1XCJA

Guanidinoacetate methyltransferase containing s-adenosylhomocysteine and guanidinoacetate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
229
structure length
229
Chain Sequence
PLFAPGEDCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanidinoacetate N-methyltransferase
publication title Catalytic mechanism of guanidinoacetate methyltransferase: crystal structures of guanidinoacetate methyltransferase ternary complexes.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 72
structure length 229
sequence length 229
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2004-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xcjA00
2OB2A 3E7PA 1XVAA 3MTEA 1L1EA 3UBTA 4IV8A 3BGDA 4YV2A 4M37A 2ONZA 3ORHA 2BR5A 4P7JA 2YVLA 5BXYA 3GRYA 1TW3A 2CL5A 3NVMB 3E8SA 4KIGA 4M7RA 3EEYA 1KYWA 3KR2A 3PT9A 8MHTA 1O9GA 2OXTA 4X41A 5E1MA 5K0CA 3LPMA 1WZNA 2I62A 5JUWA 3KPWA 3R24A 3O4FA 2BZGA 3L8DA 3GDHA 4RV9A 2JJQA 4XUEA 2GA9A 3TKAA 5C9ZA 5K0JA 1YFJA 3P97A 2CMGA 2XVMA 1RJFA 3DXZA 2JHCA 3E05A 2NYUA 3JWJA 4KVZA 3M6VA 5C1IA 2AVNA 4GC5A 5GINE 3UWPA 4OX9Y 5IKMA 4C08A 3C6KA 3MTIA 4CKBA 4AZVA 3KQVA 3AXSA 2IIPA 5EMJA 4DF3A 5HZMA 1DCTA 2PXAA 1X1AA 3GRZA 3PFHA 5GOZA 4LG1A 5GP1A 2FPOA 4IKPA 2O0LA 4C04A 2PX8A 4EMSA 3G5TA 3DOUA 3QOXA 4DKJA 2N47A 3FPEA 5FWDA 5K09A 4BLWA 1BHJA 4QDJA 1G38A 4QQNA 2VDUE 3DTNA 2KW5A 5T67A 3KPJA 3M4XA 1JSXA 2GH1A 2ZSUA 5E8JA 5H02A 1FP2A 2JHAA 4Y2HA 5LQAA 1JTFA 4QQKA 2UZ4A 4RTRA 1O9HA 3G88A 3KR0A 5EVJA 4R6WA 2G70A 4DCMA 1XDUA 4EKGA 2GAFA 1SUIA 3B3GA 5K0BA 5M5BA 3TPZA 2R6ZA 3O7WA 3K6RA 1QAOA 4YV0A 4C03A 5CD1A 1I4WA 1P91A 2V7EA 2ZIEA 1INLA 4Z2YA 4PYNA 3TKYA 2ZTHA 2PX5A 3NDIA 3EGVA 3MHTA 3CJQA 5EOVA 2QM3A 1FP1D 5E2AA 1NKVA 4XUDA 4MHTA 2IP2A 3SSMA 4GF5A 3JWHA 3TR6A 2PJDA 4AX8A 4E31A 3BGIA 3DMFA 3UJ6A 3KQQA 4WXHA 2O07A 3V8VA 3ME5A 2HTEA 3CKKA 3SR4A 1OR8A 1G55A 3NW9A 2IFTA 2YXDA 3P9CA 4CTJA 2C7PA 3MB5A 4FZVA 1SQFA 3PS9A 2YQZA 4P7KA 5DSXA 3FRIA 4V0RA 3TRKA 4BY9E 3LKDA 1RI2A 3CVOA 3NJRA 4HRAA 5K05A 2I9KA 4RWZA 1Z3CA 4YUWA 3C3PA 4ATNA 3P2KA 3BKWA 5E1DA 3THSA 2ZIFA 2P40A 2VDWA 4BP1A 4BLVA 4RVHA 1NBHA 5HILA 1MHTA 4M36A 4NECA 3KQOA 2Q41A 3DMGA 5DTMA 2PWPA 3KQTA 3HVKA 2C7QA 3FTCA 4PYMA 3REOA 2Z6QA 4PIMA 4WVLA 2CMHA 3BWBA 1YFLA 1ZHFA 2FRXA 2G1PA 1Q0SA 3TFWA 3AXTA 2ZZMA 1AQJA 4R05A 1P39A 1WY7A 4OQDA 4FT4A 1HNNA 3A26A 3BKXA 5HIIA 4CKEA 4YMGA 4YV1A 4EVIA 4ER5A 3PX2A 3MERA 5F2OA 5IH3A 5B1SA 2AN5A 2P1DA 1YB2A 3OU7A 1ZGAA 5GIOE 1ORIA 4DQ0A 2UYCA 4X63A 4DM3A 2HNKA 3Q87B 3EGEA 4YUXA 2PBFA 2EG5A 1SVUA 4E2WA 1D2HA 5DLYA 2IDKA 3FYCA 1P1CA 3OU6A 5D1NA 2P3LA 3C6MA 2PY6A 4RTJA 2PX2A 5G02A 1EJ0A 5EC8A 5KQSA 5LQNA 5EZSA 2PVCA 2P3QA 3DP7A 3BWMA 3P9NA 3CC8A 1UIRA 4KWCA 3CGGA 4P7GA 3UJBA 1SQGA 2PLWA 3EMBA 3HCAA 4X61A 2VS1A 2H00A 1N7IA 2E5WA 2NNWB 5DTRA 4O29A 2XBMA 4M38A 4RVGA 3G8BA 2F8LA 3TOSA 1JQEA 2WK1A 1F3LA 2ZLBA 3NDJA 3V97A 2ZFUA 4FSDA 1G60A 2B78A 3OFJA 1RI4A 2R3SA 2O57A 3KR1A 3LDGA 3S68A 4PWYA 4CWAA 2PSSA 4ER7A 3TM5A 5E8RA 2ESRA 3FUWA 5DX8A 1WG8A 3A4TA 1JG2A 3UZUA 3EVCA 2NP6A 2I7CA 4DCGA 4C06A 2QRVB 2ZZNA 2CWWA 1D2CA 4MQ4A 1R8XA 3B3JA 1WXWA 4HG2A 5E9QA 2ZBPA 4OBWA 5EPEA 1PRYA 5D1HA 5EHGA 4UOEA 3A25A 2JH8A 2YR0A 1YUBA 5FQNA 3G2PA 3OZRA 4RTLA 3HTXA 2PT9A 4OA5A 4FSXA 5K0NA 1H1DA 1O54A 4PCAA 3B5IA 1VE3A 2AN4A 1RJGA 1PJZA 3CBGA 3DULA 2NP7A 2QY6A 1XCLA 4PGHA 3AWIA 4AUKA 5E1BA 4C07A 1U2ZA 3I53A 4C4AA 1NW8A 3OZTA 3EVEA 3G2MA 4PCLA 3LKZA 2HV9A 3ID6C 2GB4A 3OFKA 7MHTA 1BOOA 3HM2A 9MHTA 3GIWA 4GOLD 3OU2A 3BZBA 3HP7A 3LGAA 3R3HA 1VPTA 1IXKA 3B7PA 2HWKA 2FK7A 1WXXA 4X60A 3U81A 1QAQA 5LQKA 2DPMA 3FYDA 5E9JA 5HOQA 1JQDA 2OPBA 3DXXA 3HA7A 3LDFA 3UJDA 3O31A 4OBXA 1I9GA 2Z6AA 2VP3A 1FJXA 3DXYA 2AOTA 5EMLA 3EVDA 4PIPA 1KHHA 2OB1A 5EQJB 4E30A 4E2ZA 3FTFA 1XCJA 3MGGA 4QTUB 3MQ2A 2Z6UA 1VQ1A 2FK8A 2JHPA 4KRGA 5DRYA 4PNEA 5CIYA 2HR1A 3ELDA 4H0NA 1NE2A 3LCVB 4QVGA 3AY0A 4HGZA 1RJEA 1NW3A 3GJYA 2IBSA 1M6YA 3IYLW 2VDVE 5T6BA 1RI5A 2FCAA 3BUSA 3GNLA 3GRRA 4GUAA 5EG5A 1XDSA 5F2KA 5FA5A 1MJFA 2QRVA 3HCCA 2YXEA 3DMHA 3HEMA 5DSTA 3DLCA 3JWIA 5FTWA 5HIKA 1VBFA 4AZTA 4ER3A 1X1DA 2P7HA 3PVCA 4RVFA 1BKYA 3EGIA 3ANXA 2BM9A 2AOUB 5DPMA 1YF3A 3EVFA 2ZWVA 4KDCA 5CVEA 2A14A 5HIJA 1NW5A 3SGLA 4ER6A 5HEKA 3GGDA 3OZSA 3NMUF 3E23A 3M6WA 5BW4A 1VP9A 5CM2Z 2HMYB 3C3YA 5DXAA 3LX6A 1XTPA 3EMDA 4FGZA 5FCDA 2YXLA 2NXEA 4HSGA 4DZRA 3KQYA 3FUUA 1Q0TA 3HCDA 5GWXA 3LECA 2PXCA 1Y8CA 1B42A 1G8AA 3G2QA 5EKXA 2WA2A 1V39A 3A27A 2IBTA 2IH5A 5DM2A 2Y1XA 4YUZA 1KP9A 1UWVA 5EHIA 2FYTA 5DM4A 4PYIA 5F2NA 2O06A 3KPUA 1JR4A 3TQSA 3IHTA 3PX3A 2G8NA 4P7FA 3ELYA 3FUXA 1EAMA 2JG3A 3P2IA 4GQBA 1TW2A 5CCBA 3T7RA 5E1OA 5LQCA 3FZGA 3DR5A 2AN3A 4LWPA 3CJTA 3PLAE 5DM1A 2G72A 3D2LA 3MAGA 3WSTA 3KQWA 3SM3A 1R8YA 4HTFB 4RTSA 3Q7EA 2ONYA 3KQSA 2I6GA 3ELWA 2EFJA 4PONA 3RW9A 2AVDA 1VIDA 1RI3A 3C0KA 3G5LA 3B89A 1KXZA 3P2EA 5C0OE 4GEKA 3VSEA 4PINA 4GBED 4XUCA 3FPFA 1AV6A 2EX4A 2BM8A 4MTLA 4JXJA 4AZWA 1KPHA 1R18A 5T64A 3G2OA 4ISCA 5K0EA 2UYQA 3KQPA 1XXLA 5GM1A 1L3BA 4RYLA 1L3CA 1BC5A 3RODA 2GPYA 4A6DA 2IH4A 3TLJA 5DM0A 2ZZKA 5FWAA 3EVZA 1JG3A 5HIMA 5BW5A 5FA8A 5FHQA 5K0LA 5CUQA 2H11A 2V74B 2JH9A 2P8JA 2ZBRA 4BLUA 2PGXA 3UFBA 3EEOA 1NV9A 2AOUA 2AOVA 3SMQA 4RTPA 1N2XA 1ZGJA 4DA4A 2IH2A 1N7JA 3MCTA 3DUWA 3GXOA 2XYVA 4QDKA 1VP3A 4LWOA 4OQEA 5LSAA 4RTNA 3LBFA 2IGTA 2UYHA 2QYOA 1ZG3A 2LD4A 3FTDA 3UA4A 2XVAA 3GO4A 3KPYA 2P3OA 3T0IA 2ZVJA 3I64A 4ER0A 3BWCA 5K0FA 4QPNA 4Y30A 4YUVA 5CCXA 5GM2A 1AQIA 1DUSA 1ZQ9A 3LSTA 5K01A 5KVAA 4E2YA 4PYKA 1IM8A 2ZIGA 4EQZA 4F84A 3HVJA 3JWGA 4BP3A 4POOA 4YMHA 1QAMA 3A7EA 3G7UA 4RX1A 4EKIA 5ERGB 1IY9A 4B17A 1R74A 1R6AA 3HNRA 2XYQA 3I5UA 3M6UA 4FS8A 3IV6A 4PGGA 1D2GA 2PXXA 3EPPA 4ZTBA 4F85A 5LQJA 4PYOA 1QYRA 2AOXA 2NXCA 3LDUA 2YUIA 1JSZA 4RVDA 1JQ3A 2K4MA 3R0QA 3P71T 5EMMA 1EJ6A 1G6Q1 1TPYA 2H1RA 2OO3A 2B25A 2QE6A 3CJRA 3P9IA 4GC9A 4HTFA 3EVBA 5EIWA 1T43A 4LECA 2ZWAA 1M0EA 3G89A 1KR5A 4IV0A 1RI1A 2PV0A 1HMYA 2AZTA 2XYRA 5CVJA 5E2BA 4IWNA 4PYQA 1G8SA 4AZSA 4X1OA 2AS0A 1JG4A 4V0QA 3KU1A 2P7IA 2ZBQA 4GOOD 3DLIA 2GLUA 2B2CA 2UYOA 5DTQA 3SSOA 3GWZA 5GIPE 2AR0A 2BR4A 1KPGA 3BGVA 4KW7A 1FPQA 4E32A 1L3IA 4HGYA 3VYWA 4RTMA 5FADA 2NXNA 4PYJA 3F4KA 4RTQA 2O05A 1F38A 1KIAA 3KR9A 3OCJA 3T7TA 5E9WA 10MHA 1X1BA 2OZVA 5KYGA 2OBFA 4GOMD 5EMKA 4E33A 1X1CA 3HVHA 3ELUA 2C7OA 5EGSA 4MWZA 5MHTA 3LL7A 1DL5A 1NW7A 3OE5A 1L9KA 2PKWA 4R8RA 4FR0A 1WS6A 4U7PB 2BR3A 3PFGA 2PT6A 2VZ9A 2WA1A 5U4XA 4K6MA 4A6EA 1NW6A 5CVVA 2B3TA 5DT2A 3GU3A 3M6XA 2GS9A 3DH0A 3QOWA 3CCFA 2EJUA 2OYRA 1RJDA 1SUSA 2OKCA 2ZW9A 3LBYA 4GOND 3BWYA 2P35A 4OA8A 3SVZA 5LR6A 3SSNA 5LQRA 4FT2A 5FUBA 3SXJA 1SKMA 5ICCA 3ER8A 3HA3A 5ICEA 5KS2A 4L7VA 3KHKA 2B9EA 3R9XB 5JR3A 1ZKDA 3HA5A 3LCUA 3NVKI 1VLMA 3BXOA 3FPJA 3GRUA 4XCXA 5EZQA 3KKZA 4F86A 4KIFA 3M33A 3BT7A 3FUTA 4E2XA 3NWBA 3I9FA 4G56A 5FHRA 1NBIA 5LQUA 5EEGA 1KPIA 1UFKA 2FHPA 2IPXA 2PWYA 3HVIA 1YZHA 2CKDA 3PB3A 4EK9A 3I58A 1KYZA 3T7SA 3FTEA 1XJ5A 3LHDA 1EG2A 1I1NA 3KQMA 4HH4A 2IDJA 5DWQA 3MCZA 5K0GA 1ORHA 3K0BA 3RIEA 3GCZA 3LCCA 3THRA 3UJ9A 4RTOA 2BH2A 1NT2A 4R8SA 3TMAA 2OY0A 2YX1A 4CXMA 1XDZA 5EEHA 4CTKA 3VC2A 2YTZA 1EQAA 4YUYA 1SG9A 3TM4A 3QV2A 3M70A 1YZ3A 2AOWA 2C7RA 3OE4A 4KDRA 5K03A 5ICGA 3A7DA 1VL5A 4MIKA 3P8ZA 5ICFA 4R6XA 1X19A 1P1BA 3H2BA 4QTTB 1NV8A 3AJDA 1M6EX 3EVAA 4FP9A 5BP7A 3G8AA 3UJ7A 3ERCA 3FRHA 5KQRA 3PTAA 5DRTA 3HCBA 3IEIA 5CVDA 3UJAA 1EIZA 2ERCA 3HCEA 2ADMA 2P41A 4RSRA 5EKUA 4P58A 3UA3A 2ORED 4HC4A 5K8VA 3NWEA 3KPVA 3ER9A 1QZZA 2NXJA 2DULA 2EJTA 4U7TB 3VC1A 1QANA 2ZCJA 1JG1A 4PYLA 5DX0A 2ZULA 3FUVA 3SX0A 3UJ8A 4C05A 3P9KA 3HCFA 4QVKA 3EVGA 3GRVA 3OPNA 5DXJA 5CVUA 4RTKA 2Y1WA 4QPPA 1FBNA 5DX1A 4CKCA 1R00A 1AF7A 2PX4A 3FPHA 3NTVA 3UJCA 5FQOA 4E70A 3B3FA 3R6TA 5EIFA 5P8WA 1JTEA 4DMGA 2AOTB 3X0DA 2G71A 5FULA 5HFJA 3FPGA
chains in the Genus database with same CATH superfamily
2C5LA 4BQNA 3WZ2A 2YN0A 5L4LA 5EWJA 2FRDC 4IF6A 2C9YA 2FG6C 4CW7A 3OEEA 2DGDA 4Y9UA 5A0VA 3PT9A 1O5IA 2C0QA 3KALA 3L2OB 1KF0A 4I1VA 1Q2UA 5KX5F 3ZE1B 3PEWA 3R24A 4YP7A 1Y1KE 2WJIA 4LYHA 1JQBA 1C0KA 2X19A 1I7PA 1IEXA 2FEKA 3L8DA 4LJYA 4R7ZA 2Y67A 3GCWA 4HO1X 4XWAA 1YFJA 1CUFA 4LCBA 4HDQB 5JNUA 4IGEA 1XRRA 1BHO1 4MITA 1WR8A 4F6RA 1JYSA 1UFOA 1U3UA 4DIKA 1SOAA 4WZ6A 5IKMA 2EYQA 3MSCA 3GEPA 4D3XA 2H52A 4E5PA 1J2UA 4YQYA 4AY4A 4W8OA 1R8SA 3JQ6A 4K87A 5SV2A 3QYAA 3WAGA 4O2BF 3ZGZA 1UT6A 1JWLA 1L7MA 1U0JA 1U0RA 2FPOA 3JQ9C 1T9GS 3CRQA 5GP1A 1FDOA 2KBFA 5AJWA 3BMCB 4RS4A 2ZBGA 3GC6A 1HK7A 5CCEA 3AQIA 4ENUA 3OCCA 4DVJA 4FE3A 3BF7A 4MVJP 1P7ZA 3VTAA 4DWVA 1J06A 4TRJA 5H4GA 5KTMA 5LJIA 3AR6A 1R5BA 2J7PD 2CLFB 3PR3A 5FUQA 4LN1A 4D56A 3FNIA 4U0JA 1SUCA 1Y3HA 3V2UA 2A5LA 4DLTA 3WDLA 1ETUA 4IXNA 3HKCA 4DIBA 4URXR 3G0IA 3NETA 4A91A 3CG4A 1NA5A 2G9VA 4LJSA 1ZOSA 1VXOA 5EVJA 4BPBA 5WRFA 3IMFA 7ABPA 1KMHB 4HHEA 1SUIA 4GBGA 3O9ZA 2KB0A 3SR3A 3IKVA 3AEQA 5BQXA 2HF8A 5CURA 1XJCA 1MX9A 1B4DA 1RJ9A 2UZAA 4XQ0A 3EGVA 1Y48E 5BNWA 1LPMA 2HA5A 3I1FA 1L7NA 3O8NA 4JOSA 4UM7A 5CW1A 4YASA 1KYTA 5F64A 1K08A 4HAIA 3VQTA 3Q3IA 2H2GA 4RD1A 2IOHA 5IW8A 1HYBA 2WHPA 3S2YA 4Q37A 1EK1A 1MO4A 2E2WA 2BBTA 4H7KA 1NNEA 1EDZA 3CKKA 1I6KA 4RD4A 2BEVA 2CUNA 5FOQA 4A16A 1KI6B 2QRJA 3EIEA 2POCA 1X1RA 2VZEA 4MQLA 4X8HA 8LDHA 1UKCA 4O4JF 4GUDA 2IYQA 3U7RA 3TLKA 3QH4A 3AVQA 1JEJA 2OORC 1K8QA 4LJRA 1ODCA 2DFNA 1J00A 1K89A 3HJAA 3FFBA 3L7DA 1CG6A 2PUWA 4XIJA 2PMEA 2D0IA 5K8TA 4UUOA 3IB6A 3LLUA 1FP6A 1D2AA 4CNQA 3IP5A 3KJFA 4K3VA 2VBGA 2DE0X 4X3OA 2QW1A 3TWOA 1YTUA 3UG7A 4NG5A 2Q07A 5CB4F 1SWVA 2FFRA 1GNVA 4PYMA 2HO5A 4JJ8A 2JBHA 3LOUA 4NZYA 2JFOA 2X6TA 2IA5A 4BQRA 2DFLA 1DAKA 5DM70 4NMHA 2V8BA 1WY7A 4OQDA 3ABRB 3E9CA 1UBCA 1R1DA 1Z0IA 2IGBA 2Q8PA 3OKFA 4WGFA 1LRKA 5D87A 3RVQA 1FFHA 1H2YA 1WDMA 2RBGA 4FNAA 4C3VA 4PSKA 3GAAA 3WYFA 4E03A 1YB2A 1VCNA 3A9UA 1ORIA 1TMYA 3JQBA 4B2IA 3EMKA 4XQGA 5BRJA 4DM3A 5K05A 3S40A 4AROA 1Y3AA 5KNCA 5M04A 2D06A 1USGA 4G01B 2Q1YA 2DVMA 5BSUA 4L0DA 1WMBA 4KWEA 1P1CA 3CEHA 4BBZA 2YWJA 3C6MA 1T34A 1LU9A 4B34A 1Q0QA 2HYDA 1GEGA 5KQSA 1RWPA 3K96A 5BSHA 1CKEA 4HMQA 2Y0BA 4KHPB 4XIFA 4XX1A 4EGAA 3FOEC 5T5QA 1WF3A 4RKEA 2I29A 2PLWA 4QFBA 4N6GA 4QGSA 2WMNB 1WSAA 1NSFA 1SCQA 2E5WA 2NNWB 2PL3A 1K3FA 2F8LA 2BKEA 2GVDC 5A0TA 5IPFA 4M54A 2OAQ1 2XCQA 3FAZA 2X0EA 2QZZA 3PWZA 5BQOA 1TO6A 1GFWA 1G60A 2PUBA 3QELA 1XF1A 2Z09A 2PSSA 4P0PB 3KK0A 5JXHA 2PL1A 3HLTA 2GUGA 4KFUA 5FA6A 4MR8A 2XDWA 4BNIA 4TV8F 3WKBA 4CDMA 5IXYA 4Q4JB 3ADKA 3U3MA 4LK2A 2IODA 5LFAA 3PXEA 4TKMA 5HR5A 2I54A 1LGYA 3ZE7A 3W3ZB 3PDIA 1IHOA 1YL6A 2ZWOA 4JI6B 7REQB 4AXBA 2QI9F 1UBJS 1WKBA 1W48A 4YIHA 4ZICA 1GLNA 2YR0A 1YUBA 3B85A 4HWRA 4PBSA 1G5HA 2WHXA 2ZRKA 3C8UA 3IPAA 3QWBA 4GSYA 3IH5A 5H3CA 4EZIA 1BKDR 1IHDA 1TYZA 1Z0SA 3KE9A 3VDRA 4A1OA 3E9EA 4XGRA 4EL0A 2QY6A 2EBUA 4L3OA 3X1JA 4QSMA 3KJHA 2PU7A 2IW3A 2OGWA 3A9RA 4K2HA 1RVV1 3GJ6A 2E4UA 2G9NA 1E3TA 3CSUA 4RPJA 1U6KA 3ROTA 3OFKA 2WNIA 1BOOA 3F9IA 3IJRA 4FR5A 3QWFA 4OSPA 2G3YA 4KFRA 2EGUA 3AFGA 3O3OB 1UKVY 2OAGA 5FLEX 3R3HA 4ZGGA 4PNZA 4JUFA 2WJJA 3AF5A 2VHEA 3B52X 4BC1A 4NBUA 5E7QA 4V1CI 4KWHA 5HOQA 2CFIA 2Z8XA 4D6YA 2OPBA 1CJMA 1P1FA 3WVNA 1DQRA 2QL9A 3C97A 1CP3A 4DJDC 3ASZA 3K1AA 5AI6A 6ADHA 1MZVA 1QHYA 4MVJH 1DAPA 2YV5A 3PE4A 1K3UB 2D4HA 4KXMA 4YX9A 1VE9A 1Q7RA 1U0OC 1HE8B 2G67A 2OCIA 3R6DA 4EG0A 3FTFA 1WVMA 3FNFA 1OZFA 2A0KA 3WTCA 1E2EA 1JJ7A 4QVGA 2ZJ3A 3FKJA 3TSYA 1UBOS 5FWXB 4E5VA 1OH7A 1RJEA 3PKIA 3V8RA 3L7OA 4OUDB 2W6MA 4UMFA 1YVPA 2I6FA 1OYWA 5LVAA 1RC0A 2J0SA 3LQKA 2W2XA 3I72A 3NLLA 4MKZA 5FA5A 4IAOA 4R71A 2FN9A 4YCMA 2HSDA 3D6HA 3MS2A 4K9PA 5BQFA 4TXMA 3HEMA 2SHKA 4KTVE 1VBFA 1VG8A 1DQZA 2MINB 1JNXX 1SZDA 3A6HA 3I2FA 5KJ6A 2BEJA 2G25A 2B1GA 3R8XA 1J9ZA 1ZX1A 3BGOS 2PR2A 1I3MA 1B15A 3R3WA 4PG7A 4PAMA 1UJ2A 3SP1A 1U2RA 2PFSA 4FGZA 2XXAB 2DXIA 1G8YA 3IEPA 1PT8A 1XR3A 1A5ZA 2HDOA 2VEOA 1I4DD 4N5DA 3ZE0B 3B1KA 4G5FA 4IQFA 5IMBA 2YWFA 1FMTA 1PEKE 2PA3A 2ZI4A 3VPBA 4N65A 4X92A 2WFLA 1XCPA 2QMYA 3AEKB 4N4AA 1RBZA 1RLJA 1IM2A 3L6BA 1OXSC 3OEYA 3K35A 1I6WA 1ODIA 2Y0PA 3NT5A 4HLNA 4NARA 4OJYA 3THOA 4DW8A 4F3KA 5CX4A 1F1BA 3SM3A 4D25A 4KXWA 3FKSA 2CXSA 3QF7A 2BP7A 1ZCZA 4TL9A 4CNBA 3V3KA 1NJ1A 4N0EA 1CFZA 3HXLA 3BK2A 3I76A 5H80A 5E4JA 1PIWA 1VBMA 2FPIB 2HA2A 2OBXA 4N5LA 4PGAA 1FNSA 1H42A 3O1HB 4RH3A 1YZQA 3T3GA 3ZV7A 1U63A 4BLOA 2CCGA 3Q3GE 4B0OA 4AY2A 1EGAA 2AXQA 1G8KA 3H9BA 2QJTA 2XCOA 3DD5A 2KJQA 3L7CA 1KPHA 3VR2A 4PGMA 3AKYA 3VM6A 3ZIAD 4EJ2A 1D9XA 1N3BA 1QGYA 5I7WA 1G0OA 4ZI3A 1SVWA 2CHUA 3A6JA 1CUEA 5ALSA 4K0RA 3IPXA 4MVYA 2FPRA 2GEVA 3V3TA 2QUKA 4I3GA 4ILEA 1T8UA 4KFSA 3BILA 4TTJA 1U04A 5CUQA 3IE0A 4JBXA 5ALNA 5DNVA 3ZHVA 1F0YA 1A8QA 2B7CA 4CCAA 1MC8A 2AOVA 1PAUA 3M9XA 2JLUA 2Z9CA 4L9WA 1CUDA 3P4YA 3PCTA 4GS5A 5C34B 4XDHA 3LJKA 3EH1A 1Z4NA 4D3DA 3I6BA 4UNNA 3ECCA 1T8TA 4L9SA 4ZDWA 2VNHA 4EITA 4K6FA 2R6R1 3QY0A 4BZWA 3DYBA 2ZYWX 2C1XA 1LPAB 1V96A 4Z4CA 1E2PA 4MLDA 5B64A 4OQMA 1UDRA 3F8SA 1MAAA 3K09A 4OJNA 3JWGA 4BP3A 4YMHA 4HXYA 4NFLA 5JYBA 3S99A 3U3RA 3PYXA 1DJMA 3SG0A 3G23A 1AB6A 4GYJA 1H5QA 1L5OA 2TECE 1SB9A 3M6UA 4JJKA 4ZTBA 1D2GA 2ZJZA 5T7BA 2Q27A 5EESA 3GFQA 4DG9A 5T57A 1OIXA 1U3FA 3B6KA 4HDRB 4I5GA 2JCVA 3MUEA 4MVWA 1JZTA 5ALOA 1JU9A 5BOVA 1D4FA 1HMPA 5KYTA 2AT1A 1EK2A 2JRLA 4GXQA 5J4LA 1KHTA 3VR5A 4L50A 1QIFA 1PBNA 4KO2S 1UBEA 3EX7C 4NEQA 3AL3A 1NQWA 1OBVA 2ZYIA 2MSNA 3HZZA 2GFHA 1GKYA 4FGSA 4TTQA 5FIUA 5IS2A 4HFNA 3G02A 2WU1A 3A28A 1C0PA 2AR0A 2HBYA 2BR4A 3IRUA 3Q0TA 5IAAA 4DPLA 3GFTA 1GSHA 4HPJB 3B36A 3EZNA 2I6TA 4NHEA 2Y1GA 1DIOB 1THMA 5FADA 4EHBA 2QXTA 3C15C 2OM2A 3LO5A 1TJ3A 2F7SA 1A98A 5DGCA 3THXA 1ISGA 1NDHA 3O8CA 2YV1A 4HXFB 5DOZA 2J32A 3U9TA 4DLWA 1NW7A 1V26A 5DNWA 1AUOA 4FYYA 2MR6A 1XCMA 2WWWA 2X0RA 3IAFA 2VZ9A 3FH0A 1ZONA 4OKSA 4WV3A 2GF0A 4B76A 2OXCA 4PC6A 5A5GA 2ZQYA 3GLIE 1PL7A 2BTQA 4EPRA 2ZW9A 1E2GA 3DOOA 4AI6A 1U8ZA 3H5IA 1LJUA 2H1LA 3NAMA 1DIAA 5I7OA 4R3WA 4W9NC 4ZFNA 3AVVA 4JR1A 2NVOA 2NOAA 2ACKA 2QRUA 1XQVA 4K9SA 1XSEA 2PZMA 3KKZA 1EFPB 5I9LA 4GKKB 2BGIA 5D51S 4KIFA 1WX1A 3WIUA 1PEYA 3WGGA 4RGQA 1AHIA 2EZTA 1S1CA 4MZXA 4KQIA 4LJ4A 2KSQA 3DOIA 2FHPA 4RO0A 2FSSA 5DLEA 5GZ1A 5K3EA 1Y3BE 4Y7CA 3UYLA 2BTEA 2YMPA 1KYZA 4I1PA 1C30B 2VDNB 2CZGA 3KQMA 4CG2A 4FGJA 5DWQA 2EFYA 4Q48A 3OPVA 3N5CA 3MCZA 3LCCA 5LLSA 1KS9A 4KBGA 2VRCA 5FX2A 2ZRFA 1V3QE 3T9FA 1YE3A 4L4SA 3VISA 1DKLA 1M1UA 1NF8A 2BBWA 4OK3A 5LZ8A 3DD1A 3ZQUA 4CXMA 1AKUA 4ZYYA 1NFRA 4OQYA 4YA6A 4LA4A 4Q1BA 3K9FC 3D81A 4Y2SA 5JNTA 1P19A 3PQDA 3QV2A 1L5LA 2LWIA 5AJTA 2VHWA 5DSZA 4DLYA 4DQUA 1O97D 1MABA 3KZOA 4QPZA 5GONA 4AJ2A 1WULS 1P1BA 1RQXA 4KQCA 3UG6A 4J94A 3ZDFA 1M6EX 4P3OA 4UAJA 1QPGA 1UPUA 2W4MA 3TOVA 3ZXXA 3PTAA 4F12A 3D4LA 2ODAA 2G6BA 3IEIA 2Y1LA 1NKSA 4KN6A 4NRDA 1ULUA 3B1VA 5JXWA 4PHTA 3W5VA 2BCGY 1GNQA 5TSDA 4LFBB 2Q46A 5FI0B 721PA 2NN3C 1OH6A 4PYLA 4R5MA 3UPTA 3P9KA 4RK5A 4Y0NA 1D1TA 3TQHA 3W5HA 1CTQA 3OPNA 1PS0A 4KJZA 3QVLA 3ZWQA 2BI8A 3EPJA 4NV1A 3ROMA 1KARA 5AW8A 4FBGA 5ITZA 1IIBA 2WMYA 3GLSA 1Q20A 1PV1A 2E4XA 2VSFA 3WGNA 1G2PA 2AOTB 1OLSA 1Z7EA 2FPSA 4OTZA 2WWIA 3JRWA 3ONFA 1I4LD 2PMDA 5CYFA 5G41A 3KP1A 5C31A 4B83A 1J9EA 4C6TB 1N8KA 1SCDA 2FY8A 3NIFB 3FFAA 3I1YA 3U7IA 3SYNA 1O08A 2C5EA 4OAQA 4KQXA 4G5GA 4P38A 2CL5A 1SBQA 2ZE6A 1T6ZA 2BMJA 3NUGA 5TX7A 2EJCA 3I9JA 2HFKA 3TPCA 3ZS8A 3G1UA 4AVYA 3NEAA 3QEAZ 1C4KA 5JROA 4X41A 4CIWA 1XMIA 2J5QA 4HNUA 2WF8A 4R9NA 3KPWA 3NAQA 1JF8A 4LDAA 4RV9A 3NO4A 1Q1BA 1S3GA 1DKMA 3SZRA 2XDQA 1QS0B 1B23P 1T0IA 4C4YA 1QGUA 1YU9A 2YZKA 3SHOA 1EVIA 2ZBVA 3DWGA 3PPXA 3BQMB 3TD6A 5IAKA 1U9IC 4LI0A 2C42A 4CKBA 4JYPA 5K8CA 5JJKA 2G7ZA 4JX8A 5EMJA 1KY2A 2HPZA 2V5AA 4R7TA 3UB3A 3DAOA 3AGQA 3S29A 5BW8A 5GOZA 2RGRA 2GDZA 4BX8A 1VJGA 1F8FA 1YIOA 5A6VA 4C04A 4PPYA 5THKA 5CGQB 2QX6A 4G1EB 2C2BA 1E3LA 4AZ0A 1JZQA 3LNCA 2M98A 1ZLXA 2C5GA 2PRZA 3ILYA 2W58A 3BFKA 1IL0A 5AK0A 1VC2A 2NSDA 3QEOA 5U4QA 2G1AA 4O4LB 2UYGA 3HJUA 4IFTA 4PQEA 1ZI6A 4ZC8A 1QH9A 3I9NA 2YHAA 3O83A 1DDOA 4F5EA 1DTSA 5JBIA 4IIEA 1JQKA 1CQJB 3DDNA 4DUPA 1GIAA 3KR0A 2IVZA 4WLFA 1OI2A 1DOHA 1D4ZA 1N6PA 1U2GA 3KE8A 3PGA1 2Z1NA 3H2KA 4HN9A 3GEHA 4LC1A 3V1MA 6NULA 4KR6A 2PEYA 2IYRA 3CNNA 3HFSA 3JPYA 4BO4A 4LTNA 1JQ5A 4KNYA 2H2IA 5A4DA 3VHRA 4PYNA 2XDYA 4IIYA 2ZRHA 4MHSA 1Z38A 4FBLA 5SYNA 4WY8A 4YECA 2QM3A 3FNRA 5TE9A 5E2AA 4DR7B 3F3MA 5IC5A 1LBIA 1A9YA 2LPMA 2WZCA 3GN1A 1VB5A 5AT1A 3VDMA 4B40A 1KDRA 2ENUA 4E31A 5F52A 4HWSA 2AEEA 1R6BX 1JT2A 1P7WA 2HU2A 1K8YB 5K45A 2IFTA 3DTVB 3MT7A 5F7ZA 2Q3DA 2JIBA 2FRDA 1CXZA 1KAQA 2XTNA 1KNQA 2O1SA 2EDAA 4ARUA 4K26A 4DCNA 4FNGA 4CM3A 1FNMA 2C92A 4BKQA 3I1JA 2GZHA 2I9KA 3WLIA 4A4DA 3A9WA 4XD2A 3BJEA 2X0JA 2GAJA 3C3PA 4XR4A 4FYXA 1PLLA 2VT2A 4BN4A 1QJ4A 1UXHA 1QC5B 1RWNA 2NSYA 4RIIA 4WCDA 1X9IA 4LWQA 2DWCA 2I87A 2YJNA 3LTEA 3PTLA 5TRTA 1CUZA 5IAJA 1PJ2A 3KQOA 3CZMA 5CIWA 2FFHA 2O7VA 4OMCA 1SJ9A 2V6IA 4IZHA 4U9UA 5C8XA 3BMCA 3F6SA 2OV4A 4M0LA 5EIEA 4DLUA 5K3OA 2H08A 3EBLA 1VPLA 1UEIA 2EXXA 1AK1A 3JQ9A 3TFWA 5BORA 5IWAB 4ZGBA 1P4JA 1X94A 4ZODA 4Q3LA 3IMEA 3WGIA 1OASA 1QUFA 2R8OA 4L5CA 5KREA 4U4AA 5JD3A 1CZOA 4DQDA 5A4FS 5GIOE 2WP8J 3FNEA 2L17A 2O3TA 3ROEA 4UHHA 3W8DA 4WLUA 4GPEA 1W0KA 2ON6A 1KMHA 1OF1A 5F1PA 5ILQA 1U9JA 3TGLA 1U0TA 2C5AA 2VNSA 3NBQA 5TS2A 2HB6A 4IINA 1OUMA 4BFLA 3OU6A 1NAIA 1B6RA 2OCGA 3A3NA 2NPIA 3IAS6 2I03A 2QZJA 1KVQA 3LC1O 3AKDA 2CMFA 4C5BA 1U99A 4BV9A 1PGPA 1TNDA 4DV4B 1P4SA 3CCCA 2ZJ5A 3DFUA 5KVCA 4Z5XA 1MG0A 3KSMA 3B1YA 4P5PA 3TLEA 1T10A 2I99A 3D7SA 3A1WA 4FFPA 2JB9A 4GYWA 3G7SA 4LYYA 4M53A 4OXRA 3D6JA 4RV5A 3UHOA 1XZBA 3DWFA 4M9CA 3STYA 1FSZA 4YROA 1UP7A 2BJWA 1Z17A 1P4AA 3V97A 4XGIA 4W1QA 1L5QA 5JSUA 4R0VA 1N1MA 2FMFA 4IIDA 2XUOA 4HATA 4Y98A 3K2IA 4L15A 2OGZA 1H6BA 3RFFA 4GXRA 1YS1X 5DX8A 3O94A 5SY9A 4O4HA 4J4HA 1KEKA 2BFEB 2OORA 3LV8A 4MEAA 4ZQGA 4X66B 3UICA 1UWLA 1D2CA 2XUKA 2Z43A 4JLDA 3C1TA 4MCJA 3B3JA 5AW0A 2R2AA 5E4TA 1Z75A 1JE0A 4NX2A 3O95A 5E9QA 4CI0B 3UJPA 4I9HA 4IGKA 5IJAA 3R3SA 5U9CA 4KMMA 3RC2A 4OHZA 1U0HC 4PIVA 4UULA 1XJQA 2GYYA 5DTJA 5SICE 4UNQA 5ISMA 1GGVA 1RMYA 2PVSA 1N6OA 1N2SA 1DQPA 3F49S 4LX0A 2PGNA 4PCAA 2GZMA 5IN4A 2AN4A 2I34A 4ZVKA 4YAEA 2VCHA 4GP6A 4NAHA 5JQGF 5EUMA 4TRNA 1PW7A 3FBTA 4C4AA 3L05A 1ZM4A 3ZWXA 4A8PA 4BWVA 1LV7A 5A4KA 3LKZA 4DEYA 3W2GA 1KSFX 3UV3A 1C9DB 4DMLA 3R9KA 1ZSYA 3GIWA 1IOWA 2YIDA 3HV0A 3V7FA 2QVGA 1NUTA 1S01A 1OXKB 1JJAA 3CUKA 3OZCA 1SA0B 4NABA 4X60A 3QU9A 4ZVLA 2F4VB 4PTZA 3GLFE 2B5VA 5CT9A 1RYDA 1Y8AA 2C94A 5KNBH 2WINI 1CRLA 2VI5A 1UJNA 1U5CA 3UT5B 5JECA 3IPCA 1Y7PA 5FPKA 3HGMA 3L8FA 1H9BA 2OP0A 3ZBTA 4UM5A 1WQ3A 2HBRA 3NAZA 3CN7A 3L77A 5FFMA 2WIBA 2NV2B 3MGGA 3QFRA 3DHWC 4LEIA 2XKKA 2O8CB 1KJQA 3N74A 1YRWA 1OI4A 2H4HA 1JIXA 4WKOA 3L40A 1NW3A 1RKVA 3HABA 3INGA 1F60A 1Q92A 1FNCA 2DFPA 3OCVA 1VYUA 4LMAA 4R3NA 4DB2A 2XNJA 4KQEA 5ELLA 2Q1TA 3K3PA 4A2PA 2XODA 3ZCRA 1T5DX 4U3JB 4BQFA 3HB5X 2FU5C 4ROTA 1Z83A 4KN9S 2HJGA 3KSRA 4F8YA 3ONVA 5LKAA 2B92A 1BKYA 1NPDA 1BRTA 3OOWA 4EBFA 7REQA 1Q11A 1WXHA 2Q2OA 2RJNA 2JFHA 2FVYA 1Z2AA 2CXTA 2R87A 3M6WA 5BW4A 2RGBA 2HMYB 5HF9A 2QTBA 1EKXA 3FLMA 3TMKA 3BAFA 2C8JA 2NXEA 1NTOA 2C2OA 2FW8A 2TRSB 2WWXA 2V6MA 3OOEA 4HSGA 1JR3A 3KJNA 3ZWYA 4G0XA 2EJBA 5DYTA 2HREA 2DKOA 2GGSA 1OBOA 1UWVA 3KQLA 2IIVA 4Q7EA 4US0R 3BSYA 1WPXA 3F4LA 1E77A 2CYAA 5KAPA 3TQSA 3SZOA 3USCS 3UWDA 4O3MA 3VHXB 4PSDA 3W1WA 2ZT5A 3MRTA 3FHTA 3ETLA 2O5EA 1NU6A 3F9RA 4HADA 4DC1A 3R7WB 2UUBB 1N9ZA 2QKYA 3KZXA 5LU9A 1OA1A 5FR2A 4L4XA 1OY1A 2JIRA 3KOZA 2KQUA 3AIMA 1BHQ1 2HXSA 1OW3B 4ENRA 3B7WA 4RTSA 1PHRA 2H6EA 1UPFA 2OBBA 1IBRA 2W6ZA 4FJ0A 3RW9A 5BMVB 1QCCA 3LP5A 4JGIA 5CA1F 1KXZA 4GMFA 4HWTA 3WLHA 1XTZA 4LNUB 5DEIA 5LLDA 3F46A 3FJ1A 3PGLA 1XDWA 3MIIA 5JTUA 3OPYB 2BM8A 4ZD6A 5JG7A 4LXYA 1T8WA 2ZRAA 3GA5A 3I2YX 4NR0A 1GXSB 1P2FA 4MAAA 5LXTF 4FYPA 5CEFA 3E9YA 4JZYA 1M1NB 2O1XA 5FWXA 4CTOA 2VPIA 2RE8A 3GEDA 4LDPA 1MO5A 2GYUA 4OUDA 4BV8A 1LLFA 5AVUA 2F8SA 2IS1A 1J8YF 4P82A 4TQGA 3P4UA 2H4YA 3MWEB 1EK6A 2IH4A 1YJCA 2IRWA 3I5YA 4TZ0A 3EVNA 3O21A 4DRZA 5L6LB 3I9V6 3SMVA 1BW9B 1GA6A 1ORTA 4I4LA 2JH9A 4J9UE 3FNBA 1Q1EA 2E18A 1EXWA 5IYZF 3GPLA 2MINA 1DKNA 2EP8A 3LE8A 4WOKA 1RYZA 3IR6A 1W1WA 3PHIA 1R0XA 4RY9A 1ODJA 2EKPA 2OHXA 4J0HA 3IAM6 5FAXA 3SHFA 2GEDA 1DO8A 4X8OA 1R6XA 3MCTA 4ZPJA 3DUWA 3HJTA 3HBFA 4YPFA 1B7GO 3KSDO 2BMAA 3PUWA 2UYHA 3FTDA 3IIIA 3PQFA 3L84A 2CLCX 3FF4A 3IGFA 1NC1A 2QP4A 4PO3X 4JLNA 1T9ZA 4TV9B 4UEQA 5EQDA 3VJKA 4OAPA 3WV5A 4A2CA 4JK3A 2OP1A 3D9QX 4EFDA 4OI4A 1XZ8A 3SIRA 4E2YA 3KDSE 3IOCA 1MHPA 2H1IA 1JJIA 4B3HA 5FAKA 1E1DA 1D5CA 3F6EX 3AEKA 3KV1A 3R41A 5JD5A 1FSSA 2ZI9A 2H1OA 4ZTZB 4Q16A 3W3AA 4LRXA 2FN8A 4D4HA 5GADl 1KQOA 3SNKA 3TJMA 2C59A 3H97A 4XJSA 4ZXPA 3P9IA 4Y2QA 4KV7A 4A3SA 5CEEA 4GC9A 3F2VA 4J7XA 3WHLA 2R25B 4C6HA 3CZRA 3B12A 2Y6VA 1VI6A 4BEJA 3LLVA 4NMWA 4HEQA 1K6EA 2R9VA 1ENZA 3GFBA 4H9GA 1RI1A 3UB4A 2FPIA 4YRIA 4K88A 1J09A 4H7IA 4EW2A 2QRHA 1DMRA 4YI5A 4KEAA 4RZHA 5FF9A 2CVQA 2JI6A 1T35A 1CQPA 3KLOA 2I2WA 3COPA 3N2KB 5JH7F 2YMMA 4CETA 4IX9A 3DCYA 1L3IA 4HDMB 5K8JB 3L7AA 4CGYA 5BPFA 2HJRA 2O05A 4GL2A 3I2HA 3EF1A 5E9WA 2Y05A 2OZVA 2AI2A 3DOJA 4BWFB 1XTJA 1YBHA 1PDOA 2FZCA 3IXLA 3EUAA 2IYYA 2D2FA 3NHWA 3SX2A 1S2LA 2RHJA 4UMEA 1E1KA 3OJXA 4MYTA 2A86A 4BZXA 4CMEC 3UH1A 1P0PA 5JS6A 3WOHA 5TGZA 1DZ3A 5AM2A 1R7RA 1EJ2A 3D7NA 4UM9D 3ADOA 4HLQB 4KBFA 3U0BA 3HA3A 4KH1A 1JFFB 3FETA 2GR9A 3KXIA 1WP4A 2D0PB 4QJBA 2H5IA 4RH1A 4ZO8A 1IJEA 3OEWA 1U3TA 1VBNA 3LCUA 3RWBA 3NVKI 4LGVA 2JAWA 3KT0A 1BN7A 1NXWA 6GPBA 5KNCD 4ETIA 2ZRBA 5I9MA 4YO8A 3BT7A 4JEHA 3UK6A 3OT4A 2PTGA 1RRVA 1VRVA 4RSHA 3PIIA 5BMOA 1EG7A 5KOIA 4HDRA 4EK9A 2GAOA 3IDQA 3AVUA 3L4SO 4LOHA 4LY6A 2XHZA 3W8EA 3SDZA 2WB4A 5EJMA 4DCJA 3JSAA 2PKQO 3ER6A 1Z2EA 2A94A 3FMPB 4ND2A 4A92A 1ULBA 4GKVA 3ZH9B 5BYAA 4KZKA 2XRFA 2EFHB 1JDTA 3SU8A 4KPEC 1HA3A 2BEWB 1WXFA 4RZ2A 4B45A 4CTKA 1XWIA 2LRHA 2NZ2A 1K5PA 3JVVA 4IDHA 1B74A 3TBKA 1R5JA 1PFGA 1VA4A 2D1FA 2R8BA 2XXJA 3VSAA 3THYB 2J8ZA 3ZD7A 4NOJA 2IDMA 3EVAA 1ZNYA 3OZXA 1PVVA 3A6KA 2QN6A 1XA4A 3HCOA 3HB9A 4DMUB 3F7OA 1ORVA 5AKKA 2DETA 1KFEB 3IR7A 2WTAA 1ZI8A 2O8EB 1P2GA 1DC5A 1UKYA 3W5DA 1N75A 3BJZA 4EA9A 2GCOA 5IDQA 3OX3A 3AKEA 3MJRA 2R7NA 2NUPB 3CLUD 2YRWA 1XKQA 3C45A 3LUPA 4U2DA 2I65A 3NANA 3V4LA 2FR8C 4YONB 2YYAA 3CW9A 1EM8B 5A2GA 4MDHA 3BIOA 4D0LB 4D9NA 1R0KA 2PL9A 2WUFA 4E70A 5A9SB 1XVUA 1CF2O 1Q17A 2V6GA 1T2VA 3C7KA 3WGOA 4EW6A 5JJIA 5KSZA 2AFVA 3RUAA 2XOXA 3E7PA 1LS1A 1Z2NX 4BTVA 5A5FA 4RYDA 3JCZA 2B1JA 4DJ5X 1EESA 1JLKA 1Y9EA 3V00A 4JCCA 4W9NA 1EFPA 3JVDA 2BSXA 1XZHA 3GXBA 4LJKA 2PUFA 1AZSC 4KIGA 2HU5A 3W9SA 1ODTC 4QNNA 4IJKA 1HOTA 3HWX1 2QN3A 4S1NA 5D6OA 3RVJA 1LSOA 3FVVA 2BGWA 4NBNA 1A5BB 4WY2A 5CH5A 4DDTA 3RAJA 2OK8A 5AK4A 1ZD9A 2G9ZA 1C30A 4QM6A 2OD7A 2BGLA 3VYTB 2WYHA 2J0VA 2Q9BA 2JDID 1HT3A 3KTFA 4JN6B 4Q12A 4Q1EA 5TGDA 1TTPB 10MHA 4RACA 4Y1GA 5GINE 3T5AA 1WMSA 4BB6A 1NVUQ 2O7NA 1EINA 4QFCA 4YJ3F 4C08A 3NWJA 1L8LA 3COZA 4MWDA 1QNFA 4GR5A 2IIPA 3F96A 4P22A 5JO9A 2R11A 3HPRA 3RK0A 1K2VN 1I14A 1G7RA 1WXQA 3GRZA 4HWOA 5DP2A 4FYWA 1YZKA 1T36B 3G9QA 4I3FA 4MV4A 4EMSA 3C7DB 2BKLA 2FOLA 4RADA 4ZI7B 2QTNA 3OP1A 2W11A 1JEYB 1KDVA 5K0SA 1HEYA 1XJ0A 3A31A 2XUHA 3CPHA 3EIXA 1GZDA 1KGSA 2ZGVA 1XQ9A 2PH7A 1NBAA 3M4XA 3WGLA 2VHZA 5CXUA 2O48X 1J0BA 2D5LA 3JZFA 3ZX5A 3LYLA 4UBIA 2PH3A 2ZYAA 3HSKA 1X14A 4D9BA 5EGNA 4A0SA 1SXJC 2KWIA 1IOLA 2P75A 1BJKA 4O8ZA 4RTRA 3EPRA 3IDFA 3ZUPA 4CG3A 4YAWA 4QYTA 5K2MA 1WP9A 1C3EA 3D43A 1F6WA 1SXJB 3OIWA 4G36A 4LTMA 4YJKA 4E11A 1Q0RA 3JQAB 4OH1A 2B6HA 3WB9A 4D9JA 4ZZ0A 4X3CA 4C6TA 4ID9A 3MHTA 3GZTB 4X1YB 5I9TA 3OM0A 4RQBA 4U7WA 4D82A 2HADA 3W5BA 2R96A 2YCLA 3FGZA 3IAXA 1WV0A 2EERA 1TM4E 1ZP6A 4XB6B 2SCUB 3UJ6A 1FFXB 3KQQA 3P20A 3MBIA 4FOLA 4MULA 4OB7A 3V8VA 3ZOKA 3WDKA 1ZM9A 1V0JA 5CT6A 3IDZA 4UREA 4JBWA 4PQGA 2WG1A 2HHJA 2XMZA 4OPMA 2R8PA 4MPRA 2L82A 1PUJA 3LUAA 2OHGA 3AIIA 3FKSD 1IDN1 4FZVA 4QXOA 3EQ7A 2JBAB 3U4AA 3WMFA 4Z9AA 1SXQA 4R31A 1DG9A 1NI4B 2W00A 4ED9A 4HRAA 1QS0A 1Z3CA 2GBLC 1IHUA 3B9RA 3CLVA 3MWDB 5LA6F 3HCRA 1S2IA 2KYRA 1DJNA 3AF2A 1WBDA 4M8SA 1CIVA 4MOWA 4UUBA 2Q9UA 2Q3HA 5A6SB 4ZEMA 2HF9A 4NCJA 5TEVA 3NVDA 3VR2D 5BSWA 1E20A 3EODA 2YV2A 4E0BA 4C21A 1EUCB 2XZDA 2PWPA 3D6NB 3JX9A 3OF2A 1Y1TA 3EWAA 1U9IA 2X9NA 4BNKA 4O5AA 3REOA 1QTRA 1TUBB 2FJUA 4OQPA 4OHXA 2P9YA 5P21A 1ECBA 1FUYB 4HGNA 3TAXA 3T7KA 1R6TA 2FR0A 3Q72A 3UOAB 4PLZA 1M1YB 3P2OA 4MSUA 3I04A 4Q4DA 1OB2A 3ZW7A 2QQ0A 3HJNA 4PAWA 3W4IA 4CF5A 3A26A 5C1PA 4YMGA 2VK4A 2JLZA 1GZUA 5BSKA 2D59A 4RXUA 4M1EA 3MIZA 4FCWA 4UNPA 3SS8A 1U9ZA 1CQJA 2ZJAA 1MJGM 4KGVA 5BWOA 4BWYA 4C1BA 4D4IA 3QQPA 3R3YA 5AKZA 3R1IA 5JC1A 4S0ZA 4OYLA 3C7TA 3Q1LA 1O6GA 3FYCA 5C7LO 5DW0A 2Q2NA 3LBAA 4RTJA 4M7PA 2VAWA 4O4IB 1YNSA 3I1IA 3JVEA 4R1OA 5M3BA 1K3TA 1JS1X 3KXKA 1P61B 2QUHA 1KJIA 4OK5A 2QDKA 1OAAA 2XDAA 1SK8A 1UIRA 1C29B 3DFZA 3FTNA 4JIGA 1OWNA 1SQGA 1NX6A 2XVZA 1WMEA 3G8YA 1NNSA 1TVMA 3ODGA 4RJJA 1X7XB 1RWBA 4F92B 1OX5A 2CJFA 9LDBA 2QZSA 2H9YA 2YWBA 4NCNA 1GTG1 3NI2A 2WK1A 4MYRA 4RVGA 5BSMA 1U0EA 3G0OA 2BI7A 4Y2JA 4H59A 2DKNA 2ZS9A 3DTVA 2VPQA 2V0CA 3FCXA 1JDPA 4GLFA 5BWNA 1FTSA 3BMQB 4FSDA 1RWWA 4PN7A 2AIRA 3U1TA 5FUWA 3VYVA 1EGVB 1SIBE 4EAQA 3AL2A 4V2IA 1DKUA 2OHFA 4JR2A 3FUWA 4RCZA 4EX7A 2P9QA 2IXGA 3RDPA 1QC5A 2ZK7A 4BECA 1LVHA 2GHRA 4X8LA 3UMGA 3OMWA 2W2NA 2CL6X 2IL1A 4JBHA 1FXWF 1VJDA 2OR3A 2ZBPA 3K9GA 5B1HA 3WLMA 2I7DA 1L7RA 1F4VA 5DHPA 5EKDA 5ALHA 2OPHA 4AMUA 4KU4A 4D4LA 2C95A 4DXHA 1PZXA 1GN9A 1NURA 1ZINA 2A7XA 3MGBA 5G40A 3OHSX 5GMOA 4CUJA 4PRKA 3A1CA 5EA2A 1DAHA 3FDZB 3BRWD 5FQNA 1T9HA 3R7FA 3U48A 1G5PA 2WJ4A 3NOQA 3ZHXA 4LKOA 2IU4A 2DLDA 4RFSB 4CKYA 5IABA 2DFDA 5JAZA 3IS3A 1PCXA 4A36A 3T5BA 1RJGA 4DRYA 3QW4B 1RPZA 4AKGA 1CUXA 2B82A 1UEXC 1YRLA 1XEAA 4B3FX 2I67A 1XBTA 2HCFA 2F55A 2QR3A 5L3QB 3TTXA 3AILA 3IVGA 2GB4A 3CEMA 5DNEA 3FWZA 4F9GA 1JMYA 1MORA 2HRDA 4GOLD 5BO5A 1Y8RB 4IJWA 3OU2A 9MHTA 3ZY3A 3HP7A 5HRAA 5HW0A 4WH0A 3VU8A 2OSVA 1NVGA 1A27A 4L4ZA 1RQLA 2O2SA 1KJ8A 4QNMA 3U7JA 1TL7C 5KHLB 5KOYA 4FMCB 2G06A 1YR8A 1Z4LA 5HMLA 4MR9A 4C7XA 4KIWA 4JJFA 1Y6FA 4J0DA 3TOXA 4B3BA 1I9GA 4WRRA 2VZ0A 4ZHQB 3DA8A 4LXHA 3WLRA 2Q0HA 3JWPA 5LB2A 1JWBB 1QMPA 3SEAA 3RS9A 2IYNA 2J0UB 1PK7A 4B09A 4PNEA 5A7GA 1YAJA 2VUIB 3LCVB 2A9PA 2LZ0A 3P9PA 1E0AA 3LLMA 5DNDA 4ALNA 2VRCD 4MWOA 2X0FA 5LCXA 2FB9A 2MSKA 2PANA 3ZCVA 1PD1A 4CR7A 2BFEA 3PXUA 1JYEA 2YXEA 1QFYA 1F0NA 3AW8A 1HTTA 1MRSA 1V16B 3AP1A 5D86A 3DMHA 1ZJYA 3DKVA 3CNBA 2XE7A 4PCVA 3C14C 4RVFA 2JGKA 3LQ1A 2WWVD 3ANXA 4E94A 1Z4PX 5CU7A 4JUCA 5TXGA 2BLNA 4ZVPA 5CH8A 4BE9A 3K0SA 1HLFA 4CCSA 3ETEA 4UVEA 5K3BA 1M6HA 2JHGA 3GFFA 2V54A 3HJGA 1Z25A 3CW2A 2CZCA 3LX6A 4KMOA 4ZEOA 3EMDA 3RF6A 3O93A 4ENTA 3I23A 3ZIUA 1JNYA 4ZOLB 5EKXA 3ZQ6A 5B36A 2EZ8A 1V39A 2YXNA 3VTZA 2J85A 4WINA 1QGOA 2Q49A 3A3PA 2FYTA 2MSLA 1YS9A 3KPUA 5T4HA 1P5FA 1TFUA 2E9SA 1PGNA 3CE6A 1PQYA 3FA2A 4CDNA 5BSFA 1VE6A 1M75A 2NVWA 2B4TO 2PN1A 3AR5A 2YN4A 2AG0A 1YIDA 1P8AA 3LOQA 3STWA 4PN3A 5JNLA 1SA0A 2JAXA 4ES6A 3E3OA 2HZBA 1Z63A 2HGZA 4JJEA 3FHLA 3MAGA 2MJLA 5DEOA 2ZQZA 3I01A 1SUPA 3I09A 1L6RA 1E2LA 2Y1EA 4MLZA 4WKPA 4KIJA 3WHIA 3VH2A 4TZ6A 1E9FA 4ML3A 3SQWA 4DY6A 3UT5A 3ZV5A 2HFJA 3QE4A 4AY6A 1EH5A 1GVHA 2V8OA 4XGQA 4CBVA 3B89A 1ZMBA 4L85A 3WLOA 1J5EB 3VNUA 1GOTA 4GEKA 4PR3A 4LTDA 2R65A 3WIEA 4HZGA 2O8CA 1AF4A 2V9CA 2BSQA 4UAGA 1ZH0A 3S8EA 3E3AA 1L3BA 2ODTX 4KR2A 3AVWA 1QB7A 4QJ3A 1BXRB 2PGAA 5EHZA 2JA2A 2FG7C 3C39A 1RXCA 1KY4A 1RAGA 3CR7A 3NJ4A 4U3JA 3I39X 2B7BA 1AHPA 2O0HA 1F14A 2YNMC 4QBIA 4XEUA 4ZQHA 3U4GA 1I3KA 1QG4A 4RHTA 2ZBRA 2QLFA 5FI1B 2JH3A 4R84A 1CB0A 3ZHYA 5IASA 3QXSA 4XRGA 2HRRA 1P2TA 1IB6A 2FPPB 1IHXA 1TQ6A 2BONA 5CG2A 3ZS9A 2QMOA 4BNDB 3M6LA 2VF2A 4HGOA 2RBKA 2XYVA 1FFEA 2WJHA 3FB4A 1MJ5A 3DAGA 1MT3A 2I22A 4PPGA 4A27A 1PTKA 2JLAA 1K9SA 4LC9A 3NDRA 3CO5A 3UV6A 4QPNA 3OFNA 5KJFA 4GX2A 5DK4A 2HEGA 2CDNA 3OCZA 2EV9A 2XQKA 4I3HA 3WNQA 3FVQA 1QXSA 2CJYA 3QHQA 1POXA 1IM8A 3C6BA 4F84A 2FQ1A 1XNQB 3OUZA 3PC3A 5J5VA 3VHXA 3UXHA 3DM5A 1P5JA 4TLCA 1QZ3A 1E5DA 4JC4A 3R7WA 2ZJ8A 2B34A 4MINA 2REQB 3PGXA 3REGA 1KC1A 2DSTA 2HQBA 4IDAA 4AK9A 4BVLA 3MZ0A 3LHKA 2ZIVB 2FG5A 2XKAA 1N6NA 1EEXB 3VPCA 1H8ED 2OV6A 1A2KC 2JGLA 5G4KB 1FS4A 3U39A 3LT1A 1YZUA 1OXMA 3E84A 1IN5A 5EIWA 2PTHA 3HSYA 5FJJA 3MJTA 4UHDA 1XYGA 3V7NA 5BMVA 5KQMA 3CWZA 3HWSA 3X44A 1ZH2A 2XWJI 4HYEA 4MX8A 1G3UA 1KMMA 3H2IA 3ZWKA 4LNUA 1AGRA 4OFXA 1ZD1A 1QCYA 3HBLA 1P45A 3DQZA 3OTIA 4PGFA 1VSTA 3BTOA 3OPYA 2IS2A 1Z2DA 5G0WA 1GXSA 4RZIA 4QG7A 1FYXA 2OV3A 2WMOB 1YQTA 2WT9A 1M1NA 3G1TA 5TEWA 5GIPE 2H7VA 5C8ZA 2HNAA 1ZJ4A 1JIUA 1KBOA 4JI0B 2GRAA 2X8WA 1YE5A 3EQ6A 3G17A 3VYWA 2EF0A 1D1PA 3MEQA 3MWEA 5AVTA 1C1YA 3OCWA 3OQ6A 1UOPA 4KRYA 3LCRA 1MC4A 2GWHA 3OZWA 3ENNA 1BW9A 4NOKA 2WAYA 1SZPA 2PLAA 2XMBA 4RU1A 3KTDA 2ZXUA 1YKGA 3PL5A 2MWMA 4E5DA 3MTJA 2B4RO 2R7KA 4I50B 4XDYA 5D00A 5B7PA 3BSWA 4JZKA 2W71A 3KB1A 1QRAA 1WU8A 4WWHA 1AUPA 1KYIA 2DPYA 5FBQB 1EVZA 1MRNA 2QPOA 4QC2A 1GCUA 3FCEA 4ZP1A 3F67A 2PUAA 5LQRA 1YQXA 2JVIA 2KI5A 4CODB 4IPTA 2QR2A 3KWLA 2YWEA 1VG1A 4RAOA 4TV9A 5ICCA 3CG0A 4YDRA 1YDGA 2ZWIA 4JLVA 4B7CA 1GR1A 4AKHA 1NZJA 4A5OA 1W0KD 4G8JA 3VPSA 2PPVA 3ABSB 3B5EA 3FZEA 5CFNA 5FUMA 3RVNA 4QOJA 3OZVA 3RKUA 1DJOA 1N2IA 3T3MB 2IUTA 3TR5A 5IUJC 2IPOA 2BGMA 4N5HX 4OYRA 3C3EA 1YDFA 4ZIRB 2JLXA 3OJEA 4E4YA 1L7PA 4OQQA 3A32A 1KZGB 4LXXA 4ZZ1A 1YNOA 3W5AA 1OZ0A 2MT9A 3CZ5A 4JJ7A 1KH3A 1I2ZA 2P5UA 3H8JA 4I08A 4U6QA 1AKMA 3F90A 1NVVQ 2OG2A 1CDOA 4AO6A 4FX2A 1IEWA 5B2FA 3TRJA 1WB9A 5ALGA 3CH6A 1IHPA 4RTOA 1J7KA 1FQWA 1ZCJA 2CSUA 2P5TB 4Z9XA 5ICSA 3FTPA 4RLHA 4DR1B 4N41A 3AM5A 2E55A 3Q15C 4FC6A 3CWQA 3OMXA 1M1ZA 2VDJA 2ZAGA 2ZITA 4TWZA 3W5UA 1QFMA 4JHLA 4DM4A 1EEHA 2DTDA 2I78A 3WO0A 3B6MA 3UPDA 3KZ1E 3KYCB 4EKDA 2AUNA 2DWPA 4D44A 3N2KA 3S2EA 1E2BA 4J1NA 1BIFA 2OKGA 4RD0A 4HDMA 1T24A 5CM8B 4ZO9A 3MTBA 5IC6A 3VR3A 5T4BA 5AVQA 2WYWA 4IILA 1SU4A 3ZDZB 2ERCA 1Y82A 3GCXA 3F3YA 3LS2A 2VHVA 1DBPA 4DNQA 2OENG 4DQVA 1QZZA 4B80A 3ER9A 2O0KA 3M3PA 3BXHA 1OBHA 2YJ3A 3L1VA 2YY6A 3QNMA 4GLLA 5I8WA 1BHSA 5IYZA 2BGRA 2JHFA 3DKIA 5DX0A 3AUXA 3T0FA 1QLJA 4Q93A 3AEXA 4C5CA 5DXJA 2H54A 1QX3A 2P90A 3RYTC 4B6OA 4RTKA 4XB2A 4TRRA 2ICAA 3U9LA 2XQGA 3AYXB 3WNZA 2Z9DA 2O2YA 3NTVA 2OXFA 1NLFA 4QODA 4ZRDA 4A15A 2FETA 1SXPA 4LF4B 1IBLB 3JTMA 3ICVA 1JFFA 1I4OA 5FUYA 4CMEA 3CU5A 2IYEA 2A0FA 4XVHA 2RHWA 3JWEA 3E9ZA 3WMXA 1Z8FA 2YS6A 1YZFA 1NONA 2K5UA 2Z98A 1HDRA 2QPAA 2YVLA 4COKA 2Q8NA 1TW3A 1TJNA 1E7WA 3GEMA 4P54A 2VT6A 5GV8A 2H29A 1O77A 3LLCA 4RIEA 3S5JA 3SKVA 1IWPB 1Y42X 2VJPA 3C3BA 3KIPA 3OQBA 5TMPA 3KFVA 1AS0A 1I24A 2CXXA 4JYCA 3PWTA 3R3UA 3DAHA 3R75A 3NZEA 1YBFA 3UATA 4FQ8A 2CLKB 5CPBA 5AI9A 5AKGA 4F4IA 2NYUA 3VPGA 2WU0A 2AVNA 2Z83A 2Y1CA 3IMCA 4GNRA 2ZI7A 1I32A 4IIFA 3AESB 3C6KA 2BEWA 1NWCA 1HRDA 1UPXA 2ZE7A 1A5TA 3L18A 4EYOA 5A3RA 1I7QB 4Y1EA 5DBEX 4LG1A 1NNUA 4PHCA 5TPZD 4D92A 4RJ2A 2IZOA 2N47A 3R6WA 2YZ7A 4DM7A 3THYA 1OKKA 1XRMA 3R0VA 3O03A 3CW8X 1LWOA 3RPEA 2Q4EA 1AHNA 3R9WA 3DTNA 4KQFA 1E2JA 1KAHA 3OQNA 3WYCA 1SQ0A 1E1MA 1NRWA 3FWNA 3LVQE 4LJ8A 2WMDA 4ZI5A 3REFA 1SVKA 2FQYA 2GXQA 1J25A 3A4YA 3IAEA 1GP2A 3DMNA 4NU6A 4OFWA 5EQFA 4EG6A 2O8EA 3EW7A 1V7CA 3RASA 1ESDA 1F5SA 1G2OA 2FSVC 3G88A 3QLEA 4ZVOA 3UTCA 3VBEA 3L06A 4R6WA 1K7YA 3GZNB 1WUHS 1XQYA 2PBRA 5I51A 1DJPA 2NUPA 3QHPA 4MVJA 1NBOA 4RGYA 4D9HA 3FXAA 3VZDA 1I94B 1QIIA 1LSSA 3A06A 3O3MB 2CHGA 1E5LA 1EM8A 3GGGA 1JHPA 4LQLA 3WK4A 2LIVA 3C7AA 3ZJ4A 5A9SA 3HUEA 3GUHA 3BERA 4Q02A 5IJ9B 3EGDB 1V9LA 1O8CA 2FR8A 2ZSFA 4J7AA 1NKVA 4I8DA 3L0YA 3RRYA 2R751 3N5KA 1MA3A 2AKYA 2H3EA 3P0EA 4Q47A 3WADA 1PFYA 3SQNA 3KB6A 1ZO8A 2Y93A 4ZV9A 2GN6A 1MR3F 3SR4A 4UOZA 4JJAA 2FQQA 3LA8A 1NUAA 1DUVG 4LAFA 1TDJA 3GLGE 2YXDA 1P6QA 3CH4B 1R0ZA 4DMFA 4ZVUA 2C3MA 1U7PA 4RNCA 3LL4A 1QTIA 4A6PA 4BIMA 3H18A 3IQGX 2VF8A 5KYYB 2C84A 4YT5A 2G88A 4RK0A 3LKDA 3CVOA 2CHEA 4AZ3B 3GGCA 1Z9BA 1WNFA 4LY3A 3THSA 4GNKA 4ENVA 4FC7A 1U1CA 3EBPA 3G2JA 3IP3A 4MPPA 4XSHA 3O1IC 1RZRD 1TQDA 1PT5A 3GL9A 4RPHA 2F1OA 5HGXA 2XB6A 5L7TA 2WDPA 1T36A 4LYJA 2WG0A 1OIVA 1BXKA 2ZYTX 1JALA 1YJQA 3HA2A 1QYCA 3UMSA 2FWNA 1P2DA 4PXSA 1JEYA 5HJ7A 3P9ZA 4D97A 1ZGHA 4LHEA 1MEOA 4YAKA 3N2YA 3U5TA 1KO1A 1ZVKA 4FEYA 2QE7A 2Z2JA 3FWYA 4L78A 1BA3A 1LNQA 4J0JA 1Y9AA 5BSTA 3LYAA 4YXFA 2ZU0C 2WPDD 2JAQA 5HTKA 4EIWA 1W8DA 4QZVA 2YCBA 4N7RA 4EATA 2L0XA 2ZJ6A 3FB1A 3WL5A 1FEZA 2P1DA 3I2JA 3IPRA 3HRKA 3KOUA 3KXLA 1SHZA 1IULA 1U8CB 4EPYA 4U7HA 1NJ8A 3ETNA 1OB5A 3H99A 4MV6A 4W5JA 4QPCA 1RQ2A 1XL0A 1P5ZB 2JIQA 1SXJA 2PBFA 3DR3A 4E2WA 4QQRA 4ZN6A 2PM8A 2IDKA 3EQZA 5JJBA 3PDCA 4R2LA 3JQAA 2ZJOA 2QK4A 5G02A 1NDUA 2G0NA 1K8XB 1KQPA 2ADFA 2C0CA 1FFAA 1SVSA 1LSJA 2WYVA 1UANA 3FLEA 1C9MA 4MUEA 3CC8A 4UE6A 3UT6A 4RCVA 2Y92A 2H4JA 2BMWA 1XTRA 5FP0A 1B26A 1J07A 1CX9B 3KJQA 2SCUA 4OHPA 4KZPA 1FFXA 3NB0A 3OO1A 3TOSA 1DEOA 4DCTA 4G8BA 2IV7A 4LF7B 2HSGA 3OKCA 1UJ4A 1PNOA 2NU7B 2C58A 2ONKA 5CCDA 4CDRA 4NCXA 1R9MA 4Z4EA 2WR8A 4HRXA 3F6PA 2JBAA 2WAMA 4QFDA 4J1SA 1CUYA 3GN2A 1NI4A 4XA8A 2QUIA 1QK3A 2B4AA 4JJIA 3ZU6A 1BAPA 1PL8A 3A9CA 5DNAA 2JJMA 1IZ9A 4WLOA 1XDBA 3IQDB 5CDGA 3FW1A 3MWDA 4D41A 5A4MS 5KWSA 2NP6A 3CZCA 3CUYA 4TYWA 5A6SA 2VAVA 5JRJA 3MN1A 4JUBA 3T3OA 5CP8A 2M6KA 2GBLA 5J43A 1IQ0A 3BA6A 3F5QA 1CETA 1NHGA 3HP4A 1EUCA 4CJXA 4XJTA 1RAAA 1MNQA 2GHQA 2ST1A 4D74A 3UAXA 1BEUB 1DX4A 2IYWA 1HPLA 1TUBA 3PUVA 4WK4B 2CYBA 1IIRA 3VX3A 5I4KA 1OXBB 1O54A 1GPJA 1M1YA 4CMBA 1ICIA 1TF2A 1RHQA 5HBGA 4JI3B 1NBWB 1B73A 2HDNB 2GZSA 4JQCA 2W6PA 2G07A 1Y8QB 1Z82A 3I53A 3K0FB 3WRXC 1IQRA 1MEJA 2VYVD 3G8DA 5DTEA 4LDNA 1W49A 1GD1O 3ZCUA 5ERXA 4YREA 2OGSA 3TW4A 2GZDA 3TZEA 1MAUA 1NLUA 2H2WA 4FXPA 4C0XA 3IA2A 4BPRA 3KZMA 1K9VF 4Z4QA 3QTLA 4O4IA 2C77A 3PEUA 3OICA 4GOJA 5TDHA 4CCYA 3IOYA 1JFSA 1XVTA 3GUUA 3H5RA 2VHYA 2R44A 4FQ7A 4HNAB 4L8FA 1XZFA 3ESYA 4BX3A 5TR9A 3DXYA 2XUIA 1RYEA 1X7XA 2AMLA 1UZUA 2P5SA 2VBCA 4KVFA 1WUYA 4YYZA 4Q15A 2HO4A 2IEGA 4MAFA 1Z22A 3NBFA 4QTUB 3AEYA 1Q74A 4NI5A 1WOMA 3KJGA 4AMYA 4BGIA 3BMQA 3ELDA 3UFXB 5IDXA 3FOZA 1ZVVA 2QT9A 4JLSA 4HDSB 4BO6A 1A9OA 1CE8B 3D7LA 2ZJFA 5KB3A 2C0PA 2FCAA 3BUSA 1E3IA 1NTRA 4N0PA 3NWPA 4NJMB 3X1DA 5F2KA 1DKOA 1A8SA 1GFIA 4HR7A 2PS1A 4IZOA 4W6QA 5KTSA 1ST2A 3I62A 3P52A 2W6OA 5DHQA 5BR8B 1GAXA 3HS3A 3BIFA 5AOVA 3SIWA 3LT2A 3ITKA 2KBEA 5LB4A 4AZTA 3EHDA 4PLGA 2P7HA 1N0IA 3VMFA 1QQTA 2J59A 2MSDB 5J4KA 3KBBA 4CL2A 3U2QA 5MF6A 1U6IA 3GHHA 4NKRA 4IRUB 4QXRA 3E23A 1N33B 5D5PA 3FDZA 2AF4C 3E58A 2C4NA 2IITA 3D0QA 1YFZA 3IUMA 3K2BA 4YCDA 4RFSA 5AKYA 4G84A 3WKEA 3AQ4A 1U8XX 4RHYA 5JFGA 5B3JA 2O52A 5IBRA 5BR4A 2JNWA 3G2QA 4PQFA 3EYAA 4PLYA 1BZYA 1LRLA 1EUDB 3CSSA 3GK3A 4YUZA 4DB4A 1BWRA 4P2GA 2FWRA 5I5EA 5E6RB 1SC3A 1RRPA 3OZIA 4HJRA 4JLJA 4DPKA 4DDUA 5L3QA 2FZEA 4DVGA 1WBJB 3AZOA 5I7FA 4P7FA 1XMOB 3SC3A 3PYLA 2QLBA 2O20A 1Y8RA 2AH5A 2Q50A 3FROA 3PI7A 3PIDA 4OD0A 3V4PB 3L4KA 4AKIA 3PJEA 3F1KA 5E1OA 3WB0A 1RXWA 3DR5A 3WB1A 2ZSJA 3M4NA 5F7JA 2ZUSA 4D6PA 5CK4A 1QWOA 1P6XA 1CY7A 4HEHA 4S1OA 3U7EB 1N5IA 1P4GA 1QYIA 2JIPA 2ODEA 2RI0A 3TW8B 1Q6ZA 3IIKA 8ABPA 3T41A 3PIRA 1XX6A 4WLNA 3EPKA 1RBQA 1V7ZA 3L0BA 1JMVA 1CCWA 4ND7A 4ZV7A 2GHTA 1RXIA 2P9TA 2XADA 3EZ7A 1SY7A 2VZ8A 4P86A 5DLPA 3ROZA 2MYNA 3IQEA 1B76A 1BXZA 5F78A 3ZD6A 3C4JA 1EX9A 2WJ6A 3PHCA 2J0UA 3KAPA 1P7VA 1Y1SA 1S2NA 2IX3A 2RD2A 3ZTWA 1UZLA 4PRZA 3KTAB 3SXPA 2P27A 3IP1A 1NSTA 4W5WA 4GGOA 3TTSA 4MB0A 5HSGA 5KC9A 3HYCA 2LE0A 4RYLA 4DCUA 1DIHA 2ECPA 4JL5A 1DIRA 1Q1GA 1PZEA 3TLJA 5IHXA 4LF8B 2ZZKA 3W7BA 2C9BA 1W36D 1I4EB 1XZJA 1V16A 3DZCA 4OG2A 3AJAA 3CLRC 4FDVA 4YEDA 4F5WA 3WWPA 4KQKA 1CJCA 1XZQA 2PUVA 1NV9A 4RTPA 4IS3A 3DM9B 2B69A 2Y3IA 5C5DA 2W93A 4OFBA 4POAA 3QFCA 1KDPA 1ZBQA 1AG9A 2ZR9A 2JI7A 3FYUB 3N8IA 3OQVA 4J2HA 1BQ3A 1VKNA 3LBNA 4GPTA 4E07A 4LWOA 3TIIA 1N6HA 3ZJUA 4BNGA 4IXDA 4IOKA 3W7VA 5HQ3A 4X6UA 5L4SA 1CD5A 1DQSA 1D04A 1GLVA 4FFRA 4XXHA 1UPCA 1BE8A 3IQZA 4X45A 4ZOLA 3S7ZA 3I64A 2VJMB 5K0FA 4CV0A 3T3NA 1A82A 3K15A 1JE1A 1QLWA 4BNLA 1JU3A 2B94A 3C8HA 1V7QA 5HUJA 2KHZA 4X3PA 4TMWA 1I5RA 1X74A 3N05A 4B17A 3CBQA 3RRJA 4LISA 1WAMA 1YRAA 1BJTA 4PS1A 4ZXFA 4M87A 1VZ2A 3EPPA 2RARA 1HE2A 4W5OA 4GYKA 4K9LA 4PX9A 2FRVA 1DOZA 3TB4A 1ISRA 4KYTA 2I7TA 2WPNA 5LUAA 1D6MA 3UQYS 3ZPXA 4MRNA 4BGEA 4TYNA 2C4MA 5AI8A 3OBBA 3BK7A 1W76A 4G0MA 3K1JA 2HA4A 2VHJA 2RI6A 1CEYA 4H3KB 4G1FA 3R76A 3G89A 5B4VA 4IV0A 2WTEA 1O95D 2ABWA 3AKCA 5COAA 1DEAA 5CVJA 1MTZA 3UPUA 3WICA 1BGVA 1QGAA 3NATA 3UANA 3LXMA 4GI1A 3LIIA 4B46A 3G5AA 2P7IA 4IHJB 1ZGGA 4YJHB 3RG8A 1I5EA 3L1UA 2UYOA 1Z29A 3LZCA 1H9CA 3SC6A 4I9NA 4KC0A 5B57C 2XSZD 1NVFA 4XYEA 5EXPA 2JGMA 1BXRA 3OCJA 2NX2A 4ESHA 4AJEA 2ZSAA 2ID9A 3MD9A 5TVKA 2B1IA 5BQ3A 4EP1A 1QYVA 4H35A 1ZXLA 3RYIB 2ZRCA 2O7RA 2UZ3A 4B3CA 3ZJTA 2EDCA 2C54A 2QSZA 1JLLB 2CVZA 5ESDA 3QMVA 2FPPA 3NRCA 3SS9X 3T1QA 4F5DA 5AW9A 2UXDB 2YNMA 2WA1A 3I9LA 3PV0A 3ECSA 2AD1A 4YRTA 1ULAA 4E09A 4BNDA 3MCVA 4AG3A 4BWGA 1TZBA 1WDWB 3NR2A 4F91B 1XQXA 4ECEA 2C3UA 1NR5A 2C2MA 3RI3A 5A5VA 3D4PA 3MLEA 2NAFA 4REMA 4QXAA 2A0YA 4DPMA 2FMKA 3SNHA 1CHDA 1DC7A 5CX1B 4RZQA 2GJKA 3E9DA 3ET5A 5AI0A 1WE2A 2A5JA 5BV8A 1ZKDA 1OX4B 2AI1A 3CX3A 3K53A 3GRUA 3IP7A 4MP3A 4NWIA 5G2OA 5L9AA 4MKIA 2O6LA 1FTYA 4NICA 5ARBA 1IXYA 3JD1A 5I4IA 2REQA 1NF9A 3B20A 1DEHA 1B93A 1TF7A 2Q4OA 4AJLA 3GLQA 4X9XA 5I8PA 4LS3A 4UXIA 2YVQA 5G4KA 1AK2A 1Q6YA 1XEXB 4LDZA 3NV9A 4JP8A 2JS7A 4FN4A 1A2OA 4R2HA 1CERA 1QIHA 3STUA 2BE7A 3VR4D 4M8NE 3NM6B 1JKJB 3SPXA 3DTVD 5H70A 1YI1A 1BDJA 4MIYA 3U4MA 1J2EA 4TMTA 2BUAA 5DXFA 1TXGA 5JS8A 1FDTA 4BU1A 2NACA 3EN0A 5DO9A 1Q3HA 1EDBA 3U7FB 1JXAA 1N2EA 1RC1A 5E4YA 2AOWA 2A1UB 2J4DA 3NOVA 3O1LA 4JL8A 1UJ6A 4PFJA 4WXMA 3WWZA 4MV8A 2R7MA 3PWKA 3P8ZA 3C24A 4DLSA 2QN1A 3ANTA 4KPFC 1HQYE 1MB4A 3CZAA 1T2AA 1O96B 2XBLA 4ZQEA 3RV4A 3UJAA 1P6UA 3QVVA 5JMTA 3H83A 3NFYA 1G5RA 1P72A 4A1FA 3DVSX 3MXTA 4OM7A 4PRYA 3GARA 2DPXA 4G4JA 3CWCA 1G42A 3I12A 2I71A 1CK4A 2NO7A 1NOKA 5GTDA 1XVLA 2EF1A 4G0NA 5D8DA 4B8WA 3E18A 2RHRA 4I50A 1C3OB 4XTCS 1U2EA 2G09A 3AF3A 2V1UA 1RHMA 4E08A 3ZNNA 4DA8A 3IVXA 3FYSA 1H94A 1DC8A 1VKZA 4LZNA 3K32A 2PQMA 5HKBA 3QU7A 3ZBQA 1XRSB 3F71A 2CVHA 5KOHB 2ZXFA 4G3XA 1W1IA 3ISVA 4UATA 3U19A 1SBZA 1TAGA 3BYZA 3AHCA 3RWOA 4N3NA 2OWEA 3IAS1 1ORDA 1HQCA 5ENVA 1CB7A 3DOEA 4RENA 4RMNA 5FPTA 3WL7A 4CRWB 1U28C 5B3LA 5ULLA 1GZ6A 1EP9A 3ORHA 1PWEA 2HU7A 1R50A 1XK7A 4KNVA 3GRYA 3QLTA 4R1NA 5ALFA 2WJZB 2XOEA 5AKIA 2JLBA 4GBMA 1N3LA 3EEYA 3EOAI 4ZIRA 4NXMB 5JAUA 1THGA 4G9EA 1O9GA 3E2IA 1JFLA 3A0RB 1D3AA 4NNOA 1SKUA 3WLKX 2I62A 1GTSA 4OY3A 1G1AA 3EZLA 4WOJA 4ZARA 4KFCA 1T0JB 1SRRA 1ETHA 1JT9A 2BZ0A 2OBYA 4O1MA 3ET4A 1ZQ1A 1K2WA 2GA9A 1DC4A 4MW1A 1NQ5A 4Y9DA 3DXZA 3VKVA 5C9ZA 2B2NA 4KVZA 5J5AA 4HNVA 5CDUA 2UVQA 2CBZA 2WF6A 1JDVA 1QCZA 2EBWA 2CXQA 3GOHA 2W8BB 1GZ5A 5CNKA 1Z08A 2VDPB 4WQMA 1MOQA 2QMUA 1CJSA 3MWKA 4Z8XA 3UAGA 1FDRA 4AYTA 1W25A 3MCWA 4WDQA 3WIOA 4FONA 1EP1B 1QYXA 1H8HA 3GVPA 3H3XA 3KYCA 3Q3HA 4IDFA 1A9ZA 2BZSA 4O8CA 4F0JA 4YRJA 4QDJA 4FZJA 4RY0A 1OWMA 4G25A 3AJEA 4YK7A 2Z6VA 1YS4A 5AHRA 1DEXA 1O0BA 3CIFA 1O94D 4H4EA 4ZCPA 1ESCA 1W4CA 1ZK1A 1EA7A 1FP2A 1T25A 1K7CA 4IJMA 4C6SA 2GTPA 3V6MA 3BC1A 5KNBA 4DV0B 3UC5A 3V2GA 2G70A 3TQCA 1ISIA 2HW8A 1TQ4A 4DCOA 3M4ZA 1D0VA 1N2CB 1T5HX 2APJA 3A6LA 3OLXA 2R6ZA 3TPZA 4K8OA 3O7WA 2I1VB 1P5HA 3E4CA 4C03A 1N2OA 2J45A 4QT4A 2IZ0A 2J87A 2OA0A 2O8BB 4UTOA 3PENA 4DTIA 1L5NA 1EWVA 2Y9MB 3L5KA 4LY0A 4DIFA 1L5GB 1P1IA 2XNDD 1PR4A 1HFJA 4GF5A 3UMCA 4BFCA 2PJDA 3N2NA 4FS3A 4Q1FA 3HNPA 1GUFA 1BDMA 4GG1A 4KAJA 3IE2A 4MP8A 3LW8A 2IEZA 1VPDA 4CM4B 4W5NA 1M74A 4FXOA 2QTMA 1OAKA 3NW9A 1IG3A 4KKVA 1ACMA 4LQCA 1YDWA 3DE0X 2WB2A 2WJGA 1H6AA 2XNCA 3QUAA 2Z2KA 3G9TA 5BUSA 3RAEC 3TDMA 5LC1A 1WU7A 4P7KA 5JRDS 2X7XA 3FRIA 3D54D 1NVWQ 1WB6A 4LXUA 3AV0B 3UK7A 4CT0A 5F9FA 3RHZA 4Z9YA 1HOXA 4LJ6A 2BGGA 1YU6A 2Q2QA 1XNRB 4X7BA 5ADUS 4E21A 7GPBA 1QP4A 3AESA 1QMGA 3DEAA 1N6RA 2HJHA 4JBNA 2BKUA 2YUTA 3O6VA 2YW2A 1EE1A 4P5EA 4XSGA 5SYMA 1EUQA 1XZPA 2P2CA 2VQ3A 3UJHA 2WTXA 5EN4A 2O2ZA 2C7QA 3LT4A 5LPNA 3OPYI 2GSDA 3DZFA 2R47A 3C3JA 4PY2A 1ZZEA 2GXSA 4NU0A 1TVKB 3CM0A 2VLIA 3QHAA 2BKXA 1Q15A 3GJ7A 4GU5A 4PO8A 4D9IA 5FV4A 1NVTA 3R4CA 2HD4A 2IBMA 1QKKA 3WBBA 5LLTA 3CRW1 1XNJA 4C6RA 3DWEX 4FWBA 5GGXA 1E98A 1WPGA 3JAMA 2WT4A 4O1HA 4O02B 1H0KA 4MI3A 4NE9A 3J7AC 4EYKA 3GZNA 1JSLA 4FYVA 4M98A 3KRTA 2DB3A 2GJSA 1QB8A 1XRJA 4KI0A 2PJRA 2BL4A 3CUSA 3RANA 3VNSA 1L4KA 3GW8A 4QQFA 2C2YA 3DWIA 2FSVA 4J75A 4AF8A 3CVVA 4YXWD 2JF0A 4KO8A 4RKFA 4IL5A 1UWKA 3KVVA 3OFND 4QT0A 5CBPB 3TX6A 1X70A 2VBIA 4Z1OA 3EGDA 4PLFA 4RY2A 2BGJA 5C37A 2P1ZA 2R0QC 4B74A 4R81A 4GP7A 3ETGA 5FBVB 3LY5A 3FBGA 1TZKA 1ECPA 3IEKA 3MD0A 4JUIA 5FNZA 4DDMA 1M6VB 5ICMA 2V9ZA 1CLUA 2XOKD 4LVOA 1S8NA 3O4IA 2ZUDA 4HK4A 1EWYA 5JASA 3FNHA 2IZ6A 3I2IA 1PS9A 2AUMA 4DR2B 2WJVA 4UW9A 2ZROA 4D3FA 1NC3A 2GD0A 3ASVA 1XWFA 3GJ0A 2ODWA 3WQSB 1E1LA 2GD2A 5KYYA 1V5GA 1O57A 4U2KA 2DAPA 4PG6A 4WN3A 4BLQA 2Q3JA 4AZ3A 3EVCA 5F5NA 1PQPA 4J4TA 4EFLA 2YOHA 4IZIA 2QRVB 2SECE 2CWWA 4J6FA 2XMDA 1HE4A 3I9V1 5YASA 1X1SA 5HHTA 5H9VA 5HK8A 4Q9IA 4EG3A 1G3RA