4UULA

Apo trichomonas vaginalis lactate dehydrogenase l91r
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
334
structure length
334
Chain Sequence
SEAAHVLITGAAGQIGYILSHWIASGELYGDRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGFVATTDPKAAFKDIDCAFLVASMPRKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTNCEIAMLHAKNLKPENFSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEGKTQKVVDVLDHDYVFDTFFKKIGHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVPEGNPYGIKPGVVFSFPCNVDKEGKIHVVEGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE
publication title Gradual Neofunctionalization in the Convergent Evolution of Trichomonad Lactate and Malate Dehydrogenases.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Oxidoreductase
total genus 114
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uulA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4uulA02
1C14A 3CMCO 3NKLA 4L4SA 5DOZA 4FJ0A 3E18A 5HTOA 4I5GA 2FR1A 4YT5A 1QLJA 3KUXA 2JCYA 1Y8RA 2NVWA 3RUHA 2VZ9A 1NAIA 4EYEA 4J49A 5TX7A 4XX0A 1Y1PA 2VZ8A 4EITA 1E3EA 1PGNA 4BUCA 3R6DA 3NDRA 3QWIA 3LLVA 1E1NA 2IYOA 2NADA 2J5QA 2HJSA 1E5LA 3OIDA 1U2DA 4J7UA 2PV7A 5TT1A 2P4HX 2SCUA 1GQQA 4ILKA 1DAOA 1Y5MA 4A27A 1E7RA 3PQDA 5CDYA 1XWFA 4FN4A 1P33A 3R3SA 3KYCA 3KEOA 2UVDA 3KYDB 3PGJA 1C0PA 2DM6A 3JQBC 1P3DA 2FSVA 2G5CA 3EY4A 4FFLA 2PNFA 3AOGA 1N1GA 4G5HA 3UF0A 1N9GB 2BMAA 1SB9A 3ZWMA 3L9XA 1U4SA 4CQMA 2C82A 2GYYA 2ZQYA 4P4GA 4WNIA 3C3XA 4YEDA 3JSAA 1X14A 5FYDA 3PQEA 2HLPA 1GCUA 4H16A 1EVYA 4LSMA 2BGKA 5KIAA 4H3VA 1Z45A 4DBZA 3EGOA 4PVDA 2PY6A 4W6ZA 2UUOA 3AI3A 4DIOA 2Q49A 3GMSA 4M86A 4K6CA 3BTUA 4DYVA 4I5DA 2GR9A 2VUSA 1EUCA 1LU9A 4FGWA 2GZ3A 3JQ8B 3GHHA 1PJQA 4R5HA 5CDGA 2O4UX 5T5QA 1E7MA 3KBOA 3KZVA 3MZ0A 4MVJH 4D7AA 4D3DA 3LVFO 1HRDA 2AG5A 2EKQA 1GPJA 4OMUA 1GQYA 2IZ0A 5H82A 3HDJA 1SEVA 4TRRA 1TT5B 3QSGA 1XHLA 2FSSA 3TJRA 3ETEA 4FIZA 3WR5A 4ITUA 1O8CA 2VWGA 3G1TA 2Z5LA 3KOUA 4I9UA 4NI5A 5JO9A 4DVJA 3PWKA 2NM0A 3GDOA 1ZNQO 4YJFB 5DCYA 1MLDA 4ZQEA 1F8GA 4IPTA 4EUHA 1I33A 3WIEA 3E9NA 1P44A 2Y67A 1WMBA 4XYBA 1ZJYA 2FPIA 3QY9A 1ADCA 3H7AA 4ZD6A 2WYWA 2J5KA 4CMHA 2E82A 5CAEA 5I7VA 4XYEA 1GYRA 2RHRA 1P0FA 4WLFA 2CFCA 1WLYA 1MGOA 5DCUA 2NVUB 2ZB7A 4JCOA 2C5AA 1ISIA 4Q3DA 4MVJF 1XR3A 3OFSA 3PXXA 4CMIB 2CDCA 1Q7GA 4LK3A 2EEZA 3JD1A 4CM8B 3RBZA 5I9LA 2QG4A 2R00A 2H9IA 4UEKA 3Q2IA 3WLFA 1ONPA 1KBZA 2WD8A 3ABIA 3KLMX 3U49A 4GKBA 1PJCA 2FMUA 4YA6A 4W82A 5EPOA 2Y1FA 3K9QO 5KNLA 1LRKA 2IXAA 1VSUA 1Z6ZA 4IINA 2VT3A 3AUTA 3B1JA 1A71A 1M2WA 1HDOA 4Y6RA 3HN7A 3NEPX 4WEOA 2DTDA 1PZFA 3OA2A 2WTBA 5C7OO 5A06A 1PX0A 1LRLA 4YXFA 4EGFA 3WIDA 3FWNA 4DMLA 5CG1A 2IZZA 4YJHB 2AEJA 1DC5A 3IIEA 3VKVA 1BXZA 1SOVA 4WPGA 2Q45A 2ZJ1A 1I8TA 2D5CA 3SJ7A 3GT0A 5KWEA 2O23A 4CL8A 2BI7A 4MVJM 4PZEA 2B0JA 5TQVA 3IAHA 1O5IA 1YKFA 5JAIA 4UEJA 3WICA 4TZTA 1PQPA 4BGVA 2JFGA 2O3TA 4J2HA 3WTCA 3PP8A 3IUPA 3WSVA 3EVNA 2VHXA 1HZZA 2Z95A 4RVUA 1UJMA 1CEQA 2DT5A 2VCYA 3FWZA 3INGA 4E2YA 1X0VA 4DL9A 4YYZA 4D44A 4E5PA 4A5OA 4PG7A 4L4RA 4LCEA 4IDEA 1BXGA 1DLJA 2H6EA 4GSKA 4JX8A 1L7EA 1Y9AA 5I9MA 5DT9A 1NWCA 3RC9A 4MJLA 3RC7A 2OL4A 1MC4A 3L4BA 3OH8A 4BGUA 4NBWA 1UZLA 4F6LA 5F5NA 2ZTLA 4IDDA 3K8ZA 1ZSYA 3D3WA 4GSLA 2Y1GA 3U0BA 1WZEA 4AJ1A 3FN4A 3ZH2A 1UZMA 4MDHA 5L7WA 1U3TA 1UXJA 1E3WA 1GUYA 1PJTA 4HADA 3GGGA 3AI2A 4MKXA 3U5TA 4KWIA 3I3OA 2QHXA 1G1AA 3ZV4A 2EXXA 2HK9A 4IQ8A 4MVJE 4ALLA 5C5IA 2YYYA 2I3GA 2V6MA 4LVCA 4ALNA 1MG5A 5JYEA 5DOVA 1E3SA 1AXGA 3OIFA 1LXCA 4XB1A 3F47A 2PGLA 5A9SA 1JA9A 1DLIA 4HV4A 2W2LA 5ER9A 5LDGA 1LC3A 4IJWA 4OIMA 4L76A 2FWMX 1EQUA 3GF4A 1LRJA 4F46A 3W4KA 3BMNA 2YW9A 3I9JA 2GZ1A 4JBGA 1EMDA 1X7DA 4XRRA 3HB5X 3E9QA 1DIBA 3WMXA 2AEFA 2FZEA 3ROKA 1CF2O 1I3LA 2J3IA 2HDHA 4DPKA 5DZSA 3INRA 4L9RA 1I24A 1KY4A 4TVOA 3WMWA 3AFMA 3GVIA 3JQGB 4GMGA 5KVCA 5L7TA 3TZ6A 4QO7A 4BNXA 1NX6A 2B37A 2UV8A 1E1LA 3V1UA 1QYDA 3U4CA 2O50A 1F12A 1M66A 4PG5A 3JQ6A 1C1DB 1GZ6A 3NT2A 1DHTA 4GPD1 3IKTA 1VL0A 2OFPA 4EI2A 2Q3EA 1I36A 2ZB8A 3JQCA 4E33A 1JTVA 5DF1A 3DO5A 4OXKA 2AG8A 1EVJA 4HXYA 4UVIA 4FR5A 4NU5A 4NJOA 4XEHA 4RF4A 3C24A 4FW8A 2D1YA 4KDEA 2EV9A 1H6AA 2C20A 5IN5A 5KTKA 4BNIA 2A4KA 4LMRA 1NASA 4B8ZA 2LDXA 4OGWA 4G81A 4MINA 5FI3A 1K6XA 1QR6A 3LF2A 1JKFA 2CF5A 2TMDA 4IS2A 4BNTA 3V8BA 1X0XA 3ENNA 3SLGA 3E48A 3VZQA 3JCZA 4G65A 3PFFA 3RBVA 3VVCA 3W6UA 4Y98A 4W99A 1FDWA 4RO0A 4XZ3A 3PHJA 4DMMA 4N5MA 4DQUA 2POQX 4LVUA 3RKUA 1ZKMA 3SEFA 1D4FA 2PKQO 3MJEA 3X2EA 2YHUA 3ZWVA 4YAEA 3JYLA 3QE3A 4UVHA 2W90A 4U6SA 1OMOA 3GNSA 1QYWA 3MJCA 4J4TA 1R4NB 4CL3A 1XDWA 5ILGA 4A2CA 3K73O 4TZKA 5IG2A 3GNTA 5KVSA 5JYDA 1V6AA 4RJTA 4IJVA 3O38A 1NTOA 3O9ZA 4IDGA 3AFNA 1YB4A 3T7CA 1ZK0A 2JAHA 5EQDA 3RUDA 1GCOA 4BVAA 4OXNA 5IZCA 4HNHA 1LC0A 1GEEA 1ZBQA 2GN9A 5COAA 3VPHA 2WWRA 3ZV3A 3GAFA 4MVJP 2NNLD 2OO5A 1B8VA 1IULA 1V9LA 2UAGA 2VHVA 4NHEA 1BSVA 1ULUA 3UOGA 1IHYA 1DRWA 1HE2A 1QSGA 1KEVA 2R6JA 3WJ7A 3F46A 3RSHA 3GRPA 1HDCA 4O5OA 2WSBA 4DUPA 5DP1A 2WE8A 3H9QA 1ADBA 5B37A 4BMNA 4DQVA 4J16A 4TRNA 1PJLA 2GERA 4CQLB 1VPDA 1EZ4A 3CUKA 1DRUA 4M1QA 3IJRA 1B14A 2P5YA 1E5QA 2VN8A 3JQGA 3NV9A 2CF6A 4WUVA 3U4DA 3MTJA 3TOXA 4UREA 1DC3A 4D46A 5T57A 1VM6A 5IZ4A 3DBVO 5BNIA 2O4CA 4Q3AA 4CJXA 2IDZA 3BMCB 1X7HA 4CR7A 2V6BA 4MVJD 4E5MA 1ZO8A 3PVZA 2X7HA 4YAIA 9LDTA 1W0CA 1B7GO 2EG9A 3CTMA 4W7IA 5JS6A 3RJ9A 3DQPA 1FDTA 3AY7A 1I0ZA 1DBVO 4IM7A 1G6KA 2AE1A 5KJ6A 3OECA 5A5FA 3OF2A 2J5RA 4A10A 1HDXA 4NQZA 1R66A 1R15A 3ZW9A 1SEPA 1VKNA 4HUJA 5KVQA 3AOEA 4N7RA 2CVQA 1M67A 1Y9EA 2I66A 3PRJA 1PJSA 4EDFA 2YJZA 4R69A 3PHHA 2VUTA 5TRTA 3TZQA 4PCVA 2HJRA 3LSYA 3UH1A 2EF1A 3U9LA 2XXBA 1L1FA 3PLNA 1GU7A 1MC5A 3K5PA 1JKIA 1E0DA 3R0IA 4Z9YA 3ZV5A 4AJ2A 4BNUA 5CDSA 3RUCA 5A03A 4TROA 1R4MA 5TS3A 4YQYA 2OBNA 1DRVA 4WOJA 4R3NA 1NYTA 1P0CA 3AUAA 1UXHA 2IODA 1ZH8A 3AY3A 5GZ6A 2YFQA 4EW6A 1PL6A 1NQTA 4UEOA 3GZNA 2C54A 1E3JA 2Q4BA 4FJ1A 4R68A 3ZN2A 2B83A 3H3FA 3JQ7B 3S1LA 3CH6A 2NTJA 2HMWA 4AJ4A 4NH4A 2EW2A 2YV1A 4BO0A 3UGKA 1M6HA 3S8MA 1GR0A 3LK7A 3ZV6A 3HHPA 3NJ8A 4P4NA 4NG5A 1O0SA 2CNBA 4IJKA 1YOVA 2VRBA 1IPFA 1U7TA 1PJ3A 3JD4A 3ZU2A 1RYDA 2I9PA 1N2SA 3G3EA 3ZW8A 3MOIA 3OJEA 3WNQA 2Q2VA 3OETA 4NIMA 1YQDA 3WB9A 3EDMA 3CZMA 1MV8A 2PH5A 3ASVA 3F6YA 4PLWA 3ZHXA 1CERA 2YQ5A 2J3KA 2WMDA 4MP6A 4TKMA 5AXAA 1NNUA 2R00C 1SZJG 4NBVA 3JQAB 5F1KA 4MIOA 3DR3A 2D2IA 4MVJG 2GN4A 4F3YA 2X1HA 1HZJA 5IN4A 1Z73A 3AJRA 3RUIA 1AXEA 1JDJA 5AVOA 3LC1O 1JW9B 2X0JA 1F0YA 3QWBA 2HAEA 1PGPA 4K26A 4CLDA 1R12A 3LU1A 2WM3A 1Y8RB 3GK3A 4GLOA 1WPQA 2QQ5A 3WJAA 6LDHA 3OM9A 4DC0A 2DFDA 3K6JA 2YFHA 3JYNA 4K28A 1BW9B 3IP3A 3K2BA 2D8AA 4C7JA 2PR2A 4BO5A 3OSUA 3HFGA 3Q11A 4RF3A 4QFCA 5L45A 3C1TA 4U8GA 2X4GA 2GUGA 2HMSA 4ALIA 4E12A 3OBBA 1PTJA 4B4OA 2YQ4A 1G0OA 1JWBB 4RVSA 4R51A 2O3RA 2TMGA 3KYCB 4LRSB 3KTDA 1A5ZA 4J43A 5JDIA 3V2UA 1U1IA 2VYVD 4FFOA 3ITKA 4BNNA 1WVGA 3BAZA 2D59A 1VKOA 3ITDA 4Y9DA 5G0VA 5I7SA 3PHIA 3GDFA 3ZWCA 3QWAA 4PFJA 4YJGA 4CQMB 1KEWA 1XGKA 2YV2A 4YB8A 5I7EA 3GMDA 3OMLA 2HSDA 2FRDA 2IRWA 2X86A 2RBEA 4W7HA 1U2GA 1ENPA 2XF8A 4CM4A 1U9JA 4NMHA 1LSOA 1DO8A 3L4BC 4I9HA 4AJPA 3B20A 4FFPA 4RQTA 3IOYA 3VVBA 3WLEA 2GASA 2G76A 3DAGA 4N5NA 1YE3A 3V1YA 5EL0A 4KQXA 3GGOA 5LC1A 3HQ4O 4XDZA 4ALKA 1BRMA 1PGOA 1YB5A 4XR9A 1HT0A 5KJ1A 2QYSA 3I52A 2Q1UA 9LDBA 2QZ9A 1I32A 1I2CA 4YAKA 3VH1A 4INAA 1NQ5A 1FXSA 3WDSA 4M55A 1JN0A 3P2YA 4BQRA 4ZICA 1KVUA 1QYVA 2G17A 1HETA 1PQUA 2HRBA 2PGDA 3KSZO 4WJZA 2DU8A 1QRRA 5CDUA 1XYGA 2FN7A 3DFUA 3CXRA 4Y8VA 5HBRA 3UHAA 2WD7A 3V2GA 3DBLA 3A1NA 3NDIA 4RPJA 2B5VA 4ESOA 3SJUA 5K6AA 1OFGA 4WCFA 4YRAA 5EMHA 2Y05A 4FC6A 3Q9UA 3STHA 4RLSA 4DQXA 1C3VA 3SBOA 1PL7A 3GZ4A 3SVTA 3IKVA 4TKLA 2P9GA 1ZJZA 3D5QA 1DAPA 3IMFA 4EEXA 2C0CA 4QQRA 1DEHA 5L4NA 4JJIA 1D7OA 1LDBA 4NZ9A 2ZYAA 2VRCD 2VYNA 3HE3A 3IP1A 4NJMA 4RQUA 1BMDA 3AM3A 1EDOA 1YL7A 4JN6B 2IEDA 4B3JA 1YGYA 3PHLA 2AHRA 4MIYA 5KJCA 3V1TC 2AXQA 5JC1A 3GGPA 1KOLA 3KVOA 4Z3KA 1BW9A 1QG6A 4RVHA 3DHEA 3RCBA 3H8VA 3TWOA 3MWDB 4U0JA 3WFIA 1XQ1A 3V2HA 5TLSA 1YWGO 2Q50A 2GSDA 5CEFA 1B0AA 1EQ2A 1RM5A 2RCYA 4B4WA 4JNKA 2I99A 2A35A 4F45A 4IGEA 5CDTA 2P68A 5ES3A 2QW8A 3FCOA 1VJ1A 3FTNA 1GD1O 5IXYA 2A9FA 4HFRA 3ZGYA 4CLXA 4O1MA 5JO0A 5U9CA 3OQBA 1B8UA 1LSJA 4MVJI 4CPDA 3FD8A 5JW6A 1YB1A 3BHJA 3AUSA 1LDYA 1PU2A 4XJTA 5EINA 4E32A 5KVVA 3KB6A 3BIOA 3TF5A 4IS3A 4RF2A 4CMAA 3E6AA 3F5QA 3VTZA 2NV6A 3P7MA 2E4AA 4AJOA 3JQAD 1E77A 1U8XX 4FQ8A 4R1UA 1XG5A 3KEQA 4YDRA 3U3XA 6ADHA 4R3WA 1MX3A 1ZXLA 2O3JA 5EIOA 3AWDA 3ZNOA 1D1SA 2D5AA 3S2FA 1B2LA 3RROA 1BXGB 1F17A 3VAZA 5B4VA 3D64A 1HE3A 1DDOA 1EK6A 4BQPA 5JMWA 4J2OA 4CM6A 3DBRA 2X23A 1P31A 4ND2A 3ANNA 4I08A 4ZQBA 5IZCC 1O6ZA 5C3MA 2EGGA 3D3WB 4J1QA 3ZWOA 3H9UA 5A9RA 4FBGA 3ZI0A 2Y1EA 3WQQA 3BZUA 2OHXA 2FR0A 1J49A 1QLHA 2PFGA 4W9NA 1E3WB 3ZHZA 2IE0A 4FPXA 4QXMA 4CUZA 4HX5A 3JQDA 3WGIA 1ISJA 5JXWA 2DUUA 3NTRA 3OJ0A 1T2DA 2C2XA 7MDHA 5AXCA 5JFOA 4BO3A 1MXFA 3OJLA 4HFNA 4NR0A 4BB6A 4IQ0A 1VC2A 3O26A 3HDYA 3P5SA 1E92A 3VPGA 1I3MA 1C0IA 3DL2A 3WYEA 5A9SB 3D5TA 1ENOA 4O59O 1E1KA 5JLAA 1HEUA 4GX0A 1E3IA 3GNQA 4D0SA 4O0LA 2X22A 3EMKA 2UYYA 3W1VA 3WGTA 1IHXA 2BELA 3BMNB 3WNVA 2OOSA 3I6QA 4YT4A 3F1KA 2J6IA 1MB4A 3IUSA 3ROMA 5ITWA 4ONEA 2X9NA 5JMPA 3X2FA 5AXBA 4JXKA 5JAMA 3GVPA 3HSKA 2Z1MA 4GX1A 4KDFA 1KERA 3BMQA 4D3SA 1NAHA 5EQFA 1BVUA 4BO2A 5JY1A 4G2NA 1B16A 5AYVA 4NPCA 4BKOA 1PZEA 2EW8A 1EBUA 1NPDA 1ZXBA 3L9WA 1HDZA 3G1UA 4ROSA 4GGOA 3PYLA 3TDKA 1NFQA 3MJ4A 3L77A 5G4KB 1PSDA 2EIHA 4FFMA 1NM5A 2V7PA 1ZEMA 3AOEC 3AM5A 3WQRA 2Z1NA 3WGQA 3FNGA 1ZSVA 4CUKA 1PIWA 2RH4A 3WS7A 3RKRA 1J0XO 1DB3A 1UH5A 3L6OO 2NLOA 3ADOA 4TWRA 3TZKA 4ZQHA 2E48A 3P2OA 3W8EA 1DFGA 1NQAO 3RU7A 1PS0A 3DBHA 4XKJA 3LT0A 5JCJA 5JBIA 1XU7A 3O4RA 2DLDA 4Y6SA 1ZK3A 1S6YA 3FTPA 2P91A 2AQ8A 2JFFA 5DULA 3DHNA 5GMOA 1RWBA 3TQHA 5MGBA 5BSGA 4XIYA 4JK3A 1QXSA 2HRZA 5JNLA 3M1AA 7ADHA 3RQSA 4BNLA 1DPGA 4C4OA 1Q1NA 4CMBA 1VE9A 3H5NA 2PH3A 3ONFA 4Q3CA 4IXWA 2VTDA 2PD3A 2QRKA 3ORFA 2BRUA 1LJ8A 5BR7A 1RM0A 2I5PO 1I10A 3FR7A 1PR9A 3GOHA 1YS4A 2AQKA 3CE6A 3GVXA 3ONEA 4Y6PA 2JD1A 5EJ2A 3ANLA 1GZ4A 4BKQA 2WJPA 3E5MA 1T25A 2FPGA 1E6WA 1UXKA 3DC2A 4XRGA 1UDAA 3MTGA 4PN3A 2ZQZA 3WGYA 4FOSA 1EVIA 5LCXA 1EUZA 3GVHA 2JFHA 4QT0A 3IS3A 4IDBA 2B4TO 4J9VA 4OL9A 4BO6A 4CM9A 3SLKA 2YHIA 3I6IA 3QVSA 1DXYA 3COSA 3WQSB 3F9IA 4EUFA 1A4UA 3GEGA 1RM4A 4M49A 4OM8A 5CPFA 2BF7A 4XYMA 2OORA 3NT5A 4P38A 2DQ4A 2EKLA 1RPNA 1OI7A 3FSRA 1R6DA 5IDWA 3I9OA 1WDKA 4K9DA 3MEQA 1ENZA 3H65A 1P1RA 4PZCA 5DBIA 1KVTA 4PG4A 5JC8A 2CUKA 2EKPA 2LDBA 3EAGA 4UVGA 5GY7A 3TZHA 2AMFA 2D4AA 3LF1A 2W8ZA 3PQFA 1IZ9A 3IDSA 1TI7A 5ENDA 2XXJA 1FK8A 5JCXA 2PLAA 1V3TA 1ZUD1 2EHDA 3VHRA 5JDIC 1D3AA 1PEDA 4XGIA 2Q1SA 2VWPA 5G0SA 1PQWA 5G4KA 1VLLA 2BHLA 1Q2XA 3WWZA 1U3VA 1P1IA 2OBYA 4Z9XA 2VWHA 5FEUA 2W98A 3JD2A 1ENYA 3TFOA 1ZW1A 2H63A 2OUIA 1R0LA 2BH9A 4GL4A 4PG6A 1ZMTA 5THKA 2NU6A 1TVEA 3F5SA 4KZPA 4WECA 2JAPA 5COQA 4CMCA 2ZK7A 1YBVA 1E7YA 2H1SA 5H83A 4J6FA 4KOAA 3BHIA 4UVEA 3HDQA 4GI2A 2E37A 3GRKA 4I5FA 3TL2A 5BQFA 1IOLA 2CMDA 3ZU5A 3ZHYA 1JLLA 1GPDG 2ZYGA 3SXPA 1OC4A 4B4VA 4BMVA 2A94A 5K9ZA 2DBQA 5DBGA 4LGVA 3O8QA 2W2LD 3VDRA 4DTIA 4FJ2A 2GN8A 2Q1TA 2YY7A 1H6BA 1R4MB 3RFVA 1YDWA 1LSSA 1T2FA 3OQ1A 1HLDA 4D42A 4XR4A 1NWHA 3F4LA 3GZNB 1A27A 3QP9A 1EE9A 4L0QA 1CDOA 3Q9NA 5K6AC 1QV6A 2VNAA 2J8ZA 2JD0A 3HJAA 4WCFC 3I83A 1QV7A 2NSDA 4N18A 3GG2A 1PR3A 4EJ6A 2DTEA 1E1MA 1HDRA 3EW7A 4YVFA 4WEQA 2OXIA 1JAXA 1YOVB 1O89A 2ZB3A 3UN1A 3OEYA 3VKUA 4BNYA 1T26A 4L8VA 3CPSA 2Y0DA 1MFPA 4QTZA 4J0EA 5IAAA 2O48X 1PGJA 1NPTO 4YCAA 1X1TA 2I3AA 4WE3A 3D4NA 5JE8A 3RWBA 2FZWA 3R1IA 4BHTA 1P1HA 2JCXA 3ROQA 2PKQP 5L4SA 4XDYA 1IB6A 4UUMA 3OQ6A 1LBEA 3RUAA 3HWRA 2C59A 2ZCUA 4XQ9A 3GH3A 1OAAA 3DOOA 4BO1A 3PTZA 3NRCA 3PJEA 5T64A 3JQFA 2RIRA 1HDGO 1N92A 4CLOA 3LC7O 1Q7CA 4Q3EA 1O95A 5KJFA 1PJ4A 3GEMA 4BL5A 2WE7A 1R37A 2BFAA 1JKJA 2AW5A 4H7PA 3F1LA 1CRWG 1HYGA 1K0UA 1Q0LA 4WGGA 3TL3A 4TQGA 1N5DA 1Y8QA 4RDHA 1BGVA 2IYPA 5A5EA 1DFIA 3ZNPA 4EBFA 1WW8A 4XGKA 3HDHA 4PLFA 2B36A 1SMKA 2HU2A 4II3A 1DJNA 4JP3A 4RL6A 5GZ1A 4IJUA 3QVTA 4OKNA 4PLTA 4ZHSA 5L40A 3Q6IA 2EGHA 2V6FA 1GV1A 3VZPA 1HL3A 4BGEA 2X9GA 2YDXA 2QRJA 1E7SA 4OO3A 1HTBA 4PZDA 1BTOA 2A92A 4WLNA 4YJGB 4B7CA 4KWHA 4CLRA 2VZ0A 1LSUA 4L74A 4Z0PA 2JD2A 1UDCA 4OH1A 1K89A 5ICSA 1ISHA 4I9NA 3PFWO 3TPCA 5BNTA 4CM4B 1UP7A 1H2HA 4OKIA 2Q2WA 2NTNA 1ML3A 3D0OA 3GG9A 4GAEA 4IGFA 4PLYA 3WOHA 3DFZA 4CV1A 5CEEA 2HMUA 1IL0A 3LQFA 5HS4A 1PJBA 5TC4A 2Y68A 3VC7A 3ZNQA 2GD1O 1N8KA 1ZK4A 2NQTA 4AJNA 1KY5A 5TF4A 4KMSA 1U28A 3L6EA 1GEGA 4IMRA 2DBZA 3AK4A 4W9NC 2B4QA 2BKAA 2WEKA 1YO6A 1X7GA 4ZGWA 5IFLA 1UP6A 2HCTA 3Q1LA 4YT8A 5KJEA 2AE2A 1IUKA 3QRWA 3ASUA 3NAQA 4X54A 1R0KA 1XU9A 3MJSA 3RJ5A 3M2TA 1N1EA 4GWKA 2D3TA 3N7UA 2GDZA 1NXQA 3DTTA 2G0TA 3GC6A 2P9EA 1ADFA 3IJPA 5ITVA 1AHIA 1YVEI 4Z3DA 4CMEA 2WD7B 2I67A 3DBLB 3BTSA 1ZK1A 3FHLA 1SAYA 3I9MA 4WCFB 3PJGA 1ZMOA 1D8AA 4MKZA 1GZ3A 3GQVA 3RBXA 5A3JA 2X5JO 4CMGA 1PGQA 4FC7A 3SC6A 4DGSA 4K1LA 4PG8A 1WZIA 4PRKA 3RVDA 1PS9A 5F21A 1CJCA 3F3SA 5CG2A 1G0NA 2QIOA 4J9UE 4ALMA 5T6BA 3ZWYA 4JQCA 4BMSA 1MP0A 1IPEA 3C8MA 5MDHA 2ZATA 4RPHA 1PWZA 4II2A 3HADA 2P9CA 5L3ZA 5TSDA 3PDJA 4NJMB 2I76A 4C7KA 2VNSA 1VL8A 4FDAA 3U4HA 2FR8A 1C0KA 2EJVA 1JVSA 2NU9A 2RH8A 3HZZA 3PIDA 3ZWPA 2DAPA 1T1SA 4E31A 2NVBA 3AI1A 3DZHA 4KTTE 4B7UA 4J4BA 4CLHA 1P9LA 4E21A 4CV2A 3NGLA 4R5MA 3PEFA 4RPKA 2O3SA 4RCVA 4RV9A 1DFHA 1VJTA 3IC5A 1U7HA 1H2BA 1IE3A 2EERA 1IYZA 2O7QA 2Y0EA 3RASA 2BGMA 1GYPA 1U3WA 4ALJA 1EVZA 1U4OA 1QP8A 4RDIA 2Y99A 3TZCA 3G79A 4RZIA 4R01A 3DTYA 2DPHA 5FF9A 2WDZA 2Y1DA 1A72A 5HWSA 3H9GA 4W4TA 2YDYA 4DLLA 1KEPA 4EZBA 1I2BA 1ZSNA 3DOJA 1C1XA 3NGXA 1LQTA 2P2SA 4E5NA 4IY1A 4GH5A 1H93A 1P74A 3LLSA 4DPLA 1EFLA 1B26A 3UCXA 4E5YA 4A7PA 3FNHA 4AJJA 4BNWA 4EEZA 2BLLA 4UAGA 2CY0A 2OP1A 4GMFA 8ADHA 1MG0A 2ZTVA 4FCCA 4J7XA 3GEDA 4ZVVA 2W4QA 3WXBA 3BTVA 4D0RA 3UAGA 1DC4A 3Q0EA 5IXSA 3W8DA 1YRLA 1Q0HA 1S7CA 4GVLA 4Q3NA 3GHYA 4JP2A 1CQJA 1I2ZA 3NTOA 1NR7A 3ICPA 5F1PA 3PZRA 1A7KA 4IZHA 4B3IA 4N5LA 4ZRMA 1LLDA 3DBRB 2G1UA 2E49A 1B15A 3A4VA 4YACA 2HKIA 3G0OA 1JU9A 4OXYA 4OQYA 4UUPA 3PI7A 2OMEA 1DSSG 3M2PA 3BMOB 2V65A 4AJEA 4WLUA 2ZIZA 4U7WA 5FWNA 3HG7A 4RVFA 4D43A 4PLGA 4JLWA 1VJ0A 1I3NA 1BHSA 4WLEA 3WBFA 4CLEA 1ZZEA 3GUCA 3NX4A 4GWGA 5G4LA 1LLCA 1LDGA 1E6UA 1RM3A 1OC2A 3VZSA 2J3HA 2NU8A 3WTBA 5B4UA 2X8LA 1TEHA 3U09A 3WBBA 5A05A 3B70A 1GL3A 3INTA 3JQ9A 5BSFA 5L9AA 1Z7EA 3PPIA 3DDNA 3K2EA 3E1KA 3I4FA 4AICA 2Q99A 4DWVA 2CDBA 4CM3A 3LC2O 1QORA 2GPTA 3K30A 1SNYA 4IDCA 2X5OA 4R9RA 4M89A 1I5RA 1QMGA 3CEAA 3VH2A 4GGPA 4JROA 3JQEA 4MP3A 3UKOA 4M54A 4E5KA 3S2GA 4YJDA 3RFXA 1XEAA 1UAGA 4QEDA 5HS6A 4Y67A 2UUPA 2PD6A 3BMQB 4GX2A 4UULA 3EYWA 1M76A 3CMMA 3ON5A 3I4CA 4AJHA 4R1SA 3AM4A 3DWFA 2YZ7A 3DMTA 4JGBA 1HSOA 3KSDO 4E13A 1PWXA 2AQHA 4A0SA 2EP5A 5TNXA 4IIVA 4E6PA 2DVMA 3GUYA 3KRTA 3I1JA 4QO8A 3ZWNA 2VUUA 5COBA 1UUFA 2OP0A 4QFDA 2FOIA 4JJGA 5BSEA 2PTGA 5CHEA 5TJ9A 2X0NA 5F3RA 4CODB 3FPLA 3WSWA 3PZBA 5A1TA 3RC1A 3PWSA 4BO8A 3WGZA 3DEYX 1YQXA 4YAJA 5LDHA 1EEHA 5J23A 2DC1A 2DFVA 3DAFA 3RU9A 1AN9A 3DBHB 2VOJA 1JQBA 4P8RA 4EUEA 1K6JA 2FHSA 1EDZA 3LZ6A 4BS9A 5EESA 2VHZA 5F5LA 1ISMA 4L73A 1GAEO 4I1IA 2GO1A 3W6ZA 3UW3A 5A02A 4F6CA 3WGGA 1R16A 1T24A 4IDAA 4CM5A 1DC6A 4KUEA 1F06A 3WGHA 5IDQA 3FBTA 2VYND 4Z0HO 4OSOA 3EC7A 3UICA 3DXFA 3ONDA 4ZRNA 1SC6A 2BI8A 1H9BA 5ADHA 1A7AA 1FDUA 4D41A 2PZMA 3QA9A 3BMOA 5EN4A 4MOWA 4J90A 3GY0A 1NVGA 1XCBA 3ENKA 3F4BA 1FJHA 1YXMA 2JCVA 1MFZA 4HY3A 1W4ZA 3OJOA 3I23A 3RC2A 2GF2A 2X0IA 3W4JA 4PLVA 1K3TA 1Q7BA 2X58A 4HKTA 1NHWA 4ZJUA 1U3UA 1H94A 3GLQA 4XQEA 1AGNA 1WDLA 1SBYA 1HWYA 2X6TA 1NVTA 2I6TA 3A28A 8LDHA 1HE4A 2YHIB 4FSHA 1EE2A 1V0JA 3QWHA 3E8XA 1TA4A 3JQFC 2DKNA 1NFFA 2OZPA 2PA3A 2PKRA 4J1NA 4QX6A 3HNPA 4OYRA 3TNLA 4IIUA 5BSHA 4ND4A 5L53A 2Y1OA 3VH4A 1V35A 2Y66A 3GFGA 3H9EO 1HYHA 1U8FO 3OA0A 4QUKA 5A04A 2ZB4A 3NDJA 4CQMD 3SX2A 4LRTB 1GV0A 5KOIA 4QECA 3ETDA 2X0RA 1ZK2A 4E4YA 1GY8A 4NFHA 3IQDB 4BNGA 5IDYA 2JHFA 4WK6A 3DONA 2I65A 3H4VA 4BNKA 1ONNA 4RGBA 3NJ4A 1Z82A 4ZN6A 4YAGA 3QVOA 3I9LA 2GGSA 4DC1A 1A9YA 3W4IA 4MP8A 4XB2A 1PZGA 2O2SA 3UVEA 3ZWBA 3WX0A 1BG6A 1WNTA 3D4PA 1HKUA 1Z7BA 3FF4A 3FPCA 1V8BA 4WKGA 4OJNA 3K31A 1P77A 3VPFA 1KVRA 3KXDA 1DIRA 3TRIA 1FDSA 4M87A 3ANMA 1UZNA 1W6UA 2C5EA 5TIIA 1SCUA 2ZJ0A 4MPDA 3KLPX 1GADO 1KYQA 3H3JA 3DOCA 4CR6A 1LLQA 1XLTA 3FR8A 1ISFA 2JL1A 2O7SA 3C7DB 2GCGA 3KM0A 3WWYA 1ID1A 3ZCXA 5JDCA 2RAFA 3GA0A 4IQGA 1Y5RA 1LDEA 3ZU4A 4AG3A 4E3ZA 2O3QA 4BO4A 2PWZA 3OHSX 5CPBA 3KYDA 3AUUA 2HK8A 1JVBA 5DDIP 3GDGA 1QYXA 4NBUA 4YT2A 4AJLA 5HM8A 1J5PA 1X13A 1N9GA 2ZCVA 3O8QB 1YQGA 2J3JA 3KETA 1OBFO 1W8DA 4DYDA 1P45A 3MCVA 3NTQA 4AJIA 3EZYA 4JBHA 1O94A 5TJHA 4BKPA 1LA2A 1EK5A 2ILTA 3QWFA 2E6UX 2XOXA 3ADPA 1R0SA 1LEHA 2IZ1A 1J4AA 5HA5A 3H5AA 4KTVE 4DIFA 2HO5A 3RUEA 2P5UA 1E6EA 1T2AA 4CMEC 3JQ8A 3CSDA 1DIHA 1DOHA 1H5QA 3I5MA 4BNJA 1HF3A 3BHMA 3WYBA 4NK5A 2O3UA 3L6DA 1A4IA 1GYQA 4U5QA 4M8SA 4GBJA 1YONA 4YWJA 1TB4A 2X5KO 2AEMA 2B5WA 3B1KA 1HXHA 1LI4A 1M75A 3DMYA 3HFSA 1TT5A 4FGSA 1AE1A 1UAYA 3GN2A 1H0KA 3I9KA 4R41A 2NACA 1MA0A 4U0KA 4YJFA 5A9TA 1P1FA 5T67A 1T2EA 1YJQA 5JSFA 1NQOA 3E82A 5B12A 1B3BA 3KO8A 3BA1A 4Z0TA 5T8KA 4ZQFA 4UUOA 1PS8A 2PZKA 3WYCA 2VHYA 3CZRA 4BOYA 2PD4A 3GPDG 4YRDA 1KIFA 4RORA 2PK3A 4WLOA 4DA9A 5F1OA 4HP8A 4WCDA 1VI2A 3PYMA 3D7LA 5BT9A 5ICMA 2UDPA 2IXBA 2NVUA 2D0IA 2Q46A 4I8XA 5AXDA 4B3HA 5JCJD 2Y93A 2B69A 1KVSA 2C07A 1DIAA 3DZGA 3H2ZA 2VWQA 1K2WA 4A73A 4CLOB 1UP4A 4E2ZA 5JAZA 4CMIA 2VT2A 4AJKA 5A3VA 4LMPA 1P1JA 3LDHA 3JYOA 3LYLA 3S55A 4BO9A 4CMKA 4E2WA 1YJ8A 1XIVA 4ZU3A 5B4TA 1RKXA 4CM8A 2Y1CA 4KUGA 1ZIDA 1Y8QB 1I30A 4L4XA 4O63O 3VPSA 4MIEA 5G2OA 4AFNA 5I9NA 4WOKA 2VQ3A 1N7GA 4B4UA 4J1TA 1Z75A 5CEJA 2DUWA 4CUJA 1LTHR 3PJDA 3RI3A 3Q2KA 4HNGA 4L75A 4FB5A 1P1KA 1NR1A 1ISGA 5DBFA 3ZWAA 4YR9A 2Q4EA 3LT4A 5H81A 3D4OA 4BV8A 1GQ2A 1LDNA 3GAZA 5DN9A 3RD5A 4Z6KA 1KETA 3ZWWA 1V3UA 4KP7A 4WNCA 4UVDA 5I7FA 4CLRB 4YJHA 4CM9D 4CV3A 5FI5A 2EJWA 4R1TA 2BFMA 3NT4A 3C1AA 4LW8A 4TVBA 4BO7A 2FP4A 4HWKA 4YQZA 3JD0A 5DNAA 4XWYA 4J91A 2Q1WA 2XPCA 3ZHBA 2VTEA 4B8WA 3EZLA 3DAPA 4NBRA 3D3EA 3JQBA 4XGNA 4RPLA 5ER6A 1BDMA 1Y7TA 2FPPA 5AQ1A 3KYBA 1SO8A 1ULSA 4IMPA 4PLCA 1FDVA 4I5EA 2IEBA 3A06A 3AU8A 1PL8A 1HLPA 2EWMA 1YH3A 5FFFA 1E3LA 2QZZA 5U1PA 3PLRA 1HSZA 3PYXA 1WXDA 3VPXA 1VRWA 2R2GA 4MVJA 4GLLA 1PJ2A 4IXTA 3JQ9C 1MUUA 3VOSA 4CR8A 1F8FA 1EBFA 1XKQA 5C37A 4KQWA 3MJTA 2ZTUA 4ZQGA 3ZDFA 3PK0A 3PDUA 1W73A 3Q3CA 3KSUA 3E9MA 3EK2A 4FOOA 1VL6A 3QIVA 3H5RA 2HK7A 2VOEA 5JAQA 3UCEA 3ZNNA 1U5CA 3RFTA 4Q39A 1JAYA 3BTOA 3K96A 3I9NA 2AQIA 1CQIA 2CVZA 1QKIA 5TT0A 3QLJA 1GFSA 4R54A 5G0WA 3SC4A 4NFSA 1I3KA 5IJZA 2NUAA 1AHHA 4XQGA 4GX5A 4D79A 3ROPA 1Q0QA 3DMTC 4R4JA 3GN1A 4BNMA 4D45A 4FS3A 1I01A 4D3FA 2CZCA 4NDNE 3E03A 3ZU3A 1XA0A 2Y0CA 1M6WA 5L7YA 3TFQA 2YV3A 5CP8A 5I8ZA 4HFMA 5IDXA 3WG9A 5L95A 4BIIA 4B79A 4A03A 1UXIA 1C0LA 2DTXA 3N74A 3DB2A 4WASA 3D1LA 2HMTA 4YRBA 1ARZA 1Y81A 2HUNA 4H15A 5C7IO 3IL2A 2EP7A 1KS9A 2ZTMA 4LISA 1KEUA 3U4IA 1BXKA 5AOVA 3C1OA 1ORRA 2QRLA 2ET6A 4Q9NA 3NUGA 4OAQA 2JHGA 4NU6A 3U62A 3EHEA 2FY8A 1CWUA 2PZLA 2XAAA 2GZ2A 4CM1A 1LQUA 3MJVA 3GFBA 4LSWA 5EERA 3UCFA 4DBVO 5JY6A 1XSEA 2AA3A 4E2XA 1HYEA 2C2YA 1BDBA 1C1DA 3B6ZA 3FNFA 3K92A 3PHGA 4XQCA 1UR5A 4P22A 1C1XB 3UXYA 4AVYA 2G82A 4R16A 1BVRA 1WAMA 1B3RA 3CINA 4N54A 1DIGA 4LN1A 3VDQA 4IBOA 5L4LA 1X1EA 1A9ZA 2NU7A 4ND5A 1Z74A 3JYPA 3UFXA 1N7HA 2DBRA 3C85A 3DZIA 4UUNA 4O6VA 3V5NA 1OZAA 3WFJA 5C7LO 5I8WA 1LLUA 3QJ5A 2CDAA 1T4BA 3PWZA 4B7XA 4PVCA 3A14A 3JD3A 5THQA 4XYLA 3JV7A 4OOFA 1EFKA 1LUAA 4DIBA 3B1FA 2BGLA 1T4DA 3PIIA 3QVXA 1GUZA 5ENVA 4MKRA 1ONOA 3O03A 3JTMA 3HN2A 4K6FA 3DZJA 4NBTA 4AL4A 3FNEA 1CETA 2C29D 3EVTA 3FBGA 4PLHA 4BNZA 3GVCA 3C7CB 3DHYA 4Q3BA 4ND3A 2F1KA 3QW2A 2WYVA 2GNAA 3VZRA 1YDEA 2PZJA 1YL5A 4URFA 3T4XA 3CKYA 2NTVA 1R4NA 3OJFA 3MWEB 2W2KB 4ID9A 4JJFA 1SB8A 1IY8A 4GKVA 2GRAA 2VYVA 3C7AA 1H6DA 2VHWA 4PIVA 4XCVA 4DLAA 3KHUA 4IZIA 3AY6A 3H9JA 4JIGA 4XIJA 3DZBA 1HE5A 2QX7A 3RIHA 3QVWA 3HUDA 1NVMB 4EJ0A 4ND1A 4CMJA 1FF9A 1L7DA 4RPGA 4J3FA 1KVQA 1AUPA 2ZKLA 4XD2A 4FFRA 4CM7A 4NNJA 1J6UA 4TRMA 1UXGA 3L4SO 2P4QA 2GN6A 1D1TA 4IDFA 3G49A 3ULKA 1LDMA 5HRUA 1YL6A 3LT2A 1IZ0A 4GQAA 1UDBA 4TRJA 3S2EA 3NYWA 1HDYA 3FRJA 4PLPA 4IUYA 2BFOA 4DRYA 4RVGA 4CQLA 1PZHA 1SPXA 2WYUA 3M1LA 2B4RO 1QYCA 1WWKA 3S2IA 4EJMA 1SOWA 1DJQA 5JDCC 1OOEA 2CSUA 5IF3A 1NBOA 1TT7A 2RHCA 5G0UA 2QYTA 2BFPA 3BMCA 3E5RA 3P19A 3ZZNA 1NFRA 4BKRA 1RYEA 2O2YA 1EUDA 3T4EA 4FFNA 1BWSA 4OSPA 5KKAA 4FD3A 2HQ1A 1U5AA 2BD0A 3OIGA 3RAJA 4BKUA 3OP4A 4MO2A 4NFYA 2V6GA 2OGUA 1XELA 1NHGA 1NP3A 1GTMA 5TGDA 3R3JA 4OQZA 5B1YA 3HB4X 5K0ZA 4S1VA 3TOZA 4DXHA 3AU9A 4LCJA 1X15A 4R1NA 4R9SA 1K5HA 1CIVA 3EUWA 4HFJA 2CD9A 4DLBA 1GUFA 1ZVMA 4J7CA 3PGXA 1WDMA 2C7VA 2VRCA 3PJFA 4BNHA 3GPIA 4CV0A 4YPOA 1LX6A 3DZKA 1WP4A 3BXXA 3MOGA 2ZYDA 3AW9A 2JKVA 2DBVO 3H6KA 3VTFA 4BNVA 2NWQA 4TSKA 3OEWA 2Q2QA 4JBIA 5DCWA 5KCZA 3QQPA 3GR6A 1T1RA 4XA8A 3ST7A 3BYZA 1K6IA 3G17A 5U4QA 4Z9FA 1MXHA 1T2CA 3UUWA 1O9BA 3QV1A 1GDHA 1RJWA 1VSVA 4YBZA 3CIFA 1ZCJA 2B35A 4RLHA 4BNFA 4YTEA 4NK4A 4QSMA 5T8KC 4GVXA 3DZFA 1JWAB 4E30A 3ZWXA 3ICCA 3L07A 4HBGA 3A9WA 1E7WA 2YUTA 3M6IA 3L0DA 4S3MA 3TN7A 2CVOA 3JQ7A 4DPMA 2W2KA 2GLXA 2DPGA 2HMVA 4BGIA 3T7EA 5CFZA 4TMFA 4DREA 1KC1A 3WGOA 1F14A 5DP2A 1TLTA 3OICA 2C7GA 3JYQA 4WLVA 3TSCA 4OOEA 1H9AA 3VH3A 1V3VA 4PRLA 4A26A 5L51A 1FMCA 1WMAA 1TXGA 4RF5A 2JJYA 2X9VA 2F00A 2NQ8A 3ETGA 3FI9A 4E0BA 4J0FA 4XYGA 5ILOA 1KC3A 1NPYA 3W8FA 5G0TA 1YBMA 1CYDA 1YBAA 1B8PA 4ZA2A 4U6QA 3RUFA 5KKCA 4J4HA 4RZHA 3JQAA 3LT1A 4BV9A 3KV3O 4XJSA 5A4DA 4J1SA 4RVDA 1H6CA 1ADGA 1LNQA 1XQ6A 1ZFNA 3H2SA 5GZ3A 1ZEJA 5BNFA 1DHRA 3QHAA 3N58A 1E7QA 4PGFA 1Y6JA 4PLZA 5JPIA 4OHUA 4KUHA 2H5LA 2PGJA 4BB5A 4P4LA
chains in the Genus database with same CATH superfamily
1PD1A 2VG8A 2FFAA 3FVVA 2ZBUA 5CLLA 1QBKC 4WXRA 2BE9A 4FJ0A 1UWKA 3CISA 2QZJA 2AKYA 4O2AF 4BCCA 3NBAA 1XZBA 1XVVA 3KFVA 3GJYA 3NS7A 1J2RA 4I5GA 1G5HA 3KUXA 1ORVA 3K4PA 2DB3A 3JPWA 2NVWA 3RUHA 4JUIA 5LNK6 3ZXUB 4Z7NB 1QU3A 1IK6A 1AKTA 1VHLA 2Y2UA 2RCNA 2YJNA 2AX3A 4ZOAA 3ZD8A 2H8KA 3OLCX 3K20A 2WSSD 4X91A 5F4BA 3S44A 1UBFA 2IYOA 3EVGA 5C5EA 5JR3A 3GX1A 4HEA6 4KQMA 3FM9A 4XVUA 5BQ5A 5B64A 1BJKA 3D6FA 3E1GA 1BWRA 3JWPA 4TXHA 4OXRA 1H5UA 1TIKA 2P4HX 3A6ZA 4A27A 3L6RA 5KTRA 3E70C 1P33A 4KBFA 3VKGA 1OJ7A 3A1EA 3PC7A 4RHCA 1MJGA 1UBSB 1C0PA 3AEUB 3EISA 1P3DA 3STYA 4YXWD 4KDCA 3PC3A 2G5CA 2XKBA 2NX2A 4ZOCA 4NZMA 4LIPD 3IURA 5AW4A 1IH8A 4Y2SA 2QVGA 1N9GB 3IUEA 1QIIA 3BICA 1FRNA 2IPMA 3KYJB 5AIBA 4NYJR 4JU8A 2NT3A 3HI4A 4ZQCB 3MM4A 4NEGA 3MMSA 1NJ8A 3C3XA 2ZIXA 1VPTA 4YEDA 3PQEA 3AF3A 1G8JA 3QVKA 5C4MA 1R27A 2Z4TA 4P86A 1O97D 5KIAA 3HXMA 3ADBA 1WHTA 3ND7A 4GGMX 10MHA 2UZ0A 2NZUG 3FA2A 2PY6A 2Q3JA 4DIOA 3I30X 2Q49A 1GL6A 2EFYA 3WWDA 4YHHB 5DBOA 1ULAA 3E22A 3A27A 3BTUA 1DKMA 1Z4KA 1EUCA 1LU9A 1VKHA 2FCAA 2XMGA 3CUEF 1PJQA 2Y71A 1RR6A 3GHHA 1DWPA 2O4UX 2PBLA 1E7MA 4IIGA 5CA0A 4D7AA 4A4DA 2BJWA 5FD8A 4D3DA 3LVFO 4HZUA 1CP2A 1HMPA 2A0WA 5AJXA 3LCVB 5H82A 5ALDA 4F0JA 5K8VA 3MGKA 1FYXA 1YNSA 1SEVA 1WE2A 4TRRA 3C3EA 5AP9A 2R25B 3QSGA 1G8AA 2FSSA 3TJRA 3IP7A 2RHLA 1O8CA 2VAPA 1A4RA 1NJFA 1G9TA 2Q8QA 4C0HA 1SIUA 5JO9A 3EZ6A 3UA4A 5ALJA 3PWKA 1S3SA 2NM0A 1PDWA 1ZHFA 2R6FA 3K1YA 4UU8A 3U3OA 1FQOA 1EVKA 4D4GA 1XK6A 2BFDA 4G84A 2JVKA 1UBOS 2G3YA 2JLSA 3LUJA 3OPXA 4MVWA 1MLDA 2E4WA 4IPTA 4XDGA 3FMOB 4XWWA 3MSCA 1XTRA 3I6BA 2WKPA 3R5TA 4PS0A 2YHBA 3K70B 1WMBA 2AWNA 1OIXA 2EJBA 3NYIA 1SXJC 3N87A 1ADCA 2WG0A 2ZYTX 3F6PA 4DJTA 5T4HA 2B4KA 4PYNA 4UTVA 3KDPA 4HGNA 1EHCA 2BMVA 1SG9A 2HQSA 3DXXA 3E8SA 1GYRA 4WXYB 5DCUA 1MGOA 3SVLA 3IKLA 3JAMA 3ZKAA 2JFWA 2OV2A 3DKRA 2F43B 1OLOA 3Q0IA 2CLDX 4W1RA 1WXHA 1EM6A 3QEJA 5CDGA 3SM9A 3ZLJA 2Z04A 5AVVA 1QP0A 3UAYA 1ISPA 4QTTB 1XX6A 1Y7LA 1XLVA 1ZOOA 5LSAA 2WJVA 2EEZA 4RVCA 3JD1A 1E6LA 2B1GA 1WKVA 3RSOA 3IBYA 4NL4H 2GFHA 2GX6A 2QG4A 2H9IA 4OP2A 5JMOA 1RQLA 4EY4A 3WLFA 1ONPA 3AM1A 3V4LA 3J80A 3JZMA 1UKVY 3SHWA 3WL3A 3KLMX 3ASZA 3IMGA 1FSZA 1PJCA 5HK9A 2DERA 1F0PA 2VBCA 3BGIA 2BDEA 5FA5A 1LRKA 2FPRA 2VT6A 1Q5PA 5C31A 2WMNB 1Z6ZA 5I7UA 1CY1A 1YC5A 2RGAA 3P0IA 5IX8A 2OVFA 2AI3A 3AUTA 3B1JA 3PX2A 4ZK2A 1T29A 4LHWA 4URWR 3OESA 5DH9A 4Y6RA 3HN7A 2XGSA 1J07A 1QKKA 4JLAA 3RYHB 4XEUA 2DTDA 5A71A 3OA2A 4CGZA 3QIAA 3FZYA 3VR0A 1AQJA 4C20A 1PX0A 3TH5A 1T4MA 3OG9A 1LRLA 3O4GA 2EP8A 2ZR7A 4Y6LA 2O07A 4KVAA 5EEGA 4BVLA 1H2YA 5HJ7A 2JI8A 3BJMA 5CG1A 1U8TA 1FW6A 3R6GA 2YWCA 3G82C 3IIEA 5B2ZA 3WYNA 3HDVA 4EL5A 2Y1LA 2Q45A 2ZJ1A 2R5NA 5IJWA 4JKYA 4JT2A 2PZ8A 7GPBA 5JATA 1XPOA 2V7TA 1GP2A 2C96A 4MO9A 1DELA 1G2IA 1Q84A 2P41A 2G04A 4HAZA 1ZGBA 1PUXA 4OTZA 5JAIA 2R7NA 3K8QA 5E4TA 2HSZA 4KXVA 3IT1A 4U4AA 4FFBB 3U5ZB 1GN9A 5TE9A 1P3JA 3FUUA 1JDBC 4RSRA 1MHPA 1JTEA 4Y9SA 1M0SA 1Z88A 2NPFA 1T9AA 1ZNYA 1QOZA 1GCAA 1JV2B 3F3KA 4MWEA 1TTHA 2Z1DA 2R8BA 4HXEB 4D4IA 1QRTA 3GEEA 3E3OA 2BAGA 4DGQA 3KSAC 4D2IA 3CRW1 1JXAA 3MJHA 1CEQA 1V16B 2VCYA 4MR9B 4E2YA 2X41A 3QBJA 2X14A 1J1ZA 3JR7A 4C4YA 5BO5A 3KOXA 4MQBA 4A5OA 4PG7A 1GUAA 5FBLB 2BPOA 3OT1B 1O6GA 1M1UA 2PN1A 1Y98A 5D87A 1KBOA 4GSKA 4A0GA 3NORA 4LTNA 4QGFA 2ID9A 1Y9AA 4X1YA 1K08A 5I9MA 3WIUA 2CNDA 5DT9A 3UV3A 2HMAA 2ZXFA 3VO8A 1L8LA 5JSQA 5FWYA 2BP7A 3BXOA 4BB0A 4HLQB 3AKEA 3ET5A 5IRCD 2GA9A 2V7GA 3PEVA 3FJ1A 3U0BA 1DVRA 4AJ1A 3HR7A 3ZZTA 1U0EA 3Q5EA 4K40A 2BV3A 1UZMA 4LNHA 4NG4A 5L7WA 4CEJA 2QRVB 3FCAA 1E3WA 1GUYA 1E2PA 2WHEA 3RK0A 4D98A 5E4YA 3GGGA 4HNUA 2CMKA 2AK3A 5F3WB 1AQIA 1U6KA 3GPLA 4PAWA 4YLYA 2OV3A 3Q40A 4L15A 4IQ8A 4MVJE 4F9FA 3PDIB 2OQ2A 4YCLA 2I34A 2W2QA 3W9YA 4ZIRA 2V6MA 2CLCX 2HIHA 2Y77A 3KEMA 5B1SA 2IWRA 5CFNA 5JYEA 1T36A 3PB3A 2J7PD 4X62B 1AXGA 3R9IA 3WL6A 4LUCA 1QU2A 1GO2A 3CF6R 4TLAA 4TWJA 4XB1A 1AKWA 2PGLA 4OGFA 3TLGB 1JA9A 6PFKA 3C98A 3VPBA 1X8XA 2YNMD 2HNBA 4IJWA 4ZOLF 3CLKA 3T9FA 5JNSA 5ALZA 2IE8A 1SXJB 2WT9A 4GG1A 3QLVA 1V4NA 3BMNA 3HWWA 1IN7A 4GC9A 2I7XA 1MX5A 3U26A 4A15A 5JWOA 4XRRA 4YPFA 2W11A 1G8FA 3E9QA 4ZEMA 2OB2A 4P0PB 5L3SB 1K8XB 4BX9A 1FLNA 1X39A 1APBA 4D6YA 4EMBA 4C7OB 3COYA 2Z6AA 5BMVB 5DZSA 2VJYA 3BJEA 4LJAA 3TPFA 1NUPA 3GVIA 4AXXA 2KBEA 1MIHA 4P3KA 4JOSA 4GMGA 5KVCA 1JHYA 1UKYA 2A33A 5ALLA 2PT7A 2GPJA 4BNXA 1GNLA 1NX6A 1RQRA 1Z0SA 2B37A 2ZJYA 2ZVJA 2UV8A 3I2JA 3PRHA 4N12A 4QTXA 4KOEC 3HB0A 3W9BA 2XR1A 5KS2A 2Q9UA 4KV7A 4IF4A 1F12A 2VDVE 3L5OA 3R7DA 3UG7A 2HJVA 2ZRLA 3E23A 1C1DB 1W9HA 1Z6QA 2YY5A 2ZWMA 3GP3A 3NT2A 3O6VA 1YK0A 5IDQA 1L3CA 5EQJB 5C9ZA 5FO1A 1JB9A 1YC2A 2PWPA 3B9RA 1AK2A 2ZB8A 1DWQA 5TB5A 4E33A 2P1ZA 3KQNA 1M6YA 4IHKA 3VOAA 4JASB 2G8LA 1WP9A 1M1YE 5DKFA 2AG8A 1EJ6A 1FE8A 1Q91A 2FJPA 3ASYA 4G36A 4HN9A 2IIVA 2X6RA 3MMPA 3C24A 3W7VA 1GPAA 2WILA 2JGLA 3LO5A 5IN5A 5KTKA 2PO5A 4HLUA 3W0LB 3SGLA 1NASA 4HDKA 4OGWA 1CUGA 3SZOA 1B0ZA 1AURA 2JLQA 2VNJA 3IQZA 4HDAA 1F2DA 2D0OB 2X7JA 2QAIA 3VYVA 2W42A 2OCGA 1BOOA 3D7RA 4ZREA 2GBLC 5HK8A 4IHQA 4L5JA 1GG2A 3JCZA 4G65A 3PFFA 5YASA 3OQIB 3VVCA 3WL7A 2C1ZA 3QLUC 4LWOA 1TA0A 3V3TA 1U8AA 3W6UA 2XBMA 4HS9A 1A50B 3CVVA 1QDEA 4TXJA 1Z35A 4RY2A 2GTPA 4O4JB 2UXBB 1YS1X 1JDBB 1YRYE 3OPYB 4XZ3A 2O14A 2CE7A 3UJHA 3VSCA 1CJKC 3B6EA 3O31A 4C4AA 1ZKMA 1W94A 4N39A 2VEDA 3RVPA 3G68A 2VQDA 3DCIA 2ZJFA 4PAGA 3VV3A 2YHUA 4O2BF 3ZWVA 4YAEA 1WB5A 4CWAA 2W90A 1OMOA 3IUJA 1ZWLA 3MJCA 4DLYA 4CL3A 4TS1A 5FB3A 3DUFA 2QUIA 4JH0A 3K73O 3LL7A 4YJ3A 1YJXA 4G5FA 3GIDA 5CCDA 1DC8A 3SYTA 1JEYA 5HIMA 1V6AA 3VR3D 4RJTA 2ZP1A 3DOUA 1P8JA 2AG6A 1CJSA 4J07A 1VFPA 1YB4A 2FW0A 3ILVA 3BKWA 1XA4A 3OLYA 4G5YA 1U8UA 1WUKS 3EXFB 4V0QA 3RADC 2D2XA 4CDMA 5AUNB 1GEEA 2WUGA 4YQEA 3Q4GA 2HIMA 4B6EA 3VPHA 2WWRA 3JS5A 1OGIA 3T15A 3THYA 3K09A 5B1YA 3EDYA 5AI8A 5DXFA 3CPEA 1B8VA 3V32A 4K6KA 3RREA 4LOLA 1DRWA 2HN9A 1KEVA 3AR7A 1N7IA 5HRAA 1GHTA 1J9EA 1OFTA 2VXYA 3GRPA 3T3EA 5B36A 1VCMA 2WSBA 2XCSB 2EWVA 4RW0A 3FWYA 1MD9A 1YE8A 1YJBA 3K1ZA 4CKXA 5LP6F 1QOPB 2XZTA 3R3VA 3HU2A 5EIHA 3L7LA 4XDHA 3TR0A 1YFZA 4ID3A 2W22A 3KCNA 3BD6A 4J16A 4QHSA 1JJFA 5ALEA 4AZSA 2OZEA 3KSBC 2XLBA 1EZ4A 2I71A 4M1QA 2G9VA 1Y63A 1QG4A 3DL0A 4EFMA 5LOVB 3MT9A 4R0NA 1E5QA 3NV9A 3U4DA 4EGJA 5JLJA 3EIWA 3MTJA 1VIVA 1DC3A 1M5TA 4UREA 2J4CA 3ISVA 4R6WA 1T43A 1RPZA 5AO9A 3NC4A 3SEAA 1NRWA 3NBUA 2ORVA 4C21A 3P97A 1D1QA 2C58A 5FEMA 1VDZA 5JI3E 2CLOB 5E8JA 2FP3A 1XNJA 2WWHA 3QBVA 4JBNA 2X7HA 4PNZA 5HFJA 621PA 4D9GA 2QSJA 3NWEA 3S4YA 2J1LA 2WJHA 2V5VA 3U3JA 4BMZA 1MW8X 2FSFA 4CEHA 4PONA 1SBNE 3NEJA 3EF1A 3RJ9A 3SFZA 2AFRA 4MV6A 4KKVA 2AE1A 3OECA 4AQYB 4LYAA 1R8SA 1KIMA 4IV5A 1NBMD 2PL1A 2QE7A 1R15A 4O4IB 1NC3A 1VKNA 1V8OA 2GH1A 4HUJA 3TECE 2OHJA 2YHSA 5JYBA 5E1OA 2GYVA 1PNVA 2XUGA 3JVDA 3LXUX 1MDBA 1MORA 1KI9A 1M67A 4GMHA 2Z3VA 4AROA 5LMZA 4QUAA 4ZKEA 3CZ5A 4IX1A 4YR9A 4EDFA 2OAGA 1WJGA 1X7YB 2IW1A 1NG1A 4CXMA 5GM1A 3DDWA 2VUTA 2ERYA 1NJ5A 2QSUA 1P2FA 5EXDA 2DFTA 3KAPA 3AILA 1XMIA 3E7PA 3LSYA 1M2EA 2RJOA 5EWJA 2IU0A 1L1FA 2NUTA 3PLNA 1ZVVA 3K5PA 4IIBA 4Z9YA 5CDSA 1SXJD 4WK4B 3HJGA 5GGXA 4BLSA 4Q9JA 3JRNA 1YB7A 5C8VA 2GQ0A 3HJHA 5TS3A 2I9KA 3C8DA 5ALXA 1PG2A 1NYTA 5BPFA 4MPTA 2PYIA 2CMGA 2R1VB 1D4ZA 4HVLA 4G0MA 2YZGA 3RJZA 1H2FA 2A5GA 1UXHA 2CB9A 2C4HA 1ZH8A 2ZI5A 3EZGA 2YFQA 3IR5A 4UJ5A 1PL6A 4HN4B 5GZ6A 3UJ8A 2AFIB 1HOXA 1YQTA 1JDPA 2C54A 2Q4BA 2X0KA 5C7YA 3F6RA 3GT3A 1Z15A 2VHCA 2XVAA 1P6QA 3CH6A 2PGXA 2HMWA 3NP9A 3LPDA 2GJ8A 2PSJA 1NZFA 1V8PA 4K9KA 2O2IA 2XYPA 1M6HA 3K0KA 1Y5IA 3K2IA 3QUTA 4IWNA 4W8HA 3RJMA 3S8MA 3HLYA 1C7JA 3OPNA 4H0CA 4P4NA 1DKQA 4DG9A 3X1MA 1JFRA 2VRBA 4MRAA 3C6ZA 1U7TA 4B7ZA 3ZU2A 4OEHA 1RYDA 4A92A 5HJEA 4W63A 2ROQA 2X2EA 3MOIA 2QAGC 2XMQA 5CLGA 5DGCA 4EJFA 4LF6B 3TYXA 1AN0A 3WB9A 3EDMA 3R3ZA 2PH5A 4C14A 5FTKA 4G24A 1T6ZA 3MD9A 5C8YF 1U02A 3U80A 2WMDA 4TKMA 3WYGA 2R00C 3LDGA 1KMNA 1EX7A 2BR5A 1M0EA 4Q34A 1E60A 3DR3A 3FPEA 3MWJA 4BJ3A 3I2HA 1S2GA 3AVYA 4LXTA 4NJEA 3X1JA 4AO7A 4WZZA 4H9GA 1NJ1A 1QHHB 3VNQA 6REQB 3RUIA 4QJ4A 1Y3HA 5IN4A 4FW9A 5CGQB 1IDOA 3DQQA 4OFBA 1JW9B 2X0JA 1F0YA 4HGQA 1X1SA 3ZWDA 4NYMQ 3PU6A 1SVKA 1ZD9A 4LHEA 2C1XA 3PD0A 3VR6A 2YH2A 4U00A 1UL1X 1BC5A 3OCZA 1JYSA 4CLDA 2WIGA 1RWVA 1TF7A 3GEHA 2QVLA 4QNMA 2NYUA 3FZNA 2DH5A 3D1VA 1WPQA 2QQ5A 3L0YA 4TL7A 2ZITA 3N6RA 1G7TA 4QPPA 3IAEA 4OF4A 1M6VB 4DC0A 1OFHA 5FQNA 3M6WA 4XX0B 1G4UR 2QGNA 4PSUA 4U2BA 1U90A 3HYCA 1T5LA 1FX0B 3CZPA 5IFKA 4C7JA 2PR2A 3S8EA 5KHOC 3T4UA 3OSUA 1Z6XA 4Y6OA 1SXHA 3LVRE 2CJYA 4U8GA 4BJHB 3EFBA 3KVNA 4B4OA 2EBWA 4B73A 2VHQA 3NPMA 4H3HB 5FUWA 3K5IA 2VR1A 4R51A 4HPXB 2O3RA 1O6CA 2JVIA 4RIEA 5FYQA 4EA8A 1W36C 2AUTA 3ESQA 1D2HA 3KQYA 1HQCA 1A5ZA 1RJEA 2OD7A 3KTDA 4MHSA 5M2QA 3V2UA 2ZZNA 4LXXA 4FFOA 5B58C 4CCAA 3MERA 5DPMA 5CB4A 1E1QD 3AIIA 2WTXA 4NENB 3IP9A 3P4XA 4RKYA 2UYGA 1VKOA 1M74A 2PU7A 2A14A 2KJQA 2FQWA 3EJ6A 3OZDA 1QFZA 4CQMB 3IFSA 1PEKE 1KEWA 2YV2A 4YB8A 2X9QA 1GLNA 3GFTA 3EZ9A 3ZXYA 1RLUA 2HFJA 5JZ9A 2IRWA 2FRDA 4X8HA 2HPZA 2X86A 2YYZA 1U2GA 3O21A 1ENPA 2HBRA 2CC2A 4FE3A 5B7PA 1N5OX 2XF8A 2SHKA 2QPTA 2FEWB 3AJAA 1JAHA 3PXUA 3HU5A 4G2TA 4AJPA 5DM70 2P67A 4RQTA 3ODGA 1OI3A 3LKBA 2XGJA 1V48A 4ZXPA 3KIPA 3ZTTA 1EFRA 1C3XA 3V1YA 2W93A 4QPNA 2CJXA 4FOPA 2PRYA 3IBFA 3GARA 3MS2A 3LD9A 4F2DA 1P91A 2PQ2A 4ALKA 2BEVB 3DMDA 5DX1A 4ZGGA 1NZDA 4R7TA 3DNMA 3E4CA 1A9PA 4I55B 5JI2E 2QZ9A 3DVSX 3QVVA 4KIJA 3OLXA 1TNDA 3LWBA 2FXVA 5FT9A 3VMFA 1ESCA 2H00A 4INAA 1OT3A 4BQRA 1JN0A 2H3EA 1Y9JA 3TTUA 1TMGE 4US0R 5IWAB 1PQUA 4WJZA 3TQOA 2RKOA 1IXYA 2DSNA 4ZAZA 1Z3IX 2KI5A 1HLGA 3T7DA 3OY2A 5IEJA 4B6SA 5J2TA 4I4NA 4L50A 1N6RA 2H5EA 4EX7A 3A1NA 3AB3A 1U6IA 1ZINA 4RPJA 4KR6A 5KU1A 2O5EA 2QLTA 3TGWA 5DWVA 5B3JC 1WXXA 2XKKA 1TMOA 4DR7B 1VECA 1W2WB 2Z2IA 3EDCA 5AHWA 2Y05A 4F60A 2PUDA 4FC6A 2LKCA 3E35A 4FKZA 1PDVA 2IGTA 4LYDA 4MV4A 4OMFG 1R18A 1XEXB 1FFSA 1NY5A 4LA4A 4BFWA 1JT2A 5HE8A 1F5SA 4OHKA 3IKVA 4XUGB 5NULA 2RIPA 4TKLA 1KFJB 3I2KA 2QAGB 1JSLA 3KVYA 2QE6A 2A9OA 4F21A 3IESA 5L4NA 2V55B 3KVRA 4KQEA 1NIPA 3FOCA 1V41E 3AM3A 3L5KA 2OZLB 2R96A 5CW1A 1YL7A 1JZTA 1JE1A 3L40A 5EI5A 5KYGA 4AP6A 3QVMA 3ITNA 5A2QA 2JKZA 4AM8A 5KJCA 3A6EA 1H0RA 3OLZA 4A6DA 2AXQA 421PA 1KOLA 2CHQA 4N5IX 5I3ZA 1U9CA 2WFAA 3U60B 1HYQA 5JZVA 3L1UA 2FVYA 3RCBA 1R6XA 2XNDA 4PQGA 5A5DA 3CO0S 3VJKA 4C4SA 5CBPB 5JU6A 1XQ1A 3IALA 1JEQB 1D2MA 1U94A 2D62A 1GRQA 2QD1A 4PX5A 4DWOA 5LU9A 4NCBA 4GNRA 1EQ2A 1M1NB 1RM5A 1N0IA 2JW5A 3A3KA 3Q88A 4QE3A 4BUJA 4JNKA 2AMLA 2ES4A 3W1EA 2A35A 2VDOB 3PSAA 3SHQA 4F45A 5LQNA 1QO9A 4ND8B 3CR8A 4FX5A 4TKUA 5ES3A 2QW8A 4GI7A 4TV8B 3U1VA 1EFAA 6NULA 3OAAD 3QH4A 1VJ1A 1BMFD 1WG8A 1USUA 1KPHA 1BRTA 3L7YA 4IQ4A 4TTJA 1IEXA 4B6OA 5BSUA 5ADWA 3BCRA 4HFRA 3IQWA 4A1FA 2Q0XA 2YWXA 2V9CA 4B1FA 2B8JA 1YI0A 2GCEA 2GPSA 2I6QA 3NO4A 3B3AA 4RIIA 1B8UA 3AEZA 2JEYA 1UODA 2IS4A 1DTWB 3H17A 4ZMSA 4MS3A 4YRZA 4OHCA 1YB1A 4RPIA 1Z38A 1T10A 2X76A 1A97A 3AHDA 3LBNA 4IOJA 2P9BA 4HO1X 4ZWNA 4RK4A 1AB6A 1I7NA 4V2UA 3A25A 2XADA 1MZPA 1COWA 1A5BB 5JADA 2PG3A 5IAKA 4UPVA 1VHJA 2NV6A 3N0WA 3P7MA 4GOLD 4Y6GB 1EIWA 1EDDA 3QMPA 1E77A 3I72A 3ZJVA 3UZUA 1MNAA 4P7GA 1JPNA 1WY5A 3CX3A 1T6YA 3SZRA 4YRLA 5A4KA 2OHHA 4O1HA 5HFAA 1ZXLA 3AWDA 3KQVA 4WKPA 3RIEA 3S2FA 2JFBA 4ERNA 4B40A 1EVEA 2VHJA 1BXGB 2XKAA 5FJIA 4NYMR 4EHDA 5KSWB 3L18A 1PDOA 1EGMB 1DDOA 1YR8A 3KKZA 4BQPA 2QORA 4J8PA 4MV7A 2P79A 1UJBA 2QWXA 4LZLA 5FUMA 1HO3A 1E2JA 4ZYVA 2X23A 4JOBA 1BN6A 4QBTA 1S3IA 1U0BB 2Z8XA 3ANNA 4AZWA 5IZCC 2C98A 3D3WB 2OECA 3OZCA 1NSTA 4TT3A 5A9RA 1BE6A 4FBGA 2NXEA 3ZI0A 1SQ0A 2FR0A 1L5FA 1QLHA 5CCBA 2PFGA 1NKVA 3V1KA 5JAPA 4RWEA 1RDFA 3FHOA 4FPXA 4JODA 4HX5A 5TPWB 4LDRA 2XUDA 4DAEA 5JSZB 3C43A 2JZOA 3LGAA 4JLKA 4MS4B 2C2XA 1SUBA 1MBZA 4MUGA 2OZKA 5AXCA 1QGZA 1E8MA 2QL7A 3IEVA 1SQ6A 4HRXA 5C80A 4EMSA 3HXQA 3L4JA 2O05A 2JCGA 2NG1A 1KNQA 3B52X 3HDYA 2BHNA 4JX9A 1YHNA 1I3MA 1C0IA 5BXYA 1ENOA 3LX6A 3I8XA 4C5AA 3B3QA 2B99A 1U1GA 4BZWA 4PRZA 5IM4A 4AY3A 1P0IA 2X22A 1U0RA 3EMKA 1D6MA 2JBAB 4M6WA 3T1HB 3DEIA 1PVDA 4RL4A 2ATVA 3F1KA 1P0PA 1RHUA 2I3ZA 2UUAB 4ONEA 2CLFB 4YJ3F 2VDPB 2X9NA 4XIIA 2PL3A 1YRBA 4GMKA 4HQKA 4JXKA 5JMPA 3GVPA 4Z1OA 3H19A 3KPWA 3TTYA 1GAQA 1W6RA 3TI7A 4JQZA 5IF9A 1YIAA 3BK1A 5JARA 5EQFA 2IHTA 1EA7A 4ZDJA 1C1YA 4G2NA 3U7QA 1MRNA 1RXUA 1PZEA 3L8FA 2X2OA 4TLLB 1DOAA 1SC1A 1NPDA 1ZXBA 1Z0JA 3L9WA 3X1DA 1HDZA 1NKTA 1ONBA 1CUYA 1SVLA 3AXSA 4X60A 3QPBA 1J1UA 4ROSA 3W3AA 2JIMA 1G8HA 1MCZA 1NFQA 1M6NA 1WQ4A 3MJ4A 1UMCA 3D43A 4TGLA 3S7TA 3TRKA 4NPHA 2BN4A 4HWPA 1FDOA 4W1PA 1PSDA 2EIHA 3P2IA 3V97A 3WMEA 5K3FB 1VGVA 3AOEC 3OE7D 4NCNA 3M3DA 3TTXA 5M5BA 3K05A 3OEHD 3T7SA 4MGYR 4OHOA 3RRJA 1IG0A 3NHSA 2JLUA 3OEED 5CB0A 4YV2A 1RJGA 4LDQA 3QX7A 2RH4A 2XYHA 4X71A 4D5EA 3V4SA 1DB3A 5C1IA 1W0KA 3D8UA 4FMBB 4DR1B 2E48A 1A9QA 2JAOA 5JZSA 3L4KA 4IEFB 4XKJA 4YWHA 1ZOPA 2HRRA 4YDHB 2YXLA 5IJ0B 4OYHA 4EB6A 3A2MA 1HNWB 3P20A 3AQIA 1FU7A 3CH4B 1ZK3A 3CUYA 5AKGA 3CF0A 521PA 1L5ZA 3RTCA 1JU4A 1VKZA 2JFFA 3CB2A 4D8WA 5EP1A 4FMCB 4YCJA 5LZ4A 3E84A 4Z53A 2JDID 4ZP1A 1WU7A 3TQHA 4F56A 3IE2A 2HSGA 2OYCA 4IL5A 5IAOA 4XIYA 2B0CA 2CNKA 3QXSA 1H23A 1RAAA 4LPSA 2COEA 2WMOB 1TZMA 2Q28A 1XVLA 1QC5B 5BNWA 3PUKA 3AI7A 1NQWA 2XNCA 3BFJA 5AM4A 1NU6A 4RK7A 2QDXA 4C4OA 3SF8A 3I58A 2PH3A 3WWZA 3NTVA 2ONJA 4KN5A 3RIGA 4Q3CA 1NUHA 1TU0A 3KS9A 4RS4A 3NWBA 3SE0A 1QWOA 2QRKA 2ABWA 2G25A 3NC0C 5FTMA 2BRUA 4MW4A 3EH1A 2Q5HA 4R84A 1L4YA 1LJ8A 3QPCA 4UDYX 3C45A 1H4TA 1OA0A 3AVPA 3CCFA 4JA0A 3LFTA 4B71A 3AHEA 3ONEA 1WTAA 3LPMA 2YXPX 2EZ8A 1A77A 3G6WA 3M70A 3CF2A 4JLBA 1T25A 1D07A 1E6WA 1KJQA 3DC2A 3GRFA 4DCSA 4XRGA 1CFZA 4D8YA 3SS8A 2ZQZA 4L6IA 3H04A 4UJ3A 1YFKA 2H0QA 5LZ8A 3IS3A 4IDBA 3NBFA 3A2LA 1XI2A 4CM9A 1YS9A 4GO1A 1DBIA 2YN2A 4HQLA 2Q9AA 4RFSA 1EHIA 4D81A 4GMDA 3I6IA 4BYGA 3HK2A 2Z5VA 3KDSE 1KWGA 1A4UA 5DTEA 1RM4A 4L5YA 5J5VA 3GEBA 3D3KA 3Q7IA 4MUKA 4INJA 4Q4CA 2BF7A 2Z3WA 3EIOA 3R23A 4CHGA 3K1JA 3NT5A 1NI4A 4P38A 4FGJA 4YRRA 1OI7A 4BWGA 1E9EA 1SBCA 3FSRA 1SQGA 5BN3A 4DRXB 2GZMA 3MBKA 3HA5A 4G1EB 4Y2RA 3ZWQA 2RHJA 4PQEA 1W36D 3H65A 1J0BA 4I66A 4EA6A 3FKQA 1KVTA 4LY9A 5JC8A 1V7CA 2GNPA 2XMPA 1OTYA 2XNSA 4CIVA 3HEAA 4AUNA 3HL4A 3FOZA 2AMFA 4JFAA 1WF3A 4Q0MA 3UWMA 4HN2A 2GF0A 1RYZA 1PTJC 2ZJ3A 2IYVA 1OLSA 1JSRA 4YLGA 5BQ3A 2QTLA 5JCXA 2KHZA 3SX0A 3J7AC 1V3TA 5FUYA 4C2TA 1ZNWA 3WB0A 1P9OA 3Q3JB 5JDIC 2J0EA 2IS2A 4YJKA 2VWPA 1NLUA 1GTSA 5DYYA 4TL9A 2GLTA 3JAKA 1DKOA 1GN8A 1Y8CA 4YAUA 5DX8A 3QX3A 1U3VA 1KK1A 1ODKA 3PR1A 1IBCA 1Y4AE 2J3EA 1E0SA 3R0XA 1HDEA 4TS4A 4Z9XA 3AF6A 1QRSA 4ENUA 1PR4A 3JD2A 3PX7A 1ENYA 2IYZA 3WRYC 1G5FA 1ZW1A 2N3ZA 2W2NA 3VXKA 4A2PA 1C3EA 4U9HS 2DFKB 2M6LA 2BH9A 1K97A 5AKLA 2QSYA 3HTXA 2NZVG 1JAIA 1SC4A 2DJ5A 2NU6A 5P8WA 3E7DA 5THKA 1SJ9A 2WJWA 3F5SA 1EXNA 2HO4A 2I78A 3JZDA 4KZPA 3DP9A 4UCQA 5COQA 4C6TA 4RA6B 1NVXQ 3A4TA 2ZK7A 3IEMA 3LNTA 1U80A 3L1IA 4XSVA 2H17A 3L0BA 5H83A 1F8YA 5CYPA 3TL2A 4B31A 5BQFA 3CZ9A 2R6R1 2I8CA 1IOLA 4BLRA 4BVEA 1O54A 2NGRA 4OI2A 5KOYA 3U9SA 3SQXA 1TK2A 1MTZA 4B4VA 5K9ZA 3AG5A 3DP7A 4BNDB 1J8DA 3O8QA 2I03A 4K9SA 3VTAA 2W2LD 4C0SA 2QMYA 1SHKA 4FJ2A 4B2PA 2GN8A 1MC1A 3IRUA 5KMGA 3C6QA 3HA2A 1B6GA 1R4MB 4FEEA 5LQUA 5GGYA 2IV3A 4C5CA 3RFVA 1EAMA 4WNAB 1U6JA 3CZQA 3O90A 1WY7A 2YWJA 3AVTA 1G291 1ZM9A 2IYLD 2XOEA 3I5XA 4JT8A 4M2LA 4Q1VA 3NIFB 1QMPA 1T2FA 1Z18A 3OQ1A 1FNNA 3BSFA 3WFZA 1D2AA 3GRAA 4QAJA 4D42A 2R1TB 4RZUA 4ND6A 4R0VA 5DCLA 1T13A 1XVUA 2BKVA 4L0QA 3AMVA 4O8CA 5CB4F 4G1FA 3Q98A 1CUEA 2G4CA 1Y7PA 5TMEA 5J2UA 2J0UA 1H2EA 1ICIA 2F3QA 3A10A 3HJAA 4WCFC 4XQ0A 4NU0A 1OZHA 4V1CI 5DM1A 4J29A 3AESA 2Y6VA 4F5EA 1RKBA 2JEZA 4HL6A 1E1MA 3JY6A 4YVFA 3W6OA 3RRBA 2OXIA 2H1OA 4M0LA 5EFZA 3HA3A 3UN1A 1XRMA 4DBLE 2IYXA 5AW8A 1T26A 4KLNA 2C5HA 2YINC 2QP9X 3TZBA 1GITA 2RG1A 2FMTA 5M34A 1MFPA 2XWBF 3QXCA 3ZHRA 3C3MA 1J21A 2H2GA 3MGBA 2HHLA 1GG8A 4YCAA 1CR1A 5JV5A 3G8DA 2GEDA 3OOWA 4F4CA 5JE8A 2B61A 1MX1A 3PNMA 4YMLA 2VFAA 1NBMA 1QAMA 3ROQA 4ZCMA 4QBGB 2GF9A 1UDWA 1QM5A 3UGTA 3EXEA 2L0XA 1JYEA 1NA5A 1TYCA 2OZVA 5CW2A 2ONYA 4PC6A 4HDMA 3V8RA 4N3NA 4CF3A 4XQ9A 4AECA 2P2GA 3HBMA 2RK4A 1JA1A 2G9UA 3BX1A 4F3RA 3D8TA 1AX9A 3BJZA 2JFYA 3H2HA 3JQFA 3H5WA 4FHZA 3FAZA 2X9LA 4MYCA 1L5OA 1A9XB 2RJNA 1Q7CA 3O47A 1A2BA 1MO3A 1O95A 1P80A 2C83A 2FMIA 2JGEA 4Q3EA 5DSZA 3URMA 1P2DA 2LVBA 1GM5A 4ER5A 2OFXA 3UV6A 1R37A 3LUBA 3G7UA 4QU0A 3VNSA 3H1BA 1H0HA 2AW5A 1V11A 2WFZA 3QOXA 1YZLA 1Q16A 4H7PA 2DLCX 3CPJB 3UXEA 2RGCA 3H6GA 1DJLA 1EQAA 3NFYA 5FADA 5BW6B 1NOJA 3KU1A 4XWAA 3NHLA 4OLJA 5DTMA 3D0KA 2OCPA 2Q29A 4X00A 5BV0A 1DDIA 4IIDA 5DI3B 3QXHA 5LQSA 3QELA 3H16A 1QUEA 3VYUB 1JPVA 4PLFA 2XUHA 3QA3E 1DJNA 3UB3A 2XZLA 2VA9A 1KFEB 3IXQA 4GR4A 1XJ0A 4XARA 4QTYA 2ZI3A 2EFEB 4JNCA 2GLUA 2LWIA 4DNFA 2MCFA 2Y92A 2IBSA 1JQJC 1P61B 3WL5A 4NH0A 2DHRA 3IPRA 4OK6A 2YDXA 4EL0A 1E7SA 4KIUA 1W5FA 4CFYA 5KUTA 5HP4A 1HTBA 2VDWB 3WGJA 3BK2A 1OB5A 1BTOA 2BHSA 2KWIA 3ANYB 4B7CA 4GF5A 5BVHA 3OUTA 1ECBA 3EEQA 2VZ0A 2JD2A 1E9AA 1QGUB 1ZU4A 4E5VA 4I9NA 3SQMA 1AK9A 2W6PA 4DLRA 1U7OA 1TO1E 2Q2WA 4TRNA 3D0OA 2AV6A 4CV1A 3D2BA 3FDIA 3OLWA 2VJQA 1PJBA 2A9QA 2PXCA 3VC7A 4AMZA 5IVKA 3QLTA 2PMKA 3QBDA 1ZK4A 3TMAA 4AJNA 1JQLB 1VIDA 3NHMA 4RIGA 1H8HA 3PT5A 3EGDB 4C1NA 3L6EA 4X0EA 5TPZD 1BE8A 1GEGA 5GP1A 3W6PA 2DBZA 2GS9A 4FXOA 2XD4A 3FSGD 2V7EA 1T0HB 3IX7A 1JR3E 3QBEA 1F1JA 1DZIA 2NYVA 5JFTA 2HV8A 1U8EA 1UDRA 4YT8A 2DGDA 5KJEA 4IVPA 3SZUA 5I47A 1IUKA 3QRWA 4X54A 2OLKA 2WDPA 4RA9A 9GPBA 5F23A 1XU9A 1IQRA 3MJSA 1KK3A 4MW2A 2I54A 3D6JA 1N1EA 3GFRA 2JIOA 2W2VA 4PSCA 4I9GA 3IPCA 1HQKA 3CPHA 3MUNA 2GDZA 4RJKA 1NXQA 3CV3A 5FHQA 3PNQA 1ADFA 1VRCA 4WDQA 5DASA 1O3YA 2P2NA 4JI6B 2WD7B 3BTSA 4PSAA 2EFJA 4ZU1X 4HOYA 3I04M 1T9GR 3L1HA 4G0XA 4I6JA 4WCFB 1IC6A 4Q6WA 4EWLA 3TQRA 4MKZA 3RBXA 4KRGA 1XB2A 2VH2A 3EE6A 2BGUA 1PGQA 2JJ1D 3LDAA 5SYAA 2X2PA 3R3HA 5EZQA 3M49A 3COZA 4R81A 3RVDA 1JH8A 3S40A 4XCQA 2UVPB 3BQMB 4TQ9A 1AH2A 4EGSA 2JCBA 4QJ3A 5T6BA 3KALA 2ZR9A 2LRHA 4A36A 3AUXA 3ZU6A 2ORYA 4DUGD 4F4JA 1KI6B 2DWOA 3DJFA 2VNSA 3ZOKA 1WSWA 1ULTA 5E3IA 3U4HA 2EJVA 2RH8A 1JVSA 5CVVA 4Q21A 2DAPA 3ETHA 5DN6A 1OWOA 3AI1A 3GLGB 4HWTA 4Q9HA 5FHRA 5JAUA 4FDTA 2A9PA 1NM5C 2XH8A 4OHXA 3WLKX 4B7UA 4CLHA 3QU5A 5B6IA 3MINB 3P9YA 1N1DA 5HKOA 3ZH9B 1HMYA 2CNOA 4NE2A 1TZBA 2O20A 3ME5A 1P60A 4JKIA 2OFWA 2O3SA 1RXWA 3HDGA 3WGLA 1KZ1A 1T4CB 3PPYA 4LDNA 1G41A 4FM9A 4X5OA 3R40A 5HKLA 2RAUA 4B45A 4DDMA 1IE3A 3BF8A 5AJYA 5AKIA 3CVXA 2A3RA 2XB2A 2EERA 2MWMA 4C3VA 2F55A 2QW0X 1H3NA 2BGMA 1GYPA 4ALJA 2ZT7A 1TLLA 1SHZA 4QYXA 5IM4F 3AYXB 1CUVA 2OLEA 2AZMA 5JALA 1KGDA 1N6IA 4RZIA 4CKWB 1GKKA 2WWTA 2NUBA 4OHMA 2WDZA 4KG7A 3AUJB 4MVXA 3HV0A 3MA0A 4UBNA 3CNEA 1ZSNA 4QLBA 4LXIA 1WRBA 5ELLA 3S6JA 1M0TA 1LBHA 4LCBA 3NGXA 1NRXA 1F2VA 1LQTA 4HDRB 2A0FA 2IH5A 2FK8A 1OGYA 3OOYA 5ULLA 4FHGA 1P74A 3GFQA 3NBQA 4DPLA 5FIUA 4TYNA 4S1NA 1XKLA 4Q1FA 3OE5A 3TBHA 4EEZA 3DSRA 5LVAA 1NATA 2ZTVA 4FCCA 4TTQA 1VMEA 3K8YA 4TYQA 5T4BA 1YNOA 2C7PA 3FPSA 1HR0B 4LDZA 4BBJA 4DA0A 3BTVA 4D0RA 1TC1A 2VJOA 4E2FA 4GVLA 3OX3A 4XPIB 3GHYA 1I5OA 5KTMA 2IDKA 5JVDF 4GI3A 1YCDA 4QSHA 5A7GA 3N8NA 5M3BA 3PZRA 1A7KA 1UOEA 5IJ9A 1A2OA 3K7EA 3F8SA 4MHOA 1YTUA 4D97A 4ZRMA 4F84A 1QAQA 2BZ1A 1G8SA 3DBRB 3SXUB 2KW5A 1NY6A 4EH1A 1TYBE 2X15A 3JZAA 4YACA