1XCJA

Guanidinoacetate methyltransferase containing s-adenosylhomocysteine and guanidinoacetate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
229
structure length
229
Chain Sequence
PLFAPGEDCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanidinoacetate N-methyltransferase
publication title Catalytic mechanism of guanidinoacetate methyltransferase: crystal structures of guanidinoacetate methyltransferase ternary complexes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 72
structure length 229
sequence length 229
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2004-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xcjA00
1QAMA 2OO3A 4K6MA 1HMYA 1L3CA 3FRIA 4GOMD 4ATNA 4E30A 3UJAA 2PKWA 3HTXA 4LWOA 1RI5A 4QVGA 4RTQA 1QZZA 4M7RA 3GGDA 4YUXA 3G89A 4KIFA 1KPIA 3EGEA 5K0JA 5GIPE 1KR5A 1M6YA 2BR4A 5DXAA 5EHGA 2OPBA 5EQJB 4X41A 5EMMA 3GRVA 4M38A 3X0DA 3PVCA 5E1BA 4YMGA 4WXHA 5IKMA 3CBGA 1I4WA 2OZVA 1TPYA 1INLA 4P7FA 1X1CA 3GRRA 4AZTA 5EVJA 3GJYA 3FUUA 2WK1A 2AN3A 2UYQA 3FZGA 2B2CA 3KQVA 2ZLBA 3OU7A 3LDUA 4QQKA 4U7PB 4POOA 1F3LA 5U4XA 5LQKA 5HEKA 1UIRA 3GU3A 5FWAA 3EEYA 5K0LA 3SXJA 4EMSA 5E9JA 3P2IA 2PY6A 3EVBA 5CUQA 1I1NA 1JQEA 3MTEA 2ZZMA 3OZTA 2FRXA 4OQEA 3TR6A 5F2NA 2P8JA 3A27A 3LECA 2P41A 1RJDA 4RVGA 3BGDA 3Q87B 3I9FA 2NXNA 2XYQA 5FA5A 2CMGA 1ORIA 2C7QA 1YFLA 5GOZA 3Q7EA 3EVAA 3P9NA 3FPJA 8MHTA 2R3SA 4C06A 3SSMA 3DR5A 1M0EA 2XYRA 3BUSA 3LDGA 2JHCA 3P9CA 1QAQA 4YUZA 1WY7A 2O07A 1R74A 5FWDA 2P35A 3UJ6A 3KQMA 2AOWA 3KQPA 5K0BA 3SSOA 4WVLA 3FUXA 1XDUA 4QVKA 2GPYA 4BLUA 5GP1A 3KKZA 3EGVA 2QY6A 5GWXA 4YV0A 3CJQA 5F2OA 4LECA 4XUCA 2ZW9A 3FUVA 3KQOA 5D1NA 4FSXA 1JSXA 3T7SA 4GUAA 3HA3A 5CVJA 1D2GA 4YUVA 1N7IA 2GS9A 2IH4A 3KR0A 2OYRA 3G2PA 4CWAA 3ID6C 3MCTA 3E8SA 2ZZNA 4RTLA 1T43A 2G8NA 2DULA 3G5TA 5CVUA 3VC2A 1FPQA 3PT9A 3R0QA 4F84A 2ZBQA 1G55A 5HOQA 5DX0A 4F85A 2BH2A 1KXZA 1TW2A 3PS9A 3CJTA 1Y8CA 1MJFA 3M33A 5K0EA 1VPTA 4HSGA 4R8RA 1YF3A 1ZGJA 3NJRA 5C9ZA 2CKDA 3OZRA 2PSSA 4X61A 5DTQA 3TKYA 5EZSA 3KR9A 1XDZA 5BP7A 5ICEA 5E2AA 2FYTA 1UWVA 3DUWA 3BZBA 3HVHA 1DCTA 2AOXA 3C0KA 4KWCA 2G1PA 3ELWA 2AOTB 2I62A 4Y30A 1TW3A 2NYUA 3MAGA 5KVAA 4RTOA 2YTZA 3SSNA 2I7CA 4C04A 3HA7A 2YXDA 2OXTA 1BKYA 3GXOA 3EEOA 3M6UA 4CTKA 1SUIA 4PYIA 4CTJA 5B1SA 2B25A 3DXZA 2QRVB 4KW7A 5EMLA 4QTUB 3QOWA 5EKUA 3RODA 1Q0SA 1G8SA 3LL7A 5F2KA 4RWZA 1RI1A 2Z6QA 4FS8A 4HTFA 4R6XA 2YUIA 2XVAA 3E23A 2ZIEA 3BGIA 5HFJA 2EFJA 3P97A 2IDJA 4PGHA 1KHHA 3EGIA 3LKZA 1N7JA 3UJ8A 5CCBA 5K8VA 3SR4A 1RJEA 5DM0A 2B3TA 5M5BA 1ORHA 3C6KA 5HIJA 4YV1A 2C7OA 2JH9A 5K0FA 3KQTA 3GO4A 3K6RA 2VZ9A 4C07A 1O9GA 3QV2A 5FQOA 5C1IA 4HC4A 4IV8A 3I5UA 1EJ0A 2YXEA 4HG2A 4LWPA 1D2CA 3G5LA 3HA5A 1WXXA 5DRTA 3UJ9A 3TPZA 4E2YA 3NWBA 2GH1A 5E1MA 3P2EA 5LQNA 3FPFA 4QTTB 2ERCA 1JSZA 1M6EX 3VC1A 4QDKA 5E9WA 3PX2A 2AOUB 1SVUA 1NBIA 2PT6A 3DTNA 5E2BA 4F86A 2JG3A 2P40A 4FR0A 4MQ4A 5E8RA 3NW9A 1B42A 3HM2A 3M4XA 5DM1A 4GC5A 4PYMA 4NECA 3THRA 5LR6A 1P1CA 2PV0A 3MCZA 5EMJA 2FCAA 1R18A 2Q41A 2V7EA 3HVKA 4EKIA 2PLWA 5E1DA 5C0OE 2ZWVA 5K0CA 2ONYA 3DLIA 2Z6UA 4DM3A 2PXAA 3CCFA 5BW4A 3FPEA 1AV6A 3DXXA 1AQIA 2DPMA 3NDJA 3JWIA 1FJXA 2IIPA 3OE4A 4FGZA 3THSA 2EG5A 3BKXA 1EAMA 2H00A 2PXXA 4G56A 1NT2A 5FUBA 4DZRA 3KR2A 2PT9A 4JXJA 3MHTA 3NVMB 4BY9E 1P1BA 4EKGA 3R9XB 3HNRA 2PVCA 4PYNA 1X1BA 1V39A 1ZGAA 2GA9A 2BR5A 2IFTA 3TMAA 4E2ZA 2ZIGA 5LSAA 4UOEA 4CXMA 4XCXA 1KIAA 1NW5A 3FTDA 2FHPA 2E5WA 3C3YA 2P3LA 4XUDA 3KQQA 1YUBA 4AZWA 1EG2A 1SQFA 2CL5A 1JG3A 1QYRA 2HTEA 3EMDA 4R05A 3NWEA 5FCDA 4E2XA 2EX4A 3FPHA 1NBHA 3EVCA 3V8VA 1DL5A 4LG1A 3DH0A 3M70A 4L7VA 5DLYA 1JQ3A 3KPVA 3SM3A 3G88A 3SVZA 5LQUA 2I9KA 1FBNA 1G8AA 1KYWA 2VDUE 3ELUA 5DTRA 4YMHA 5KS2A 2H11A 2G70A 4GF5A 4MIKA 3WSTA 5EC8A 4PYJA 2NP6A 1YZHA 1H1DA 1JR4A 1NKVA 1BOOA 4HH4A 4BP1A 4AUKA 1XJ5A 4EQZA 3DOUA 3OFKA 4OA8A 5DX8A 3TLJA 5EKXA 3FUTA 2IBSA 2NNWB 4HGZA 4GOOD 3G2OA 4BLWA 2F8LA 4PYOA 2JJQA 5HIKA 1G6Q1 2GLUA 4PYLA 3HCDA 5ICFA 4YUWA 2VDWA 5ICGA 1FP1D 1OR8A 4P7KA 5T6BA 4CKBA 3TM4A 5ICCA 2P1DA 1KPHA 3EVGA 4RX1A 3T7TA 3GRZA 5EPEA 3TKAA 3LCUA 1XTPA 1L3BA 3HCFA 4O29A 4RTSA 4HRAA 3SX0A 5LQAA 4GQBA 1Q0TA 2NP7A 5GIOE 2BM9A 1YB2A 3AWIA 1JQDA 5BW5A 1EQAA 1NW8A 5FADA 4PIMA 3I58A 1IY9A 3UJCA 3FPGA 4RTMA 2YX1A 2IPXA 1BHJA 1JG1A 2VP3A 4P7GA 3UA4A 1PRYA 5FA8A 3UJDA 4ER7A 3P8ZA 3BWCA 4AX8A 5DT2A 1RI2A 1ZQ9A 2AN5A 2OB2A 4RTJA 2V74B 3M6XA 3O7WA 3LKDA 2AN4A 2PX8A 1ZKDA 3LGAA 1VP9A 3A7EA 4AZVA 4PWYA 3TQSA 2IP2A 4DF3A 2ZULA 2P7HA 1R6AA 2ORED 4AZSA 4DA4A 3E7PA 3KPJA 1AQJA 4GEKA 2PX2A 3DP7A 4V0QA 3G2QA 3JWHA 3MQ2A 3FRHA 1KYZA 2FK7A 1NE2A 2P3QA 3UA3A 2IGTA 4PINA 4C03A 4MTLA 4OX9Y 1X1AA 5DXJA 1G60A 5EG5A 5HIIA 4GOND 2LD4A 3CVOA 3GWZA 4OBXA 5K01A 5JUWA 2PBFA 1I9GA 2ZFUA 4Y2HA 3TRKA 1RJFA 4E2WA 3PLAE 3A7DA 3GDHA 3FTFA 2OY0A 2ZBPA 3OU6A 4CKCA 1WS6A 5G02A 1PJZA 3HCBA 2HMYB 5EZQA 5KYGA 4IWNA 3A26A 2ZZKA 2ZIFA 2YVLA 1UFKA 2CMHA 3EVZA 3TM5A 2AS0A 3EPPA 3IEIA 1X1DA 5GINE 1XCJA 3HVIA 3KPWA 2QRVA 3LBYA 5CCXA 3KR1A 3G2MA 1QANA 2NXJA 4RTKA 5EHIA 3G8AA 2EJUA 1EIZA 3C3PA 2ZWAA 3BWBA 3EVEA 3JWGA 4KDCA 5DWQA 2IH5A 4GC9A 4U7TB 4PNEA 3M6VA 1XDSA 3ORHA 4IV0A 5CVEA 4QQNA 1HNNA 3CGGA 1SG9A 5DSTA 5EIFA 4OA5A 3R24A 3EVFA 2VS1A 5LQJA 10MHA 4ER5A 1SQGA 1EJ6A 5CVDA 2YR0A 2OKCA 2AZTA 4ISCA 3OFJA 2HV9A 5D1HA 4EK9A 2PJDA 2ZCJA 3KU1A 4PONA 1XCLA 3R3HA 4FZVA 4RVFA 3VSEA 3I53A 1VIDA 2JHAA 1L3IA 2ZSUA 3ANXA 2UYHA 4FSDA 5ERGB 5CD1A 1KPGA 2AOUA 2G71A 4H0NA 5MHTA 2NXCA 4GBED 3QOXA 4DMGA 1G38A 3UBTA 3BT7A 4RVHA 3REOA 5DM2A 1L9KA 3LSTA 3LBFA 4ER6A 5LQRA 1VQ1A 3H2BA 1VP3A 3EMBA 2O0LA 3ELYA 1NW6A 3D2LA 3V97A 3B89A 2WA1A 4HGYA 2AVDA 1XVAA 2GB4A 3HCCA 4R6WA 5GM1A 5P8WA 2Z6AA 3TFWA 4E33A 4DCMA 3A4TA 3LHDA 1X19A 5E1OA 1R00A 5DPMA 5DSXA 3NDIA 3PB3A 3F4KA 1WG8A 3KPUA 1O9HA 5CM2Z 3S68A 9MHTA 5EOVA 3RW9A 3FYDA 1WXWA 2P3OA 2KW5A 4V0RA 1JTEA 3HCAA 3UJBA 3FUWA 4RYLA 2XVMA 3GNLA 2HNKA 3BKWA 3KQWA 3BWMA 4E31A 2CWWA 3AXTA 1RI3A 2BZGA 2I6GA 3NTVA 4XUEA 3ER9A 4RTRA 3OPNA 3B7PA 1VBFA 5CVVA 3OE5A 2XYVA 4X60A 4YV2A 1P91A 4RTNA 2C7PA 3AJDA 1R8XA 3UWPA 3UZUA 1VE3A 4R8SA 2NXEA 3P2KA 1N2XA 3OCJA 1VLMA 1JTFA 4P7JA 1DUSA 5K03A 1RJGA 2R6ZA 5FHRA 4OQDA 3SGLA 5KQRA 2UZ4A 4M36A 4ER0A 2QYOA 2ZTHA 2AR0A 1P39A 3LDFA 1KP9A 2A14A 3P9IA 1VL5A 2PWPA 3SMQA 1YFJA 3U81A 4DCGA 3HVJA 3ER8A 5T64A 2PX5A 5FULA 3FYCA 2ONZA 4FT4A 4MHTA 2FK8A 2G72A 4PYQA 2BM8A 1Z3CA 3LX6A 5DRYA 4BLVA 5KQSA 4B17A 4PYKA 3L8DA 3MGGA 4KRGA 2OB1A 2IH2A 1U2ZA 1NV8A 2UYCA 2PXCA 4DKJA 2O57A 4PGGA 5E8JA 3KHKA 3ELDA 2WA2A 4QPNA 2JH8A 4ZTBA 2C7RA 2PGXA 1FP2A 1IXKA 1SUSA 2O06A 3G7UA 3MTIA 4CKEA 4FP9A 3T7RA 1ZHFA 4MWZA 3DXYA 5FTWA 2PWYA 3LPMA 3FTCA 3DMHA 3MB5A 5HZMA 5JR3A 3ME5A 3T0IA 1QAOA 3GRYA 3R6TA 3PX3A 5LQCA 1D2HA 3CJRA 2UYOA 3B3FA 3UFBA 3I64A 2HR1A 5FQNA 2B78A 3BXOA 1MHTA 2P7IA 3B3GA 1F38A 4HTFB 4P58A 3PFGA 4RTPA 2AOTA 1JG2A 3GIWA 3KQYA 3OZSA 4E32A 2QM3A 5EIWA 2JHPA 2O05A 4YUYA 2YXLA 2XBMA 3GCZA 1SKMA 5EGSA 1L1EA 3CKKA 3DMGA 3RIEA 3NVKI 4Z2YA 2H1RA 2N47A 1ZG3A 1NW3A 3KPYA 4E70A 7MHTA 3B5IA 1NW7A 2B9EA 5EMKA 4A6DA 3BWYA 3MERA 5CIYA 2ZVJA 2YQZA 3FTEA 5K0NA 3DMFA 3ERCA 2OBFA 5HIMA 3M6WA 3BGVA 3PTAA 5K0GA 4PCLA 2ADMA 3AY0A 3UJ7A 1BC5A 4GOLD 1O54A 4M37A 2PX4A 5T67A 4EVIA 3JWJA 4A6EA 5DM4A 1RI4A 3GRUA 3O4FA 4RVDA 5HILA 1YZ3A 3VYWA 2Y1WA 3NMUF 3DLCA 4OBWA 4PCAA 4FT2A 3G8BA 1NV9A 2BR3A 2EJTA 3CC8A 3HCEA 3C6MA 2AOVA 2FPOA 4KIGA 5GM2A 3IHTA 4C05A 2ESRA 5FHQA 4ER3A 3HEMA 3IV6A 1AF7A 2GAFA 5K09A 4IKPA 3E05A 3P71T 2VDVE 3DULA 3AXSA 4BP3A 1WZNA 1JG4A 4QPPA 3PFHA 2HWKA 3EVDA 4C4AA 5BXYA 5DX1A 5H02A 2IDKA 3P9KA 4RV9A 2QE6A 3K0BA 4RSRA 3LCCA 3IYLW 3LCVB 4KVZA 5DTMA 5EEHA 3KQSA 5IH3A 3OU2A 1IM8A 1R8YA 2ZBRA 4C08A 3TOSA 2IBTA 3HP7A 3B3JA 2Y1XA 4QDJA 5E9QA 4KDRA 4DQ0A 2K4MA 4X63A 3O31A 5K05A 2AVNA 4PIPA 4X1OA 1XXLA 5EEGA 3A25A
chains in the Genus database with same CATH superfamily
5JRZA 2EZTA 5LMUB 3VHQA 2J09A 1RYMA 1U11A 2H2HA 3F5DA 4HFNA 4KMRA 4C43A 1U4SA 4L5YA 2PKWA 4F8JA 1I4EB 1F4LA 1U7HA 1EI9A 1V43A 2HRQA 5CB4B 4UBKA 2W90A 2VJPA 5E3HA 1QGUB 2EHJA 3D7NA 1CX9B 5JXGA 1UQUA 4GNKA 3RRXA 1EFPA 4QRDA 1NXVA 3U4GA 3IDQA 4YRLA 3L7OA 3GRVA 3DO6A 1O96B 1T29A 1TM5E 1YV9A 1NJ6A 2KHZA 2IODA 3H5NA 3NTRA 4G81A 4K9NA 1SVIA 4EJSA 2UZIR 1ZOIA 3LLCA 1NULA 3NEAA 3FZGA 2UYQA 1ZK1A 1M7GA 1I13A 5LWQA 5FV4A 3RNOA 1W93A 5HK9A 1J97A 2JGKA 3DT9A 4H31A 5HEKA 3U5TA 4RK0A 1V6AA 4WUVA 3MTEA 1VA5A 4IJWA 2DE0X 1ZQ1A 2ZTSA 3ZR4B 1W35A 2WWXA 1OJLA 3R9KA 2I6TA 4FNMA 1S6YA 2WTUA 4D4LA 3IQFA 3M82A 1BXZA 3LBAA 4P4SA 3E03A 4E3ZA 2HOQA 3A14A 1JKIA 5M7EA 4E7PA 5AUNB 4I5EA 2ONJA 4O0MA 1L4BA 4LAFA 4QGAA 4LZLA 3WI7A 2J67A 4K5QA 1KK2A 4W82A 1XVUA 3TQOA 2BFCA 3LWDA 1T9GS 2A5DA 1M75A 2VDPB 2PGOA 4EIWA 2O7VA 2QZPA 4BLUA 3QVUA 5GP1A 1B6TA 2IV7A 4BO4A 4XGKA 3GQBA 5GWXA 5AVRA 1QIEA 1P1JA 1VLVA 4O2LA 1G66A 5HWSA 5IK2D 4L8YA 3HPRA 3EIXA 5CM9C 5EJAA 1C1XB 2ZYUX 4F2PA 1WEHA 3G8CA 5AQEA 3VU3A 3VO2A 4UMEA 3ZHVA 2OOSA 1P8JA 2GFQA 1H8HD 4A0QA 1BGXT 4BDSA 5DI9A 3MYYA 2XT9A 2NUTA 2I6FA 4BMVA 2D7DA 1S2DA 5T4FA 4ARBA 4DLXA 3BB3A 2QLLA 1P4HA 1VMKA 3M33A 5JJLA 5H5JA 1Z12A 5FYDA 2PIDA 2CEAA 2OV2A 3AZOA 2DH5A 2QN2A 2ARKA 4JH0A 3CUWA 2GJKA 4Z7NB 3K5HA 2Z8ZA 2AMFA 2G1PA 2XRFA 3AU8A 3QYFA 4GZMA 1KMIY 4UNSA 2YXPX 3KYDA 4XPIA 4KVAA 5FFMA 4ZVQA 3BQMB 4GSKA 3DTVD 1Z13A 4ZAGA 1NYLA 1NQUA 2H9AA 3EF1A 4QRIA 1ADJA 1F51E 2VDOB 3GPDG 2X9VA 5EERA 5DYWA 3WBKA 3CLUC 5TXGA 3A3OA 3ONVA 3NASA 1OBOA 2CE7A 3SJAA 2GAIA 1XOIA 4OB6A 4RC9A 4ENWA 4MXDA 4V1CB 1BX0A 4AF7A 5K3AA 1XTIA 1X3SA 2ZSHA 4CM9D 2P9QA 3RNLA 4YAFA 3I23A 3SZGA 2R6R1 3DE7X 4RZSA 3DM5A 2P6PA 4UQPA 4Y6RA 1KHHA 1T9ZA 1U0SY 2JEZA 3A6KA 3KUUA 3ZY2A 1FUUA 1G7TA 5B7PA 4IOJA 3M89A 1TZCA 2MIIA 5JSFA 2C7OA 1P62B 3NGMA 3ZQKA 1H23A 4NH4A 1ZICA 3PENA 3IMCA 2D0IA 2UXDB 1N7HA 1E94E 2GZHA 3I2FA 1EJ0A 2YXEA 3OIGA 5K8UA 1EB9A 4C88A 1QG6A 1YS6A 4PFJA 2GOYA 1TK9A 2B83A 4IG9A 4BKPA 2I99A 4DRXB 1XCMA 4I8IA 4WWHA 5B2EA 1M6EX 4OMUA 2O54A 2OHHA 1OKKD 1NVMB 5CB8A 5BR7A 1SOUA 4HDCA 2VBIA 4I4NA 4G0OA 5KWJA 4EHFA 4XVCA 3OESA 5EJ4A 3KOMA 3T0FA 2CCJA 4HKTA 4S1WA 1N4DA 1PG2A 2Q41A 2BL4A 1DT5A 1RJ9A 3K73O 1XEFA 3JVEA 1NJ2A 3Q0IA 1I1HA 2GEBA 3PPXA 4M46A 1ZCFA 3JXEA 2VNKA 3OC0A 4W8GA 1NMEA 1Z22A 5K0CA 3VR2D 2X9QA 4GMKA 4DG9A 3OEED 3QK7A 2FRVA 3GFVA 1PNOA 2CJWA 3VR0A 4X71A 2AK3A 1KJJA 5D7NA 4KN8A 3L1HA 4FGZA 1RU3A 3JRWA 1CPYA 4C89A 5FUBA 2EV9A 1W4LA 4GW3A 2ZXEA 3DZGA 4A36A 1DINA 1ZY2A 4ARZB 5JNWA 2D0DA 1FS5A 1KSFX 3KHTA 4HYTA 1RHUA 3QELB 2IFTA 3DV9A 3GT3A 3CUYA 5JY6A 3IXQA 4UOEA 4YAKA 4CIAA 1E32A 1W4AA 3ACCA 3MS4A 3FTDA 4XCXA 3MBKA 3N2LA 3W06A 1IM5A 2UZ3A 3WNVA 3A4VA 2RH4A 3NRBA 4DRZA 3PUIA 1IXSB 5CP8A 5FI3A 1W5AA 4AX4A 3HDQA 1CY0A 1U8CB 2XMBA 1GNTA 1W85B 1UEXC 4WFJA 2GM4A 1UQRA 1IH8A 2ZIZA 2QVXX 4TRNA 2X2FA 2DUWA 1FBNA 3ONDA 3Q7TA 4UTOA 4BIIA 1KYWA 4CQMB 1DLJA 2AWNA 4IINA 4RIFA 1WNFA 4KO1S 4QPZA 5HZGA 4TL7A 3FYUC 4RK4A 4KG7A 5FLXA 3K8QA 4LX8A 2WLTA 3QKIA 1H2EA 1SZPA 1KYXA 2QQGA 2VDJA 3K09C 5EKXA 1NXTA 1Z33A 3NDBB 1FFEA 4NATA 4HT3B 3VTZA 2VJQA 2BC9A 3PUKA 1Z0JA 2PAFA 4I5DA 2F8LA 2QRQA 2B2XA 1NL3A 4K9KA 2QRGA 5ICFA 1EVEA 4S04A 3G0CA 1J22A 4DWWA 5DT9A 2BKEA 1QDLB 3PZBA 2BI8A 3EYAA 4R68A 4GXRA 1Z82A 5CX1A 3B7WA 4GX0A 4MQEB 3OF2A 4JHLA 1UT6A 1XTPA 2WINI 4OHRA 4QQ8A 3BRWD 1M9NA 4GQBA 1GZ5A 4KPFC 1MJ5A 4FX5A 4LC1A 1F6BA 3BHIA 4FFMA 4HWGA 3VMFA 3OQNA 3TMYA 4IUBS 2O2XA 3GPLA 3KHUA 5EJGA 3TUZC 1X39A 1E61A 3HB5X 3WHPA 3FWKA 4Q9DA 4A0SA 4CDGA 3K8YA 1EJ2A 1RZ3A 2ZRPA 3GLHA 1YZFA 5DT2A 5I7WA 3QUAA 4ZV4A 1GL7A 4H1WA 5TVGA 3WV4A 2WRZA 4BEJA 4DMMA 4MQFA 2B1QA 1SD2A 2JASA 5K5EA 3FGOA 1SHTX 3A6PC 2QRLA 4AZVA 3K0SA 5TLSA 3U3KA 1SUPA 4NCNA 4ZVPA 3KQLA 3WRYA 4PR3A 3TLGA 1SHKA 1JSLA 5JI3E 3V1TC 3K2BA 3MWYW 4QNNA 3IUMA 5FA6A 3BRCA 4AZSA 3N2GB 2Q0SA 2QMQA 4UARA 4WK6A 1E96A 4G4SO 1ODCA 3LV8A 4HDMA 3SQMA 2FPGA 2ET6A 1OZGA 1VRVA 4JLNA 4MGIR 4N0EA 4EMTA 1LBTA 4KXYA 4BIMA 1R3UA 5F3DA 1MU0A 5BOSB 2IVFA 4Q4AA 3KM0A 1ZWKA 2GMWA 5J4HA 7ABPA 3U39A 1I9GA 4BEVA 2Q6TA 1RWXA 1LJUA 2JJ1A 2ODPA 1R4ZA 2QVZX 2DAPA 4N5HX 1WS6A 2DT8A 3HSSA 1GT6A 5KNLA 3A3NA 2O3QA 3UCXA 3ZZUA 2CXQA 1YRWA 1NW4A 1Z5WA 3C4JA 3O94A 4J0FA 1TCAA 4M9UA 4UBOA 5KOIA 1XTQA 1P19A 4MR8A 4ASUA 1YRLA 1FTQA 4A6XA 5JT1A 2Y6VA 3UANA 5DV9A 3VH3A 3H5OA 5I7UA 4KDCA 4GPZA 2HWWA 1JAHA 1OF1A 1Z34A 3WDMA 5AW5A 5KCZA 1VJDA 1XZGA 1RQXA 3INYA 3ORHA 2JIRA 3VHRA 3PA6A 2IYAA 3HUUA 4BVLA 4J1NA 1L7MA 1OTHA 3CGGA 2J32A 4H15A 3A6ZA 2E0IA 5HMMA 4ZA2A 2R7MA 3MGAA 3K8ZA 3H11A 4E3WA 1RABA 1DC4A 2QLTA 3I1IA 4XDHA 1IEVA 3SBOA 5KYXB 1Z0KA 1Z74A 2YJNA 3R0XA 5D86A 2ZCJA 1R12A 4RDCA 2HPAA 4Y2SA 2I66A 3WDKA 1RPAA 1SUDA 3D3JA 3E8MA 3FX2A 3VSEA 2ZIXA 3SIPA 3KL4A 1NVXQ 1J24A 3PC8C 4JP3A 4O4IF 3V5NA 3MRXA 4NMMA 1ESCA 3LTNC 3D7LA 3RIMA 4I46A 1NF3A 3TW0A 2WWFA 1QYWA 4AWBA 3N53A 3GVXA 4RHTA 4F4HA 5JVDA 1JR3A 1KK0A 4OXYA 5JCPA 5EI5A 4Z4HA 1GVNB 5DM2A 4D0RA 5LQRA 2OM2A 2R8RA 3P20A 3R4CA 4UEKA 1X7DA 2B8WA 3VTFA 5EZYB 4CLDA 1V37A 1Z2EA 2R1VA 1Q92A 4DMFA 3DHWC 4EF4A 5A5DA 1TGVA 1ZM2A 2AVDA 1BWRA 3HCCA 3RS9A 3EG5A 3DA8A 4DARA 4ZKDA 1G63A 2EGUA 4DCMA 2HLPA 1PLKA 3B1ZA 4EBBA 2J9RA 1V16A 4GPIB 4GI2A 1ML4A 1KDPA 4XX0B 3L6BA 3LKVA 5JDIC 3KE9A 5HCNA 4YALA 1ZZEA 4OYYA 5CM2Z 1UT8A 4JBGA 4DCVA 1T4DA 2FCRA 2LIPA 1OASA 2VHZA 2OSBA 4ZCSA 3I61A 1LLQA 3ZCSA 5K3EA 2GM9A 4B3MB 3TSYA 2XBUA 2CSXA 2AUMA 1Y89A 5BVHA 4BTEA 2XVMA 2LGJA 3GBVA 2G07A 3TR0A 2YHIA 4ZI7B 4MA5A 1A8QA 1NJ8A 3EG9B 4BMPB 1UFOA 1YU9A 4BNDA 5B58T 4BWFB 2QORA 3NEPX 4DSNA 5C35A 1C8BA 2J0UA 1BROA 1L4KA 1VBFA 4XKJA 3MWEA 1CZNA 1S2OA 2HO4A 5K4GA 2VRNA 3LK7A 2HA6A 4KUGA 4WK4B 3JVVA 1VDMA 4W1RA 1DQYA 2Q99A 5P21A 4EY6A 2GBPA 3PG5A 3FVWA 1IQRA 1YHZA 4LDAA 1N2CB 2XJ9A 4YPFA 2HMWA 3MJTA 3OPYI 3N8DA 2ZUDA 3ILXA 4NS1A 2A5GA 4MJ3A 5JROA 4YASA 4ER0A 3ZDZB 4IEIA 1BVUA 2ZTHA 4U6QA 4KQ2A 3DEFA 1E9BA 1Q1NA 2D1SA 3MMXA 4UC0A 5KYKA 2C98A 2FR0A 3L8ZA 4BFVA 3R75A 2QT9A 2G0AA 1TX4B 1J9GA 3MWDA 1ZI8A 4R2JA 4WI1A 2W2TA 3DEYX 3HR8A 3U7HB 2BM8A 4TVOA 4F9GA 4X24A 2WJPA 5KQSA 3WLJA 4E5PA 421PA 3OQVA 1CUFA 1P18A 3TMKA 1NV8A 1PV4A 4FJ1A 1CY6A 1J2EA 2AFIB 5EQFA 3ESAA 3SC2A 1QVAA 2RBKA 1ODKA 2PTHA 1HUQA 3GFSA 4FEEA 1L0BA 5HSGA 4X3CA 2XCLA 1KIMA 2DKNA 3L40A 2XI4A 2IP4A 4KVGA 2XCIA 2YW2A 4IGIA 4D79A 3IP8A 2ACVA 1RBYA 2VQSA 4TKVB 4EJFA 1P17A 4KPUA 2I6XA 4ABYA 2V4ZA 5JJ5A 1NURA 3T94A 2UYOA 4LY9A 1QV6A 3QKRA 3CZAA 4KMOA 4ZVRA 3KQYA 2JJ2A 2OK7A 1A9PA 1E2EA 1KO4A 3G5UA 1NU8A 1L1EA 3PXUA 1KIFA 1LS1A 1VLJA 3G9ZA 1U5CA 1UBUS 2JHGA 4MWSA 4TRMA 2GUWA 4KL8S 2BFBB 5BUSA 3USCS 2I1QA 2QLFA 3STXA 4MPTA 4DL9A 4EA9A 3AB7A 5A4FS 1LV8A 1A3CA 1Q74A 4PZEA 5ERYA 4UNNA 3QG1A 2C1XA 1G98A 4PCLA 5FWXB 3ZBQA 1ZD3A 3RUFA 3NBXX 1QDEA 2PYZA 4EENA 3MS2A 1NQWA 1S3IA 2P6MA 3O8CA 3FMPB 1D09A 1AHNA 2Q2OA 3V4LA 4OLAA 3EIQA 2W2PA 1P1FA 3B3QA 2KE5A 3FVRA 3GAZA 4UXIA 3ZE8A 3SYNA 1DEAA 4ED9A 3COSA 2AG5A 5K0ZA 1XF1A 2ZRFA 3C6MA 3DO8A 4U6SA 5GM2A 4CIXA 4F5DA 3A4LA 3R4VA 5JG7A 4IKPA 4F93B 4QFDA 3MLAA 5L4SA 1P7VA 4KQFA 1QQ6A 1WZNA 1Q7TA 2AX4A 3MJCA 3FDZA 3LG2A 1ZDMA 2C77A 2RGDA 5ERXA 2GF2A 1G59A 3RJ5A 4B76A 4DAOA 1M34A 1I33A 3P9KA 2H2FA 3DOCA 1OAOC 1FP6A 1JMVA 5K3FA 3ZDRA 5HR5A 3PR3A 1CQXA 2HIMA 4WESB 4TV8B 1XZPA 1H22A 1GQFA 1PT6A 1YZUA 3I4LA 3M34A 4TZKA 4U9IS 5UKDA 4C08A 5I9NA 1GT91 4B2PA 2O2EA 2A88A 2WHXA 4BO8A 3OQJA 4ZQEA 5GZ6A 4B3TB 1W0KD 2A4KA 2CK3D 2R2GA 1ZH8A 2RCYA 3AERB 1M5UA 4RLQA 4XWTA 1HFJA 1BGVA 2NVUA 3QITA 3R9IA 4EL0A 1FW8A 4E08A 2I2BA 1HDCA 1XMQB 1OBCA 3EQ7A 4Z0HO 2L17A 3P45A 2R1TB 2WAYA 3ACDA 4M7RA 4JVMA 3EGEA 4HBGA 1JRLA 3IR6A 4KQKA 5HRUA 2M1ZA 3VR5H 4M1QA 4F6CA 1Y8QA 1KEUA 1M7HA 5A02A 4I1SA 1LPMA 3NAGA 5GV7A 4O4LF 4N7RA 3P9YA 1U80A 2X1MA 4ZHQF 4WN9A 2FR1A 3RUPA 2A0FA 1ETUA 3TPCA 4E5VA 3DF7A 2X1VA 5LKRA 4U7PB 2ZLBA 1E7WA 1UR5A 4D8VA 3SIXA 4XIFA 1FIUA 1FY2A 3MNFA 4H1UA 1F3LA 4O08A 5TF4A 4ZIRA 1US8B 3SQLA 1MAAA 2IIVA 2Y99A 3LHKA 2QLNA 3F98A 4S1PA 1L7BA 3TX2A 1QF6A 1ZIXA 1KNXA 3UW1A 2EZ4A 4RAQA 3VI3B 2H31A 4W63A 3A27A 3Q8XB 5H59A 3BJZA 3EFOB 3Q87B 1CZLA 3QIAA 1EE9A 3L3BA 4KYIB 3RHFA 1TQ6A 2GN8A 1NVAA 3FJOA 3L1JA 4YXFA 3Q2KA 1UBTS 4D8XA 1VSBA 4RACA 4CDMA 4F96A 4AMYA 1RXVA 4HAIA 1I7SB 4BMZA 1JX6A 4DUPA 1ECLA 3BMQB 2IV2X 1F7UA 1SA0A 3ZHTA 5LQSA 4B3IA 1P1KA 1QX3A 2WKQA 1C7ZA 2G5TA 2ZKIA 3CJQA 4BFTA 2F43B 5DHTA 1X9HA 2YVQA 2PSDA 2NU8B 4RJLA 1FJHA 2PRYA 2WWRA 4FSXA 1JSXA 4RUKA 1FSGA 4OB7A 3UWKA 1HQYE 4P5EA 1WZ2A 1JHAA 3O21A 1PSWA 221PA 1XTSA 1B8OA 4BUZA 3HZZA 2IH4A 3R8CA 4TLAA 1NP7A 4KQJA 3VR3A 1TUGA 3WYNA 4EX6A 1NBME 3N6VA 3TW4A 1U0NA 3LQYA 1YAHA 3BS4A 3L77A 1ZBQA 2AQKA 2FB9A 3BIOA 3PITA 4QE3A 4BJ1A 4G9BA 3NAZA 4UASA 5LZ4A 1G0OA 2Q4BA 5EIAA 4J6FA 1WUJS 5J59A 3RRMA 1GZDA 1E3SA 2IYEA 2CKDA 3OZRA 4HGQA 3RM3A 4XE5A 1KGSA 5DFAA 4K9LA 4GI1A 1XDZA 4EP1A 2P69A 5ICEA 2TMDA 3HVHA 2IIQA 4FGUA 4Z8YA 1T3GA 4D4KA 4FHCA 2H1OA 4IXDA 1PX0A 3HKDA 3O7MA 1PG5A 2EXXA 4DLUA 1D0IA 3FLEA 3MSCA 4HZIA 1JPUA 4LPSA 4X6LA 5B4TA 3SNHA 5KVAA 4BXOA 2QQEA 1U1DA 4GKBA 2YXDA 3JWEA 4EDFA 1Z6YA 2BFDA 5M3BA 2IHUA 3NATA 3CUSA 1PFQA 3G5AA 3OZCA 4RY8A 1G8PA 3H2YA 4L74A 3DXZA 4NMHA 3EW9A 1CSEE 4MQ6A 3OUUA 5TARA 2HAEA 4XSVA 2C8VA 2ZRAA 3AKDA 4BFCA 2YUIA 1JQKA 3OF3A 4XPZA 4WKGA 4OGKA 4ZRNA 1H6CA 2HCFA 3FOZA 1V8DA 3EHDA 1ZYUA 5AK0A 5JZMA 2JIQA 3Q8LA 1EKXA 1RJEA 3GEDA 3LRPA 1XMSA 3NCTA 4FNGA 4U8GA 1SC1A 2RCNA 1LXCA 3R7WB 3W9BA 4XYEA 1E3WA 1B6SA 1AQUA 1JEQB 2R5WA 2V6GA 4RHEA 1KKLA 2VZ9A 3BE4A 3P2YA 2FE4A 2NU7B 3QV2A 3V7NA 1BA2A 2WWHA 2YCBA 1WL8A 2J31A 3UT6A 3ZQJA 2PUHA 3LA8A 3NOXA 1TUEA 1PL7A 1XRPA 2NPOA 4J1TC 3G5LA 3QE2A 4MI6A 5D7BA 5GZ1A 4FFBB 4L0CA 3HABA 3IJEB 5HTOA 3RS4A 1VSVA 1LF0A 3C16C 3AF2A 3H3XA 4CM6A 3USES 2BCEA 3H1GA 3ZTYA 4Y3UA 1RXYA 5CDGA 1XJWA 2WUWE 3FI9A 2Y1GA 1EP2B 1T34A 3RFTA 1VI6A 2BKAA 1GRVA 3M6FA 3SZLA 4RGYA 1GGFA 2YJGA 3KQHA 2O3UA 1BJKA 3KKMA 2R6HA 4W1SA 2G04A 2PL3A 5A9TA 5J4VA 2V7EA 4F8YA 3ENZA 4S3MA 5E1DA 1K89A 2ZSFA 2BGLA 5A5FA 4D9MA 3KJGA 1HDGO 3F90A 3Q2OA 1Y7HA 4RSGA 1PWHA 4YP9A 1EEHA 3I5AA 2DPMA 1BSVA 2NZUG 2Y9PB 2IY7A 2Q5IA 1GTSA 5E7QA 2QZZA 3JWIA 2OILA 2C5AA 2I3DA 3LUJA 1MCZA 1N6LA 2J9ZB 2EG5A 1DOHA 4EI7A 5LJLA 2JLXA 2NOAA 1N9ZA 1I6KA 2QF7A 5FO0A 4JXJA 5BO5A 3DHNA 3AZQA 3WAKA 3ZE1B 4BP8A 4JQZA 1L8XA 1EHCA 3DHEA 1ND5A 3D9QX 4GUDA 3I5YA 1W8IA 1KC1A 2FHPA 1XZLA 1EGHA 2BRUA 2E5WA 3KE8A 2BTOA 2HA2A 3LP8A 4IGAA 1FS4A 5IAAA 1UBGA 3EW7A 1Y37A 4DMKA 1Y98A 4F2GA 3CVVA 1PL6A 2CFTA 3NBUA 1E7SA 2Z2JA 2ZEJA 3QA9A 3VR6D 1Q57A 3ZU6A 1AUXA 3I8SA 4JP1A 4LOJA 3KOWA 2KBEA 2D1QA 4TMTA 2OENG 3ISJA 4G26A 5LYJF 4BFWA 1R0BA 4ERXA 1V35A 1IN6A 1SVOA 2AFHA 2WFAA 2RHWA 4GO1A 1ACMA 1HYQA 3PQFA 1L5QA 4MIKA 4NCXA 1HXHA 2A2ZA 1DWQA 4ARVA 5JLJA 1J2YA 2G1KA 1U3WA 3L5KA 4WBNA 3F7OA 1CS4C 4I4CA 5K3SA 4DV4B 5KSOA 2EARA 3EZNA 5GAJA 1UINA 2DRIA 2H5IA 2O23A 3A0UA 3ZHQA 1RXWA 3TVDA 3STWA 1E3IA 1YQEA 1YQDA 1OXKB 3GJZA 4IMIB 5IW8A 5LB4A 3RK1A 1PJLA 2JGLA 1B0UA 3FWNA 4LY6A 1TL7C 5ITVA 3IHLA 4M6WB 4M8KA 4JJZA 3W6UA 4HFMA 2HQBA 1QZTA 2OGUA 1THGA 3GFPA 4FEGA 1SURA 4GSYA 5EXTA 1AS0A 1E1KA 5K8IA 2FSUA 4RTSA 2XLBA 2W6ID 3C3AA 5FOXA 2NP7A 4UOQA 2HWUA 3BD7A 2ZAYA 3Q8WA 1TT5B 3I58A 4J0QA 4CDRA 4AVYA 4CKEB 4Q34A 3C3BA 1BHJA 1UIMA 1F0PA 1Z8DA 3PFWO 2WJ3A 4J0GA 1GGEA 4D8TA 4YP6A 5K2OA 3E7FA 2VUUA 3OY7A 3VV3A 4WY8A 2KLBA 3BMXA 3SG0A 3VH2A 4AS2A 4BX0A 4D3XA 3KAKA 4QYWA 2X6TA 5EYPB 3QHPA 1IHUA 3AVXA 2W48A 1WMDA 1ZD4A 2HHLA 5A4MS 1XTZA 2DCUA 2WIBA 2XNJA 4JSRA 1N6PA 4RQAA 3W2GA 3DE1X 3LMKA 1JPJA 1SPXA 5CNKA 4WV3A 1Y5RA 2QQFA 1TXGA 2P7HA 4E4TA 3BILA 4W1PA 1D1QA 4FMDF 3U3ZA 4OQPA 2HYDA 1G3IA 2FW7A 4M1KA 5B7QA 1JBKA 3MHPA 1Z39A 2HU7A 3OSUA 2V7WA 4QUIA 3RSZA 2CLKB 2KJQA 4PINA 1VJGA 2Q0HA 5IULC 3MD0A 5EXDA 4OX9Y 1VL6A 1X1AA 1YBAA 5FOVA 3S5JA 2P4UA 4BQRA 4C4OA 3BSWA 4QDUA 4NICA 3PHHA 5AXBA 1A4XA 3UV6A 5IUNC 2J6HA 3MT7A 2F3PA 3DM9B 3CMMA 2VP0A 1YKSA 3LS2A 1EUDA 2E7ZA 2ONCA 2A1TS 3HCBA 4W5WA 4C0BA 3AL0C 1TUBB 3I3SR 1TJYA 5AVKA 4L0DA 1XMIA 1SZCA 1HDZA 1SCAA 2NYVA 4QUEA 4EO4A 1H42A 4QBFA 3JARB 3RVLA 1JALA 1GUYA 3UKOA 3GFQA 5KINB 1NYTA 2ZYAA 3OIVA 2CNLA 4KTVE 4TLLB 5CHYA 3JTEA 3N1UA 4OQMA 3OQMA 4OHWA 4C0AC 3ZDDA 2I67A 2BI7A 2YNMC 1GPNA 3AFOA 4KQHA 1EIZA 1PT9A 3C3PA 3GX1A 4QPJC 5FNVB 1MPXA 4MPDA 3RANA 3WGGA 4B3FX 4CM3A 5BSFA 2HT6A 2WKRA 3L0BA 3M6VA 3ZEAA 4PNEA 5EINA 3ANYB 5B58C 1GVHA 3LT5A 3CKYA 2F3UA 5TQ0B 4HF7A 1QGYA 2IXFA 2YR0A 2F90A 2PT7A 4RDHA 3V55A 2HNBA 3WR5A 2TS1A 4IR7A 4EFMA 3TJMA 2Q5QA 2BP7A 2J07A 3AK4A 3WGNA 3KU1A 3MB8A 2NSYA 3BFKA 3N58A 4HAVA 1H8EA 2C2WA 1MGOA 1SBYA 3BN3A 4FC6A 4GKVA 2HH9A 1HDRA 1VLLA 3CLTC 4M49A 4DYHA 5JNLA 2BGNA 1GZ7A 3O5AA 4YBRA 5A4DA 4JI0B 4GKKB 1KKUA 2PD3A 4DMGA 4JL8A 4TYNA 2QD3A 2AIRA 2QYTA 2CSUA 5J2UF 4ZYVA 1FYVA 3D64A 3KG2A 4BC0A 3B8EA 5DNCA 4A5SA 1DQSA 2YHUA 2BTEA 1R66A 4R4JA 3EBLA 2O20A 1SVKA 1C14A 4RKQA 3H19A 1QKJA 1XLVA 4BQNA 2WTMA 4JJKA 5SYAA 3UMFA 4AF8A 1W581 1YE3A 3CNBA 1EK0A 4YBZA 1EG7A 4OMFG 3RVSA 3ZJYA 3K16A 3PB3A 3BIJA 1YR9A 3ROMA 3VPHA 4I66A 4EELA 3IV9A 4BMCA 4M1ZA 5IBQA 3OTGA 4BV3A 3Q9SA 1K4KA 3MTGA 1FLNA 5ISMA 1FVFA 1JTEA 3HCAA 1XMJA 3A1UA 1Z0ZA 3C4QA 3O4JA 3OECA 1EFKA 2YQ4A 1B8VA 1SRRA 2JIZA 5CK5A 1D2AA 1V7CA 3RFCA 1T1IA 4KGDA 4RESA 3IULA 4ALJA 4X97A 5B3JA 3ABQB 1R8XA 2GKGA 1R10A 3UWPA 3RS3A 1C5KA 2QEQA 1DP4A 2VDWB 5JJBA 1PU2A 4CGZA 4II2A 2O3JA 3MXTA 4A26A 4B83A 1JTFA 3W5SA 2UZ4A 2BD0A 1EXVA 5AFSA 4UTZA 1BS1A 1ZAKA 4PLHA 1SCUA 1E8DA 3H5LA 4PCUA 5TMEA 1QP0A 1XO1A 5D5PA 1E3QA 2ZDQA 3WJ2A 5DHPA 3SJ7A 4J7XA 4G86A 4G4JA 3HY6A 3I2JA 4GECA 2VYND 3CRMA 1I10A 2O0HA 1G8MA 4IDBA 1WKVA 2D1YA 4DE5A 2WZCA 3Q40A 1SUAA 2FOIA 3ZV7A 2JBAB 3DT6A 3LLUA 4TYMA 4AZ3A 1SHJA 1QIKA 3L8DA 2IH2A 1PIWA 4WXPA 1S1CA 2XF2A 4FYIA 5C8ZA 2JFNA 3MW8A 3AGQA 4INJA 5IASA 2UYCA 4FSHA 3QHQA 4FYWA 2WA2A 3DEJA 4UEWA 4Z99A 2I6SA 3F6CA 1DDOA 1PUXA 4U0KA 3L7LA 4BNUA 2X8BA 3T3HA 3DTVB 1EGVB 1K5HA 3MJSA 4MWZA 2PWYA 3LY7A 4CR8A 2GYVA 2WU4A 5BVGA 5E6UB 4UXJA 3IQXA 2DFVA 3QP9A 1P4RA 3RSFA 4EEKA 2OC4A 3W3AA 4DBLC 1FNBA 3HXTA 1N1DA 2JEYA 2XWSA 4PRZA 1UC8A 3THXA 1YBFA 1LB1B 3A6FA 2B9VA 3I45A 1YQUA 1ZVJA 4H16A 1BMDA 5ESDA 3M4ZA 5FORA 3IH5A 3N0TA 2O8FB 1I1OA 1KU6A 1KA9H 3CO0S 5DGCA 5BSGA 5JZBA 4ZN6A 3C1UA 3IOBA 3OZUA 3K71B 4D80A 1CIPA 2C2HA 1VLZA 1Q0LA 1QUEA 2DTDA 2N47A 1YKFA 5D00A 2BY4A 4C4RA 1YR7A 1REQB 3M5CA 4MIOA 1DTSA 4CR6A 4F92B 1IOZA 4FCWA 2C7BA 2A9OA 2QUKA 1KO7A 1WCYA 2DCMA 3PQ4A 4LOHA 2KM1A 2NUPA 5CHEA 1E79A 1Y63A 3MMPA 4DSUA 2ZM6B 1CD5A 4EVIA 4FZJA 3C87A 5G3YA 2XRYA 3D1JA 3GRUA 3O4FA 3OQ6A 2ETXA 3RVBA 2WJVA 1S5PA 2BPOA 4JP8A 3E2PA 3G8BA 5G4LA 3RWMB 2EJTA 3OETA 2EFGA 3EXG2 4IL5A 4H0FA 3KWLA 4WCDA 2BMVA 2QD5A 3D2AA 1KY5A 3DZHA 4MWEA 1OZHA 4ZREA 4Y6LA 1LUAA 1K7YA 1K5PA 1CY8A 3QKUA 4YJ2B 1SXPA 2IEAA 2HWKA 3EVDA 4TT3D 4XJSA 5HMLA 5IJAA 4BB0A 3R7FA 4DCTA 3OM0A 3QLVC 4O5OA 5I5GA 4CG2A 3P0RA 4QOJA 1IXRC 4BMOB 2P2YA 4OX9B 3JPWA 4E13A 1KI1A 4D4JA 3HKCA 5EFOA 1Z2CA 3B85A 3BC1A 1UKAA 3BICA 2R87A 1NVKA 2JAPA 1N36B 4IVQA 4QBKA 4U1RA 5I4KA 3LZCA 1M2NA 2PWAA 2YHAA 4ZQBA 2ZI9A 4DQ0A 4C7XA 5LVAA 3LO8A 4P3OA 3EGWA 4U39A 4U9UA 1MJGA 3C8HA 1C8KA 2FMKA 3D6UA 3E2MA 4MYDA 1YXMA 1Z8HA 2VA9A 1QAMA 4QAJA 1WX1A 4RENA 1GDDA 3QE9Y 3HFGA 3PDJA 4TMFA 2WFLB 3IPXA 2C0QA 1TJ4A 1KWKA 3V7FA 2QVCA 2XQIA 5I5EA 2ZETA 1SXJC 1MORA 3FCCA 4KXNA 4QVGA 5TQVA 1JAXA 3HUTA 3UTCA 3VC3A 1BNCA 5IN5A 3WLIA 5CAEA 3TDNA 1BQ3A 4IGKA 1IK4A 1IBCA 4KAFA 1ZI9A 2GD6A 2OPBA 1LWOA 3L9WA 4AT1A 2NAPA 5B37A 5HUHA 5IM4F 3VJRA 5E1BA 4DC0A 1UK7A 5JAUA 2N1MA 1KEKA 4OEHA 1W2HA 2BDEA 4YJGB 1BEUB 3O4VA 2J7PD 3ZCXA 2EP7A 3HEBA 1GLVA 4WADA 1K8ZB 3RU3A 1MAUA 4HZUB 5AW8A 5ALXA 4ZVMA 1G5RA 4BNYA 5I9SA 4HLCA 4L5BA 1L7AA 3FF4A 5FPQA 5AVXA 4I9GA 3ZV6A 4ENSA 1V45E 4F4FA 3NB0A 4XGIA 1ZGBA 2W2QA 4CKBB 1ESEA 2P8JA 2C95A 4IDCA 4EYOA 2D5IA 1MPTA 4RVGA 5EIOA 4S1NA 2TMGA 4LGMA 3IQZA 5F35A 1QNFA 5DCYA 4J7CA 3T61A 1NMSA 3DKVA 5A3SA 4H35A 3E48A 3U7JA 5KWVA 4LCEA 5AYVA 1RXUA 2NGRA 2ZTLA 2QJOA 3TJZA 1IJBA 1MB2A 2XCOA 4DDTA 1OROA 1DEKA 5K0BA 2VHEA 3SSOA 2IHNA 2GDZA 3FUXA 3PUXA 2VNAA 1XVVA 1Y3HA 3COVA 3OUTA 3OIWA 3THWB 2XQKA 2H16A 3KZXA 3T4UA 1LBHA 1QO0A 2ZW9A 3CR8A 4F2WA 3JZAA 5HZHA 5D1NA 2HLDD 3TRHA 2HXSA 3IXMA 3KKPA 2H0AA 3KXLA 2ZJ6A 1W5EA 4HVLA 3OT1A 1KFBB 5LXTF 3ID6C 1Q7RA 3E8SA 4BGIA 1HFKA 4R3UC 4TKMA 5ULLA 5C7YA 2VG8A 4O4JB 2IYUA 3FPAA 1SKBA 1JEEA 1G55A 2HU2A 5C5EA 2XAAA 1HFEL 4TMXA 3AETB 1HE5A 3C2QA 3IHKA 1IXYA 3HSYA 4LTNA 2OEPA 3DL4A 1ULSA 1DC3A 3QTLA 2QRUA 4D9EA 1YF3A 2ID9A 4XCQA 5EXSA 2F48A 2PZ8A 2WBLC 1J09A 3U9LA 4D6PA 3RC1A 1U2TA 3BJRA 1MENA 1PV2A 1TM3E 5AK4A 2IUUA 3RADC 1T6XA 3H2GA 3IIMA 2OXCA 2B6NA 2WDZA 2XOKD 3HWX1 1TW3A 1Y4AE 3PHCA 1LA2A 3RRZA 1K3TA 2I7CA 4EKYA 1TM2A 2IKSA 4ZAWA 1RLOA 1R9JA 2CHVA 2HC9A 2FZGA 5TGDA 2R1ZA 3CLSD 1GN8A 2REQB 3CEJA 1P4AA 3CCBA 4K86A 4XJXA 3ZK8A 4CTJA 4NBLA 5HGXA 3A1TA 1A1SA 1SZJG 1G8SA 1BW9A 2RIRA 2BHTA 2WYVA 3EQ8A 3QKSA 4TM7A 1IK6A 1WCXA 4UCXA 4FCVA 3V46A 1KI2A 5IFLA 2PUDA 1P2BA 2CNWD 1TO2E 1RRMA 1CIVA 3BGIA 2QS9A 3WS7A 8ATCA 3P97A 2E89A 1QRUA 3L07A 1FRFS 1JQ5A 1XV5A 3H86A 4BV8A 2VSNA 1LCIA 2WZDA 1T0PA 3NBQA 2GK3A 2ZYSA 3KOUA 4H1HA 3FAKA 1TVCA 3SR4A 1JEAA 5KHOC 1EXMA 5K0FA 2AI2A 4X6UA 1GPDG 4GNRA 4OAOA 2PSEA 2B5WA 4YQYA 4NV0A 4P4LA 1G4AE 3DR3A 5C1IA 4HC4A 4D44A 1FZQA 3B2QA 3W7BA 2IQ5A 3PKJA 3THYB 1JJAA 3V8VA 4HG2A 2N46A 5CXSA 1CS0B 3A10A 4FDUA 1W88A 3RUIA 1ZSYA 4JP5A 1XQWA 3A1WA 3CG4A 3UV7A 2OVBA 1WWKA 2QL9A 3HYRA 5BMVF 1FNDA 3I0NA 4FB4A 4ZYZA 4CM4B 2JAXA 4YRPA 4JI8B 3WLAA 3I9OA 2A57A 2EU8A 4IDFA 4RFLA 3V7WA 2D3TA 2C00A 3PSHA 3K5PA 4OQXA 3JPYA 3NS7A 4UBLA 4IJMA 4NECA 3LOUA 4E5SA 2L2QA 4IXTA 2OORC 4RM3A 2BKUA 1Y6GA 5HF6A 3OAAD 1QIDA 1GKLA 1U28C 2VUSA 2BM1A 4DM3A 1T1JA 4R1OA 2HWXA 3CCFA 4ITRC 1C4WA 4KO2S 4LF6B 4JV5B 1OX4A 3N3BC 3VHXA 5KTPA 2YRWA 3R5KA 4BE9A 4BRWA 2FWJA 3GEIA 5FUQA 2VPWA 5D3MA 2SCUB 3F7TA 2CVOA 1CZOA 3LVRE 2AJTA 4WT7A 2PXXA 4KUHA 1V0JA 1EDEA 2V98A 3B2EA 5JD6A 5ICSA 5TJ9A 2GPSA 1S9HA 2GFHA 1POXA 1NDQA 2YWDA 1OREA 3NVMB 4NCJA 4PYNA 3B1VA 3S2UA 2GTIA 3TMAA 5JS8A 5JWRA 1NRIA 4XR4A 4ALMA 4DLLA 4IEEA 1O0SA 1ENYA 3TZ6A 2I29A 1BCSB 1PNTA 4XUDA 2ZCVA 2FPIA 3G82C 4P3PA 2WNSA 4MV8A 4R05A 2DJ5A 4MRRA 4G0YA 1UBMS 1R1DA 1Z37A 3BB1A 3DH0A 5KEIA 4NHOA 4RKWA 5TT1A 1PYGA 2NTYC 1XQVA 3I09A 2B4AA 1P2TA 5TQ2A 3RRFA 1DAIA 3HDJA 5KS2A 1XXHE 3W8RA 3MCAA 1A76A 2H18A 1MIOB 3OMLA 3T1TA 2JKZA 3RS0A 4D41A 4PYJA 5IKPA 1LBQA 3ASZA 1JR4A 4MOWA 3H84A 3EQ2A 5SZKB 1ZCBA 3TLAA 1PZXA 3X1ZA 1K08A 2VWGA 1FFCA 3SQXA 3DHVA 2HUPA 4PXAA 2VJYA 3O73A 3QFRA 4P7KA 1C9MA 3ZDEA 4EJMA 4QXMA 1CEQA 1JA0A 3Q7RA 4ERNA 4L78A 4IICA 3H3JA 1P73A 1NQTA 1NNLA 1RNLA 4RX1A 1I2DA 1WMEA 4FW8A 5G41A 3TKAA 4XYGA 4DEXA 3H1EA 4CU2A 3TQIA 5KVVA 3RFVA 4DA7A 1F2TA 3AWIA 1Y42X 1UM9A 4YUAA 2RH8A 2ZBFA 2R0QC 1T9DA 1EQAA 2PGJA 2R6DA 4D8YA 4DOMA 1IY9A 1JJVA 2G6TA 4DBLE 4EATA 3EE6A 2Y0CA 3IDOA 2NVBA 1BDJA 2J3KA 4HR7A 4KXVA 2W83A 4CW7A 1V5EA 4RGQA 1KOGA 2A3NA 4FFSA 3NTOA 4JLSA 2GZ3A 4C1NA 4EUSA 2VDKB 3EOZA 4II7A 4KVFA 1NR7A 1B4DA 2V74B 1H5NA 3RF6A 3LKDA 4AQYB 4RVSA 1O0CA 1H9BA 3OTIA 3FMIA 4RABA 2QG6A 1V8FA 1VZ2A 2UVPA 3NT2A 4ZEVA 4BVJA 5AM5A 5IT9A 4XFJA 3FYTA 4JLUA 3GLFB 4DCOA 1UOQA 1YS2X 5EXXA 1J2JA 1RAFA 2BGMA 2PQ2A 5DBEX 4XPIB 2QP9X 2C88A 6CHYA 1B41A 2P11A 2WTAA 2V55B 1MEEA 1GR0A 5TQJA 1QC5A 3JWHA 5G4KA 4B81A 7REQB 1ZAYA 2P3QA 2QDXA 1DXHA 3QZUA 2AX3A 3CVOA 1ISFA 6PFKA 1L6IA 4IDDA 3TOXA 2EF1A 2VUIB 1ST2A 2R65A 2X41A 3H65A 4NWIA 1DPFA 1OWMA 2GUGA 4F9TA 4BNFA 1YS4A 3NXSA 4LZZA 3ZZ1A 1N5KA 3CSDA 1BQEA 2CW5A 2XQJA 1P75A 5F7ZA 3TIVA 1CLEA 2BV3A 2PZJA 3WKCA 3PDUA 3ROQA 4RK7A 2GZMA 3BCHA 3CNQS 3AR2A 2X2EA 1M1YE 3HCWA 1UBOS 4QYSA 1CU1A 1O3YA 4YTEA 4WVFA 3S2YA 4DJJA 4OH7A 4AQ7A 3TRJA 3CRNA 2HPHA 3KEGA 1NQ5A 1JFLA 4U2CA 1QS0A 2P9TA 2Q5FA 4J0KA 4JMLA 1D2EA 1T9GR 1NF9A 2J9FA 4G4IA 1IIBA 4QQNA 4EJ2A 3VKHA 1M33A 4LV6A 5EIFA 3OQIA 5DEOA 1H65A 3AR7A 3O2NA 2XKKA 1JT9A 1SIWA 1E59A 1Z0AA 3E9RA 3O03A 1ZD2P 4CMBA 1Z45A 2JVIA 1U9IA 3DZJA 3R7NA 1FDRA 1WVIA 4J3FA 2PJDA 1UXGA 1SXJE 1J6UA 3DBOB 3BH0A 2FX2A 4NQZA 1RWQA 3T4EA 1G7RA 1W8DA 1GGKA 5DZSA 2ZSUA 4JUAA 4V24A 3S70A 1E2BA 3GLVA 1UP6A 4O33A 4N3BA 2NN3C 4EG3A 1L7NA 3TLYA 2Z4SA 4PQFA 1O9BA 3LUGA 3QF4A 4BNWA 1SXIA 2X4LA 2DFKB 3A9UA 3LSTA 4DV2B 2IY9A 1ZGHA 1FXSA 1LLDA 1NLFA 3FNGA 4GYKA 5ALYA 3ZGYA 1O97D 3KRTA 1MDBA 1DELA 3IA7A 3VH4A 1ZWLA 2V58A 4Z54A 2Z6AA 4KE7A 3PI7A 1GPUA 4LC9A 3F6SA 4MGHA 3R5XA 5T5QA 4MJXA 3UYLA 3IKTA 2ZR9A 1S4QA 3TTWA 4GLFA 3GYBA 3NDIA 5ER9A 5BORA 4LEIA 1T36A 1PN3A 3L4SO 2Z09A 3CWQA 2P27A 5HA5A 4YRIA 3TUJC 2IK8A 5EOVA 3ISTA 1D5WA 4OUDB 2Q29A 4TKUB 5ES4B 3HBNA 2CFCA 1V3UA 4I50F 3FUWA 3HVUA 4M0UA 4NJEB 3UT5A 4P53A 3FPBA 3BGWA 2R84A 1JDNA 2AMLA 3R2JA 4FI3C 5IZCA 5JS1A 1DGQA 5IJ9B 2B8NA 5AVQA 2Q2WA 5JI2E 3NOOA 1YZYA 4B6PA 1H93A 3NAQA 1MVLA 1LS6A 1G18A 2WTNA 4YJ3F 2C8KA 4AY6A 2XYVA 5IARA 5I7RA 2C94A 4LWQA 3VTAA 3RTEA 3N7TA 4N3NA 3CZ4A 3A4IA 4PSKA 4G1VA 3P2KA 3VOTA 2IZOA 1Y0BA 3OZIA 3AF5A 2PFKA 1C81A 3OEHA 1DRKA 3SGLA 3SHQA 1PSZA 4WKBA 1BDBA 1NVTA 1T91A 4KGZA 1G42A 3UOWA 2CXNA 2TECE 3CW2A 2J5XA 4A0RA 4UHBA 3Q7IA 1J33A 1I4TD 2QI9F 4NBNA 3F4LA 1DWUA 2P4EA 5C4IA 1EZ1A 1MG5A 1GZUA 2AXQA 2GSWA 3ICPA 3Q1KA 2WHPA 1DMSA 2ONZA 1E2KA 4L5JA 1QHGA 2EL7A 2QX6A 5F5LA 5MGNA 3TXAA 1JLLA 1T0HB 1ZUWA 2NV2B 3JQEA 4TN1A 3GLUA 3HBFA 1ORVA 4Q1VA 2O57A 3GT4A 4MQFB 1DAEA 2G82A 2JH8A 2VWHA 3AWDA 4Z9AA 3UF0A 1NIJA 3L93A 1FP2A 1IXKA 1U2GC 1E3JA 2UVDA 3N2IA 4FHGA 3SQOA 3TXYA 3U9TA 3UM9A 1GZ3A 2FKNA 2BIFA 3H0EA 3V4SA 2CUTA 3ZPXA 4K6OA 2RBGA 2TYSB 3IOCA 4LXGA 1V1RA 4P84A 4TROA 1RM5A 4NYMQ 1K63A 1U2SA 5TNXA 4EPVA 4B3GA 2BOVA 4HDMB 2YV5A 3ME5A 2FPGB 3AOGA 4R1QA 5FUWA 5BUCA 2FQWA 4ETNA 4ZP1A 2HR1A 1ZK0A 1ODLA 1IHXA 3MUOA 2FFJA 3QX3A 4DCJA 2P68A 2HPVA 3RAJA 3GJ8A 5AUOB 2E4WA 2IYYA 4W8OA 3JQ8B 3WG9A 4YV7A 1K86A 3G0HA 1TNDA 2OV8A 4H7DA 3CONA 4EECA 1K6JA 5EIWA 1GZSA 4N5MA 1AH2A 2CZGA 1XQ9A 2QLMA 2IUSA 2LKCA 3CKKA 2JLBA 4NFHA 4E51A 3E58A 5K6RA 4OI0A 1VRCA 2MR6A 1YL6A 3IUQA 5IXJA 2YUTA 4QU8A 4YACA 4BVAA 3M0EA 2C5HA 2IEBA 4BFSA 1WB4A 4REOA 2HEIA 1LLCA 5A9SB 1OBHA 3WYEA 3ERCA 5A2QA 4CTMA 2QKYA 3X2EA 1QIHA 1KDRA 1CEYA 2N0SA 3AY0A 5A1JA 5FR2A 5D6NA 1TD9A 5B57C 5GTDA 1KJWA 3NHSA 5HOEA 4OFBA 1VJRA 3SC6A 4A6PA 1YR1A 4H27A 3WSVA 2PG3A 3OP4A 5HRCA 4Y2GA 1W5TA 3VO8A 1SK8A 1XRLA 1RPTA 3LHFA 1NV9A 3Q0EA 3H05A 4MROA 2UXCB 1OLUB 2M9MA 3KKQA 3S28A 2O59A 1JKXA 1ZGZA 1DFHA 4GWLA 2GAFA 2ZS8A 4PX2A 1U2PA 1Z6ZA 3VXKA 4IAOA 3HZRA 3I9NA 4PLGA 3S6JA 4JDPA 1IPHA 4X0EA 4BLQA 4MQ5A 1PFUA 3RTDA 5IWCA 3VR4H 4GDMA 1GNQA 3FB1A 4D0LB 2XXBA 3RYHB 1E4EA 3O90A 4YRAA 3GB9A 5DX1A 5TGTA 3K1AB 1CF2O 4G5RA 4O6VA 3I2KA 3ETEA 2F9FA 4LJ6A 4FWBA 4AS3A 3LCCA 2BGJA 5AKHA 4W5HA 2EEZA 3LPDA 1LF5A 5JVDB 3ZKWB 4QJ4A 5HE9A 4CMCA 3WNCA 4ZZIA 1Z07A 2WSYB 3ONFA 5H9VA 4DJ5X 3RQIA 4DVJA 3G1UA 1XRMA 2VNIA 4GEGA 1ML3A 3MWKA 3KB6A 3GG9A 1WPXA 2R1VB 1T8UA 2Y71A 4D92A 1H2RS 4RKEA 5ALMA 3WX0A 2VO1A 2J3IA 4JJ8A 1B2RA 4JUCA 1VL1A 2OO3A 4O2BA 1Z0SA 3OC6A 3OFNA 3TLZA 4BNHA 1QQ5A 3FLAA 3HCNA 3T8YA 4MUBA 4C6HA 3HTXA 5IYZF 3SOZA 4EPXA 2VHWA 3CVXA 2KS6A 4Y6PA 3V4VB 1ICIA 4MJLA 4BLSA 5C8XA 5LIRA 1U7WA 2WF5A 4W7HA 4CEJA 3QTBA 4NJOA 2ZRGA 4DBVO 2XCTB 5DCLA 2FZLA 1WKCA 1JDSA 1NOJA 1INLA 2NLOA 1LRLA 4D0NA 2V5AA 1T2UA 2GZRA 3FNHA 2XUIA 5B7NA 1KQFA 3QBJA 4DR1B 4TVBA 4L5IA 3VR5D 2CF5A 2E48A 4W7IA 2Y1LA 3NP9A 3TOZA 4TQUS 3PUJA 1G20B 2AF3C 4MA4A 3F0TA 3F3SA 3ASYA 4C5CA 2AF4C 5AKEA 1CUYA 5DYIA 3H2SA 4EM6A 2QT1A 2QYHA 3KSMA 3LP6A 1JDVA 1I80A 1M2WA 2FRXA 2REXB 4JD5A 4MGYR 2BFAA 5K6AC 4CZ2A 2OYSA 2GARA 1CY2A 5JNRA 2ZJ3A 1ORIA 3K9QO 4JLJA 3QJ5A 5FPKA 1ZHHA 4HVCA 1ADGA 2Q3HA 2A5JA 4WXMA 2XYRA 4G5HA 4J91A 2ZUFA 2OHVA 1QAQA 4HQLA 4QOGA 2NZXA 2WD7B 2DY1A 3OZAA 5FWDA 2XLCA 1GWNA 1K9SA 2QG9A 1R9GA 3EXAA 5A0FA 3SR0A 1YULA 2RGWA 3PUZA 4DJFC 1K66A 3CVUA 3BMNA 3QUBA 4M54A 2W6JA 3HXQA 4DV3B 4G5XA 3FA2A 1DEHA 1G291 1AT1A 1U6IA 2W43A 4WNYA 3TZCA 3UNXA 1Z35A 3CE6A 2JFVA 3PFKA 3EZ2A 3R3SA 4XUCA 1H5QA 1SR8A 2LE0A 2Q07A 4LOAA 4A2WA 5KQGA 2X5XA 1V1MB 1NN0A 1D8TA 5JQWA 5LM3A 1KXJA 3WGOA 5CLQA 1KFKB 1G1AA 1ORDA 3A9SA 4LRYA 4L16A 1P72A 4QOIA 3AFIA 4X91A 3KR0A 2OYRA 4FLEA 4WEQA 3PRKE 3AVUA 3I76A 5IC6A 2DULA 5LQDA 2NO5A 1FYWA 2PTGA 2PGAA 3WKAA 1AM4D 2VP2A 5HOQA 2CL6X 2B35A 1GCOA 2ZB7A 3NTQA 1ABFA 1GN9A 3OCWA 1O7JA 4U2EA 2L18A 2XZPA 4QHTA 2HK9A 4UATA 3PF9A 2C61A 3TKYA 5EZSA 2RHDA 3HV0A 4F9FA 1MVNA 1WW2A 3GJ4A 4FFNA 5EUQB 5FDFA 3L4BA 3KKOA 2FJUA 4OHCA 3CF4A 3U4AA 1ZXLA 2WJHA 2Z1NA 4M55A 4XTCS 4CKCB 1VA4A 2RK4A 3V34A 1DAPA 3OMXA 3CX8A 4K7JA 4KN9S 3O4IA 3CLUD 1C3JA 4LE0A 1Y3BE 2AFVA 2OHFA 5F1KA 4ADSG 5C1BA 4MQLA 3KZVA 4XWAA 3ZK9A 1SUIA 1XZMA 4CMEA 4JJGA 1CULC 4X8MA 5TB5A 4EFDA 4K0KB 3ESXA 3NAMA 4QTUB 5LP6A 4H0CA 3I42A 5F2KA 5AVWA 5H3LA 2J5BA 3BSSA 3L18A 4EW2A 5IU6A 1SXQA 2B8TA 1QWOA 2BZSA 2XVAA 2IJGX 2PHZA 4P3KA 1E77A 621PA 4PGHA 2NU6B 3GV0A 2PUCA 4C0XA 3OOJA 5ADHA 5DM0A 3IAFA 2V3VA 3WLEA 1DCTA 3ANNA 3SN6A 3S81A 4MB0A 1XQXA 1OHHD 3DF9A 4UM5A 3U1BA 3BVPA 2DUJA 3GJ6A 1J1ZA 1U0HC 2INGX 3NHRA 4QM6A 3F8WA 4Q02A 2O8EA 1TRHA 2CFOA 4DLZA 4YR7A 4UZFA 1QQTA 3PI6A 1Y4DE 2B7BA 2VH1A 4J4BA 1U9YA 4EX7A 5CT8A 5L3QA 1BEZA 5KQMA 3K0AA 3U5ZB 1DC6A 4S0XA 4IHKA 3D7KA 3SC3A 1QF9A 3SE0A 3FMFA 4Z9BA 1FFXB 3TFQA 2FW1A 2XOXA 2GZSA 3PX7A 4JZKA 1JHZA 3UMRA 4M53A 2IHJA 5E8RA 2QAGC 3GVCA 2X6RA 5C4GB 1T9HA 3SS7X 4C1BA 1XCPA 1OTYA 1SQ6A 2B0JA 4LJAA 4LOKA 1W44A 3LQ4A 3OP1A 2GR9A 2ODNA 2Y76A 3A1SA 3SEFA 3KSAC 2RGCA 2I3ZA 1OD6A 4W9NC 3TEMA 1V8ZA 1O94C 1O87A 1KRWA 2F3SA 2JRLA 2PK3A 2P4SA 3CIFA 2G40A 4NMXB 1M6VA 3AIOA 2Y77A 5ER6A 1T24A 1B15A 4HEHA 5EP3A 4WCFB 5REQB 1JQJC 1TADA 3MCVA 3ZW7A 2UUBB 5JQGA 3LUHA 1HWYA 2CLOB 2H7VA 2IZ6A 4D0GA 1A69A 1B0AA 1HY3A 4CM1A 4P4NA 3FSRA 4FC7A 4BN4A 2PYDA 3GGJA 1I36A 1Y8QB 1SG0A 2OBBA 2PT9A 1YR3A 4W6QA 4HQ0A 4AN1A 3WLLA 4JJ6A 1YI8A 3TCNA 5E6RA 3O3MB 1PKEA 3NHMA 4CXMA 4OYHA 3EULA 5JMOA 4H4DA 1QO9A 1VXRA 3UMBA 5ADWA 3GDOA 1YUBA 3S8YA 1L5HB 1SQFA 2HTEA 3LWBA 3B3AA 3F78A 5AUQA 2XE7A 4U5XA 4GQIA 2EX4A 4WNAB 4DYDA 3EVCA 4DJEC 2ZOSA 4LG1A 1T3LA 3IEPA 3ADPA 3BE8A 4HNAA 1UM8A 4FUTA 1ULAA 4ZO8A 4BATA 4I55A 4BZPA 2IE0A 1VKNA 2FR8C 3CTPA 3NHUA 4YCCA 2VC2B 1CUEA 1F8YA 1PQWA 2BTQB 1BGWA 2PYIA 3L1IA 1R8SA 4WDRA 1O5TA 5DX8A 1HRDA 3RUHA 2ZSAA 1T2EA 1FUEA 2QTVA 4M9XA 2EZUA 2O1EA 5K9ZA 2Y1CA 2DR2A 1E3TA 3WTCA 2G1UA 1TQ2A 1OPXA 2I2WA 1U7TA 1GV1A 2JJQA 4D9KA 4HEA6 1T4CA 2FZVA 4PGFA 4YUWA 4KJZA 2JFGA 3VDQA 1X7GA 1HDEA 2ID8A 2RD2A 1OU0A 3I8OA 2PX0A 4Q12A 2XMSA 1T10A 4YCNA 1MABB 5JXIA 3OFSA 3W5JA 2QIPA 5CW2A 2ZB4A 5KNCA 1IBRA 4PIMA 2O3TA 3UJCA 5C8YB 5J4YA 5CRIA 1LY1A 1YR8A 1N3YA 1KH1A 4XJVA 4CCAA 3S0JA 5CDSA 2FEXA 2VP3A 1A9OA 3REFA 4KNYA 1HT0A 4ESHA 3CVJA 3GN1A 3I92A 1F7VA 3HGQA 3BTUA 4IHQA 3IAHA 1V2HE 4A91A 4OAPA 3R0VA 3W3ZB 4CQNA 2CXHA 3WNQA 2PX8A 1M2OB 1HSZA 5JPDA 1ZKDA 2EOAA 1Z7WA 3LGAA 1MX5A 2C96A 4PPFA 4TLMB 16PKA 5J9FA 4BNMA 2O8CA 3ZCUA 1VJ0A 2W6CX 4V0MA 2PCLA 2RGYA 5FI0B 4C0QC 1WBBA 5KTNA 1XPOA 1B0ZA 1GGMA 1ADCA 4GM0A 1T6NA 3HFSA 1MG0A 2O0JA 4WIAA 2PX2A 1ABEA 1U8AA 2FG7C 3BWDD 3EA5A 3IO5A 3N0RA 1UMDB 2WMOB 3E27A 2ZRIA 2BFDB 1KYZA 1NBMD 3G6WA 3H75A 2D4HA 3IMGA 4JGGA 4PZCA 3VOSA 5JAOA 5L6LB 4WLVA 1M74A 1PS9A 2GN9A 1FX0B 2GJ8A 3NDRA 4RLSA 1TTHA 4AFNA 4AROA 1MX1A 2GZ1A 4OBXA 3BCSA 4FBLA 5AI6A 3E1KA 1JQAA 1YRBA 4A0GA 4UTVA 2ZRNA 2OY0A 3CG0A 5F7JA 4R9VA 5HM6A 3AX6A 3KOOA 4DCCA 4L8LA 2R6FA 2QSYA 5KDOA 3UPDA 1FS6A 1XQ6A 1FMTA 2YVLA 1UFKA 3C70A 3GEEA 1HZJA 1Z3IX 3TSAA 1VYHA 4J1TA 1CEEA 4LSMA 1DCFA 4O59O 3G9TA 5JW6A 3OIUA 3SSAA 3HHEA 3EIWA 2Q3MA 1S2IA 5L9AA 4RTKA 4JOSA 1NG9A 2BEWA 2A0WA 2EJUA 3C3XA 3KBBA 3RBZA 3AHEA 4YNBA 1VMEA 3GVHA 4KQEA 3CE9A 3QBEA 4YMSA 4HCJA 3M5WA 2I55A 1HNNA 1TT7A 1VSQA 3B1WA 1FPMA 3HCOA 1ST3A 4MS4A 1DTWA 4MS1A 1ZVVA 5LFAA 3EXIB 10MHA 1S7GA 1NN5A 1XAHA 2GETA 3IELA 4OKSA 4XAQA 2Y0DA 3C5HA 5HCIA 1G2OA 2HADA 3TNLA 4BO9A 1F0NA 4UMDA 1CR6A 4R71A 2F4NA 4CMJA 4TUYA 3ZD9A 5DCWA 1P2SA 4KNVA 1QR6A 2I1VB 4CHTA 1WPQA 1CUCA 1I4DD 1WSBA 2JCYA 3HB7A 4FEAA 3EMKA 4Q4DA 1KKMA 5JPIA 3QOXA 4YN3A 3UBTA 3B6ZA 2G8LA 3BT7A 4EAAA 2F00A 2YXNA 2JAWA 3PC4A 4IV5A 1Y81A 4ER6A 2DOKA 3AUYA 3NV9A 2IYTA 3DLHA 2E82A 1WV1A 3IGFA 3NNSA 3TTYA 2XXJA 1A2QA 4XA8A 1TJNA 4TVKA 4DV0B 4W5RA 2XUJA 4HY3A 1AK9A 2CJPA 1X19A 4N54A 3IP6A 4Z4CA 1XK7A 2YN4A 4GVLA 1P61B 121PA 3QFFA 4XX1A 5DGHA 2YZ2A 2F7SA 1RCTE 5F77A 1H2ZA 4QM7A 4R1MA 3PEWA 1N9GB 3KT8A 3I0ZA 3BFVA 2LCQA 1NVGA 4HBZA 1HL7A 1AMUA 3PWZA 1P0QA 3IMFA 3LT1A 2Q1XA 4G24A 3OZGA 1VG0B 2VPQA 3KDAA 4MB2A 2HNKA 2OG2A 2P6NA 3LU1A 4TOIA 3WMFA 2EYQA 3BWMA 4IPTA 1DKMA 2MOKA 3IOMA 3DDNA 2XNDA 1C7IA 3O8QA 5ALQA 4EABA 1H94A 2YC4C 5TIIA 1LZKA 5CA1B 4MVYA 4NZPA 1VYTA 4YEDA 4WASA 4ACBA 5JSZB 4UMVA 2Q8NA 1VMAA 5AW4A 5EWLB 3U7FB 4DR7B 4P5PA 2FW8A 1N2XA 4D9FA 4JJ4A 5GZ3A 5L7TA 1RXEA 4QLBA 3GEPA 4X62B 1RJGA 1UOEA 1YZNA 3ZWVA 1KMHA 1EFRD 3CN7A 4K2HA 5AW0A 1V7QA 4FXOA 1NBEA 5BOVA 3TNFA 2AA3A 3GNSA 2PWPA 3M1IA 3PNLA 4QVIA 2DLCX 2ZU0C 1SVMA 3TQCA 4QDTA 4ZQCB 3T5CA 2WJYA 4GYYA 2H2GA 3DDOA 2CD7A 5DYTA 4Q3AA 4ICIA 2LBPA 3AY6A 3JQGA 3OTHA 1BS2A 3LX6A 2HF7A 3AUKA 3VNBA 4ZMSA 1PV1A 4KRGA 5LWHA 2QX4A 3NBZC 1PTJA 4NFLA 2C9BA 4DKJA 2QLJA 4ZODA 4WERA 4BNTA 2C7RA 4RELA 1FVXA 1P77A 2P5YA 3AJ9A 3IJPA 1T3HA 3PFIA 2JGFA 2QG4A 4R40A 3QLUC 4MP6A 1ZHFA 2C9MA 3T7RA 1ZUD1 3CRW1 3DXYA 2W6PA 1WMSA 4C7OA 3P0HA 2WHQA 5SYMA 5BQFA 1XLTC 2IXEA 4NPAA 3J81k 3GA7A 1JE0A 1YJ5A 4KIUA 2D0OB 2ATVA 3CJRA 2R68A 4JCCA 2V5VA 4YREA 2R7AA 4YJHB 3O2QB 1ZJ6A 5DIZA 4H7PA 4HAXA 5I01A 5DHFA 5IBCA 4RM2A 1Z6AA 4EHAA 2QM3A 2AG8A 5CPBA 4DYVA 1JDJA 1K98A 3EMVA 4MUAA 5T7BA 2R8OA 2NO7A 3H9GA 1YQQA 2IWHA 3ILVA 4DCSA 3LOPA 2XAUA 4HAOA 5CIYA 3P0JA 4JUFA 1VJCA 1V41E 3C6QA 2NUAB 4KE9A 4MKFA 3MZ0A 5CA0A 4X8LA 4M37A 1D4OA 4BCCA 4YFYA 4LY0A 2WB4A 2H85A 4RVDA 1XWWA 2COKA 1VCHA 2BMJA 2IYWA 1YBVA 1MRNA 3K9NA 4P7JA 4UVHA 2BR3A 3RTCA 4DMUB 4AI6A 1HDIA 1G2PA 3UHJA 4A2PA 3UGJA 3HY4A 2WKPA 3LY8A 3NLLA 3A4NA 3WLSA 1ZUNA 3KUKA 4L50A 2RC6A 3PE3A 4RJJA 1ZMXA 3R3VA 5JYDA 4PBSA 1YT5A 4A7PA 1AXEA 1T2VA 1KP3A 3TI9A 2O2HA 2ES4A 3OM9A 2PKXA 4HNHA 2JFWA 4RGVA 3ZIDA 3OCXA 2CDNA 4HX2A 2XNKA 3ONWA 3K0KA 2AC2A 1DMRA 2VJCA 4QGGA 3VO1A 1G21A 5A1TA 5G0VA 5BXYA 1NVBA 2WW8A 3KOXA 2AXNA 4L4XA 5F2EA 2H57A 4UHDA 4EEXA 5JPCA 3I1JA 1XK6A 2PM8A 3LCVB 4I8DA 5EEHA 2BFMA 4EEZA 4YDRA 3LC2O 1R0WA 3FJYA 2E3JA 1HG0A 2D06A 4TV9A 5AUPB 1H69A 2BJHA 3FSGA 2XTAA 1I5EA 3OOEA 3SKYA 1L3CA 1G9TA 3AFHA 3G5MA 5KVQA 4X85A 4E30A 2R48A 3AZPA 1GPBA 4YMUA 1T5BA 2PKQP 1RMQA 5EVCA 4JLMA 3WXMA 4Z7OB 4TYWA 4OHFA 2HK7A 3G89A 3EXEB 1KPIA 1PX2A 1XTJA 1ZIDA 4I5IA 2VPPA 4IX9A 4L2IB 5G1PA 2JLSA 5E6SB 2H2DA 2BFFB 3GK3A 4C0JA 5A4KA 3NNDA 1XZJA 4BVGA 2A86A 3RSCA 4ZZ3A 2P0EA 2IE8A 2B2CA 3GZJA 5JZSA 1JLSA 2A9VA 5E9AA 2FN7A 1V9LA 5AHWA 4F5EA 1KY4A 3LNCA 1UIRA 5FWAA 2Q6LA 2QRHA 4MP8A 2IU6A 1Y1RA 2XWJI 5AIAA 4H6PA 1FTYA 4IGEA 3KJEA 1G4HA 2F8MA 2LCFA 3U13A 4KRFA 1QX4A 1IHDA 3LHSA 4B6QA 3BGDA 3KTAB 4QT4A 2QTFA 3T99A 2FWMX 3N76A 2H1FA 1Z6GA 1ZM7A 3JS5A 4I4IA 4R8LA 5DBHX 3GP3A 2NZ8A 4DPMA 1YIAA 4V3CA 4OPMA 4OV6B 3FNBA 4ZVKA 4PN7A 5E95A 5IAOA 5JMTA 2DJIA 1CP2A 1WY7A 2XUFA 3FHJA 2P3SA 1D0VA 1U0RA 5IC5A 1GRQA 5CXUA 3E7DA 1UODA 2IKQA 1FMFA 4Z4EA 2FDCA 1N6NA 4OVKA 4QWMA 6REQA 1MB9A 3PGA1 1EUCB 3P0EA 4PRYA 5KTMA 4YV0A 2OCLA 4BJ5A 4DC1A 4AZ3B 3OLZA 2VF5X 4XQ9A 4PG8A 1JL3A 2G7MC 4PAMA 1BIFA 4EW6A 1KEPA 1C1HA 5K3CA 3GLGE 3UAXA 3OHPA 3PR2B 4G0QA 4P4UA 3VUEA 4ESOA 721PA 2IUEA 4JOQA 2YV3A 4FDVA 5A0VA 3S1AA 3AUUA 3WMGA 3K96A 3LFHA 1T43A 3G5TA 5T4BA 4NBRA 2DB3A 3VC2A 1LDYA 4HO1X 4UHCA 1VPLA 4PZLA 3GLIA 3CEAA 1KXZA 4G37A 4IWYA 4DMHA 5BVGB 5EJ8A 1NVVQ 1X1EA 2GCPA 1MJFA 4Y6GB 2A35A 5IVKA 5F3WB 2XB4A 4CIWA 2D2XA 1BRTA 3URMA 4HB2A 2A4MA 3G2KA 3AILA 3ODGA 5DTQA 2J48A 5G0TA 3OI7A 4JGBA 1UJ5A 4GMHA 2HU8A 4JP2A 1ZK4A 2PDAA 1UWVA 2VYFA 1PTKA 2J9XB 2H8GA 4HMPA 4YAOA 2JJ2D 1NSFA 4NBWA 4C22A 2VHJA 4L9SA 4BE4A 4HSEA 1XU4A 1CFJA 4EO9A 5LOVB 3NFYA 4R0MA 3JSAA 4GBJA 4QYIB 1QFXA 4ZC1A 3IPAA 2N9UA 4H4CA 4AXBA 3RVQA 4BFXA 4URZR 4IJQA 3WL5A 2QRVB 4G1MB 3EB9A 4Q5IA 5EKUA 5FWYA 4GMDA 1V47A 2WG1A 3LPNA 5EWMA 1OLSB 4UD2A 3FGZA 4CG3A 3E15A 2QDKA 1QK4A 2PRKA 3SICE 2VBFA 1Q17A 3STYA 3ENVA 4EY4A 1ORHA 1C0LA 3QVWA 5HIJA 3VZSA 5I9TA 1N0IA 1F14A 1GGVA 1EK2A 3OO1A 1VE7A 4WEOA 3ZIAA 4BNLA 1YBHA 5A3QA 3JTMA 4C07A 2E4AA 1JB9A 3LZ6A 3N0VA 4BQFA 4HDSB 2ZJ4A 5A71A 2PKQO 1RCUA 3JW8A 2QK4A 4RK1A 3HA5A 5THKA 3ZZ0A 1WXXA 2GEUA 2HCTA 4ONEA 3X43A 5A62A 1Y4SA 4E2YA 1XMOB 3ZLJA 1U7ZA 3UENA 3K2EA 3AYZB 1M2VB 1OZFA 1ZNWA 2ERCA 3GFOA 3MT9A 4QTTB 2XWPA 3O1IC 1X1QA 1SVUA 1YR6A 2AOUB 2AR7A 5E2BA 1R7RA 2YFKA 5AOBA 5HS6A 3W77A 1I7DA 2P40A 3NBAA 2ZSIA 5JH7B 4RPCA 4RLFA 1TCBA 2OR3A 3EWSA 3K1YA 3M4XA 3O8DA 4Q16A 4Z0PA 3ROTA 3T3MB 5F9HA 1LDMA 3MCZA 1SWVA 3M4JA 4XXHA 5EMNA 5EMJA 4NEGA 5DLEA 3I0MA 2OV6A 3K0FB 4EGAA 2SECE 3EPHA 3NQ41 3V48A 5I4CA 3AEUB 3COYA 4RF2A 1WULS 1O95A 1AUOA 2TSYB 4TMWA 2NPFA 1SEVA 1OUMA 3O84A 1J0XO 1FXWA 4E1AA 3CH4B 1KI4A 3RS7A 4MZXA 5A5VA 1N75A 2QTWB 4A16A 4KK3A 2V4UA 3QEJA 2IIPA 3OE4A 1BOFA 1EQ2A 3EWNA 4W99A 5SY6A 2X8AA 1VG8A 3M3PA 3RT9A 5CFRA 4ZGWA 1BAPA 3HNRA 5I8WA 5FUXA 2JCVA 5J58A 2CZQA 2PUTA 1FFBA 5DGTA 4JUDX