3KAQA

Flavodoxin from d. desulfuricans (semireduced form)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
b'SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADGYDAVLMGCSAWGMEDLELQDDFAPLFDEMENMGLKGKKLAAFASGDMEYEHYCGAVPAIEEKARGLGAEVICEGLKIEGDASSDPDAVSAFAEDVLKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
molecule tags Electron transport
publication title Crystal structure of flavodoxin from Desulfovibrio desulfuricans ATCC 27774 in two oxidation states
pubmed rcsb
total genus 50
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kaqA00
1QR2A 2Q9UA 2QX4A 1T0IA 3N39C 1D03A 3B6IA 3QFRA 2N1MA 2FX2A 1D4AA 4H6PA 4PU0A 3FJOA 2HPVA 1B1CA 1CZKA 4YQEA 2V9CA 5NLLA 4U7GA 1SQSA 3ESXA 1OBVA 2FZ5A 4ZVLA 3SVLA 1TIKA 2Q62A 3FVWA 2V5VA 4M0CA 1J9EA 4DILA 4OXXA 5A4KA 2W5UA 3K1YA 1RCFA 3FW1A 3GAMA 1AMOA 3N3BC 1XI2A 1CZHA 3OJWA 3OWHA 2FZVA 3OX2A 4ESEA 4LTNA 4S24A 5LMCA 5FX2A 3B6JA 1AKTA 3L9XA 4GI5A 1VMEA 4LTDA 4C14A 1DXQA 5LLDA 1J8QA 3NHKA 4CETA 2D5IA 2BN4A 3F6RA 3R6WA 4XDGA 5TGZA 4C0XA 4PTYA 4BMOB 2R96A 1TLLA 4YAWA 5EMNA 4QOIA 3UXEA 3OJXA 3F6SA 4ICIA 2MT9A 3U7IA 1FTGA 5LBTA 1AKRA 1F4PA 1KBOA 3HA2A 3U7RA 3B6KA 4R81A 2MTBA 3JSXA 3KEGA 1QBGA 3KAPA 4XDHA 1E5DA 2BMVA 3NHSA 3NHJA 1CZRA 3OX1A 1H69A 4GQIA 1ZWKA 2X2PA 3O73A 5EA2A 4N65A 1I1OA 2QR2A 2HNBA 1YCFA 1FLAA 3KLBA 3W78A 3FNIA 4YAOA 3GFQA 2OHIA 2Z98A 3NFRA 5NULA 1T5BA 5LJLA 1OFVA 2FAXA 2QWXA 3LT5A 3EYWA 3O2NA 1AKVA 3D7NA 1FVXA 1GG5A 3LCMA 4J8PA 2M6SA 4Y7CA 2R97A 3F2VA 5F51A 4YAFA 2Z9CA 3K20A 4GR9A 4NLLA 1CZLA 3UXHA 5LJIA 3TZBA 3QE2A 1YCGA 3P0RA 1AZLA 5FUQA 3FX2A 5B3LA 4FGLA 1XYYA 3GFSA 4N9QA 1AKWA 2ZKIA 2QX8A 1AHNA 2BPOA 2QMZA 5JROA 1H66A 4N82A 4ZVKA 1FLDA 2Z9BA 4ZVNA 5FA6A 3ZHOA 3NHYA 3B6MA 5LBUA 3OX3A 1FLVA 1AKQA 2FVXA 3ESYA 1DX9A 2KQUA 2OHJA 2BF4A 3L9WA 5B3KA 4U7FA 3NHRA 2FOXA 1X77A 2FDXA 1WSBA 2B3DA 3W7AA 5EAIA 4H2DA 5LVAA 2RG1A 4DY4A 3EDOA 2QX9A 4QOFA 2QX6A 1CZUA 4LAFA 4QOJA 4Y9UA 4C0WA 2X2OA 1FUEA 1WSWA 5F4BA 6NULA 1C7FA 2Z9DA 4QOGA 4FGJA 1FLNA 2M6RA 1JA1A 1FX1A 4PTZA 2FLVA 3NLLA 1NNI1 4D02A 2FCRA 3HR4A 1XT6A 1XYVA 1BVYF 1KBQA 2A5LA 2XOEA 4U7HA 5ULLA 4LTMA 2ARKA 1RLIA 1YCHA 4NULA 4QOEA 4Y9RA 4CF6A 1QHEA 4ZVMA 3NHUA 3G5MA 4HS4A 1RLJA 1YOBA 2HNAA 1RTTA 3W77A 2GSWA 3GFRA 2WC1A 2QMYA 1ZWLA 4FX2A 4C76A 1CZNA 2F1OA 3OVMA 2OYSA 4LA4A 1AKUA 1J9ZA 1QRDA 1YKGA 3ESZA 3RPEA 1D04A 4HEQA 4QODA 3NHWA 3TEMA 3F90A 1BU5A 2XODA 3QFCA 4F8YA 1J9GA 3NHFA 5F12A 2KLBA 1V4BA 3NHLA 4QOHA 3S2YA 2BZSA 3N3AC 3TE7A 1CZOA 1ZX1A 4YALA 2MWMA 3NHPA 3W79A 5BUCA 1YDGA 1JA0A 2OHHA 3HLYA 2AMJA 1OBOA 3OWXA 1SG0A 4BMPB 4DIKA 1DXOA 4FGKA 1AG9A 3ES9A 2V5UA 1C7EA 1YRHA 2MOKA 4YAUA 3KAQA
chains in the Genus database with same CATH superfamily
3EZNA 1ECGA 1V8BA 5IF9A 5KSYA 4R7TA 5CNMA 3SIPA 1W30A 1B2RA 2O8BA 1BW9A 2J1LA 4ER5A 2R5WA 1WHTB 3BBPA 3GNLA 4WBSA 1J0DA 1C8BA 3WGMA 3FHOA 3V33A 4R51A 1SQSA 1ZITA 4HH0A 4ZMBA 1KAEA 2NO7A 1JAZA 1VPLA 5I7HA 3LBIA 4C21A 3U62A 1F8GA 5K5EA 4OJQA 3RS0A 1SUIA 3P0JA 4J16A 1GL3A 1KDYA 3HY4A 4IIBA 3L01A 2IHYA 3EFHA 1KI6A 3TKYA 3EVZA 4FDTA 4YMHA 2FJUA 3Q6MA 2WRZA 3LVRE 1LVHA 4Q9JA 3R6WA 5DZSA 4ZGBA 3H6KA 4OHKA 5HCIA 1N5KA 1JFFA 2VQ3A 4KR7A 4YRFA 3FOFC 3DDNA 4KLZA 4ZO7A 4XAQA 1LDYA 1GZHB 2G5CA 1R0RE 1II0A 2XXBA 3WLPA 3C45A 4EG4A 4NEHB 3MW8A 3K5IA 2QB5A 2OC4A 1N8KA 1UJCA 2XE6A 3U9TA 1LSUA 1Y3IA 2XXJA 2QUIA 4MA5A 4Y1RA 1O6BA 2Y6UA 5T6BA 7MHTA 5L3SA 1CUHA 3T61A 4HDRB 1T5BA 4YUZA 4NDNE 5F1YA 2PXHA 3C7TA 3OCCA 4KQ2A 4N1AA 3EQ2A 5D6OA 3H8JA 1QZTA 1E6CA 2Q46A 3PQ4A 4WIAA 1R0BA 3EBPA 5CT9A 4CQMD 4ZEMA 4A6DA 2ZUBA 1XN4A 2MSWA 4KR2A 2L17A 1XMPA 2C77A 2NGRA 4IMRA 3E23A 1KMMA 4NR0A 1R6UA 3BF8A 2HSZA 4LXYA 2H9AA 4GYJA 3W2GA 5ALSA 5JQGA 4ZO4A 2JFHA 1YK0A 1N5LA 1TT5A 2VCEA 1GU1A 3E7WA 1U81A 1MGPA 2NT3A 3EIQA 4Y2HA 4XGNA 1PJQA 2PWPA 3KTAA 4A2WA 4JV5B 3K0FB 5KCZA 1OA0A 3NR2A 5G3ZA 1DJMA 5JBNA 1HY3A 2QPOA 4QZVA 3PJEA 4A3SA 2PRSA 4DR6B 2QV7A 3TTXA 1ZNZA 4JJFA 3WWZA 1U7PA 4MVJE 5BV1A 1HG1A 5LMUB 5JVDA 5GADl 3UY4A 3LK7A 4AJKA 3PCTA 2VRBA 2HMWA 4ZVRA 3SJCA 3WFZA 1ZOOA 1MR3F 2Q5OA 2G06A 4Q05A 3JTMA 2RD2A 1X80A 2BEUA 2BFCA 1WF3A 1WU7A 3KQOA 3C5CA 4RY0A 2NSLA 2XZPA 4OQXA 4PNHA 1M1YB 1REQA 2I6FA 1EUQA 3WDSA 4FOLA 4MAMA 4DEYA 2Q4OA 3QITA 4Y2GA 1A5BB 1R8JA 2ANCA 2X9VA 2C0PA 3NC4A 3G8DA 3MM4A 2WLSA 1V4BA 3QGMA 1Y82A 1SU8A 2XOKD 4F4JA 1WOMA 4BVBA 5U1PA 3RE1A 1P5ZB 1ZX1A 2DJIA 2J6CA 4MTCA 1UC8A 3GIWA 4F85A 2X58A 2Y1OA 5EHZA 4DRYA 4PBSA 4ZV4A 2PGLA 1C7EA 1R12A 4ALMA 2FPIA 3FYCA 4ZU6X 4NV3A 5L40A 4DYHA 3OMWA 1W4AA 4M8KA 1KI2A 1V6SA 2E4VA 5CT4A 1B1CA 4Z2YA 1GKUB 2FXIA 3KXPA 5DK4A 3D1LA 1C5KA 4DLYA 4EPRA 1IHUA 1EFHA 2ZIEA 4ERNA 2B37A 3DOFA 3EVCA 2V0NA 2Y0EA 3CR8A 1J22A 3OX2A 1ZJZA 2I6XA 2H3HA 3DZDA 4Q4JA 1BH6A 3O74A 4WOJA 4JN6B 5DYWA 2PX5A 3RO7A 5KAMA 1EJ2A 2HIGA 3TBHA 3OZRA 3TRDA 4EUKA 1IK4A 5LCXA 1IZZA 1L4LA 1JEQB 1HMPA 2JH8A 2NVOA 2WM3A 3DS8A 2OOSA 1Z0KA 4N39A 1ESZA 3JQQA 1OGJA 3MELA 4RD6A 5SZKB 2HRQA 2IZZA 1KORA 1MVLA 4I1UA 4QBKA 1JQKA 4RCVA 4MLDA 3ZY3A 4HK4A 3W1VA 4PNEA 2YZGA 3B9QA 3GLUA 1A72A 2QORA 2Z1MA 3NJRA 1GZ5A 1FNDA 5HFNA 5CDFA 3HA2A 2AWNA 3EEFA 2G3YA 3B6KA 3HCDA 3JQFA 3HY3A 3JYOA 4UU1A 4AUMA 2F59A 3PXBA 1S4QA 5L3SB 1RACA 1SCUA 1YQQA 2VDRB 2V3VA 3PRHA 1P6XA 3FKSD 1RTKA 2AKAB 3BH0A 5COQA 3V2UA 1E4OA 1Y7PA 4JT8A 3IT3A 3P9IA 2BVNA 1L7MA 1N2OA 3DD1A 5EJGA 1NVUQ 1QS0B 2WWRA 1M8KA 3NT4A 5BRAA 2F3PA 2ZYTX 4RX1A 2PGOA 1IJFA 1RZUA 5G0TA 4RIEA 2V7QA 3VDMA 1EXWA 3NBKA 2WV7A 5HUHA 5J43A 3SZOA 5J4HA 5U9CA 2AWOA 3PC3A 3RK1A 4C20A 4BNFA 4EHAA 4MUEA 1U28A 2JH3A 5AKHA 5AQEA 3L93A 1A8PA 4O1HA 2BPOA 2QTGA 4PZ9A 1B2LA 2VPXA 3KALA 4PS1A 4QATA 1FLDA 2AXQA 1N8SA 2FP3A 5C31A 4FYIA 5KYNA 3ADCA 4KQIA 4N49A 1RQGA 4RXUA 3AETB 3K5HA 4EAAA 2KHZA 3O8RA 2JZOA 3DDZX 2A84A 1S2OA 1N2GA 2VWQA 5K3BA 4K8RB 1Q20A 2IPNA 1A4XA 3ZZ0A 2HPHA 2HA3A 1DDOA 1JW9B 4BB9A 1OR8A 1UXOA 3TUZC 3GIDA 3B1VA 1JTVA 3L6OO 3C7KA 3DVSX 4M37A 5CK5A 4YGYA 3TDMA 4BMZA 1GAQA 4D43A 4Y6RA 2R6AA 3HJTA 3QNWA 4X1KB 4G0WA 1WQ4A 4PSAA 1HQYE 3DPSA 3H8VA 3FF4A 1AUXA 3KBBA 2R8XA 3DJYA 5JYCA 5I4KA 1IAQA 3IV7A 3CZPA 4D1YA 4E4YA 4OXQA 2X6QA 2AQHA 3W2EA 1HK7A 3K2EA 3N53A 2WF8A 3EWNA 1GPJA 1U9YA 1XZAA 2GPNA 3G2QA 5ITZA 3QEJA 4RV5A 1E1DA 2RGNC 4GZLA 1YRQA 3OHMA 2Q3FA 4Y0AA 4GE3A 1UFKA 1DUVG 5DWDA 3RYFA 3B12A 3SCZA 2KLBA 1AXEA 5CR9A 4YI3A 5K8JB 4WZ6A 2TS1A 3RKRA 1IFXA 1OIWA 3QU4A 4IHAA 4L6IA 4PLTA 3OFND 3A9SA 3QU2A 3KQHA 4DMKA 1YAHA 4KGXA 5I4BA 5JOQA 3EIHA 4RJLA 3WKDA 3Q40A 1YZFA 4JKOA 1QZXA 4H3SA 5BYBA 3DL2A 1C7JA 3D5QA 3LP6A 3QLJA 1WHTA 4AFNA 2PVCA 1U2EA 2CYCA 3OEEA 4JJEA 1L5KA 4B3TB 1VI5A 2GHIA 1Z8FA 3BICA 2H2FA 3SBXA 3ESXA 4YJ2B 3R5FA 4KBFA 1IZ8A 3BAZA 3DMDA 3KM0A 4PX2A 4LGYA 2Y76A 1NRIA 1XPJA 2BC9A 2A9QA 1N33B 3K5PA 3N5KA 1W49A 4C1NA 5K4HA 4I4TF 2FQXA 1KEPA 2YBEA 3O47A 1JHOA 4MV1A 1W47A 5IJ0A 3E1GA 1XBTA 1G5PA 1G7RA 2BN4A 1MU0A 5AXDA 1V26A 2NNWB 4ZU3A 3QM1A 5LP1A 3MMSA 3OUZA 3T6KA 3B5JA 3OUUA 4IO0A 5C1PA 5FYQA 4C7KA 4Q9AA 3SD7A 5GONF 2H1LA 1A97A 1OASA 2UZIR 3VUFA 2Z57A 3P4UA 3F5DA 2AUNA 3UAXA 3IGFA 1Y48E 2EV9A 2QUAA 1XQ1A 2J5KA 4N3BA 5JWRA 1YCDA 4FE4A 4DMUB 3HU5A 3TCXB 1R4MB 2ZE7A 2E87A 4R8SA 2L42A 4Z1MA 2ZYAA 4OEHA 1HDOA 1LLCA 5BW6B 2C3YA 4B4VA 3DBRB 2G40A 3DE0X 4BASA 5BXQC 4K2HA 4C0XA 1FFCA 1AQUA 3P2IA 3ZDFA 1X7XA 1N75A 1T3SA 3KP1A 3HSYA 4OM8A 4JZKA 4V24A 4JIGA 3IURA 3OBIA 1T3HA 2AOXA 2NU8A 1XEWX 2OHXA 1F38A 2WIJA 1M1YE 4Y2RA 4EG7A 2C83A 3H9GA 2QY9A 4IGKA 3MSXA 3OIWA 4ZCRA 3LAWA 1I7DA 4FHCA 5FNVF 4PLCA 2Q3BA 2CCGA 3GRKA 2AFIA 3M6FA 4MKIA 4R7GA 2HNKA 3H83A 4TSFD 3H8WA 3L7IA 5F2NA 1B23P 4WQMA 3WMGA 1DOAA 1OT3A 1FC0A 3CB2A 3EVAA 4HXGA 4LZAA 2IWHA 2FZLA 2YXPX 5EE5B 3SF8B 3ZWXA 4ARZA 4EABA 3QBVA 1VMKA 2X8LA 1OTHA 4V0RA 3HPRA 1MC8A 2EFJA 3GGDA 4LF6B 4UBKA 1UEXC 3VYRB 1AUQA 4IICA 5EJ4A 2HQSA 3LCUA 5GOTA 3B52X 1MO5A 1DGQA 1S8NA 5DT2A 3M1IA 4HXYA 5IZ4A 1TQ2A 2OQRA 5D7BA 5KYXA 1TKRA 1ZGBA 4GQBA 4Z2AA 1T0HB 6LDHA 2AUMA 2GM3A 1WDWB 3A3KA 5AVKA 1RW4A 1II8B 1EFCA 1HYHA 1WXFA 2WU1A 3G02A 3GFTA 1N6NA 1D9XA 1YR8A 2UVPA 1RYEA 2WU0A 3FZYA 3K0AA 4IVNA 1H65A 1GFIA 4RH3A 5FV7A 1YOVA 3AUUA 3IUBA 1NM5A 3AEQB 2OPHA 4E14A 1QIEA 4I8DA 4GMGA 4J91A 4PBTA 4AU1A 10MHA 4MYCA 4RD1A 1DT3A 4DJ5X 3MCAA 3SSMA 3ISTA 1OILA 5DX0A 2WHQA 4LRUA 4AJLA 5H70A 2XRZA 3L6BA 1C3LA 3I28A 5AHKA 4WADA 1QF6A 1LTQA 1E7YA 2M2IA 3BGVA 5CVDA 3BHJA 2EW1A 3VSBA 3AF2A 1JJBA 4NMMA 3F7MA 4MWSA 1QGUB 3PQ7A 1L7VC 2ZBGA 1CVRA 4LYFA 2GZ3A 4RVCA 4EO7A 4E5DA 4DBLE 5LQCA 5AVRA 2XXAB 2IYNA 1CLEA 1P9OA 3ST7A 4DJEC 3Q98A 3RKUA 2CUKA 2D7JA 3CJTA 3B3FA 4BTLA 1SURA 1TQHA 4N9WA 2XMBA 3TZQA 1JIUA 3ROQA 5BNWA 2AX3A 2C58A 4EGCB 4NV1A 4N76A 4DT1A 5EIBC 2CGEA 2DX7A 1RS0A 1VKOA 2BFDB 4Z51A 3IP5A 2PFGA 2NAPA 3L6DA 3QYAA 4FYKA 4ZVSA 3U9SA 3VR6H 2O14A 2W2VA 1HG0A 1IE3A 4F9TA 4O4JB 2WWVD 1ACLA 3ACBA 1FRVA 2Q5EA 3HYNA 4MJ3A 2OFFA 3UJ7A 3FNGA 3NPMA 4N03A 4BYMA 2CKMA 4TM8A 3RB8A 1EXDA 8OHMA 3GARA 3QKSA 4Y2XA 1FTGA 1GR0A 1M8JA 2QS9A 5JNRA 4LXUA 2QJFA 3C15C 5JE8A 4FLFA 4A1FA 1Y6FA 4BQSA 4XDHA 3RTGA 2ONKA 3AV0B 1E5DA 3LQYA 2WWTA 1PVDA 4Q5IA 4WCVA 5KOYA 2QROA 4N7MA 1K8RA 1R5BA 4RHYA 4YUAA 2N75A 3IQEA 1VG8A 4G56A 4QJBA 5CA1B 3HRKA 1LI5A 4M89A 5DTQA 1VPWA 3HBFA 5EMHA 3RD5A 1GPWB 3ZV4A 1Y6JA 1C3VA 2VFAA 3BCUA 3CB4A 5EZ5A 3A1DA 2EJBA 3OEHA 2RGWA 3FJ1A 3WGTA 4K9DA 5A7FA 4O0MA 1UKZA 2BZ1A 3DE7X 3DE4X 2GXQA 2R86A 2JJ1D 1ZEMA 3EWIA 3PHGA 4OXRA 3P0RA 5DYTA 3TRHA 5DM70 1Q1NA 1ZMTA 4M9UA 3TZLA 3WXMA 1XNJA 2C2HA 1B6RA 1CF9A 1BC5A 4PE5B 3O94A 3P5BA 1X7WA 4WWHA 2Z9BA 2HLPA 2Z2YA 3PQ3A 1P6UA 3LM8A 5I7EA 1E2QA 1UBFA 3HUTA 3N75A 4M9CA 1CHDA 1TLFA 2QR5A 2V7PA 3CONA 3DV2A 4ZEVA 1LPNA 2P6PA 3UGJA 5G53C 2IYEA 2EG5A 4Q1BA 4YBZA 4K6CA 5E9WA 1KYIA 4FEYA 3PPXA 2VF7A 4KKVA 5C80A 2FLWA 1YRBA 3AONB 3VDQA 2DHQA 1Q5PA 1G7CA 2P90A 1FE8A 4WT7A 1POXA 5JSHA 1GTSA 4R1UA 4BNZA 4DC0A 4R2HA 2PWBA 1OE0A 3CGWA 2QVLA 2HMUA 1K6IA 3CSSA 2JD1A 1KZ4A 1EBBA 3FB1A 3QPCA 4C4OA 3B53X 4D92A 4LHZA 4EQ6A 5KOJA 2BRUA 1N1MA 2CC2A 4TXLA 4YX9A 4DWWA 1N32B 3MA0A 2BELA 4QJIA 2XTZA 2W8ZA 4YIKA 4ZAGA 4G6ZA 4AXXA 5LLSA 3TTSA 3L8MA 4YQFA 5HJ5A 3D7RA 3HN2A 3H9CA 1C1DA 2X40A 2EZTA 4B74A 4CKWA 3F1KA 4B17A 1ZSYA 1JS1X 3HZZA 4BAUA 3PI7A 3GJ5A 4D42A 4F71A 4NK4A 4HDRA 2QI9F 3F8WA 1NNUA 1T5DX 4OYRA 5CK4A 4L5CA 2EX1A 4FCVA 3T3GA 2PD4A 3FUWA 1HGXA 1U1GA 2BMDA 5CX1B 5DSXA 4F93B 1K4MA 3LCJA 3Q8MA 1PJ4A 1O95A 4HEHA 2AMJA 3GRAA 1A2KC 2R7MA 2F3SA 2CLDX 3DNFA 3K73O 2GRAA 5FF9A 2O7QA 4DABA 4D4LA 5LP6C 3SYNA 3PRKE 3T99A 1G21B 1K8XB 1M8GA 2ZJ1A 2HTEA 3AL2A 5JYEA 1XKTA 2R6FA 4YQEA 1PGQA 3E7DA 4A5SA 4U7GA 1DO2A 2BFEB 1Q1EA 2BMEA 2DPYA 2BUBA 3QX7A 3N2NA 5CDTA 2GWHA 5GIPE 1IZYA 2W71A 1IDOA 2WKPA 2BFDA 2J32A 2OLEA 3QVGB 2YN4A 4BRZA 4JLKA 2PMCA 1B93A 3BL5A 1AGXA 3ZU6A 1GM5A 2VNHA 1D4FA 2Y0BA 4MMYB 4O33A 4PCVA 1C9YA 1QK5A 3DTYA 5TC4A 3SNKA 4L2IA 4BB0A 1RXSA 3OPYB 4PXYA 2B35A 1LNQA 5I6DA 1HZJA 2PNJA 1LK7A 1U3GA 2MYTA 2G80A 4MEAA 2VPYA 3GAZA 1KH1A 1QGUA 2OTCA 2OLJA 1KY2A 1S9HA 4NHEA 4W7SA 4HH4A 4Y2JA 1AOXA 2IHTA 4YAOA 1NNSA 4W8GA 3J81k 1ST2A 4BV9A 1M2OA 4MRNA 4CM4B 2FFQA 3K9WA 3GCXA 4US0R 4MRMA 2PMFA 4X8LA 2ZOSA 3EUFA 3V4OA 4NJEA 2IZ6A 2ZT8A 4K9MA 1EG2A 2HHCA 3WLRA 3H2HA 4R8RA 4UBMA 1U63A 2SCUA 5FPTA 3HO1A 3AEQA 3I83A 1CY6A 1NXXA 1E92A 3QTBA 4JJ4A 3RYHA 2PRZA 1NUHA 2ERCA 3C3XA 5F73A 5JADA 3R74A 2R68A 3BDIA 4Z7JA 2IQIA 2P5SA 3GEGA 3TNLA 2W37A 4H7DA 1QQTA 1ORIA 2XTJA 1YR9A 2J45A 5KSPA 2IV2X 1C81A 2I4TA 2A33A 2Z2KA 3BGWA 2VPQA 1EVEA 4OUDA 3STUA 2GEKA 4JOSA 2DUWA 2BKUA 2X0KA 3IO3A 3T1OA 2MJLA 5EUQB 4F6CA 3L4JA 4X44A 3A1FA 1ODJA 1M1ZA 4LWZA 2X0EA 5CYOA 3TRKA 1ZY2A 1EWQA 1Z68A 3VPCA 1N9KA 3DL7A 4K6HA 5JD3A 3UWPA 4IHJB 1AQYA 1QUFA 2EP5A 1KO1A 1OAOA 2HXSA 1CD5A 3DZCA 4WOPA 3SZRA 3FYHA 3N74A 3NAQA 1C7FA 1D4OA 1WBDA 1MJHA 4FYPA 4PZAA 2UKDA 2P9GA 3ZZMA 5FWXA 3ELUA 4LZLA 4ZAFA 1FB5A 1O95D 5B1DA 4QDKA 1UK8A 3FRJA 4DQ0A 1K3FA 2QMOA 1ZBDA 4RTSA 1GL7A 4CR8A 4LMRA 2I6QA 2JH9A 3GFGA 3TECE 1Y7TA 1NV8A 1R0LA 1DBRA 1E1KA 1HBJA 3RJ9A 2FMHA 1QB7A 4J03A 5CYFA 2H1CA 3M7IA 4DV2B 4EK9A 4DYDA 1JT9A 4ZVTA 2HIHA 3ZPXA 1K66A 3GRUA 1OA1A 3MN1A 3GELA 5BMOA 1P1CA 1Y3CE 3IVGA 2HHLA 5FL7A 3OWXA 3V6MA 1WTCA 3BSWA 1Z5ZA 1GN8A 1P75A 3LUAA 1LDBA 3KWLA 4FMPA 2ZJ2A 4D25A 2ATCA 5H80A 3VVMA 5AM5A 4D9KA 2AF4C 2Y77A 4GNKA 3N6VA 2IW1A 3IP8A 3GWZA 3EVDA 3E2MA 3V6LA 4CKEA 1TZBA 1EHYA 3FUTA 1CKEA 3KKZA 3LOUA 4HXEB 1M2FA 1OQAA 1Z5NA 2Q1SA 4H0NA 3IBSA 4KE6A 5DT9A 3ZCPA 3B9RA 2ZPAA 3NOQA 2XGMA 3EDCA 3Q7TA 1MRNA 4M0CA 2XCQA 1HE4A 2WVHA 1W2HA 3U81A 4E13A 3BWEA 3QTTA 2YIDA 2I78A 3AUJB 2OB2A 3EJ6A 3H5VA 1DEKA 4XVRA 1D1PA 1FXSA 2O5EA 3HDTA 3SBEA 3DMHA 3ASYA 1Q3KA 3HUFA 4JJIA 3K9FC 5K51A 3A70A 4GI5A 3ZE1B 3KB6A 4CLXA 3TX2A 1OOEA 3L43A 3BK1A 4IH4A 8AT1A 4LYAA 1N6OA 1W36B 4PTYA 1L5HA 1N3YA 4G84A 3W2HA 3DE6X 3VPAA 1N3LA 4QJ3A 3L4KA 1UFOA 3R09A 5IBPA 1G42A 3UUGA 2F9LA 4YCMA 1LCIA 3L8CA 1VSTA 2QJWA 3WK9A 1F0KA 3GEMA 3CUKA 3H13A 2C5SA 2BLNA 2ZIWB 2W7TA 4ZI2A 3QVGA 1B6GA 3EA4A 2PR2A 5C5DA 3ILVA 3NBQA 5F3WB 3KPYA 4L85A 4Q3LA 5HSGA 3OTOB 4JGBA 3JRWA 1SPBS 1DTSA 4J6FA 3KL4A 3D2AA 3MCVA 1M6VB 3HZOA 1Y8QA 3MWDA 4ZYXA 2YH2A 2VP3A 2ZIVB 4KPUB 4LYJA 3R9KA 2DTEA 4A6XA 4OQDA 3LDAA 3PHLA 2QZZA 3CEHA 1D2HA 4P80A 2GO7A 4MKFA 3FX2A 4FGLA 2AJDA 1FP2A 3KUCA 4Z99A 1UFQA 1TLTA 2X3YA 1SOVA 2QHXA 3OTIA 4IW3B 4C1BA 2NZWA 2ZWIA 4DLPA 4RE6A 3BWCA 3OKAA 4PYJA 4P98A 1NMQA 2XUZA 1TJ3A 1AHIA 2AEMA 3BKXA 4CE6A 4ITVA 4KVZA 1OXSC 2EIXA 3DOOA 3EY9A 4YEDA 3HJRA 1VHQA 4DQKA 4Z6KA 1NMXA 4YJ2F 1RMQA 2V7GA 2GASA 1R66A 3BB4A 1X8XA 2AMFA 1L4GA 3OQJA 1IB0A 3IVRA 3S81A 1ZVKA 2IYTA 2GXUA 3W78A 4E07A 3H65A 3AB3A 3IRUA 4L3OA 5DRYA 3WXBA 1K1EA 3FTEA 1LK5A 3O8BA 1NHWA 2VF4X 2UV8A 2J9GA 4L22A 4WZAE 5FBHA 5JD4A 3UKDA 3RTCA 2XR1A 2JW5A 1T6ZA 3GQVA 5AHWA 5BOSB 1KAMA 5FL7D 4U7HA 1XD2A 1ZAKA 2QP9X 2ZTLA 4HDKA 1K0FA 1HM5A 3ELWA 3F6YA 1UKAA 1W5FA 2L19A 2AOUB 4CG3A 2MYUA 4A91A 3H97A 1EFAA 1WOYA 4K6OA 3AK4A 4LA4A 1U5BB 2C2MA 1U2SA 4Z0NA 2EDAA 4H4EA 5E9AA 1KNQA 2W6OA 4Q7JB 4Q1AA 3REFA 2CY0A 3I52A 3NHFA 4JDUA 3MJVA 4MWZA 4NFSA 1DZIA 3K1TA 2J41A 3MBIA 2G1AA 4D99A 4MDHA 4P4GA 1N0IA 5FHRA 4CU5A 2ID9A 4EY3A 4ZYWA 1E7SA 1XWIA 2OHHA 3QPDA 4RH1A 2YJGA 3NTUA 5SY6A 2E4UA 1EIWA 2PWYA 3D6NB 3KZKA 4UUPA 4QLBA 2IHJA 5BNZA 2WHRA 3W4KA 1E7WA 3H2IA 1RMYA 3HJCA 4ZDIA 1YTUA 1P81A 1W1IA 1WMAA 4FYMA 3W8DA 2GHQA 3KQMA 3WLMA 3P9ZA 3M3DA 3H1AA 3IQHX 3PTZA 3PPVA 2BBSA 4J2HA 2VEOA 2UVQA 4IJMA 3SFVA 4JJZA 5CA0B 1AJEA 3K1AB 4EM6A 1R0ZA 3R0XA 4ZVPA 1U9JA 2CUZA 2A4MA 2YY7A 3UH1A 1XEWY 4ZC8A 3WBFA 1ZLYA 1SEVA 3KYDB 2XNDA 1QVRA 2O4CA 3C8MA 4JJ7A 3BSFA 2J7KA 4G8CA 3RVJA 2NTJA 1YB7A 2AI1A 2PVPA 4KQ9A 4LPKA 3ZCVA 2C5AA 2OORA 4R0MA 5KWIA 3C24A 2XTNA 3DLHA 4MYDA 1M7BA 1EJ0A 4HV4A 2GM4A 2XW6A 1HRDA 1AKEA 5KS2A 4MS4A 4PWZA 2WWWA 5FD8A 5J4LA 4F11A 2LCQA 1HYBA 2K6GA 3DL4A 2OKGA 3NEYA 1YJ8A 3BYZA 4GMKA 5LBTA 3U7FB 4C5BA 4XLLA 1R0WA 2PEZA 1X9IA 2VAPA 2XSZD 3N8KA 2Z4RA 3BQ9A 4M1TA 4W1SA 5CDYA 1N9GB 4TMWA 3PWSA 1YE3A 2C59A 3LW7A 4EAQA 1SIOA 4M0PA 4IGIA 1UP4A 4XVHA 3VHXA 1FNMA 1V11B 3P0EA 3M6AA 1U3DA 3FMGA 3IAM1 1EP1B 1GUBA 1N0HA 4LJYA 4MQFB 5CU7A 4YFVA 3LXXA 3TI9A 4AF8A 1XZJA 1ZJWA 2V1XA 3GEIA 4RETA 2XIQA 3CIFA 3TZBA 4CIWA 4DCVA 3UHJA 4EJMA 4HLUC 2WPDA 3GRPA 2WG2A 2VKTA 4HI0E 5FQNA 1TF2A 1GU7A 5IM5A 3T7SA 2VDKB 4EPWA 1XU4A 2JAXA 1GZ3A 4M88A 4V0KA 5ALNA 2UZAA 3Q8LA 1TEHA 2OCLA 3RROA 3EIFA 3R9IA 2ZS7A 1E1CB 4RTQA 5E3HA 2BRUC 4KXVA 4UNPA 2P27A 4ZN6A 4F6RB 5AI6A 2Z3WA 1F60A 1NFQA 1NI5A 2PZFA 5B6JA 2D1FA 1A7UA 3O38A 3OE5A 1GQYA 3PVCA 3KVNA 4AJHA 5KYWA 2IYSA 1RYYA 4DY4A 1IATA 1SFRA 4LFAB 1IH8A 5FWYB 3SF0A 5DB4A 1IVNA 1Z37A 3L7LA 1VCMA 5HJ2A 5BR1A 2X7XA 3LBHA 1LA2A 2A35A 3BMOB 4B3JA 1DARA 4PY2A 3VR6D 3GZNA 2G0AA 4KOEC 3ROFA 2R7LA 1WR8A 1T5SA 1J8MF 3EA0A 2I03A 4EJ2A 4TKVA 4HYYA 5KWSA 2ZZMA 3Q6NA 3DH0A 5HF6A 1TCBA 5U4XA 3O3MB 5KTYA 1ZD1A 3WR5A 1RAAA 4ECEA 4RZ2A 1SM4A 3G9TA 5DNYB 3W3AA 1A82A 3F96A 4CL0A 5LZ9A 1KEKA 2DLCX 3PEWA 1KZ7B 1SCIA 1U7OA 3B7PA 5C7IO 2ZUWA 3TK1A 4PG5A 3KKMA 1Q7GA 1W5AA 2WWHA 2ZT5A 5FIUA 1V3TA 3OLXA 3RVQA 2ZSJA 4BO3A 4Z3KA 3V7WA 3THSA 2C07A 3GEBA 3TL3A 1DWPA 2VNAA 2W2TA 3RVOA 1YDMA 3Q7EA 4S1WA 1HETA 3F3MA 4ENPA 3DUFB 2HO5A 2ZAMA 3AR3A 3DXZA 4ZO9A 4I9FA 4A16A 3HA3A 1SVNA 1HO3A 1EX7A 2JJYA 4UC0A 4CR7A 4F8JA 4NE2A 2HQRA 4WLUA 4B3XA 2DQYA 1QLWA 2I2FA 4DAOA 3VOTA 3TDNA 2I7DA 1JEYA 2XTAA 2AZDA 1KO7A 2D2FA 2QRVA 2Z0MA 1JMKC 4PM4A 1M34B 3AUSA 3UQYS 4EUNA 2Y4OA 3AVQA 3EPKA 1ENYA 1P7VA 1I8TA 1RXIA 1X1QA 3G89A 3JTEA 4UAVA 4D97A 3KJIA 1OLSA 2OCAA 2R8OA 2QSJA 1V2GA 2AG5A 1BMFD 2HF8A 2I4IA 4IEIA 3K4HA 4ZARA 4CXMA 4OX9B 3SBDA 3T52A 4K6MA 2IELA 3CRZA 2PDAA 2V6MA 3EAGA 2IU4A 2W6ID 3G7SA 3T0FA 2A6PA 2FN3A 1CULC 4CV2A 1VJCA 1RVV1 3A3NA 3PDJA 1KVQA 1PP4A 2VCYA 3HCEA 4HRVA 4I55B 4MYTA 4B40A 4MH0R 1NMEA 5DE3A 1HSZA 3NKFA 4F4IA 4A0RA 5BW8A 3ZD9A 1GZDA 4N6GA 3Q0TA 2PTHA 4AMBA 1X70A 4TROA 3N05A 2C2YA 1RYNA 4JXJA 4J43A 1Y89A 3NGXA 5E8JA 2PRKA 3KO8A 4ZYTA 4DLUA 5HYVA 1Y1PA 3SI7A 1J0BA 1K75A 2GPYA 5LYJB 3KSAC 5KYWB 3QE2A 3BCHA 3GYGA 3H2ZA 3VR4D 5KOHA 3H5OA 4ACAA 3C4VA 1RYFA 4O4IB 4AUNA 4TZ0A 5CCXA 1F6DA 1L5YA 1MFPA 2ES4A 3T54A 1K5GA 1XFDA 3MTIA 4R2WA 2GM5A 2VWHA 3K2QA 3CH4B 3A1WA 3OZDA 2X0FA 1G8SA 3BILA 4CT0A 4S04A 2NP6A 1GRCA 4PFJA 3HFSA 4XCQA 3G7UA 2F1RA 5DEOA 3M6UA 5TRTA 3H75A 1L1EA 2PUVA 1PJCA 3MWKA 3OEHD 1B8OA 2E5WA 2QN1A 2ZLBA 5ICGA 1QB8A 4PCAA 1ULUA 1K98A 3OG9A 3LPAA 1XMVA 2Q9CA 2FKAA 3ENVA 3JWPA 4IDOA 4XR4A 4XQ0A 1FRZA 4HB2A 3EVFA 4G1BA 2CWDA 3B1XA 2ZSKA 2HU7A 3CGGA 4FD3A 5ALRA 3WYGA 5JPCA 2XMSA 4AZTA 1TPZA 1H42A 3EG5A 4HN2A 4DR1B 3M5DA 3QEOA 2O2XA 5BSRA 5FPKA 1C0KA 1XXLA 2DTXA 5ESDA 3F9RA 1CFJA 2HFKA 2QMYA 4PHTA 4EY4A 1BX1A 4EFLA 3Q5EA 1YZQA 5ADHA 2ZCVA 1P4SA 2WJZB 1WXQA 1ZKMA 4JY7A 3T5DA 4B4DA 5KU7A 4PF1A 3MEQA 3OUTA 4CBVA 2J67A 4F4FA 4B45A 3I53A 4FMBB 5CPBA 1T9HA 3D8NA 2PSEA 4DGQA 1XZNA 3LD9A 2O4UX 3HUEA 3WZMA 1DXOA 7ABPA 2QPTA 1U8YA 3PJFA 1SOWA 4AZ0A 2QTFA 1QIDA 3O8NA 2FFHA 2ZWMA 2OV8A 4C6HA 3WNQA 4PN7A 4DCPA 1QORA 1YACA 3H5LA 2H7VA 3ZY4A 3C3WA 4GSKA 1C3XA 4MUBA 2JASA 1V7CA 4BJ1A 3SIXA 3KJFA 4BN0A 4DM7A 3T9BA 2MSNA 2EQBA 2TMGA 4ZK2A 1B74A 1WA5A 2HSEA 5E6UB 1Z4QA 1DRKA 1E8NA 4NNOA 3KHSA 4LY6A 1E6KA 3GEEA 1KYYA 1F1BA 2GLUA 3DDSA 3VPGA 3ONDA 1KHHA 1G8HA 3MTJA 4ZO6A 2CLEB 3GUUA 4ZZ3A 1CS0A 2P77A 1OPRA 4N5IX 1P7YA 5ERYA 3I2GA 2OEPA 4OFWA 3EEYA 3GDFA 3GLSA 1KMQA 1R4AA 4YR9A 1HDIA 1DXQA 2B94A 2Q3LA 3CX8A 2YHBA 1UMCB 4H16A 3HABA 2HO4A 3DHEA 4D96A 1KPGA 1W0KA 3KSRA 5SICE 3OJXA 1RJGA 2QZJA 4NDZA 1M0WA 2IYXA 3GPLA 2CMKA 1NVKA 3B82A 2WNIA 3NIDB 1V8ZA 4FQ5A 2AOWA 2GPSA 1XWWA 2Q0HA 2XNHA 2A1UB 4J7CA 4PZCA 2IT1A 1FVHA 2FE1A 3EC7A 4YI5A 3TI7A 1NXSA 1GA4A 1ZUD1 4KYIB 2HA7A 2NUAA 2Z1DA 3BMQA 3N2LA 2IBMA 3IFSA 3EGDB 3LQKA 2AXPA 1X7GA 5M3BA 1PE0A 4KPFC 3UMMA 3R9WA 3FSGA 4G1FA 3RV3A 2OUIA 2FRVA 4G8BA 4R98A 2R6CA 3EXIB 2B2XA 1WPQA 4B7CA 1QU2A 2C1ZA 1YB4A 5K2MA 4C2AA 3NNSA 1EP2B 1J24A 1E3IA 1PT6A 5IS2A 3DBVO 2NADA 2WAYA 5IP5A 2IU0A 2YMLA 3OICA 1XYYA 2Z4SA 3WRVA 5IFKA 2YFKA 3A6JA 1G4AE 3H4IA 2AYZA 1JFVA 4QYSA 4UE6A 4EA6A 3ZHOA 1JV2B 4NP6A 1C3OB 1LI4A 4UHCA 1YS7A 1JE1A 3ZCTA 4JP3A 4CLDA 2FWMX 2EJWA 3UMBA 1F8UA 4OXKA 4DIBA 5B3KA 3F6EX 4Y9DA 2RH9B 1SQGA 2DHEA 5EIWA 2WTMA 2LCIA 3FSGD 3RT1A 3ZD7A 3WL8A 4FYWA 5FTKA 3UENA 1XAJA 4Y67A 1VFNA 4P8RA 3W6ZA 5BORA 2Z6UA 1GL6A 2FH5B 2HQOA 2GBIA 2R6JA 2VZLA 2E5FA 3OQMA 1SU4A 1ND6A 1NNI1 1QO7A 1X7YA 2FPMA 3CJQA 3S2FA 3A4NA 2PBRA 2P1RA 2YYSA 4Y2VA 1U0EA 4CW7A 4ZMSA 2FWAA 1YHYA 1MMFB 1QTNA 3QEMA 1IDN1 4II2A 1QJCA 3MCZA 16PKA 4YJDA 3UNXA 3V7YA 4KMOA 1WDKA 3LDUA 2G1KA 3AUYA 3LPMA 4XQEA 3ZOZA 4Z86A 2VA8A 5FOQA 3ZD6A 4BMSA 3K70D 3HWRA 5DYNA 2YQ4A 3KD2A 3SX0A 3R8CA 1G2IA 2AMYA 1Y6QA 4NESA 3GDWA 4EGJA 1G3MA 2OO7A 3HC7A 3KUKA 4RHXA 4XJSA 1X86B 1GV1A 4LRQA 4EFKA 5HRUA 4WEOA 4KREA 3C3BA 1FDSA 1NIJA 3FMFA 3GNTA 1C1HA 4P4SB 2I71A 3EEIA 3PX3A 1KQNA 3UGKA 4DDWA 5BSHA 1ISRA 1FQJA 2Q2QA 3L49A 4FW9A 1GRNA 5HIAA 1KZ9A 3OC0A 3D8TA 1TRHA 1IHYA 4YPOA 4YAUA 4YCSA 1KRXA 4F5DA 1KK1A 2FP4B 1R8SA 2XADA 3KQQA 4IDGA 4UUMA 4YRRA 5H81A 1SCAA 2VJOA 4FGSA 1DVRA 1O96A 4QM6A 3RM3A 2VNKA 2CLOB 1QMPA 2H0AA 3MJRA 1THGA 4XM1A 3VR3A 4BGUA 5DN6D 1LQTA 1UWKA 1K6MA 1UCFA 2GN4A 3OEWA 4RE5A 1LRJA 4DIUA 2XWJI 3HXLA 2PH3A 4UM7A 3C97A 2EGUA 5JT1A 3LSTA 2KBEA 4LYHA 1QGED 4LTNA 3H8SA 3S2EA 2HWYA 3TLCA 2HF2A 1ZD9A 4B3CA 4BV3A 4XLTA 1EE2A 1JBQA 1P45A 2O2CA 1P7WA 1P9WA 1C4KA 3NBAA 1DEOA 3PFCA 3STYA 3KD3A 3P5SA 5KWJA 1YASA 4FFNA 1C4XA 4G5RA 5GQSA 1J20A 1HA3A 4DSAA 2AKEA 4MEBA 1GZSA 4WZAB 3E1KA 2ORED 1GD1O 4FMDB 4UKDA 4MKXA 2QXYA 4Z54A 5DCLA 4OX9Y 4OFXA 1CUXA 2IC5A 3KLNA 3PFKA 1H5NA 1U9IC 3DQZA 4JIMA 5IK2A 5A3SA 4AWAA 3W5CA 2ZITA 1ESMA 3QBJA 3FWPA 4D9IA 2IODA 3NYIA 3WIBA 3SAJA 1OFVA 3V3KA 3V2HA 2GCGA 2CFTA 3CUTA 3NIGB 3FDZB 4DMRA 2GN2A 5DX8A 2DFNA 4G1VA 1I2BA 1MB9A 4QL3A 3DZKA 4RKEA 2FPOA 3INTA 3FF1A 4PZUA 2EXXA 3W6NA 5K8TA 3UMSA 3A7EA 3U3RA 4PIVA 2C96A 4P4NA 3OCZA 5JZOA 3WA7A 1C8KA 3QY9A 3OX3A 3FSEA 3QXHA 4MZDA 2A57A 1M0EA 3VBEA 4QUJA 4M9XA 4OJTA 1LLUA 2KQUA 3I9LA 3NPAA 1CE8A 1VE3A 4G81A 3SSAA 2PGJA 4NBWA 4XIJA 2JKVA 5L95A 2VQEB 1S89A 1ZHFA 4ZO8A 1ZR2A 3KXDA 4BP3A 4AMYA 5ELLA 3FB4A 3GLGE 4I99A 5TJ9A 2R1TB 3WNZA 3QIVA 1TMYA 5G1NA 3GJ4A 2PGXA 1FLNA 2VDNB 5HQTA 2BBOA 5IPFA 2FR0A 4TSFA 1R8YA 4HUJA 3EGWA 5G4LA 3K53A 1XRSB 5DGXA 4RZIA 3LOPA 5CXSA 1TNDA 4UZEA 3DMNA 1NONA 4CJXA 3KLOA 2CXPA 3AFOA 1ONOA 4RPKA 3RG8A 3BD7A 2C8JA 1ULAA 3H9QA 3V1NA 1SCBA 1Y80A 2F1JA 3AI2A 4ZOLF 1IEQA 2ZI6A 2GERA 5CG1A 4O4LB 3D5EA 4IDCA 4N5HX 2VDMB 4P6VF 5IH3A 3TTYA 1Q0SA 4F2GA 5AW8A 4TQGA 3DTVB 1PG0A 2AG6A 4XSHA 2IZOA 5A03A 4TMFA 4W5OA 5LKRA 4GP9A 2AEJA 4OMUA 4YALA 1RHMA 3KOOA 3DAHA 3JASB 3RK0A 5EKXA 4O1IA 3UK2A 4RPJA 3HGTA 2O1XA 1BXGA 2CHEA 1THMA 1GKKA 1U1EA 2NXCA 1L5FA 4EX6A 2AS0A 5CAEB 2QYSA 1S6YA 2VZ9A 1PNRA 1X0VA 2VOJA 5LKAA 1CHNA 2Z2JA 1K5DA 2P9ZA 3OF3A 4MGEA 3AH8A 5E0OA 2R6DA 2OQ2A 3OQIA 3OZAA 4QTZA 3WG9A 4RJTA 1CEYA 2RJ3A 5G4KB 3IO5A 1Q91A 4S1NA 4HNUA 4N5NA 3SZLA 3VPFA 4J4HA 2IDZA 1DIOB 421PA 4PYQA 2RHCA 1WZIA 4JQYA 3VMFA 1XZ8A 4B34A 5CCEA 5LMCA 2JBHA 2CT8A 1SD1A 4KQEA 2ZIFA 4CEHB 2QYOA 1AKTA 1SGWA 1RP7A 1P0PA 1TTQB 3FA2A 3OOSA 2NTEA 4GBED 5DNAA 3UH0A 1G38A 1V1MA 1UJ4A 3M6VA 1N7GA 2FTKE 2GYWA 3C5EA 4WOBA 2YMQA 4KI0A 1F4LA 5JCZA 1H1TA 1I6KA 4K28A 3ZEIA 1D2CA 5CFOA 4FGWA 1T4CA 4BZPA 2BGRA 4HADA 2C95A 2C7QA 5DGIA 3BIXA 3A6KA 1UKVY 1F51E 3HKBA 4BMCA 3K92A 2ZU6A 3JSXA 4K05A 1E79A 1KR2A 3A6FA 5ALQA 5B1EA 2QD4A 4DLVA 1N6HA 2I91A 2HKIA 3SEAA 4EI8A 3ZZ1A 2H63A 4QO8A 5MFPA 2FY8A 1I24A 1S8FA 4ZV9A 1KFBB 3TZKA 1HKUA 2QD3A 3F67A 4NFHA 3CHYA 2G08A 1DV2A 1WVIA 4D4GA 3VNBA 1U11A 2C84A 2QW0X 4B3HA 4EJSB 3D1JA 4DZZA 2CL5A 2PKQP 3UOGA 1G8KA 2GJ8A 3SQWA 5EE0A 4KZKA 4QECA 1H5QA 2I5PO 3LO8A 1QP7A 5EJ9A 1UPFA 2DETA 1BWRA 3QSGA 2C9DA 4ZWNA 3EXFB 4QHTA 1FXWF 4N6OA 4BWFB 4RUKA 1AKQA 3HPQA 3OZWA 2FYTA 4B6EA 5TGDA 4CMIA 3HDVA 2REOA 4JQCA 5LVAA 4UM8B 3WB9A 5MN4A 3PB3A 4LISA 1LLFA 1ZIPA 2BISA 3ICCA 3L41A 5H59A 5KTSA 2DF8A 1F1JA 1NTOA 1TUIA 2O1WA 2WWIA 2YR0A 4JCCA 4M0DA 3TW4A 1OH8A 4GL2A 1I10A 3TLBA 4AWBA 4OG2A 3VPHA 1CNMA 2C8VA 2VHQA 1KKUA 3UF0A 3S5UA 4FONA 4QDXA 3SC4A 3ZDRA 3E05A 4X93A 4DKJA 3EASA 3I72A 3OZGA 4I50F 1FP6A 1ONPA 3AL3A 2IOQA 1NNEA 4AZ3B 1NQUA 1RLJA 3FI0A 3GGPA 4IRXA 1Z2DA 5FTNA 1K7EB 3ZIDA 4LSMA 3AR6A 3DB1A 2FPKA 4O4HB 3CWCA 4E08A 4PO8A 2CE2X 4XQCA 1L2TA 4P32A 3MTEA 4I5EA 4B7AA 2ORWA 1E0DA 3FRIA 4NNPA 2ZRLA 4OLJA 1WB9A 2QTVB 1C3JA 2UZ0A 1LY1A 5AVQA 3AKCA 2O2JA 1GCGA 4NV0A 3NFYA 3ICPA 3IX7A 3PKIA 1JEDA 2HY7A 4C01A 3RHSA 2JANA 3GLTA 3GLGA 3B3JA 2OVBA 2P3SA 4RHUA 4W1RA 3CLVA 5TXGA 1IULA 2PWZA 3ES9A 4YAGA 2OE2A 4YXWA 3UV7A 3KQNA 1YH3A 1PGOA 2JD2A 4R8LA 1NBIA 1PYGA 3RS9A 1NQTA 2BGTA 4RGYA 4ZJUA 1P7CA 3V4RA 3GT7A 3DW1X 3H1GA 1LC3A 3U7JA 5KX5A 4EVIA 2DQKA 3BE8A 6REQB 5DYIA 4IH9A 4DRXA 4X8HA 1PR3A 1B8UA 1K8ZB 1MOSA 1BFUA 1U7DA 2PXXA 1N5JA 3AFIA 3KVRA 1BCSB 1T3GA 4QUBA 2IIVA 4ZQEA 1X80B 3RVSA 5B55A 3DLBA 2X3UA 3N76A 2XQKA 3UCEA 4RVUA 1Y9ZA 5KOIA 1OREA 2ZDQA 4PC1A 5KYGA 4GP6A 1QG6A 5KTPA 4UEQA 1U8AA 2H5EA 1NZFA 3AF3A 2FZWA 3C43A 4ZZ2A 5JVDB 3VPXA 2HBZA 2P4QA 3R0VA 5DCUA 2O9JA 821PA 2HPAA 4J3JA 4AUEA 1NUSA 4IFTA 3L77A 1NQVA 1JQ3A 5K4GA 2FETA 5KJFA 4MKGA 2A7QA 2XB2A 3EQZA 1ZP6A 2OM2A 4Y98A 5EP3A 1E18A 3AHDA 2FA9A 3TGLA 3KZVA 4EHLA 3KV1A 4C0LA 5FBWB 5ESXA 1MTOA 1N2EA 4E2ZA 2JHFA 1Z82A 5E1OA 5GV7A 2VP4A 3DEJA 3GUVA 1N1GA 1RPTA 2I8AA 5K0NA 4C04A 4A23A 4EUFA 5HUQA 5DSZA 1QE5A 3MYYA 3PYXA 3RWBA 3RS2A 3OH8A 1Y8RB 2KB0A 2BE7A 3SF8A 1AUVA 3D6UA 3RBXA 1CRZA 3GD7A 1TKBA 1W52X 5FUQA 2WWFA 4C3UA 4DSUA 3P19A 2AUTA 2ATVA 1DFGA 1G7SA 1I80A 4Y1RB 3ZLBA 5ADUS 4DJDC 2PZKA 2QVZX 3VO9A 4CLRB 1AD2A 4M7RA 1QVVA 2FW7A 3H1BA 1RD4A 4JFRA 1F4VA 4WFJA 1ZXXA 2XF2A 3DONA 1JECA 3WLHA 3ZNQA 2FFJA 4F3NA 3K2IA 2WJPA 4D9CA 4QKQA 4X94A 3AG6A 1WEHA 1RBZA 3GVPA 3QKTA 1V41E 1Z16A 1IHPA 4AIRA 1DJQA 2ZXUA 1DC6A 2VQ6A 1P1KA 4IPTA 1UXIA 4X71A 2RHMA 4OK5A 4TVSA 2D0DA 1X8KA 2FCRA 4ES6A 3DMYA 1NT4A 3MAJA 1WCIA 2BEVA 1TM7E 5IC5A 2LZ0A 4QOEA 1HT3A 2Q4BA 2VWGA 3A9TA 4JSRA 3CVXA 3NGLA 4XB6B 2BH2A 1W19A 1XZQA 4UPEA 5IKXA 2BUCA 3AI1A 3QQPA 1GLVA 3CE9A 4RZUA 3IEMA 2IHNA 1XNRB 2DG2A 4R1MA 3S5JA 3CKLA 4F5YA 3OLCX 5FR1A 5BNTA 2VDJA 1BE1A 5AJHA 2B1QA 1HI9A 1Q1AA 4UU0A 1Z2EA 2IH2A 1DAHA 2H8KA 3AVOA 2ZP1A 4CN9A 3ONEA 1MAAA 3C6XA 4XB2A 1Z7EA 3RJ5A 3FPSA 1K68A 2WJAA 5LB2A 4MVXA 5JYBA 4PZPA 5JV5A 3HKDA 3TWOA 5H1YA 1XEAA 2CJWB 4B82A 2GK3A 2R25B 4R2JA 1QRRA 4B46A 5H3HA 3HO6A 4HDMB 4RL6A 1IC6A 3ZD8A 1RYMA 2P6NA 3DULA 4G24A 4GBGA 3VOAA 4EG5A 2AL7A 5AVYA 3GLFB 5GVRA 1RNLA 4PC6A 1W7AA 2XZLA 4COOA 3UATA 1MRSA 1R27A 2BFBB 4JSYA 2A5JA 4DA8A 4JP8A 3OHSX 2NTYC 3BA6A 4P31A 1W9HA 1P4RA 5AXBA 1R3UA 4AXBA 2V96A 2RARA 1K89A 3LF1A 4BYGA 5FBZA 2BFBA 3H0EA 1M1NA 2ACVA 3G49A 1PT7A 5A1TA 3ZWAA 2CHGA 5HIKA 3PVSA 2X8JB 1JG2A 1K06A 1PQPA 2YXEA 3NATA 3DXYA 1WM1A 2VUTA 4Q18A 5EP4A 4N12A 1KOLA 4C08A 3RTEA 1P60A 1SKBA 5BXYA 5KPDA 3GHYA 3CS3A 4RGQA 4BNIA 4LSWA 4J1NA 5ITZB 5K0BA 1TF7A 5B30A 4CEJA 3HU2A 5CB6A 1E1YA 2PT7A 1L4HA 3L7KA 2FUEA 4TLAA 3SZGA 1JXMA 4FTWA 2C7OA 3OESA 1Y3HA 2ZB4A 2CNDA 1TQ8A 1FFXA 2BFMA 5K3EA 3JQEA 5DBGA 3DD5A 3F5QA 2XB9A 2B30A 2BV3A 2C2GA 4GIBA 4F2WA 1RM3A 3I4LA 1P2BA 1V8FA 4QGGA 2IDJA 4DJTA 1A7KA 1I0IA 3OZ7A 4UAJA 4MLPA 4PQFA 3E18A 3K20A 1FRNA 1OJ7A 2XZOA 1CZLA 4UTXA 2GUWA 5C3UA 1IWPB 3PXCX 2YOFA 1EK1A 1XJ5A 1XMXA 2QK4A 4HQRA 3BERA 4HY3A 1M6NA 5C8YA 2NUBA 2OZLB 3LX8A 4JJAA 1JYEA 2PTGA 4ZRNA 3CWZA 4ETWA 3GC6A 1JQLB 4K88A 1G60A 1EQUA 4C2TA 1L7NA 1M34A 3W0LB 2PZJA 1MNQA 4QT4A 1R0KA 2KPOA 2X7HA 3CY6A 2ZRNA 2IU3A 1Y7IA 2WIDA 3NBFA 2C1XA 4EYKA 4AKIA 4CGZA 4NZNA 1NPTO 3K6JA 4ZOBA 2GTHA 4UEKA 3FXAA 1J90A 1BGWA 3KUXA 4JA0A 2QL7A 5TPWA 3DUFA 2V6GA 5EPEA 3K70C 1AK2A 1ZL2A 2VRCA 1USWA 3ECAA 1EK0A 2P3LA 1QE3A 3N7AA 3R3WA 4OQZA 4OSOA 4X97A 4Z9YA 1JTFA 1YFJA 1H85A 2E5LB 1L6IA 4CUZA 4TVBA 1JIIA 2AC2A 3RU2A 3HJHA 5ES4B 3GV0A 2OV3A 1JLLA 1DOHA 3KQKA 2EKPA 1JHYA 1RZRA 2JKYA 1LSOA 1OLUB 4TXMA 2XQFA 3TOCA 2UYHA 1FFWA 3PFFA 2QBYB 1TM5E 1I1NA 4EW1A 2B7BA 3LQ2A 3THYA 2WZBA 1ETUA 2AFHE 3B6ZA 1FW6A 1GEGA 1JVSA 5CBPA 3TF5A 3U19A 1Q12A 1IOWA 4AO6A 4C3VA 4EF6A 3K5WA 4S1PA 1NUAA 4WVLA 3NYQA 1ZYUA 5IJXA 4KLRA 5JS2A 4CN8A 4DBZA 3VNSA 5DM1A 4HQNA 2R65A 4GC5A 4U3JB 5FUVA 4FFLA 4U4AA 3RC2A 1BFDA 4N5MA 1L7PA 2FLKA 1YDGA 1H0SA 3TLGB 3JARA 3X1WA 4NJMB 1M9NA 3V1UA 1OYYA 1NAIA 4IJ5A 1A5ZA 5KTOA 3WK8A 5LUAA 3H1EA 1Q0ZA 3AR9A 2A67A 2C9BA 1B15A 1QUEA 2I4MA 3ER6A 3I1YA 3N07A 3USZA 3L7AA 4DQUA 4ZK6A 2F43A 3CRRA 1H2AS 3OCUA 4FN4A 4RKFA 2SECE 5AW7A 2D2IA 3ROZA 1UC4B 2Q1XA 2HA6A 4QIHA 4E0BA 5B37A 3AM3A 2BBTA 2UXCB 4ZT7A 3ANTA 3PTLA 3EVGA 1OMOA 4E21A 1UM9A 3WGGA 3NW9A 4MGIR 4E30A 1K7CA 1VLHA 1D6MA 4BWYA 3G2IA 2DKOA 5ES3A 1BQ4A 4CIVA 1QMGA 1H5UA 1RWKA 1UC5B 1Z06A 1N9ZA 3FJYA 4PRLA 1KXJA 5JBQA 4E33A 5LXTA 4YHHB 1BDIA 2C8KA 4IVRA 3SVZA 3SMQA 3C8HA 4XGRA 1W34A 1ZESA 1FXUA 2HHHB 1DFIA 1E77A 5JPDA 1O8CA 1PRYA 1C1DB 2XUQA 4NG5A 5ALDA 4Q1CA 4YLGA 3RRMA 3WB0A 4FYXA 4YWHA 3UWSA 1ISMA 3ZNOA 1QZZA 2FQ1A 4O08A 4Q4HA 4AS3A 1XKQA 3VPBA 1ITZA 4WBNF 2HL6A 1U04A 3TW8A 3HNOA 2I2BA 4CMKA 3DBIA 3M33A 3O3NB 1MT3A 4JBYA 5K3OA 4ARCA 1H23A 4KBGA 4QNNA 1U2DC 2OHIA 4H60A 4OA8A 4FHFA 5A04A 3D5TA 4BMVA 3LCMA 2C9YA 3C5HA 3UPTA 4RU1A 1L4KA 2YRFA 1D0VA 4J1SA 4ED9A 5ALKA 1X92A 5HM8A 3ZE7A 4KWEA 5HM6A 4D5GA 1XELA 3LQ1A 3ABOB 3C4QA 4GF5A 4R40A 4KXMA 4ZDWA 4DSOA 4HCJA 3DXXA 4JBXA 3VR4H 5FBQB 4HLNA 1AHNA 2GPAA 4Q47A 4C4SA 1HQDA 1TJYA 4N82A 1FPQA 1GPMA 1EGVB 2WFLB 5JQGB 5ENVA 3SDBA 2AQIA 3NXSA 3LHFA 3TQRA 2VAXA 4CF7A 2OYCA 3DFZA 3H04A 5CA0A 2CFIA 4JUBA 3HN6A 2E4XA 1KP3A 1BYUA 3HJNA 1E9CA 1NG1A 2ZUSA 4OCZA 4WLNA 2X0JA 5BOVA 1W1UA 4DEVA 4EBBA 3LC1O 5A2GA 3IBTA 2GA8A 4FGJA 2Z56A 4GEGA 2C98A 2XH8A 5F9MA 5C8VA 1UJMA 2WT9A 3UJNA 5DHPA 1F7VA 1VE6A 3PNYA 4EY7A 4K26A 2C9MA 3Q10A 1J8DA 3OCJA 1NN0A 5IHPA 4HLQB 5AM0A 1RRCA 3THXA 2BYTA 4TKMA 4WY5A 3SC6A 2NTNA 3WMXA 3WTBA 2VTBB 4FCWA 4TVOA 2WJ4A 1JNYA 3I6MA 1X9GA 3DYIA 3Q72A 4G4SO 3MAGA 1D2MA 4BX3A 5DMXA 1SU6A 3DAPA 4W6ZA 4ZTBA 3FDIA 4W5NA 1U5BA 1ST3A 2J3MA 1WQ3A 3OVMA 1NDQA 1LNZA 3AVWA 2IP4A 2ZJ6A 1Y37A 2ZAIA 4QODA 4TT3D 5CH5A 2JI8A 5BRJA 3U39A 3E2IA 5AK3A 2V5AA 4WBNB 3U4CA 3BIWA 4QYTA 2MINB 5DGHA 2IE8A 1Y6RA 1YIAA 3OCXA 1O9HA 3E3LA 5JRJA 4EO9A 2CHVA 3W4JA 1GCUA 1XQXA 4B6SA 1QTQA 4DNXA 2BY4A 4JJ6A 3D7MA 3S40A 2NVUA 5JNSA 1NBMD 2Q5QA 1ODIA 2FZ4A 4L4ZA 4Y0NA 3QLUA 4YMWA 3SPXA 3L84A 2D13A 1E3MA 1OBHA 4M9RA 3S8EA 2CK3A 4FNAA 4H7IA 5BPHA 1BW9B 3TD2A 5NLLA 1DFHA 5KKNB 2QRJA 1U3TA 3JQ8B 3NNDA 1B0AA 3WHIA 3QEKA 4F5WA 3DA8A 4LWOA 3S28A 4C0KA 3WGIA 1MOQA 5HKLA 5I9LA 3CCBA 4DPLA 4IOKA 2R8ZA 3OLYA 4OFBA 2YIMA 1XI2A 2FMXA 3L18A 3O1JC 5B4TA 5C1BA 1ZK3A 3OPMA 1X42A 1SKUA 2VXYA 1IEWA 1KQFA 2FUG1 4AN4A 1S96A 4F2DA 4MDEA 1RBQA 1DX6A 1P7ZA 3HKEA 1FDUA 3Q8WA 1GQSA 1A4UA 1TLLA 1XK6A 3ND5A 4QUGA 1G5TA 1RRVA 3IOEA 2A9KA 1CY4A 1FOEB 2WR8A 1VLQA 4D8YA 1N2BA 4ZOLA 4X3OA 1AO0A 2FQWA 1ODLA 4B3SB 1B26A 2CJPA 4ZKEA 4J4BA 4OJNA 1P74A 1U0FA 2CB9A 4H6PA 1C2TA 3CTMA 1IN1A 3GJ6A 3IHKA 4RLSA 1IU9A 3D8BA 2HMTA 1E96A 1JU9A 1JILA 4MQ6A 4LWPA 5A6SA 3PU6A 4ID3A 4BNKA 1WUTA 1XEFA 3BMNB 3ZXIA 1N2CA 3UMJA 1XAHA 3O2NA 2FPPA 2QN3A 3N2GA 3CEMA 4HH3C 3T7RA 1VGQA 5EGNA 1MUUA 5LP6B 4G5HA 5MN6A 3LKZA 1IM2A 3ITDA 4DV5B 1WJGA 2PR7A 1YRLA 3HA7A 1ECCA 2VZ8A 3DBHB 3I23A 4IUYA 2J48A 4F60A 4EL5A 5CFNA 5JC1A 2QTCA 3E9RA 1U9ZA 4OP2A 1C2YA 2BFOA 2VYNA 2IJGX 5E6SB 4BFWA 2LE0A 4MAAA 3FUXA 1UAYA 2QTRA 4G4SP 3C6KA 4E2XA 1F5SA 1VG1A 4FW8A 5FYDA 3T8YA 4AC9A 2GO1A 4BY9E 3ET4A 3V8BA 3AVXA 2CD7A 1H6AA 3EDOA 2D5LA 2IF0A 2FPPB 3N2GB 1B14A 4BO1A 1XCGB 1CE8B 3B7WA 3QBDA 5EWLB 3QOYA 3JPYA 4Y1EA 5KNLA 2I33A 5FR2A 4FU0A 4JUAA 2AIRA 4BMNA 3SX2A 1RAHA 4GPBA 3TSZA 3MGBA 4HF7A 3LUCA 3ZJUA 3QJ5A 3HVRA 2J0UA 2A5LA 4LKRA 2F3UA 1MORA 1OZFA 4KFTA 4YNBA 4F9FA 5C5CA 8GPBA 4QPDA 4F5ZA 1MX9A 2B0CA 1W85A 4Q66C 3I4FA 5DISB 1Q15A 1MPTA 2Q4EA 3KYBA 4AMZA 5ITVA 4E5PA 1PK7A 2JEZA 2VKQA 1NLUA 3U7QA 4BNXA 1ZW1A 3GRFA 3A3PA 3IQXA 3L8ZA 4HAXA 5KDDA 4JJKA 1BDMA 3DV0B 3E2PA 1OI7A 4JB2A 1EQ2A 3BORA 1QAQA 4U63A 4WZBB 3TOVA 4CKCA 4BEJA 1VRWA 3O9MA 1OGYA 4FT4A 4FFBA 2FWIA 4KAXA 5IK2D 2BR4A 1X7DA 4RYDA 1C0IA 1B00A 4CLEA 1SQ5A 3GZNB 5K0FA 2O8DB 2GJSA 4KXWA 3U09A 1ZU4A 3KR2A 2O8FB 1GAXA 2W48A 2IFTA 4KRFA 1M74A 1ZC4A 3MT7A 4OHCA 1F20A 5GGXA 2EHDA 4JQSA 5CHEA 5REQB 1B1AA 2PY6A 1E0SA 1NVGA 3GRYA 1RQ2A 4EHFA 3CUSA 5FUXA 3VO1A 2VP5A 4L9WA 1G59A 4FQ8A 1NRXA 2J3QA 3AVVA 3DGFC 2W93A 3HJAA 2RHRA 4HS9A 1Y3AA 4MCAA 4BCCA 4OSEA 2IU6A 5BMVA 1MG0A 4QDOA 2Y68A 5EJAA 1YR2A 1IHXA 4A8JC 3R76A 2RHWA 5JASA 1WG8A 3ZTWA 1NULA 4DV7B 2OV6A 5IAKA 2QDKA 2HB6A 1WLYA 2JIZA 5C46F 4CETA 1WPXA 1YGPA 5EHNA 3PZRA 4LFCB 2V7QD 3DVQX 4NZPA 1L1QA 1ARZA 4MUHA 1VDMA 3I04A 1T2EA 3AY0A 5BY2A 1KNXA 3CSDA 1CETA 4JVMA 2FE4A 3EPPA 4G01B 1U6KA 3NBXX 4LJ7A 2CSXA 4BLSA 2Q6IA 2OWDA 5EE1A 4IF4A 1GNTA 3LWBA 5ILQA 3WB2A 3ZGOA 1T5TA 4HNVA 1ACMA 1PYOA 1W6UA 2I2XB 4OHYA 1TVEA 2PX3A 3I37X 1JJ7A 1BHJA 1Q0RA 4NBNA 1ZU5A 3KX2A 4F5EA 3U16A 3KOZA 4JK3A 3AERA 1AUOA 4WW0A 1ECPA 5TR9A 2GKSA 2ZRBA 2VAVA 3QVKA 4I5IA 5HFAA 2P5YA 3HCOA 3DBLB 1Q6YA 3WRXC 2B5WA 3BEDA 4JI2B 1QK3A 3NP7A 3TQQA 3Q5GA 3CPEA 4D79A 1AKWA 3AB8A 1G7TA 1T3TA 3A4YA 5EXSA 3FCYA 4L28A 1CUVA 4MQBA 1P2SA 4NZYA 1Y81A 4CIXA 4F56A 2RI1A 3ZDEA 4U39A 5CEJA 1FLVA 5AI5A 1FMLA 3QKRA 4R2KA 4DLNA 5LQUA 2POQX 3FN4A 2IZ1A 1FDWA 3B2EA 1YS6A 4YQZA 1RM0A 1AMOA 5JH7A 3OZTA 4NXMB 2JATA 2CNLA 3O1LA 4GBMA 2IQ5A 4H9GA 5IXSA 4QTYA 1NT2A 1ZL0A 3R7FA 5DO9A 1Q1GA 1CUJA 5FBVB 1DO8A 3HLKA 4PXAA 3IESA 3KAJA 2OBNA 2CE7A 4ARIA 4UVGA 2I7TA 3MJEA 1LJ8A 4K9PA 4F86A 5G41A 3EMBA 2CN1A 1A8IA 4QRIA 3KQUA 5D7NA 1U8EA 1P5RA 3M2PA 3C1AA 5AM2A 7REQB 3PUXA 4LY3A 3D8SA 4NCIA 4IKEA 2FWBA 2V8BA 4GWGA 4WASA 3SQDA 1MV8A 1HDXA 1N6KA 5E2IA 5HQJA 1USUA 5CDSA 1DQYA 5IWCA 4IQFA 2YRXA 5L3VA 4W1PA 4DS3A 3G0BA 3II6X 1DX4A 4F3YA 1IRXA 4UPVA 4YP5A 3ZCSA 3PFBA 1RQPA 3UJDA 1PHPA 4FOOA 3EISA 1XD2B 5DM60 1JAXA 2RBKA 5FI3A 1K63A 4CIYA 2X76A 1WO8A 3OOJA 4HQOA 3RVLA 5KC9A 2FGJA 3A58B 1LU9A 4NENB 3QFRA 2P0YA 3HCBA 3JQRA 3F6BX 4C7MA 5J2TB 4PCLA 3MYRA 5HGXA 1EVLA 1XZGA 1YBHA 2ZWPA 1FDOA 1ZRMA 1B43A 4ND8B 3NDJA 4GLBA 4J7XA 5CLHA 2WWGA 4UHDA 3QV2A 2ZUCA 1QIMA 2ZTHA 1QIFA 4QBHA 3QEBZ 2GAJA 4W9RA 1A27A 5BQ5A 1AXRA 1AK9A 1E61A 1CS0B 4TN1A 4EVRA 1EFPB 4JJGA 2YNMA 1G3UA 1MEOA 3MWJA 4RPCA 1FXWA 2RG7A 2PL3A 1EVKA 1XVIA 1B3RA 3FR7A 1Q0QA 1WP4A 4DCOA 2NZ8A 4BL5A 1LXCA 3MILA 2HXYA 4X61A 2Z08A 4FKBA 5EKUA 1SU7A 3CNBA 4P83A 4RULA 5IJ9A 3IE0A 2YJZA 1E0JA 1NJFA 3ODGA 3QVUA 2ZAYA 2YYYA 3DEFA 4BC1A 4HUQA 1TFRA 3HXPA 3BOSA 3BJZA 3HDYA 4E4RA 5IM4A 2Y2UA 2PPVA 1OLUA 4BQRA 4BCDA 4FK8A 1ZM3A 1UANA 4RCYA 2IEAA 2IUYA 4GKAA 2E9SA 3ZWNA 1J2RA 3ILYA 1XL1A 4H17A 4TXHA 4XM2A 4F12A 3AR4A 1RC8A 3R9XA 1MX5A 5DIZA 4HWGA 2RJOA 1UF9A 4EW3A 3D7NA 3HDJA 3CVWA 4TT3A 2AFRA 2GCNA 3EMVA 5ALOA 2FOIA 3IPLA 2OHOA 5GP1A 3ASVA 4J94A 4MWOA 1W93A 1M66A 3EYAA 3DFKA 5CBKA 5KU1A 1HTWA 1ZZGA 3I32A 4G0QA 3RW9A 1SWVA 5B3AA 2D6FA 4JOCA 1Z8NA 4EKEA 3VH4A 1APBA 1AGYA 3ADBA 4AB1A 2DT5A 1TM2A 2Q9AA 1T5OA 4R9VA 1X1RA 4HVLA 2OGWA 4PZLA 5EJ8A 4QAQA 3A4VA 1R0SA 1F8XA 2KM1A 2DLNA 4HYEA 3TQHA 1GCIA 4L0QA 4KO3S 1PSDA 2AG8A 2W2PA 1NUUA 3ELDA 1QGZA 1ZRHA 2WI8A 2NUTA 2IBSA 4BLWA 2XWSA 2JIRA 4PPYA 5JCJD 3NTQA 5EHIA 4NU8X 4CDNA 1WHSA 4MARA 3VR5D 3S0JA 1KIFA 1Y4AE 3DTNA 5KYTA 1EDZA 3G2MA 1Z12A 4QU8A 3T3PB 3TL6A 1G63A 3WWDA 2I3DA 2VUHB 1D6NA 3HCAA 3GFFA 2JARA 2J85A 1G98A 2AG1A 5BPFA 4FBGA 5HOEA 4MQUA 2CJXA 5A9TA 4WECA 4TPKA 5FNVA 5I7OA 2R1VA 1RCUA 1XEXA 1PJ3A 4HG2A 4HZGA 1CC1S 4OL0A 4ZVOA 1LZLA 2PX8A 4ZRMA 5TMBA 4CTKA 5JECA 2WZQA 1VKJA 2JKZA 1KZYC 1RXCA 2NSYA 1EFVA 4ALLA 4C6TA 4EG6A 4A82A 2O8CA 1O6FA 1P0MA 3QA3E 2PL1A 2QLBA 2QG9A 3QLVC 4BO0A 4CMHA 1WW2A 1T9BA 1IXKA 2BJHA 2O5VA 2WHEA 3M81A 4L75A 3CC8A 2YASA 3UFBA 3ZEAA 3GR6A 4DIKA 4EKNB 2ZQ5A 3DOIA 3TG2A 3R5SA 4J0FA 4EEZA 2BM8A 4D0SA 1ZQ1A 3VPDA 4AY3A 2GAOA 3E3AA 5AJTA 3HL0A 1D4AA 1EFRA 4IIVA 3SC3A 1N2IA 4RFVA 4CQMB 1E2HA 3MJ4A 1BXKA 1N34B 1G20B 3QF4A 4FC7A 3JWGA 2M32A 3GGGA 4TYPA 3COJA 3O7MA 2F4NA 5F64A 1NVMB 1NVEA 4B35A 4JLJA 2IA5A 1MJGA 4L8YA 1K7XB 1NDHA 3D59A 5K0EA 3OWHA 4HLCA 2OV1A 2DWUA 1XQ9A 3GJ3A 4S24A 4DWOA 1E8DA 5F7ZA 1C9EA 1KRWA 4MW2A 2HWUA 5KJ1A 5LP6A 3DT8A 1TFUA 1U3FA 2OO3A 3MTDA 1KEUA 2VP0A 3G0OA 1KYVA 1NJ6A 1GPYA 1T2CA 4GWLA 1YA8A 3GG9A 5BR7A 2P9TA 4F91B 3F8TA 4MITA 3U7IA 4PLHA 2XZTA 1VJ1A 3I76A 2X8JA 3ZC3A 5AJXA 5ARCA 5FNVB 2Q5FA 1MC4A 1YK1A 2P69A 4TQAA 3ZE2B 3T34A 2BMVA 4B1FA 1L5MA 5A3QA 1H69A 1P29A 1VHDA 2O6HA 2V7XA 4V0LA 5AK0A 4EHKA 4BX8A 3P2KA 4U2DA 4Z4QA 3M9WA 5K09A 1ID8A 3Q1LA 2H8GA 3G13A 5C0OE 4B71A 4CM5A 1OFHA 4NH0A 3BTUA 2ZJBA 1YRWA 5NULA 4WN3A 4C7OB 5AOVA 1YI8A 3TIVA 1F5NA 2BMAA 3VGPA 5KVVA 2BFWA 2ZZNA 2WMNB 3G2JA 1JEAA 3U44A 1D0SA 3IUJA 2NUTB 3OURA 2HF9A 3KTDA 3V34A 4ARSA 1OHHD 1QFXA 4FHZA 5DHUA 1BD3A 1SUDA 2IPOA 4MJXA 1PV4A 3MF4A 1OWLA 4D6YA 4QXOA 3C87A 4ZDJA 1M76A 1PX2A 4MUKA 3VDXA 1U0BB 3IAFA 1SOMA 3AU8A 3C8DA 3F74A 3N8NA 4JUFA 4ROSA 4RZ3A 2IYOA 3F7NA 3UAOA 2IUFA 2Y1KA 3AR5A 2HI0A 5DOZA 1YS2X 4BO2A 4F96A 4ENQA 1X1AA 2BF4A 4YJFA 2ASVA 9ABPA 1E69A 3OM9A 1H8ED 3HB4X 5K8UA 3IJ5A 4HNGA 3PFNA 4QOJA 4M55A 1Y5RA 1DWUA 4MQEA 1U5AA 4OQYA 2WA1A 3E4CA 3ZIAD 4H6WA 4AQYB 2P1DA 3JALB 1T8YA 1N2HA 1XZPA 1GZVA 3PQDA 2X77A 3K9HA 2GCPA 3D7KA 4HDOB 1DL5A 4XTCS 5IC6A 2O7NA 8MHTA 3S2IA 4C4RA 4JNCA 4HRYA 1J2TA 2ETXA 4LSZA 4P84A 1FX0A 1NC1A 3EIEA 4R1SA 4EYOA 2I6SA 3QFHA 1RTTA 1Z2CA 5H0IA 1ND5A 3KCNA 1ZOPA 4IS2A 3E1SA 4X91A 2ZUTA 2HBQA 1QKIA 2JEYA 3CYFA 4NU0A 1Z4PX 2GBPA 3U3MA 1OYVA 3OAAA 1ZCFA 5T64A 1V11A 2WD7B 4FWBA 4HX9A 4OAPA 5TDHA 3VHXB 3UBTA 1BGVA 1QS0A 1U7ZA 3AV3A 1IRIA 3CM0A 1EKXA 5CNJA 3JRXA 1PR6A 3MOGA 1M7HA 1ABFA 4U7TB 4U9IS 3RKSA 3LVQE 1U0RA 3C1OA 3G5UA 4C0QC 1NVVQ 4ER3A 4LBYA 4ZICA 5KYUB 3I0MA 4MQ5A 3D54D 5A3RA 4K9QA 3CW9A 3BXGA 2CDRA 3DZBA 1W44A 2ZBFA 4HNRA 1Z8DA 3SSOA 4LGMA 2FMKA 4YDQA 3R0QA 4D8UA 2Z5LA 1PFKA 2ZSIA 5KX5B 4DR2B 3PG5A 1CRWG 4A27A 3QXJA 3QWHA 2ZRQA 5GJVC 3AKDA 5JH7B 2VBFA 2VJKA 3G5AA 3AHIA 4TN5A 1I1HA 2E6KA 3AWDA 3ILXA 3BK2A 3QBTA 4UDXX 3X44A 3JZAA 2ATXA 1YR7A 2NVWA 1XXHE 3CRVA 2WFLA 2XUDA 5ECGC 4O02B 3VR2A 1RLTA 1VB3A 1XF1A 3PYLA 1UBEA 2G76A 3RQSA 3SHWA 4BEVA 2HFJA 1ZKDA 2WUVA 4L9AA 3UMVA 4URVR 5IX8A 2R47A 1XD9A 1DLIA 2A5GA 2FHPA 1J8QA 1E4EA 2GJ9A 3AEKA 2FG6C 4M6WB 2ZJZA 1ILEA 2HLDA 2B6HA 3A05A 1X0XA 3ZQKA 3OQVA 3OM0A 1JIJA 1JLSA 2R6ZA 1RJFA 1ISPA 2EGGA 2PX4A 2X5JO 4ND7A 1NE2A 1NQXA 4ARVA 1XIVA 1HL3A 2ZE5A 2Y9MB 4ZAWA 4F04A 4BVHA 3UAYA 3ZR4B 1E2FA 1Q84A 3DL0A 3MERA 4LQCA 4Q16A 5BW5A 1G20E 1BD4A 4AZ3A 4QGAA 2I76A 3R0JA 4RK6A 3R3XA 3ZHTA 5JQGF 3PNSA 4WXEA 4I36A 3DXFA 1I01A 1CUGA 1S3IA 4DB4A 3N28A 3B1ZA 1BCSA 3B38A 3FTPA 4AKSA 2JLVA 3DO5A 5JCJA 2XLCA 4X1IA 2OCKA 3RS4A 4ARBA 3AVUA 3T4XA 3QYPA 2PG3A 1TGYA 2WM8A 4YAFA 2ZRFA 2C5BA 1GRVA 1JPJA 2C8LA 4P3OA 1SBQA 3ADOA 2PV0A 3DTVD 4K2AA 1JHDA 4FFPA 4XIFA 5TQJA 5TS3A 2OK7A 1ZIXA 3H16A 2X15A 1JZTA 1EG7A 3W5VA 1G2PA 2YXLA 2QR3A 1XZHA 4Z1OA 1QQBA 5JJKA 1I3KA 2JFFA 1JVNA 5IDVA 1LV7A 3ND8A 3GEHA 1PF7E 3BIJA 1BZYA 2QTVA 2PGIA 3RI3A 3I5UA 2DHRA 3NHRA 3L1VA 3OF5A 4JJ8A 2Q4TA 3AKEA 3V1KA 1JR4A 4BVGA 4KWHA 2FFBA 4O4HA 5FPPA 3K31A 5FUMA 2PMWB 1LFAA 6CHYA 1QTRA 3D2BA 4NPCA 1LRKA 1RE0A 2LP4Y 1YVUA 1MENA 4D82A 4HVCA 3JAMA 4RDIA 1G5QA 2F64A 3QZUA 4CZ2A 3JARB 4IQ4A 4MVJF 4Z49A 2NU9A 1TKCA 1DBQA 2UUPA 3K9QO 4LDRA 3QV1A 4ALJA 1ABEA 3EULA 4GD3Q 3VJMA 3CIOA 3AXTA 4E22A 2FN8A 4TS9A 3WLAA 3T35A 3R20A 1NF2A 1EDBA 1OBFO 1XE3A 1SXJE 2DT8A 3QVXA 3WLJA 1E20A 1JJIA 1Q0LA 4A15A 4H08A 3FZNA 2J5RA 1NYTA 1EDOA 3TUJC 2B7CA 3X1MA 1QRDA 4IKOA 4Z0TA 4BQNA 3IQGX 4GPEA 4HFNA 3AKYA 1T9GR 1N1DA 1V5GA 2AGVA 1XTBA 2XRFA 3EBOA 2R85A 3AINA 3G2HA 1CU1A 3LRXA 4QBIA 5EEGA 2G9RA 3R7WA 1MCZA 2ZYIA 3N3AC 3K0SA 4WKCA 1TAQA 1TC2A 1NJ8A 3WS7A 4DC9A 3MTBA 3PUVA 2WPNA 4ER6A 4A92A 2Q4DA 4FOPA 3VNVA 1AS0A 4DV3B 2C57A 4P58A 1J2EA 1N7IA 1HORA 4HD8A 5KPJA 4LKOA 2WMYA 3IKJA 1R4ZA 3KAQA 4FFMA 3MNFA 4P22A 5CTAA 3HL4A 1TYEB 3FSRA 3HEAA 1L5HB 1JR3E 2JI9A 1YR3A 3RTDA 1YFLA 3TQSA 3VJLA 3F9CA 4B0PA 1E4YA 2C4HA 4Y30A 4CFZA 2PLWA 4M1ZA 2JLBA 4L08A 3RRXA 1ZHHA 2HHJA 3OLVA 1KSJA 1T8RA 1S1CA 2FF7A 3OE1A 4H59A 2ZVQX 2ZBRA 4DUZB 1W0JA 1GPUA 1EK6A 3I5XA 1XRRA 4FIZA 3FKJA 4IHQA 1CRQA 1GVHA 1JH8A 2AR7A 3I9KA 3LRTA 3N2IA 1JQDA 4HWOA 3DTVA 4G2NA 4ALIA 5AJUA 1U3UA 1S2GA 1KVTA 1OHHA 2IGBA 3LE8A 3UUWA 1DAKA 3A8TA 4E2YA 2YX1A 4TZ6A 2EQ5A 2MYNA 3OT1A 3SS7X 2WTNA 2PE5A 2G82A 5H82A 4ENTA 2WMOB 5BQPA 3ZWKA 2J4CA 1E9RA 1LS6A 1AKRA 5ILGA 1RXVA 2PXAA 1TADA 3CCCA 1S7GA 3BC1A 3HGQA 2I67A 4RQTA 3Q7QA 1F8FA 1S02A 2GS9A 2ZJOA 2HJSA 2WJ3A 3CZRA 1L5OA 4EZIA 5BSFA 2B99A 1K7YA 1VHJA 5DRTA 3VNQA 4B7ZA 4BLQA 2HRCA 3UG6A 4BDSA 3QE0A 2GF0A 3X1XA 5A7GA 2C2BA 1VG9B 1A69A 1RXEA 3PDCA 3WIUA 1I51A 4LC1A 1PQUA 3C14C 3Q3HA 5K9ZA 1BS1A 1J2JA 1H4TA 1WCYA 4LE1A 1RPZA 3R6LA 1WKVA 3EZYA 1YZYA 4ZQHA 1SUWA 1DOZA 2QNBA 3IIEA 4IWYA 5J63A 2Q7XA 2XUAA 5FBRB 3JQGB 2ZJ8A 4JC0A 1NVXQ 1MB3A 4QC2A 4KSCA 2NIPA 4F2PA 2JA2A 4XJTA 3LPCA 2KX7A 1FUUA 2WIKA 1LBSA 5K0ZA 3EOBI 2IL1A 3SR0A 2ZUDA 4NYJR 5CFRA 3EGVA 3RJMA 1KMHA 2FPGB 3OA0A 1XRLA 4UCQA 1TRKA 4UARA 1T2NA 3TSAA 3ZI7A 3I04M 1PG5A 2ZUVA 2VYVD 3FDZA 2GTPA 2ORYA 3W5IA 2XCRB 1VM6A 2VQSA 1Z2OX 1QH0A 4Y9UA 5EHQA 3EF3A 4LF7B 4JT2A 3RVKA 4AN0A 4BNWA 5LU8A 2PANA 3L6UA 1A76A 4AG5A 3HHPA 1C7ZA 3BHMA 3C3KA 3F1LA 1VL5A 1PL8A 3H5RA 3FLAA 4KZPA 1T2VA 4LBWA 1Y3DE 4MXDA 4PPFA 5DFAA 3EQ7A 4EI9A 2CB0A 4A8JB 4B9AA 2C5GA 5BN3B 2RAFA 2RHJA 5I9MA 3RNOA 3WLEA 4ZVMA 4JUIA 3U61B 1XWFA 4D4MA 1JKIA 3PHBE 4RK1A 1RHRA 4GM0A 3L6EA 4M21A 2GJ4A 2ZRMA 2JLWA 3BRWD 1H6CA 1ISFA 3LG2A 3RYHB 2XMQA 3ZV5A 1ZGZA 3UHFA 4FWTA 1H3EA 3MS4A 2FEXA 3OI7A 3D02A 3JQDA 4W1QA 2BR5A 1EEXB 1YO6A 4DMGA 3P2JA 5KVCA 1HEUA 3FNBA 2O2DA 3DLCA 4RQBA 3MHPA 1ZGJA 1PT5A 1EWTA 3ENZA 3WDKA 4G0UA 1GPAA 2OXFA 3M9XA 1GAWA 1O0BA 3LUHA 4HGZA 3N0XA 3MHTA 2O0KA 1ODCA 1TYBE 3L7DA 2WOOA 4MVJI 2R2AA 1XVTA 2OXTA 2WUGA 3RJZA 1P80A 1T3LA 1V47A 2P9C