1R3UA

Crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
b'PSPMEDIEEILITEEQLKAKVKELGEMITRDYEGKDLVLIGVLKGAIMFMSGLSRAIDLPLSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Crystal Structure of Hypoxanthine-Guanine Phosphoribosyltransferase from Thermoanaerobacter tengcongensis
rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Transferase
total genus 53
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r3uA00
1LH0A 3OHPA 4RABA 4S2UA 1QK3A 1I0IA 4P86A 5IPFA 4M0PA 4P84A 1OPRA 5ESXA 5BSKA 1AO0A 2FXVA 4TWBA 1P4AA 2XBUA 5IAOA 3MBIA 1VSTA 2IGBA 2H07A 2YZKA 4Z1OA 3OZFA 4IJQA 1J7JA 1QB7A 1VDMA 1XZ8A 1U9YA 3H83A 1IBSA 1DBRA 3QW4B 1O5OA 4RV4A 1G2QA 3EFHA 1ZN9A 4OHCA 3GGJA 4WMLA 2C4KA 3S5JA 2JKZA 5HIAA 1L1QA 1STOA 2VFAA 4RANA 1GRVA 3M3HA 3OZGA 1BD3A 4LYYA 5HKLA 3ACDA 1A98A 2JBHA 4RAQA 4JITA 3DAHA 2AEEA 4RHUA 1I5EA 5EUCA 4RHXA 1QCDA 4RADA 4RHYA 1MZVA 1U9ZA 2PRZA 4RACA 1UPFA 1OROA 5BQOA 1DKRA 4X45A 1NULA 1ECBA 2EHJA 2JKYA 2GEBA 1V9SA 1A96A 1P17A 1TC1A 1VCHA 1XZNA 1BZYA 1ZN8A 2P1ZA 2PRYA 3HVUA 4RHTA 1DQNA 1O57A 4P3KA 5JSQA 1G9SA 1Z7GA 1TC2A 1HMPA 1P19A 1XTVA 5E38A 3NAGA 4LZNA 1HGXA 4X44A 3LPNA 4WN3A 1A95A 5KAPA 4MB6A 3DMPA 1JLSA 1A4XA 2E55A 1UFRA 1WD5A 3ACBA 1JLRA 2WNSA 1ECGA 1BD4A 3O7MA 1ECFA 4P82A 1OREA 1QB8A 3GEPA 1P18A 3G6WA 4QYIB 2H08A 5ESWA 1DKUA 3KB8A 5KAMA 4F8EA 4PAWA 3N2LA 4ZFNA 1XTUA 1I14A 4RAOA 4LZOA 1ECCA 3MJDA 5BRNA 1Y0BA 1DQPA 4LYGA 1G9TA 1L1RA 5JV5A 1A3CA 1CJBA 4LZAA 4P80A 1I13A 2HCRA 4M0UA 1ZN7A 3DEZA 2H06A 1UPUA 4P81A 1D6NA 1GPH1 4FYMA 1YFZA 1R3UA 2DY0A 4RQAA 5K51A 1I0LA 3GGCA 1QK4A 1XTTA 4PFQA 4QRIA 1NONA 2PS1A 3LRTA 4P83A 5BQPA 4KN6A 1ECJA 1PZMA 1QCCA 3ACCA 4JLSA 1W30A 4RQBA 1G2PA 2JI4A 4QYIA 4M0KA 1A97A 1QK5A 1FSGA
chains in the Genus database with same CATH superfamily
2AFHE 2CXPA 1G4AE 5H4HA 1GYQA 1WDMA 2Y4OA 3FPFA 1RXIA 4E13A 4JBHA 3ROGA 1RHKA 4OMFG 5CA0A 4D3FA 1EBUA 4GW3A 8ATCA 1Y37A 2I7TA 2OXTA 3ZOKA 2J7PD 4O4IB 5GQSA 1VE1A 2SCUA 2ZZMA 4BVGA 5J47A 4BO3A 2CLDX 2JFNA 1HDEA 1DAKA 3EMVA 1X8JA 3PPXA 4Q5IA 1HSOA 2PH3A 2XUIA 3KZNA 3Q88A 1HE1C 4I5DA 3T4EA 3IRUA 3PDIA 3TFQA 5KQRA 1UM9A 1R0WA 1U7TA 4LCJA 5KYUB 3P4UA 1ZSVA 2W6JD 5GPBA 2DR3A 1VBKA 2YBEA 3ROXA 1PX0A 4N39A 4EHHA 1ZN9A 1HTBA 5F33A 1IG3A 2FCAA 1XN4A 5BURA 3HBFA 4ZO9A 1X80A 1N2XA 2F64A 3OM0A 1FVHA 3OCWA 3ABZA 3R9KA 4JBGA 2PWAA 5AOBA 2F1JA 1ZD5A 5E3JA 5J4VA 4F91B 2J3MA 4ER0A 1OI3A 4UHEA 4CHGA 1KGSA 1FFBA 1SVSA 3MWEA 1XRQA 4I2VA 4MW5A 4IL5A 3G2OA 3JWGA 3T5MA 4YJHA 4FJ0A 4W7SA 3VISA 3ZE0B 4BNDA 1KVQA 2HU5A 5JXHA 2Q62A 4C21A 4E5KA 5LB4A 2WIKA 3OECA 4E5YA 5F76A 5KYKA 4PC2A 3NASA 4JCOA 4U0KA 3OIYA 1C50A 3R7WB 2NACA 1M1YA 5JSQA 5C5DA 2ICAA 2ZAMA 4CWAA 4CM6A 3GK3A 3C6XA 1DUIA 3PZRA 2WWRA 4L9SA 1QX3A 2XYGA 4UMEA 3PPWA 4C5CA 1F8UA 4ZOEA 3MCUA 3UENA 4I5FA 2JGAA 3I8XA 1TJPB 2HUPA 2VPZA 3CEJA 3HNPA 3RTGA 3SMQA 2CLFB 4IICA 5JS8A 4DR2B 1TU3A 4XUEA 1P60A 1EFVB 3H2ZA 1P2SA 3KE8A 4X3PA 3WGHA 4EA7A 1K75A 1Q6ZA 1ANKA 4IVPA 1MZPA 1MC8A 5K3EA 3QWFA 4OA8A 1U1GA 4U9HS 5AOCA 3M33A 1E2KA 1ND6A 3B1JA 1YNSA 3LCMA 4ZVRA 1CWUA 1WE2A 2H08A 2MTBA 5E2BA 1FMLA 3AW9A 5G0TA 4EG5A 1EVEA 2BHSA 2JAOA 3HGMA 5FDFA 2HBYA 5JO0A 3HKBB 1LDYA 2C0PA 4RY2A 3WGQA 4BBJA 3F46A 5I7RA 5JCOC 1RZRD 4LEIA 1BCRB 1JQ3A 1N2HA 3CUKA 3ED1A 5BN4B 2PV0A 5A9TA 5L8VA 4D0NA 2BFEB 1X3LA 2GA8A 2WD7A 3O6VA 1VMEA 1YASA 2R1ZA 5EI5A 3RKRA 1NIJA 4TKLA 1GPNA 2LD4A 1XTIA 2JLCA 2ZR9A 3K9WA 2ERXA 4MVXA 3DVAA 1NUHA 3I5AA 3MWKA 2WU1A 4UJ3A 4BC0A 2IPXA 4EFLA 4CUKA 2G5GX 5F9FA 2QYHA 5JG7A 3GCXA 4IIUA 1G5PA 3FPJA 1L5SA 5FJJA 2BGGA 4R1QA 2AB0A 4NZOA 3UEOA 3QEJA 2WAYA 2NXNA 1DAOA 3WY9A 3QPDA 1ECJA 3K5WA 1EK2A 1VI2A 3R3SA 1OBVA 2J9FA 4MEAA 5C5IA 1KORA 4DQXA 3E3OA 5L7TA 1YDGA 2KS6A 3DFZA 1WCXA 1QHYA 4HADA 4F0JA 3MWDB 3AL2A 2OMKA 1I7SB 3AKDA 4INAA 3HM9A 4MPJA 4LYJA 3AOEA 1O4VA 2QMYA 3G8CA 1EX9A 5E6SB 2QMHA 1AO0A 3P9RA 1Z8NA 3LYAA 5T3YA 1JEOA 1JTFA 4B6RA 3KPUA 3UAXA 1C9DB 2IOFA 1JEJA 2B9EA 2R7KA 4XRRA 5B5SA 4NULA 1UBCA 3OZFA 1WOMA 4UE6A 2YVAA 4QM7A 1QRSA 4RF4A 4M54A 4V0ME 2DXIA 3D1VA 2FDRA 1FLDA 4L08A 2E3JA 3JVEA 2ZLBA 4J0JA 4QICA 4IIJB 2I29A 1I6LA 1SKUA 2BBWA 3TTYA 2QTAA 4YQEA 1MXHA 2HA0A 5DOVA 3EXFB 4ZMSA 2R5NA 10MHA 2NXWA 2RC5A 5IKEA 3Q7PA 1NN1A 3HU3A 4FINA 1ZCAA 1P5JA 1V16A 4LYFA 4MKZA 4OU4A 1Z36A 5IF9A 1G5FA 4H1UA 1VXRA 5KSPA 3V2HA 1TYBE 1Z4IA 1P7YA 3AUSA 2IYSA 3T1VA 4AKIA 1WLYA 3D59A 1ZUWA 1YU6A 5TJ9A 3LT1A 2BEWB 2XRYA 4FLMA 2IEIA 1YV9A 4DEYA 2PQ6A 2ZJ3A 4DMGA 2HWWA 4Q7JB 1JEYB 2Y92A 2PV7A 4RCZA 1VM6A 1YBMA 1II8B 5BOSB 2V8OA 2GZAA 5A7HA 3HMQA 1T91A 2HIMA 1Z88A 1ZKMA 1EJBA 2R751 2C5GA 1AGXA 3R40A 3ETNA 4HEJA 4B6PA 3KJZA 4PE5B 1F0PA 3ESYA 2CNOA 4F21A 2OYCA 2HU8A 3D0OA 1TAUA 4BKRA 3ROKA 4ASUD 2CGEA 1DPFA 2Q7OE 4AF6A 3U4QB 2FFHA 2Z5FA 3GT3A 1JWLA 1U8ZA 4JBXA 4KPUA 4R1MA 1HSZA 1AF4A 4D8TA 1WF6A 3T7AA 1U6IA 1GGJA 1W25A 2CK3A 3D6TB 5FUVA 5C4GB 1C7ZA 4K9OA 5J2UA 1E3DA 4FK8A 4LJLA 3ZZMA 4V1CI 4CDNA 3GW8A 4XCQA 1XCJA 3GT7A 2VSNA 4FMPA 4HV4A 5CD9A 2AN9A 1ISGA 1YZYA 2KBFA 3CH6A 3PQCA 2XXAB 4QYIB 1DKUA 3WJ7A 2X42A 5EZ6B 4OLHA 1N6RA 4BKQA 1LLQA 1Z5PA 3AXSA 1XTBA 3BFVA 3S2SA 3O2SB 3W2EA 4PU0A 5IUKC 3WBKA 2ZE7A 3OWXA 3DO5A 4N5LA 2DQ4A 1KAHA 5JV5A 3K5HA 1T8YA 1DCFA 4EB6B 3L6BA 4YIHA 2C8LA 5ENVA 1K7FB 1I8TA 1YS7A 2Z83A 4KFSA 5CHEA 1FSFA 4O4LF 5E7IA 1AO3A 1RAEA 3AR2A 2JCBA 2LBPA 2VHVA 4TTQA 3CISA 4JLUA 2WIDA 4R81A 4RF5A 1TTQB 3RYCA 1E1NA 4C3ZA 3NWOA 1THMA 1YVUA 4G0ZA 1JXMA 5ESDA 2J5BA 4DL9A 1G1MA 4WN9B 4GM4A 3FOZA 1EBBA 1XKXA 2N3ZA 2YCLA 3K32A 3M5WA 5CCBA 3H9QA 5CDFA 4AG3A 1RCFA 3TLZA 2KM1A 2BONA 4GI5A 5DX1A 3CJQA 4PX3A 3PXEA 3BEDA 3URMA 1M6EX 1QV7A 4L95C 1G21E 2A9OA 3CPSA 4WV3A 1QK5A 1ZS9A 2W2KA 1QFJA 5LB2A 5KNBH 4PX2A 2PO5A 4XI9A 1WIWA 2YV5A 4Q4AA 3SHVA 2QVCA 2A1TS 1MLDA 1YRHA 1Q6YA 4C3VA 2ZRAA 4ETWA 3VHQA 1MX9A 1OV6A 3K20A 4PSUA 2IH2A 1UCFA 2B2XA 3VPDA 1Q1EA 3PX3A 4M8NE 1PL8A 1ZRNA 4P3NA 4AQ7A 1XVVA 3QW2A 2EU8A 4RS4A 3Q1LA 5CLFA 3RV4A 2NT3A 5AM4A 5ARDA 2O8NA 1YTLA 4H3SA 3TQIA 4LF4B 1FFSA 1E2BA 1S4MA 2FZ4A 2VNHA 4G1VA 3BIXA 3TR0A 2IXTA 4D8VA 4X20A 1EWRA 1FNCA 4ZT2A 1RQGA 2NU8B 3VZSA 2W6MA 1IONA 3KOWA 4OUDB 3CZQA 1FYXA 2CUNA 2N42A 2H5IA 2I1LA 3ZWNA 4M7PA 2H18A 3DP7A 3G2PA 2CMHA 3H6HA 1DARA 2WG0A 5JD3A 5KTSA 3IEMA 2JZNA 3D8TA 3BB1A 4RFLA 3FMPB 1SUBA 5ES4B 1FMFA 221PA 2VF4X 4A7PA 3E23A 4B6JA 1FJ2A 4YPOA 4BVLA 4PWYA 1A8IA 1QG0A 2X77A 4F86A 1VKOA 2JFPA 1M1ZA 2VBCA 1GAEO 3CEHA 3GLTA 4UEOA 1TEVA 1LBSA 2EZ8A 3QYJA 5JNVA 3C87A 5DHRA 4N8SA 3I3SR 3SLKA 3H84A 3SE7A 1G8JA 3EVCA 4KQCA 1TEHA 1KFJB 4TN1A 2PD4A 4YT5A 3I92A 3BXHA 2NTVA 3WGOA 1P6QA 3PT5A 4B8WA 2KHZA 2DZDA 3MUNA 4JJGA 4RUKA 4P36A 1G8AA 4ZYXA 3EN0A 1E94E 1U7OA 3LRXA 3TW8A 4XYMA 3T9DA 4FZJA 1FMCA 3H9EO 3PIRA 1QYCA 2LNDA 1KARA 1CY6A 1NXVA 3R3WA 4BLVA 5JH7A 2JJ2A 3FTEA 4N7MA 5IHXA 1AKQA 1PTKA 5J59A 3UWOA 1UAYA 2CJPA 5BNWA 3W2GA 3LUGA 4E7OA 4H7KA 2H92A 3EBPA 4G86A 4Z9AA 2RI6A 4C06A 2ODWA 2L69A 5FBWB 4I08A 2DPHA 1HLPA 2J33A 3I32A 4PX5A 5IJ9A 4GKAA 4QRDA 2F90A 2OV4A 4YBZA 3G82C 3CVXA 2BTQA 1L5ZA 2C9ZA 5FPPA 4HWGA 1T25A 4TV9A 1B8VA 4F9GA 5LU8A 1ESMA 1T8TA 4FFBB 4CNBA 3UICA 2PJRA 1C0PA 1DT5A 3TAXA 4V0QA 1RC1A 4DV1B 1GG2A 3A06A 3DFMA 3NHJA 1A5TA 4U7TB 2VQEB 2DGDA 3RYFA 3A58B 5IDQA 1P2BA 4GZ6A 5JQGA 1LTKA 4HDRB 4ID9A 3KJQA 2XY4A 2YMQA 4FX2A 1AN9A 1HFEL 1NW7A 1U81A 3N6XA 4QBKA 3USZA 2JZOA 4TTJA 2RGEA 2PNFA 3HADA 5JSZA 4HLQB 4AYTA 1DG3A 1NXXA 3GA5A 3EYWA 4CLXA 5JAIA 2QQ5A 3G3EA 5KX5F 4G0VA 1FU7A 2HA3A 2QTVA 4YRDA 4UJ5A 3LPDA 1V4VA 3L0CA 4BJ1A 1E2EA 1P7WA 5DNDA 1SKAA 4KBGA 2IYAA 1NDQA 4R0MA 5JJCA 4FBGA 2ZWOA 4Q4DA 5KVQA 1R50A 1U2GA 2QX6A 3L7NA 2G1AA 1N2EA 4FD3A 3CN7A 4Q9KA 3UMGA 4A26A 3P27A 1XA4A 4XAQA 3K8YA 2HI0A 3GLGA 1RWPA 4Y9UA 4PLWA 4RVCA 2DWUA 1GUYA 1US8A 3DHWC 2PXAA 2H3EA 2WU0A 1IN1A 3M9WA 2HQ1A 3WOVA 4DGQA 3C24A 1ZVVA 1I9CA 3WSVA 3DXZA 1JIQA 3CXRA 3OCXA 1P9LA 4M1OA 3OLCX 4XUGB 3PQ3A 3ZWMA 4C29A 1JDSA 2W2MA 3RBXA 2NO6A 4ZO7A 3WHKA 3V9PA 3G2LA 4O29A 4XARA 1NQUA 1KS9A 2X2PA 5MF6A 4RHUA 1C3VA 2IKQA 3RFXA 3PHIA 2NP6A 5LMZA 4TN5A 2R8RA 3VUEA 4RTOA 4I4TF 1RHJA 1X9IA 2VDWA 4CIYA 3JVUA 3K0FA 4GXNA 2PUFA 2ZJ7A 2A9PA 1QH0A 2AC7A 4PBRA 4RVSA 5HEKA 1NGSA 3RQIA 2G1KA 1J8VA 5EFOA 4HQFA 3HO8A 3BB3A 4LK3A 5L53A 1Q14A 2G9RA 4HPJB 4DUYB 1BHSA 1IJKA 3EVDA 3KVOA 1JR3D 2A3RA 1SQ0A 4FI3F 2F8MA 4LJSA 3VTKA 3HNOA 3GO4A 2GM5A 3O4FA 2WJWA 5ALWA 5CEEA 5L7WA 4WNAA 1Z29A 3ONFA 1WP4A 2HIHA 3KSMA 2PUVA 1HMPA 1VC2A 3PR1A 4RA6A 4M38A 2PSJA 1Z34A 4QPPA 4K03A 5DT9A 4ARCA 3SF0A 3LQ2A 4GICA 3WMWA 5EJMA 1BJTA 5K4GA 3IA7A 2X14A 4AXBA 2B8EA 4A03A 3O4RA 4BV9A 1CEXA 2A92A 3V8VA 1CDZA 3FDXA 5CNJA 2QP4A 4TWRA 4D96A 3N7UA 4RKQA 3H9JA 2XV1A 3DOUA 2HL6A 3HDTA 4XLTA 4JI8B 2UUOA 4CLDA 2ZJYA 2JIPA 3F8TA 4B2LA 2PKQO 1F20A 3C6BA 1BMDA 2OXEA 4HNRA 3GXBA 4WUVA 1IIBA 2PWPA 4GFDA 5B7PA 2JHGA 1J21A 2JGDA 2OUIA 5AI9A 1JDVA 1L9XA 1L4GA 3CX3A 3JQQA 2XHZA 4GGPA 2QP3A 3EGDB 3O47A 3T1TA 3LCCA 3WFZA 3CNNA 4DIDA 4MDYA 2NUPB 1MAAA 4F5ZA 3IP6A 5B3AA 4B8YA 1ZH6A 1K8XB 2H4XA 1T8RA 2VXBA 3OOSA 2D0IA 2GN1A 5E8JA 5JATA 2DCUA 3KV3O 2RKBA 4E4RA 1UBEA 1C9JA 2ZRHA 3COZA 1O8CA 2O3TA 1ES9A 2Q2VA 3GI1A 3KEGA 3MIIA 5DJ5A 1YK0A 3REOA 5E8RA 4MS4A 1QIKA 4UUNA 3EDCA 3HDQA 4P4TA 1BA2A 1T4BA 4QPNA 2QK4A 4UM7A 3BUSA 3GAMA 4BKUA 1WS6A 3T3DA 1H23A 2QE7A 1FNDA 3NIFB 1FS4A 1IBRA 2PEYA 1H2WA 2R8YA 3MLBA 3OZBA 1T1GA 4Y6OA 4YRPA 4BFSA 4E2XA 4EY5A 5J2TB 2H9IA 5HCNA 4C7XA 5T5QA 1K68A 1ORWA 3BE4A 3DEFA 2W6ZA 3N07A 4J0CA 2XMSA 1V8BA 2YJNA 1NLMA 4P5DA 2OAP1 4BQIA 3SYMA 5JPDA 4I8IA 1ZIPA 2QRZA 2X9QA 3ERCA 2PT9A 4AXXA 2YN0A 4KE7A 3BHJA 5GZ3A 2P67A 1U8UA 1MIHA 2J7PA 3SPXA 1PV2A 3B1FA 3LUDA 3H5AA 3I9MA 4R1LA 5KYYA 2I3ZA 4W9NA 3IP1A 3W5DA 3PEWA 4B4KA 3HXKA 1S9HA 1GQFA 4F4FA 2IL1A 2ZIFA 3TOCA 4N3BA 3WR5A 2NSDA 3ZBPA 2W6JA 4NARA 1W6UA 4EW1A 4MPRA 3UGJA 2ZREA 2ZVJA 4JUFA 1V6SA 4XYEA 4C7OB 2DWQA 2KW5A 5CBPA 2WJ3A 5C8VA 1SU7A 1Q5PA 1V11B 3SZLA 5I4IA 1PJAA 1UPFA 2PX6A 3P71T 1KFBB 1GN8A 3R4VA 1Y5NA 4OQLA 5SYMA 5I3CA 2CVHA 3OAAD 1XLUA 1CP2A 1Y1PA 4QG7A 4DT1B 4F12A 3TLJA 4LNUA 4FDLA 3SC2B 1GAQA 5KQSA 1X0VA 2FMIA 2WP8J 1V5FA 5KHAA 2NM0A 4ENQA 1ICIA 4NABA 4BB9A 4RSGA 3ZOZA 2N75A 1X3SA 4UDXX 1XTVA 3NHLA 1XRRA 2XB8A 1E9VA 3G2IA 4NYMR 3ZY3A 4BMXA 3NVMB 3U2QA 4NS4A 2G88A 1NP7A 1OAOC 1WOYA 2JFQA 4DDTA 2DHQA 1O95C 3E9MA 4PPNA 2DB3A 3EGVA 4IIJF 1UFRA 4KIFA 2WG2A 1CUAA 1VXOA 4MGIR 2H5JA 2WSLA 1GQQA 1O6ZA 3OPYB 4HVTA 2VRNA 1XOIA 1NUPA 5DNVA 5LM3A 1Z33A 2R8BA 1Y8RB 2FZCA 1JI0A 1KIMA 3P2IA 2I4LA 2G8LA 2ZSIA 1KBQA 1IY0A 2QUIA 2W00A 3CNQS 1R4MB 3AXTA 4I14A 2BHLA 2QL6A 4UHDA 4DQ0A 1LJUA 3M2TA 4A27A 4MKFA 2FWNA 4GBJA 3R8CA 1CJBA 2XZLA 4TZ6A 3ZHUA 3COPA 4ALKA 1R3DA 5E7MA 1C1DB 4Q1VA 1H4TA 4P81A 2PH5A 4EYOA 2OQ2A 3OOHA 2IH5A 5BV7A 4C5AA 3E15A 4CEHA 2Q1XA 2OC4A 1PEKE 2BFMA 3RODA 4JLBA 3QUCA 3NTUA 4MAFA 3M4JA 4CR8A 1RZRA 3OY7A 4IFTA 3DBHA 3QKTA 4FCVA 1Z5GA 1JKJB 2RBGA 1PR3A 2NGRA 2ZVPX 3O8DA 3UB2A 1T9HA 2FVXA 5AJYA 4I5IA 2YOHA 4GEGA 1PR6A 4HQLA 3U4CA 1ZCJA 2WHRA 3D4LA 2QG6A 4ZJUA 1QGOA 1EHCA 3Q3JB 1OGYA 2ZRNA 4QWMA 3EZ9A 2OD7A 4NENA 4JP5A 2P9YA 4RABA 3ER9A 4BP1A 1DIGA 1PVOA 1H4SA 4JIMA 1WB5A 2FZLA 1Z16A 1J09A 4ENVA 5LOVB 4ALJA 2ZB2A 4MLPA 2J3HA 1RPTA 2ZSKA 2EQBA 3ZWXA 1VHJA 3IP7A 4B87A 4B3JA 1J24A 1WWKA 3CIFA 4MZXA 3F2VA 4C4YA 3TLYA 1CF4A 4FOPA 1FP4A 3SC6A 1BS9A 1J7JA 1FMJA 2QORA 4Z0NA 3A9CA 4F3YA 4IMRA 5DB4A 2F3SA 5HJ2A 1FIUA 1XJCA 2NADA 4NK5A 3CCCA 5P21A 1KYZA 1BVYF 1M75A 1VJRA 2EF0A 3HB0A 3EYAA 4RFVA 1SBZA 2G9ZA 4BP3A 3I8OA 5HOEA 1BXGB 3OZGA 4YV7A 3FNFA 1EA5A 2W6PA 4PIMA 2XCTB 2HCBA 5DLYA 1GRCA 5EZQA 1M8JA 3E3NA 4WD3A 4ZQHA 2XTNA 3HG7A 1Y5MA 3PEEA 1KC1A 3QMPA 5HZHA 4PM4A 1XJ5A 4ZC1A 2H9AA 2REXB 4MQEB 5LXTF 1Q12A 2WMDA 1PNQA 1ZN2A 3U7QA 1XDUA 4A5OA 1DAEA 3FXAA 5FFNA 3WB2A 1IEXA 3TQRA 3OUTA 3IV6A 2BI4A 3EUEA 3IOCA 4R1PA 4Y6PA 1HKUA 3LBFA 1ZIYA 3UG6A 3ECAA 4DLAA 3OQ6A 4N7JA 1FDVA 2GEBA 4YJ3A 4KTVE 4Z3OA 3PU6A 2VHUA 1E5QA 1VJDA 1C7JA 1Y3BE 2NTNA 1C29B 5SY9A 4CIBA 1O57A 5JLJA 1SVOA 1UJNA 2WRZA 4EPYA 2F1IA 4QEKA 2WZBA 4TT8A 1Z73A 5B3JA 1KQFA 3ISVA 4MR7B 4X6UA 3TSZA 1P8AA 3NBYC 2G72A 4I3GA 1JKXA 1WHSB 3FUVA 1P5FA 3Q7IA 4DLKA 4DSUA 2GF2A 4JEMA 1JLLA 3ZHCA 4MHTA 4ASUA 2BJWA 2ZDGA 3DMRA 5EJFA 1EWQA 4X92A 3GJ8A 3N2LA 3ND8A 2B78A 3HKEB 2ZQ5A 4HDKB 1I3NA 4I1SA 2AFVA 3ZW7A 3ZWOA 4LZOA 5A6VA 4Y6QA 3OFJA 1GL6A 5ADWA 1PW7A 3JQ9A 1BYIA 1YS9A 1W19A 2FN4A 2B8WA 3CF4A 3MF4A 4X84A 3S2GA 1XAGA 3NIGB 3SU8A 2VBGA 4S1OA 1EUCA 1A7AA 1P7ZA 3STWA 5FV4A 4IMJB 4II7A 3TQSA 2ISCA 2C54A 3GLIA 3P5SA 4RY8A 1OFVA 2ZXEA 4ZZ0A 3V4ZA 4H7PA 2CHEA 2H59A 1ZVMA 5DLEA 2PGAA 4RF2A 2AUMA 3R7AA 1WCIB 3SS9X 1CIVA 2OAGA 4QTXA 3FSGD 2Q0XA 2AXQA 3HBJA 1JE0A 3OLXA 5CT8A 4IMIB 3ZV4A 2APJA 1BS2A 1M54A 2AC2A 2RGNA 3D7LA 1O6GA 1V35A 4PC1A 3ETEA 1QH9A 5FWNA 4DZTA 4DSOA 1EBFA 3FMIA 4IVRA 1KPIA 5C7LO 3H9BA 1K6IA 2HD4A 1YMVA 4K05A 1NDUA 1RHQA 5CA0B 4CLEA 3EDQA 1NP3A 4RVFA 4Z9BA 4P86A 4RESA 3NHBA 3KL4A 1S2GA 3L3BA 4K9DA 1JG2A 2GFHA 1E89A 3Q3HA 3O26A 4GECA 1JALA 4X00A 3WWCA 4BOYA 1CBUA 1P2UA 1SQ5A 3QXJA 3K4PA 4UHHA 1TQ2A 1EFPA 3PDIB 1GUFA 1UM9B 1JPUA 4L75A 3DKPA 4BKOA 4M1WA 1KO8A 1TKAA 3ZH2A 1KO5A 3X2FA 4WK6A 3A1UA 1X42A 4MS3A 3A31A 4Q1CA 4IPTA 4PZCA 3ITDA 4ROTA 5EZ5A 1VZ2A 1I5OA 4N6GA 2QLLA 4K6OA 3IULA 5DVZA 5CITA 2D6FA 1AUVA 1X80B 4FYXA 3FIJA 3KSRA 3GZJA 5EJ9A 3EGOA 5KS2A 3ADCA 3V8RA 3HVHA 4ZKEA 3HB9A 1L6IA 5KCMA 4FUQA 3REQA 1H0SA 2HK7A 1F14A 3MWEB 2J3DA 1RLJA 1OIXA 3H1TA 1KH1A 1SBTA 3LSTA 4M76B 4YJHB 2E4UA 3IPCA 3RVRA 3V8EA 4BNDB 5A04A 2QX7A 1CB0A 1CQXA 1SQGA 2J9YB 2PBFA 4O4JF 3SHTA 3RSHA 1TU4A 1EWKA 1XQ6A 1NHWA 3WDMA 1R9JA 1OXUA 3HVJA 3I42A 3IBTA 1S2DA 2NV2B 4KMSA 4X7PA 1TDJA 3OY2A 5AIAA 1QQ6A 2P69A 3C1OA 3BL5A 3UJ9A 4AJJA 1M1YB 1DCKA 1ECBA 3N28A 5LD2C 2WE7A 4N0EA 2FPKA 5GJVC 4AY6A 5EN4A 4MW7A 4UARA 1UFQA 1ZD1A 2BJVA 3NBFA 1PQWA 1ZR2A 1MO6A 3AEKA 3N8KA 3KVNA 1O03A 2CXRA 5E38A 3C3AA 4OKSA 4QFMA 4R1UA 1PK9A 1KAOA 2OV1A 2VG8A 3VVCA 3HCEA 4A9AA 3HV0A 1IBKB 2QVXX 3LHDA 2Y8EA 2XA1A 4QGSA 1REQA 1V7ZA 4FS3A 4QGGA 1RAHA 3JQCA 3LNCA 1TF2A 3FPCA 3CLVA 5CP8A 4QOGA 2ZYAA 1GTVA 1KAQA 3MFYA 4O0MA 2QAJA 1W0CA 1CY4A 3L8MA 4NHEA 3ONNA 4Z86A 5DIZA 4C3UA 1NNEA 3VHLB 2JLWA 3KB8A 1F2TA 2DECA 3NAZA 5IKXA 4EKDA 3NTQA 2C1XA 3PUZA 3UC5A 1H1TA 3S6JA 2PO7A 2WD7B 2WJIA 2ZJ5A 2EJTA 2CLEB 3PKIA 1QDUA 1Y4DE 3IO5A 3K5PA 3TSYA 1NUSA 1QMPA 3EULA 5BN1A 1TKCA 3DVAB 4BTLA 5C7YA 1K7CA 1NW3A 3DM9B 1YQXA 2R86A 2EFJA 1LQ2A 2QQFA 4H77A 4UUOA 2PR7A 2ZBQA 1NURA 4RGBA 1XA0A 1FXWA 4YLGA 2I7XA 3AIIA 3K0CC 4ZRNA 3OZRA 4CM4A 4QOJA 2JI8A 1RPNA 3IEXA 4F85A 5B6PA 5ICCA 3OE7D 1QAQA 2X76A 4WCFA 1TM2A 4B3SB 2J9FB 1MAVA 3RFUA 421PA 2XW6A 2Y1DA 3TE6A 4ABYA 2XCIA 2VT6A 1Q1GA 3O2JA 1NC3A 2V0GA 3B48A 4Q3DA 1CF9A 3NCTA 2HTEA 1TYEB 4KO2S 3VGPA 4CG2A 2V9PA 1AH2A 1G5QA 3STUA 4I36A 3OMWA 4JBYA 3WZMA 4WJLA 3S7ZA 4TWJA 3I2GA 4F9EA 3EF0A 5IPFA 5ALOA 4AU1A 4NAHA 2GO1A 3J81k 1U7HA 1UMCA 2IVZA 4M1EA 4O02B 3FRJA 2VAMA 2PDAA 1PJQA 3DTYA 2QROA 1FP7A 4XR4A 3EDRA 3U7GA 3D3WA 3LOUA 2J6IA 1CJCA 1EP2B 4MEJA 1N78A 5IAGA 4Q03A 2ECOA 5NULA 1QKIA 1ZK3A 3JQBA 4IH1A 5FUYA 1O0SA 2CZQA 1A9PA 2HZBA 3GGJA 3PF9A 2E82A 1V16B 2P3LA 5CVUA 1EFTA 2AEMA 3GN2A 3MCVA 1J90A 4GS5A 5FR1A 2HDOA 2QX4A 2FKAA 1PEDA 1U0FA 2QPLA 2XWQA 4GRIA 4DCOA 1OUMA 2QW0X 1CIPA 1NVMB 1S1CA 4V38A 1LVGA 5C34B 4K5QA 1ADGA 3K0EA 2YYSA 4IZHA 1JVSA 4HMPA 2FUG6 1GGKA 1WL8A 3NHZA 2CXOA 3IESA 5KTRA 4LHXA 1VA4A 3BCUA 3JZFA 1KVRA 1T9CA 1DFIA 1YVDA 2CEKA 3D4NA 3KYJB 4PZLA 2XKKA 1H3EA 5EWJA 3TFOA 3E9RA 1P0IA 1OXKB 3K53A 3P1JA 1SKYB 1SCNE 2IHZA 4TYMA 1UJ5A 4UXJA 2WQ6A 4BO0A 4HUJA 5CT4A 1DQNA 1E18A 3G2JA 5J2TF 4C05A 4BN4A 4KPUB 2ZS9A 1ICEA 1R6DA 4I50F 4G0YA 3M3PA 3U19A 3TXAA 4FBMA 2C0CA 2ZB3A 5J2UB 4MB6A 2Q1WA 2IZOA 2Q4EA 1YF3A 4ZT6A 5IJWA 3P2MA 3C48A 3LK7A 4MQUA 4OX9B 1JR3A 3QFCA 1BOOA 4X7MA 4X6XA 3LQ4A 2AOXA 2GZ2A 4ZICA 4FFWA 4PLPA 3ESBA 3ENQA 1QFYA 2O57A 1F0NA 2YYAA 3CB2A 4J8PA 2ZAGA 3LCUA 4CFSA 1HXHA 4HG2A 5M29A 4LJRA 1YUNA 5K8VA 3CG0A 2R79A 2O6HA 4I2NA 3ZWAA 3TG8A 3T6KA 2BIFA 2Y1WA 1FPMA 2RB5A 2JGIA 1AS0A 1ORHA 1F6DA 1P1FA 1M8PA 2O7QA 2V7EA 2ZYWX 2UZ0A 4LRYA 4DN6A 1AHNA 1VE5A 1NV8A 2O2ZA 1NXWA 2JHFA 1U3CA 4KQIA 3DEZA 1L8QA 2LDXA 3RYCB 3S44A 1WXIA 1Z8DA 3CGGA 3R0ZA 3OCCA 2ID9A 3AU9A 4UAGA 3R74A 5KOJA 1Z0IA 1XL0A 2QU7A 5EQTA 3MYRA 5G2OA 4RO0A 1ZRSA 1JZTA 4C0AC 3HDJA 3IDZA 1PO7A 1T9ZA 1IY2A 4GVLA 1RE1A 5FEMA 4B4UA 5IAAA 3BJMA 3N75A 4LJYA 5HIIA 2EZ4A 4OYHA 1BWPA 3VJRA 2W2KB 2B8NA 2PGOA 1MABA 3LUCA 2A2ZA 5BQFA 1DKPA 1Q91A 3ML1A 1TFUA 4Q4AB 1NKTA 1KNQA 4TKVA 3TLAA 3VO9A 3O2QB 1CY8A 3Q7TA 3L0DA 3M49A 3C6KA 3RBVA 2SKCA 2FQXA 1T0PA 2FAXA 2ISSD 3QVWA 2I3GA 1UBNA 4B3MB 3DEJA 2XADA 3AIKA 4M0DA 4BQFA 3QRWA 1X7ZA 3UK1A 4HNSA 5LMCA 5JASA 2HSDA 3GGSA 4FYIA 4AG5A 2OYRA 3NV7A 1AHPA 1JDZA 4M0FA 3SSOA 4Z4FA 2KQUA 2PANA 3HCAA 3PCXA 1IN8A 3EZGA 3PFKA 4MYCA 3IJEB 4X20B 3RHFA 2VIIA 1T24A 2PCJA 1JDNA 1RYDA 3DE7X 3CH5A 3E03A 4AYWA 3RC1A 1PR9A 3TYXA 3WZLA 4IKOA 3E5MA 2HPHA 2RC6A 1KQGA 2W0MA 3G9XA 5EJIA 2OCLA 3OA2A 3BXXA 3IQZA 1T1EA 4MVJG 4R1OA 1D2EA 4AD8A 2EKDA 2PX5A 4JQSA 4YWHA 4W5NA 4QM6A 4I9UA 3IVMA 2IHJA 3GVPA 1BHQ1 3KQPA 3TAUA 4ZQCB 2OM2A 1AKWA 4BNVA 2HMWA 3WYDA 4QE3A 5JYDA 4AN0A 2LR0A 4F2GA 4YMHA 5AM3A 1HNXB 1IN4A 1CLEA 3ZXIA 3V2UA 4M8LA 2DUNA 1RRMA 2C8VA 3K35A 3F1KA 5HE8A 1ZPDA 3ZY4A 1XO1A 4JXZA 3L41A 3EGWA 4RKWA 3RNLA 1NJ6A 3WYFA 5B1YA 3VOTA 3P4XA 1CUBA 1PW5A 3RQSA 1VKRA 1NU8A 3HPRA 1WPRA 1G6Q1 3UM9A 3TW8B 4M9UA 3BOSA 2VHWA 3G9QA 5LOVF 5BR8B 5KO2A 2QN7A 4RJJA 5JH7B 3P32A 3ZY5A 1O7JA 1BE0A 5CJ2A 2V4ZA 4M0CA 3W8EA 1E6UA 2WLTA 3GBSA 1VCNA 3L05A 5F5LA 1RXWA 4OL9A 3OAAA 4MXDA 4YRNA 5F52A 2H51A 5B1IA 1JDTA 3DMPA 5IJ9B 3R6DA 3V6MA 4IX1A 4WLFA 4OHFA 1KWKA 5DHPA 1B2LA 2BTQB 2EBFX 3EMDA 3IUSA 1IHDA 1E9FA 4TV9B 2WNIA 1V3UA 1PKXA 3DNPA 1U90A 2Z8YM 3ANSA 1NATA 3IOYA 1SCIA 4LRXA 4R8SA 5CVDA 4D1YA 5FLKA 3IP9A 3GELA 2Q4DA 4POAA 2AJDA 4GR5A 2HBRA 3NP9A 2X6RA 4WNIA 2C7QA 4OHVA 4NZYA 2AH5A 4Z8XA 4URXR 3F67A 1I7DA 3RYFB 3S99A 1P33A 4IV8A 5JQGB 4NE2A 8ADHA 3IAS1 4EPTA 4IJMA 3EVFA 3PXCX 1MX5A 2DFDA 4OA5A 1V25A 1J2EA 3HCCA 2IHKA 4EDHA 3RVSA 4KHPB 2R44A 3E9CA 1M3SA 5JSZB 3WA6A 2BGNA 2O2SA 2P4SA 4NQZA 4REMA 3VTAA 2BCJQ 2ZUFA 1Z63A 1KRWA 2VSXA 3UH0A 2XWPA 4PLFA 5AK0A 5F3RA 5CAEA 4DM7A 5BY2A 3GOQA 2QTVB 4U7DA 3L0OA 3C3WA 1Y7PA 3U7FB 3GOHA 4TMZA 2GCNA 1V8OA 4NESA 3V80A 2J9XB 3L93A 3BXEA 1VFNA 1LI7A 2CD7A 2XNJA 4I19A 3NS7A 1U28C 1CKEA 2GARA 4O63O 3PXBA 5ALGA 5LDGA 1UWLA 5LZ8A 4AWAA 4C0BA 3SG0A 4B83A 3L0YA 4IJVA 2BR3A 1CUHA 1VSUA 2BWJA 3T9CA 2C59A 4JC5A 1QH8A 2FOIA 3L7CA 1P1IA 1N5LA 2XIJA 4N0DA 3UXEA 3VBCA 4X1KA 5ALVA 7ABPA 2PUAA 5B53A 1FUKA 4OTZA 3UGKA 3GLGB 3KR1A 3BE6A 2Z08A 1SIWA 4HOYA 1WCWA 2GNOA 4MMXB 1US8B 3DOIA 3IEUA 4ZVUA 4KWTA 4CMEA 4I4CA 1H0RA 1YRAA 1KYWA 3AHHA 4IQ8A 3WDKA 4KN8A 5FO0A 4HGNA 4R8VA 4JLWA 3GJ7A 1GEEA 1ZKDA 2HC9A 3D43A 2C9BA 5DI9A 4DXDA 4Q15A 3D2LA 1XEWX 4I8XA 1K4YA 5BQXA 2C4KA 1SVMA 3IHLA 5EGNA 4INJA 3CPJB 4B75A 3C97A 3Q7RA 1CU1A 3KKLA 4JT9A 4R69A 1YR6A 1XCMA 4S35A 1Z3IX 4Q1AA 2JBHA 4O08A 4WOJA 2XAUA 3W5BA 1TA0A 4M46A 2W6CX 2Z6VA 2VDWB 5DM0A 5HK8A 5GJCA 2OEPA 3K0FB 4GEKA 3E58A 4HX9A 4Q9IA 2JPDA 2E4VA 3PUWA 5K09A 2F62A 3SHQA 2D2EA 2I78A 3ZYCA 1MJ5A 1XU7A 3UMMA 4EPWA 5G02A 2IW1A 2W22A 1EVZA 2WKPA 4EJ6A 5LP6C 1EX7A 3LCRA 3H05A 4B8ZA 4WNAB 4MZDA 4HNQA 4WDQA 2F1HA 2J41A 1TC1A 4HDQB 3PFBA 1I3OA 4EYEA 3LUFA 4IXDA 4Q3NA 2Z5VA 1WEHA 1EU1A 2AMFA 3L8GA 4MROA 3CF2A 3FGPA 4M3NA 1LNSA 3O4JA 2RHOA 4EYSA 2JDID 2GB4A 2B4KA 4G5GA 3WQBA 1QIDA 4N3AA 1E0JA 2RGUA 2ZVDA 3LLCA 3OFKA 3TL6A 2WJAA 2EGGA 3V1LA 3D4OA 4KKXB 4COOA 5B64A 1ISHA 1Z28A 1HY3A 2I8LA 3NORA 4JDPA 5CR9A 1DAHA 2VHYA 1CRQA 1PFYA 5JNSA 1KZ7B 1ODCA 3AHDA 2XYVA 2WU3A 1LPMA 4KUEA 1Q50A 3X1ZA 3WRXC 4GD3Q 3A6PC 2Q5IA 2ZYHA 1EVJA 1BCSA 2JGDB 5H81A 1U0HC 3TSAA 2ZB7A 4HFRA 1V3VA 5T6BA 2XOEA 4QXQA 2WF8A 1T0BA 1A3CA 2QLNA 3KXLA 2WOOA 1K5GA 4PQFA 5ALJA 1EP9A 2FFQA 3OU2A 3U3RA 3B6JA 2G6TA 5CA1A 1CJMA 1LX6A 4CF3A 5BP7A 1I51A 3H11A 5EIAA 4NYJQ 3W7BA 4LA4A 2ZJBA 3GLVA 5CLIA 2GPBA 4BJ3A 3H1EA 2GSWA 2X5JO 4KWIA 4AKEA 4YO7A 2G83A 1QTQA 5JCJD 2YHUA 5DM70 4GRDA 4BCDA 1ST2A 3A1CA 2PS1A 1KFKB 3CY6A 1M2OA 4HJXA 4MS4B 1RYYA 2JGKA 2A86A 3B9PA 3IYLW 5L6MB 1N34B 3GR6A 4G0WA 1SUFA 1D9ZA 3M6FA 4K3VA 4QEDA 2HO5A 2QSUA 4OXIA 2GI4A 1E7WA 3G0IA 1RVDA 4IXMA 1M6YA 3DWGA 1SELA 1UBMS 2RAUA 1QPGA 2YNMC 3GJ3A 4NCXA 1LWOA 4EF4A 2OGZA 5EZYF 2NAPA 3ZHSA 2AI2A 4YQFA 4RZSA 1M6HA 2R4QA 2XQGA 2I6FA 5CK4A 2E2WA 1PSDA 2BYTA 1C2TA 2P2NA 3GCDA 1P2DA 4FHZA 4I6JA 1QWSA 1SUDA 3FSGA 4ZOCA 1W36D 1KP3A 3W5JA 2BM8A 3FWPA 1I80A 2I71A 5F73A 4EG4A 1N5OX 4RZ3A 1D6MA 1UQUA 2O7RA 1XEXA 3AP2A 2PPVA 3C6YA 3L79A 3N3AC 4JJ4A 5DP1A 5AVZA 5CH3A 3WHIA 5JY6A 1WBDA 5K3OA 1M1YE 3I4FA 1HFWA 1EX1A 3A6FA 4PGMA 1Y7HA 3RVPA 3JQ7A 4F3CA 1X2EA 3D3JA 3NDRA 1SHLA 2QLMA 1DINA 1XR3A 2JFYA 5KYYB 2JLRA 1E66A 2VS1A 1FB5A 5KC9A 2JCSA 3GZTB 3GJSA 3PJGA 2C2WA 4XPIA 5BYBA 1TCCA 4IUCS 1PJZA 2B0CA 5LDHA 1G5TA 1G8SA 2CDRA 5AOVA 5LFAA 3ZD8A 2GK6A 2XYRA 1JXOA 2QUAA 5CBPB 1JHVA 3OICA 4L8LA 5J4KA 3CPHA 1DHRA 2Y0BA 4JBWA 4A2WA 2N47A 5E95A 4BZZA 1KI2A 2VWHA 3QE4A 4P5PA 4LYAA 1XZFA 4RYLA 5KEIA 3IEVA 4K9LA 2WJPA 4WZBA 2YKGA 1R9NA 5TC4A 3RC2A 2PRZA 4LNUB 5B6IA 1TM7E 1FFHA 4GOOD 3HV2A 4N5DA 2ZZNA 4UXHA 3RC9A 4YJKA 5TE9A 3WB9A 1Q92A 1CPYA 1DWQA 1U9IA 1VJ1A 4JOCA 3ZCPA 4ZQBA 4WXYB 1WXEA 2YWDA 2CXTA 2M1ZA 1H85A 2EC5A 4LHWA 4P3KA 1TFRA 4P3PA 3HN7A 3L4JA 1TTHA 4PTLA 1VPWA 2QM3A 1IZZA 1P1RA 1H4QA 1PDWA 3TMKA 1ST3A 2I7CA 3Q9UA 4ALIA 5FQNA 1HE5A 4QHYA 4U9IS 4N5NA 1KFCB 4BCCA 1MOQA 2DT8A 3Q3GE 3B85A 3BSYA 1RJ9A 3GEMA 4BUCA 2ZBVA 4DREA 1GTSA 1Z6TA 4C0LA 1JT2A 4JVOA 2PUEA 4FSXA 4JP2A 3NUQA 4IDEA 2WVJA 4L8FA 2C92A 2FV8A 2NOAA 3H6GA 1QYIA 1NPTO 3IURA 3TCNA 3DSRA 1D0VA 1PV4A 3CURA 3I73A 3DVRX 4BIMA 2Y0DA 2O0LA 2KJQA 3FCCA 1PAUA 3JQFC 5SICE 1QYWA 1N9ZA 5IYZA 5JAOA 5JSFA 3S8EA 3FYDA 3K0HA 4B3IA 2R8XA 1JFLA 1SNYA 2QRLA 2DQYA 2X5OA 4CEHB 3L7OA 4IRMA 5FA8A 3P2KA 4CPDA 3S27A 4B3HA 4EVSA 1CDEA 1PT5A 3ZVLA 5CB4F 2P7IA 3DBHB 1Y7LA 2A4MA 2DLNA 3DR3A 4OBBA 4R2MA 4IZOA 1EA7A 4J76A 1I3LA 4PFQA 5C53B 1FXUA 4Q02A 2ZBUA 4KX3A 2Y76A 4CV2A 3TL2A 1NVKA 1AS2A 1X9HA 3KS9A 1H6DA 4J7AA 2I1QA 4ZGBA 1OXVA 3HA3A 4K86A 2C96A 4MO9A 5J2UF 5JJLA 4NENB 3LY9A 1I32A 4JH0A 3X1KA 5IWAB 1N0IA 3JQGA 4LBWA 3THOA 4QDKA 1SD2A 1LI5A 3QU4A 4MUBA 3V48A 1H94A 3VU0A 1ZK1A 2GAOA 3OE7A 3ZWKA 4FE7A 2RSLA 3NM4A 1G20A 2C42A 3T4XA 3GV0A 4CBVA 5AM5A 2DHRA 4U2GA 2D0PB 1FP4B 2ST1A 3GRZA 1HE3A 3PRJA 2CE7A 3B38A 3MD9A 3T1NA 2V5UA 2V6JA 5MFZA 4PNPA 1GZSA 4GMXA 3IALA 5F1PA 3OE5A 3VHXA 1PR5A 1J49A 4MUAA 1QMGA 4RF3A 4YB8A 3GFOA 2VTDA 1S3FA 1E77A 2AE1A 2QSZA 4OQMA 1TYAE 4OCZA 3UA4A 3WFIA 1SKYE 1EFKA 4LSMA 2ACVA 1NSYA 4AK9A 1K5HA 4R2XA 2FRXA 1XA3A 3TM5A 1QM5A 4BO8A 5HKOA 3UT6A 3OIGA 1GPAA 5LR6A 3I76A 2RGCA 4FFLA 4DB2A 4JMLA 3HVIA 3I1JA 5AVSA 4IDGA 2I0FA 5AH0A 3O5AA 2ODBA 5IC5A 3DE5X 3VRHA 2HJ9A 4RWEA 3U7QB 5F2OA 2VYFA 1KZYC 2Z2YA 3ABOB 2QSJA 3IUYA 2QF7A 3CRNA 1GPUA 4QXAA 3RAGA 3CLKA 5FH9A 1P0MA 4XXHA 3MB8A 3WE7A 1I4TD 1R37A 2JCYA 2Z0MA 4JZKA 4PRZA 2ZU0C 4FYJA 4YJ3B 1Z06A 3SX0A 1LNZA 3JW8A 1NW4A 3EXIA 5H9VA 3FPLA 1J8MF 3QEMA 2Z4TA 3I6QA 4BNJA 5LQCA 1JE1A 2ARKA 2ZBRA 3UVEA 5AK4A 5I9SA 2IYNA 2CL5A 1S4QA 2GHTA 3C7AA 1YQ9A 2D06A 1S3SA 1FVXA 1WVIA 3CXUA 4WW0A 4AJ4A 4YAKA 4PO9A 3IRVA 3VMFA 5KYTA 2B0JA 3RS8A 4L3WA 2DBVO 4KAAA 4JL5A 3LQFA 4JMPA 3DL4A 1VP9A 4FMBB 1JLLB 5CDFE 4QYSA 4RXTA 1NM5A 3VSCA 1IPHA 2Q5FA 3RW9A 2GRUA 5ICEA 1QVAA 1S7CA 1ZMXA 4RZUA 5A0TA 1CUIA 5LQSA 2PA3A 1BDMA 2PYIA 3KL2A 1AOXA 2F48A 3DVLA 4B46A 4M88A 2EZTA 2EP7A 4QU8A 2ZBFA 4EBFA 4DV4B 4URFA 4ARSA 3G1UA 2B5VA 1VZ3A 3L01A 1VECA 1K0FA 4HB2A 2J4CA 2P68A 1EUCB 2XJ9A 3AP3A 2Q2OA 2NSLA 3AINA 3VR4D 2E4ZA 2V7VA 3K2QA 3RKSA 3ZEIA 4LZAA 2YC4C 3U62A 4RK5A 3KT8A 5TPZD 3I01A 3VO8A 1HX7A 3FHJA 1LVUA 1YQDA 3PLAE 1XKTA 3CRW1 4YRZA 5JNTA 4EATA 1O3YA 2J9RA 1TIBA 2BMFA 2AG1A 5JRDS 2HYIC 4XCVA 2EBWA 2IYRA 5EJ5A 2CNDA 3CUUA 1LS1A 1SUIA 2FUCA 3HCBA 5JAQA 2Q1TA 5JY1A 2YIJA 3T34A 3URKA 1Y6QA 3BHNA 3TBHA 1I0ZA 2MR5A 4BYGA 3ACCA 3RO7A 3LPCA 4F7DA 3KZOA 4V3CA 1GZ6A 4WKOA 3SI7A 5J1TB 1HF3A 3FLMA 1XWWA 2C4VA 2HBQA 2VXCA 2VYQA 3DLBA 5L45A 5IAJA 3HP7A 2G9UA 1DEKA 3MRXA 1EFPB 3NYIA 1WXHA 2G08A 3COYA 3RU2A 1RQ7A 1YZGA 2EDCA 2HXSA 3O3NB 2JANA 4AO8A 1N3YA 1VB3A 1D0IA 4MS3B 5AQEA 2BFNA 1JHUA 2JIRA 4QFCA 4Z0HO 3U31A 1RMYA 2HYDA 1G8MA 2UYQA 1CUFA 2V7XA 3F6PA 1TQ6A 5EKDA 2NXJA 5FBKA 1AJEA 1N8NA 1ZA2A 3KSAC 1I24A 4GP7A 2CKDA 3ZCRA 4HNAA 1UFVA 2Q99A 3AVOA 3QI7A 3L0PA 5DEIA 3REQB 1FRNA 1MGOA 3BZBA 1EPUA 3WLPA 2GILA 2PT7A 5K8CA 1XRLA 5TS3A 3FBWA 4RDHA 4LYYA 3LA8A 3HM2A 3A05A 1HTWA 4UHCA 4CFZA 4EJFA 1DEHA 1KY2A 3EISA 3MQFA 2JJYA 3OCUA 4MWCA 1NXQA 4KYUA 2N1MA 3ROPA 1W8IA 4S1NA 2P3SA 3IKVA 3MHPA 3R3JA 5HBGA 1EP1B 2FPSA 5EP2A 5HFNA 1FFYA 1Q2XA 4UZEA 4LJ5A 4A8HA 2VT3A 4YGYA 3DTTA 1SOAA 1IUKA 2AW5A 4ZALA 4JQYA 5G0UA 4QBGB 4X8OA 1KDTA 4MI3A 1ZJWA 3BKXA 3DYBA 3AEKB 3WLQA 4LV8B 5KU1A 2ZUTA 4EB0A 3A4VA 1RI4A 3WX0A 1GA4A 5ICGA 3EDYA 3CO0S 2XF2A 3LC2O 2A1TR 3X43A 4LF6B 1Q44A 5DK4A 2FN8A 3VYVA 4C20A 5IULC 4OQNA 4ZZ2A 4Z3KA 3LOQA 4G4GA 1REQB 3PEVA 4DJDC 3V4FA 2GBPA 1PSZA 4B4VA 1CLUA 3NO4A 3PYXA 3UYKA 1K7EB 1L7EA 4B45A 1YHYA 3N59A 3CUWA 1L5MA 1SHTX 4DA4A 2E49A 1B6GA 4JUDX 3KJXA 1EVLA 1F2TB 2F3QA 3THYA 4OH1A 1J0DA 3KKNA 3C5VA 3U3DA 1IHYA 1IY1A 5A4IS 1LK0A 2FP4A 2NMVA 4RK6A 2I5PO 1B4DA 3MBOA 3FY4A 3CKLA 1YKSA 1WZEA 3F73A 1OWOA 1E5TA 1V71A 4H7EA 3TZHA 2M32A 1XAIA 1CRZA 2P6PA 2JW5A 4NMXB 1CD5A 1DBIA 1N4DA 3PCTA 5DMHA 2VKTA 2OZEA 1HOTA 3JWIA 4B33A 4BX3A 4CM4B 1FXSA 4WLEA 2NV6A 4M7WA 1RWXA 5B37A 3CH7A 4FWIB 1WO8A 4OI2A 3L84A 2Q4TA 3I6YA 4WCFB 1DTSA 5KIAA 3GLGE 5HMLA 3GLHE 3LIIA 4MWDA 4GLFA 5FPQA 1CQZA 4MTCA 4QRIA 2WJ4A 1Z37A 1NPDA 4IS3A 4MYHA 2C4HA 2VP5A 2XKBA 3VYRB 1GLVA 4D4LA 4DA9A 4UOZA 4GC5A 4OGLA 1JEEA 3DZJA 3ICVA 3NDIA 3IX7A 2O2XA 1MVOA 2I54A 3EVZA 5EPOA 3L7IA 1RPZA 4O3MA 2C2KA 2GWHA 1Z07A 4YP5A 2WQZA 2GSDA 4DZZA 4EH1A 3JATA 2V45A 1IJEA 3HCWA 2VTKA 4ZARA 4G6ZA 3UMSA 5CBKA 5GJWC 2C7BA 1UMCB 3EEQA 3N0WA 4UBKA 1K92A 2DWOA 3GBVA 4BWVA 5BWNA 1J9GA 3JSAA 1VIVA 2OENG 3AG5A 4JL6A 4LOHA 1R0CA 2X8JA 3D3WB 4D4GA 1N6IA 4M1KA 4DS3A 4XQ0A 2XRMA 5IC6A 4LFBB 1NVGA 1HE4A 2FSVA 2PZEA 2RAFA 4U7WA 4YJDA 5BSWA 4QA9A 3K6SA 1C41A 2WIFA 1BDHA 1YAHA 3DOFA 1NBIA 3PS9A 4LSZA 1MV5A 3OIWA 4W82A 5EUBA 3HFJA 4RZIA 3ZDQA 2YV4A 2JHCA 1QZXA 1NJFA 3A2LA 1VHDA 4H7HA 4WMLA 3VSBA 2VDMB 4UD6A 3G68A 3TPZA 1YJ8A 1GL7A 1VL2A 1G7TA 1TZ2A 3CZ4A 3DPUA 3LLVA 3W7AA 3OMXA 2CWDA 1ZM3A 2PTGA 4H7IA 4JVSB 2A84A 2VPTA 3IP5A 2GXQA 4DCTA 1OYVA 4Q9AA 1P1KA 1SXJD 1T9DA 4BGUA 1QWOA 2NVUA 4NZNA 5LA6A 3VQTA 4BQPA 1J5EB 5EWJB 5KB3A 2QGZA 5KZMB 3SBEA 1XD2A 3IKLA 3SM9A 4CKBA 1TK3A 3E1SA 2P27A 5DEOA 4KMRA 2VH2A 2GLTA 3S5UA 4IDPA 3LKBA 2B61A 1KTIA 4MKHA 3WQQA 3UKDA 3GEHA 4CQLA 1QHEA 2ZE6A 3CZ5A 4Y6LA 3CVJA 1YJXA 3SIRA 2HT1A 1USWA 2IKSA 3MZ0A 3TX6A 2X9LA 4QKQA 3PNBA 1RR6A 1U1CA 3DKRA 2MMCA 1IN7A 4FI3C 4B40A 1Y9ZA 5FBRB 4LJ6A 4DPMA 3LXMA 5AVTA 5CLGA 4JJ6A 5FBLB 4GOXA 1Q83A 1T3SA 1UEJA 4J0GA 1D4ZA 2DPGA 4BQRA 5KQGA 1TD9A 4BECA 3IOBA 5E9JA 4LKRA 1DAIA 2AQKA 4NEQA 2VJYA 3GRUA 4QC2A 2G36A 4KZPA 3HC7A 1YNOA 4MR8A 1ACLA 2VBFA 4HGPA 3T3IA 1FZTA 2JDIA 1DC5A 1C1HA 1DRWA 2HWXA 3AW8A 3T5TA 3VX4A 1MEJA 4LJ8A 4ZAXA 3T7JA 3CJTA 1ZFNA 3HJUA 4RMHA 4GMDA 4D81A 4CGYA 4D79A 5E4JA 2R8ZA 1LTHR 3T35A 2FR8A 4RPCA 3QSGA 3U7JA 2ZBPA 4I4LA 2C5AA 2NIPA 2QAGA 5KOJB 2QGFA 3FVTA 4M6WA 2MMGA 5EIBC 3BTSA 1IM2A 1T3ZA 1YR2A 4CR7A 3AY6A 3UB3A 5BWMA 3WLTA 1ADYA 5LQMA 2CLMB 3O2NA 1M2KA 3OKPA 5AJVB 2X0FA 3H5LA 3P9YA 2VC2B 2LDBA 3B6KA 4QELA 1A8QA 3RJTA 2J9GA 3KOOA 2C78A 2XGSA 4KYVA 4TKVB 4BPBA 1HL3A 4HWSA 3JYLA 3Q0TA 4JNCA 4U2EA 1BWQA 4OHWA 3L02A 4QODA 5TMPA 4PYJA 4HEA1 1WA5A 1XELA 2Z4RA 3DZHA 4Q9DA 4NKRA 4TL8A 3VMMA 4XUDA 1X7ZB 2R8PA 1H6AA 4FGWA 2VP4A 5JCJA 3L5KA 5B36A 4MQ4A 1SEPA 2OKGA 4ZTZB 1IE3A 5CNMA 5B4TA 3VNRA 2P2CA 1PFVA 3ORFA 2EERA 1DX4A 1CR0A 2WHEA 3QWIA 4J0IA 5JR3A 4RTLA 3DEHA 5FBVB 1U8AA 4LY6A 1VKNA 5HCIA 3F5SA 1X1DA 2YXDA 1CUGA 4UQPA 4D8XA 2ZJFA 3NFYA 2RCYA 1QRDA 4HRXA 3W05A 3FCXA 4IIBA 2D5BA 4L7QA 2QZ9A 4XVHA 1SHKA 4JN6B 2GPTA 2TMDA 5LQAA 2O8FB 1AD2A 4QDOA 4BNGA 1ILWA 1EWYA 1RJGA 2GESA 3TLKA 4B31A 3QVGA 3HYLA 3R7NA 3LMKA 2BMJA 4DMUB 4N6NA 1UEXC 3DL2A 3MPOA 1EUQA 2XUAA 3LGSA 4YJ2F 4JNKA 2E0IA 1WU7A 2JAXA 4B3BA 4F6RA 1FW6A 1QRAA 4IJWA 2CN1A 2I91A 5FCDA 1TRHA 3CR8A 3PE4A 2V7WA 4G89A 1BU8A 3O95A 4N9QA 4PHGA 3ZWDA 4NH0A 2XWBF 3PUHA 4ZCQA 5T8KA 1DKRA 4KBFA 2C5SA 4ZHQF 3BKWA 1BQ4A 3AI2A 3N87A 2VPPA 2BEJA 1P0CA 2D5IA 1Z7EA 2WSSD 5HA5A 3N2YA 2Q9AA 4BVBA 5BXYA 4IFIA 2W6QA 1YI0A 5DFAA 2WABA 3IGFA 2RGXA 1RXVA 5JPIA 4QLOA 5C1PA 1S3GA 3T5AA 2DTEA 2MSLA 2E9SA 2GERA 3N2KA 5I8WA 3AI3A 5EMLA 1VP3A 2BZ0A 4TV8A 4GHWA 4YCJA 4AFNA 1OZ0A 3OC6A 3NBAA 2GEKA 1P7CA 1FVOA 2OORA 4JGGA 4Q1EA 4TSFD 3T1OA 5DNYB 5H9WA 3RC8A 1T4GA 1T6BY 4TTVA 3U3KA 1Z6GA 3UOAB 1ZGGA 1SUWA 3TI7A 2BEVA 1Q19A 3L4BC 1KKMA 1BX1A 1TIKA 1EQUA 2QVYX 3RH0A 4MO2A 4OQPA 2G1UA 4OKNA 2O5RA 3AHGA 3PC8A 1I14A 3MXOA 4V1CA 2GJAA 1TAGA 1L4LA 1G9TA 1KH2A 1MAHA 3DDHA 2XVZA 1P77A 1Y7TA 1EFUA 2C82A 5IKPA 4G56A 5LQRA 2QNIA 3DD1A 2JFZA 2PWBA 1YJQA 4YONB 4BQEA 3JY6A 1W52X 3H5WA 2OO3A 1B43A 3JYQA 4FNMA 4S3MA 2ZDHA 1KBOA 4ZDKA 5CAEB 3RPEA 3NPMA 3LI2A 4O3FA 5H5JA 5GZ1A 2GTHA 2WM2A 3BJEA 5EJ2A 5J4YA 1XWFA 1XTTA 1YSCA 5JWRA 1MPTA 1U8TA 1R6TA 1PGPA 5LWHA 4QJ4A 2O3JA 5BNFA 5EIWA 1PE0A 3RR2A 2DCMA 2X3UA 4C4TA 3K70C 3IIJA 4MICA 3UIEA 1SGWA 2CBZA 3WK5A 1HQCA 4GWGA 1HLFA 3G9UA 5HFJA 2X0KA 5TMDA 1UMBA 1ZM7A 4EZBA 1NBAA 3K4QA 2QVGA 1QH8B 4MV1A 2J5RA 2VDNB 4PYQA 4U2CA 3I9LA 3TPCA 4CL2A 4X1KB 3DUFB 1V7QA 4R9UC 4H7FA 1UPAA 1UINA 1NJ5A 2XE7A 1ZU5A 2FW7A 3QPVA 4QPZA 5AD1A 4RM3A 5KREA 2CT8A 3GMDA 3NKVA 1NNUA 3OE1A 4YMSA 3W5CA 3DDCA 2M98A 1NN5A 3WGUA 2CNNA 5SY4A 2I62A 4UHJA 1I6WA 1K4KA 4DRZA 1XLVA 1V96A 4M99A 3QUSA 4F46A 1IIRA 2PFKA 4DW8A 4XYLA 2H1CA 3KWLA 3LDHA 1DEXA 4LC9A 1MFPA 2JRLA 2ZPAA 2IDMA 5BVGA 4IHAA 3I39X 1TGVA 3QPCA 5GM1A 1YZKA 4UBMA 1BD3A 2AL7A 4B3XA 4NS1A 1PJ3A 5AW1A 2OZPA 3ZC3A 4HLUA 4FQ7A 2IJGX 3ZWVA 4R2KA 5YASA 5EHZA 4U2DA 2JAWA 3ICWA 3CG4A 1V1RA 2CCGA 1QOZA 4J3JA 2Z9CA 3R0XA 5JSKA 2H2GA 2PL1A 5CW2A 3SX4A 1E2JA 1B8NA 3F6EX 4BO2A 4GPBA 3GAZA 2R5FA 1DWOA 4JQZA 4BU1A 2LP4Y 2MHCA 4FOSA 2ZWMA 3K3PA 3NHPA 3I5UA 1V5GA 1YC2A 2DPMA 5LIRA 2MSDB 2PX3A 3TS1A 2X8BA 5CUQA 4CDGA 2IOFK 1HWYA 2MSNA 3E7XA 2GM4A 1W1WA 1IAQA 1DV2A 1BMQA 3T3MB 2EJWA 2AZTA 4GWKA 3KT0A 2JASA 3PGMA 4E2YA 3FJ1A 2WBLC 3ZIAD 4DARA 3R9WA 2ZI7A 4ND6A 3QNWA 3RS0A 5IZCC 1YCFA 4ZVMA 4AUKA 4LCEA 1XFAA 3MPUA 2O8VA 1F2UA 2Q3MA 3IIMA 4OGFA 3FCSB 3ZG6A 2FI1A 3C45A 3FZYA 4JAVC 4UAJA 4E22A 1YFLA 1NNLA 3LXXA 2P35A 1EAMA 1RRGA 4J16C 3KQSA 4UOEA 5KSWB 2HN9A 2JGMA 3CLSC 3L8EA 3S4YA 4MKIA 4Q39A 1NVBA 1Y9DA 3O7MA 4OB6A 3L4KA 1NBHA 1BCSB 3B70A 4XLZA 4ZU6X 2PU5A 2MSEB 1P29A 2GJ4A 2YIVX 1MFZA 3AUFA 3VU8A 5IEJA 1L7PA 2PZKA 1BTOA 3OWOA 4LI3X 3QYPA 4L76A 3FUXA 3TW6A 1MW8X 1UWVA 2WEKA 3KYCA 5CA1B 3HWX1 1EM8A 4L16A 2C5BA 3GQBA 4M9CA 3H11B 4GBED 1UANA 2IOQA 1QVVA 4II3A 4DLYA 4E03A 3GCGA 2CFTA 1ZBQA 2FSPA 1H69A 3HS3A 1VPLA 4Q24A 2IQIA 3HPQA 5G4LA 3E27A 4QO7A 1TVKA 1W5AA 2XECA 1THTA 1M2OB 3ELUA 2JLVA 2P8JA 4L4UA 3MMZA 5C32A 1KI1A 4JX9A 4IILA 5IW8A 1LC3A 3ISJA 3VR4A 4WGGA 5ADUS 1I1QB 2MCFA 1BRMA 3F96A 5TPZA 1U5BA 4ALMA 5AJZA 1E1DA 4ODIA 4PHTA 3SXUA 4J2OA 1DO8A 1RWMA 2ZVQX 1QG6A 4PR0A 3I0MA 5FOXA 3SCZA 1KDRA 4BZXA 2P3QA 2AG6A 3T0FA 3G2QA 3BAFA 1LCIA 1XD8A 2JS7A 1XEXB 5LYJA 1ESZA 1NOKA 1QQ7A 3HABA 2FXVA 3ZGNA 1M8FA 3MWJA 4A92A 2R0QC 3L8HA 3DW3X 1TK2A 4MQBA 3GHHA 1HEYA 1W2HA 2XKAA 1WP9A 2MU1A 3LBIA 3JQ7B 4R7GA 5T6MA 3PNOA 3WQRA 3M6WA 4N1AA 4NBRA 1B1CA 3HA5A 4PG4A 4Z3DA 2FMKA 4A6DA 1VL0A 4XWWA 1YKFA 3IPXA 2J5XA 4C7BA 2DQZA 2H8KA 2WD9A 4R9SA 3WMRA 4ZRMA 3ZX5A 4L0DA 4DQKA 5BN5A 4GL2A 4XPIB 1ONNA 4RXUA 1T2UA 5I7WA 2G04A 3KQTA 2PYDA 3VOBA 1H6BA 2AMLA 3EIEA 4RSMA 3VR4H 4JT8A 4OQYA 1CEYA 2I4MA 2BCEA 1XT6A 4H08A 1XFDA 3PC4A 1I4LD 2BSAA 1PYDA 4U9UA 3DPSA 3I9JA 3ELYA 4OXYA 4E1BA 2PUTA 2HA6A 2A3NA 3CF6R 1QE5A 3GCZA 3HZOA 1JR2A 4MLZA 4GWLA 1UZAA 4EKNB 3QFFA 1H9BA 1H65A 2ZYDA 1T10A 1V3QE 5FIUA 5TGZA 3RWBA 3NNNA 1KAGA 1GZ7A 3T9AA 4X3CA 4DR5B 4N47A 1AE1A 4AZVA 3TOXA 4BRZA 2OO5C 4G1EB 1S01A 4GMGA 4KJZA 2WKRA 3FTQA 2KE5A 5TMBA 3FFTA 3SQMA 1JVBA 5C0OE 2HW8A 3ZWQA 1SKBA 2HA7A 1TMGE 2BE9A 1NC1A 3EBLA 4O2AA 1V26A 4NECA 1R6BX 1E2PA 3EQ9A 2DAPA 3RM3A 1RJ9B 4JI5B 3WRWA 1YFJA 4IO1A 4ITRC 4GYKA 2BKUA 2CF5A 4TT3D 5HIMA 2PBZA 5JDIC 3OFSA 4TM7A 2Q9BA 2JD2A 4C0JA 1TX4B 2RBKA 3BK1A 3BA6A 4IIEA 3NWJA 4IWYA 3JRWA 5TGTA 3V00A 4A1OA 4J03A 4QREA 4B34A 4ZEVA 2JL1A 2UUPA 1FFDA 3F7MA 4FCWA 4GR9A 2HMAA 1JEQA 2ID8A 3P20A 1GG9A 2GDZA 3C6ZA 1DKMA 2XI4A 3F74A 5GV7A 3IOMA 5IYZB 4L0MA 5HWSA 3ETGA 3QLEA 3AUJB 3OPQA 3OMLA 1DKQA 3GL9A 4BDTA 3W2FA 4G4SP 3U3JA 1RSZA 1ZITA 3VNVA 3MTIA 2QN8A 1GL9B 2PM8A 1RC0A 1SVKA 3KCNA 3VH4A 4LZJA 4NOLA 4C4AA 2A9VA 1DQZA 4CKZA 3W9YA 4TYQA 4JP3A 4AY5A 1DG1G 1XTRA 3FTPA 1D3AA 3MJHA 3O4GA 4A6PA 4EY6A 3A9WA 3FZGA 3VVMA 4F06A 4EZIA 4UTPA 4KNYA 1RAIA 1FCJA 1RTTA 1AK9A 1YR9A 2VJLA 4B7ZA 5EVCA 4TLLB 2PVPA 5LVAA 2O5EA 1UDBA 1M6VA 3KPWA 5FL7A 1T15A 2ZI4A 1OZAA 4Y8VA 5JVDA 2OPHA 3GDHA 1O9GA 1CG6A 1YH3A 2QJRA 3L1VA 4IIYA 1E2MA 4M9RA 1IHXA 3KETA 2MIIA 4M53A 1VLJA 3OT4A 2B2CA 3AC0A 5IDYA 3NH6A 2ENUA 3E3LA 1G20B 2XMCA 1Y33E 3THXA 2VCEA 4P4UA 1FP1D 1NT2A 3HXQA 3TQOA 1L5QA 3SS8A 2HT6A 1ZESA 3OHPA 3UATA 2BKAA 4MGHA 1OZFA 1M0WA 2V3VA 3DXYA 3ZU2A 2QGNA 1XL1A 5KDOA 3QV1A 1RW4A 4RH3A 3HU2A 1PQ4A 2XNCA 2O5VA 3DGEC 3A9UA 4TPKA 3VHXB 5HW0A 3VZRA 3SHFA 1R8JA 3OJLA 1SPXA 2I6XA 5JDCA 3ZJVA 1VSBA 2ZJ8A 4HTAA 1KI6A 4TKUA 1FP6A 4D9NA 3JQ8A 5CNIA 2DKNA 5ALYA 1L3IA 2Z5GA 2XYHA 5EXEA 1ULSA 1ZO8A 2AN5A 4XGRA 1PFGA 1YXMA 1J8FA 2HNKA 4NMLA 1DIRA 2FP3A 2ZSEA 3JD3A 4XB6B 1ULHA 2PMFA 3QTLA 4GLJA 1G0OA 4HBZA 5D5QA 1L5WA 3D8SA 4NEGA 3PQ8A 3ACDA 2PSDA 1JR3E 2ZEJA 3LFHA 5FF9A 1RQNA 4LJ9A 1ENPA 1YIOA 2PG3A 3BFJA 3UK6A 4EPRA 1TUEA 5FTJA 2HPZA 2KSQA 4YXFA 3F8SA 1RM4A 2NZWA 3EXIB 3U16A 3CUYA 3R9XA 5B2EA 3QEMB 1RC8A 2O3SA 5LBTA 3SKVA 3DDZX 1C7IA 4O59O 3ZGLA 4BB6A 2D1RA 1Y81A 1Z2EA 3PG5A 1B0ZA 3R5HA 2HJSA 2WKSA 3A04A 5ALTA 1N33B 2RHDA 2B37A 3LLMA 1SEVA 3R9IA 4B82A 5KOHA 5KTMA 3UJNA 1XU9A 2GN9A 1C0IA 3W04A 4YALA 2BJHA 1KNXA 1P1HA 1TUBA 1XVAA 2OFOA 1VL5A 3CVWA 1NLYA 1QZUA 2AD5A 3I28A 2W2TA 5LQKA 1JYEA 1JDPA 4CMGA 4EGAA 4G63A 1T43A 1DMSA 3H7AA 3PJDA 5KTPA 3A2KA 2VCHA 1BRTA 4FYVA 4IDBA 1HDCA 3GEDA 3CQ9A 3NALA 3OZXA 1TNDA 4J1SA 4J2TA 4US1R 1IXKA 2H7CA 2NW6A 2XT0A 1S6YA 3E05A 3M5PA 3QFHA 5AHOA 3UQZA 1SZCA 4AJOA 1EINA 4BBPA 4A8TA 1XN1A 4Y1FA 2QUJA 3WFJA 3ZGZA 1PBNA 3SNHA 3T7CA 2GJ9A 4P82A 3UOGA 2NYRA 3FYSA 3PDHA 3ZWWA 5B7QA 5HKAA 2HZ7A 2O1WA 1Z2PX 2C1ZA 4PAWA 1I3MA 5AW4A 3D2AA 1RBZA 4O2RA 1BDBA 1GNPA 4JUIA 3BGIA 3KP1A 4WBNA 2WSMA 1W9MA 3W7VA 1UBHS 3LYUA 2MOKA 1DC6A 4BRSA 1GZVA 3SIWA 1PZNA 2WJ6A 5SZJA 4RD6A 2O6LA 1WTAA 3K8QA 1XLWA 3F5DA 5DXAA 1N3LA 3ASZA 1U7XA 1YHZA 3QLJA 2HRBA 1NVVR 2ZDQA 3FOWA 4IGEA 5ER6A 4EY4A 4NXNB 1FU4A 1RXCA 5KTKA 1EZZA 3VX3A 4TYNA 5KTYA 3AVXA 5FOQA 4ZVSA 3WSTA 2AR9A 4MRNA 1GKKA 2OXFA 2EBHX 2O59A 2CV0A 4WBSA 2GFQA 3D6MA 4R3NA 5K8IA 3AUXA 1V6CA 2VNAA 1JAYA 2ZULA 3QXSA 1AQUA 4XVQA 3ZV5A 1VCMA 2QYSA 1JA0A 1WY5A 1S02A 2QVLA 1WPXA 4UAVA 2CNBA 3EPPA 4B2IA 1XVIA 3LK6A 2JLBA 3TINA 4BQSA 1XZJA 2RGBA 3HJTA 1Q7TA 4FLFA 2D4HA 1EAYA 2XVXA 3HEBA 1ZGCA 2W6ID 4ZV9A 3CWZA 1ZJ5A 1WW2A 2G17A 1ZCFA 2P5TB 2Q4BA 3QVXA 4C5BA 4W1SA 2YRWA 3WNQA 3M83A 1O6BA 3NEYA 4FMCF 5F12A 3M4XA 4ILKA 4X65B 1NBEA 2SKDA 2XMGA 4D3YA 2GN4A 1R10A 1DADA 5LZ4A 3FGOA 1DWUA 4HNAB 4BKPA 4B76A 2F3PA 2IDKA 1HRDA 4ZV4A 1GYPA 4W1PA 3PNMA 1Z4QA 1YJCA 2VEDA 4OXNA 4AZ0B 1UM8A 1VPTA 2FVYA 3EFHA 4OJMX 4OHOA 3X1JA 1Y98A 2D7CA 2PKCA 4G0MA 4V0MA 5DW0A 1QBKC 4C4OA 2C95A 1IOZA 4IOKA 3S2ZA 1O77A 3U1BA 1FYFA 1ZD2P 1N2ZA 1O95D 2ECKA 3VM6A 2OECA 3ENNA 3RADC 2WM8A 1JPNA 3GP5A 5FNVF 2VJDA 1H4VB 3LRPA 3QVJA 4B35A 4GRAA 4EHJA 4D8YA 4O2BF 2AZ4A 2P5SA 3H5IA 2H54A 4PBSA 2P3OA 3KIPA 4UFNA 5KQLA 3A3OA 3TN7A 4I4NA 2PGLA 3F78A 1Y3CE 5A62A 2WWTA 1M2HA 2OCKA 3GLSA 3K09C 4K9SA 2VRWA 3L6EA 4CIDA 1XMIA 2L0XA 4XWYA 3Q11A 1BGWA 1SA0A 3G49A 3UT0A 2DULA 2FNAA 1XTSA 4GQBA 1XZKA 1X8XA 2HRDA 4L3OA 5E4FA 1UPTA 3CKKA 4AECA 1E7MA 4GOMD 2JGRA 4JR1A 4BUJA 3GJRA 4XOUA 1G2OA 1Z45A 4MUXA 4QBFA 2V1UA 2VQDA 3U6KA 2IUSA 1PEAA 4AMZA 4GLBA 2Y27A 1A8SA 2YQZA 5G1PA 3V3TA 3ZDDA 3THYB 1NRXA 3L9WA 2WSSA 3KCQA 4DMMA 2PVSA 5EE3A 4E5VA 4ETIA 3G85A 2O23A 4IEEA 1Z25A 1FY2A 1HQKA 2FP4B 3I2IA 4DJTA 3GEPA 4MWBA 3CRZA 2QZJA 1I2MA 3H7IA 5D1HA 2W37A 5KJCA 5ANRB 2PMDA 3EODA 1XKLA 4CW7A 1N6HA 4TGLA 2DH5A 1M73E 4TLAA 4TSFA 1Z0JA 3G1TA 5AK6A 1F0KA 5IU6A 2H7YA 3FWNA 4GSLA 1A8PA 4UNRA 1NI4A 3F8WA 4M1TA 3QU7A 1H2HA 4B6GA 1UXHA 3IPLA 3EUAA 3PR3A 4GX0A 4A2QA 2R11A 3SBOA 1D1PA 3ASVA 5E1DA 5FP0A 2RG7A 4NE7A 2N1BA 2VKQA 2AQ8A 1IEQA 3A4YA 2SECE 2J5KA 2QN9A 3QOFA 4G5HA 3TIIA 3ZV6A 5C37A 4HWKA 5H3LA 1BVUA 5FADA 5K4HA 1QP7A 2WVGA 3BHIA 3LP8A 3BMCA 3E9ZA 1JXQA 3HEAA 5AHWA 1RTKA 1UK8A 3KSUA 4XDZA 5F35A 1OXMA 1SRQA 4R8KA 2X5NA 4BNKA 3JATB 4D5EA 2H2FA 3E2PA 4GX1A 4E70A 1J2UA 2NO4A 1ECLA 1T6ZA 3NYQA 5ERXA 2FWBA 3K9QO 3TX2A 4YUWA 5C2JB 5M5BA 1QHXA 2PFSA 1SG6A 3DEIA 2X8JB 2GNAA 4C7JA 2R6GA 3BGVA 4AVYA 2QM8A 1QRUA 2EAUA 3I9V6 3QVOA 1P4GA 1T2DA 3E4DA 3TSWA 2ZI9A 3C43A 1SULA 3RSZA 4HUQA 4KGVA 4OLFA 2GN2A 3OO1A 3K6SB 4L5IA 5EKSA 3SE0A 1PJ8A 3ZR4B 2FDCA 5C4IA 1WSDA 3A9SA 5D2CA 4H1VA 2Q3CA 3RU9A 1U0TA 1C4KA 2PRSA 2VXOA 4U5XA 4W9RA 4EW6A 4PZUA 3MRVA 4Q4LA 2Z3VA 1OH6A 2VNKA 2CEAA 2ZUDA 1ZGZA 3PC2A 3GUCA 4MYTA 4ZCSA 3I5XA 4OD0A 3CRMA 5JO9A 1KQPA 5BMVA 3PIDA 3QQ5A 4D4IA 3AKEA 1A8HA 3N2IA 2V9CA 3WGNA 5HJEA 4IJ5A 1Z6YA 3WB1A 4N7BA 5FTLA 1NLZA 1NU6A 2NVUB 5LA6B 3N2EA 3EH2A 4OB7A 2J5QA 4U63A 4A8JB 1HLDA 4XWTA 4MARA 2J7KA 1XD2B 1ZISA 2D5CA 1XYVA 2ZRFA 3T1QA 4CKBB 1ZWLA 1XQWA 2JJQA 2O50A 2HWUA 2PUHA 2R6ZA 3VHRA 3JV7A 3TR6A 3A26A 4B7UA 2IK8A 1OY1A 1YS2X 2WILA 3L7MA 3HEMA 2XGGA 1GZDA 4IDHA 1U9JA 1A69A 5H83A 4GNRA 1E3QA 1T5SA 1DC7A 2ZUBA 2X4GA 3GD7A 4UU7A 4W5JA 5M3BA 4DLSA 5FLXA 3AVYA 2OESA 1BHO1 1K8YB 2QD1A 3MXTA 1Y1SA 3MM4A 5E1MA 3UWSA 1P17A 5C7OO 5J1SB 5EIOA 2W4QA 1GRQA 2FEKA 2GQ0A 4PZ0A 4R1TA 3VVLA 1GN9A 3P9NA 2TYSB 3ZDXB 4UHKA 1KDOA 4HQ6A 5COQA 3RVOA 4W5TA 4NBVA 2M6KA 4Z53A 1LY1A 5KUTA 3PYLA 2J0UA 2HGSA 2JIZD 3I72A 5BV1A 5P8WA 4BEBA 3V8PA 1DBVO 1X74A 4QSMA 2JFOA 2CXNA 1FDTA 1U3TA 4MR8B 3DXFA 1HR0B 2JLAA 2BHRA 3SOPA 1N75A 2O3RA 4EG3A 3ZIAA 1NNI1 3CU5A 5FOSA 1LW6E 4MCJA 1ZHOA 1D8AA 1T5LA 3FZQA 1FDRA 3WNBA 4DNPA 1CJTC 4BQNA 4JHXA 5LBUA 1NFRA 3GIDA 3H86A 3P9XA 5DBFA 2YXPX 1XZMA 1YACA 1XZDA 2QI9F 3BGDA 3QJGA 5HUJA 2QAGB 4M6WB 3WICA 3EAQA 2ATEA 1XQXA 1WZCA 3W90A 1Q95A 4H1TA 1QP4A 1AK2A 1NUTA 1W76A 1KMNA 2VZ8A 4IIDA 3WLFA 4WECA 2Q0SA 5M7EA 4LCBA 1RQPA 1L7VC 3DJFA 3U61B 1NFFA 3M6AA 3OEHD 2ZRKA 1SVLA 2XUOA 5DISB 3IAUA 1NTOA 4MP8A 4C7KA 1G4UR 2CXXA 4BRUA 1SUSA 1Q7RA 3O8QA 3DW1X 4TYYA 2QRGA 4L7VA 3LECA 5K3CA 3QKWA 1P72A 2PQ2A 1X86B 4J7CA 2JFGA 3NGLA 3STYA 1GQRA 2W71A 4HWPA 2QEQA 4AIIA 3N5KA 2HO4A 4KRYA 3UT5A 4WXHA 5EJ4A 3A3NA 1MQAA 4D97A 2Z6UA 4YRKA 5IRCD 1DXHA 1EIZA 2IUYA 2H1VA 3ADDA 3LIPA 1ZOOA 2PKXA 4EHLA 3X3HA 2CUZA 1RRPA 3R6WA 3IXMA 1FUUA 4YREA 1QS0A 3D6FA 3KM0A 4H0CA 2H2IA 2Q28A 4MVJD 2GM9A 3LDAA 4NDZA 3RFFA 4JI0B 1H2AS 3BRCA 1GV0A 3OJFA 5B55A 5A3QA 1SC4A 3P4YA 3ZNNA 2IUFA 4IXTA 4BFLA 4R83A 3SX2A 3ZD6A 4FW9A 5IYZF 4M55A 2RIRA 3UTCA 1J8DA 1OF1A 4CUJA 1Z3CA 1ULAA 2JLXA 4I55F 3PNYA 1MO5A 3BYZA 5FT9A 1MJGA 3PHBE 3PWKA 1RQRA 2Z2JA 3BTUA 4WACA 3F71A 1G5RA 4DJ5X 1W36B 4Y30A 5FNZA 1W0JD 1K88A 4A0GA 4R6XA 3QVGB 2JFWA 3QIAA 4P4NA 3ZXXA 4X1IA 3QTBA 5EJEA 4CL8A 1H2EA 1UBGA 4EHFA 4EUNA 3Q41A 3O03A 5KNDD 3SDSA 3BE8A 5HKBA 4ZVTA 4YV2A 4D0SA 5CVVA 1AMUA 3EMBA 3VR2D 1JQEA 2RK4A 4FGKA 1K89A 4OKIA 3TZQA 3DT8A 4FW8A 4YR7A 2C5HA 2QLBA 4PLGA 2HSGA 4V39A 4UNQA 3COWA 1QYRA 1RKQA 3RCBA 3L9XA 3TOVA 2Z2XA 3TGLA 3ONDA 5IM5A 1UXGA 2R87A 3AF3A 3JR3A 3TLMA 3U7EB 2BFPA 2W0SA 4R98A 1RZ3A 3WLLA 2BM0A 2HQOA 1N2CA 2VWQA 2ZUCA 5G1NA 1BZYA 2I2BA 4Q1DA 3DD5A 1U94A 3N2KB 4KGZA 2KPOA 1AXRA 1GT91 3PHGA 4TV8B 1JR6A 3V4LA 2FU5C 1FP2A 3QYFA 1TUGA 4OG2A 2Z43A 3D8NA 3IO3A 1QUFA 2VZ0A 4MA5A 4JYCA 3NVDA 1TAQA 2Q1UA 4J3NA 3UMCA 2ILVA 1FQWA 1O97C 3TGWA 3L6RA 4AMVA 3CNLA 2RHCA 5DU2A 1SXIA 2FUG1 2AW3A 1J70A 4LYDA 3K2IA 2BEVB 3BMQA 3STTA 2ZB4A 4JU8A 4IDFA 1MDFA 1JDUA 3FOBA 3MG9A 1S2LA 1K4MA 1J06A 5DYNA 4V1CB 1ZH8A 1HETA 1NY5A 4TT3A 5B58C 4BAGA 4NXMB 3DDUA 5GVRA 1G20E 1H42A 1D5WA 4P93A 1N0VC 2BGIA 3LKDA 3OTWA 2H5LA 1LPNA 3GFQA 3R8XA 1L7MA 2IFTA 3CMMA 3L7BA 5D51S 1FFXA 1H2FA 3QV2A 3WNZA 4YYEA 1RYHA 2GBGA 1ECPA 1V8DA 5F78A 4CQJA 1YKGA 3HFRA 2C07A 3F49S 2VATA 5CLLA 3FRIA 2Y99A 4Q18A 1RNLA 1H1LA 3ST7A 3IUBA 1WDKA 1GQYA 3NTVA 5IABA 2WYWA 4PQRA