3KAQA

Flavodoxin from d. desulfuricans (semireduced form)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADGYDAVLMGCSAWGMEDLELQDDFAPLFDEMENMGLKGKKLAAFASGDMEYEHYCGAVPAIEEKARGLGAEVICEGLKIEGDASSDPDAVSAFAEDVLKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Crystal structure of flavodoxin from Desulfovibrio desulfuricans ATCC 27774 in two oxidation states
pubmed rcsb
molecule tags Electron transport
total genus 50
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kaqA00
4M0CA 4C0WA 1FLAA 1YKGA 5TGZA 3HLYA 3OX2A 4NULA 2WC1A 3FJOA 4Y7CA 2V5UA 3B6JA 4FGLA 4YAFA 4H2DA 2BZSA 3QFRA 4GR9A 3KEGA 6NULA 3SVLA 4DY4A 2Z9BA 1CZKA 1AKQA 5F4BA 4PU0A 2FX2A 2QMZA 1YCFA 1WSBA 1FVXA 1AKUA 1FLVA 3QE2A 3GFRA 1XYVA 3ES9A 3OX3A 2QR2A 4CF6A 2R97A 3OJXA 1C7FA 4GI5A 1CZRA 3HR4A 4ZVLA 4ESEA 4FGKA 5BUCA 1NNI1 2XODA 5EMNA 1XI2A 3NHUA 4D02A 1SG0A 1WSWA 5EAIA 1H66A 3UXEA 1YDGA 5NLLA 3OVMA 1XT6A 4YALA 4H6PA 4QOEA 4XDHA 4HEQA 1E5DA 3L9XA 4PTYA 4FX2A 5ULLA 1VMEA 1TIKA 2W5UA 4QOHA 3NHWA 3KAPA 2OHJA 4U7FA 2XOEA 2HNBA 1I1OA 3NHFA 1T0IA 5LJLA 3S2YA 4ZVNA 4U7GA 4ZVKA 4QOGA 1OFVA 1JA1A 4R81A 5FX2A 1D03A 4QODA 2A5LA 2QX9A 5EA2A 5NULA 3N39C 4C0XA 4LA4A 1QBGA 1OBVA 2QMYA 4N82A 3EDOA 1DX9A 2FAXA 3LT5A 5JROA 4DILA 5LVAA 3GFQA 2KLBA 4LTDA 2BF4A 2QWXA 1RLJA 3JSXA 3KAQA 1J9ZA 1FX1A 5B3LA 3KLBA 4ICIA 2MOKA 3NHKA 4GQIA 1CZUA 1DXOA 4QOIA 3NHYA 1FUEA 2M6RA 2Z9CA 1RTTA 4N65A 4N9QA 1AKVA 1AKRA 3OX1A 3QFCA 2Q62A 4C14A 5F51A 1F4PA 4QOJA 4NLLA 3UXHA 2Q9UA 1T5BA 3NHPA 2FZVA 4Y9UA 4LTMA 3NLLA 4BMOB 3FX2A 4OXXA 3OWHA 3TZBA 1D4AA 5LMCA 1J9GA 1YCHA 2B3DA 3NHLA 5F12A 2D5IA 2M6SA 2Z9DA 1OBOA 2FVXA 3NHJA 2QX6A 2MTBA 2FOXA 5FA6A 1AG9A 1QRDA 4F8YA 3EYWA 2OHIA 3O73A 1BU5A 1YOBA 4YAWA 3D7NA 5FUQA 3W7AA 2HNAA 2MWMA 1TLLA 3FNIA 2FZ5A 2BMVA 1RLIA 1SQSA 3HA2A 1D04A 3GFSA 3GAMA 2Z98A 3ZHOA 1X77A 1J9EA 1JA0A 1AZLA 1FTGA 2QX4A 4XDGA 1FLDA 1V4BA 3O2NA 1YCGA 3W77A 1GG5A 1FLNA 4J8PA 3NFRA 2AMJA 3F6RA 3F6SA 4YAUA 5LBTA 3NHRA 1ZX1A 3TE7A 4PTZA 3U7IA 2FLVA 1KBOA 1XYYA 2ZKIA 3OWXA 4LAFA 1CZNA 1DXQA 1YRHA 5B3KA 2OYSA 4YAOA 3TEMA 3ESXA 1AMOA 3R6WA 3K1YA 2X2OA 5LJIA 1AHNA 1B1CA 3FW1A 4C76A 3P0RA 1QR2A 3B6MA 3FVWA 2RG1A 2HPVA 4CETA 3B6KA 3NHSA 2QX8A 1CZLA 2GSWA 4U7HA 3ESZA 2F1OA 1AKTA 2V5VA 1QHEA 3OJWA 4QOFA 3W78A 1ZWKA 4HS4A 3B6IA 2MT9A 3RPEA 1ZWLA 2BPOA 3ESYA 4DIKA 5LLDA 5LBUA 2X2PA 3LCMA 2R96A 2ARKA 2FDXA 1CZHA 3N3BC 4LTNA 3L9WA 4ZVMA 1H69A 4YQEA 4FGJA 2N1MA 1RCFA 4Y9RA 2KQUA 2V9CA 2BN4A 1C7EA 3G5MA 3K20A 3W79A 1CZOA 3F90A 3U7RA 1BVYF 4BMPB 3F2VA 1J8QA 1KBQA 1AKWA 2OHHA 5A4KA 3N3AC 4S24A 2FCRA
chains in the Genus database with same CATH superfamily
3RRZA 1V1MB 1YJ5A 3IURA 3MQFA 3RTDA 4ALKA 1LLUA 1SN7A 3QVKA 2XD4A 4QBGB 3Q8MA 1NT4A 1NC1A 2ENWA 3GXBA 3VC1A 1PL8A 4CM9A 4G0WA 1U7WA 1RHKA 2IPMA 4JLWA 4G3XA 3T3PB 3WB9A 3NV7A 1IQ0A 4P0TA 5EJ6A 3NGLA 2J0EA 5TGZA 4MYCA 1OXBB 3U4CA 4AW9A 1Z6XA 1BMTA 4DBVO 4RADA 5FAKA 4XTRA 1BQEA 5LMZA 2D1TA 1VTKA 2DZDA 3FJOA 4BTEA 1B8UA 4N5HX 1OI2A 1EWTA 3BHNA 2L18A 1YAJA 3C39A 4I46A 5AICA 5AUQA 5K3FA 4GX5A 4X3OA 3MAAC 1MABA 5EHZA 2BZSA 3T5GA 4ZGWA 4DV1B 3KQSA 1SWVA 5BQFA 2IDZA 4D57A 1PJCA 1U0RA 2HRCA 1C9EA 1XSEA 2H1SA 1C1XB 3D0QA 3WK7A 4A4DA 2F64A 4XDZA 1SQ6A 3H3XA 5CEFA 4P8RA 1CJTC 2GCOA 1P9RA 5D2CA 5JJKA 3CEAA 2IX9A 2ZSFA 3RYCB 4XIGS 1UM9B 2ETVA 2WT4A 3D1JA 4NNJA 4B7CA 1IXYA 1U9CA 2CEKA 5LN1A 4AY6A 2OC9A 3IPYA 1NN3A 2X8LA 2HNKA 4II3A 3FWNA 4W1PA 2OB2A 1XAGA 2VAVA 4LJKA 4E46A 4ABTA 5CXSA 4B0OA 4NRDA 1WPQA 3MGBA 5AWFC 4TKMA 4BB9A 4RA9B 4QQKA 4TSKA 2IYEA 1FYFA 4YRZA 2Q1SA 2F2TA 1J07A 1FYWA 4MLPA 1NVGA 4PRLA 1TJ3A 2JJYA 4BPBA 3TLEA 1U0NA 2H4ZA 4G1CA 1MDFA 4CNQA 3SSOA 5TT1A 1KHHA 3ZHYA 4WX2B 4JT4A 2LKCA 2H2WA 2QTRA 4LY3A 1M2VA 4PLPA 3ZN2A 2LGJA 3NDRA 4HH0A 4NYJR 1OHHA 5A2GA 5H80A 4Q1CA 2PPLA 4K6OA 1CRWG 5B4VA 3BCRA 1E1CA 1JL3A 1DZ3A 2GEVA 2P0YA 2P7HA 1IRXA 4B6QA 3HVJA 4NBNA 1U1IA 4KGXA 1W8DA 4BO4A 1JALA 3JQ6A 1EG7A 4S35A 3NOVA 5FCDA 5GINE 1IK6A 1GA6A 4BWGA 4JL8A 1ORTA 1PZNA 2P77A 2P2LA 2IUTA 4I50B 4CE6A 3IB6A 2ZVQX 1XJQA 1ZAYA 2VFAA 3QW2A 5DBOA 3MCZA 2PX5A 4Q7MB 1HFKA 3G89A 3IO3A 3R7NA 1S8FA 3KDAA 4D46A 2Q2OA 5JS6A 2R5WA 5JPCA 1RZVA 2CHUA 2BELA 4ALJA 3FPBA 3LUHA 4UOQA 2ZKLA 5F33A 4B76A 5BSKA 1H66A 2CDRA 3DQQA 3S7ZA 2QTVB 4BKRA 1S9HA 3QPBA 2CJXA 1E6MA 1YDGA 5GADl 2H52A 3C6QA 3E9MA 4HTFB 5J63A 2WUFA 3DBOB 2GD6A 1FQJA 1I9CA 2XI4A 1JJAA 2HSWA 2Q1WA 3EGWA 4N5LA 1BHJA 4PCUA 4RZIA 4FX2A 2GPBA 3ZHQA 1Y3DE 3D1LA 3TECE 4UMEA 1UDRA 2Q5JA 1D0SA 4FT2A 4XPZA 3RSFA 4UCQA 1N0IA 3VX4A 4F5DA 1PS9A 4YRJA 1N2CB 4TSRA 1E3IA 2AIRA 5A71A 4DA6A 3JCZA 3MTEA 4JOQA 2LCFA 4NYJQ 1YCDA 2XVYA 3QSYA 3QYJA 1PJ2A 3OEED 3AJ9A 4JELA 1BXRA 1UPUA 1XL0A 4XJVA 1L5GB 1RM5A 2GEUA 4MEJA 4A82A 4B3SB 1BU8A 3RIGA 1SHUX 4QOSA 5KTYA 3KETA 3ZDAA 2QZZA 3GB9A 4QLBA 1T9GR 3L3BA 1ZM9A 1YE8A 1G2PA 2BEVA 5LJLA 4G0QA 2IJGX 3QF7A 2C92A 1JTFA 5FTKA 1ZNZA 3VZPA 2OL4A 4P0QB 3IAAA 1CX9B 1X0VA 1QOZA 2FF5A 2X14A 1ZN2A 3NBKA 3D6AA 4O3MA 5LB4A 4LF5B 5E3HA 5CDGA 4QODA 4US1R 1YTUA 4BJ1A 1PR2A 4RIGA 5EJMA 3T7CA 1U1GA 3V8EA 3EHDA 2A7XA 2WZQA 1KAHA 1IOLA 1P3JA 1MX3A 2Q50A 3EUAA 4ZT4A 1J21A 1GL9B 3RUDA 3WGTA 3WNZA 2QW1A 3KKZA 4HEJA 1IJBA 1L7NA 2KSQA 2GQ0A 2Z56A 3GNQA 2GZAA 4DILA 3RC8A 2PYDA 4UPEA 2VPPA 1KXJA 1O6FA 2D1SA 2R9VA 4AC9A 4EUFA 1JVBA 4CMIB 3HV0A 5E6RB 3RVOA 2FXVA 1U0BB 2PH5A 4ER5A 3GRPA 4N01A 3BF7A 2IP2A 3JWIA 2WSYB 5BYAA 3RSCA 2Q4EA 2VT6A 1YDWA 4NJEB 5CH8A 3TE6A 4AY2A 4IUCS 4MV3A 3S81A 1US8B 4ND8A 4QXRA 4I0WB 5JH7B 1LLFA 3AU8A 1VLMA 3PWKA 3LYUA 4QASA 5GAJA 1ZK1A 4IHQA 1YR6A 3NHKA 4L9AA 5L4LA 1QONA 4TX1A 5ERGB 2VK8A 1H4QA 1DXOA 3ONVA 4QJ5A 3RNOA 1V1MA 4XVRA 4AUEA 1XCGB 4E09A 1EVQA 4HDKB 1TK9A 5IJAA 1VPLA 1S5PA 2CLKB 3OE1A 3R0IA 5ALXA 3TQSA 1QO7A 2NXWA 4E2XA 2A6PA 1HLGA 3PGVA 1WCIB 2F1JA 3SIWA 3DL2A 4YV2A 5JQGA 3HR8A 3QFSA 1ZI6A 3MJHA 3PEEA 4IV5A 3HTXA 4CQLA 1T43A 4WBNB 7REQB 3O84A 4U6SA 1PQPA 2VQ3A 2WINI 3B9PA 3FOAA 1FRVA 2QXYA 2W6OA 3HJCA 2HK6A 3IR5A 4IYRA 5CB8A 5KJCA 2ECQA 2JCVA 4XYEA 4CI0B 1NF8A 1C1XA 3WADA 1R8SA 3WK4A 2RHCA 4QC2A 5G0UA 3UXHA 2CLOB 3WTBA 2XT6A 2G1JA 3KJIA 4L8FA 5AESA 2R8ZA 3FWPA 4MR7B 5CB0A 2OZEA 4Y9UA 1ZGGA 1P0QA 1YULA 3HYNA 4HLDA 4JFRA 5LZ7A 2J9FB 3D02A 3X2SA 3SQWA 2CE2X 1SHKA 2P9FA 3RYCA 1C7RA 1UM9A 1A8SA 1U3TA 2IEDA 2Y1CA 2YIVX 5CH5A 4AURA 3O8QB 4JZKA 2WJIA 1IVSA 4EY6A 4NV0A 1TKRA 1T5SA 2GJAA 1UKZA 2I4RA 3WLEA 4IKOA 1EP1B 4RA9A 2WG1A 1E79D 2WSIA 2Y1DA 1E6EA 3V4OA 5IJWA 1EQ2A 2ZUCA 3GLHB 4YRBA 1DEXA 1VMKA 3HL0A 1JHYA 1GADO 3WMFA 2G06A 4PHFA 4MITA 4R01A 4B40A 4G8CA 2QW0X 3AM4A 4BNXA 4F8YA 3K9GA 5E4JA 3QKIA 1GLVA 3M4JA 4IH1A 5AIAA 3VKWA 2NAFA 1WJGA 1DIBA 3A31A 3FROA 3OSUA 3FWKA 2A3RA 1A4UA 4Y30A 3LW8A 4BNNA 3W5UA 3MB8A 2ZW9A 4IJQA 2AW5A 2WJYA 4KRFA 1A5ZA 3QVVA 3R5HA 1T2EA 2NQTA 4CEHB 4BYMA 4QICA 5FAXA 4FCCA 3BDVA 3DAFA 2H3EA 3PSAA 1MRNA 1N5IA 4ESOA 2F9MA 2N3ZA 2OUKA 3O8NA 2J7PA 2LNDA 1TCUA 3E8SA 1GO2A 1ORVA 2LIVA 4UASA 2RC6A 1DC6A 1T5HX 2VF2A 3INRA 3DCJA 2WMOB 3AW9A 3WGQA 4EHBA 5AOBA 3CSUA 3HBLA 2HNAA 1YE5A 1SZPA 3TKLA 2J1LA 3PNMA 3Q3CA 1D8TA 2AFHE 1A2KC 1GGKA 3JQ8B 1AQNA 1VP9A 3VSCA 4JI8B 2R8PA 3I9OA 1EFCA 3KYDB 4C7VA 1RLIA 3G2KA 3RRJA 1L5WA 2QTVA 3QKWA 1G3MA 3SX2A 3VPXA 4F8EA 1M67A 2VHZA 2H1RA 1VSTA 4UHFA 5FLYA 3UFBA 4HTFA 3SHWA 5K0FA 1YZFA 1EUDB 3IBCA 2RC5A 3QEMB 3QLVC 4G0ZA 1BKSB 2PYIA 4PEVA 4QQ8A 4HUQB 5IUKC 2ZUTA 1BRTA 4D9EA 3I23A 3PT9A 3NV9A 3QU2A 4L7VA 1C9YA 1F4VA 1N2HA 2QTLA 2JGKA 3JXEA 3OZAA 2RHDA 1N2CA 1QQAA 5UKDA 4IS2A 1T8TA 5B4UA 1ANKA 4RVGA 1VYHA 2C3YA 4P93A 3RLFA 5EJ8A 3U5TA 1FLDA 1NVWQ 3WLQA 4KLCA 3OQ6A 4ARBA 1A2OA 3GA0A 1UOOA 4PQRA 3T7TA 1PLJA 2XVAA 4UDNA 5HXAA 1YFJA 1EP2B 1VCHA 5EWJB 2JI9A 2F3TA 3RS4A 3HYRA 2I34A 2DF8A 1W4BA 3DNPA 5I7HA 4JN6B 5L3RA 2JLAA 9LDBA 4ZIRB 3EQZA 1DEHA 2KHZA 3HU2A 1UMBA 1ES9A 4ZWNA 4XSVA 3O90A 1O89A 1P2SA 2PKRA 4JKYA 5BPHA 1KDPA 3HXPA 3VYRB 5CDSA 4L22A 1NXSA 2FLVA 1YAHA 1VJ0A 2R8BA 2G28A 3OC0A 4KXNA 4LOAA 3A6HA 1JA9A 1XYYA 2C9DA 2YXPX 4QGSA 3Q8LA 3H2GA 3O21A 3WYAA 2ZWOA 4RTKA 4EMSA 5FBHA 4RFLA 3ZJYA 2VDUE 5ED4A 1SOMA 2A0WA 3CNLA 3EPRA 1E2KA 1T2VA 2R4TA 2HREA 4BWYA 5SY4A 3CRQA 5B3KA 4P7BA 3AF6A 1R8XA 2FSPA 4JBHA 3O8CA 4JGIA 3ZEIA 3AHEA 1QPZA 2MINB 1ZSYA 3OTHA 4CMIA 3IBYA 2O3QA 5E6RA 3RS8A 5DIZA 4RAOA 5JCOC 1JG1A 3ZCPA 4CIYA 1YBMA 2G9QA 2JAPA 2YXLA 1XD2B 3N53A 5HTOA 4C06A 5IWAB 1ZM4A 1W0KD 4AJLA 4NJEA 4B87A 4EFDA 4LV5B 1AY0A 4QVGA 4RNCA 3H42B 1U4NA 4B6FA 5FOUA 1TF2A 1UK8A 1US8A 3GJ4A 4M9SA 4AYWA 2IE0A 3A2LA 4KE8A 5F9MA 3ORQA 5FOXA 5JH7A 1CQPA 4OMUA 3I52A 2IH4A 2Z6QA 2QYSA 2EJTA 5KCZA 3E2PA 1YA6A 2HPVA 3LT0A 2ENUA 1O95D 1H2WA 5KVSA 3G6KA 4DR5B 1NW9B 3AYXB 3HY6A 2FFRA 2I6SA 1CQJB 1T4BA 2VKQA 4HDKA 1DQSA 1E8DA 2JEZA 3DLAA 4G89A 2PEYA 2H7CA 4GVPA 1W4CA 4TQ9A 3L8GA 2DKNA 1NBAA 1QIDA 1SBTA 3GT0A 1WCIA 1JX6A 1ETHA 1RXUA 4JYCA 1THZA 4KO3S 4NY1A 1B6GA 4DT1B 5AXDA 4HVTA 1KQOA 4KXQA 4QO7A 4L4SA 1JB9A 4WBNA 3GK3A 1R50A 7REQA 3NTQA 4HI0E 5HUHA 3FWYA 4DB4A 1AV6A 5C8XA 4NL4H 3FUUA 3BTVA 5BSUA 2P2DA 1Q44A 2YFHA 3I53A 3LG2A 4FJ0A 4G41A 3WRYA 3QEJA 5KOHB 3BL6A 4MV7A 5HZHA 2J3MA 2Q3FA 3E27A 4GBJA 4W6ZA 621PA 5JWOA 4EYKA 4O1IA 1HO3A 1BHO1 1DAPA 1G17A 2EL9A 4TQUS 4MR7A 1NNEA 3BK7A 4RZHA 5DHTA 3NG1A 2FFAA 2J9FA 1ZINA 2V5AA 2HMTA 4HS9A 4KQIA 4ZYUA 4QTZA 3S2EA 3NDPA 3U81A 4RL4A 2O8BA 2AYXA 3O8QA 5F2KA 3MIIA 2GBCA 2WT8A 3RUAA 3T3DA 4Z54A 3KSDO 2IOHA 3L4EA 5LQRA 2XR1A 1H2ZA 2A35A 2OP1A 3L0SA 5TGTA 3W2IA 5BWNA 1UWLA 1XAHA 3TAXA 5EZSA 4UUNA 5B7GA 1KMQA 3TWOA 1KAOA 3K9HA 3GLHA 3QXSA 3IO5A 2ARKA 2FLKA 3O83A 1OUMA 4OFZA 4OFWA 4NQZA 4W9RA 1XTIA 2B4AA 4RKWA 1MDBA 1U2PA 1UKCA 1NW7A 2QU8A 3HB9A 4I3GA 2VP0A 4S2EA 5DGHA 4K9KA 4PYRA 1RLTA 1ULZA 3Q3HA 4DQVA 3NIDB 5JATA 4DSNA 2E48A 3A6KA 1VPWA 4YUVA 1G4AE 1ZL0A 5JZMA 2G70A 4FC7A 4FGJA 1TKAA 4CEHA 2R79A 2FYTA 3CR3C 4Q15A 3NKLA 2ECKA 1LDGA 1SC4A 4JP3A 2OXIA 4Z51A 2CK3A 1I7QB 1JHDA 1S3IA 4FYHA 1ISSA 3PDHA 2HIMA 3H9JA 1LPPA 3JD2A 1KAQA 3O3MB 2ONCA 4GT1A 3KLMX 5CM9C 1I01A 4AMYA 4R8MA 1GRQA 1NURA 3EVZA 4LBYA 3H0CA 5B3AA 3VNQA 2AD5A 3KOXA 2QLMA 1BE0A 1RQ7A 2EERA 3JQ8A 2I6TA 4CV3A 4B2LA 2NN3C 2R8EA 4QULA 1NG1A 3G5MA 4IKEA 5DLYA 4PX2A 5EHQA 1G16A 3HCWA 3KYDA 4L28A 3WFJA 2XYVA 4JNCA 4LJ8A 3DEKA 2WKQA 5IC6A 4QPDA 2QMUA 1CQXA 4CKYA 1RWKA 3RUIA 1CR2A 1LVHA 4A0QA 1YB5A 4QZVA 4C7OB 4HNRA 2ZE8A 4AWXA 1EUDA 1TCVA 2C1ZA 3QEMA 5IZCA 3D2CA 1WDLA 4G6ZA 3JVVA 2POQX 4AKIA 4R51A 3P0JA 1D6MA 3CE6A 3MRTA 4HUQA 4BVKA 3MTDA 4DBZA 1KVRA 2CFRA 1NBME 2HMVA 3H7AA 4DC0A 1M34E 3CLTC 3PQ7A 3ND5A 1QGAA 4ID3A 1V71A 1BAPA 5LU8A 3FKQA 2PDAA 4ZI2A 4TN1A 4ARSA 1MIHA 3L05A 2M9MA 2VF8A 3GRYA 4PRYA 4XLLA 3U62A 2VXOA 4IEFB 1L5RA 1TGYA 3VYSB 2QG6A 2GPTA 4LBVA 1UBCA 5DSZA 1ODCA 3AJEA 3EXAA 1FSPA 1ENZA 1N8SA 1GRRA 4QYXA 3RTEA 2CCKA 3S0JA 5IMBA 4G4SP 4BNYA 5EWJA 5HW0A 3O8OA 1NYRA 1JFTA 1G2IA 2EXXA 2ZB2A 1XTKA 1BWSA 3FMPB 3H8SA 1EVJA 3AEXA 4ZIRA 4PZ0A 2UYCA 2VBCA 3BJRA 3HADA 3E22B 1HFJA 2ZBFA 4ZEOA 2AF4C 1RKUA 2WV7A 3A3OA 1NY6A 2GEKA 3H97A 3I92A 4H2DA 4URUR 1GIAA 3E9QA 4Y2JA 3PC3A 4GR9A 1O97D 1PF7E 2P41A 2Z2JA 3CF4G 4CMEA 5KWVA 4LZJA 2EYQA 4O4JF 1JIKA 1TJNA 1WXIA 3ACCA 5LLTA 2KYRA 4C2AA 3LHSA 3JD4A 3IE1A 2GJKA 2EZUA 3OICA 1XTJA 5JARA 3KIPA 1SXJD 1T5LA 4G5GA 2Q4OA 1N5JA 3PDCA 1WEKA 2JZNA 2IHVA 2QMOA 4KZKA 3U4IA 2QTGA 3BM5A 3L0IB 5E38A 4BC0A 2BJVA 2MINA 3DOEA 1JU3A 4C0JA 1ADBA 3MYYA 1CDEA 1EWKA 1TQHA 1FPMA 3VGPA 1G3QA 5THXA 3W9UA 1HTWA 1QDUA 1UP4A 1XD2A 1WUYA 4KH1A 4N54A 4P4GA 5A62A 1KMMA 3F96A 4KL8S 1GFSA 3QGMA 3MM4A 3EXHB 2HSGA 3C3KA 1TU0A 5JQGB 4WZBE 1T9HA 3O4FA 2GNPA 4AJOA 3WZMA 1YS1X 2HYIC 3P0IA 3SC2B 3A1CA 4ZT3A 1N2IA 1I7LA 1LS1A 2BHLA 2VA9A 1CQJA 1R5OA 4PYNA 1EK1A 2BCEA 4DNFA 1T6ZA 3C0KA 1ECFA 1DS6A 4Z8XA 1ZG3A 2AEFA 3O95A 4NBLA 3GWGA 4DT1A 2IHKA 3QUQA 1K63A 1K9SA 1TYCA 4XLZA 1PJBA 1P9OA 1BX3A 3W04A 4BTVA 1MB0A 2ID9A 3N8NA 5AVJA 4E14A 3OE5A 3SBEA 2LRHA 3VNAA 4ML3A 3BREA 2CT8A 3COPA 1K98A 4Y0NA 5KDLA 3OQVA 3P1JA 3PENA 4H7DA 3RFXA 3BT7A 1S96A 3E9CA 3QW4B 1YS2X 3JQRA 5KOHA 4EKIA 1PSWA 3TQHA 4BBJA 2BE9A 2GZSA 1BJRE 3O1IC 4M53A 3QX7A 4X84A 1DLJA 1JKXA 2AOWA 3UV6A 2SHKA 3SJ7A 1ZVVA 1U8AA 4WLNA 1UBRS 3G23A 1E63A 1Z9BA 3HO1A 1F14A 3H83A 3GGGA 4I8IA 3R7DA 1A0OA 1K89A 3RHSA 2CVOA 1TAHA 1WRBA 3OIVA 4KIGA 2G82A 3EIEA 4QGAA 5K8IA 1PE0A 2AG8A 1U2DA 2PFSA 4V0ME 1YVEI 4LISA 1EJ2A 5E0KB 3TIXB 4HAIA 3H4MA 4U5QA 1F06A 2UUPA 4XIFA 1LH0A 5GJWC 4II7A 4Q7QA 3RBVA 5KTKA 5HSGA 1ECJA 3M6FA 4TZTA 2YIJA 3LDUA 1DUVG 3P94A 4GKAA 1U7DA 4RETA 2CK3D 2AC4A 3AVVA 5H68A 4AQDA 3NEYA 1OVGA 3OJEA 3QOWA 3F4BA 4QPCA 4EOGA 3DLCA 3I8SA 4R05A 4E7OA 1RE1A 5IJXA 3PHIA 4B34A 2UZIR 1SKQA 3BQ9A 3GJ5A 1K27A 2RGCA 4Z7OB 1NV9A 1Z4NA 1J5PA 4AJJA 2WF9A 5BXYA 4LFBB 3USES 3WNBA 1XP8A 1EQAA 3VI4B 1DHRA 3HS3A 3TQCA 3V4SA 3LK7A 3D4IA 4TRJA 4U7GA 5PNTA 3R8CA 4I1SA 3K0HA 2CFIA 3E3MA 1XRLA 4QOGA 2WWHA 2GAFA 3HWWA 4Z86A 4RANA 2JCSA 3BX1A 2FZEA 4MB6A 4JHXA 2B98A 2DUNA 4KN8A 3RKUA 2H0QA 3NANA 4XPIA 3KR1A 4UMVA 5JMTA 1B4DA 4BRSA 1DXHA 3LT5A 3GA5A 4BPRA 3F67A 1M6EX 4IWNA 5EZYF 5AIBA 3BRWD 2Q27A 2BI4A 4IUBS 2Z4RA 3DWGA 3FFXA 4RDHA 3GX1A 2KLBA 4LTDA 2V6GA 1QHHB 3BXGA 4M0UA 1IJEA 2VJMB 5CFQA 3GYGA 1W0JA 1QIKA 4AL4A 1ZEMA 4X6UA 4C7OA 2ISQA 3W2FA 3K6JA 2EFGA 3LOQA 2CBZA 3ZGOA 3HBNA 1DI0A 2RGUA 1ZOLA 3CLSD 3FIUA 1G1MA 1PFQA 3LLMA 3LUKA 3GFVA 4PWZA 1CJVC 3O6VA 4IXDA 4W5HA 4XYBA 4YBRA 1FX1A 3RK4A 3VTAA 2AD1A 4F12A 2GM9A 4PLFA 4DLLA 3OM9A 4FB4A 2MOKA 1F38A 3FDZB 5EIWA 1B1AA 1SUWA 3DNFA 4ZZ3A 2QY6A 3U6KA 4Y1FA 5FL7A 4BLSA 2TRSB 5GZ6A 3ROEA 4BEWA 3PYXA 1T1RA 1JXMA 3M8KA 2Q0QA 2XRZA 2C4KA 2F67A 3EH2A 3TX6A 1Z8NA 1NLMA 3OCXA 4ZTZB 1PWHA 1NPDA 1VMAA 2G5TA 4D4IA 1V96A 2VNJA 5I9TA 2O07A 2FFHA 1JHZA 4C0HA 1M6HA 3QELB 1WMDA 4EGFA 3PFCA 1FDRA 2VP3A 3E22A 1QYIA 3UYKA 1EUQA 4X7PA 5KQGA 4H1WA 4OI0A 3N8HA 3NNNA 2CHVA 3M2TA 3NX4A 3QYAA 1LTKA 2EFDB 1PCXA 1KO5A 2XQIA 4GKKB 5D86A 3C3JA 3AB3A 1R6VA 4XTCS 2OV8A 1SXHA 3NHPA 4FBLA 5DE3A 2GD0A 2R62A 1G6KA 1LXCA 4RTNA 2GM3A 4MQLA 1ZCFA 4BLWA 3DP7A 4R9RA 2BFAA 3C5CA 2CEAA 3WK9A 1NXTA 1AH2A 2YQ5A 2Q0HA 3WBBA 1L2TA 5KQSA 1QU2A 3G8CA 1WV1A 2HSJA 8GPBA 2P69A 4XRRA 4IOLA 3RRXA 4JEUA 3OX4A 4DQUA 4M8SA 1Y33E 2AMFA 3TOCA 4EKGA 1LBEA 3A3KA 3S2UA 3EXHA 4X94A 1R16A 1L4BA 5L6MB 1XK7A 5JNRA 5CCXA 4E3ZA 1M1UA 4O5OA 5C52B 2QYHA 3SC2A 2QM0A 4JBYA 1TM5E 3Q5DA 1YJCA 4LJ5A 2ZRQA 3PJRA 1A1SA 1DFGA 2ERCA 4BFZA 4GU5A 4BKMA 4HRAA 3FHLA 1FXWF 1SWWA 2CJYA 4S1WA 4HWGA 2YYZA 2W2QA 3T9BA 1MBZA 3V3TA 1NJ5A 2DR3A 3GEHA 3QVLA 4TVOA 2G7ZA 3II6X 5A4IS 3RCBA 1WXQA 3AR5A 3T34A 2ZBPA 5CLIA 4LY9A 4U7DA 3FF4A 1C0LA 2OZKA 1EJ0A 2B1RA 2WVAA 3Q3JB 1K4KA 3FNIA 4LWOA 4MUKA 4XQ0A 3EY9A 3G2MA 2OT3B 1SBIA 1L5QA 1UK7A 3L8YA 1ZUD1 2ZJ7A 3NTOA 3L0CA 5FPPA 1IXRC 1O54A 4YT5A 2NVWA 1ZMTA 2EAUA 5AFSA 4QNNA 3LKDA 3ZDXB 4FS3A 1H8HD 1RCUA 5FV7A 3CYFA 1KL7A 4D3XA 5JNVA 5KYKA 1RW4A 4JJ4A 4UW9A 2PZBA 4UNSA 4Q48A 1WWKA 4JLKA 1FNMA 3JWEA 1X7HA 1S8OA 3QOXA 5TDHA 3KKNA 3VJMA 1TQDA 2ZS8A 1CQZA 3IGFA 4L15A 4B5LA 1AF7A 4QQNA 3MWFA 1HPLA 4XM1A 2GCEA 2PX2A 2ZLBA 3TPCA 4XDGA 1C7QA 3SYLA 2PAAA 1BZYA 4BJ5A 4ZDKA 1LK5A 3VU1A 2R6R1 5B64A 4R40A 3BIOA 1OAOC 3CWZA 4CBVA 1RPTA 4IH9A 4XB2A 3GN2A 2ONYA 3FVRA 4Y6OA 5KDOA 2W42A 1V16B 1GUYA 4K6GA 4LC9A 3MD0A 1R5JA 4UNIA 2OUIA 4HCJA 4MV1A 1TD9A 4QYTA 3ZX5A 3M6UA 2VT7A 3KOWA 4QXAA 3OIDA 4MQEB 3U48A 3URKA 3VR4H 1VKZA 5BW6B 3EFOB 2C4VA 3EBOA 4JLNA 3DFMA 4TSFA 1NP3A 1X7DA 1PNVA 1RACA 3WRYC 1RTKA 4HFNA 4Y2GA 3TE7A 1L1FA 2P5UA 4GLJA 4RESA 1KIFA 3AY3A 1X1SA 1XRPA 2UYYA 4BRWA 2PUWA 1J39A 3BZUA 2YBDA 5BNIA 1M6YA 2ZKIA 2QTWB 2PXHA 3OWXA 1OXUA 2ZIEA 2XUKA 4OXQA 5LXTF 4X7RA 1J0BA 4YXFA 1IM2A 5KTOA 2EG9A 2C5HA 1Z0ZA 4OK6A 5GV7A 1DKQA 4UM9B 3LKVA 1ECLA 3BG5A 4RABA 2NUTB 3R75A 5BYKA 2XGMA 3GUHA 3B38A 4RORA 3CRW1 5JE8A 1QHHA 3WWZA 1PW5A 4R2MA 4R8SA 4BNJA 4WSOA 5KYVA 1FIUA 1QLJA 4OQNA 4MIKA 2WWRA 1A5TA 2V4MA 1RYNA 2HU7A 3IDZA 4YCLA 3J81k 3SJAA 3RIMA 2YYAA 3ZNOA 4IIJB 3M1IA 1FTYA 4MYSA 1Q17A 4C4TA 1J0AA 1XZMA 2NZUG 1VI2A 5D6NA 4AQ7A 4XFJA 1S2MA 4RXMA 5DISB 2A92A 1S8AA 4HH1A 3BXHA 1E77A 3ILXA 1XLWA 3HGTA 1E66A 5K05A 2HWYA 3FDZA 3JD1A 2XIJA 4A15A 3DCNA 3LQFA 4KYUA 3FZYA 4OSOA 2I03A 4HZIA 2D2IA 3BIJA 4R9NA 4RQAA 2RKOA 5T41A 4DUGA 5KNCD 4PS0A 1GT6A 3KJXA 1XDSA 4MV8A 4NG5A 3WNDA 2AFHB 2AFIE 1VE3A 3M33A 4Z1MA 1GNLA 4ABYA 4OLJA 5DRTA 1PTKA 5I45A 1NL3A 1FDWA 2REQB 5A05A 1Q95A 3UGJA 5BR1A 4JMPA 4PPQA 2V7EA 4JS0A 5F1KA 3VC2A 1IN8A 4O1HA 2QAJA 1JAHA 3QELA 3RJMA 1RAFA 1TKCA 2RHMA 3I2GA 5K2OA 5CIQA 5CLHA 1GKLA 2VAWA 2L2QA 4G5YA 5EP2A 4QOFA 5KTNA 5J47A 1UDWA 2BFOA 5C5EA 1WB9A 4A2QA 1J5XA 3E5MA 2VYVD 3MGGA 4BWVA 1QB8A 2XT9A 1H9BA 1WHSB 3E18A 4G5OA 1ZWLA 2BPOA 3GEMA 1A95A 1BYUA 1WG8A 2AG5A 5GOTA 5IZCC 4KVGA 2ON6A 1MB3A 3DF7A 2Q5OA 1RE0A 3ESYA 1QM5A 3TMYA 3PNKA 1V4VA 2ZRKA 1U2SA 2QJRA 5I6DA 4Z4CA 3H1GA 2E7ZA 3EEFA 3VDNB 5G2OA 4BLTA 4DHWA 4Z2YA 3WA7A 3RADC 4W7IA 3AVXA 2H4XA 3NBXX 2DBVO 4WNCA 3W5CA 2BEWB 1IEVA 2JH8A 3VKFA 3GGOA 3T1TA 3MGAA 3VR0A 1QIGA 3IIKA 3KT3A 1I51A 1OREA 2ZWVA 2D06A 3D64A 4JP1A 1DU4A 1YZUA 4WADA 4JI6B 1Z33A 2Z2XA 3ZNNA 1RXVA 1TJPB 1V6SA 1P7YA 1A9RA 3QWIA 4MPJA 4FZ3A 3H5WA 3W8FA 4DJAA 5AKGA 5JSQA 2BLLA 1D6SA 4IXTA 5AKYA 4J6FA 2I9KA 1K5HA 4XJSA 4EJFA 2ET6A 3C5HA 2XMGA 2ZT8A 1L5MA 5FTJA 2JLXA 3BICA 3SYTA 1HDRA 1HNNA 1YS4A 2BKXA 1FMJA 1MB9A 1EAMA 2H0RA 3E6AA 2UZ3A 4TWJA 2N1MA 2QPOA 4IOJA 3A6JA 3UCEA 5EXPA 2PGXA 5L3SB 5IM4F 1YVPA 2A2ZA 2ZEJA 3L46A 2CLFB 2Q3LA 2VDQB 3MUNA 3T7RA 5AP9A 2PAFA 4XEHA 3GDOA 1MUUA 4B32A 2AW3A 2O8VA 2ZJ3A 4L51A 5DRYA 3BXOA 2Q29A 3ICQB 4BE7B 1B8VA 4JOBA 4MUMA 1JHVA 3AERB 2BBTA 4D8VA 4AXXA 1U8XX 4RS4A 5U1PA 1T0BA 1TFRA 1GGFA 2AUNA 1JZSA 5BW5A 4X97A 1R37A 4MQ5A 1HDGO 4V02A 3U7RA 5DJ5A 2A88A 1H0RA 4KR3A 2JAOA 2I6QA 3MLBA 4ZXFA 3TVDA 1CUDA 2FR0A 3WKBA 5A4KA 1Q84A 3KAJA 3QE9Y 2JS7A 4MUGA 4Z0HO 3ZV4A 1P4AA 3I37X 1G8JA 5JIBA 3BKXA 4IV0A 2BJHA 2FZWA 2YXNA 2DB3A 2FPRA 3EIUA 2PKXA 5DYYA 1RP7A 2BV3A 2QN3A 4JCOA 4RX1A 5FNZA 1U2RA 1N8NA 3C6KA 1JYEA 3F46A 4LDJA 4GO1A 4E33A 1TM2A 4PSAA 1L7XA 1ZMRA 3AM5A 2G7MC 4Z7QB 2JBAB 3UPDA 4FFWA 3MMSA 4DLWA 5DO9A 2PWAA 3K0BA 1LU9A 2MYTA 1BMDA 4OJYA 4DMCA 5J5AA 5JDCA 4BEVA 4E08A 2VA8A 1V16A 1Y8ZA 1AHPA 4CRWB 4COKA 5KJ6A 4HJXA 5IDXA 5SY6A 3CG4A 1N2ZA 1M1XB 4D5GA 1T25A 2AF3C 2RGWA 1ZA1A 4W8GA 3DP9A 2JGIA 4NE7A 4MQEA 1KFJB 2V5UA 3B6JA 3EFOA 4QFCA 3BB4A 3K2IA 2JAXA 3D2BA 3K4QA 1ZD4A 2ATCA 4NNPA 3RDPA 3WLNA 2JEOA 2FPXA 3IPRA 5HG0A 3LWZA 1ODFA 3S4YA 4DIUA 3UUGA 5EHNA 2NTNA 3OOYA 3NC1C 4N48A 1RI3A 4CU2A 4C03A 1GSOA 1L4HA 2IPOA 2Q5EA 2ZT6A 1GPKA 1XRRA 2H0AA 4TKUB 2NUTA 1FRFS 4YH1A 4F0JA 1NWCA 4W5TA 3E0QA 4J7UA 1H2XA 5U4QA 3SF0A 1XMPA 2R6ZA 4XQCA 4B6EA 4ZCIA 2VQSA 1VL8A 3HYTA 4OQEA 3QWBA 4XSHA 1JKMA 3GFRA 4OHZA 1G8SA 3AGQA 3NVDA 1E9FA 2W2VA 3P96A 4J2OA 5M2QA 1VE5A 5FBKA 4V3BA 5GV8A 4DV6B 1NP7A 3E3LA 4IIJA 3RBAA 1Z28A 1NLFA 2CNLA 1CUXA 5AKJA 1ORDA 2O8FA 1Q1QA 2AG6A 5AVYA 4CLOB 4GKVA 2GEJA 3SNHA 3G9XA 4WLVA 3FJ1A 1XMOB 1LF5A 5D7BA 1QVRA 1HH4A 2A33A 3U0BA 1MEEA 2W2TA 3AH8A 5A3QA 3O74A 3UEOA 1RWVA 1M66A 4NH0A 4RPJA 5DLQC 2CXRA 1KFBB 3HDQA 4KLAA 3D8RA 2AFHA 4IRMA 4U9IS 3UTCA 1PZEA 3RVSA 3MWLA 2REQA 2YIMA 1L4GA 4OMDA 4ENTA 3FB1A 3M34A 4Q3DA 1Z08A 5KC8A 2J7KA 5DNDA 5L7WA 3ILSA 4HXEB 2HF8A 1G42A 5JPIA 3FI9A 1GDDA 2OV2A 3E7DA 3M81A 1C8BA 1AA9A 1TVKB 2A57A 2DX7A 3B6ZA 3D5QA 3GO4A 3FNRA 5I9BA 4V1CI 5K8LA 4DXHA 3CCBA 3VR6A 1JXOA 1M34B 1I4EB 2ZBEA 1WB5A 4WE3A 1WHSA 2BMWA 5NLLA 3T9AA 1NUUA 1KPHA 1WQ1R 3OTGA 5D87A 5IJ9B 5GJBA 3L5OA 2QX7A 4W82A 5JT1A 2RONA 3ADBA 4J1NA 1DHTA 1CD5A 4JJEA 1L7RA 2W6NA 1JIUA 2C2GA 2BDTA 2NO6A 3GLGE 4EZBA 4KQGA 3D7KA 1VPVA 3V4PB 4L4YA 5ELXA 1V8FA 1Z45A 2BEWA 1YHYA 1PEKE 5ITVA 2E4VA 2C31A 1R64A 1VRWA 3DBVO 2W58A 2OCIA 2ASEA 1WCYA 2PZ8A 3GT7A 3QXGA 5DBHX 3U4GA 3H2HA 3JWGA 3H6GA 5CCBA 1SM4A 1GUZA 2P1DA 1U02A 1XTSA 2EQAA 2HGZA 3WL3A 1ATZA 4DMMA 1QCZA 3E23A 3ET5A 5THQA 4RVSA 1KVSA 4PSKA 1DQPA 4IMIB 2X9LA 3AEYA 5REQB 1EE1A 1H2HA 2AL7A 3S1LA 2VCEA 2O1SA 4MMZB 1XGKA 1ZXXA 2ZI4A 3PD0A 3SGLA 4KUHA 2QUJA 3H16A 1G8AA 2CLCX 4MI9A 4PFJA 4PS1A 3BOSA 5L3SA 2C58A 2OO7A 5ALLA 5B55A 3D6JA 1G2OA 2CLLB 2V3VA 1FUIA 1RVDA 5FEMA 3TFWA 5L8VA 2ISSD 1DX9A 1GKIA 1N0WA 1Y1KE 2QVLA 5DN6A 3RF6A 4BEJA 2DKFA 5FTMA 3TSYA 3UAYA 4GRAA 5LVAA 4K3VA 2VHUA 3KKMA 1Q16A 2YHSA 3IDOA 4E07A 1RLMA 3AERA 1PNQA 2DFDA 4CV0A 1JECA 3U80A 4WZBB 2EF1A 1DX6A 2QWXA 4HGPA 3TLXA 5IN4A 3GVIA 2XRFA 4Q16A 3M5PA 3HACA 2JLUA 3EGOA 4HPJB 3FAKA 3G5TA 3CEJA 5JJ5A 4A8HA 1Z2DA 4LDQA 3EB9A 2HU2A 4JB8A 1D1PA 3AI7A 1PFYA 3EXHC 1IHXA 1PL7A 1Y1SA 2EX0A 3LL7A 1JLKA 3NB0A 2WB4A 3T1HB 4RK7A 1DJOA 2COUA 3UHPA 4YT8A 4EJ0A 2A14A 1FFGA 4CLHA 4TMWA 1ONSA 1J2TA 1I2DA 3FPEA 5A7FA 5K45A 3AXTA 4DB2A 3C3AA 5BWBA 3HWX1 3EGCA 2JBAA 4HVAA 2H06A 2P3QA 4V2IA 3ZJ4A 2QMHA 2WAYA 4XARA 3NHYA 5H9VA 3C7DB 1U04A 4NZNA 1QKKA 3G88A 1KEUA 1CUCA 1WVMA 1Z5ZA 2B7BA 2JB9A 2YINC 3ABIA 2J59A 2XYHA 1JHOA 1MTZA 2HJRA 4Y8VA 5IC5A 3SHQA 5C7YA 1QZTA 2Z0MA 5F3DA 3UIEA 4J43A 1Z6TA 1DL5A 1PR0A 4UM7A 2FK7A 2GZHA 2EWVA 4S1OA 1GXSB 2O23A 4URYR 5CFZA 1LJLA 3AZOA 4KPGA 2Q62A 4LDRA 1HEYA 2P11A 3GJXC 1U9ZA 1N7GA 3HCBA 1N3BA 1HR0B 3OT4A 1NN1A 3PUYA 1SBQA 2P2NA 1EX6A 4EUKA 4IHKA 1YDEA 2PLAA 4PYMA 3R20A 3ZE1B 3OZSA 3H9GA 3PHHA 3FYHA 4M1WA 1MV5A 1P2BA 2GAJA 3KZCA 4MS4B 4B4OA 2EEZA 3N2EA 1UMDB 2NAPA 4ETIA 1T5BA 4N8EA 1UINA 4UTRA 1E6KA 3KM0A 3HXQA 1NKSA 3S5UA 1X8LA 1XHEA 1P33A 2R6AA 1ESNA 3GEGA 3MG9A 4RD1A 4TKUA 3QU7A 4LPSA 3NU1A 3GJQA 4ZC8A 3BMCB 1NW3A 1QWOA 3FUCA 4LG1A 4Y2PA 1P80A 5DPMA 3RTAA 2J0QA 2B3DA 3R77A 1D0VA 1JJ7A 3H5OA 3HSSA 2IOFA 4JB2A 3EQ6A 5ANRB 3UO8B 4DARA 5HM8A 4HQFA 4NCKA 1K7EB 4A27A 4C6TB 3DZIA 3G6WA 3L1JA 3PFNA 4KWCA 1Z4MA 2CKMA 3WLKX 1VLZA 4PYQA 1EFRA 1DOZA 1HK7A 3ELUA 4KSCA 4GIBA 4BGVA 4CLOA 3BB1A 3EC7A 5T6MA 4EB0A 1GGVA 1NAIA 2OLEA 1D2CA 4M0KA 5P21A 5KO2A 4KPFC 3WR5A 2Y0BA 3ICCA 1MOQA 1WD7A 4FNAA 3L8HA 5HJ7A 4QDJA 3CY6A 5FLKA 2QTAA 2WA2A 2RMKA 3TL3A 3HO8A 4WMLA 2PMCA 2FDRA 1KNQA 3C3DA 3CUTA 1FP7A 4K28A 3QBJA 4QRDA 4K2AA 3KS9A 3IVXA 1T8WA 4OBWA 3GAFA 4CIVA 3W2HA 3GEEA 3F3MA 1FK8A 2P9CA 3PQ3A 4EDHA 1J97A 3GLIE 3OQOA 4YUYA 2E21A 2Q28A 3JYNA 3QVMA 4N0EA 3BMOB 3WMXA 4ZI5A 1SVLA 1CSEE 2YZGA 1UFKA 1JQJC 2EJBA 4Y3UA 1Z6AA 3P0EA 4JBNA 2X4IA 2BM8A 3F9RA 4PXSA 4D41A 2JEYA 2FPWA 3KKEA 3U4DA 3VNVA 2EHDA 3O1JC 2BIFA 1TVKA 1CVIA 1JLLB 3GDFA 2E4XA 2C83A 4JB3A 4MTLA 3JZMA 4UUOA 3V7WA 4KVFA 2B7LA 3CZMA 3C8UA 1NBMA 3A32A 2DUUA 1M34A 3CX3A 3DE7X 5EIBC 5FJIA 3GFSA 4F4DA 1CIJA 1HE4A 2BGUA 2WOJA 1E1NA 4Q02A 4V3CA 1D09A 1Q7GA 2R60A 3I9KA 3KK0A 4YTEA 2ISCA 4EPYA 1MC8A 3AFHA 2Z98A 1P1BA 1QKIA 3ZHOA 4IQ4A 2Y1GA 1YIOA 1GHTA 4AWBA 2G36A 4ZOLB 3VXKA 1LLCA 4BQIA 3GP8A 3FDFA 3ROKA 1FTGA 1P3DA 3M89A 3VPGA 2WB2A 3B1VA 1AQIA 2HSEA 4IJ5A 4DRXB 3FFWA 1QDLB 1FYVA 4YWJA 3HVHA 5DX8A 4EI9A 4GUAA 5CM2Z 4A36A 4G23A 3W77A 1PYDA 4LYFA 2ZJ6A 2B21A 2ZK7A 4ERNA 2BL4A 1MORA 3ZWPA 1SG9A 4YRGA 1K86A 4R0NA 3RHZA 3UT0A 5I9IA 5FR1A 2WJ4A 5REQA 3UJDA 1E2JA 1U0JA 2EL7A 3DE4X 4ZPJA 1QYDA 1J8FA 3F6SA 4L9RA 4NCNA 5CFMA 5HRUA 3K92A 2NU6B 3ETHA 3GH3A 3C48A 1VHJA 1C4OA 5AVKA 1K2VN 3TNFA 4OQFA 1U4SA 1KI6B 5AK0A 1ZW6A 5DXAA 1EXVA 1IONA 1E3QA 4EMTA 2J46A 1QYRA 1HL3A 3HA5A 4RJJA 2QV7A 1J70A 3DT9A 4LOHA 2VJDA 2IV7A 1SVKA 3V80A 3WMEA 4EYSA 1DAHA 2A78A 4HMOA 4OFXA 3SE0A 3WIVA 2FW8A 4MUIA 1OTHA 4E5PA 5HUJA 3H2SA 1SQGA 3PIIA 3LUDA 3Q40A 1FFYA 2CNWD 5ALSA 3E03A 3U3DA 5JASA 3EFBA 1H3NA 2PQ0A 2W2LA 3EQ2A 4WZBA 5C2JB 2DY1A 4DMUB 5K6AA 3R9XB 2YNMA 4ZVUA 3UXMA 4MARA 1QRUA 5AXAA 4D99A 5C5DA 3WGLA 4R2KA 3HZOA 4X1IB 1CEEA 1N5RA 1D07A 2JL1A 1X1RA 2YJGA 3K0AB 1AHNA 1K8RA 1XEWX 3IHWA 3TLZA 3I64A 3IOBA 1BE6A 2Y71A 5MGBA 3P0RA 3ILYA 4B79A 2FPSA 2R68A 1G9XA 3ROZA 1BX1A 1Z7YA 3NJRA 4D5EA 2PZAA 1QR2A 2WSSA 4R1OA 2QIOA 3Q1KA 1ACMA 3V8NA 4OXRA 3QLTA 2G9ZA 2LBPA 5KHAA 2R44A 2PRZA 5JMWA 1VJ1A 1JKJB 1M2GA 2RH8A 2EC5A 3GGDA 3WNVA 5I7SA 5IXYA 4WXRA 9ABPA 1OOEA 1GZ6A 5DV9A 1G9TA 1TCBA 2BKLA 1L5VA 2IK8A 1B93A 2OG2A 4ZODA 4U7HA 1VXRA 4BMVA 4E13A 5MN5A 1M0EA 4KUGA 3COZA 1X19A 4BO9A 2H07A 2WJGA 3DLHA 1OD6A 2X9QA 3GGJA 3DUFB 3HBFA 3I2HA 4TLEA 1GXSA 1RYDA 1SOVA 4LJ7A 4Y6SA 5ETJA 3VMMA 4F9EA 4WA8A 3OPYB 3OIWA 1Z7WA 2AMLA 4OHYA 2VYND 1T2AA 4GYJA 4ECAA 3HFGA 1VMIA 4V0MA 3WB2A 4RYLA 1YS6A 3I5YA 2H2HA 1ADCA 2XE4A 3P9KA 5FUVA 2HZBA 5KHLB 3L49A 1PJ8A 1E5XA 2I1LA 3L7JA 3RPEA 2XDYA 3CNOA 3HXLA 2ZU0C 4KXLA 4MS4A 3T1NA 4B75A 3MELA 1UMDA 4RKEA 5HIAA 1F1JA 4EECA 2YKGA 4OO3A 1D2RA 3BC1A 3HJHA 3C6YA 1P4SA 1S2NA 5LIPA 5CA0B 3BMCA 2QBYB 3C8ZA 5KU1A 3JQPA 3Q1LA 3E3NA 2GILA 1VLVA 3ZGZA 4I66A 1OWPA 4EB3A 5ADWA 1XZJA 2JK1A 3T7IA 2G1PA 3W4KA 1ZD9A 4TV8B 4F2PA 2CGEA 3H9QA 5JJIA 4NENB 3G2LA 1D1QA 4RPGA 5HIIA 4BQRA 4C6TA 3DCYA 3QMPA 3BZBA 3OEHD 3LCJA 4MRSA 2QL5A 1TQ4A 3EQ8A 4DVJA 1V8ZA 1OH5A 2I2AA 4Q4LA 4PIVA 2I8CA 3PDIA 3PNYA 3SZLA 4CCAA 5C9ZA 3R0VA 3QVGB 1GEGA 2Z1DA 3BWVA 4JUCA 1JJVA 3PDJA 2GN4A 1H0KA 4MHOA 4DCNA 2A5DA 3VHRA 5L3VA 1FFAA 3CLHA 5GWXA 3CBGA 4PG4A 3SZUA 4RH1A 5JG7A 3T5DA 4LF8B 1Z56C 2O8DB 5ITSA 1HY3A 4NOMA 2BVNA 3NKVA 4MYTA 4WECA 1Q3HA 3RC1A 3WWYA 5C7OO 1RCFA 1XTZA 1OZGA 2YL2A 3BD6A 4YJ3F 2VHVA 3C7CB 3AV0B 5SICE 1DBQA 2DTXA 3PGKA 3M70A 1NRWA 5C5IA 4CCYB 5K0JA 1PHRA 1JLLA 3ANMA 5LCXA 1UXIA 3P71T 5DOVA 3K20A 4JBWA 2X19A 4OLBA 1G8HA 4NAVA 4WL0A 2XRMA 2ZSDA 5EP1A 4AFNA 2I4LA 5DEIA 5LDGA 4GC9A 4PONA 3ZY4A 1I7NA 4XD7D 1NG9A 5EE0A 2GNOA 1QF9A 1UBTS 1KBQA 5ICMA 4I81A 4RF2A 4XRGA 1FDTA 2DECA 3JRXA 5JZVA 2XNKA 3GCWA 4RHTA 2WD7B 5H8WA 4UOZA 3HKDB 1Q19A 1XO1A 3GU3A 2AFIB 2XDWA 4FUTA 1QF7A 4ZOLA 3MPOA 4HLUA 2XMZA 1FXSA 3B20A 3ZY6A 3L4BA 4YCSA 1H2BA 2V6IA 2OOSA 4KDFA 2MDTA 4MROA 3W2TA 4AX4A 4DRXA 4GX2A 10MHA 3BA6A 4KLZA 2VUIB 1JEQB 1K3UB 3QNMA 1L8XA 4BLVA 4LOLA 4MWCA 3VVCA 2GHIA 5B6PA 1OZAA 4NZYA 1RKVA 3HBAA 3E70C 1S1CA 4I4TB 3RRNA 1SVWA 2I65A 4JENA 4WTOA 1NMYA 4TXNA 3RYFB 2GCGA 1ZCZA 3VU0A 3EF0A 1M8FA 4JOCA 2YJNA 2FUG1 4JH0A 3L0OA 3QFFA 1C14A 4K6MA 4UCWA 4XZ3A 5DTMA 4YP1A 2R86A 4DA9A 2NU6A 3SMQA 1H4TA 5HKKD 4WKNA 3VYUB 4WOJA 1KI6A 3CVYA 1UADA 3OCJA 4G5XA 4OJQA 4HGQA 3VR3D 3KD3A 4KR9A 4DEXA 4QUEA 3MCWA 4M0MA 5ALQA 1FBNA 1IATA 2E4WA 1BMFD 1I3LA 1E9DA 1O6GA 4EY4A 4PU0A 4GYKA 1AZTA 3A1EA 5DM1A 2PGNA 2AI2A 1BGXT 1CS4C 1ZJYA 3LPLA 5FBZA 3STVA 3ZQKA 3ZZTA 3DJYA 4B71A 1PDOA 2XXJA 4ZD6A 1PR9A 1KH1A 2CF6A 4QGBA 3SHVA 4G0XA 3FRIA 3VKUA 1O0CA 4AQYB 4JJ8A 1ZPDA 2AG1A 2WUWE 3R9XA 3I34X 3B13B 2DPGA 3D3QA 3OMWA 1G8KA 2J67A 2O2CA 5GPBA 4C0QC 3ZK8A 1ZK4A 2I9PA 2I6UA 3KB6A 3OC6A 4NHEA 2EZ4A 4MUAA 4X1IA 5J43A 3UH0A 5JD4A 2L17A 1T2DA 2ZPAA 1JI3A 3L1VA 4Q05A 2Y76A 3CZPA 2GARA 3RC2A 1O0SA 1W48A 3IP6A 4B4KA 4A3SA 1OW3B 5EKSA 3PDWA 3WGHA 5K8VA 1A69A 1DMRA 3JYPA 1J2UA 5B12A 5KOJB 4O2RA 2REXB 2PVSA 4MUXA 1SUBA 2Y99A 3TF5A 5F1OA 3E58A 1I33A 1K1EA 1VSQA 4P4LA 4P2BA 3EOBI 2ZZMA 2TMYA 3LXUX 1E1KA 2BM1A 1WMEA 5JISA 2ZPUA 5IASA 1C81A 2XVXA 4UDXX 2PJRA 1EX9A 4LHEA 2Z4TA 1MA0A 4BRZA 3GROA 5JRZA 2R6DA 2LD4A 3ZZUA 3NHMA 3PHJA 3EIWA 4B4UA 4ND4A 2WNSA 3R6DA 4EGCB 1VBFA 4X91A 3JVDA 3GP5A 2ZPTX 2WFLB 3DUFA 1TRKA 3O8LA 2PA0A 4EZIA 3SXJA 4I2VA 2HTEA 2PQ2A 3OPYA 4QUGA 2FR1A 2XMQA 3K31A 4ZZIA 4B48A 4YCCA 3V97A 2A8YA 1HNXB 3UT5A 4HQKA 2BMFA 3AF4A 3AHFA 3SOPA 1F5NA 4B8YA 2LP4Y 3CZ9A 7GPBA 1CDZA 2WDPA 3DB1A 4J9UE 1USIA 1IIBA 4QOEA 2IYXA 4DR7B 2H11A 3VSAA 1AS0A 3KDSE 4Q4AB 3HY3A 4ZCMA 4AP9A 2V96A 4FFOA 3NAGA 1ISPA 2PGJA 5CA0A 1HX7A 2HPAA 5BMVB 4Q93A 4WH0A 2PUJA 3D31A 1ONBA 4MO9A 4WBSA 4K0KB 4JVNA 4BNLA 4TV8A 3HLTA 1EZZA 2WVGA 4ZI3A 2D1YA 4NENA 2BYTA 4LJAA 2PQ6A 3RRMA 1OLUB 5I3CA 2XF2A 4PHTA 4TL8A 1NN5A 5ICEA 2QTTA 4D3FA 3IERA 4W9MC 1I5RA 1NDUA 3ICEA 1I1OA 4O4IF 4DEYA 2AEMA 2E49A 3C4JA 4EO7A 3IYLW 2YN4A 5DM2A 3UV7A 4KH0A 4F4FA 3QVGA 3HKBB 1P1IA 2CL5A 2WICA 5BRNA 3K70D 2ZJZA 5BO5A 2M6KA 3RRFA 4M9CA 4WZZA 1N2EA 4JT9A 4PC3A 5FUXA 3LCCA 1RQLA 2VAXA 1IWOA 2JIZA 3PGJA 1K5GA 4KMRA 5AW9A 3NORA 4HNAB 2ZYGA 1N2JA 5EZ6B 5JS1A 3HWSA 5FX2A 3KAKA 2O8DA 5CITA 5I7FA 2A5LA 1GTVA 2G25A 3G7NA 4M7RA 1Y6ZA 5EIAA 1Z06A 4CM7A 3X1JA 3N7AA 1N0UA 1XCLA 5D1NA 3I9V6 1GR1A 2XQVA 3GVHA 3UHOA 3DV0B 1NQTA 2YY6A 1E1RA 1DBSA 3O2QB 1HC7A 3R7SA 4ZAFA 4AB1A 3JVIA 5KKNB 4DV0B 4CCYA 3U7GA 4Y67A 3NVMB 3RWBA 3MB5A 2FRDA 3OZTA 3RT1A 5LD2B 4Q47A 3R76A 3RKSA 1YRYE 2YZ7A 4YRPA 1FJ2A 4UVGA 2K87A 3NTLA 1RLJA 1NBWB 3DYBA 5AW2A 3VBCA 3DZ8A 1TF7A 2PR7A 4L5BA 1NIPA 3A1TA 4QRHA 2QBYA 2XT0A 4G5QA 4E1AA 2AH5A 5IAOA 2HCFA 2OGSA 2P65A 3HJRA 3JS5A 1AUOA 1AA6A 2WWIA 3STXA 5GIOE 1YR7A 2WD7A 3JPYA 3K1AB 3N6XA 4O4LB 1R5BA 4LNAA 4RK1A 2P5YA 2XE7A 1KYYA 1S0UA 2G5GX 2AMVA 3BRSA 2AFIA 1BA2A 3HKDA 4DJEC 1NV8A 1Y98A 2O1XA 1NDQA 2XNDA 1UFQA 2FNAA 3HDHA 1MXHA 4DGQA 2GBLA 2HU8A 4TMVA 2Q8NA 5AVUA 1J2JA 1GPYA 2HAEA 4G67A 3Q3EA 2B8EA 1HG1A 2DAPA 5BNTA 5ICGA 4TTAA 1JEQA 2ZJ5A 4IDHA 4QHYA 2OGUA 1FU7A 2XA2A 3EMBA 5J2UF 1W5TA 5EUQB 4I4TA 4M54A 3LW7A 1FFBA 4MPPA 4DIDA 1CUEA 3CPJB 3RYFA 2JFGA 1FW6A 1NULA 1R2QA 3QE4A 4UUBA 1DKOA 3VPCA 4E4TA 1GITA 2IU4A 2VF7A 4PHHA 1QK5A 2O2ZA 1JVSA 4TKZA 4UTXA 2IHZA 3SS9X 5JCXA 3MA0A 3ANSA 2DHRA 2QRJA 4CHGA 4DWJA 2DTEA 2O5EA 3GLGB 4FMDF 2YC2C 3DE1X 2QVBA 3R4VA 5KI6A 2XYRA 5IULC 1A98A 1VKRA 2GYUA 1DOAA 2J07A 3AR2A 3TNYA 2IHBA 3C3MA 5E9AA 4FEEA 5F5NA 4G1VA 4PFSA 2QN2A 5E4TA 2BFFB 3H3FA 4YBZA 3DEYX 1B6TA 3T7EA 2GLUA 2XUFA 5FT9A 3GD7A 1GNPA 1VIVA 5FA5A 4WY2A 4UUQA 4OHPA 4DMKA 2EFYA 3AP3A 5HOEA 4QPZA 5FL3A 2QM7A 2XW6A 3IDQA 5F12A 1XD8A 1P91A 1Q1NA 2J32A 2GZ1A 4NXNB 4Z9YA 1E1QD 5EXEA 4QU8A 2Z9DA 4L8VA 2RGXA 4ND6A 3WWCA 1WTAA 3ZK9A 2IX3A 2UZ4A 2CLMB 2QX6A 3R5JA 4HDQB 2CV2A 2N46A 1PQYA 1WBJB 3PZBA 2A30A 3Q10A 4RHUA 2N47A 4R5HA 5C80A 2DLDA 5KOJA 3SQOA 1T5OA 4C3VA 1LDNA 1N3IA 3LHFA 4QNMA 2IPAB 3H1AA 2VTDA 4G8JA 2F17A 5IJ0B 1FFWA 5LWQA 2BONA 2GMWA 3HDGA 1UBOS 2GO7A 3B1XA 4ZYYA 1YQDA 3VDRA 4AZTA 2JJ1D 2IXGA 1HRDA 1Y5NA 1N9GB 4B31A 3DF9A 1NQUA 4WJLA 1QNLA 3K0FB 2HI0A 3SS8A 2GXQA 3IXQA 5AT1A 1F3OA 4FP9A 3M4XA 2W6MA 4I36A 3SKVA 5IFKA 1OXMA 4CG0A 2B1GA 3BCUA 2WFLA 3I72A 2RK6A 4P0PB 4ER3A 1IVYA 3VAAA 3KCQA 2G6BA 4DG5A 4KGDA 1ILEA 2FZ5A 3GMTA 4LYHA 1VL1A 1OBCA 2LIPA 4TTSA 5GY7A 5SY9A 5K6AC 2BJWA 4UM8B 3FCEA 1RJDA 2C5BA 5C8ZA 2R6CA 2FWJA 1R0KA 1VHTA 3ONEA 1HT2E 4GMKA 3VHXB 2YZKA 1JSZA 2BBOA 2YY7A 3VDXA 5I9LA 3ZY5A 3JYHA 3G85A 4Q4AA 3ZBUA 4W4TA 2GN8A 3AQ4A 3ZXYA 4BKQA 2JIZD 2FOLA 4UZFA 5AO9A 4K9RA 2WG2A 4HPXB 1Z4QA 4X65B 4D98A 2SICE 4FJ2A 5BMVA 1P4RA 2P4SA 2WYWA 5IC4A 2NZ8A 2CLDX 2ZQZA 2J31A 3L2OB 3P32A 4ZMBA 3LGAA 1DRVA 1Q2UA 1BEEA 1XTVA 2WE8A 4JUIA 3SCZA 4BMYA 4C2BA 4EO9A 1OLUA 5D01A 1XN1A 4YJKA 1T9KA 3AB8A 3F5QA 2IZ1A 4UJ3A 5ICCA 2O5CA 4HX5A 2EW1A 4D26A 3IFSA 2JDID 2B20A 3UW1A 2H9IA 1L4NA 4BNVA 4P2GA 3HKBA 2Y0PA 1RQ2A 3K05A 3OM1A 3X1YA 4AN4A 3DW3X 2ZM6B 3AUTA 3BXEA 5CD9A 1P39A 1OPRA 5EXDA 4AO8A 3GJTA 1VHLA 5DVZA 2AOUA 3VPBA 4FDTA 4HNAA 4ZQFA 3EIQA 3HEMA 1PZXA 5BORA 5IANA 1Y9EA 2J3LA 4H7HA 4MAMA 2AJCA 3I4FA 1GLNA 4B5KA 2GFQA 1CULC 2XUZA 1FU4A 3DV0A 4IDCA 1LZLA 4FX5A 2NTJA 4BLUA 1P4GA 2HF7A 2GJ9A 5HIJA 3CRVA 5K3SA 3WO1A 1E4YA 3IQXA 5ALPA 1XA4A 5TPZD 1AMUA 1RYMA 3R8FA 5A1JA 2BFWA 4H0CA 3OE7A 2BISA 1SULA 4Q1AA 1HQYE 3NWJA 2ZAYA 3GLTA 2UUOA 4MP3A 3K1YA 3KV1A 2YV4A 2LWIA 3WMRA 2XQJA 3SM3A 3NCTA 4DREA 1H2YA 1T15A 1U5BB 1LI5A 3BWMA 1X1DA 1XZLA 2E2WA 2E82A 2GHTA 3FKJA 5B3JA 1RRVA 2PJUA 2Q0XA 2WHEA 2JGAA 3A9TA 1BOFA 1RJWA 1EVEA 1NVBA 4N7JA 4BX3A 3A11A 4O4LA 4Q12A 1DKNA 1MJ5A 3TGWA 3ZWOA 4QXOA 5AK5A 5CLFA 3CF2A 5C8YB 2QL6A 1N0VC 3GLIB 2CYCA 5KVAA 4QIHA 3RFFA 1A9QA 4JJAA 5LR6A 1DV2A 3ETEA 4EK9A 3QMVA 3ZCTA 3VFDA 4MRAA 2J3DA 1RFLA 2O14A 2IH2A 3MT7A 4BS9A 2HF2A 1JBQA 1T5DX 1P6QA 1XA3A 3F97A 4NZZA 4YREA 4EMUA 3NVKI 3TVTA 3BH7A 4DLVA 1I3OA 2FEKA 2R7MA 1M8JA 1XPJA 4JGBA 3TW0A 3WJ2A 4NHOA 1IUKA 4OI1A 4D97A 4CDGA 3WDLA 2O19A 1GZVA 3NEPX 3ZWDA 3ZR4B 2OD2A 1GQQA 4HNVA 3KZ1E 2AYZA 1QUFA 4TMTA 2FP3A 4WUVA 3UV3A 1CY7A 2AKEA 3OJWA 2JASA 4M86A 1UC4B 4QXMA 4TQAA 4CM4B 4DDMA 5BR8B 4R41A 3HEBA 4UKDA 1A9OA 3IKTA 3GLGA 1Z6GA 3MXTA 4GLOA 1KMIY 3KNZA 1L5LA 3AWDA 2YWBA 2IU6A 1JEEA 4EMBA 1PZHA 1U3VA 3CIFA 1ZAKA 2ZRBA 1IN1A 3N2ZB 2DPLA 4KCGA 2BFFA 4DIKA 5HVNA 3S1AB 3VA7A 3W06A 3PWTA 3RVLA 3RW9A 4CLDA 5F23A 1ZVMA 1ORRA 4A2WA 1JE0A 2YOFA 4DPMA 5IAAA 1JH9A 2FR8A 4GGOA 2NYAA 1YQQA 1L5NA 4WEQA 4AY4A 1ULBA 1PSZA 1TA4A 2OHFA 4HLUC 4U2DA 3VR2D 4LRUA 3NKFA 2DH5A 3L4BC 1IBKB 4YUWA 3THOA 3LCMA 3I0MA 1X14A 2VF4X 3QKTA 4NICA 3SJBA 3UGTA 1P1RA 4NMHA 1I1HA 1Z4PX 2VH5R 5DLDA 4I55F 3ZDEA 4YMWA 1NXQA 5EG5A 2JCYA 1GFWA 2FQQA 2C3PA 4YHBA 4PZCA 3MYRA 1SC3A 3QVJA 5F98A 1S2DA 4IFBA 4EG8A 3MCVA 4ZT2A 4IQGA 5CD1A 3RK0A 2A1UB 2B8WA 2AWNA 1KYIA 4M0LA 2FB9A 4H18A 3ND9A 2P9HA 3DXXA 2ZUBA 1VJ5A 1WZNA 5DM70 5IJ0A 5DYWA 1JQ5A 2X77A 5I7UA 3W0LB 2HHCA 1T26A 3RTBA 3H1TA 1CT9A 1F0YA 3T54A 4BFVA 5ESWA 1XNRB 1MW8X 3IAM6 1N9GA 4M9ZA 5JJBA 2QRUA 4PQGA 4KACA 3OIFA 1E3WB 3K0FA 4EY8A 4TYMA 2I22A 3NH6A 3C1OA 2ZDQA 1JDSA 1PLKA 3HMQA 1ZHFA 2RAFA 4PLYA 5AHWA 4OYHA 3I6BA 4ZOEA 3ZXUB 4W5JA 1LJUA 3KELA 1GGEA 3CO5A 4BU0A 1WVIA 1PU2A 2ZIAA 1G8GA 4R7ZA 2IYTA 3DT8A 4GYWA 4HXFB 4KWEA 3CBQA 2PV0A 3TS1A 4CIAA 5HRCA 3W34A 2EZ9A 1G5HA 4IZIA 5BSGA 2O2DA 1CQIB 4A5SA 2CVPA 3VHXA 3WWOA 1OTYA 1LBHA 4YYEA 2LZ0A 1HE2A 5FOSA 2JLWA 2YR0A 3ZJ5A 1YMVA 3N3AC 5DK6A 3CF6R 3UHFA 4J1TA 1O9BA 2HOQA 2I62A 5YASA 3O4GA 1MVLA 1X1BA 2PT6A 4PYJA 1OCEA 3SDZA 2PZEA 5JXJA 4MGEA 4C78A 1R6DA 1U2EA 4LPKA 1QP7A 2FKNA 1A9PA 1KI4A 3A4TA 4ZT5A 3TZCA 1TAGA 5LYJF 1NAHA 4ZHSA 2F55A 1F20A 1ZU4A 3DMTA 4FFSA 2XCSB 1IQUA 4G97A 3GC6A 1S2GA 1E7RA 2HLPA 2HO5A 4IIFA 1FLAA 5DSXA 5FBVB 2QQFA 4Q9LA 3RF7A 1C1YA 3I0NA 3FM9A 3IQIX 5AI0A 2VDWB 3KYBA 3L1UA 3EODA 2ZYVX 2XGOA 5IVPA 1E7QA 4XB6B 2H85A 2WUVA 3VNBA 2EQBA 5KJEA 2CDNA 4TS1A 2A7QA 1QS0B 1XKQA 3U0VA 1AZSC 2A5FA 5BV8A 5KNBH 2FPUA 4J0HA 1VJRA 1MG0A 2W2NA 5EIEA 1FUUA 4DSOA 1M2KA 2GN0A 2GNAA 1O8CA 2NNWB 3F71A 3MJ4A 1UANA 1KI3A 1WUJS 2BZ1A 3IODA 2FSSA 3R4CA 4EFNA 1UPCA 2FRXA 1MA3A 3AIIA 3PJEA 4Y2TA 5EP4A 3SVLA 2O1EA 1W5BA 4BBZA 3OTOB 1FDIA 1SBYA 2OLKA 5AVRA 1ZNXA 3VO2A 3EEYA 3M5CA 4EHJA 1TO2E 3AQIA 4EHNA 1K3FA 3QPCA 5H9WA 2PBRA 5IS2A 1TYEB 4PLZA 4P4UA 2OXTA 3CZ5A 2ZRLA 1KDVA 1RABA 2QLNA 4OXKA 4ZMRA 2ZB8A 4MDFA 1OA1A 5HOQA 1QH8B 1X86B 2ZIWB 2B4QA 1W36D 4A9AA 2M6LA 5EKDA 3D3WB 5C53B 4HGYA 3W3ZB 2X1LA 3QE2A 3KUXA 3QOFA 4Q03A 4RIIA 1ISJA 3B7PA 2DWUA 2E85A 1U5BA 1YB7A 4XKJA 1W6RA 3AF5A 2EU8A 3F1KA 2P68A 2OV3A 4ENRA 2ZULA 3PD7A 1XWIA 4KDRA 1G20E 1JFRA 1CJBA 3LLVA 1U31A 4LEIA 4C7MA 1H9CA 3VR4A 3KSAC 5C8YA 3ER8A 3GLIA 1Z5NA 3PEUA 3WC4A 3TW6A 1C7FA 1ZK3A 2WILA 3MCTA 4HAUA 3IP9A 3M9LA 3IHTA 2ZRMA 3O7MA 2Y1KA 3Q6NA 4C4YA 2H1OA 4RTOA 4BIIA 4O4HF 1C9KA 4LDPA 4CZ2A 1JXAA 1H3EA 2ZJYA 4LZOA 1OZ0A 3QY9A 1CUGA 4BNUA 1LZKA 1GZ4A 5IBRA 4UE2A 3UK2A 4C22A 1V7CA 2OLJA 4FE3A 3QMMA 4N8DA 5EE3A 3TZEA 3ZHRA 2L82A 1TTPB 1W0CA 1XMJA 3LUPA 5ENZA 1WLYA 4RM3A 4B3HA 1X3SA 4BO2A 5JJCA 4UQOA 2GHQA 3THRA 4B3DA 2AC7A 2G77B 3K8OE 1YQWA 3WYCA 4CM4A 1P1FA 5H3LA 1GZDA 4NKRA 5JHHB 4RFSA 4F04A 5HKAA 3DOJA 3FR7A 3IT0A 4RKQA 5ENVA 1XTQA 1N33B 3FTFA 2YFQA 2HLDA 3TR5A 3ER6A 5AQ1A 2OORC 1DZIA 3K0KA 4M0PA 5HWSA 3PXGA 1A8PA 4ETWA 5BSWA 3RLIA 5LKRA 4V0NA 2R7KA 3LOUA 4JLOA 1A5BB 1U1CA 2VWQA 1OC4A 3C6BA 2B35A 4EVRA 2XB4A 2JA2A 4FR5A 4ITVA 4XWAA 3QKRB 5B1IA 4AN1A 2CE7A 5K09A 3INTA 3T99A 4QTYA 4BUCA 2B6HA 2QRKA 2QRZA 1HETA 3UMRA 4KBYA 3DT6A 3D81A 3JWPA 4IQ8A 4YXWA 4ZQCB 2GBLC 2B30A 3ONFA 4FWIB 2OVBA 2WVHA 3KQTA 3X44A 3KYIB 4YMSA 2OHJA 2VJQA 2BGIA 4QQRA 3LZCA 2XOEA 1AVTA 2ACVA 3DG9A 3B70A 3HG7A 1PVVA 3IV7A 2QGZA 5ALRA 2J0SA 3DE5X 3S2YA 2ZRHA 1YVDA 4IQ0A 1KDTA 1XDBA 3OI7A 2Q41A 1SHLA 1ZVJA 2IYNA 3M1LA 2XECA 1T6BY 4IGIA 3A1VA 2P4QA 4A2PA 1I13A 3REGA 1ZW1A 2D1RA 1C1DB 1KJWA 3E9EA 3OECA 1GQSA 1KQ3A 2C84A 2VZ0A 5DNUA 5JBQA 5M3BA 1PRYA 4R81A 4ZAWA 1D03A 1L5HB 3RC3A 3SKYA 3UANA 4EBBA 5EA2A 1YB2A 2EBWA 2IZ6A 2ODQA 4MV4A 1JEYB 4JAVC 1TJ5A 4G9GA 2X9VA 4INJA 3PGLA 1OBVA 3GV0A 2O8BB 3WGIA 3AR8A 3VI3B 5JS8A 2JHCA 4LHZA 1Z2PX 3OO1A 4LZAA 4XWKA 1QF6A 4OUDB 2PX3A 4KQ1A 4Q7EA 2PZKA 3BXZA 1EVYA 1YQXA 2PXAA 2I1VB 3D8NA 1O57A 3KLOA 1G0NA 2QQEA 2DQSA 2CHGA 3VX3A 3FPLA 4IDAA 4ILKA 3WLHA 3JQGA 4UE6A 1RR6A 4AYTA 1DJPA 3LS2A 3V1UA 1V11B 1AGXA 3EVEA 3TI9A 3JSXA 1CQIA 4OHMA 4MVJD 3TIFA 5KYUB 3WKDA 2RBEA 3Q4GA 3EZ6A 2HKIA 3S3TA 1P3Y1 1NZDA 1X13A 3Q7QA 1N1MA 4NU6A 1N36B 1AKMA 2ZRIA 5CB4F 1VL6A 1QFXA 4QDTA 1M7BA 3B60A 3KLBA 2AZ4A 3STHA 1IY0A 2GWHA 5DT2A 3OAAD 5FBQB 1JJIA 4JYMA 2DPXA 2ZXUA 2H8KA 1G41A 1PG5A 1CZUA 1J2EA 4X61A 5DOZA 2NSDA 4LWQA 1G6OA 1ECGA 4OU5A 3AX6A 1M6WA 3KQQA 4HVLA 2IS6A 2O05A 2EKLA 3STTA 4YC7A 4NYIR 5T4BA 1EUCB 3WRXA 4BQQA 2UV8A 3F6BX 2BFNA 4D8UA 5T6BA 2VDWA 1Y6QA 4Q7JB 1COWD 3ASYA 1QO9A 3L6EA 2EJUA 1YR8A 2J41A 2UYOA 1MLDA 2XNJA 3DKKA 3ORHA 1MEOA 4UVHA 3ZCRA 1W85B 2FMKA 3DFFA 2D2XA 2ZI7A 4HWRA 1DCMA 3G5LA 5WRFA 2O5VA 3KKPA 4XFKA 5M29A 1QS0A 3MGCA 3BWXA 5LU9A 1N5OX 4NC9A 1D2MA 1MC5A 2BHSA 2W43A 4O0MA 4X71A 1BWRA 2JW5A 2RK3A 3M6VA 4JNKA 1R0WA 2Q2QA 5I8PA 3ZLBA 2WPNA 2ZJAA 1U0LA 2JIOA 1V5GA 5EKUA 3IMFA 5EJFA 5HM6A 2AS0A 1GZ5A 3KUCA 4ETMA 4GRDA 4FNOA 1OLOA 2PD6A 2NO1A 3OHMA 4TYYA 2BSXA 4DW8A 3VTFA 1FFHA 5DGIA 4U63A 3VU8A 3EZ2A 3GYBA 5LMCA 1QH8A 1KS2A 1YCHA 2RHGB 2XNSA 4K46A 1DAMA 4OL9A 4HYQA 521PA 1F48A 3D3WA 3UA3A 5KJ1A 3BFKA 2ZVJA 3HSKA 2AOVA 1ESEA 3JRNA 4YO7A 3N8GA 1WZEA 2DH6A 4OGKA 4UAUA 2FVXA 4X8HA 1A9YA 2RAVA 1QZUA 4G4JA 4Y18A 4JXZA 3OJOA 4MDHA 1Z5VA 5C1BA 4ZMSA 1CHDA 2GN6A 3OY7A 4NYIQ 3E2MA 2F8SA 1AG9A 1UBEA 4PGGA 4R1UA 3T0IA 3H1EA 3ZVNA 3N0VA 1AM4D 3F0TA 1IXSB 2E1PA 4H77A 4HYTA 1NFQA 4E5DA 1T2UA 4W6QA 2H9YA 1RPJA 1RKQA 2XQFA 3GRZA 3PPYA 5ITZB 4EY3A 1XZHA 3SQNA 2IU3A 3Q6IA 2VP4A 3OZBA 4UU7A 1CJKC 4HPWA 1A82A 2GCPA 4KIWA 1TUGA 4YJ2F 1WXEA 2NW6A 3ZVKA 4AD8A 1U3DA 5I47A 1S01A 2X8BA 2Z5FA 3GZ4A 4QBHA 5SZJA 2J9RA 3W7AA 4TS3A 5SZKB 2XGGA 4J94A 4KQXA 2JFUA 4BP3A 1NGSA 2JBHA 1RAHA 3EDCA 4KFUA 4MW9A 1XOIA 1RWNA 2WTBA 2PSHA 3LC7O 2VK4A 2V7WA 1ZCAA 3H5AA 3OFNA 3T7DA 3W7BA 2HH9A 4JLJA 1N3LA 2G8LA 2O06A 1ZRNA 3B3FA 3UK0A 2WJWA 3WY9A 4RH3A 1RAAA 5L40A 4ZP1A 1NUHA 3CPHA 1K7SN 1RPAA 4QX6A 1JHUA 2G76A 3FPAA 3QKRA 5F7ZA 2O8EB 2FV8A 4X85A 2IWRA 3PNPA 4FD3A 1CR1A 3EK2A 3G0CA 3PNLA 4ETNA 1JA0A 2GVDC 2RI1A 3AY7A 4R9SA 3Q5GA 1Z29A 1ZRSA 1ZYUA 2ZVDA 1HA3A 3G82C 4L4XA 4RJLA 1N6LA 2C9YA 4GGMX 5KYWA 2AE1A 2ZBRA 3KALA 3DDCA 4EKEA 1PS0A 3AUSA 4ZARA 3UY4A 3F6PA 4MOWA 4MVJM 3QJYA 4DQXA 1FXUA 1TNDA 5IUJC 5CURA 3A10A 1CJUC 4NMMA 3KBBA 4E4YA 4ND5A 4WXMA 1YBHA 1Z62A 4IUYA 4DFDA 4AIIA 3LE8A 3H18A 3OJ0A 5JSYA 2FPKA 4BNGA 3OKCA 4OQPA 1JDUA 1C1DA 4YRIA 4L4UA 4AULA 3UNXA 3G8DA 3PCRB 1SCUA 2FWAA 3Q8XB 1I5EA 1L5HA 4PR3A 2H5JA 4JWTA 4ZQIA 3TX2A 1JEYA 1Y1QA 2QU7A 3DS8A 2XWBF 2JFPA 3DFIA 3OUTA 4OA5A 5FWYB 4LMBA 4R1LA 4AF7A 4CMAA 4DHEA 1RHJA 3OCZA 1L7BA 1GR0A 4KKXB 4L1KA 3SFVA 3ZDQA 1N1EA 1NA5A 1NBOA 1Z8DA 1SG6A 1RYZA 3M2PA 4LQ4A 4OUDA 4G5RA 3X1XA 4YT2A 4RLHA 1SD2A 4S0ZA 2MYUA 5EZYB 3C8DA 4GI1A 1JH8A 1G5IA 3A6PC 4XQGA 5DTJA 4N9WA 3REQB 2Z8ZA 5IEBA 4HD8A 1V11A 2ZYUX 3ZTTA 3W8RA 3ZE0B 3DDNA 5DU2A 3QBDA 3P2OA 5KYUA 4NBWA 4GPTA 3WHIA 2ZR8A 3HCAA 5DM4A 1DT5A 1LCIA 3FW1A 3LC0A 1EZ1A 4HDRB 4DYHA 2I2WA 4RPHA 4OTZA 4BFLA 1KC3A 3P2EA 4YRAA 3M3DA 5L6LB 1YHZA 2H57A 1C0KA 3CT6A 4L02A 4CHTA 3UAVA 3FGOA 1SKMA 1K8QA 2H48A 4JZYA 2IXAA 2XHZA 1N25A 1EUYA 2IUFA 5EPOA 5D5PA 1CB0A 1KYZA 4BUZA 4JL6A 4MYUA 3MMNA 3GY0A 5TMDA 5T67A 3JQDA 2GM4A 1KP3A 3Q0TA 4WLOA 2NSLA 3BBPA 3PQFA 1EUCA 2B82A 1TECE 1Y4DE 1Z6ZA 3G2HA 4FFBB 4EA7A 5HTKA 1E2LA 1EK2A 1ST2A 3KT0A 1QFZA 2FPGB 2QIPA 1J42A 3QVUA 5JLAA 2O2JA 3T12A 4Z4EA 1AKTA 2YVUA 1KPIA 1NMQA 1P73A 3QEKA 5B53A 2V5VA 5I01A 4EW2A 1LPOA 3DAOA 2C2ZA 1OE0A 4TMFA 4B74A 4AG5A 2NM0A 4NABA 3GRVA 3WHKA 2QTZA 3DDOA 4GXRA 4YFVA 3ZV3A 1GG2A 3E7WA 2ZI3A 1QLWA 2K7ZA 1NBHA 4UDYX 2Q21A 3STUA 1KETA 3TOSA 2C7QA 3Q72A 1FSZA 2EHJA 1IHPA 2YZNA 1NJFA 3OIUA 2PU7A 2XYQA 4TTVA 1VE6A 2OM2A 1KZHA 5JBNA 3HVRA 2R7NA 5HFJA 1LEHA 1KI8A 4PSCA 2DHCA 1P5ZB 1TYZA 3OLVA 4J1TC 4KE9A 3SYNA 3KBOA 2V03A 3ZGLA 2C4UA 2Y66A 4H4EA 2OBLA 7ADHA 2ZBVA 2W71A 3OLQA 3UAWA 1P8AA 1P9WA 3FE2A 4BV2A 1CKEA 1RYBA 3DMTC 1ZDMA 3EBLA 3W8EA 1GUAA 2MYPA 4ZU1X 2CNDA 4EY5A 2PKCA 2RDMA 2POCA 3IS3A 2WLTA 3KEOA 3A1DA 4QL3A 2G04A 3DVQX 2WJAA 2UVDA 3R74A 3TCNA 4YLGA 3PVCA 3ZGNA 1HYGA 2R25B 3H1PA 3AHJA 2P9YA 4C7XA 5A9SB 3CW9A 3PLRA 3RU2A 5IT0A 2YV5A 2V7UA 2GK6A 4RWEA 3ZU6A 4OQLA 2D74A 3MJDA 1UOQA 5AVXA 5ITZA 1M0TA 1L7QA 1XF9A 3BK1A 2VDVE 2VDMB 2PYZA 2WTUA 1TPYA 1M76A 2DWPA 1ZQ9A 2VZ8A 3FNFA 4FOSA 4PGFA 1J2YA 2V6BA 3UOWA 1MOZA 5KTMA 1CLEA 1K92A 3T9EA 4UFPA 1X94A 4G5FA 1DSSG 2G80A 3U1TA 3NM4A 4IVRA 4JR2A 1P60A 3O4JA 3FOCA 4TTIA 2WT9A 2ZSBA 1RZUA 1H8EA 3PPXA 2JFXA 5EZ5A 4LZNA 5HZGA 4NWIA 1XMIA 5J40A 3VAZA 4P3YA 3FI0A 1T6XA 1PYGA 1U3WA 1C7EA 3I62A 5ALMA 2C1XA 4HR7A 4XWWA 4JLAA 4C4PA 4MVJI 1KJYA 1EDOA 1JYFA 2Q4TA 4M21A 5AJYA 2BR4A 4BVLA 2VC2B 3QU5A 2R8XA 5C1IA 4NVRA 4ZCRA 3PVSA 4DCPA 1KEZA 2EX4A 5I7EA 1WSAA 9GPBA 4II2A 3ZH2A 1J33A 2NZ2A 3KG2A 4GR4A 2IEAA 2O8EA 3WZLA 3CURA 3VSBA 5LOVA 4K05A 3TQTA 1UT8A 3I3OA 3AEUB