1R3UA

Crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
PSPMEDIEEILITEEQLKAKVKELGEMITRDYEGKDLVLIGVLKGAIMFMSGLSRAIDLPLSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Crystal Structure of Hypoxanthine-Guanine Phosphoribosyltransferase from Thermoanaerobacter tengcongensis
rcsb
source organism Thermoanaerobacter tengcongensis
total genus 53
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r3uA00
5K51A 1L1QA 2PRYA 4LZAA 1AO0A 4JITA 3DMPA 4RHYA 4RACA 2WNSA 3EFHA 1I14A 3M3HA 4P80A 1A4XA 1P17A 2JI4A 3HVUA 1ECBA 1ZN8A 4LZOA 5BQOA 1XTTA 1G9TA 2DY0A 1QK4A 1A95A 1HGXA 5ESXA 5JSQA 1ECFA 5IPFA 1V9SA 2YZKA 1QCCA 2GEBA 5KAPA 1OPRA 2PS1A 4OHCA 4RHXA 4RHUA 4X45A 4M0PA 4P84A 1VCHA 4RHTA 2EHJA 1O57A 5E38A 1JLSA 1DBRA 1ZN7A 1HMPA 4QYIB 4TWBA 1A3CA 1Y0BA 1MZVA 3MJDA 1A98A 1XTVA 1P18A 3OZGA 5HIAA 3DEZA 4ZFNA 1TC2A 1ECJA 2H07A 3GGJA 4FYMA 3GEPA 1XTUA 5IAOA 4X44A 3QW4B 1U9ZA 4RAOA 1XZNA 4P3KA 4WMLA 5KAMA 4Z1OA 5JV5A 3ACBA 3G6WA 2H08A 5EUCA 3MBIA 1ECCA 1QCDA 1ZN9A 4LYYA 2FXVA 2H06A 1L1RA 2AEEA 3OHPA 2P1ZA 1G2PA 4F8EA 3ACDA 4M0UA 1I0IA 1VSTA 1JLRA 1PZMA 1DQNA 1Z7GA 2HCRA 3ACCA 5HKLA 1VDMA 1QK5A 1DKUA 1O5OA 1OREA 1UPUA 1YFZA 4MB6A 1UFRA 1P19A 1IBSA 2JKZA 5BSKA 4RV4A 3N2LA 3LPNA 4KN6A 1J7JA 2IGBA 4RADA 1I0LA 1QK3A 4P82A 1D6NA 1ECGA 4P81A 3LRTA 5ESWA 1I13A 2XBUA 1I5EA 3DAHA 4JLSA 4WN3A 4PFQA 3GGCA 1BD3A 1NULA 1G9SA 1G2QA 1WD5A 4IJQA 2JBHA 4RQBA 1BZYA 4RAQA 1A97A 1LH0A 1XZ8A 3KB8A 1UPFA 2E55A 1GRVA 4RANA 3O7MA 1CJBA 1QB7A 4S2UA 4PAWA 1U9YA 4RQAA 4QYIA 3OZFA 1STOA 1W30A 3H83A 1R3UA 1DKRA 1A96A 1FSGA 3NAGA 1TC1A 1BD4A 1GPH1 4RABA 5BRNA 1QB8A 2JKYA 1P4AA 1OROA 4LYGA 2VFAA 1DQPA 5BQPA 3S5JA 1NONA 2C4KA 4LZNA 4M0KA 2PRZA 4P86A 4P83A 4QRIA
chains in the Genus database with same CATH superfamily
2G9NA 2A5DA 4INPA 2HLNA 5D51S 3T3NA 1WO8A 2ZUCA 2QRUA 5CU7A 2WNSA 1GEEA 2H8KA 3EFHA 3H7AA 4CI9A 5K7SA 1PQPA 5EMLA 1QU3A 3L4BA 1FFXA 1UIMA 1ZRHA 2QI9F 2X4IA 4PZUA 3IP8A 2B3DA 3MMPA 3E84A 4KXNA 3AEYA 4XUGB 4OHFA 5AW9A 4F8YA 2GVDC 2Z0MA 3BN3A 3COZA 5KYXA 3M2TA 4GO1A 3TTXA 1JR6A 2C0CA 3DL2A 5FBZA 3PFBA 3TXYA 5AVYA 1H2FA 4DR1B 1V6SA 3F7TA 4MKHA 3WVNA 4ARIA 1U2DA 4FGWA 3VR6H 4XCVA 3ZQJA 1U0NA 5A4DA 3R77A 3HWWA 3CJTA 3PZBA 5ITSA 1CFZA 1I33A 4I6GA 4AMYA 2AE1A 4G5QA 3RHSA 3BGOS 4Y67A 1JJ7A 3FNRA 1P18A 5EWMA 1U3DA 3BYZA 1RYZA 4O2RA 5CYFA 5B4UA 1I7NA 2EWVA 4INOA 4KWCA 5MF6A 1JF8A 1L9KA 3IEPA 1H4QA 3S28A 3HBAA 3T34A 1FRNA 5JHHB 3FLMA 4CL8A 4JHLA 1GGHA 2JL1A 5DHUA 2G04A 1EWYA 2NYRA 2P4UA 4ND4A 1CJKC 1ZU4A 4DCGA 4ZGWA 3R0ZA 4XSGA 5C1DA 5JXHA 1DSSG 3ZTWA 3DXXA 2H4ZA 1A9RA 3NRCA 4UMEA 2QX4A 1DS6A 4YJKA 2HA2A 2UZ0A 3IAS1 1TK2A 1AKYA 2QNRA 3WIEA 4KR0A 1SXJA 3QG1A 3C48A 1EXNA 1K63A 2MYPA 3MWFA 3VPHA 2CJXA 2BJWA 3LT0A 3BQNB 4LPKA 4R6XA 3DB2A 1XTPA 3NFRA 1F5SA 5H16A 3SY8A 4FR2A 3K72B 2FSSA 4IV0A 3BUSA 1QV6A 4QLBA 2QROA 3CVOA 4OYHA 4UQLA 4C0HA 4JXXA 3HGTA 1N2CA 3CTMA 3FNHA 2D8MA 4MHOA 5TARA 4CYMA 4BU0A 3R75A 3SEFA 3WBFA 3TW0A 1DJNA 1GAJA 2NTEA 1ZM2A 2H29A 1LI5A 1RAIA 2HCJB 2QN1A 3IBFA 4NEHB 1HFEL 4AO8A 4DR3B 3EEOA 1IIRA 1LQTA 2JIRA 1ZA1A 1A4RA 1Y6RA 2GVNA 3EMBA 3MERA 4Y2XA 2IZ0A 4P92A 1RZRA 1W88A 2C59A 2EAUA 5L45A 3PJEA 2IXDA 4B48A 5IHPA 3OM8A 2IZ1A 5ADHA 4O4IA 2ZKLA 5F33A 1DAEA 4X85A 2FZ4A 2PVPA 3EIXA 1S2MA 2L19A 4PZDA 5DM2A 1LUAA 5CTJA 3C7KA 4QVGA 1U0GA 4EF5A 1FDUA 1ZL0A 1FYEA 3L7LA 3QFTA 5CX1A 4RSHA 4HYQA 1XAGA 1AIPA 3ICCA 3S1LA 1VA4A 4BNYA 2W2KB 1Z0JA 1D4AA 1MJGM 4AWXA 5JS8A 2QY6A 3WSVA 1ODJA 5T4HA 3TIGA 1BX0A 4AX8A 2BCJQ 4UD2A 2V9PA 2XGMA 2QN3A 4HO1X 4JB0A 4MEAA 2IYWA 1C3EA 5ARDA 3UQZA 1APBA 2IOFA 3RUHA 1Y8RB 5T64A 5JCJA 1X7ZA 4PV7A 1SWVA 2V7QD 4GC5A 5LB2A 1SUSA 4KYUA 4K26A 3V1KA 3IELA 3ZV4A 4AJHA 4HNRA 4EHFA 1BW9B 4DNXA 2W6QA 5D7BA 3JAMA 1QG4A 2FVXA 2POQX 2WIBA 4FYWA 1OZHA 5REQB 1PYGA 2RGBA 3I1IA 4GPTA 4ZO7A 4XWKA 1A5ZA 521PA 3HJRA 2A5LA 2XECA 1QMGA 1XLUA 1JE0A 2BGRA 2O9JA 4G4IA 3TX6A 5CBPA 2NMVA 1L8QA 1YBVA 4CCAA 1XMIA 4L72A 1MCZA 3RC2A 1DKQA 4RHCA 1U7ZA 1KJQA 1G20E 2QTFA 1EM6A 1EX1A 3PGVA 2JFWA 2HSGA 1W59A 3THXA 1GU0A 1G8KA 1Q6YA 3EZ7A 3KSRA 2YXLA 4OHCA 3B89A 4F92B 3I2FA 1E1RA 1Y3AA 3Q98A 1GTRA 1H6CA 1NXXA 5AJXA 2OZLB 5BYKA 3OP4A 1DO0A 4E21A 1F51E 1ZQ1A 5ITZA 3LV8A 1HT0A 2FPRA 1EDBA 1C30B 3DDZX 4NPAA 5CYGA 3RJ5A 1W5EA 4IAOA 4XB6B 5HR5A 1O96B 3RTEA 3SSAA 3S2EA 4C14A 3C3CA 4LRTB 2I5PO 1TXGA 4JI1B 1N0WA 5TQ2B 4OI0A 4YRPA 3V8MA 2G0TA 4IO1A 4II3A 1O4WA 2CBGA 3WL4A 4FSXA 2HCTA 3A0RB 2CLEB 4QULA 3HADA 2KSQA 4B2PA 1X0XA 4K88A 2C5GA 1EFPA 3LPMA 2BP7B 1OKKA 4LTMA 4BWYA 1E2LA 2GJSA 3DBRA 3PK0A 3ESAA 5DM1A 3U39A 1T4CA 1G0NA 2WSIA 4EKDA 2AFRA 3TS1A 4QRHA 3P2MA 1D2GA 3HKCA 4KNVA 1AN9A 3CRQA 3LQQA 3L6UA 4CLXA 3LTNC 1EVYA 3AR5A 1F8UA 2GCEA 5DVZA 5A5EA 5B12A 4ZJUA 1PUIA 4ZZ2A 3WTBA 1TQ4A 1ZQ9A 2J46A 1FNBA 2Q45A 5FUBA 3UMJA 4D4HA 2PQMA 3ZIUA 5HZMA 3RS8A 4D92A 1VFNA 5ED0A 5BR1A 4O0LA 3ITKA 2NZ2A 1R0CA 1XKXA 2IE8A 4H6WA 2BN4A 3GT7A 2JGMA 3QX8A 4ZJYA 4P4UA 1NN1A 1BD3A 3T61A 2K7FA 4EJ0A 4ZA2A 3FOEC 4ZCLA 5AKYA 1IBRA 1YE5A 3HB5X 4DC9A 4AUEA 4QOIA 3JZFA 2P0EA 3O8RA 1PJ2A 2WU8A 4R2IA 3LCUA 3TINA 3A32A 3AW8A 4GWGA 4WVLA 2HU5A 4HGPA 2BW0A 3IULA 4QYXA 2X2EA 1JKFA 2RGCA 2DBYA 2ZS9A 2A9KA 3E15A 3N58A 1TJ5A 2QT9A 2VQ6A 3QWHA 2RGYA 4MIKA 4UQOA 4EENA 4LV6A 1L5MA 2NZYA 1JFTA 4Y9DA 1UPTA 2P7IA 3CX7A 4L3OA 5DISB 5KTNA 1DLIA 2HV8A 4I5GA 1XJ5A 2R00A 3NBAA 3IUBA 1EAYA 4MGEA 3KZCA 3RKRA 3K20A 1LV7A 1XLTC 5CXSA 5COAA 2JHFA 3DMTC 4TKVB 3ESYA 2UVPB 1V8FA 4CKZA 3WC4A 2RGDA 2ZI5A 1E1CB 3PL1A 2CHUA 4BLUA 2JGDB 5L53A 1IWOA 1FTNA 1NBIA 2YCLA 3ENWA 2G4CA 4IXMA 1C1DB 4Z4EA 1PG5A 3FPLA 1VIMA 3R6GA 2X8WA 3QPUA 3ZHQA 3SQOA 3EHDA 4CF4A 3RW9A 3K2IA 5ELLA 3A2NA 2VJMB 4CN8A 1JZTA 4ECAA 5IJ9A 1XZCA 2ZCUA 3FTPA 4LC1A 2VDWA 3FZNA 4JLKA 1PP4A 2JFGA 3HCDA 2NP6A 3BX1A 2OKCA 3DMYA 3MBOA 5KOIA 1UT5A 3WWPA 3UJ3X 1U28A 4FQ7A 3VZCA 5A1JA 1DV2A 1X80B 3ZS8A 2WJWA 2MSEB 4BBAA 2MR5A 1U2DC 1MW9X 1ZPDA 4ASUA 3ZH9B 2ASEA 2B35A 1ZD4A 1JLLB 3TIXB 3VYUB 1BEEA 2AXEA 3RVPA 1J2TA 4GR9A 1Y1QA 1VG8A 1NMXA 2GEUA 3Q1LA 2Z3WA 4F5YA 3FMVA 1P4HA 2Q2NA 2V1XA 1XEAA 3DEZA 4BJ3A 4LJRA 4NG4A 4P1ZA 1KI4A 4QXPA 4J16A 3HFGA 4QXQA 5HCIA 3F78A 2H18A 5F73A 1POWA 4LZJA 4Y9UA 3DEIA 2X8JB 1IULA 4CV0A 1HTBA 2E5WA 5K8UA 1EP2B 5EZ6B 3TLKA 4YUXA 4DQLA 1NI4A 1FMTA 1AZLA 1JQAA 2ZYTX 1WZNA 1U7UA 2JC3A 2IEBA 3N0TA 4RHFA 1K6XA 1N77A 1RAGA 1SXJC 2QVXX 2Q4BA 4PYJA 1ZLXA 3QEJA 2BCGY 4RTJA 3IA2A 3VVBA 4MR8B 1I6WA 1CJMA 1PO7A 1VDMA 4DR6B 1YMUA 3BS4A 4HTAA 3OPYI 1KSJA 2GYWA 3PB3A 1UPUA 2Q8QA 3W4KA 3NZEA 4A0GA 5HZHA 2CHQA 4Q1FA 3F46A 4BC0A 2GUWA 4WNCA 5BR4A 2ZR7A 3G5LA 4FCTA 4Z5XA 5BSKA 5AW0A 3NIFB 3NUZA 5DBIA 1DCFA 1CP3A 1LSOA 2CL6X 2PBRA 4GPEA 5ALVA 3VR3D 3I0MA 5EVCA 3D1VA 3L18A 4FYVA 3F6YA 3T7IA 3WGJA 5ESWA 3U4AA 2RI1A 5J2TB 5J9FA 5BUZA 5I7EA 3K0EA 3Q9NA 4WLUA 4NJOA 3IQHX 3NEYA 3OLQA 4HAUA 1Z2OX 1E3SA 5LQMA 3HI4A 4YRRA 2GBFA 3LNCA 2BGWA 3A6PC 2WZDA 4P4NA 3O9VA 4TMFA 3F6PA 1YCDA 1NZDA 3NPMA 4R01A 1QF7A 5ETJA 2OVFA 4EG8A 4JI7B 2TMYA 1AKVA 4CBVA 4E11A 4CE6A 1OMOA 3V9AA 3CVXA 3HGQA 3RJTA 2H85A 2NNLD 4DJEC 3OZDA 4R1OA 3G8AA 1Y63A 2VPWA 1MW8X 4GP6A 1ISPA 3QX7A 1A5TA 1L4NA 3CZCA 4QARA 2GD1O 2V5AA 4PAQA 3GRYA 5DHRA 4V02A 4LPSA 1PW5A 1U1IA 1TM1E 3I2KA 3TTUA 1DV1A 5G4KB 3RVSA 5K3AA 1DEXA 3LCJA 5HXAA 1P9RA 1DQPA 3QUSA 1EBFA 4Q4LA 1YRBA 2ZUBA 2EEPA 1TA0A 2BKAA 4OJKA 5IUNC 5JIBA 4M0MA 5L3QB 3UC5A 2OFWA 1S6YA 1HT3A 1T3LA 2RG7A 2QENA 1NT4A 3U7QB 4F9GA 4IIBA 3GMTA 3HP1A 1ML4A 1TKAA 5K0CA 3WIDA 1HOTA 4QKQA 3K30A 2D0OB 1GNPA 2PD3A 3QBVA 4CMBA 2EJUA 2YC2C 4RS3A 2Z6VA 4KN5A 5LYJB 1NFRA 1XWFA 3LC2O 5JMTA 2ZULA 4M87A 1YR9A 4UEWA 5EPUA 3SAJA 3IOMA 4HUJA 3SQDA 1YZFA 2WWFA 1GKKA 1PW7A 2I9PA 3PC8C 4XZ3A 3JTMA 4XQEA 2H1VA 3LDAA 3OX4A 1E1MA 3W3AA 5TT1A 5BVGB 3SVTA 2UUAB 3MWEB 3Q85A 4G0QA 1RQRA 2A1UB 3KYCB 2TS1A 2WNHA 3GI1A 3LDUA 3SS9X 3X43A 4EPVA 2X77A 3EWNA 4GNRA 4F1WA 3TMYA 4WOKA 3OE5A 1RVV1 1TC2A 3T9BA 3GGJA 4E1VA 1TX4B 1WVIA 3LPCA 2OV4A 2W7TA 4AZTA 3F49S 1ZZEA 3WMRA 1PNRA 1GXSA 3H5RA 2Y1CA 1LBQA 3DE2X 5FTKA 1SUFA 2VLIA 2EBFX 5DSTA 4M8NE 4DG9A 3EPPA 3CH6A 2W48A 2QP3A 3EVFA 3ILVA 2FN8A 2PN1A 4M7OA 2CC2A 3DE7X 4OGWA 3ROQA 2SHKA 2WWXA 1DO2A 3F98A 3EG5A 3LCMA 2H92A 4JWTA 4CM8B 3WAGA 1G2PA 2X14A 4F71A 5I7HA 3RS0A 1CLEA 4ALJA 1KFBB 1W5TA 2CMHA 1RBYA 5GJWC 721PA 5AVVA 2R6CA 1O4VA 3R41A 3WL8A 1XX6A 1AY0A 5CDFA 4MEJA 1X2EA 3VKUA 4TV9A 4BMDA 1KAGA 4QUIA 2QF7A 4PQGA 4E88A 5KZMB 3BZBA 3Q11A 4M4SA 3GA0A 2P91A 2JIZD 5EUBA 3R7LA 4FMDB 4PEVA 4O2BB 3RB8A 4W5NA 3COVA 3WGNA 1GAEO 4KR7A 1DFGA 4C6SA 1UP7A 4NOKA 2E5FA 3PKIA 4EPXA 4WXEA 2ZYDA 5ALDA 3A70A 2OHIA 3NWPA 2LW7A 3D3KA 2BAGA 4L5AA 3O3OB 3ZGYA 4M76B 4ZZ0A 4C21A 4Y7DA 2QM7A 5F23A 4FFBB 1XPUA 4RFSA 3WLSA 3QLTA 4BO2A 3P9QA 3NVMB 3AR4A 3R40A 4FZRA 4AECA 2VWHA 4DVJA 5DNYB 2ECQA 3L5OA 2PCJA 4E2XA 1U02A 2FE1A 5CVEA 1DJPA 3WQHA 1V5EA 4I81A 1MRZA 1CG6A 1WKVA 3EJWA 3HDGA 3R7AA 3RBXA 3TD9A 3L8CA 3U81A 4M6WA 3KEGA 2H59A 4JT8A 4GMKA 4QBIA 1LC3A 1A5SB 3DGEC 3H4VA 4NC9A 5HA5A 2QN6A 4MDEA 2ES4A 3IPXA 2W83A 3C8DA 1Z6XA 3F7MA 4JSTA 1S4QA 2Q3JA 1Z6QA 1ZZGA 1CQJB 1EJ6A 2QSZA 5JECA 1KVQA 3V7FA 5BW5A 4GMDA 3NHPA 2ZRCA 3R5XA 4BV9A 5K0GA 1V9CA 3TRHA 1R0KA 2A1IA 5JJIA 3JD3A 1RWQA 1L5HA 5K6AA 4F3CA 5FTLA 5MFZA 3VNVA 3ZE2B 3PUXA 3E23A 3REQA 5IG2A 4K9KA 3PA6A 3BXFA 2ALJA 2AF3C 4RDHA 4O4HB 5HQ3B 5JZSA 3UMYA 4WSOA 1B1CA 1HFWA 3I73A 1MB4A 1BMQA 3G2HA 1RHJA 3K1YA 3IODA 5B37A 3R6DA 3OUZA 3U4IA 2O1SA 1HNWB 1SXHA 2VUIB 1Y9AA 1XDGA 3M3HA 3QFHA 4KQ9A 2W2TA 4I19A 4PM4A 3EUFA 3O75A 2ZTSA 4R7ZA 3S0JA 4B82A 1JG1A 2RH9B 1YU9A 2CVQA 4K6KA 1XZJA 3L7JA 3T41A 4P22A 2I1VB 3KVRA 4JP5A 4HVCA 1NW9B 1JEJA 1SY7A 1VPEA 2ZJ8A 3A14A 4B2LA 2VYVA 2CD7A 1U28C 4ZVRA 4MI9A 5G0TA 1NXOA 4PQEA 3CGGA 3L9XA 1HEUA 4HQLA 3Q40A 4DV2B 4YREA 2D5BA 4CI0B 2ZJAA 3D7KA 3PPWA 4NENA 3PEEA 4PRKA 3SXUB 3H99A 5HUQA 1FQWA 5JSZB 3RC8A 3KSZO 3IDQA 3KYDA 3MEQA 5SZHB 3QFRA 3RV4A 5A5FA 4WKPA 1VJDA 2FEPA 1VYHA 4BV8A 2ZROA 2AJBA 2V8OA 1H8ED 1PR5A 3GPIA 4I7EA 4NABA 5EUQB 2CNDA 3QIAA 4L3WA 1L7PA 1O0SA 2J30A 3NEJA 3WG9A 5M04A 3X1ZA 1P62B 3CHYA 1DAKA 4J16C 4ISCA 5TIIA 5DHSA 3I2HA 3DKIA 3LP6A 3GPCA 1XO1A 3QBDA 1N34B 4GBMA 5FFNA 1ZK3A 1B93A 1SU6A 1SU8A 3QVWA 4U7FA 3VR6A 3I64A 4EUSA 5I01A 1F48A 2DY1A 4ZCIA 2XJ9A 3ZCVA 2ILTA 2WVGA 1YA8A 2HXGA 4CHGA 5DT2A 4RL6A 2CHFA 2HU7A 1O6CA 1GAWA 4A0QA 3AM1A 5K99A 3HVKA 3VTKA 5A6SB 1AQJA 5LN1A 5M2QA 2YJ5A 1ONOA 2PFKA 5DEIA 5FX2A 5HKAA 2GAFA 2HA7A 1O6BA 3MXTA 1GNTA 2MSWA 2QJFA 2GAOA 3NDJA 2WU3A 4O59O 5TY0A 5FOUA 1JXAA 2PAFA 3KOYA 3W8DA 3ZXYA 1G7RA 3F67A 3EDCA 5BV7A 1DTEA 5ALYA 5E2AA 1TQ8A 1VKZA 4UM8B 4CKBA 5IT4A 2O14A 4W7IA 2CLOB 3QM1A 4BFYA 4I9UA 1CIPA 2DHRA 5KWIA 4P5PA 4J07A 3AFNA 4HWOA 4ZO6A 3SC6A 1ISMA 2CXXA 4MQ4A 2QLNA 4NPCA 1D1QA 2VUHB 3E2IA 2G70A 4KODA 1D2HA 4AKEA 1NVAA 3MUEA 2IWHA 1XLWA 1AKQA 1ZSYA 2NZVG 2XPCA 3DE3X 3OCZA 4I1SA 3TLCA 3VVMA 3GAZA 1M83A 4WINA 1NC1A 2PKXA 5G3ZA 1Z5ZA 4YRDA 3NTQA 1A97A 5JYCA 1CS0A 5FUQA 3K2BA 3RFVA 4O5AA 2DUWA 1H9CA 3UN1A 4L57A 3T5GA 3KKZA 2GHQA 1OVGA 3AP2A 3HY3A 4M1MA 1NW8A 2CBZA 1Z8FA 1GLNA 4DMUB 5C4MA 4F3NA 3L7CA 4AMBA 2VPTA 5CH8A 3DFKA 5EESA 2HDNB 2EWWA 2F1OA 2BY4A 1NJ5A 1GR0A 3DGFC 1E79A 3D0KA 2QUHA 3K9QO 4EGCB 4IY1A 2JFQA 3HVIA 4ROSA 4HR7A 1UMBB 4Y2SA 4CR8A 4US2R 4QQKA 5HILA 2QGZA 3MLAA 5G0UA 1F4PA 4HWPA 1XK7A 1VHJA 4FGKA 3MGBA 1QE0A 2RGWA 1ANKA 3ZDEA 2DH5A 4B7XA 3PQ4A 1H1DA 2CVZA 1K0UA 2C84A 5GIOE 3FB1A 4X6YA 4GRIA 3ZNNA 1LK7A 1MO2A 3LQFA 1ACJA 4JITA 4XQGA 4IILA 2JFZA 2P6UA 4HLQB 2NT3A 3GVIA 1D04A 4QM7A 4MGYR 1XJWA 2BLNA 4XRGA 1F38A 1N2ZA 3H75A 3LX5A 2C9MA 2WUGA 2DY0A 4UXIA 1CTQA 5BWOA 2C54A 5G2OA 1BXRA 1A69A 1E4YA 1VLZA 5F77A 4CNQA 4NL4H 2KQUA 3AVUA 1J7KA 1G4AE 3E70C 4GX1A 1W25A 1KR2A 4Q15A 1LCIA 1FU4A 3NALA 1B7GO 2QG9A 2OMKA 5JTTA 1BFKA 2OZKA 4FOLA 2VNSA 2YOHA 4BCDA 3ILHA 4G4GA 3MBKA 4KO3S 3UW3A 4TOIA 2EQBA 5IZ4A 3JQ7A 2DF8A 2QD1A 2XBLA 3MJDA 3QVOA 4CKEA 5CLJA 2NQ2C 3EMKA 1Z0KA 3MJRA 3PIIA 4MYRA 4RIGA 5CT8A 3TZQA 4DPLA 1OBOA 2H63A 3RU3A 1JEYB 3RFXA 1Y80A 1EVJA 2W2XA 3ZG6A 1E9CA 2AKAB 2Z56A 4MUXA 3FMFA 2FPUA 4DUPA 1P75A 3UK0A 4QVKA 4ENUA 4GSKA 2D1FA 1LDNA 2ZWAA 2DLDA 1XK6A 4KX5A 4KXWA 4DDTA 3T5TA 3FCOA 3R44A 1ML3A 4Y2QA 1UBMS 1Z8DA 4FOOA 2H2IA 4WY5A 4N49A 3RT7A 1GPUA 1NXSA 1QIFA 4RFVA 5KQRA 3UT6A 3FYTA 1DC8A 3SR0A 1FUIA 1KEUA 3DLIA 5SYNA 5DOVA 1NRIA 2LPMA 2CB9A 2O2DA 4AMZA 4EG7A 2ZB7A 3GC6A 5D1HA 3WGHA 4IHJB 4MUFA 4P4SA 5HG0A 4I3GA 4C3VA 3O8BA 2XZLA 1Y3HA 2L2QA 4LIPD 2R1TA 2A4KA 4YBRA 4DLKA 1XYVA 3ZTTA 1F6WA 1KYXA 3R2JA 5TJ9A 4Q9HA 5ALNA 4FIDA 1NQ5A 3S2SA 3BMCA 1V7QA 4YWJA 3WRYC 3A05A 4URZR 5BQXA 1RSZA 1RWWA 1WEKA 1Q50A 2C8JA 2JHAA 2OV1A 2G71A 2PRKA 2XE6A 1D4OA 2A9RA 2JLQA 4FBGA 3A9CA 2ZAMA 3M6VA 3U26A 3HEBA 4V1CA 5IULC 4JU8A 4ZVQA 4ITUA 1IBMB 1AMUA 3O95A 2ZVJA 4DQXA 1C3VA 1W73A 3B85A 1AKWA 1UBHS 5FAKA 1RU3A 2IPAB 2QUBA 3RHZA 3T3MB 3CLUC 5JT1A 1EEXB 3X1DA 4D45A 3SKVA 2BEUA 1V1JA 3A6LA 3BMOA 4R2JA 3BSFA 3R5SA 4XVQA 2YV2A 1NHWA 2OZEA 3DZIA 3C43A 3CQ9A 5IN4A 2QE7A 1FSGA 3DBOB 2P27A 3DV0A 5DNCA 3P9KA 4KLCA 4G4SO 4ZRMA 3OEHA 1VG1A 3TH5A 1RHUA 1CYEA 1BGXT 3K15A 1J1ZA 2P9HA 3LECA 4PLYA 3W1EA 3KXDA 821PA 1PHPA 4PHFA 1ZXBA 4PX5A 2A0KA 2OSBA 3CKMA 1EFRA 1MNQA 3OZEA 5FO1A 1JTFA 1KYIA 5KU7A 2YWRA 2BCEA 4S1TA 3DZJA 4PFJA 3QWIA 4H4DA 1VL1A 1W93A 2YHIA 1L5QA 3HSYA 4GYWA 1Z8HA 2BFFB 2WHYA 2Q6TA 1I2AA 4LJLA 1ESZA 1LEHA 3NTOA 5CH5A 5KBYA 3D7NA 3NBMA 2NO6A 2CXRA 3B6EA 4MVCA 3DONA 1NZFA 5ERGB 1GT6A 2X0DA 2WT8A 4LDPA 1BXKA 1RRFA 4RUKA 4WK4B 5DWVA 1XKTA 5JADA 2PXHA 3CZAA 2EDAA 3KE8A 3LBFA 1P9OA 1EFVB 2O48X 1L7AA 3OE7A 3OAAA 3TW6A 3I5MA 2ECPA 3DEJA 4OUDA 3LBAA 1KO4A 3OPYB 3P2KA 1L4FA 2D54A 4GX0A 4X6XA 5ANRB 4CM9A 1MZVA 1SOUA 2VO1A 4MX8A 4C4OA 5EJEA 4UCXA 2H51A 4KDCA 3ETDA 3GJ7A 3JQRA 2X7HA 3T1HB 5FYQA 2XEXA 4HAXA 4QBFA 4E3ZA 1T10A 4L0DA 3P2OA 3HR8A 4DPKA 3DQPA 2DR2A 3VBCA 2RB5A 2VNIA 3G6WA 3U44B 1P74A 1UEJA 2BJVA 2ONZA 1I10A 4LNAA 3PFNA 2XD4A 1HSZA 2OFFA 3FZEA 4AQDA 5K3OA 1B15A 4LYYA 5KNBH 2JEOA 2J08A 3QTBA 4YECA 4BRSA 5K3CA 1KZ9A 1MO6A 1XEFA 2W90A 3B1WA 2YVUA 4BWVA 4B34A 5GWXA 5AXCA 3M8KA 4YDRA 1V0JA 5HCNA 1JECA 3MAAC 4URUR 3LBYA 1OXBB 4DJAA 1ELOA 3RUCA 4EAQA 1QHIA 1O03A 1S4MA 1W1WA 2B7BA 2XUIA 3ZHXA 4L4ZA 4EVQA 3ICQB 1BMFD 4TXJA 2IIVA 1C1XB 4YV1A 3HU2A 3UUGA 3GLGE 5JJLA 3UJ8A 3WQQA 1SU4A 2W00A 5HHTA 1EUCB 4CFZA 1BGVA 4AMVA 3N28A 2Z58A 2ZFUA 5SZJA 5EI5A 2QI9C 3TK1A 2VOEA 1BKDR 1FYDA 1G20A 5DMXA 3CR3C 3LRTA 5DM4A 2PQ6A 4JBGA 3I9MA 2ZJ4A 2MMGA 1CY6A 4MJ3A 4CL3A 3MCTA 2DH6A 3GLFE 4C9BA 4HSEA 1Z37A 3H1FA 1AT1A 2GD2A 2Q2VA 5FI3A 4IVRA 3WV5A 1X92A 1UXIA 2AW3A 2M1ZA 4DC0A 4HDRA 2MDTA 1GP2A 4O4IF 1C3LA 2GRJA 4OV6B 3TNDA 4CTKA 3AFOA 2F48A 1RWNA 3GP8A 5JJ5A 3OPNA 5E7JA 4MA4A 1OFHA 3OZWA 1VL0A 1IM5A 3BE6A 4ZAYA 2R8ZA 1MHPA 2XF2A 1R6DA 2PX4A 3FVTA 4OXXA 5B58T 1UBTS 5E2IA 1VGRA 4XUDA 4LW8A 3DCJA 1IQRA 4WNAA 5D84A 3LWZA 4DLLA 4WPGA 1JDSA 1R9JA 3NAZA 3WMFA 3ZK8A 4XD2A 1Y6FA 1NYRA 2A0UA 3W06A 1M1YE 2RI6A 2Q4RA 3TVYA 4F4JA 3HWRA 1Q1ZA 2X8BA 1JA1A 1YAJA 1WB9A 3GLRA 1WNFA 4NAVA 4KE7A 4O1MA 1P81A 1M2OB 3C74A 1BWPA 3D3WA 5AP9A 4WA7A 5AM4A 1R8SA 4D9NA 2PJRA 3LWDA 3DDHA 5JATA 1WB4A 3IDAA 3BIFA 3OSZA 4B7UA 2OZVA 3OJ0A 3CGWA 3AONB 4BB9A 2A0XA 5IJXA 4DQUA 1GNSA 3C16C 1UM9A 5LCXA 3C8MA 2NU9B 3AB7A 4G36A 3NOQA 4XQ9A 5E6RB 3FFAA 5CAEB 1UWVA 3K4PA 4KTVE 1GSOA 3ZZMA 3FPHA 4LGYA 1NNEA 1UBNA 3WJ1A 4BDSA 2JLXA 2WP0A 1CLUA 1AX9A 3V8EA 1FBTA 4UDNA 5K4AA 2VBIA 3HJUA 2AZXA 3VMMA 3EWAA 1TKBA 4LRYA 4F2GA 4FYIA 4HATA 1JLKA 2JVKA 3HFRA 1SOWA 4OJMX 4J4BA 2G25A 2H0RA 5FOVA 3I2GA 5FTNA 2JLVA 2C3UA 4MRRA 3QEAZ 2W6NA 4H9GA 3O91A 4OMUA 1QNLA 1WHSA 2V3VA 2RH4A 4JP8A 3A7EA 3JWGA 4M55A 3BDIA 3UB2A 3KZMA 2QYOA 4TTRA 2AC7A 3BTOA 3Q0TA 4MDYA 1X3LA 5IBRA 1JXOA 3DWIA 3UH0A 1R0YA 1CZKA 1YNOA 5ALRA 1YL7A 3EVZA 4QU9A 2VK4A 1FC0A 5H02A 5BXQC 3W79A 4B6PA 4AL4A 2ZKIA 3AI7A 1KQNA 1AQYA 5AJWA 5F7JA 1JR3E 1PLLA 5CA1A 5JSUA 4GGPA 1V37A 4N6OA 3HQ4O 3IBYA 1AB5A 4TSRA 2JJ1A 3LQ2A 4UM9D 2YDYA 2AWNA 3DNFA 4G1CA 1I94B 4EKGA 3KKNA 4I55A 4MW4A 2C2WA 2EFYA 4MLDA 1ONPA 2OCXA 3G2NA 3SI7A 1H3NA 2GOYA 2IHZA 3DDWA 4ZT4A 1XKQA 1FDOA 1KIMA 3FYDA 3HC7A 3NTLA 1PX2A 3RGWS 4KIJA 1VRCA 1RMTA 1Z45A 2WWHA 1CCWA 3KT0A 3RUPA 3ZHOA 1GPNA 3GRRA 4QTZA 5BR7A 4PBRA 3MTEA 1CY2A 4BPRA 2D5IA 3OCUA 2VRCD 3ED1A 3HB0A 3R3YA 2B1QA 2I1LA 4Q4JB 3TQHA 3VR5D 1UZMA 2ANCA 2WWWA 2XWQA 4G81A 2AN9A 4M49A 3OLXA 3ZGZA 5AUPB 1DBWA 4OL0A 4U8HA 1SPBS 1DO8A 3AB8A 1RWKA 3K0AA 2OQRA 4XEUA 3N2KA 2C94A 4YRIA 2PSJA 4P36A 4OFXA 1XZPA 1M74A 4R8SA 3MHPA 4MI3A 3UOAB 3GJZA 1H6BA 1KDTA 3OKAA 4GM0A 2HBQA 2BFCA 4LY9A 4AMGA 1QFJA 1H2WA 3ZY6A 4CPDA 3TKLA 2Y0BA 1XU4A 1U2PA 4YXFA 1FRZA 1PJTA 2I6FA 2QKYA 5EE1A 4A36A 3GFPA 1KDRA 4M60A 4B2YA 2O3QA 1S9DA 2MINB 2C9CA 3I1JA 4C22A 4ZI3A 1E3DA 2GCPA 2HA5A 4US0R 3NMUF 3A28A 1UBFA 2VKTA 3EUWA 1OROA 3DBVO 5TPZA 1GUYA 2XMDA 3NHLA 4TS1A 3ZDAA 2ZAYA 3HCOA 5DBEX 4IVQA 4HT3B 2G6TA 4MULA 3H5TA 3NBZC 2FN3A 4V3BA 5E95A 3Q6IA 3IO3A 4YXWA 2X9GA 5IW8A 2PH7A 3A37A 2WAYA 3NVKI 3BCUA 4M8KA 4BVBA 5KEIA 1TL7C 3HVUA 4EJSA 4DJFC 1L6IA 3ZBUA 1CX9B 4WQMA 4Q3OA 5I7VA 4J3NA 1V4BA 2OYCA 2VJQA 5JY6A 1CK4A 5LMZA 1JQLB 5JR3A 3U4QA 3VM6A 1HBJA 1A7KA 2N46A 5SY4A 1FVFA 3RT9A 3TLEA 1J2JA 2H7CA 3IRVA 4Y1FA 1KYYA 1L4HA 4CT0A 1XMQB 2BV3A 1Z4OA 1ZVJA 2V7XA 4QQRA 2ZBRA 3NANA 1P5RA 4URHA 4EB8A 1IJBA 1QTRA 1PD0A 2CEKA 2HHLA 2HXSA 4ZDIA 5C1PA 3DD1A 5I3ZA 2QW8A 1JS1X 2CZGA 1SM4A 1BE1A 4N1AA 2A5JA 1OC4A 2ZITA 4XTCS 2ZR0A 1TYZA 4ODIA 2XXAA 2GLXA 5AXDA 1XMVA 2ZYWX 1DIOB 1AKNA 4E09A 1MDFA 3CVVA 1N4AA 3MTDA 4GS5A 3ZJ5A 4DPMA 1SBCA 3ZXUB 2E82A 3ABSB 4IVNA 4N12A 4NHOA 4A92A 3VJLA 1BW9A 2PPLA 2YS6A 5REQA 1XT6A 4P3KA 3TECE 2CYCA 3NYQA 4CUKA 1ZNZA 2HK8A 1P2VA 3AKDA 1G1MA 3UO8B 4GI1A 5DRYA 3OOSA 5AOBA 5AYVA 5HOQA 4HZUB 4W5RA 2YYSA 2O20A 4F1JA 4L8WB 3WLQA 4R4JA 2H4XA 2ZSIA 3ZZNA 1T3TA 2WTUA 3SC3A 3WYGA 2GZ3A 3PQ7A 4OA5A 1P73A 3AM3A 4N03A 1JVNA 5EMKA 2ZRHA 5A03A 4L5IA 4BFTA 2Q1UA 2ZYAA 4LY0A 1FK8A 2FPPA 3O4IA 3SBEA 3R7NA 3QE4A 3ZE9A 1FW8A 1D5CA 1K3UB 3RVJA 2X42A 1VCMA 1B8PA 1G8SA 1GAQA 1K6EA 4N3CA 3C6QA 4I1UA 1CUXA 2B2CA 4B87A 2CK3D 1QHHA 1JH9A 1IQ0A 2B1IA 1RAFA 4ID9A 3HSKA 5GM2A 3RVKA 2NUBA 4FLMA 5TMDA 1KJ8A 4C7KA 5LZ2A 3O93A 3SJZA 3HLKA 1IZ9A 4EW6A 1Z34A 4NU0A 3BHNA 3GJQA 1Y5NA 1QGZA 1E2PA 2M2IA 4WFQA 5HDBB 1US8A 2ZIXB 2REQB 3TRJA 1ID8A 1Y3BE 5K0TA 3S27A 1I1NA 4NYIQ 4HX9A 3FGZA 3UF0A 1M8GA 2VP2A 5BN4A 1DRVA 4MAFA 4EJ6A 3RYIB 2Z8YM 4TMVA 2OKGA 2JH9A 1WU8A 2J31A 2LNDA 3TQRA 4LWQA 2IHNA 4OGGA 4F8JA 1G60A 1ECPA 4C0WA 2E6UX 1W6UA 5JD4A 4AM8A 4F4CA 2JCYA 4B3RB 3VO2A 3BDVA 2BM1A 3ZHZA 3LOPA 3HZZA 1L5OA 2B69A 2FEKA 5JFOA 3PC2A 1AHHA 1J25A 1UMCB 4B3SB 3EGDA 2W11A 3PNLA 2YHAA 3M5DA 1GQSA 4FDTA 4G67A 3N76A 4Y98A 5JARA 1GCIA 3MT7A 4LRUA 2GRAA 1GQOA 3MT8A 2B98A 5KNDH 1SAYA 3FYSA 4IFBA 4P54A 1GGFA 1E69A 4B6QA 5BYAA 3OPXA 1Z82A 3QMPA 4HJRA 4Z0NA 1VL2A 1E3WA 3NETA 3D6AA 5FV4A 4BIMA 2BBTA 2AX3A 3B9BA 4MS1A 3D6UA 4LZZA 2OQ2A 2GBLC 4PAGA 4Q1CA 3UNXA 4L02A 3K5PA 5P21A 3HO8A 1I2ZA 4S1NA 2X1LA 1UKAA 4KACA 3IIIA 3LFTA 3OU2A 4JI2B 1Y9JA 3A10A 1DGQA 1VBFA 3GEBA 1QO0A 1FW6A 1U3GA 3IYLW 2LTAA 1JW9B 3GEHA 5E1OA 4ZRNA 3BK1A 5DNVA 5JW6A 1V7CA 3BXPA 2IY8A 4TKVA 1E18A 1G3UA 2GFHA 4DUZB 2UVPA 4Z0HO 4KWIA 4B3GA 1X8LA 3NBYC 2HUNA 4BNVA 3HVRA 1VMIA 1MV8A 1WRBA 1UDRA 2YXNA 1UJ5A 4PRLA 4R9NA 4ABTA 2BGJA 3EN0A 1LTHR 1IM8A 1Q20A 1XRNA 1N2EA 2G7MC 2LRHA 5B4TA 1A88A 3P9NA 2DBVO 1BDJA 1S89A 5EZSA 2O59A 1CPYA 3SIPA 1BS9A 3T5DA 4JJ6A 1GYRA 4U6QA 1FP4A 1LF0A 2HRQA 1N5DA 4KIWA 1P7YA 2VAWA 3DOEA 4W8GA 3TL6A 2VSFA 3ZDBA 2WJIA 4RD6A 3BEDA 3FTNA 1KFJB 4ZI5A 3VKFA 3PE4A 3IBSA 1ZKDA 3WIUA 4BVEA 1HE8B 3PXAA 1R37A 3KTDA 4OK3A 1X80A 1KOJA 1T1RA 1UT6A 1XCLA 3TFOA 1EYZA 2CGEA 4ENRA 3ZDDA 3QVLA 3B7WA 2QJWA 3DUFB 3MGCA 5KCMA 5A5GA 2E89A 2IS2A 1KS2A 5JROA 3SX2A 1VMAA 1UZNA 3ANLA 3G9ZA 4L27A 4NVRA 4Y9RA 2Q5JA 1U04A 3TLZA 4EO7A 3LKZA 4WA8A 3UV7A 1LRLA 1R00A 2XKBA 1P4RA 1RYBA 5DTQA 3V7NA 5JLAA 1OFUA 1XMPA 3DVQX 3CCCA 2AMYA 1RXWA 3TEJA 1N57A 2G77B 2YCBA 1SVNA 1UUFA 1MX9A 1I13A 3OX3A 1LY1A 3AKCA 1XD9A 3IC5A 3GGCA 4Q7KA 5CFPA 2JAXA 3GAMA 1IPEA 3TI9A 3SZRA 2ZUEA 3F4KA 5H80A 1Z63A 5FO0A 4II7A 2IIBA 4IG4A 1UOOA 3NDPA 2J59A 2GBGA 2QMYA 2RI0A 4WL0A 4YP7A 3SP1A 4LF5B 3EEBA 3GFBA 2WPDD 5CUQA 1LU9A 3IP1A 3IP9A 4QELA 2DFNA 3PSHA 5TQ0A 4J8PA 1PI3A 1MA0A 1SHTX 1II8A 5LIPA 5ESDA 1GWNA 2R7NA 3K8QA 1U6IA 4M0FA 5HTOA 2OD2A 4JS0A 5DP1A 4ZC8A 1LB1B 4QPZA 3TCXB 3GLVA 1XF1A 4F38A 3G0DA 4MV4A 1OU4A 1JVBA 3HKEB 9ATCA 2Q29A 2WILA 4QT4A 4F5ZA 3LWNA 2WSLA 3OY2A 3SHQA 2OV6A 4Q3BA 4DAOA 5J2TA 3J80A 8GPBA 3R3HA 4IKOA 4ERNA 4A8JB 3V00A 4EW1A 5A3SA 3D6NB 1X19A 1JRLA 2DQZA 2NU8B 3UAVA 3UT0A 1KZ7B 3TLJA 1Y37A 4EJSC 1A4XA 5B55A 2XUQA 3HSSA 3KO8A 5H3LA 2Z6QA 5IAJA 3GGSA 4NR0A 1PL0A 3F3SA 1GEGA 1IUKA 4GOOD 2NVOA 5HRAA 1Y8AA 5AT1A 2IYZA 3BXGA 3JY6A 3QWAA 4J7XA 3ROPA 4RKQA 4JIMA 1X39A 1FUUA 4KFCA 4WBXC 1KPHA 2W6MA 1JDNA 1DG3A 1H2AS 2YZKA 3HH8A 3IAAA 3GLHE 3MJ4A 5BOSA 1NGSA 3W34A 2VZ9A 2SBTA 1M34E 2AC2A 3P5BA 4EQ6A 5IKPA 1OPRA 1OBFO 4XD7A 2YX1A 5F9FA 3PXUA 4GDFA 3HM2A 4OH1A 1CDDA 4AY4A 5L3SB 3N87A 4JJFA 4OHWA 1ZN7A 1TQDA 3PHHA 2ZIAA 4J9UE 1C0PA 4JXKA 5ALEA 5FTJA 5GJVC 4LA4A 3RFFA 3TJMA 4BBPA 1J1IA 3KZVA 2Q0HA 3DXYA 1IOWA 3AG5A 3PA8A 5J43A 3JVUA 3NUQA 4IICA 2XUKA 1BNCA 4B9AA 4V0SA 4AKGA 2ID8A 3EWSA 2WV9A 5LBIA 2OD7A 2G5GX 3OC0A 3RC1A 1ZAYA 4KHPB 1WTCA 5F9HA 2QP4A 3WGQA 4IGEA 1WQ1R 5LD2C 3LGSA 1DG1G 3OCWA 2ZZNA 1OCEA 2VA8A 3I3OA 3LZCA 1WABA 4ZU1X 2DFKB 3WBKA 5LR6A 3K70C 2WJJA 2VWGA 4Q3EA 3R5HA 3BL6A 3RFTA 1PNOA 1Z7GA 4FNOA 4Q02A 1LLDA 4Q47A 1RRMA 2A1TR 3H0CA 1RTKA 4FFWA 4HH3C 5LDGA 2ZSUA 2W8BB 4FYYA 3OZIA 4ZZ3A 1A9TA 3P9RA 3MWEA 1PS9A 1JIVA 1BXZA 3CF4A 1Q14A 2ODWA 3GXOA 5FBHA 2ZE6A 5KOHB 1WY5A 2C9ZA 4KN9S 5KNBA 1VYVA 1PFWA 1EXWA 1GKYA 2VJOA 5J59A 3K73O 4LNUB 1P2GA 2ONCA 3FVRA 3G2JA 1Z4IA 4O2AF 3K94A 4NXMB 4DLSA 1NR7A 2QSYA 2CNWA 2GPNA 3HY4A 2V65A 2XRMA 2I62A 4KH0A 1M33A 2CE7A 4NZPA 2DR3A 2NO0A 5I8WA 4QLOA 3LKDA 1F12A 4G86A 1JA0A 4CMEA 2F00A 4DWOA 2PJUA 1S8OA 5EUMA 3H1GA 4BMOB 5IKEA 1LVUA 1TU0A 1WZCA 2GAJA 3D81A 4CM8A 5LWQA 4EX6A 3H42B 4OP1A 5JS1A 2C88A 3CKKA 2D4AA 5CHYA 2HRZA 1H5QA 1O94A 2I8LA 2WIAA 3FUCA 3QX9A 5D85A 2QGNA 5EQTA 1P4GA 1SEVA 3Q5DA 4PCVA 5AHOA 2IHKA 4IHAA 5YASA 2F3QA 2FUG6 1EGHA 1SG9A 2HDWA 3PEFA 4UCQA 3ZZ1A 3OTHA 2GBPA 4MQEB 1RPNA 4HTFB 1UDWA 1OE0A 3DPIA 3RHTA 3ROKA 5CB8A 1BFUA 2FR8A 4S1WA 2AVNA 4TUYB 4BQNA 2FPMA 5TGZA 1Z5VA 2Z57A 1U8CB 5D5PA 2PR7A 2Y99A 5A4FS 3FFWA 4LZAA 3VOAA 1UJ4A 1B4DA 1ORTA 5BPHA 3D8RA 4FFBA 4MWDA 4AD8A 3C3XA 3T54A 5KI6A 3RF7A 3RVDA 1QZUA 1SPXA 4DMHA 3DOUA 3OICA 5A4IS 5ICSA 3HB7A 1SKYE 4R51A 1PZGA 3EIOA 4ARZB 4LTDA 1NXPA 1PR0A 4G24A 3VU9B 3H3JA 5JQGB 1YZ3A 5CRIA 3CRNA 3F1KA 2CXNA 2F4NA 3GRFA 3NNNA 3VPCA 4D3DA 1KEKA 2QD3A 4ER3A 4EZIA 3MYRA 2JARA 1Y82A 1B41A 3O31A 1WCIA 3B52X 2WWRA 2EQ5A 2VVTA 3AERA 5K3FB 3JCZA 5JU6A 5FWXA 1JIKA 3AIOA 2VHVA 2OO5A 3A9SA 4BJ1A 4DA4A 2PS1A 1YR6A 2C5FA 3P9CA 2IXEA 1T2DA 4BNUA 1C3OB 2ZUSA 1T15A 4FW8A 1O54A 2P75A 3CSUA 3AVOA 3U2QA 2UZIR 1B6SA 1XTZA 2J4CA 2VP6A 5CT4A 4ZEXA 3OZGA 2FR0A 3MRVA 3FRIA 4EUEA 4FBMA 4IH9A 2I67A 3ZVNA 3EIFA 1H2XA 2H65A 2QDKA 1W36C 4DS3A 4U00A 3EW9A 4KPEC 3R9XB 1ONBA 3ZIAD 3A1TA 4GYKA 4IIJA 2HF7A 2HK6A 2QAGA 4B79A 1YKFA 2V0GA 2AMVA 2YUTA 1QRSA 5J3JA 1J4AA 4DV3B 1KNQA 3O38A 3DLHA 2OCPA 4JUBA 1R8JA 2R2GA 2R66A 4YRBA 4N7JA 5FEUA 1PWEA 3QXJA 2AEEA 4RVDA 2BTQB 3W05A 3ZD9A 4RD3A 4BN5A 4EI7A 5AD1A 4HH4A 1WMAA 3QFCA 2FPIB 1XYGA 1XU7A 3SXUA 1PLKA 1DNPA 4DV5B 4DLBA 2EJWA 5IDVA 4B8ZA 2FDCA 5AOCA 1JMYA 2P4SA 3MRSA 3Q7IA 4EWLA 4NCBA 3W9UA 4JLDA 1Y42X 3SYLA 3UGTA 4LBWA 2JFVA 1UC5B 2R62A 4UKDA 2DMRA 4DLXA 2OWDA 1JFVA 4Q4HA 3SYKA 5K0ZA 5AHKA 1CNMA 1U8YA 4N5LA 4BNTA 2O57A 3LKVA 1KI2A 1NVDA 4PX9A 3A4MA 4F45A 5A9SA 4NMWA 4CMIB 1P7VA 1Z07A 4GW3A 4YP5A 4ZRDA 2ZT6A 2BOVA 1WP4A 1NT2A 2BD0A 3MRTA 1K4YA 5EWJA 1Z4LA 2ZXFA 1PJSA 3UTDA 2ATCA 1MG5A 3AR6A 5LOVB 4KLNA 2V7WA 5A6SA 5EMHA 1EQAA 1SBZA 4Y3UA 4BZPA 1M5RA 4QFBA 2VTVA 4AF8A 5E0KB 1NDUA 2NV0A 3L06A 4D7AA 2HPZA 1OH8A 3V2IA 4X8OA 2H1HA 1TADA 1U8EA 2YRWA 1E3LA 3FKJA 3H6GA 2W4QA 1MC8A 2EL9A 3DD5A 3GB9A 4MDHA 3WK5A 3VR2A 1UP4A 3EAFA 3FPBA 5JZ9A 5ISMA 5DHPA 3DAFA 2XUGA 1E4EA 3HBMA 4TRRA 1EXVA 1BD4A 3QELB 5IEJA 3EXFA 3GOQA 3SF0A 3P4UA 4CXMA 3TBHA 3I9JA 1IJEA 4WN9A 1C4OA 4YMSA 3QY9A 5HGJA 3WRXA 5HJEA 1X77A 1JJAA 3B36A 5CA0F 1J9GA 3OQIA 4LMBA 1KP3A 3FSGA 5C8YB 1PT5A 4DV4B 3NFYA 4LE0A 1JWBB 1LBIA 5DYTA 5FWAA 5IKXA 5EIFA 3S2IA 5EJ9A 1NY6A 4LHZA 3UOGA 5MN5A 1JJVA 4W5HA 3O9ZA 3OQ1A 4AJEA 1S0UA 4Y6LA 4DIMA 3IMEA 3LL4A 2AOTB 3V8RA 4FN5A 3VVCA 2QSUA 1YC5A 2AUMA 3FF4A 3JALB 2DFVA 3NCTA 4ZOCA 5DNDA 4OA8A 3F8TA 1E5TA 4ARAA 4XVUA 2R86A 3DZFA 1IZZA 3WYDA 3CPSA 1Z2PX 3LGXA 4UHEA 1UAYA 3NBFA 4GQIA 2BMWA 3ZUGA 2XWSA 1LBSA 5C34B 4CKWB 3R8FA 4AJPA 3HJTA 5I9MA 2FPGB 5JSFA 1G8AA 3BRWA 4GKVA 3PWSA 3ZWQA 4HVLA 1SOVA 2LCIA 3MD9A 4FB5A 5A4KA 3BT7A 1S3SA 2X4DA 4M1SA 3H17A 2EATA 4RHTA 2R7LA 3H2ZA 3BCHA 1UMDB 5EIBC 2PMCA 3EDMA 4KKVA 1NLMA 5EE5B 4EB0A 1YH3A 2QUIA 4TYMA 3U3DA 4A1OA 3KR9A 2Z1NA 3GDGA 3OD5A 4I8IA 4XQ0A 1A9XA 3JV7A 4RJLA 4DMCA 1DJMA 2UZAA 4JVNA 1E2FA 2UZ3A 4KP7A 1QQ5A 1TECE 1T9ZA 1MDBA 3K0CC 1G17A 4WMLA 2DU8A 5ENVA 2ZYGA 5F1PA 5FOTA 1M1YA 3BXHA 3E7PA 4DB2A 2PY6A 2I87A 2XWPA 3KELA 4TMZA 1CD5A 2GILA 3D8SA 2Q99A 1JQDA 1VPDA 3I6MA 3M4YA 4GUDA 4TN5A 1KARA 1U7OA 2ATIA 5EQJB 3V1MA 3LF2A 4GRDA 4H16A 5FIUA 5KYWB 4GI2A 2G9QA 2BDTA 3L8ZA 4YCDA 2PL9A 1VHLA 3FPFA 1FSZA 4K9RA 3VSEA 5B3LA 3IOEA 2MSDB 5TJHA 1CUJA 4PQFA 2DQSA 3UOWA 5GOZA 3UK7A 3ZTYA 2KI5A 3GH3A 1C7FA 1ORDA 1ZOPA 1A7UA 1OBHA 1FUEA 3F74A 1N5OX 1Y1RA 2RHLA 1Z7EA 5GGXA 3ZDRA 4TWAA 1G3MA 3IXLA 4MMXB 3BORA 4DCMA 5JCXA 5IC4A 1T2NA 3CXRA 2ZR8A 5ECYA 4L9WA 1M6WA 3O4GA 3PRKE 5HBGA 1RKBA 2AXPA 2EJBA 2OY0A 4XM1A 4GZMA 3EXG2 4BB6A 3THWA 2PLRA 2O05A 3EG9B 3M4NA 3QU7A 4ZVMA 5GQSA 4KWHA 4LVNA 1QHFA 1CF9A 4R1NA 1FDIA 4EPTA 1EHIA 1CZOA 4CM4B 4MK4A 5KSOA 3EXEB 2Z1DA 3RDPA 3NVAA 2D5LA 2Q6OA 4BECA 2QORA 2QGFA 3KJXA 4I6JA 1EFKA 2C42A 3VNSA 3WK4A 3ZVLA 1HURA 2NTNA 1GZ6A 1T4DA 1YZKA 4UBNA 3DCIA 3ZI0A 4F4UA 3V4RA 4BNFA 2C4UA 3IMGA 4QTXA 1B26A 1IBKB 2HHHB 1TZJA 1T8PA 4ND3A 5E1MA 4MVJG 1GN8A 2Y0DA 4K05A 5BP7A 1R3UA 1JR3A 2HUPA 3LVBA 4PYLA 4AC9A 5AW2A 3C7AA 1NVMB 3H1BA 1KR5A 1F8YA 1W9MA 1P91A 1VXOA 2FZ5A 2V4UA 1OTHA 1TAHA 3D7MA 3DG9A 3QENA 4PGFA 5DKFA 2PUFA 2AI2A 2OYSA 4RPLA 3VSBA 1GFWA 4X3CA 1TYAE 3Q8KA 1DC5A 1ZVMA 1CRLA 1Z7WA 4ND1A 5E2BA 4ZALA 3S4YA 1FUYB 3O8OB 4DDHA 3ZHCA 4EECA 4JP3A 3RD5A 2NXJA 2X0IA 1P39A 2DCUA 2Q6LA 2WA1A 1E6MA 1W5BA 3FPKA 3I05A 3IT3A 1OOEA 4H1TA 5AUQA 1FU7A 2P90A 1PQUA 1BIFA 1YZUA 3QTLA 3T1QA 5IJWA 5IZCA 1GUAA 3ODGA 2NUTA 1TIKA 3NHSA 4FHFA 1NOIA 2W42A 1NI3A 3LU1A 3O2QB 5UKDA 2LCFA 4TKUA 4BNXA 1D6JA 2OHVA 4J0GA 1UOPA 1XA3A 4P7GA 5I9IA 2DFDA 1QCCA 3H9UA 3H97A 4BVHA 1KOLA 4BFLA 4G0WA 5KNDA 2PHZA 2ZB3A 5AVOA 2XDQB 1T5HX 2XTAA 3BWEA 1V8OA 5FBLB 4ZAZA 3SDSA 4B81A 2R1UA 2YV1A 1G4HA 4YRFA 2Z3VA 5DHFA 1Y89A 5E9WA 5BSGA 4O63O 3GLUA 5EMMA 3ANYB 3QY0A 2R48A 4JAVC 5CLLA 1I7LA 1CJVC 3KQYA 4Z4CA 1YVPA 2AL7A 3NOXA 4QQFA 3G2OA 4RD2A 1RXVA 3DP9A 3ISVA 3MIZA 3UJHA 3VTFA 1KZ1A 3FDFA 3D6TB 3KQKA 1GPJA 3Q3JB 3ZDCA 3L77A 1PL7A 2R5NA 3P20A 1E59A 2JFUA 2YHBA 3E8MA 4BNMA 1H5UA 1OU0A 2QAGC 1YR3A 2XUPA 4MO9A 4V24A 2BFFA 3SZOA 2BHTA 2FMFA 3HPQA 3PUJA 4CEHB 5H4GA 4XFKA 2HT1A 4RPGA 4QQ8A 2XDYA 1FXWF 2HJWA 1X1DA 2FEAA 3P9PA 4JHXA 6GPBA 1OLUB 3ABZA 4CT4B 5HW0A 2BKLA 2O8DA 3KT8A 3SSMA 2C00A 2Q1WA 4AQ7A 4G0PA 2WJ3A 5F3DA 1VMKA 3SYTA 3M5PA 3ZJUA 1U9CA 1EFVA 5JVDA 2IYYA 1SJ9A 5CEJA 3DEKA 4MS3B 4DCJA 2CKMA 3FMIA 2RARA 1W48A 3DYVA 4FR0A 3VPSA 4DARA 4C20A 1RMQA 4N0PA 1FMJA 1Y8CA 5K3EA 1QF9A 5ADUS 3ONDA 1VLQA 4KN6A 4PLFA 3P94A 3O3MB 4TTPA 4X95A 1OX6A 2O7NA 5KVSA 3ZD6A 2QT0A 1VCIA 2P9ZA 2YV4A 3BWDD 3JD2A 3QI7A 3VNBA 4ALMA 2I2AA 1RRGA 3M70A 4FCVA 3DWEX 4NCNA 2PBFA 4KQFA 3WYBA 3SBDA 4EGQA 3K0HA 1GSAA 1USUA 2EJTA 6REQB 4MP3A 5GINE 2IK8A 5FNVA 2X0KA 4QJ4A 4FD2A 3FOCA 1ETUA 3WLPA 3IP7A 5DU2A 2VUTA 3AH8A 4DREA 5CDHA 4A0SA 4PONA 1BA2A 4GLLA 2O5EA 1ONSA 2B4QA 3O7MA 3PXEA 4UARA 5ERYA 1VIAA 1LQ2A 5L51A 4C5AA 4QFMA 1CJBA 4EYEA 4BS9A 2H1OA 2OSVA 4EY5A 1FNCA 4EKNB 3W0LB 1E9BA 4WXYB 3U9TA 1M2HA 1V9LA 3U3JA 2DP4E 1KVUA 2O3TA 3GD5A 2OHXA 1C1XA 4JROA 4DABA 5AW4A 2NTVA 1IDOA 3WDMA 1DKOA 4P3YA 5K4HA 2BFEA 4KBGA 1WHTA 4QJ5A 3V2UA 2I6TA 1WXQA 1F3LA 1Y5IA 3ZWXA 5ALQA 1SNYA 4D0SA 1G5IA 4NF2A 3WRXC 1T9BA 4X61A 2X0FA 3GLIB 1SXJD 4TQUS 2IYXA 1JBEA 1M6VB 2WVJA 5CNKA 5D3ZA 5DBFA 3URKA 1A9PA 4QLAA 1PJ8A 4WFKA 4Y2TA 5ALMA 3B6JA 3SPXA 3UMCA 2YUIA 4XWWA 3MNFA 5KPDA 1DKMA 3T15A 4I14A 1CE8B 4HS9A 3H0KA 5ENZA 1HL7A 3L3BA 4WKNA 3WFIA 2WJVA 1W4RA 4RD1A 3EZ2A 2UXBB 1R9MA 1P80A 5AW5A 2R2AA 4OB8A 2CMGA 1ECFA 3NJ4A 4LZLA 1QQBA 2C2MA 2ZXEA 3OOEA 4KG7A 4PS0A 4C4ZA 4CRWB 2NZJA 3MXOA 3AR9A 3KSUA 4HNSA 4DCTA 1HYBA 4N8EA 1J6UA 1WW3A 2J4DA 1CUEA 2GEDA 4M86A 4QUJA 4YAEA 3AHJA 4RZSA 3WZLA 5D87A 4AG5A 4EB6B 3U16A 2CV0A 1RZRD 1CUIA 1YBMA 1VPLA 2FYTA 2HLDD 3HS3A 1M2OA 3IPLA 2V7QA 3QOFA 4GZLA 4HHEA 3WYNA 1CF4A 3M6LA 3NO4A 1ZIXA 5EGSA 3TLGB 4HBZA 1AA6A 1V8BA 5CYPA 1M0TA 2Y0CA 3ETEA 3ZXIA 1G19A 3UUFA 2CXPA 2MHCA 4OBXA 2IZ7A 3T4UA 3E5MA 4RHEA 2V45A 5G1NA 2VCEA 4ZXFA 4DWJA 3HLYA 3H8SA 3QW4B 4N8DA 2C20A 5JV5A 2JAOA 3NV7A 4LOHA 3MWLA 5G1PA 3RIXA 3UT5A 3F6EX 1IHUA 2OECA 3L84A 4GSLA 3PBKA 5E6RA 4E6PA 5CAEA 5HMLA 2O0JA 2AGVA 1SMKA 2FXVA 5B1DA 3ABQB 3JZIA 3CO0S 4NYMR 3NH9A 1U63A 3I6BA 1YDMA 4L22A 3ELBA 3NM4A 3KM0A 1DC3A 1SN7A 2WFZA 1Y98A 4NICA 5JCJD 2C7OA 2O2HA 4B3MB 3K8OE 3GRPA 4KQGA 3BWBA 2FRDC 3U60B 1I3LA 1V11B 1RJGA 3HJAA 1IZ8A 1PJRA 2A9VA 4JQCA 3TTWA 4PAOA 2ZBVA 2R8XA 2HF2A 3ENVA 4GZ3A 2BI8A 5HGXA 2JF0A 3AC0A 4OU5A 4GI3A 4RPIA 5TV2A 4HAWA 3RQIA 3C1OA 1PF7E 2CXOA 3ZJYA 4NYJQ 4YHBA 2Z2YA 3SC2A 2FGJA 3GUUA 3ESRA 3GUYA 4N6NA 2OFXA 1WSBA 2BMEA 2Y3IA 2Z2ZA 3GRCA 1A72A 2PMDA 3KTOA 4QYTA 2C2YA 1E1RD 3UKJA 1TF2A 4TV8B 3FMOB 421PA 4QREA 4KPFC 1N6RA 3WP0A 4A1FA 4HB0A 3CNHA 4WXRA 1I2DA 3GYBA 3B7PA 3MUOA 3N6XA 2ST1A 4N3NA 2XZPA 1ZXLA 4P5EA 1ST2A 3B9RA 4KRGA 1KMHB 4YT8A 2JGKA 4B7ZA 2XADA 1L3BA 1MEEA 1YA6A 5DTIA 3IURA 1JP7A 2FEXA 1GUBA 2FWMX 1N5JA 4YRCA 2Y6VA 4ZHQB 3WGGA 3MTIA 1R4ZA 1UFOA 2IU0A 3DAYA 5THXA 4EO4A 4MTLA 1LFDB 2PT5A 5KX5B 2P3SA 5DYIA 2ZJZA 3P0JA 5AK0A 5JISA 2CVOA 2IDKA 4I5DA 1OKKD 3PI7A 2IYFA 1RXIA 3HCEA 2OXRA 2WF7A 3MJFA 5WRFA 4Z0TA 1YDWA 1XNHA 4TS3A 4JQZA 3TZHA 1QTNA 1VE9A 4BWGA 1AUQA 4G01B 5IZCC 2EP5A 4YLYA 2XB6A 4U63A 4UXHA 2HJ9A 4HEA1 1BRTA 3M1AA 5JANA 1THMA 2V74B 1G9TA 3E03A 2D2IA 4Y30A 2PGXA 4GE3A 1ZUWA 4LDRA 3A1EA 3PFFA 2XD9A 4EL0A 3L43A 2LD4A 2IXBA 5DTJA 1T8WA 3R20A 1X7DA 1E9SA 1GGNA 4RZIA 3L82B 3LXMA 4RNDB 3T7CA 3KT3A 3Q5EA 1IN5A 3V4ZA 2MINA 3UW1A 2CHEA 3EVGA 1SCAA 2YW9A 3UPUA 4GPIB 1MQSA 4QYSA 1W85B 4WKGA 2DXIA 3A1FA 2QXUA 4G2NA 4QG3A 2FRVA 2HV9A 5FWYA 5LU9A 3KETA 3U3ZA 3UICA 4E33A 1M1NA 4KDEA 1NAIA 1P0MA 3PNYA 3PC7A 1MTZA 3VHQA 4C08A 1HDZA 2RIPA 3QUQA 3RU2A 3CXUA 4E2YA 1FNDA 3QH4A 2QMHA 2IVFA 4PNPA 1DWOA 3BAFA 3HYSA 3NH6A 3SDBA 5FI5A 3ZHSA 1F5NA 1KYTA 2ORIA 4AJIA 2A9PA 4UUBA 2FP4A 4MWZA 2ZJBA 2AUNA 1QLWA 1F7UA 4OHPA 4E2ZA 4DG5A 2IBTA 5IASA 1SCKA 1Q1AA 2H5LA 4GBGA 4AIRA 2ZSBA 4O08A 1I3MA 5BWBA 3U4GA 2C78A 4RM2A 3BICA 1ZVQA 5BT8A 2HU8A 3DVAB 4EKEA 4WGFA 2NUPA 2QZ4A 1BDHA 1IU9A 3Q9UA 4M7WA 2IPXA 3ET5A 4CEJB 4I4CA 1L4UA 3K35A 4JWKA 4BFVA 3KLMX 2C9YA 4FBLA 2GM9A 2PD6A 4PGAA 4EY8A 4B3TB 2FEMA 3NC4A 3OCYA 1CNEA 1G8GA 1IBSA 1ID1A 2C57A 3C4VA 2ILVA 4UEOA 2I2XB 1COWA 1NRJB 1U0JA 3JWEA 2O0MA 2Q5FA 1U4NA 1XRPA 2Z9DA 1T8YA 4OB7A 4EHNA 4M9SA 1P0FA 5ES4B 4X84A 4OLBA 3GLHA 2R6ZA 2IYAA 4QFDA 4FDLA 4G85A 1M34A 1WXXA 4ASUD 4EYGA 3VO8A 2ZSKA 3EHEA 3LO8A 3CEMA 2EQAA 4BVLA 3EODA 4MI6A 4FILA 5LFAA 2QDXA 2W8ZA 4JZKA 1N6KA 2GN6A 3NDIA 4LJ9A 1XZ8A 1E1KA 1T6BY 3A3KA 2H2DA 2ZRLA 5KWSA 2TMGA 3T5BA 3WNVA 2J41A 2XITA 3ENKA 3GBSA 2Q9BA 3GVPA 5HNKA 4TXNA 2EZ4A 3GPDG 4OTZA 5BSUA 3VO1A 9MHTA 1G9XA 1VSBA 2EFCB 3KWLA 4LJ5A 1GTZA 5BQ3A 2PX0A 4J29A 5JAZA 1CV2A 1TJYA 4J76A 2BEWB 3AEQB 4OHOA 4RW0A 3VR3A 3FD8A 1NYLA 4ITVA 4B6FA 2UYGA 4IZOA 4OSEA 4WKOA 4C78A 2JCBA 3GQVA 3W2TA 1KK0A 1U1CA 1N2GA 2VFAA 1V8PA 4BV3A 2P67A 4QUDA 1E6KA 1N1MA 1JUDA 2KBEA 4MIEA 4NFSA 4YDQA 5I4KA 4G37A 3WXBA 1ARZA 3WSTA 1QVWA 2YYZA 4H3VA 2IV3A 2RIRA 2VTBB 3R6LA 2GSWA 2C5BA 3E9MA 1O87A 1CQIB 2VZLA 3C1UA 4HNAB 5HYVA 5I7FA 2X9QA 2REQA 2ZIXA 3O9MA 1QORA 2ZUUA 3FJ1A 4WFJA 3MT0A 3S2YA 2OCDA 3OH8A 4BUZA 2Y4OA 2I0FA 3OPVA 4H59A 4YT2A 2B20A 3WKAA 4AJLA 1QF6A 5B7QA 3KPVA 5T3UA 2Q3DA 4OI4A 1NHGA 3SG0A 3KKMA 5JC1A 3IT2A 1ZK1A 4O3MA 4KQ6A 2ZRFA 3EDYA 3L7YA 5CT6A 5TS3A 2PX3A 4CM3A 2C95A 2BFMA 2QYTA 3LUPA 4P8RA 1GCGA 3JYPA 1Y6GA 3ZS9A 4RCYA 4AUKA 1MGOA 2NACA 3D59A 4YJ2A 1NM5A 1OZFA 2ZRBA 1XRQA 5AKZA 2LV8A 5AR1A 3ZJTA 1PZXA 1TVMA 3ORSA 4H60A 3ORHA 2YN4A 3F3MA 1NVBA 2EEZA 4NOJA 4AG3A 5KU1A 1QIDA 2ID9A 1VP3A 3RBZA 4AU1A 1D6MA 4I4TB 4PZYA 1HZZA 4EA7A 4XH9B 2O2JA 4ND6A 2EDCA 3C97A 3GFQA 4FYMA 4HMPA 4MV1A 1EUZA 5TS2A 4WDRA 1YS6A 1NMEA 2NVUA 2OEPA 1F2TA 3MPOA 3ZN2A 4D6PA 1N9GA 4QZVA 5LYJF 1DVRA 3G7SA 5CR9A 3LLCA 3AF5A 4ARSA 4BMSA 2CZQA 1ENYA 3ZDXB 3T94A 4NMXB 3FOWA 4L9AA 1Z4PX 4PX3A 1D6SA 3T6KA 4MH0R 3D2LA 3QEOA 2QYSA 4DZZA 4K9DA 4EO9A 3BQMB 4BGUA 1EK5A 2RBGA 2AHOA 2VF2A 5CP8A 3C3MA 5ALKA 5L3VA 4GKBA 1ODLA 4MUKA 4CM1A 5D2CA 3RC7A 2E9SA 1ZGGA 2BFWA 4I5EA 4O3FA 3TZ6A 4JR1A 4LRWA 3CT6A 4KMMA 2IITA 4YCAA 4OFBA 1JX6A 3FCSB 4YMVA 3P9SA 1W581 2OM6A 2RONA 1KAMA 1D1TA 3AOEA 4LV8B 2P3LA 1LLFA 2Z30A 1LZKA 1UC9A 4OX9B 3RT1A 1CDEA 3TI7A 2GXUA 4DCPA 3H05A 3ZWBA 2YIJA 3MPUA 1UBRS 3O4VA 4B46A 5CT5A 1NMZA 2J9YB 3IQGX 3L6EA 4JX8A 4EI2A 3CG4A 3OT1A 4IYRA 4Q24A 5AVQA 1WKCA 5G02A 4EYOA 2B8NA 3ZW9A 2B4RO 2O8EB 3A36A 1DL5A 1XTIA 1ZIOA 2BFOA 3CF0A 4KQCA 1L1FA 3V8VA 5KNCD 3N8GA 1FJXA 4XEHA 4BN0A 4KR2A 3BZUA 3JYNA 1SELA 1U0SY 5AK4A 1D2EA 4RTLA 2F3TA 3OZUA 2R751 3HA5A 4MO2A 4QHTA 3HN7A 4QX6A 2VA9A 5P8WA 3S2ZA 3RAPR 4ED9A 2JIZA 3QVGA 2ET6A 1T3SA 2G09A 2V6GA 1L5ZA 3P1JA 4FMDF 3DZKA 4O2BF 3WB1A 5KSZA 1BHJA 4BLVA 3Q12A 4DSOA 2ONYA 1Z6YA 1R0RE 5LXTB 2B4KA 3LCRA 4KLZA 3T5AA 1SC3A 1T9AA 2EOAA 1FLVA 2LR0A 3UATA 1O9BA 5CURA 1LLQA 1UFKA 4X5OA 4PCAA 2NSDA 3DHYA 1K5HA 2GLUA 3B78A 3MRXA 2JK0A 1UOQA 1U3UA 4ZQFA 2CE2X 2CW5A 4LOAA 1NQVA 2R6HA 3RC3A 2BM8A 4QRIA 3RASA 3MSCA 1R4NA 1RCFA 3Q10A 1WOYA 4MICA 1MMFB 1EIWA 1AD2A 3BIOA 1JZSA 1VYUA 1Y9ZA 2YV5A 2YWXA 4D8YA 3N3BC 1RQ2A 2I33A 1PZHA 2VDLB 1RYHA 3O4FA 4Q16A 5C3UA 1PTJA 3IFSA 3HBLA 4FFLA 4KE8A 2F43A 4PLCA 5JAPA 1J20A 3GDFA 1USWA 4AJOA 3ZI4A 1L4MA 4W4TA 3VHLB 4KDRA 3EGXB 4COOA 1J24A 2WP8J 1YS4A 2XB9A 4CQMB 3QE9Y 2LUOA 1YDGA 3EZ9A 1E96A 3OKCA 4C0AC 1B74A 1YJ5A 1XZIA 3GQBA 2CUNA 3EIQA 4X20A 4HFNA 4O4HF 2HBYA 2B9VA 4EGAA 2WYHA 4JY7A 1D0VA 4CG2A 4V38A 4WADA 1BCRA 4TWBA 4L4SA 4D41A 2ZT5A 1B6TA 4JYCA 4U3JB 2ZE8A 2GLTA 1ZMRA 3VX3A 1C9EA 2HQBA 3TIVA 3CLUD 4P6VF 4MWBA 5FUYA 5TMEA 5AVZA 3WOHA 2FE4A 2DRIA 4GVLA 5AQ1A 2ZB4A 3ICPA 3OQJA 3OC6A 3FBGA 3GARA 4XGKA 2Z09A 4C0SA 3LY9A 4QGHA 5BQ5A 3SZGA 3STVA 1QXSA 4MUJA 1DEOA 4QXOA 3AEUB 2QLJA 2CLLB 5IH7A 2Y1WA 3H6HA 1PLJA 1M2NA 3EH2A 3LJKA 5AVXA 1BX3A 4MV3A 1W94A 2FPOA 2VG8A 1EFTA 2Q1YA 3SE0A 4ZMSA 3AF0A 1H8EA 1JSLA 3ER8A 1D07A 2YWFA 5H4HA 4EY7A 1A1SA 1DIHA 2XCUA 2GASA 2VHXA 3LHSA 2HIAA 5L3SA 3Q8LA 2E4YA 3ESXA 3B82A 3PR1A 4X1KB 1C3XA 2QN7A 4ZREA 4HB4A 4WOJA 1ZUNB 3LUKA 2C1EA 3QXSA 4D6XA 3ADCA 4ESOA 1YA4A 1OLSB 2EW8A 1QK3A 5MFPA 2RHRA 1XU9A 1GPLA 2GCOB 3ML1A 3EXG1 1Y7LA 3NNDA 1V7PC 1A71A 3ZOKA 3AB3A 5IJ0B 1JYFA 3ZGLA 4YCSA 4DB4A 3BHMA 2FVYA 3RAGA 4BXOB 3SM9A 2G80A 4MPJA 3TX2A 2RKOA 4KN8A 1USVA 3ZWWA 3MINB 4B1FA 1R16A 2JFNA 4HAYA 4KXFB 4EY4A 3ZHRA 3TB6A 1X74A 2JBHA 4TSKA 5SZKB 2CXSA 5AHRA 5IHXA 2P30A 4J3FA 3NS7A 4E1BA 2XSZD 2M1XA 3C7TA 1JHMA 1FDRA 1PJBA 2A9QA 4ZOLB 3ZV6A 1BC5A 4E2FA 4HCJA 2I6QA 3EZFA 4A2PA 2JZOA 3JARB 3ADBA 1GL6A 3CLSC 3KYBA 5EXPA 4ZCPA 3SF8B 1UBOS 2W8BA 3HMQA 3PVZA 4UEKA 3PHGA 1W30A 2PLWA 2DBRA 2OP0A 2O52A 3VR6D 3ORRA 3EBLA 1VHDA 2BI4A 3UK6A 5BWCA 5LKRA 2BZ1A 3IPRA 5DGCA 4F91B 3T9FA 3FJYA 5AOAA 5AQEA 1T0PA 1YFJA 1K7SN 1P4AA 3ABRB 2G1UA 3F3KA 5ALOA 5BQPA 3EVNA 4C1BA 4Q4CA 3VXKA 2K6GA 2FR1A 3QOWA 3VR4H 3ZWNA 1NUSA 1W4CA 3TQFA 3ZJ4A 2PMBA 5CT9A 4LF4B 4R9RA 1PTKA 4Y18A 1YVRA 4Y2JA 4D3FA 2LGJA 1HG0A 4YUAA 2WTXA 3TL2A 1RACA 2NO5A 1CUYA 1C0LA 1ECBA 3NOVA 4KXUA 3CJQA 3EA4A 4M8LA 4MGZR 4U9HS 4DTCA 2QRVB 5DT9A 3NNSA 5C37A 2OA0A 2KS6A 1CUBA 5H81A 2IZ5A 3OPMA 2BMJA 1JHOA 1TD9A 1XDWA 4ND5A 1SQGA 4RVSA 4RMNA 4I99A 5J2UA 3UANA 1XN1A 3VSDA 4UMDA 3RS5A 4AI6A 1ESDA 2W43A 4R98A 1UPBA 2VH2A 4NJEB 5EWLA 1KXZA 3RRFA 1VPWA 3O92A 1U7WA 3EIWA 4RKYA 4ZI7B 4P84A 3AIKA 5AXBA 3F6RA 3EPLA 4EA6A 5A9TA 4RXUA 4MSUA 1Z22A 1B8NA 1JKXA 3PVSA 4IJMA 2HR1A 2ZR9A 1H85A 1YZGA 1BO6A 1GCAA 1EZZA 3M49A 3G0GA 4QXMA 4UJ5A 4I1YA 2H07A 2H2FA 4JKYA 5LZ7A 4C4XA 3F96A 5K0LA 4AKSA 4DJJA 4G0YA 3UV3A 4GQBA 3IHWA 5KC8A 1CJCA 4YJ3B 2W6CX 2G5TA 4KI0A 2JFHA 1NW4A 1KJJA 4HXGA 2AX4A 2PTHA 3KJHA 4UNPA 1RIFA 3OQ6A 5I3CA 2ZJ3A 4IV8A 4M0DA 1M2JA 3C6XA 4KUEA 4I50B 2G9ZA 4LJ6A 4B35A 3V5NA 1LPNA 2I4IA 1MLDA 5K3FA 4RENA 4BEVA 4OOFA 3VBEA 1RMYA 4DY6A 4TMYA 2V7GA 1NFQA 2NSYA 1UP6A 1YU6A 1XNJA 3PEVA 3L4KA 3ELDA 4G1FA 1GTMA 3OTQA 1Y3FE 2G67A 3S8MA 3T0IA 4Q1DA 5LZ8A 4CF5A 1M7HA 1RIIA 2VT6A 3BSSA 3E3OA 4HPWA 4Q19A 1NC3A 4K2AA 4YJGB 5JTUA 2J6HA 2C99A 4EHKA 4E5NA 3K9WA 3C6MA 1ODKA 4BBJA 4YJFA 1RLTA 1QU2A 2JIQA 2XB4A 2FNAA 5AM5A 5H7XA 5K01A 3PQDA 5IT0A 1BYUA 2XT6A 4JVOA 4BVFA 1TIBA 2PWZA 3EMDA 4UUNA 1U5BB 1OT5A 1WD5A 2Q6IA 3AW9A 3ILXA 3RWMB 2BTQA 4HDMA 2AR0A 2FPIA 3U80A 2XZDA 5LQNA 3IAM1 2G28A 4IHJF 1C3JA 1IIBA 2GA9A 3FUTA 4O0MA 4QDJA 3RFUA 1M1ZA 4BLTA 3CN7A 3NQ41 4EDHA 4GPZA 3RADC 4ENSA 3R7WA 5KQSA 2NP7A 1E2QA 4XB2A 1ZI6A 3Q2IA 5SZIA 5JBIA 1QGED 2QTVB 4Z9BA 2DTEA 1CVIA 1NUPA 1UBUS 3H86A 4FQ5A 2ZUTA 3WFJA 4IQ4A 4ND2A 3BE5A 3UFBA 3ZE6A 4WZBE 1XTJA 3TPFA 1KI6B 1T9DA 3H2GA 3T95A 1IOLA 1ZKMA 2BMAA 2XGGA 3OP1A 4OSOA 2QSJA 4HVTA 3DPUA 3DXZA 1G8PA 3R3SA 1PAUA 5KDOA 3E53A 5K5EA 4CMIA 2IC5A 2WM8A 4TL7A 2KX7A 1GG2A 3D2AA 3ND7A 1N8SA 3PPVA 3M1YA 4UMVA 4P7BA 1ZCZA 2E0IA 2PTGA 4NLLA 1Q1QA 3CTPA 4XFJA 5IBQA 4CTNA 1IMOA 1TMKA 3BRQA 4YRGA 2AEJA 1XEXB 4L76A 4QGAA 4RZXA 2PR2A 2JPDA 4UFPA 4AG6A 3RJ9A 2WFLA 1Y4SA 3HB1A 4RZHA 2XUAA 5L3RA 3VZSA 5HK9A 4ILEA 3JYHA 1LTQA 4AJKA 4C7OA 2RMKA 4BQIA 1EVEA 3AHFA 3F5MA 4ENWA 4A0FA 3NLLA 1Q1BA 2Z98A 1E2MA 1W52X 3G1WA 1KC3A 5TE9A 3RH0A 3PQ6A 3H9BA 4BMVA 1RWMA 3QELA 4BJHB 1P1KA 1W8IA 2QV0A 4CVNA 1GVHA 1DKPA 2JLAA 2Q2QA 2FFBA 1W34A 2VQEB 3VZQA 2QZJA 3GG9A 2EERA 1IZ0A 3R74A 1TF5A 1RQNA 1YQ9A 5LP6F 1U7PA 3IEIA 1JZQA 1TYCA 2WMDA 3DO6A 1JHUA 1XMJA 3WGVA 2J6CA 2WTBA 4EYSA 1KI8A 3U5TA 1XAIA 2JCSA 3ZU5A 2AOTA 5HF8A 3H1AA 4HJXA 4K2HA 4C76A 4K9OA 4MV8A 2POCA 2Q4EA 2CNOA 1PT6A 2SKDA 3BXEA 3JALA 3Q9SA 1DBVO 3PQ8A 3EZNA 3ZXSA 4KEAA 4G0MA 3QPDA 5EXDA 4KVZA 4BLRA 3CZ4A 4H35A 3WOVA 1ADCA 2XNDD 3DYIA 3LX4A 4F60A 2WZCA 1FFXB 3TAUA 3WLLA 3MTJA 2XY4A 4DKJA 2DQYA 1EFRD 2FPGA 4WACA 1YHNA 4IDFA 4RE6A 2I3ZA 2TECE 5DDIP 1RM4A 4B31A 4YRZA 4HKTA 4UAUA 5LDHA 5KDLA 2J3JA 3LQRA 2IH5A 2XNCA 2YJ4A 3RG2A 4Q34A 5KYXB 1UMDA 2NN3C 1J1UA 3QPBA 3FTQA 1OC2A 2AZTA 5AI4A 1QIIA 1IUPA 2VDVE 3EVCA 2WB2A 3TLAA 4ZYZA 4J1SA 2VJDA 4OSPA 2C7QA 3PP8A 4AUNA 1YE3A 1XC7A 3L9WA 4LYAA 2Y1DA 1RJFA 3PHBE 3R9KA 1E2HA 2OD9A 2QLLA 1RJ9B 3OFKA 5B1EA 3FJOA 2YY6A 3E22A 4YGXB 3K9CA 2WPNA 3OE7D 1KAEA 5EKSA 3HV0A 3AY0A 1BE6A 2BFNA 2Y0EA 2W98A 5EWMB 2GWHA 2O2GA 1JU3A 1JR2A 3A31A 2HD4A 1E58A 3LRXA 2PA0A 2E2WA 3JW8A 1V4NA 1B0UA 1QM5A 1CHNA 2O2EA 2DWQA 2ZW9A 1BMFA 4TYQA 4Q1EA 1CR4A 3QYPA 1HEYA 4KQIA 4MVJE 3PUIA 5HCUA 1S2IA 1T6NA 1DKRA 1B6RA 1VJGA 4OMCA 5B7NA 1U0EA 3UIEA 1UKZA 3KAKA 4RABA 4ETIA 1SXJB 2OK8A 1QHXA 1S3GA 3GCXA 1G6HA 5FTWA 4M37A 4Q9DA 1EGMB 2WD7A 4YDHB 4KPGA 1NVEA 1SZCA 1CERA 2ZVPX 2AR7A 4LQLA 2PUGA 1G7CA 2FJPA 5FORA 4BFUA 4CM4A 1KEPA 4LJAA 5IK2D 1KYWA 1M2EA 1XVTA 2CDCA 2VDQB 3TOZA 4GM4A 4DT1B 1HF3A 2AC4A 2X3YA 3N5CA 1BDIA 4DWWA 1CZUA 4K3VA 1E3QA 2CV1A 1CYDA 1T8TA 2J5QA 5CDTA 2C2HA 1JJIA 3L8HA 5A3VA 2BGNA 3UTCA 1PYOA 4RDCA 4DIOA 4ER7A 4DLRA 4WY2A 2BKUA 1C81A 2FZVA 2FZEA 4PZZA 2C8KA 2BGGA 3G0CA 4ZC1A 5F78A 2XT0A 3AP1A 1PSWA 3QIVA 3ZWVA 2E85A 3QBEA 1JG6A 1LPBB 3HO6A 2Z4RA 3WI7A 4BFZA 1Z08A 2AFHE 3RVBA 3LRPA 4H7IA 3OIDA 1IAVA 3RYFA 3JZMA 1TOAA 1WCWA 2ORED 2P9QA 2I4LA 4NNJA 2NXWA 3ZLJA 1WE2A 1ND5A 5D5HA 1V3QE 1R0ZA 2V54A 3L92A 3ZQUA 2NXEA 2X4GA 4URWR 1MT3A 2I80A 1OXKB 2CWDA 2VIIA 1E66A 4M7RA 1YJQA 2GZMA 2IY9A 2JA1A 3F9CA 3JQBA 2WUEA 4FKZA 3CN9A 5JDIA 3KTAA 4NS1A 3W6NA 1XZDA 1B00A 2D2XA 5ES3A 5AXAA 4MMZB 1L8OA 1N5IA 1UDXA 4KFRA 3RQSA 2VDJA 3A6EA 4ZAGA 3JR3A 2O0KA 4ZD6A 3LP5A 1FPMA 2HQRA 2CLHB 5ALLA 3K96A 3LCVB 3QU5A 2X15A 3GFOA 3EZ6A 1CY4A 2MCFA 3FOBA 4ZEVA 2ZYHA 3HXLA 4R71A 3AU8A 1MB9A 4ETMA 4YJ3F