVIA 4DB4A 4IJWA 3KO8A 2FWMX 1EAYA 3LOQA 4Z9AA 4Q3CA 4BMXA 2CFOA 3GLUA 5K8VA 2BGTA 4OMFG 3QVWA 3MWFA 3OWOA 2KHZA 3NU1A 3FPHA 3IURA 1QK5A 1HG1A 1BNCA 2R6CA 5B58T 2VSOA 1TGVA 3ETLA 4PAQA 4UBOA 3R75A 4Q4JB 5MN5A 3VVCA 4D4MA 2D4HA 1Q7CA 1T13A 2R8EA 1DHTA 1EDDA 1WMFA 1CZKA 1KEUA 1P9NA 2QRPA 4QHTA 4MGHA 4X8HA 5AVTA 2W0SA 2EDAA 5LQMA 3EXG1 3LY9A 3KSAC 4B3GA 4NV3A 3A9UA 1O8BA 4JLAA 5KC8A 1K7XB 1VLJA 2D1RA 3RR2A 1QOQB 4BQOA 2XB6A 3E22B 4D0RA 1SXJD 2FRXA 1IHXA 3IBSA 4FGWA 4JUBA 4BUCA 1FYFA 1TCBA 3D8BA 4L8WB 4M86A 3ZDZB 2K7FA 3IQFA 4DCVA 4GT1A 1U80A 4C03A 3HBNA 4JC8A 1PS9A 3ZHZA 3E8XA 3IMEA 1U6KA 4FFWA 4YI3A 4AX4A 4I8XA 1IN6A 3T1TA 3PQ7A 2JGEA 1GP2A 3CH4B 1WNFA 4PC1A 1KIFA 4B7UA 3J7TA 5B6JA 2EDCA 2OZLA 4EEXA 3VVBA 2PVSA 1AS2A 4G5OA 5CG1A 1PG0A 4L22A 4AECA 2P90A 1YDHA 1DS6A 4D5EA 1KOGA 4NX2A 2MYUA 3V9PA 4Q5IA 4ND5A 1LDMA 2CL7X 2ONKA 3K9WA 3QVGB 4LJ7A 3SC6A 4KFCA 4YUWA 4JLSA 1FVHA 2OHHA 2GKOA 4EO9A 1US8B 4D3ZA 2GNAA 1HL3A 3WTBA 1RIIA 4E08A 2NU6A 3M9LA 2BHLA 3P9YA 3DBVO 1IXSB 2C3YA 5HNKA 3AOEA 1HE4A 4J1NA 2B6NA 2GMWA 3U3ZA 3ESDA 3Q6IA 4IUCS 5FUVA 3TW6A 1FX0B 3FYCA 4L9RA 5E3HA 3MZ0A 5CVJA 2OXFA 1KP2A 3MS4A 3QUCA 4DNXA 5JVDB 2R85A 5K6RA 2HQSA 3E53A 4CL8A 1GG9A 1JR3A 4HL6A 1H6AA 4P82A 4FOPA 2OO5A 5K2OA 4YY3B 4OUDA 3FHOA 4GX2A 4RJLA 5EERA 5AXAA 1OXMA 4ZCQA 4RIEA 2O0HA 2V54A 3AM3A 4Z49A 4ZRDA 4JJGA 4KR2A 1W6RA 4HGRA 3N5KA 2BAGA 4EENA 3MSCA 5TS2A 1RTKA 3D6HA 2P91A 3BRWD 9LDBA 3IB6A 1XXHB 2YC4C 1VKNA 1Z6YA 1QKJA 2QRMA 1KBZA 1XTQA 4RQAA 2KI5A 3OPNA 3OZSA 5B37A 4AZ0B 4LK3A 4NH4A 4XQGA 1TK3A 1V45E 4UMEA 1V9SA 1QR2A 3MG9A 2PSFA 4GX1A 3BWVA 5THKA 1M1YB 3TZLA 3HLTA 3PFNA 2OL4A 3RAEC 2P4EA 3VPSA 2WVJA 3ZE6A 4KAFA 3T3PB 2V9ZA 4OKSA 3KDAA 4LQLA 3TLXA 1AUXA 3H65A 4X64B 4A0QA 2HM7A 1ACMA 5DNVA 1HMPA 1CJVC 3SEQA 3ZJUA 1E0SA 4M7OA 4GMFA 3RS8A 1PSZA 1P39A 3EUWA 2CB9A 1CEEA 4V0LA 4V0NA 1E2DA 5FBLB 1P2SA 3VKVA 1MT3A 4QASA 1DBVO 1EA5A 1XVIA 4O4IF 2EFYA 3F9IA 4GE0A 3UJ9A 2RHGB 1YB7A 1KZ1A 3K1TA 4W9NA 5AW0A 1RXWA 1I24A 1F5NA 4EX7A 2H85A 3NHWA 5M7EA 1U7UA 5TE9A 3KQMA 2GH1A 4QBGB 1GL9B 3U44B 4MUKA 2MSDB 3V7UA 3BAFA 4BKRA 1Q1AA 2VC2B 4FW8A 1RIFA 3KTFA 5JC8A 3GA0A 2UXCB 3DR5A 4FUQA 4F3TA 2ODQA 4KLNA 4KN6A 4C3VA 2X5NA 3FLBA 1SKUA 5JDIC 5K0TA 3TQSA 2P2LA 2G7ZA 2RIRA 3BSSA 2QPTA 4WZAB 2JFXA 4MDYA 2VTBB 2PLNA 4A2PA 1TB4A 3RF7A 2Z6QA 3BB1A 4NEQA 1QH9A 4DCMA 1T8YA 5ALGA 1ZH0A 3QOYA 3QLTA 2FPXA 5TQ0B 3VDNB 1XRPA 4RANA 2FR8A 4RVSA 1TZJA 3LPLA 3WK4A 1K7SN 2BONA 4XWAA 3WGVA 1CUZA 5SZKB 3GFVA 1IAQA 4BJ3A 1VJGA 3GDHA 4KO3S 2IHNA 4EMBA 1RC1A 1RYZA 2XA2A 1KEEB 3QVUA 2KLBA 3IESA 4RZIA 1RAIA 1UXGA 4IOLA 3DD1A 1JFTA 4ZDJA 1NSFA 4TN5A 1J6UA 4MVJM 4XR4A 3REQA 4BQRA 1B7GO 1Z4JA 2HFJA 2OD2A 1VJTA 3I6ZA 4RENA 3ROFA 1M9NA 3RREA 1Z7YA 1WMSA 3L5KA 4FIZA 1C0EA 2G0TA 5LR6A 3CG4A 1J49A 3IILA 2UAGA 5K8LA 1G5HA 3R24A 1FUEA 3V55A 2XZPA 1H2WA 3LF1A 5KNCD 3JD0A 2WWIA 3O4VA 4ZA2A 4BBPA 4D26A 1ZNZA 3H1FA 4L6IA 4N3CA 2WNHA 1QONA 2BMDA 2P5SA 1R74A 3BF8A 3HFGA 3LNCA 3QEKA 2F62A 2G67A 3B3AA 3OU2A 2O2DA 4O2LA 1VKJA 2R84A 3C6QA 5F52A 3JSAA 2UV8A 2IS2A 2ZUUA 1TCVA 1CF2O 3GJQA 2NYVA 4JKOA 5AOVA 3NFRA 5CA1B 2HCFA 3E2IA 1UBCA 2IYZA 2YICA 3DGEC 1EEXB 1XMSA 4OK5A 3W6OA 4EI2A 1CX9B 2Z5VA 3A3KA 4XJSA 2AFIE 1TU0A 2I33A 4ZU3A 4UM5A 4C4OA 3LV8A 2BDTA 4GOMD 3MTAA 4PX3A 2A5JA 4IAOA 2O3SA 1ILEA 3OE1A 2ZAYA 4GAEA 1TW2A 5KZMB 3QZUA 1ATZA 3UFXB 4RE5A 3DMFA 2O5VA 4CM8B 2O5EA 3B9PA 5IC4A 4PANA 1GN9A 2WG2A 2Z4RA 3O9ZA 1OVMA 1XZLA 2A8YA 4H6XA 5H82A 4YQEA 3GGDA 1XVLA 5HHTA 4N5LA 2Y68A 2XCRB 3GFTA 2FPIB 3VOAA 4CNBA 4RESA 4BKUA 3Q7IA 3X43A 4BO5A 4YUAA 5BPFA 2E0IA 1Z2AA 2QQFA 3ISTA 1SBIA 4GI7A 4IJ6A 1EK1A 4MVWA 3CTPA 3WOVA 5JSUA 2QZ9A 3GGSA 3GVHA 2J7KA 4X44A 3WYFA 4QREA 4P58A 1TM5E 3MMXA 1VJDA 2C2WA 2IEGA 2R9VA 3O8DA 4G1UC 2IYPA 3OTWA 4EPTA 1WKBA 1TZ2A 3NAMA 4GPD1 2I5PO 4AJNA 4XJXA 4JVLA 3EPRA 3PXAA 2AFRA 1ZSNA 5EXPA 4Q15A 2FFQA 4ZVMA 4D6PA 4COOA 2IHVA 3DL7A 1SHKA 1BWSA 1SVWA 3DTVD 2X13A 3IO5A 4P5PA 5CX1B 3S2EA 3TLEA 4D2IA 4AY4A 2XE7A 3MTJA 4D3YA 4LSGA 3THXA 1RQLA 2JIRA 4OGKA 2C4WA 4HLDA 3KETA 2JGDB 1W6UA 2WNSA 3AIMA 2XWJI 4PBTA 1PN3A 2H2FA 3SVLA 3TD6A 4GIBA 4AROA 4JLVA 3WP1B 1E69A 1Q3KA 3A0RB 4G24A 3M34A 4EUKA 1G8YA 3ZLJA 1RI5A 1AF7A 1SKQA 1HEYA 4EA8A 4QVKA 4G9EA 4EFMA 4AC9A 4RQBA 2BKAA 2DKNA 2P1RA 2Y0PA 5EZYA 5CK5A 5D2CA 1A7JA 1UDBA 3F8WA 4HHEA 2WIFA 3RBAA 4JI3B 4BMZA 5IANA 1QO0D 3NM5A 4R9UC 5A9RA 1P4GA 4NHOA 2R48A 1LXCA 4BC1A 2MMGA 1TKCA 2EKPA 4HAXA 4EJSB 4IPTA 3NHPA 3BL5A 1PQWA 4HPJB 3CH5A 2EYQA 3OE5A 1UINA 4PTLA 1VBMA 5EWLB 4F9FA 5KNLA 1U0JA 1E3TA 3ORRA 1QOZA 4MS1B 3ZHCA 1HGXA 2CXHA 4A2QA 4EG1A 3P2EA 3TSOA 5IX8A 4XA8A 3ROZA 3ZXYA 1Y48E 3L8CA 3URKA 1NU8A 1FYVA 1JYSA 5CPFA 2XNHA 3GLTA 2ERCA 5TT1A 1ONNA 1A9RA 1ZRMA 1XEWY 4MZDA 1U4NA 5FNVF 2G7MC 1JJFA 3QXCA 1KRXA 4YLYA 3ISJA 4BNTA 1RHRA 2KPOA 1L7QA 3DC2A 1NE2A 3A6ZA 1DVRA 3P4UA 1AQIA 4I50F 5INTA 3OLCX 3FI0A 2A5DA 4TMXA 2LW7A 1SBNE 1QZZA 3HYCA 2P65A 3KFVA 4MLZA 2AWNA 5CRIA 1H2XA 3PTZA 4MRMA 5JYDA 3KQNA 2AI1A 1SU6A 2R97A 3K0HA 1OSNA 3TSYA 4EECA 4TZKA 3QU2A 3LTNC 1DRKA 3SC2B 3RADC 5IVHA 2NZYA 2UDPA 4UNPA 1IUKA 1O57A 1P2TA 3CUYA 1YZNA 1ZKMA 3UQYS 4KQXA 3ELBA 5BORA 2GJAA 2GAJA 2C3MA 3NNNA 4V03A 1J9ZA 2X3YA 2ZBQA 4MWDA 4PF1A 4PYIA 3UWKA 2IPMA 2ZPUA 1V7CA 2Q62A 3BGWA 4Q66C 3IHWA 3DZFA 5J59A 3ZXSA 1I1QB 2IYXA 1FUYB 4H35A 4II3A 2PEZA 2BGRA 1DEKA 1LQTA 3P0FA 4FR5A 5ALNA 1A69A 4JQYA 4NAHA 3HUUA 5GINE 5DHTA 2XUZA 5AH0A 1MX9A 3B6KA 4BCDA 6ADHA 1SG9A 3OJ0A 1G55A 3L4EA 4OHFA 4MWZA 2G28A 1AHHA 1P17A 2C3UA 3C6MA 1W36B 3T9CA 3MCWA 3DAFA 3V1TC 5IBPA 1MKYA 1SVNA 5F78A 4U2BA 3WVNA 1W88A 3BRCA 1JAXA 1KI2A 1YBMA 3KEGA 4XSHA 2FN9A 1EI9A 1PJ3A 1I4DD 5JCJD 3W8DA 1USIA 3Q6NA 2WA2A 2C2GA 2CE2X 5E9JA 4PPYA 4H7JA 5ICMA 1A72A 2V5UA 4AF6A 5DNYB 5CYFA 1UBNA 2VP3A 5U4QA 3TUIC 3U6BA 4V24A 4POAA 1O96A 2VDUE 4U9IS 1NLFA 4TTPA 2GLXA 2G6BA 2XE4A 5KTSA 3S7ZA 1Y3CE 2EKBA 4LBYA 4GI1A 3H5IA 2QYSA 1JIVA 4TLMB 1QKKA 3Q41A 2J1LA 3R3XA 4CE6A 1PFVA 2Z04A 4BRZA 2I8CA 1A4IA 1ILWA 4WXMA 5LQUA 4JI4B 3DZIA 3INNA 3FNHA 1WCWA 2E89A 2H4WA 3KPJA 4JMPA 2BZ1A 3SQNA 1KSHA 1QC5B 2I6GA 4LTNA 5DMHA 4EG7A 4TTQA 3TRIA 3QEBZ 5KTMA 1N1DA 1HYEA 2JLVA 1WNTA 2V74B 4EY5A 3DO8A 4YMWA 3UMFA 3BDAA 1EP1B 2IXAA 1L7RA 1WA5A 1QP0A 2EGGA 3D5EA 1BCRB 2PCLA 4MRPA 1T4CA 2WZDA 1H1DA 1ZIYA 4KDEA 1PZHA 2W90A 3IUPA 1VMDA 5EMKA 5FBRB 4IV0A 5LYJF 1EESA 2ZTUA 3K1ZA 3QPCA 4MHSA 3QOWA 3QUSA 4ZAVA 3NOVA 3UAOA 2FG6C 4Z54A 1T9GS 2Y2VA 3EDMA 4JITA 3BE4A 3EEBA 4GRIA 1SU4A 1J22A 2XDAA 121PA 1AGRA 1P7WA 2PV0A 1OOEA 3OQHA 4RZ3A 5CH3A 3MGBA 3C70A 3P9XA 1J33A 1I2BA 1YRYE 3FPKA 2GCGA 4J1TA 4KXMA 4EY3A 2HRBA 1ULSA 1DUIA 5JXHA 4QLAA 5BQ5A 3DT9A 4WBSA 5EJ7A 3IMFA 2GTPA 4E14A 3BMCB 5NLLA 2LKCA 3HHPA 3FF1A 1WOYA 3IBYA 3K1YA 2D1QA 1NVTA 4ZJYA 5GGYA 1SQSA 3O1IC 2BKLA 3UB2A 2C98A 2BV3A 2OKGA 3VDXA 4GF5A 5LBUA 3G9XA 4FMPA 4LMAA 4V1CA 4P0PB 1CDEA 3UUWA 4YCJA 4NCJA 1AD2A 4PZAA 1J1IA 4UEJA 5KHAA 2Y1EA 3AUJB 5SY9A 5I7FA 1JKMA 4CR6A 3IJPA 3NYQA 2RGYA 1Y7IA 3HU5A 4LXHA 1VIYA 1Q12A 2H2HA 2QX4A 2XGSA 3GJRA 4M8KA 3RRYA 4E5VA 4C0LA 1JA1A 4UUNA 4ESOA 1ZNQO 2QQ0A 3EVFA 3SR4A 2C0PA 3CEJA 1GPAA 2YJNA 1VLMA 1GZ6A 5H70A 4FX2A 3T5CA 3H9EO 4JUAA 4TMFA 3LG2A 3KLBA 3KVRA 4AJJA 4BNYA 4II7A 3GLSA 1M34A 1VZ3A 1U0RA 2C99A 3PZRA 4TZTA 5B6PA 1MHTA 3WLMA 1RVV1 3CZ5A 3ICCA 1D2HA 5B64A 4IGEA 2ZXUA 4NCBA 3TL2A 2BL4A 2RJOA 4ARIA 1SBTA 2MT9A 4V1CI 4L74A 4QDKA 3WY9A 3W4KA 4MYUA 3K3PA 2NT4A 3K9NA 4LOJA 1R1DA 2JVKA 1NKTA 2P3QA 1IQ0A 1FFEA 1LBQA 2XH8A 3D6UA 3AHJA 1DEAA 4WLEA 4B3JA 2WD8A 3FTEA 2Q8PA 4WA8A 4DCSA 1L6RA 3FG9A 3RODA 1NQWA 4DIMA 1HURA 3H9GA 3U81A 4MIYA 4X7PA 1ZJ4A 4J0HA 2VT3A 3N86