5CLHA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
APVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
total genus 53
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5clhA00
3LP6A 4YCJA 3KUUA 5C5DA 3TRHA 2YWXA 5CLIA 5CLHA 4AY3A 2ATEA 4Z7JA 5BOSB 5CTJA 4YCDA 5CLFA 4YCCA 2FW7A 2NSHA 2FWPA 4ZMBA 4ZJYA 1XMPA 3OOWA 1U11A 4JA0A 2FWJA 4B4KA 2FW8A 1D7AA 4ZK2A 3ORSA 4AY4A 1O4VA 3OPQA 3RG8A 2FWBA 4ZC8A 1QCZA 3RGGA 2NSLA 4GRDA 5BORA 5BOSA 5CLJA 2FW6A 2H31A 2FWIA 5CVTA 5CLGA 2FWAA 2FW9A 4YCBA 2NSJA 2FW1A
chains in the Genus database with same CATH superfamily
1QOQB 1YJCA 1TNDA 5KOJA 3FDZA 4CM1A 2W8BB 3MWEB 4OBBA 5CX4A 1OYYA 3NCHA 3KBBA 4AJ9A 3PJRA 3K7EA 3VKVA 4FT2A 3DT6A 1B6TA 4X84A 1Z6GA 2AC7A 4TXNA 1XEXB 5JJBA 2CFTA 3QVTA 2WVHA 4D9CA 4A16A 3UB4A 3DMHA 1C3OA 3H17A 2ZSDA 5LD2B 3AUYA 3ZGZA 2HSZA 1N5KA 2WF8A 5GOTA 1SZPA 3KQTA 1DLIA 3WFZA 4B31A 1D2GA 2IPNA 1Q3HA 3VVCA 2Z09A 3WVNA 2AOTB 4LJ4A 2ZSHA 4IFIA 4UBMA 4AZTA 2CN1A 3WHIA 4JC5A 2CD7A 2L0XA 3FVRA 3AUKA 3THWA 1WRBA 5CFPA 4TMYA 5CG1A 2F3PA 2J09A 1MIOB 4DCCA 3WL8A 1I32A 1SXJC 4WUVA 2CV1A 2ASVA 3WWCA 4EW3A 5IDVA 2QAJA 1U7TA 1E89A 4PYMA 5DT9A 2AEEA 5LB4A 3RC9A 4NF2A 4XVQA 2ZRPA 3R7AA 2FLWA 4LMPA 3ENKA 3G9UA 2OHVA 3SHTA 3TZBA 2N46A 2CVQA 4MS1A 2A1UB 3KEMA 2PTGA 4G9BA 1T6ZA 2H2WA 2NU7B 1J21A 2V97A 4L4SA 3UHOA 1WHSB 3MWLA 4KQJA 3RSHA 2WQ7A 4IIHA 3P0IA 4X6XA 2BFFB 4URWR 3ZYCA 1CT9A 2ESRA 1RYYA 3PDIB 4PIPA 1P9LA 4EUHA 1MJFA 4W8GA 5H9WA 2DTXA 3CY6A 2QG6A 3OU6A 5IUJC 5FJIA 2WHPB 3QG5A 2WABA 5LBUA 3N2NA 1X8LA 3VO2A 1X15A 1XQXA 4NNJA 5JD5A 3W6UA 3M4JA 4F2GA 2QTFA 2W4IA 3L06A 1YRQA 4CV0A 4YY3B 5FO1A 4RESA 5L40A 2M1XA 2XZPA 1WXHA 4WBSA 2NSHA 1K8QA 4ND1A 3BWXA 2FPKA 3BWEA 2BH9A 3OZUA 4QEKA 5H81A 3N59A 3TS1A 3RW9A 1YBHA 5J1TB 5KSZA 1NF3A 1SKYE 2INGX 4KVZA 3ZV6A 4B4DA 1TUGA 5GJBA 2BP7B 2YXLA 2JZOA 4HTFA 4J0CA 5TEWA 4KQHA 2Y6VA 4ZMSA 3EPPA 4NEQA 1R10A 4NBWA 3PVCA 2XGOA 3ZNNA 2Z6QA 2ATXA 2V55B 3B9PA 3CF0A 3QTTA 1Z34A 1T2FA 3KKOA 1YVPA 5KUTA 2E4AA 4P98A 2O5EA 3GR6A 2GJSA 1I1HA 1BCSA 2PWYA 2PLNA 3O90A 1M8KA 2FOLA 3QLEA 4YIKA 3W05A 3W3ZB 2J5XA 3WHLA 2PJDA 2IWHA 4DZZA 2F3RA 5LB2A 1EZ4A 1LPOA 2H29A 2V0NA 3R23A 5CMLA 5IN4A 1CP3A 2BUCA 4XB6B 1ZHFA 1K6JA 2AC4A 3TSOA 1IY8A 4GD3Q 2HD4A 4HDOB 4QGHA 5AXCA 4EFLA 5KTNA 3L7BA 3GEDA 4BP8A 4I6GA 4OFZA 3TINA 1CQXA 3B1ZA 2XVZA 3ZY4A 1UDBA 1QZXA 2O1EA 3HVKA 4QPNA 3E5MA 2XB4A 3BBLA 3SJ7A 4FE3A 1XL1A 3TW0A 3UVEA 5IJ9B 3WIOA 2Q6LA 4MW2A 4GQBA 1D4ZA 2GBGA 4IKPA 1KZGB 3HEAA 3PKJA 3C7KA 4YMIA 4L4ZA 2W8ZA 1IHOA 2FHPA 5KWSA 3LW8A 5H3HA 2Y67A 3GPBA 1DWOA 1XA3A 3RJ9A 5DBEX 4ER7A 1A9PA 5JNVA 1UKVY 5DU2A 4R31A 2R8ZA 1B16A 2PX2A 3R7DA 3ZEIA 4NPHA 2FFQA 3KJNA 4L72A 4MWCA 3EWSA 4RHTA 4EMUA 2IYZA 2CHUA 4BVLA 3WGUA 3GT3A 2GVNA 3L1UA 1WXGA 3BAZA 4MHTA 1YUBA 4I1YA 3DHYA 4I9UA 3LWBA 2H54A 3M6UA 2NACA 1NGSA 2C99A 3RU9A 2BHNA 1J4AA 4EHNA 5B12A 1N9ZA 1PWYE 1ZK2A 1UXGA 3W3AA 2JFUA 5ELMA 1NOKA 1J8YF 1GUFA 2Q1TA 3A9VA 1EPUA 2IBSA 4J0DA 2OV6A 3JD0A 4X00A 5K09A 2Q28A 3ADOA 3OH8A 3KEFA 4ID9A 2CHEA 4LHWA 2CDBA 1ACJA 4Q7KA 3ST7A 2JKYA 3DBRB 2J9FB 4FYXA 3HBMA 3CVYA 1I80A 3CRMA 1P1IA 4C08A 2LE0A 1MV5A 1WO8A 5EKTA 4LDRA 5JD6A 3PFKA 4YA6A 4TZ0A 1A5ZA 3C6ZA 2RH5A 2HJRA 3GCZA 3IMKA 3JAKB 4N1AA 4TL8A 3WZLA 3DMTA 5LQCA 4PQGA 5EVJA 4FMDB 1BS1A 4CUKA 1OH8A 4I99A 4JZKA 3KKZA 4DEXA 2O8CA 4HVCA 1PO7A 3KWFA 4LXTA 3SC6A 4MV7A 1XOIA 4Q21A 5CAEA 2NMVA 1RAFA 3K9NA 1LB1B 4K03A 1HQDA 1LBQA 2JH3A 2PDAA 1LZLA 4KFUA 3UMVA 3B2QA 1EK0A 4BQSA 5FBVB 3TIXB 5AXBA 3BQNB 4PX2A 3EC7A 5CIQA 3K0CA 3CNQS 1NQUA 5CM8B 3UHAA 5HXAA 2QUIA 3SF8B 1G8HA 4DIUA 4GX2A 5K3CA 2JAUA 5FOXA 2GLUA 4V1CI 4WLNA 1BG6A 1PGNA 3D7SA 1TD9A 1Y80A 3FROA 2GBCA 2YUIA 5EFZA 3ZGOA 5JSHA 1KFJB 1EUDB 4HDKA 4L9SA 4Y2QA 1V4NA 4KITB 4X65B 1W19A 2NAPA 4HGYA 4KH1A 4H0FA 4Q9HA 4F72A 4YLYA 5CFQA 5FNVA 3BK2A 1Z6TA 1PZXA 1TYCA 3BH6A 2JLCA 1M8GA 3PNPA 1GL9B 1KVQA 5LDDC 3VZBA 3KSRA 4QOHA 5FBZA 2O8DA 1MH9A 4REMA 5JMTA 3N75A 1Z39A 5H80A 1CJUC 2QSZA 3FCCA 3AZOA 1ZMTA 2ACEA 4MYDA 3NYRA 1TJ4A 4DLPA 3RFXA 2IK8A 5K0BA 1P9WA 2VHUA 4DPKA 3H3JA 3Q9LA 3ZBPA 2DBYA 2PBLA 3HS3A 3M3PA 1X14A 4B4WA 4CG3A 4CV1A 7REQA 1SXJB 4YFYA 1C0IA 3FDZB 4CKYA 4Q12A 2VYQA 5FI0B 3RG8A 2ETVA 2QUHA 3ECAA 1QH8B 4FTWA 2EARA 3LCJA 4KLAA 3TAHA 4E3ZA 2MYPA 5KWVA 3HCBA 1VMAA 4BNLA 2QAGB 4K0RA 4K9DA 1MGOA 4U5QA 3UQZA 4RVCA 2G5GX 1HQKA 3J7TA 1C0KA 3FBTA 2H1VA 4LBYA 3P9XA 3BQ9A 4QM6A 2RHCA 5G0TA 1E6LA 2PZBA 1RWWA 4FILA 3EIQA 3UPDA 4C7KA 3CEJA 1JG1A 4CKEA 4MWEA 5AFSA 1UMDA 3V3KA 4BE4A 4GRIA 1WXQA 2FQ1A 2YV2A 2FVYA 1NXWA 4JGGA 4ZJPA 4RBNA 3ILHA 4R71A 1QVVA 2RH4A 4U7JA 4DPLA 4NY1A 3FTDA 3ZJUA 3DLAA 4A27A 1E9BA 1SOVA 4MKIA 2GZ1A 2IYRA 1NJSA 4Z9AA 5TLSA 4ZDKA 1FLNA 1LBHA 2O0KA 4D4KA 3DE6X 4KG7A 3O3OB 3LKVA 1PSDA 3HSKA 4ZRNA 3IBTA 3WGQA 4IIGA 4EUKA 1PLKA 4EBFA 1H0HA 5KPDA 3LYLA 1JQDA 2JLSA 3WLNA 4ZAZA 3BT7A 4C0JA 3JYOA 2HDHA 3M6LA 2UUPA 4BNUA 4H6PA 4JBGA 1VDMA 5ITZA 3CN9A 3LXXA 4XWTA 3ZHOA 1DCKA 3E9MA 4KN6A 4AS2A 3OPYA 1XEWY 1QRAA 3I83A 1JXMA 2PEYA 1JR4A 2FUNB 2WWHA 2OBXA 2ZRFA 1SCAA 2NO1A 2BBOA 2WTMA 4FN5A 4MR7A 4D4LA 3TXYA 4XIIA 2P9ZA 5BOSA 3J7AC 2GWRA 4E12A 3GPDG 4XDYA 1N7JA 2G4LA 3EXFA 3CG4A 5D8DA 1EK2A 2O1WA 1OGYA 4CMIB 4XVRA 4QDTA 2M1ZA 1M2OA 2XPCA 4OU5A 4X85A 4A9AA 4E5YA 1P2TA 5C1IA 2I9PA 3NNSA 1XROA 4LZAA 4QQRA 5BYJA 1J5EB 5D3ZA 4XZ3A 2CBXA 2VSYA 3FPKA 3PC4A 4QQFA 3INNA 1A7UA 1XUOA 2R6AA 4LHXA 4Q3KA 3BJZA 4RPIA 4YP9A 4AO8A 2PTHA 5KTSA 3ZDDA 2UZ4A 3WZMA 2PJUA 4JQZA 5FBWB 3IEKA 3H18A 3COSA 2VDWB 3OT5A 3K1TA 1X19A 2D5BA 5C4GB 1HE4A 1XDSA 2C83A 3RF6A 4BFZA 3LP8A 3CLVA 3PRJA 1V5WA 4LSMA 4J49A 3VH3A 1N2CB 4Y0NA 4URZR 2R68A 1VLHA 2A5LA 2CWDA 3KVOA 3PLRA 4IIBA 5AJYA 2PWAA 4KQGA 1RAHA 1RSZA 1QBKC 3DZCA 2JCYA 1R66A 1CUGA 2FN4A 4TL6A 2LIVA 2ZRIA 2OKCA 2P1ZA 2XUQA 4IFBA 2OCAA 1UZMA 2HDWA 3AIIA 3F5MA 2PNFA 2VOEA 3IPRA 1W8DA 2YJGA 4J3NA 2IEYA 3W34A 1Q14A 4TWRA 4ZMBA 3LLCA 3VX3A 4LYEA 2RKBA 4FD2A 1JDJA 5I9TA 1QO7A 5H4HA 3H2IA 1NQXA 3WRXA 4OFXA 2QRVB 3QKSB 4ISCA 1NX6A 2OVFA 5IZ4A 4BOYA 3D4PA 3TPFA 1QFZA 1KZHA 1Y8ZA 4BWFB 3AY7A 2AB0A 4OHUA 1EAMA 3D3EA 3BULA 3D5TA 1GDDA 4G0QA 4I66A 5E1DA 5BURA 3T3IA 4DV3B 3PKZA 1Z0AA 4KQFA 1B8PA 1XCPA 3KAJA 3R3SA 3STHA 2K7FA 3KEQA 5AVXA 2ZTLA 4NOMA 2GCOB 5B7NA 1JEQB 1MX5A 2RIPA 1K7CA 5HPYB 3RO7A 4TSRA 3TPCA 5HR5A 3UV6A 2Q9CA 5LQJA 2DHDA 4D9IA 5CW1A 1VFNA 1YAHA 2ZSEA 1PGQA 1C8LA 4N7MA 5JQGF 2EDAA 2OAQ1 4GQIA 1G8YA 4H35A 1LD3A 3X2EA 5IABA 2TSYB 3A4NA 4LJAA 4CLXA 1EXMA 2FDXA 2G40A 2OG1A 4CLHA 4MQBA 4UVIA 4UUQA 1O95A 3DBRA 4GPZA 1OLUB 2VJCA 3U4QA 4OH1A 4B8ZA 2BM0A 1X7XA 2QYSA 2ZYGA 3K1JA 5TJHA 3WLMA 3AB7A 5FYQA 2Y1LA 4GYWA 1F38A 4L2IB 2PSJA 2F3TA 5ALPA 1T4DA 1UOQA 2WT4A 4PC3A 4HATA 4CT5A 2PR7A 1W36C 2PXHA 5KWEA 4FW8A 4DR4B 2O8CB 2BZGA 5DV9A 1SU6A 4L1KA 4I1VA 3K5WA 4ND6A 4XJVA 3UHFA 2PZEA 5D7BA 2PO7A 1BH2A 3K35A 5DI3A 1SXJE 1RWOA 5I7AA 5I4IA 5KNBD 3CB4A 1BWSA 1CJSA 1JEEA 3LDHA 3WL7A 1PR0A 2XXAA 3NGLA 4H6VA 1UBFA 1XZDA 1ZL2A 2H5EA 3CNNA 1KYWA 4YAKA 3ZWKA 2VNAA 4Z4QA 3EDQA 2HWUA 1NBAA 3IAXA 3FUUA 4ARZA 5TPWB 4WQMA 1UC5B 1L6IA 1V6AA 1E6UA 3KQMA 2AFVA 1N2SA 3I30X 1KMMA 3IQDB 4G89A 4TKMA 5DTEA 1U2DA 3LT0A 5B1DA 3ZVMA 1RR6A 1WU7A 4U2DA 1ULSA 4HEJA 1QK3A 2H0QA 4KSCA 3BN3A 2GFHA 2HO4A 2FGKA 3EIXA 2D0IA 4U0JA 5LMNB 2OCBA 2ZB4A 4MPRA 3N3AC 1IY0A 1PR9A 4BUCA 1J0DA 1JS1X 1V25A 3E5HA 1KZ4A 1VB3A 4FCCA 3EISA 1KYIA 3OF3A 4WX2B 1HGXA 1JMKC 4D2IA 4KQMA 2QXUA 3OD5A 1BDHA 2FXVA 4O2BB 2VDLB 1WHTB 2NU8A 4ZYZA 2AMJA 3LX8A 1IDOA 4GE0A 1JDUA 3E61A 5CLHA 2P0YA 2YRFA 5DLPA 4D5EA 4K8OA 1S8NA 2VCEA 4MO9A 4FP9A 3RWMB 4N3NA 3U7HB 4TQUS 4EG0A 1FYDA 3ZK9A 1QS0A 16PKA 2JC3A 2HQSA 2XGMA 4JN6B 4ARIA 3T1OA 2SBTA 4NL4H 3R5XA 1OH5A 2C2XA 4YUYA 2AZMA 3P45A 1QCYA 4TV8A 1U8CB 3KE8A 2CJYA 2PL3A 4AJ2A 4CW7A 3HU1A 2WWWA 5F4ZA 3SIPA 1XTVA 3M6IA 2CXHA 4D6XA 1WXWA 4TGLA 1BXRA 4CKWA 5AHKA 4DHWA 4BN4A 2QWXA 5A6SB 5H68A 1GUDA 1OXUA 2VP5A 1WSDA 3G2HA 4ZVNA 2OYSA 2QT9A 4GUDA 1N78A 2BLNA 5ALRA 2NUBA 1Y1RA 1XALA 2ZBRA 1UK9A 2DUUA 1NBWB 4HAIA 5ED0A 3WFIA 2CJFA 4R2KA 5IH3A 1QO0D 2EATA 2Q45A 1TU3A 4MDYA 1M9NA 4W1QA 2EXXA 3PWZA 5KNDA 3KVVA 3STVA 1UWKA 1RDFA 4I1RA 1ODIA 4RDCA 3S2EA 5DH9A 3MCZA 3ZDCA 2CE7A 5I7OA 2E21A 2OILA 2LXNA 1NVXQ 3KLBA 3QI7A 3WBJA 2NZXA 5EGNA 3LUJA 1C3VA 1Y5IA 1AT1A 3M8KA 4QO7A 1RPNA 3IOBA 1ZVMA 4YWHA 1VGVA 5KSYA 3L0SA 2NUAA 3G8AA 2HKIA 5DHTA 1OFUX 2CXSA 3QWHA 3WWDA 1OLSB 1Y42X 1QP4A 3LUGA 1CQIA 1GU1A 3FSRA 1QV6A 1K5PA 2BEJA 2GTPA 3AKEA 1LLQA 2G9VA 4K40A 1TFRA 2W48A 4OJKA 2A14A 2HPAA 4KR9A 4LOAA 3LUHA 3LCCA 2OZEA 1FQWA 4FMPA 1KAOA 1UT8A 2HOQA 4Y1FA 3U7FB 1W0KD 3IJEB 4N48A 5ICSA 2RHHA 2CNBA 4DIOA 4B6QA 1C8KA 2DECA 5AOAA 1PLJA 2RHMA 3DAFA 3I1IA 2HWYA 4MPTA 1R0WA 1WZIA 2NADA 3EH1A 4JT4A 2L42A 4MW7A 4X60A 3PHIA 3IOEA 2A30A 1KWKA 1WW8A 2JKZA 2B8EA 4XB1A 3TRDA 5CGQB 1E1QD 4HDRA 5TY0A 1PT6A 4RIEA 4JFAA 3RRJA 3LBAA 3T34A 3H04A 2D4AA 4LEIA 5T8KA 4XPIB 3WI7A 3RS8A 4A0FA 3CS3A 2G04A 3NBFA 4UAUA 3ZBUA 4N0EA 4QO8A 3RFVA 4DPMA 4PLVA 5KYNA 3EXG2 2Z6AA 3HNRA 3NWEA 1BKDR 2DBZA 3EUAA 5AVJA 3RE1A 4POAA 1C1HA 3MGBA 4HNAA 3Q8KA 4CL2A 5J5VA 2IHNA 1QGED 4HLDA 3PFBA 1JDTA 1L3CA 1YJXA 3GRCA 1IYZA 4M46A 1SKYB 3EEFA 1XMQB 1C14A 3EE6A 1RWNA 4FKMA 2BFPA 4FLFA 2R6JA 4RPKA 1Y7HA 2OWDA 5F1OA 5LP6B 3RHFA 4JB0A 4CCAA 2O2DA 4WHMA 1N77A 3F8WA 1FXWA 4EVIA 4WESB 4E5SA 4E5PA 1FOEB 1GPYA 4B6SA 2XE6A 4FFSA 5G3YA 4ZJYA 1TEHA 1IBRA 4C06A 5DPMA 1J0EA 2YS6A 3HEBA 3P0JA 1M2WA 4RO0A 4RVDA 4EG7A 3W9YA 5F98A 4CM3A 2GR9A 3FCXA 1EFDN 3IIKA 4JJ7A 1G6OA 1CS0A 1CR2A 1JZTA 3O26A 2DU8A 2JIPA 4O4JF 3AR8A 4FS3A 2EWWA 2QRHA 2YVQA 2QROA 3E3LA 3MB8A 1RCUA 3N2LA 3P0RA 4AO7A 1W59A 5KJ6A 5EZSA 2B1IA 1Y4ZA 4LISA 3ZE6A 2EWMA 5BVGB 4YO7A 1YWGO 1GAJA 1OSNA 1JSXA 4RQUA 1DS6A 4U2BA 4TVBA 3PB3A 1E5QA 5FOQA 1ADBA 2JIRA 2RGCA 4IIVA 3Q3VA 1VKHA 3LFHA 4ITUA 2GXUA 4ZEWA 4EGFA 3DLCA 5JZBA 1QG4A 1OREA 4TMFA 2ZZMA 1HKUA 1ZQ9A 4IJMA 1DWUA 1KXJA 1OAOC 1ZYUA 4NZMA 2DPYA 3HYLA 4MAAA 1PR3A 3PCTA 4NFYA 2BGRA 2YCBA 4TV8B 1JEDA 1QYCA 3D6MA 1F20A 4C1BA 4QDKA 2ON6A 4UDXX 3H2GA 3MUNA 3RASA 1ZO8A 1NR5A 1XMSA 4QUGA 1GZHB 2A35A 1NM5A 3VHLB 2HTEA 5EG5A 4RTRA 2JD2A 2PX8A 5F7JA 5TQ0A 1G9TA 1OLUA 4LYJA 2DKNA 1BZYA 4QYSA 2BAGA 5FL7D 1AQ6A 3GZTB 1QQ5A 4NS4A 1CPYA 3ZXUB 3G1WA 2LDBA 5DBHX 2UVDA 3PNYA 1E32A 4J2OA 4N5LA 4TYQA 4ZVKA 4RELA 3UT5B 4UEJA 5EXPA 4Z4HA 4NBTA 4FZ3A 4HDSA 4GMHA 4EQ6A 4YK7A 3ZWQA 1LJUA 2FMUA 2PS1A 3KQSA 2ZI7A 4OUKX 4ENVA 5D2CA 1D8TA 3ASVA 5GJVC 1LC0A 3TR6A 5K01A 3R5SA 4GRAA 4KR2A 1JKJB 3E35A 4B7UA 4PTYA 1S3IA 1JT2A 3O1JC 1QQ7A 1UPBA 1KH3A 2BY4A 1WCV1 3FZEA 5HQTA 1A9ZA 1UL1X 1ZD2P 2YL2A 3EUEA 3GHYA 4QBIA 4ES6A 1FU8A 4C3ZA 4WDQA 4DILA 2AG1A 5DLDA 1FSPA 1ECPA 2DVMA 2V54A 4AECA 3AI2A 3RLIA 1H85A 1TXGA 4Q3NA 1EJBA 4P6VF 3U39A 4A5OA 3ERCA 2HA4A 3ETGA 2V58A 3K3PA 3BD8A 3SWWA 3DQPA 1GYRA 1Q84A 1KIMA 5IAGA 3WNZA 3O0TA 4BZQA 3RJTA 1QUFA 3DWGA 1XT6A 3R09A 1ODKA 5KO2A 1IZYA 3GJ3A 1TA9A 1IRIA 3BA1A 1M54A 1NRWA 1SCBA 2IEBA 2QL6A 3AIMA 2YHSA 2WE8A 4FHCA 3EY9A 1DEOA 2WFLB 2MIIA 4X6YA 3ZOKA 3NUGA 5JSZA 4PBRA 4RA9A 3IAHA 2GBLA 3R4CA 3N8HA 2OLJA 5FI1B 3ROPA 4JR2A 3OOYA 3VTKA 4EBBA 3I52A 3IP7A 1U0SY 1YCHA 3EVGA 4UE6A 3UK2A 3A7DA 3MC1A 2J67A 1KVRA 3GT4A 4HNHA 1KH2A 3CO5A 3H8JA 4ZVRA 3AFOA 2Q4EA 2VBGA 4YLGA 3MMSA 2IDKA 1UXKA 3EVEA 4HFJA 3GP5A 5COBA 4RH3A 2HU5A 2VDRB 1GCUA 3I2JA 5AKHA 3TQIA 2DLCX 4KUHA 2E37A 2OMEA 2DERA 5KU1A 4BGDA 5JANA 1UQTA 1I6KA 4PWYA 1AMUA 2XNKA 1RRGA 2FKAA 1LV7A 4H1VA 3L6CA 1BQ3A 1SXJD 1V3VA 4MGKR 3Q2OA 5HDQA 2CYCA 2HHLA 2JVJA 2I91A 4B0OA 3QBJA 4QDXA 3UKJA 1HRKA 2VJMB 4MV5A 1VYHA 3EGOA 2C98A 4R6XA 4S2EA 3ZD9A 4A8JB 5I7EA 5AKGA 4Q9AA 2HTFA 1KPHA 1GARA 2AH5A 3WGTA 5B7GA 3PHGA 2JLUA 4WSOA 2XYPA 3TTXA 1N5LA 3EBOA 2HZ7A 4KFSA 1K2WA 2G08A 3N2YA 3ZVNA 2IUUA 3DOJA 5ARDA 2CXUA 4DT1B 2WG1A 3HZZA 3EZ9A 4QBKA 4OI1A 1OH6A 1VHJA 1BN6A 1K4YA 1M1ZA 4OHCA 4INPA 1BEZA 1RM4A 3BXHA 3VR2D 2OTCA 4HMQA 2REQA 3NM6B 2R6CA 3FNEA 4Y1EA 1IZ0A 4RF4A 4QTYA 5KDOA 1CTQA 1D7OA 1Z5WA 1G9XA 5EIFA 1V2HE 4U8HA 1I2MA 2NP7A 2NUPA 1QKJA 1TO1E 4F46A 3OE7A 3D7MA 1ZH4A 2YZNA 4QELA 3SDBA 3JWPA 2TMGA 1YBAA 3M1AA 5AKXA 2YQ4A 2MSDB 2XBUA 1RXIA 1JKFA 1SQ5A 1GXSA 2X0IA 3AVQA 4ZIRA 4CR7A 4NMHA 2BGIA 3L7JA 5T7BA 3MLEA 3S5JA 1G8KA 4D3DA 4BPBA 5KX5B 1KS9A 3B12A 4OAPA 1AIPA 3WFJA 5FAKA 5DHPA 5ITWA 2PZFA 2ZPAA 3PXAA 4OREX 3I3OA 2CMKA 1OBVA 4ZQHA 4P4GA 4ER3A 4KGVA 1ZOIA 1KOGA 2RBKA 2QL9A 4GZMA 3BMOA 3TIVA 2CZGA 2RKOA 1KMHB 5KOJB 2Z98A 3V6LA 1RMTA 4F1KA 3IGFA 4Q19A 1P1RA 5K99A 5M29A 2EW8A 2RKWA 5FORA 2AA3A 4BYMA 1I3NA 4V0NA 4EO7A 4A6DA 5K3FB 1X8JA 1GDTA 2B2XA 3HY3A 1DTWB 4W5TA 1G5IA 2AJ8A 3KR0A 1M75A 2OZKA 4QOFA 2EW2A 1ABFA 1OKKD 1XZBA 3DBVO 1IMOA 3TEJA 4U00A 1OJ7A 3TFQA 2OAP1 2Z4TA 3SHWA 2C8JA 5TPZD 3AR2A 3H83A 4ACBA 3DNMA 4ZYVA 1UF9A 1L5VA 3EWIA 4NNOA 1AQIA 2Q41A 3IXLA 4YH1A 5JPIA 3FF1A 4E03A 1FC0A 3AR6A 4ND8B 3K70B 1AGRA 1DG9A 3HJFA 3GGPA 4B3CA 1OE0A 2Q1WA 2QV0A 1P1FA 3I09A 3HFJA 4HQFA 4PTZA 3RYCA 1VE5A 4P3PA 2DQSA 1TZJA 2EGUA 2JFHA 4BQEA 5SY9A 1ISHA 3A4LA 1CHDA 4HLCA 1H65A 4WNIA 6GPBA 2IV3A 3FCEA 3T7KA 2V7EA 2DQYA 2VDKB 4NHEA 4CV2A 4Z7NB 3FAKA 1M8PA 2X3YA 1YKFA 3K4HA 3NEJA 4OGGA 3U19A 5EYPB 3QIVA 3HDQA 2AOTA 5CA1B 1T8SA 3U6BA 3SK0A 2ZXUA 2LDXA 2W2KB 3FYUC 1E79A 3MS7A 5LKAA 2BFWA 2JI4A 2QTZA 4I6JA 4NG5A 3UAOA 2FEAA 3D7KA 1EM6A 4DB4A 1C0PA 5T67A 3WXMA 6Q21A 3DYIA 2FSVA 1MKYA 3HKDA 4L8YA 4CWAA 3IUEA 4J1SA 4YMVA 3H19A 1FFDA 4GS5A 4IWXA 1PK7A 4HB2A 3ACCA 1EIWA 1HE3A 5JC1A 3I4FA 5TQ2B 1HM5A 1D8AA 4B6GA 3QSGA 2K2QB 1L7EA 1U90A 2A1UA 2R96A 3WTBA 5CB4B 5HJEA 3H5LA 1TFUA 1PUJA 1T4GA 2ZRDA 3BHIA 3GDGA 2B78A 1G4AE 2YWCA 3GU3A 1IHDA 4BNVA 5JAUA 2GYYA 5AJUA 1RXVA 3PXBA 2JJ1D 2JFYA 3R1IA 5GWXA 2GJAA 1U2GA 4G2TA 2R1ZA 3VDQA 4BNDA 1CUEA 3RBVA 4JVLA 4C2BA 2XQIA 4C9BA 3AOEA 1R37A 1X39A 4B3MB 1E79D 3EEQA 2FP4A 3M2TA 1W47A 4TS3A 5ALHA 3Q7EA 4CKZA 3FPJA 4DLVA 3JPWA 2IIQA 2MYNA 2O06A 4LHYA 5JQGA 2AOUA 3AY6A 2HZBA 4R3UC 3SYKA 5BN3B 3ZZUA 2FFJA 4D81A 4DRXA 4BKQA 1AO0A 2YC4C 1QCDA 2V1XA 1GGVA 4NSNA 5ANRB 2W2QA 5AW7A 1YZ3A 4N4AA 4XVHA 1QDEA 4IG9A 2XGSA 5FV4A 4PAOA 5HZGA 2XHEA 4DBVO 4A36A 4DQXA 4GGMX 3P9ZA 2CUNA 3L5OA 2H2AA 3AB3A 4AP5A 5B2ZA 2RGYA 4F96A 1RKBA 2EZ9A 1W34A 2WUEA 3HVRA 1JE0A 2F8MA 4AQDA 3IAS1 2F1IA 1IOWA 5FPYA 4G67A 4NHOA 1GL6A 2X7JA 4DCVA 1KI1A 4HMPA 4M37A 5CAEB 4U3JB 1ABEA 1ZRNA 2IYLD 3HDHA 3ZI4A 3RROA 4LAFA 1OFGA 5DSTA 1UDXA 3SMVA 3G1TA 3UAXA 1D0SA 2PUGA 4X44A 1O96A 2Q5OA 4DFDA 3QOWA 4C0QC 2D1SA 5MDHA 2NUTB 2EKPA 2ZIEA 4KLCA 2R6DA 3MZ0A 3VX4A 2NSYA 4E5MA 2WIDA 3SSOA 4Z2YA 2VDOB 2H1FA 1KK1A 4NVRA 3KQWA 4KXNA 2Q7OE 2Q9AA 3DVRX 1E2KA 2EGHA 5GJWC 4BS9A 3K0AB 3N2KB 3W5AA 5GADl 2JZCA 2Y1KA 4Q3BA 5EJMA 4AICA 3NHLA 2QT0A 4IG4A 4TYPA 1S4MA 4M99A 3QQ5A 3P4YA 2CLCX 1Q7TA 1X87A 3GLIB 5H1YA 1JG6A 1RJFA 1ESCA 3TFOA 1TUEA 1M1YB 2AQHA 4FOTA 4QLBA 1WMDA 5BSEA 3VC2A 4RLHA 4EI2A 4LRQA 1CZKA 5FWAA 1WSWA 4LPKA 1M6HA 5K3SA 1PR2A 1CNEA 2GD2A 3SC3A 3H2BA 3TW8B 4RIFA 3ZDZB 3ABZA 2EQAA 1JFLA 4D7AA 1G2OA 1JR2A 3JTEA 1BVUA 4JUDX 1PR1A 3T1HB 4JJIA 5A3JA 5TX7A 2P5YA 1MENA 4LCBA 2VQFB 4IXMA 4RD6A 4UAGA 3U4HA 4QPCA 1TVKA 2HHCA 2YXBA 3NKLA 5GPBA 3U3KA 3NI2A 2OCPA 3LLUA 3SNKA 3CHYA 1DC8A 3SPXA 3HP1A 1U0BB 3FYTA 3IKLA 3QUQA 2VZ8A 3P9NA 1CCWA 1THTA 4TMXA 1LVGA 3A4YA 3EPJA 1N5DA 1L7XA 4IDCA 1CZOA 1HSOA 1WU8A 3AUAA 1P72A 3EGVA 4IUBS 4J16C 5GMOA 3SR3A 4NBKA 4KCGA 1JDVA 1ADGA 1PNQA 4L7VA 2BI7A 2BEUA 3ZLUA 1RXEA 4WK0B 3SF8A 3V8QA 1DX9A 3R3XA 4DDWA 3ZQ6A 4D9GA 3T94A 3H0EA 2EFHB 3BZBA 3AFHA 3HB4X 1X7YB 1YDGA 3DZIA 1PJAA 1CUXA 3R6DA 1FYWA 3PHLA 4ZI5A 2GJKA 4AW9A 2ZJFA 4RTSA 3S7TA 5LQDA 2UYOA 3L0OA 3O8QB 5CNMA 5IKOA 4CMEA 4D3ZA 4CNQA 4RTPA 2PSSA 1MP0A 2OAGA 2CCGA 1ZIXA 4RDHA 1C1DB 2AK3A 2BKEA 4JXKA 5B6IA 2X8WA 4OMCA 3LCRA 1XPRA 2GO7A 5BUZA 4OGWA 3W5BA 1FNNA 3SM9A 2C1EA 2GPNA 2O5RA 4Y6QA 1O0SA 3MW8A 4ZCRA 5FBLB 2JD1A 4F6RB 5CT9A 4L5YA 3QEAZ 3QY9A 1M73E 2EJUA 1IN6A 1Z2DA 4M6WA 3H9QA 3FNBA 2P6PA 3NGXA 1J2YA 3DC2A 4R1PA 1ZBQA 4Q7MB 4B6RA 4BX9A 2OOKA 4CKBB 1BW9B 4YS6A 1P60A 3TF5A 2Z08A 3F4KA 4X8MA 5B3JA 3KT6A 5DLQC 1EUDA 4HDKB 5DULA 3D81A 5K8LA 2IOFK 2IEZA 1X7GA 3B89A 2VTBA 5K4AA 3VDNB 4LHVA 4TTRA 1Q3KA 3NALA 1E0AA 2WB2A 4N0PA 5ICEA 2Q6TA 2V7PA 3KUXA 4KGZA 3FWNA 1TTPB 1N0VC 1XTKA 1BC5A 2H51A 1XAHA 1CQJB 4YP5A 1LEHA 5DM60 4H16A 4UTPA 3TMAA 1USKA 3LCUA 1S2NA 2P75A 3EPHA 2I99A 5HTOA 1FPQA 3QYFA 2P68A 1FZTA 5EE0A 4D9KA 4QRIA 1SUSA 1JLKA 3MLBA 4RIIA 4R2XA 1FB5A 4RAOA 4TVOA 5GZ1A 4RTOA 4MUFA 2ZB8A 2ZIUB 3LQYA 3QH4A 4PCAA 5DN6D 5HQ3B 2VJDA 3O4HA 4ZGBA 3PNLA 2G6TA 4U2FA 4UCXA 1Z0FA 2D00A 1DKOA 3T7EA 1YR2A 8GPBA 4HRVA 4X7BA 1CQPA 4V0LA 4DS3A 1JB1A 3ZZMA 3C8HA 4Y30A 1T6NA 4BV8A 3VAYA 1BWRA 4PZYA 1KEUA 1FSZA 1ZW1A 2OGUA 4J07A 4N8EA 3UWMA 3WGZA 5EIBC 4CCSA 2AOWA 3G5TA 3KXDA 2ZI6A 4MW1A 1QONA 4CTKA 3DS8A 1H2XA 2XWQA 4R81A 1SHUX 4X61A 3VKUA 1IPFA 1FXWF 1HEYA 2C07A 2FN3A 3EOZA 4FKBA 5CEFA 1JDPA 1WULS 4L95C 1V1MA 4EFKA 3FYCA 4YB8A 1Z7EA 3ORSA 1EGMB 2YMQA 1SUBA 1QVAA 2NG1A 2SCUB 4J7UA 4JBWA 1W4ZA 1RP1A 2JGKA 3W5VA 3TVDA 4LG1A 1Z8FA 1BEUB 1L5HB 1P0QA 4LRSB 1IUOA 3FGPA 5HRAA 1CJBA 1VJ5A 4N40A 2OBYA 3PRKE 3F6PA 4MUYA 4NNPA 4U2CA 3WQRA 4LF5B 3N0VA 1PD1A 2WM8A 3AHHA 4LJRA 4REQA 1CJKC 5JXGA 1KBQA 2UKDA 3AK4A 2EP7A 5T4HA 2R79A 1XPOA 3AV0B 5EHZA 2JCSA 4YGYA 1N5MA 4OO3A 2NTVA 1RRKA 2GCOA 1RTTA 4ZEVA 3BIFA 3TLXA 1T4MA 3IR5A 2QJTA 1B8VA 3LL7A 2FP4B 2ID8A 3IQEA 3CLSC 1UDCA 4RA6A 3DLHA 4B3BA 3I2KA 3NWJA 1CK4A 2GAIA 3MT7A 5E2AA 3IDAA 2XITA 3JQ7B 5K0NA 3S0JA 1ZCJA 3ABOB 3FA2A 3MTIA 2Y1WA 3HBLA 2NVUA 3NJ8A 1SUWA 2WJAA 4MB0A 5CLGA 2IIBA 4AY5A 1GZ4A 5JRJA 1NT4A 2FFHA 1NQVA 1ZEJA 2QN6A 2EZ8A 3I2GA 4L2IA 5SYNA 1RPZA 2JD0A 1W76A 1R5BA 3U9SA 4C7MA 3K9WA 4WNAA 3C6XA 2ISSD 1T6XA 5EQJB 1ARZA 1Z63A 1FJHA 3W6OA 3A9UA 5KYWA 2AYXA 1M66A 2ZRBA 4R8LA 1XV5A 5I9SA 1G18A 3SOZA 1GPBA 1Q0PA 1YU6A 2JHFA 3Q6IA 1Z2OX 1G41A 3BERA 2O07A 3OFNA 5T8KC 4JHLA 3CX7A 3WRYA 1S2LA 1KP2A 4TZKA 4CLRA 1K6XA 1T34A 4J9VA 4ZVPA 1SXIA 3F73A 5AQEA 3UWKA 2GPBA 3ZHUA 3R0IA 4WEQA 5FIUA 4FQ7A 4TKZA 4O3FA 5TARA 3VC7A 3I9NA 5A3SA 4BNWA 2GD0A 3THYA 3S2GA 2X8JA 4JBIA 3FRJA 3IUJA 5EE1A 4A2WA 4GSKA 3U3MA 3CEPB 4EG1A 3PEWA 3SYTA 1J2TA 1NC3A 3U16A 1LX6A 1NY6A 3CNOA 2O2JA 1TUBB 2GEJA 4R1SA 3I2YX 3IAEA 2IF0A 5LLSA 1XKLA 1JYSA 3RC2A 4NE2A 4IDEA 3NT5A 2JIQA 4J90A 1MD9A 1SC4A 4BE7B 1F6BA 3RS0A 1TZ2A 3K1AB 2GESA 1F60A 1I1NA 1TIKA 2EIXA 2Y66A 4JA2A 3TB6A 3X3HA 5LZ7A 4YAIA 3OTOB 3L8YA 4GI2A 3T12A 1RABA 3ZZTA 4XLZA 5IBCA 1SVSA 2E4XA 1XZQA 1GNSA 2K6GA 4CLEA 4P8RA 4KN8A 5G0SA 2HQ1A 4HLNA 4TSFD 1UC9A 4HQ6A 1WDWB 1MO4A 3M5WA 1L5FA 4PQFA 5U9CA 1YQQA 2OCLA 3WO0A 4XQ9A 1WXXA 2ORVA 3JQAB 3KL2A 3VMMA 3DTNA 2Z5VA 1KYTA 2I1LA 4WA8A 2NVOA 3E58A 3Q98A 2HMTA 1JEQA 4ATNA 4ZDIA 2JJMA 3ONVA 1R5NA 1EMDA 4PO3X 4P3XA 4CM4A 4OI2A 1UAAA 1WAMA 1TIBA 2C0CA 1GLVA 2QMUA 4KXUA 3SIXA 2IUTA 5BV0A 4DWOA 1AKEA 3KM0A 1YC2A 3IDSA 3DO8A 5F52A 2VAXA 3LSYA 4CKWB 3BBPA 4MKRA 3WB2A 4CG1A 4ZD6A 4O4IF 1ZOOA 1V47A 2B9EA 2CLMB 3QV1A 3W1EA 3WP0A 4P0QB 1J5PA 1Z4MA 3IS3A 1A7KA 4TKVA 4BVBA 4Q18A 3K70C 1BHJA 5U4QA 4RWZA 3E5RA 2CCJA 3GMDA 1AH2A 3H9JA 3CGGA 3GRZA 1W1UA 3W2IA 4FE4A 1PJCA 3COPA 3NLLA 3VSDA 5L6MB 4TKUA 1RFGE 4KXWA 4UCQA 1UXIA 1XDGA 2F3UA 3DW1X 1FXUA 1FSGA 1K63A 2KPOA 2ZIXB 3OX4A 4ALLA 4UM9D 1RRVA 3ESDA 3PSAA 3A4TA 3IL2A 1E2EA 4KKXB 4MI9A 1PJQA 3A1FA 3FRIA 1JSZA 2FOXA 1R6VA 5CCBA 3UAVA 2OV2A 4L3OA 4WKOA 3HYSA 2I2BA 5A3RA 3AKCA 1RQ7A 4R8VA 3WBBA 1YQ9A 4MUAA 3ZZ0A 4CGYA 4QARA 2X1HA 2XVAA 4MMXB 2RC5A 3DPIA 3O38A 1U3GA 1N6IA 4MW0A 5JHHB 4UTNA 3GAFA 1D9ZA 1QR2A 3EZNA 3T1NA 1EQAA 1T5HX 4LSGA 3K09C 2YJ5A 1N5JA 2V7QA 4BFYA 4CPDA 2W4MA 1YACA 2AFHA 2B6HA 2V7WA 4PINA 2CNWD 3L4BC 2XCTB 3KB8A 4LDJA 1OYVA 3HLTA 5KNLA 3DZGA 2HF7A 4O1IA 3NWOA 2DQ4A 1E5XA 4JDUA 2PL9A 1O77A 4YP6A 3W90A 1TYEB 4B2LA 5HJ7A 3EQZA 4Z7QB 2UZAA 1MC4A 2ZP1A 4M9UA 1R4NA 1RRFA 4K6GA 1P2FA 4MA0A 5HEKA 1S6YA 4E09A 5G1OA 1X1RA 4O4JB 4EEZA 2ZUVA 5A6SA 2LBPA 1NF2A 4OAQA 4RVUA 3OESA 1I0ZA 3EG9B 1LK0A 1D4AA 2D13A 4U1RA 1T2CA 4W9MC 4OHPA 5C5DA 1B6SA 1FMFA 3CH4B 3CRVA 3EDOA 1BD4A 3AEKA 1USVA 1WPQA 1H22A 1Z35A 2BT4A 5DP1A 4C6TA 2ENWA 4B9EA 1TMOA 2I6UA 4JUBA 3VYRB 3AI7A 2H65A 2NYVA 3FFWA 1OROA 1T5OA 3K53A 4HGZA 2EKZA 1PCXA 3DBOB 3LOPA 3MXOA 1X9HA 2VPWA 3FFXA 3IDQA 3QMMA 5EIBD 2W90A 1CBUA 1S8AA 1CJVC 3GRPA 1GKIA 5EJ5A 4E5UA 3OBBA 3LNTA 4OQLA 1CQZA 1E4EA 1GQRA 5EWMA 4B80A 3OF5A 3U09A 1GUAA 3GBSA 2F9FA 3DR5A 3ZI0A 4BX3A 1CEQA 3V3TA 4EFDA 2D59A 4KQ6A 1DIRA 5ECWA 2D0OB 3ROGA 3SXJA 4UU0A 4DR2B 2J0QA 3PPIA 2XUOA 1FNBA 1LRKA 3RDPA 3V8EA 1MGPA 3MT0A 4IDFA 5A5EA 1KI2A 3A2KA 1HI9A 3OHPA 1FLDA 5LZ8A 3KXPA 3ORRA 2ZUDA 2RHGB 1EQ2A 1QVZA 4FFOA 3H9GA 3TRHA 3U6KA 2JI9A 4J75A 1TLTA 3H5IA 5ALOA 2FTKE 3GZNB 1ZIPA 1IJFA 3O7MA 3M82A 4HB0A 1L5HA 2NZWA 5K4GA 1F2VA 3MGGA 1FJXA 5J4HA 4KFRA 1RNLA 2XEDA 2V98A 4MSUA 3WWYA 2ZAMA 4BNZA 3FF4A 1DUSA 1PFGA 3B3QA 2WMOB 4REQB 5BWBA 5BWCA 2GM3A 2R60A 1VMKA 1ZRMA 3OZEA 4DYVA 4HEHA 5E6RB 4I7EA 3QSYA 1MIHA 2IUFA 3TNFA 4AJNA 4WZ6A 2D8AA 2I6SA 1UZUA 1UANA 1XTZA 1OLSA 4A0GA 1Q2XA 1V16B 3LUAA 4CU5A 2HHAA 4KVAA 1K1EA 1USWA 4QULA 1Y82A 2Q5JA 5TRTA 2FZCA 1NYTA 3CEMA 4GOJA 5EEGA 3VPHA 3NWPA 4MVJF 4HDCA 4K2AA 1ZU4A 5E4FA 5C8ZA 1MZPA 2VBFA 3Q3IA 1RTKA 2BOVA 4NZ9A 4HN2A 4L5IA 4KPUB 1PJBA 2GXSA 4UZFA 3AL0C 1G19A 1TAUA 3C6MA 1XKXA 3OSUA 3RKRA 2HA5A 4M7RA 3VUEA 2YVLA 3QZUA 4NJMA 2C3MA 1ISPA 1YZGA 2ZLBA 4NYJR 4D97A 1U80A 1I51A 4NABA 5F2EA 1QOZA 3ZIDA 1QZUA 3HL4A 3PPYA 4BFTA 4PGHA 3JVUA 3QIAA 5J2TA 1YDWA 4AXXA 3R44A 4ZO8A 2NPIA 3LH5A 3N0TA 1QOPB 2G0TA 3CR8A 3QPBA 5IHPA 1MX1A 1DXOA 3EWNA 3OP1A 5AVSA 2P27A 1XRQA 3BQMB 3IALA 1IWBB 3IMFA 3FAZA 1PEKE 4L28A 4AP6A 1H6DA 1JUDA 1RU3A 2CFSA 3WNVA 1PJRA 2XMZA 4RNCA 1M83A 3HMKA 3WAGA 1NL3A 1PQWA 1XVIA 2Q3HA 2QZPA 4D98A 1B23P 3UUFA 4IDNA 1ZS9A 5E0OA 4ZI7A 5AHWA 2HV8A 3WK5A 2IPMA 1PFUA 3GELA 1MAVA 1QAQA 1G2QA 3NTVA 1MQ9A 2Z6VA 4HKTA 4HGQA 4IIJB 4NENB 3ZCRA 5FB3A 4F9TA 3AJRA 1A4RA 2IPXA 2YOGA 4BWVA 4UTXA 2BEKA 2ZYAA 1GQ2A 3COJA 1GRQA 1BX1A 4EGJA 1S2DA 1QC5B 4HD8A 1FUYB 3PYLA 3U49A 1X38A 2BFEA 1U6KA 2SNIE 4ND7A 3MPUA 5CPBA 5JBQA 3ELBA 3LOUA 4L08A 4LGCA 2B8TA 5KVCA 2HMAA 2F1HA 3RJZA 1ZZGA 1R4NB 1Q1GA 1H1LA 2V6FA 1GLGA 3OCWA 4IJUA 1YS9A 4CQNA 1P6QA 3AXTA 2AQ8A 4OMFG 2QD5A 4B6OA 1UJ5A 5AK6A 4EY3A 3DR3A 2WZQA 3GJ8A 5IVHA 4V03A 2GBPA 4BEVA 8ABPA 4MW5A 3NVMB 2POQX 1JLLA 3MRSA 3Q6MA 2Z3ZA 3D59A 4JBNA 4QFMA 4UU8A 3ZHTA 2AN3A 4BLPA 2XUIA 2Z2YA 3WSVA 2FEPA 1UDAA 4MVJH 5AHOA 1YB2A 5ALLA 1QQTA 1LWNA 2FWIA 3EVZA 1DAGA 2ZTVA 4CYMA 1AV7A 1ONBA 2CNDA 4MIOA 4XPZA 1UFOA 3PD1A 2GCIA 1TM5E 4LDZA 4YREA 3NVDA 3RS4A 3CWQA 1A9XA 3C3CA 1XZAA 1LTKA 4YCDA 2C9CA 2WKQA 1ZPDA 2VBIA 2C82A 2ZSKA 3AEQA 4D5GA 1G38A 2YNMC 2J07A 4R3WA 3I9MA 1C41A 1FYFA 1KC1A 1E58A 4KVFA 3NRJA 1LW6E 2HMWA 3EXHB 1EVJA 4ZRDA 1SHKA 2UYGA 1UBHS 1LCIA 1ZOSA 2DBRA 4QHSA 4XWAA 3WHPA 2AZ4A 2CL5A 1M5TA 2D3TA 2HA6A 2Y1EA 3RRBA 4E7PA 3SBDA 4F11A 4QUBA 3C8ZA 4URFA 1MC1A 1US8A 3PDCA 1TGYA 3IEUA 4N5MA 4KFCA 1QU3A 5GZ6A 1IPEA 1KOLA 4ZCTA 4CL3A 3M6XA 4R40A 3WJAA 2JA2A 4B7ZA 3SC4A 4DMCA 1HFEL 2R1TB 1Z9BA 5CK4A 4NCAA 1KMNA 4V2IA 4AULA 1S5PA 4CQLA 3UXMA 4EL0A 3HDJA 3K92A 3QELB 5EC8A 1R4MB 4DWJA 1TCCA 2BFMA 3ZK8A 1C9NA 2G28A 4EYKA 2EZUA 2ZQYA 3AEZA 3DCYA 4CDRA 1ZM3A 1ICIA 3W4JA 3I0ZA 1E1MA 3SJCA 5A03A 1P61B 4FBMA 5ALZA 4LV8B 2Y3IA 2QR5A 5DW0A 3L0IB 4DG5A 4DQUA 3KOMA 3QUBA 1VSBA 2GJ4A 4G1BA 4WH0A 2C2YA 1U0NA 3NP9A 1QK4A 5C3UA 1L9XA 1K4KA 4TXHA 2GETA 3LWDA 5AM5A 2NU9A 4MW6A 4CKCA 1VPDA 3TUIC 4YUXA 2FNAA 4WXYB 2YBDA 3KWMA 3CH7A 3HE3A 3MVEA 2Z6UA 4LXUA 1G8FA 1O9BA 4R1NA 3S68A 1QG2A 3FBGA 5AJVB 2XSZD 1CR6A 2AWNA 4LZZA 4ETIA 3QVMA 2G9QA 2YFHA 4ZFNA 2PLWA 1DO0A 1Y8CA 2PKYX 5C35A 1TZBA 5JZOA 2A0FA 2FWNA 2ILVA 2R751 1BE6A 2WD8A 3I23A 4M8KA 4XB2A 3KZKA 3HHEA 3WRXC 5ALJA 4UD2A 4AAYA 2P9GA 3T3MB 3EXAA 2BMVA 1M8FA 3GYGA 3LUPA 1YRYE 4PZCA 2C4MA 1KY5A 2FR8A 4YDRA 5FBQB 5F7OA 1NW3A 3C2QA 5BUCA 3C70A 4R1MA 1A4UA 1T9CA 2O14A 2QG9A 3D2BA 3A6DA 3THXB 2F4VB 5A4DA 1TVCA 3HXPA 3I37X 3RSSA 3K5IA 2W5UA 1NJ1A 4B3DA 3E1SA 2VUSA 4OKSA 4PC1A 5LBIA 3PT9A 2W6IA 4ZVVA 4JL5A 3ZU2A 1CZNA 4YV7A 1JTFA 4GKKB 1J90A 4A2PA 2YJZA 1JQ5A 2B1RA 2CVFA 2IYYA 4ZQCB 3ILXA 3L4EA 4UNSA 3UK6A 1UKYA 1RAGA 3DM9B 3O83A 3CTMA 1Q50A 4YJGA 1P1JA 1WWKA 5ABPA 4BNFA 4Y2JA 2H16A 4L76A 4C43A 2GSDA 1QQ6A 2JHAA 4PAQA 4TMTA 3HXMA 3CRW1 5DTJA 4ILKA 3ZTYA 3B85A 4F4FA 1Y8AA 2OXEA 2D7JA 3OPYI 2JGDB 3LBFA 3ZHVA 2N1MA 5JCXA 2DM6A 3GVCA 5K3EA 1SEVA 2ZTSA 4QQNA 3WL4A 1H66A 1TO2E 4BWGA 3HZRA 3WS7A 3I1YA 1F4VA 3T7IA 2C31A 1O0CA 3UG6A 4AU1A 5IXSA 1XL0A 1KZ1A 1NR1A 3F97A 2BRUA 2HCBA 1C7JA 5KSWB 5DP2A 4HXFB 4PZLA 4FHFA 5LMUB 3B7WA 5IDWA 2ZB7A 4Q6WA 3DD5A 4D92A 1W1WA 1GPJA 1QNFA 1SBCA 2VRWA 2DG2A 3IT3A 1MVOA 4KE6A 2Q6KA 2YRWA 1GNQA 2QTNA 3GBPA 3HL0A 2TYSB 4LQDA 1RRPA 2MR6A 4M1ZA 4M8NE 3RSZA 1PJ2A 2YOFA 3O31A 2BHSA 2LIPA 3K5HA 1FXSA 1KJQA 1XVTA 2C2OA 2AZDA 4GIBA 1YRWA 3AF2A 1VI2A 3CE9A 3DMYA 3FPLA 3JR3A 4LQ4A 2WWTA 2PT9A 3G49A 3SR4A 5EMKA 3ANNA 3AR4A 4JR0A 4PPQA 3E48A 4B75A 2C61A 4URYR 5BN3A 3IQXA 4IBOA 4CZ2A 1B76A 2P6OA 2WVGA 4C6RA 1M2VA 4CMAA 4UOEA 1JHYA 1HYHA 1PBNA 1IVYA 1K08A 1RM0A 4N6OA 4QDZA 3UJCA 4YMLA 5AVVA 5LQRA 1EB9A 3CSUA 3I64A 4ZZIA 3ELWA 1L1EA 1ZP6A 3F6YA 2GVDC 2EBWA 1DTWA 4PQEA 5T4FA 3UT0A 1B26A 2HB6A 2QLFA 4GW3A 4GM0A 2C59A 2W6ID 1NJFA 3V1KA 5B55A 2RGWA 5ALFA 3JX9A 2XEXA 3HCNA 4F3KA 3RGGA 1LI7A 1SZCA 1JL3A 4ZOLA 2CDAA 2D3WA 1GCGA 4JEIA 1A2OA 3KAPA 1QPBA 4M22A 3ROTA 4NE7A 2C3OA 4DLYA 4EKDA 5D01A 5IC6A 1NHGA 2X6TA 3EYWA 9GPBA 1G5TA 4FMCF 3UM9A 2WMNB 1ISGA 1IH8A 1GCIA 2O7RA 4MV0A 4GZ3A 1HSZA 4N0DA 4TKLA 1N4AA 1XX6A 1CR4A 4JYZA 1STOA 3DE3X 4ISBA 2C29D 4YRZA 3QMPA 4KBFA 3OZDA 3ME5A 4FFPA 3VR0A 2MMCA 2JLVA 2VPQA 1JP7A 5KVAA 3OMXA 3A3NA 1KK2A 3HUUA 2NGRA 2ONKA 4EHBA 4MDFA 2GK4A 2AZTA 1JLRA 3KJZA 3LPCA 2F8SA 2VATA 4KJZA 4S2UA 5AW2A 2PRIA 3FPSA 4J0EA 1ZNXA 1YB1A 4IJWA 4L9AA 4QDJA 4ANFA 4LF8B 5FHQA 4QG3A 1C3EA 1XTBA 2O3SA 1CJMA 5E2BA 3F6RA 2PKXA 1UDWA 5JY6A 1GCAA 5HK9A 4XXHA 4DREA 4D26A 2QTVB 1N6NA 2IXEA 2W98A 3BXZA 3RUIA 1OB5A 3MWDA 2P2GA 1BWPA 2FSPA 2HSDA 1OA0A 4NOLA 1NNSA 2FRDA 4L5BA 5K0FA 4ZCPA 5KJCA 2ZM6B 4HDNA 2Q1XA 1IY2A 1CRZA 1NVAA 4XSHA 3A6JA 1Z38A 3ESAA 3HDYA 3EGWA 2NWQA 3BUSA 3STTA 2Y4OA 1R0LA 4EJFA 1HQCA 1R4AA 2IIVA 2AKAB 4O59O 5FNZA 3WLPA 5INTA 3O8DA 2VUHB 3PE3A 2VYND 1NNEA 4BVGA 3IAAA 3H1AA 4YECA 4CV3A 2I1WA 1TQ6A 4BNDB 4DLNA 1PI3A 3FIUA 4MLCA 5IK2A 3RYIA 3E9RA 3FW1A 4NFSA 1L4EA 2JDIA 1JJAA 2C0QA 4HYYA 4Z5XA 1NAIA 3N2GA 3ROMA 3HKEB 3IP9A 5I9MA 2HT1A 4M0DA 4CMHA 3DZ8A 2R87A 4D80A 2BBWA 4YMUA 4AKIA 1CY0A 4M36A 4JZYA 4BLWA 1I2DA 4HQOA 2QG4A 1Z8NA 3GG9A 3PEYA 1D1SA 1OZAA 1D2AA 3KK0A 2PQ6A 4GT1A 5CFOA 2ZI4A 5AVWA 1QRDA 5D6NA 4OX9B 4GEGA 1MB9A 3V1MA 3K8QA 3DL2A 3IPYA 5CA1F 2P5UA 3UAGA 3DV0B 4UNIA 3E9DA 2HMUA 1VLLA 1W96A 3JRNA 4NDZA 1T2UA 2W2XA 5F2OA 4F6CA 1MO5A 5JAQA 4WKBA 3EC2A 4COKA 2X3UA 1C1DA 1UT5A 2N0SA 4RMIA 4ARBA 4GICA 4TPKA 1NXSA 1BHQ1 3V4LA 3WYEA 5KTRA 4L22A 5D1NA 1GGNA 4B74A 1K7XB 4ZO7A 2I6QA 2B92A 5LM3A 1LPPA 5TQJA 1NFQA 1XVLA 2VF4X 4YCCA 3DCNA 3EIEA 3FLBA 4AFNA 5H82A 1HBJA 3S1LA 2FW8A 2C9BA 2ICAA 1PP4A 1SVIA 1KORA 2VC2B 3MILA 2O2CA 2V7XA 4XE5A 1OPRA 2UYQA 5FX2A 3LO5A 3KLPX 1CUFA 1P31A 1F48A 1O5IA 1X2EA 2ZFUA 4M88A 4X7PA 3WBFA 2XOKA 4HN9A 4ZDJA 5KMGA 4MRNA 3UJPA 4X64B 1Y6ZA 5E7MA 4QOEA 3L0BA 4EYEA 2JAQA 1JBKA 1NATA 3LQKA 3IB6A 3M9WA 1A8PA 1E96A 5G1PA 5L3ZA 5T4EA 1A7JA 1W87A 3DULA 4O1MA 3ER9A 2P11A 2BN4A 1O94D 2FF5A 4I50A 4XOIA 3VUFA 3ZWDA 4PTLA 4DVJA 1U1FA 2EL7A 1L7BA 4W8OA 4NTZA 3BILA 4QTZA 3ECCA 1OFUA 3RJMA 1OOEA 4Y0AA 2C9MA 5FFFA 1M6NA 4J0QA 1SCNE 4QU0A 3UWSA 5TDHA 3KUCA 3RBXA 1ZMBA 2FLVA 2VDPB 3UO8B 2B2CA 3VR3D 1QFYA 3B3GA 1OFHA 1U2QA 2WY2D 2RGUA 3L40A 4A6EA 5LOVB 1WW2A 4GHWA 4UUNA 3DUFA 4N76A 1U02A 2O2ZA 3TLGB 1T36A 2XOKD 2CVHA 4W8HA 4YJGB 4BDSA 4NAUA 4X6UA 1CDOA 1PNVA 2BDEA 2GN6A 2QD1A 4H7IA 4U7DA 3HSYA 3B6ZA 4JSTA 1Z25A 1OU4A 2J30A 4C89A 2I54A 1O97D 1X70A 4P81A 2WJGA 3G17A 3NHUA 3RUEA 3VJLA 4EY4A 2PU5A 3O9VA 3Q88A 3UICA 4LYHA 2O0HA 4M76B 1QM5A 2GAAA 3ZCPA 3ISVA 3TR0A 5EJFA 2R62A 2YCLA 1XZIA 3L0ZA 4PLFA 3ZQUA 3NYWA 4FEEA 1U31A 3EXIB 3ULKA 3CCBA 3RTGA 4GR4A 5L3VA 3IMEA 2M2IA 1ZJ5A 1WXFA 1SHTX 2FSHA 1GTG1 2PEZA 2X5KO 4JNKA 3TBHA 4ZZ2A 4MICA 4POOA 4UOZA 4H0CA 4Q7LA 3CCCA 9LDTA 3CX4A 4N6GA 3LUCA 1NBMA 3A6FA 2GDZA 4UHDA 4YJKA 4EVQA 1I14A 1NM5C 2VOJA 1OVGA 3BE5A 5DOZA 1YF3A 1Z36A 4O2BA 2HPHA 3AWDA 3MUEA 5JPDA 1K8ZB 3GB9A 3OZAA 3JQAD 4JT2A 4YJ3F 2IDZA 4CM8B 2O8EA 4CMGA 4RL4A 1Z4KA 1PZGA 2IY7A 4AIIA 2YWGA 3NOXA 4ZJZA 5DCUA 3TXXA 3AESA 4LK3A 3TW6A 2AUMA 1IN5A 4FEYA 4BO1A 1COWA 3E4DA 4P4NA 1M34A 4WI1A 5F1PA 4P0PB 3N5KA 1BWQA 2IL1A 4ZQFA 2CF5A 3CWZA 4WKPA 4BNHA 5B30A 4D46A 3AF1A 5J2UF 1J97A 4L4RA 5AVRA 2H4YA 1SCJA 4LC0A 1RJ9A 4WCFC 4DLRA 1PHPA 2XR1A 1CU1A 1VBKA 1V1RA 1KEPA 4XM0A 4AKEA 1QAMA 3JXEA 4HWTA 3E7FA 4D3YA 3H5TA 1QF9A 3OWXA 4UEKA 1JU4A 1I6MA 3IV7A 5FL3A 2ZREA 4F2DA 4LXHA 1DTEA 4RSGA 1AUOA 3BIWA 4MXDA 4ZT7A 3UMMA 2BR4A 3MF4A 4S24A 3GNSA 4AMBA 4NZOA 4TWJA 4V0QA 1M7BA 1BA3A 5CNKA 2YQZA 1E1RA 2OHGA 1NRJB 4KPFC 3EEIA 1ZGAA 5EP4A 1KJNA 1YASA 3GG2A 5IU6A 1Z37A 3C43A 3JQDA 5DTRA 1U0GA 4CF4A 4AG5A 4JSRA 3IUYA 4CMCA 3DMGA 1QH8A 4D3FA 1GUYA 1LDGA 4AF6A 1X1TA 1ZINA 5FYDA 3GMTA 2XHZA 4MX8A 3ZN2A 5BPHA 1DT5A 4XUEA 3KYDA 5KB3A 2EJVA 4JBLA 4RVNA 2ZROA 2ZRJA 4EIWA 1WOYA 2OUIA 1DUVG 3K0BA 1Q1BA 1I9CA 2R11A 3DDNA 1ZA1A 5CCXA 2B1JA 3EY4A 1GGJA 3FPGA 3G85A 3NM4A 3IE1A 1IN1A 4OATA 2NV0A 5HVNA 3DVSX 3WE7A 3F6BX 3GXOA 4ZYWA 2XSZA 2OKGA 1DCTA 3IELA 3DE0X 2A67A 1GT91 1CZHA 4IJ6A 2NQ2C 4ZXPA 3SJAA 1VLJA 5D87A 5AJTA 3O91A 4DMRA 1QIHA 5KC9A 1G64A 5C32A 1PQYA 3O9MA 1VOTA 3L77A 4HR7A 4OQYA 3TLGA 2XCSB 1FTYA 3N87A 4RV5A 2AVNA 4XYEA 1R88A 3VHQA 3WBKA 4MVJP 1E9RA 1OB2A 2OCXA 4F4DA 1VSTA 3EQ6A 2PZLA 2C7QA 2H1CA 2VO1A 3DJFA 4GKVA 4O8ZA 1AKTA 4BMDA 4Y2XA 3VISA 3K9FC 4I9GA 1G5RA 1OI4A 2GTIA 4PICA 1BSVA 2FW1A 1F2UA 3JVVA 3KTDA 2OVBA 1N6OA 4MUBA 1P2SA 1TADA 1XEAA 2QK4A 3BIJA 1PGPA 2C57A 4A03A 2QX8A 2PZ8A 3DV0A 2QLMA 3U1VA 3E7WA 4WN9B 4GEKA 3DD1A 4G0WA 4DIKA 4JQSA 3AW9A 4QYTA 2CLLB 4AK9A 1QGDA 2JAPA 4XTCS 3UC5A 3S8EA 2E0IA 2JI8A 4HLQB 4PRLA 5A62A 2V4ZA 1YKSA 2HIMA 2NXEA 1RC0A 3K1AA 4P4TA 2YOHA 1GZ3A 1E3WA 1KQPA 4B71A 4CLRB 4RQBA 1L8AA 1JHOA 4PXAA 2PRYA 4Y6OA 3VA7A 1PTJA 1NUAA 3I01A 3X44A 3A3PA 1PTKA 3GL9A 4QNRA 2RGRA 5KEIA 5EHNA 4NV0A 3T61A 1XCGB 1XXHE 2YYZA 3E7XA 3PFIA 3K6RA 2PWBA 4M87A 2C4NA 3I5MA 1PQ4A 1UBRS 1NUQA 1NXPA 1ONOA 2Y4NA 3KFLA 4HNVA 4S1VA 3WDSA 2XQKA 4JOBA 4ZV4A 3F74A 3GGGA 4ZP1A 4NEHB 4PG5A 3VJMA 1EWVA 5IG2A 4IIUA 5DEOA 5AM3A 721PA 1FDTA 1RRMA 1E2BA 2R8PA 4OXQA 1FRFS 2BSQA 3H5WA 2VJLA 4K9QA 2HXYA 4QFCA 2PL5A 4UNQA 5ALGA 1ECBA 1NRXA 4INAA 5D00A 4DADA 7ADHA 2I9KA 4LTDA 3V8PA 1T2AA 2I3BA 4EGAA 3KQUA 4E7OA 1QIFA 4N0QA 4IV0A 5DYGA 3R76A 1V96A 2G1JA 3QFHA 1XYVA 1RE0A 2ECOA 5I47A 3AG5A 4JP1A 2X41A 2VPXA 5DM4A 2XLBA 2X7XA 3BH7A 5CTJA 1LPAB 2WE7A 2DPHA 3DB1A 3EAGA 2ZITA 1E1KA 2HSEA 2IE8A 3IDZA 1XPUA 1MQSA 2IZ1A 1L5GB 1A76A 3U4CA 2JBHA 3RNLA 3JR7A 2F59A 3TLEA 3ZQKA 4M9CA 2MYTA 4WIAA 3L18A 2QUAA 4KAXA 3LXRA 3O5AA 3FCSB 4DA0A 2VQSA 2A2ZA 4PSUA 3C6QA 3G5LA 4HEA1 2C4WA 2A1TR 3N0RA 1GDHA 4XH9B 5E1MA 5IBQA 3K70D 3M34A 2OC9A 2UVPA 4QXRA 3HXKA 1KH1A 1E7WA 3IURA 4NCXA 1E4VA 2A0KA 3A31A 3O4RA 1PR4A 4RPHA 2H8GA 3AKZA 2ZBDA 4H7KA 3TOSA 4Y6RA 5IANA 2QP9X 1I36A 2P9YA 2XBLA 2XMDA 3UKDA 1AQNA 3CRNA 4LIPD 4RM3A 5IKXA 1KJ9A 1N7HA 1R6BX 3DNPA 2Z1DA 2WSLA 1VP9A 4BJ6A 4GNRA 3V6MA 1Z0SA 2BZ1A 5JSYA 4LJSA 3WNQA 4NQZA 2X1MA 1JPUA 3T7CA 4LYYA 7GPBA 4CR6A 1QHSA 1ZDMA 4KB5A 1J8DA 2Q5LA 2QLLA 4X7MA 3LY5A 1V1JA 3HABA 2H48A 2QVLA 4E33A 1KKLA 3OU7A 5JCOC 3PX3A 3TWOA 4FYVA 1E8DA 1MB2A 5ALXA 5BN4B 4W5HA 3SE7A 1YA4A 4FINA 3EG9A 4LTNA 3C3BA 4MQ6A 5ITSA 1EWKA 2O1XA 2QRKA 2ZIWB 1VM6A 3V33A 2XAAA 4CF5A 1SVNA 2A9PA 5A4MS 5C37A 1CB0A 5DXFA 5B57C 1TPZA 3FOFC 3C5VA 4TMKA 3K8YA 5DNWA 2VXBA 5A71A 1JLSA 1LS1A 2F1JA 3O8NA 1QZZA 2ILTA 3AB8A 4JLNA 2H1SA 4FSXA 4F5WA 4LOHA 3BXXA 5JNLA 5FTMA 3DMTC 4P93A 4M1OA 1J22A 1XRRA 3B60A 1U28C 2BEWB 4GKAA 4HNQA 4CBVA 2ZS9A 2P90A 4OHXA 4RSHA 5EJ2A 1RJ9B 3ND5A 5BRAA 2BE9A 2I62A 3T1TA 3A0RB 4XUDA 5C4MA 2FPXA 2BL4A 1L1QA 2QDKA 4V02A 5CXQA 3AR5A 4GZLA 2X8AA 3WYDA 3VSBA 4XIGS 1GPLA 2IQ5A 4MGYR 4RZUA 3NG1A 1UMCB 4UHHA 2CFCA 2E2WA 2HF2A 1D0VA 1LFAA 3ILYA 3KZVA 4X0EA 3WK4A 5KVVA 1L8OA 2E4YA 4ZAYA 3KVRA 3DA8A 5F3WB 1KEEB 3QLVC 2QTBA 7MDHA 2Q2QA 2QPAA 3EZ7A 3Q1LA 3QFTA 4FFBB 2JCVA 1Z28A 3HN7A 5BMVA 3FB4A 3HUTA 2ZRLA 3B82A 3BTVA 3DXXA 3OZCA 1G8GA 4R1UA 4JYCA 5ADWA 2XZOA 1C4XA 1XTJA 5JVDF 3T1YB 3DMNA 3RRYA 4RVHA 5F2NA 4YX9A 2YZKA 4QSMA 3CLUD 4MRRA 3L1KA 5C0OE 1WF3A 1KO7A 3HVIA 4YRQA 1ILEA 5ELXA 1KO8A 1V16A 1TAHA 4GMDA 3R7SA 2FSSA 4XFJA 5AVOA 4MQ5A 5DM1A 1PFKA 2KI5A 5FPSA 1K6MA 1SVLA 3MWJA 3ZGLA 3VAZA 4M0FA 1T3LA 2G8LA 1J7JA 2CUZA 3JAWB 4C0KA 3C8MA 1IONA 3LQ4A 4G4JA 2D6FA 3RYHB 3PGVA 4G97A 5KHAA 5KHLB 4DCJA 3BJRA 1XMVA 3VQTA 1U63A 2WTUA 3QGMA 5JJ5A 1ZI9A 2QU7A 2HBYA 2YJ4A 3L7YA 4KOEC 3IHKA 1J39A 3D3QA 3MMPA 3OZVA 5EUCA 3EDYA 3OHMA 4BGEA 2BRUC 5C7YA 1E1YA 1T8WA 4DNXA 4FEAA 4OLBA 3DWEX 1VZ2A 3OTWA 4CI9A 1UQRA 2Q0HA 2BH2A 3WLKX 1DOZA 4G25A 3G0BA 1EKXA 1OCEA 3ZCSA 4C2UA 4MQFA 4DBLE 4F71A 4EL5A 2JAXA 1RBYA 3NZEA 3TX2A 5TR9A 1G4HA 3LFUA 1RKVA 2DFTA 4PM4A 2JVKA 5EWLB 3L6RA 1TF7A 4RTQA 1XZLA 2XXAB 4JL6A 3D5QA 4YQEA 3OT4A 4F56A 2W6NA 4DV6B 1R0YA 1XAGA 2JJYA 5DGDA 4C88A 1T8TA 3AL2A 3N8KA 4G8JA 1GZ7A 2XWSA 3UKOA 2Y05A 1U6IA 3OKCA 1C4OA 3ZVRA 1I10A 4XRGA 4OXYA 2OL4A 4IIJA 4NENA 4Y3UA 4AO6A 5HM6A 4FEGA 2P1RA 3EZ2A 2D0PB 2FCRA 3DOHA 4CT0A 4Z53A 3BHMA 5M34A 1E92A 4UBKA 3BJMA 1TTTA 3CLSD 3GFTA 2PPVA 1VHTA 4L5JA 3ZE2B 5FLYA 3FB1A 4HB3A 5FUXA 4HBZA 3TJMA 3C98A 4YJFA 2DCUA 4Q4AB 2OV4A 2Q4TA 3CU5A 4NCIA 5KVQA 1H8HA 3NKVA 2VRCD 2WM9B 2GN2A 1BMQA 3A1UA 3K1YA 1OVMA 1HNWB 4QU8A 2J3QA 2ZT7A 3PUJA 4GQAA 4MPJA 4ZAVA 5EOVA 2XTMA 1UPCA 1WA5A 4O63O 3O8RA 3U17A 1FFHA 1L5LA 2HRDA 5AKJA 1LF0A 1DG3A 2APJA 3P2KA 5BN5B 3RC7A 4AT1A 4BMYA 2D1RA 3L9XA 3OM9A 5SYMA 4MUXA 2Q3DA 1TYAE 1WB4A 3RABA 3SC2A 1G21B 4PSAA 4NDNE 4YCJA 3DZJA 1W5FA 2G76A 1XG5A 2WT9A 4PX5A 3GLRA 4IIEA 4WLEA 3TN7A 2R6R1 2OHOA 4EJSA 2ZEJA 4R7ZA 4UQLA 1CFJA 3D3NA 4YCLA 1O5OA 1XA0A 3M1LA 4L5AA 4AQ7A 2HYDA 1RP7A 3A58B 3BH0A 4RD3A 4Q9IA 4JJZA 1V7QA 4AMUA 1QNLA 3KOUA 2HJGA 1IE3A 2AT1A 1Y9DA 2BV3A 4IVQA 2OYRA 4Z0HO 3P9KA 1IC6A 2MOKA 1ZUWA 2RH9B 2WWVD 1M10A 4BVEA 1U8XX 3S55A 2GQ0A 3SLGA 2YJ3A 4NV3A 5J3JA 1DXYA 1OAAA 3AVOA 4MUKA 5ECDA 2P67A 5E9JA 4BVFA 1O89A 2WUVA 5BW4A 3C5CA 1P0CA 5H8WA 4GLLA 2FN7A 3CW9A 3HJAA 3IR7A 3KT3A 3VZSA 4W5RA 5F35A 4Q3OA 1D5WA 3W6PA 3A2MA 2DUNA 1MW8X 2ZAYA 5DK6A 3FM9A 2GSWA 3GRRA 2GEUA 4KVGA 2ACVA 1IBCA 2VAMA 1TYBE 4LKRA 5IMSA 1VMEA 1UFVA 4KIJA 4OBWA 2J7PA 1PT9A 2UVPB 2XZTA 1ILWA 1OXSC 2ZRKA 1GAEO 4GP9A 4KACA 4PYLA 3WSWA 2CNWA 4NH0A 1QYVA 1QH1B 1J8VA 2F2TA 2GO1A 3ETHA 3OZSA 3ZW9A 2CHGA 3DMRA 4KQKA 1HNXB 4R84A 4MKXA 4FFMA 1KDOA 1AGPA 2MHCA 1PT7A 1OX6A 3D4LA 4H60A 4PEVA 4UXHA 1IRXA 3CRQA 2BSXA 3L1HA 3L7NA 4LZOA 1QQAA 1MJ5A 1QQBA 3C6KA 4V1CB 1YQUA 5I7WA 3OPVA 1HKHA 1KWGA 2J6HA 2RHJA 2I8LA 3UEOA 2IP2A 2ZANA 4UJ5A 4A82A 4JI2B 3MRXA 4M55A 5JXJA 2QW8A 3L8ZA 1UPFA 4IW3B 1Z4JA 2VAPA 3R5FA 3RT9A 4G85A 4DLSA 4TV9F 2BFBA 1IN7A 4ALKA 2C1ZA 1R9MA 2ZTMA 2ZXFA 3A25A 4LY9A 2L2QA 3OKAA 5LP6C 4D79A 1L5KA 4YRSA 3HV0A 5C52B 2C5LA 2C2ZA 2QRZA 3TKLA 5TVKA 1GG2A 1VYVA 3WRYC 5K8CA 4XCQA 4EP1A 5DNYB 5DE3A 1M6YA 1UINA 2JFXA 2B1GA 4Y67A 5HFJA 2H7VA 4A1OA 4EI9A 5I3ZA 2CC2A 4JGBA 4II3A 1SA0A 3OTHA 3UW3A 1GGFA 1Z3IX 3KJEA 3GUCA 1W48A 4FJ0A 3S2UA 3I2IA 1EE9A 3B1YA 3FMOB 4W6QA 3ZHSA 1RC8A 4Q1AA 2HWWA 2P2DA 3KKNA 4EKEA 4N18A 1FTSA 3W0LB 3SBOA 4K87A 3T0IA 1TEZA 1E62A 1ZCFA 1TL7C 4BFCA 3U3RA 4JB8A 1GQOA 3H2ZA 2VP9A 4FZJA 3ZHRA 5BN1A 2XADA 3FMPB 1E20A 5AVZA 5DIFA 3HR4A 4FLMA 1I4WA 4U9IS 5F12A 4YRIA 4UNPA 1HG1A 1MO6A 1Z7WA 3DUWA 1VJDA 4D45A 2OORA 1T0IA 4BO0A 2ODTX 4EJ0A 4O3MA 2YIDA 2X42A 4JLJA 1FJGB 5CVTA 2E1RA 4MDHA 4CQJA 3VNBA 2V96A 2CHQA 4G0OA 1NLZA 3I4CA 3W5UA 4MI6A 2G7MC 2FPIB 2BGNA 2Q27A 3DEZA 2D8MA 3AJ8A 3L0PA 5EMNA 4D6YA 2LR0A 5DT2A 3O8QA 4EGSA 5KYYA 5BWOA 2DPGA 3CW2A 1E0DA 4P08A 1E5LA 2QTAA 4LVNA 4P35A 3GF4A 4AKSA 1JJ7A 3JS5A 2QJOA 1ISSA 1TM7E 3TW4A 1MF7A 2I65A 5CT6A 1LGYA 2Q49A 4N0MA 3SR0A 4QQ8A 3VC1A 4MWTA 5DISB 3ZD6A 2JLYA 1O4VA 4XGRA 1Y1LA 1P2GA 1N7GA 3HCAA 3QVGA 5KKAA 3ROKA 3TRJA 4MO2A 5HNKA 1NQWA 1GZ6A 3W1WA 2PUEA 3R5JA 3OQIB 1JQBA 2Q21A 1YVUA 4QYWA 5DDIP 3RYFA 3KQNA 2XH8A 2I3GA 3KXKA 1E6WA 8ATCA 4DR3B 3GK3A 1XN4A 1CRWG 1UWVA 4DLXA 5NULA 2VR1A 2O8BB 1MAHA 4YDHB 4YAGA 4MI1A 4RH0A 3L8MA 4I08A 5FR2A 3M81A 1I4OA 1M0SA 2V1UA 1M2VB 2BKLA 4GE3A 3OZFA 1LPSA 1YFJA 5HFNA 3KJGA 4PO1A 4E2XA 3WK9A 3EGDA 4UKDA 1AQJA 2NZYA 1TUIA 1QJCA 4KE8A 2VJBA 3PQ2A 5E3JA 4M9SA 3BE8A 1KVUA 1PW7A 5E95A 4UUPA 5HBGA 1JKIA 3WMXA 4DUGD 2REOA 3IEXA 3GJRA 4LS3A 2Y1OA 3AZQA 2BISA 4BQOA 4WWHA 2LW7A 4GZ6A 1RKXA 1F51E 4RHYA 3GEPA 4KK3A 3T5DA 4LOKA 5COAA 1EUZA 3C7TA 2CXXA 1TYDE 2RK4A 3FUWA 4REOA 1U9CA 4R2WA 5KX5A 1BIFA 2WI8A 3BXGA 1MORA 2C04A 2FDRA 3QPVA 5K20A 4ZCQA 4GDFA 3ZGYA 1L4YA 4IV5A 2J8ZA 2VN8A 3QITA 2V6BA 2EG5A 3BX1A 4QBTA 2UU9B 3LV8A 3WKAA 3BMOB 3GFVA 3AW8A 3W4KA 4B1FA 3O2SB 1E3SA 2X4IA 4B84A 4JJ6A 4YJ3A 1Y4SA 2NSLA 2RK6A 4IHAA 4IILA 5F77A 5FV7A 1W85A 1ZJYA 1YNSA 1HV8A 3HWRA 2JGEA 4L8FA 2Q5QA 4HXYA 4YV0A 1M34E 1AF4A 5TMPA 2FN9A 5L4LA 3W5DA 1U0JA 4I4TA 1G8JA 2AI3A 4JQOA 3PIRA 3U5ZB 1NBOA 3EK2A 5KI6A 3UK7A 3KLNA 2GNOA 1H2WA 2JCGA 3AF5A 3I6MA 1ISFA 2IH2A 3UJ7A 2V03A 4TLDA 3P4XA 4OA8A 3F2VA 1GG9A 4HNUA 3MD0A 1YB5A 3BCSA 4CGZA 2ECFA 2AG0A 4ZOBA 1LSSA 3MGCA 3NHWA 2ORED 2XQGA 2HUPA 4LJ9A 1PU2A 2WM2A 1G17A 3HCOA 3SEZA 2NZ2A 3I9FA 3DP7A 1D03A 5LUBA 2FW0A 1XHLA 2GASA 3BKXA 3AR9A 3BCRA 3NATA 4EJSB 5KS2A 2I0FA 4Y6GB 3EGIA 4OOFA 1H1TA 2GDJA 1FMTA 1DNPA 3PYXA 3TL3A 4NULA 5IAEA 2J3MA 3C3WA 4KR0A 3ZDAA 3AXSA 3QPAA 5THXA 4HWKA 4FJ2A 1A4XA 2WTAA 3HVHA 4TM8A 4DNFA 4CKEB 3PICA 3Q7PA 3GC6A 2OO5C 2IF2A 4Q4DA 2LGJA 1U7OA 4F5ZA 5FBHA 1TKBA 2ZM5A 5JYBA 3WL6A 2C5AA 1KR2A 3L05A 1E9VA 4RD0A 2QMQA 3PTAA 3KOZA 5D3KA 1WKVA 3EA4A 3W1VA 3BA6A 1R9NA 5KKCA 1N2HA 1DO2A 3DUFB 3GH3A 4P7KA 2LCIA 5DNEA 2Q3FA 2HFJA 1U9IC 3OC6A 3TLZA 4EVSA 5KYWB 1QLJA 4FGSA 1Z3CA 4LY3A 1EP1B 4FM9A 2IC5A 3NBXX 2FF7A 3R5KA 2ZK7A 2VYNA 3TEMA 4PAMA 1TQ4A 1TEXA 4IL5A 5FF9A 1W36B 1B2RA 1CY1A 4ND3A 4BAUA 5KQGA 1M33A 3BVPA 5TC4A 3B8EA 4YCMA 4M9QA 2CBZA 4ZTZB 3UGQA 1XZMA 1ST3A 2QB5A 3L6UA 3DZDA 4G84A 2CE2X 3FJ1A 2PFKA 5JR3A 1U3TA 3EW7A 1Q0ZA 4QODA 5AK3A 5T64A 3CSDA 4ZALA 1OUMA 2H5LA 3T9CA 2IOFA 1XQ6A 4ENUA 1Q1ZA 3CISA 3GA0A 3JZAA 3L82B 4YPFA 3S2FA 4K88A 2RI6A 4V38A 3GA5A 4GOLD 4X1IA 5KMGB 3DDHA 4KWTA 3I2FA 2YV3A 2JBAA 1K5HA 4PSCA 4EG5A 1YA6A 2Q3BA 3K72B 5K3FA 2Q4BA 3M6WA 3R8CA 1ECLA 4ZPXA 1EJ0A 2LCFA 4KRFA 1VI6A 4CEIA 4L8GA 4PIVA 1T2EA 1X94A 3HZHA 4E4YA 1YFKA 3BRQA 3CZRA 3TI7A 4EJ2A 4C5BA 3GLFA 1VHLA 2A0UA 4V0OA 2O59A 2I4LA 2GKSA 3ZY6A 1ENPA 3K0KA 2ODAA 2VWHA 1Y8QB 4BJ5A 3OQOA 2IX3A 4WY8A 4IH1A 4BDTA 4OXIA 4BP9A 1QHYA 4BQPA 1WNTA 4F4HA 1QG6A 1I0LA 4P83A 2HT6A 1KFEB 1UP4A 3IA2A 4H08A 1NXVA 3KHSA 4Q16A 4JP8A 4M8IA 1II0A 1OLOA 1L5ZA 1O94C 3GP3A 2XLCA 1PEDA 3ITNA 1EVLA 1GSAA 4BJHB 3L92A 1EUCA 2PX0A 1A9QA 2Z4RA 5K51A 1QYWA 4DUYB 1B15A 2CDCA 4YYZA 3KWJA 4AUNA 5B4TA 3FWHA 3QBDA 4UVEA 1IK4A 4HQRA 1RBMA 2BKXA 1YQTA 3QW2A 3CUVA 4JJ4A 1XJCA 3OECA 4KO8A 1RKUA 2GGSA 5AVQA 3IULA 1O8CA 5CVUA 4YN3A 5ULLA 4C03A 4KQCA 4NC9A 3X1MA 4YBRA 1FQJA 4IMJB 4J9UE 1SC6A 2DLNA 1PAUA 4B09A 3EQ2A 4EH1A 1JIXA 1W5TA 3L41A 4AJPA 3HY4A 4JS0A 2Z2IA 1BO6A 3UB2A 5G4KA 1ZXLA 4BO2A 3BHJA 1M2OB 2E4WA 4R4JA 4EMBA 5ES4B 3GGOA 2J6IA 2BIFA 3PS9A 4C0SA 4R8SA 4WNYA 5L6LB 1E2DA 3KP1A 1NU8A 1X0VA 4CFSA 2TMKA 3G2KA 3IKJA 3QVVA 4O6VA 5AM4A 3FX2A 4AYTA 4E5VA 1VLVA 2HWKA 4DQDA 1P0FA 4O02B 5EPOA 3GRFA 2FKNA 1GTMA 2H1RA 2PXCA 4ZMRA 5LWHA 1LTHR 3H8SA 1W44A 3E9ZA 4UHCA 1R00A 5D6OA 5HZHA 1V48A 2C58A 3RTAA 1XXHA 5CM9C 5BV1A 1AKMA 2HA0A 1L1FA 2IGBA 1NP3A 3BCHA 5AK5A 1GSIA 1XTUA 4TRMA 2Q2WA 3DKKA 3E4CA 3Q41A 4KQ1A 4NBNA 4RTKA 2PGAA 3BXEA 4FFRA 3E1KA 1UKAA 3AESB 2GBIA 5E4JA 4CMIA 4B3SB 3EMVA 5JSUA 1P1KA 1YZVA 3HCEA 1KAMA 2GRUA 1BDMA 2QUZA 1O58A 4FB4A 3HUDA 5IJWA 1JQAA 4IH9A 1OBOA 4LBWA 5JFTA 1OZ0A 4MYCA 1L5OA 5T6BA 1QGZA 1KAEA 2WSMA 4YMTA 1C7EA 1CRQA 2JG3A 3PTZA 1VE9A 2Y1FA 4PG4A 2DQZA 1W9MA 1SH7A 1TTQB 5CA0B 3P96A 1BNCA 1VJCA 2W2MA 4R51A 2VDWA 1XLWA 3RSQA 2UXDB 2I4MA 5AM1A 4B2PA 1R18A 3RVLA 1YIAA 4YRDA 2RAVA 4LZJA 2LWIA 2XCLA 3NP7A 4E1BA 4WJLA 1VXRA 3U7JA 3Q9NA 4TLMB 4ARSA 5BVHA 1F4LA 3OO1A 4HUTA 3FJYA 3FGOA 4HH3C 4IO0A 3SZMA