5CLHA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
b'APVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
molecule tags Isomerase
source organism Acetobacter aceti 1023
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
total genus 53
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5clhA00
1O4VA 2FWPA 5CLFA 5BOSA 2FW8A 2FWAA 2FWIA 2NSJA 4ZJYA 2FWJA 5CVTA 5BOSB 2ATEA 1U11A 3OPQA 2FW7A 1D7AA 4YCBA 5CLJA 3ORSA 4YCJA 3LP6A 2FW6A 5CLGA 5BORA 5C5DA 3OOWA 4JA0A 1XMPA 4GRDA 2FW1A 4AY3A 3TRHA 4Z7JA 2FW9A 4YCDA 4ZMBA 1QCZA 5CLIA 3KUUA 2FWBA 4ZC8A 2NSHA 5CLHA 2YWXA 4YCCA 2NSLA 4AY4A 5CTJA 3RG8A 4B4KA 3RGGA 4ZK2A 2H31A
chains in the Genus database with same CATH superfamily
3AEUB 1MAUA 3H1PA 4LFAB 2R6DA 3HTXA 2KLBA 5HJEA 4UEOA 4ZDIA 1FJHA 1P1HA 4PANA 3KLNA 3QHQA 1SC6A 5EIHA 3PXEA 1EGVB 4UQOA 5SZIA 1PGJA 4LWZA 5T67A 3SXPA 2XD4A 1YZNA 4MLPA 4GXNA 3PPIA 5D7BA 5FQOA 4FYIA 2O2EA 5KNBH 2FG7C 4OJYA 2BMJA 1VGQA 4JWKA 1T2FA 1KMNA 2I8CA 3WBFA 3GMSA 1SXJB 3OF5A 3OFJA 1JP7A 1BFUA 1W19A 1P0CA 2IE8A 3KKLA 2PL5A 3R0ZA 4QHYA 5F23A 1COWD 2WDPA 3B1VA 4N0QA 4RW0A 1A3CA 1QGUB 5DN6A 1TYDE 3AEYA 4MRMA 2F17A 4F06A 4S2EA 1YGYA 4AO6A 1PQYA 1TYCA 3FETA 5EZYB 2ZRMA 1ZVVA 2Y1WA 1EZ4A 5CFNA 4WT7A 1EFHA 2AFHA 3ETJA 3MM4A 4TLLB 1NY6A 3G0IA 3A58B 2BZ0A 3A4NA 5A2QA 5KTPA 1PZGA 4HVLA 4YJ2B 2Q50A 2YXBA 1C30A 1N6IA 4BO5A 2E4ZA 1CY0A 5GTDA 5JY6A 2BKLA 2J9YB 1C3XA 3I42A 3WRXA 3ZI0A 2VHWA 5CB6A 3W3AA 1QE0A 2RC6A 3GJTA 2DTEA 4IDPA 5CLGA 3CKYA 4REQA 3RBAA 3OOWA 1J8FA 3ICVA 3HZZA 3NGLA 3ZXIA 4R8MA 4CT0A 1NI3A 2J6IA 1LI5A 1Y6QA 2DPLA 3IBSA 1T3GA 3BRWD 3IP1A 2D4HA 2XYVA 4LXYA 1MN6A 3NC1C 1T3LA 3OZGA 5JSHA 2QENA 3TIIA 3ZUPA 1IEXA 1I8TA 1ZN9A 2GAJA 1E9BA 2ONYA 3MT7A 4Z9YA 1JWLA 1N34B 1XELA 3RIEA 4Q47A 4BCCA 4MS1A 3UMCA 3AT1A 3TIXB 3NKVA 3T7RA 5DBEX 5IBCA 4KAJA 1U3UA 1D6JA 2IY9A 3PWSA 4H27A 5FIUA 1D9ZA 4DLBA 1KMCA 1REQB 5J2TB 5TDHA 4ZVVA 1YZFA 2UVPB 3C4JA 3FBGA 3JD0A 4KVAA 3SYLA 1DOZA 2R6GA 2JB9A 2VYVA 3PF9A 3HRKA 4J1TA 3G2IA 2EG9A 2ZJ7A 3UXEA 2OQIA 3EXEB 3UUFA 1W36C 5KTMA 1SU7A 4AMVA 2VF5X 4CM9A 2VZLA 4WZBE 2JLXA 2JIOA 3T9AA 1J0CA 5I7UA 2PWYA 1OF1A 4RD6A 2OYCA 1PFYA 3ELYA 3NZEA 4H7DA 4I1RA 4MNTA 3T34A 3VZCA 3PQEA 4UM8B 1EE2A 5AJTA 1RRFA 1JI0A 2L0XA 3X1ZA 2XWJI 5EJGA 3SQMA 4ODIA 2JH9A 2CXSA 4YAOA 5CXXA 2B8TA 1C81A 2OMKA 2VHQA 4GNKA 2FCRA 1E3SA 1PZHA 2EBUA 2YZ2A 2K4MA 2QTNA 2DSNA 2KQUA 2JZCA 3OPQA 5KNBD 4E5KA 2BGLA 2RH5A 1VJRA 1T6NA 3G2QA 4J3JA 4PYMA 2ZSKA 1JEJA 2CUTA 1GKYA 4WK2B 1EA7A 4Q7KA 2DUWA 4ALKA 2F1HA 2QW1A 2NZUG 1AKTA 1XDSA 4XPIA 3O84A 1N2GA 5EJ8A 1IDN1 3LPDA 2V0GA 3LX5A 2W6JA 3AGPA 5J63A 4AJ1A 2P6NA 3DZDA 5A3RA 1LVUA 1GGKA 2ZYAA 3A3PA 4I2NA 3DE5X 1WWKA 2G9RA 4GX2A 3DVAA 1XZIA 2W6CX 2ZJ0A 5FNVF 2J5XA 821PA 1ZWKA 1FIUA 2NO6A 1V3VA 5E1BA 4TWAA 1GUZA 4ETMA 1YTLA 2B78A 2VXCA 3CE6A 3K0AA 2X0FA 1EA5A 1U5BB 2H6EA 5ALDA 1J90A 2XB4A 1Q0UA 4OBXA 5EJIA 3UEOA 4RK5A 4CV1A 1GCGA 2JIDA 4GRDA 1YI1A 4OREX 3KJNA 4J03A 1JEOA 2QZZA 3OE7D 4IYRA 4CF5A 1P1JA 4LZZA 1Q1BA 1XWFA 4UC0A 2D62A 2V58A 1L5ZA 2C4KA 2IRWA 2JHAA 1H0HA 2E4UA 2XA2A 4IAOA 1E62A 4OQYA 1UUFA 5FPHA 4KAAA 1E3EA 1NMXA 2OV6A 3LCVB 2F4VB 4TVOA 2CSXA 3DDZX 1E3MA 4K0KB 1I51A 2YVQA 3ORYA 3TRJA 4WXYB 1M1NA 3LDUA 3KTOA 2GPBA 3TM4A 4JI4B 1US8B 1QE5A 4B8WA 5KSOA 1VKZA 2OK7A 2GERA 4IWNA 4YFYA 4BGDA 3MRSA 4FVTA 3FPLA 1BZYA 2FUEA 3M5DA 1JFRA 1CZNA 1I2ZA 1HORA 5CH3A 4LBZA 5TMBA 3M4ZA 2HV8A 4F8EA 4QQRA 2ZFUA 4Z7NB 4BWVA 3BRWA 2Y66A 3O8RA 3CVXA 4MYUA 3H1AA 3P9PA 2REXB 3HB0A 4XYLA 4Q9NA 5IJXA 3ISJA 1Q7GA 3MA0A 4G63A 2NYAA 4OK3A 2A4KA 4BS9A 2PGXA 1FQJA 1CZHA 5KPJA 1K2VN 1XCPA 1G1AA 3DSRA 2ZBPA 5LZ4A 1DBIA 4GH5A 3CNOA 5EXEA 1XTIA 3WHIA 2OCDA 2P9TA 3P9IA 2XHZA 3D2LA 4HQNA 2FWAA 4A91A 4UM9B 4HUJA 1G64A 1GKLA 1NZFA 1PT6A 2W9XA 1NE7A 4DJJA 1UBCA 1L1QA 4J1SA 2Q7OE 2OHFA 5F3RA 3MPUA 1XZGA 3BMOB 3ABRB 1SO8A 3C0KA 3RFFA 3TQHA 3M89A 1D1TA 3LA8A 2UZ3A 3SJCA 1R27A 1DUSA 1JLKA 4Y6OA 1TJ4A 2XKAA 3AGQA 3V4ZA 3N2IA 3WSTA 3GBVA 1GDTA 1U6IA 2XNHA 1KZYC 2GZDA 3I53A 3I2IA 2EZ4A 4ND7A 4RPKA 4DJEC 5ALXA 1XZJA 4DCMA 4MR7B 4OEHA 2UVDA 3SBEA 5L3SA 1Z5WA 1GCAA 1NM5A 2XMZA 3H1BA 4HDKA 4YXFA 1GY8A 2XQFA 2HPHA 4KXLA 2GPWA 3JD3A 3GMIA 2A33A 3H1GA 1MW8X 1UKEA 3NOXA 3R8XA 4YROA 1CR6A 1MENA 1WP9A 4FGJA 4CW7A 1T2UA 3RVLA 3QMPA 1L7QA 5GJBA 3NP9A 4JVMA 4I9GA 2W8BB 3V4SA 3IPCA 4L07A 4H18A 5K6AC 2IYLD 1JIVA 3G0GA 3T99A 1KVUA 1JAHA 2VQSA 4PF1A 1OY1A 4TX1A 3VR6D 4XVUA 1HYGA 1K6XA 4FI3F 2ONKA 4LJKA 5F4ZA 1ORHA 3GP5A 2P78A 4MV6A 3QQ5A 4ZCTA 4ZK2A 1UAYA 1C7EA 3MCTA 2A35A 2HKIA 1BCRB 2W2TA 4JB0A 4OHPA 3MWJA 3VZPA 1GNRA 2ATCA 3H16A 5ELLA 2JZNA 3LP8A 2YJ3A 4YJDA 2CY0A 4BMXA 1OAOC 4W8HA 1EFVB 1RABA 1SHKA 2OVFA 4EGFA 1VMDA 2WYWA 5FI5A 2OCYC 3BIXA 2F2TA 2G1JA 4UJ5A 3OZXA 3O73A 5KJ6A 4GNRA 3TQTA 1FPQA 2WNIA 5EKSA 3I01A 2C9MA 1OLSA 3PE3A 4EW2A 3CKLA 2VDJA 4OKNA 1BVHA 4UD6A 3DBLA 1T13A 1V5EA 3TLEA 3TLJA 1TM7E 5CLHA 3ZJ5A 1B3BA 1X7GA 3CZRA 1T25A 3UPDA 1WQ1R 1L2TA 2R60A 1XNJA 5FWXB 3AG6A 2XMSA 1HR0B 3EXFB 1JA9A 1ULTA 3O4FA 2RMKA 3AB7A 3U37A 4UBJA 4BNXA 4X6YA 3U7HB 2PQMA 1V0JA 4K40A 4I4NA 3ZCXA 3MBOA 1PNOA 4CDNA 4CQMD 4EFLA 4RTNA 2E4VA 4MUMA 4NEQA 4XYGA 1GDHA 1USUA 3IUJA 5G1OA 1YQEA 2NU6B 4KAXA 4B48A 5H8WA 1YA4A 2X7XA 2B34A 1T4BA 5D87A 2GO1A 2Q9CA 4WDQA 1WY5A 2RJOA 1R50A 4MDFA 5JXHA 4YMWA 2Q2VA 3ZR4B 2HMVA 4MIYA 4ZHQB 1NMSA 3T4EA 2FPPB 3EWNA 1AUOA 3K92A 1X80B 1Y80A 4ARZA 3I9V6 1USGA 1WV1A 4R5MA 5IANA 2JHPA 2P11A 4DCSA 4CL0A 3VU0A 5LZ5A 1K7SN 1RLIA 4ZCQA 4I1YA 5IM5A 2HSGA 3OIVA 4OXNA 3MCZA 3BH7A 3I37X 3OM8A 3S2IA 4WN3A 4PGHA 3NM5A 5FBQB 2F3SA 5T4FA 3UATA 4HDRA 3PG5A 4CRWB 1T1EA 2B8EA 1GFWA 1U3GA 4KPEC 2B69A 1O3YA 3VXKA 2H7VA 3X3HA 5JAPA 1ZEMA 1RYMA 4M7WA 5KMGA 4BL5A 3WYDA 1KI6A 1GLVA 2VPQA 9MHTA 2QG6A 4HH4A 3DFIA 3NV9A 3MTBA 4DMHA 2BGMA 3WGOA 4N40A 4PAWA 1QB7A 4R8LA 4C5AA 1HTTA 1PR5A 2ZZKA 3M1LA 4WFQA 4IO1A 4NK5A 1Q74A 3BTUA 4BKUA 4OIMA 1A7JA 2G28A 3IMEA 3JWGA 4MGHA 1ISFA 3IRVA 3JQ7B 4M7PA 3V9AA 1SBYA 2EJWA 1I4WA 2LBPA 3PUZA 2WE8A 1KARA 2JFBA 4L3VA 1QH1A 1DWOA 1UL1X 2WC1A 2X2EA 4PYJA 1Z5VA 4O4LF 4TN1A 3ETDA 1XXHE 4YBZA 3X1MA 2OORC 5AH0A 1W94A 1RE0A 2XNDA 2XVAA 2NAPA 3DFMA 4HRVA 4R3WA 4N3GA 3V1MA 3ZWPA 1LSJA 3GGOA 4G6ZA 4I5DA 1IOZA 5TQ0B 2QQ0A 3AVUA 2P1RA 2WKPA 4KYUA 2WJJA 2Y6VA 2WF9A 2IZOA 3FBTA 3ILSA 3OCYA 4LJ8A 2AC4A 2R44A 2J3IA 1EDEA 1K4YA 4HMQA 2O6HA 2FJUA 2RHCA 1JHQA 1JYSA 3LCUA 2D00A 3A4TA 2JAWA 3H99A 4F93B 1V3QE 1OT3A 3WLSA 1I6WA 1B23P 1ZJZA 5L3ZA 3TJRA 1YFZA 2YKGA 1R0LA 2GSDA 3MJCA 3K9BA 5A62A 1J0XO 5TNXA 3X1DA 3U3ZA 3BGIA 2C2KA 2H2IA 1Z2DA 3EXHB 4JC0A 4NEGA 3PNLA 4E11A 3VVBA 2OORA 1M0EA 2UYGA 4HN2A 1UIRA 1RIIA 3NBQA 4JX9A 4NHOA 3WDLA 1RLOA 2HM7A 4FOSA 1ISJA 1AOXA 5EWMA 2GCPA 4TKVA 2ENUA 2NVUA 1GZ4A 3O7WA 2GSWA 1K5PA 3K6KA 2KLHA 1FVHA 1BN6A 4IVRA 4B71A 2PCLA 4L8GA 1E32A 4KI7A 3V8BA 3AM5A 1CNEA 4QODA 3E61A 1CPYA 3U4CA 3ZHCA 1G21B 4KFTA 2OZEA 4GEGA 1QFXA 1OBHA 1QP7A 4ZOCA 3NVAA 4ZYLA 3NDBB 3PEFA 2G09A 2X3YA 2BIFA 2OUIA 1T1SA 1TX4B 3RUAA 3WWOA 1SHTX 5EPUA 3D8HA 2C57A 5DI3A 5D5HA 4K6HA 5JXWA 1G5FA 3THYA 4QGAA 4TQAA 4Y7DA 5HE9A 5DP1A 1YULA 4GKKB 1DIOB 1QF7A 2ZBDA 3C3WA 4NCHA 4EHDA 3SQNA 4DTCA 4UOZA 4UUNA 2WAXA 1EBUA 1H6CA 5HNKA 2JKYA 4R2HA 1JGTA 3E03A 1E4VA 3HO8A 3I1JA 4ZAWA 1D2MA 4MVJI 1I7SB 2ORWA 4EW3A 3GK3A 4R3NA 4CIAA 1C0KA 2DJIA 1Q0PA 3TR5A 4JJZA 2W22A 3O4RA 2A5DA 5JFOA 2PO5A 3FDXA 3JAWA 3HA2A 5DSXA 3NR2A 4G1VA 4H0NA 2HN9A 2JCXA 3GIWA 4D46A 5I7EA 1XQVA 3U5TA 3IAS6 5TEWA 5BSVA 4QFBA 4MUHA 4N39A 4G1EB 4C30A 1V3TA 5SV2A 2CEKA 2J5BA 5AM4A 3WNDA 1TF2A 2QSZA 3FGPA 3HP1A 4QXQA 4M1KA 4TKVB 2PGNA 1FQWA 2FMIA 2LVBA 2HQ1A 2EKQA 2JVIA 2X9LA 5EYPA 4HAUA 4QQFA 4DHWA 1PJLA 3I9V1 5CLFA 4E4YA 4DV5B 5LXTB 1BXGA 4HWPA 4DA4A 5F51A 4DUGD 4RIIA 1BJRE 1V95A 5A6SB 3R7WA 4JLKA 1L9XA 1GL6A 1IN5A 2D5BA 4PNHA 1QYVA 3KNZA 4LOIA 4RY9A 1BMFA 2BV3A 4RA9A 1L6RA 1NLZA 2B5WA 2XKKA 1E2NA 2JASA 4KH1A 1KWKA 1E2FA 1I0ZA 2X0IA 2BBOA 1P73A 1WB4A 1YS2X 3FYSA 4I1OA 3SEAA 1HY3A 2W6IA 3GFRA 2I2WA 3GWGA 3ACBA 1AUQA 2OAP1 4V0NA 2AZ4A 2Z6QA 4LFBB 1AO3A 5ALOA 3G23A 4AP9A 4FQ7A 3K05A 4HKTA 2AHRA 3IPLA 3K1TA 4YQYA 2QUKA 5ALZA 4M98A 4GQAA 1DDOA 1N0UA 1TQ8A 3ZHSA 3SYTA 4AY2A 3R0XA 4YK7A 5EWLA 1SCQA 4OFZA 5KOJA 4CFYA 1P2SA 4B5KA 1CIVA 2ESRA 2FW7A 4KV7A 4QBHA 1NW9B 1WAMA 4ND8A 3N2GB 1UEXC 4ENSA 4FWIB 4JH0A 3VR4D 3VX4A 3IQGX 3L84A 4GXRA 2WUEA 1GKUB 3V7FA 3CVYA 3IVAA 4BP3A 2B4YA 5CDFA 3AR7A 5ENZA 5B2ZA 2R66A 5JS2A 2ZJ4A 4HEQA 4NRDA 3LQRA 4GE3A 4NFHA 3HHPA 4RK1A 3ZX5A 4FT2A 3CUWA 5JHHB 3OEYA 5LQKA 1KJNA 1JF8A 1KRHA 2H0AA 2Q62A 4GPD1 4ZJZA 1XLVA 4HN4B 4E70A 4L51A 1LBQA 4C87A 1YJ8A 3GLUA 4DGSA 2D54A 2JLSA 2R00C 2UYQA 2VTBB 1L7AA 5JRJA 1DBWA 1L3IA 1ULUA 2ERCA 3RU7A 1XYGA 1Z6QA 4QNNA 4RSHA 5ALEA 5KSPA 2FPOA 4HB4A 4KWEA 4B34A 4EJSC 3GRYA 4MR8B 4DDKA 3LTNC 3OO1A 2PSSA 2X5JO 2XA9A 3L6DA 3JTMA 3OP1A 2HJ9A 1FUEA 2LCQA 4DLAA 4J16C 4H35A 1PR9A 2W8BA 1II8B 3FWNA 3HJNA 3R5SA 4KACA 3FR7A 3LT2A 4E2FA 2CF5A 2WU8A 1QOQB 4K2AA 4ZGWA 1C9KA 3G5AA 3HL0A 4RAOA 1RI3A 4IDFA 2VTKA 3T7CA 5LNK1 3G7UA 1QVAA 1FDRA 1RI4A 2WJVA 4WXEA 4EBBA 2CJXA 4B33A 1BKDR 5TE9A 3NBXX 3N75A 3NJ8A 3DDUA 1H2RS 1LBSA 1ZA2A 3RVBA 1UJCA 2C5GA 4YECA 1E1CA 5HF6A 5H9WA 3KZCA 1WDLA 2Y0EA 2YY7A 1XTTA 4LISA 3ETHA 4ZYZA 4GR4A 5HF8A 3KPWA 2FEKA 1J2TA 2O0HA 3AI2A 3E9MA 3KTAA 5JZOA 1ZJWA 5LUBA 2PMBA 4P2GA 1IB0A 3ZY5A 5DK4A 2HRCA 3T8YA 3C3MA 4OA5A 2WB2A 3NHJA 3BERA 3QHAA 3S1AB 1ZGJA 2LIVA 1SGWA 4JR0A 2OXEA 3GI1A 5JCZA 2FPIB 2ZJ6A 2R6CA 1JPVA 3DCJA 3OPNA 1CUWA 3QYPA 1PP4A 1ZR2A 1OA1A 2I2XB 5IUJC 4B47A 1YFJA 1OH8A 2WQ7A 4PG4A 1KRWA 5AI5A 3OTGA 1J9GA 1EB9A 3D4LA 3H7IA 3PLRA 3FHCB 4TL9A 2JBWA 4AY6A 5DXFA 4HNVA 2B2XA 3OQOA 1G4AE 3D7SA 4WKCA 4QNMA 3RC1A 3NBYC 1XA4A 4LMPA 1Z18A 3GFTA 4OKSA 4D8WA 5JI2E 5K0SA 2GRUA 4CHGA 3UWSA 3K2BA 5C4GB 4EZIA 5FUQA 5CT4A 1BDIA 3BAZA 3U9TA 4GMDA 1GGVA 3PGA1 4AKHA 2AOVA 5AW6A 1AF4A 4XB2A 1GUFA 3CPEA 3IMKA 1QIDA 1GKIA 2OBNA 4GE0A 4QL3A 5ALLA 1RHRA 3GDGA 5F2KA 1E4EB 1C50A 1E5LA 3KWFA 3N9IA 2XNJA 4NOJA 4IBOA 3RC2A 1PV4A 3IYLW 1GSOA 1NSFA 2V5UA 4Y3UA 1N0WA 2YWXA 1M6NA 1Y4ZA 1CRLA 2I03A 3FXAA 3A4YA 4OGWA 5DW0A 1E9EA 2Q4DA 1PS8A 3C74A 3KYDA 4KVZA 5U4QA 4AUKA 4C4SA 1U02A 2VP6A 3WV4A 1YZTA 3BYZA 2Q27A 1B6RA 4NJMB 4LJSA 3U80A 1Q83A 4TRJA 3E9RA 4I3FA 1X3SA 3Q7SA 1RYDA 3R0VA 4BVKA 4CE6A 1D0VA 3K70D 3ZNQA 2YFHA 3CONA 2D5AA 2A59A 4MRPA 5C8YB 5JTUA 1YXMA 3R4VA 4I5IA 3V80A 2BL4A 4UHFA 1EVQA 2Q5FA 4CKWB 4DLRA 5BPFA 1RM0A 1KQFA 2VNSA 2OZPA 3W7AA 3R8FA 2ZUEA 2CWWA 1K8YB 3ZUGA 5IVHA 1PK7A 2GBLA 3U0VA 3H1FA 1U1CA 4RFSB 1WBBA 1ULBA 2QLLA 1KSGA 3PIRA 1J2UA 3OM0A 2AKEA 1JNYA 2HDWA 2VWQA 3FRIA 3ETLA 3PR3A 3R7DA 5A04A 3L6RA 5EJ5A 5T7BA 1PW7A 4WXRA 2Q2OA 1HEIA 1TXGA 1IQ0A 2MSNA 2JRLA 2KB0A 2NGRA 4QZVA 3PA6A 1LDGA 1GCIA 3BXPA 3PYMA 3QI2A 1D2CA 1FF9A 3HXTA 5EP4A 4XFDA 1IBSA 5J40A 4CLEA 4N6GA 1ORWA 2JCBA 4MUYA 2YUTA 1QGZA 1B74A 2POCA 2JGDB 3QENA 3BZWA 2BUCA 3NBZC 3QVSA 4MV8A 4RQUA 3A2MA 3SN6A 4QDOA 5KI6A 4B79A 1EVIA 4HK4A 4OGLA 4N6OA 3VGJA 1WCV1 3OEEA 2LCIA 3UIEA 2P1DA 3W34A 5D1NA 3BSWA 3HVHA 3QF4B 1MXHA 1T9KA 3PUHA 2IIBA 3RYIA 1G60A 4ZXPA 1YR3A 1YS9A 3IBFA 5EJMA 1T6XA 3GCZA 1QHEA 1CY1A 3PNMA 2YXEA 3MCUA 3VUFA 2C0PA 5IRCD 3WYGA 1GYQA 4EIWA 5ERYA 2Q3HA 3KS9A 1LZKA 3HXLA 1P5JA 3QLEA 4H7PA 3CY6A 3QPBA 4QELA 2HF7A 5CXSA 3VYVA 2GCNA 3TOCA 5DBGA 1TQ2A 2VTBA 4OG2A 3UO8B 1E2IA 3WP0A 1ZESA 2IYYA 5DXAA 1WMDA 2VAWA 1VYTA 1N3IA 2JIBA 3DDCA 1RBQA 4RKEA 2QTHA 2Z5VA 3AQIA 1XLTA 4JL5A 2IODA 3W3ZB 4EYSA 3DBLB 3IULA 3PC8A 2DH5A 3KVOA 3LCMA 3M33A 2X0RA 5IZCC 3OHPA 4IFTA 2OBBA 3F67A 3SX4A 1EI9A 3GNQA 2J09A 4LYGA 3CCCA 1VECA 2YXNA 1OJ7A 1KZGB 1TKCA 4MWZA 2R1VA 4ILEA 1Y37A 1ZGZA 4QQNA 3BHMA 1BC5A 1YHZA 2G4VA 2G25A 2IEDA 1G21A 2VYCA 3EIFA 3JQAB 2NG1A 4NYJQ 4X85A 4D8UA 2GPJA 4RZXA 3EQ7A 3A7EA 3ZDQA 5C4IA 1LQ2A 3ESBA 4CF7A 1J0BA 2N9UA 1VFNA 4K1XA 5H3LA 1O94A 3SJ7A 2GXAA 5AVUA 4CDMA 2PTHA 1TVCA 2CK3D 4E5PA 5K6AA 1ISPA 4AULA 1QV9A 5AW0A 4DV3B 4EHJA 5THQA 3JY6A 1KOGA 5LLDA 1PGPA 1C8VB 4RPGA 3I3SR 1MC5A 4J76A 3D1VA 4JLJA 2OV8A 4DJ5X 1PYGA 4TZKA 1FXSA 2QTTA 4P0QB 1A0OA 3DF9A 3L05A 3PHIA 1XDDA 3IUPA 1DFIA 3IDOA 1XCOA 3S70A 3G8AA 3IAXA 5GONA 1NI5A 4JI8B 1YBHA 1EM8B 2PCJA 4W6QA 5EI5A 4KPFC 3JYLA 4BBAA 5B1SA 4BWGA 5IHPA 4ECEA 4V1CA 1KEZA 2VDRB 1YB7A 3AY3A 4BVEA 1HE2A 1KI6B 4DIBA 4WADA 4F3NA 2E89A 2IKSA 1J2JA 3PBKA 2ODBA 1R0SA 5L3SB 1TA9A 3UJ3X 1XTSA 1THGA 2EBHX 2ETXA 3DGFC 2DCUA 4RE6A 1W88B 4TLCA 3LBAA 1DC3A 2E6UX 2XIQA 2FR8A 4L9AA 1P5HA 3A6LA 5B3JA 1OC2A 2F3QA 1YBVA 4KQWA 2QMEA 2ZQZA 2PNJA 3TBFA 4D8XA 3IDFA 1QVVA 1PEAA 1FUKA 3OF3A 3R3WA 3ZK9A 3AFIA 2EQBA 3CZPA 1RQPA 4PXSA 3S68A 5KX5A 4HXGA 5F73A 1MABB 3PITA 2PGJA 3I52A 4J6EA 3RSOA 4CCWA 3HN7A 2VHXA 5G4KA 3B1ZA 5AUQA 3UW3A 3K09C 3ER8A 1NBEA 5LKAA 1O6GA 1RLTA 4RELA 5DI9A 4QT4A 2Q5JA 2QQFA 3OTIA 1VLVA 3B3QA 1DT3A 3T7IA 3OJXA 2H1HA 3BOSA 4IDAA 4Y8VA 4ZVMA 3DA8A 2H59A 3G0BA 2Q8NA 3IV6A 2NU8B 5IKEA 2Q3LA 4DDMA 2IXEA 4HDMB 2ZVPX 1V2HE 2Y1EA 4GMGA 2DQSA 4B7AA 5JY1A 1P5RA 3HO6A 1RXWA 2VVTA 4BMOB 3KAKA 1XCLA 1CZKA 4UNIA 5FI3A 2EFEB 3U7JA 2XUIA 5D3QA 1DMSA 7REQB 2V1UA 3K0HA 1JIUA 2AMLA 4PM4A 4CMBA 1OZGA 4DJFC 1ZOLA 4YJ3B 3W1EA 3KXKA 3TCKA 2AV6A 4AROA 4BE7B 5AM5A 1AU9A 2TS1A 4GZLA 3SBXA 3EMBA 3LQ2A 2GK7A 3GFOA 5EWMB 4RORA 4F9TA 2ADOA 2V6FA 3WBJA 2PE5A 2WAAA 1QGED 2I6QA 2O48X 1Z9BA 4P5PA 3RKUA 1VJGA 1VPTA 4ENVA 1E9AA 3H05A 2VPTA 4JEMA 4KQFA 4MGYR 5KDLA 3RYHB 4B87A 5ADHA 3AJEA 5FCDA 4Y1RB 5E2IA 2Q5CA 4AJNA 1XXHA 2C7GA 4H59A 1O95A 2H9IA 1SQSA 3DPUA 3NYRA 5JAOA 3TBKA 5LSAA 1M8JA 1KIAA 1C7FA 2Y0PA 3IHWA 5AK3A 3L0IB 3GRRA 1KO5A 1XTVA 9GPBA 4OQNA 1UBJS 2VNHA 1TK9A 4IH9A 5EJ7A 2ZBUA 3MD9A 3NBKA 2JEZA 3ND6A 4K1LA 4ZC1A 1F2DA 2PUTA 5ER9A 3GT7A 1DIBA 3N0XA 1JKJB 3DAPA 3R6DA 4TYQA 4JIGA 4UNNA 4YP7A 4D0NA 4OI0A 5DGIA 4D3SA 4HCJA 1MEEA 3VR2A 3S1SA 4H77A 2QTZA 1YQQA 4BBPA 3JQCA 4YAGA 3W9BA 4MS4B 3PNSA 4KGVA 4R7TA 4BZPA 3DZCA 4WLNA 1WTAA 1W36D 1UQRA 2G0NA 3L4EA 1R0BA 1M7BA 1INLA 2I4RA 3ELBA 4LDRA 4M0DA 4RF4A 5BT9A 3T3EA 4C2UA 1WXQA 3E2PA 1PUIA 1Q0TA 3D6AA 3G2PA 4AF8A 3UA4A 4C08A 2XYHA 2I80A 3M6IA 4ZXFA 1U7PA 3OSZA 2R5NA 5U4XA 3NH6A 3L6CA 3RUIA 1II8A 2XCTB 4FX5A 4ZOAA 1WXXA 3PQFA 1EHIA 3F7NA 1XKQA 1IUNA 5KHLB 3OBBA 3AEQB 4JJFA 1KAOA 4AZSA 2KPOA 3WA7A 3UV3A 2ZB7A 3ABZA 2GYUA 3JQ8B 5G0TA 4LNUB 1QP4A 1W2GA 4ZOLB 2VBFA 1SPXA 5A0VA 3CFYA 3QU4A 2GTHA 4NL4H 4Y9TA 4MDYA 5HK8A 1SVIA 4P4LA 3ZJYA 3O91A 2O54A 2BWJA 2GJ4A 3I9MA 1C9JA 3K73O 4ASUD 1JKFA 2OV4A 3D7RA 3GH3A 3OA0A 4C29A 2X6QA 2EZUA 1AX9A 1HZZC 3U49A 1W4LA 2IYWA 4RTKA 2GN0A 1NBWB 3V33A 4EHAA 3IE1A 3EPJA 2EFHB 1K6EA 2EKPA 3AINA 1S2GA 2C3PA 4YS6A 2FLKA 1IJEA 1JX6A 1N6PA 1RIFA 5KKNB 2YV1A 2V7VA 3AEQA 3T7JA 5IT4A 3A4VA 3CINA 1DZIA 5EXXA 3D7LA 2EZ9A 1H8ED 3K0BA 3M5PA 2JD0A 1JLHA 2V6MA 4NF2A 4RIGA 4Y2UA 5DYTA 5EWLB 3ZV7A 5LWHA 3NVMB 5THKA 3Q0EA 2Z6VA 4H2DA 2FDRA 1YDHA 3BWYA 1NV8A 3O4IA 4CQJA 1QK4A 1D6SA 2OLKA 2R2AA 5BSRA 1RHUA 2XUZA 3KPJA 1SOMA 4X41A 2Q6VA 1RI5A 2VPXA 2XQJA 3EDCA 1QAOA 4NNJA 2MR5A 1TO2E 2A0YA 5DGTA 3U26A 1C9MA 4NU6A 4DG8A 3ZDAA 1K89A 1TECE 3FVVA 4LTDA 1E2UA 1ZD4A 4CYMA 4QEDA 3UQYS 2HIGA 1GNLA 5HGJA 5K3SA 4BO8A 1G2QA 3ENZA 4OD0A 1NG1A 4HWOA 1A5SB 5A9TA 4RSMA 4CM9D 4U2DA 2CJWA 2RBGA 3HLTA 4HAXA 5DNDA 1FTSA 4E5VA 1T2CA 3GXBA 3KIPA 3HUUA 1Y33E 1QHIA 2GCEA 3O95A 5JOQA 2OO5A 2GKSA 3BWXA 3MHTA 1B16A 1FX0B 2PWZA 3HNOA 1W35A 2ZSHA 1YS7A 3TDNA 3A70A 4W9MC 1KDOA 1EEXB 3BWCA 3FTNA 3RGGA 3NXKA 5KVCA 1VJ1A 2HAEA 2I3GA 2XMDA 5GOTA 1U8EA 2VSOA 3VDRA 2BFWA 2XSZA 5C51B 3CNLA 1V8FA 4PVDA 2ZIAA 1JJIA 2Z56A 4DARA 5M04A 2PFSA 2QMZA 4CLHA 1FP1D 2CLDX 4OU4A 3RRBA 2Q1WA 3ND5A 3OPMA 2Z04A 4MINA 5IH7A 1W2WB 4QEKA 4CMJA 5C8ZA 2IF0A 1HDGO 3RUCA 1XRNA 1R4NB 4HNUA 2PT7A 3BS4A 2XCSB 1DEOA 2HPVA 3RLFA 4L57A 4BEBA 4DWVA 2JFYA 1N2CE 4HFJA 5EE9A 1NLUA 2G7MC 2OZKA 1ZI6A 3DMFA 4FEAA 4LRWA 4WKNA 5C31A 1K7XB 1DIHA 1CLEA 2C7VA 2O1WA 2WWRA 3EVNA 4MJLA 3IDZA 4YJKA 3O6VA 5JBIA 3GEHA 3D8RA 4JLPA 3I45A 1WZEA 3Q5GA 1IULA 3EA5A 5TXGA 3IHKA 1TLTA 2Y9MB 2JGEA 3OQ6A 1I14A 2F9MA 2O0LA 4ZMRA 1YQ9A 2DPYA 1HNNA 2V96A 1GQRA 1FYDA 1JG1A 1ODLA 3IXQA 4CG0A 4LJAA 1YA8A 3BQMB 4AM8A 3IAAA 3UUGA 5HIKA 5K9ZA 4W5TA 1ZN2A 4DC9A 1FMCA 3G8BA 5CH8A 2GZ2A 4H16A 4MARA 2V8BA 3MJTA 4BO9A 1MRNA 3A37A 5FX2A 4C20A 1HDCA 3NIDB 2E48A 4PLTA 2PN1A 1ZUWA 3P2MA 2AC7A 4UTXA 5CG2A 1H6AA 4RV9A 1QJCA 1BS1A 1YS4A 1GLGA 2G5CA 2EF0A 4YMVA 4NP6A 5GV7A 4BBJA 4R31A 3ESQA 3FGZA 3RVQA 1ZITA 5AOVA 2YZGA 2WM2A 4EJSA 2HHLA 4P86A 2L82A 5CXUA 1Z4LA 1X13A 4JUBA 4KO4S 4QX6A 1DKPA 3HKEB 3OZSA 2ID8A 1SOWA 3COWA 1L8QA 4IRXA 2VTVA 1YACA 1O9HA 4MVJE 2EKBA 2QMOA 3MJHA 4M54A 1CDZA 1XHLA 5CM9C 4ZOLA 4IKOA 1EVJA 5BUCA 3KQYA 1SELA 2ZDGA 4LMAA 3O8OA 2DY1A 5EJAA 3S81A 5HRUA 1Z4IA 4KXQA 3L7DA 4MI3A 3PTAA 1JN0A 2NO1A 3I9KA 3HZRA 1T5HX 3IP6A 4IMRA 2GRJA 1SA0A 2X40A 2BEWB 3R7WB 3BC1A 1H66A 2J3MA 4E5SA 4PZ9A 3F97A 4BVJA 2M6KA 2ZROA 1UMCA 2RK6A 2NZWA 4HX9A 4O0LA 4GOOD 5L3QA 3IIIA 2I4MA 3NAMA 1AUXA 4X94A 3P9YA 2ZSEA 4LK3A 4UFOA 3BB3A 3FSEA 1JFVA 5DJ5A 4BNUA 2E5FA 3MCWA 4OJTA 5DO9A 5KQLA 2BJWA 2PXAA 1ZR4A 3A6JA 4CEIA 4IM7A 1A4IA 3RT9A 4IOMA 4H1TA 1KJ9A 3BJRA 1F8XA 1HFJA 3D4IA 4PINA 1OFVA 4KO1S 3WP1B 4MW4A 3UAXA 2ZTMA 1K98A 1LNQA 3ENKA 1CUBA 1DQRA 5EMLA 4LDJA 3I8SA 4AZVA 1DWUA 2ZUBA 2HGZA 5B36A 4CM1A 4G56A 2C54A 2CLOB 5KYWA 3FOZA 1KERA 3FI0A 4AYTA 3OPXA 4YRIA 4K0RA 3NAQA 5KIAA 3TDMA 2DTXA 3FNQA 2I7XA 3G02A 4DLTA 4KODA 3FWPA 2VH5R 4BMPB 2BKAA 1VIVA 3SS8A 4PCVA 2A9FA 2OHHA 3G17A 3ZPXA 3PC2A 3F98A 1G98A 3R77A 4IPTA 2Q9BA 1W4BA 3PIDA 2QUBA 2ZTVA 2IYTA 3GLGB 4KJXA 1Q1GA 3HL4A 2OMEA 1U3CA 3ESXA 4FYVA 1UC8A 4RVGA 4ZO9A 4BFCA 3ZXYA 4OHZA 4TVSA 2J5KA 1PU2A 3KAPA 2Y0DA 4JBXA 1M34A 2BKXA 3D8UA 4JI7B 1MIOA 4PLZA 4PAQA 2A57A 2QX9A 5HJ5A 1VCHA 4LI3X 4NX2A 1DFHA 1PUJA 3B6JA 1DBPA 4RHTA 2DFTA 1JHAA 1U9JA 3PCXA 4D6PA 2VUTA 3KB2A 5K8IA 1XZMA 5BYKA 1AMOA 4OMCA 5ECYA 3EH2A 2QT1A 2GI4A 1F5NA 2QDXA 5A5DA 1ZXXA 3BZBA 3BGVA 3CLRC 1QR6A 2BGTA 3DV2A 2X9QA 6CHYA 2FW6A 4NATA 3R7FA 4AUMA 3THRA 5B3LA 1Z45A 2I1VB 5AI8A 1P72A 1YONA 2VRCA 2J3EA 3KFXA 3NPAA 4H7JA 4QOSA 3ILXA 4TL8A 4UVGA 5JG7A 3U9LA 1YVUA 3M2TA 5JDIA 2GFHA 3GFBA 3WKDA 1SIUA 4NAUA 4I6GA 3ZD9A 2Z2KA 4GIBA 2OKCA 3LH5A 4FMDB 1RP1A 3N39C 4EHKA 1DRUA 1US8A 2VNIA 4AAYA 3L7CA 4ZVUA 3WR5A 2WYVA 4F72A 4Y1RA 2O20A 3PT5A 4BEJA 5I5EA 2BGKA 4QPJC 4ZYWA 1TZKA 1EINA 4EJ0A 1N36B 3AM1A 2FMTA 4GRAA 4E08A 4ZI2A 4E12A 2C7OA 5J4HA 2W00A 1QAMA 3PS9A 3AKYA 3ZIAA 4KUHA 1FNMA 4F38A 2P9EA 3CLUC 3FUWA 5DTRA 1DQZA 2JFZA 2TYSB 4J1QA 1NJ2A 1SBHA 3ZVRA 1AG9A 1RM3A 5AJXA 1FOEB 2WIDA 3GROA 4GZ5A 4HC4A 3KZNA 2HMWA 1XJCA 1IE3A 2OECA 3MBKA 4FSXA 1J6UA 3H5VA 2FPMA 1KVRA 2Z9DA 3RD5A 4BRZA 2VHTA 2O8CA 2FOLA 3UC9A 3VYWA 2WKQA 1J7KA 1L5WA 4OK5A 3S55A 2GM4A 4DQUA 2C2YA 4IQ4A 4TTPA 5D6OA 1NBHA 4DW8A 4XUGB 1AK9A 1AQIA 1JA1A 1GRVA 4FBLA 4Q4LA 3UCXA 1XPOA 3I5UA 3A1VA 4BLPA 4DDTA 2FVXA 1NN5A 1QVWA 4IW3B 3VQTA 3ANTA 3HC7A 2B3TA 4QGFA 3VHXB 2FUG6 3GGJA 4Q19A 4PQRA 4TMYA 1C8LA 1I4DD 2FR1A 3NC4A 3ABSB 3VM6A 4O8ZA 4BNJA 2IU0A 2BTQB 3GLHB 4ME6A 3U60B 3B60A 1DWPA 4LXGA 1JEQA 3IUYA 4JA0A 2NNLD 4O2RA 2IHKA 2G72A 3II6X 1AC5A 2VXOA 3HI4A 3MB8A 3P5SA 3B3FA 4EVSA 1UOEA 3DJYA 4C6TB 1OBVA 3HV2A 4Q15A 5AVVA 1J5EB 2RAUA 4JGIA 1Z22A 1PL7A 3MJFA 3OWOA 1YJBA 4TXMA 3KEQA 3OCWA 2P2LA 4NZZA 4PPNA 3ZWNA 1FRFS 1M1XB 1ZOSA 5D00A 5DE3A 4EUEA 4F11A 3KFLA 1NKVA 4KTTE 2DPXA 4LG1A 4KQ2A 4RANA 3WAJA 3FLAA 4B80A 5D7NA 7ABPA 2WICA 3IE2A 3VSEA 4I50A 5ICCA 1Z4NA 2O5VA 2QQ5A 1YBMA 2CVFA 1GJRA 4D45A 4UTVA 4PICA 4KIJA 1AH2A 1YK1A 2YIJA 3QBJA 2QRQA 3F0TA 5AJZA 1CVRA 2PKWA 1BG6A 1QHYA 2QTBA 3CE9A 1H69A 3RSFA 5K4HA 3OQIB 3ANMA 5KBYA 1U2ZA 1CU1A 1O0SA 2QLMA 3X2SA 4EKEA 1X6VA 1YR1A 1WEKA 5JMWA 3HJTA 1YRWA 4I3GA 4FU0A 4RLFA 1M10A 1ECGA 2QEQA 3N05A 3SQXA 3GLRA 1TLFA 4P34A 1ZD5A 5AHKA 2FMXA 1AV6A 3QVUA 1IUPA 1UBOS 3RSZA 4XYEA 2XBMA 4MROA 3UT5B 2C4HA 4LZLA 1FUUA 3KVYA 4TRMA 1TZ2A 1A7UA 3BGOS 5C53B 3EPKA 4ARCA 2Z57A 2VJLA 2GFQA 2W58A 1KYTA 4J2TA 4PYIA 3DW1X 4CKXA 4IWYA 5U9CA 2EQ5A 1GRCA 1P8JA 3ZHBA 4JQSA 3UGKA 3I8XA 3JRXA 3LUFA 4R1OA 5D2CA 3R3JA 3TL2A 5ICGA 5JECA 1Q12A 1N8NA 1Q2UA 2EXXA 1BWPA 3FDZB 3A9RA 4MR8A 2RHTA 4NNOA 3VU9B 2F4NA 3GRFA 4KK3A 4A8JA 2OYSA 1WW3A 4NV1A 2ZR8A 3RVKA 3VR3D 3NHPA 5DIFA 3AHGA 1N5DA 3RPEA 1Y6FA 3UJ8A 3AIKA 4P3KA 1ZIYA 2YV3A 1TJNA 4YY3B 1F51E 4O6VA 4JGBA 2LDXA 3HA7A 1OKKA 1BYIA 4EUFA 5J4LA 1ZMTA 4FPXA 1FMFA 5CD1A 2O4UX 1AB6A 5C1PA 5K03A 5G0SA 2PMKA 5MDHA 3T3IA 4OSOA 2WU1A 3DUWA 3IX7A 3AP2A 1E0DA 2P4HX 1PJCA 1O8BA 3RRYA 4D81A 1CF2O 1EUDA 1KE2A 5JEEA 2O6LA 5HMLA 4PZEA 2YH2A 5BSUA 2OB2A 4LF9B 1NQOA 3CPHA 1SXQA 1Y81A 1TF5A 1IEVA 3R24A 3DZGA 3KVNA 4YT4A 3KLBA 2QN8A 3TVTA 1QOZA 3RVMA 1M2EA 1RHMA 4W9NC 1OHHD 3O94A 4TLEA 3PFCA 2PD3A 2QAGB 3MN1A 1GPUA 1ZK3A 4GX1A 4P22A 4UTNA 2XZOA 1GN9A 2QI9F 1P80A 1SXJD 1ZJ5A 1Z4PX 4CLOB 3HA3A 4LE1A 1XZKA 2EZTA 3HJHA 5DSTA 1L5VA 3QG5A 4M0PA 2NPOA 2XDQB 3UENA 2NO9A 1T9GS 3D6NB 2PMEA 1CXZA 3P0EA 2GARA 4GOXA 1V5WA 2F62A 4JITA 4PTYA 4J7CA 4PXAA 3R3ZA 3U13A 5BW8A 4DSZA 4QPPA 3ETGA 2Q5IA 2HU5A 4GHWA 4WCFC 5IX8A 1Z2NX 2HRRA 1V39A 3ZWWA 3QE0A 3B52X 4MVJM 5CW2A 4HQ0A 3W8FA 1MB0A 3K9CA 1WCIA 1KP3A 4M49A 2B1IA 2PEYA 5T4HA 3U1TA 1YQWA 3PP8A 4M1QA 3BZUA 3H84A 4FCCA 5AR1A 1KFBB 2ODNA 2ZETA 3E2IA 3DJFA 4JJ7A 5ALHA 3DFFA 1TUGA 2IYQA 2JVKA 3JQEA 3ELDA 2PS3A 1KDYA 1WV0A 4G8JA 2IY8A 4J75A 3U7RA 1EK0A 3IUQA 2QTVA 4RACA 2I1LA 3LT1A 5JLAA 3IVRA 4WFIA 2I6UA 3PEEA 3Q7PA 5CX1B 5KVQA 3I1YA 4NYMR 3ROXA 3LIPA 3SJZA 3V3TA 1FFBA 4WK0B 2JLVA 4WK6A 4D4HA 1OU0A 2O5RA 3O1HB 2E55A 5I7VA 3T95A 5L4SA 4G0UA 4LYAA 2C3MA 1ATIA 3TD6A 2B4AA 1E9DA 4Z4CA 4F7WA 1WBDA 1DS6A 2BAGA 2AR7A 4EG1A 3F4KA 2K7ZA 2OV2A 4YAWA 3C8DA 3SZ3A 4XVQA 1RCFA 2C5LA 4GPIB 4LYYA 4NTZA 5IZ4A 2IEBA 1PVVA 2JLZA 1NOJA 3GZNB 3H3XA 3NNSA 3AUXA 3OBIA 5HCNA 1C80A 4MA4A 4ZI3A 1RP7A 4JLSA 1I2CA 2CMFA 2ZQ5A 3LPNA 1Y6JA 3VU1A 1VYUA 3ZQ6A 4C7JA 1KO7A 2LUOA 2AK3A 2Q5QA 3DUFA 1ZD8A 4CIWA 2FPWA 1JTEA 1PIWA 3QE3A 4RLQA 5AK0A 1U5CA 1NQ5A 5CVDA 1LJ8A 4J2OA 5CVUA 1YVEI 2X6TA 3LS2A 5GGYA 3MD0A 2JI9A 3OE1A 4GI3A 4Y2RA 4HF7A 2JJ2D 2NUTB 4DWWA 4L4YA 4Q1CA 4Q37A 3URKA 4CL8A 4O4LA 4Q00A 2D1QA 2I8LA 5JQGA 3NHAA 2O2SA 1L4NA 1S8AA 3CB4A 1B15A 1U0SY 3O92A 2H3EA 3VSDA 5K0EA 1ISRA 2DFLA 2QT0A 1ULHA 1PV2A 3PGXA 4D8YA 1XMVA 4HDMA 2P1ZA 5EFOA 2AI1A 4EA8A 2HSWA 1YQGA 4JR1A 4QQ8A 5KC8A 4NHEA 2RAVA 4M1EA 2F1KA 2XCOA 3OKCA 3NS7A 4JC8A 4MMZB 3DMNA 4EA6A 3PFHA 3OLZA 3I39X 4OFBA 1NHGA 4B9EA 4ZGGA 1RWPA 3FHTA 3WNBA 3EZGA 3OOSA 2Q4EA 4K9MA 3KQNA 1T0PA 2EFCB 2BI4A 4W9NA 2CDBA 3FCYA 3LL7A 3B3AA 2WB4A 4P82A 6NULA 3T3PB 3PFWO 4FGSA 2AVDA 3G2MA 2L18A 3BK2A 3GUHA 3UOWA 1Z8NA 3ZHQA 4WVLA 4HGZA 1H05A 4GR5A 2SECE 4N0PA 3RVDA 2N42A 2Q1YA 3BRQA 2QP4A 1IH8A 3GEIA 3I0ZA 3SSMA 3ZY2A 6REQA 2ANBA 2W2NA 1E3TA 2BEUB 2A84A 3EX7C 3F5QA 1QG6A 3FTPA 2W6QA 4X65B 3A28A 3AUSA 2BFDA 3ZG6A 1D6MA 2EW2A 2JFPA 4CNQA 4RXMA 4I9HA 4MR9A 2KM1A 4MDEA 2HBYA 4NBVA 4LVUA 4D9NA 4ZZ2A 2ZBGA 1DOHA 3WO0A 1T6ZA 3IAUA 3UKDA 4GP6A 3WBKA 4H1UA 5FUXA 3UN1A 4O2BA 1M2FA 2JFQA 2NZ8A 4INAA 4IVNA 4LKOA 1QWSA 1E6EA 1J5PA 3AIOA 1UBSB 1YZUA 2CLFB 5FBKA 1HSOA 2ZKIA 5G4KB 3CRQA 4CXMA 1N5OX 1TQDA 3FR8A 1Y89A 3UXHA 1V11B 3IKTA 2NN3C 3WB0A 3WB9A 1IWPB 1P1KA 4JQOA 2Q4TA 3FX2A 3Q41A 3GRCA 2KWIA 1HXHA 3TCNA 1L4KA 2BI8A 1UOPA 2FF7A 3W78A 1PX0A 4DMGA 4HDRB 1DJLA 1F9AA 4RJIA 4IX9A 3SKXA 3V3KA 3V32A 3J7AC 1L5FA 2QVGA 2QRZA 1M0WA 2DLNA 4RMIA 4RDIA 1F6BA 1F8YA 3GDOA 1LBEA 1WLYA 2EIHA 1N9ZA 2Y3IA 3OPYI 3QITA 3LDHA 3R3UA 4MIEA 2Q8QA 3WLJA 5BWMA 5CFLA 1YBFA 4NH4A 1AK1A 1O97C 3BSYA 3KZMA 2GFIA 3PNPA 4CU2A 4B83A 4D5GA 3DE3X 3NEPX 3H5WA 3Q1KA 1L5KA 3V6MA 4BHTA 1UMDB 3BJZA 4ALJA 3O75A 4C7KA 3H9GA 1YQUA 2WAOA 4EP1A 5YASA 4AKGA 1T6YA 4J1TC 5B4TA 3LY5A 1I3KA 1ESNA 3AFGA 5HEKA 5JI3E 1MH9A 1I0LA 2XXAA 4GI2A 1FP4A 3QWIA 5KTTA 1BWSA 5CU7A 5CVEA 1J21A 2H00A 1PYDA 3MIZA 1PJ8A 2GBLC 3FYCA 1ZJ6A 1V6CA 3U62A 3EVAA 1ABEA 5ERGB 4L6IA 5A3VA 3VI3B 1DTWB 3S2GA 4I8IA 3IURA 1ZH8A 1H2YA 1EWQA 1BKSB 2Q1UA 2EERA 3DL0A 5FWYB 4KQ9A 1KI1A 1ZKDA 3BQNB 3U7IA 3HKDB 3EVCA 2J9ZB 3DLCA 4B81A 2HO5A 2PPVA 2W2KB 3PU6A 3G2JA 5IAAA 5B55A 3JR7A 4Q16A 1T5TA 4E5YA 1D0SA 1RT9A 2CLCX 3MAGA 3DPIA 4F21A 2PH1A 4XX1A 2AFIE 3ZS8A 4TM7A 1OFGA 5CURA 3QRWA 4CM8A 1FNBA 4EAAA 1ZP6A 1NP7A 4X61A 4OPMA 2H07A 3QPUA 1HKUA 2BRUC 2OHOA 4QYMA 3DXYA 4IS3A 1ID8A 3S8EA 3QFTA 4MAMA 2MDTA 3K1AB 1VCMA 3FZYA 4H7FA 1Z36A 3Q3JB 4OHKA 1VE6A 5AXCA 2X0EA 4ZRMA 3BHNA 2MSDB 3WB2A 1CUAA 4EPTA 3KPVA 5LN1A 4PX3A 1KYZA 1Y5NA 5LXTF 1M34B 2HA3A 3K71B 3KUUA 3WLFA 2IHBA 3PNVA 2G07A 5J5AA 3WHLA 3G2NA 3BE4A 1QS0B 3ZGLA 3IEPA 4B3GA 1KR5A 4NDAA 5AXAA 2C3OA 1G38A 3HP7A 5HTKA 1A4XA 4AWAA 5KSZA 2PWPA 2AYZA 1LQTA 4G5FA 4WEOA 4XR9A 1U2PA 3KJGA 5LA6F 1F8GA 1KI2A 2WE7A 4ENPA 4AQ7A 4I1PA 3WIEA 4BJ5A 3K32A 4ZCPA 1GPWB 3R9IA 2R65A 2AQKA 1R66A 5FL3A 4AY3A 5CEFA 3OJFA 3TLKA 3C1AA 3SYMA 2J31A 3DP9A 3A7DA 3EIHA 3WB1A 1IL0A 5CFPA 1A82A 4L73A 2FE4A 3GT3A 5K1ZA 1V2GA 4K9DA 1NU8A 4X90A 5ALRA 3RG8A 4EGSA 5EQDA 5L53A 1NUTA 4KWHA 5GM2A 5I7HA 2F1RA 2MYTA 3K0KA 2RHLA 4XZ3A 5J5VA 1AO0A 3ZWYA 2AQ8A 1U0OC 4TUYF 2DYKA 4IQ0A 2D74A 1H4SA 4W5NA 3EVZA 2WD8A 1QIIA 3GCXA 3MS2A 4WZAA 1KBOA 3HCNA 2XSZD 1U11A 4UAVA 4Z2AA 2O2CA 4V2UA 1O6ZA 2NZ2A 2DRIA 4L5BA 4MEAA 5A71A 2F3PA 4MX8A 1ZNZA 4C0WA 1SUBA 4XEUA 2ZSJA 2VOEA 3TGLA 3CLSD 3NTQA 1I2MA 2H92A 2XV1A 3QEJA 3O93A 4LY3A 521PA 1PR0A 2ORIA 5GJWC 2YTZA 4OLJA 3DLIA 2IYVA 1RTKA 3LWDA 4JP2A 4G2TA 4ENQA 2X6RA 5B53A 4M7OA 1F8FA 1JR3E 3HVKA 3L7IA 5MGNA 4AX4A 4U2FA 2AF3C 4UPEA 4TYWA 3CZAA 1AS0A 5IBQA 5KOIA 1CK4A 1MZPA 2VQDA 1J8YF 2Y05A 5ITZB 2YMMA 3S7TA 4BFVA 3KSDO 4J0EA 2RD2A 2FZ4A 4QJ5A 4EW1A 5LJIA 5IULC 1F3OA 4JFAA 1G59A 1KY5A 5AD1A 1L5HB 4IX1A 4MW2A 5EEGA 2UZ1B 2ZSIA 5AQEA 3DZHA 2IDMA 1AGNA 3GEBA 3HCDA 3HRHA 4IJMA 3BORA 3NHYA 2AZDA 4DCJA 4CKCB 2HHAA 4GKBA 1U8CB 3RQIA 2GH1A 5AKIA 2W98A 1H5NA 1JUDA 1FNDA 1QH1B 3H2HA 3WMGA 1FDVA 1Y3IA 3EW7A 3QZUA 3R7SA 2AOUA 1XRQA 1VKOA 1JHOA 5B3JC 1S1CA 2PVSA 4IF4A 4KYVA 2OWEA 2J08A 4D74A 3PPYA 4MB6A 1M34E 1LJLA 4NCJA 4YRPA 2UZ0A 1F2TA 4J0DA 4HWGA 1FTWA 2NU9B 5J43A 4KIUA 2A2ZA 2IC5A 3ICCA 4YPFA 4B6SA 1XQXA 4JFRA 4FT4A 3JQBA 2H2GA 4G5XA 4YMTA 1D8AA 4HUQA 3T5DA 4WBNB 4C4PA 3RRMA 4ZP1A 3MZ0A 2CD7A 3E82A 5ETJA 1QGUA 2R87A 2G5PA 4X3OA 4E09A 3PJRA 2CKMA 1R5JA 4JMLA 1PR2A 3CJRA 2A14A 2E21A 1DX6A 1HYEA 2H06A 4KBYA 4WDRA 4WY2A 4Y2YA 1LEHA 2J4DA 3HZHA 2Q6IA 2QVBA 3I05A 2VPPA 4HDCA 3W2FA 5LMNB 1I2BA 4FYHA 2W11A 4E5DA 3WX0A 1U2GC 1TE2A 4PHFA 1EP9A 3K20A 1TEHA 3JQPA 3M83A 5FHQA 1JQAA 3JZAA 2VK1A 3FNHA 1T43A 4RF2A 1NJ5A 5IAJA 3BWBA 5JXGA 3T1OA 3CLTD 4LXXA 5FWYA 2EWVA 4B3FX 1O94D 3IMFA 2X8AA 2XW6A 2Z3WA 4DSAA 1UXGA 2I67A 5IJZA 3WZ2A 1G3RA 4RJ2A 5AICA 1IXZA 3FRHA 3M8KA 4MHOA 4PGFA 2P5TB 2PFGA 3L1VA 4CM8B 5IEJA 4RS3A 4W8GA 1CEQA 4I8DA 3QU2A 4BQQA 4A8PA 1VRCA 1DAEA 4MS1B 1Y1SA 3DKVA 3I6IA 1DC6A 2B1QA 3T9DA 3VR0A 2V7QD 3EDRA 4IXWA 3WGYA 3LK7A 3PX7A 4FLEA 2DFNA 2WHQA 5ELXA 1CUIA 1KNXA 1JQLB 2UYOA 3GY0A 1DCMA 1XZNA 5CJPA 1VMEA 3RJMA 2WYIA 3KBOA 3BUSA 2IXGA 1USVA 1EDBA 5KQGA 5KNBA 1Q1EA 2B6HA 3C7KA 4UFNA 3HJFA 5IHXA 1AXGA 4FR5A 1XLTC 2FETA 2G9ZA 3O3OB 1T10A 3TX2A 3R5JA 2B1JA 1ULSA 3ZBTA 3FUUA 4QTXA 1A9SA 4A2WA 3HWWA 4QJIA 4BN4A 1Q0QA 1SIOA 3EGOA 4YMGA 1SWWA 5JFGA 2WFAA 2XOKD 5LIRA 4Q7MB 2IBSA 2P6RA 5TPWB 2FMFA 3F3SA 3F6EX 5CCEA 4Q6WA 3DVRX 4ZALA 1ISIA 5BYBA 1B8UA 1JE1A 1AKNA 5AFSA 2XZLA 2OYRA 2BT4A 4NOMA 2IUFA 3MJRA 3GJ4A 1IZYA 1QVRA 1XAIA 2VATA 1LWNA 4AB1A 2ZYIA 5DX8A 2XT9A 3FOFC 5D84A 3L1IA 5COQA 1ULZA 3UH1A 1PR1A 2BCGY 5EAIA 4FSHA 1AA9A 1EVLA 4CCYB 4B6EA 3I62A 2BHTA 2X2PA 2VQEB 2I87A 4FNAA 4P4GA 1ZIXA 2PTGA 4IIUA 3NASA 3RTGA 4AMUA 2O2DA 1SEVA 5A4MS 3MTDA 3RC8A 4BVBA 2CFCA 4DCNA 1GGNA 2F00A 1Q5PA 3LFTA 2QJOA 2FVYA 2YN2A 4JN6B 4TMTA 3W5IA 2RGRA 1C3EA 5EJ4A 2NZJA 1L4BA 2YYZA 2AYXA 3AUKA 3G1TA 4ZZ1A 2HO4A 3V1KA 3C6MA 2VKQA 4HDAA 3AJ8A 4Q9JA 1QYDA 1B00A 2VOJA 4OFWA 3CUYA 2Q6LA 3G1UA 1ZXLA 2MOKA 4ND2A 4BX8A 5CBPA 1JQJC 1LS1A 4OUDA 2OFXA 4PCUA 4A92A 3CSDA 4E4RA 1WMEA 5C80A 2HFKA 5IM4A 3FYUB 1VI5A 1IPFA 1UKCA 4DIMA 1L3CA 4YP9A 1F4LA 1RHKA 4M0FA 2YY6A 1BHSA 1NR7A 2AX4A 4BP9A 2HF9A 4KQ1A 5EMJA 3E9QA 1ZS9A 4NZ9A 2P27A 4LK2A 5E6RB 4AJ4A 3VNSA 2XQVA 4QJ3A 1U9IC 4N3BA 1L5HA 1DARA 5BSFA 3UT5A 3K31A 2QXTA 4FZRA 3A3YA 4CWAA 2GN9A 3PGKA 3U7QB 4AKEA 1R8XA 2O2GA 1KYQA 4XD7D 1RKBA 5TPWA 1EJBA 3Q0IA 4II2A 3EGCA 3VPBA 1B1AA 2BJVA 4PRYA 3AVYA 2MIIA 3EGXB 4ZEXA 1UBUS 3SC2B 5BSKA 1D4ZA 3H2KA 4CKEA 1YZKA 4RIFA 5FR1A 1R7RA 1ECBA 3ZZ0A 1JILA 1YD7A 3OQBA 1NW3A 3T0GA 3RC3A 3TB6A 2IJGX 4ZAVA 3TLBA 4EI2A 5FD8A 4QO7A 5I8PA 3SXUB 1RYBA 4OHFA 5LFAA 1AMNA 1OIXA 1IXRC 3CH5A 3E3MA 1FFAA 4IMIB 3LVQE 3AV0B 1QX3A 2VH1A 4JLNA 2YY5A 1RFLA 2BUAA 4A10A 2XODA 3QVGA 1LTQA 4FQ8A 3TRIA 4C14A 4EQ6A 4LX0A 4HPJB 3ADOA 2PBZA 3DOJA 2EW1A 1D1QA 2MCFA 4N54A 1LB1B 2HWYA 3BCUA 3OECA 1QG2A 2ZUWA 1E18A 4G23A 4GS5A 4WKOA 1OGYA 4COKA 3A1UA 4X97A 2DMRA 2FRDC 2VJYA 1YFKA 1IHPA 1LF0A 1FP4B 4AURA 2JG3A 4IHKA 4NZOA 4DN6A 2A7XA 3R7BA 4Z4HA 5DM70 4QXAA 4KRYA 4GF5A 2ZJ2A 3CS3A 4ED9A 1SBNE 1IM5A 1Y7HA 5J4KA 2ZOSA 3MJEA 1BJKA 1X1EA 2XCUA 1CZOA 2YBDA 5IC5A 3WGHA 3L2OB 3ER6A 4PC7A 2W0MA 5REQA 4G4JA 1DEXA 4QYTA 3RAPR 1FFCA 1SG9A 1DEKA 1P62B 2L42A 1UZLA 1OSNA 5GY7A 2V7TA 1GOTA 1ZNQO 4BYMA 1PI3A 4F6CA 2P9YA 2VDWA 3E53A 4IY1A 4BLUA 3LF1A 5C35A 3DT8A 1N1EA 3QLVA 2P0AA 4IDOA 4UNPA 3FFWA 4D4LA 1A2OA 1YU6A 4C88A 1NC1A 1WF3A 3DAYA 3DE6X 4HDSB 4HFNA 4H6WA 2R751 1SQ6A 1SOVA 3COZA 3DHYA 3W1VA 4NESA 5KTRA 3NHLA 4IMPA 3G0DA 2RJ3A 4LOHA 1W9HA 2P4EA 1XQYA 4MB2A 4KITB 1E79D 2PMCA 4EOGA 3CIFA 4RNCA 1KJJA 1NN0A 3L0DA 5KWSA 2PZKA 1TT7A 2CXTA 3AR2A 2Q7DA 4LOJA 5JV5A 1BCRA 2G4CA 2YMQA 4RA6A 4WBSA 5FBVB 4C4ZA 4Z3OA 4IGFA 4V02A 1D8TA 2OGSA 1KOJA 3JAKA 4B7CA 2GPTA 2BFEB 3I2FA 3KYCA 1Z5OA 2HNAA 1HDEA 3KR1A 1O95C 3OY2A 3UJHA 4DRXA 2AN3A 2RHHA 2VWPA 3ZKWA 2PFKA 1PJ2A 1TKBA 1H3NA 2WUFA 2FNAA 3ONFA 4P1ZA 4U00A 2HRZA 3VO9A 5HQTA 3QTBA 4URZR 4IP0A 5FI0B 4JS0A 1NQUA 1ZDMA 2OK8A 5I4IA 4BOYA 2QL5A 4EY4A 2E1PA 3FW1A 2DUUA 1K63A 4G1CA 3BJMA 4X84A 5JE8A 1NVMB 1M9NA 4F2DA 2AJ8A 3KE9A 3M6VA 4H3VA 5GONB 1FJXA 2WRZA 1Z37A 5F76A 4P0PB 4HX2A 1DAPA 2A58A 2QMQA 1G8SA 3VR1A 2RK4A 4EGJA 4R83A 1RXSA 2C2BA 4LWOA 2YZ7A 3SOPA 1MFZA 5I4BA 3IT2A 1T1GA 3IJPA 3JALA 4PCAA 5IKPA 2B7LA 3RS3A 3D43A 3A6FA 5JAZA 1RACA 4FDVA 2HXSA 1U2TA 2V97A 1JKXA 5BSEA 4KFRA 2W4QA 2VDWB 1BS2A 3DL4A 4O4JF 2MYPA 4A5SA 2PG3A 5JPDA 1PJZA 1EK5A 1FQKA 1TK2A 1TM4E 5CMLA 1VC2A 4PYLA 3T7KA 1DMRA 3RK0A 5CT6A 3L43A 2OGZA 3ADBA 3P9CA 1YT5A 3BGWA 4XVRA 1LSSA 3TVDA 4XWKA 4DIUA 5HS4A 1GGMA 1HEYA 3WGGA 5FPKA 1MC4A 1BGXT 8LDHA 2NVOA 5AP9A 1DKLA 2VHEA 1SBIA 3PQ7A 2PYDA 3KUXA 4G9EA 4R81A 4XLTA 3OEWA 1HT2E 3H2ZA 4YJGA 5G0WA 3R76A 3TQSA 2XEDA 2IHUA 4IDQA 4PHHA 5G4LA 2I1WA 2K5UA 2QKYA 2OBXA 2Q3MA 2QYTA 3D7MA 4DOMA 1O6BA 2HIMA 7AT1A 4I3HA 1T4DA 4HDOB 3BK7A 3V1UA 3Q40A 2X42A 1LW7A 1JHUA 2C5SA 4U2EA 1E1NA 1NXWA 3MXOA 4JL8A 1R10A 1HTBA 3PJEA 1Z7WA 1VB5A 3TZBA 2QAJA 2GASA 3H86A 3KJXA 3U9SA 4F4JA 1M1ZA 3IT3A 4MW9A 3EB9A 4ZOLF 4BO3A 3F2VA 1W4RA 3H5RA 5B4VA 3GDWA 4PO3X 5B6PA 1QPGA 3BH0A 4FJ0A 1SQFA 4LJ6A 1VE9A 3I4FA 4JR2A 3SGLA 5A4DA 2JIPA 4TLBA 4KXXA 4X92A 3MUEA 4HUTA 2PRKA 3H2GA 5IYZB 5K3CA 3EAQA 3IOMA 1OAKA 1XRPA 2PLRA 2QX7A 4Q4DA 1D2NA 5EHIA 3ZLTA 4D0RA 4XOUA 4YI3A 1KEEA 2IF2A 4AZTA 1YA6A 2GVDC 3KB1A 1HDYA 2XWPA 2IX3A 3H8WA 4W9RA 5E6SB 1H93A 1ML3A 1RXCA 2QSYA 3O8BA 4U0JA 4CV0A 1Y8QB 2BP7A 2C99A 4F3KA 3PFKA 1KS9A 3HN2A 4R69A 2PUCA 4LZPA 2F48A 2WZDA 2VN8A 3EIQA 1E89A 3R23A 1SVUA 5BXQC 1E1RD 4PYKA 4U2CA 1UXHA 3K3PA 3V7YA 1I01A 2ZJ1A 1EFPB 3DZIA 4BTEA 1YCDA 3SR0A 4KH0A 4BV8A 4CMIB 4DNQA 5L4LA 2PGAA 5I4CA 2FWRA 3PQ4A 5CITA 2AG8A 1VBNA 3F3MA 3ECCA 4BFSA 3DEYX 3HDYA 4K87A 5LQJA 4KWTA 3JYQA 4F9EA 4Q7LA 2CNNA 5IMBA 5JYCA 2AN1A 3GRAA 4TLAA 1J33A 1L6IA 3RTBA 1J0AA 4Q4CA 2FPRA 5T6MA 5FEMA 1JFSA 3LSYA 3RVRA 4JJIA 4DMFA 2Q6TA 5E6UA 2AJCA 5HQJA 2VDVE 3O8DA 5JSKA 1OE0A 2JCSA 4RMGA 4C04A 4KR7A 4RADA 1EMDA 3R0IA 3U40A 3PQ8A 1N4DA 4Y6SA 1RAAA 3O47A 5F9MA 1FMLA 3QPCA 3LC7O 2XYPA 1O8CA 3GJ5A 1IQPA 1DHTA 3G5UA 3QWHA 3Q98A 2RH9B 3DWIA 1NVBA 2RGYA 5DCLA 2G06A 5JNLA 1SHLA 3KOOA 4ZHSA 1A27A 3Q8LA 1CUCA 1DHRA 5HHTA 4KQJA 4K9RA 1L4UA 1QYXA 1JHVA 1XD2B 2P5YA 3C3YA 1RQ7A 2CXOA 1U9IA 4PC3A 2QPLA 4UM7A 2XE4A 2R4QA 1YI0A 1X1DA 3E1SA 4MYHA 5JT1A 1B3RA 3UFXB 1Z34A 2YRXA 2ZIZA 5HIJA 3ANXA 4AN4A 2PHZA 5IWAB 2V45A 1YZYA 2YXPX 1F2VA 2DPMA 4BNNA 4U9UA 3JWEA 4YUVA 1OBOA 3LKBA 3Q8XB 3TGPA 3DAOA 1Y6ZA 4PEVA 1Y1PA 5FBHA 5JR3A 3FSGD 3GHHA 2AVNA 4X3PA 2FFBA 1CEXA 5D3ZA 5FNZA 2AT1A 4JU8A 4TM8A 3I61A 1LVGA 2K87A 4WY8A 1C3LA 1VRVA 5DYYA 4LWQA 4AG5A 1J07A 3RS2A 2R5FA 4B3BA 4BYGA 2ZANA 4JCCA 3TD2A 5IF9A 2BKUA 2JJ2A 5A7HA 3WL8A 3V8NA 1XQ9A 2NU7A 1YNSA 1N78A 3KLMX 3CRZA 3MF4A 4KLNA 3RWMB 2A9OA 1PJQA 3CNBA 1Q6ZA 2F7SA 3PXAA 1H9AA 3C3DA 9LDTA 4KDCA 2H8GA 4MV5A 1V1MA 3C8ZA 2Q07A 4Q05A 1JDZA 4TS1A 5CK5A 1NATA 2PUDA 3QFSA 4UVEA 3UYLA 1TC2A 4DXDA 1D7AA 2GPNA 3B38A 1NF2A 1IIRA 4X8HA 1TJ3A 5SZHB 2FR0A 3RHSA 4HVCA 5IC6A 2QJRA 5IXJA 3WL7A 4E6PA 1M73E 1W30A 5FYQA 3GELA 4JI5B 3FCXA 2VP0A 4BNKA 1XUOA 1MIOB 2AH5A 3LVRE 5JMTA 4BIIA 5KQMA 2YZMA 4RF5A 5A0FA 3TTVA 2I4NA 3HKCB 3DDHA 4MVCA 5F77A 4ARUA 5I01A 1DGQA 4DNXA 1O6CA 3LOQA 1V5FA 3B1FA 3E2MA 7MDHA 2J3JA 3AL0C 2P7HA 2C5HA 2Q1XA 4FONA 1GUBA 3ZHXA 2O8DB 3IDSA 4KN6A 1Z6XA 1CJMA 1OB5A 1RBZA 3RIGA 1N7GA 4OYYA 3B8HA 3DVSX 1XXHB 1QQBA 3FYUC 1G7TA 1ODKA 2J41A 3LUHA 3RIMA 2ZRLA 4D92A 1ADJA 2IT1A 1PE0A 3GT4A 4YB8A 1WCXA 1S8NA 4WKPA 1I4OA 1OQAA 2ZAMA 4XGKA 3WGUA 2HFJA 3O2JA 4O2AA 1XWIA 4WOPA 3UB3A 2ORYA 3UKOA 5KSYA 3E7DA 4H3HB 4BCBA 5BQFA 5EJ9A 2X5NA 3HJGA 5FUYA 3O4GA 3KSMA 2ZBRA 4F7DA 3TEFA 1W49A 1AS2A 3FPBA 4Z0PA 4E15A 2VJPA 4KOAA 4MP6A 5AJYA 1T9GR 1RXIA 1VLMA 4JB2A 2HTFA 3ASYA 4OAQA 3NBFA 1KY2A 3LPMA 4GBGA 1HYQA 2C8VA 2Z5LA 5E9AA 3T38A 1YZVA 5JDIC 3GLIB 3FH0A 4IIBA 4AIRA 2JGLA 3G9TA 2IUEA 1JAZA 3EWSA 4UDNA 3H4MA 2ZTLA 1X8JA 5EPOA 4RTOA 3NHSA 3AH8A 3ASUA 2XUKA 4HPXB 5FPYA 3W3AD 1CQJA 2Y1KA 2PO7A 5FJIA 2YV2A 5H81A 1NNLA 4OTZA 3NO4A 4RESA 4MUAA 3ZV6A 5I9BA 1XDBA 5MN5A 3FRJA 3HJUA 2GLTA 3H04A 3ITDA 4PLWA 3EFEA 2VKTA 1HK7A 2FK8A 2FRXA 5IBRA 2ZSBA 3FAZA 2DWCA 3CF2A 2DECA 3IOBA 4EH1A 5E6UB 1HYHA 1WM1A 1PLLA 1BIFA 2FPKA 3RVJA 1S2DA 5HR5A 1UWLA 2CV0A 3QEBZ 2FWMX 4QWMA 3FVWA 3ESYA 2BF7A 4NXMB 3H1TA 1P18A 1U4OA 3EIEA 1VHJA 3O8QA 3GZJA 4LHEA 4ARAA 4DM4A 5BWLA 1SM4A 3O3MB 1K5GA 5IMSA 5EE5B 3R3YA 1L4GA 3HDTA 3O31A 3IOYA 4GSYA 4OQDA 2QSUA 3THWA 1HM5A 2I2CA 1F0NA 1LS6A 3K9NA 3AXSA 3P8ZA 5AM1A 1FJGB 3I9LA 4FUQA 3L5OA 4YWHA 1Z88A 4YCDA 2ZBFA 3D8SA 3RSCA 6YASA 3KXLA 2G1PA 2OA0A 3ZHRA 1SHZA 1UT8A 1XD9A 2XA1A 4LBYA 2WNSA 4WUVA 1T4GA 1QIFA 4M6WB 1NP3A 4N9QA 2CEAA 1XZDA 5E2BA 1Q15A 1L5LA 3DMHA 1TVKB 4Q0MA 1CUJA 3AEUA 5GGXA 4NYJR 3K70B 2G9UA 3MJDA 2FPGB 4PLCA 1ZM9A 4U2BA 1O08A 1IBLB 1IN6A 3DXZA 4J2HA 1YB4A 3CKMA 3LA6A 1GVHA 1OR8A 3KTFA 3K8YA 4MPTA 4BAUA 4D96A 4P83A 1VDZA 2C84A 4BWYA 1RKVA 3SBDA 1E2DA 1LCIA 3JQ6A 4FMDF 3U5ZB 4BZZA 3SF0A 3LMKA 3U4DA 2I7VA 2DUMA 3UAYA 2GM5A 5JALA 1KDPA 3GNTA 1BQ4A 2ASEA 2GN6A 2VNAA 2VP3A 2GS9A 1XXLA 1NQTA 1KORA 2JHCA 4LQLA 1EUYA 1M1YE 4H7HA 3A06A 4UEKA 3ZHTA 4EY6A 4ZQGA 1V7CA 2AFIA 2BY4A 2SKCA 4MSUA 3BD8A 5ARCA 2HLHA 1WZUA 2IYXA 3Q3EA 1EG2A 1SA0B 1M1NB 3VDXA 2NADA 4J7XA 1TK3A 3K5IA 3LKZA 3LW7A 4XTRA 1J39A 1A96A 1PZMA 2O23A 1E3DA 3KEOA 2JJ1A 3KOMA 1E1QD 2BVNA 2FSHA 3DTYA 2NT3A 4UCWA 2JIZA 4CR6A 5DHRA 1MT0A 2GWRA 4EJFA 3W77A 4JIMA 3DDNA 3NALA 1CLUA 2OHVA 4EPXA 5SY6A 4F9FA 5ALTA 2ZIEA 2I4IA 2EQAA 5BORA 5BSWA 5EIBD 4C9BA 4PZ0A 5FRDA 4N7JA 2KBEA 1QZXA 3T41A 3WWZA 4BFXA 1O4WA 1XEAA 4AICA 5LKRA 1B0ZA 3ABOB 4HLQB 4I6EA 1G2OA 2XUFA 3GPDG 3I30X 3IUNA 2VF7A 4DCPA 4MI6A 3OE7A 2YQ4A 2GN8A 4CTNA 3V4FA 2Q8PA 3WLKX 1CY2A 3GW8A 4TN5A 4FGKA 3NTOA 3NEAA 1A7KA 3GF4A 5ALUA 1FFHA 5HK9A 2HMTA 4B17A 4G5RA 2EYUA 2HA2A 2DLDA 1ZOIA 4PRLA 1GSAA 4PC6A 4HMPA 2NUTA 2JANA 3PJGA 3W9YA 2VJOA 1V11A 1X9GA 4FN4A 2ZIGA 2FB9A 3VNBA 5CK4A 2ZM6B 5JSYA 3MWDB 2MHCA 2WIGA 3GGDA 1Q1AA 2C97A 3ROGA 1JQKA 1C1XB 2PXHA 3PRYA 1JDPA 1KF0A 1SZPA 4NYIR 1VZ3A 3NOVA 5B7NA 5HW0A 5MN4A 1KTVA 2GX6A 3MOIA 4G9BA 2LRHA 3IPAA 1VG9B 1DEAA 1Y8AA 4TOIA 4HRYA 4F1JA 2Q28A 5A6SA 5ULLA 3CVOA 4DA0A 3Q9UA 5JNSA 4BLVA 1JDJA 2EHDA 1GR0A 4LJ7A 5CIWA 2OOSA 5KTKA 4TTTS 2CB0A 2W2MA 3D2AA 3MCVA 1PJ4A 5AJWA 4CV3A 2QK4A 1NF3A 4DS3A 2I54A 4CEJB 4ZVKA 1ABFA 2Z8ZA 1F5SA 4UU7A 4WK4B 3RRNA 2DGDA 3SYRA 4A8JC 4TSFD 1V1JA 3LXUX 3BMCB 3HJRA 4RA6B 5LVAA 2VYND 1LV7A 4X1OA 4Y1FA 1P8AA 1NDQA 1Q7BA 1MJFA 3IMGA 5U1PA 4CEHB 1XPUA 1OX4B 2AR9A 2X23A 4MWTA 2W43A 3QJYA 1YO6A 1U4NA 3A4LA 3FFAA 2E4AA 1I1HA 3NNDA 4O59O 2VJKA 2Q2QA 2QVCA 1FSFA 3GJQA 4MW1A 1BXZA 3CZ5A 3MWLA 4NOLA 1O4VA 3EUEA 3VZDA 4ASUA 4BX2A 4NBNA 3FOEC 4LDPA 4F4HA 3OD5A 1UJ4A 1M75A 3LLSA 2HCJB 3E1GA 2YMLA 1OFUX 4WNYA 2C00A 5DF1A 3QX3A 1EFLA 3FZEA 2PRSA 2D1RA 2NQ2C 5C1BA 3KR0A 3AWIA 4M22A 5JQWA 4AT1A 5FLKA 4IHJB 4P38A 2I9PA 2UZ1A 1FY2A 1GVNB 1QHNA 3CSUA 1NVEA 3QFRA 1HGXA 2R1TB 1ODIA 1VLLA 3JQDA 3TPCA 3ZWQA 4Z3KA 1BA2A 5MF6A 4YRFA 4QYIB 2YZNA 3FTQA 3K5PA 1T3ZA 3RU3A 3R8CA 1MUUA 2O9JA 1HNZB 3TH5A 3I64A 2F1JA 4LHSA 3BWEA 5AVQA 5LLSA 2VAPA 4WIAA 3QH4A 2C83A 4X1YA 1FXWA 4ZFNA 3FYDA 3DD1A 5F98A 1X1AA 2C88A 2OXIA 4J0CA 2PRJA 3UWKA 2FMUA 1H1LB 1MOZA 4KIGA 1XO1A 1KR2A 4G0OA 1AGRA 4DWOA 4CIDA 3A1SA 3H5NA 3DUFB 3LO5A 1FTNA 3QSGA 2D2VA 2QT9A 2XPCA 3DKPA 2ZE7A 3LWBA 2HRBA 3NIGB 2X41A 4DV7B 2GNPA 3HKBA 5AOCA 2WIKA 5IDVA 1WD5A 5CPFA 4YUWA 3Q11A 3G2KA 1N3YA 3RBXA 2EGHA 3ESCA 2ZYSA 1D07A 1YC5A 5AESA 2XITA 3WJ7A 1JQDA 3AR3A 5CDSA 3QY0A 2HLDA 2JFWA 3R3SA 1UH5A 3E3AA 4TS9A 4Z9FA 1XF1A 4QYWA 1OLUB 2C5AA 3DB1A 4R0VA 4DUYB 1JHXA 4JROA 1PTJC 1CWUA 3ODPA 3G9ZA 2FZGA 3NDJA 4BMDA 5IT0A 1ZIPA 2J32A 2PPLA 3C6KA 2HNKA 2QP3A 5EVJA 4NQZA 1BDBA 3IQDB 3V4PB 2ONCA 3IH5A 3CQ9A 5H5JA 4OP2A 2QMHA 1JIXA 1V41E 5LOVB 4GQBA 3L1KA 1KI4A 4J9UE 1NGSA 3DDSA 5JJBA 3U61B 5HGXA 3LT5A 2DQ4A 2HT6A 2ZT8A 2W4MA 1SJ9A 4YO8A 2R0QC 2QTAA 4V0ME 4WTOA 5AXDA 3CPJB 4RHYA 5K45A 1MB2A 1T4CB 1UP7A 2FMHA 1WZIA 2XZTA 5DTMA 4MV1A 4B8YA 1SUFA 3FFTA 4YONB 721PA 5JJIA 3ILHA 4JD5A 5I6DA 2RG1A 1CS4C 4EABA 3Q8MA 5THXA 1PDVA 2L2QA 1LLCA 1YJAA 4XASA 2QAIA 1GKKA 3V8MA 3IAM6 1UZMA 4FC7A 3MINB 1ZVKA 4C03A 4QRDA 5JBQA 4KX5A 2IBTA 2VSQA 2Z2YA 4NSNA 5ICSA 2ZUUA 1QFYA 4D9MA 3IT1A 3AY0A 5A9SB 3OQPA 1X8LA 2V6GA 4LF8B 3U31A 1AZLA 3BGSA 4BMZA 3OIDA 2X8JB 3LCCA 3EVBA 3MWYW 2W2QA 3EE6A 3P0RA 5PGMA 5C7OO 2A6PA 1WRBA 3Q88A 3SK0A 4ABTA 2WDZA 5LYYA 1N6KA 4J3NA 1I9GA 4P98A 4QPCA 2Q6KA 2OFWA 1E61A 3GGPA 2WJ3A 5BNFA 4JI6B 4L9WA 1J0DA 4IIGA 2OBLA 4X8MA 4DR7B 4KGXA 5ARBA 5AOBA 2ZVQX 1QDUA 3O21A 5BN4A 5F3WB 2XRFA 4NIMA 5EUMA 2QLBA 4B5LA 4IYJA 4QO8A 1W5EA 4G5QA 3AOGA 2QYSA 4DG5A 3FDJA 5ALJA 3BQ9A 1LWOA 1Q0LA 1PGOA 3L7OA 2GM9A 1M2WA 2RHOA 2MYNA 3AVQA 4QYXA 2I6TA 4TGLA 5DM60 5HKKA 3U1BA 1RZRA 1K5HA 1M8FA 4NJEA 2R7LA 4FMPA 3DMDA 4LRSB 5HBRA 4BNGA 3MGBA 1YJQA 1N77A 4ICIA 1PBNA 4LCBA 2B2CA 2FEMA 4D3DA 2PM8A 4MCJA 3KSZO 3ONDA 5DWVA 4JXKA 1KYVA 3OJCA 3PKJA 3QQPA 1U0GA 4I46A 4LJRA 4PSDA 4IEFB 2MT9A 3EXG1 2BM0A 5HCIA 4ALNA 4DCOA 1EUZA 2QP9X 1J7JA 4ARZB 1P2FA 2PAAA 2GF2A 3B9RA 3PUXA 4L8VA 2C1EA 2OTCA 4KGZA 3U4IA 4RHUA 1N7IA 5GIOE 1CVIA 2W93A 1C3VA 2Z4TA 2B61A 4M1TA 4P7KA 4QRIA 4PR3A 3ZIAD 5CCBA 1PL6A 1NXPA 2RHRA 4Z9BA 6REQB 4E21A 3RIXA 4AY5A 2WM9B 4GSLA 3NIBA 2V8OA 3GBSA 4M4SA 3QM1A 4QARA 1LPPA 1MZVA 2VHUA 4WA8A 4FB4A 2Z2ZA 4C7MA 5F9FA 4AU1A 4GMFA 2WG0A 4HI0E 4US0R 3VH4A 4COOA 1Y4DE 2VI5A 3FPFA 3N28A 4ON9A 4RPHA 2A1UB 4CCAA 4U7GA 4EG6A 4FGWA 4LZJA 1IVNA 2O7NA 1D5CA 2H3HA 3GUVA 1N33B 1Z6PA 1QMPA 1KL7A 1XZAA 4FNOA 4JUFA 2QGFA 3EULA 4W1SA 2ZI9A 3U3OA 3WGMA 1BX3A 4RFLA 4DUPA 1GEEA 1VJ0A 3BBPA 4DZTA 1T9CA 4FNMA 4UASA 4KR6A 4TSFA 3PHJA 3DVQX 4BUCA 3E7FA 4MR9B 2XUPA 1AMUA 1RM4A 2G36A 2H4XA 1IRXA 2X13A 3MLEA 2O2XA 1SVWA 1JS1X 1W34A 1KMHA 2YXLA 1POWA 1BU5A 1W85A 3CUSA 3PYLA 4FD3A 1Z6TA 2AFHE 4CPDA 5L6MB 4G0VA 3FPCA 3JVDA 1QV7A 3FROA 1KGSA 1CZRA 3CTPA 5JH7B 2FKAA 3BIOA 2QZJA 4A1FA 3I9NA 1TAGA 1JEDA 1LFDB 3LY8A 4QXRA 3L40A 4M89A 1CW2B 3ZDZB 3QGMA 5JCJA 9ABPA 4L75A 1CULC 2QE7A 4PAOA 4YUXA 5ELMA 4JOCA 4NEHB 2UKDA 5BV2P 4XQ0A 1N6OA 1EBBA 3F3KA 5KYYA 1CJSA 1UM8A 1XZQA 4YIHA 4GVPA 4K6FA 2FX3A 5JSQA 3NVKI 3GUZA 4Q03A 1JPJA 3UJAA 3QEMB 1CQIB 3P19A 3UMGA 5GZ3A 1KH2A 4HRAA 1GTRA 1JJVA 1WOYA 1X0VA 4BKRA 1GZVA 4EVQA 4F0JA 1KNQA 4CN8A 2ATIA 2CLSA 4LYHA 2M2IA 2XADA 1VYHA 1QXSA 2H2HA 3LW8A 3QXSA 4OMUA 4U4AA 5DCWA 4FHCA 5B7PA 2V03A 1W88A 3BCHA 4DT1A 5DEOA 1LUAA 3WLMA 4K8OA 4PFJA 3PGVA 4CFZA 1GCUA 1AN0A 3WQHA 1U8FO 4ISCA 1K66A 1P3DA 1VYVA 3VYRB 3QKTA 3P94A 4Q4HA 1U7ZA 2CNLA 3A3NA 4MWGA 4Z4EA 1XMQB 1E92A 5EINA 1H2FA 3DCIA 4Q6BA 1P9WA 3CISA