3KAQA

Flavodoxin from d. desulfuricans (semireduced form)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADGYDAVLMGCSAWGMEDLELQDDFAPLFDEMENMGLKGKKLAAFASGDMEYEHYCGAVPAIEEKARGLGAEVICEGLKIEGDASSDPDAVSAFAEDVLKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Flavodoxin
publication title Crystal structure of flavodoxin from Desulfovibrio desulfuricans ATCC 27774 in two oxidation states
pubmed rcsb
total genus 50
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kaqA00
3O73A 1ZX1A 2V5VA 1D4AA 1DXQA 1ZWKA 2X2OA 3QFRA 4C0WA 4D02A 3ES9A 3HLYA 4LTNA 2X2PA 2HNAA 3K20A 4HS4A 3ZHOA 2RG1A 2N1MA 1JA1A 3OX1A 3L9WA 1WSWA 2Z98A 4NULA 5LMCA 1AKVA 5LLDA 1CZNA 6NULA 4PTYA 2M6RA 1ZWLA 1RTTA 1YCFA 1AKUA 4N9QA 3W77A 3NHUA 1AKQA 1FLVA 5B3KA 2BPOA 2Q9UA 1AZLA 5F12A 1YOBA 1OBVA 5EAIA 3U7IA 1CZHA 2FZVA 3NHRA 2Z9CA 1AKRA 5LJIA 1CZLA 1X77A 1OBOA 3OWHA 3OJXA 4M0CA 4FGKA 5ULLA 2QWXA 3NHJA 2FVXA 3NHYA 3W7AA 1QBGA 2Z9DA 3OX2A 4ICIA 4PU0A 4QOEA 1T0IA 5B3LA 4GQIA 2QMYA 1OFVA 3N3AC 1RCFA 2BF4A 2ARKA 2MT9A 5EMNA 4ESEA 1KBOA 2FOXA 3FX2A 1JA0A 2M6SA 4QODA 1QRDA 2FDXA 1CZRA 1YCGA 1XYVA 5F51A 1FLDA 3NHPA 1FVXA 4NLLA 4QOGA 2W5UA 4R81A 1V4BA 4N65A 3S2YA 3TE7A 1KBQA 2BMVA 4XDGA 1E5DA 3ESYA 4GR9A 4LA4A 4FGJA 2QX4A 1DX9A 3GFQA 2MOKA 2QX6A 4GI5A 3UXEA 4BMOB 3F2VA 4N82A 5F4BA 5LBTA 4LAFA 1YRHA 3NLLA 2FLVA 1TIKA 4ZVKA 1YCHA 3L9XA 1XYYA 3NHFA 3P0RA 5A4KA 4ZVLA 3B6MA 2XOEA 3B6JA 4Y9RA 3OJWA 4C14A 3QFCA 2F1OA 3W78A 3OVMA 4QOJA 4FX2A 4DIKA 1SG0A 1CZKA 1J9GA 1BU5A 2HNBA 1TLLA 1AKTA 2WC1A 2OHHA 2FAXA 4U7FA 2FX2A 4F8YA 3RPEA 3N39C 2Z9BA 2Q62A 1WSBA 2QR2A 2V5UA 3N3BC 3QE2A 3FW1A 1QHEA 4QOFA 3B6KA 1XT6A 2D5IA 3ESZA 4YAWA 3TZBA 1RLJA 1AMOA 3K1YA 2BZSA 4DILA 3W79A 2B3DA 3NFRA 1FX1A 1T5BA 2QMZA 4DY4A 1VMEA 2QX9A 2HPVA 2A5LA 3GFSA 4H2DA 3NHKA 4XDHA 4HEQA 1FLNA 3F6SA 3EYWA 2BN4A 4YQEA 4Y7CA 1H66A 3KEGA 3EDOA 2R97A 2OHIA 5FX2A 2MWMA 4U7HA 2FZ5A 2MTBA 3LT5A 3KAPA 3KAQA 3FJOA 1FUEA 4PTZA 3NHSA 1J8QA 4CF6A 4J8PA 1B1CA 4C0XA 3F90A 4ZVMA 3F6RA 4QOIA 4U7GA 5NULA 3GAMA 1FTGA 4OXXA 4H6PA 5LJLA 1DXOA 3GFRA 3D7NA 1SQSA 3B6IA 1AHNA 1RLIA 3FNIA 1FLAA 2KQUA 5LVAA 3ESXA 3TEMA 1J9ZA 4CETA 3NHLA 1F4PA 5FA6A 1GG5A 3U7RA 2XODA 3R6WA 3NHWA 1AKWA 5LBUA 4YAUA 4LTDA 4Y9UA 1D03A 4FGLA 1BVYF 3LCMA 5BUCA 3HR4A 1YDGA 5EA2A 2GSWA 4BMPB 3SVLA 3FVWA 1AG9A 1NNI1 1C7FA 1CZOA 2V9CA 4LTMA 5FUQA 4S24A 2KLBA 1H69A 2ZKIA 1J9EA 2FCRA 3G5MA 1C7EA 4QOHA 1YKGA 3OWXA 3OX3A 1I1OA 1D04A 4YAFA 1QR2A 2OYSA 3JSXA 3UXHA 4YALA 2R96A 4ZVNA 1XI2A 5JROA 3KLBA 3O2NA 4YAOA 4C76A 5NLLA 2OHJA 5TGZA 1CZUA 2AMJA 2QX8A 3HA2A
chains in the Genus database with same CATH superfamily
2B4RO 2A5DA 2PLFA 4GR5A 4TZ0A 5DT9A 4EUKA 1TD9A 3MBIA 1XZMA 2GESA 1G2PA 4GT1A 4TV8A 1MOQA 2DUMA 4OB6A 5TQVA 5TQJA 1IQRA 1BA3A 2OT3B 1R0CA 3IA7A 4HNSA 2Q5JA 1V4NA 5DX8A 4EG7A 2ACEA 1RHQA 1Z2PX 5ITZB 5K3EA 1DEAA 3FMIA 5BURA 3J81k 4K9OA 2FN8A 2XRFA 3RW9A 4NF2A 2YWGA 3MCVA 4HSEA 4C0WA 1C0PA 2A7XA 2WNIA 5ALYA 4ERNA 2CKDA 4CI9A 4QO7A 4XIJA 4YXWA 1C29B 1TQ8A 4BUZA 3N05A 2YZGA 3CCFA 4DNOA 4F2DA 4ZOCA 1JJFA 2J0UB 1SKYB 3EMKA 2OZLA 1IHDA 1N8TA 4MQLA 3R7LA 1YQGA 1HTBA 4G0PA 4TV9A 3KETA 2GZSA 3HSYA 3JYQA 2YHSA 3WK7A 3NH6A 5G2OA 2Y6UA 5MN5A 4D82A 2WWHA 1CRZA 1PE0A 2DWPA 2XR1A 3HCPA 5HQ3A 4C2UA 2D74A 4UDOA 1XP5A 4D0LB 5CB4B 1UPAA 5EMHA 4KO1S 4CKEB 1MHPA 1ZCAA 2ZYUX 4YDHB 5ALNA 3OX1A 3L9WA 2ZTUA 5TEVA 1GGMA 2PWZA 1MQ9A 3U17A 3PWKA 2QDXA 1XJ5A 2DR2A 1XD8A 2HRDA 4B8YA 4BRZA 1Z74A 3E27A 1BQEA 1CQIB 3WMRA 1BA2A 1FMJA 5TDHA 3I8SA 4LJ7A 4Q9KA 3BXPA 2XCSB 2EW8A 3DR5A 4FFBA 5CCBA 3SK0A 3WGHA 1H65A 4GAEA 4JNKA 3ABIA 4CHTA 1IZ0A 2Z1MA 1DTSA 4HDSB 4OUKX 1Q1AA 2WWGA 2F4NA 4AQDA 1YZYA 2YKGA 3SD7A 4NFHA 3ILVA 4P4UA 2QD5A 2HA2A 3ISJA 2UUCB 3DFIA 3I5AA 4UVGA 4XOIA 3WBBA 2H52A 3F2IA 1QIEA 2I6XA 3R41A 3DYBA 4CIBA 3LX4A 2VHXA 4YAKA 2XRMA 1IOVA 1MCZA 3D3QA 1M6NA 4Y2XA 4MR7B 2XB2A 3B3FA 1VDZA 4WXHA 4XWTA 1J20A 3CLKA 5IYZA 2Z4RA 5C31A 3PFHA 4KRGA 2HT6A 2DU8A 3VVBA 1LNZA 4WKCA 2DBQA 2R00A 1X2BA 4YWHA 3OBIA 2P0EA 3NHRA 4OM8A 3LT4A 4E31A 5HRAA 5KOIA 2BLLA 2A0UA 4UHKA 2JIOA 2BSQA 1U4SA 3PQ5A 4UTOA 2B8JA 2BEUB 3EDMA 1KKUA 1J22A 5BMOA 2DY1A 3E82A 4C0AC 2W8ZA 2GM3A 3EG9A 3FZNA 2PWBA 4GOND 4ZT5A 3BXOA 3UMFA 2P90A 3KQTA 3V1MA 3GRVA 1PFVA 1BCSA 5DGCA 3A1TA 4KO8A 1EWKA 1TTPB 4YVFA 4I0WB 3S2FA 3UMJA 1EUYA 5I7FA 4NAVA 5AFSA 2NADA 2ZUUA 2IRWA 4J0GA 3P52A 4XLZA 3U62A 2D0IA 2PL9A 3GPIA 4IHJB 3WNVA 4DWOA 1LC3A 1WLYA 2ZUBA 4TKZA 5F21A 4DOMA 1H2AS 4P3OA 4EY4A 3ZDFA 2DQZA 5CD1A 2CEAA 2FFRA 3UK7A 4DMUB 4P38A 3H16A 4JEIA 1MH9A 1V5WA 5LQJA 2CL6X 1IU9A 1WMBA 1G64A 3GQVA 5ISMA 2QMYA 3LOQA 3R5XA 4OFBA 5B1SA 3K09A 3AINA 1X9HA 3OEED 1YDHA 4I3FA 1X14A 5CHEA 1KQNA 1RWQA 5JDIA 2BEKA 1IEWA 1RJFA 2X8JA 1O9HA 4M8IA 5LWQA 1SZCA 2OV1A 2AL7A 5ALSA 3RVRA 2BHTA 1Q3HA 4G2TA 4ND6A 1AC5A 4X93A 1YOVA 3SM3A 3BMOA 3VU3A 1ZGBA 3UOGA 3EX7C 1JFSA 5D3KA 1U1EA 3SR3A 1NRJB 3WKBA 3FLAA 1O7JA 2P1DA 4E11A 2R65A 3MUNA 3O7MA 4GXQA 5KTTA 2P77A 1JVSA 3WJAA 1PN3A 1MAWA 1DNPA 2E4WA 3B70A 2P4QA 1IEXA 3FSJX 3K0AB 4XQ0A 2FDXA 5JATA 5EXSA 1C4KA 1V9LA 4DV7B 4F5ZA 2AD1A 5G0VA 2Y6VA 1KSHA 1QFMA 4C7JA 4KREA 1AQJA 4BNYA 5CBPA 4FR5A 1YZKA 3K4HA 2CXXA 3K1AA 3NAZA 1SB9A 2NPOA 2WU4A 4NABA 4XEUA 5M34A 1KEKA 5AD1A 4H7PA 1QKKA 2GDJA 2XVZA 4BV8A 4YR9A 1GL6A 5BWBA 4I55B 3NAMA 4PO8A 3MYRA 5ALZA 3VC2A 2OQIA 1I36A 2PL1A 1K4MA 2A67A 3CUTA 3EVEA 4GR9A 4OHUA 5DM4A 3RU9A 3T7RA 3W8EA 3ZE6A 1QPGA 1U81A 1U65A 1QE0A 4P32A 4MW0A 5THXA 1IH8A 3U16A 2KBEA 1JFFB 2O0HA 4QGAA 4BKQA 5LYYA 4ESOA 4LF8B 3BTUA 4WERA 4EJSB 5AKJA 4RH1A 3BDIA 5K0SA 3KL2A 1F4LA 4WACA 4CMGA 5CB6A 3IJEB 4CKZA 4IIFA 3BZBA 5IVIA 3OJFA 3L41A 4RPLA 5DVZA 2HM7A 1SOUA 2DPGA 3ONEA 4OHFA 1J5PA 4L15A 5T8KA 4CM5A 1UODA 2AVNA 2IZ7A 1UJ4A 2IYWA 3GFTA 3G6KA 3O31A 4RGVA 4BZXA 2Z6AA 2VPPA 1NOIA 1NBAA 1ZRHA 4DMHA 2CFIA 1S7GA 3Q7PA 3C0KA 1MW9X 4G8DA 4JLJA 4ZRDA 5C8YF 1H2HA 1S8OA 1MR3F 2ZUVA 5GVRA 2FOIA 3SEFA 1NPYA 4RSMA 1DO2A 2OAQ1 1IXKA 3N2ZB 1L7QA 1O6ZA 3PXAA 1ACLA 5GZ6A 3O03A 1XEXB 1DRUA 3C3YA 2BFBB 2C7GA 1WF3A 1ZI9A 2Z1DA 4RSGA 4RY0A 5K3FA 3NRBA 4KL8S 5SZKB 4LXXA 1E2UA 7YASA 4DKXA 4CQNA 1T4BA 1N3IA 3GH3A 5EFOA 3E22A 3C7TA 3LECA 1XROA 2Q5QA 3GRPA 4HNAB 4IJUA 5DHAA 5DYWA 5A05A 4UPVA 4HFRA 4J03A 4URVR 2YJ4A 4IQFA 2R2GA 4ONEA 4V1CI 5IHXA 3LUKA 2ZWPA 1UT6A 3TTYA 1KO8A 3PR1A 2AJTA 4XUCA 4YIKA 2G0NA 1HLDA 2JAQA 2J3EA 3IIJA 2EDAA 3ZLBA 2FEMA 2YWCA 3H2HA 3OTQA 1GPBA 3SQDA 2O8NA 3DAFA 1TU3A 4DCTA 1J0BA 4O8CA 3BJRA 1J9GA 1TK2A 4U9IS 1PTJC 3GLSA 3VISA 3FKQA 3UT5B 1NBOA 3DKRA 2IS4A 5LM3A 2AG6A 5GIPE 4TLCA 2YRWA 1U0JA 5FTWA 3T94A 2WD8A 2IYFA 2EP8A 5KAPA 4D4MA 5JNWA 2F62A 3AU8A 1NIJA 2P68A 1SIWA 4HX5A 1FFHA 2IHBA 4Y67A 3PFFA 5DBGA 2WM2A 1JIKA 1X86B 3FUXA 4MUFA 2QP3A 4UE3S 3I01M 2XD9A 1WEKA 3W8RA 5CT6A 5CG1A 3ABSB 3TH5A 5CX4A 4G4IA 4D9IA 3DBRA 5I5EA 1ZC3A 5GJCA 4YR7A 1NT4A 2GVDC 2YICA 5IMSA 1G20A 5AJUA 2VJKA 3DV0B 3N39C 1WG8A 1O96A 2YV5A 5HUHA 3H4IA 1E3WA 3ACDA 1BMDA 5H02A 5LA6B 3WFZA 1CJKC 3AW9A 1T9KA 4GZ6A 3S1AA 3TLBA 1U28C 2QR2A 3KSUA 4R2JA 1IXSB 2XA9A 1IB6A 2RBKA 3AR7A 3LKZA 4GOOD 1TZMA 4K81B 4L4SA 4WGGA 1T3GA 1C9YA 4Y8VA 4YMVA 2BR5A 4BVFA 5KYYB 4O4LA 2I3DA 3RYFB 4PLFA 3S27A 2ZJ3A 3JWPA 4P93A 1NVTA 2NZUG 4XUDA 3QUQA 4FCVA 1DKNA 3QJ5A 3COZA 1ISRA 4O08A 1ZH0A 4ZVVA 3NEYA 3HP4A 4RAOA 4YRBA 5A3RA 3PQ8A 5SYNA 1T5BA 4YJ2B 4CR8A 5A06A 2DZDA 4MUIA 1BN6A 1XCJA 1MNQA 4EUHA 1EU1A 2PU7A 4WZZA 1YHYA 1TKAA 1Z2AA 1L4BA 3L46A 3PS9A 3THOA 4UD6A 4HAWA 1BEEA 4C4RA 4X64B 4EJ0A 2GEDA 2W83A 2OUKA 3HV0A 4AP5A 4NXMB 4Z3OA 3II6X 1L8XA 1VI6A 3C98A 1QRUA 2CNDA 4JMPA 1TUBA 1FLNA 4AN0A 4YWJA 3EA5A 4M89A 5HCUA 4QGFA 3SKYA 1P4GA 3FXAA 1SBNE 3SJCA 4EARA 1M34B 1Q92A 3EG5A 4UBOA 1A72A 3O8OB 3R8FA 2CMKA 5HZKA 2W0SA 4R1QA 1WXWA 2O2ZA 2BTEA 4ZIRA 2FK8A 1P2SA 4P7FA 2BGUA 3EEBA 4MVCA 4BE9A 2DMRA 5IDVA 3EAGA 2H8GA 4PNZA 4ROSA 3RQIA 2GAAA 4CEHA 4W99A 4FDLA 2W2OA 1CQJA 4D3ZA 1RYNA 2H1RA 2F9LA 2OAEA 1JXMA 1QGUA 4Q34A 1L7OA 3NHSA 2GWHA 1ID8A 3B1ZA 5CX1B 1RBZA 3TNFA 4CF6A 1YQ9A 1NWCA 2Q6TA 4QQFA 2BI7A 4B5KA 2XLBA 3G2NA 4HQKA 5TQ2B 3R3SA 2JLQA 2QLFA 1V8OA 3SHWA 3HXOA 1J49A 1TM7E 4B46A 4JOQA 1CF4A 2A33A 5JS7A 3ESBA 4IX1A 1QQ5A 4BQRA 4BBAA 2NSYA 4FDUA 1RBMA 1G60A 4LY3A 1XA0A 3FZGA 3NHMA 4PAMA 1XZPA 3FWZA 3UXYA 3A2KA 4MKFA 1EINA 1W76A 1F38A 2J3KA 3OCZA 3H3JA 1Q7GA 4L4UA 1EGVB 1TCBA 1UC8A 4GQAA 3KYCA 2GI4A 4HUJA 3JYNA 4JK3A 3A37A 3H0KA 4DYDA 5FUBA 1DWUA 3BBLA 4HQ0A 4XB6B 1RM0A 3SQLA 3GDWA 4YJFB 3RSFA 4K6FA 4RQAA 3R77A 1F0PA 1VIMA 3D81A 3FUCA 4I4TB 1RCUA 3B5IA 2ACKA 1GPAA 1NNUA 1Y33E 1YRBA 2XDAA 1NW9B 3LLMA 4FN5A 3RM3A 4C4OA 2FEKA 4MITA 3OE7D 2GHTA 5BVGB 4DV2B 3OZWA 4ZALA 1PJQA 3CVVA 4CETA 3AFMA 3N0RA 2YS6A 1GOTA 5GP1A 2VATA 5BO5A 5LIRA 4JGBA 1Y5IA 2D2FA 3CJQA 4ZYYA 1U8UA 1UBJS 2P3SA 2V6BA 1Q0QA 5BOVA 3BSSA 3PHJA 4YXFA 2WKRA 4FVTA 3F9RA 4CEIB 1QCYA 3H9JA 5U9CA 3PD1A 4TL9A 4DLKA 2JIRA 3LX8A 2G08A 5E38A 2WJVA 1RI4A 1HNZB 1XLUA 4IPTA 2CWDA 2RGBA 1OZHA 4V0SA 4FIDA 2ZW9A 2ZOSA 4MYTA 5JD6A 3C7KA 3NAQA 1K27A 1YIDA 3NS7A 2AE1A 1W0JD 1NUQA 2VDQB 3H8JA 5KIAA 2AN9A 2E21A 1T4MA 2R8RA 5EKTA 1NW4A 1D5WA 1O5IA 1ODJA 1TRHA 2IYAA 2V0NA 4DNQA 3P2YA 1WOMA 2VK2A 1KAEA 3LM8A 3AGPA 3CLUD 5FWDA 4BVLA 4IHJF 4EWLA 1GL7A 4E4TA 2O8CA 4HVTA 5KX5B 2ANCA 5I7RA 1KMCA 1N0WA 2PGLA 1P1FA 1ZXBA 3BXFA 1C0KA 3HI4A 3W5VA 1NNI1 5AVJA 3VSCA 1JHYA 3N7AA 1QHYA 1SN7A 3Q9NA 1MQSA 3ZVLA 3KSAC 1Q2UA 5LQDA 1EVZA 2NU6B 5E2BA 1AUPA 4MGEA 2XIJA 3SC6A 2F3QA 2P7IA 2KE5A 2V6IA 4JX8A 5EKXA 1AKMA 4BKRA 2PWAA 3T3OA 5FOXA 3TLAA 3HBFA 2ZRHA 4CN9A 3U3OA 5KWIA 3H75A 1AUVA 1SXJE 2QDKA 3HSKA 4PYLA 5CH3A 1I5EA 4E6EA 2A3RA 1RKQA 4UFNA 2N3ZA 1B16A 4W5NA 1XN4A 4Z8XA 4MRRA 1S4QA 2FTKE 3O0DA 4Z0TA 5AUOB 5EIOA 4FE4A 4WK6A 1OZAA 4DEVA 3F8TA 3OZUA 2CDRA 1HH4A 1BWSA 4FS8A 2X7XA 2CDNA 4JJFA 4M9ZA 4Q3DA 3SY8A 1XI2A 4NBLA 1C7ZA 4GU5A 5C18A 3UMRA 3CX3A 1JSCA 2B2XA 4R8VA 3MK31 2RARA 1IZ9A 3EIFA 4TSRA 3TCNA 2EL9A 3Q7IA 4RPGA 2RHRA 1RMQA 5LYJB 4GLFA 4MAFA 1XWFA 2G5TA 3ZTYA 4D6XA 1EUDA 1R9JA 2P9CA 4LJ6A 4LXIA 1JKXA 2J41A 1RJ9B 4U9UA 4AS3A 1H8ED 2QMHA 3E3OA 4UMEA 4W7IA 5LU9A 2PRIA 4G36A 3HA2A 4QA9A 2GEFA 5DX1A 3M5CA 3NTUA 5KTRA 3L1IA 3OOEA 1TJ4A 1U2DA 2UYHA 3QYJA 1EFAA 2QRVB 4QDXA 4UJ3A 1U2PA 3F5SA 3GG9A 2VPIA 3IDAA 1V9CA 4IS2A 1JJVA 1BJTA 1WAMA 3D1VA 2WIJA 3OZGA 4C7VA 4FB5A 3D6JA 2A0XA 1H4VB 2Y66A 4MS4B 1KZHA 1X9IA 3MQ2A 4R1LA 3ZTWA 5B4UA 4NCAA 5JMTA 3ZIAA 4OLBA 4CZ2A 1WOYA 3AR6A 4IOMA 2ADFA 2D5AA 1OH8A 4CHGA 1YL6A 4QOSA 1DO8A 5GWXA 1L4FA 1MRZA 3L93A 2ODQA 2PKCA 3STVA 4YT2A 3UCFA 1EVIA 5IX8A 3H42B 1QE3A 3MA0A 4MUGA 3H2KA 1L4EA 4Q1FA 4JEUA 3RC1A 2XMZA 1VBFA 2B34A 3W6OA 2H07A 3E2PA 3EMDA 3SZLA 1XQYA 1TTHA 1Y80A 2C54A 1PGPA 4UM5A 2DR3A 3TQFA 1NQXA 2PS3A 4EO7A 1XU7A 4FCWA 4JQYA 1QB7A 1SUDA 3MERA 4UVDA 3MJEA 1Z15A 1EDZA 2O2DA 3CX8A 2OESA 1JXAA 3EPPA 4H1HA 2QD3A 1T24A 2VG8A 3JD3A 2PCLA 3AY3A 2PS1A 3IESA 4AF8A 3GRUA 2GEKA 3K5WA 4H0FA 4Q4JB 1DCKA 1KVRA 1T3TA 4RK1A 5D51S 9ABPA 5A1TA 4EGFA 2H5EA 2Z98A 8AT1A 2TRSB 4K9QA 1VJ5A 5C4MA 4P80A 3TBFA 3D6AA 2FMIA 4A8JC 1RZ3A 1U2QA 2PV7A 5D3MA 3KJXA 3AUAA 4TM7A 2ID9A 3SEZA 3HZRA 3P9RA 4ZOLB 5REQA 4BMCA 1UXGA 2ZTMA 3BJZA 2GLUA 3TRHA 4GZLA 4BFSA 2OA0A 5I51A 1RTTA 2F43A 2GFHA 1KYIA 1W4BA 2PSEA 3QLVC 3T52A 3EYAA 2QTMA 5U4QA 1M8KA 1V35A 3AO0B 5IF3A 1AKUA 2FFBA 1HL3A 1JVBA 1JKJA 1Y4ZA 2MR6A 4PYMA 2BYTA 2QP9X 4ND8B 1XVVA 3M6XA 3HJRA 1YIOA 1NF9A 1ZGZA 3JPYA 3Q7TA 5D00A 3UANA 5A9SB 1S8FA 1MNAA 1IG3A 3E53A 3MWGA 2CEKA 3DHYA 5JAZA 4AO7A 2Z6UA 3OZXA 5DWVA 3WNCA 5AJYA 1SZJG 2ISQA 2I1WA 5EUQB 8ABPA 2VSQA 4HOYA 1E7QA 3NKFA 4JJ6A 4XARA 4GUDA 5DYIA 3Q4GA 3I9V6 4Q7EA 4MRMA 2ZLBA 5K0NA 4B45A 2PYIA 1RABA 5FAKA 3LD9A 3N2LA 1Y9JA 3QVVA 5B3AA 1VPDA 3LUJA 3IIEA 4TTVA 4TRRA 4KE6A 5H4HA 5ILQA 4RTOA 4Y2HA 4I3GA 3V8PA 4Q9JA 4LF5B 2H7CA 2ODEA 1ANKA 1GGJA 3MWKA 3K35A 2FHSA 4AWBA 2PKXA 1CE8B 4ZDJA 3IP9A 1C7JA 3LF2A 4AKTA 3CZ9A 4IBOA 2VHJA 1MA3A 3AZPA 4WWHA 3MMSA 4K6OA 4COKA 1WHSA 3FPLA 2Y1KA 1E9BA 2DBYA 1I0LA 1DFHA 3AUXA 4CLHA 1M1XB 1NQVA 2CDCA 1GZ5A 2AOXA 1U99A 4JT4A 3EFEA 3JQ8B 5L40A 3BL6A 3DMPA 2ZKLA 3BAFA 3NEJA 1JKMA 2QQ5A 4XYGA 4ZT6A 1PEDA 3CFYA 3CLUC 3K9GA 4QUHA 3GPCA 4MQFA 2BZ0A 1Y7TA 2KSQA 1GG2A 4AG6A 5BN4A 3HL4A 4LF7B 2H2WA 4OV6B 1DQPA 3U3KA 4K46A 3DVQX 1ZR2A 1EXDA 1G8FA 2XDYA 5I9IA 3QEMB 5JJIA 2QT9A 1CQZA 1RP1A 2IEBA 4LNUB 4NEGA 3HKDA 4RJTA 1T8WA 2F2TA 1NI4B 3GELA 1ZP6A 3KJZA 5IKOA 3P20A 3V8VA 5I7UA 1ZK2A 2WFLA 5BXYA 1LPMA 4I5GA 4S2EA 3AJAA 2R8YA 1WCIB 4A0HA 1CHDA 2CXSA 2ARKA 1XCGB 1ST3A 1XKXA 3EQ6A 4FFNA 4F4FA 4LJRA 1EGMB 4QYTA 4A73A 2H00A 2XHZA 1JBEA 3I1IA 4KWCA 4S3MA 4KPFC 3WRXA 1G3RA 1JF8A 2Y9PB 2O8EB 2FOXA 2FA9A 4LXQA 4MP8A 4JVLA 4BGDA 1W4LA 2BFEA 5CP8A 5I9TA 1TYZA 2HX1A 3JZFA 3ZKAA 3ZV6A 1DEXA 2AQKA 3CEJA 4E0BA 5M29A 4KPYA 5EZ6B 1X42A 2AR7A 1GKUB 2OGZA 4MRSA 1KEUA 3BM5A 3GLHB 3RBAA 1BAPA 1DDOA 1QH8A 3GCZA 2CJYA 3S5JA 2FQXA 3AM4A 4CQJA 1ZD1A 5JCJD 5E3HA 5IVHA 2R8BA 1N7GA 1U0LA 4Q66C 3OIGA 3UW3A 4WBNB 1XZ8A 3K9BA 3HA5A 2ES4A 3FBGA 2AX4A 1JTVA 1NW3A 1UR5A 3AW8A 3PHBE 4M98A 1YVRA 4QGHA 1R0LA 1UK9A 5DBHX 1C4XA 4AYWA 3VA7A 1BROA 3Q3IA 4FGWA 2ZRJA 4MVXA 1TDJA 4DM7A 2JLYA 3RVSA 1N77A 2WIBA 3UVEA 3SZGA 5DGHA 4Q18A 2XDQA 1E32A 1XF9A 3CWCA 3TSCA 4L0CA 1OY1A 4LRSB 1O03A 4NBNA 1EFCA 2JFXA 5A3JA 1TOAA 1JBKA 1Z0KA 1EAMA 1L5HB 3TB4A 4EGJA 1K8XB 4I4TF 3I9OA 3JRXA 2V59A 3HVUA 2L17A 2CNWD 4JC0A 1S7CA 2E4VA 2JLAA 4TMTA 4B3CA 2O14A 4JP5A 4RHEA 4H1TA 3AHCA 3I5YA 2OK7A 4PZ0A 4TKVA 2WD7B 1AQLA 1USGA 4RC9A 4UXJA 1Y6FA 1Z0UA 4KXLA 2CSUA 1V3TA 5K0TA 4RCYA 4KV9A 2EDCA 1OWLA 1YCHA 4H7EA 3UQZA 2IYYA 1E96A 5KQPA 5EJ7A 2IYSA 2O2XA 3QW2A 4CGYA 2CXHA 2ZPAA 4YCAA 3RUHA 1XMOB 1B15A 4HN2A 3QRWA 1VRWA 1WZEA 1IB0A 1EH5A 4MQ5A 1KC1A 5A2GA 4F93B 1H2BA 3CGWA 4JXJA 1CJBA 1WTCA 1NBHA 4JMLA 4WCVA 3B48A 3N76A 3PC3A 3SX2A 4EIWA 3IRVA 5F64A 1LU9A 4G8CA 5KOYA 4EK9A 3FCCA 3DR3A 3VNUA 1Z0AA 3V4RA 2XXAA 5DSXA 4X1KB 4NNOA 4B44A 3OT5A 2J3LA 4BWGA 1M1NA 2FQYA 4WZ6A 4AJ2A 4IDBA 4B6JA 5AVWA 3GUCA 3I0ZA 3IHLA 4JOBA 1J7JA 5B1EA 4BFXA 5FXMA 4MQ4A 4PNEA 3UGKA 4V0NA 4WRRA 3ZDXB 4NSNA 4J4TA 1M2OB 4IEEA 2H16A 3IQGX 3D0RA 4KR7A 2E1PA 1F20A 3ID6C 4FMCB 1XQVA 2QE7D 1DUSA 1VHTA 4S1PA 3PCTA 4URHA 2VXYA 5JR3A 1UZLA 1XTSA 2RI1A 3AHIA 1BQ4A 1H4TA 3H7IA 1AKTA 4JLUA 4CM4A 2C7RA 3CNEA 5F5NA 2WC1A 3PF8A 4G0WA 1N32B 4UNQA 3QNUA 5JBQA 1ZVQA 2AFHB 5K8LA 2XEXA 5LC1A 4U7FA 1QYIA 1T1GA 4YTEA 3TDNA 2FZKA 2LIVA 1ZGHA 3IDFA 3E7WA 5G1PA 3VOTA 3W5CA 3FOEC 4F8YA 2QKYA 5DLQC 4OG2A 2Q3LA 1T8UA 3SXJA 1DAGA 3RFTA 3ICVA 2HU2A 2EHDA 2PGXA 1SCIA 3UK0A 1KP2A 3WHIA 1KTVA 1NYQA 2EX0A 2VTBA 4G4GA 1VYHA 5J2TB 3KOMA 4CN8A 3OCYA 1F1BA 5P8WA 4CMKA 3EC2A 1PR4A 2E2WA 2FGKA 2JJ2A 4NE2A 4JI5B 5KWJA 1ZJWA 3BIFA 1FDOA 3L0CA 2QLMA 3HKEB 2HWUA 1THMA 2OOSA 2GPJA 4BC1A 4BJ1A 4DXAA 2I2CA 4RLSA 1JBQA 3WP0A 3PEWA 2ZXUA 1SBCA 5BMVA 1F48A 4AAYA 1GSIA 3QOXA 4W6QA 3B6KA 5KO2A 1GZ3A 5E6UA 3I2YX 1JHDA 3OPVA 1Y3DE 3NASA 1N6HA 1OSNA 4KPUA 1QV7A 4J1NA 5CH8A 1GYQA 3HMQA 3SSOA 3TZBA 4JOCA 4LWZA 3E05A 4C2TA 3NV7A 3OLXA 2CF6A 3PWSA 2GD1O 4EENA 3JQCA 1QAQA 2HL6A 3KT3A 4W6ZA 4D9JA 5CXXA 1U9ZA 2JATA 4DLPA 3OIDA 4BL5A 2QMZA 1LF5A 2N42A 1OTXA 2R1ZA 4DY4A 1YZTA 2FE1A 4JI2B 1CUFA 1RI5A 2XPCA 2ZE7A 2J5BA 2QL9A 1GCOA 4E5UA 1SCAA 3IDOA 4IJKA 2BFCB 1M1YE 2NAPA 2VDRB 4BP1A 5JJKA 3IQIX 3I64A 2VBFA 1G38A 2BDUA 4KR9A 3GX1A 1BX0A 2GZHA 1FRQA 3OWOA 5DTQA 5GONF 2VJAA 3B1JA 4M9UA 1MG5A 3MVEA 4NR0A 3TMAA 2I54A 4TV8B 3H9CA 3A9CA 1KH3A 1TEHA 4UE6A 1C8BA 2GJKA 3N7UA 4YXWD 3PPVA 1CB0A 1ZL0A 3BIXA 2ZT6A 4K1LA 2A57A 3JY6A 3OM9A 3R0QA 4ZEVA 5KDLA 2O57A 1JHRA 3GJ0A 3WK4A 1G6Q1 1K2WA 1N5OX 1K06A 1BXRA 3H5AA 4I46A 2RH4A 2YJ5A 4JJEA 3ZOKA 5DI9A 1QO9A 4DAEA 4ABTA 1IN1A 2PX6A 5CVVA 1HYHA 2IYPA 4PTZA 5C7YA 1IATA 5ER9A 4OTZA 2C59A 1P18A 2N46A 4FK8A 1Q0PA 4PNPA 3RC2A 4RA6B 3ZWBA 4M1KA 2B78A 2FY8A 4BNKA 3U7QA 2OZLB 1KI8A 3BSYA 3K16A 2C9BA 4TV9B 1T1JA 2N9UA 1RE0A 2RHTA 3DMHA 1S1CA 3HXTA 4HN9A 4KE9A 4PYQA 3P0IA 4X20A 4KN9S 5A0TA 1GGEA 3GRZA 1WZIA 4DTCA 2L18A 4OXXA 1PVOA 5A4MS 3ZUGA 5AK6A 1Z38A 2X5OA 1MV5A 2R6FA 1C1DA 2H5JA 1FP1D 1X0VA 4J7XA 4R40A 2YJNA 1E59A 3GOQA 5FTJA 2PGOA 3EVTA 3HPQA 2ZBRA 1ZICA 4RFVA 5AVTA 1N2JA 2Q6OA 1HZJA 5ECGC 2H4JA 1I6WA 3VYTB 4M1ZA 2QT0A 2JCGA 3A9VA 2JEYA 2CYAA 2MSLA 1RC0A 3IDSA 4RTJA 1NG1A 3KFVA 2GMWA 3HTXA 5LVAA 4RENA 1CF9A 5LUAA 4FFBB 1I3CA 3A3PA 3GRYA 2I6TA 4OSOA 2ZBUA 3U19A 4Y2QA 4LZJA 4LRUA 4H08A 1IWPB 3UJ6A 2ETVA 2G83A 4BMDA 3WL7A 5IW8A 1CWUA 1R5BA 1TQHA 4UREA 3H2BA 1HE3A 1GG5A 3AHJA 1TA9A 5A03A 4TXHA 2I4LA 5TMEA 1AKWA 3TW4A 4HQOA 2FR8C 5C1OA 5KTOA 4CT5A 1NOKA 1X2EA 4EYGA 2YV3A 1IN8A 3KS9A 4D99A 2QGNA 1ISIA 2J3DA 1RZVA 2ORYA 4TOIA 1V5IA 1JG2A 5DE3A 3UICA 1A7KA 1UBRS 1P62B 1FYVA 3LLSA 4IDQA 3MS4A 5HM6A 2IP2A 2Q0QA 3NC4A 1N36B 2AEEA 4WESA 3B1YA 4L0QA 4AO8A 1EK1A 4BPBA 2LD4A 3HJHA 4GZ3A 2XCUA 1KU6A 5HXAA 2D2IA 3ZPXA 2P40A 4Q6WA 1HYQA 1M8FA 1I3KA 1O54A 1ML3A 1E1CB 1PEKE 2GA9A 2MYUA 2VT7A 3EGCA 2GN6A 1GUZA 2WZQA 3QWFA 4ME6A 4TWIA 4TVKA 4YQYA 4ZOEA 1BCSB 3VPBA 5K6AC 1D07A 3TG2A 2HBRA 3OZ7A 1RKUA 2VDUE 3PICA 3ONNA 3R7NA 2PKQP 3UGTA 3UHPA 1TO2E 2OM6A 3CMCO 1P5RA 4S24A 1E6EA 1RU3A 5FOWA 1MP0A 3L18A 1AQNA 1CJSA 1KHHA 1W35A 3ROEA 3UJAA 4FMPA 2XUAA 3OC0A 4ZQCB 2QMEA 1T1SA 4KRFA 5GTDA 1ND5A 3UPTA 4QOHA 4JQZA 1YKGA 3NUGA 1ZI6A 3PYLA 4KMOA 2BWJA 3T5BA 2F8TA 1L1RA 2CB0A 3EXEB 1J06A 1J2UA 3OX3A 1MVOA 1NSYA 1FFDA 3PKIA 4J16A 1UK6A 1DI0A 3SQOA 3SI7A 4YV7A 2PAFA 5AM4A 1UEXC 1HE5A 4Q93A 5A5FA 2AOTA 1L5FA 4UUQA 2GNAA 4PPQA 2OCDA 2DQKA 2X6QA 1AX9A 4RVCA 5CMLA 2BSXA 2YHBA 2JNWA 2VCEA 1ZCJA 3KKZA 3ONVA 4MEBA 3V9AA 4AJ1A 2V65A 5I7OA 5IULC 3BMOB 2P1ZA 1PR0A 1VIDA 3COSA 4MX8A 4OQXA 2VTKA 4D8VA 2FQQA 3DMFA 2GBIA 4I5EA 3O4JA 3RFXA 4URZR 3VTFA 1BHSA 2FSVC 2KHZA 4EHAA 1DBQA 1LPNA 1C0EA 3AILA 3CRZA 3CPJB 1EQAA 4QM7A 3QBJA 5JAQA 3NIDB 3CUSA 2JLCA 3KQSA 3H9BA 1RC8A 3DAOA 3EVNA 3KB1A 4I1OA 1UP6A 3DEFA 5EJAA 3PKZA 3GD5A 3O83A 4B34A 1C41A 3BIWA 1YA4A 4WECA 3KL4A 2P2SA 5KYUA 4P5DA 5H0IA 3UTDA 3K1AB 3WGLA 4DG9A 2GK6A 1REQA 4LBVA 1Z45A 5EQFA 1T43A 4D43A 4DCNA 4MB6A 4L4ZA 4BMNA 3H2JA 4IGEA 1N0VC 2FQ1A 3GBVA 4GC9A 4V0OA 5G0TA 4O4IA 4YJ3A 1D4AA 4REMA 1FJHA 3LPAA 4LWPA 221PA 2EYQA 5T7BA 3T7EA 2W2MA 2XUOA 1YS2X 2CFCA 2P8JA 3AJDA 3DF9A 5ALKA 3SYTA 1OH6A 1NM5A 4FYYA 2ZQYA 1ECGA 4IGFA 4ARVA 4BUCA 5JT1A 3K6RA 1V7QA 3CZCA 1PT6A 3B7PA 2BE9A 5F7ZA 4EP1A 3BH0A 1O6CA 3BOSA 3RRJA 1ZD9A 4XQCA 4YONB 2CUNA 2GASA 1RAIA 3LXXA 3OEYA 4M8NE 2ZJYA 3CISA 4R3NA 4UHCA 1PL7A 3PD7A 2H4HA 3NO4A 3SWWA 2M32A 2PZLA 2V7VA 4HAIA 2ZYAA 4GOJA 3UV7A 3ZI4A 5GMOA 1PQYA 1O58A 4TTAA 1ZVVA 5B55A 1RPTA 1UKYA 1WDKA 4ND4A 1E20A 3VDRA 1NX6A 3ADDA 4EG0A 2JHPA 3SPXA 1UFVA 2BKXA 4NPHA 1OB2A 4RFSA 2Q9AA 3L3BA 1E5TA 3VPGA 1GFWA 3WTBA 3K71B 3QMMA 4J3JA 4MRAA 1TD1A 4QM6A 3VHLB 1OLUA 3D7RA 3V7NA 1CPYA 2OC9A 3N2NA 2PX8A 2PXHA 3FPAA 1M34E 5DH9A 1TO1E 1BMFA 4L6CA 1P8JA 3AZQA 4PM4A 1E5VA 2HCJB 4BVHA 3ABRB 3QK7A 4ER0A 1FTNA 3E22B 4R9SA 5CBPB 2HQBA 5MGNA 3M4JA 3MHPA 4EAQA 3OZSA 4FMCF 4AP9A 4B7AA 2DHEA 3F67A 3AJRA 3GOHA 3ZKWA 2ZJAA 2IEIA 2WA1A 2O07A 3I6BA 1WS6A 5LCXA 3LG2A 2W58A 1A9TA 2A5FA 2VYCA 3UA4A 3DDWA 3ZZ0A 4N48A 3C7DB 5IJWA 1WA5A 4MWEA 4W1QA 1HOXA 2VBGA 1E6MA 4C43A 1HXHA 3MIIA 5I47A 3MLEA 1F2VA 1PS0A 3RK4A 4ACBA 3KUKA 4RFLA 5KNBH 3FWPA 3JWJA 1GQQA 4G0NA 1U8CB 4R98A 1Y8QA 3CU5A 5J2TF 3X3HA 3CNLA 1MC5A 5JD4A 1WQ3A 1OBVA 5CK5A 1WPGA 3OQPA 5L3VA 4ZDKA 1Z37A 1V6CA 4RVSA 4H60A 1XK7A 5IJZA 1LWNA 1LSUA 2ZTVA 3EFBA 3R24A 3V7UA 2R00C 3AP1A 3KYDA 4LVUA 5YASA 3DBRB 1CZLA 3AX6A 1PWXA 3QY0A 5FUYA 1G20B 3AR2A 2Y9MB 4KQXA 3HQ4O 2FPSA 2ZXFA 3R6LA 4GRAA 3SYRA 3I9KA 3O3MB 3GDOA 1O96B 4K3VA 2VJBA 4IEIA 3UMSA 1TJ5A 3DT9A 1SA0B 3CWQA 1COWA 1E6KA 3GEEA 3OTIA 4O4HF 4XVQA 4ML3A 2JBAA 4I14A 3SE7A 2HY7A 2SHKA 3N9IA 1I14A 1R9MA 1XPRA 1DGQA 2XH8A 3O75A 2WTXA 4O4LB 1XZJA 3G0BA 1YZ3A 5DNUA 4A5SA 2GZ3A 4ZARA 3MT8A 4FCCA 5IXSA 4Q82A 4B3SB 1FL9A 1WCWA 2LPMA 3IMEA 1DX4A 4MLCA 1D5CA 3V32A 5E6SB 3DUWA 3F3MA 1Y34E 2M1XA 3M4NA 4B4DA 3DLIA 2VT6A 2QUBA 3VR6A 2WNHA 3O74A 1TCAA 1W1WA 2G1UA 2ILVA 2YS7A 3AWDA 3JQAD 4JUFA 4FX5A 4YREA 3VR5D 5D1HA 1CJMA 1R7RA 4L76A 2BUAA 1O4VA 2G1KA 3GFVA 4OLJA 3LOUA 3DAYA 4AJKA 1UCFA 5IEJA 4G23A 4I08A 1X8XA 3K09C 3L6DA 3ND5A 4PICA 4LGYA 4F38A 4DDWA 5JDIC 2RGGA 1UZAA 3A4VA 1U7ZA 4PG8A 2MT9A 1R64A 1UEJA 3KJEA 4RTRA 1OXTA 5EMNA 1H6DA 1EM8A 2WHYA 2PTHA 2XTZA 4W9RA 4ED9A 1QOZA 2P0AA 3AR8A 3OFKA 4UTNA 2Z2XA 2FW0A 2Z3VA 2H7XA 4F3KA 3IQWA 4B40A 1DWOA 1K3FA 1YU6A 4KQWA 5F1OA 2C5HA 1S2NA 3PC4A 4KQMA 1QRDA 3B89A 3F6PA 1YCGA 4R1SA 3WRWA 2MMCA 2QR5A 4BJ5A 4TLBA 3VSEA 1RWXA 5F51A 4AUMA 3FM9A 4QOGA 2UZ0A 3E8MA 3RB8A 1YVUA 2OBFA 2DWCA 2GD6A 1E4VA 2EG9A 3CKMA 3JARA 4E2ZA 2YVQA 4YCNA 1CQJB 1CRWG 2GEBA 3DCJA 4M1EA 5AUNB 4IUYA 5E6RB 4LWOA 1EFHA 3WWEA 1HT2E 2XOKA 3KEFA 4G0ZA 3NEAA 3IAHA 1RD4A 4X8LA 4QWWA 3RO7A 3HDVA 1RZRA 3NX4A 4YNBA 2GAOA 4LZLA 4RK6A 4KDCA 1G8YA 4XJVA 2A4KA 1LS1A 5FQNA 1ZHHA 3Q6NA 1ILEA 1BWRA 4KQHA 3ZOZA 4A4DA 2OCBA 3SZUA 2O48X 5BUQA 5FYDA 1GUAA 4LDPA 3F2VA 4XUGB 2ZJ5A 5H7XA 1U3DA 3FLMA 1D2CA 3BDAA 2O5CA 1T0HB 4HN4B 1G55A 2P9EA 2WAYA 1FXWA 1MFZA 3KYCB 2HQ1A 1Z33A 2JAXA 4B2YA 2ZDQA 4XSHA 3DXXA 3PE6A 4Q01A 1D2HA 2OXRA 2YMLA 3G2OA 1Z4OA 1QZZA 1Y8RA 2CKMA 2HMVA 2I9PA 2Q5CA 4QEDA 3RT1A 6PFKA 3DEIA 2ZSFA 5DNEA 1P5FA 5HR5A 3OU6A 2O06A 2HH9A 3RVPA 3BULA 1AGNA 3HEBA 2J59A 2VP4A 4W7SA 4XCXA 4BZPA 4E94A 5DIFA 3V8QA 1EX7A 5DYYA 1XLWA 1SUCA 2ZRCA 4NU8X 2CLHB 3WNQA 5JV5A 1WXEA 3JYPA 3ZWCA 4BB9A 1LDBA 3D0QA 3IAEA 3F73A 3TTTA 3ZXIA 4K03A 4DLBA 3ERCA 3AVVA 3OSUA 1K98A 1DBRA 1RHUA 2IDJA 4CCWA 2WP8J 3HKCA 3ZHVA 3MTJA 5M5BA 2NW6A 2G1AA 1Q74A 3UIEA 1CIJA 4JD5A 2BMJA 2X7HA 2ZZMA 4DLXA 3IAUA 4XQGA 4D0SA 2XAUA 5I8ZA 4L5IA 2QG9A 3QFCA 4QECA 4N1AA 2JHAA 3MTIA 3OVMA 5ER6A 2Z3ZA 2QM7A 3E3MA 4C4TA 2Y92A 3D2LA 4D9MA 5KVCA 2QN3A 2FZLA 721PA 3AI2A 4GH5A 4BNHA 4ZGGA 3K7EA 4KLAA 1BOFA 1UK7A 1VLJA 3ZX5A 5AYVA 1XPOA 2GCNA 1TF7A 3I9V1 4DZRA 1BU5A 2HJRA 4I66A 4DVGA 3R8CA 3LNCA 4EUSA 3E1KA 2XRYA 3LHKA 4KFCA 3DXFA 3FPCA 4XQ9A 4AXXA 2QA5A 3MGKA 2O8CB 1DO0A 1EBFA 3M1IA 3TK1A 4ZO6A 1A9ZA 1C1HA 2HIMA 2QTLA 3HWWA 1J8VA 5EQTA 3WHKA 4CG2A 5GJWC 1B26A 4EMTA 4F4DA 3S5UA 3O3OB 1FE8A 3CSDA 3GJRA 4JY7A 3WOVA 1UADA 4AX8A 5E4YA 2BBWA 3HLTA 4ZHSA 3A25A 2ZBFA 2HOQA 1OXBB 4RVOA 5K3CA 3CF2A 2WMOB 1IY1A 2XNSA 1HUQA 3JAKA 3WQRA 1WX1A 2ZBQA 1J8MF 4RE6A 4TYMA 2FW9A 2OAP1 2WTUA 3A7DA 3SBXA 2IELA 3NBXX 1LLFA 2E4YA 2PO7A 2EJCA 3TXXA 1ZYUA 1UDAA 2YMMA 3EHDA 4KP7A 1ZUNA 1B7GO 4XH9B 4U00A 5IUNC 4DJ5X 2HF9A 1GCIA 2BRUC 1N33B 4R3WA 5LZ5A 1RI3A 3MT0A 3PUIA 4NJEA 2ZI6A 4UUOA 4W5JA 4YAWA 4EKNB 2KI5A 5A4DA 4O1HA 5BRNA 1AMOA 2R6R1 1XOIA 4REOA 3TAUA 3O2QB 4JVNA 3DZHA 2ZB4A 2ETXA 4RM2A 4XEHA 2QN7A 3DLTA 4UDYX 2B3DA 4XYBA 1TVCA 1UF9A 5KVAA 3WYGA 1P2VA 2C2ZA 2NM0A 4EKEA 5EP1A 4YPFA 1FFSA 1BMQA 2NPFA 1P5ZB 1RFGE 4CMIA 2JKZA 3GO4A 4QD3A 5CCDA 1NU6A 2ZIUB 3AYZB 3ABOB 1EUDB 2R84A 2G4CA 1MVLA 4R2LA 4H59A 3SJBA 4CTMA 1IEVA 2C07A 1SUSA 5K09A 5EJFA 2IHJA 4HZGA 1SHKA 3ZIAD 4FHGA 3EODA 2V7WA 4AC9A 1L5OA 1ZLYA 2ZRDA 1TK9A 3B13B 3LQRA 2X5JO 3M6AA 4WZAE 4XGKA 2PGIA 3BE6A 3AUTA 3U80A 4W8OA 3FZEA 4BS9A 1VP9A 2ZWIA 4FXOA 4FZVA 5FUVA 4JYCA 3O94A 4PG7A 3W9BA 2EKDA 5TMPA 3CA8A 2UUAB 1KAHA 5K3DA 1IHPA 2DLCX 2QRUA 1CW2B 1CNFA 2FZ5A 2QRQA 2O2HA 1BE8A 4UQOA 2AQIA 3DBHA 3LT5A 1J0AA 4QGGA 5G3YA 4BO8A 1JG6A 2ZBVA 3LQKA 4EG3A 1PNTA 4H4DA 4AYTA 5B4TA 2PZKA 3IE0A 2G4VA 5JNVA 1QVRA 3Q7RA 1JSXA 5EIEA 1H2YA 1KERA 2ET6A 4AP6A 1NMSA 2CBZA 1KQGA 3T0GA 4DDUA 1MA0A 4IZIA 4I8XA 2PRZA 4O1IA 4CIYA 3ZCSA 3OEHA 1Z22A 2PM8A 3ANLA 1NAIA 2PZ8A 4QOIA 1MZPA 1H05A 1L7EA 2P78A 3RRYA 1E2EA 4A1FA 3C6YA 3M4YA 4CFSA 2AJBA 2H0RA 5EXXA 1OXXK 4CM1A 2DTEA 1XKTA 1C8KA 3E9CA 4RXTA 1SJ9A 4EZIA 4INPA 4I1SA 3NRCA 1GR1A 3ZX4A 5CNMA 1NMZA 3LWDA 4GEKA 3VDMA 1UH5A 2YCBA 5JSZA 1O0CA 4BFTA 4JBHA 4BJHB 1UBKS 2QBYA 3ADBA 3L8EA 3PEEA 1XVLA 4P4LA 5D3MB 3IUYA 3H4VA 2G5PA 2Z57A 5AM0A 1QNFA 1UM8A 2HZBA 1VKZA 3TRFA 3JD1A 1LXCA 1JU9A 4RIHA 2GPYA 3QPVA 2F43B 4EG6A 5DYTA 2G9ZA 2Y4NA 3JWEA 4YRGA 1SUAA 1Y6JA 1OXMA 1D2RA 1ONBA 1I7DA 2ASVA 2XNCA 3IPYA 4LCEA 5HBGA 1SQ6A 2NV2B 1BKYA 3V1LA 4R0NA 3F78A 1OI3A 2ZRLA 3BMNA 4J0HA 1V39A 5FA6A 6ADHA 4B3FX 1JHAA 1N9GA 1U2RA 3U3MA 1T0BA 2W43A 3QMWA 1Q0RA 1Z3IX 5LBUA 1Q12A 3ZV5A 1NXOA 2WU0A 3CRNA 3OOWA 3MWEB 4FC6A 5A6VA 3VSDA 2QTHA 2A9FA 2PX4A 1G8AA 1O8CA 2V7TA 2ZCVA 3NKVA 4GS5A 3KD3A 5GQSA 1L5LA 4X0EA 2V4MA 1R6UA 1SH7A 2Y1OA 2HSGA 1W48A 4L6AA 2BCEA 4LQCA 4MRMB 4N5MA 4U2CA 3TR0A 2GXSA 4GOLD 5TF4A 3M6MD 4Q4CA 3JU3A 1EWQA 2NN3C 1Z73A 3ELDA 4BKPA 5F9HA 3C41J 4OB8A 1LQUA 2VH1A 2C1XA 3K0SA 5EA2A 3ZY6A 3GUHA 1ISFA 3KZVA 3Q5DA 2HA6A 1W7AA 2B4YA 1D2MA 2OLEA 2XWBF 4NCIA 4JI1B 1EESA 2P9HA 3QOWA 4CL2A 3DE2X 4NHEA 5IBCA 4DMRA 1WHSB 3IUBA 5JVDA 4GXNA 1YIAA 1A5TA 5EJ8A 1VBKA 2F17A 4Z9XA 5KDOA 3W2HA 1MEJA 4Z9BA 5FR1A 1IWBB 2I0FA 4Z7JA 2P27A 1OT3A 4M7WA 1PLJA 1E0JA 2GBGA 3M33A 1OREA 2CFOA 2IYVA 1J9EA 4N49A 1HPLA 4H3VA 4ZXFA 3RGWS 4QBGB 2OZEA 4MCJA 3T5CA 3NM5A 3VI4B 3DDOA 2EJWA 1HC7A 2GRUA 4MB2A 5BN4B 3RV3A 4C20A 4B9AA 1XPUA 2CLDX 3CEMA 1X7XA 3LUCA 2NTNA 2CGEA 1DT3A 1QE5A 2CLKB 2XKKA 1JR3A 2W2LA 2IC5A 5DNAA 3HKDB 1LNQA 3VMFA 2ZRFA 3T3HA 2IOFK 4E1BA 2WFLB 1DLIA 1N3YA 5ITSA 3NM6B 1PZEA 4M36A 4NQZA 2PR2A 3LWNA 3EGOA 3GJQA 3HB5X 1L5KA 2WFMA 5DRYA 4EFNA 1KYWA 4QG7A 4YALA 3T41A 4N3GA 1U6JA 4PZCA 3W6NA 3C7AA 3AUUA 3LUPA 1TX4B 4AZSA 5JROA 1O3YA 3W4KA 1KIAA 1EP1B 2B4AA 2WJ4A 2XTJA 1QZTA 1CVLA 2CLFB 4GKJB 2BFEB 1GIAA 3HYCA 3GZNA 4PNHA 1D4OA 1RR6A 5JADA 1ZIDA 1NYRA 4LV5B 3RAJA 2QUJA 5K0LA 1QSGA 3D5QA 4WFJA 1TYCA 3WDLA 4EY5A 2EGUA 1R12A 1M6YA 1QH8B 1RIIA 3NXKA 4RL6A 3TB6A 4J6EA 3E4DA 2Z6QA 2A0KA 3AL2A 3C85A 3G0GA 4AUEA 4FNAA 1ZMBA 2O2CA 3NYIA 4NYMR 5JNSA 1UQUA 3HZHA 5KOJA 2C5BA 5FHRA 1KJYA 1W73A 2B9EA 3FCUB 4KDRA 4BX2A 3SVTA 3GGDA 1KYVA 1U2DC 3FDZA 3AUSA 3UAZA 2GN9A 4MVJA 4H1WA 5BW5A 1QX3A 1CFZA 5T64A 5U1PA 3SE0A 4KQ9A 2IHTA 1J0EA 4LRYA 3COJA 2XOXA 4RDXA 2JRLA 4HVCA 3TLGA 4D92A 3TLEA 4C7OA 4IIHA 4TXMA 2DKOA 2II6A 3QPDA 3NANA 1KWKA 2FPPA 4FNGA 1FUIA 5GM1A 4I81A 3OQBA 4L78A 3BD7A 4C5CA 4YAJA 4ZD6A 2IUSA 3L1HA 1JKFA 2QQ0A 5AM3A 1Z2EA 1U98A 5JJBA 2J7PA 5D86A 5KYGA 3INNA 4AJIA 3PC6A 1EVJA 4WKPA 3OOYA 2OXFA 5JSQA 5JFOA 4TKVB 4WX2B 5IC5A 1TPYA 4IF4A 3M5DA 4OOFA 4F4CA 4R2XA 3JQ7A 2D5BA 1C4OA 2FXVA 2NU7B 3UJ8A 3GMIA 3VU8A 2WJ3A 3QYAA 3GT4A 4KO4S 2AKAB 4Y1FA 2H6EA 5BT8A 2PLWA 1DE0A 2A92A 4HNQA 3RUDA 1N5LA 4PS1A 1OPRA 3T7TA 1AKVA 3N6RA 3R44A 3A9RA 2C8JA 3KOZA 4MA0A 4IGIA 6NULA 4NTZA 3NW9A 3EIXA 5DOVA 4GF5A 4YRDA 1O9BA 2ZJ6A 1R1DA 3K2IA 4X7MA 2X76A 1JHQA 1BDBA 1GSOA 2I6SA 3KFLA 2FZGA 1E4EB 1GGHA 3LDHA 2XXAB 4FLMA 3BA1A 2X9GA 3FTNA 1VL5A 4HZUA 1V3QE 2H0AA 4QNMA 3R9IA 4Y2SA 3WIEA 5HOQA 1AUXA 1P2FA 1T36A 3G8DA 4MICA 3T35A 3D4NA 1OU0A 2N75A 1NAHA 3HJTA 3NHUA 4FUQA 3SS9X 3W77A 1GAQA 1WE2A 4K3UA 4O6VA 5HGJA 4DC0A 3KVVA 3VKUA 5K2MA 1K4KA 4MVWA 2Q9UA 4JFAA 4GM0A 2ZJ8A 1K7SN 1L7MA 5IAEA 1V1JA 1X7WB 4WV3A 3ISTA 1TCUA 3QY9A 4MQMA 4CM4B 5LP6A 4GE3A 4ER3A 1YOBA 3R0VA 4E08A 5GV8A 3WSVA 5ESDA 4BVAA 3FI9A 2JJ2D 2BCJQ 2ZRPA 3JQEA 5LZ8A 3EFOB 3RK1A 1HFJA 1Y3CE 4AJLA 2VTVA 1Q0SA 3R1IA 1XU9A 1PGOA 2H4WA 1UZUA 2GT1A 3LF1A 1A5SB 2XTMA 2NG1A 4TWJA 1MF7A 3P9KA 3ZWAA 1CYEA 3D3EA 2JFUA 1XAHA 4RZUA 2QGFA 4BXOA 3BFPA 3H2IA 5FPTA 4P86A 2CLEB 4MUJA 4MV1A 4ODIA 5K3SA 3VU0A 8ATCA 4X44A 4N3CA 4FGZA 4CRWB 4ZJPA 1N2HA 3IAS1 2I4TA 4LOHA 2NO0A 2OCAA 4WMLA 1R9NA 2X0RA 4JC8A 4MUMA 4R8RA 4EUFA 1WCV1 1KXZA 3T9FA 3U9SA 3D2AA 4BEWA 1NSTA 1VKOA 1BXKA 2O1XA 5E6UB 1E0DA 1G291 2J48A 4ZI7B 1IRIA 4KPUB 4Q3KA 4AY2A 3DA8A 3NKLA 1FW8A 5BQFA 3T1HB 1VIVA 1QF9A 4NKRA 2CXRA 2ORVA 1JQKA 1E1RA 2OSVA 3DMYA 3EWAA 3LV8A 3K15A 2H59A 2JGRA 4KBGA 4YI3A 3AL3A 4ARUA 4EB8A 1J4AA 4JDPA 1A82A 2B4QA 4NICA 4OMDA 1PR9A 3L6BA 3N3AC 2QLLA 3VUFA 2HJVA 1W44A 4Z2AA 1F2UA 3DS8A 5CFMA 3G9QA 3QU4A 4Y3UA 3TCXB 2Q9BA 4L72A 3GDGA 1CUCA 2O23A 3LW7A 3CVXA 5D85A 3SJAA 4LE1A 2CLSA 5EEHA 3TEFA 4OVKA 5EIXA 1QV9A 2BJVA 2XT6A 4XD7A 3LBNA 1ZOOA 2WJHA 3S29A 4S1WA 3WRXC 3ZLVA 4LBWA 2BVNA 1DAHA 3KYIB 2HHHB 1HE4A 3LVFO 3THXA 4POOA 1KH1A 2ZWVA 4BKUA 2O4CA 4UC0A 5IM4F 1SUWA 4FU0A 1BZYA 5JNUA 3RS0A 3S8EA 1FLDA 1CS0A 4RLHA 1SWWA 5AI4A 3SX4A 1BXRB 2GJAA 1USIA 4BB0A 3TE7A 2VSNA 1PJLA 3TTWA 2A9JA 3TM4A 3X1MA 3G7NA 3E9ZA 8MHTA 3M9WA 1LPOA 5IC4A 1NJSA 2CLLB 4QDOA 1L5GB 4J7AA 4M0DA 1BH6A 4EEKA 1MOZA 1A7AA 1QH0A 1WZNA 1U94A 4GI5A 4KW7A 4KN6A 4NZNA 2W22A 3QLTA 3AF4A 3SDSA 1HDGO 1Q15A 1M6EX 1OGYA 4R6WA 3TZCA 3VYWA 2FSSA 5CFRA 4C4PA 4YUVA 1Q20A 1C1DB 3KSRA 2VWGA 3N7TA 1K9SA 1P6UA 5KU1A 4B32A 3CEHA 3SIWA 1GWNA 5AXBA 3SLKA 2WHQA 4L7VA 1EDOA 3G9XA 3WLKX 4EECA 4ETMA 1IBLB 4QXRA 4ZTZB 1F2TB 1D4ZA 2WG1A 5IAGA 3CONA 4JP1A 1A04A 1IQ0A 3A4TA 3NOVA 1WABA 3R9XA 1O94A 5JXJA 4KIUA 4V0LA 2QLBA 3DF7A 3A7EA 3ONDA 3P0RA 3DZ8A 2H31A 4PGFA 5FCDA 5BSUA 1KR5A 3KYJB 4ZCIA 4IQ0A 4MW1A 1NBIA 3AEUA 2A1IA 1E8MA 1VG8A 4Q0MA 3MWLA 2VNSA 4X1YA 4TLDA 4ZA2A 4A91A 5K0CA 2GN2A 4JJKA 1KS9A 3ECAA 3HUTA 4EDHA 2Q4TA 1ETUA 3KQOA 2IIQA 1OFHA 2VRCA 2ORWA 3DE7X 2HMTA 3B6JA 3OLYA 2Y1XA 1NVFA 2FWJA 1NMEA 1H5QA 2A6PA 3NNNA 3GRFA 3MD9A 3K9FC 1E7SA 2WZDA 4U2KA 3B8EA 1AV6A 1IPHA 4N4AA 1PZHA 4REQA 2AG8A 5SZIA 3TPZA 4DIKA 2PD6A 3ZW7A 2BT4A 4GPIB 4ZKDA 2PQ0A 4Q3LA 1YUNA 3ZWYA 3HBJA 2F64A 3QE9Y 1E1KA 4WESB 2BM8A 1FFXB 1YZUA 2L42A 5C3UA 3FFTA 3CZ5A 1O77A 1KEVA 3EQ8A 4GICA 3NTLA 2WVGA 1PSZA 3S8YA 4FWIB 3NDJA 2XCQA 4NYJQ 2YBEA 4A2WA 2OLKA 1WXXA 4MWZA 1LEHA 4RUKA 4W8GA 1R6XA 2G67A 4BWVA 3SR4A 2C1EA 3CW9A 3TZQA 4ER7A 4F9TA 4V0MA 3TZLA 4B3HA 1QU2A 1ZGAA 3LCUA 1UWCA 4OBEA 5KYTA 1NJ8A 4X1OA 3ROFA 1ZOPA 1KMHA 4BLSA 1FK8A 2AYYA 2D3TA 3SFVA 1CYDA 4G5HA 5FFFA 1T0PA 2X4LA 1PAUA 1BX3A 5DLEA 5LZ2A 1GNTA 1KO7A 3AVUA 4PQGA 3FYUA 1OKKA 1P5HA 2BH9A 4LJYA 3TIIA 5KHOC 5DBFA 1XCBA 3JW8A 3ZW8A 3QGMA 2HA3A 1FVFA 4B82A 2AOTB 4YUXA 4H18A 1NFQA 2HR1A 1MQ8B 1TVMA 5CDUA 3HYSA 5CEFA 1WMAA 2GN1A 2Q5FA 4CF4A 1DAIA 1EFVA 3KTAB 4MYCA 4KOAA 2B98A 3N87A 3B82A 4JX9A 2ZAIA 2A8YA 4M37A 5K7SA 1MB0A 2W2XA 3I05A 2DHRA 3WYFA 1GYPA 1UBOS 1UPXA 5FOVA 1QFZA 1M2HA 1T6ZA 1H23A 4HB2A 4TS4A 5KTYA 4R41A 3COYA 1ORTA 2JLSA 2Q3EA 3M83A 4G85A 1C30A 4PZEA 4Z2YA 1JB1A 4GDFA 1A2QA 1LW6E 4A1OA 5DNCA 4P1ZA 4QFDA 3ELYA 2BF7A 2PFGA 4G97A 4RIEA 3ZXXA 5DTRA 5KYUB 3LU1A 5LDGA 3O8CA 4FM9A 4R68A 1E3MA 1REQB 3AB8A 4JIMA 5TV2A 1V3UA 3O8LA 3KQHA 3OMLA 4YJKA 3AH8A 2NWQA 2OXCA 2ZJ0A 4YRZA 3FGPA 1HDZA 1T5SA 4O4IB 4V0QA 1KQFA 5EINA 5JMOA 3I32A 2Q50A 1C8VB 3OM0A 2VYFA 1I5RA 4EL5A 1C14A 1FNMA 1U1GA 1W0KA 3HH8A 4PQFA 3T4UA 3ZH9B 5FYQA 4PZ9A 4BVBA 3ZJUA 2O5VA 2QJRA 3EPHA 1Y42X 3HG7A 4KWHA 5EWMA 2Q3CA 3WGGA 4UPEA 4E7OA 2JFYA 2ZU6A 1Q2XA 1HF3A 1UZNA 5CEEA 1XD2A 2HA4A 2HO5A 4TQAA 1UAGA 1OT5A 2VT2A 3JASB 3E6AA 3IEKA 3K2EA 2HTEA 3DVAB 1QP0A 1X8JA 1D0SA 3KKNA 4KNYA 2FI1A 1QVZA 4MGYR 3R20A 1CFJA 1QFSA 3Q7SA 3TBKA 3EXFB 1BMFD 4Z4EA 3LIIA 3UWSA 3S40A 3T34A 2TMKA 4Q9AA 5FULA 3EQZA 4M0LA 1I4TD 3B51X 3P4XA 3TMKA 1DSSG 1SCKA 1GRRA 1ECFA 1C7IA 2DJ5A 4XM1A 2D2EA 4ZQFA 5JFGA 3H2YA 1I94B 3CVYA 2FZWA 1Z35A 2JIPA 2XZDA 4FR0A 2IV2X 3ZD7A 2ZJZA 3OG9A 4X8HA 2DE0X 3AVOA 3OICA 3Q8XB 4G25A 3ZD9A 4BQIA 4F5DA 5H4GA 3OTWA 3L0SA 3W05A 3QHPA 4D9CA 2WAAA 1ZQ1A 5HF9A 2C7BA 2B6HA 4B8WA 3ZGZA 3BWMA 2PS0A 4DBLC 3THYB 4G8BA 4RDCA 1SVOA 1QH1A 2IPMA 3H11A 5DNWA 1G8GA 2PNFA 4BNTA 1XDZA 5JIBA 3C8HA 1GPH1 4OLHA 2JLBA 1JEDA 4QVIA 2ID7A 3EVCA 3FOBA 1HG1A 2CMHA 4BTVA 3H6GA 1T1IA 3FR7A 3AUYA 3LHIA 1EFPA 2VO1A 4P3PA 2ZWOA 3FMOB 4XKJA 3E5RA 1EFDN 3EZNA 3WSTA 2FV8A 4Y1RA 2QVYX 2GTPA 3LUGA 3GYBA 1VBNA 3TNLA 5DO9A 2YQ5A 3BWXA 4YAUA 5EQJB 1SXPA 1LB1B 1JSLA 1D03A 4MUNA 2O8FA 3DDHA 2HI0A 2RIPA 2X4IA 4WLEA 3WZ2A 1K86A 4F45A 1USWA 1OYOA 1P7VA 2HGZA 2B5VA 3DKKA 3G85A 4O29A 3WA6A 3JSAA 4WJZA 4EI8A 2DXIA 2HHJA 1NFFA 1V7CA 1QHHB 2JG3A 1COWD 3M1YA 3FKSA 2J87A 2NQ2C 4NOKA 4AU1A 1ZIOA 2AG5A 4DUGA 4UOEA 4DBZA 4PO1A 4BTLA 2JW5A 3KYDB 2HF2A 3W5SA 1UJ5A 3EDCA 1M5RA 3USZA 4ZI7F 1VTKA 3GI1A 1AO3A 1UWLA 3DQQA 1HNWB 3DM5A 4LMPA 3ZQUA 1SC1A 2A2ZA 1U02A 3O1IC 2JBAB 4KG7A 2V9CA 2XYGA 4KMMA 1O2DA 3VR6D 4EHDA 5IXJA 1GY8A 4H77A 4HGYA 4NY1A 3T7CA 4RKFA 1U8EA 3JD2A 3Q10A 3C24A 3HNPA 3LAWA 4ZAGA 2YUIA 1CR1A 3UV6A 4JBGA 5CHYA 3AETA 4PC7A 2FLKA 3X1KA 2C5SA 3DEZA 5HEKA 3H4TA 4CR6A 4NJMA 1KZ4A 4QYMA 1CDEA 1T2NA 2DT5A 4EKYA 4LYDA 5K99A 4IVPA 4MDYA 1JWBB 5L3SA 1NY5A 2G8LA 5BWCA 4G5FA 3RSZA 3ZQJA 4TYWA 2P5TB 3K70D 4J16C 2NU8A 2EXXA 1QVAA 2VOJA 3QLUA 2I3ZA 3FNRA 4W9MC 1DAPA 2EWMA 2XGOA 1QHNA 2B1IA 3HUUA 1JQ5A 4A5OA 4YCLA 2WJJA 3DBLA 4OXQA 3WSWA 5C5IA 1XELA 2I8AA 2B3TA 1BS9A 2ZSUA 1EM8B 2WT8A 5AKZA 3VNBA 1V1MB 3SYKA 3IPXA 4HDMA 3K70B 4Q7MB 1G8SA 4UM7A 4HWPA 3G7SA 1XZHA 3M81A 4U8GA 1TT7A 4YRAA 2J33A 2NTVA 3AJ8A 4WNIA 2WIFA 5D5PA 1RCTE 2XOKD 3DE4X 2HRBA 3OF5A 1KE2A 1JJ7A 4Q4HA 4GXRA 3D7MA 3DXYA 4X92A 1Q0ZA 3H9QA 1RZRD 4JQOA 4Z86A 4KGVA 4CT4B 2BGTA 1S01A 2QX8A 1X1DA 1NZDA 1P4HA 4DSAA 5BOSA 2GK4A 1XAJA 1UXIA 2R6HA 3F98A 5AHRA 4JXZA 1X8LA 3UNXA 4KDFA 2H54A 4L51A 1KY3A 2AZXA 5JSYA 2HLNA 1EB8A 2ZZNA 5EHZA 2Q3FA 1B8VA 1DXQA 1UMBA 4FJ2A 5FIUA 3UW1A 1FZTA 3L7YA 3O8DA 5CGZA 4IHKA 4OA5A 1MB3A 2C8VA 5C9ZA 1R37A 3KQPA 2QMOA 4K6GA 4KVZA 1XN1A 3ITKA 1A5ZA 4F3RA 2IZ6A 5TVKA 3QFHA 5I9NA 1TU4A 1K75A 4PZYA 2J3JA 2XB4A 3MRSA 1J2YA 5JRJA 1R3DA 4D4JA 1NM5C 4QRHA 2X15A 1ODTC 3ZV3A 4FDAA 4G81A 4CIDA 1AU9A 1G42A 1GU0A 2ECFA 2QN2A 2BJWA 2XIQA 5LFAA 3L7OA 2RD2A 4WASA 4KR2A 3LT1A 5IH7A 2R1VA 1KP3A 3EULA 1FYXA 1Q0LA 5TF0A 5BSHA 1A4UA 3VX4A 1NBWB 4YP1A 1Y8RB 3CZAA 5CT5A 1QG4A 3KQQA 1HL7A 4P83A 3EBLA 5DNDA 4ZCRA 3RBXA 4RXMA 4EH1A 2R5WA 2XKAA 3GJZA 4XE5A 3HYRA 4QDTA 2XMRA 4YRQA 4ZK6A 1YRWA 1KH2A 1BE6A 4JI6B 1GILA 3MN1A 2SECE 1JXOA 4RJLA 4C1NA 1LS6A 4ZTUB 2PZJA 1C2YA 1QK4A 2CUZA 3EXHB 3F3SA 2YZ7A 3LX6A 4C06A 5BNWA 5KTPA 5JVDF 2H5IA 4RH3A 3IAFA 2CC2A 1LX7A 2P91A 3HKCB 2WUFA 2BDTA 2FX3A 4BP3A 3THWA 3H1AA 4B0OA 2VWPA 3VZBA 3JATA 2B83A 2FPKA 2V7EA 4ZVOA 1Q6ZA 1CEQA 2V8OA 3EF0A 1RAFA 2MYNA 2GLTA 1QC5A 1GZSA 3IFSA 3D5TA 4ENSA 1EUZA 3S2EA 4N5LA 2PH1A 3KDPA 1R4MA 3K9CA 3M3PA 3MCTA 3UB2A 5AVYA 1VCHA 1WP4A 5B3KA 4N6GA 3ROTA 4OH1A 1ZGJA 4AG3A 1IUPA 4X63A 3U6BA 3NBQA 1C9DB 1WW3A 1YNSA 2DBRA 4HWGA 2IWRA 4E5MA 1E2MA 4EFLA 3NYWA 4MROA 2WHEA 4G07A 4B7CA 4OKIA 1UM9A 2WIDA 1AZLA 3HEMA 2NUTA 4Q7JB 4YRMA 1JQBA 1OTYA 4QBTA 4DUZB 1KYXA 2CVOA 3IOCA 1EP3B 3PEVA 3T1OA 1FQKA 1SUEA 2QU7A 2R48A 5IDWA 2BEJA 4U7DA 4OQMA 1CUSA 1T8RA 1XCMA 1H0RA 2CVQA 1VDMA 2QTTA 3DE6X 4U7JA 3W0LB 1L5NA 1EXWA 2FKNA 3A6FA 4GX5A 1BNCA 4C7XA 1V8DA 2MINA 3BWBA 2ZSDA 2C2YA 3CTMA 3DOJA 1YJAA 1HNNA 3ETGA 3DL7A 2X9NA 3JAKB 4GRDA 1G8MA 2HEGA 3DJFA 2VQEB 4LGCA 4KPEC 2NLOA 3HGMA 3OWHA 1Y9EA 3JWIA 1BHO1 1CQWA 1GKKA 2Q3JA 2R8XA 5ENDA 4AJOA 4LX0A 5LLSA 4DIMA 1ZN8A 4LK2A 2HJWA 3LO8A 3TLYA 2W6IA 1K7FB 2HQRA 3MJFA 1ZUNB 5FFMA 5H3LA 4NBVA 3RAGA 5B2FA 3RUFA 1PK8A 5E7MA 1SU4A 2X0NA 3V46A 3WL3A 2O19A 3W7AA 1DDGA 4NJEB 4UBNA 3OC6A 2ON6A 1ZLXA 1UPUA 1YR8A 4KXMA 3MG9A 4N8EA 5CD9A 1I2CA 1QP8A 4DDHA 1RHJA 5JNTA 4ZTBA 2PGAA 4YMSA 1PFGA 3VDQA 1I01A 2XKJE 3CIFA 1KI6B 2OK8A 2VNKA 3OD1A 4TVSA 3F4LA 1JLLA 1G5TA 1U7UA 2QT1A 4I5IA 3X1JA 5CFLA 4KEAA 1AV7A 4EKGA 5KQSA 2QTRA 1AHPA 5BN5A 1JAZA 3A9UA 5H8WA 5HIJA 4DCUA 3PJGA 2ZYIA 2KJQA 2HD4A 1JDUA 1MO2A 4Y2GA 2V54A 4G4SO 5AP9A 4D3DA 1K7CA 4Q19A 1FS5A 2DQSA 4UD2A 2HFJA 2UDPA 1RAAA 1EVQA 1N2IA 3UHFA 1N1EA 2MSNA 4C7MA 3CJTA 2QOEA 4V02A 3I6MA 2Q7OE 1Z0SA 3K70C 4BP8A 4TXJA 1MKYA 4F5WA 2PRSA 4S04A 3AUFA 3RD5A 5AQ1A 2ZRBA 1RLMA 1J8YF 1RRKA 1SURA 2Q41A 3MJRA 4IVNA 4WLUA 4XZ3A 3RKRA 3SYMA 3ZDQA 3NHPA 1FVXA 3ZE9A 4F2PA 5ES4B 5JC1A 4RVGA 2GBLA 1B8OA 3I6IA 4KQJA 4R81A 4JR0A 3DBHB 4ZYLA 1XZLA 3GLGE 2E55A 2J8ZA 1S02A 1ZJYA 4G1CA 4XRRA 4BFLA 4TWZA 5JQGF 4KPGA 2PQ2A 4RPJA 2EKZA 2IOHA 3IPCA 4IH9A 1B73A 3VKFA 1RJDA 2D4HA 3I9LA 3A6LA 1I4LD 3FVQA 4F12A 4DEXA 1I1HA 1IZYA 3OCVA 2ZS8A 4FGJA 4IJVA 4B6PA 2V8BA 1MABB 3LZDA 3KHSA 3PI6A 2GZMA 3UXEA 4EVRA 1T9DA 2QPTA 3TPCA 1NDQA 1VSQA 2D2VA 1EE1A 2I65A 3WFIA 5MN4A 1ZISA 3FRHA 2Y1FA 3HYTA 3CX6A 4P81A 5DTMA 4YHBA 3KJFA 3QX9A 3RARA 3W8DA 1IXYA 4B2LA 5FTNA 1G1MA 3DSRA 4PR0A 4RHUA 1LJ8A 2Q0XA 2C95A 4F6RA 4B80A 2XI4A 4HMOA 1EVLA 2B69A 1YS9A 5JSZB 3GLTA 2YWJA 1ECPA 2JHFA 1Z4KA 2V1XA 4PFSA 4CQMA 2C7OA 1DKQA 2Z5VA 1QGDA 3R4CA 4HRXA 1KOJA 2OFFA 2KBFA 5HE8A 4QKQA 3K0HA 3RUAA 5T6MA 1WU7A 5DB4A 3WMXA 4CEJB 5ALEA 3NZEA 4GE0A 3DYIA 2NXJA 5DWQA 2QG4A 1PR2A 4AD8A 1GAXA 5JMPA 5COQA 4OATA 3VR0A 4KNVA 2GTIA 1BXGA 4HI0E 5JMWA 3OESA 4HDCA 4IZ6A 5TSDA 3GK3A 3RVNA 1GPDG 2G82A 1PGQA 1STOA 3DLCA 5KTSA 1V2GA 3KPUA 3R7WA 5K6TA 1N9GB 3EXHC 1W19A 2Y1GA 1JFLA 1YUBA 3ETCA 3MCWA 4NMHA 4D4GA 3FHLA 2JJYA 4HGRA 4MUBA 3V8EA 2E7ZA 3DOCA 4RTKA 1DZ3A 1V45E 5K8UA 5GADl 3H2ZA 2F1OA 4KXXA 2F6RA 1T8PA 121PA 2I3GA 2PVPA 4IP0A 3KK0A 3WGMA 5I7AA 1PUIA 1ODIA 1Y1LA 4AJHA 1CUHA 1X80A 4LE2A 1SXJA 4NMMA 2VQFB 1QX4A 1P1RA 2VJCA 1M5TA 3OPMA 4PLPA 1WXFA 4JVOA 1EXMA 3DDUA 3NNSA 5L4LA 4AZVA 2R2AA 2BC9A 2CHVA 3QPUA 4XJSA 2I3AA 3N0VA 3CZMA 2QNBA 4G56A 4RD0A 3FWKA 4K87A 1FFBA 3N75A 2F3SA 2IYXA 1JR3D 2XGJA 1O6FA 1H94A 4GR4A 3IT3A 4HEA6 3NBAA 1UDXA 3JWGA 1W52X 1KO1A 4UZSA 5EMKA 2QPAA 1LBIA 5AW0A 2IUFA 2WK1A 2XWPA 4BNVA 1N2GA 3O4RA 3HY6A 1M2JA 4J1TA 5JS2A 1ENOA 2JJ1A 2WT4A 1GPYA 3ZN2A 2Q62A 4OAOA 2I1QA 2QVXX 1CY8A 1QIHA 4TTSA 1WSBA 1CCWA 2V5UA 4E1AA 5BPFA 2JFOA 4PGMA 3FW1A 4WEOA 1RMTA 1S2GA 4K88A 1NY6A 4IICA 4D6YA 2ZSJA 4KQCA 1M0EA 2OFXA 4BQQA 1AE1A 4AJPA 5EY5B 2YL2A 5I4BA 3GJXC 3RTGA 1U9CA 2GCOB 3EC7A 3GCGA 3KPYA 3NATA 4FYWA 2AFIB 1W36D 1RLJA 3Q85A 4BP9A 4BAZA 5FBHA 3HVRA 4M22A 3MB8A 1SOWA 3ICQB 4R6XA 4N12A 1LBQA 4LK3A 5B6IA 4FKMA 4QFCA 3OEWA 2FW7A 3QKIA 3DOIA 1ULZA 1GEEA 4HRVA 4TS9A 4J4HA 1YDWA 3WK5A 4JC4A 2C3OA 4HWOA 3DB1A 4JU8A 1L7RA 2XX3A 3CLSD 1JUDA 3VNRA 1KKLA 2BY4A 1AK1A 5BWOA 3GZNB 1RM3A 1IL0A 3WL8A 4F9EA 1W36B 3DBVO 4G0OA 1SEPA 1TYDE 1PDWA 2H8KA 4I50F 2VEDA 4KAXA 1U4NA 2WTEA 1ZU4A 5TC4A 4D4KA 4QEZA 4CDRA 1MVNA 4DBVO 1QB8A 3NDRA 4HX9A 4MMXB 2Q6KA 4LRQA 3PE3A 4K9MA 4JUAA 4ALKA 4LXGA 4PZLA 4D57A 2L2QA 1TB4A 4DLVA 1JV2B 1YFKA 3P0JA 4ZP1A 4OO3A 4EMUA 3FDZB 2R6CA 1TAGA 4B9EA 4X41A 3HRKA 2J7PD 4ZOBA 2R97A 2OHIA 1AHHA 3ELUA 3HJUA 2QRNA 3WLLA 1BOOA 2OCLA 2MTBA 4QIHA 5EHGA 3TLGB 1OZFA 1GTL1 4YLEA 5KB3A 3LC1O 4JWKA 2JGJA 5EKSA 3SLRA 2OV2A 1E3DA 1SVMA 4FMDB 4OPMA 3SLGA 4CG0A 3FJOA 2FPPB 3C6BA 5GM2A 1KKMA 2VHWA 3CUYA 1YI1A 3PA6A 5KCMA 1J8QA 4JIGA 6AT1A 3G0CA 4LQLA 4AYXA 1CDDA 3NPMA 1KQ3A 2IKQA 4KKXB 4EG5A 4D81A 3HDJA 4KTTE 3R5FA 2EP5A 3RRNA 4P7JA 3HKBA 4FFDA 1TM5E 1PO7A 3F6RA 1TVEA 3DTTA 2PGDA 2WWIA 3GAMA 2TSYB 3R09A 2QLTA 4LXYA 1Z6GA 2RC5A 3LFTA 1Z2NX 5EIHA 1XCLA 5LJLA 5K0BA 3J80A 1UFOA 4PHCA 2D1QA 1E7YA 3RVLA 2BSAA 3DC7A 3M6LA 3B6IA 3ZDYB 5JSHA 5H5JA 3KQUA 2JVKA 2H3HA 4EX7A 2Q3DA 3ACCA 1UOEA 2GO7A 3A1NA 4GGMX 2OR3A 4E07A 1FLAA 5DYGA 1THGA 1DC4A 2XQKA 2AW3A 2Y76A 5PGMA 1CB7A 2B7BA 2I03A 3DKIA 3E8SA 2VP2A 3D59A 3ESXA 3ULKA 1TM3E 3G2HA 3KWJA 1SUBA 4ND2A 3VNQA 3L4SO 2X7JA 4E33A 2P3OA 1R6AA 4WDQA 3T06B 2G09A 5DMXA 2ZR8A 4HZUB 5DEOA 3RRZA 4EQZA 1I9GA 5L9AA 2I80A 3B1XA 4GGPA 4H17A 2GX6A 2Q2WA 4DIUA 1T36B 1YC2A 3QUCA 4G24A 1SZDA 4HCJA 5BQXA 3EW9A 3R6WA 3BXHA 4US0R 3OQVA 3QF4B 3W90A 2VNJA 1LX6A 3PRJA 3TG8A 3B3QA 4ZAVA 4FQ5A 1DL5A 3BRSA 3F7OA 5LP6B 5KHLB 1CIVA 4EITA 3KU4A 4JU9A 4N9WA 2WINI 3ZQ6A 2I8CA 3W5HA 4RANA 5C8YA 4UM9D 1UBMS 1OAKA 2F55A 3RC9A 3H9UA 2NZVG 3FAKA 3B1WA 1FNNA 1TQ4A 1RRVA 2RH5A 3VKHA 2NYUA 3V8BA 2HF7A 1Z6YA 2V6MA 4V2UA 1M5UA 3RVKA 1EFRA 5ALFA 1G0OA 1PEYA 3NI2A 4R9UC 4BFWA 4WY2A 5CB0A 2COUA 4BXOB 3DO6A 1CX9B 4UM9B 1XMIA 1VHQA 2I2XB 3G2IA 1G4UR 3VXKA 1I6MA 3HCNA 4BX8A 3L04A 5ETJA 4L8YA 2W42A 5KI6A 2QPOA 3E1GA 5BP7A 5C7OO 3U7GA 2HRRA 1ZINA 1E1RD 3L02A 1F12A 3MJ4A 3K53A 4AZ3A 5JS8A 1O0BA 3FETA 1B8PA 4WCFA 5HYVA 1QS0A 2BISA 3MIZA 4XIYA 1E5QA 4BNDA 5B7GA 2RFLA 1I7NA 3LCRA 2ERXA 4TMVA 3AEKA 3UB4A 1UKVY 2PTGA 2C7VA 2WSLA 4OQPA 4X60A 1PR1A 4UU7A 1KZGB 2QX7A 1FUUA 3VYRB 4WLVA 1BDJA 3QF7A 1D04A 1TKCA 3DHVA 1WDLA 4J0KA 4XD7D 3BC1A 4Q7QA 4QT4A 5I7EA 1JDZA 3T1TA 1G8JA 4YAFA 2J5XA 3ZV7A 3C3PA 3OZTA 5KNBA 3CF6R 3A11A 1VECA 2ZJ1A 1Z34A 3SC3A 2DT8A 2JD2A 3JSXA 1YVEI 2JGNA 1XA4A 1Z5WA 2NNLD 2WB4A 3WIUA 3WMWA 1Q95A 4LKOA 3DZCA 3A6ZA 5KYWA 2IS1A 1J2TA 4WZBB 1G8KA 2WJYA 1CVRA 2YYYA 4GZ5A 1WDWB 3UGQA 1MJGA 5CIYA 2HW8A 1ULSA 3FMPB 4D96A 4URXR 3PKJA 4JS0A 4C76A 3FY4A 1LSSA 1UWVA 2YXBA 4R3UC 5AOAA 2W2KB 2J6HA 5J59A 1HNXB 1GQ2A 2RGNA 3IIMA 1P0QA 2P4UA 2VL7A 3LBAA 4GG1A 3QJYA 4Z4CA 1EE2A 1MJHA 4U39A 3TJRA 3K9NA 3A2NA 2JIZA 5BSMA 4ZGWA 1CS0B 4HH1A 5BSWA 2VWHA 5JAOA 4Q1CA 3NVAA 3DGFC 1XDSA 2RKBA 3GZTB 3L6OO 3O73A 1RXWA 4DZTA 3A27A 3QVKA 1ZSYA 3SX0A 3TD6A 1GRNA 4E2FA 4Q02A 5GZ1A 4MYUA 4MJ3A 1IOZA 2B8TA 3BCRA 1ONNA 3CLSC 1N3BA 4RVUA 1IAVA 3WNZA 4Q15A 4XWYA 3W2IA 1UUFA 1B2RA 2E4ZA 1DVRA 3H9EO 3NNDA 4EPVA 2F1HA 5AW8A 3ILYA 4MPJA 1CSEE 1OYWA 1GGNA 3VVCA 4PG4A 3MB5A 1SIBE 2JD1A 4R9NA 1PX0A 1O94D 2P5SA 2I91A 4M9RA 2QRLA 4E70A 1PJ4A 1SMKA 3EA4A 1ENZA 2O2JA 5D3ZA 4