5CLHA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
APVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
total genus 53
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5clhA00
2FWAA 2FW8A 3ORSA 3OOWA 3RGGA 4ZMBA 4ZJYA 1U11A 5BORA 2NSHA 4YCCA 3OPQA 2NSLA 1D7AA 4ZC8A 4Z7JA 4JA0A 2FW9A 2NSJA 3RG8A 5CLFA 4YCBA 5CLGA 2FW1A 4AY3A 4GRDA 5CLHA 1XMPA 2FW7A 2FW6A 3LP6A 5BOSB 5CLIA 3TRHA 2YWXA 4AY4A 5CLJA 2FWBA 2FWIA 2FWJA 4YCJA 2H31A 5BOSA 2ATEA 2FWPA 4YCDA 4B4KA 5C5DA 5CVTA 5CTJA 4ZK2A 3KUUA 1O4VA 1QCZA
chains in the Genus database with same CATH superfamily
2E89A 2F6RA 3TPCA 1R88A 4WXRA 2H0QA 3OJFA 3RVDA 2CHFA 5JJLA 1ZMBA 5BWCA 3UGTA 3BIJA 4G0PA 1CUYA 1EXWA 3MCTA 3QQPA 3L02A 1TZBA 4HCJA 4XWYA 2VJNA 2IH5A 1NBIA 3H5OA 3N59A 3ROMA 1V8OA 3P4UA 5I7RA 2ODPA 5F51A 3BCSA 1B6TA 3RVKA 2H1OA 4HNHA 3X1JA 4Q4JB 5AW0A 4WBXC 1QHGA 2ZRAA 4H27A 5KYYB 4B4KA 1T2FA 2PFKA 2P75A 1QGAA 4H7DA 2PZJA 1UBRS 2ZIZA 1A96A 4W99A 4OMDA 1B8PA 5IANA 1N2SA 2C92A 3KPYA 4N54A 5LUBA 3WMXA 1X7XA 2ZRLA 2DFLA 3E9QA 4YCSA 3HXOA 1MR3F 5CB8A 3PDIB 3OTHA 1HEYA 4P92A 4B4OA 2OLEA 2P79A 2J9XB 1QF7A 1CUJA 2BP7A 2PXXA 3WLQA 2AFHA 3UJ9A 3MOSA 5E6UA 1WMAA 4ZT4A 4ENVA 3QKIA 3WLKX 3F73A 2MU1A 2OQVA 1SU7A 3D3WA 5C8YF 2IEYA 2BMFA 3C87A 1LK0A 4K0RA 4J8PA 4OKSA 1JMVA 2ALJA 3LQFA 2ZUWA 4M87A 4DLTA 2EBFX 1P4RA 1G6OA 5LNK6 4QPPA 4ESOA 1SOVA 4RGYA 3SM3A 5JISA 3KR1A 3AKCA 3BIOA 3W6OA 2DWCA 4I50F 4QYMA 3T7IA 3TEFA 2Q4RA 3C6KA 3ENZA 1KMHA 4XWTA 5K03A 4W5RA 2CXXA 1JA1A 2PM8A 4A73A 3OQMA 1BN6A 1KI2A 3V55A 1SXJC 2R60A 1J39A 3WFZA 2WWYA 1JLKA 4JMLA 2V5UA 3OHPA 3TDNA 1H6DA 3C8MA 3W5UA 2E4ZA 1SXQA 1RWXA 4Q03A 3D4IA 1DHTA 4X85A 3A7EA 1PUJA 1SA0B 4ZVUA 4GH5A 4O8CA 1ONOA 1CD5A 3VPCA 3SXPA 2O19A 4F60A 5E95A 1WBBA 1E96A 2ZIXB 1N4AA 4LCEA 3JQBC 1XRNA 2JIBA 5LFAA 4FOSA 2I34A 2VA8A 3EQ2A 1D7OA 1ST2A 4FT4A 4TSFA 3EZFA 2VF2A 5HZGA 1VJCA 1GDDA 4WHMA 5JY6A 3T54A 4M8LA 1G55A 2V9ZA 2CV2A 4ZV4A 1EUYA 1YQEA 5AM3A 1ZDMA 4N6NA 2ONCA 2CXHA 3TUIC 3Q7QA 1YB6A 4H60A 3Q9LA 1DUSA 4Y2RA 4AMYA 2XVMA 1JT2A 2X42A 2ZB8A 3O9MA 4YXWA 4RTOA 4NOLA 5K3CA 1OIWA 2F3PA 1YR2A 2ENWA 4BC1A 1JR6A 4PG6A 4X41A 2R751 2AJ8A 4IJKA 3EXEA 5CLHA 3NJ4A 1C3VA 3A6GA 3CZPA 1H5QA 1A9QA 2D5IA 2H2HA 3JD2A 3LNCA 1JR2A 2RHHA 3QEKA 5CURA 3FAKA 1W5SA 5GIPE 1GPKA 2GCGA 3ET5A 3GDGA 3HCEA 4RHEA 2FMUA 1MVNA 2CE7A 1L5RA 1NI4B 4GP6A 2JJ8A 1TL7C 4RD6A 3SX0A 3TE7A 2VDKB 4DY6A 1M1ZA 4KDEA 4BO9A 4EHDA 3D8SA 4MUAA 2HA3A 3OZWA 1DOZA 5ALNA 3R7BA 2VHVA 2ZBUA 1DBVO 5JAOA 5THKA 3DFFA 4NMXB 5CGZA 5KB3A 1VBMA 4NBKA 2DT5A 1M73E 5ULLA 2BDTA 1WU8A 4XJSA 1M8FA 3T9CA 2AI3A 2XT0A 3VR4H 3MJTA 2C7PA 3L0BA 3SJ7A 3ZZTA 4CLRB 1NIPA 5DSXA 3FPGA 1KVUA 4ZCRA 1Y8RB 4M1YA 3CKYA 4G5RA 4R3WA 1OBHA 1XRMA 2EBWA 3BTSA 4OU5A 1K7EB 2Z9CA 3MYYA 2O2GA 1OPXA 3AHEA 3H6KA 4ZVRA 4TXLA 2F48A 1KU6A 2GPAA 4FBMA 4LTDA 3NEPX 3TZCA 5EHXA 2X3FA 1L7OA 2C03A 4CE6A 1U63A 3P2OA 4DDUA 3OOJA 3I6ZA 4D4LA 1G9TA 4G1UC 3RD5A 2V54A 4ZEVA 5D2CA 1RXVA 4D3XA 4BY9E 4IO0A 2PUGA 1DJMA 3EDMA 2JGKA 3A1VA 1ISFA 3P0JA 4IH9A 3T1YB 2W98A 3AF2A 2G5GX 1H9CA 2Q4DA 1DPGA 2FKNA 5EKTA 4WVLA 3KSBC 4RTQA 5JPDA 5FI3A 1RVDA 4L0DA 4FFBB 1OXVA 4XJXA 3JQCA 5A4FS 5C5DA 2C9BA 2IYYA 4XGQA 1N36B 5GONF 3S2SA 1T6NA 3WB0A 1DRUA 1L5MA 1L3IA 3DZKA 3O1IC 2NUAA 5TMDA 3VUFA 2OBBA 4DM3A 5MDHA 3LCUA 1YOVA 3C5HA 2D0PB 3A1UA 3SC3A 1BG6A 4IKOA 1G1MA 3I4FA 2IIPA 3LHIA 3OZ7A 5GV8A 4COOA 3P9CA 1KYWA 3PLNA 4RHFA 4DILA 3C6ZA 1R0LA 3QEJA 1Y3IA 2AT1A 2ID9A 3NC4A 2IZZA 3Q0TA 5FNVA 3C3CA 3RSQA 3BXGA 3CN9A 4M37A 1TOAA 4WLNA 2P2DA 3AIKA 1PV4A 1I94B 2G8LA 1SZCA 3QYJA 1PZNA 5ER6A 3L4JA 4C7MA 4RK4A 1X1AA 1XU7A 3K3PA 3N2GA 4FONA 821PA 2AOVA 4DR5B 4PYRA 1MOQA 2GDZA 2W6OA 2ZKLA 1V1JA 4EY3A 1AKYA 4ZOCA 4C0JA 3ZU2A 2OZLB 1VE1A 4MITA 2DWPA 3B9PA 4MYRA 2JH8A 5FPSA 3N8KA 1JEOA 3ELUA 3RU3A 1AB5A 1INLA 2JLBA 1FP4A 2PZEA 3GCDA 3UB2A 3V8PA 3FA2A 1Z28A 2XNCA 2R0QC 4MWCA 4JI2B 2OC4A 5ARCA 3DLTA 3L7AA 2W2KB 4W1QA 1OTHA 5JEEA 1F2UA 1JKIA 2RJ3A 3U26A 1VKHA 4L8GA 3ZJ4A 4QEDA 1Y3BE 1PVDA 1J56A 4UEWA 5AW3A 3NB0A 2NTJA 3OA2A 1RXUA 1ADBA 2W43A 2FN7A 4I81A 1U7OA 4IIJF 2JHGA 4A8JB 3WZ2A 4QU5A 1BRMA 1OZGA 2H92A 1BXZA 1UMCB 2R8XA 4YDRA 1E9EA 5LLSA 5T57A 4AG6A 4QM7A 3BKWA 4NYJR 1SHJA 1E61A 3W34A 3AHDA 1NXQA 4QXPA 2PX8A 4ZO8A 3WYEA 1KGDA 1U0JA 1G9SA 3ICEA 5EVJA 4B6GA 2IEGA 2I54A 3TRIA 3I9OA 5JCJA 1HE8B 4LXIA 2HT1A 4G97A 3DL2A 4EI2A 2X6QA 2H1SA 2UVQA 1ZQ9A 1JHXA 1U7PA 3PTAA 2QTVB 4Z4IA 3CW2A 3DO6A 1ORRA 4DDHA 2DEUA 1YDMA 5T5QA 1A50B 4OUDB 3R7AA 2OVBA 2AXEA 3A4TA 3FNQA 3IDOA 1LLFA 3PUHA 4JOSA 4K9KA 3BMOB 3NTLA 4C3VA 3GPIA 3PHLA 2VTKA 3I30X 4KJXA 2CXUA 4RVDA 2O23A 3P0RA 1OZHA 1FSSA 1P9WA 1NMSA 2GEVA 5ALQA 1J33A 3BHMA 4D4HA 1VCIA 1XTRA 4DV0B 2WU4A 3G0HA 4CM4B 4MI9A 2CD9A 4E21A 3QX8A 5KIAA 5C3UA 5L6MB 1Z6AA 1YRWA 3AINA 1CV2A 4V1CA 5F21A 4KQEA 4NK4A 1ARZA 1QZXA 1WWKA 2VDJA 1RZRD 1FZTA 1W4CA 3J7TA 1WCXA 5A9SB 4FYIA 4NKRA 1ZNYA 3RS0A 4JI7B 3MGKA 2EG5A 2E5LB 1PL8A 2W9XA 3O94A 5EWMB 4Y2UA 4B84A 1YBVA 3O4IA 3GN1A 5CXXA 4C07A 3B6KA 1XMPA 1K1EA 4MV6A 4D8VA 1E1YA 1QS0A 3TS1A 4DS3A 4BO5A 2ADMA 1QVWA 4MQBA 4Q1DA 3TCKA 3I2GA 3P2YA 3KETA 1J42A 4D9EA 1P1RA 2B5WA 2HYIC 1V3QE 3HB7A 5DI3B 4B46A 1X1DA 5F77A 3BTVA 2Z6VA 4J91A 3IQGX 3MWJA 1CR0A 2A9PA 2FMIA 4HUQB 4WN9A 1PF7E 3TECE 2GYYA 3MWKA 3PGA1 1T8PA 3Q2IA 1CPYA 4HDRA 4PM4A 2C2WA 3UT6A 3UBTA 2VEDA 5KQLA 1PBNA 2R4QA 3TEMA 1X15A 2PLNA 2B8WA 3SR4A 1ILWA 4E07A 4V03A 4AMUA 3AR9A 5BW4A 1OXTA 2WM2A 4QPCA 4OFWA 4N9QA 1OROA 1O1YA 4GM4A 5DXJA 5IYZF 5IC6A 3WGGA 4DR4B 3ML1A 3UF0A 1TTTA 3RB8A 4L9SA 1MXFA 1OB2A 1XF9A 1V39A 2P91A 4GEGA 4KQFA 3ZYCA 1GG2A 2B9VA 1K86A 4JI4B 3N58A 2OCAA 3AGPA 4DJFC 2P0AA 2IYXA 4LF8B 2AOTB 2IE8A 4WEOA 3W77A 5K0BA 1PJRA 2QIOA 2W6ID 1X74A 3I45A 1P19A 4BTVA 2OBNA 2XRMA 3ENVA 1Z26A 3LIPA 4WXHA 3LTNC 1I0ZA 4V1CI 1T8TA 4Q9HA 1YQXA 1XJCA 2DH5A 2XBLA 4IEIA 3D0RA 1L7RA 2ZAMA 4KG7A 3OM9A 1OBOA 5K01A 4TV8A 4CMGA 1EFVA 2BR5A 4ZIRB 3F3YA 2C59A 2G82A 2Q8PA 2WJPA 2NU6A 5AVKA 3S5UA 1XMVA 2EGGA 3M6UA 3GLFE 2WIAA 3TM4A 1IB0A 1QCZA 4EMSA 3LI2A 4IGIA 4IXTA 3L49A 5ECWA 3PC7A 1T43A 3LFTA 3MOGA 3VHQA 1GLNA 3ZV7A 1U7WA 2BFCA 4M2LA 2GESA 3UA4A 1RRKA 5KSZA 4N7MA 4PQRA 3WBJA 4CDMA 3DLHA 3ZDXB 3O7WA 4PLYA 3HC7A 3U1TA 4NBSA 3V8BA 3F3MA 4GUDA 3EJ6A 1JDJA 5EZYF 5F3RA 2QPTA 3VC3A 3DFUA 2I2WA 2X2PA 4QUIA 3OM0A 2QBYB 5EJ8A 1Z5VA 2GWHA 2JAWA 2OQRA 3HQ4O 3O8QB 5L4LA 3UMBA 2ZSUA 1E1CA 4L7VA 5FT9A 3T5TA 1ZK0A 2VBFA 3GA5A 3SICE 4XSHA 3V2UA 1Z5WA 4BQOA 4EYOA 5AVOA 3JWHA 5TQ2A 4M0KA 4CQJA 3I1FA 5AVUA 3IAAA 4ZT6A 2PO7A 5JAHA 4S04A 4IJ6A 4NTZA 4FSHA 3K6KA 2G36A 4IXWA 3E18A 3UWSA 4OGGA 4AN4A 3Q7EA 3QLVA 3V8MA 1OH6A 2QM7A 4PHFA 2ES4A 1CBUA 4HGZA 2CNLA 3WI7A 4E33A 3KSAC 1AZWA 2Z6AA 1OILA 3CJRA 1MPXA 4OGFA 4YRJA 4GSLA 2DSTA 2X6TA 3ONDA 5I7FA 3E84A 3B8HA 1OD6A 3VDNB 4HWSA 2ZRKA 1UADA 1YOBA 3AHFA 3BQNB 4GKVA 4A4DA 4D80A 3ZH2A 1EXNA 4D82A 2IH2A 1A9XB 1M74A 1GPNA 2DC1A 4FYKA 1GXSA 3DCIA 3HNRA 3OLQA 2YZ7A 3ZUPA 2W6NA 3KVOA 4A23A 5EWJB 3NHLA 1XALA 2VJDA 1TFRA 1E6WA 1SXJB 3OEYA 1RAHA 4HZGA 3HGTA 4BVKA 1EX1A 1U81A 4MV5A 2QWXA 3H1EA 5DYNA 3KZKA 1NQWA 3IS3A 4G1VA 4F72A 5K0CA 3EPKA 4HAVA 1G20B 1NU8A 1Y7LA 2SECE 2YOFA 3JQRA 1TRKA 3OCUA 4NFSA 4XEUA 3BXHA 4F92B 2A7XA 3FUUA 1DZ3A 1GUYA 1QIFA 3D6TB 4XGNA 5JWOA 2C7GA 3E3MA 4KR3A 3GUHA 3T3IA 3R20A 1EH5A 4EB0A 5HMLA 1F2DA 2CMDA 4C21A 1OW3B 1X87A 2IC5A 1IEVA 3ABQB 2R11A 1JXAA 3FDZB 4RS3A 3QF4B 3VV2A 4MW7A 5LB2A 4R9VA 1LX7A 3S6JA 5BSGA 5KVCA 4JH0A 1X2EA 2X1LA 4K81B 1J6UA 1EFTA 2CL0X 1I36A 4W5HA 3ZHXA 5LPNA 3DXFA 4JWTA 2BJVA 4O8ZA 3IE0A 1V26A 4MUJA 2XGSA 4F56A 3HDJA 4B09A 1KI9A 5L3QA 1O96B 3EGDB 3JWPA 1U0NA 3VZRA 2WT8A 4BX0A 1N6RA 3HCRA 4QARA 2FI1A 5L3SB 1J2RA 2VP6A 1MRZA 2FZKA 2QA5A 2PGDA 3CR3C 3LP6A 3LVQE 5BR1A 2OG1A 4UNSA 4NC9A 3B48A 1PP4A 2IXGA 3ELYA 5FUXA 3IT1A 3ZCQA 5EUMA 5KOHB 2E4XA 4A6PA 4F8EA 1GG8A 4S1VA 5ER9A 3GIWA 3FOWA 3U9LA 4E94A 4EO9A 4ZD6A 4LE2A 1T5OA 3K4HA 3HMKA 1Q83A 1HUQA 4TKUB 4B34A 1UBHS 2QQFA 4YRSA 3SHFA 3T94A 1RIIA 4OAOA 1JQDA 4LXXA 1II0A 1UXHA 5JNVA 3VR6D 4YQFA 2CBXA 1ZJJA 4P7JA 1NC1A 5IAAA 3BWMA 3ND7A 4NH4A 1GD1O 1N5JA 1Z7YA 3EUFA 4TXJA 5TRTA 3WYCA 1ZKMA 4F3TA 1WU7A 5LQSA 1JPUA 2QT9A 4YCBA 4ZOLB 3JAWA 4E5PA 2KB0A 2ACKA 4XE5A 3TMKA 2P9GA 1RJ9B 1XP5A 2R1TB 4FMDF 5AI0A 1QQBA 4O1MA 3AVOA 3AL2A 3HG7A 1B1AA 4X6YA 5ARDA 1K89A 1RM4A 4D1YA 2QE7D 1N3BA 1GAXA 2HU2A 3MTEA 5K3FB 1WXHA 5E4JA 3VBCA 3RARA 4BZPA 1MX3A 3FCUB 4G5YA 2C42A 2WAXA 1FXWA 2P6RA 1FUKA 3U56A 4D0GA 2PIDA 2ZWMA 3KV3O 1YACA 3A6EA 3FETA 3FWNA 4P80A 3RV3A 3CLVA 4G9EA 3W0LB 3Q10A 2IEAA 4D99A 3AM5A 2CLSA 2G7ZA 3B2QA 3DP7A 5JS8A 5EZQA 4B31A 4CF7A 4PC2A 2CYCA 1JILA 2J0EA 4G37A 2D2XA 5ICFA 3MBOA 5AJVB 3V7WA 3VR2A 4FE4A 4B3BA 2A9VA 2NZYA 4X1YA 4HXYA 5JO9A 4X5OA 3WLOA 5J1SB 1QFXA 3ECCA 3RVRA 2GBPA 2OCPA 2VLBA 3IUJA 1IN1A 5JD6A 1FP1D 4INOA 4AVYA 1GTMA 4R05A 2WAYA 5JFTA 2DR0A 1RT9A 2OD9A 1JH8A 2ESRA 1SVSA 3BDIA 3PT9A 4M1WA 4XRRA 3THWA 1R66A 2QGNA 5EERA 4ECAA 5BMVF 2CY0A 1U2SA 1PCXA 4F8JA 3KXLA 2QRKA 2FW0A 5BSHA 4WINA 3WWDA 5JMOA 4XQCA 5JHHB 4Z1MD 4NNPA 1BJTA 2EDCA 2ZJOA 3Q40A 1ZX1A 3FDFA 4ALMA 2Q0QA 1XPJA 1VOTA 4CQMA 3QE3A 1YZGA 4C08A 5KOJB 3HKCB 2ZYAA 3TZ6A 3LWBA 5EIFA 4B3FX 2NTNA 2D2FA 2ZXFA 4U9HS 2P2NA 2G06A 2WYWA 3R3JA 5JBQA 4KLAA 1F0YA 1ICEA 2OCXA 1JEDA 1TD1A 1VLVA 2EP5A 2P2CA 3RU2A 3VHXB 4D81A 3Q72A 4HYYA 1M6NA 1Q0UA 2EFJA 1KAOA 3IHTA 2HNBA 2C95A 1JG3A 3LUHA 4CN8A 1GKUB 1YUNA 3B3AA 3CE6A 2EZUA 1BWSA 1ZFNA 3QUTA 1A9TA 3AFGA 1CY2A 3RYFB 3WP0A 3GDOA 3L0DA 3GZNA 4HJXA 3ZDCA 1O0BA 3CT4A 1JKXA 3F5QA 4DL9A 2HCBA 1H5UA 1X70A 1UP6A 2H4WA 3DLAA 4PZ9A 4G5QA 3D4OA 4R6WA 4BCBA 5JROA 1VKJA 2QSJA 3VISA 4I4NA 2ZAIA 2VYFA 1HL7A 4JVLA 4WMLA 5GM2A 1PLJA 2CXQA 2H9YA 3NBYC 2DPLA 2IS1A 2H5JA 3SQNA 4PANA 2WUFA 3SZGA 3DZCA 1T8UA 4JR2A 2UV8A 4LGYA 3OQBA 3CRZA 1D03A 4WGFA 3OT5A 3B3JA 5LUAA 2XY4A 2QAIA 2JBWA 3EZ6A 3MCWA 4Q3OA 3PUXA 5JXJA 5DHFA 1E5TA 2OUKA 3DV0A 1Y3AA 1I2AA 2TMDA 1KJZA 5E2IA 5F35A 3WMGA 3NBUA 3CX7A 3ETJA 2P11A 2I3DA 2W4QA 4KXLA 4TN5A 1YKSA 4GDFA 3F6EX 4MUEA 3MFQA 2PD3A 4D3SA 3S7ZA 1LXCA 2OQIA 3WKEA 4DVGA 4AP5A 2DPMA 4PFKA 2BC9A 3P71T 1Y6RA 3UT5A 4Z51A 2WSSD 4MIKA 1PHRA 2EGUA 4KK4A 4K40A 3WYAA 1CTQA 3K94A 1L5SA 3LDFA 3N53A 2JARA 1EWTA 2V4UA 4HDAA 4M7WA 1YHYA 4BZZA 1DAMA 1YMQA 1MJFA 2NG1A 3RLIA 1TX4B 2CD7A 3KEOA 2G9RA 4M22A 3T9DA 3ID6C 3OEWA 1FCJA 1GU7A 2D5CA 3OLXA 2QN8A 2ZJ3A 1D1PA 3UXYA 4JKOA 4NZNA 2CFIA 2NO7A 2Q6OA 2CUZA 4D02A 1RXIA 3ZDBA 1EGQA 3R9XB 5K7SA 3N8IA 1FU7A 2PV0A 1J90A 3EGEA 3N70A 1SUFA 3OKCA 1UBGA 2HREA 2OAQ1 1B14A 2OYSA 3C4VA 4FE7A 4NATA 3QI7A 4D7AA 1H3FA 3L41A 1PR6A 3DW3X 3KEMA 1M6YA 4KR0A 1P18A 2GRUA 3DTVA 3ECSA 1MQ9A 1PX0A 2Q4OA 2VYVA 3GZJA 2O2DA 5EY5B 5TMEA 1F38A 3IGFA 3KZMA 5EPUA 2H9IA 1EU1A 2BMDA 5TGDA 1O0CA 2YINC 1UBTS 1EFCA 1Z4KA 4PQFA 1ESEA 1X7YA 3VPFA 4YJGA 3JX9A 2OFXA 3QX9A 2FHPA 3PC3A 1KDYA 3OOEA 2A7QA 2WD8A 5IBCA 1AU9A 4JYBA 3DLBA 5CB0A 1EP9A 1C1HA 2H18A 4NZOA 5FXMA 1QQ6A 3BFVA 5CFPA 4ZV9A 4IKPA 1MJHA 1LPSA 4NE2A 1EVLA 3RTAA 3CLTC 2YVAA 2X13A 4LWZA 3BUSA 1HDCA 1W59A 4OQ4A 5FADA 5FOWA 2PIAA 2WWFA 2YWJA 2P9BA 4PO8A 2E4VA 2ISCA 2AK2A 3NVAA 3T7AA 2YWDA 5JBNA 1CY6A 2N1BA 1H4VB 4AUEA 1KJNA 2R8OA 4P5PA 5AK0A 2IW1A 1SBTA 5CT6A 3AFNA 3D0QA 3KVNA 3ZCXA 4DIMA 2F90A 4BMPB 4AYTA 1GCGA 2HF8A 1L6RA 1YL6A 2IPAB 4R0VA 5HA5A 4WI1A 4MVWA 2EP8A 3QVTA 1PQWA 3P5SA 2APJA 3AEUB 3QPVA 3QTLA 3R74A 1IZZA 1YRLA 4ZMRA 4Z4CA 1PUIA 3FLAA 4K88A 2FCRA 2BGMA 1LTHR 2GEBA 3Q9SA 2F3RA 4UW9A 4CIVA 4WH0A 1ECFA 4KE8A 2LVBA 4MW6A 4B81A 4F9GA 3ADDA 4KIUA 2HQOA 4YPOA 1O57A 3B2NA 2GETA 4ACBA 4X60A 2VPIA 3EZGA 4D79A 1W35A 1XIVA 3EULA 1B8NA 4JQYA 4QUDA 1NTRA 3THSA 2VWQA 5JXHA 4IJWA 3N7AA 1HNXB 1VRVA 4L6CA 1KY5A 1E2HA 3HBMA 3MRSA 4MGEA 1B3RA 2V7TA 4I66A 2XSZD 3U3JA 2MSNA 1UMBB 2C5SA 2OOKA 3SFZA 1LSOA 2XCSB 1DFIA 1TVKB 1XQ6A 4L8WB 1I5RA 2I4MA 4BQEA 3ZDDA 1YS6A 2R8RA 1E62A 4MVJA 4QDOA 2FF5A 1SY7A 2AA3A 1I51A 2VSNA 5IAJA 4IJMA 2W4MA 4COKA 1C4KA 1CS0A 2W58A 1P1IA 4YI5A 5T3UA 2QL6A 4KQ2A 3JPWA 4LPKA 3FOZA 1MH9A 1P80A 1JJ7A 4UNIA 1FPMA 4R41A 3DMGA 5HNKA 3J81A 4BE4A 1A2OA 1X77A 3BQMB 3OTGA 4BNKA 3ETLA 1EE9A 1TZJA 3DFIA 2CUNA 4O4IF 1K9SA 2RH4A 5TQ0A 4BFWA 3KQMA 3DBHA 4EF6A 5LQRA 1XN4A 3PVZA 3RANA 4XTCS 1S7CA 2OL4A 1SXIA 3JZIA 2I6QA 2QUIA 3EOZA 4LIPD 4U00A 2WSBA 3RQSA 1TVCA 2Z95A 3OEHD 4BNTA 1O4WA 3LHSA 3QLVC 1O03A 2FPIA 2A30A 3BREA 4E12A 3C3WA 4HC4A 3WKAA 3AEXA 5A06A 2RK4A 1E5DA 1YE5A 5BN5A 1J8VA 3H4TA 1DC8A 2IDZA 5C8DA 1TYCA 3UCFA 2YYYA 5AKLA 4KNWA 1QK4A 2VYND 4ZCSA 4L4XA 4MB0A 4QUKA 1AMUA 3TUZC 2W42A 1VIVA 4URYR 1QHFA 3GMIA 4PYOA 1RJFA 5K0TA 1EVEA 2BGLA 3ADCA 1DUIA 4MAAA 2F4NA 5JCOA 5EJ9A 1W9HA 3SOZA 1ZXBA 3P9QA 2RCNA 2ZI7A 4QJ4A 1YZFA 4BKMA 3D2AA 1I30A 5EXEA 1U6JA 3IBYA 5FTNA 1DKNA 1P31A 1BVRA 3D7SA 3FWKA 3QUBA 1ZIXA 2FVYA 2G72A 2Q29A 3UM9A 1DKQA 3JTMA 2NYRA 5KYNA 3RU9A 1G18A 3FHTA 3FSRA 4GZ6A 3JAKA 3UMRA 4QU8A 4B6SA 1J0BA 1P7ZA 2GHQA 2CXPA 3DMTA 4B43A 4B7AA 3NYWA 3NVMB 4Z3KA 2ZRMA 3EA0A 1DAFA 3ER6A 5BOVA 2RBKA 3KWJA 4HDKB 5CA0B 1EQAA 3FROA 4UD6A 1JRLA 1IXRC 3FKQA 3PITA 1SXPA 3K5PA 2BKVA 1BKYA 1OXXK 3P9SA 2NNLD 2ORWA 3EMDA 1XVAA 5D3QA 3KAPA 3V8QA 1DGQA 2BTOA 1THGA 2FF7A 1FVXA 4F21A 2CF6A 3G8BA 1YS9A 4LE0A 4JUIA 2Z83A 2BN4A 4YCCA 2YZMA 3PKJA 2N9UA 1EDOA 1QP4A 1K6JA 1RCTE 3GO4A 3MPUA 4JT2A 4XPIA 3P20A 5E6RA 2M6KA 2C3PA 4DREA 4MKFA 4MAMA 4V0MA 4WXPA 2O8FB 2PV7A 3BHJA 4HQLA 4DLXA 1RRCA 3STYA 1QU2A 1J07A 4J76A 4A0QA 3BQ9A 3WRYC 1EK6A 1C0KA 1KYTA 2CFTA 3RTDA 3ZEIA 1RYBA 4BMZA 3O3NB 2DWUA 3RK0A 2G63A 3V80A 1ZNQO 1BFDA 3KRTA 1TA0A 5EHZA 3A2NA 3UMSA 3RWMB 4AJNA 1PUXA 5CM9C 2AS0A 3H97A 4U2CA 3R0XA 1XZBA 1Z0AA 2J7PA 2IEIA 5SV2A 3R9IA 2EHJA 3TOCA 3TQFA 5IXYA 1YS1X 2YKGA 4RVHA 3IE2A 1L6IA 4YRRA 1ORHA 1XZIA 3D6UA 5LR6A 4P86A 4F9TA 3N0VA 1K6MA 2BISA 5EC8A 1I7NA 5TSDA 1JZQA 2TYSB 1RVV1 1EVJA 1BCRB 3LUGA 3DL4A 4YCNA 2HHAA 2F3SA 2Q5QA 1R64A 1PEKE 3TUJC 1V11B 3WSVA 4DTIA 5KNBD 4NFHA 1BDIA 3UBMA 4MICA 4EYQA 5J1TB 2BFPA 3ADBA 1AJEA 4EA8A 3RRFA 3T1HB 4KBFA 4NJEB 3UTDA 4O4LA 4LSWA 3ZDEA 1WKVA 1K9VF 2ZS9A 3MRTA 5KYVA 1LI7A 2FFBA 2G1AA 4P7FA 4AWBA 1JWAB 1N6HA 2ZJ1A 3R7NA 4UCQA 1QG6A 5BNZA 5TC4A 4IW3B 5LQMA 1PS8A 4RE6A 3RTGA 1XZ8A 2ZE7A 4GI2A 1EFLA 4AROA 4E11A 2PXCA 3ZV6A 3BMQA 1CEQA 3NC1C 4ALIA 4NCNA 3C6MA 2A9RA 2W8ZA 3PENA 3PWZA 3DOUA 3PXXA 5G3ZA 3NW9A 3VVMA 3DYBA 2F64A 4NBVA 3FOAA 2QRMA 1NF2A 3K1AA 3RPEA 1G7SA 5I4CA 1MF7A 2NO0A 2WVAA 1KDVA 2A5LA 1MQ8B 3E3NA 4H0FA 2JI8A 2I2AA 3V4VB 3VOBA 2HU5A 1KZ7B 4DSOA 3V48A 3F6RA 4GPTA 4IDHA 2YWXA 4BS9A 4J0JA 4KRYA 3FD8A 2GF2A 3MWFA 3T9BA 4MKZA 4DUZB 1TAUA 5IBPA 3G85A 4YMVA 4UNRA 4UBLA 1DLIA 3CMCO 1PZEA 1RCFA 3I9MA 3I9JA 4XRGA 5CA1A 4DIEA 3LBAA 2R6R1 4Q3NA 1FLAA 4JLVA 5CJJA 4C4OA 1EPUA 2O7NA 2WTXA 1VA5A 1GLVA 4FGKA 3MWEA 2R1VA 3E9YA 4TTQA 3UKOA 4EZBA 2EX4A 1T9GR 4WNYA 1UK7A 4FHFA 4KLZA 3HCWA 2QTFA 1N2EA 3B51X 4GR9A 4FZRA 5DT2A 1ZI9A 4RZHA 3ZHYA 4R54A 5ALRA 3IT3A 4R31A 5K3DA 3HN2A 1RXCA 2Q5IA 3EOAI 1VB3A 3HUDA 5KQMA 2RONA 3O26A 1YB5A 2PZKA 2V1XA 5ILGA 3WGTA 4CMCA 3K71B 4PCLA 1DXOA 3LF2A 4D8UA 5CG1A 1C9NA 5REQA 1SXGA 2QPAA 3ZJVA 3AFIA 2IOHA 3FE2A 3JVIA 4JR1A 5HCNA 2IY8A 4AZ3B 3UWMA 4RM3A 2ZE5A 3BEDA 3W05A 4RA9A 4AJJA 3FSJX 4DLVA 3OT1A 4RMNA 3AERB 5HKOA 2COKA 1P9LA 1I6LA 4C4RA 1GNTA 3QE9Y 3GAFA 5TLSA 2NIPA 1JALA 4JVSB 4TKZA 1CYDA 4P35A 2BOVA 1J9GA 1QPBA 1SG9A 1W0JA 1TO1E 2NSDA 4GGMX 4DDKA 2PTGA 2Q6KA 3PDWA 5DHPA 2G70A 3ZY2A 2DETA 3E9ZA 4RHTA 3S40A 3UB4A 5INTA 3DAHA 3P7MA 5DP2A 4ENQA 3ET4A 4YAOA 3PFBA 1XKTA 1YL7A 2R2GA 3HWWA 1DBWA 2ISQA 3IAFA 1TM1E 3K1YA 1M1YA 1YJ8A 2FWJA 4LNUA 1RMYA 2RB4A 4KMSA 1ORVA 3V2GA 2XVYA 4QGGA 4DJ5X 4HFJA 4E2XA 4ZGGA 2I2CA 5FJJA 4BEWA 2VC2B 2Y68A 4ZYWA 1EUDA 2RGRA 5BP7A 2ZJ7A 1P2VA 1WZUA 1CVLA 4I5EA 2YV1A 4O0LA 2PT5A 1PGOA 3LGSA 5FTKA 3KKPA 3ESCA 3U13A 3WXBA 5HW0A 3DDWA 3Q8WA 1D0VA 1EUCB 2B1RA 2SHKA 3E48A 5YASA 4MV3A 2RH9B 2IXFA 4PBSA 3G9ZA 3F7NA 1LU9A 1F06A 2DWQA 3NGLA 2JGAA 4RTRA 1A76A 2FXIA 3LOPA 4OM8A 5EJGA 2JZCA 4I55B 4HNAA 4C6TA 4DIFA 3RAFC 3V3TA 1JL3A 3BXFA 2YVUA 4P53A 5H3CA 3LSTA 4DC9A 4U2KA 4F91B 1DRKA 1X8LA 2RKBA 4OI4A 3WKCA 1Z5OA 3GFPA 1GZ6A 3LY9A 3OOWA 4FFNA 5AK5A 1ZQ1A 2IS6A 4ZOBA 4DJAA 2BT4A 1EDDA 1X94A 4W1PA 5DWQA 4DQXA 3IP1A 2FZ4A 1GCAA 1XZAA 4OAPA 5HQTA 1DIAA 1N2CA 2OSVA 3KUKA 1QIIA 3PPXA 2G9ZA 1VCNA 5DYIA 1L4NA 2WIGA 3AR6A 3GFQA 3I4CA 3KD3A 4Y0AA 4F38A 2OECA 4MGIR 4ZGBA 1ZCFA 2C57A 1XZDA 3NXSA 1ZICA 2PK3A 2Y1GA 2GAIA 3G0CA 2H3EA 3IPYA 3K2EA 5C8YA 3V1NA 2OBFA 4DG5A 1E6EA 3G8YA 3MD9A 2JAPA 5SYNA 4CI0B 1NM5A 3ZC3A 2Q6TA 4J0EA 4JT4A 3WHIA 4D44A 1Q2UA 1YB4A 5JXWA 1K6XA 3N2IA 4V0QA 2XYVA 3PD7A 1RQ2A 4B3DA 5BXQC 4I50A 4OFZA 5CX4A 2IQIA 3K5IA 4Q66C 2PN1A 4DIUA 3NHAA 4RAQA 2BTQA 3IR6A 4WT7A 5A03A 4H9GA 4HLQB 1I5EA 3Q8MA 2BMJA 1XELA 2Q46A 1VPEA 3OF3A 5DNYB 4JDPA 1IEXA 3ZW9A 2RG1A 2HA7A 1D4OA 1HM5A 2QLFA 4JX8A 1QWOA 4DCUA 3QE0A 3QYFA 4FU0A 4MYTA 2H65A 1ILEA 4X8OA 4BHTA 1SCJA 3C4QA 5A2GA 5LXTF 2O06A 3U4AA 2VQFB 2B4RO 4KLCA 5ETJA 2VDWB 4PLZA 1D1QA 2ZUTA 5FOSA 4C5AA 2R6DA 5LQJA 3ZLJA 3U1BA 3T99A 3KJIA 2X0RA 2HC9A 2ZRNA 4G4SO 5KYKA 3IJRA 3VO9A 1S3FA 3PI7A 5KPJA 4ILEA 2HSJA 4U7WA 3T0FA 1ADJA 5AM1A 1AC5A 2WICA 2QJFA 4JCOA 4JVOA 2MSLA 2VJQA 2Y05A 4LGMA 1JEYA 3OZEA 2PFSA 4TV8B 5JJ5A 5AWFC 4BKPA 2ZDGA 3ORHA 3FYCA 3K31A 2VNSA 9LDBA 2ZXUA 4P81A 1W47A 2NU6B 3K0FB 2EARA 1I2BA 3OTIA 5CLIA 1DQZA 1KHTA 5DSTA 2FLKA 3TMYA 1WS6A 3I6IA 4UVIA 3U3OA 1XJQA 3L7JA 3DOFA 1ZRSA 4K8OA 2AXPA 4IHJF 1R9GA 5FQNA 4V38A 4KAAA 1L5FA 2FG7C 1O6GA 4KN9S 1HNNA 5DM2A 2R85A 1TJYA 2C4VA 3EWSA 2Y2VA 1Y5MA 1YZQA 3AUAA 4FKMA 4N03A 5E0OA 3CCFA 3G6KA 4TYYA 2KLBA 1ONSA 1WR8A 2GKGA 4S2UA 3VZSA 2GCIA 1BN7A 3QKUA 3TTXA 3EZLA 1VJ5A 2YN2A 2AFVA 3RV4A 2YV3A 2CK3D 4MK4A 4C5CA 1ZUHA 5A7HA 3WHKA 3H11A 4KQKA 4XYEA 4EGCB 1WHTA 1OBCA 3TI9A 3CX6A 3MCAA 3TW6A 3HH8A 3IT2A 1ML4A 3AXTA 3HBLA 2P78A 2QR2A 1R37A 1MW8X 1OZ0A 3DZGA 2ZYTX 4F04A 3Q8KA 5K0SA 4YAUA 3P96A 2COEA 3R5HA 4RA6A 2JDID 1DXHA 2PGNA 1OTYA 4KV7A 4EZEA 3DEHA 4GKKB 3RUIA 4F06A 4MVXA 5JBIA 2RHLA 3TD9A 3FLEA 5EIBC 1LBIA 3BWVA 3K0HA 2Z4SA 3CEHA 4EKYA 3ZCVA 4ENTA 1P0CA 5JAMA 2A88A 3AZOA 4NMWA 3BSFA 3EFOA 4LKOA 5LYJF 3GCXA 2IKQA 4GBMA 3NHUA 1GXSB 3G1UA 4U2DA 1ZR4A 5AXDA 3F78A 4CDGA 2GEUA 1R5JA 2WQ6A 3ZDRA 1TLLA 3FOBA 4R81A 2CLMB 1SVWA 1YQGA 5JCOC 3K1JA 5D8DA 2BLNA 4HSEA 4AMBA 2I3BA 1ENPA 2Q99A 4GVLA 2ZCUA 5GONA 2I22A 3F5MA 1G98A 1YRYE 1SK8A 2WVJA 3HXMA 4M0FA 5GJVC 2V03A 5BW6B 4RCYA 3GPLA 1ZN8A 5K0EA 1IM5A 1ORDA 1GFIA 1NMZA 5TB5A 2V7UA 5A3VA 2I4LA 2GLXA 1EFHA 3DMTC 4CM9D 3D4PA 3PRKE 3JQAB 2XV1A 5TF0A 4DQVA 3Q0EA 3RSFA 1AGNA 3NRBA 1N2IA 4IJUA 4XEHA 2AZDA 4ERXA 3MJSA 4ZQCB 1KBOA 4MKHA 4MP8A 4CKEA 1EA7A 1VSTA 2HCRA 3GRUA 4HK4A 2F4VB 1SQSA 4TS4A 3HB4X 2XX3A 4MDEA 3TQHA 1CUEA 1DWUA 2FWPA 1Y5RA 1UMDA 1WBJB 1Y3DE 4CIDA 5ED4A 4DR6B 5FPQA 2LR0A 5L3QB 2YJ3A 4BP1A 4LBZA 1XRJA 4TMKA 3FMPB 3I5UA 4U6SA 4Z0HO 1UM8A 2WU3A 1LVHA 4IDEA 2V4ZA 5T4FA 2QSUA 2ZITA 1S2GA 1FJ2A 3GLQA 4I8XA 1GA1A 1U8AA 4NWIA 1WNTA 2VUIB 4JU9A 3DA8A 4US0R 2Q49A 3VR4A 1J7KA 1PU2A 2A59A 4KP7A 1ITZA 1F9AA 4KE9A 1V5EA 1M2OA 3NP9A 1MABA 3K8ZA 2DXIA 1A04A 4DEYA 2JIQA 2LTAA 5HRCA 5C35A 4YLGA 3PEUA 3MRVA 2NU9A 3H5WA 1ADFA 3JVUA 4IIJA 3RFVA 1KYYA 4GX1A 2EFEB 3E3LA 2ILTA 1T26A 3DEIA 2IHUA 4YX9A 2NVUA 3ZXSA 2UXBB 4HWKA 5D87A 5E4TA 4B7XA 1JTFA 2CV0A 1HURA 5FWYB 2PZMA 3A4IA 1NVKA 2PH7A 3C1OA 1FBTA 3I23A 4PS0A 2VP4A 1LPOA 4IDCA 1EJ2A 1SN7A 1KQGA 2H0RA 3W5CA 5A9TA 2PWYA 3BXPA 1O94D 4YUVA 4CLXA 4N49A 3F6BX 1ID8A 4PN7A 2J3LA 3HKDB 4YV2A 2M1XA 3C3EA 4Z4GA 1IMJA 4M8NE 8ADHA 3FMOB 3PNMA 5AJWA 4TT3A 1EG7A 1RYMA 3G02A 1W52X 2BF7A 2SKEA 5DLPA 2L82A 1UP4A 2XWBF 4MYHA 1GITA 1N9GA 1XRSB 3VM6A 1F0NA 4GE3A 3VU9A 1XT6A 2VHQA 4MA5A 1F8FA 1OJ7A 4Y0NA 4IIGA 5BV1A 1SBYA 2YV5A 3THWB 1WW8A 4ZHQF 3FY4A 4GXQA 5HPYB 4NBWA 5K5EA 3PV0A 2DH6A 4M8SA 3AI1A 1SCQA 3UCEA 5BRJA 1DELA 4EG7A 2JIZD 4RWZA 4AL4A 1ZINA 5CBKA 2VXBA 3ROFA 4RYDA 5IF9A 3DFZA 4QPDA 4UTPA 1A5AB 4BPBA 3M4ZA 1DAKA 4HPJB 5KVSA 2ODNA 4MYDA 1LTQA 3PJGA 4FLMA 1DKPA 3D5QA 3JQ8B 4PQYA 4AZSA 3SS8A 1W36D 4BMDA 3UPTA 2JNWA 3E53A 2C0PA 2BD0A 1WZEA 1KH2A 1QDLB 3ICOA 3GFFA 1PFUA 4ZKEA 4OHZA 3UHPA 5GV7A 4OD0A 3MUEA 2C5FA 2VR1A 1ZD9A 3DYVA 1GNSA 1L3CA 2NO4A 4ZA2A 3RVJA 2J9GA 1RM5A 4RGBA 2OLKA 4AY3A 3K30A 4LKRA 4YRLA 5DCUA 4BX9A 4Q12A 4MRMA 1QRRA 4WTOA 4AICA 2XUZA 1CR1A 3R3HA 3PC2A 4I3GA 3KTFA 1OCEA 5HBRA 1XNJA 2LUOA 2GCOA 2HT6A 3IDAA 5BQOA 1O5OA 2BI7A 2P9CA 3QFCA 3WDLA 1RPAA 3ZXUB 1VPDA 3T4UA 4N18A 4FYXA 3GZNB 5M5BA 1W0CA 2UUOA 1IN8A 1SC4A 2I3AA 4O25A 1KKLA 2LBPA 2XUKA 1L1QA 3MIZA 5K3AA 2WV7A 1CJSA 3FGZA 3NX4A 2PT9A 4OATA 3ZZMA 3EG9B 1UZAA 2C97A 4G56A 4MULA 4XUGB 4JOBA 4PGAA 2AZTA 1VIDA 2YJZA 3HHPA 3WLRA 5I7WA 1FRZA 2H51A 1MRSA 4JLUA 3UATA 1GT91 3SD7A 2ZUUA 5IVIA 3M8KA 4A5OA 1IN6A 9LDTA 1JQ5A 2QQGA 4IVPA 1THMA 1JBQA 4ILKA 4RKRA 3CLKA 2VAVA 1RZRA 1PI3A 4LGCA 4B3MB 4JI6B 2XADA 1OH8A 3HUFA 3ORQA 3FCEA 4NAVA 2ANBA 1ZITA 1HT2E 2YYAA 2X58A 1Z8NA 3D3JA 3DV0B 2ERYA 4FFVA 5I9TA 3ZHVA 1D09A 1W5TA 4NK5A 4KOEC 2AG8A 2AXQA 2ZRHA 1UK6A 1Y8QA 5JSKA 1JV2B 1TJ4A 4TTAA 2Z1NA 1X1TA 1CJVC 2ZE8A 4XIIA 5DNVA 3QFSA 3I8SA 3HBJA 1DIGA 3R9XA 2WY2D 5L3VA 1D2HA 2R8PA 3M3PA 3LUBA 4D42A 5EZYA 5AM4A 3OLWA 3DE6X 1GADO 2OM6A 5FUBA 1GQSA 1SHLA 3G8CA 4C7KA 1X7ZA 3N0TA 2A5JA 2F43B 3DOIA 4OOFA 5G2OA 4LG1A 4F97A 1X3LA 3ETEA 3TFWA 4ARVA 2FQXA 2J4FA 4ZC1A 1FFBA 1GSIA 4Y98A 4LZJA 1JG1A 5L4NA 2ZI9A 4PYQA 3B9BA 4B44A 3TQSA 1IXSB 1Z2DA 1A98A 5FTMA 3I6MA 2HMUA 4M9ZA 3H7AA 4A91A 1WXXA 2IV3A 3FPLA 1Q44A 3G2HA 1IBKB 2W6CX 2FPPA 3TVDA 3WQRA 3ZVRA 3L6UA 1Z3CA 3FSEA 1KE2A 1RJWA 1U2DA 2NZVG 3WNBA 4C4ZA 3FNFA 1G60A 5B1YA 2OCYC 1R4AA 2PKRA 2ODBA 4FGUA 3W8FA 4YT2A 3O82A 3RHZA 3KXIA 2VK4A 2FZEA 2Z56A 3WLEA 2H54A 3HR7A 2B8EA 2CXTA 1B0UA 2W6IA 3LX4A 2CMHA 4MLDA 1Q0ZA 4BWGA 3D4NA 3UKDA 4PNEA 1NM5C 1X7YB 1A4XA 2G5PA 2CVZA 1FRQA 4Y6OA 1H0RA 4CM7A 1IIRA 2I6UA 5A2QA 1M0SA 1DDOA 2WLSA 2ZR9A 4L3WA 3WSWA 2HSZA 5K6RA 2V0NA 3FGPA 2OYCA 5DF1A 3SX2A 1OV6A 2W11A 3JQQA 4NJMA 5DN9A 1UJBA 2N42A 2Y6UA 1SIUA 5IUKC 1CQIA 4GVXA 2HNKA 2JAOA 1PL0A 4IZHA 3ZHTA 5IAOA 5L6LB 3TD2A 3SHVA 2QTGA 2XTNA 3T8YA 1B41A 4DCNA 5KOYA 4Z4EA 5BR7A 5FUMA 4TWJA 1VE5A 1XDDA 3ZOKA 2QE6A 3PYXA 1B73A 4CQLB 4MVJG 3UMMA 2CEKA 3VO2A 4I3FA 4WQMA 4GWLA 1R8YA 4URXR 1EP1B 4FFSA 1SUDA 1SR8A 5JQWA 1Z08A 3LHKA 5C1PA 2V9PA 3TGLA 1NVMB 1NUAA 3PL5A 3IRUA 4ZYUA 1NDQA 3R9WA 4D43A 1JDPA 3EW7A 2CKMA 3AR8A 1A9YA 1K92A 2Z2JA 1BXGA 3O1LA 4WCFB 3EA4A 4AMVA 4IV0A 1WW2A 1N9KA 5KTPA 5JDIA 3OE4A 1LLUA 3LAWA 2GAAA 1LS6A 1I2MA 3DLCA 4O2AF 2C5LA 3NRCA 4ND7A 1HFKA 3IBSA 4WJZA 3RROA 4OSOA 4OK6A 1B42A 1NE2A 3SBEA 1HE4A 2FW7A 3DC7A 2OK7A 3ZE0B 4BZXA 4PPQA 3CSUA 1P4JA 2VT7A 1BRTA 1L5HB 1IK6A 1JNXX 1YUBA 2X2FA 4C7BA 4UZSA 1VLZA 3DV9A 4P4SA 4YR9A 3B7WA 2HMSA 1JQEA 2PH5A 4QX6A 2FTKE 1P62B 3TAUA 4JU8A 5EIAA 3MJCA 1IG0A 5JSQA 4NJOA 1X38A 4JBGA 3ZV3A 1ZCZA 4D4IA 2VVTA 1CS0B 1Q1EA 2VZ9A 4XX1A 5C37A 4EY5A 4YAEA 4CUZA 2HKIA 3UMCA 2F67A 2XHZA 4M9RA 4IDNA 1SEPA 3FAZA 1AKVA 1FDTA 4D0RA 1NP3A 2WVHA 3FYSA 4QT0A 4BWFB 4PY2A 2JLSA 2J3KA 3MTQA 1LTKA 4RX1A 1KZ4A 4YRPA 1A5TA 3CH5A 3KELA 5TPZD 2WJYA 3PUWA 3SFTA 2R00A 5LZ7A 1T4GA 3U40A 4F86A 3GNSA 4YT4A 5TVGA 2QOEA 4OFBA 3GLVA 5AW9A 1QMGA 2AQKA 4BLVA 4Z0PA 5A5DA 1E1QD 4MVJP 1NVDA 2V6IA 4MEJA 3PPYA 4QFMA 2MTBA 4QRIA 5BN5B 5T67A 3B1YA 3AG6A 3ZUGA 1Z2OX 3VI3B 3D54D 1GM5A 1RBQA 5DPMA 1R16A 2I0FA 3MJHA 4A92A 2YHBA 5BN3B 4DCCA 1XFDA 3HR8A 1JBEA 4J0CA 3TLMA 1U2QA 1XZQA 3AJ9A 4S3MA 1MD9A 4LQCA 1XRRA 4HI0E 1LV7A 2J87A 3IAXA 5BYAA 3S7TA 3B6EA 4OMFG 4C01A 5JSFA 2JFWA 4B45A 3IMGA 1GGMA 4KFUA 1I4WA 1D0SA 4TLBA 1YCGA 3PUZA 4GMDA 1VMIA 4F3KA 2I2DA 4BVLA 3M5DA 2JFFA 2NP6A 2HV9A 4TLEA 1G16A 3BB1A 5BMVA 3U09A 5ALMA 1L4BA 3FLBA 3O7MA 5FTJA 5E9JA 4ALJA 2FK7A 4IGFA 3EGOA 1AS0A 4N4AA 2EBHX 4PPGA 5FA6A 2J46A 5CAEA 3HKEA 1U1FA 1QVRA 4C0KA 1HT1E 1FS4A 3MBKA 2V6MA 4RF5A 3NCTA 2D2VA 5EHIA 2Y76A 4UMFA 1AY0A 3M6IA 4K9LA 4AMGA 3CRNA 1Z33A 3RGWS 3IEKA 5DW0A 4DUPA 4FM9A 1NN5A 4FCWA 3PBKA 4YIKA 5GAJA 3CV3A 4UHJA 3IDZA 3AHCA 4CV2A 4W8HA 5BMOA 5BWNA 1IQRA 4Q1AA 3LRPA 3DTNA 5ESWA 5J47A 4R1NA 1U9ZA 5B1SA 4CV3A 4IGKA 1CF2O 4G8CA 3I28A 5L7WA 4QLAA 4X7MA 1ZOPA 1ULUA 1ESDA 1C3OA 1S4QA 4HVTA 1X7GA 2CFSA 2IFTA 3UN1A 4D46A 4F3RA 5I4IA 5JRDS 4ZU6X 4XR9A 4B7UA 1X0VA 1PFYA 4JLAA 4X61A 3RTCA 3TZKA 5E6RB 1IHXA 1TYEB 4OJQA 2J6BA 1HYBA 1X13A 2PWAA 1OYYA 5TS3A 5KOIA 2V58A 1GN8A 2EFDB 2ZATA 3RS9A 4B8YA 2B7LA 3UAXA 2JFZA 3NM5A 2J0SA 1EEXB 5ICGA 1E77A 4EKNB 2GTPA 3AIOA 4YQYA 5EE5B 3RFFA 2RGBA 2RHBA 1VJDA 2AYZA 3CISA 3CKKA 3V5NA 3DE7X 3RFTA 3UK6A 2GJSA 2OCDA 4D8YA 4LMRA 2G4CA 3OFND 1VKRA 4IOLA 4RH1A 2J0QA 1CUHA 2OV4A 2V7VA 2VHXA 3BL8A 4K87A 4PPYA 1MKYA 5IZ4A 1V1MA 2E49A 1J2YA 5DXFA 1YR6A 5E7QA 4K1XA 1II9A 3F6SA 4TQ9A 5AOAA 5IU6A 1G6Q1 4DJDC 1WF3A 4FFRA 4BMNA 1F48A 2DT8A 2W6MA 4OL0A 5JZBA 5IZCA 3GL9A 2Q2OA 1IZYA 1YJXA 3TQTA 1N0HA 4CM5A 1V7ZA 4DIKA 1FUUA 4JC4A 2E48A 4YRMA 3Q3HA 5A6SA 1RHUA 5HK9A 5F2EA 4J4HA 3ETHA 2I6XA 5CT5A 2PX5A 3U4MA 3VPGA 3FXAA 1QRSA 2VI5A 1M72A 3H7IA 4N5IX 1IN7A 1J09A 4CRWB 1DTWB 4U7JA 4FFDA 3P26A 3VC7A 5KVAA 2XVXA 3BMQB 1R0RE 1DQRA 4BQFA 1FNBA 4J49A 4DRYA 4AAYA 4F5EA 3FI9A 1ZIPA 5G4KB 2M9MA 3EIHA 5TEVA 3U0VA 3GLFA 1EG2A 3LBNA 3FW1A 5FP0A 3COPA 1ZLXA 5KNCH 2J9FB 5KZMB 3RUHA 4LJRA 1CRZA 1FU4A 1X9GA 3AHJA 5CUQA 1G8AA 2N47A 3O2QB 3W6NA 1QYIA 4JYCA 3RF7A 1QH1B 3DD5A 5L8VA 3H1PA 3UKJA 3C7KA 3OTQA 1NLFA 4LOAA 3C7DB 4UMDA 1T2VA 3K9NA 4X20A 5AH0A 1VPWA 1K8ZB 5DX0A 1E9SA 4RVGA 1CDZA 1GNRA 4W82A 3VAAA 1PVVA 3JQPA 3CH4B 5DHSA 4TKMA 4OKNA 3RUAA 3VV3A 4IHKA 2AHRA 4C3OB 1U1EA 1FXUA 5EJIA 4CNBA 3TD6A 2OV1A 1U2PA 1HSZA 2H0AA 3AI2A 2OENG 3CH6A 2VHZA 4G41A 2YBDA 3C97A 2ZVJA 3KVYA 2HA0A 2YR0A 4H35A 4HMQA 2FZWA 3MMPA 4XIJA 3TGPA 4EJ0A 3TR6A 1KWKA 1U4SA 3N8DA 2E21A 4X44A 2OMEA 3U44B 2CWWA 3U0BA 1NZDA 1HMYA 2HLPA 2CDBA 3NQ41 1SQ5A 1BS9A 2X5KO 3OFVA 4J2OA 3PXDA 3OE1A 3C7TA 1Z5UA 3R40A 4HGRA 4WKNA 3RYHB 3TQRA 2JKVA 3G9QA 3S8YA 3EEYA 4FIDA 4J7AA 4K9NA 3PNPA 1DT5A 1E3WB 2YRFA 3X1KA 4G8JA 5T3YA 1KARA 4MS3B 3BB4A 4F4FA 1JQBA 1NSFA 3SJCA 3PGMA 3P9PA 2CXOA 4OF4A 4CDNA 4MCAA 5CCEA 4KQIA 3RRBA 2YNMD 1H0SA 4BWVA 4HTFB 3FPKA 1YE8A 2WYVA 4K6GA 5LDDC 1AMNA 5AKKA 1EAYA 1NQAO 1YULA 2XD9A 4P3NA 5AD1A 2QENA 3JQ7B 4QDZA 4GOKA 4JUBA 3U3RA 1MG5A 1SVOA 3E70C 4DAEA 1W4RA 3KM0A 3IKVA 2XNSA 4ER0A 4INZA 1BX0A 1HE1C 3LWZA 4JSYA 3BZUA 1V4BA 4LBVA 4X7PA 3WAKA 5I7HA 6ADHA 2E1PA 3M6FA 4G4IA 1NDHA 1O89A 1QH8A 2EVWX 2PRZA 2R8YA 4WESA 1VDZA 1GFZA 4TYQA 1PJSA 3U81A 4ARIA 4BRWA 1GSAA 3TTYA 3BL5A 2FRDA 3C7AA 3NUQA 5JSUA 2AQHA 1E89A 2ZWVA 4CFYA 3VUEA 4W6ZA 4XYLA 1RFLA 4JQOA 2PUCA 3O2JA 3CR8A 3AVTA 1UC5B 1UBEA 2IUYA 4RXMA 3ZU4A 2AJCA 4K6FA 1OUMA 2NVOA 3G7UA 2EZ9A 3RLFA 3C3YA 1YH3A 2HIGA 4E88A 2C4WA 1T8SA 1TIBA 3N74A 3USES 3ZCRA 1ZGCA 4EG3A 4JUCA 4UASA 4U0JA 4JY7A 2RKWA 1W87A 3R8CA 2VK8A 1KYIA 1SG0A 3OCZA 2WWTA 1QZ3A 4N5DA 1GPWB 1DAGA 1SXJE 3LL7A 3JD3A 3QM1A 4M21A 2R84A 4HJRA 5F52A 4CUKA 1KK3A 3FSGA 4IWNA 4UUNA 1SD5A 1A0OA 1P91A 1G20E 1LQ2A 2PUHA 2IU4A 4ZEWA 2YS7A 3DNFA 3HB1A 2KQUA 1ZRMA 3OKPA 2EWVA 1AB6A 5I3ZA 4XPZA 3GGPA 3RSCA 5D3KA 4O4IA 3KDSE 3LO5A 1F2TA 1TM5E 5D84A 1U1GA 2I4IA 4CFSA 4NCBA 2XT9A 2B94A 3VTKA 4IIFA 4P3XA 4KUHA 3WL7A 1R6AA 2ZI4A 2ZBVA 4P3YA 4JZYA 3N2KB 3UJ7A 5M04A 1C9YA 4YMGA 2VKTA 3D8RA 2CVHA 3WK6A 4EB3A 2XD4A 3MWLA 4KDCA 1U2DC 3I1JA 2FPRA 2IUSA 4L5YA 4QOEA 5AHOA 3OU7A 1I2ZA 2H29A 1XEXB 3HM2A 4LHWA 5TPWB 3G2PA 1N6IA 1DU4A 4BB9A 4CMAA 2GEJA 5CDGA 4B40A 2C7OA 3BH6A 3FRJA 4P4TA 1QFMA 3WL8A 5JFGA 1NVWQ 2WJJA 3HO8A 3PUKA 4ZO6A 5EMHA 4E2YA 3BRWD 4XB1A 4MR7B 3VZBA 4I50B 5AI8A 4AM8A 5JI3E 4YN3A 3K35A 4X97A 3VTFA 1SCKA 4JV5B 2BTQB 1JFSA 1BHSA 3HI4A 3RRXA 2HYDA 4E1VA 3A4LA 3R6DA 3WZMA 1TC2A 3QELA 2PWBA 4WBNF 2WJVA 3NETA 3RBVA 4K9DA 4B0PA 1QR2A 5ICEA 1D2GA 2QW0X 4KO4S 1EE1A 4FJ2A 2D1QA 4LW8A 3SDSA 3HJTA 4X63A 3SF8B 3WYDA 3ZQJA 2EZTA 3VU3A 3FTEA 4GNRA 3ZHRA 3OHMA 1UZLA 4JAVC 2YBEA 3G5LA 2XSZA 1S8AA 3SHTA 3HA3A 1Q5PA 3KJNA 5JSYA 3UOWA 2WAMA 3ZCSA 1OYVA 3UAOA 4D3ZA 4XQ9A 1X7WB 2I80A 4QPJC 5JAIA 1W93A 1X1SA 2VCEA 5DHAA 3O83A 2BL4A 1LLQA 1NYRA 2V4MA 4ENSA 4OG2A 1NAIA 2ZSHA 1ZK2A 3KHUA 3D1LA 3UAWA 3FJOA 4XWKA 2XB4A 1D2AA 1VL0A 4BQSA 4CT5A 4FCCA 1ZC3A 5E8RA 5K09A 2MINB 2HA6A 4DBVO 5ALOA 5TIIA 4BZWA 1E2GA 1NRJB 1ESNA 1HDIA 2YUTA 3H2HA 1FMCA 4CHGA 2A92A 3II6X 1GQYA 3R4VA 4WACA 1E3IA 1YKGA 2VUUA 4RDXA 2XYHA 4ZYYA 1IFXA 3DHNA 4NZPA 3OOYA 4UVDA 2O2EA 3CU5A 1VBKA 3OEHA 1KBQA 5B37A 2C88A 2VHUA 3E9CA 3U31A 2RB5A 5DEIA 4MCIA 4RZ2A 1C8LA 3D8HA 3M4XA 4A2QA 2WIFA 4WW0A 3NP7A 1M9NA 4PBRA 5LBTA 1ZD4A 3SCZA 1RC0A 1SQGA 3A26A 4QECA 4ARZA 1YD7A 4WKOA 2VYNA 2NLOA 2LKDA 1DP4A 1CB0A 2A9FA 3GT0A 3SFVA 2OO7A 2YWGA 3TIVA 5AYVA 1GZSA 4ITRC 3SJBA 1JECA 4PWYA 1WHTB 2XB8A 4QGHA 4MUYA 3NWBA 1NFFA 2C84A 4FGJA 3ZIAD 3ZWPA 1P7VA 4EA7A 4BMXA 2MSEB 2WKQA 5EESA 3F5DA 2PBLA 1U02A 2OFFA 5BPFA 3J81k 1N1GA 2JRLA 2WA1A 4P84A 1WB9A 5KJ6A 8AT1A 2C4MA 1YQUA 3GP3A 1ORTA 3EWNA 1E6KA 3G7SA 1I4EB 1BS2A 1NKVA 3MJ4A 1G3QA 3RUEA 1V47A 3NEYA 2R00C 4TM7A 3UO8B 1IL0A 4RZUA 3KD2A 3OE5A 4Y2QA 5J4HA 2J31A 4JT8A 1G5PA 4MS1B 3BMCB 4DCGA 1V2GA 4ALNA 2HADA 3EFOB 5B7NA 4MA0A 1WMDA 2HL6A 1IN5A 1IPFA 3F6PA 3QEBZ 2W00A 2K6GA 4PNZA 3R75A 3CO5A 1DUVG 1OHHD 4I5FA 3U7RA 3QXSA 2P9QA 2REOA 3O9VA 1JHDA 3PQDA 3VZDA 3ZWMA 2VHCA 1GQRA 4YVFA 3RUPA 3W2IA 4GIBA 1ZGJA 4DRXA 3T5AA 1GV1A 1ULTA 3CBQA 2ONZA 2XECA 4E13A 4I4LA 1XV5A 3ISJA 1JHZA 2XB6A 4MJLA 5JH7F 3RKSA 1GPJA 1MQSA 2WU1A 3LY7A 3LKBA 1WB4A 4IX9A 2FSSA 1SURA 2GHRA 2E5WA 2P7IA 3Q3VA 4LVOA 4PR3A 4X64B 1W94A 5CX1A 4P1ZA 1XQVA 4D4KA 5JTUA 2FXVA 1R74A 1B6GA 1Z17A 4FWBA 4IFBA 1GRQA 5AKIA 4KMOA 5DGXA 5AKZA 3HO1A 4FYHA 1G66A 1YBMA 4LYDA 4REMA 1JKMA 2K2QB 3DEAA 3PU6A 2PS3A 3LZDA 4DV4B 1OI7A 4A6EA 5BORA 3F1LA 2QVYX 2BIFA 1AGXA 4PWZA 5I45A 5DTEA 4BV8A 4DNFA 2AG1A 3LP8A 4I4IA 1DRVA 3E27A 3IIKA 2J0UB 4OP1A 1SC9A 1ZI8A 4Q9LA 3X1MA 3MTGA 4FK8A 4KHPB 2IOFK 1TTHA 4K9PA 3DXXA 3IAHA 3ON5A 2O2JA 4L7QA 4M1KA 4MV9A 2B82A 3TXXA 3T3PB 1QCYA 5IC4A 3O8CA 3Q98A 2MMGA 1T4BA 1T5SA 1ZIOA 1WHSB 1RLOA 3MXOA 2BEJA 3QSGA 2E2WA 3ITNA 3RVPA 1V3UA 1ZD5A 5D7NA 1QNLA 1TFUA 4C0LA 1JH9A 4D9CA 2IV2X 1QIGA 1CC1S 3H3JA 4HLNA 4M89A 2I6SA 3TDMA 4JMPA 2GZRA 3E8MA 3WLIA 1NVTA 3SY8A 3VHRA 1FUYB 1U0SY 1QX3A 3G2NA 4FEAA 2ZRJA 4YRGA 1ZUIA 2EQBA 2IVZA 2Z3ZA 1Z2CA 4UHHA 3PKIA 4ZC8A 3ZHUA 1MABB 5GPBA 1HSOA 2KX7A 3FKSA 3P2IA 4FYJA 2P40A 2CLOB 2G09A 3B6ZA 4NYMQ 5A5EA 2XTZA 5K4GA 1R15A 1CQJA 4KYTA 1TIKA 4P0TA 2QJOA 5LCXA 1G8PA 1NW4A 3A1NA 4OHFA 1DXQA 5B5SA 3KT3A 4MW2A 2PKQO 4DLZA 4AQ7A 1CERA 1DB3A 1YDHA 2HRBA 2PY6A 4WVFA 3E5MA 1H2FA 2FSFA 2VH2A 3DTTA 3F9RA 3UJ8A 4JXZA 1CY4A 1XU4A 3HP1A 5IM5A 2PT7A 2WTEA 3K8YA 4H7IA 3ND9A 2G80A 2CB9A 2ZIAA 4ZU1X 1OVMA 3L7MA 2VUHB 5IZCC 1Z7EA 1XLVA 1YNSA 2GM3A 1U3VA 2GGSA 2I76A 2J0VA 1JIIA 3GPDG 3VSEA 1I3KA 1NLYA 4DMMA 1FDOA 2PNJA 3O4VA 4L4SA 1HG0A 5JSZB 5BYJA 5TJHA 1FYVA 1RWOA 4FTWA 2WU8A 3L43A 3SQMA 5IDYA 2G0AA 4RL4A 4UAJA 1PYGA 2WF5A 4EH1A 1OAAA 4H16A 3FZYA 4KGDA 1U5CA 5H3HA 2WNHA 2O8DA 2L69A 2EF1A 3DDHA 5ALWA 1DKMA 4BU1A 3TB6A 5DDIP 4OGKA 4B0OA 3RHSA 2SBTA 2BZSA 3GJYA 1P5JA 4PPFA 3OJWA 4IQFA 4QUHA 4UNQA 4OB7A 1WRBA 4RV5A 1WSBA 2AOWA 4V0SA 1AQNA 3QENA 3C3AA 4M9UA 5DXAA 4F1JA 1L8AA 2P2SA 2J3QA 2HHJA 4IFIA 2F8TA 3NMUF 5AVTA 3T3GA 4ZYXA 2P9YA 5CVJA 3T3EA 4QWWA 1U7XA 4L27A 1XA3A 2Q2WA 3IFSA 4QT4A 2PUFA 1AH2A 4TYNA 1EBFA 1UKAA 5EIWA 3PE6A 3FGNA 1JFTA 5CR9A 5KSOA 4TXHA 2OCBA 3LLMA 1W30A 4G07A 2C7QA 3DE1X 1SWVA 1QYCA 2J6CA 3TW8B 3EGWA 1E1RA 1V2HE 2O4UX 2QNIA 5C34B 4AJIA 2DPGA 4UOZA 3BEOA 4ND1A 1YSCA 3PFKA 4AK9A 1FOEB 4PGGA 2F9LA 4RJTA 5EQDA 3ZJTA 4RCVA 3HVRA 1QCCA 2BGRA 4RIGA 5ENDA 2FOIA 2IYOA 2UXCB 2LW7A 4NRDA 3CRVA 4Q05A 3JATB 2PNFA 2R48A 2Y8EA 3K0EA 4PQEA 3GH3A 4KAFA 1KK0A 3FUCA 3JARA 4HAXA 3JXEA 4WKBA 3SBDA 1NMEA 3SC2A 3ZH9B 1ODIA 4Q19A 2ZJ8A 1AF7A 5EKSA 1W2HA 3RO7A 1PEDA 3N75A 2A33A 2XT6A 4OPMA 3RC7A 5B3LA 1UFRA 3KQHA 5IYZB 2GCOB 2YMPA 4FKBA 4E03A 2HCFA 4TMFA 4D98A 2XNHA 1NJ2A 1GAQA 3O4RA 2RI1A 2C3MA 4HDCA 4QEKA 4DA7A 3UNXA 4BEJA 5LXTA 5HEKA 4XVRA 1VJ1A 2CHVA 4CT0A 4YGXB 3DWFA 3R3WA 1DFGA 1ZN2A 4HEA1 2OHJA 1TXGA 1U8CB 2GTHA 2P6NA 2WHEA 2Z04A 2ZB7A 3QXHA 4J75A 1WF6A 2ZPUA 5CW2A 3WA7A 3TRDA 5B3JA 1CSEE 4IZ6A 4Q02A 1H8HA 1TM2A 2WDZA 2AWOA 3LXRA 5B2EA 2D00A 3T34A 4W4TA 3UWKA 4HWTA 3K70D 1U9YA 2PZLA 3GYGA 2FRDC 3BJEA 4EI7A 1UWKA 5BR4A 1DG9A 3DCYA 3NDPA 3H2JA 5G4LA 1MT0A 2VF8A 4YAKA 2BFFA 5E3JA 3NYQA 4GI5A 5COQA 2JFOA 1I1QB 2JCBA 4OFXA 3QIVA 3SVLA 3HLKA 3RWBA 2ATXA 2H57A 1E4OA 1URPA 4EECA 5JADA 4IHJA 3KG2A 1PQPA 3FDIA 4YDQA 4Q9KA 1T2UA 4MIYA 4ZP1A 4JB0A 1U28A 3CNBA 4KPUB 2JPDA 1GG9A 5BWLA 4Z3OA 1POWA 4R16A 3QYPA 4EHFA 3AY6A 3H87A 3FCAA 3HP4A 3OQIA 3CXUA 3SYNA 4Z1OA 5E4FA 4PZAA 5TMBA 2FK8A 4K8RB 2O52A 2PA3A 2VBCA 2WMYA 2JS7A 5A4MS 1P8AA 4IIXA 2OLJA 3FNGA 1LF0A 2ZGVA 2ECFA 3PX3A 4KIJA 4L6AA 1FL9A 4WNCA 4JP2A 3GVHA 4U7TB 4DR7B 5J4VA 1U3TA 2HTEA 2YWCA 3CB2A 2GD6A 3FPBA 1Q7EA 3N28A 5T6BA 3CMMA 3WYGA 1UODA 4X1IB 3CLSD 4Z7NB 3ZDAA 1TYZA 2FPPB 4FR5A 3RBZA 3D7LA 1DBPA 1JQ3A 1PVOA 1UOOA 4FN4A 1F60A 1IHPA 4INAA 2IYNA 3PXAA 2BHSA 4K28A 1JHPA 1Q91A 1BMTA 2YW9A 3ADOA 3Q7SA 4HPXB 3STTA 5JS2A 1CJBA 5FYDA 1P5FA 1XQ1A 2EJBA 4TWAA 4YQEA 2JLZA 1Y6GA 3PEYA 1CUVA 4RPGA 1GLGA 2J30A 4YRDA 4Q47A 3OJOA 3QJ5A 5LYJA 3PHJA 1KZ9A 2B6HA 1F9EA 2JKZA 3KDPA 1K8QA 4XB6B 3I64A 3RYTC 3Q3IA 4Q9AA 2DQYA 3ELWA 4LDJA 5EXSA 3R8XA 3WL6A 5IT5A 4ASUA 1T6YA 3OPYA 1F8UA 4BMCA 5CFRA 5AI5A 3T9EA 3TRKA 3K0CA 3EEOA 3WBBA 5CH3A 1VIYA 5AUOB 3KTAA 2P6UA 2QL7A 4DYHA 4NJMB 1U0OC 4JVMA 3ZWQA 1JEAA 2AR0A 3A9WA 4IF6A 5E3IA 1CQIB 1K5PA 3IQWA 3PVCA 3F47A 3SJAA 3LHDA 4NENB 3RKRA 4ZI3A 2WHXA 1ZESA 3NO4A 1M1NB 1R5OA 3AIIA 4EHLA 4RYLA 4EVRA 4M99A 3ENWA 1J24A 1WEHA 2PA0A 3O2NA 4XCVA 4ZO7A 5HIKA 1E2EA 3VU1A 5FL7D 2WWVD 4WRRA 2JFBA 1ORIA 6AT1A 2GD1O 2MDTA 2WG2A 4XSGA 3H2ZA 3CUYA 3NALA 5F3DA 1M2VB 1GSHA 1VXRA 4ECEA 3X2EA 4OP3A 5CD9A 1CETA 2CK3A 4DV7B 3GDWA 2GXUA 3PFNA 5ESXA 3MUOA 4JROA 5DCLA 4F84A 1DIBA 1F20A 4TMTA 2OHGA 3PUVA 3PX2A 4QYIB 5D5PA 4QXMA 4R1PA 2CSUA 1L7BA 2WDPA 3H5NA 4DB2A 4OSPA 5ITZA 1W85A 1WXWA 4UTZA 1Z74A 5K8IA 1R3UA 4A27A 3K2IA 4DGSA 4FMCB 2QLLA 1Y6ZA 4EELA 2H2DA 4IQGA 3T4PA 3HRHA 4KDRA 3LPMA 3JYPA 1U9CA 2HWYA 3GRVA 2AZMA 4YLEA 4C1NA 4M0LA 4HDNA 5HM8A 5DE3A 1DOHA 1UM9B 5K20A 4XVQA 2Y92A 3PNSA 3KEGA 2ODEA 2WAOA 4MARA 4OXQA 4OQQA 4AO6A 4RABA 1X6VA 4K9SA 3R76A 3OPYI 4JKYA 3EUAA 1ZGZA 3DG9A 3R0IA 2WIBA 1AK9A 4ONEA 2DP4E 4R9RA 4RETA 2GFIA 3P0IA 2GKSA 5A71A 3ZU5A 1XB2A 3OAAD 1Z6XA 3DPUA 4LHVA 4C76A 3H8VA 3B13B 1G7TA 2YXDA 3FBTA 3D7RA 4FMDB 4IMIB 1YI1A 1I3NA 3Q12A 4OQEA 3KU4A 2WG0A 3PSHA 4JC5A 1TCCA 2Q5LA 1DG3A 3IAM6 1JHOA 4IGEA 4KXYA 4GKBA 5B58C 3CINA 3E61A 4QASA 2BHRA 1TJ5A 1YCHA 2X9GA 3PICA 3PNLA 3U7EB 4CM9A 4F6RB 5E9AA 3WGUA 3OE7D 3IAUA 3CO0S 2CMFA 3G7NA 3G8DA 3U4CA 2GYWA 2VS1A 3UY4A 4DA8A 3MGAA 5CTJA 2A67A 4YRZA 3IUEA 3CHYA 4KL8S 1FMFA 2B98A 2QMQA 3U7QA 1SC1A 5HZMA 1B6RA 1KETA 2WHPB 4GXTA 1A69A 1YONA 3OJCA 4LGVA 1WDLA 2BKEA 1JDVA 3KLMX 3DPIA 4XFJA 3A70A 4B4DA 1G6HA 2NXNA 2GN1A 1XWWA 3CRQA 4MQMA 2JBAB 3EXHB 2MYNA 2NSJA 1LWNA 1XCJA 2QNRA 2R7KA 4I9HA 2AWNA 5EYPB 4BATA 3KK0A 4ZHQA 5EJ4A 1F4PA 2PG3A 5HZKA 5BMVB 1RWNA 3D6HA 4YIHA 2FW6A 2H08A 3ZIDA 3TLJA 4ES6A 2H17A 2P4QA 3B36A 4BBJA 3EBOA 3N5CA 3VU0A 2V7EA 2GKOA 2ZB2A 5JJKA 5F1KA 1A8PA 1WV0A 3HKEB 4IAOA 4R68A 4YCJA 5CB6A 2A3NA 1RXSA 4NMMA 4O29A 5AW2A 5FPTA 2JFUA 3NHRA 4CKWB 3DDSA 3O8OA 5HQ3A 1GU1A 4J4BA 4KVAA 5AIBA 4BO0A 4QE3A 2WI8A 1DO8A 1QYRA 3I9KA 4RACA 3OC0A 5CJ2A 4ZQIA 3ZY3A 1SCIA 1P1FA 4M7PA 1PR4A 4Q4LA 4YP1A 4JLSA 2CHQA 2JGNA 2N0SA 5I4KA 2MYTA 3TG8A 3PC4A 4RMJA 4TMXA 5AW1A 1DKUA 1MFZA 3NYIA 3PJFA 3GAAA 2XMBA 5CXQA 4HLUA 4QLOA 3A3OA 4RFSA 1U3WA 3GEBA 3MW8A 5SZHB 4ZFNA 4OB8A 1OZFA 2QHXA 3KXKA 4NE9A 4MLZA 1QIEA 1OA0A 2BBTA 2BLLA 3R24A 4IDBA 1F6WA 4IOMA 5ILQA 3ZK8A 2PZ8A 2Q3BA 1MEEA 2QZSA 2HK6A 4HL6A 1L5WA 2QPLA 1DTEA 1PTKA 5LZ5A 1CFJA 3EGXB 4ZO4A 5DLYA 1CJCA 2VDQB 5JD4A 1D7AA 2XE6A 1BA3A 5H82A 1K6IA 3STXA 3L0PA 1N33B 4OX9Y 3PRJA 1OE0A 2X77A 3DC2A 3ILSA 3KL4A 4KKVA 1TU0A 6CHYA 2PX4A 3EC2A 4DQ0A 2C4NA 5CTAA 1KO1A 4NV1A 5AVYA 3KJEA 4PONA 3UH1A 1PFKA 1L7NA 2BCEA 3DLIA 4HNSA 1WXQA 1JFRA 4BO4A 3TOVA 1EZ1A 1LX6A 1SUWA 4Y1RA 1WXDA 2JFHA 1Z39A 3NM6B 1NLZA 1R0SA 2DF8A 3RVLA 2AJDA 4LHYA 2JIZA 3GLUA 4PSAA 1JSXA 1M7HA 3M6VA 3DBLA 3KLOA 3Q9UA 5KCMA 3TW0A 2HWWA 3A3YA 3CN7A 2BFBB 1Z8HA 1JFVA 1NFQA 5SICE 2R8ZA 1KQFA 2K4MA 4DC1A 1V48A 3GRKA 3ER9A 1DO0A 4GX5A 5ICSA 3PGVA 4OVKA 5DX8A 1JU3A 3DZDA 3JR3A 4II3A 4HFMA 3ZLBA 4C0XA 2BUAA 4ZRMA 4TN1A 2OD7A 4TLAA 4EA9A 3UGQA 4LYJA 3W7VA 3OMXA 1KDPA 4J0DA 2HY7A 1A27A 4HN4B 3GELA 2BJWA 2CB0A 2IXAA 4UFNA 4UHBA 3WG9A 4NESA 3ZVLA 3KEFA 1DAIA 3GFSA 4Z99A 2C4UA 4GS5A 1Y5IA 3HJRA 2FOLA 4Y30A 4X1KA 5CRIA 1RWWA 2TSYB 2HQSA 2X4DA 3MAGA 2JGDA 1ZI6A 121PA 3P45A 2UZ0A 1VHLA 2OBMA 1Y8AA 3QU7A 3EC7A 5LMCA 2EKDA 4NH0A 3INGA 4UARA 1Y1TA 4FP9A 3L8HA 3GG2A 3WFJA 1Z6GA 2B35A 3V8RA 1WABA 3H17A 1JPJA 1IJKA 1XCLA 3BWBA 1NN1A 1P75A 1E99A 4HX9A 2RH5A 4MO2A 1G2PA 1YKFA 3OCXA 2XGOA 2HQRA 2QG6A 4RGVA 4EARA 2QX7A 2W6ZA 3DMFA 3I3SR 1XYVA 4X54A 2A1UA 5CA0F 1PRYA 1RAEA 1ZISA 1QP0A 3GUCA 4DA0A 1KVRA 2O05A 5JS7A 3KUUA 1K4YA 5FI1B 4EIWA 4DRZA 3QU9A 3U5TA 1XAIA 5AOVA 1FU8A 4YGYA 4TKVA 1NG9A 1QBGA 3F98A 3VI4B 5DIZA 3I04M 3M9XA 4JC0A 4Z9YA 4B79A 1Q0LA 1TCUA 3F5SA 1MRNA 3UJHA 2PKWA 4X3PA 1P2TA 1UCFA 2CHUA 3M9WA 4YUAA 4DLPA 3QW4B 2FJPA 2PU5A 2VP5A 3I2KA 3L1UA 3OLZA 4K3UA 4QSMA 3SVZA 5C8XA 1M34A 1NAHA 5MGNA 2HSWA 2EFHB 1H8ED 3THYB 5DNWA 3A7DA 4IUBS 4K1LA 1EKXA 1C50A 3VPSA 1PK7A 3HU5A 4O02B 3HN6A 3VOAA 3FKJA 3QU2A 1S3IA 3TQQA 5BSFA 4CR6A 1I8TA 4BO3A 4HQFA 1I4TD 2JCGA 5KBYA 4ROSA 5B3JC 3OD1A 2C98A 5JZOA 3TLKA 3SVTA 4ETIA 4RY8A 3V4PB 4NG4A 3FB4A 1D4FA 2R4UA 5JCZA 2C4KA 4KXWA 3BFJA 3HSSA 3UUGA 1LWOA 4OQDA 4O2AA 2RHCA 1QVVA 4XB2A 4KFTA 1VDMA 3F96A 3GA7A 4QNNA 1R4MB 2DQ4A 3TLYA 1H6AA 1SK9A 3D6JA 1YQDA 2QMZA 4H6PA 1U80A 4M0PA 5E3HA 3O3CA 4PYJA 5A5GA 1SRRA 2VP0A 3WIBA 4UU8A 2R1UA 3VR5H 4QYXA 2Z6QA 5IDWA 1RPZA 5KC9A 3KSMA 3BSWA 1ZJ5A 3RFUA 1FDIA 3RT7A 2X76A 3KQUA 1Z8DA 1ZJZA 1KPIA 4N0EA 1RJDA 1U28C 4FYVA 4LMPA 3B3QA 4JBWA 3PK0A 1ZVVA 2HRCA 4ZZ3A 1T5IA 3Q85A 2HCTA 1LBQA 2BBWA 3L46A 3FWYA 1EVKA 3LC7O 4R2LA 3X1ZA 3ZCUA 5B7PA 3KBOA 1KERA 5LOVB 3OJ0A 4J6FA 5LKAA 2B0CA 2SCUB 2HU7A 4WFKA 4XYMA 1SWWA 2P6MA 3LKZA 4FDUA 3HA2A 1ZMXA 5LMNB 3HFSA 4O4IB 1D8AA 2B1QA 4QRDA 4AJEA 5IF3A 4DLYA 3TQIA 5IWAB 5I9LA 1L8QA 3H3FA 3ZE8A 2IGBA 4LDPA 1KKUA 1M6VA 2EW8A 2V7GA 3HVJA 1UBOS 4ZI7B 2GPTA 1V45E 3T7KA 2EJTA 1N0UA 2J5BA 2Z58A 1KFEB 3I92A 4UBNA 3WLTA 4F1WA 2FFAA 5BURA 3L0CA 2BGJA 5H83A 4AKGA 1QV6A 2VF7A 2ZVQX 1NRXA 2IZ6A 1VHTA 1GV0A 3I12A 3QBTA 3UAZA 3WR5A 4C1BA 4ZOQI 1ZSNA 4TZ6A 1GEEA 2OXEA 1TMYA 1NMQA 3KZCA 4BLRA 3DOHA 1TQ4A 3U17A 1OLXA 3VO1A 3LYAA 1U5BA 3S3TA 4RNCA 3IDSA 1U0TA 1UDXA 3ZDQA 4POOA 3EMBA 3QBDA 4D4JA 1BW9A 2C9YA 2F55A 4U7HA 3T5GA 2G07A 4F8YA 1YJCA 1Y4DE 1M2GA 3IELA 3H0KA 1WUHS 1RKBA 1XMJA 3NHBA 3QELB 2J1LA 1WX1A 4IIYA 4R8SA 3CLRC 3AY0A 1RYEA 2GN6A 4H0CA 1G8MA 5KNDD 1OA1A 2PEYA 3NTOA 4NX2A 3EVTA 1DWOA 3KYIB 4ZANA 1IVYA 1UAYA 4NEQA 4TLDA 5TS2A 1EBBA 3TTSA 2WUEA 1TUIA 2B92A 4H3SA 2NZWA 4KYIB 3UZUA 3X44A 4N6GA 3ZY5A 4CLOA 5BT8A 3EVAA 3BE6A 3JYNA 1C0IA 3OZDA 4INJA 3LM8A 2DFNA 4FHCA 3B3FA 4CTJA 4LY6A 2W90A 2GN4A 1WBDA 2XNKA 3HB0A 1MIOA 3KYDA 2HSDA 1Z6TA 4GE0A 3YASA 2R47A 5HOEA 3H8JA 1DO2A 2IX9A 4Y0VA 1HFWA 1BVYF 3HGQA 2FN9A 4DDWA 5JYBA 2QRLA 2Y66A 4CETA 1WY5A 3GVPA 1E60A 3JCZA 2QD4A 5I7OA 3KJGA 1YZNA 2GA9A 4OB6A 4A2WA 2WJWA 4EJFA 3NEAA 4NYIQ 5KREA 5F76A 1MOSA 3QTTA 1DARA 2WKWA 3NPMA 5DO9A 1JHMA 4KK3A 2JEYA 3AX6A 3PXCX 2AX4A 4AJ2A 4BJ1A 1SU4A 5KSWB 3NKLA 5TPZA 1W4LA 3KR2A 2D2EA 5F1OA 4NXMB 2QT0A 4HEHA 5EL0A 5L4SA 1R0ZA 1KK2A 4XARA 2QGZA 5I7UA 2DUMA 2WRZA 3LLUA 5JYCA 2A3RA 4X7RA 5EMNA 2WVGA 1DQYA 2JIDA 3FYHA 4ARZB 5MN6A 1GU0A 2WHYA 1KAGA 2VTVA 3E9MA 5D3MA 5TNXA 4GMKA 1V37A 4CLEA 1CUBA 4IRUB 4QGSA 4C03A 3T3OA 3WGNA 1QYVA 1ZH2A 3KTDA 4YALA 3ORRA 3UGKA 2ZJ4A 2NUBA 2OHHA 4YP6A 1HQDA 4EFDA 2EYUA 2PQ6A 2WT4A 4I55F 5C4MA 4DLNA 5HS6A 4DYVA 1B2RA 4EJ2A 4IDOA 1PWYE 1LCIA 3LVFO 4HX5A 2GM5A 2ACEA 1Z07A 1C2YA 4OHCA 1UQTA 3UMGA 2IXDA 1LDBA 3C8HA 1JAIA 1U98A 4LBWA 4GPEA 5GMOA 1USKA 2OD2A 1HEUA 1ZN7A 2WJGA 3E7WA 1B1CA 3N2NA 2VJMA 4YUZA 4I9GA 3SXUB 1A88A 5CLGA 1TJNA 4D0NA 4ZZ0A 2JIMA 4D9NA 4W6QA 2VG8A 2NVBA 3PDIA 1Q0PA 1N2GA 2G83A 4P54A 5AVSA 4JEHA 3M6WA 3WXMA 4CEIB 5LBIA 3AF4A 2IP2A 3ES9A 4NS1A 4UM9D 3MK31 3AVPA 3O90A 3Q87B 4BQQA 4CKCA 3O75A 4IH4A 2DY1A 2PJRA 2C5HA 3DOEA