3HY6A

Structure of human mthfs with adp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
b'MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
molecule tags Ligase
source organism Homo sapiens
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
total genus 66
structure length 198
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy6A00
1SBQA 1YDMA 3HXTA 3HY4A 3HY6A 1WKCA 3HY3A 1SOUA 2JCBA 1U3FA 1U3GA 2G40A
chains in the Genus database with same CATH superfamily
2ERCA 1M1YE 1BYUA 1UXGA 1ZUNB 3VOBA 5DP2A 1KXZA 1TAQA 1O94A 2WHYA 1T6NA 4RENA 2W6JD 5H7XA 4BMSA 2J46A 3K0BA 4TOIA 1WSBA 3KJZA 4LXXA 5ICGA 1L1EA 1HX7A 4NXNB 1XZAA 2PT9A 1SXQA 2Q0XA 2OAEA 4RD6A 2GK6A 4E1VA 3N2GB 4PR3A 2AJ8A 2W48A 3A6DA 3H3FA 3JCZA 4FKMA 4QUIA 4U3JA 5BO5A 1JV2B 4Q15A 4D8WA 4Q39A 1A8UA 3HKEA 4BN0A 3HFJA 2HU2A 3TIFA 3I2HA 3DHEA 4YREA 3BWEA 2Q9AA 5AHXA 3M6LA 5A3RA 3IAHA 4NDZA 2IC5A 5IJZA 5IXYA 4FZVA 1NUPA 2X4DA 4LISA 3RJTA 1K7XB 3D6HA 1JG2A 2Q2VA 4R2HA 2XT6A 4LTNA 1TJ4A 1A8PA 3ZNOA 3U5ZB 4XR4A 1PZHA 4M86A 3WRWA 4YXFA 5I9NA 3GLVA 1ZU4A 1UJCA 4P7FA 4QOHA 1HNWB 3IEUA 2DHCA 1FFDA 1Z88A 1ZL2A 3T5PA 4JK3A 4E21A 1OH8A 5FPHA 4JBNA 3DO8A 4M89A 1LFAA 2AMLA 3GMDA 1MC4A 2O7SA 3OZAA 1LRKA 3TAXA 2ZB4A 4IJWA 4KNVA 1JBEA 2RI6A 3GRPA 3CUWA 1R5JA 2HI0A 4IHJB 5C34B 4CLHA 4EFNA 2BGUA 2EGHA 4KZKA 1U8EA 4XGQA 5C8DA 4CCWA 3QQ5A 1S6YA 2B1IA 2X5OA 3HUTA 2A94A 3ZZMA 1DFGA 4C4RA 2WNSA 2WUVA 9GPBA 1PZNA 3FUXA 1KK2A 4WKBA 4JI3B 5F1OA 4OKIA 5JPIA 2FEOA 4X8HA 2E6KA 3C3CA 2BV3A 2IVFA 1PT7A 2DSTA 4II2A 4WZAE 2DFLA 5F3RA 5JRZA 4FMCB 4B17A 1XNQB 1JA1A 2RGAA 3W8NA 2XOEA 1GT6A 5EWMA 3LDUA 2GM9A 2H4XA 4CMJA 4U5QA 1KU0A 2FY8A 3TQFA 5SICE 3IQEA 1C0IA 1FL9A 2XVZA 3RK0A 3ZI4A 1QCZA 3MCTA 4L74A 4BNNA 2D74A 1VBMA 5LC1A 3LVQE 5K01A 1J2JA 2BL4A 4DF3A 2QN1A 4L9WA 3AU9A 4QYIA 2DC1A 2DTXA 4U2GA 2FFJA 3VSBA 4ILKA 5JAIA 1NATA 2QVGA 1KZHA 2OXTA 5FYDA 5GJVC 5BW6B 3ZK7A 1K2VN 2H1SA 4GUAA 5ESDA 1XD2B 1T29A 3HDHA 3Q0TA 2XPCA 2YWCA 1JHPA 3A2LA 2UZ0A 2FGKA 2ETXA 1SMKA 1CHDA 2H9YA 3OVMA 5TV2A 2B0CA 1CUWA 1KK3A 3URKA 4L9AA 3G0IA 1TYDE 5HUJA 3KXKA 1HO3A 1XZKA 2ZSIA 4QLOA 5ECYA 1I2MA 3KDAA 1XCLA 3OCWA 4XYMA 4KAXA 3TW8A 5IJ9A 4BGVA 4ALIA 4BLTA 5JAPA 1YF3A 3GJYA 1UKZA 3LC1O 1E1CA 1TPZA 1FNNA 2WE7A 4AURA 3RVDA 2PGJA 5KREA 4N3CA 4H15A 4AB1A 2ZEJA 5FWAA 3ZZNA 2GJKA 4DUZB 5I8ZA 2W83A 5C5DA 3TOVA 3FE2A 1Y42X 5AI9A 3UENA 4CLXA 5I01A 2NU8A 4TUYA 3BT7A 3TNJA 2OVBA 1V4BA 4OJQA 2NUPA 4QG7A 2PMKA 1PGQA 2CUTA 4HH0A 1WLYA 3T9CA 4LF4B 2O8EA 1U0NA 2EQBA 4ZDKA 4YI5A 3S1AB 3ETGA 4TMVA 4CR8A 4Q3OA 3K4PA 4O1HA 2C9OA 4YRKA 1C4KA 4F56A 4JB8A 2CE7A 3K6KA 1UKVY 1FPMA 3G0CA 3BWDD 2AVDA 2XCQA 4GMFA 4WFKA 5E38A 4GECA 1GTL1 5A03A 2OCDA 2QZSA 4ETIA 4HAYA 1SKMA 3TTYA 1F4VA 4XUEA 1E60A 2EKZA 3UFBA 3U48A 2TMGA 1NJ2A 3THXB 2XUPA 2BDEA 3B5IA 1I3LA 3G0GA 5AW9A 5CW2A 5JNVA 3ABOB 1MGOA 1BYIA 5BURA 4DL9A 1TK2A 2JAQA 3R5FA 4MKFA 4MWBA 4ZT3A 4AN0A 5C8XA 2CKDA 3FVQA 1MT0A 3FZYA 3W77A 2FW8A 2ROQA 5AVWA 3KAQA 3WZLA 1CUIA 2HSJA 2G4VA 4Z4GA 4ZYVA 4ZYYA 1G8JA 3ZJTA 3MTEA 3IDOA 1NNSA 1V4VA 3AINA 2VDVE 5L4LA 4MB2A 2V6IA 1TD1A 5P21A 4JC5A 2C00A 4YJ2B 2PN1A 3UK6A 5LDDC 3LQ1A 2QTNA 5AXBA 3EGCA 3T7TA 4ZCMA 5L3QB 1N4DA 2RHGB 4LYGA 2AOUA 1JQKA 2E1RA 1GEEA 2V6GA 1NVKA 1YV9A 3JU3A 1B1AA 1EINA 4XWGA 1YC5A 2B4AA 2PJZA 2HU8A 4RVFA 4WT7A 3I5YA 2NV6A 2QLBA 4BNJA 2Z04A 3D5QA 2IDMA 2VPZA 1DRKA 3TFQA 2YY5A 3ZVNA 4KQMA 2UXDB 3GV0A 4M87A 2ID7A 3FIUA 3GFQA 4UTZA 4YJHA 2PUEA 5KWVA 4HFJA 1UBHS 4ZCIA 2WP8J 4QO8A 4R81A 3LZ6A 1NBOA 2EAUA 1Y8RB 2J67A 3RPEA 1CERA 4BBAA 3W1EA 4C3OB 1GLNA 2A4KA 1QZTA 2WZDA 2GEFA 4HFRA 2CVZA 2QV0A 2RCYA 3TPZA 5IKPA 1YBMA 3FOZA 5BXYA 4U9UA 1XJ5A 1CVRA 4OP3A 4PIVA 2RJ3A 1XCJA 4GE3A 3WKAA 2Z6UA 5F5XA 4KYIB 4RKWA 2WINI 1TL7C 4O6VA 3RSQA 4OMFG 4U3JB 2JCYA 3DDWA 1I33A 2QQ0A 4HN4B 5DW0A 4DR7B 2PX2A 4V2IA 3FWPA 2GKSA 5FXMA 2X5KO 1GN9A 3I9FA 2HEGA 4ITUA 4ND8A 1FSSA 3PHLA 4CFSA 1O6BA 2GZ1A 3QBJA 5FP0A 2BI8A 3S81A 1VYVA 2Y2UA 2WJJA 4PFQA 4Z4IA 1P91A 2ZUDA 4P08A 1H42A 2NP7A 3WJ1A 4EDFA 1RYHA 4BNZA 1TIBA 4YEDA 1YTLA 1VSVA 4Q02A 1P0QA 4UTXA 1FJXA 4PS0A 2Y4NA 3SZMA 1B8PA 1BQ3A 1YRQA 2POQX 2UZ1B 4L9RA 4RGQA 1VBKA 1NQAO 3SQLA 2GLUA 4BX8A 4LZZA 2VUUA 1ZLXA 3LDGA 4W5WA 4YRDA 3VSDA 3H2SA 5CH8A 4QGHA 1T2NA 3R0IA 3AJ8A 3BD6A 3VUEA 3NG1A 2JBHA 3I9OA 4YMSA 1XWFA 3HRHA 5CJ2A 3ZLTA 3GVCA 1IEXA 4IHJA 3PTZA 4KRXA 3VTKA 1EK5A 3W7AA 2ZYIA 3WB9A 4ACAA 821PA 5ADWA 5IAAA 5JADA 2ZYHA 2FW6A 3E61A 2PQ6A 3MSXA 2H4FA 3DYIA 4MW4A 1XDZA 5K4GA 4YASA 5CFMA 4DIOA 1PK9A 3O8QB 1OB5A 4YCCA 1LDYA 2G88A 3FUUA 1TUGA 1ZQ9A 4MHOA 4XGRA 3PTLA 4IIJA 1K0FA 3VYSB 2WA2A 2ZTUA 2QL7A 3WV5A 1IZ8A 1IQPA 2ZWVA 3WRYC 4CG1A 2NT4A 3IBFA 3SZUA 1HR0B 2P8SA 5IF3A 3OLYA 3DC7A 4BMPB 3QYFA 4QDKA 4F3NA 5I9SA 3BXHA 4JB3A 1E6LA 1J90A 3KQWA 3MWEA 3O73A 2DP4E 3IOEA 2BN4A 4GC9A 4NAHA 1V3UA 1H85A 2QRVB 4JBHA 4TSFA 3A32A 2L82A 5LKAA 1TAHA 4X84A 4LIPD 3GDFA 3KHKA 5CIYA 4JUIA 3WL4A 4YRCA 1XJQA 3RE1A 1ZSVA 4PX3A 5IXSA 2EKBA 2WWIA 3IV7A 3HG7A 1Q95A 3NGLA 1HE3A 4EUFA 2Q99A 1MMFB 3AP1A 2I54A 4IIJB 1CSEE 4D43A 3K71B 5D87A 5BSTA 1E4VA 3T1HB 1DCFA 2OBFA 4MCJA 3MXTA 4Z9FA 5K0NA 4BVFA 1CQIA 1XZJA 1JILA 2JLRA 2NSLA 2BSXA 3MWLA 4HFNA 4OKSA 5LZ5A 3U4AA 3WO0A 2QGZA 5D7BA 1ENPA 2QRVA 2DHQA 3SJUA 2PH5A 5DM0A 1G8SA 1MEEA 2W37A 5CNIA 3HLKA 4L4RA 1K88A 2ON6A 3FYUA 2QX9A 2E55A 3O38A 4FMDF 4MWEA 4HQFA 4PHHA 3DKRA 5LQRA 3FDZB 3VHQA 4PLTA 1KIMA 5HSGA 3NTVA 5CNMA 4GWGA 4DSTA 5IASA 5DSXA 2CJYA 2YV3A 1YA4A 2BZ0A 3O1IC 4H4EA 1GRRA 3LZCA 2WMNB 3CTMA 1QO9A 3I3OA 3VDNB 3KPVA 3Q5EA 3N0XA 1P0PA 3CF6R 1VXOA 2EW2A 1GUFA 2CJWA 1IAQA 2VYND 4XRGA 2MWMA 4DMKA 4I50A 2OKGA 4E7OA 4OG2A 4OLHA 1BA2A 3CFYA 4NESA 1TJ5A 1T9HA 2JGMA 2QR5A 2VAPA 3OOYA 1XCPA 4KYVA 1TI7A 1TDJA 1YCGA 4ZDWA 4D46A 1JIKA 1NVDA 1RWQA 1MB3A 4YCBA 2R1VB 5KYUB 4ZT5A 2DFTA 3FFAA 2ZQYA 4AL4A 3I5MA 1W4ZA 3ZHBA 4P4TA 4GYJA 2HWXA 1N5IA 2W70A 2JIOA 3RODA 2Y1OA 5AVQA 5AK0A 4J7AA 3VR6A 2A84A 3NIDB 3MRVA 3MBKA 1Q44A 3RUPA 2LCFA 2PRZA 3GLTA 2BF7A 4EI7A 3U17A 1XEWY 2IZ5A 3PX7A 3OSUA 2VT7A 3RSZA 1A88A 1KJJA 2YVUA 4ARBA 5AW0A 1JDZA 3NYQA 3LY8A 1CZRA 1J9EA 2X5XA 2XXAA 4MUEA 3EK2A 4MR8A 5K0BA 1DUVG 2A5LA 5CX1A 2ZZNA 3L6CA 3ONFA 4TMTA 2F3RA 4EQZA 1YCDA 2CNOA 2R84A 1EP9A 1NBMA 4BQOA 1T4BA 2R66A 3P2MA 4FEAA 2H92A 1WB4A 3WYAA 4EZBA 5HRCA 1AO3A 1X70A 2F1HA 2VP3A 2W2VA 3EGOA 2EKQA 2BUBA 1L8XA 2B36A 1KR2A 1T3TA 3WDKA 2O1XA 3PEFA 3OPVA 3KOUA 1CZNA 4IM7A 2A5DA 3JPWA 5BV1A 4ZAFA 3M6MD 4S04A 4IDHA 5LMUB 2OV3A 3QFHA 4MGIR 4Q1VA 1OI3A 3VR2A 1WG8A 3K2IA 3ZEIA 1Q6ZA 3O91A 4CM6A 3OX4A 5KEIA 2ZAMA 1JQ5A 4IYRA 1K0UA 1KJIA 3ZV6A 1QP0A 2ECOA 3MJVA 1MVOA 1ZESA 1Y3FE 1M6VA 2X13A 1R0KA 4NL4H 5I7SA 4F7DA 4JHXA 4DR1B 2YJ3A 3D7NA 2ZJ2A 1OGYA 4KZPA 5AIBA 4RETA 1WCIB 1LNSA 3I9V1 2KS6A 3K72B 4MQ4A 2BHNA 3ICPA 2XOKD 5D3KA 3SCZA 2D5IA 5FBRB 2E21A 1PS8A 2EF0A 1IK6A 2GBLA 4CETA 1OAAA 4P36A 1PQYA 4FKBA 5CDUA 1N1EA 1JJFA 1ZRHA 3G8CA 3K1TA 1MR3F 1G21B 1AQUA 1J25A 5BMVB 2F1IA 4IO1A 2ODAA 1H0SA 5IT0A 3RAEC 1CQWA 4TX1A 4WNAB 2BD0A 2D1RA 3QYPA 4YH1A 2AWOA 4KQGA 2JHCA 4TM7A 2X0JA 1BWRA 4JASB 2ZCJA 4Y0NA 4HV4A 5CHEA 4C0QC 3HB0A 2AFHB 3N70A 4DSAA 2ZJ7A 2OQRA 4FZ5A 2ONKA 1SC3A 2RHWA 1OX4B 4Y8VA 4DA0A 3QTLA 1AGPA 2PHZA 1DCKA 1UXHA 3BGVA 4QRIA 1CR4A 3VTZA 3NTXA 2JIZA 2L2QA 3LUPA 3LY7A 1SO8A 1OLSA 2AZDA 3ECAA 5DHUA 3W5VA 3ESZA 1XQXA 3ER6A 3UWOA 4EYEA 4F9GA 2AYZA 1WVMA 1V8FA 4FGLA 2VP4A 4NBVA 2VPXA 2XDAA 5EZ6B 2OKCA 3LL4A 1I3CA 1T5BA 4LTDA 2M6KA 4EL0A 3COZA 4UAUA 3SIXA 4O4JA 1FMCA 4PLFA 5BQ5A 4K6FA 1KP3A 3IODA 1N3BA 1G7SA 2SKDA 5DN9A 3ZE2B 2C82A 2UYYA 4FEYA 1YDMA 2QDKA 4EG4A 3R9XB 1W9MA 4CLOA 4GL2A 3L7KA 3F8TA 5HRAA 4ECAA 3A6JA 3C3PA 4S2EA 4OHCA 3FY4A 1FRVA 3VV3A 2VHYA 2GYWA 3OM8A 5LYYA 4B2PA 4L6IA 2J3JA 3E1SA 3HB7A 1JAXA 1R74A 3K5PA 5DYNA 3OKFA 4XWWA 5B6PA 1NV9A 2YZGA 2ZR7A 3LUJA 3QP9A 7MHTA 4BP9A 4REQB 5JPDA 2IWHA 3WYCA 3HBNA 4DNXA 3HP1A 4LE1A 4TRMA 4CTJA 4RX1A 2GRAA 2JFPA 5SV2A 1RT9A 2JGLA 4LJAA 1Z0SA 4HDNA 3UUGA 1VRVA 1H1DA 2OXCA 4WZBA 2QAGA 4EOGA 3R3YA 2FW1A 3VMFA 1NHGA 3EH1A 1UBUS 5T5QA 2BFMA 2MINB 3AUYA 5BQOA 1O95A 2PANA 1RZUA 2QL9A 4KMRA 5T4EA 3E9EA 4KXUA 2IHJA 3CMMA 4L76A 3DE0X 4JYCA 1U1FA 3OJEA 1C9YA 1K68A 3PZRA 3RBVA 1YONA 3ZGYA 3FB4A 3Q72A 4K40A 2Q5JA 4CQLA 4ZHQA 1LQUA 1U3TA 5CK4A 1R00A 1ACJA 1XZ8A 2OP0A 5LXTA 4FBLA 5ULLA 1ISIA 1WD7A 1E2DA 1NBAA 4MIYA 5FT9A 2ZI7A 5JXWA 1YKSA 2QV7A 5JCOC 1E1KA 3C5EA 3LVRE 1L4HA 4KIFA 3Q85A 4OFWA 3ZOZA 2WNHA 1Z75A 3UK7A 2OC9A 3UJ7A 1YR3A 1VI5A 1TYAE 2FHPA 3T4XA 4M9CA 2FUCA 2VS1A 2ZBVA 1O94C 3PWSA 1X7DA 1CY6A 3QELB 2FSVA 2RG7A 2VP0A 3OJWA 3ID6C 4IG9A 2QI9C 4YP5A 3FKSD 4EPVA 1I2AA 1UWLA 2Q3CA 2PRIA 2ZRFA 1X7WA 2P4HX 2X4IA 1KZ7B 4AF8A 4D98A 3V7UA 1FXWA 3OU7A 1V8DA 1UJ6A 1NVMB 3PRJA 2PBRA 3AG5A 5COQA 3AHEA 4MVJH 1E9DA 2AEEA 2BBSA 3K70D 1R4MB 4BNMA 4AUMA 4HXGA 3DKIA 5BT8A 4BNDA 3E3OA 4LFAB 2V5VA 2J5RA 4W82A 1T9AA 3HKDA 3HYNA 5D86A 4AYWA 4DMCA 2RHBA 4UARA 1A77A 4Z7QB 1C9EA 4BGUA 2YBEA 3LTNC 4XTCS 4YT4A 1ECJA 1TZJA 2AMJA 2GA9A 4YROA 1E94E 3D6NB 3L1IA 4OXIA 1UT5A 1YVDA 4CQNA 4ES6A 1J09A 1V47A 1X77A 2FPGA 2BR4A 4LNAA 1P9RA 3D3NA 1QVZA 5TIIA 3GEHA 4KJXA 1KI2A 1NRJB 3HV0A 1DOHA 5DMHA 3KWFA 4PBSA 2PSEA 5AKIA 5DHTA 5GPBA 4EA6A 4ZOBA 4GP7A 5LD2C 3CR8A 1KPIA 1JHUA 3B60A 4CIBA 5KWSA 3N2GA 1AOXA 1VLJA 3TVDA 4UM9B 3MCAA 2VXCA 4PZCA 4JLJA 1CX9B 4PCAA 1M2NA 4Z1OA 3K09C 2DERA 1MKYA 4TWBA 4X94A 3ESAA 2PRYA 3T9EA 3UC9A 1E2FA 1FC0A 2X9QA 5JE8A 1RKUA 1PKXA 2F9MA 3EXAA 3MJFA 1RQLA 1VGVA 2G1JA 2W58A 3L7LA 4KQIA 2NU8B 1NG1A 1ODKA 5JHHB 2HHAA 4BNYA 1HM5A 1RLMA 1SFRA 5JNLA 5DNUA 4ZVOA 3MPUA 1BAPA 1JFFB 1USVA 1VXRA 3DOOA 3R74A 3GVPA 2IW3A 2YIVX 1RXYA 3WIEA 1H6BA 4G5XA 2DCMA 1FYVA 1NDHA 2G5TA 1CUBA 1U4SA 1BXZA 1V71A 1O3YA 2IHZA 5HOQA 3T54A 1HE1C 4RADA 1HYBA 5DBGA 2O7VA 3E5RA 2V45A 2FHSA 3ILHA 2UUAB 1NNUA 2QK4A 1QNLA 2GAOA 2W8ZA 4GWKA 2Z4TA 3M89A 1QZ3A 4PG5A 2QLTA 1IH8A 3CJQA 4A7PA 4PG7A 1E8MA 2DPHA 2XA2A 3IULA 3NTUA 1PEYA 1GFWA 1VL6A 4WXMA 2Z30A 1NVWQ 1WE2A 3D4BA 1NUSA 4GMGA 4BMYA 4R0MA 3PCRB 1PVVA 3NIBA 3TD2A 2FUG1 1N5OX 1X8LA 1J00A 2X9NA 1W30A 2YMQA 3AR9A 3V7WA 1ZX1A 3DO6A 5TDHA 1U2PA 1KTVA 3IDQA 2JGAA 3K0FB 4EIWA 1YAJA 3U26A 1G5QA 2MYPA 4RY9A 3OQIA 3O1LA 1J6UA 4AP5A 5IAJA 1QHGA 1YI1A 3DE3X 3OWHA 3KV1A 4N7RA 1ODIA 5E9JA 1CP3A 4LOLA 1P0MA 3F8WA 1RM3A 1EJBA 1CUDA 2AOUB 4GMXA 3HSYA 2RHTA 4DCUA 4ZV4A 1Z3IX 1YULA 2JCSA 2VPWA 4IQGA 5BWNA 1U4NA 3A37A 3WNDA 4TN1A 4Y6LA 1RHQA 3VH3A 3DHNA 1KNQA 2V74B 3DVQX 4MV4A 3H2IA 1SA0B 4F3RA 4IOJA 1YKGA 1V11B 4EGQA 1YB1A 2LRHA 6AT1A 1H69A 4IWYA 4PG6A 2E18A 2CVPA 2PS1A 2R8PA 3A4TA 4WPGA 1AZLA 5CYPA 3KQUA 3IAAA 2Z8YA 2FUG6 3H11B 1COWA 2FN3A 2HLNA 4O5AA 2FWNA 5IM5A 4GOJA 9ABPA 1HDOA 4KPFC 4IHQA 2WFZA 4GP6A 1O6GA 3IP3A 1XVLA 2AVNA 4L57A 3L84A 4LK2A 5CFZA 4N5DA 4QBHA 1MGPA 2OBBA 1G3MA 3AY6A 3EDCA 1T4MA 3IOCA 3L82B 3OOHA 1MJ5A 4CJXA 3CUVA 5I47A 3QWIA 3VZSA 1B6TA 1XQ6A 3ITDA 3KELA 5AW3A 1JKIA 3GLQA 2IYLD 1J07A 2PU5A 2QPTA 1LLDA 1RXSA 2XHEA 3KQVA 4LZLA 3SIWA 3J81k 3CVYA 3EXIB 2IV3A 1NXPA 2AGVA 3V4OA 4GKJB 4D9KA 3TIIA 4DB2A 4GBMA 4ZU3A 4RWZA 4AMYA 2PK3A 3TLMA 2FJPA 3GUCA 1XKTA 3JAKA 5ADVA 4LAFA 1F2VA 4EYSA 4K2HA 4IIHA 4G25A 3ZOKA 3U4HA 1PWXA 1FMTA 2NZ8A 4HDNB 4IIJF 4PAWA 3I2KA 2YMMA 3OCXA 5E4TA 5H16A 4F2WA 1DRJA 4N47A 2HGSA 2P1DA 3ADCA 1XRPA 1L4NA 3FFTA 4GR4A 4MO9A 1ACLA 4L7QA 4DCOA 3H1GA 1NJ8A 4OEHA 2ECFA 3BSYA 4QPZA 4U5XA 3MRTA 1U8AA 3PL5A 2P5SA 2WV7A 4KR7A 1G6Q1 2I65A 4RVHA 2XUHA 4FJ1A 1YB4A 2GESA 4H59A 2EX4A 1R6VA 3O84A 4B0OA 3TZLA 4YWHA 3DUFA 3M1AA 2JIBA 1FJ2A 4RZUA 4WZAA 4HTFA 4HGZA 4L4XA 3IO5A 1Z12A 4CZ2A 5KNCH 1W0JA 5THQA 3TRFA 1TZMA 1Y7LA 2O3TA 5LD2B 5FNVB 2AMVA 3FJYA 1X74A 2A3NA 3R6GA 3ZH2A 5JJLA 2E49A 1AVTA 5HJEA 3HTXA 5JBIA 1C0LA 3CT6A 3SKXA 3DVAB 3R5SA 3QELA 3HZOA 2XE6A 3LPDA 2VJKA 1TEHA 2HIMA 3C7DB 3ELYA 3A6ZA 5FWYA 1LJLA 1Z68A 2ZJ5A 3JQ7A 2O54A 1HDXA 3B3QA 5DTIA 1I1OA 2WJHA 4MQ5A 2HWUA 4G23A 3BERA 3LBAA 3AF3A 4CFYA 4BMOB 2IH5A 2R7NA 2G1AA 3RYCB 2WWVD 3ZWOA 3INRA 4YJ2F 2RHRA 1WKVA 5F21A 3FVWA 4KSYA 4IZHA 1EVQA 1E5DA 3DAGA 1IB0A 3BRSA 2F2TA 2HLDA 3EDQA 3F90A 4HH3C 2W8BB 3EC1A 2OUKA 4QBTA 1XCGB 4HZGA 5FBHA 5BWLA 2BP7A 4EYQA 2JLCA 5FNZA 3CZAA 3S0JA 1HQYE 3L7NA 3L7YA 4LN1A 1GPUA 4S2UA 3IAS6 4QU9A 4MUAA 4I50F 4D82A 4BUJA 4K6GA 4ND6A 1P5RA 2O0HA 2QD2A 3PQCA 2GT1A 2HSGA 4OQXA 4WA8A 2I5PO 3ZHVA 4J3JA 3G85A 2ZUCA 3KIPA 5EP3A 4M1QA 2BHLA 2GAFA 4GX1A 3M5CA 3VBCA 1EJ2A 2X8JA 3SF8B 4ZAXA 2CL5A 1P19A 4LWPA 1UBKS 3NVDA 1GILA 1SHLA 1SKBA 2XDQA 1CDDA 2W8BA 2KLHA 4F7WA 3PQ6A 3PRKE 2BOVA 1PDOA 3AF5A 2H4WA 3HRKA 2JHGA 5CCDA 4BASA 2IYNA 1CR1A 5ALOA 4MKHA 1SCJA 3OOWA 3HBMA 4K9DA 5KYYB 3H84A 2V7QD 4WDRA 5AESA 2PSDA 4DVGA 1P6UA 1P7PA 2ODNA 1N4AA 2G1PA 1YJQA 2IOYA 3HFRA 2O8CB 4Z3KA 5K4AA 5H4GA 4KO1S 5HTOA 2VT3A 4E5UA 4MPTA 3OLXA 1WDMA 1KU6A 2Q4EA 2WOJA 3ZJ4A 4CT5A 4M1WA 4L5JA 4DYVA 4E33A 3GZJA 1OKKA 4J8PA 1BO6A 4Y1EA 2VUTA 3U9TA 4XM0A 3VVLA 4OFXA 3TMYA 4LHSA 4MW9A 1NJ5A 1W93A 2BWJA 4WINA 4BFTA 2F1RA 3O8QA 1PTJA 5EQTA 3U3KA 3EMBA 3AZOA 4TKMA 3AV0B 2N0SA 4QREA 2XGMA 5FORA 1CVLA 4TMWA 2I9PA 2FPRA 1OASA 2QTVB 1FP2A 2GZAA 3RS2A 1IZ0A 5FWDA 2ONCA 5K8IA 3RRFA 4Y2YA 4TZTA 5C3MA 4B35A 3UHPA 4Q4AB 3U4CA 5GV7A 5TARA 1E7MA 3N39C 1D4ZA 3NHPA 4H3VA 1M66A 1XMVA 4O1IA 5LU8A 3A28A 2HH9A 1DLIA 3IA7A 3Q11A 3TX6A 1KP2A 3EXHA 3BRWA 3WK5A 4EZIA 4IY1A 4W99A 1X3LA 1NLMA 2HQRA 3AR4A 4KQ9A 4P35A 3BXOA 3BEOA 3CNOA 3LMKA 2AA3A 5DHPA 3RF7A 1WW8A 4N3GA 1CJSA 1WUJS 4RTMA 3U2QA 3C15C 3JWGA 1XZQA 1N92A 1Y3CE 4HKTA 1D1SA 2AFRA 3EJWA 3ENWA 1M74A 1N8TA 3UW1A 1XK7A 2NVUA 2PX4A 5EJFA 1G8YA 4J03A 2LPMA 2BFAA 4ZVQA 3QVTA 3X1JA 4A8HA 4D42A 3AIMA 5DGTA 1ST2A 3O8CA 1QZZA 5ITZB 1UFOA 3JR3A 2KHZA 4TQ9A 3LVFO 1Q1GA 3D1JA 4K46A 4D9FA 3V8PA 1YRHA 3F96A 5JAUA 1KTIA 1XLUA 1DAPA 3TQQA 2P5TB 3IVXA 3NETA 3O8RA 4PNPA 5IPFA 5FLEX 2P30A 4V0QA 4DCCA 1FA9A 1WSDA 2GBCA 1BG6A 2NZVG 2YDXA 1CR2A 1JBQA 3P71T 1WS6A 4ND3A 5H4HA 3NHZA 3SYLA 3FSGD 2PZAA 4LYJA 4YO7A 4QA9A 1MHTA 1JDBC 2NZXA 3EXIA 4WLUA 5F9MA 3WGMA 2JJ8A 2H31A 5JQGF 3U62A 1QYWA 3PQ5A 3ZDYB 1GUYA 4N8EA 2P5UA 3Q0IA 4MLPA 1F2TB 1BKDR 1UQRA 3V33A 4DPLA 6REQB 4K88A 2NG1A 4NS1A 1SD5A 2X2FA 2CL0X 4MGEA 2SICE 3K1ZA 3P2YA 1E96A 5F33A 1SUWA 3ZJYA 4G0VA 1QK5A 2Z5FA 4A03A 3IE1A 3QWFA 1LUAA 3A1VA 1LPSA 2ZS9A 1PTKA 2GSWA 2Q41A 4G1VA 2VBIA 5DMXA 2HO4A 1YXMA 4JYAB 1TQ8A 3T61A 1BDMA 2RAVA 2OGSA 3P4XA 1G17A 4IO0A 4N5MA 3VDQA 3U80A 5KQRA 4HDSB 1AV7A 4PHFA 2PL9A 4QYTA 4F3YA 1Z6AA 4QQNA 4M2LA 5HG0A 1D9ZA 3VKHA 5G0WA 1PR4A 4EHNA 5I9BA 5K0CA 1ZWKA 1ZXXA 3MMXA 2IY8A 2JC3A 4NMHA 4X6UA 2QTAA 5C8YA 3DXXA 5ALRA 3SM9A 5A7FA 3S1AA 1J9GA 1MOQA 2OBLA 3BGWA 4O4IA 2ZBUA 3RT7A 2QN2A 4F1WA 4P5EA 1UEXC 3ZU2A 3EW7A 4FFNA 1V9SA 5CAEA 5JNWA 3U6KA 1PWHA 4X3PA 3HO8A 4U63A 2IYRA 1X80B 3QZUA 4OHMA 3VKGA 2HD4A 3OE1A 2E4VA 3FTDA 2RJNA 4IRXA 1QGOA 2AHOA 5BQXA 3MYYA 2QD4A 3L1KA 3OHMA 4EF5A 4EJ6A 3U7FB 4WLVA 1EUQA 3G7NA 1RXVA 2WWWA 5AR1A 4NICA 1E4OA 2PZMA 1UKCA 3EGEA 3JWJA 3QF4A 4W5HA 2BAGA 3TF5A 3JQPA 1LC3A 4XW2A 2GLTA 5D3QA 5CBPA 1JQEA 3EVNA 3L5OA 4O4IB 2B4QA 1JI0A 2Q0QA 4X3OA 4TL8A 3GPIA 1ZAKA 3V00A 3QJGA 3ZHOA 4F4UA 1E7WA 3B5JA 8OHMA 3OPQA 3DTVB 3SS7X 4QUJA 5LA6A 3G79A 4J4HA 4F9TA 4ZZ0A 2HBZA 1DELA 2V3WA 4D3YA 2XGJA 3ZWDA 1XDBA 2JGDA 3D4PA 4LTMA 16PKA 3ZWNA 8GPBA 1UMCB 3NJ8A 5E1DA 5HOEA 4EY5A 5B2FA 3F9CA 4IFIA 1UOQA 1J8FA 2AOTA 5LXTB 2ZI3A 4WASA 3WAGA 4JV5B 1YSCA 1K63A 3QMWA 5ALJA 1B7GO 2XIQA 1PWYE 3CXUA 2W4QA 1VSTA 1F8GA 3TQCA 3A1CA 1P7VA 2JEZA 4DUGA 5K0ZA 3HA5A 3THWB 1R0CA 3AUXA 3QEKA 1CU1A 3GX1A 1WUYA 3DHWC 3FIJA 1YASA 3MTGA 5A2GA 1CHNA 1L4MA 1XTBA 2R47A 2B8NA 2Y0DA 2WC1A 3H97A 3SYNA 1VP3A 4UMFA 5MN5A 1TQ4A 1J0EA 1CUJA 4IXTA 1W2GA 4KB5A 5KYWA 4Q21A 2VJNA 2X4GA 1FCJA 5I7VA 1G8GA 1OZAA 1RJWA 4RF5A 1XPUA 5GQSA 3PEVA 3BULA 4C87A 1IQ0A 3F6BX 1YT5A 2AN1A 3KKQA 5JAHA 3COWA 4Q3KA 3M2PA 1E7YA 2VNAA 2IEBA 2QYTA 2R97A 1I6LA 4RSMA 4J75A 5HWSA 2JIZD 3RK1A 3HXQA 1EB8A 4V3BA 3TRIA 3OOSA 3WYBA 1II9A 2UYQA 2O7NA 4UCXA 1PIWA 3KJIA 4G5GA 4YLEA 4GLBA 4GVLA 1EX1A 2PXCA 4BUZA 5AK4A 1R0XA 1U9JA 3G9XA 4ZVNA 3ZLBA 3QEOA 2IBMA 3P0EA 3SJAA 2X15A 4DUGD 4H7PA 3T34A 5IVPA 5M29A 3UN1A 1TZBA 1F8FA 1XRLA 1NBHA 2XSZD 2I2WA 3Q8MA 4IDFA 4ZDIA 3BMOB 1M6WA 1LSOA 2UZ1A 2VZLA 5K09A 4TN5A 4V0ME 2HFKA 1N2CE 1NONA 3OE5A 3UIEA 3W04A 4DBVO 4Y2HA 5A7HA 1XCMA 1MLDA 2WABA 3GD5A 4Y2VA 1TKAA 3JV7A 4ZVUA 5U4QA 1GAQA 2CLMB 1KL7A 5BVHA 5JYEA 4OX9Y 3KKEA 3DYVA 3KLMX 5FR1A 2F9FA 5CB8A 2VT6A 2VPTA 3PU6A 2O2EA 3BWYA 3ZXYA 2BSAA 2J41A 3T3DA 1SOAA 4AN1A 1ZPDA 1RJEA 4B31A 4EECA 1I7SB 1ZEJA 2WIJA 2G5CA 1GA1A 1JKFA 3BGIA 1T5OA 2XR1A 3O8NA 2BGWA 1AQ6A 3FDJA 4CUKA 1AIPA 2NVBA 1GZHB 4RKQA 5DP1A 1T5SA 2KI5A 1ML3A 4YRPA 1W85A 3TVYA 4CL0A 5I45A 5C7LO 3RIYA 3HV2A 4LF9B 5KSWB 5EC8A 1NR5A 1SXIA 2XRMA 3MJ4A 3Q7IA 1ULHA 2CLDX 2P7IA 1TUBB 3EQ2A 3IYLW 1MOSA 3HJUA 3R6LA 4HX2A 2NVUB 3X1WA 3MOGA 3F73A 3MJRA 1SUPA 3RROA 3UHAA 1IBRA 3ZVRA 4C5BA 5DTMA 2FE4A 3PL1A 1PCXA 2P9CA 2Z57A 3F5QA 4Q3EA 1FDSA 1GXSA 1KI7A 2O7RA 1B14A 4A3SA 4N0EA 4CQLB 4GC5A 4FYPA 4X62B 4YUXA 5DLYA 4K87A 5EJ7A 1GTRA 3HVKA 1M1NB 3UANA 5BYKA 5KYGA 3B1FA 1GQYA 1FSPA 1DTWA 1II8A 1XTSA 2VDLB 2YR0A 3U0BA 1P39A 1PVOA 2VNKA 4EZEA 1BXKA 2R6DA 1QQBA 3OQIB 3WDLA 2A9QA 4W9MC 4LF5B 1UIRA 4I8XA 4ZEVA 5EIEA 3N75A 4P38A 2QF7A 3AUJB 1J20A 3E9MA 1JQJC 4GXNA 4OBWA 1S9HA 2R7LA 1OWNA 4HYYA 4L07A 4UE3S 4UUPA 3HDYA 3JQBA 2COUA 1F2TA 3CH4B 4FVTA 4ZARA 3CUSA 2X6RA 4ZEMA 2X0NA 4BCCA 1JL3A 1H2RS 4Y1RA 4PPQA 1TKCA 2QZPA 4OX9B 2PRJA 2H2FA 1ZJYA 4CL2A 1P1JA 1YQDA 2ZCUA 3IAFA 5D51S 3EA5A 1PR9A 2QTGA 2REBA 1Y5RA 3FWYA 5JNTA 2ZYRA 1QJ4A 3X2SA 3TBFA 3FCEA 2Q2OA 3D0OA 1SCDA 4AICA 1TCVA 1O96B 5EWMB 2QQGA 2QVBA 2C4VA 1JQDA 3H8WA 4MDYA 3DMHA 5F2OA 2FP4A 3AKCA 3MB8A 4OQFA 2NN3C 3O92A 1I0ZA 4I6GA 3AVQA 1TYBE 3R7WB 3W3AD 1P5ZB 1FP4A 3H4TA 2WD8A 1DBWA 1KGSA 3IHKA 4EFDA 1NUTA 4D79A 2YOHA 3CLTC 3W0LB 1RZRD 1DO8A 4DLZA 1LW7A 4YUYA 3TTXA 2VRNA 2JFQA 2YQZA 1DDIA 3C8ZA 3CF4A 3LF1A 3ROTA 3PUWA 3CC8A 3GROA 4IJQA 2F8LA 4MCAA 5TC4A 5IJ0A 5TGTA 4QUEA 1V6CA 3FPGA 4RY8A 4DLTA 5AVYA 4XDYA 4EMTA 2AX3A 4U6NA 3CB2A 3F7MA 5ERYA 2RGUA 3O9MA 5LZ8A 1SM4A 4B6JA 1XCBA 2VQ3A 4J3NA 3TW8B 4JELA 3T3GA 3DZ8A 4DM3A 3W9YA 1CFJA 2BE7A 4MVJI 4WESB 1XWIA 1JN0A 4FW9A 1ODSA 3WMEA 2BMVA 4CF3A 2BPOA 5EIFA 2XDYA 2RGWA 3ELWA 2OY0A 4QUBA 3AF4A 4AMUA 5JIBA 4S1VA 1E62A 2IIBA 3MINB 1D6NA 5ARDA 2LW7A 3S8EA 1KFKB 3UJBA 5FA5A 2GERA 3N5KA 5D5QA 4B76A 4OL0A 1Q0UA 2D2VA 2HWKA 2W2KA 5EJMA 3SLGA 3V3KA 1OGJA 1MPTA 3C97A 4A92A 5P8WA 2OZLA 2VDMB 3VSAA 2PGOA 2WTNA 4IIFA 4LRYA 1GUAA 2NO7A 3EB9A 2N46A 2ID9A 4YTEA 3DPUA 3IPCA 4CKCA 1QE3A 3UMMA 1U7OA 1W8DA 3NU1A 1R9GA 3U7RA 4DLSA 3ZE8A 1D2EA 2GAJA 3C87A 4TTAA 3VGPA 4CM4B 4DY4A 5G2OA 3M9LA 2YWBA 4LSGA 3LT5A 3VOAA 1NMYA 4IOLA 4KKXB 3DFIA 4O2BA 2OZLB 5GADl 2GKOA 1C4XA 1HE8B 2XUZA 1EAMA 1JLRA 2RIRA 4UHCA 5FAXA 4DTIA 3EMVA 3RGGA 3RV4A 4Z7JA 1J2TA 5C53B 5JLJA 1J06A 1EM8B 4MP8A 2XH8A 1P72A 3QM1A 4XIYA 1RBYA 4KN9S 4CKCB 4U7FA 2AS0A 1ODLA 1RYNA 2YYYA 2GN2A 5IZ4A 1QDEA 3AOEA 3QEMB 2V9PA 4N7JA 3ZCUA 1LX7A 4F93B 4IQ8A 1AKTA 1EDZA 3A14A 1YZKA 1J8YF 3JVDA 4PRZA 5AJWA 1EK6A 3LOUA 5KCMA 2HC9A 4UHBA 1K4YA 3TRKA 3TRHA 5BN5B 2ZSBA 3KLBA 5E0OA 1NI5A 2C9ZA 4OL9A 4XARA 1KMCA 3HKEB 4MO2A 2PH3A 5A62A 4OUDA 1KKMA 3VR0A 4I7EA 2PLRA 3V4FA 1OLSB 2HJGA 2YASA 2ZYUX 4CV2A 4AMVA 2N9UA 5DZSA 3L0BA 5I7FA 2Y1FA 1X8KA 3L79A 1JXOA 4BU1A 1YMQA 3AYZB 3NWOA 3RAJA 1EK2A 4YRJA 2QE7A 3I01A 5AM1A 1XMQB 1ZK1A 4OM7A 4F5EA 5KOJA 1QVAA 2C20A 3UPUA 3B3FA 1DP4A 2WJYA 5ERXA 2Q3BA 5DK4A 2J6IA 3AGPA 3BTOA 4WHMA 4P33A 3T1NA 3NBQA 1P5JA 4ND8B 5JS7A 5JAOA 2C03A 3ZNNA 1O5TA 3R7BA 5KC8A 3HACA 5HTKA 4BNVA 3LCMA 4OSPA 5LVAA 3AERA 3ROFA 1IDOA 1RHRA 4K1LA 3GLHB 2ATEA 4Y0AA 4KWTA 3B12A 4R1QA 4LBWA 1Y8CA 5CDFE 4O2LA 4BXOA 4N18A 1NZFA 1BJTA 1ABEA 4QARA 4MI3A 1N7HA 2JEYA 4L6CA 5KMGA 1Z2CA 2AFVA 3ZJ5A 3ZWWA 3B38A 1VL2A 2ZPUA 3N2KB 3T7RA 4FKZA 4GEGA 1G3UA 2E89A 2GAAA 3U4QB 4PLVA 2EFYA 3WDMA 1E1RD 4O4LA 1XU7A 2QTBA 3CZ9A 1IONA 3NAMA 5IVKA 4KTVE 1ULTA 3PFNA 5JVDF 1JXQA 4XUGB 3AI1A 3EC2A 3AERB 5AW5A 3SEQA 3L4JA 3S5UA 1HPLA 3HDJA 4L5CA 3RRNA 3X44A 3UO8B 2OG2A 4PRLA 3FPLA 4KODA 4MGYR 2XXJA 2IIVA 2HJWA 4I55F 1W581 1GGEA 1BWSA 2G67A 2PO5A 4HD8A 2G08A 4IR7A 5TQ2A 3OTIA 1BS1A 1KJZA 2JARA 2JS7A 3GJ7A 4P82A 2ZBDA 3WBJA 1PWEA 1V9LA 1FIUA 3H3XA 1TT7A 3T0FA 5EESA 2FSGA 3WXMA 2H0QA 2QRNA 5HQ3A 2GSDA 2LP4Y 3DULA 2K4MA 3CEHA 3L18A 3LT4A 1JB1A 4LBZA 5EUCA 1AX9A 5K2OA 1JHQA 4B2IA 4HDKA 3THSA 5JASA 3SD7A 1M34E 4XFKA 5KJ1A 2CB9A 1CK4A 2F1JA 2EKDA 1ZHHA 2MCFA 3V6LA 1Y6FA 2OQIA 1IBSA 1QK3A 1ZUHA 1ZOIA 4BVBA 2HQBA 2QL5A 5K3AA 1SXGA 3EUFA 1I9CA 1E3EA 5BV7A 1O1YA 3FJ1A 1USWA 3KQMA 4UTPA 1KO4A 5GOTA 4P7KA 3GRZA 3Q9LA 4YHBA 3TR0A 1OH7A 2JKZA 3NBZC 1N33B 3EZ2A 3DTVD 1MIOA 3Q6IA 1EFTA 2PLFA 2VPPA 3BE8A 2NQ2C 1NW9B 3IRVA 4TUYB 2D7CA 1SVKA 2C77A 2O4UX 3EMDA 3OLCX 1DI0A 1YZQA 3LYHA 2ASVA 2YXEA 2ZUWA 4IDBA 1P9OA 1UPFA 3ORYA 4Y2SA 3A2KA 1JDSA 3B1ZA 4BRUA 3DXYA 4DSUA 4WN9B 2QEQA 5C1OA 1YDFA 1MX9A 2JATA 4TS4A 4AKSA 5HGXA 2X9LA 3SR4A 3KLOA 2JGIA 2XYGA 3VTAA 4B4DA 1T9KA 3KXPA 4BQRA 5KTYA 5M04A 3KSDO 4LEIA 2A5GA 4ROSA 4I3FA 3KVRA 4TL6A 3RKRA 1ENOA 3T94A 2MR5A 3EVDA 3BCUA 2ZU0C 5E6SA 1QC5A 2ZJ8A 2A1UA 2I6XA 3CKYA 5KAMA 1RP7A 1PSZA 2WMOB 5A06A 2I22A 5L3SB 1NGSA 2C2BA 2G9ZA 1FFXB 4ZXFA 5BUZA 1XWWA 4B4WA 3FCSB 1CNEA 1WPQA 3FUWA 4MV6A 3LYAA 5T7BA 1CZKA 4DAOA 1X7ZB 1TF5A 2V7PA 2ZULA 5HF8A 4GMDA 2OD9A 4DBLC 3AK4A 3COPA 4KQ1A 1EFRA 2QRPA 4QGFA 1KC3A 1I0LA 5JARA 3OKCA 3JALA 1ZW1A 3PFHA 1X80A 4KFUA 1P7WA 1UT6A 1X3SA 1C1XB 5EHGA 3JATA 1PK7A 3KKKA 4PONA 1R9MA 2NTNA 3GFSA 4O8ZA 1U94A 5D6OA 3Q88A 1IM5A 4KOEC 2QUIA 4BNUA 1WZEA 4BDSA 1KEWA 1Y7PA 4JSTA 4EKIA 3R41A 5LUBA 4RORA 5JSUA 1A2QA 3EZXA 1U7XA 1MVLA 1SHZA 3ZWQA 4AS2A 1R8YA 1VSBA 5CDFA 3AILA 4C03A 1VDZA 2FXIA 3I3SR 1W2HA 1F51E 3HVHA 4QYWA 3O93A 2BGLA 4TVKA 1FFCA 4DARA 2QDXA 1P4JA 4MGZR 1H2BA 3V1UA 1DDGA 2A9OA 4EABA 5JJBA 3SHVA 3TSCA 1WLSA 2JNWA 4XJXA 2NU7A 1Z16A 5AM0A 3OJXA 5EXSA 1WRBA 3LT0A 5FNVF 3L6RA 5CH3A 4OQNA 5LA6B 1WSWA 1A5SB 1X15A 4H3KB 4Q34A 3SP1A 4BQEA 1N6OA 2CBZA 2CBXA 4QVKA 4NU5A 1HQKA 1GV0A 1SBHA 2WYOA 1J23A 4DMMA 2ZVJA 3KD3A 2AOTB 1DADA 1S9DA 1N2HA 5EJ9A 1K7CA 3VH1A 4C0AC 2I4NA 4JROA 4GZLA 4C78A 3N05A 3LM8A 3KKOA 3QX3A 3WJ7A 4FGKA 3COVA 4HH4A 2Q6KA 5BN3B 1E5QA 2ISQA 3RI3A 1U81A 2N42A 3DL2A 5KVSA 1NRXA 3ZDFA 4UJ5A 2NU7B 4RJIA 5F5LA 3QEJA 5AVUA 4CEIA 2H2WA 5CG1A 3M82A 4BMVA 3IE0A 4UPVA 3ZY5A 4C05A 2QN7A 4R16A 3N2EA 4KXWA 4NU0A 1NJFA 4DCNA 4YP7A 4AJLA 4HQOA 3O1HB 3WGZA 5D3ZA 2I0FA 1FX1A 3WLLA 1ZVKA 1N7JA 4C4YA 5IKXA 3GGCA 3WIDA 4I1YA 3OIGA 3ZD8A 4WOKA 5K8UA 5EZ5A 1J0CA 1UXJA 4C0XA 4RVNA 1KERA 4JA0A 1BFUA 1EWTA 3SR0A 5LWQA 3TAUA 1RIIA 2IGBA 1Z5UA 4KXFB 3LY9A 3OQNA 1Y9EA 1R2QA 1K7SN 1EE9A 1AG9A 4C6TA 5TE9A 3K8ZA 3E22B 4RDXA 3G5LA 3WL7A 1H5NA 1P7CA 1UFKA 3FPAA 3AB3A 4Q93A 1V7QA 3HP7A 2CHGA 4D0NA 1YZUA 4ZI2A 4ECEA 3PDUA 1K6EA 3ROGA 2HMUA 3RJMA 3EZFA 4GUDA 2VNSA 2H1FA 2ZRDA 4YMUA 3RRXA 1O77A 1MDFA 3KXDA 1XN1A 4OHOA 2FPXA 1ONNA 2V3VA 3CEMA 2QQFA 1RHKA 5A9TA 2R8YA 4UOEA 4R2MA 1VHDA 1I7NA 4BLOA 2G77B 1CIPA 3PX2A 5A0VA 1Z08A 4NBUA 4DLVA 1GQSA 4OYRA 3EDMA 4LMRA 4E5PA 4ERXA 1DC7A 1EJ0A 5HHTA 3VC7A 4B0PA 1PFVA 3JQFA 1E1QD 2QSZA 3GGOA 1B41A 3ORRA 1RM5A 3OFND 4R8SA 1XHFA 4PYMA 4LV6A 2JVJA 4D97A 1RWOA 2ATCA 3PV0A 3O74A 5JANA 2GZ2A 5LU9A 1O4VA 2WHPA 5F7JA 2C0QA 2DFPA 1OR8A 1U8XX 3WDSA 1ZAYA 1EVZA 1OAKA 1UBGA 2AEFA 3ETCA 1G5RA 2QW8A 1N2IA 2WVHA 3AOGA 3R20A 4LOJA 4OQEA 4DREA 2ARKA 3CVWA 2ZIEA 4GI5A 3DWEX 4Y2XA 1IMOA 1TKBA 3G5TA 3RWMB 4BIIA 4ALMA 1OLOA 3DVAA 5B58C 2PUFA 3JARA 4OXKA 1WU8A 3N7TA 4ZODA 1QH8B 1YBVA 5HM6A 1QFJA 1QKIA 1OVMA 1BIFA 1L7RA 2X6QA 3KKMA 4KN5A 2ZRMA 1FNDA 3AQIA 5JY1A 4XYGA 5D85A 4EMUA 1RQPA 2BDUA 3R4VA 3LG2A 3PB3A 1BRTA 2C9BA 3Q7TA 1MX5A 2WJWA 1FTSA 1J0AA 1T3GA 2X8BA 4B6GA 4AY5A 4RDCA 4KWEA 4G5FA 1NASA 1R6BX 3Q87B 2WYWA 4JZKA 4INJA 4UE6A 5DJ5A 3VOSA 4E51A 5BOSB 5JATA 4KAAA 4XCXA 2XKJE 4A1OA 4B44A 5KNDA 2IE0A 2D0IA 5KTRA 1V8PA 1U28A 4FDUA 4HT3B 3ITKA 3TBKA 5I4IA 3JARB 4I1VA 1PGNA 3UT5B 3OMWA 3IEMA 1F3OA 1DHRA 1MB4A 4ER7A 2I1QA 1X7GA 3U61B 2SNIE 3QXCA 1SIBE 4TMFA 1RLOA 2XQJA 1A72A 1NYQA 2RCNA 1QF7A 1JIQA 2UYGA 3O75A 3T9AA 1MHPA 2FLKA 1GP2A 5KYUA 3TUJC 2VZEA 2H9IA 2KWIA 2AYYA 1RRGA 3AWIA 1AN0A 2JJ1A 3K6JA 4KCGA 3RTBA 4EY3A 3KQHA 3PC7A 4PYJA 4JC4A 4BMCA 5E6SB 2VEDA 2BFCB 3EZLA 2Y3IA 4PAMA 1TVMA 3KYCA 5SY4A 3WBKA 2J8ZA 4DIKA 1TIKA 1KQFA 4MV3A 1UBEA 1NSYA 1Q1AA 2B82A 2GQ0A 3HADA 1EE2A 1W5FA 2HDNB 3EIEA 1FP4B 2PH1A 5BSHA 4RH0A 2VWGA 1YR8A 3DAOA 3MGAA 5FTJA 3PDHA 1LPOA 2XRFA 4BUCA 1P73A 4EG8A 2IS6A 4PHTA 4KQKA 4AKTA 1K7FB 1F6DA 1ORIA 4TMKA 4NNPA 2PS3A 3R9XA 2JLAA 4HLDA 1KMIY 1RADA 3A2NA 4CMBA 1V45E 2ZTMA 3Q0EA 1VB5A 3BZUA 1KKLA 2PLWA 2WKRA 3BKXA 5AUPB 4QDXA 1NIPA 3T52A 2HTEA 5AOAA 1WBDA 1OZ0A 3A4LA 1M2VB 2OOKA 4W7SA 3WBBA 3UFXB 3KOMA 2X8AA 3H5OA 1KAQA 2H85A 5EGSA 3WV4A 4WESA 2VRCD 4PV7A 5HKKD 4IZ6A 5U1PA 3JQFC 3KUCA 4GW3A 3DF9A 4NYMQ 3CX3A 2X0FA 1P75A 3MTQA 4P3YA 1U1CA 3RFXA 3EISA 3M1IA 4H4DA 1PYOA 1FDOA 2C7GA 2P75A 2ZBPA 4UUQA 3RT9A 4CLDA 4D56A 4ZCPA 1P8JA 2Q07A 2GMWA 1E0KA 2AKYA 2JIMA 2OXEA 2IHVA 3D8UA 3WP0A 2YWDA 4M1YA 5TB5A 2NO5A 4NHEA 2GBPA 1XSEA 4KIUA 3EFEA 1M75A 1PFGA 3Q5DA 3VZDA 4BZQA 2X0RA 2Z5VA 2NW6A 4LZJA 4PNHA 5A5GA 1KFBB 1ARZA 1PDVA 3G3EA 4Z0TA 2ABWA 1NHWA 3DLCA 2ISCA 2O0JA 3TRDA 4OK3A 4URYR 3OQPA 5J58A 2EERA 2ZPAA 4IZIA 2PZJA 1X1AA 4FFSA 1XEXB 4LMPA 4Z4EA 3IA2A 2W6QA 4KLNA 2P9QA 4B34A 5CNJA 2D06A 1T8WA 3P45A 5BNIA 3OSZA 2DTDA 4B45A 1VMEA 4ABYA 1KJNA 2GEBA 1UDWA 2H65A 3BF8A 3H5AA 3JZMA 4FXPA 4PLPA 5IAOA 3I61A 4AU1A 3DMTA 2CLKB 1OWPA 1JAIA 1WULS 1IHDA 1T2UA 3P0IA 1GT91 4ENTA 3KTAB 3UWPA 2QN9A 1QYCA 3GT3A 2ACEA 2RI0A 3B8HA 1NFRA 3GEEA 4Q18A 5EHNA 4Q9AA 1JNXX 2WWFA 3Q2KA 1LI5A 5ALHA 4UU0A 1UUFA 1Z0KA 1H9AA 2WILA 2FRDA 3VJKA 1YA6A 5EPEA 3ACBA 4X00A 1ZN9A 1QPBA 2WWGA 4DNFA 4PYLA 4CUZA 1XZDA 1JPJA 2Z56A 2XNDD 3ZVLA 1NUUA 1GUBA 2P0EA 3I39X 2UVPA 4R8VA 4RPCA 5TMPA 4UHDA 3FLMA 1P3JA 3VYVA 1U9ZA 4MGKR 3OOEA 1AN9A 2BGJA 3K0KA 3LKBA 3KZMA 2OB1A 4NCIA 3F1KA 2QG4A 2ECPA 3BOSA 3JW8A 4P32A 4UTVA 3TZBA 3D02A 3E82A 1YIOA 1K9SA 4XX0A 5GVRA 4EHJA 1MG0A 3TTUA 4EKGA 4PW0A 4RH3A 4RQTA 5J1TB 1K6XA 3PXDA 5TS3A 2VHXA 2QJFA 1NAHA 3QRWA 4REQA 1DC4A 2XB6A 4YJ3B 5D84A 1G66A 4E08A 5BORA 1P18A 2BMWA 4FOPA 1TEZA 2C1EA 2WHPB 1L5VA 2XX3A 1N25A 1Q57A 4BJ5A 1A9ZA 2FPUA 3D0QA 4L22A 5CDYA 1GARA 1Q2UA 1XE3A 2JJYA 1JQAA 2FFHA 2W90A 6GPBA 3EUAA 4G8CA 2FX3A 3S7TA 1L5QA 3ESBA 4HRYA 2VYVA 3HH8A 3VU9A 4WJLA 1R7RA 4GZMA 5K3FA 3R0JA 4NYIQ 5CB4A 3JQ8A 3NV7A 5CT6A 1SH7A 1IHXA 1CQJA 1XNRB 2YFQA 3JAKB 2C54A 2R8OA 4UM9D 3SKYA 2Y92A 3BK7A 3FGPA 1IWBB 1R4AA 2ZKLA 4M1KA 4BU0A 4N9QA 1XD9A 1ZA2A 4Q7QA 4O4JF 2B1RA 3FKSA 2H57A 3I04A 3TCNA 4OHPA 2C9DA 1G0NA 2WB4A 1KI9A 2B5VA 3D43A 3CHYA 4QUDA 5DBEX 5CLIA 5IN5A 1ZKMA 2HA0A 2VTDA 2H5EA 2J0QA 5EXEA 4AW9A 2VQEB 2GXAA 2G0TA 1WZ2A 3ANYB 4RCZA 2MSLA 3QUBA 2WEKA 4OGWA 1GZ4A 4GMKA 4KW7A 4AECA 5KNBD 1VCOA 4GPBA 4EI9A 2CNWA 1O6CA 4B3SB 3AHJA 1IZ9A 1G8AA 2GN9A 2TS1A 3NHRA 1SU8A 2O0LA 3OKPA 3ZK9A 2WQ7A 4LYFA 5T67A 3V97A 4LC9A 4KQXA 4B3CA 3WNCA 1EE1A 2QY9A 4U02A 3ASZA 3CRZA 3MTBA 1E1MA 3GFBA 3U4IA 4G4JA 4XIGS 2D1FA 3B1YA 2HHJA 3ZDRA 3FYDA 3TZCA 4E7PA 3AGQA 3ZKAA 5CLJA 1A2BA 1E9RA 3BH6A 3MWJA 2ZB7A 4MQBA 3K0SA 1V1RB 1GFZA 5IC5A 5TVKA 4YGYA 2YUTA 2BJHA 1KAEA 1Z6ZA 1C7QA 3KLNA 4JUDX 3DZKA 4F6CA 3RYHA 3RBAA 2BM9A 4Q00A 4FC7A 4NBTA 1I94B 5ANRB 1XTIA 1M5TA 2IYQA 4QU0A 3ISJA 3PXEA 2HQOA 2JD1A 5FOWA 3RHZA 4PAOA 4DY6A 2PM8A 1EBBA 1Y81A 4NZPA 2CL7X 2KBEA 3G5MA 3K0HA 2NSHA 5CCXA 1GNLA 2X2PA 3ZPXA 4ZKDA 5JZVA 1RSZA 3WHKA 5JOQA 2HXGA 5B2ZA 3M81A 4EUNA 1S1CA 3O5AA 5C0OE 1ORHA 3Q12A 2QM0A 5K99A 3BQ9A 1IXKA 1GPNA 3EWSA 1SUEA 3H5RA 3ONEA 4HUTA 4WK0B 4YAJA 1I2ZA 1B43A 1M0SA 1W0KA 1THGA 2ZIXB 4R9SA 1F0NA 4PF1A 1SUCA 4MVJD 1AKMA 1L7NA 2RGCA 1GSIA 4FLFA 2VOJA 1VBNA 3F5MA 2XWSA 1YRWA 2QP4A 1Z2PX 3SNKA 4NBWA 1ZITA 1JLKA 1THMA 4P9NA 3B36A 3UJDA 1G5PA 1OXUA 3W1VA 1P0FA 3GMIA 4IBOA 3OZCA 1S8AA 2VN8A 4DIBA 4V03A 4Q9DA 3HPQA 4YCNA 1GL7A 2YV4A 5B53A 4XASA 2HAEA 4Y0VA 4YRSA 1Q0LA 3OZIA 5F23A 1FNBA 1OYYA 3AIIA 4FT4A 2EFDB 4JXXA 2WU8A 1TK9A 3RVNA 3OBIA 4QXOA 1ACMA 1ZMOA 4KUHA 1XQWA 4QQKA 2K7FA 1MNQA 3SXUA 4LJ8A 3KSMA 3DJFA 3L1UA 5AW7A 1YK0A 5LSAA 3NBUA 1SZDA 3KHSA 5CVVA 3ZCSA 3RYFA 1VCNA 1FXUA 1NBWB 1T2CA 3EEBA 4WIAA 2YJGA 3OP4A 2C4HA 1D2AA 4Q9IA 5KWIA 1NF2A 4QUGA 3M4NA 3K5IA 1Z8HA 1CCWA 4DYDA 1WQ1R 3RB8A 4BIMA 1NUHA 1ZM2A 1A4RA 3WLQA 4I1RA 4LJ5A 2QVCA 4EJSC 1XNHA 3F5SA 3NR2A 5ALPA 3IP8A 1N32B 4PAQA 3I1JA 3KR1A 5F52A 1ESEA 5E9QA 4F8JA 4HWGA 5MDHA 3HR8A 3PS9A 1EBFA 4DDMA 2O1SA 1QBGA 1VPVA 1PZEA 2XCTB 1TJNA 4OATA 1T0PA 2IE8A 5HZHA 3MF4A 4F1KA 3T3IA 1JR6A 3LFHA 2FDCA 2BBOA 1XELA 1PL6A 4LF7B 4C43A 3RUAA 5B57C 1UMKA 3I64A 4BVHA 1W1WA 3PRYA 4JMPA 1R9NA 1WWKA 4CKEA 1TGYA 2P40A 3P26A 1DKUA 1WXEA 2AEJA 2R1TB 4H27A 2W6PA 5BYBA 4D6PA 4E3ZA 2YRXA 2HLDD 2YVAA 4B9EA 4ZDJA 2NP6A 1KIFA 4Y1RB 2NPIA 4EJ0A 1XDSA 4JB2A 3PGKA 1KSHA 3R44A 4IQ0A 1CT9A 3DV0B 2EJCA 4FYHA 2HDHA 4YIHA 1E2NA 2WTBA 4WD3A 3WL6A 1EP3B 2V03A 4ESOA 3VPDA 1T9DA 5COBA 4ASUA 5KTPA 1KZYC 3HEMA 4FQ7A 3R8XA 1GG9A 1OWLA 1U5BA 4RO0A 3FSEA 1O08A 2DPMA 2DT5A 4RBNA 4RJ2A 1V2HE 1UBTS 2O52A 2ODPA 2MTBA 2NV0A 3LP5A 3OD1A 4BQSA 4QXRA 1NRWA 2FF7A 1Z8FA 3C6XA 5IJAA 4EFLA 3NKFA 1M6EX 1Q3KA 4TLDA 3P9ZA 4MRRA 1QRTA 5DASA 4LZPA 3KDPA 4JSRA 1IUPA 1CPYA 3LY5A 2ZU6A 1XP8A 2IPMA 1R6DA 1VMAA 2G5PA 2VWQA 3IQZA 4ZVTA 4H1WA 1Q0RA 1S2DA 3JVIA 1MZVA 2QMOA 4WXHA 3R6DA 4GRDA 3VU9B 3EDOA 4RUKA 4ZAYA 4D9IA 1U5BB 3AXTA 4D5EA 2YWEA 1HBJA 5LQCA 3RT1A 1QCDA 3EAQA 1MZPA 4Q9LA 4TYMA 1UK6A 3GBSA 4BV3A 2YJTD 3BPSA 7YASA 3BBPA 2EZ8A 4O3FA 1FBNA 2XBMA 3PC8A 4D81A 1E0DA 4DA9A 2QZJA 2GR9A 5CITA 1TVEA 4JT4A 4CKXA 4HQNA 4TTJA 3TR5A 3ZY3A 1EDOA 3BILA 4PYRA 1U9IC 1KRXA 4YJGA 1WCXA 2GK7A 2C61A 4YVFA 3RS7A 2DQZA 1U1IA 3QWHA 4C7JA 1PT6A 2DBYA 4JKOA 1KE1A 4EDHA 1CNMA 3CQ9A 2GHTA 3KTOA 5B6JA 2IYZA 3BKWA 3C4JA 3CUUA 4HWTA 5AVSA 1Z8DA 5BV0A 1YA8A 1YQQA 1WEHA 4RS4A 4AX8A 5ITSA 3PFCA 1CRZA 1GZUA 5CFOA 3B3GA 3NVKI 1ONPA 4MRMA 2QE7D 2YWGA 3SAJA 5CHYA 2KE5A 4AS3A 4AVYA 1PR3A 5F9HA 3FWZA 4JEMA 1JQLB 5F1PA 3SE0A 3VZRA 2PQ2A 5G1PA 2EJUA 3PZBA 4WZZA 2FTKE 2P9TA 3HO6A 2VP6A 3G0OA 2OAQ1 3QWAA 3ONNA 4UOQA 3BDVA 2D2IA 4RTJA 1U6JA 2IY9A 4J94A 5T4HA 4ALNA 4X0EA 6LDHA 3H86A 3N74A 4OGFA 1AGRA 2H2IA 5BYJA 5HR5A 1TYZA 3CLRC 3MK31 1UXOA 3NFRA 3NP7A 3UB3A 2QTRA 4B83A 3JAWB 5KKNB 2BLNA 5FR2A 2X0DA 1P1HA 1V1RA 1KMNA 1KQGA 4QT4A 1XVTA 2FZ5A 4JQOA 2YWRA 2Q2NA 1VIVA 3DEAA 3G59A 5AXDA 3RASA 2HO5A 1H3FA 2PQ0A 2TMKA 5AIAA 3SICE 3NC1C 3SY8A 3BSWA 4MRNA 3S8MA 3T12A 1HQCA 5AVRA 3ROZA 5TQJA 4M49A 2G9NA 3UV3A 4FQ8A 4PR0A 3N07A 1HG1A 1VB3A 4O2RA 5FA8A 3P2JA 4AMGA 1JLLA 4WXRA 2CLHB 1XPJA 4RTLA 5LMNB 3OAAD 4TXMA 2B94A 2Q1TA 4LJYA 4U0KA 3CX7A 4F5ZA 4XIIA 4EQ6B 3HRIA 4OQMA 3N3AC 5E6RB 2RGNA 3UAYA 4BAZA 4DM7A 2QENA 4DZTA 5AI8A 1QQTA 4YECA 4DABA 3W2TA 1P1BA 3T5CA 2I7DA 2NUBA 4Q16A 3IOBA 4M8SA 4WH0A 2PWAA 4UNIA 5ESXA 3AEXA 5T41A 3WL8A 3DE2X 3RVQA 1CVIA 3DLAA 4TYYA 5IEBA 1Y4DE 3TLJA 4BJ1A 1INLA 3L0IB 5IAEA 3WRVA 4CMIA 4QDTA 3QE2A 2FYTA 3G2OA 2ZRCA 3QMPA 1O9BA 2I4IA 4QO7A 5UKDA 4BTEA 4UZFA 2AN3A 4A36A 1LH0A 2YXBA 1MX1A 3BJRA 3D6JA 4CTOA 3ICQB 1DWUA 1X9HA 3KJQA 4PC7A 1XYGA 1RE0A 3D8RA 3C14C 5JJKA 2WQ6A 1Z4OA 2QRKA 4H31A 1VRCA 1G3RA 2PR7A 3HCRA 2ZYAA 2YC4C 5BRAA 1BNCA 1NF8A 1ZEMA 2CK3D 3CN9A 4LJ9A 4UU1A 2J59A 5KKCA 1HSOA 4WLFA 2AI3A 2AJDA 2ATXA 4FEEA 3A25A 4GMHA 3RHFA 3OZVA 3UWMA 1H1LB 3GPLA 4ZOEA 4YN3A 3GCGA 2B69A 4G4SO 2A0XA 3FOAA 4H1TA 2QBYB 4UUMA 3S4YA 3E0XA 3ZQKA 1VZ3A 4HL6A 1UDRA 5TPZD 4UAVA 1IRIA 2YY7A 4LCBA 2Q0HA 3COJA 4G81A 5E2IA 1NNLA 1CDZA 2DQ4A 1XDGA 4INOA 2QTMA 4OHKA 1U0BB 2WTUA 3RVPA 1RU3A 4LXTA 1B2LA 2A3RA 1G6HA 3NNDA 4HZUA 1FFYA 4PZAA 2OA0A 1BJRE 1GYPA 3O4IA 1JHZA 1NN1A 4CQMB 3UGJA 3DE4X 1ZSYA 2CXQA 1VL0A 1QLJA 1DWQA 4MMYB 1ZK0A 1R6UA 1YUMA 5EPOA 8ATCA 5JH7A 4GHWA 1TVKB 3H9BA 4M0DA 4CM7A 1Z37A 1T36B 1EFVB 3IVGA 3TW6A 4IDAA 3HJBA 4TMYA 5C7IO 3EVEA 4U2BA 1WCYA 3B7PA 1HT2E 4ZO4A 3SQWA 2G80A 3B9QA 1E7SA 4OXXA 4R7GA 1LGYA 4MX8A 1R0YA 4TT3A 4EUKA 3PENA 4CM8A 5TT1A 5EMNA 1P2UA 1YO6A 3EIOA 3JD1A 1LBSA 4GYWA 1ZCJA 3FFWA 4JQYA 1P4SA 5B4VA 2V5UA 1JFLA 3WWYA 3UT0A 4DCTA 1HNXB 5KQSA 2WNIA 1UJ5A 3KKPA 1A5ZA 3PC8C 4NPAA 4DA7A 2F3TA 5JJCA 5JH7B 3O31A 4YAIA 3RFTA 2I7VA 1M0TA 3CEJA 1Z7GA 4X24A 2W71A 3K8OE 5KVVA 4JJFA 2O5RA 3WGVA 2B2NA 4KQ2A 5JZ9A 2Y1DA 4YWJA 5DLQC 2FFRA 3TG8A 4RSRA 2R8ZA 3QU7A 5NLLA 3CNQS 3NIGB 2F9LA 4G0XA 4H1UA 1CUZA 3DEFA 4MDEA 4ZAGA 3IHWA 2X7XA 5CD9A 1QG2A 4GQAA 1ZKDA 2FRVA 5FPTA 2G82A 2ZIVB 2YJNA 3H17A 2P11A 3ZI7A 3DMTC 1WBBA 1U3GA 3BCRA 2A4MA 1PR5A 4YV0A 3U3OA 2FZGA 4DA6A 4JJ4A 3JS5A 1OIWA 4U7DA 1L7EA 2IUYA 2PUDA 4MKIA 1B73A 2BGGA 3R0XA 1R0LA 4FFLA 1PZFA 4CN9A 1EXWA 2FJUA 2NWQA 3FPEA 3LYLA 4RPLA 1I7QB 1IN1A 2NV2B 2HU5A 3L6OO 4G85A 1YS7A 2FEWB 2WPNA 4HQRA 3ZJVA 3KLPX 4JX8A 3EIQA 4LVUA 4UATA 3RIEA 5AUQA 1W4RA 2W42A 3ZE1B 3PGLA 1N9KA 1Y1KE 1VMIA 5KQLA 3INYA 4JJAA 1RFLA 2VWPA 2ETVA 3B2NA 3SZLA 4ALLA 1NC3A 1VYHA 5A5EA 3SIRA 3OJFA 2WG0A 5KJCA 2ACVA 3AVUA 3Q98A 4MV7A 2HU7A 2CLFB 1GZ3A 1EI9A 4LBVA 4YJ3A 4A23A 2Z6AA 5CDSA 1GZVA 3PPVA 5B1IA 2A58A 3LUFA 4O59O 3S2ZA 4TVSA 5JRJA 5FOSA 4LE2A 1G3IA 4NARA 2R6JA 2I2FA 4DCPA 1O5IA 3L5KA 4O1MA 1WMEA 5EP2A 3U7IA 4EHAA 3ZW8A 3OM1A 1Q1EA 1C14A 3DBVO 2ZAIA 4QNNA 1E5XA 5ALEA 3DTVA 4L4UA 1B0AA 4YFVA 3WLRA 5BXQC 1Q77A 1QANA 3MERA 4X1YA 4ZYWA 1RWXA 2J0UB 2IDJA 5F64A 1TCAA 4B85A 2IODA 5HJ5A 5IJ0B 3FOEC 3ITNA 5K0TA 1JJVA 5CTAA 4IX1A 3VXKA 1YQEA 2HQ1A 1AHIA 3EZ9A 4ENSA 1WDTA 1UINA 1XF1A 2I76A 1JG4A 3S70A 5KYXA 4CKWB 1Y3DE 1P45A 3PD0A 3WGYA 4ZYXA 5LBIA 2B1GA 3BA1A 2NT3A 1ADJA 3IMGA 3TTVA 1UBFA 3NHLA 2XE7A 2FG6C 4NU8X 4Q05A 5SY9A 3ER9A 4N03A 5A9SB 5JT1A 2VHCA 1E0JA 1V37A 1PTJC 2FPPA 3MB5A 4MUYA 2ODEA 1JVNA 1FTYA 3RIHA 4X1YB 3SE7A 1C3OA 3GQBA 2PX8A 4TTVA 2VDNB 3ZD9A 4KITB 2H3EA 2LDBA 3NWJA 5FV7A 2FXVA 4FXOA 2VH1A 2BC9A 4QTYA 1F5SA 1Z4JA 2FQYA 2RKBA 1TCUA 1K92A 1DC8A 3CWCA 3N8NA 4QKQA 4X44A 5BR8B 1JSLA 1GQ2A 4S0XA 4FWIB 5E6UB 4AULA 4QFCA 4NJMA 2A0KA 4F38A 2JG3A 3BD7A 3LQQA 1V1MA 1IM2A 1N8NA 4EYGA 3REFA 5F7ZA 2P2NA 4XD2A 4I4IA 3DVRX 3DQQA 1BVYF 2Z8ZA 3OE7A 3S8YA 1XQ1A 3E18A 5FBWB 1GKUB 1TJYA 3QK7A 4M8LA 4AWXA 5IYZB 3DB2A 4S1TA 1XLTA 2JCXA 4ZT7A 1LDEA 1X1RA 1NQ5A 3OQBA 3W3AA 3RNLA 6CHYA 5L95A 4ZGBA 2WHQA 3F0TA 1Y4SA 3HHEA 1JI3A 4OH1A 2HBYA 1QQ7A 3A1FA 1QRRA 1KOLA 3L9XA 5JVDB 1L8OA 2NSYA 1Y4UA 4J0JA 5AJVB 1UM8A 1NM5C 4CI9A 4DHEA 4GGOA 5CDGA 1SRRA 5HF6A 5KQGA 3OUUA 1V1MB 4XJTA 3W7BA 2CCGA 4MULA 1BZYA 2A0WA 4MPDA 2P7HA 1PW5A 5BSWA 2AFHE 5FEUA 5D00A 1F06A 2P27A 4G6ZA 1TUEA 1Y1QA 1L7QA 1X0XA 3RSOA 5JUWA 1HL7A 4DWVA 1AZWA 1YS4A 2B3TA 4V0MA 4MVJG 2Q6VA 1ADGA 3WKBA 2ZT7A 4B6SA 4B33A 5E7IA 1HLPA 2GI4A 5FTWA 4LJRA 3W5HA 4G5OA 3RYIA 3ENVA 2FDXA 3WBFA 4BVJA 5JS8A 1BCRB 2ZUSA 1JDUA 4RA9A 3DBRA 3JQEA 4MDHA 2HKIA 5AKZA 1VHJA 5JG7A 4EHDA 4EUHA 1FLNA 3QLUC 1IOWA 5C1IA 2NUAB 1NR7A 4EJSA 4J1SA 4AZ0B 1HT0A 4FCCA 3MLEA 4JQZA 3BJEA 1QQ6A 3LUHA 1RWVA 4M1MA 1U99A 3C7TA 4MQEA 4KQWA 4J0GA 4IIYA 1B3BA 4OBEA 4ZALA 2DQSA 4G4GA 1HE2A 3WYEA 4I5IA 2VJPA 1DMSA 3BGDA 3HA3A 1W1IA 1BE0A 4P4SA 2AR0A 4GOKA 4IEIA 1FP1D 1M1NA 4LFCB 2R5NA 4GLOA 521PA 1FYDA 1RRCA 3E8SA 4PAGA 4UVGA 2GHIA 2DBZA 2NOAA 1WF6A 2EHDA 2Y66A 3JZAA 4UXIA 1LCIA 2ZB3A 2C4MA 2EYUA 1G4AE 1F14A 3UWKA 3D6MA 5GZ3A 3AUSA 5EMKA 4HR7A 3DMFA 1IULA 1NT4A 1MOZA 1ZHOA 4AI6A 4TSFD 3T7KA 2Z9CA 3KB1A 2G9UA 2Q4TA 2VLIA 1L5WA 3OT1A 4X8MA 1S7GA 4PM4A 4A5SA 1IY2A 3JQAD 1TTHA 2ZB2A 1FYWA 1RD4A 3CXRA 4YBZA 3FZQA 2Y1LA 4IGEA 1F8XA 3QG5A 1ZWLA 4ZEOA 1HL3A 3TE6A 3TGLA 3F4KA 1L5YA 4W63A 2VG8A 3VZCA 1UFVA 4WL0A 4N6GA 4GG1A 4JY7A 3N7UA 4ZIRA 1Y33E 1VZ2A 4J49A 3N2KA 1LKZA 2CYCA 2BR3A 3TLYA 1LK7A 3NHKA 1O97C 1MX3A 1C4OA 4YDSA 3W5BA 3R9KA 1M0WA 2IXBA 2KM1A 3BK2A 1IEWA 5TQ0A 5C3UA 1KDYA 4BE9A 4DNPA 1G5FA 4DPMA 3HYTA 2PZGA 1A50B 3I6BA 5A4AA 2OO5A 2IH2A 3A3YA 1ZL0A 4YCDA 1IEVA 1UL1X 2A57A 5IH3A 3UT5A 1E3WB 4BAGA 4OHUA 4BB5A 1TVCA 1YCHA 5BNFA 2MMCA 4ALJA 3D1VA 4L2IA 1NR1A 1UP6A 2QTHA 4Q1EA 4QXMA 4W1QA 1QYRA 3RKSA 1K3FA 2Q3EA 5KOHB 1V6SA 1Y1PA 2XITA 3WR5A 1Z4PX 3GT0A 3LP6A 5T8KC 1VE6A 5EHZA 1SGWA 3LPLA 3G8BA 1YNOA 3CH7A 2IS2A 1IWPB 1TOAA 4HNHA 4G84A 2CXTA 3WWEA 4YQYA 2ZITA 3ETJA 3P0HA 4EA7A 1RYEA 1QP4A 3QWBA 3OD5A 5U4XA 1A9OA 3QXSA 2XJ4A 3PPXA 3RTCA 3ZIDA 3IT3A 2XUOA 3E27A 3GO4A 2OL4A 1OXMA 2XV1A 1I32A 4KC0A 1VE1A 2HY7A 3KU1A 1XX6A 5AW2A 2EX0A 3KSZO 3CVVA 1PE0A 4PLHA 3HXTA 2I87A 5DULA 2MYTA 2QRGA 1IVSA 1PJQA 3VV2A 1Z25A 2XEDA 4A16A 1EGVB 4BLUA 3ZXUB 4MVJF 1J33A 2VDQB 5G0VA 1AUPA 3LCUA 4HUQA 1T2FA 5ALDA 3TL6A 3IQDB 4BYMA 4CPDA 4Z7NB 5BWOA 3EWNA 4L5YA 3K16A 3G02A 6NULA 5J47A 4FD2A 1D2MA 2WUEA 4MDFA 1HYQA 2WMDA 3CKMA 1PV2A 3I9V6 4D9MA 3T99A 4MR9B 2M1ZA 2XNHA 1I1QB 2VP2A 2EXXA 4LX8A 4M0KA 1NKVA 5LP6C 1QWOA 1YR7A 2GPYA 4GFDA 2ZRHA 5CYFA 2ONJA 1DG1G 2BEWA 3DAFA 5E3IA 2EP7A 5TS2A 5IDWA 3NHWA 3PHCA 3UAGA 1HYHA 3U56A 1M10A 4J0KA 5LWHA 4NEQA 2XOXA 2FUNB 1AT1A 4KL8S 4CM4A 3UAOA 2QM8A 2HDWA 2A5JA 3G2JA 1S4MA 3IDFA 2CNBA 3OE7D 1CUHA 2B25A 3ND5A 2LCIA 4LV8B 2XMGA 4NPHA 1KSGA 3SBDA 1U2DC 3JQ9A 4ZVKA 5K45A 2C2OA 3KJNA 5E6UA 1M54A 4BRZA 5HPYB 3EXG1 3DGEC 4CDMA 1FYXA 2PS9A 4ZOAA 1BXRB 2H51A 5AKKA 3UMJA 1NKSA 2YNMA 1QF6A 3F6CA 1P4RA 1RYDA 1AUOA 2NXJA 1DKQA 3GJXC 5D1HA 3MXOA 5DHSA 5JTUA 2B20A 5KI6A 4B1FA 2IHNA 2W43A 1Q14A 2DJIA 2JFZA 3FYHA 5E9WA 4C88A 2BH2A 1WETA 2R1TA 4HEA1 1ZD8A 2CDRA 3DQZA 5HS4A 1M0EA 3CPJB 3FWHA 1I9GA 4OO3A 3VKVA 1RLTA 2IOQA 5BN5A 1JQBA 1YI0A 2AOWA 1I2DA 4DR5B 3D6AA 3NYWA 3OTHA 1K3UB 4PZUA 2NLOA 3TCXB 4IH4A 4OHZA 3WS7A 5BUSA 2QKYA 3IGFA 2ZIZA 3DEYX 5F51A 1LK5A 1LPAB 4IOKA 3GT7A 2FKNA 4HPJB 1JR3A 2HA5A 1C8VB 4HXYA 4OI1A 4G07A 3TNLA 3GDHA 5E7MA 4YR7A 1SXHA 3UQZA 2LIPA 5JQWA 4I4TF 3IQWA 4M53A 1KZ6A 2ORWA 3JD4A 4R5HA 3UTCA 1OFVA 4LVOA 4TXLA 3GAMA 2AZ4A 4XQCA 4QPDA 1TUIA 5SY6A 3HYRA 4CEJA 1HDCA 4ZRNA 2O07A 1I4TD 3OFSA 1JUDA 1NXVA 1TQ6A 2PX5A 4EATA 2R86A 3HFGA 1NN3A 1NAIA 2PPVA 8AT1A 1JPVA 3QFCA 4KOAA 3KOZA 4LHVA 1S2NA 421PA 1DUSA 3VJRA 1JX6A 1T6YA 4G5HA 4JL8A 4MZXA 1EGMB 3WQRA 2WG2A 3IP5A 3HJCA 2ZK7A 2AKEA 3T8YA 4PGHA 3OEHD 1TIPA 5JS2A 3ANTA 4F92B 5FPKA 1F48A 2G40A 1N6KA 2FR0A 1MAHA 3NBXX 4LXGA 1M1UA 2OCXA 1W0KD 4J0FA 4NECA 3SZOA 4Z49A 2VDPB 3I1IA 3JQAA 1JHYA 1GCGA 2QRHA 2ATIA 3IDZA 3LFTA 4JGIA 4W4TA 2YOGA 1L4EA 3NWPA 2WTMA 3L0ZA 2R5WA 1WF3A 3BH7A 2O3RA 3G9QA 2JAHA 2FNAA 3GYGA 3HL4A 3L6EA 3P7MA 4PX2A 2VQDA 3PQDA 4UXHA 4NLLA 3K6SA 1J4AA 4NS4A 4C4PA 1NW6A 3LZDA 1UMDA 1I7PA 3IS3A 4RLSA 5DTJA 3PNKA 1JEOA 5CFQA 5DNCA 3PQ4A 2WA1A 5FDFA 3PE4A 3QEAZ 3X1KA 1O5OA 2HJ9A 5BNTA 3AHGA 1A69A 2XUQA 3EW9A 2W11A 1UM9B 1QP7A 1R3DA 1MAWA 3NGMA 1MO5A 1QTIA 5EFOA 4L8FA 1LPMA 1RAHA 3JXEA 2GCOA 4TRJA 1OBCA 3AUUA 4II3A 2WSSD 2WSLA 2HWYA 4PGMA 3E0QA 4M9UA 4WCFA 1RVV1 3MWEB 3N2LA 1FBTA 1YWGO 4M7OA 4KRFA 2I3ZA 5IDQA 1PL0A 3ADKA 3EMKA 1TF2A 4PYNA 3RLIA 1A9TA 2ZJ6A 3K6SB 4EB6B 4F3KA 3OA2A 4G24A 5CD1A 3TX2A 4LW8A 1PJCA 1QFMA 5EQDA 5JAMA 1R0ZA 5G1OA 4QG3A 2FVYA 4HDKB 4UFNA 4WXEA 4O4HA 5H1YA 1CUYA 2E82A 1DBQA 1Q1NA 3NGXA 1HH4A 1G42A 1QG6A 2JI9A 1B74A 1L8LA 1BU8A 1XF9A 2AN9A 1C2YA 2BJVA 1ZGZA 1H4VB 4IJ6A 4M98A 1OI4A 5KSYA 2BEVA 2YN4A 3TW0A 1UBCA 4G0QA 1PBNA 1HTBA 1QLWA 1ID1A 2YYAA 4LJLA 2X58A 3DE1X 4U1RA 1ZA1A 2X0EA 5CEEA 4YYZA 4ZICA 1MIOB 5HMLA 2MR6A 4FGJA 3QHPA 4AUKA 5I7UA 4IIVA 4ADSG 1UODA 4LDJA 1UK8A 4LQLA 4UM7A 3SEZA 3F9IA 1EUDB 2R00A 3OLQA 4R01A 4KJZA 5DOVA 3HLTA 4ZC1A 4AN4A 3TL3A 2EEZA 5I8PA 3PEYA 2GZSA 3LHSA 4NNOA 1YVPA 1HDYA 3HP4A 3I5AA 4E12A 4WEQA 1AK9A 3PC2A 4QFDA 5FRDA 2H4ZA 1V7ZA 2ZBQA 1FYFA 5EVCA 4RS3A 3JTMA 4AZ3B 3K70B 3TPCA 3ZIUA 3O95A 4IRMA 3ZUGA 3QXHA 2CJWB 4HI0E 2PUJA 3DCJA 4WWHA 4GH5A 1LRLA 2CHEA 3NALA 3BVPA 1ZD3A 3P9NA 3R7SA 3ROQA 5JISA 5KO2A 1ES9A 4HAIA 1WUKS 4OMCA 4XPIB 4UPEA 4XSGA 1NY5A 3DSRA 4UTOA 4UZEA 4YAEA 1Q11A 5FPSA 1QS0A 1KBZA 3NCHA 2W6OA 1R0SA 2P41A 3I32A 4RZQA 4B2YA 5B3LA 4MS4A 5DGDA 4DLNA 3QY9A 3RGWS 1M2GA 4BTVA 1ZVMA 1PNOA 1U7TA 4NK4A 3LQ2A 2DE0X 3CU5A 3QVGB 1UCFA 4HQLA 4LDNA 1BOOA 1RJ9A 4GD3Q 4WGFA 4RA6A 3RAPR 2JFBA 1E5LA 3KC2A 2G36A 5IEJA 4IXWA 4RL6A 3MNFA 3U44B 4ZC8A 4DXDA 3C5HA 4AJPA 1UPCA 1W8IA 4PSDA 4RMJA 5FO0A 4RELA 2ZYGA 2JANA 2QNIA 3HU1A 5K8LA 2HK6A 5EY5B 1V39A 3ZW7A 3AV3A 4XSHA 4E4TA 2BMFA 4KYUA 3FOWA 4ZT6A 1RHUA 2ZYDA 2MHCA 4IDQA 1LX6A 4Q1DA 4R9RA 1E59A 4C89A 2OLKA 4YMHA 4QPJC 4YUWA 1T36A 4DIDA 2XMPA 1BX0A 3DUWA 3RU9A 2BFBB 5E95A 4JNKA 2R7AA 4FS8A 2VSFA 2EU8A 3H2GA 5KNBA 2BM1A 1CUFA 4JR0A 1PBTA 2QX6A 3KT0A 4DUPA 3PCTA 3SWWA 3O03A 4CM8B 3KUDA 5ALGA 3MTIA 4YV1A 1A9SA 1X1EA 3T7AA 3OKAA 5C32A 2Y9MB 1ZH8A 4B8YA 2BM8A 3CSSA 2FQ1A 3FMVA 3UJ6A 1XLTC