4UULA

Apo trichomonas vaginalis lactate dehydrogenase l91r
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
334
structure length
334
Chain Sequence
SEAAHVLITGAAGQIGYILSHWIASGELYGDRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGFVATTDPKAAFKDIDCAFLVASMPRKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTNCEIAMLHAKNLKPENFSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEGKTQKVVDVLDHDYVFDTFFKKIGHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVPEGNPYGIKPGVVFSFPCNVDKEGKIHVVEGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
publication title Gradual Neofunctionalization in the Convergent Evolution of Trichomonad Lactate and Malate Dehydrogenases.
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 114
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uulA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4uulA02
1ZKMA 3INGA 3BMCB 3EC7A 5TF4A 3FSRA 1DIBA 2Q1UA 3K2BA 5JFOA 1XWFA 5KJCA 2QHXA 5F21A 3C1OA 2Q45A 5TX7A 2Y1OA 4WOKA 3E03A 4IIUA 1R0KA 3M6IA 3JD3A 5CPFA 4GMFA 1ADBA 2E49A 3ZU4A 2XXJA 3QWHA 3Q1LA 1JLLA 3DMYA 2CUKA 4J1NA 1S7CA 4W9NA 3PYLA 1B7GO 3ZWAA 3HFGA 1D7OA 1PR9A 1UAGA 3RUCA 1I36A 3FR8A 1LI4A 5CPBA 3P7MA 1U3TA 2UVDA 3ZWCA 2J3IA 3FNFA 5IZ4A 4J0FA 2RH8A 3C24A 1HDGO 4OKNA 3GAFA 3MJVA 1E3JA 3JQGB 1DIAA 2ZYGA 4WJZA 6LDHA 4QUKA 2NUAA 3K31A 4DL9A 5ES3A 3ZNOA 2DPGA 1A4UA 3ZZNA 1ZIDA 2V6MA 4BNKA 4BB5A 2V65A 1Z7BA 5A4DA 1B2LA 3P2YA 1EDOA 1JKFA 4J4BA 1UDCA 4YQYA 1JU9A 1RJWA 4M1QA 4PG6A 2Y93A 4ND3A 1R4NB 3U62A 4DIFA 3JSAA 3AFMA 3B1FA 2X4GA 4CQMA 5HBRA 3V1UA 2YV3A 1ONPA 2E6UX 1PWXA 3C1AA 4E5PA 4BV9A 1Q0LA 1LRLA 3K30A 4J1SA 3WS7A 1T1SA 3DXFA 4L76A 1GQ2A 3OJOA 3OECA 3S1LA 1P1IA 3PHIA 3AU8A 2CDCA 3ENNA 1UXGA 4J2HA 3BMQB 1RPNA 2BRUA 3AOEC 3K5PA 1NM5A 5L4LA 4BO2A 1R15A 3GVXA 1EE2A 3PJFA 1VL0A 3RUDA 1PL6A 3TN7A 1TXGA 1B14A 1LBEA 1WDMA 3HDQA 4WLNA 3OA0A 3BIOA 1HKUA 2VN8A 3TZKA 5DCYA 3V8BA 2F00A 2X5OA 2X5KO 3GUCA 4OJNA 2QQ5A 3GRKA 4Q3BA 4OYRA 4YVFA 1HT0A 1HDOA 2NU9A 2ZJ0A 1UH5A 1E1MA 4OKIA 2PNFA 3EK2A 3F1KA 3WSWA 3RROA 1B3BA 1NHGA 1P0FA 1U4OA 3EAGA 2XOXA 4XYGA 4BO9A 3UOGA 1U3UA 4XYMA 1PEDA 1K0UA 3NT5A 1DIHA 2VRCA 3ASVA 3UCFA 3F4BA 4YRAA 3U4IA 4AJEA 2G17A 3DONA 5JCJA 1HE5A 1SNYA 2CNBA 1BDBA 1GV1A 4IZIA 3UAGA 1KOLA 4MVJI 1WMBA 1E7WA 5H81A 4IS3A 3NDIA 1HEUA 2JL1A 3FNGA 3AM4A 2X0JA 1HDCA 2NWQA 2P5YA 1OAAA 2Y1EA 3PI7A 3VHRA 1SEPA 2AG5A 3ONDA 1W4ZA 3PWZA 1ZZEA 3F3SA 5I8WA 4DLLA 3DAGA 1IHXA 2ZB4A 2AMFA 1QYDA 3EGOA 3KM0A 5JY1A 5IDYA 3UN1A 2BFMA 3GT0A 4RQTA 3HADA 1I33A 2C5AA 3ULKA 4RCVA 2HSDA 4HV4A 4RVDA 5ILGA 1E3IA 3KVOA 3ICCA 2PY6A 3ITKA 1ZXLA 5JDCA 4ONEA 1PGJA 2I66A 5TGDA 4M87A 3RFVA 2WSBA 4J2OA 4WECA 1HDRA 1YB4A 3PHHA 3GVPA 4R1UA 1NR1A 1DLJA 1ENZA 1Q1NA 3I4FA 5ER9A 4EI2A 4MVJG 2BGKA 1VL6A 2XF8A 4W99A 5TIIA 4NK4A 3OQ1A 3AWDA 3TQHA 3ZV4A 1U2DA 2Y0DA 1PGQA 2DC1A 4P4GA 2Q3EA 4R1TA 1DFIA 1QXSA 1I0ZA 5BT9A 1OI7A 3DHYA 1QYVA 1KERA 1ZFNA 2FR8A 4B3JA 1BSVA 1PU2A 3H8VA 1BW9A 3L6EA 3N58A 2O3UA 2VHYA 4QX6A 5CHEA 3BMNB 1I32A 1DIGA 3BTVA 3S2IA 1VJTA 7MDHA 4E4YA 4MP8A 5B4TA 4M86A 4CLRA 3FRJA 4UREA 4RF4A 4NFSA 4ITUA 2PKQP 3WB9A 3GAZA 4J9VA 2DQ4A 4DUPA 2X6TA 4FFMA 7ADHA 2CD9A 2O4CA 2IRWA 4G65A 1PZEA 3EDMA 4GWGA 4Z9FA 1M75A 1RM3A 3ZNPA 3P2OA 1U3WA 4JBGA 1LU9A 1I3MA 2GN9A 4Q3CA 3AUUA 3ZDFA 3L9XA 3WTCA 1Y8QB 1GEGA 1GY8A 1CDOA 4OIMA 1LUAA 5AXBA 1SEVA 2VCYA 4MVJD 4LSWA 4Z0HO 1NXQA 1PGOA 1XR3A 1UUFA 2BFAA 3KYCB 4IINA 4WNIA 3WX0A 3RUHA 2HMVA 4YDRA 1DEHA 3PIDA 4BNLA 5KNLA 3E9MA 2NU8A 2YYYA 3JV7A 4BNNA 2VNSA 4JJIA 2PK3A 3PVZA 3DFZA 1NFRA 1YWGO 3DAPA 1JN0A 3JYNA 3JYPA 3VOSA 3ZWBA 4EUEA 2ZCUA 2Z1MA 4GH5A 1AHIA 1P45A 4UUPA 3W8FA 1T2FA 3RKUA 1SO8A 5A03A 3H9UA 2RIRA 4Q9NA 4YB8A 2X23A 5C7IO 3U49A 5F3RA 4FFNA 1W6UA 5F1KA 5HTOA 3DBHA 5KJ1A 4U0JA 4KMSA 4I5GA 2GUGA 5DULA 4NNJA 2X9NA 1Z74A 1GCUA 2W2KA 4IDCA 4NJMB 1ZXBA 3ON5A 1WXDA 4WUVA 4E2XA 5KWEA 4M55A 4FJ0A 4YA6A 2EHDA 1GYPA 2LDXA 2X0IA 4GGOA 1WMAA 1DDOA 1XG5A 1PZFA 4CM6A 2C2YA 3QSGA 3TRIA 3L4SO 3GZNA 3VDQA 1U5CA 3WLFA 4ROSA 5L95A 5IDWA 3JQ9A 2JAHA 2G76A 2FP4A 2EKQA 2HJRA 3DMTA 1B8UA 1Y6JA 4OSPA 3B1KA 4E12A 5F1OA 4RL6A 2GASA 5LC1A 5JXWA 1UP4A 2I6TA 3PHLA 2Y99A 1UXHA 2GYYA 2B5VA 3IMFA 3NTRA 3SBOA 4L4RA 4EW6A 3KO8A 1CJCA 2AEJA 4FIZA 2ZATA 5G0VA 5IJZA 1DB3A 1L7DA 4HP8A 2QYSA 2X0RA 2PGLA 2ZTLA 5K6AA 4D0SA 1ZK1A 3VPFA 4D3SA 1E6EA 2VZ0A 3OM9A 2Q1WA 2Y68A 1RM4A 3L4BA 2YHIA 4H7PA 4IBOA 4D79A 2NTVA 4E3ZA 2P9GA 4UULA 5A04A 3BAZA 1YBAA 2HLPA 4G5HA 3COSA 4B7XA 2FRDA 3GRPA 2IXAA 1UP6A 3JQFC 4D7AA 4ZRNA 3IC5A 1ENYA 1FDVA 2YY7A 2P9CA 2FY8A 2DTXA 4HBGA 4F3YA 4QO8A 4A10A 5ITWA 2Y1FA 2ZB8A 3PZRA 1G1AA 2D5CA 2P68A 3H9JA 4CMCA 2WE7A 4E32A 4K26A 1A72A 5F5NA 4HNHA 2JD1A 5JY6A 4NZ9A 2Z5LA 4XQCA 1Y9AA 4RLHA 5A3VA 2O50A 2CSUA 4W82A 3OEWA 3U09A 1EFLA 1QLJA 3WGQA 5JLAA 3T4XA 4EYEA 3NGXA 3TF5A 1P3DA 5JO0A 5DNAA 3WGYA 2FZEA 3INTA 5L4NA 1NAHA 4Z3DA 5JAZA 1UZMA 3NRCA 4YYZA 1HSOA 2HMUA 4DREA 2VT3A 3D64A 1JVSA 5AQ1A 2W2LA 4Y6SA 1D4FA 3SVTA 4NU5A 3AY6A 4ZN6A 3DTTA 2DTDA 2EEZA 2WEKA 1GQYA 3D3WB 2UAGA 2ZTMA 4HNGA 1QSGA 2R2GA 1DLIA 1UDBA 4Q3EA 2HJSA 5EMHA 1HLDA 3KYDA 1FDSA 2WD7A 2GN6A 3TWOA 2VT2A 2RHCA 5C7OO 2Q46A 3JQ7B 2NVBA 3ZWVA 3HN2A 3MZ0A 2UUOA 3P19A 3VDRA 3H2ZA 4U8GA 4B4OA 2JKVA 1K3TA 1N1EA 3R6DA 4PZEA 4BO5A 3KZVA 3PWKA 5BSHA 4KOAA 1NTOA 4JJGA 5BR7A 2P2SA 4M89A 1XQ1A 3DZBA 4W7HA 3EW7A 4BNMA 3NEPX 3WIDA 2Q1SA 1X14A 5A9TA 4PN3A 3K6JA 1ZBQA 3ZN2A 2VUUA 2QX7A 2Y1DA 3H6KA 3LLSA 4MVJE 4PLFA 4J4HA 1ZEJA 2ZYDA 3CEAA 1EUDA 5AXAA 2EG9A 1D3AA 4BNZA 2VQ3A 4BGEA 1GAEO 5EINA 5B4VA 1T2AA 3RU7A 4AJHA 5L7YA 3RVDA 3WGHA 3OA2A 1EK5A 2Y0CA 3KV3O 4J16A 4UEKA 1CETA 1BXGA 3PJGA 1LEHA 5F1PA 1DHRA 4BNXA 3WYCA 3DZKA 3T7CA 1K6IA 5KJ6A 5I9MA 5ADHA 2P91A 4NQZA 4DIOA 1XELA 3D1LA 4CPDA 1CIVA 1KVUA 3FNHA 3MOGA 1EMDA 3BHIA 1ENPA 1A27A 4BV8A 1P1KA 4FFOA 2OXIA 3CKYA 4J1TA 4YWJA 3AI2A 1PZGA 1XHLA 4R3NA 5JS6A 1VJ1A 1EVZA 1Z45A 2DKNA 4DPMA 1MV8A 3FD8A 2JFHA 2G0TA 4BS9A 1SBYA 2YZ7A 1YOVA 3C85A 4ND2A 3ZNQA 3WWYA 3OQBA 1XU7A 3LLVA 4UEOA 2AQHA 4XD2A 3PRJA 5I8ZA 3QWIA 1ISJA 4E33A 4EUFA 3AOGA 3L6OO 4CMIB 3UXYA 3IUSA 1RYEA 4IDBA 2Y0EA 5HM8A 4GAEA 4IXTA 1WWKA 3OP4A 3SJUA 3I9MA 3S55A 1YVEI 1MXHA 1ZMOA 1LLCA 1SZJG 2X0NA 5G4KB 3Q3CA 2JAPA 2C5EA 3GDOA 2GZ3A 4WCDA 3ORFA 2BLLA 2GZ1A 4LISA 1PX0A 1MB4A 4RVSA 8LDHA 3VZPA 3DZJA 1U5AA 1Z82A 1ZK0A 1IZ9A 4CLOA 5I7FA 4CMEA 5BQFA 2DUWA 2R00A 4L4XA 4PLZA 5A9SB 3AFNA 3QVSA 2NU7A 2HMSA 2VWPA 1AXGA 2HKIA 1K2WA 2EGHA 1QYWA 4PRKA 4OL9A 1XGKA 3FWNA 1K5HA 3DQPA 4MVJH 1C1XB 3UW3A 4WKGA 4IQGA 2IZZA 2H63A 4GLOA 1E6UA 3EUWA 4NG5A 4XDYA 4L8VA 2VZ8A 3GDFA 3JQDA 3ZHYA 4ALIA 1YL6A 3KOUA 4J1QA 3E18A 4R1SA 3GOHA 4BIIA 1GEEA 4KZPA 1LSOA 4HWKA 1E3SA 3O26A 2FR1A 4U6SA 3GGPA 4TVBA 4ALMA 3M2TA 5IAAA 4DYDA 2DBVO 4Z0TA 5TQVA 1BG6A 4WK6A 4B8WA 2BI7A 2YW9A 3HZZA 3P5SA 4PRLA 3BA1A 1CYDA 4XRRA 3ETGA 1BWSA 5JE8A 3ZNNA 3KUXA 1E1KA 2BD0A 1U7TA 4IJUA 4IQ8A 3DOOA 1DFHA 5THKA 3FN4A 2NQTA 4XR4A 1VM6A 1PZHA 2Y1GA 3FTPA 1N2SA 2C29D 4UUNA 1GCOA 4I5DA 4YTEA 3IL2A 1F06A 3SEFA 5HRUA 4LMRA 5CFZA 5FEUA 5DCUA 1VJ0A 5DP1A 5TNXA 4DVJA 2H9IA 3Q6IA 5GZ3A 1EUCA 5IZCA 4MP6A 4HY3A 5L40A 2BHLA 4FR5A 3DBRA 4S3MA 5A1TA 2DAPA 5GY7A 1HLPA 1LSSA 1NPDA 1TEHA 1XA0A 2D8AA 4CR7A 1C1DB 4N7RA 4DBVO 1V3VA 4KUGA 3H65A 4KWIA 1GUFA 4DYVA 5CG2A 2CZCA 1OC2A 1LNQA 3EMKA 4RF5A 3FNEA 4YJDA 4C7JA 4D3FA 1CERA 3D0OA 3KYBA 3GZ4A 1FK8A 4F46A 2C0CA 4XGNA 1EZ4A 4TZKA 4C4OA 4A5OA 4FGSA 4CM8B 4E31A 1BVUA 1H5QA 1ZNQO 3WFIA 4UVDA 2EV9A 4CV1A 4WNCA 3RC2A 1FMCA 1YB1A 4FFRA 3SC6A 4M49A 3M2PA 4WEQA 4YAEA 4ZRMA 4D45A 4EUHA 2C59A 3TL2A 5U9CA 4A73A 2Y05A 4S1VA 1R4MB 4CM5A 4DLAA 4L75A 3UKOA 5COBA 3H4VA 1J5PA 3NUGA 3QIVA 3RJ5A 4XZ3A 4BMVA 4PIVA 1GPDG 5T67A 1MG5A 4HFNA 3PYMA 4WLUA 2CY0A 3HSKA 4RF2A 1TA4A 3ROPA 4PG4A 1X0VA 1I3NA 3DWFA 3RFTA 1F17A 2XPCA 3GEGA 3B6ZA 1ADGA 2NACA 3OJFA 3VH3A 4BKQA 2UYYA 5TJHA 4TRMA 1RWBA 3AY7A 3JQBA 2YDXA 4DQXA 1E7MA 1AXEA 3EVNA 5JAMA 5DT9A 5KKAA 1PS9A 4EJ6A 2V6GA 1IY8A 2A4KA 3WGZA 3PWSA 2PLAA 3A1NA 4ZICA 4NI5A 3KB6A 3E5RA 3FWZA 4OQYA 5JMPA 4YT2A 3JYQA 3VC7A 4BGVA 5CDSA 2X9GA 4K28A 4I1IA 4WLEA 4NBUA 4HXYA 3QV1A 3C7DB 1I2BA 4ND4A 2HU2A 5JDIC 5LDHA 2EP7A 4WCFA 4IDDA 2WD7B 4RJTA 4CM9D 2BGLA 4BHTA 2CF5A 5COQA 5CDGA 2C82A 4U6QA 2VYNA 3G79A 1DBVO 1A7AA 4RQUA 4NFHA 1F8FA 4XQEA 3ROMA 2I3GA 2UV8A 4R16A 4BKRA 4PLPA 4OM8A 4BO3A 2GN8A 1JDJA 2OP1A 3Q9UA 1BRMA 2NADA 4OQZA 2HMWA 1J4AA 4GX1A 3RUIA 4LVCA 4U0KA 4QSMA 3QP9A 4A26A 1DRUA 4IUYA 1EFKA 3PIIA 3TZQA 1GZ4A 3E1KA 3KETA 3AK4A 3F4LA 4H16A 3FPCA 4XJTA 9LDBA 4FOSA 4WOJA 1KY4A 3IAHA 4A0SA 1WAMA 4YJGA 5JC1A 1E77A 4O63O 3L0DA 4TRNA 4Q3AA 4E13A 3HDJA 3Q9NA 1YQDA 1EQ2A 4E2ZA 1E5QA 1GYQA 1LSJA 4MOWA 4K6CA 1P9LA 2FMUA 4PCVA 2B0JA 4P4NA 1U2GA 5IN5A 4Z9YA 3STHA 3K92A 1TLTA 1A7KA 3GVHA 1DHTA 4IY1A 3LT2A 1DRWA 3QWBA 3HHPA 2BH9A 1SMKA 4BO6A 1DIRA 3CTMA 4PFJA 4BKUA 3GMDA 3HB4X 2NM0A 2PZMA 3AU9A 5AVOA 3PHGA 3QVTA 1MX3A 1Y8RA 4BO4A 4YJHB 2GD1O 2BELA 2HUNA 4YXFA 2ZB7A 4ALLA 1SOWA 1X15A 4J7UA 4Q39A 4ZA2A 3HE3A 1YOVB 4LK3A 2AE1A 3UVEA 4YQZA 3D4NA 2CF6A 5LCXA 2EKPA 4MVJF 1M6HA 4BGUA 3I9NA 3QY9A 3UICA 3H7AA 4GBJA 4J7CA 2P4HX 2IDZA 4MJLA 4P4LA 3GG9A 2AG8A 4Y8VA 3GDGA 3PJDA 2HAEA 2PD4A 3RCBA 1P1RA 3WGGA 5A5FA 2E82A 5BNTA 4CL8A 1LC3A 3JQ6A 3JQ8B 2GO1A 3QWFA 5TJ9A 4NMHA 4XIJA 5DBFA 2B69A 1T2EA 3OFSA 4DC1A 2ZCVA 3HNPA 3ITDA 2UDPA 4KUHA 3ROQA 3GFBA 2IEBA 4AFNA 4FSHA 3NTQA 4UVEA 3WQSB 1D1SA 2JFGA 1Q7BA 3RKRA 1A4IA 3I9JA 3O8QB 4TKMA 5HS6A 2AQ8A 2EF1A 1DRVA 4XYEA 4YAKA 1DAPA 1ARZA 3IOYA 3PQFA 3GNSA 3Q2KA 4INAA 2O2SA 1LC0A 1AHHA 1KY5A 4KWHA 1F0YA 1B3RA 4FW8A 2OBNA 5A05A 4L4SA 4QXMA 1IPEA 4NIMA 3AUAA 4IIVA 3UCEA 4KQWA 4AJLA 2AHRA 4B3HA 3LZ6A 5HWSA 1RYDA 2BFOA 2GSDA 1GPJA 3DBLB 4PGFA 1NAIA 4CQMD 4M54A 4B4UA 4CMJA 3NGLA 2W90A 4QT0A 5ENVA 4R69A 4MKRA 3U5TA 3AJRA 2V6FA 4RDIA 3A06A 3FCOA 2VTEA 2OHXA 3MJSA 2PKRA 1MFZA 1P33A 3DAFA 2VZ9A 2VOEA 1K89A 1WP4A 3H9GA 1VKNA 4JXKA 1W8DA 4NR0A 3VZRA 2Y67A 5TT1A 4DGSA 2W8ZA 1LLUA 1H9BA 4H3VA 4M8SA 4NDNE 3BMOA 2Z1NA 1LRKA 1BGVA 5HS4A 1SCUA 3TSCA 5C3MA 3IKTA 4IMPA 3M1AA 2A94A 1XYGA 1OOEA 3C7CB 3HG7A 1FDUA 4PVDA 4JGBA 4NBWA 4QECA 1Y1PA 1IPFA 3OJ0A 1O89A 2B4RO 4BQRA 4R9SA 3JD2A 4K9DA 5EJ2A 2WE8A 2YQ5A 1GADO 4TRRA 1WDLA 2GGSA 2GCGA 2WMDA 1NVGA 3GA0A 2NLOA 3WG9A 2VRCD 1QYCA 3IJPA 2FPPA 1LA2A 2YUTA 3F9IA 1NQTA 1KBZA 3I5MA 3V1YA 3S8MA 5JCJD 3GEDA 1Y9EA 5JC8A 3PGXA 3PGJA 4MIOA 3H2SA 1CRWG 4GMGA 2GDZA 2ZB3A 4FJ2A 4ZJUA 4RF3A 1PJ3A 3JQAA 1Z73A 1O5IA 2D1YA 3RD5A 3K8ZA 3AOEA 4BNWA 4Q3NA 4L74A 3QVXA 2NVUB 5KJEA 1HETA 2QW8A 2PZJA 4RPGA 1E7RA 3K96A 4GX5A 1ULSA 2EW2A 1J49A 2LDBA 3CZMA 3LSYA 4YT5A 4HADA 4ZQHA 3R3JA 3NT2A 2VYVD 1ZVMA 1A9ZA 1NPYA 2OL4A 1YBVA 4HX5A 3GN2A 4CQLA 2O4UX 4FBGA 4GL4A 2BGMA 3I23A 3SLGA 4E0BA 4UVGA 5U1PA 1PJTA 5T8KC 1IYZA 1P77A 1HYGA 1LX6A 1HYHA 3W4IA 1GTMA 4JP2A 2EW8A 4BOYA 1ZJZA 2YFQA 3MTGA 3LC1O 5DCWA 1E3WA 3UHAA 3H3JA 2J3KA 3W4KA 1HRDA 4CLDA 1Z7EA 2X9VA 2VHWA 4U5QA 5IXYA 2ZJ1A 1BTOA 3HJAA 2PH5A 3ROKA 5KCZA 2QIOA 5JW6A 2FSVA 4XCVA 2PH3A 4R3WA 4WLOA 3BTOA 3KHUA 4ND5A 1O0SA 5JYEA 1KC1A 2FZWA 2PR2A 3BZUA 2HMTA 4J6FA 4JBIA 4JQCA 3GEMA 4O0LA 3U9LA 4XRGA 2YHUA 1DXYA 1K6JA 4TWRA 4ZU3A 1C0KA 1TT7A 1U4SA 4UUMA 1GR0A 1PQPA 4E5MA 1KVSA 2AW5A 3OMLA 4FPXA 3E5MA 3DZGA 4L9RA 5DOZA 2DVMA 1LDGA 1X0XA 1BDMA 3GPIA 3QE3A 1FDWA 2DUUA 1N9GA 3SX2A 4CODB 1AGNA 1H2HA 1YL5A 4E30A 4AL4A 4BVAA 5TC4A 2O3TA 1M67A 1E7QA 1HL3A 1QG6A 3MJEA 1IHYA 2FHSA 5T6BA 5IDXA 4J91A 4N54A 4EBFA 1N7GA 5T64A 4D3DA 5B4UA 1YE3A 1H93A 1I10A 4F45A 1NVTA 5AYVA 5JMWA 1HE2A 1JA9A 1VKOA 1PWZA 5L51A 3GGGA 1AN9A 4DTIA 1JQBA 2X5JO 3BMCA 4Z9XA 3Q0EA 1E3LA 3TPCA 2X22A 3MJTA 4CMAA 5EQFA 4E2YA 4J0EA 3DC2A 2OGUA 1EEHA 1YB5A 1VLLA 4CMGA 5CAEA 4CQMB 3E48A 1I2ZA 1T26A 2IE0A 4IJVA 4II2A 3NJ4A 1YXMA 3KSZO 1ONOA 5FWNA 2EJWA 3EVTA 5CP8A 2AA3A 2QZZA 2IODA 4CR6A 3LF1A 3RIHA 4B8ZA 2PWZA 2C2XA 4QTZA 1DAOA 2PFGA 1YKFA 2D4AA 4WLFA 1PGNA 2X86A 1NFFA 2FR0A 3GQVA 4HKTA 5EIOA 3TZCA 4I9UA 3PP8A 4IJWA 4YJGB 5TLSA 4HFRA 4JX8A 4PLCA 1LQTA 3QW2A 1P0CA 3CH6A 3FF4A 4GWKA 5G0WA 1N8KA 4DPKA 4XB2A 3R1IA 3GG2A 1T4BA 1X7DA 2QZ9A 4NBRA 3JQGA 4XDZA 4TZTA 5G0UA 1JWBB 3ZWNA 4ILKA 4OGWA 2AQKA 3KSUA 2C20A 2DPHA 2ZYAA 2I67A 1QP8A 3HB5X 3I4CA 4BQPA 2B83A 5DBIA 2OMEA 1ISMA 5C5IA 2OZPA 2VWHA 4BNHA 3GH3A 3ZU5A 2EGGA 3DHEA 3QRWA 4R1NA 4W4TA 1Y8RB 2A92A 4JK3A 4IJKA 1SB9A 1R4NA 3PFWO 2XAAA 3WICA 2WYVA 1P44A 1B16A 2VWQA 4IMRA 1T2DA 3WXBA 3GVCA 4J7XA 1VSUA 5DBGA 1Y81A 4OXYA 1ONNA 3IP3A 4IQ0A 3VPSA 2PV7A 2AE2A 3NAQA 4IXWA 4CV2A 4R68A 3U4DA 4B3IA 3OIDA 4CLEA 4KDEA 3IP1A 1KEWA 3KXDA 3WGOA 1O94A 4F6CA 1NR7A 4JIGA 4OHUA 5K9ZA 3BMQA 1IOLA 3IUPA 2HK9A 2NNLD 2X58A 1NWHA 3PYXA 5JSFA 1EVYA 2CFCA 3W6ZA 1PJSA 1GV0A 1YBMA 4DXHA 4ID9A 2C7GA 1G6KA 5FI3A 3ASUA 3I9KA 4CL3A 3JCZA 1OC4A 1HXHA 4P38A 2POQX 2OOSA 4N18A 1EBFA 3HWRA 3LDHA 3WGTA 1R12A 2P4QA 2P5UA 3PDJA 3GHHA 1UZLA 5BNFA 4XGKA 2IYOA 3GVIA 3W1VA 1G0NA 2W98A 3BXXA 5L3ZA 2JD0A 3E9NA 3HFSA 3HQ4O 2O7SA 1AE1A 3AUSA 4P22A 3WR5A 1ID1A 4D44A 3ICPA 1QR6A 3RC9A 3V5NA 2GNAA 4BNVA 1JAYA 2VUSA 3SLKA 3R3SA 4BNGA 2W2LD 4B4WA 3F5QA 1BW9B 3ANLA 4J4TA 4KTTE 5EERA 2JFFA 3GPDG 3PK0A 5KJFA 3M1LA 4XYLA 3D5QA 1LDNA 3JQFA 3UH1A 4CLRB 1I01A 4CLXA 2B35A 2WDZA 4BMSA 1XSEA 3MOIA 5FF9A 4ZGWA 1H6CA 4BNUA 3KEOA 4W9NC 3H5AA 1ISFA 4GI2A 5KVCA 4D41A 1V3TA 3V1TC 1XIVA 1FXSA 1GYRA 3BMOB 1TVEA 3VH2A 4XR9A 1J6UA 3B20A 1T24A 5KVSA 3EYWA 5A02A 5A5EA 2ZTUA 4N5MA 4RDHA 4ZQFA 3CINA 3H9EO 1H6DA 4XA8A 4YAJA 2IZ0A 2V6BA 4CM7A 2X8LA 2DFDA 4W7IA 1H6AA 1V0JA 4ZQEA 4ZD6A 2GLXA 2GZ2A 1P1JA 5DDIP 3DFUA 2R6JA 5KKCA 4YCAA 1ZSYA 4FC7A 4FD3A 2G5CA 3WLEA 4PLTA 3RC7A 2Q99A 4E5YA 2O23A 1H0KA 1N7HA 1UDAA 1R0LA 3S2EA 1U3VA 1C3VA 2H1SA 4BO8A 1XQ6A 4A7PA 4TROA 4ALNA 5CDYA 5DP2A 1ZK4A 1SOVA 4FFPA 1I8TA 4GLLA 3ZU3A 1JVBA 1ADFA 3WSVA 3D3EA 1MC5A 3AM5A 5JO9A 2VHVA 3KRTA 4LCEA 3ZGYA 2JJYA 1IE3A 5JPIA 4DLBA 3K9QO 4IGFA 1WLYA 2EXXA 4YT4A 2YV2A 4RORA 4UVIA 1Z6ZA 1LLQA 3DBHB 4R01A 3GFGA 4NH4A 1PJ4A 1Z75A 2VNAA 3N74A 5MDHA 2B4TO 1M2WA 4CQLB 1ISIA 1R16A 2W2KB 3GK3A 4FCCA 5U4QA 4DQVA 3JD0A 1KETA 1KC3A 3CXRA 4DBZA 1X7GA 1V9LA 4BO7A 5KTKA 3WGIA 3TFQA 1M66A 3GZNB 3PFFA 5B37A 4MIEA 3KYCA 1JTVA 2DLDA 3OJEA 4Z6KA 3UF0A 3B1JA 5K0ZA 5AOVA 4NPCA 4RGBA 1Y7TA 5L7TA 4IPTA 4AJKA 1WZEA 5JYDA 2OO5A 2VHXA 1DOHA 3A28A 3PTZA 4NBVA 2YQ4A 5CEFA 1MA0A 3IDSA 3DZHA 1SC6A 3ZV5A 4NJOA 1PJCA 3LU1A 2FWMX 3MTJA 2V7PA 2JD2A 2XXBA 1LDEA 4MVJM 1LDYA 2J5RA 4AJ1A 1EE9A 2ILTA 2YHIB 4K1LA 1GD1O 4IS2A 4BGIA 1NX6A 4DIBA 4D0RA 4IDEA 3G0OA 1FDTA 1KYQA 3GLQA 4OSOA 1PR3A 1E92A 2F1KA 4DPLA 4HFMA 2E4AA 4KTVE 3G1TA 2JCYA 4W6ZA 1MGOA 3MWEB 3Q2IA 4DQUA 1HDZA 9LDTA 3DOJA 1KIFA 1QMGA 1JKIA 4NJMA 4EJ0A 3OIFA 3B70A 1T4DA 2JCXA 4BMNA 4EDFA 4U7WA 5L45A 1BXKA 1JAXA 2O3JA 1EQUA 3VPXA 5ICSA 2X7HA 4ALKA 3V2UA 5TSDA 4YT8A 3ADPA 1W0CA 5JDCC 1I5RA 5AXDA 2BI8A 4Y6RA 4PVCA 1HDYA 3AY3A 3G1UA 3PJEA 5CEEA 3TZ6A 5F5LA 2EERA 1N92A 3EY4A 3K2EA 2E48A 4TMFA 4UEJA 4YAIA 1YL7A 2VWGA 5G0TA 1E3EA 3VZQA 4JN6B 4IDAA 2PA3A 4J3FA 3W8DA 4BNFA 3DDNA 1BXZA 2ZQYA 3SJ7A 4CM4A 4CUZA 1YO6A 4XIYA 1R6DA 4FN4A 4N5NA 1DC5A 1GUYA 2IXBA 1MXFA 2DT5A 3QVWA 4EEXA 4I5EA 4IDGA 5H82A 2RCYA 3KYDB 3O38A 4G2NA 4PLWA 3E9QA 1D8AA 3GY0A 2I76A 3DZIA 5T57A 4BB6A 4WASA 2QYTA 5TT0A 3CE6A 3MEQA 2FOIA 3WQRA 2PKQO 1NASA 4KQXA 1PQWA 3OQ6A 4JNKA 4CMBA 4XGIA 5G0SA 3UUWA 1B15A 2GF2A 4I8XA 3AW9A 1T2CA 3OICA 1NFQA 2BMAA 1LQUA 3PQEA 4HUJA 3VPHA 2DM6A 5G4LA 4ESOA 3ABIA 2NTJA 4GPD1 2VRBA 3AM3A 3ETEA 2J5QA 1I3KA 4GX2A 1YQGA 2O48X 1HTBA 1WPQA 2PGJA 3O03A 5FFFA 3WNVA 3C7AA 3RBZA 2Q2WA 4DMLA 4LW8A 1PJQA 4XQ9A 2CVOA 4XX0A 3EHEA 5ICMA 4R9RA 4DWVA 3D7LA 3IKVA 4GSLA 4E6PA 2NV6A 1Q0HA 2JHFA 3C1TA 1BXGB 1MC4A 1V35A 3JYOA 2FN7A 4XJSA 1PSDA 3D3WA 3PLRA 4ZHSA 5L4SA 3RFXA 2O3RA 4DC0A 2QRKA 1PJBA 1X13A 1YONA 3FBTA 4XYBA 2RBEA 5DF1A 4MDHA 5FYDA 5EQDA 2ZQZA 1CQIA 3JQ7A 1IZ0A 3I9LA 5I9NA 2Q2QA 1B8PA 3E82A 3ZWWA 4RVHA 2OBYA 1CF2O 1ORRA 4KDFA 1KEVA 1Y5MA 1Q0QA 3L6DA 4O1MA 3F47A 2G82A 4YRBA 2EIHA 3SC4A 3VTZA 4FB5A 4WEOA 2O7QA 1X1TA 2BKAA 1GDHA 5BSEA 4XKJA 3QWAA 2O2YA 3RI3A 4NBTA 1Q7CA 3LVFO 1PJ2A 1P31A 1ZW1A 2HQ1A 2D59A 1KEUA 1W73A 4MVJA 1EUZA 1XU9A 2I3AA 3E6AA 1NVMB 2RH4A 3JQ9C 3FTNA 3FBGA 1C0LA 1U1IA 2D3TA 3DMTC 4II3A 3HUDA 1UR5A 1EBUA 3A9WA 1ISGA 1DC6A 4YJFA 1XKQA 3NT4A 1GU7A 1DFGA 5A9RA 3L77A 3MCVA 4CLOB 3A4VA 1N1GA 3BHMA 3PXXA 4AJPA 4RZIA 5A06A 4OMUA 1PGPA 1RKXA 2I99A 1X7HA 3OH8A 3VVBA 3I6QA 4XB1A 4BKOA 5K6AC 1V8BA 4CLHA 3DO5A 2DBRA 5IN4A 1F12A 1IUKA 3L4BC 4YPOA 4D46A 4LCJA 3D4PA 2VYND 4R5HA 2H5LA 1QKIA 1VL8A 3QA9A 3QLJA 3ANMA 2VYVA 4K6FA 5ITVA 5KIAA 4KP7A 1ENOA 2FSSA 1U8XX 4O6VA 2O3QA 3A14A 4I08A 1HYEA 4CMIA 1E7SA 1LXCA 3TFOA 3JQCA 4CV3A 1LTHR 1UAYA 4GGPA 3ZW8A 4Q3DA 2C54A 3MJCA 1SB8A 1X1EA 3RBXA 3LC2O 3W4JA 2SCUA 3WYEA 2Q1TA 1UXJA 5GMOA 5KOIA 3NYWA 5G4KA 5I7SA 2PD3A 5ENDA 4AJ2A 4R4JA 3ANNA 3KLMX 1L1FA 1RM0A 1GZ6A 4IDFA 1XEAA 2IYPA 3PHJA 3GC6A 2A9FA 2TMDA 4HFJA 1GUZA 1QORA 6ADHA 2G1UA 3LK7A 3X2FA 2W4QA 4E5NA 1R0SA 3LT4A 3ENKA 3G49A 5DOVA 5DZSA 2B5WA 5I9LA 3JD1A 4LMPA 5G2OA 2JHGA 3ZH2A 4AJOA 2I5PO 5JDIA 5A9SA 3AI1A 1ZH8A 1DJNA 3GNQA 3H9QA 5LDGA 3TNLA 4R51A 5CG1A 2OORA 5JAIA 4YRDA 2WTBA 2Q4BA 4J49A 1NBOA 4UAGA 3PQDA 4J9UE 3TDKA 1PS8A 1N5DA 3UCXA 3CMCO 3F46A 1HSZA 4LSMA 4UVHA 4PZDA 4MKXA 1ZSVA 1C1XA 1ZK3A 5BSFA 1LDBA 2YFHA 1OFGA 2OFPA 3LC7O 4C7KA 1PL8A 8ADHA 5ILOA 3PEFA 1SAYA 3KBOA 1MUUA 3DBRB 4B7UA 4CM3A 5CDTA 5IDQA 4OOFA 1KVRA 5L7WA 1I3LA 4QQRA 1HDXA 4D42A 3R0IA 5JNLA 1ZJYA 1E1LA 3F6YA 3L9WA 4F6LA 3GN1A 1LDMA 2D5AA 3PDUA 4QO7A 3WJAA 1FF9A 3CZRA 3HDHA 1SPXA 1JW9B 5JCXA 1VC2A 1VRWA 4FQ8A 2FPGA 5I7VA 3NJ8A 1ZMTA 1Y5RA 2PGDA 1DC3A 5B1YA 3EZLA 2DU8A 3GHYA 2NSDA 4EJMA 4RPLA 4FOOA 3WBBA 3F1LA 3TOZA 3DEYX 1PS0A 3ZWPA 5L53A 4J43A 4CUJA 3CMMA 3GGOA 3RWBA 3IQDB 2ZTVA 3QHAA 3GNTA 4CMKA 4MKZA 3LYLA 1B0AA 3IS3A 3OF2A 5T5QA 5B12A 3RUEA 1A5ZA 4RZHA 1OZAA 1PQUA 1WDKA 2NQ8A 2Q49A 3DR3A 3OJLA 2RAFA 4ZVVA 1LJ8A 3RU9A 3NTOA 1HE4A 1ZUD1 4Y9DA 1HE3A 3OEYA 2WD8A 3VH1A 3ZHZA 1ZCJA 1NPTO 4AICA 4LN1A 2DBQA 1U8FO 4TQGA 1B26A 3VTFA 3ETDA 3Q11A 1HZJA 5JBIA 2IEDA 4EZBA 4NU6A 3I9OA 1C1DA 5BSGA 4JJFA 2NU6A 4DRYA 4IZHA 3NDRA 4OOEA 2YJZA 3WOHA 2I65A 3S2FA 3PPIA 3ADOA 3X2EA 1ML3A 3CIFA 1WNTA 4B7CA 1EDZA 3ZWOA 5EN4A 4XWYA 5C7LO 1B8VA 3BTSA 4PLYA 5ER6A 4FJ1A 5H83A 3FHLA 1UJMA 3TOXA 3WIEA 3KTDA 3LT0A 2C07A 3FI9A 4AJJA 2VOJA 1ULUA 1YS4A 1RM5A 4CM8A 4EGFA 4YR9A 3BHJA 4URFA 2AXQA 4YACA 2Z95A 3VVCA 3RSHA 5I7EA 3TL3A 4P8RA 4CM4B 3GR6A 3T4EA 3PLNA 4I9HA 4AJNA 1TT5A 3ZU2A 4CMEC 3WYBA 2JCVA 3LF2A 2R00C 1R4MA 4E2WA 4ZQBA 3OBBA 4IM7A 3RQSA 5C37A 4WCFB 1P74A 1M6WA 2PZLA 3DTYA 4YEDA 2FPIA 1NWCA 3ZI0A 1D1TA 3WMXA 1U9JA 1YRLA 2HCTA 3F5SA 3OETA 3ZV3A 1A71A 4Y67A 2QRJA 1DPGA 1JKJA 1P1FA 4PG8A 4RPJA 3HN7A 3OIGA 1IL0A 3H5RA 1DSSG 1E1NA 2D0IA 3JTMA 4BNJA 2AEMA 3UFXA 3IJRA 3K73O 1M76A 2AEFA 4H15A 3EZYA 3WBFA 3BYZA 3JQAD 1EVIA 1ZK2A 1VSVA 4OAQA 3S2GA 2ZIZA 4JLWA 2Q4EA 2BF7A 1UXKA 4OH1A 1EVJA 2GERA 1KEPA 3FR7A 2PTGA 1P1HA 4FC6A 3ZWXA 3WMWA 2J3JA 3DBVO 1NP3A 4J90A 2QRLA 2HRBA 4CV0A 1OMOA 3GMSA 4RV9A 5THQA 1O8CA 5JAQA 3CPSA 3MJ4A 4PLHA 4RPHA 3UGKA 5IF3A 3KEQA 2DBZA 5TRTA 2B4QA 1CWUA 3G3EA 3LT1A 3RAJA 1C0PA 1V3UA 1KS9A 4GVLA 4BL5A 2OP0A 4YBZA 4EITA 1T1RA 3JD4A 4GQAA 1J0XO 1S6YA 5TS3A 3CUKA 3ZW9A 5IZCC 3O9ZA 4PZCA 3GUYA 4A03A 4UUOA 2TMGA 4JP3A 1V6AA 3WDSA 1NHWA 2GR9A 4L0QA 2D2IA 3O4RA 2PZKA 3U4HA 1YDWA 1O6ZA 1H9AA 1LSUA 2CDAA 2I9PA 1YGYA 3ZHXA 1E0DA 1C0IA 4IGEA 2ZKLA 1NNUA 1ISHA 3T7EA 4WLVA 3WNQA 4Y98A 4OXNA 1R66A 4MVJP 2NTNA 1I30A 3I6IA 1PJLA 1GL3A 1Q7GA 3VKUA 1TI7A 5AXCA 4JCOA 3RASA 5T8KA 4YJFB 2CDBA 4JBHA 3D4OA 4GKBA 4BKPA 2EP5A 1WVGA 1H2BA 5DN9A 4YAGA 4LRTB 1IB6A 1K6XA 1YJQA 3QVOA 2Y66A 3DB2A 4WGGA 1A9YA 4RPKA 4Z0PA 3E8XA 3ZCXA 3ZHBA 1XLTA 4B4VA 4CJXA 4CUKA 2EWMA 3WTBA 3I1JA 4YJHA 1QRRA 4I5FA 3AUTA 3VPGA 5L9AA 2IZ1A 5A3JA 4KUEA 4RVFA 4LGVA 4ZQGA 3AI3A 4D43A 1BHSA 3ONEA 4XEHA 4TKLA 4RLSA 3V2HA 1HZZA 2GRAA 3VKVA 2GN4A 3SXPA 2J5KA 3ZWMA 1Q2XA 3NKLA 3TJRA 3VAZA 3NX4A 4MINA 4DMMA 4TSKA 2EJVA 2WM3A 5KVQA 2YDYA 1MLDA 5EESA 3INRA 4FGWA 1OBFO 3JQ8A 3OHSX 2J8ZA 1GFSA 2HK7A 2RHRA 3N7UA 3RUFA 3KSDO 4GSKA 1H94A 3BTUA 5IXSA 1UP7A 2GPTA 3WFJA 1YH3A 3U3XA 1G0OA 1H6BA 2HDHA 3DHNA 4GX0A 4AVYA 4PLGA 3I3OA 4CR8A 2PD6A 3HDYA 3JQBC 1E6WA 3O8QA 4CMHA 1MG0A 1E7YA 2J3HA 1JWAB 3C8MA 3NV9A 2NVWA 4L73A 2CVQA 4MIYA 4NHEA 4A2CA 4ND1A 4BO1A 4A27A 2CMDA 5BNIA 2VHZA 2Q50A 1YJ8A 5KVVA 5IG2A 3KLPX 3G17A 1CEQA 1NQAO 4G81A 1ZO8A 2HO5A 2OUIA 3QQPA 4E5KA 5J23A 2QG4A 3QJ5A 5FI5A 4WCFC 4BO0A 1NQ5A 2BFPA 3DBLA 3ST7A 2YV1A 2O3SA 4R5MA 4FFLA 2VTDA 4RO0A 3TZHA 2ZK7A 4B79A 3MWDB 1F14A 3LQFA 5CEJA 4BNIA 4MP3A 4PG7A 1QV6A 2P9EA 3BMNA 1VE9A 3L07A 3W8EA 4E21A 2J6IA 3JQAB 5EL0A 3PZBA 1KVQA 1ZEMA 1L7EA 3DOCA 4AG3A 4DA9A 1ADCA 1O9BA 3ZWYA 1YDEA 1KVTA 3JQEA 3WWZA 1U28A 1WZIA 4GKVA 3W6UA 4RVUA 1ZSNA 2DFVA 2B36A 1BMDA 2A35A 4ALJA 4BNTA 1HWYA 1BVRA 1DC4A 1T25A 2UUPA 4RVGA 3RBVA 1YQXA 4OO3A 4QFCA 4AJ4A 1F8GA 1DO8A 4AJIA 1WW8A 2EKLA 4GVXA 2E37A 4MPDA 1QYXA 1FJHA 4QEDA 1Y8QA 2X1HA 3I52A 1LLDA 4X54A 3U4CA 1R37A 3RC1A 2C7VA 3V2GA 3VH4A 4WPGA 1PL7A 3DL2A 5COAA 4Y6PA 1MP0A 4FS3A 4PG5A 3H5NA 1I24A 4CM9A 2WYUA 1AUPA 1UXIA 1DJQA 1E3WB 2HRZA 3NDJA 4FDAA 2Y1CA 4TVOA 3WJ7A 1HF3A 5HA5A 2B37A 4XQGA 2HK8A 4O5OA 1CQJA 3IIEA 1XDWA 1O95A 1NYTA 3FPLA 4R41A 4BNYA 4LVUA 5GZ1A 1PIWA 1GZ3A 2WJPA 3OSUA 5EPOA 4R54A 3D5TA 2NVUA 2WYWA 3DZFA 4NFYA 3ONFA 1GQQA 1LRJA 1U7HA 1XCBA 1PTJA 4N5LA 1UZNA 1QLHA 4I9NA 4JROA 3ZV6A 2Q2VA 2AQIA 4BUCA 4WE3A 3C3XA 4MO2A 4Z3KA 5GZ6A 4NK5A 3U0BA 4O59O 3WQQA 3RJ9A 4PLVA 4QFDA 1VPDA 1N9GB 3CSDA 1NQOA 2ET6A 4CM1A 3JYLA 2WWRA 5CDUA 3RUAA 1I2CA 3VZSA 1EK6A 2H6EA 1TT5B 4TRJA 1IULA 2DTEA 2VUTA 1C14A 1VI2A 1QV7A 4LRSB 3H3FA 1E5LA 4EEZA 5IFLA 3I83A 1TB4A 1MFPA 4OXKA 5MGBA 3GF4A 2CVZA
chains in the Genus database with same CATH superfamily
1H0RA 3DEHA 1ZKMA 4ZT4A 3INGA 3NIWA 4MYHA 3BMCB 4J29A 3FSRA 2C9ZA 3K2BA 4N47A 5HOEA 2OVBA 2FSFA 5KJCA 2DHQA 3IIKA 5BN5A 5FP0A 3A6JA 2Q45A 2AI3A 4WOKA 3VAYA 5D1NA 1YA8A 3R0VA 8ABPA 1NU6A 4UU8A 2WFLB 5LLSA 4R6WA 2JLSA 2ZKIA 2XVAA 3KLBA 5CPFA 1EKXA 5BRNA 1L4YA 2YIJA 4MGHA 3QPBA 3FUCA 1ADBA 2CFSA 2E49A 4PONA 3X1KA 1RU3A 2XXJA 1M2EA 3EUAA 3QWHA 4YO8A 3ZTWA 4NU0A 2V3VA 4CF6A 1M7HA 2GXQA 5JAUA 4MYUA 1T8RA 3HFGA 4IF4A 5KYYA 1IZYA 2EWWA 2R1TB 2G6BA 5CPBA 1LI4A 4YMWA 3P7MA 2MSLA 1U3TA 2VJCA 4YRTA 1GGFA 4M7RA 4LJ5A 4PQFA 1RWQA 2DWQA 1V2HE 2GJ9A 4GI1A 2RH8A 3E7DA 3C24A 4M8IA 3CVXA 3OOJA 3RTAA 2E18A 5BSRA 3RVJA 3AM1A 4PX5A 3OTQA 1W581 2RAPA 1XPJA 4MQEB 2XX3A 3MJVA 4M9RA 1E3JA 1YI0A 4MYCA 1AKEA 2ZFUA 1E4OA 2XUAA 2ZYGA 2QY9A 4WJZA 3SMVA 5A06A 3ZDAA 1MO2A 2O7NA 2NUAA 3K31A 5EIBD 5BR8B 2L2QA 1YKSA 5ES3A 4ZVMA 3ZNOA 3C8ZA 3OCVA 2Q9UA 1R8QA 3G88A 4MR7B 3NHSA 1J90A 2P2GA 3P2YA 3LZDA 3RKSA 5CLLA 4KE7A 2XLCA 1UDCA 4J4BA 1DAHA 1ABFA 3KVNA 4WESA 3I0NA 5H8WA 1NNEA 1JNYA 4YALA 1Z16A 2QPLA 5G1OA 4AWBA 1G38A 1ADYA 3QPDA 3PWTA 1RJWA 5H3LA 2PZGA 4N6GA 5I8PA 4R2KA 1FC0A 1SVIA 3COWA 2Y93A 3TX6A 4D2IA 4EYSA 4KQIA 1KOJA 1XK6A 1ELOA 1QDUA 4NENB 1PG0A 5FUYA 2W4IA 3FDZA 3A7EA 2BEVB 4B7AA 2J0UA 3RFUA 1I5OA 4BV9A 5IKPA 5HDQA 3WWOA 4E14A 3HJUA 4Y6QA 4J1SA 1Q77A 1ESCA 5AK5A 4E46A 3UJNA 2A5LA 3OF5A 3FTFA 1GQ2A 3KIPA 4DSOA 4K03A 1KAEA 2FMXA 2NYUA 3N8GA 1ZITA 3VC1A 5DHUA 3OUUA 3O74A 4G8CA 5CXSA 5BSTA 2ZETA 5ED4A 2NO4A 3PHIA 3L6BA 3ORSA 2QD3A 4HDCA 4J2HA 3BMQB 1E2MA 2BRUA 2VA8A 4NICA 4WNAA 4BO2A 2NIPA 5HKOA 1EE2A 1YZ3A 1S8FA 4NATA 3UBMA 4B9EA 4BE9A 1FJ2A 1YDGA 3CUWA 2NZ2A 4M6WB 2OV6A 3D7RA 3CM0A 3EWNA 1B14A 3SX4A 3HDQA 1GNVA 2ZRLA 1GHTA 1X80A 2FMIA 1CJBA 4FGKA 3ADKA 4LXGA 4NTZA 5DCYA 3V8BA 3GFOA 4ROTA 1YNOA 3C4JA 3A4IA 4LHVA 1YTLA 4JCCA 5FPPA 4H3HB 2IH5A 2IU4A 1Y6QA 1E0AA 3UK1A 1E1MA 2YIMA 4OKIA 5KNDH 3EK2A 3VC2A 3F1KA 4IRXA 1ZY2A 4PNPA 3WSWA 2PUHA 1B3BA 1NHGA 2O0KA 3DKVA 3FY4A 5AKHA 2B6HA 2OV1A 2Q6OA 2XYHA 3RS7A 4X64B 1FPMA 4BO9A 1K0UA 1W5TA 1WUTA 5K1ZA 3R9WA 1P80A 3TQSA 2R86A 2JFVA 3ASVA 3EXG2 3H8WA 5CH5A 3SD7A 2I4OA 3WL8A 4JOBA 4YRAA 1SZCA 5BXQC 3H4TA 2YJ3A 4DG8A 3QGMA 1IBMB 1AK1A 3KEMA 1U3GA 4Q1VA 4GOOD 4ZVKA 3C6KA 2GHRA 3DO8A 2HU5A 3LQ1A 3PNKA 2GVDC 1N6IA 4MVJI 1KIMA 1UBLS 2PYZA 2O0JA 3GLHE 1FTYA 2QV0A 1KXZA 4IS3A 3ECCA 3G82C 3LBNA 2P1RA 1OHHD 3FCUB 5C4GB 3SJBA 3PNVA 2O57A 3DV9A 3AM4A 5PNTA 3DM9B 4WXMA 2X0JA 2NWQA 1WU8A 2J3MA 2Y1EA 2ZI5A 4FDUA 1UBKS 1SEPA 1ONBA 2ZIAA 4GO1A 1EESA 3PWZA 1BDHA 1UM8A 3CW8X 1ZZEA 4X60A 2H1OA 3PQ6A 1JJIA 1SOUA 2HCJB 4WIAA 4C0XA 5LXTF 1E79A 3BSWA 3QNMA 2AF3C 1QYDA 2JJMA 3KM0A 4KXWA 1F38A 1T5LA 2QJRA 1RPJA 3F0TA 2IY8A 4C7BA 1AV7A 5A3RA 3ZJVA 4D8TA 4RCVA 3DAYA 1U9IA 4G1BA 4KLRA 2RHJA 4H1WA 4JI8B 4BPRA 2P3SA 1KMHA 3ICCA 4PCUA 1ZXLA 4BWVA 1T3TA 1PG2A 5LXTA 5DLPA 3L8ZA 1UMBB 1C7IA 5TGDA 4MKHA 3S70A 1BVYF 2CMFA 2WSBA 4Q4AA 4B2IA 1PYDA 1Q21A 1TCBA 4R1UA 1NR1A 3I4FA 4WDRA 3K9NA 4TQAA 4B80A 3FX2A 3ADCA 4FM9A 2BGKA 3FCXA 1Z7GA 1MQ9A 3UMRA 3ZBTA 3O4GA 5TIIA 1KI9A 4NK4A 4Q02A 3OQ1A 3TQHA 1IPHA 5K3OA 2O8FB 3R2JA 4DCVA 3L02A 1U2DA 1EZ1A 2DC1A 4NESA 4P4GA 1UJBA 2FJUA 4KYTA 3E9YA 4L8FA 2H3EA 2FZKA 4NQRA 2WHRA 1QANA 3GJQA 2HF2A 4XARA 2OQ2A 4J07A 1WBDA 3DHYA 1BKYA 4PAMA 1PU2A 3L6EA 3EA4A 2O3UA 1U80A 2VHYA 2NTYC 3BMNB 2XUIA 3S2IA 3IJEB 3E8MA 5KQPA 5B4TA 4CLRA 3LPNA 3FRJA 1IY9A 3DFKA 4Q24A 4NFSA 1FBTA 2RKWA 1BX1A 3GRCA 3OUZA 4KX3A 2PJRA 2X6TA 1X38A 1CY2A 1NXWA 1G1MA 3JASA 3WYGA 2ANCA 4TTQA 2EW1A 5GONF 2VJQA 3CR7A 1PZEA 3JSXA 3EDMA 3HC7A 4Z9FA 1L7MA 4XVCA 3P2OA 1C8KA 4J0KA 1U2RA 1NQVA 3G2MA 3AUUA 2W6PA 4MRNA 4G24A 4F2DA 1Q50A 1RWOA 2XY4A 1O4WA 3ZI4A 1NMYA 3GEBA 5KTRA 2H2HA 5DYGA 3KSBC 3THYA 2SKCA 3PNLA 3SFZA 1LUAA 3N07A 3H04A 2B98A 3MTBA 4UTOA 3RSFA 4Q47A 3UG7A 4JB0A 2CLHB 1NXQA 2BFAA 2CLDX 2P6MA 4HTFB 1TYBE 2P67A 2ZJBA 3NHRA 4QOJA 2YS6A 1SD2A 4RLQA 5B1EA 4YDRA 1DEHA 5EC8A 2OHIA 3PUWA 5KNLA 5LKAA 2VZLA 3OTOB 3RLIA 1W75A 1UBHS 2H7YA 5JYBA 2JFOA 2YYYA 4BNNA 3FVTA 4M9XA 2VNSA 4AX8A 5EZQA 2Z2IA 3OQMA 1AOXA 2HMYB 2J3LA 1KWGA 2EFHB 4BFLA 4DV7B 3K1ZA 2ZRDA 5HE9A 4ZT3A 1ZCAA 3CW2A 1I9GA 3VOSA 4C4SA 2R1VB 3BPSA 3SDBA 4X1OA 3I92A 2XB9A 4MYDA 3HJTA 3KQNA 4FGZA 4OF4A 3IEMA 3W3AA 4UUPA 3W8FA 4F7DA 4LWOA 3B6IA 3N2NA 3OF3A 3TAUA 1XDZA 2A0YA 1NJ8A 1O94C 2PLNA 1AZLA 4X8OA 2HO4A 1V71A 2X23A 3DMGA 1DZ3A 2X0KA 2DUMA 3DBHA 5KJ1A 2P2YA 3Q2OA 4GYWA 2Q6KA 5JYCA 4DCOA 4BRWA 4CN8A 2P69A 2C4VA 4X6YA 1NMEA 2IXEA 3KSAC 3UV3A 5DULA 1NDQA 2R97A 1D09A 1Z74A 1GCUA 1PQ4A 2JK1A 4JT9A 1WXDA 2ZUSA 4M55A 3PTAA 4YA6A 2AYYA 1OLUB 1CUWA 1GYPA 4GM1A 2LDXA 1FFXA 1YR3A 4RCZA 1P7WA 4GGOA 1JMKC 5JVDF 2G06A 4PC7A 1FP6A 1Y7LA 4OMCA 3ZDCA 1P0QA 4CL0A 1XYYA 2QYOA 4A8JA 1ISPA 1XVLA 4F04A 3VDQA 3AERB 1RKQA 1SPBS 4NYIR 5K0EA 4MX8A 2JAHA 3OFND 4NECA 5DGIA 2FP4A 3HN6A 1HG0A 2EKQA 2KSQA 4DA7A 2E5LB 3CX8A 4URVR 4OSPA 5JVDA 2ONZA 1Z0IA 3R6LA 1W96A 4E12A 4RL6A 3PLAE 4GF5A 5DGDA 1UP4A 1XNQB 1X8LA 5GVSA 5AK0A 3H19A 1Z4NA 5JIBA 3OPNA 4L4RA 3QLUA 1Y3DE 3RRJA 3MVEA 2I7VA 3REQA 5D5PA 4G5OA 3TR5A 1GZSA 3HUFA 2ZTLA 5KTYA 5BPFA 4XVQA 4D3SA 1Y4UA 1I0LA 4H7PA 3VU8A 3QBEA 4ZO9A 4D79A 3CLHA 2PIAA 2P9GA 4JDPA 2Z9DA 4RE5A 4UULA 4EP1A 2GF9A 3QFSA 2OFXA 5KDLA 1DWQA 1IM5A 3Q6NA 5BP7A 3BAZA 4S35A 2Q2OA 3K70D 4QL3A 1EFVB 3GRPA 2IXAA 1ZCZA 2AFHE 3NXKA 3FROA 5IM5A 4GR9A 3L0OA 1WHTA 4HH3C 4HWSA 2FY8A 4HBGA 1KDVA 1N2CB 1YK0A 3OM1A 2ZTSA 3SE0A 2Y1FA 3EOZA 2F4NA 1T8UA 3C43A 4D99A 3PZRA 1MRSA 3HPRA 4N3AA 1W88A 4X62B 4O1HA 4FSXA 2OCXA 1BS1A 2F3RA 1M7BA 1RE0A 2RAUA 2VP4A 3T5DA 2VSYA 4FI3F 5JY6A 2VXYA 5DN6A 3EIXA 3FOAA 4XQCA 3KFXA 4QASA 4PC2A 2FE1A 1OWPA 2CSUA 2JH8A 4W82A 2IPNA 2ZAIA 3TZEA 5MN5A 3C5VA 3JAKA 2WTUA 1Z0AA 1GA6A 3GYBA 2HLNA 5JLAA 2QE7D 4TM8A 3T4XA 5A6SA 5JANA 1FSFA 3G59A 3RVSA 5JO0A 3OC0A 4RZ3A 3R3XA 1RXUA 1VPVA 3GFTA 5AJZA 4Z3DA 1XJ5A 3PUKA 4J3NA 1UZMA 2REXB 3H8JA 3HM2A 4RFSB 5D84A 4YYZA 4R6XA 1TA9A 2VT3A 1PVDA 3BKXA 1EBBA 2GA8A 1VKJA 2R87A 1ZH2A 2W2LA 3F9CA 4QTYA 3SVTA 3QM1A 4UJ3A 3GI1A 1OXBB 3PQ8A 3WNCA 2XRMA 4HNAB 2DTDA 4IIDA 1QSGA 1SVLA 3MTAA 1OXVA 3ACDA 4JFAA 2HJSA 2JFPA 3ZLTA 3KV1A 1KMMA 2KX7A 1JLKA 4U2EA 3SIPA 1AA6A 2RHCA 2ENWA 1R5OA 3QE4A 2Q46A 4L15A 2Q29A 2UZ1A 2OFFA 1JEYB 1I3CA 3ZKWB 2B1QA 3MZ0A 2ORED 2D5BA 4DCSA 1IJEA 2X42A 4XLTA 5SY4A 5BSHA 4MKIA 4NCBA 3KZVA 1M2HA 4KOAA 1NTOA 3W6PA 1AUVA 3LX5A 3PDWA 3C5HA 4M89A 4A8HA 1XQ1A 2VJKA 3K53A 1S2NA 4LAFA 4X20B 4DCUA 3V8RA 1KPHA 3NEPX 3OE7A 3LMKA 3CB4A 2WSMA 4PINA 5EIBC 2GT1A 2BTQA 1X14A 3L7MA 3P26A 4Q3OA 2X4DA 4R9UC 3JRWA 5A9TA 1KDZA 4PN3A 1K8ZB 5IT9A 2VUUA 3LLSA 4DZRA 3IP5A 4IIYA 1KPGA 3MGBA 1SCIA 2WILA 1AF7A 3NOVA 4MVJE 4PLFA 1QKKA 3F5FA 1SUIA 4FWIB 4F4CA 4HTAA 5AXAA 3W5JA 5IKMA 1CKEA 1CFZA 5K09A 2VK4A 3B6JA 4N12A 1JEOA 2OZLB 1L5MA 2R4QA 3RU7A 2A59A 3SFTA 2WIFA 5FWYB 4NH0A 3WGHA 3VR4A 4LZOA 1EK5A 2PE5A 2Y0CA 4J16A 5FJJA 3SQOA 4HK4A 1KEEA 5HVNA 5F1PA 5K3CA 3TQRA 1NULA 3PNSA 2NOAA 4MV8A 5TY0A 2W6NA 4BNXA 1L4EA 3K1JA 4DV5B 3U4QA 2DQSA 2IYQA 2WPDA 1XELA 4CPDA 1KVUA 3LCVB 3IOBA 4N4AA 4QYWA 1KQNA 5FWXA 3SEAA 2GWHA 2O1XA 3CKYA 4QUJA 4KR2A 3AI2A 3QBJA 1J97A 3LS2A 4WBSA 1XHLA 5I3CA 1HX7A 4R3NA 1VJ1A 1EVZA 1PBTA 3I01A 1MV8A 5KOJA 2WTXA 2PG3A 4PZUA 4ZOEA 4ZI5A 4MWDA 3N8HA 2VF5X 3E15A 3OZSA 4LQ4A 1JVNA 1KJYA 1WXWA 1XU7A 1J1IA 2AQHA 2CCGA 3QKSB 4QGAA 3AR7A 5I8ZA 5GP1A 3R5FA 1ISJA 3EG9B 3FJOA 4KK4A 4CMIB 4EUFA 5BVGA 3B78A 1SIOA 2EIXA 3OX4A 1XTVA 3IUSA 2WUDA 1EG7A 2PX6A 2Y0EA 3KAKA 3KQOA 3L0SA 4GAEA 4TYNA 3UV6A 3A04A 5IAGA 5CK5A 5C9ZA 1WWKA 2ZBUA 3QBTA 2FRXA 5HUQA 2SCUB 2NP7A 1K6EA 1LLCA 2O2DA 2X0NA 3MXOA 2FGKA 2QF7A 4ZARA 4ZEWA 4INZA 1XMVA 3AHJA 3FPHA 2DLNA 2W6MA 1VL2A 4TMKA 2GZ1A 3S68A 5KOHA 3OCCA 3A2KA 1UBNA 8LDHA 1WSWA 3DZJA 3R3ZA 2NZVG 1R0ZA 3WSTA 3JTEA 1IZ9A 4GHWA 2OYSA 2WIBA 3UWPA 5I7FA 3GFFA 1FFWA 2WAMA 2N47A 1B0ZA 1QDEA 4PXAA 2QM0A 3OX2A 1FNCA 1ZNWA 4WAUA 5EP2A 3DB1A 4L4XA 4PLZA 1U8EA 2J08A 1UPUA 2R44A 3I4LA 3OLCX 2JFBA 1DXOA 3NWBA 3Q7RA 2NU7A 1MW9X 1AXGA 1QVVA 4X66B 2JKYA 2EGHA 1HEIA 1KSGA 3AVXA 3PCRB 4YK7A 1FRVA 4PRKA 4Y6LA 2BE7A 4BUZA 3UW3A 4J75A 3P52A 4JIMA 1ULBA 1V2GA 4F5YA 4IQGA 3V34A 4X71A 1FNBA 1XZAA 3QG5A 1E6UA 4XDYA 2I87A 3OKFA 1OX4B 2VZ8A 2HBYA 4L8VA 4ALIA 4ZOLB 2X40A 1QGYA 2AN5A 1P5HA 2IA5A 3GOHA 1IFXA 1M6YA 1LSOA 2A14A 2W0MA 3KPUA 2VBIA 2YKGA 1UFRA 2ZYHA 3PC8A 1GAWA 4P31A 1EEXB 2FUNB 3UB2A 4ZMBA 4F60A 2P6UA 4MYRA 2II6A 2KB0A 4B8WA 2BI7A 2BP7A 1H4TA 3EISA 2H52A 3HRIA 2CLEB 4O25A 2FPGB 2V7WA 3ZTTA 2CXPA 1H2XA 5JSKA 2E6KA 3MTDA 5JMOA 3SF8A 4KITB 4ZOCA 3S7TA 3WA6A 1BWSA 3NUZA 1XJWA 4KKVA 1AQJA 2V6JA 4I55B 5I6DA 1F2UA 4JGGA 4BN5A 5D00A 1SC4A 1W5SA 3L8CA 3NYQA 3DOOA 3D8RA 4RKWA 3T1NA 1DFHA 2P4UA 3G8AA 4OHFA 3BIXA 1DO2A 2G5TA 1BHQ1 1N2SA 4RABA 1WDTA 2F3TA 1F5NA 2L82A 3QFCA 4V1CA 1R6TA 3HEMA 2JIRA 5D7NA 1JJ7A 2AN4A 3SEFA 4PN7A 5K5EA 4LMRA 4ZYLA 5CFZA 2CXSA 4LC1A 1DBWA 5JS7A 3E35A 3ZGNA 1PLLA 5TPWA 1TQDA 2H9IA 4F91B 5GZ3A 1EUCA 5IZCA 5HZGA 1RQLA 5LQSA 4ZYYA 2YC4C 2O0LA 3MSCA 1U7UA 1K08A 4EY5A 3HO1A 4ZXFA 1VCNA 4NFLA 5L40A 3BD6A 2UYCA 2I3ZA 2N1BA 3A11A 3SQNA 2HA7A 4BZQA 3KVYA 4S3MA 3Q98A 4ZEOA 5IAKA 3U3MA 2IYEA 5KPDA 1NPDA 4ZAGA 3U1VA 2WWWA 4PYJA 1DS6A 3GPLA 3J7AC 3A3OA 3DLTA 3NOXA 2EF0A 4UOQA 5SYMA 1KI7A 1IG0A 2RB5A 3BIJA 2YOHA 4ETIA 4X1IA 5AM1A 3SBXA 4QDTA 5AM2A 3OLVA 3Q10A 3R6WA 2I34A 5HILA 2CZCA 5FI0B 1LNQA 3PDCA 2PWYA 3EMKA 3RSCA 2C03A 3KOMA 3W3ZB 1C4XA 4XGQA 4EB0A 5BPHA 3HWWA 1ABEA 4YJDA 4AUKA 4D3FA 2CVPA 3D0OA 5EVCA 4B74A 3VFDA 5LQKA 4UMFA 4F46A 4D8YA 4U6NA 1QGOA 1N6OA 1SA0A 4C4OA 4XCXA 9GPBA 4A5OA 3GXOA 4F8JA 1HQDA 5CVVA 5EHQA 4AG5A 5JWRA 3PJRA 3A6ZA 1BVUA 2EJBA 4UOEA 3SP1A 1LVUA 2QAGC 4C3VA 3CPEA 1XD2A 4N5IX 2UUAB 2I4NA 1BOFA 3RC2A 1MW8X 3TI7A 4N48A 4DLRA 4M49A 4HLUC 4PX2A 2WD9A 3IPXA 1ZDMA 4ZZ1A 1AGYA 4YRQA 1NOKA 4NZZA 4C2UA 4A73A 3EXAA 2WWTA 3FJYA 5FUQA 5I48A 2JFYA 3GBSA 4IUBS 3M4JA 4DLAA 1MZPA 4IDNA 1ZRSA 1ZONA 2GOYA 3WOVA 4WBNB 3DYIA 5B36A 3DZCA 2BI4A 1BDJA 1G5QA 3FSJX 4QYIB 5COBA 3H4VA 4HX9A 4FOLA 5H0IA 3WDKA 2FPIB 2XE7A 4KXQA 3ZW7A 4BEWA 5K3EA 2A9OA 4YNBA 5B3KA 1Q83A 2YWFA 2W37A 1I9CA 2FUCA 2Y6VA 3KWJA 3LNTA 1OAOA 1JKJB 2DRIA 2XWBF 3O91A 4K6MA 4D98A 5CB4A 2O54A 3CF4G 2XD4A 3OTWA 1GPDG 3S1SA 4LBYA 5E7QA 4FMDB 4XGRA 3WK8A 2ZDQA 2IFTA 5AWFC 1MO5A 1FNSA 1DKQA 4P3OA 3V42A 4PG4A 2JAOA 3RG2A 1ZVVA 3WMRA 1F17A 1RRMA 2XPCA 2QTFA 2HWUA 2ORYA 2YV5A 2Z6VA 1ADGA 4BLPA 4MMXB 1VTKA 3CKKA 1LV7A 1B23P 1RWBA 4M0DA 1EFHA 4XSHA 1G21E 5E8RA 1GT6A 4RSRA 2CHVA 3CRNA 3GLGA 3SMQA 4RSMA 2G36A 2ZBPA 4EJ6A 4X3OA 4JS0A 1IY8A 1KGDA 2XIQA 3WRWA 4X45A 4EHDA 2FRVA 2JNWA 4YUYA 3MWGA 5EXTA 1W0KA 4K9MA 1W1WA 3GJ7A 4NOKA 4UE2A 4KZKA 3NHKA 3W6NA 4DWWA 5DH9A 5JMPA 4DCCA 4ESEA 1PUXA 2X9GA 5ADUS 4K28A 1GM5A 1M6EX 2GN0A 4NBUA 1DDGA 1OZHA 1THGA 3UJ9A 1Y6GA 3DCJA 4LJ6A 1W25A 4C76A 3WAGA 2HU2A 5LDHA 2QN9A 1R0XA 4MV4A 3UG6A 4L95C 5L3SA 4IDDA 1ODTC 2OORC 3PXAA 2NSLA 4RJTA 4HNSA 3C1UA 4U6QA 2KI5A 1IN1A 1G8YA 4PANA 3WLPA 3CLSD 4XQEA 1H23A 2DCMA 2V9CA 2V4ZA 3K70C 1GFWA 4R16A 4PSUA 4PLPA 5FKJA 2VSFA 1TZJA 4MVXA 3UAOA 2GN8A 3I76A 5BV8A 3ZCVA 1Y7PA 2DPXA 3FOBA 4OQZA 2YV4A 1KIAA 3NDBB 2WVJA 2KBFA 1RWPA 4N0PA 1Y6ZA 4KIGA 1QBGA 2YHAA 1IB0A 3KWFA 2P9YA 3D6FA 2QPTA 4IUYA 5ESXA 1EFKA 1YGPA 3ENZA 4DDKA 4DMRA 5EJ5A 5DO9A 2XWSA 3G2QA 1DE0A 2WF7A 1W1UA 3K05A 2PWAA 3FPCA 4TYPA 1VG9B 4FOSA 1N34B 1KY4A 4UMDA 2CLIB 3A1WA 4NYIQ 4OEHA 3RH0A 3L0DA 3SOZA 2XRZA 4TRNA 1VL1A 4Q3AA 5LOVB 1W4LA 3R20A 4PEVA 3PICA 4KSCA 2DJ5A 3OLYA 5EG5A 3O92A 2XUGA 3WGJA 1A5BB 4P4NA 4RJJA 2EZ4A 4ZVUA 2XIJA 3IT0A 2AUNA 5IUNC 4FB4A 4WY8A 3M6XA 4JR0A 3K92A 1KJ9A 4PNEA 1A7KA 1J8MF 1S1MA 4UUQA 4MV7A 2GHQA 1DHTA 3LT2A 3B53X 1C8VB 1JR3D 3BSFA 3WHPA 3WE7A 2ZLBA 2VDWA 4G67A 4ABYA 3KKQA 1DIRA 3DKPA 3EWAA 4P3PA 4BLUA 4F7WA 3GMDA 4GSYA 2R7MA 1MVNA 3L8HA 5FOWA 2Z08A 4JI2B 2NM0A 3OOHA 1VBNA 5AVOA 5EZ6B 3IMGA 3SIRA 3K71B 3GXBA 2IVFA 2BELA 4QGFA 1M1NB 3OPYA 2F8TA 3PRKE 4ALLA 4EB6A 5L6LB 3HJFA 2H7CA 1DEKA 1EVKA 4HYQA 2ZYTX 2VIIA 2JI7A 4II7A 5JSZB 1A95A 1M1YE 1YOVB 2HY7A 1ESEA 3QENA 4DGQA 3Q8MA 5EP4A 4C88A 4G0UA 3TMYA 3MELA 2OMKA 1M6HA 3B3FA 4BGUA 3QUQA 3L0PA 4GBJA 2C61A 3EEBA 4J7CA 1EFTA 5AHRA 1M9NA 4HQRA 4Y8VA 1AN0A 4PZAA 2AOTA 4MJ3A 3RSLA 2EP8A 1JXAA 4EGAA 3PUXA 3QKRB 4DR2B 5C8YB 2E82A 2JCSA 1JIQA 3C3DA 1LFAA 3HXKA 1C3OB 3JQ6A 4QJ4A 4CL8A 4D92A 2J7PA 5TMBA 1OPRA 4AECA 3IUNA 3VYRB 4CGYA 2ZCVA 3UMVA 3HNPA 3CW9A 2UDPA 4JAVC 1G8SA 2IEBA 1WPXA 5LZ8A 1GNQA 4H7HA 4F3TA 2Y92A 4FSHA 4B85A 4BVKA 4U5XA 4JR2A 2JFGA 1Q7BA 1A5AB 1E60A 1N5KA 2FG7C 2BMFA 2FX2A 2YINC 3I9JA 4MQ6A 4TKMA 4P4SB 1GNTA 3BZWA 5FR1A 4AKTA 3STWA 1QM5A 1I5EA 3KQKA 1DRVA 4ZP1A 1BKSB 1CUCA 1EP9A 2OKGA 2RGWA 3LAWA 1OCEA 3GNSA 3PQFA 3Q2KA 4RTOA 2AK2A 2IP1A 5DHRA 4DM7A 6GPBA 2MR6A 1Z33A 4QE3A 1RWXA 1AHHA 4EKEA 3KAPA 4N03A 4HEA6 1H1TA 2OBNA 5A05A 2JA2A 4L4SA 4G0QA 4DUGD 3E2MA 5CDUA 4IIVA 3KVVA 1XRRA 3KTOA 1ZR4A 2PAAA 4JI1B 2MINA 3G2IA 3CEMA 3GPCA 2BFOA 3PCXA 4YRZA 4CKCB 1GPJA 3IKJA 5B58T 1C7ZA 1NAIA 3Q9LA 5FHQA 1B93A 2C9BA 4MW9A 2JI6A 3NGLA 2HM7A 3KT6A 3NEJA 5ENVA 4ZANA 3K3PA 3OO0A 4MA0A 4MKRA 2EBUA 1JPJA 4BRSA 2VPTA 1W19A 1MT3A 1GTSA 5EKTA 3ONNA 3NTLA 2RGNC 2QXTA 4EUKA 4FHGA 2OHXA 3L8FA 4DLKA 2AFRA 3A2NA 4QJIA 1P33A 1XXLA 1U3DA 4AY6A 2M98A 2VOEA 4MK4A 1VKNA 3IUJA 4KAXA 5ELXA 3IPYA 2ZT7A 1OXSC 2Y67A 2BBOA 2QTCA 4YV2A 1IHDA 2ETXA 2O2IA 1E1DA 1Z12A 1ZN8A 2GVZC 3GD5A 2NXNA 1ESNA 1R0CA 2G63A 4M8SA 2OB2A 2Z1NA 1BGVA 1I14A 5HUJA 3BUSA 2H9AA 3RT9A 5C3MA 3IKTA 1KJIA 1CSEE 2A94A 3QU4A 3VR3D 2M6RA 4BC0A 1NI5A 2C96A 4NBWA 1PLJA 2BAGA 2OWDA 3WMEA 4CEJB 3ICQB 2B4RO 2CNOA 4R9SA 3JD2A 2JGAA 1WY7A 2NX2A 2FPUA 3Q3HA 4GIBA 3MT0A 5EJEA 2CKDA 1NVVR 3V4OA 4MLDA 2PX2A 2P9HA 4ZEVA 3N5KA 4HEHA 3CSUA 3W5BA 1J2JA 3FFAA 4OLHA 5DKFA 3I42A 1OZ0A 1PRYA 3CWCA 1CX9B 4V0MA 4EGCB 2DGDA 4LIPD 1YUMA 1QYCA 3W2HA 2P1DA 3IJPA 2FPPA 3IRVA 4F6RB 3EF1A 1WSDA 1LA2A 2Z8XA 5LA6A 2FPWA 2FSGA 2XRYA 3V1YA 1ZN2A 1SKYE 4XVRA 1PQYA 1XPOA 3FCYA 4OSEA 3IAXA 4HD8A 4RELA 5JC8A 1B8NA 2C88A 1B00A 4MIOA 4MKFA 2F1JA 4DABA 4KU4A 4GMGA 1JHVA 8ATCA 4D9BA 1JTFA 4C2TA 4FJ2A 1GN9A 2CFRA 1QE3A 5F4BA 4P81A 2WPNA 3ZWXA 1JXQA 1VBKA 4CEIA 1KRWA 3NAGA 3T3OA 3K8ZA 3OPXA 1NI4A 5EZYB 5KSWB 3LY8A 1G20B 2B0CA 5G3YA 2SBTA 4L74A 1EB9A 3WLAA 5CA1F 1I7LA 4QODA 3V6MA 4PYOA 1ZC3A 4GZ5A 1J23A 3JWGA 5HK9A 5G1PA 1E7RA 3IVMA 3ZDRA 3S29A 3LSYA 4ZQHA 1CJMA 4HADA 1WS6A 4KDRA 2YVQA 1B76A 4NZNA 1ZVMA 1ZH0A 1KA9H 3R5JA 5C7YA 5CA1A 3ANYB 4AWXA 2OL4A 1J0AA 1NJFA 4AC9A 1NVBA 3GN2A 1TK9A 1TTPB 1UBTS 3CNNA 1R6VA 4E0BA 4RBNA 3DW1X 4UVGA 1D2GA 1EFAA 5T8KC 3AQ4A 1VIMA 2X5XA 1BHJA 4LQDA 1IYZA 1FU4A 4A1FA 5HM6A 1HYGA 4I4LA 5GVRA 4FZ3A 4Z4FA 3D2LA 5CVUA 2X14A 3ELYA 2Q0XA 3VNUA 3CX4A 5IP5A 2XDAA 1IVNA 1WCYA 4I50F 4EFMA 1EXWA 2QRVB 3C8DA 4DMFA 1XCJA 1KAMA 4A0RA 1T0UA 3W4KA 3NFYA 4TT3D 3D81A 3OOYA 4Q4JB 4EK9A 1HRDA 5AVQA 1OH8A 4MDFA 1Z7EA 5DBOA 2X9VA 4S0ZA 1XLWA 2VHWA 3RYTC 2XMSA 4I50A 2JBAB 3BK1A 3EBOA 5DBIA 3L01A 1AF4A 3R7FA 1QIEA 4C1NA 2N42A 3VSCA 1JB1A 4ERXA 1NURA 1WPGA 2SKEA 4GDMA 3X2SA 1KBQA 3G1WA 4XRGA 1ZUNA 1I80A 4J6FA 4R9NA 3GEMA 3U9LA 4J7AA 2XNHA 2ZR7A 2MWMA 2W0SA 3IQHX 1BZYA 4CIYA 3C3KA 3FMVA 1C0KA 5CGZA 4ZU3A 1CIPA 1UOPA 2YY5A 1YR2A 1AK2A 3T3NA 1XEWY 3AO0B 3OMLA 4FPXA 3DZGA 4L9RA 5GPBA 2DVMA 1NLUA 4H3SA 2WU4A 2PUEA 3UGQA 4TTPA 5JISA 1CFJA 5IJ0B 1NP7A 2BEUB 2DUUA 4CDMA 2JLZA 1L7AA 4CODB 3HA7A 1Z0ZA 1PHPA 3RHZA 4GP7A 4I1RA 3I5UA 1D6JA 5KYVA 4RD4A 4YRLA 5IJXA 5M3BA 4YV1A 3GEEA 1EINA 4RK5A 3EZ2A 1JHQA 2HQRA 2MTBA 3E5NA 4EBFA 1N7GA 5T64A 3MRTA 2Y77A 2BR4A 2QGFA 2E0IA 1YE3A 1H93A 3LQ2A 2FPXA 1KU0A 3ZCRA 4X7BA 3BGOS 2QM3A 1HE2A 4L5AA 5DHQA 4YREA 1VKOA 1PWZA 1AIPA 1NN0A 3SS9X 1EGHA 5L51A 3CKMA 2PHZA 3FCCA 3PV0A 3RE1A 1ZD8A 3M0EA 3DSRA 1A9PA 4I8IA 2X22A 3QOYA 4XI9A 1KDPA 3UYKA 5C8VA 5E4TA 3W9BA 3TW8A 1VLLA 2HNBA 1E1RA 2PQ0A 2VR1A 4CQMB 4UU7A 1H2RS 1T26A 2IE0A 3ZJTA 1H3FA 4JJKA 1BS9A 1DEOA 1HT1E 1NUSA 4MQMA 4MQUA 2JK0A 3A6GA 2HLDD 3QI7A 4ARSA 5AOCA 2QN8A 1LB1B 1CF9A 1MR3F 2RG7A 4FYMA 3VHXA 1D5CA 2AR7A 2IODA 2JI8A 3EZFA 1E2IA 4PO8A 4RWEA 3RIHA 4PBSA 4YY3B 4I2NA 1SXGA 1BU5A 1KYVA 2PFGA 3OQIA 3PIRA 4LZLA 4MGIR 2BKLA 2HK6A 2XCOA 1NFFA 1ECJA 4HKTA 5E4FA 3ADBA 5M29A 3TBHA 1Q0ZA 2IS2A 1FYDA 3S5UA 3UMBA 4HFRA 4JX8A 4JSRA 1U65A 1Q7RA 4Q1FA 3OM8A 4BEBA 1LQTA 4FMPA 4F2GA 5E2BA 4Z7OB 4GWKA 4H18A 2K5UA 3INNA 3TTVA 1N8KA 1XWWA 1XRQA 5BNWA 4DSUA 1S8AA 3A6DA 4H35A 4XDZA 421PA 1TVCA 1ZGCA 3JQGA 2FZ5A 3QPAA 1G66A 3BRWD 5IWAB 1PL0A 7REQB 5D87A 4JJAA 1WLSA 1J8YF 5FADA 2AQKA 3F6CA 4IX1A 5J58A 1TKAA 3BRSA 4C5BA 4Q7MB 4RHUA 2X15A 2I67A 1QP8A 4IRUB 3W5HA 4BQPA 2ZJZA 3PRHA 2JLVA 4U00A 3OT1A 2H1WA 3QYAA 1YZNA 2OMEA 4KE6A 1LWNA 2OZPA 3Q7EA 4WINA 4X1KA 1ITZA 2WKSA 1OROA 4FDLA 3ACCA 4Z0NA 5IHPA 3LNCA 3T1TA 3DHEA 3CONA 1NP6A 4W4TA 1T10A 1Y8RB 4JK3A 3GLFE 3AJAA 1M1ZA 1E5TA 4IH4A 1D4ZA 3WICA 2WAAA 2VWQA 3Q85A 3CLSC 3GVCA 3I72A 4J7XA 5LYJB 2NO1A 4EW1A 4DJ5X 1Y81A 3OJXA 4OXYA 2DCUA 4CF5A 4ESHA 4E4RA 1V1RB 3DT8A 4OB8A 1B6RA 4WXRA 1P6QA 3R4CA 1PVOA 1OLSA 1BU8A 1MB3A 2I1LA 3TSZA 3NHLA 1AQNA 3KXDA 3WGOA 3HB7A 1G4AE 2QN2A 2O2GA 5HJ2A 1SQSA 2ERCA 2IDJA 2VPWA 4HB3A 3LOUA 2C2KA 4R7GA 2AC4A 3MOSA 2PT5A 2NNLD 3AHFA 1AU9A 3BH6A 1JI0A 1WA5A 2CFCA 5I7WA 4HEA1 3W8RA 4BMYA 5AW1A 5G02A 1ULHA 3W34A 4A2PA 2HPAA 1K63A 2B8TA 2EFCB 4BECA 5KX5B 1S4MA 3ETJA 2POQX 4IGKA 1L1QA 3KJZA 4U3JA 3FMGA 4CDGA 4E08A 5BV0A 4MLZA 2E87A 1JSRA 2OOSA 3MW8A 1RZUA 1WB5A 1RIIA 3BWXA 1K7FB 3GUHA 3UJ8A 2XW6A 1R12A 3KNZA 4B1FA 3FUUA 4OQFA 3MG9A 2G9QA 5I4CA 2P5UA 2VHJA 4DCMA 3H11B 4HS4A 1UZLA 4PWYA 5BNFA 4XGKA 4BX9A 1UPFA 2WMYA 3GVIA 3W1VA 4EPXA 1FNNA 3F3MA 3AUKA 4TWJA 2ZZNA 2EEPA 2W98A 2BSXA 2PGXA 3HCBA 1G8KA 1Z5VA 4L8LA 5EKDA 4C5AA 1P4AA 1VIDA 3KYJB 3TIFA 2W6ZA 3ZGOA 3CH7A 3R77A 5JLJA 4Q01A 3A31A 2GNAA 4NCHA 4BJ5A 2TECE 3ZDXB 5BWMA 3SYMA 1WUKS 3R3SA 3U60B 4BEJA 1P4JA 4TL7A 4Z8YA 4J4TA 4PPYA 1OZGA 1J24A 2FFJA 3GPDG 3HR8A 5KJFA 3GLTA 4YUWA 1U1FA 3M1LA 2HIMA 3BJMA 4MUKA 4XYLA 3FPJA 1FB5A 1G7TA 4CLXA 1N6KA 2B35A 2WDZA 3OZVA 4UTXA 4UJ5A 4CCSA 1TECE 4V2IA 3MINB 1KQFA 4ZGWA 1H6CA 4YH1A 1RXIA 3GDWA 1HDIA 3WRYA 1JEAA 4XOUA 4G1MB 1IAVA 2DG2A 3BICA 1SCUB 3UBTA 5GGYA 3PL5A 3D7KA 3SHOA 1J6UA 1JIVA 1DU4A 4GOND 5G41A 4JBYA 4D9FA 1NXPA 1SC1A 1P9RA 3H9EO 3H7IA 2GAFA 3A4MA 5KSYA 4YAJA 1EVQA 4WY2A 5FR2A 1EZZA 1YJCA 3GLIA 1SZDA 2W2OA 4R3UC 4ZQEA 4X84A 5D5HA 1JILA 2FYTA 1RPAA 1N36B 2F7SA 1R0BA 5EUMA 5DDIP 5A71A 1X1CA 4QATA 1ZSYA 4YS6A 4ENSA 2BWJA 2G5CA 2H5IA 4ITVA 2HA3A 1AZTA 2ESRA 2Q99A 3RC7A 4E5YA 2B6NA 1G3IA 1ZNYA 2GZSA 1R0LA 2HA2A 1U3VA 2QUZA 3UK7A 1TDJA 2FSPA 2V5UA 1VMEA 2H1SA 3B9BA 3AJEA 3B5IA 1U9CA 3EEFA 4NMXB 4BO8A 5CDYA 2WG0A 1ECBA 4FFPA 3VKFA 2A0WA 1I8TA 1QTIA 1TVMA 2QUHA 4Q7QA 5AKJA 5CURA 5H1YA 1Y82A 1XKLA 3ZU3A 3VPAA 3SGLA 4FE7A 3ZBUA 1WQ4A 4UZEA 1MC5A 1VE5A 1ESDA 3Q15C 1XTUA 3OIVA 5K4AA 4TYMA 2GFHA 2I03A 5JPIA 4JVLA 3AJ9A 4CKXA 4ZXPA 4IGFA 2BR5A 1BXRB 1MX1A 2EXXA 1G7CA 3EGIA 3WC4A 4RORA 2C7RA 4D25A 1NM5C 4R01A 1QLWA 4HNRA 1PJ4A 3AEQB 4N0DA 1NI3A 3AESB 4I3FA 3ZCSA 1SBIA 1P2SA 2GK6A 4S0XA 4DUYB 5T3YA 1J2RA 3OZEA 2Z30A 4CQLB 2ZYSA 2H92A 2NMVA 3BXHA 1N5RA 5U4QA 5JBNA 3DVAB 4E6EA 1N0VC 2DE0X 4DNPA 5D7BA 4DBZA 3GNLA 5AOAA 2EWVA 2FFHA 4BO7A 3WGIA 3AB3A 2H16A 1M66A 2WSSD 1TJ5A 1YNSA 2ZYRA 1V8FA 5LD2B 1T1GA 3EE6A 5AI5A 2Q6VA