3HY6A

Structure of human mthfs with adp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 198
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy6A00
1SBQA 1U3FA 3HY6A 2JCBA 1YDMA 3HY4A 1U3GA 1WKCA 3HY3A 1SOUA 3HXTA 2G40A
chains in the Genus database with same CATH superfamily
1Y9JA 3AHEA 4A6PA 1KEEA 2RGDA 1TM2A 4W5WA 5K3BA 1QHEA 4Q1DA 2D3WA 4LFCB 4B46A 3QUTA 4EY6A 4Y67A 1NBIA 5K0EA 4DT1A 1H2RS 3SLRA 1JIVA 3B1ZA 1KO4A 2E4AA 3OBBA 5DGDA 5I9NA 1GUDA 1AUPA 5DP2A 4QUGA 3LBFA 4BU0A 4CN8A 3CUSA 1HT3A 3LT0A 3ZWOA 4AG6A 1CJCA 5GY7A 5FO0A 4EA9A 2IQIA 1XQ9A 2NIPA 2QENA 1WW2A 5LDGA 3U7GA 1V1RA 5DYIA 3W6PA 3IMFA 3OTIA 4ASUA 2Q0HA 2Z83A 1OQAA 4LNAA 1MCZA 3ZWMA 4MW2A 3ZLBA 3H8SA 3TCNA 3KKMA 1LC3A 2QZ9A 3EZYA 3IQGX 3DE2X 3V4LA 1JG7A 1X7WA 4A0FA 4PYIA 3DL0A 1M1UA 1SG0A 4D81A 5HMLA 3CKKA 4DA9A 4HAOA 1G5HA 1DAEA 4O2AA 4HLCA 3O1LA 4XJSA 3CZMA 1L5MA 1CZOA 4UJ3A 3LBHA 3H9QA 5IT5A 3O94A 3E5RA 3W79A 1NBME 4F7WA 1PQ4A 1XZMA 3OM1A 4HCJA 3PCTA 1FB5A 4C6TB 4F85A 1Q6ZA 2MYNA 3SJCA 2FN9A 3U62A 2BV3A 3S40A 2RH5A 3QVVA 1WD5A 1L5KA 2YHIA 1P5HA 4DZTA 1QIEA 3CISA 3HXTA 3U4QB 1E4YA 1RYDA 2F3RA 3GMIA 3KSRA 4L3OA 1X0XA 3HR4A 2YJ3A 1Y33E 2ALJA 3AZOA 1L7PA 2B5WA 4JLVA 4WV3A 3VTZA 3UCXA 1U9ZA 3LQFA 3GMSA 4OK3A 5B6PA 3UCEA 1DQRA 3HKDB 1DS6A 1R0SA 2R44A 5JI3E 3EYAA 4JT4A 2C96A 4CM1A 2JFNA 3ZCPA 1FQKA 2WZDA 2EGUA 4PZ9A 4EW2A 1VKNA 2B1QA 3C5WP 1E9EA 1PNQA 4YRGA 2NXWA 4BO1A 1CJSA 1LW6E 2NSJA 3TOZA 2DECA 1ADFA 4BFUA 4NJEA 2A84A 3F7OA 1FDOA 1J09A 1YQTA 2NSLA 2CVPA 2QVCA 3W0LB 4IUDS 3KQHA 3QKUA 2Q6OA 1NMQA 3CHYA 3DVAA 2BGWA 4WUVA 4AF8A 1TPZA 2Q21A 2YFKA 4ZRMA 3ZWXA 4XJTA 3FMPB 3RC8A 2VVTA 1J6UA 1RE0A 3W8FA 1KDPA 5ETJA 3H65A 1G17A 2YYSA 2XYHA 5KI6A 1DSSG 2VZ0A 1E2LA 5FPYA 4JA2A 3WKBA 4NCKA 3RKUA 3U4MA 2MTBA 3QXGA 2WTAA 4FFBB 1MHTA 4RGBA 4DRYA 4RPIA 1JTFA 3VPFA 4YR9A 5A5EA 2WMDA 1H2AS 3FWPA 1TEHA 5HVNA 4F84A 2ZZKA 4ZT7A 3P26A 2IX3A 3KQKA 2R4UA 5GGYA 1XX6A 2JLYA 3KV1A 2R7AA 3A6FA 3ZCTA 5A5GA 4RYLA 1T5HX 1ZVJA 3SC2B 4V0MA 1X3SA 4GXTA 5FYDA 5HW0A 3BRWD 3OSUA 3EZ9A 3X1KA 3D0OA 4MQ5A 4CEHA 1GTL1 4X44A 3R0JA 2WI8A 2EJVA 3EZ6A 4JI6B 1JQLB 4AYTA 2G40A 1BMTA 1M33A 1F4VA 2CJPA 3RD5A 3BD8A 1XDUA 3GHHA 3IVMA 3ZUPA 4BMVA 5DLPA 3KOZA 4NATA 4DCJA 4EATA 9GPBA 1C7EA 5LBIA 3CH7A 4RK1A 2SHKA 3UAOA 4HG2A 4BVJA 1RAIA 5H4GA 1D7AA 2W6OA 3TLAA 5I9IA 4LY9A 1GAQA 1MAHA 4R7GA 2DFKB 1N77A 3SJUA 3QEAZ 1PS9A 4O63O 1ZPDA 1EFPA 3QXSA 5KCMA 3FHLA 4K7JA 2P7IA 1VJ0A 3QLUA 4N82A 3WI7A 4DJAA 4UW9A 3K9BA 1SXPA 4ZZ0A 4UTPA 5C8DA 4L9WA 2G28A 2FG5A 3JZAA 1HNNA 3JQAD 2G80A 2R87A 3I6ZA 1AC5A 3Q12A 2D0OB 1Y6RA 2LW7A 4P0TA 2QQ0A 2XYPA 3THWB 4ZPJA 3CNHA 4XWYA 3N2IA 4AP5A 3MGGA 4RCVA 4MR8B 2R60A 1YC5A 3O3MB 1WDTA 2EWWA 4JI3B 1C3VA 4KQCA 3VFDA 1BE6A 3ITDA 4YEDA 3U80A 4BO7A 4WXMA 5J43A 4HPWA 2HBRA 4J2HA 1WAMA 3DO5A 1WX1A 3AHJA 5I8ZA 1SD2A 1ZH8A 2VP9A 3BHNA 3D7MA 1TZKA 1EFKA 2M1XA 2ZIUB 5GAJA 1HTWA 1TKRA 2OO5A 1YFJA 3SIWA 4AKGA 1CIVA 3BHIA 1DVRA 4N54A 4GOOD 1J2JA 4BNUA 4U9HS 1UDBA 4GI1A 1XJWA 3I1JA 4GX2A 4JU9A 5T8KC 5JAHA 2BMVA 5J4VA 2XUZA 1TVMA 3R5JA 2PV0A 3P9NA 3U4DA 2JGIA 3E2PA 4RETA 2BBWA 1WTCA 3RSLA 3VHRA 2WW8A 2EFYA 1KZ9A 3G17A 4G5YA 5EXDA 3LVFO 1W2WB 2AMFA 3R5TA 2PT5A 4JB3A 2JLUA 3DDSA 3HRKA 4R1LA 2CMKA 4BQNA 4R98A 5LVAA 1P1HA 2BSXA 2ZS8A 3CNNA 1T2AA 3R5FA 4OSOA 4P92A 3V2GA 1XFDA 3KUKA 3P9CA 5B37A 1JFLA 3W90A 3ZWCA 5ED4A 1X1AA 1IUKA 1XBTA 3BKWA 2RONA 3C3DA 1MO3A 5JJIA 5C80A 2I03A 3AUYA 3LUHA 1ZGAA 4EH1A 4Z2AA 3D9QX 3L1UA 1Q6YA 3IBTA 1RABA 3TUJC 1DIBA 1IVNA 4HVCA 5FX2A 4GKKB 1XXHA 5K8TA 3CUEF 3GRFA 1ENZA 2VNHA 4GF5A 4NJOA 1CJMA 1NVXQ 3BFKA 2M6RA 4MQEA 2GAFA 5KVSA 1U3TA 3CZ4A 2PRIA 4GXQA 1VE3A 3C4JA 4B6EA 3OQNA 1V37A 1U81A 1UXGA 4O2BA 3N3BC 4TRJA 3K9QO 3DV2A 5KAPA 4W9NA 1QOZA 3NWOA 3CR3C 3VC3A 5HXAA 4D25A 1X7DA 1YO6A 1ZGHA 2C2XA 1YGPA 4MPRA 1WCIB 4YP6A 5BN3B 5IK2D 2B8JA 4AX8A 3U7JA 4C7BA 3SF0A 5EL0A 4H7DA 2PWAA 4HXEB 4FHFA 4GOJA 3NLLA 5ISMA 1XNHA 2DAPA 2C3YA 2WZQA 3GEBA 5IAAA 4ALJA 2YV4A 3IVXA 4TGLA 5CH5A 4ZYXA 2AG0A 3OJEA 1BWQA 1G5RA 1TA4A 3K09C 3G82C 1LS6A 3DC2A 2EP8A 2RBGA 3JS5A 4KMOA 3CB2A 4H7IA 3KKEA 1JVSA 1WUTA 1ZSNA 2ACEA 2ZAMA 4OY3A 3JVUA 4CM5A 2PUVA 3EAQA 2FEOA 3GLTA 2FR0A 2H1SA 3ROFA 5BWLA 2X86A 1PJ3A 3FDXA 2E4YA 3LT2A 1CQPA 1JR4A 1XTZA 2B1RA 2ZT5A 3JQEA 4I9GA 4MR9B 2C8KA 4JGBA 2NU9A 3CYFA 4QOHA 3ADKA 3NKLA 2IQ5A 2WHRA 3AG5A 3IUJA 5JNLA 1W2HA 1A9SA 1KIMA 1JSXA 3PHCA 5FIUA 1AT1A 2IDJA 3TJMA 3U3OA 1ZGZA 4MI3A 5K8IA 2R1TB 2F3PA 1M73E 3L1HA 3OD5A 5AOBA 3F3SA 4IEFB 2QNRA 2WFMA 4XM1A 5A3QA 4WCFB 4ZO7A 5BV7A 1V16B 3BB1A 4WK0B 3UV3A 2B92A 2WSMA 4ZDWA 1IY9A 2FRXA 3GJYA 2VF7A 2FSFA 4JYPA 3D6JA 3EAFA 5IKMA 5HIJA 4JIGA 1C0PA 3IJRA 5FPQA 4TUYF 5LQRA 1KFKB 4YQFA 1T1JA 1X39A 1LWOA 3D8RA 3JWEA 4QUIA 1UDRA 4XXHA 5KBYA 1QH8A 1XJCA 3CJTA 4N03A 2EFJA 5FJIA 4ALLA 4C7VA 5CEJA 3ZG6A 2XNHA 3T9EA 1WJGA 4ZV9A 4LX0A 2ZUUA 1A27A 5BNTA 5M2QA 5HQ3B 4CYMA 1KEKA 2CUNA 4I1RA 2L0XA 3VPBA 2OB2A 5EKTA 2ECKA 2ACKA 3BB4A 3T1HB 2W2QA 2CB0A 3CGGA 3OQBA 3TR0A 4G0UA 5CX4A 2QX8A 3HP1A 5TF0A 2VH2A 1RXYA 4XVQA 4PZZA 4N5HX 3I2IA 3PC8C 5B36A 4ARAA 4B6RA 2UZ3A 3HTXA 2PA3A 3KUUA 3ODGA 2Q6LA 3WQHA 4BRZA 4RLQA 1DDGA 3SVTA 2NTJA 5EJMA 1YJ5A 1XHFA 3SR0A 1ULUA 3CEAA 1E79A 4LBVA 1SQ0A 2AKAB 3L9XA 1CULC 1B6RA 3PQ5A 3QITA 1CT9A 4LPSA 4WZZA 1T8WA 3I5MA 3DDUA 2OOKA 1NLZA 3PQ7A 4IAOA 4IRXA 5M34A 1M1NB 3ET4A 1BHJA 2RAFA 2X6QA 3AF5A 4Z3DA 2F3TA 2ZDQA 1VRWA 3IYLW 3Q5DA 2CYCA 4CV3A 2HQ1A 1N92A 4YCNA 2YIVX 3ILSA 3F7MA 4GYYA 5F1KA 4PNPA 2QTLA 1RZRD 3QFFA 1BEZA 3PI6A 4UHDA 4ZJYA 1Q16A 1LSUA 2KBEA 3A4VA 1PX0A 3KYCB 1GKYA 1C1XA 4KPEC 1LX7A 4M9CA 1BO6A 1QBGA 3AI2A 1MAVA 5CBPA 3VR5H 2YBEA 4QUKA 3V97A 1ONBA 1N6NA 4O29A 3MAJA 2C7RA 4XASA 1KDYA 5IM4A 1SQ6A 1UKZA 3CUWA 1ADCA 4HQRA 4ZMSA 3GMTA 4PZDA 4ZJPA 1TD1A 1PK9A 1XD2A 1L4MA 1SVWA 2FFQA 2AXQA 1HFKA 2DGDA 5ARDA 4C78A 5BV8A 5IT9A 1XZ8A 1T36A 3ASVA 5CNJA 2QG4A 4TUYB 4XLZA 3ZW8A 2FW8A 3KZVA 5KNBA 1JA1A 1RXWA 5IFKA 1EGAA 2FRDC 1GDHA 2ODWA 4XSGA 4YONB 5LQKA 3T1YB 2AE2A 2ZU6A 1NYRA 2JLVA 4O3MA 4DDUA 1D1PA 1YK0A 2HRCA 4DBLE 4HX9A 1J0EA 2GJKA 4LYJA 1JXOA 2GYWA 3FETA 3I2GA 3WWYA 2NNLD 2BKAA 1J56A 1V39A 4KAXA 3SDSA 4EJ6A 4URFA 4NZMA 2YCBA 4L2IA 1OE0A 4DNOA 4I3GA 1JLLB 1O95A 5LD2C 4MR7A 4IIHA 2AXEA 4HGYA 4IOJA 3ZHXA 2TSYB 1XC7A 3PQFA 3T0IA 2J1LA 5ALHA 5I6DA 1LF5A 3ETJA 4RMIA 4WIAA 1C3EA 2FP4B 4ZEOA 3SX0A 4DM3A 3FMVA 1J9EA 8ADHA 5CFNA 1I7NA 5KB3A 4PHFA 2P9HA 4D74A 2ZSKA 4AD8A 3D59A 4WOJA 5CVCA 1YULA 5KSZA 1D2MA 1SXQA 5FOQA 1T2FA 5A5DA 2CLHB 1DT3A 3K9GA 4Y6QA 4X85A 5TQJA 1YUNA 2HDNB 5C1OA 2YXEA 4ZXFA 3UWOA 2MINB 3HYRA 3OICA 1JG1A 5F7ZA 4B82A 1K98A 3GRYA 5EOVA 1K4YA 2VTBB 4EYKA 2ZIXA 1A72A 4J1SA 3HKCB 5ICFA 5HS6A 2WV9A 5YASA 2B8TA 1NJFA 1EI9A 4TWZA 4MRPA 3MUEA 2Y05A 3T5PA 2X8LA 3WSWA 2Q41A 3A04A 4LK2A 3GCZA 4BLRA 2C3PA 2Z1NA 4ETIA 4X41A 1T8PA 1W35A 2JATA 4L50A 1Z08A 1QYXA 2DLNA 3U19A 1PV1A 1C9EA 2ECOA 2PD6A 2RHWA 2GXAA 3OCVA 4FR2A 1C9DB 3BTVA 4JT9A 4W5TA 1OXTA 1JSLA 4EJSB 1JA0A 4BQSA 4QM6A 2IIPA 3KUCA 1RWBA 4UE2A 1NVVR 1QK4A 2KPOA 5HIIA 5DYYA 1DZIA 1GM5A 4PC7A 2CLFB 4TZ6A 3B3JA 1V9CA 5HQTA 3WWOA 1SGWA 2KWIA 1PVOA 3N70A 5BQXA 3RF7A 1W8IA 2LTAA 4BNGA 3BX1A 4Q7KA 2HWKA 3CUTA 4LPKA 5CPFA 2C83A 1ZJWA 3AVPA 4ND6A 4X92A 4ZYYA 1CRPA 3GEGA 4OU5A 3MD0A 3RSSA 1ZD4A 3RV4A 2RKBA 1L9XA 1AKUA 1Z6QA 1JNXX 4TLEA 3PUZA 3TD9A 5KJ6A 4JYAB 3I6BA 3AGPA 4QDKA 1UK9A 1C9KA 2I5PO 2XF2A 3NTQA 4GX5A 3R4CA 4Y8VA 4JN6B 5JYEA 3RS3A 3RSGA 2DT5A 2VATA 3RTGA 5EHZA 5B55A 3IERA 1M67A 3R74A 1GWNA 3EEYA 1GKIA 1SJ9A 3DF9A 5E3IA 2BFMA 4A8JC 1TVCA 4WNAB 5KVCA 5E4YA 4HWOA 2M98A 4FOTA 1VJCA 4L51A 1NIPA 1SUPA 2Y71A 3BXHA 2QIPA 4NBLA 3CW8X 1XJ0A 2A2ZA 3QE4A 3V33A 4DR1B 2I71A 2F8MA 3ZZUA 2Q5OA 4TV9F 1RT9A 4PBTA 4A6XA 2GCOB 3ZCSA 5LOVF 3R8CA 1LPNA 2GEFA 1GZVA 1LLDA 4AAYA 3RADC 2C3MA 2RG1A 3IPAA 3NNSA 4OPMA 2XB6A 1AZTA 4RM3A 4U8HA 3U7QB 2YQZA 1DO0A 3QH4A 3U44A 4R2MA 3TDNA 3PNYA 5MN5A 4IGAA 5ALQA 4Q12A 2JFXA 3MNFA 2L42A 3UGTA 3TVDA 1W6RA 5L3QB 1XMQB 1SXHA 3QIVA 1G64A 4KQFA 3WL6A 2ZJ7A 3OZAA 3ICVA 1W76A 3SJAA 1NR5A 3A6KA 3SSMA 5C8VA 1PEDA 1B42A 2QUJA 3AU9A 3EVEA 2IBMA 4FOSA 5E9QA 3E3MA 2BGLA 4NBRA 3WNZA 4AUKA 4DXHA 1A82A 2CD7A 2DTEA 5C1DA 2B0JA 1E2JA 5IULC 2I3BA 2DY1A 2BFCA 1E5DA 5ERXA 4B8YA 1UOEA 2NO5A 4G81A 6AT1A 4X5OA 1PE0A 3DXFA 4URYR 2YCLA 5TY0A 3TQOA 3KQLA 3J7TA 1ESCA 4E94A 3NHJA 4OLHA 3VU1A 5KPDA 1P2FA 1RHRA 4M9ZA 1RWKA 1SOWA 2R1UA 2ZJYA 3ZK8A 5HNKA 4TYNA 2VPQA 3ZCUA 3GLGB 3VR6D 1BDJA 1Y5RA 2LZ0A 4FT2A 1A4XA 1G4AE 4RV4A 3PVSA 1XPRA 4H0NA 4MS1A 3GEPA 6REQB 4R69A 3LGXA 4GUAA 3DZIA 2CHFA 1SZJG 1X9IA 1URPA 4M0CA 4X64B 4DEVA 3FTEA 3DBRA 1U0JA 3PFFA 1DFHA 1XTTA 2CXUA 1N9GB 2I1QA 4QARA 4WW0A 4Y2YA 4BFTA 1QVWA 2OHVA 2ZRLA 3EXEA 4EQ6B 1EXMA 1I1HA 1RP1A 3NIWA 5KTPA 1C81A 2VHJA 4L27A 1G16A 4UHFA 5KQRA 5IT0A 2R68A 4E4TA 1DXHA 1PSDA 4XQ9A 1NF2A 4I8IA 3TPFA 3B1XA 3PD1A 2E87A 4LMBA 4V3CA 5BW5A 1NP6A 2IRWA 3AXTA 4TV9B 2ACVA 3EXFB 4HTAA 3RC3A 3SK0A 3ZBPA 4KOEC 1Z18A 4PM4A 5LOVB 3TR5A 2QW1A 1EWTA 1FNCA 1I6KA 1ZIDA 1Q74A 3E48A 4UUAA 3R7DA 3X43A 3G68A 4L28A 1UZAA 1EGVB 3QBVA 4B3DA 4WFQA 1J97A 1LK7A 2OK8A 4L9RA 5BW6B 3CSUA 1R5NA 1C2TA 1T5OA 4BV2A 4QDTA 2IZ5A 1YJBA 1I9GA 5DWQA 2OG1A 3AL2A 4LA4A 1OILA 5AMXA 2FPOA 3D6UA 4TXMA 5CDYA 2C9MA 3G3EA 3H8JA 1KPHA 5JQWA 2JGDA 2QRVB 4MQFB 3DC7A 4U63A 4MARA 2O3JA 3UHAA 2PUWA 3MOGA 4OIMA 3DZJA 5IJZA 4YNBA 3Q5EA 2L2QA 4K9SA 4FS3A 4DA8A 3OOWA 2Z08A 3JYLA 3ZU5A 3MT8A 2VXCA 4MRNA 4PFJA 3QSYA 2HT1A 4BWYA 4NYIR 4MCJA 2OZEA 1VZ3A 1FSGA 2Y99A 2XITA 3HU5A 3IEKA 2G7ZA 4DLVA 2PEZA 3H16A 1XQ1A 2AYYA 2YHSA 1O9BA 3KDPA 1XF1A 1RRMA 1Z28A 3UJBA 1CVLA 2NTEA 1N2OA 4TL7A 4ETNA 4UTZA 1P7WA 4BQQA 4WQMA 1O3YA 4DLTA 1SY7A 5IXSA 4X8MA 4K9QA 4YYZA 1R1DA 4W7SA 3BFJA 4QNNA 3VR1A 3X0DA 2X7XA 5K0GA 3L8FA 1Z4PX 4RAOA 1PKEA 4H17A 4DCGA 4N3GA 4EW3A 3CO0S 1CB7A 2DCUA 1AK9A 4L08A 4DWVA 1VE7A 2ZI3A 3MAGA 1SULA 3NEYA 4MQUA 1AH2A 3G8DA 2VDJA 4I4NA 3EXHC 1UEIA 1U3VA 1EFVB 3GA0A 1GT6A 3GDFA 1YTUA 1R0RE 2H18A 4E12A 2F8TA 2AQKA 1PDVA 4JQSA 1JI3A 3SYKA 3UMYA 2H17A 1JPNA 3D5QA 1U1EA 1Z5NA 3QMMA 5TJHA 1OZGA 4XPIB 4GE0A 3D6VA 4FCVA 1X8XA 4HDSB 2B7LA 3H97A 3ZKAA 4GT1A 2QW8A 1XZDA 5DLQC 3GGSA 2GAJA 2LPMA 4TSFA 1GKLA 1ZHFA 2FZWA 3EZ7A 3M0EA 3PPIA 1P2TA 4ZARA 3QLTA 1NVKA 1I51A 5LMZA 3EGWA 5H82A 2IITA 3TG2A 1KMMA 1XRSB 3AKZA 2AXPA 2X6RA 3BMCB 3CBGA 3CLHA 3LQQA 4KNVA 1FY2A 3JZMA 3HWRA 4WBXC 3FCUB 3DBVO 4KWCA 5F76A 3KXLA 1KI4A 2Y6VA 3GZ4A 4MUFA 5T4HA 4B6PA 1O57A 1N3BA 4EL5A 4Q18A 4F46A 5HIKA 4RULA 1AUXA 1U3DA 1IN7A 2XUKA 3E9YA 3WZMA 1WCWA 1T2EA 5JQGF 3P2YA 4DWOA 1BGVA 2DUJA 3DAGA 2A9JA 4EIWA 2FWRA 4C4XA 1ESNA 8ABPA 4CEJA 4XQGA 2Z8YM 3ZTYA 3U48A 5ILOA 1EX6A 2TMDA 4IZ6A 4FJ1A 4E09A 3TD6A 2V7UA 1FYEA 1QIJA 1W581 1X8JA 3OZEA 3ZCQA 1JIXA 2E6KA 3W1EA 4BCDA 1KI6B 4QVGA 2ZE7A 3FGNA 2ISSD 4F06A 3JQ8B 3K6SA 4GLFA 4UBLA 4YCBA 1R4MB 2QTFA 5JNTA 2BEKA 2J09A 3F8TA 5IBCA 2JVIA 5CLQA 4BJ1A 3EFOB 1P4JA 5ALEA 3CNQS 2BEJA 3I9NA 3ZI4A 3TUZC 2C61A 1HZZA 4MI1A 3TEMA 4BVGA 3QNWA 1Q12A 4KQJA 3JX9A 2GTPA 2ZREA 3WLKX 1JU3A 2WYUA 3K73O 5COBA 4AZSA 3NXSA 1UJ4A 4AZ3B 2AF3C 4W82A 2VQDA 3B9QA 5AI4A 1S7GA 4ZIRA 4YCLA 3IDFA 3DW3X 3IKVA 1KHHA 2MCFA 2VSNA 3NONA 1QGYA 1T6BY 1XRNA 3GEMA 3ND9A 2VYQA 1MIHA 2WOOA 4RC9A 3C39A 1IBLB 3OM8A 4TTRA 3UXMA 1RRCA 3NVAA 1FFSA 2E6UX 2CFSA 1SVIA 2AMYA 4HRVA 1J8YF 1TW3A 2PD3A 3VNUA 3H5IA 1A9RA 4GI5A 1QTNA 3EJWA 3EVDA 2XCOA 3TFWA 3JAKA 3QPBA 5KQLA 1T8UA 2WAAA 3CUVA 3QMPA 2FPRA 4MUKA 1IXRC 3L01A 5DNDA 2FMTA 1D2CA 4PX3A 1LBEA 5B7QA 4BEJA 4QBKA 1TIPA 4CNQA 5JQGB 4Z5XA 3ABQB 4KLAA 2IHJA 3HU1A 2OBMA 3L7OA 1ODJA 2AZMA 5B3JA 5KYWA 3LYLA 2B0CA 5BYJA 3S5UA 2RHJA 4R68A 2PZEA 5JRZA 1D0IA 2FF5A 4RD6A 3OIYA 2XUGA 3USCS 5KYGA 3FCOA 2R9VA 5G4KB 3DDNA 2HX1A 3I2HA 4POOA 4RABA 4D0SA 4FVTA 5AR1A 1LX6A 1DJOA 3FZNA 3LXXA 3CNEA 2IZZA 3K8QA 3UA4A 2ZWMA 3PG5A 3SC4A 2P6PA 3KQWA 2V6BA 4IV8A 3C6MA 4CFYA 4PWYA 3NBYC 1XQYA 1P9NA 1ZJYA 2P3QA 5E1BA 1M2GA 3U16A 4YECA 3JRWA 1YA6A 1QMPA 4RADA 1YE8A 3WLRA 2W0MA 3R9WA 1GRNA 4EENA 1OI4A 1QO7A 4L22A 5EHNA 2PXCA 4OGGA 3IQEA 1Y1QA 1R10A 4G0QA 4RD4A 1WMFA 2JJ2A 3BCHA 1KU0A 3B2EA 4Z54A 2O2GA 2ZI6A 3OKFA 2ZT8A 2CNDA 4MQMA 2G88A 5CAEB 2ZRQA 4ENWA 2C1EA 3TNJA 1PJTA 3RYIB 2WMYA 5ERYA 1TYDE 1XYGA 3DF7A 1TAHA 2WFZA 1G5IA 3IELA 4HWKA 1JFTA 4D9CA 4RESA 1T0IA 1T1RA 1FYFA 2HRRA 3C7AA 2IY7A 3VJRA 3RIMA 3K0KA 1O5IA 1GFZA 2J6IA 2WWRA 3AJ9A 3AR9A 3AVTA 1DTSA 1LNZA 1UP6A 3OFSA 1LBSA 1DDOA 3PDUA 1J2RA 1ZHHA 4FIZA 3IHLA 2HFJA 5K2MA 5FTJA 2V8OA 1MX9A 4S05A 1RKVA 1WDLA 4IIUA 1NT2A 2NQTA 4D9HA 1UXIA 3PUYA 4E6EA 3OCYA 3GDOA 2I4NA 3UYLA 1L7DA 1L5WA 2OD2A 2ZETA 9MHTA 4PONA 1X15A 2H5LA 5K6RA 1NONA 3LF2A 4QBHA 2ZDGA 3KZKA 1CLEA 4LOAA 2LKCA 3KBBA 3PC3A 1JQ3A 1KI7A 1W0KD 4HWPA 4LI3X 3DSRA 3U5TA 5AUQA 3ANSA 1GVNB 3F5SA 2VFAA 3KTAA 4CFSA 1PF7E 1X80B 1G3MA 3O8QA 1DO8A 1U0GA 3D6FA 2SICE 3R1IA 3N8HA 3BVPA 3R0IA 2C2GA 2D8MA 4RFSB 3WBKA 3WMEA 2HLDA 1USUA 3REOA 2H92A 5F77A 4EPWA 1LS1A 4FI3F 2CFCA 2GX6A 3FNGA 4X71A 1J8VA 2BZGA 3KX2A 4PSCA 5TQVA 5TPWB 3IALA 4NHEA 1P4HA 1CJVC 4K6GA 4QYTA 1ZH4A 1K7EB 3RHTA 1ZINA 1JDTA 1A2BA 2A5DA 1IYZA 3L7KA 5KNCH 3M2TA 4G0XA 4XCVA 2J0UA 1M72A 4OATA 3WFZA 4ROSA 1U2RA 2Y0CA 3G0OA 4ND2A 5C1PA 2ZVJA 4B3JA 2A9FA 1BVUA 3T4EA 4A36A 2IU3A 2EYUA 3H9EO 5FCDA 1BGWA 3WP0A 1K0FA 5KNCA 1OXKB 2ZRJA 4WZAE 1PN3A 3DE1X 4GP7A 3K6JA 2QVLA 3DEJA 3NJ8A 4IDQA 4HV4A 4JJGA 4U7GA 1CY6A 1TF2A 1A9XA 3QX9A 1KY4A 1E4VA 3CG4A 3KVNA 4OQYA 5IVIA 1GU1A 2QJWA 3TRKA 3W1WA 3DFZA 3LY7A 3UAVA 4MVJA 2CV1A 4M1KA 2ZROA 3WIDA 5JAUA 4FZ5A 4O5OA 2YY5A 3VPHA 1D04A 5IKOA 2OK7A 1M66A 5J2UB 3HCCA 1XTSA 4M1YA 5CIYA 3WLOA 2P27A 2H52A 5CH3A 2QPOA 1J9GA 3QW4B 1IDOA 3DL4A 3LV8A 1TT5B 4ZO8A 4Z1OA 1TK2A 3EGVA 4OJKA 3ZU4A 1NI4A 4CPDA 4D8VA 1PZHA 2R6FA 5HCUA 1YL7A 3PJDA 4MUIA 1KMNA 3DLTA 4GXRA 1HEYA 3CRZA 4PINA 3TOCA 2G08A 4DMUB 1N5LA 2RH4A 1J4AA 1A0OA 5LCXA 4KZKA 1AN0A 2NXJA 1TFUA 3H2GA 4Q05A 3OH8A 3WWDA 1YJXA 4NMXB 4DILA 1Y9EA 3KEOA 2QMEA 3DVSX 1XZKA 3V1KA 3ABSB 1ZD2P 2G67A 2JHPA 1VYHA 1JLKA 1SCUA 3ESCA 4D3SA 3EARA 1VG9B 2ZUBA 1OXXK 5FI5A 1K6XA 1LZLA 3W1VA 4BEWA 3SWWA 4JQZA 4Q03A 3LNCA 4I99A 1SHZA 3VDQA 1OX4A 1XYVA 3IHKA 3N07A 4YVFA 3W2FA 2BN4A 1HY3A 4ZAZA 1TD9A 2DF8A 4DQ0A 2H2HA 4XD2A 1C3LA 2ST1A 3RVLA 1MW9X 2PDAA 5A6SB 3E84A 4WK4B 2VJOA 3LRPA 5K3DA 3SX2A 4R1MA 1RBYA 4IR7A 1XTRA 1E3JA 4BYMA 4EAAA 2Z04A 2B82A 4PYKA 1U5BB 1FUEA 5K45A 3CZPA 1N6PA 3CB4A 3E5NA 4UM9D 2HHLA 3LYUA 2A9OA 3DOEA 3DR3A 3BDAA 1Y3AA 4NBWA 1VMDA 1WXIA 1MG0A 1L7NA 1W4RA 1IDN1 1RQPA 1ZY2A 3ESAA 3JQ9C 2PFGA 4RGYA 1OH5A 2IPLA 1N6LA 3UXEA 1RRPA 2WUWE 1QVZA 2GZDA 2GCPA 1UJBA 4WL0A 1C14A 3INGA 4GM1A 2MYPA 3RASA 3IMCA 4Y9RA 4K9MA 1UL1X 1L7BA 5BT8A 1LVUA 2QN9A 1EWKA 3CF2A 3CLUD 5DTJA 2FPPB 2O8NA 4JBGA 1CFZA 4YRBA 5KYNA 4MJLA 3VPCA 1SHKA 2FPLA 4JLAA 1QR2A 3MMZA 2XD4A 1ZUD1 4Y1GA 1IHOA 3DOJA 1BKSB 1I2CA 4EFLA 2EBHX 3IPRA 3OJWA 2NACA 1SVMA 1N33B 2R11A 4DFDA 1XEXB 3VBEA 1ABFA 4QUAA 1QHXA 3DG9A 4R2HA 1EB8A 3ZIUA 5LP6C 3P4XA 1JLRA 2QT0A 1Z38A 1IEXA 5EVCA 4DLPA 2ZYSA 4JOBA 1RC8A 4AMBA 2AC2A 2D5LA 1B8OA 1HYHA 1MC8A 3VOAA 3NOOA 1U65A 2A3NA 4ZTBA 1VBNA 3HB9A 2ZEJA 2OV1A 1XA3A 4J7XA 1QKJA 4ZGBA 3NHAA 2BEVB 3E0QA 1YOBA 5EJ2A 4DIUA 1E9SA 4V38A 1Z29A 1G41A 3JQPA 1HRDA 3PTLA 3LSTA 3QU4A 2R1ZA 1IQRA 1WDKA 1CFJA 3DV0B 4RK5A 5FUYA 1JAXA 1L1QA 1CUFA 2C20A 3IEIA 2BL4A 3PNVA 1QWOA 1YKGA 3T1NA 1YBHA 2P5SA 4DC9A 1EWYA 2UUAB 1UMBA 3MGCA 2I99A 1OKKA 2FLKA 2XMPA 3FSRA 1KJIA 3STHA 3ADPA 4XARA 3UHJA 2P0EA 3LPAA 5F3RA 2IYLD 4OHUA 3ANTA 4X1IB 1IBKB 2QY6A 2ZJ5A 2YBDA 2AN3A 2XPCA 2MYUA 4XSHA 4LWZA 5AW1A 1XZBA 1E99A 1YSCA 3HZOA 3J81k 3WMGA 2QE7D 4C4TA 2CFTA 2C7BA 2ZOSA 3F6BX 4BUJA 2AN1A 2BFBB 2F43A 2YR0A 4KU4A 3KEGA 4BQRA 1U98A 2YJTD 3KQMA 4QPDA 4D2IA 1DAPA 2VS1A 4GSLA 1NHWA 2QT9A 1OAOC 3SLGA 3PKIA 1S1MA 3S2IA 1RRGA 1WB6A 1BVRA 2YJZA 1BX0A 4FPXA 4JX8A 4C89A 1H23A 4HAYA 1PS0A 4QTXA 3IXMA 2ID4A 2YV3A 1IY8A 4OVKA 1EE1A 3ICPA 2F4VB 3SAJA 2OV3A 3BN3A 3I09A 1ENYA 3T3GA 4RD0A 3ESXA 3EQZA 3I9V6 5E8JA 1SOMA 4Q21A 1NJ8A 3RRMA 1QVAA 1NN0A 1QE5A 2I7DA 4ZZ1A 1D1TA 3RWBA 2NTYC 4AP6A 4YT5A 5CLJA 3FSJX 1SA0A 3O8OA 5EE9A 2FN8A 3IVAA 3MGAA 3O2SB 2BP7B 2QV7A 3AP1A 2IEIA 2JLWA 2GPBA 4TXLA 3JQ6A 4BLQA 3ICQB 1QRUA 5AESA 2PUEA 2BH9A 2DSNA 1LCIA 2QHXA 2PSDA 5EIHA 4RY9A 3I04A 4QHSA 1U0HC 1N2GA 4FEGA 3D3EA 1XQXA 1DGQA 5BUSA 3LIIA 3DB2A 1UWVA 5K0BA 3RTEA 1HTBA 2CJYA 1L7AA 2CZGA 4P1ZA 2JFBA 1BDHA 1QCYA 3EK2A 2GXUA 3W7AA 2ZI4A 1Z36A 2C8VA 4Y6SA 3GI1A 3G5UA 1EUYA 1DWPA 1EWQA 3DHYA 1IUOA 2WYOA 1PO7A 1NG1A 1W9MA 5ES3A 4HQNA 3AEKA 3OZWA 3GCDA 4BKQA 3S2FA 5E3JA 2R48A 3VPDA 3WYFA 3OQIB 3KV3O 2HREA 3VX3A 5G0WA 4HB4A 4EGSA 5IKXA 4C03A 2WQZA 3I6IA 1ECCA 5C7YA 5D01A 2FR1A 3UAXA 4J43A 2VUHB 3CW9A 4EBFA 4TS4A 3TXAA 4TSKA 1OW3B 2GB4A 3OSZA 1JMYA 5E4JA 3V5NA 3ZE9A 3VO2A 5DI9A 2AR9A 1NJ5A 3CCFA 1H5UA 4L4UA 3PQEA 3RJZA 5J47A 3DH0A 4G25A 1ZH2A 3BM5A 5JS7A 4HLNA 4QASA 4D3FA 4DCPA 2J59A 1ETHA 5AI5A 1AMNA 3TOSA 4ZO9A 3HRIA 3G88A 2WTXA 1YVEI 3MA0A 3HDTA 1NQXA 1N6IA 3AB3A 4JUIA 4BNYA 4K9DA 3NWEA 4P6VF 4IG9A 3VHQA 1JQ5A 4V0QA 2YZMA 4PNHA 2X0JA 1QKIA 2WSLA 5DBGA 2WD9A 3OOHA 2AKEA 1EHYA 1JAZA 4LZWA 2PSFA 5ENZA 5GONF 1FW6A 4YV1A 3L41A 2XQVA 3NTRA 4XLLA 1XZQA 3CUKA 3MJSA 1R3UA 1KOGA 3BMOB 1U2EA 3E5MA 4J90A 2W2XA 1E1RA 4II2A 1FU4A 3KHSA 1TCAA 4MPDA 1KPIA 1Y6QA 4DV2B 2QMOA 3PPXA 1TK3A 1GV0A 3JTMA 3NGXA 4MKRA 5FNZA 4PZYA 2EG5A 3SR3A 3TKLA 1O2DA 2HK7A 1XDSA 4HWSA 5DHTA 2PKQP 3WQSB 1G42A 1BX1A 3GAMA 2YHUA 2YICA 4P58A 3P1JA 4P5PA 3VPAA 4HVAA 4DCVA 1UIMA 4RJKA 1I3KA 5CA1A 1U2DC 3BK1A 1Z13A 1CXZA 7YASA 8LDHA 1I2AA 3AVOA 1PR2A 4EJ2A 2FKAA 1ZNXA 4GPEA 1K7FB 4R0MA 4YXFA 5EUCA 4MRMB 1AZSC 1MEEA 4FFLA 1X42A 2C2BA 2V9CA 3H11B 2V7EA 1C1YA 5FAXA 2BHNA 4K26A 3W78A 1YZHA 1QZUA 2NSHA 1JQBA 4TZKA 2OLEA 4OHOA 1NM5A 2H1LA 2FWAA 2WWIA 4YJ3F 1B16A 5DM70 3FUWA 1IY2A 1J49A 3L4SO 1DBVO 2Y1LA 3K2BA 3NGLA 4LQDA 5E7MA 4CTNA 4FLMA 3ZDRA 2HZBA 1K3FA 4LJKA 1KL7A 1RE1A 4PBRA 2GZHA 4ZYUA 5JSQA 3DGFC 2C2OA 1W49A 3M1YA 1SKBA 3M33A 4WOPA 4R7ZA 4BWVA 4WBNA 5JR3A 1J8DA 4PO3X 5EIWA 2EBFX 4CMHA 3KVYA 4ALKA 4HN4B 3KP1A 4QOEA 1FXWA 5AK5A 4EI9A 4ZZ3A 4I46A 2IKQA 1JDSA 1HG0A 3D2BA 2GBIA 1MA3A 5B53A 5EIEA 4E33A 2WIKA 3QRWA 1ZAYA 3H5TA 4YRPA 1CK4A 1VMEA 1JFVA 1TM3E 1XCPA 4HX5A 4X8OA 1DQZA 2XE4A 1A69A 1YDHA 3JRXA 5JSZA 2Y93A 4WZBA 2XKJE 3SP1A 4ZJUA 2EERA 5GONB 1Q3TA 4FEAA 3ELUA 1GIAA 2IYEA 1OU4A 2ZATA 2G9UA 1UK6A 3LZDA 4LOKA 4C6TA 1Z6GA 1RMQA 1X7GA 3WMFA 3QX7A 5B2EA 3U09A 4I50A 3AI3A 2FQWA 4D43A 5LQCA 5LYJF 2YN4A 5DCWA 1NWCA 3A1UA 3NHZA 3R8FA 2PJZA 3MJRA 3VU8A 3A28A 1TFRA 2G3YA 4OP2A 1J24A 3FR7A 3HVUA 3LP6A 3M6WA 4MINA 1WXXA 4BQOA 3TLZA 3TQTA 1YI8A 3LDFA 1QHHB 3NRJA 3ETEA 3MTDA 5L4LA 3L49A 4FONA 1OXBB 4S2EA 3ZTWA 2ZI5A 5AK0A 4PXSA 1UQTA 1KO5A 1NSTA 1K6MA 5FB3A 5JCOA 5FUVA 2MSDB 5KQGA 1QXSA 1LSOA 2DQSA 1M7GA 1OOEA 5LWQA 1E9BA 1NIJA 2C5EA 3NVMB 2AD5A 1I01A 4JC8A 2WLTA 3D3KA 5I9TA 2IV7A 3NFYA 3GA7A 4M98A 1T5BA 4JA0A 2VHVA 4YJ3B 2HCTA 1GSIA 1GR1A 3UA3A 3A9CA 4NCBA 3BMXA 2BY4A 4CLHA 1W4AA 3GNQA 2F62A 1O6GA 1QP8A 1M2EA 3O4JA 1QX3A 1NDQA 3VDMA 4ZHQA 1R0CA 2A0UA 2IIQA 3PIRA 3G8AA 4KV7A 3B1WA 3SKVA 5LUBA 1KSFX 1RAAA 4CM8A 1C5KA 3C7DB 4KRFA 5CT6A 1GPJA 2X4IA 3AYXB 4HQ6A 4LF4B 2E5WA 3UFXB 3MXTA 1J2UA 5HF9A 2YWDA 3WLHA 4CCSA 2V0CA 3SDZA 3CM0A 3I2JA 2HJWA 2OLJA 3KSDO 4FFBA 5BN1A 1FMLA 4TTQA 2X5KO 4LKOA 1KZGB 2FVYA 3AFMA 5HF5A 4J07A 3T7IA 5C32A 4W8HA 2I91A 1RYFA 1XZAA 1PD1A 1CCWA 1WW8A 2FR8A 2HOQA 1H2XA 3EOBI 2JI7A 5J40A 3OUUA 2XB9A 4WFJA 1L3BA 3C7CB 5D1NA 1BHO1 1G6KA 3QVMA 2J08A 5AP9A 3LMKA 4OHXA 4XB2A 1N78A 3R20A 3NO4A 1V3TA 4BO8A 5BY2A 1YI0A 1VLLA 4CU2A 3B7GA 4QPPA 1E5XA 1JVBA 2QOEA 3KAPA 1C50A 2ESRA 4GBMA 5LYJB 3BRWA 3K9WA 3LM8A 4PICA 3SZ3A 3DV9A 2WQ7A 4JC0A 4EDFA 4G86A 3VV2A 1ID1A 4QYIB 5HF6A 4NDAA 3HA5A 5F3WB 1IBRA 2BJVA 3I1IA 3SZOA 1C0LA 4QOJA 4U4AA 4QXQA 3LHIA 4YROA 3LDHA 3NP9A 3HBMA 3FOWA 4FILA 1LFAA 1U2SA 3SEFA 3PC2A 5G2OA 2QTTA 2WABA 5H3LA 4ZEMA 2YVQA 3KXKA 2E5LB 4KYTA 3AEXA 1K6JA 4GMKA 3ZLVA 1AZWA 2FSVA 3PDCA 1QYWA 2UV8A 3TZHA 4D42A 2V7PA 2PH3A 1SVUA 4C4OA 1RPNA 3JQAA 3EXIB 5KSOA 3BMNB 3KLMX 2FMKA 4FMDF 3J80A 1T3GA 5KEIA 1XMVA 3QM1A 5CVDA 3KZOA 4LKRA 4R8SA 5JAPA 5F98A 3RVJA 1N2ZA 5JH7A 2D6FA 4OQPA 3PXAA 3TAXA 3TLBA 1IG0A 3ZQ4A 2IU0A 1RYHA 2M9MA 4R54A 1VL1A 4UAUA 4XEHA 3W6OA 4WRRA 1IG3A 4J49A 2H9YA 2I6XA 2ZBQA 1AHIA 1XLTA 3PUXA 3IHTA 3TQFA 1VL8A 4EKNB 1FQJA 2NYVA 2RGGA 1UKVY 2ZRFA 3NUQA 3SY8A 3Q2IA 5M5BA 2CXXA 4JUBA 2C2WA 2GCGA 2B4KA 4HTFA 5CIQA 1MW8X 3JAWA 3E1GA 2CD9A 1F6DA 5J59A 2HA5A 2XHEA 4DCSA 2X5XA 1KP9A 4H77A 3HFGA 5D8DA 3FTPA 2O5EA 4LTMA 1EDOA 4TLDA 3P9KA 2OFOA 2NX2A 3LKBA 3MYRA 1OWLA 3UT5B 3W6UA 4RTJA 2CV0A 1FZQA 4KQMA 4OLBA 1MB9A 1BNCA 4MGZR 1FF9A 2BMFA 2CKMA 3PXUA 3N7TA 3TLGB 2V4ZA 1OFTA 3S8EA 1L7EA 3F5MA 3TRDA 5HUJA 1HZJA 1XTIA 3WYBA 2W8BA 3VH3A 3JZDA 3EPJA 1HF3A 1TI7A 1SNYA 2VTDA 1DJMA 1J99A 4X7MA 4H4DA 1QIIA 2ERYA 4WY8A 4DJDC 4DTCA 5ALZA 4REQA 1Z7GA 5FOTA 4EI7A 4D8YA 3GJ4A 1VHJA 2QR2A 1YR8A 4O0LA 1IEWA 4TQUS 1X77A 4AROA 2AA3A 5CX1A 2R7NA 1UZLA 3FPCA 1IEVA 1YQQA 2GZ3A 2O50A 2X8BA 4RZUA 2G76A 2CLKB 1H4TA 1PRYA 4IQGA 4NZ9A 4UDXX 4CQJA 1TO6A 4ZICA 4X6XA 3PGLA 1OFGA 3OY7A 1DHRA 2ZUVA 4EHDA 1U8FO 4FMDB 3O4HA 1SN7A 4OXKA 5EPOA 3RODA 3SEZA 3T5TA 2VBIA 2B83A 4ON9A 3V1YA 3WIBA 4L5CA 5F4ZA 1U5AA 1E0SA 4WE3A 1KNQA 1RFGE 3KR2A 1EJBA 4CDGA 2ZPAA 3EBPA 2KSQA 1KI3A 3BC1A 2CB9A 1I6LA 1GPAA 3PS9A 4F2WA 4NMMA 2YMPA 5A4DA 4YCJA 1U28C 2BFEA 2VEOA 5KINB 1W52X 2OFPA 3FPEA 2X19A 3OCXA 4MRRA 1Z8NA 3AB8A 4NICA 3RYHB 4A5OA 1MUUA 1UBCA 3U9SA 3HJFA 2VHYA 2B7BA 2X4GA 4MUGA 1OZHA 2PXXA 3I6MA 1JL3A 4I1SA 1Z7YA 2XJ4A 3QLEA 5KDDA 3AR6A 3UMSA 3TYXA 2KLHA 2JHGA 3SQOA 1QNFA 4NPHA 1EQAA 1NOKA 2C5BA 1JKXA 3KAQA 4KH1A 1B00A 2GUWA 3ENKA 3KLPX 1F8GA 3LP8A 1PZMA 3HDYA 2I1VB 5IW8A 5TGZA 2YWGA 5KSWB 4DZZA 3PEWA 1Q0PA 3F3KA 5ULLA 2PZBA 4RTRA 2XZLA 1IWBB 3ZDCA 4NH0A 4F04A 4FYIA 1DBPA 3L82B 3P2OA 1AO3A 5HTKA 2QVBA 2IYYA 4LDNA 1TU0A 1V1JA 1U8TA 5KTKA 1HQCA 2FQ1A 2WR8A 2VJCA 4CKYA 2DHRA 5LSAA 1EESA 5BRAA 5ECYA 3TIVA 1RRVA 1JHXA 4P7GA 4LOHA 3EGDA 3ONDA 2O20A 5FUBA 3R7AA 2Z57A 2QROA 1NXTA 2QP9X 5CB0A 3BG5A 5DULA 1UMDB 3O2JA 3WAKA 1O5TA 3KXIA 5B1IA 1XNJA 3WRVA 2FWIA 2XVXA 4X60A 2INGX 3VYRB 5B4VA 4WK2B 1V8DA 1NQTA 2HUPA 3HU3A 4F8YA 4C0SA 2IDKA 3AOEA 3FRIA 4OI1A 2ZWPA 1LGYA 2L69A 4ZCIA 4G8BA 1A8HA 2CNLA 3G49A 3IAEA 5GIPE 2WOJA 4BB9A 1BIFA 4ZYLA 4YS6A 3QHPA 2J07A 1OIVA 1UKCA 3QEMA 3UB4A 1X70A 4M9XA 5E9JA 1G3RA 4YASA 3WA7A 1K66A 3VJMA 1DIAA 3ZXSA 2IT1A 2R8ZA 2O0HA 3KPWA 4KWTA 3AVVA 3S1SA 3WVNA 3DWFA 2P69A 5H70A 1QZZA 4GPBA 4BP1A 5TC4A 4I8DA 2J87A 4MP8A 5EWMB 1POXA 2HR1A 2FSSA 5I9BA 4V1CA 2HQBA 1P2DA 2QTVB 1N8TA 1RBZA 1DLIA 2GZAA 3A7EA 1WZEA 3KE8A 4YGXB 2IZ6A 1D0VA 2RGEA 1DC7A 4H6PA 4WNCA 2OC9A 4FT4A 2JHFA 3GCGA 1Z2DA 1L4KA 1M76A 3AUJB 1RLTA 3OZBA 3QJGA 1NU6A 1S3GA 4RK0A 4C29A 2WF7A 1LV8A 3ODPA 3GBVA 3JARB 1K5GA 5CVEA 1Z2PX 1W44A 2FEAA 4TKZA 2V4MA 3BJIC 1W8DA 3IPLA 4LF7B 2IVZA 4AJPA 5I45A 5LP1A 1HDCA 3KQOA 3T15A 4C2AA 4B76A 4FS8A 5I4CA 1RZRA 1AUVA 4L8GA 3RSHA 1LI4A 5EJ7A 2D5CA 1DIRA 3H7AA 1E3TA 1VG1A 1Z8FA 3KKNA 4Y0VA 3ZR4B 1CC1S 4HDAA 1AMOA 1CY8A 5EQFA 3BIWA 1Q84A 4Y0NA 3HBFA 4CV2A 3RYFB 4UATA 4BQFA 4FK8A 4G0ZA 4PO8A 1J5PA 1X2BA 2OE2A 2BLLA 2AN9A 2V9ZA 3A58B 3H6KA 2AG1A 2HF2A 1GYRA 3QLJA 5IT4A 3EW7A 1EM8B 3KWLA 4BLPA 2CJWB 3GFBA 4QEZA 2KS6A 1EBUA 1UFQA 3CE6A 2QE6A 3O26A 4D6PA 1G20E 2ZFUA 3KHTA 4Q9NA 1IEQA 1I3MA 3DVRX 3IR7A 3TVYA 3UXHA 4B87A 3DNFA 1FUIA 1W4ZA 4D9GA 1LSSA 3GZNB 1N3IA 2FXIA 5DDIP 2IFTA 3GUYA 3MAAC 3O8RA 1TM5E 1U3WA 3AO0B 4OBBA 4BTEA 1SELA 4YRZA 4KGDA 4IEEA 4O08A 1ABEA 1IATA 5ALGA 1SBQA 1FFCA 1NC1A 4L9AA 2Z4TA 3DVLA 2COEA 3EQ7A 4D3XA 3NCTA 4QODA 3L1JA 3LOQA 1ESZA 1AB5A 2CBGA 3PKJA 1KKUA 1W2GA 3T52A 4RQUA 3PVZA 2G25A 4AXXA 1A3CA 2GEJA 1RJEA 2IYVA 2WT8A 4IDAA 3NPMA 1TU4A 3NG1A 3GN1A 4WJKB 1KEWA 2Q4RA 3M3HA 2PQ0A 1KE2A 2ZSUA 3RK4A 1K88A 1N5RA 1JX6A 2Q7DA 4CIDA 5DE3A 2A9PA 3GVXA 4IUCS 4FE4A 1V41E 2H9IA 4LXIA 2PLWA 3ANYB 3M4YA 2DMRA 4F60A 3CNLA 1XVTA 2ZBVA 1HV8A 1TQHA 3RTDA 1HNWB 2MR6A 2WKQA 3CBQA 5DX0A 2XNJA 1G98A 1ATIA 3EOZA 1XKTA 3BSWA 4XX0A 3AYZB 5DTRA 1XEWX 5FA6A 3EPRA 3F78A 1O7JA 3RS5A 1Q92A 2AUMA 2JA1A 2VHUA 1MRNA 1GR0A 4PPGA 1LA2A 1YK1A 3QY9A 3W3ZB 3NALA 4S1TA 2EXXA 2J31A 1FTGA 1MAAA 1QG6A 1F06A 3EXAA 3OC6A 4K6HA 5DSZA 5EC8A 2CBXA 4FHDA 2NXCA 4FJ0A 2OAEA 5BN5A 1O08A 4NESA 3OLYA 5J3JA 1C3JA 3A1VA 4ER3A 1OB5A 1SXJC 1OZ0A 4EG3A 4CM6A 4AN4A 1YVRA 2R1VA 3QKRB 1TCVA 2NWQA 5F4BA 4RS3A 4TS1A 2BJHA 4RPKA 3OLVA 3WYNA 1KKLA 1P8JA 3UAGA 2OBXA 3H1TA 1UDWA 2C57A 3E3NA 1VSTA 3E53A 4H1WA 3VR2D 3L18A 4MIEA 2CLCX 5ENDA 2RHMA 3RFUA 4N7BA 5AVVA 4DLZA 1HE3A 2H65A 2WDPA 4IWYA 5ER9A 1HT0A 3MLBA 5KU1A 2DJ5A 4H7EA 1UBKS 4LDAA 4K5QA 4MV7A 1DOAA 1UZMA 4PHHA 4ZAVA 4C08A 9ABPA 2EW1A 1BROA 3PXCX 2A1TS 2VNIA 4M49A 1JDPA 2X15A 4EHBA 5JSKA 3U49A 1EINA 4G85A 3HDHA 2JRCA 1WTAA 4OQFA 1XKXA 4C3VA 1I3OA 2QGFA 3H1BA 2FEXA 3W5DA 4TTVA 4HWRA 1MT3A 3V7FA 2YKGA 1CUYA 2XNDD 5E1DA 1YNSA 1UDAA 2NG1A 3D31A 3JW8A 4LXQA 3T7RA 3RUAA 1KY3A 4N48A 2KBFA 4Y2HA 2ZZNA 4J3FA 2I6GA 4JC4A 4NTZA 5JS1A 4KBYA 2JCGA 4DG9A 4WERA 1I7QB 4DG8A 2BEWA 1WS6A 3EVNA 5AVKA 5C34B 1SKMA 2ZRKA 4LJ5A 4N76A 5DP1A 2WWYA 3OPNA 4YX9A 5BYKA 3EN0A 1ID8A 4RWZA 4MKGA 4AWAA 3OX1A 1I4DD 3S68A 5KYXA 3SXUB 1ZU5A 4NU6A 5FL7D 2QDXA 2EWMA 2GCOA 4KTVE 3DMRA 1XIVA 3K9LA 4X84A 5M29A 4GSKA 4Q7EA 2D5BA 4CI0B 1OXUA 5K3SA 3IQWA 1L5ZA 5BSGA 2Q5EA 4TN1A 2EHDA 1W5SA 2FX5A 1EUCA 3AR4A 5F12A 3JR7A 3QWHA 1EVYA 5ALJA 2GCEA 2I29A 4Q9KA 1ULSA 3PDWA 1R0BA 3K8ZA 5FNVF 2YRFA 2YY6A 2BC9A 3W5IA 1OGYA 2H2FA 1RAGA 1TLTA 1QYDA 4INJA 1Z26A 1QDLB 1Z2EA 4RDXA 1N2JA 4QECA 3C6YA 2RGYA 5AUNB 1KFEB 4M89A 5JMPA 1PZNA 3SHTA 2HA0A 3N86A 3FOFC 4KUEA 2FMUA 2VP3A 2ON6A 3DOCA 3HVIA 2ZT7A 3MWGA 5JBIA 3LCVB 3B8EA 2BSAA 3GT0A 3DDZX 3JTEA 3P0EA 1Q22A 3U9LA 4FFOA 2WIAA 1T0UA 3N2NA 4LHXA 4RD3A 4B3FX 3GXOA 1KDOA 3DZFA 4JBHA 4UVIA 4P53A 2W2VA 5ALIA 3VR6H 4N8DA 3IAAA 5EP2A 1E2HA 3C3CA 4ENRA 1XMJA 5FUMA 4JYZA 4QU5A 5D5PA 1RI1A 3GLGA 4RBNA 4MTCA 1TO2E 5I7UA 3EZNA 6REQA 1FRQA 5D2CA 3L7JA 3VR6A 3FOAA 4MJ3A 2NV6A 2PRSA 2JCYA 3RKRA 2QPLA 3LUKA 2PGLA 4CMKA 1SCJA 5COQA 1J5XA 3JYQA 3VM6A 5KOJA 2RE8A 1K8RA 4EQ6A 2CMFA 2P3LA 4EMUA 4RZHA 1Y34E 4N3CA 1UR5A 3NI2A 4ILKA 2H06A 2JPDA 4QPZA 1LPPA 1SO8A 2CYBA 2GZRA 3OVMA 3ETLA 1P7PA 1J42A 4LRTB 5G0UA 3U4IA 1GU7A 2AD1A 3A1EA 3IX7A 4LE1A 4UPVA 3ZV6A 4IJUA 4ZOCA 1ZMRA 1MGPA 2R6DA 3UEOA 1FTNA 2AFIE 3HUDA 2NU6A 2ZRHA 4KBGA 4FM9A 4QYWA 4BKPA 1DEKA 4P4NA 1O97C 4O4HA 2I65A 2X22A 3M1LA 1ZMTA 1S5PA 3L7IA 1DOHA 1Y7PA 2B5OA 2PQ6A 4RLFA 3L7YA 5TEVA 1QFSA 2C9OA 1KQNA 4F3RA 1P45A 3FMIA 4ZRNA 1P9OA 1KZ6A 1JDUA 4L5IA 2RGBA 4XVCA 2EJTA 4H6WA 2JIPA 3AF4A 2J33A 5G1PA 2GBGA 3EIWA 2XIJA 1QRTA 3RC7A 1BDIA 1OAAA 1N7IA 1UMCA 3LY5A 3FZEA 3STYA 1GUAA 3AF0A 3C8HA 2DWOA 4NAHA 1DQSA 1F8FA 1SHTX 3FCYA 5IWAB 2WA2A 2AK2A 3KOWA 1IC6A 3WGZA 4D57A 3D6HA 1P7YA 1WBBA 1FP4A 4L02A 4KPUA 1DWUA 3DMFA 1SIOA 2GK4A 3IP3A 3FAZA 2F7SA 4N01A 3RARA 3NZEA 3GAZA 4JR0A 3D7RA 3E9CA 4YMWA 5EXSA 4P7BA 3U7FB 3GLIB 1E2QA 3AFGA 4MHTA 5H81A 4NENA 4YBRA 5EJAA 4P3OA 5FPKA 1RYZA 4HSEA 2B8EA 3W6ZA 2X5OA 1NNI1 4J0DA 2JH3A 4LXTA 3L6EA 1HEUA 3H9GA 4BASA 3BWVA 3LC7O 1UPXA 4INZA 3F9CA 4PANA 4LCBA 3ZZTA 4C5CA 2R3SA 1EFVA 1NFFA 2CUTA 2OV2A 2QQEA 3HJCA 5J5VA 4CV0A 4E2FA 2ASVA 3PDHA 3R6DA 2PWBA 4B6OA 4LYFA 4QC2A 4NBNA 3AHIA 4MSUA 4TRMA 1DCMA 1Z39A 4MV3A 3HRHA 4KDCA 5IM5A 2PUJA 3JATB 1KI9A 1PW5A 1N3YA 3WS7A 1AKVA 3WZ2A 1ZQ1A 1XAJA 1FYXA 1AHPA 3OE7D 4BP9A 4E0BA 1FRFS 2HFKA 3WTBA 3K4QA 2J48A 3PYMA 1A8PA 2VJAA 5KKNB 2RD2A 4DRXB 5JZBA 3ET5A 1OYVA 3AR7A 1S2OA 1LBTA 1SD1A 2BZSA 4RH3A 5AM4A 1CS0A 1ZU4A 2F1JA 1E3WB 4B8WA 2XTMA 4BE7B 1HUQA 4GOND 2JFFA 3BRQA 4DR6B 4YBZA 4DBVO 3WMRA 3A10A 1QS0B 1TGVA 1Z6XA 4LWPA 3IPCA 2CXOA 5K6AC 3S2YA 4I55A 3IDQA 4PG5A 3FMFA 1JSCA 2AR7A 1KS2A 5JDCC 4C87A 1J9ZA 3QVJA 3NC0C 3WAGA 5LQMA 5JSUA 3B82A 4J3JA 4L4SA 4Q01A 4BNIA 4BE9A 3UJ8A 4EJFA 1ZCFA 5DCLA 1EXDA 1LJ8A 2WNHA 4IQFA 3RDPA 3PTZA 4A9AA 3VBCA 4JBXA 3MTGA 1JSRA 5CW2A 1YJCA 5G3ZA 4Q4DA 1YR1A 3WLQA 2VDPB 3ZIAD 5J4HA 1T8YA 4Q39A 3WDKA 4DTIA 3Q9UA 1TPYA 2JIDA 3H2JA 3G5MA 1ZWLA 4IJ6A 2AOXA 5JXGA 1B74A 1PT8A 4QYMA 3W8NA 1ZVQA 4Q1FA 4C2BA 1QTQA 3FYUA 2PFSA 1KRHA 2XUAA 4JHXA 4JBLA 1Z35A 2MSCB 4YRQA 3HA2A 1NHGA 1YASA 3CX3A 4FHCA 4NV1A 1R4MA 3OLXA 4Q4AA 4RF5A 4B1FA 3FPSA 4AS3A 2Z2ZA 3E22A 3F6PA 4XSVA 3IVRA 1ECFA 1QIDA 3E3LA 3G9ZA 4ZODA 4CKCA 3ZJUA 4Y6OA 2J8ZA 2ZLBA 1SB8A 3AX6A 1P6UA 2GO1A 2BVNA 3QHAA 2M1ZA 3TNLA 4KGZA 4GNKA 3MWEB 1T2VA 1EGHA 2QB5A 1R0KA 1QHGA 3LT1A 4UNRA 4OAPA 2FSIA 3G2JA 4C6HA 1H85A 2XGJA 3KJQA 1R66A 3D4PA 1NE7A 4UXHA 4AZ3A 1RPZA 3UUWA 3Q0EA 1Q7GA 1ESEA 4MW1A 4M1ZA 3C48A 1I2ZA 3R9XA 1XZCA 2XMZA 1E3DA 5GV7A 4XVHA 3A8TA 1P5FA 1SVOA 4TZTA 2Q07A 2ZTLA 3H1GA 3DZDA 1ZKMA 3HK2A 1L8XA 2WU3A 1GT91 2YDYA 4QU8A 2ZAGA 4MV0A 2QMUA 4BEVA 1M7HA 1SZDA 1VJ5A 1F0NA 1KSHA 1VSUA 1RLOA 1FDIA 1NSYA 1A04A 1II8A 4GQIA 4WVLA 3ZHOA 1THTA 3H6HA 4XB1A 3P27A 2CUKA 4C5AA 4YMGA 2H2WA 3IVGA 1M1XB 1A9TA 3DMTC 3PHHA 4IHJF 4EQZA 1JWLA 1ZR2A 2Q27A 1A7UA 4H0CA 4J6EA 4N0EA 3SS9X 3OKCA 3N3AC 3AHCA 3MF4A 1X7XB 2VZEA 3FVRA 3ZBUA 2GILA 4NFSA 1A88A 2IYZA 1D4ZA 1CS4C 2VF8A 2ZRIA 4UCFA 3RAJA 2RGUA 1ZNZA 5GZ3A 4P83A 2G72A 2CDCA 2ZSIA 3PPYA 4U5QA 2JZOA 4WY5A 3RBXA 2ODBA 3V4RA 1Z82A 1S2DA 1Z7WA 3OAAD 1QYRA 2QTMA 3OEHD 1MDBA 2FGKA 4D99A 2XGSA 2WIJA 4N0MA 4W7IA 2BMWA 1PYDA 3O1JC 2HJHA 3BL6A 1JEJA 3DO8A 1MPTA 1Z9BA 4XWOA 3OEED 1H22A 2AHRA 4XH9B 2IYUA 3P94A 1IHUA 4B6FA 3BH6A 4XGRA 3DM9B 5AQ1A 3LKDA 1YJQA 2I54A 4G09A 4G5RA 4X6LA 3F6EX 2RHHA 2IP2A 3ZHBA 3AZPA 3DEAA 2V8BA 2JFQA 4EKDA 4YRIA 4OEHA 1B3BA 2H7VA 3HSSA 3LAWA 5AO9A 3LCMA 1HYEA 2OP0A 4I19A 2J9RA 4MKIA 3B6JA 4BP8A 1FNBA 1XYYA 2NPOA 3LU1A 5J4KA 4L9SA 5DXAA 4UASA 3EZXA 1RS0A 2E1RA 2R6JA 4UFOA 4E70A 3RYIA 4YI3A 1KIAA 2QEQA 1D4AA 4Y2GA 2X3YA 8AT1A 1QP0A 5HZMA 2EZTA 3T8YA 2UKDA 3O95A 2A67A 2AZ4A 2TRSB 3IVCA 1E66A 4RA9A 4TTIA 4TWBA 1CQXA 5H4HA 3MCZA 3TLKA 3PNLA 3WKAA 1QGOA 4N9QA 3V4PB 2IBTA 4NU0A 1QIMA 3PNQA 5JG7A 4OAQA 1ENPA 4GH5A 2AG5A 1VYTA 4ND5A 3X1WA 2IOFK 2FETA 3DPUA 4DDKA 2O8EB 3I73A 1PHRA 1QAMA 1KERA 2AUNA 1YR3A 3G8YA 4IHJB 3UIEA 5TIIA 5DBHX 5JVDA 4F3NA 4RPCA 4WBSA 2VP6A 4FYWA 4TMZA 2AG8A 3DCYA 2WYHA 4E3WA 3PWTA 2COKA 3PNKA 2WP0A 3Q15C 1NUTA 1ZD8A 3OKAA 3C7KA 3IIMA 4IKPA 1XO1A 2HADA 3BOSA 2ES4A 2V7BA 3Q7IA 4H31A 1PLJA 4R1PA 4R83A 4EHNA 3NOXA 3DLBA 1JN0A 1TCBA 2WHYA 4UEOA 3REQA 2I4LA 3TX6A 3P9XA 3K6KA 3ELYA 2UVDA 3DE3X 1GZDA 3TKYA 4F8EA 1ZNQO 3C16C 3K16A 2JGFA 4NJMB 2JI4A 1Z47A 2JGKA 4DYVA 1JJFA 1OWMA 4Y1EA 1JMVA 1NKTA 3GUCA 3L8EA 4HNTA 3D3JA 2FZVA 2X3FA 1RACA 3MWKA 1KY5A 1RXVA 1KC1A 2Q6KA 2J3MA 3L0CA 1GAEO 1WSWA 2A4MA 1TZJA 3LWNA 4K05A 3PITA 3T5CA 1T6XA 1Q0LA 4CDMA 4X20A 2Y9MB 3HVJA 3R7WA 4DQKA 1DKUA 1SCDA 4GYWA 5HE9A 2W2LD 4KLCA 1R00A 4KQHA 4UCQA 1T1EA 5DBOA 3V7WA 1N36B 1C0EA 4V0ME 4DCCA 1ZJ6A 3IAS6 3I05A 3L6DA 3WL3A 5J2UA 4MWOA 1QG4A 2SCUB 3KT8A 1FX0A 4DDMA 5DT9A 2E2WA 4OKSA 1JWAB 1YZGA 4B3MB 1OTHA 1ZM2A 1JZSA 3ZQUA 2BFWA 2F3SA 4ZOLA 4DNQA 2Q9BA 3LH5A 1K75A 3FNIA 2J0SA 1ND5A 2QA5A 5E0KB 3ZTTA 5BSKA 1PSWA 1UBJS 5F23A 2Y67A 3TZKA 2BGTA 1J2EA 1GARA 1MGOA 2JA2A 2VAMA 3DJFA 3SQXA 5HRAA 5NULA 5ITZA 3DAFA 4LQLA 4V0SA 1N7JA 3B85A 4KV9A 4P22A 1BDMA 2BRUA 4ZYZA 3RUCA 1FMTA 3DT9A 3CX4A 2G9RA 4LI0A 4Q3KA 3ZVLA 6Q21A 1UKAA 1I7SB 5JSFA 1U1IA 3K31A 3OPYB 3NDJA 3TW6A 5B1EA 4N4AA 2O8CA 5KU7A 4NFHA 4Q1BA 3IP8A 3SYMA 3RWOA 3NT2A 2VPWA 2CVQA 2ZVQX 1PGJA 1XPJA 4G37A 2RHOA 3B3QA 3KJXA 2JFZA 3B5IA 3E58A 3PICA 4FSXA 5LXTA 3AM1A 3O82A 4GI7A 3PNMA 3I01A 1F7UA 3COZA 4JC5A 1FYDA 1UZUA 4H0FA 3K8YA 4IH9A 3LZCA 4S1NA 5JO9A 1KARA 2ACWA 2MU1A 4KQ1A 1HFWA 2Y1OA 4KN6A 2H1CA 2IGTA 1OFIA 5IBRA 2YXPX 2AFHB 3C24A 2PAAA 4MMZB 3TIFA 4DHWA 4MPPA 4UD2A 1NNSA 2UZ1B 2XEDA 2GPWA 1THGA 1QE0A 1U5BA 4RKRA 4ZREA 5CYPA 4YHBA 3TNDA 5BSHA 1FMFA 5CDUA 1KJ9A 1RIIA 5KC8A 4JVLA 4R8RA 4CLXA 3K5PA 3AVUA 1CETA 2C2HA 5JXWA 3V00A 4UHBA 4W8GA 3CKMA 4MS4B 1DV1A 3UGQA 2PX8A 4JI0B 5AW4A 3IC5A 2FW9A 4WI1A 3N0XA 2NUAB 3W2GA 1FIUA 2YOFA 2P9ZA 1PTJA 3EEFA 1U80A 3UAZA 1MOQA 2DHCA 2H7XA 3JASA 3QVUA 3K0BA 2VDVE 3GRUA 4RPLA 1HT2E 3NU1A 1ZMXA 1XD8A 4UXJA 5GINE 3PHJA 1IXZA 2R5NA 2X0EA 3GJRA 1O9HA 1JJ7A 3GK3A 4U5XA 3ZDZB 1AJEA 3CJQA 2V6FA 3FG9A 3CLSC 4I0WB 3LFHA 3OE5A 5CDSA 1R16A 3M6FA 1XEXA 1RKXA 4GM4A 1FW8A 2V5AA 2XEXA 3BIFA 3HBAA 1H6DA 4LK3A 4M6WA 5E7JA 1YFLA 1LVHA 5LA6A 2O3SA 4AJLA 3LCCA 4DMRA 1A4RA 4JLMA 1NUAA 5IMBA 1L5QA 2IUEA 1ZYUA 2J7PD 2Q28A 1Y42X 3L0ZA 3NHYA 1YR6A 1D09A 2PNFA 1QHFA 1YR9A 2Y1DA 2F17A 1ZDMA 4KSCA 2E4XA 3ZJYA 3LOPA 1FU8A 2QBYB 3FGOA 4EA6A 1F8YA 5D3ZA 1VGRA 2P4EA 1V45E 4FFSA 2LBPA 4I3HA 3U3KA 2ZM5A 1Z0AA 4F3KA 2PKCA 1ISGA 3BMQB 5DASA 2O1WA 5DEOA 1IJFA 3NDRA 3U6BA 4MKZA 3GJ7A 1VI2A 4J1NA 2E4VA 1KZ4A 5DHUA 5TMEA 1MTZA 4BIMA 4OBWA 4DNXA 2VBFA 3I9MA 4YQZA 2PVCA 1MHPA 2CL0X 2CY0A 4FDVA 4N7MA 2PVPA 3C41J 2YFHA 3NC4A 4PFSA 4X1IA 5DW3A 5BN4A 5BP7A 5C1BA 1E5VA 2OC4A 4N7RA 1ADBA 5A05A 5IZCA 2XHZA 2YMLA 3VR3A 3WNDA 3OTGA 1M34B 4HWTA 4L8WB 5ILGA 4O2AF 1PNVA 3ESQA 2DVMA 3ERCA 2QE7A 4LYEA 4CG1A 3H17A 1GGMA 2WD7B 5HWSA 1H65A 2A5JA 5AKZA 4BNZA 1OT5A 3VHLB 3L40A 1JYEA 1B8NA 4IVRA 2QD1A 4PGHA 4Y2XA 5U9CA 2P8JA 4JBWA 4Z0PA 3GP8A 3H75A 4HNGA 5JD5A 1VHLA 4I9UA 1CEEA 1GZ3A 2P2NA 4W1SA 3QWBA 3L5OA 5IAEA 2CXSA 4PYMA 1US8B 4WKBA 1XK6A 4W5OA 1XVLA 4O1MA 1NW6A 4MB0A 4PAGA 1CWUA 4YCCA 1KH1A 1GTG1 6CHYA 4OHVA 2WVAA 4PTZA 3BGDA 1VHDA 4QJ3A 1R9MA 1VP3A 1WHSA 4AI6A 1FFWA 2XMQA 2X40A 1GZ5A 3RIEA 2ZE8A 3LUBA 1JFSA 5IARA 1I4OA 1TRKA 2UZIR 4QEKA 1CUDA 1VFPA 5D85A 5BQOA 1G20A 1YS9A 4B33A 5DBFA 1KEEB 2X0KA 1RBQA 3LUCA 5IUKC 4S3MA 2XIQA 1TW2A 4WNIA 1DQNA 4PX5A 5EZYA 5FUWA 5M04A 4NMWA 1TZBA 3R3UA 3D8SA 4M0EA 3G2QA 1PJ2A 5B7PA 3N2GA 3OT5A 1KY2A 2N46A 1GG8A 4QQFA 5EI5A 1T5IA 2FFRA 5KYYB 5H02A 1F4LA 1MX1A 2B99A 3UWMA 1KQ3A 1XMIA 5C9ZA 3HEAA 5L53A 2A5GA 1QH1A 3QSGA 4DCNA 1YRQA 3EBOA 4QREA 3GX1A 1NFRA 2ZB4A 1V4NA 3HH8A 2FDRA 1QQ5A 4CHTA 1V1RB 3QELA 1PTKA 5LQDA 1GQQA 1GNVA 4YWJA 1X6VA 4D96A 4ESOA 3RK0A 5AKJA 4EF6A 1O54A 1GTJ1 4G5GA 4ER0A 4NG4A 2CL5A 4WAUA 5KOHA 4B9EA 1FL9A 1QGUA 2YINC 5D00A 4GL2A 1X7WB 4XGKA 1ZGGA 2QMYA 4JYMA 2H07A 5DYGA 1HNZB 1GA6A 2JL1A 3MTAA 4KFRA 4O2AB 3IUQA 1G19A 4L8VA 2C78A 4Q7MB 3BJRA 2IZ1A 3GJSA 1LPSA 2Q49A 5K05A 2ZYUX 1QONA 5JPIA 3UBTA 3T4PA 5K8JB 3BE6A 1WVMA 2CFRA 4OK5A 2DPXA 3V7YA 5JV5A 4KXUA 1L4GA 3Q1KA 4UVHA 2ARKA 4BFZA 1S2NA 1WXEA 2ZR7A 4DUPA 2EHJA 1KP2A 2YHIB 4GYJA 3JQFC 5EERA 4ZEXA 1G4HA 2PSSA 2Z5GA 4ARVA 1SBIA 3ND8A 3BMOA 1J21A 1AURA 1UM9B 3UHOA 1GVHA 5TS2A 1T5SA 1WUKS 1M7BA 2SKDA 1Z5OA 5GM1A 4D4MA 5A04A 1W1UA 1RQXA 3P96A 4IZOA 4PGFA 1FP2A 1WU8A 3I8XA 2HRBA 1A9PA 1ZBQA 5EWLA 1LPOA 1VSVA 1PYOA 3T9CA 4CRWB 4QOFA 5KVVA 1EDEA 1V11A 2D2FA 1HQYE 3RT7A 4UUMA 1N75A 5ELMA 2WG1A 4EEKA 2AJ8A 1I3CA 5IJ9B 1V5FA 4NJEB 4KQ6A 4EHKA 4MRMA 2XDYA 2Q4EA 3DVAB 4N8SA 2C58A 1T10A 4GMGA 2I2AA 4MI9A 1TUBA 4UUQA 1GCUA 6GPBA 3V8RA 3V8QA 2FMHA 5CJPA 1SKUA 1E3MA 4G1EB 4NWIA 2O57A 4MYHA 4RKYA 3JYHA 1N6KA 2G1PA 3NCHA 2PL9A 4UEJA 1Q1AA 2FW0A 3D7LA 4Q3EA 4YFVA 4RSHA 4LNUA 3H0KA 1MABB 3L4BC 4H6VA 4MW4A 2DB3A 3BT7A 5FULA 3RO7A 1TEZA 3L1VA 5BWBA 1LBHA 2PX5A 3L0IB 1HYBA 4PLWA 1F17A 3LL4A 4X1OA 2BGIA 1DAGA 5KTNA 1G8JA 1TYZA 4NOJA 4G41A 4XGNA 3SDBA 3WAJA 2PUDA 4LOIA 1T26A 1CU1A 2G1AA 3F4KA 4QAQA 3S2UA 3SOZA 1TQ4A 5C8XA 5ITSA 2ZSJA 4OFZA 3UQZA 3VVLA 3QTLA 3EC7A 3EIHA 4OHRA 4DB2A 3GRPA 1Y1RA 3FJYA 2D00A 2I1LA 5CITA 5C4MA 4DW8A 1PJAA 1JUDA 2HMYB 3BZWA 2W8ZA 4C0LA 5TQ2A 1CZLA 2NMVA 2E5FA 4P86A 4YTEA 1X7ZA 3I23A 4U1RA 3OJCA 4C88A 3THXA 1U0RA 4PX2A 4CEHB 1JZTA 4F4UA 1N2EA 2YIDA 1JYFA 4NNOA 1T4CA 4QPNA 1U2ZA 1BXZA 1ZEJA 2VP0A 2X0NA 3D8BA 1DTEA 4N9WA 3ZQKA 3ZWYA 3TDMA 5CT5A 1TMYA 3MMSA 1E7SA 1JHZA 1TVEA 2OGTA 5BRNA 5H3HA 3W2TA 4DRZA 2BSQA 2B78A 3TFQA 1EFPB 3G02A 4NPAA 5EE1A 4LIPD 3SZGA 4D9MA 4FWTA 3STWA 1KGSA 4L15A 1E1CA 5DBEX 1F8UA 1S9DA 4H16A 2NV2B 1S7CA 3OETA 4IYJA 4OK6A 1WPGA 4M8KA 3SF8B 4R7TA 1C9NA 1E6CA 1MH1A 3WRWA 3CE9A 4UULA 4RX1A 2ODTX 4PYNA 4N47A 1SPXA 4O2BF 3ROQA 4BOYA 5LZ2A 1SK8A 2CYAA 2PM8A 1M0SA 3U4AA 4PLVA 1Q19A 3NWBA 3T1VA 3V48A 1IB6A 1V4BA 4JLDA 4L5AA 4IL5A 1R3DA 4OHPA 1NY5A 1MD9A 2P6OA 5B6IA 5L51A 1MQ9A 1A8UA 3WFIA 2EKBA 3N7AA 3ZZNA 4KO3S 2Z1MA 2FX2A 2GN6A 4WOBA 4R9SA 1BFDA 4AKIA 1K2VN 5EMNA 1W19A 1HT1E 1Q14A 4LDZA 4LDJA 5C18A 4JJ8A 1UQRA 4KR6A 1QBKC 1EJ2A 2CNOA 3FUTA 5F3DA 1EBBA 1WMSA 3HI4A 2YNMC 4RXTA 2UUPA 5G0TA 4D45A 4U3JA 2HD4A 4FOPA 1P1BA 3H42B 1NAIA 3EASA 4HAXA 4AN1A 2B2NA 4MYCA 4XUCA 2C04A 5KNLA 3RRNA 2IUTA 2PGOA 5I3ZA 1JVNA 4U00A 3H1FA 1T5DX 1V5GA 1Q44A 2W2NA 2FDXA 4NCAA 4FNOA 4LEIA 4KC0A 2WMNB 3B9PA 4TLCA 1HORA 4ENTA 1QGZA 2CXHA 2I2DA 3U39A 1RHUA 1S4QA 2X1MA 4Z0NA 4EYQA 5KMGA 1NV9A 4EF5A 2FE4A 4TL8A 5MGNA 2NYAA 1ZVMA 2DR3A 2GN8A 3WB1A 1RJWA 2Q5IA 2PFKA 3MILA 4WDQA 1RWOA 4UNNA 4TXJA 4AYXA 4Q4CA 2R66A 3TNFA 1RTKA 3WTCA 2OFXA 5T41A 1GGJA 3BXFA 3EGIA 1IN1A 2CFOA 3CG0A 4RMJA 3DHWC 1ZESA 3F96A 1ANKA 4XDZA 1T9GR 4ALNA 5T67A 2ATXA 3HCRA 4ME6A 1JXQA 3JQRA 1Y8RA 3PU6A 2QAGC 4IIJA 2DRIA 2DT8A 3ZWBA 1XXHB 4LDRA 4UHJA 4BXOA 1NVUQ 5TX7A 3BERA 3WRYA 1UANA 1ZRNA 3PHLA 2QN1A 2P9TA 4MQEB 4TXNA 2XVZA 3T95A 1ZRHA 1NQWA 2JKVA 3MTJA 4P36A 2VJQA 4GM0A 5DZSA 1CJTC 4O2BB 4AYWA 3KETA 2P75A 1MC5A 1TEXA 2DR0A 1EX9A 2H1IA 3PEFA 5CXSA 1CX9B 1E9AA 2D13A 2VYFA 1NQ5A 4FFNA 2V3CC 1AG9A 4G5OA 1SCIA 3LGAA 1I5RA 1R4AA 4QGHA 2LDBA 2VT7A 5DXFA 3RREA 1SUFA 3WADA 4J9UE 1Z12A 3D0QA 3NORA 1QO9A 2EWVA 4H3VA 5IFLA 3R5KA 4JVNA 5JHGB 3ED5A 4CTOA 3U40A 4GR4A 3MD9A 4QHYA 4UUNA 4G07A 1O0CA 2VT6A 4BMDA 3QLVA 4J16C 4FJ2A 3L8YA 4PYLA 4QRDA 4OUKX 4QWMA 1JALA 3OM9A 5HHTA 2CSUA 2E18A 4XYGA 2C7VA 5CNKA 5ALRA 5IH7A 5JJ5A 221PA 1BYUA 2Q9CA 3SNHA 3K6RA 4UTXA 3G0HA 5B7NA 5BSEA 4BJHB 3WGGA 2BFDA 1ML3A 2OEPA 3AHDA 4NNPA 2QXUA 4U7JA 4ZMRA 5JAOA 5SYNA 1IU9A 4Q9LA 2O59A 1X19A 1DKQA 1O58A 4IHQA 1P1CA 2MSLA 3C5VA 3WNCA 1Y4SA 4DIMA 1KJQA 2YOGA 3BEDA 3NBKA 3PJGA 3V8NA 16PKA 2IZ7A 4YP7A 2NU9B 3K2QA 4AY3A 4M60A 4HGRA 1Y37A 4KNWA 5FOWA 5JSHA 2D2IA 4TMWA 2AEFA 3ABRB 4LFBB 3GUUA 2J5RA 3RPEA 1NXXA 1Q21A 3HA3A 5D6NA 3RWMB 2CLDX 3BHJA 4PTYA 2W0SA 2XQKA 3TXXA 1ESDA 1YAJA 1KVRA 5BURA 5IM4F 1FFYA 4PHCA 1G6OA 2C9YA 2ZJ2A 3SEAA 3Q87B 2HSZA 2UYGA 3WV5A 2X6TA 3MT0A 2FN3A 5L6LB 2VJBA 1JR2A 5AW3A 1XDWA 1U4NA 4MGYR 3GW8A 4OYLA 3V4OA 4LJ8A 1PCXA 2HHHB 4R0VA 1N9KA 2G82A 4TYPA 2EAUA 5JYBA 2OVFA 1EHCA 1C30A 2CWDA 4W99A 3S8MA 1IN5A 1J1UA 3C45A 4PQRA 3CR8A 3LUAA 4LTNA 1XVVA 4PNZA 4EHIA 1NZDA 4KJZA 1DLJA 5ENVA 5FP0A 3ZOZA 1AQ6A 1EP1B 2DBVO 3UT5A 3LPLA 3S7ZA 3IR6A 1I7LA 1KGDA 2VRCD 2OL4A 2DH6A 2I9PA 1BU5A 1VIYA 4X90A 1NU8A 3SOPA 3NWPA 1RAFA 2Q0XA 1Y1TA 3DA8A 1RADA 5F7OA 1QOPB 1YIAA 2H00A 2XTNA 2Z4SA 4YXWD 1P5ZB 5C1IA 4E5YA 2JLZA 3DNPA 3A3NA 3FYHA 3Q3VA 4FQ8A 5LL6P 2DJIA 3A05A 3DAOA 4FEEA 5DCYA 2X0RA 2BM1A 4GC9A 1F48A 1P77A 2REQB 2K7FA 4JWKA 2ZUSA 4GXNA 4KLZA 3BD9A 3M5CA 13PKA 1LJUA 1PWEA 2BGNA 3LBYA 1GZSA 5E8RA 2I8AA 2LP4Y 3DT6A 1DBSA 5AJZA 3SC2A 1GCAA 1VSQA 1UFVA 4TYQA 4GI2A 2JLRA 2PH7A 5E1MA 1AE1A 1D6JA 4A0RA 4DIKA 1TUEA 1OZFA 1M8JA 2HPAA 3AUFA 2JFWA 2ZIGA 3F71A 4HADA 2ZKIA 4XM2A 4MMXB 4RFVA 4HRYA 4AJ2A 1RI2A 2K5UA 4BNVA 1F38A 2FWBA 1XD2B 4TZ0A 3EDOA 4UU1A 3T3MB 2IHUA 2ZRBA 4JH0A 5FPPA 3V1LA 4AZTA 1B2RA 2ZIFA 4AURA 2DFNA 2XMSA 2XOKD 3GARA 5JCJD 2JAHA 5DN6D 2OUKA 2OHJA 3LUGA 4ZT5A 5T3YA 3TVTA 5CLFA 4CF7A 4QXPA 5KNDA 3FTDA 2FWJA 4UNPA 4W63A 4NF2A 1WETA 1TX4B 2CHVA 3ETNA 3OZXA 2OYSA 1I6MA 1I33A 5CYOA 2RMKA 5F73A 4YC7A 3FE2A 3MB5A 3KLNA 2IS2A 3C3JA 2BBSA 3KK0A 3QUSA 2XADA 2HF9A 3JSXA 4HNAA 4L2IB 3VC2A 4EHJA 4J0GA 4MR7B 5E4FA 5E0OA 2YJNA 4IJVA 2B9EA 5GM2A 4ZU1X 3TQRA 3UNXA 1A8IA 1NZJA 1ZFNA 1WZ2A 2K2WA 3GGOA 3Q3HA 2ZSBA 4C9BA 1TOAA 3G1UA 3X1JA 1ODSA 1T9CA 1EH5A 2XWBF 2O2CA 2FSUA 2BPOA 2G63A 2HSJA 3DCJA 3VNVA 4FCTA 4M88A 3COYA 1PGNA 4MWZA 4RSMA 1XTJA 3AJAA 3WKDA 3BQNB 4PLGA 4GHWA 3CVWA 4UZEA 4YMLA 1ISMA 1L7RA 2X13A 2ZIXB 4MGKR 1CVRA 1ZXBA 2COUA 3TECE 1TKAA 3M2PA 5EWMA 4JT2A 1ZM3A 1E1DA 2PLNA 2IJGX 5HJEA 1CPYA 1OJ7A 2F3UA 3OJ0A 4KDRA 4QO7A 1DC5A 1UBRS 3GP5A 1VDMA 2UVQA 2WUFA 3EX7C 4L5BA 3JWPA 3P19A 1VPLA 1SHLA 3HZRA 4YRLA 3WMWA 3GJ6A 2BR5A 4FHZA 1KBZA 3B3FA 3F98A 1NAHA 1YZLA 4I5GA 1DMSA 2PGXA 1QV9A 3JARA 3OZSA 4X45A 4ARZB 3MT9A 4LZNA 1EIWA 4J4TA 3T4UA 1JAYA 1P3Y1 5IAJA 3PDJA 2IWHA 1SUBA 3AIOA 2GGSA 3H3JA 3OZCA 1VLMA 4LOJA 3SFZA 4EY3A 1INLA 3QYFA 2O05A 1ZM4A 3RUDA 4PLPA 1AA6A 1C29B 1B26A 4M1SA 5HG0A 4G01B 2QZ4A 3C5EA 1R12A 4IGIA 1DCKA