5CLHA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
APVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 53
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5clhA00
5C5DA 4ZMBA 4ZC8A 4YCCA 5CLIA 2FW6A 3RGGA 5BOSB 5CLHA 5CTJA 2NSJA 3TRHA 2FWBA 4AY4A 3KUUA 3LP6A 2FW9A 1XMPA 2FWJA 5CLGA 4GRDA 1D7AA 4Z7JA 2FWAA 4B4KA 5BOSA 2NSLA 2FWPA 4JA0A 5CLJA 3OOWA 2H31A 4YCBA 3OPQA 1U11A 4YCJA 2FW7A 5BORA 2FW1A 5CVTA 2YWXA 3RG8A 1QCZA 4ZJYA 1O4VA 2NSHA 2FWIA 2FW8A 5CLFA 4AY3A 4ZK2A 4YCDA 3ORSA 2ATEA
chains in the Genus database with same CATH superfamily
1KOGA 4C6TB 2HL6A 3KOMA 5C7LO 3BAZA 5D01A 2VXCA 3DDSA 3ZCPA 1AJEA 1B0ZA 4TMKA 1ZUWA 4LF6B 3MBIA 1RMTA 4UBNA 2JHGA 3H6KA 2HGSA 2O2XA 4KOAA 4HB2A 4WNYA 3C8ZA 2CLLB 3KYDB 3UO8B 5KCZA 4PLFA 1YKFA 3K5HA 2WQ7A 4K8RB 4A0FA 1DO8A 2HA3A 3JRNA 5KNBA 4MVWA 2QI9F 2XB6A 2PWPA 2XTNA 1EGHA 1OLSA 5T3YA 1HI9A 3NM4A 1DWOA 3GAFA 4XWGA 5IK2A 4RGYA 4CQJA 2V7PA 2ZRKA 1MFZA 3LC0A 2J7PA 3LQFA 3OTGA 3B13B 3HB0A 1RRVA 1NBMA 3HBLA 1WCYA 3EEIA 3MJSA 2H2WA 1C8VB 1YL6A 2ZJ1A 4TTSA 3B6EA 1ZISA 1N6IA 5FOUA 4GSYA 2FLWA 2WF6A 2GD1O 1TRKA 1EA5A 4JLAA 5E6UB 1WPQA 3EMBA 4B5LA 2CLIB 5G0VA 4P5PA 3HJNA 3IODA 3AFOA 2IDJA 5E0OA 1L0BA 4D79A 5E9AA 5HOEA 4CMIA 3N8IA 3IVMA 1MG5A 5DIZA 1VG8A 4LUCA 4E5SA 3GZ4A 3WTCA 2WJVA 4DR1B 3O9MA 2UUPA 1YL7A 3HFJA 2PKCA 2P68A 2HDWA 4NONA 1AA6A 3ESZA 1VI2A 3NETA 3RVMA 3OG9A 3JW8A 1U8ZA 1ZZEA 1NNI1 1NY5A 4NF2A 3W2HA 3UMMA 1OTYA 4CM8B 5AI5A 3L7KA 1GRVA 2I4OA 4E08A 1YZYA 2FSSA 4UD2A 3WIUA 1U2ZA 2QM0A 3AB8A 5JOQA 3GB9A 3V4ZA 4ARAA 4B74A 3E70C 4WRRA 5CDSA 3BZBA 3S2GA 4D97A 2GCNA 2HJVA 3KKQA 1GPJA 1YGYA 4NCIA 3Q2KA 1W87A 3ZGNA 2ZI7A 1EVJA 4JQSA 3UATA 3FMGA 4Q1CA 3QPAA 1AN9A 3KU1A 4DJFC 1SELA 3LA8A 4LPSA 3K8QA 1CJTC 2CMFA 5BYKA 1W0KD 3JD0A 3EIFA 2OP0A 4C88A 3DXXA 3MRVA 3FHLA 4UNRA 4N7RA 1SC4A 3H19A 2Q62A 4MV3A 3PZBA 2FSVC 4XM1A 1JDPA 1ZD9A 4JB3A 4BO5A 2CEKA 5FFNA 3RCBA 1MG0A 4UEKA 2WG2A 3GJXC 1F2UA 3M83A 3U4GA 3FTFA 5JISA 2G88A 2RG1A 2ZXUA 1EJ6A 2RGYA 1UBKS 1ZA1A 4OP1A 4QUGA 4AUMA 1ILEA 4NCAA 2P6PA 1ODLA 3TRKA 2XB9A 2OK8A 4JP5A 5EMMA 2I4NA 5TMDA 1RYZA 4K81B 1Y3IA 4WKNA 2DJ5A 3JX9A 1UXKA 3CRW1 3MILA 1D2CA 3A1DA 4KV7A 4NZZA 1B8PA 3QPVA 2OUIA 4LJ6A 4KUHA 3HV2A 2VO1A 4F2HA 1IZ7A 1U0OC 3T1OA 2A1TS 3NHAA 3E6AA 1EFPA 4L28A 3VO1A 3NVMB 2ZDGA 4XUDA 4AURA 5FPSA 3UB4A 1OIVA 2NTYC 2PLFA 2ZTVA 2HNBA 3CJRA 5C8YA 3X3HA 1JPVA 1PT8A 3L8YA 4UHCA 4L7QA 1EHCA 3EGVA 4OFXA 3TLEA 4R6XA 3T7EA 4YLGA 4LSGA 4OUDB 1ODSA 3NHRA 1WU7A 2J9FB 3PQCA 5BUQA 4XARA 3PX2A 1TEVA 1Q19A 3EVAA 5LDDC 1C7EA 2Y68A 2ZKLA 4DFDA 1Q1NA 4A2WA 3VR1A 3GT3A 2O8CB 1DDOA 4E2WA 1AXGA 4MVJF 5JANA 1F9AA 1CNEA 1CULC 1WO8A 2H7XA 2P35A 3BL6A 5FWAA 3KQLA 3JYHA 3N2ZB 4DR2B 3ZWXA 1JBQA 4MVXA 4L22A 2TECE 5JZVA 3I5AA 2P67A 3WMEA 2P8JA 4C7VA 2W6JA 4YJDA 2VQFB 2R79A 4Y2YA 2G1UA 2Z3WA 4L07A 4B3RB 5T5QA 1H2WA 2WYIA 2EXXA 5EJAA 4IH4A 3EZFA 5TB5A 3PFNA 1GPAA 4FEGA 1U31A 1WVGA 4CT5A 4GI1A 3SG0A 5K05A 4KFRA 4N3NA 4M8IA 3T7TA 4BXOA 5A3VA 4X8HA 3OPYI 4Z2YA 3AESB 3GIWA 4LVUA 1JVBA 5CCDA 5B3JC 2QJWA 1QO0A 3X1DA 2XUOA 2FW6A 1BMDA 1Z2OX 1ML3A 3P0RA 3PC8A 1XVUA 2NO6A 1CP2A 1TRHA 4CEJA 4GLBA 5EIOA 3TUJC 4NESA 1FNMA 3GDFA 2G9UA 1NVVQ 4GQBA 4JDUA 4LCBA 4S35A 5BQOA 4BLQA 2FKAA 2ZBFA 3KX2A 3T3HA 5C35A 1LI7A 2RK4A 1J70A 3AF1A 3JQBC 5KHOC 2RHBA 2QMYA 4JYMA 1PGOA 5HF6A 3FYSA 5K7SA 3BFPA 3C6MA 4MDYA 2XSZA 2CD7A 4HUTA 3NTLA 2X77A 4ZAFA 1L7QA 4WNCA 3TE6A 5HRAA 3PRHA 2BUBA 3B5IA 3ZQKA 3RWOA 2X5JO 4XRGA 2EBHX 1KJZA 1A7UA 1E0AA 5T4HA 1Y3CE 2WWYA 1XLVA 1MH9A 3IEXA 3DDUA 4LY0A 3QQ5A 4NKRA 3N86A 1Y6RA 1SWVA 3F47A 4W8HA 3RFVA 2TYSB 2GVZC 3JSAA 3UFXB 4DA6A 1G21A 1T4GA 2FZLA 1P4SA 1QK3A 3L6RA 2BR4A 4I6GA 4HPWA 4MGEA 4RK6A 5FNVA 5K3FA 5AK0A 1HFKA 2LXNA 4RC9A 4MB0A 3HKCB 4UFNA 1UZUA 3DE6X 2WPDD 4I3FA 3KSBC 3B7GA 1CIPA 1T5BA 3HDVA 4GWGA 3LX4A 1EDZA 3PPVA 4RMIA 1XVIA 4RZIA 3K0EA 1ECBA 4GGMX 2HBYA 3UBMA 2NV2B 1Z4KA 1MZPA 1FX0B 1DAOA 1Z7BA 1Q44A 4Y1GA 5CTAA 4QIHA 1J2UA 2CJYA 4XLLA 3FNIA 2O1XA 4WXRA 4DR6B 1TM3E 4MW4A 2QX4A 1NMXA 1RWOA 1RW4A 2I66A 4EY6A 2BUCA 1W94A 2WKWA 4MUBA 4DC0A 1YQWA 3JY6A 1PVDA 3Q5DA 1AZWA 3WRYA 5EUMA 3HK2A 1WKVA 1ABEA 3NBZC 4LTDA 4UCXA 4Y2XA 5HNKA 5CB6A 2OO5A 4EJSC 2YWGA 4OXKA 4WVFA 3L8FA 2YHIA 4JQZA 3MRXA 4QYIB 2NACA 1GWNA 1KMHB 4GC5A 5T4EA 1O57A 2JKYA 3QEAZ 1U9JA 1CY2A 2F3TA 5AQEA 1SIBE 4UHFA 5LC1A 1RRMA 3AJDA 3F4BA 2QRKA 3IDAA 4HNVA 1THMA 5IHXA 2NO5A 3K5IA 2PAAA 2VLIA 2YBDA 2B1RA 3QNUA 3HGMA 3FR7A 3QKTA 1CRPA 1G4UR 2GJAA 1GQOA 3AKCA 4W8GA 1FJ2A 1LS1A 3KHKA 4X8OA 2P9GA 1WMSA 1E2NA 1YOVA 2D54A 3EDRA 5JNWA 3VJLA 2YUIA 4ZT5A 4UBKA 3CNNA 5EESA 4RADA 1G42A 1NKTA 2AX4A 5L40A 2IY8A 1VOTA 2RB5A 1JAYA 1IPHA 1RKUA 3C6ZA 3P96A 1J6UA 3EMKA 3PHGA 3GLQA 2NUAB 3W3ZB 1RWVA 2HN9A 2VOJA 3GZTB 5KSPA 2X13A 2PGXA 5H59A 4ZXPA 1CB0A 2PZAA 4EHHA 2Q1YA 1CUGA 1UWKA 3B89A 1ADFA 2QU7A 4IFTA 4BJHB 1GL3A 2C1EA 3EGDA 3LT2A 4YHBA 3BL8A 1NNLA 2QDKA 2J5XA 3UTDA 3QE9Y 1SBQA 1XZCA 1ZZGA 2JAPA 3ONWA 1KIAA 2R1VB 3QMMA 2IL1A 3A11A 4ZKDA 4EHKA 3I61A 2I6UA 1JRLA 3HHEA 4UASA 3IHLA 2ASVA 4A10A 2FMUA 5FQNA 4WLUA 2XZOA 4XD2A 1H2RS 4G5SA 2V7VA 2VK8A 4UEJA 1ZP6A 3DFZA 1KAEA 1L8XA 4YGXB 4WBNB 2ERYA 3FWNA 4KZKA 4ZT3A 1YR2A 3CPSA 4ZYUA 1IL0A 5HILA 3EFOB 4ZZIA 1CHDA 5B4TA 1BW9A 2ZE5A 1KH2A 1C29B 2AOTA 2VK2A 3KQWA 3OLXA 5HZGA 3TQQA 3NLLA 3VDMA 5JG7A 2I2DA 3OIGA 1YVPA 2C3PA 2VHEA 1S8NA 2DR3A 3NNDA 4XJXA 1LX6A 5EYPA 4HX5A 3CKYA 3K9BA 4RFVA 2UKDA 3N2EA 4TGLA 1IULA 3SQLA 1FXSA 2ZIXB 4IXNA 2WJPA 2QAGA 1CHNA 4YCAA 3IBCA 4RSGA 3HCPA 3D0KA 3PGLA 4MUHA 5C0OE 5J58A 3CR8A 5ABPA 3T7RA 1GGMA 3HCNA 4LMBA 1RWKA 2RBEA 4F4CA 3IAHA 3RFFA 1CVIA 5GIOE 3TTXA 2RK3A 4CN9A 1QE5A 3PD1A 2GUWA 4PPGA 4L3VA 3KJXA 5KAPA 2PT6A 3ZNPA 4BE7B 1ZK0A 1VBFA 2Z58A 9MHTA 3M2PA 5COAA 1MVNA 1KEWA 1WXQA 1NLZA 3ESQA 3M3PA 1YMQA 1X9IA 2OFXA 1EBFA 5IJWA 5FL3A 3VNSA 4G67A 2PLWA 4DIFA 3VPCA 4J0KA 1JJAA 2OD2A 4MPTA 3BHIA 1Q7BA 3O4RA 3VA7A 1KSHA 2QJOA 2ZSAA 4NVRA 4RX1A 3SBEA 3TJZA 2Z30A 2ZTHA 3T7CA 4DB2A 1A4XA 3LWBA 2G9VA 4RUKA 3T7AA 4P86A 3E8MA 1NLFA 2M6RA 4Y2SA 1GDHA 3MTJA 1QHHA 2OAQ1 3RYFA 4EDFA 1Z07A 1RADA 2PR2A 5EVJA 4II7A 1WZIA 4PHTA 4C7MA 5EHQA 3U1BA 1OXSC 2GILA 3D7LA 3LW7A 2B1IA 1UDBA 1QJ4A 1XVLA 4W9NC 1G60A 1YQXA 3PP8A 4EENA 4N0PA 2XQGA 1EUDB 1FPQA 1GCGA 3FPJA 3QIAA 4HQOA 4XWTA 5SYNA 4C0SA 2E0IA 1KARA 3MAAC 2EFDB 3B48A 4TTIA 1JXMA 3PHBE 1V48A 3RARA 3T12A 4OI4A 2CL7X 2HU2A 3OX3A 3C85A 1NATA 1R5BA 1F4PA 3EWAA 2REBA 1UIRA 1GZ5A 2FN8A 2ZBQA 1I51A 3CF6R 4UM9D 4HZUB 5AJUA 1QG0A 2QTAA 4FHGA 2WT4A 2R48A 5AUNB 2WM9B 2XMSA 4JT2A 1C1XB 1VIMA 2ZIFA 1AUQA 4D9FA 2VSYA 3LK6A 3M2TA 4RTSA 3NOXA 4I1OA 1TX4B 1G9XA 1P1CA 2PGIA 1Y5NA 2HWWA 3EGIA 3IP9A 3VMMA 5CW1A 3C3YA 4KFCA 4BQRA 5IMBA 2SICE 3TTTA 5IBPA 4F5YA 3IX7A 1BJTA 4B09A 3WV4A 1SOMA 4UTPA 1EFLA 1VE9A 4G09A 2V8BA 4HWSA 5J4KA 1B6SA 4Q7LA 4RTNA 3ZV5A 5KYWB 3K9NA 4FSDA 2R85A 1FFDA 1OBOA 1YFZA 3LUFA 4WL0A 4D8XA 2C3OA 4S1OA 1D4FA 1PF7E 2HTFA 2AUTA 2P6MA 2CXUA 3RHZA 4HGPA 1G17A 1E9SA 2FWRA 3MXOA 1C4KA 13PKA 3CX7A 5AJTA 1ODIA 4US1R 4LZOA 5CEFA 1KWKA 1NJGA 4LF5B 1W1IA 4OQEA 5DKFA 4FDMA 1JAHA 3JD1A 1EVZA 4UTOA 1OASA 2AR7A 3GEBA 4D0LB 5C9ZA 2C4TA 2PJDA 2HLDA 2Z5LA 1Z16A 2FOLA 4RVSA 5ERYA 3UGKA 1U0RA 3AF6A 1SMKA 3RREA 2OV1A 4LYYA 1S2LA 1E3TA 2QTVA 1YIOA 2C8JA 3FNGA 4LJRA 1GZDA 3MWKA 5AM0A 1NHWA 2FUKA 1R4NA 4FOTA 4QEZA 1B2LA 3W4IA 4RQUA 4D45A 5THQA 2Y1CA 4KXMA 1INLA 3JQ7A 3JZAA 1C0LA 4H1TA 1NKSA 1Q3HA 2HSWA 2QN7A 3LLMA 2BSXA 1FFHA 4BEWA 2YV4A 4RTPA 4Q3OA 3AZOA 1RP7A 5FP0A 5IX8A 1RJ9B 1EFVB 1V9CA 3M6FA 4BFVA 2IX9A 3D0OA 2ZM5A 1I1QB 2EZ9A 2R8YA 1FXWF 4HQNA 2ZIVB 3R7LA 1TZKA 2YCBA 2A67A 1HXHA 4M1MA 1QVZA 4D3DA 4YV7A 5JROA 5K3DA 2GLUA 3L4EA 3QTLA 4J7CA 1X6VA 2WSSD 3ANXA 3MCUA 4XD7A 2XDQB 4CM9D 2HA2A 1NI4A 2I6FA 3KM0A 5LQRA 2GF2A 4Q1DA 5L4SA 3U7FB 1JT2A 1TJNA 5EJIA 2VYND 3FIJA 4JLJA 3O3CA 5G2OA 4BQPA 4W5TA 3PVSA 1YR3A 2Q1SA 3BJZA 1J1UA 1I3CA 1V43A 1I80A 4P3KA 4Y98A 1ANKA 2XW6A 1F6BA 2XIJA 4JLWA 4O2BA 3U1TA 3TGPA 5KO2A 1U0LA 5SY6A 1UXOA 4BNUA 2IYVA 2XV1A 3Q6MA 3ZY2A 2R7NA 5ICCA 4MJ7A 1W19A 4JROA 5HDQA 3GEGA 1ZVQA 2IUUA 2W2VA 4ILEA 4Q7JB 5F2KA 1EIZA 2IYNA 3FJ1A 4BWYA 1TVMA 2HCRA 3OZXA 2C54A 3OPMA 1TF5A 4DV4B 3ER8A 2CUZA 1ZITA 2TMDA 3WZMA 4WUTA 4KAAA 3VM6A 4C6RA 1LFDB 5KQPA 1ZK3A 2Q5LA 1SVIA 1ECPA 2ZTSA 3GRPA 2YCLA 3KZ1E 2B5VA 1O4WA 3F6BX 3F5FA 3OU2A 4FYXA 1N5OX 1BRMA 4UTZA 2HQ1A 3SIPA 5HZHA 2GEDA 3C1UA 1K8RA 2ZJ7A 4EHJA 1FDWA 3FFAA 5IHPA 3R7FA 1UINA 3F7TA 2AJDA 3Q6NA 1CY6A 3OCJA 1GG2A 2FRVA 4RH0A 6CHYA 3LVFO 2FQ1A 3ESCA 4PM4A 4GDFA 1VPVA 4E1BA 4B4UA 3DE3X 3ZLVA 2HAEA 3EQ2A 1NBWB 1IY1A 2YH2A 4AJOA 4NK5A 3RS0A 4DXAA 1L5KA 1U0BB 3JQ8A 3PEEA 1JDNA 4FDVA 4AULA 2DSTA 4MS1B 4A23A 3U7IA 1MCZA 3GZNB 3ZH2A 2CLSA 3KKLA 1E6KA 4ZXFA 3SC4A 3TMAA 5K0LA 3HEMA 3K15A 2HZBA 3PCXA 1CR4A 1BOOA 3GUYA 3N07A 5F5XA 1F3OA 1U9CA 3BUSA 1IHYA 1DAIA 1SG9A 3T3GA 5K3CA 4BGEA 4C3ZA 4D6XA 4IGFA 1BQ4A 1DO0A 2AEMA 1NVXQ 4XPIA 3TG8A 3L0YA 3IURA 1B23P 4K40A 5BVGB 4E03A 4LJAA 3JQAD 3C7CB 3PNPA 2VP4A 3D6NB 5ARBA 3SDSA 1EM8A 3KQPA 1AO0A 4YDQA 1E3MA 1YCFA 1RZUA 3OESA 2XYVA 5KJEA 4RF5A 4J49A 2WWFA 5ALPA 2OHXA 3GG2A 3MA0A 4RZ3A 2K7FA 2CDBA 3REGA 4E4RA 3W0LB 3SZ3A 4MV7A 1PV1A 5AXDA 3FUWA 1U0GA 3W2FA 2JLZA 3U4QB 1HV8A 1L5LA 3PL1A 5AP9A 1IBSA 4ATNA 2XRZA 3U4MA 1VKRA 4HH1A 3SF8B 1ONPA 1Z62A 1E6EA 5G3ZA 1HDCA 1LBSA 3RS4A 1J49A 4J16A 1UBEA 1HRKA 1YVRA 4TSFD 3SVLA 4GU5A 1BN6A 3MMXA 2YY6A 3U62A 3ONVA 2JJ2D 3B5EA 1Z26A 2C84A 2VJYA 3FE2A 3L6EA 1K7YA 2E49A 2REXB 3A9SA 3VR4H 4QNRA 5KINB 2IYYA 2Y3IA 2JLBA 3TINA 4JIMA 1UMDB 1HA3A 2IYSA 3AI2A 4BKRA 3V4OA 4NV3A 2P11A 2RKWA 4EIWA 1J0BA 1ZHHA 3K09C 4TUYA 4PG7A 2FFQA 2F3UA 4RFSA 1FFYA 1ICEA 3BMOB 4RA6B 1OZFA 5GGYA 3W78A 5HJ5A 2JAWA 3WOHA 1ISJA 3CYFA 4IV0A 5JAIA 3EXG1 3TR5A 1XROA 1F38A 4KQ9A 4NIMA 1GYRA 5DPMA 1W0KA 2I6SA 4Z4QA 3AR5A 3VQTA 4G36A 3WGKA 2CVPA 4B6QA 3EA4A 5CLJA 4G3XA 5I8PA 2YHSA 1E1LA 2C8VA 2WABA 4Q4DA 3PHIA 3OJLA 4HEJA 1V1RB 1I3NA 3CLVA 121PA 2IEDA 3HKBB 4J03A 1QIKA 4HLUC 2D0PB 3GJTA 4NCKA 5E0KB 2ZBRA 3RF7A 3VYUB 5JLJA 1ULZA 2FPIB 4IDBA 1QH8A 5IDYA 1UUFA 1VL8A 3B51X 3EBOA 3LHFA 5P21A 4EW3A 4QUIA 2Q1TA 4WSOA 1UC8A 4RVNA 1D2RA 3O93A 3QWAA 5IVDA 3E1GA 3Q3VA 4Q18A 3L0SA 2XGGA 3ZW7A 3ZWDA 2MYPA 3ROKA 2X6RA 3W90A 2NMVA 1YQTA 4YCMA 3SOPA 1JEAA 2BFNA 4LOJA 1E7RA 5FA6A 1JLLB 2RBKA 2PMKA 5IF3A 3HBJA 3RGWS 3WV5A 2P5UA 1BOFA 1WDMA 4M49A 1BTOA 4YCJA 1Y1TA 4ZZ1A 5JW6A 5IYZF 1M54A 5HZMA 1AB6A 3L1JA 2IDKA 4CQLB 4UOEA 3PFCA 2W6ZA 4H1VA 1KE1A 4BMVA 4YT8A 2IF0A 2EFJA 3ZWWA 3IUQA 1HDIA 4QRDA 2BFBB 4HRYA 2VHVA 1UH5A 4M8LA 1OYYA 2J9ZB 3GEDA 1EG7A 2LE0A 3KP1A 3OZAA 4FFPA 4J2TA 4JXXA 2VH1A 1DINA 3D31A 1R4ZA 1XE3A 5LYJB 4FU0A 1U5BA 3B8EA 3R77A 1DIGA 1XZKA 2W0MA 1HDXA 2GAOA 2VUSA 1NQUA 5EQJB 1I30A 2OOSA 3D2BA 1HNXB 4UMDA 3TPZA 5HKOA 5JYBA 1X8JA 2H8KA 2YHBA 3GMIA 5J1SB 1QTRA 3DPIA 2RJOA 2H92A 1HZZA 3WMWA 4AYTA 2IU4A 4HAIA 3PXUA 4QSMA 4Z4HA 3HXKA 2VAPA 2PMCA 1TI7A 2CNDA 3V4LA 2HEIA 2WFZA 4GD3Q 1DC3A 1YFKA 2AVNA 4HNUA 1L7RA 2JLSA 2YICA 1IHUA 4WZBB 5E4JA 1LZLA 5HK9A 5EP3A 4IIJA 4FOPA 4FYPA 1FFXB 4CETA 3I62A 3UJPA 5KYXB 4PXAA 2XUDA 3F97A 4PC6A 3RT1A 3ZBUA 2JCBA 4CLEA 3RUAA 2W70A 1L8AA 3JVUA 4XKJA 3I83A 2AJLI 1ZM4A 1KYTA 3VKUA 1A9XB 4LOKA 1J90A 5AVZA 2VQSA 2J0VA 3WS7A 3TIFA 2BDUA 1NA5A 3KOYA 1V1JA 2WWXA 2C0PA 1BDMA 2DC1A 1WKBA 2IX3A 2VPPA 3MJHA 1DQRA 4KPFC 2YWXA 2OB1A 4KXLA 4U39A 3DOHA 2JI9A 1JP7A 3PUZA 3GAAA 1U2GC 4DLPA 1QP4A 1GG5A 1YOBA 4G5QA 5C1DA 2JCGA 1CEEA 3MK31 2DFLA 5IAOA 5H5JA 3RUCA 3K0FA 1IEVA 5ADHA 1CT9A 4FGLA 3C48A 3R75A 3CW9A 1J9EA 4AT1A 3IKTA 1A04A 4AD8A 3KPYA 2G4VA 3NBYC 4GT1A 4XM0A 2NPFA 2JRLA 4G2NA 3B3QA 2ZYIA 4OXIA 4D8YA 3BHJA 2XMDA 3DE5X 3GLGE 4CKWB 3NGMA 1H3EA 3H87A 2YN4A 4PLWA 3B7WA 4LXUA 1PU2A 4PSVA 5F3DA 3C24A 1WPRA 5I9MA 1TU4A 3VR4D 3WWOA 4EW2A 3IOYA 4PHHA 1N2XA 4QUKA 4HVAA 3IIJA 2WPDA 3VVLA 1LSUA 1X38A 2Q0QA 2FZKA 1T29A 3NEJA 4L9RA 5FV7A 1QU2A 4NV1A 3V00A 3E2PA 4YJ2F 1TA4A 1USGA 4DCJA 1MO5A 1ONBA 5E95A 2FFHA 4PTYA 4WQMA 5FTKA 1V7QA 2P75A 4EHBA 5AJHA 5GJVC 1QLHA 4L6IA 1QOQB 2GWRA 2RD2A 4ZYZA 3Q8LA 1M74A 3GFPA 3ZJYA 3NEAA 4R1SA 4ZK6A 4C4AA 4ETIA 1MQ8B 1T3GA 1XD8A 2I7CA 4UM8B 4MVYA 1U0FA 7MHTA 1UK6A 3G8AA 2QUHA 3MT9A 3P0HA 5KQSA 5TQ2B 1XCPA 1PJ2A 4WFJA 1NAIA 3ZBTA 1VKHA 5I9IA 4Q1EA 4HEA1 2E6UX 2RHHA 3E9MA 4GZ3A 4IM7A 4EABA 3DM9B 5LDHA 4YUWA 2WHYA 5T7BA 1KMQA 4BTEA 5EKSA 3FVQA 1GVHA 3NT2A 5EQFA 3TB4A 3EBLA 4RY2A 1FSFA 4S12A 1G6HA 4JJGA 5HWSA 2G4CA 5DTQA 4PZDA 1CY7A 2DKFA 3VKWA 3W8EA 4LWQA 2O5CA 1QZXA 1G7TA 2B1QA 3JALB 3W9BA 2VRBA 4FFVA 2GAFA 1KOFA 2P9ZA 4RESA 3OPNA 2H7YA 5JYDA 3JRWA 4F46A 5K6AC 3KB8A 5A6SA 3RABA 3SZMA 4W1PA 1QBKC 1OREA 2FW7A 3AUXA 4MKGA 1PT9A 4XWYA 2V9CA 5F7OA 5DLDA 4Y7DA 5LXTA 1NW4A 1P9RA 2ISSD 3AI7A 3IALA 4B82A 5TT1A 3GV0A 1NFQA 4ZVTA 4L3OA 3TW4A 4RXMA 1W5FA 1AQNA 3ZWBA 1SUIA 1Q1QA 2ZB2A 4YUVA 1QB7A 1KDTA 1FSZA 1MT0A 2BFCB 2JW5A 1B8NA 4ARBA 3JAWB 3O8CA 5JI2E 4PO9A 4DABA 3DMDA 1L9KA 4PNPA 4EAQA 1U2DC 4TTVA 1ISFA 3FRJA 5F77A 1JU9A 3GMTA 3M1AA 3GLFB 2PCJA 3QLVA 1KDRA 3BWMA 4MWEA 1NIJA 4OHXA 1VJTA 2QSUA 2F9MA 1ZMOA 1QANA 2W2XA 1CERA 2WLTA 2V7WA 4XVCA 2BLNA 1FK8A 5FBLB 5I4CA 2NXCA 1U2QA 1MKYA 2LW7A 1KEKA 1OV6A 1E9DA 4QJ5A 3UV3A 4O0LA 1P6UA 4O4JB 2QD1A 2IEBA 3U39A 3EGXA 4RKRA 3ZGOA 3DCNA 6Q21A 1J5PA 3F67A 3GI1A 2HBRA 1MXHA 3FNFA 3LY7A 1N0UA 2WVGA 1SZPA 3HYNA 4I19A 3BKXA 4R5HA 2AK2A 2F67A 3OQIB 2HQSA 2IK8A 4M89A 3F5SA 3H8SA 5ICSA 1CWUA 4OPMA 5JRDS 4KQ2A 1A50B 4UNNA 1JB1A 4Y2HA 2QTLA 2Q1WA 3JWHA 5AKGA 1E6WA 3P9PA 5I7RA 3D59A 2XXBA 3G3EA 3WBBA 1K89A 2J0SA 2SCUA 2VYCA 4DPMA 1JKJB 2H5EA 1N6NA 2XDAA 1OAOA 2QZ4A 1RRKA 4HAOA 4HAXA 4B3CA 3FB4A 2BZSA 1F0PA 2F59A 3EZ6A 3GP3A 2XBUA 4O1MA 4QO8A 2O8FA 1YA4A 5LMNB 4U8GA 1D09A 3ZE7A 5KWJA 4NU6A 3SE0A 5LB4A 4UU1A 4AZ3A 1FW8A 2PAFA 1R9GA 4S2EA 4B83A 2VJAA 5DYIA 2FMXA 2ZSFA 1KFEB 1Q1GA 2JCVA 3MZ0A 3FBTA 4EUKA 1R8SA 3VPBA 5IWAB 2V5UA 1OKKD 4QDOA 4GVPA 1VLZA 5ALUA 3TF5A 1OD6A 1E3LA 1KP2A 1X3LA 4RM2A 3VPHA 1KRWA 3Q2OA 2XUFA 1U2SA 4QOFA 5DXJA 4X64B 2HQBA 3EZ9A 1B8OA 1KYWA 1T34A 3W5VA 2BE9A 1IOVA 2I29A 2RHDA 3M8KA 4H7IA 4TSKA 2R68A 4XEUA 3O2SB 4M0DA 1QTIA 1FU4A 2BZ0A 2BFAA 2PZLA 2J59A 2BHRA 2W11A 3G0CA 3L1KA 3SHOA 4CKXA 1VSUA 2JI6A 1S01A 1JNYA 1UOEA 4RLFA 4EW6A 3Q5EA 3OAAD 4D81A 3A4MA 3KR1A 3T7SA 1VXOA 1RD4A 1J5XA 5B1SA 4PLPA 4BO0A 3NIFB 3CJTA 1XEXB 1ZJYA 1ZUHA 1W30A 2HCFA 3NKVA 5KYUB 2VYQA 1HNZB 2PTGA 3SMQA 3CT6A 1MRNA 4DIDA 1EVIA 4GWLA 3PE4A 4QSHA 4R9UC 2VUUA 4CHGA 2VF2A 3REOA 2F6RA 1G16A 2QR2A 4RM3A 3V7YA 3FZYA 3IJRA 3CZMA 4BVJA 1OVGA 4DQDA 3FVVA 4BNKA 1GZVA 5DBHX 4D4JA 4N5LA 2XMQA 1L7DA 4MKIA 4H3HB 1JEOA 5EPUA 4D0NA 1AV6A 2X9VA 2WD9A 3OOHA 4NJMA 3UV6A 3WGOA 4BNDA 1O89A 6PFKA 4HC4A 4L85A 4YRBA 5K45A 3COVA 5IWCA 5C4GB 4JN6B 2CV1A 2VUTA 4X92A 3TDMA 1VZ3A 2PBLA 3LMKA 2BH2A 4ALJA 1FNNA 3H4IA 4DCPA 2XD4A 3ZH9B 2BF4A 4EZEA 1XKQA 4FYYA 2GPJA 4IOJA 5AVXA 3R7BA 3AEQB 1JXQA 1C4WA 2Q28A 3BG5A 3RKUA 3E22A 1GNPA 5JSYA 5B3AA 4BLOA 3FBWA 2KBEA 4S0XA 1Z2EA 3ELDA 1NYLA 1EBUA 1XU7A 3W5HA 4GP9A 2VBGA 3BE8A 3M4JA 2VWPA 3NWEA 5EINA 2AHRA 2E4WA 1POXA 4KYVA 2GERA 1V11B 3D6FA 3E5RA 5FTNA 5JSFA 1Z4IA 1G8JA 2EZ8A 3C3CA 3ZQJA 2GM4A 2GFIA 2I03A 3C3JA 1HDOA 1JILA 4EYQA 1BHO1 2PJUA 2AOUB 2V6MA 3U5TA 3E53A 3D4IA 1P72A 2UYGA 3BXHA 3OIDA 1U0EA 1Z6ZA 2PHZA 1Z2CA 1DAPA 2B36A 2O7SA 4EBFA 4EUEA 4IJ6A 3TLGA 1AUOA 1LNQA 1XLTC 3QHQA 3Q12A 2J30A 4K9KA 4G0VA 4BRSA 1VE3A 4CCYA 3WRVA 3AERB 4FT2A 4C89A 3QLJA 1R64A 4KV9A 2GEFA 4QWMA 4UHEA 2CF6A 1QG2A 3BSWA 4TQAA 5LA6F 2QSZA 5TE9A 4UMVA 5IKOA 1AUVA 1DADA 2YJTD 1WJGA 3DO6A 1U8YA 3G17A 1PL6A 1DAMA 1Z68A 4B2LA 3VU0A 2YXLA 4PYNA 5I4KA 2QVBA 3JQDA 4OG2A 2WSSA 3CPEA 4HRVA 2NQ8A 4US0R 4M76B 2B3TA 5A04A 1FMTA 2PV0A 3RVLA 1YMUA 1QHGA 4CM9A 3PLNA 4RK0A 5CAEB 4ARZB 1TL7C 5JMPA 3O8OA 4FJ2A 2VYNA 4FZ5A 1TTQB 1W88B 1YE3A 2Y99A 2IELA 1Q92A 2ZSEA 3EZNA 1C3XA 1UKBA 3H97A 4Z9YA 1Z7YA 1UPFA 2OD7A 1Z3IX 2ATCA 5H4GA 5E4FA 3RT9A 4QUAA 3DDNA 4ZI7A 3SQWA 3KZKA 1SULA 1ZGGA 2D5LA 3OZWA 4KCGA 1E1MA 2AFVA 4GEKA 4KWCA 3VJMA 5ICMA 1I7QB 1L8LA 4NENA 2IV7A 3E35A 4ER6A 5K8TA 1G8MA 2CXOA 3GYBA 4RCYA 3QNWA 4GMHA 3TLAA 2F8TA 2Y0PA 1ULBA 3MD0A 4K26A 2I7TA 2NZWA 3GBSA 1PX0A 1E1YA 2VK4A 3PC2A 8ATCA 2C9DA 3ZK9A 1WF6A 1XDZA 3LT4A 2W9XA 4MZXA 1I3OA 2OZLA 4V2IA 4C0BA 3WB9A 3COZA 1DKMA 3UW3A 3M70A 5JHHB 3QUAA 4G5GA 4KK4A 2ZUWA 4G0YA 4P93A 2XUGA 1JT9A 1ENPA 3RYIB 2CL6X 2EL9A 2HY7A 1HRDA 2IEIA 3PHLA 1K6MA 1KY5A 1LPNA 1XYVA 2I6XA 3K2QA 4P4SA 2BFFA 4DNQA 4UBMA 2ORVA 5M34A 3HYTA 5C1PA 1E7YA 4BB0A 4OU5A 4JI1B 2XUZA 3VAAA 4U2FA 4X1KB 5HF9A 4BUJA 1A82A 1OPXA 3DFUA 4C0HA 1BCRA 2OGZA 4JQOA 4OXXA 5DT9A 4H4DA 1KNQA 4HDNA 4MR9B 3H2YA 2X15A 2I4MA 3R3WA 5FBRB 1NN5A 1ZC4A 3R6TA 3NAQA 2BYTA 4CIWA 1VIDA 3F7NA 1WKCA 3FDZA 2E89A 1PGPA 4FKBA 1Q1EA 2C97A 4MS4B 2OHGA 3I28A 3QBVA 5DW0A 4L5JA 5EZ6B 3FPLA 2OHOA 1U7TA 3DOFA 4U9IS 4B7XA 1TA9A 4TTAA 3L1IA 1U6IA 2B8NA 2JAUA 3L79A 3VPSA 4NDNE 4X1YB 1DG3A 5LQAA 1UDCA 4X3PA 4XA8A 3AMVA 3AY0A 5B7QA 5E6RA 4NBSA 1ZQ9A 4WA8A 2QLNA 3I0ZA 4JHLA 5IBQA 1XEWX 4B47A 1XXLA 3HN6A 4C7XA 1XMIA 1XC7A 4DHEA 3OE5A 1B2RA 3SI7A 3HDTA 2IPLA 2NXEA 5CFZA 3DPSA 4WJLA 4CTJA 4MYSA 1DAGA 2X9LA 3DDHA 3JQAA 5DYNA 2NPOA 3CS3A 1Y34E 3B2NA 3RYCA 1A4IA 2NNLD 3WSVA 5IABA 1JIJA 5KWIA 1RBYA 1XDUA 3BTUA 4Z7OB 3C1AA 3LQQA 4IVPA 4I7EA 3IDFA 1TGYA 2OXCA 3HJGA 1MOPA 1GT91 3WL4A 1OW3B 2Z4TA 4JJZA 3E9QA 1TUBA 2XX3A 3TTWA 1FVOA 2GO1A 3GK3A 1RPZA 2OLKA 1REQB 3PNYA 5AVWA 1M6NA 1RMYA 3GX1A 5THXA 4B3HA 1SXJC 5AKIA 5BV2P 3RTAA 1YZ3A 2VATA 3EFBA 4ON9A 5NLLA 2XIQA 1BXGA 1OFUX 2HRCA 2QQ5A 1MF7A 4MGHA 3OECA 5E3JA 3TW0A 4BIIA 1ESMA 1NVMB 2YJ6A 1RLJA 3CF4G 3NYQA 3LDAA 2J3IA 2WJAA 2YMPA 4TSFA 2R44A 4AN1A 2B8JA 1TU0A 2A2ZA 1K2WA 5ALMA 2A9KA 3HKDA 2JJ2A 3R0VA 3ZY6A 4OKSA 1NXPA 2BM0A 3JQ6A 2RGCA 1PR9A 3PVCA 1JUDA 1NGSA 4Q9LA 2IYPA 4YJ3B 1VPWA 4ZU1X 4CBVA 2QVGA 1E5VA 2VRWA 3ILYA 4IIUA 3WKCA 5DLYA 4HXYA 4IIBA 1B00A 1EDEA 4W1QA 2A57A 3DMRA 3FAZA 1PJAA 2V97A 3T1HB 2C03A 4FCVA 4MLDA 4A5OA 1L9XA 3VUFA 3V9AA 3NRJA 1GZ6A 4IVRA 4YPOA 1IBLB 2X8LA 1H94A 3CQ9A 3VNQA 1S7GA 1BJRE 4REQA 4FWTA 1KFBB 1RLMA 1DEKA 2QRZA 2XTZA 5JWOA 3H84A 1UP4A 1JQDA 1QCZA 1GXSB 3ESRA 5HSGA 5EZYB 1KVTA 2EQAA 3OEWA 4E0BA 1AGXA 5JQGA 2BF7A 3KLPX 3R7DA 4YIHA 4BO8A 1YNOA 3IYLW 1I5RA 1DBIA 1NZJA 1DV1A 2FVXA 2PRKA 3AKDA 4M55A 4YDSA 4BLRA 1BFDA 1QAMA 1EGAA 2DWOA 2FEKA 1JSRA 2ZOSA 3IDSA 3PRYA 4H1UA 4BVAA 4C0KA 1ZAYA 2HIHA 4DSZA 4LPKA 3PDWA 4MYUA 3GR6A 1MA0A 1M33A 3PC6A 3PF8A 4BMDA 1UZAA 5FA5A 2J5BA 4Q7QA 1PR3A 3G0GA 2GASA 1F17A 4X8LA 1MPTA 1RXCA 5FOQA 5J2UA 4R2MA 4CMEC 3THYA 1WS6A 1NONA 3DE1X 2YXDA 4C05A 1T15A 3R9KA 4EMSA 4DA9A 3CPHA 1DHTA 1Y8QB 2Q3JA 2X6QA 4M60A 2HLPA 3I1IA 2Q5JA 4YRPA 5K3OA 1GPDG 4NU8X 2FUCA 5EERA 2NXJA 5LYYA 4PNZA 4B46A 5K1ZA 2JFPA 1VXRA 1X7XA 3BREA 2PA3A 1UXHA 4KDEA 4KPUB 1FBTA 3WAGA 4MVJH 3DD5A 1V4NA 2AN4A 3CURA 5L45A 4ZRDA 2AN9A 2CY0A 1BWQA 3IR6A 3IP6A 1GZ4A 5ALTA 2VNAA 4EL5A 1UK7A 3QMWA 5LP6F 4MO2A 1AKRA 2IODA 4ZT4A 3WDSA 1WB5A 2DEUA 3H8WA 3K9WA 4MW6A 3CFYA 4PX2A 2D00A 4JUBA 1RIIA 3L7YA 3JCZA 2XA9A 3KZVA 1ZI6A 4NLLA 4DMFA 1LDMA 1Z5PA 2DWPA 4RYLA 4ZDJA 4LGYA 2PQ6A 2IUFA 2I33A 2QR3A 2PKXA 3UGTA 5BWMA 3IO3A 3RFTA 2C3YA 3VX4A 4IPTA 2FSVA 4NZMA 4P31A 2PT7A 2M6KA 4M7OA 3EVNA 1NQVA 2HMWA 4MLZA 2Y2UA 3CH6A 3A9CA 3EYAA 3S2SA 4QYMA 4QJIA 3MWDB 1O8BA 3LLUA 3WGVA 1RDFA 3QPDA 3QWIA 1L4GA 5E8RA 5K0ZA 3W3AH 2JBHA 3SQDA 1XMPA 1FP6A 4HDCA 4FYMA 4XGKA 3DVAA 1X70A 2A1UB 4RF3A 1ZJZA 2A5DA 4IIEA 1T8YA 1WSAA 2FEXA 4JVOA 3GEMA 1MMFB 4IO1A 2P7IA 2XE7A 1GRRA 2C59A 1BCSA 3LVQE 4PE5B 4YONB 5FBKA 2OFPA 1N2ZA 4AWAA 4EHAA 1SUPA 1YACA 4GKAA 5KYVA 5FLXA 3VZQA 2Q29A 4JLKA 5CPFA 3LJKA 4O4HB 5JUWA 5EAIA 3HCOA 2AI2A 1WUJS 2F2TA 2WWRA 2C9YA 1D1QA 3RRJA 2FOIA 2O2CA 1EUYA 3Q0TA 3LD9A 3E1KA 1XJCA 2NYUA 1J06A 1NXXA 2W93A 3AINA 4WZAA 5CR9A 3JAKA 3T9DA 1Y3HA 4NNPA 4P0TA 3VO9A 3GP5A 4ENQA 3RC8A 1QU3A 1E94E 1MRZA 2GDJA 2VHYA 3EDQA 2WIGA 5F64A 3GRKA 1E2UA 1O2DA 4L9WA 2FDCA 5TS3A 4PO3X 2EGGA 2X8BA 3ROEA 3O7WA 1NZDA 1JS1X 3BX1A 4RKFA 4RVUA 4BMZA 4X45A 1ORHA 1NVFA 4Z3OA 3F49S 1G63A 3BWXA 4GEGA 4FLEA 4R8SA 2FJUA 3VR4A 4X65B 2C96A 2JF0A 3KYIB 1NW7A 1CR1A 2C8LA 4IDEA 4JLNA 1PG5A 2WVJA 3DEKA 4TWZA 3CH7A 3V8PA 1OFIA 1OU4A 2IDZA 3H5OA 5EXXA 1LX7A 1RI2A 1YJ5A 2QIPA 4COKA 4DADA 4RPKA 5LBIA 5BURA 4F97A 1UIMA 1V8DA 2H9IA 1A7KA 1T4BA 1HM5A 2HQRA 3VNVA 4AMZA 4ZANA 2ICAA 4MWGA 5B3JA 1A0OA 5F1YA 1QLJA 5IVKA 2PX6A 1Q0SA 4YRZA 2H1SA 5A0TA 4FBLA 2XCQA 2CLMB 3FUTA 3GVHA 5DHUA 3U9TA 2YMQA 1AKNA 1UWCA 1TM4E 1NVVR 2EGHA 4YRAA 2AKEA 3MB8A 4WLVA 3LXXA 1JJVA 4HRAA 1M8KA 3N39C 3NJ8A 3JQBA 4FI3F 2PYDA 3HR8A 1FEZA 4YAGA 2C7OA 1P33A 2BCEA 2F7SA 1SJ9A 3LPDA 2Y05A 2G9RA 2HREA 3IL2A 3HMQA 1XZEA 4FT4A 3O73A 2H00A 1JWBB 2O4UX 2REQA 3R2JA 4MLPA 2NSYA 4CN8A 4FCTA 3QELA 3AIMA 4A36A 2XADA 2UAGA 5JE8A 2NSJA 4GYYA 4HLQB 4XRRA 4F0JA 3MXTA 2AQ8A 1LS6A 2EW2A 2WIAA 3VJRA 1UF9A 1TB4A 3BXGA 3MMNA 4PIVA 4DNFA 5JT1A 2DETA 4E5YA 4AJNA 2J6HA 2XUJA 4IGIA 2P2SA 1CV2A 2FPUA 4TTJA 1NF8A 2FJ0A 5AI4A 2BKUA 2JLRA 5K09A 4ZICA 2EGUA 4I4TF 4K9LA 4C3VA 4YPVA 2O9JA 2ZJ0A 4LJ5A 4UPDA 3FW1A 1BEUB 2BGKA 1DTWA 1EEHA 2YVQA 4H6XA 4MVJD 5ALLA 1FFWA 4EEZA 1BQEA 1E96A 1QQBA 1ZD2P 3D7SA 1CJUC 2O8EA 1GZHB 5AW9A 1D07A 1FFEA 1G3IA 4ZAWA 5C31A 4I1UA 2BHNA 1TJ5A 2D2EA 2IXBA 2RH4A 3L0CA 5A4JA 5IJ0B 3RTDA 4ZP1A 1HSOA 4MULA 4RDIA 1RT9A 3CLTC 2P4QA 4U3JA 4ARSA 1GIAA 1PR6A 1BMFD 3A27A 3IAEA 4YMSA 3WISA 3L4BC 5EXSA 4IKPA 2QV7A 5BRJA 3LUGA 4ND3A 2CVFA 4UXHA 4KR7A 3L8GA 3FXAA 1TK3A 3IIKA 3ZE1B 1QV9A 2FUNB 4ZTZB 3KWMA 4YMUA 1F8UA 1I2ZA 3LDUA 2PGDA 3GLRA 3QU4A 1UBJS 1V5GA 1VRVA 4IINA 3A4TA 4JAVC 4P7FA 1QH1A 2V5VA 3NPMA 2G70A 4EJSA 3ESXA 4DDKA 1GUZA 4KPEC 1L7PA 1XR3A 4KREA 3NYRA 2VF8A 2GYUA 1RC0A 2QROA 2R8XA 3W3AD 4A73A 1AM4D 4G4GA 3QEBZ 3SKXA 3KC2A 2AQHA 2CFIA 2FZCA 2H1CA 1JEYA 5L9AA 3F96A 2RGNC 3NHZA 4YBZA 1XF9A 5HX7A 3OF2A 4JQCA 2PZJA 1UBGA 4D8TA 4TV8F 4IIYA 4ENTA 4UREA 3HJHA 3OTIA 5BXYA 3A7EA 1L7VC 3E7WA 2GPTA 3I2IA 3IRVA 1FDSA 3LPCA 3QTBA 2M6LA 5C18A 4E12A 1D0VA 2QN6A 1ENZA 2GJKA 2XPCA 1VKZA 3WO1A 3B9BA 1VA4A 1Z8DA 1KKUA 2DHDA 3WYNA 1QGDA 5BR8B 1U4OA 3HR7A 3ST7A 2ZUEA 4N7JA 1FRVA 2BCJQ 3OTHA 1CQIA 2QL5A 1UMCB 5KOYA 4QULA 2H4FA 1V3VA 1TLFA 1D03A 5FPTA 1COWD 1DIBA 4JZYA 1V5WA 3R5XA 3IXLA 1Y8ZA 5DHQA 1YULA 4W5JA 3QHAA 1GOTA 1CK4A 3QPUA 1QE3A 4IHAA 4MUMA 3CZPA 5GV8A 1KJ9A 1DXHA 4DIKA 3KL2A 1NULA 4NBRA 1IN5A 4POOA 2H1RA 2D7CA 3A1SA 1VCMA 3DR5A 4PLTA 2AI1A 1SQGA 3KSAC 1TW2A 1SCKA 3H99A 5BNWA 4YRIA 1G6Q1 3RIEA 4U7PB 1OVMA 1E98A 1VHDA 1LBQA 4KFUA 3WMFA 3WVNA 1JEQB 2WVHA 3QRWA 1OKKA 1MXFA 4C4YA 4YR7A 2NTVA 4UBOA 4DR7B 1P17A 4G1BA 3QX3A 3GWZA 3EG5A 1GHTA 1N0WA 2ZE8A 1GCAA 4J4HA 4A4DA 2JHFA 4ZAVA 3ZWAA 4B32A 4O02B 1VJDA 4Q01A 2OT3B 3PXXA 2XA2A 1SKAA 3BAFA 1UBUS 3R7NA 2VT6A 1HT2E 1BFUA 2AFIB 4QXQA 1K3TA 4E6EA 4CG3A 2WV7A 5KX5A 4O4LA 4HSEA 1H2HA 3H2HA 2XLCA 4A16A 2PD6A 3SC2A 3OAAA 3SLGA 3VBCA 1C3VA 5IULC 2ORWA 3KD2A 4PEVA 1PSZA 5DBEX 1UZLA 1PJZA 4AJ9A 4AS1A 4LZNA 3KJEA 5DTEA 5DM60 1ACJA 5EJ9A 4E11A 4M0KA 1T3HA 1NQXA 1J0AA 4BJ5A 2RI1A 3TD6A 3UAYA 5E2BA 3W4KA 4WAUA 2CZQA 1C0KA 4RHEA 2Q2VA 1KDYA 3SQMA 3WDLA 2L19A 1BEEA 2LZ0A 3WK5A 2W4MA 5TIIA 3ND7A 3QBJA 4YV2A 1KTVA 5C5IA 3QY0A 5JTUA 3ZZTA 3PQ6A 1U28C 1QVVA 1YONA 4BP3A 1FF9A 1ZM2A 2IUSA 4OY3A 4BGIA 3T6KA 3K0BA 3KQYA 1YRYE 1YQQA 2G40A 2YASA 5H1YA 4IHQA 4XR9A 5DULA 4DY4A 1A2BA 2O1WA 3PR2B 1IBCA 3BHMA 3F0TA 3EBPA 4AMGA 3G2NA 4F91B 2OXEA 1PWXA 3QJYA 1CBUA 2P2CA 2ID9A 1N9ZA 4IRUB 5EC8A 2R1UA 3EXHC 5CT4A 2XTJA 5LM3A 1QYRA 4OXNA 1EUCA 2Z5FA 3CVWA 1ECFA 2FLVA 2UVDA 1PR1A 1JZSA 3ZGVA 1R6UA 2HPVA 2ECKA 4GOOD 5FRDA 2V58A 3TVDA 4CUKA 3OFKA 5C1IA 1SBYA 4EF5A 2PS3A 2UUCB 1K27A 3VR6H 3QF7A 1O08A 3OX2A 4HXGA 1SCAA 4JEIA 4W9NA 2CVOA 3ZV6A 2PIAA 3C2QA 4NL4H 5FADA 3VC7A 2XDYA 2BW0A 1Q7EA 1M34B 1DWUA 1P2FA 4PRYA 1HR0B 2QTCA 3D6HA 1P29A 4ZV9A 1W36C 2XT9A 1FS5A 3IOMA 1PJLA 4IOLA 4GZLA 3F1KA 3Q7EA 1N5IA 2I1VB 4TVOA 1FSGA 1RPJA 2OECA 4ZGGA 1P0MA 2V6JA 3E9EA 1FP4A 3N2KB 3FZEA 2Q6LA 2IV2X 4P4UA 2IKQA 1CVRA 1KU0A 4NARA 4Y6SA 4DJDC 4RF4A 4WFIA 3IMGA 1C81A 1UM9A 2CT8A 3GCZA 3OZGA 4C2BA 1SUEA 1DIAA 1RLUA 1G5TA 1SEVA 3L6UA 4EG1A 4ZO6A 1KWGA 2VJOA 4XWKA 4G8JA 5EHIA 1I7NA 1N0VC 2J9RA 1PEAA 3DVQX 1TKRA 1XJWA 2GJ8A 3A0RB 3AIOA 4MX8A 2JLQA 4UZSA 4A5SA 2IYWA 4LJYA 4CR6A 4IGKA 3TXYA 1RTTA 3EUAA 2YY7A 4MAAA 4I9FA 1J1IA 4CV2A 4NXNB 3H0CA 4DBZA 5G40A 4KLRA 4BWFB 2ZYHA 3WG9A 1E3WA 1QDEA 1BU8A 1QORA 1Z3CA 2JJQA 4EPVA 5AM3A 4U2CA 4PAMA 2QTWB 4DA4A 3E9ZA 3W79A 3BF7A 4OA8A 2QRVA 4LTNA 4M0FA 1IXZA 2BC9A 1C8KA 2F62A 4CCSA 2XGOA 2LCQA 1XTJA 2P78A 3KOUA 4NS4A 3QY9A 3W6OA 1SNYA 5CLFA 2ZULA 3VC1A 1E2MA 1RE1A 4XSVA 1VMAA 3JATA 4YRQA 1M9NA 4DYDA 1SZDA 4EA6A 4NAVA 3K2EA 1CJBA 1W2GA 4KL8S 3ORQA 4H7KA 3EC7A 4RJLA 1T10A 1IY8A 4L5AA 1ACLA 3V7NA 4HAWA 4MRMB 4Q9IA 3S0JA 2NU9A 3GU3A 1PQUA 2JVJA 2P2NA 3E23A 2CUKA 1CX9B 4Y6OA 3I1YA 4YFVA 3A1TA 4ZIRA 4AWBA 1URPA 2ODQA 2IJGX 2YFHA 3PV0A 5HGJA 3FOZA 1XK7A 1UANA 4RV4A 2J33A 1KY2A 1PHRA 2AWNA 3OFJA 1EE1A 3IJ5A 3DFFA 4EQ6A 1O5OA 2VDUE 1QP8A 4N49A 3UW1A 3SQXA 3A2LA 4HJXA 1SCQA 2G0NA 2RGWA 2VJQA 4IZOA 3TIXB 3DW1X 1BWPA 2ESRA 1L6IA 2CD9A 3VSDA 2MSDB 5F52A 3SX2A 5C1BA 2W6CX 4M0MA 2EKQA 3M6UA 1JFRA 4OB8A 5FNVB 3CRRA 3OP1A 2P2YA 2XMZA 4ZQFA 4P4TA 3B12A 2O4CA 2ZBVA 3FWKA 5GVRA 3DL0A 5H3CA 4FW8A 3SSNA 1Z4OA 5LJIA 3J7AC 5DWQA 4RKWA 3TCKA 1XALA 1MGPA 2ASEA 4E5UA 2WMDA 3UPUA 3R5HA 1HTBA 3MSCA 5HBRA 2NUBA 3GVCA 1PZXA 4JCOA 3S55A 1GV0A 1T8SA 2KQUA 2ZJ3A 3AUAA 2PZMA 2GBCA 1DOHA 1HFEL 1GG8A 2OWEA 1C3LA 1S7CA 5ITWA 3MHPA 1P5JA 4I5IA 4DRXA 1F2DA 2VN8A 2VNJA 4L8WB 4LRYA 2GQ0A 1N1EA 5DHSA 4BQQA 2O8BB 3RV3A 3LQKA 4PQYA 2XJ9A 3M9WA 4HADA 2H1LA 4Q4LA 2IPXA 3R6WA 4BFCA 3U5ZB 1UEXC 3VOBA 4B3MB 4R69A 1VJ0A 1U7HA 3PF9A 1N2CB 1XZAA 3B6KA 3PTZA 4URWR 1QQTA 1RJDA 3M49A 4X84A 2O59A 5JXIA 1XNGA 3LIPA 2O3TA 3OPYB 7ABPA 3LW8A 3WNZA 2VPIA 4RMHA 4UTRA 3NU1A 4D80A 2PX8A 4NABA 3K35A 4OM7A 3VR6D 1JGTA 3ND9A 5E9WA 1M67A 1CFJA 4I14A 3BGOS 5TPWA 4Z99A 3U7RA 3UJ6A 4EUNA 1KJWA 4F9GA 1CF4A 3UGQA 1WXIA 3VZSA 4I50F 1CRWG 2EJVA 4C0WA 4KRYA 3DJYA 4QFBA 2PMBA 4Z1OA 3HXQA 1QIJA 4KSBA 2BEKA 3X43A 4RHXA 1U2RA 3T35A 2DTXA 2HKIA 3F3MA 4UDNA 1GKYA 1L7NA 3DVLA 4Y30A 5CIQA 2XHZA 4YP9A 1ISHA 2WJ6A 3CUUA 5JWRA 2F55A 1NW3A 1VGQA 1H6DA 4Y67A 3HA7A 1CUEA 1IU9A 1H2XA 3LP5A 1FYFA 4U5QA 3LDGA 3N8KA 2VWHA 1KQ3A 4LX8A 3HY4A 4MS3B 2VSOA 5CDUA 2J85A 2HZ7A 2R1TA 3GJ5A 5EWJB 1WWKA 1TTTA 3B1XA 4G9GA 4P8RA 4QBFA 5HCUA 2XF8A 2LRHA 1D7OA 4H3SA 5CEJA 4OAPA 3LOQA 4NTZA 4BO7A 3A2NA 1JA0A 1W4RA 2F43A 2GKGA 1EI9A 5ULLA 2NU8B 1QP0A 4KIUA 3LQRA 3I6QA 3O21A 1I4DD 5HXAA 1CLUA 4DMLA 2PRJA 4UVDA 1DCMA 4NH4A 4D0GA 2XCUA 2JA2A 2LUOA 3WGIA 2AJ8A 4QELA 4NK4A 5DT2A 1GAJA 4FHEA 1A9OA 2IOFK 5EIBC 3WP0A 3DV2A 4PYKA 5CFLA 4QATA 4QODA 3IMCA 4YAOA 3ELWA 1I1OA 1T8RA 1ZIXA 4QPCA 2BE7A 2FPLA 1EBBA 2G63A 1VFNA 5IVHA 3K70C 4WCFB 2VQDA 3N3AC 1V2GA 4F3CA 2DHCA 1T2DA 2VWQA 3G0DA 3KUKA 2DECA 2D2XA 2RB4A 3A6KA 4N9QA 4YAWA 5GJWC 5J4VA 3BBPA 3T4EA 3UXEA 1CUWA 1Q1AA 4EHDA 1P7YA 2BELA 1EFUA 1SQ6A 1OTXA 3L8CA 4B8YA 1UKVY 3GC6A 1RYHA 2HPZA 3IMKA 3O95A 5DOZA 4CDNA 1TYEB 2PPVA 3EVEA 4LHWA 4KE7A 3I9LA 1XTBA 1C0IA 1NSYA 4LHYA 1NBHA 3M5CA 1VZ2A 2VDNB 3IAFA 1RQRA 1BQ3A 3QV1A 4W1RA 3FFTA 2C5EA 3SX4A 4BO2A 2GRUA 1XNJA 4B8WA 4EVSA 1CRZA 4ND2A 3I9NA 4DXDA 2C4HA 4XVHA 2X3YA 1EQ2A 2DWQA 3K09A 3UAVA 2EJUA 2D2FA 1KP9A 3CCCA 1NASA 2FEPA 3PIRA 3IJEB 5JXGA 3NDIA 2UZ1B 4TS3A 2FF7A 3VOAA 3EXIA 2BTEA 2KE5A 2J0QA 3OURA 2VJMA 2WF5A 3KJZA 2L18A 3G6KA 2QTRA 3I32A 1A72A 3KHTA 4LDNA 1ADCA 3UJ8A 2UVPA 1E77A 1F0KA 1KK0A 1QRAA 4YP6A 3VDNB 4HLUA 2P6OA 4E32A 4TS4A 2ZRHA 4PGMA 4AG3A 4BQSA 4RVHA 4G85A 3LX8A 4K28A 3ROZA 2WSLA 4K9MA 2DXIA 1N0HA 1DWQA 4GX2A 2ADMA 3JPWA 3VTKA 4LW8A 2XLBA 1U3VA 5JCJD 1V35A 4Q9NA 1RRCA 1E32A 3LUBA 1MJHA 1KZ9A 1L4EA 4EVRA 4FR5A 5HP4A 3SJCA 1T1RA 3KWLA 3E61A 3HACA 3OJWA 3VPXA 3AB3A 3LC7O 3DUFA 3G88A 4F45A 4ND1A 1Y6GA 1D4AA 1TTPB 4FK8A 4BOYA 5ALFA 3D7RA 4ABTA 3EASA 3N75A 1SU8A 3ET5A 5ANRB 5F5LA 1V7CA 3ITKA 5E7IA 2ZRCA 3AETA 3AW9A 4RELA 3IUJA 3QFCA 3N8GA 4Z7NB 3QJ5A 4LYAA 2FCRA 1ZH8A 1TXGA 2JANA 3SP1A 2DQYA 1JE0A 1NU8A 3W9YA 2NO4A 1L3CA 4RPJA 2O5RA 3AFHA 4AYWA 2AG1A 4R54A 1VB3A 2XUAA 1ZVVA 3LZDA 8AT1A 2EG9A 5FUBA 2JFQA 2JGFA 4NEQA 1LQ2A 1Z45A 2GJ9A 4HDKB 3C1TA 1NUSA 3FCUB 4CIBA 3H11B 1QPBA 5HMMA 1LQTA 2HLNA 2OCXA 4CL8A 4I46A 1RHJA 3NTVA 3PUVA 2PN1A 1E7MA 2HSDA 1H3FA 4BP9A 2Y67A 3C5WP 5LP6C 5A0FA 5FWYA 2IBTA 1TEXA 1PFVA 4IJUA 2J08A 3AR9A 3JASA 2BMWA 2WR8A 3KHUA 3OUZA 4IWNA 1DKRA 2OHIA 4GMKA 4G9EA 1OF1A 1SC9A 2UYQA 1A5BB 4GXRA 1Z0AA 5AICA 2G5GX 2VQEB 4OQZA 2H8GA 4L9SA 3GT4A 3SZRA 3G6WA 5TDHA 1BKDR 3H3FA 4JUDX 4OQFA 1NXOA 4WBNF 2G0TA 1Y6FA 1BROA 4L8LA 3R0IA 2GBIA 1FP2A 1XPJA 4I5EA 2ONJA 1UBRS 2JFNA 3QSYA 4AQ7A 2XVYA 3CLKA 5A05A 3CR3C 5KQGA 1Y4UA 4DW8A 2YWEA 3B1YA 5CXUA 4QTYA 4C30A 2PXXA 2GF9A 1OC4A 1HC7A 3L92A 3PWKA 3TKYA 4O1IA 5FI3A 3CVJA 4BRUA 4G07A 4PS0A 3UQZA 5KSWB 2M1XA 3HPRA 3HVJA 4QASA 3WKBA 3I5YA 4F12A 1KZHA 2ONKA 3I52A 1ZGZA 2WFLB 3V33A 3ZVRA 3AHEA 2FP4B 1U2GA 1RM3A 2O3QA 1ZFNA 2DB3A 1NSTA 1TKBA 1ZD1A 2GZRA 2P3LA 2BJVA 4HBZA 3UKJA 5KSYA 3H5IA 2G8LA 1GFSA 2FWJA 3WK6A 1Y7TA 1SKUA 4E7OA 1EZ4A 2X0IA 1UJNA 5I47A 4HDSA 1ETHA 1WEHA 1IB6A 1M6VB 2N0SA 2ZT8A 4FIZA 3HXPA 3MIZA 4D5EA 3UWOA 1G1AA 3ADDA 4P9NA 1B0PA 2E4VA 3HO1A 5J59A 4UOQA 3VYSB 1NI4B 1R88A 3P9QA 5KNLA 3HKEA 3AF0A 4OV6B 1IBMB 3LFUA 2R00C 1QLWA 5EE3A 3KDPA 4K9DA 4MVJA 5BSHA 1EESA 1U7ZA 3EIUA 4AY2A 4XWWA 2RARA 4MUEA 3UJAA 1U1IA 3CT4A 3B78A 3MWFA 4XVRA 4X3CA 4C08A 1KOJA 3TJMA 5IZCC 2HIGA 3WHPA 5TC4A 1KQGA 2JDID 3LP6A 3HJCA 3HP4A 5SYAA 5ALZA 2OM6A 1BMFA 3REQA 2VG8A 3RJZA 5HS4A 3TK1A 3IPRA 1XP5A 4IH1A 1GLVA 2FHSA 1PR5A 3EMVA 1GGFA 4KDRA 4YJFA 3J81A 1L5OA 5LCXA 3SZUA 3TTUA 1T6ZA 4H3VA 2JIZD 3SS7X 4ERNA 6REQA 1GPLA 1U7OA 1FUYB 3GXOA 1BFKA 1A8SA 2CZCA 4U8HA 1N8NA 2IYFA 4GL4A 1NVTA 3CO0S 3K8YA 4HMOA 5FXMA 3VISA 4Y6LA 2VDMB 3D5TA 1Z35A 3W3AA 3ZHQA 4WK6A 4R71A 1EA7A 1I9CA 1EDOA 2ODTX 4P32A 1SUSA 4Z9FA 3ROGA 2BEWA 2WHEA 4J76A 2UYCA 1PW7A 3PU6A 3EYWA 3PQ4A 1LVHA 3BL5A 4JP1A 3EMDA 4RL6A 4DBVO 4DMMA 3MB5A 3T1NA 1FL9A 2KYRA 2K2WA 3DC2A 3DT8A 5KYKA 4IUBS 2Q1XA 3EY9A 1XTRA 4GBED 5TMEA 4EI9A 1XMJA 3QA3E 3B82A 3A58B 2YOGA 3AUKA 1N1DA 2JD0A 4E30A 4QUJA 2I2CA 4RIGA 1L5VA 1KPGA 2Q7XA 1Y1RA 3PS9A 1R16A 1EK6A 2DF8A 5K6AA 1E79D 1M1YB 1HEIA 5CVTA 2HC9A 1S1MA 1ZCZA 3OWHA 1COWA 3GLIB 3FSGD 1AXEA 1R00A 3AP1A 3OY7A 5HMLA 1R5OA 2BZGA 5FLKA 2COEA 1YNSA 4UKDA 4YRMA 5BMVA 3C3MA 3K71B 1WB9A 3UOAB 1YR8A 2VDWB 2HMTA 4RPCA 2O8CA 5IDXA 1JDBC 3GLHA 2MYTA 4XPIB 2O3JA 2X4GA 1JH9A 5CRIA 4RK7A 3CLTD 3KZCA 1MW8X 3LZ6A 3W8RA 5KVQA 3R3JA 1CZLA 1RMQA 1NVKA 2AFHE 2JJMA 4JK3A 2O7NA 5ALDA 2ZBPA 1E1NA 1MC8A 4EQZA 1U2DA 1THTA 1E2IA 3WJ1A 1VB5A 4EUHA 2BTQB 4Q02A 1NAHA 4HKTA 2WOOA 1ZKMA 1FS6A 2JCXA 2QRHA 4CLOA 1Q50A 3OMXA 4UATA 2UXBB 5GP1A 3ESYA 4QJBA 4PCAA 3C16C 1P6QA 3ISTA 4EITA 2XCSB 2FZEA 1J2RA 1W7AA 4QEDA 2LGJA 4YO7A 1QVRA 2QNRA 3OZSA 2JGKA 3N2LA 3UK0A 3FGPA 1A77A 4MZDA 4FGZA 4UJ5A 1SD5A 1DQZA 2PM8A 3FJOA 4J2HA 4NFSA 1YA6A 1ZBDA 2ZBUA 3V8EA 2BFEA 5CB4F 1NPTO 3LTEA 3NBFA 5FYDA 4DLYA 3FHCB 2VSNA 1X87A 3AV0B 4N54A 1T0IA 2UZ3A 1C7FA 4PYIA 5BYBA 1UK8A 3RBZA 3VVMA 1UQRA 2GESA 3AK4A 3SJBA 2P1RA 3NAGA 3O90A 2OBNA 4QLOA 1EZ1A 1O4VA 3NAZA 1IHXA 3EHDA 3ZLJA 4MVJM 5JPDA 1QGYA 2JKVA 3GD5A 1GUYA 3FVRA 4UEOA 1XEAA 5ETJA 2FQXA 2GRAA 3HYLA 4GBJA 3OJXA 4B3XA 3OETA 2C78A 3MCWA 1K5DA 2YZKA 5J4HA 3W1EA 1KPIA 4MKFA 4OQNA 3FUVA 1E2BA 4Z4IA 1DWPA 1KAQA 3DFKA 4C6SA 2DOKA 3HEAA 4HUQA 3ITDA 3D81A 1KDOA 3QPWA 4IXWA 2WHPA 1B8UA 2GN1A 3UG7A 3C4VA 1DDIA 3C98A 3CLHA 1FZQA 1MAUA 1JFFA 4DBLE 1H93A 1JQEA 1OBCA 1ENYA 1ORVA 1VYUA 3A28A 5JS8A 5KQLA 5LQNA 1QF9A 1NUPA 2X8AA 5BN3B 3DBIA 2GPBA 1X1TA 2ZUCA 4X6XA 5BN5B 4JJ4A 1LNZA 5GIPE 3WL5A 1MX5A 1ZHFA 1U5AA 1ZJ5A 4RWZA 5GMOA 4HATA 5T57A 1Z12A 1PK7A 1TMGE 3KJFA 3TEMA 1C2TA 5AMXA 5KDOA 2OAGA 3RH0A 2A9RA 4BS9A 1ULUA 2ZWMA 1YB2A 3UCXA 1DAEA 3F6PA 2R62A 4Q16A 2ZBEA 3IHKA 4YUZA 1DC4A 4XIGS 2OXRA 4JDPA 1KS9A 4G0UA 2AMVA 1PQPA 2CLDX 5J43A 3A2MA 1N6OA 2VPTA 1G8HA 3BIOA 4XYGA 5B3LA 5G1OA 3GLFE 5GVSA 4DLVA 2BMDA 1D9ZA 3OOYA 3DBVO 1VYVA 1UXGA 1P0PA 4XDZA 1EPUA 2P62A 5EQTA 4CXMA 1KI6B 1QQ7A 1HK7A 2XZLA 1TLTA 1XCLA 4HS9A 2B61A 2A14A 2OZPA 3NIWA 2G7MC 2C5AA 4YTEA 5HQ3B 2V54A 1EE2A 5HK8A 4YR9A 2KW5A 2ERCA 1M72A 3VTAA 1WX1A 2IXFA 4EYSA 1Y9EA 1FS4A 2HTEA 1W6UA 2QK4A 3KTDA 1T9GS 3EAGA 1IB0A 2YRWA 3HLYA 3QXGA 3T99A 1WETA 1YCDA 1CF2O 1NPDA 3VZRA 1ZJJA 3GRCA 4FNAA 1RKXA 4PQEA 4DLSA 4M21A 2C07A 4QFCA 2FX3A 1DBPA 2Y1XA 1K88A 1Y1PA 1Z56C 3RG8A 5KTPA 1RXWA 5D3QA 5ALKA 1EKXA 2DTEA 2CV0A 1JHRA 2AE1A 4QUHA 2H0RA 1VTKA 3DZJA 3IBFA 3KQVA 4JMPA 3SFTA 5JNUA 4MWOA 1WHTA 5EE0A 2R1ZA 3U16A 4HQFA 4YAUA 4UBIA 3UMVA 1YRBA 2J7KA 1O96A 1XTVA 621PA 4YP5A 3X0DA 4MQEA 3PR1A 4YECA 3ONDA 4J2OA 1RQ2A 2XTAA 3MS7A 3GGDA 4A2CA 3PYXA 1YE5A 4FLFA 5AW1A 3IQDB 1L7EA 4AO8A 1UAGA 3DTVD 3P9CA 3RHSA 4UTNA 2WAMA 4QXOA 1XLTA 2DSNA 2HH9A 2N1BA 4QO7A 4UXJA 2C2ZA 3NALA 1PT5A 4PGAA 1Y9AA 2M98A 1J24A 4D42A 4RTKA 4UDOA 3T8YA 1RFLA 1N0IA 2VUHB 3AUTA 2MINA 3DR3A 3KVVA 4R81A 4TL8A 4ZOEA 5IANA 4Y9TA 3ZZMA 4WGGA 1U8UA 4CM1A 4TXHA 4IQ8A 2JFOA 5HJ7A 2PG3A 4OGGA 4N3GA 1P2GA 1S4MA 4RH1A 3SJAA 4Z54A 4IXMA 1QG4A 1V5FA 2ZETA 3I0MA 4FGJA 5FJJA 3S28A 2XB2A 2Q5CA 1JDUA 3LQYA 1JJFA 1E6MA 1L4FA 1UODA 2WV9A 3GJQA 3RT7A 4J0HA 4DA8A 2GM9A 2VQ6A 3DG9A 1BA2A 3LRTA 3CGGA 3D3WA 1JFTA 2IU6A 2BI4A 4M8KA 4FB4A 4GM4A 3IOBA 1KMNA 1Y0BA 4HWPA 3TPFA 5HUHA 4AECA 5SY4A 1LZKA 2ZVDA 4B35A 1LXCA 2X5KO 2V4UA 3M4NA 5T64A 5E1DA 4BX3A 1O8CA 3INRA 1Q20A 1TJYA 1U1DA 3I2KA 2PBFA 3W34A 4AXBA 2YYZA 1TFRA 4D1YA 4UULA 5LQJA 2GNPA 2C0QA 2X5NA 1MO3A 2J3KA 1NYTA 4LRQA 4MICA 2DBRA 4HGYA 3E15A 4S05A 4BFZA 1DUVG 3UN1A 3HE3A 4C0QC 4C87A 1PJQA 4HO1X 1B73A 5ITVA 1LW6E 1MIOA 2IRWA 2B78A 3DV0A 5B1EA 1B3RA 4HX2A 3OIYA 1BRTA 3AG5A 5K3SA 1L5HB 3CUKA 3H9BA 3PXCX 4I6JA 4UU7A 3TW8A 5DE3A 3SGLA 4D9CA 3SZOA 5KYGA 1P7WA 3VR6A 1GGNA 4BV8A 3HA5A 2PYIA 3SEFA 1JIIA 1HE5A 2C0CA 2SNIE 4B0PA 2GETA 3DEZA 4KGXA 3R0ZA 4PCLA 4W63A 3PQFA 5LYJF 2BDEA 1D9XA 5TMPA 1L4KA 1DQYA 2RI0A 4R3NA 4EVQA 1DC7A 1EDBA 1XX6A 1ETUA 1D2EA 1LBIA 2OY0A 3G2LA 1T36A 1C80A 2F9LA 2IZ6A 4HI0E 4NPHA 5IN4A 3WK9A 3PGA1 4PANA 1HDGO 4CLXA 2IHBA 4PZAA 4BQIA 2ZJ2A 4EOGA 3N0VA 4BU0A 4EG4A 4FCWA 5DTIA 3EPLA 4JJKA 1E9RA 3EQZA 3PJDA 4BNFA 5A0VA 4JEHA 3VYVA 2YKGA 3Q0IA 5LXTB 4QYXA 3HH8A 2VWGA 3ZD9A 5L7WA 1FXWA 2AKAB 3IV9A 1I5OA 4B79A 2RKOA 2LNDA 1T13A 5A4AA 1XN4A 2OENG 4X20A 2X1LA 1RS0A 3ZXYA 1P3DA 3ADBA 3IUEA 3ND5A 1LSSA 1WZEA 2H16A 2QYTA 3I09A 2P40A 4TL6A 3K31A 4TWIA 4WY5A 4Z86A 5DHRA 4Z51A 3SIRA 2G67A 4DEYA 4EJ0A 4PPNA 3IT0A 2G4LA 1NMSA 4G0NA 3DWGA 2ZAMA 4KJXA 1A5AB 5IUNC 1K8XB 1PFWA 1SZJG 3EFHA 4X97A 721PA 5CT8A 4ASUD 2ZP1A 3OZVA 1G0NA 3ECCA 4RPGA 3S2ZA 4AN0A 1KMMA 4OQ4A 4BIMA 2DBVO 1UKAA 2WTXA 3T7IA 3CKLA 4Q93A 1RU3A 2Q3LA 3TSZA 2IXEA 2B8EA 2OGUA 3AM4A 3BIJA 1F1JA 4X62B 1WY5A 2A9PA 2AZMA 3K5PA 4PXYA 4FR2A 3W1WA 2COUA 4G4SO 4Z0NA 5JD6A 3BSFA 3VZPA 2GCOB 1QQ5A 5BQPA 1L5MA 2L2QA 4L72A 3U40A 5CH5A 3NM6B 3K1AA 1F6WA 1OCEA 4LV8B 1NMZA 4UAJA 2H1HA 4C5BA 3G5AA 1GSOA 4NMLA 2B6NA 3W04A 3ZD6A 4ND6A 2FRXA 2IQ5A 1XB2A 3SEQA 2ZPAA 3KIPA 1W46A 3X44A 2DFTA 4Q3KA 1ZRNA 1X13A 1ZMRA 1J8QA 3NGLA 1IH8A 3V46A 1Y8RA 4G5XA 2BKAA 2D0DA 4XFJA 5JRZA 4YRLA 1E3QA 3MGKA 4BQOA 1L1EA 4ZMSA 4QXAA 3U0VA 1SU6A 1MVLA 3L82B 1Z88A 2XOXA 2HEGA 4ZVKA 4FM9A 1GM5A 1N6RA 4B4DA 4D7AA 4KSCA 4WE3A 2EARA 4JLMA 1KEVA 1L6RA 3JTEA 2ECPA 1ZNXA 2XYHA 4UNQA 5LKAA 3QVTA 1E2EA 3DL4A 1L4YA 1E0KA 3UF0A 4CG0A 1YKGA 4YRTA 5D84A 4DCCA 2NU6B 3K5WA 2YC4C 5AKEA 1XZ8A 1H4QA 2DCUA 1P2UA 2IC5A 3A1FA 3KU4A 4N5MA 2JS7A 4P7GA 1QYDA 3B9PA 4OQDA 4DXHA 5KVVA 1J7JA 1TU3A 4W4TA 1SUFA 1C1HA 1NUAA 4DLTA 4IQFA 4MYTA 1GNLA 1A5TA 1IRXA 1KI9A 5TQVA 4TXJA 1HE2A 2YYYA 3KSRA 5ALJA 1ZA2A 3HZHA 3PXGA 1WLSA 5EIBD 5GOZA 2JGAA 4J1TC 2RGDA 2QLFA 4NJEB 5JCJA 3SF0A 3W8DA 3X1XA 1SQ5A 3EPRA 2KMLA 2H1FA 3IVGA 2Y4NA 1E1RD 1XU4A 3U7QB 3ULKA 2WA2A 3WLMA 3G0HA 4P22A 2HU5A 1TK9A 3BD7A 3KAQA 3K70D 2JASA 3ICOA 1YR1A 3IPYA 3RUHA 1ZDMA 3IQXA 4CMEA 3UMGA 2PXAA 3ZC3A 3ZIAD 3PQ3A 4V24A 3TZBA 1DKUA 1UFKA 3KTAA 1ZWLA 1YU6A 1YJBA 3TD9A 1EAMA 1TCBA 1IC6A 1TM2A 3TTSA 2KJQA 3O94A 5BVHB 4M37A 3GFRA 4F4DA 3M6WA 2PJZA 3HZZA 2PUWA 4ZOBA 4BVLA 1OH5A 3KUUA 4AB1A 2UV8A 3G8YA 4EG8A 4P08A 1G8KA 2LVBA 3MIIA 3PDJA 3RS3A 1SVNA 3PYMA 4X7RA 1QVWA 1X9GA 4AXXA 5IDQA 4EY5A 1ZX1A 1K8QA 4MA4A 2FPRA 4Q5IA 4WERA 4K6GA 2YWJA 3WL6A 2CXQA 3VFDA 4F2DA 2NUPA 1E3JA 3A37A 3A7DA 3AVVA 4NBLA 1FSSA 3I37X 3UMJA 5JADA 1RCTE 3A9VA 3HBMA 4H7JA 4HNTA 2ZWIA 2MSLA 5DWVA 4YRCA 1KSGA 3QKSB 2I8AA 3TPCA 4ZMBA 5WRFA 2QRQA 2V4MA 3A6ZA 3KFXA 2OCYC 3R3VA 1ZN7A 2A0WA 2J4CA 2K6GA 2C4KA 2XBLA 3GD7A 3JR7A 4MARA 1MQ9A 4KIWA 4KVZA 4GPEA 3DQQA 4BNMA 1T3LA 1JE1A 1MENA 3MAGA 3P19A 3RS7A 3SBOA 1L4HA 1VLMA 5GGXA 1HEUA 5EQDA 4DWOA 2A5JA 3N7TA 4G5OA 2F48A 1ZKDA 3AEZA 1CW2B 1X94A 1JHDA 2JGMA 1US8A 3H42B 4J0DA 4O4JF 4P38A 3YASA 1J9ZA 4JYAB 3AFNA 3QIVA 4R8KA 3ZHXA 4BVHA 1OJ7A 3Q7PA 2OHJA 1BXKA 2YL2A 3RUFA 1MB3A 3ZZ1A 1RCFA 2PT5A 4MR8A 4KNVA 4LFAB 1Q21A 4KBGA 4OHPA 1BH6A 2CSUA 2P2LA 1OXXK 1T9BA 1ZH4A 4DMCA 1LK7A 3P45A 3ELBA 2QPAA 3ZU2A 1YTUA 1AHIA 3CCFA 3OICA 5FKJA 1NHGA 2R6DA 4BAUA 3D1LA 4C4TA 1J97A 3Q8KA 1VIYA 1WBJB 4QPJC 2CW5A 5I9BA 3TS1A 4AF7A 4CTOA 1JEJA 2OE2A 3K0KA 5EIAA 5BOSA 3KEOA 2IGTA 5AJXA 5IYZA 1QCDA 3O1IC 4FPXA 2P90A 1QIIA 3G13A 2GS9A 3B9QA 1OXTA 1Z5VA 2GD0A 1CUJA 3ROPA 6YASA 4JENA 1JVSA 3PLRA 4F7DA 3FETA 5HOQA 4JEMA 3ZDAA 3O5AA 3O8OB 3IBYA 3EXAA 3Q88A 5E2AA 2RHJA 3G8CA 1NJ8A 3HNPA 3ONEA 4BMOB 4AM8A 1EK0A 2XRFA 3JZFA 4M0EA 5DX8A 3FG9A 5CYOA 5SV2A 3F6EX 2ZZKA 1XD2A 4BNXA 1DZ3A 4DSOA 4N03A 1XZLA 2RAPA 1FLNA 4Y0VA 3OTOB 4CIAA 3GW8A 2WJZB 4PLVA 2Y77A 2I91A 4XQCA 1PDWA 4AO7A 1CIJA 2JDIA 4PAWA 2CCGA 5ALEA 4BGUA 3FDIA 3WLRA 5ALRA 4DSUA 1WCIB 3HI6A 1KI2A 1U2EA 2X7XA 1OIXA 1UQUA 3P2MA 4WA7A 2JIZA 1KK2A 4WHMA 1I4WA 3TOXA 1Z0DA 4UBLA 3AQ4A 1M2OB 1E2QA 3VYTB 2O07A 4YYEA 4EB6A 4CEHA 2IS1A 1Y98A 3ANYB 2O20A 2Q4BA 4D46A 1H2EA 5IXSA 3C7DB 3LBIA 2E21A 4Z0PA 4P4SB 3MLBA 1V71A 1ZVKA 3QVGA 4JJAA 3PITA 4JL5A 4M0UA 4OL0A 1UPTA 3BQMB 3R7AA 2RH5A 2PD3A 2OO5C 5JJ5A 1AB5A 4K6OA 3VOTA 5KTOA 4MEJA 2PJRA 4Y0NA 2OZVA 1AMOA 2ZQ5A 3QXXA 1CB7A 1BCRB 4UQLA 2H5LA 4DR4B 3ZR4B 4DUGD 2ZRDA 5T8KA 1WDLA 7ADHA 4DCTA 5JXJA 1E5QA 2P6RA 3HA2A 5L3RA 3FAKA 4I08A 2GK4A 1PSWA 2OWDA 4MW7A 2Q4TA 5AHWA 1RJEA 3IA7A 2ZRMA 3BILA 4CZ2A 4MA0A 5KKCA 4PTLA 7AT1A 3VHQA 1E79A 2IIQA 3QWBA 1YZGA 1OGYA 3NTRA 1XMXA 3FSGA 4HAYA 3DT6A 3MELA 5E6RB 2BISA 1RYYA 3KOZA 4M36A 3SIWA 3LXMA 3A25A 4LMAA 4BGVA 1G2PA 2X3UA 4OU4A 1T5IA 1UBLS 4FBMA 1MHPA 3CNLA 1JR2A 5ENVA 2HJRA 2A4MA 3S8YA 1S3IA 3BDAA 3QWFA 2KLHA 2AYYA 3UGJA 4D25A 3F9RA 3A1UA 3L4BA 2C2OA 4PPYA 1R4AA 4JB2A 3TLXA 4BLPA 4L3WA 4YJ2A 2Q0HA 3QF4A 3PC3A 5KYYB 5A4DA 3W05A 3TSYA 5EJMA 4MV9A 2XECA 3ED1A 2QG6A 4R2IA 4DLAA 1I10A 3T3IA 1A9ZA 3PQDA 2HJGA 3G0BA 1TUIA 2FFJA 3OOJA 3TYXA 2JLXA 4K0KB 1FQOA 2Q8NA 3BMNA 3LYHA 3MF4A 2EZTA 2HA7A 3FYTA 3FSRA 3NXSA 2X76A 3L49A 2GSDA 3UV7A 4LNHA 4QTZA 4D82A 5JCZA 4HG2A 1A5SB 2HSJA 4EKEA 1I94B 2RGNA 1QK4A 3UHAA 1Z4JA 2SHKA 1O95C 3F2VA 4EY4A 3NVDA 4QBHA 4FE4A 2ODWA 4R0NA 4D4GA 4PIMA 5LR6A 2FUG6 4YRJA 1T2CA 4HGRA 2AR9A 2CJPA 2IXTA 2J87A 4XFKA 1V47A 5A7HA 1H5NA 1DRWA 2BBSA 1UWLA 5FV4A 4I9UA 1U2TA 3H2SA 3L02A 4HXEB 4JU9A 4C7BA 5JSUA 3LXUX 1GITA 2WVAA 3NHMA 3F5QA 5AUPB 1MTZA 2BOVA 2V7TA 4N39A 3MPOA 4JLBA 4REQB 5DGDA 3UT5A 4Z53A 3CG4A 3RIGA 1ORWA 4JKYA 1LDEA 1E8NA 4D0RA 4MEBA 1PZHA 5PGMA 2IUEA 4GKVA 5DYWA 4EY3A 5IJZA 3WGGA 4A82A 2C2KA 2JJ8A 1ZCAA 5AO9A 3ZWKA 3BPSA 5FOWA 4AKEA 2H08A 2WB2A 3H8VA 1G291 2HMAA 2GHRA 1KYQA 2YV1A 1PFYA 3KR0A 3NC1C 1E58A 2C99A 2OCAA 1I0LA 1GR0A 4DF3A 2Z2ZA 2QQGA 4MR7B 4Y8VA 4BV2A 4Y2JA 2PY6A 4LAFA 3RQSA 3ZDQA 4HWTA 3DF9A 1GU1A 1VLHA 3ZV3A 3HNRA 1D5CA 2HU7A 4JI6B 1SCUA 3D02A 1CS0A 4OK5A 2FXIA 4IDDA 4NE7A 3R7WB 5EMHA 3BGWA 1X0XA 2DUUA 1J0XO 2QYHA 3FSJX 1NG1A 1QTNA 2Z4SA 3JARB 4KXQA 3NJRA 5J2UB 3CGWA 1N5KA 1ZYUA 2KHZA 4G0XA 2WKSA 2B6HA 2BBWA 1P3Y1 5EIHA 4YO8A 3DP7A 4QDXA 3UYKA 2CMDA 2ZWPA 1X9HA 2I7XA 5BSMA 4V0RA 4YJGB 2I9KA 4X8MA 3HM9A 3I1JA 4IX9A 3B7PA 1T1IA 5CB0A 3OQVA 1BDIA 1AA9A 1IBKB 1ZGCA 3DMHA 5G4KB 3WDKA 3BZUA 2ZUFA 1E66A 3OEYA 1X7XB 1I2DA 3KZNA 2G7ZA 2WYOA 3HJUA 4PBRA 1QIDA 1TM5E 2VLBA 4QGAA 3RW9A 3ACCA 1FW6A 1K9VF 2FW8A 3SXUA 1Z17A 5JAZA 1LC0A 1R18A 1NN3A 2X8JA 1NDHA 1UZNA 1WDTA 2Y1KA 4IS3A 4XGIA 1HYEA 4OXRA 5K8JB 5K6RA 4E14A 2VTBA 2ARKA 3R20A