3O4RA

Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
TRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase/reductase SDR family member 4
publication title Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 86
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o4rA00
4E3ZA 2UV8A 4WNCA 5BQFA 2VRCD 3G17A 3C24A 4J1TA 3NT2A 3P2YA 3D3EA 4HNGA 1FXSA 4IZHA 2V6FA 4W7IA 4E2XA 4EW6A 4GX5A 3WSVA 1VPDA 3DMYA 3ZHXA 1EEHA 1E7RA 3BAZA 3MJVA 4TRRA 5C7OO 1QKIA 2RIRA 4FDAA 1H0KA 4CM5A 2YYYA 3ZWVA 5JW6A 1D1TA 1YKFA 1PJ4A 4JBGA 4B4VA 2F00A 1N1GA 4M54A 5IDXA 1C0LA 4BO0A 3PWKA 1NR7A 1QLHA 1R4MB 1YBVA 1R4NA 3SLKA 3F1KA 4BNZA 4FJ0A 1V8BA 4E0BA 1I5RA 2JCYA 3WGZA 1I32A 4NBWA 3ROMA 3LC1O 3WICA 4C7JA 2RCYA 2ZYDA 1JTVA 4HY3A 4BMVA 4E5PA 4J16A 1GCUA 4U7WA 3DZIA 1DAOA 1EUDA 1DIRA 1XIVA 3EDMA 4BGVA 4DQUA 4FSHA 2J3KA 1BHSA 1CIVA 3HFGA 5JDCA 1E3JA 2HO5A 2NQ8A 4BNKA 3UICA 1QRRA 5I8WA 5DN9A 3DDNA 3VPHA 1PGPA 3FSRA 3QJ5A 4DREA 2HLPA 1RM5A 3WIDA 1PU2A 4MVJG 5AYVA 3KYBA 4Q3NA 4Q3EA 1PWXA 2B4RO 4TMFA 4CM4B 1QXSA 2VZ0A 4J9UE 4BB6A 3IKTA 4YTEA 4PG5A 3NYWA 2WM3A 4FD3A 4MPDA 4BKQA 5L9AA 1U2GA 4ILKA 1ZO8A 4R1TA 1DHRA 1GD1O 3QHAA 5MGBA 4IDCA 4GL4A 3GN1A 2YY7A 4FGWA 4J91A 4IZIA 3V1UA 3COSA 2PV7A 1R4MA 4P22A 5FEUA 1A7AA 3UF0A 5A06A 1NASA 1E3SA 2Q99A 3WBBA 1ZK4A 4BNHA 3C8MA 5JMPA 1LSJA 3EVTA 4PLCA 1Y5RA 5KJEA 3C7AA 4B3IA 4HFNA 2NTVA 4YACA 1HDGO 2GNAA 5G4LA 1O0SA 5ICSA 3VH1A 2DT5A 4GWKA 5JBIA 2WYUA 1WZEA 1Z75A 2X8LA 2HMTA 2ZQYA 2ZYGA 3DZBA 2BFOA 2ZJ1A 3MOIA 4J7CA 2W8ZA 2TMGA 3JD4A 3O8QA 4R3NA 4XIJA 3JQFC 2EP7A 3O03A 4I5DA 4PLYA 1HTBA 2BGMA 3PPIA 1I2CA 3SBOA 2FY8A 2I3AA 3PGJA 1B26A 3VVCA 2X0NA 4IQ0A 3DAPA 4TVOA 1BDBA 3K2EA 1IZ0A 3R1IA 1YVEI 3E9MA 4Z9FA 4HXYA 5EL0A 3S1LA 2SCUA 4BNMA 1J5PA 2NM0A 5F5NA 2X58A 3EUWA 1PGNA 1N9GB 3WMXA 8ADHA 3B1KA 3JQBA 4W4TA 1QYCA 2FZWA 1MXHA 1ISMA 1AUPA 4JP2A 4GKVA 1KY5A 4RL6A 2GPTA 1PGQA 1NR1A 3QE3A 4CM9A 1ONNA 3JQEA 4RDHA 3BMCA 4YQZA 3RUAA 1I3NA 1LC3A 1LNQA 2OUIA 1VL8A 2GLXA 4DGSA 2JCXA 3G1UA 1ZH8A 4E21A 2D1YA 5H83A 2Y67A 2ZTVA 1TVEA 3INTA 4JIGA 3D4PA 2AXQA 3PK0A 5THKA 2HJRA 2P68A 2BRUA 3T7CA 1YQGA 2VYVD 2J5KA 4NFYA 3ETDA 5KKCA 1YQXA 2PNFA 3ZWBA 1HF3A 2HRBA 3PRJA 1H94A 2O23A 1DJQA 4ZQBA 1E3IA 1I3LA 2B69A 2QX7A 2AQKA 1D8AA 1XYGA 1Y8RA 4CLHA 1GADO 4DVJA 4D7AA 3IQDB 1LC0A 4RLSA 4J1SA 4RPJA 3W6ZA 4CMEC 4CV3A 1EQ2A 4IJVA 1PTJA 2P4HX 3VOSA 2X6TA 2OP0A 5COBA 2B83A 3JQDA 4YRAA 1HE2A 2Z5LA 1SPXA 1HZJA 4YT2A 1NP3A 1PGOA 1PZHA 4BQPA 4UVHA 3GOHA 4GX2A 4DMLA 1TLTA 1DLIA 2PLAA 4IDFA 4ALIA 3ZWNA 2OP1A 1N9GA 1XU7A 4H15A 5L7TA 1BVUA 2Q3EA 4Y6RA 3PHHA 3T7EA 4NJMB 4CMBA 3ZWMA 3ZW8A 1TA4A 1K89A 3UVEA 4TSKA 4UREA 5ENDA 1ULSA 1O94A 2WYVA 2X1HA 3O9ZA 1C1XA 1CWUA 4B3HA 3WB9A 3JYQA 4AFNA 1VJ1A 1X0VA 3U9LA 2NU8A 1YH3A 3DHEA 1UXGA 2PR2A 4LK3A 1YDWA 1MXFA 3INRA 5JS6A 5CDYA 4K1LA 3EW7A 4OXNA 1G1AA 5JMWA 2ZTLA 1Y1PA 3U3XA 4PLPA 2P5UA 3L77A 2R6JA 3L0DA 1HDXA 4EUEA 4DLAA 1EVIA 1X1TA 2GERA 3H5NA 4BO3A 2X22A 1CYDA 3RBZA 2NVUA 4W7HA 4CM8B 4EYEA 2X86A 4BV9A 2QQ5A 1PZFA 4ND1A 1CERA 1YO6A 1DC3A 1BXKA 2GN8A 2DC1A 1WP4A 5COQA 3GDOA 2YQ4A 4BMSA 4WCFC 3RWBA 2FSVA 4IS2A 2V7PA 3F47A 4P38A 2PWZA 3RASA 1UXHA 1ONOA 2D59A 3R3JA 4QFCA 3PJGA 3B6ZA 4NJMA 3GPDG 4WCDA 3GH3A 2P2SA 2G0TA 2PD4A 3ABIA 1C14A 1SBYA 1KYQA 1LEHA 2DTEA 3JQ8A 1H6BA 3TNLA 4KTTE 4RVHA 2CD9A 4R3WA 1J49A 1EDOA 1P0FA 2VZ9A 4EUFA 4PZDA 4G2NA 4CPDA 4DMMA 4UVEA 3K8ZA 3NJ8A 1GAEO 1JVSA 1LLDA 3L9WA 4A03A 3OQBA 3F9IA 4A27A 2NU7A 1PEDA 4QTZA 2OHXA 3CMCO 2CDBA 3Q0EA 2GASA 1A7KA 1GPJA 4DTIA 3UCEA 1M76A 2VWQA 1SEPA 5I9LA 2DTXA 3WXBA 2AHRA 3ULKA 3I9NA 3GA0A 3FNFA 2BHLA 3PI7A 4CM8A 1TT7A 4O1MA 4NQZA 3VDRA 5KIAA 2CF6A 4E5KA 3GNSA 4JQCA 4Z9XA 4P4NA 4I5EA 4BO9A 4XRGA 1KIFA 2DM6A 2VYND 3MEQA 1E7YA 3OJFA 1PS8A 4KP7A 5I9NA 3GUYA 1B0AA 1BVRA 1U4OA 3RCBA 5KJ6A 3DHYA 3K92A 3GEMA 3H7AA 1KS9A 4IINA 3KTDA 1GL3A 4NJOA 4YXFA 2V6BA 4GSKA 3WS7A 2A9FA 1BXGB 1MG0A 2O3TA 4B7UA 3GRPA 1GEEA 3TSCA 1PS0A 1V9LA 1NQTA 3AWDA 1LTHR 5JCJD 3IAHA 5ILGA 4MKXA 4NBVA 3GZ4A 4R1UA 1KC1A 3GLQA 2FR0A 2D8AA 1FDVA 3QVOA 2NU9A 4W9NC 1DC5A 1DRUA 3HFSA 3MCVA 2D2IA 4FC6A 3TZ6A 3AU9A 3KSZO 3K2BA 4E6PA 2VTEA 1PZGA 4D44A 1WW8A 1ZUD1 3I1JA 2POQX 5DCYA 3E03A 1IZ9A 1EK6A 2O50A 1YBMA 5TQVA 5GZ1A 2J5QA 3RSHA 3ADPA 3NDRA 3TJRA 4GWGA 3HG7A 4A73A 1VL0A 4Z0HO 1QYWA 3ZH2A 1IHYA 1P1HA 3IJRA 3A1NA 4FGSA 1IB6A 3WWZA 3OEWA 5FFFA 4CLEA 3ZWYA 4J0FA 3IL2A 2HKIA 3CMMA 2C82A 1ENZA 2EGGA 4ND3A 3SX2A 3UFXA 4D79A 2JAHA 3TOZA 4GLOA 3RU9A 3FTPA 2PGDA 1BDMA 1Y9AA 3CEAA 4MVJE 3LVFO 4XKJA 1E1KA 5JYEA 1XGKA 3BMOB 3WFIA 4M55A 3KB6A 2X5OA 3UOGA 1NFQA 3QLJA 3D64A 5HM8A 2C29D 3QP9A 4IGFA 4KWHA 1CDOA 4TKLA 2CDAA 4FJ1A 2J3JA 3Q1LA 1JAXA 1RYEA 2UAGA 1R15A 1NQ5A 3LLVA 4KOAA 2PY6A 3P5SA 1P45A 1W8DA 5JY1A 3AI2A 5TT0A 3L4SO 1HE3A 4Y98A 5IG2A 3AK4A 4OKIA 4HWKA 4OYRA 1ADBA 5THQA 3RIHA 1ZXBA 2X5KO 4JBIA 3FWZA 1XA0A 2AMFA 4JX8A 4C4OA 2NNLD 1XELA 4PCVA 3RC9A 2VHVA 2PKQP 4CR8A 5KWEA 4IS3A 2W98A 1PX0A 2OBYA 4F46A 1V3TA 3UHAA 1GCOA 3BXXA 4ZRMA 4YRBA 1OI7A 2OOSA 1TI7A 1PQPA 1O95A 3PJFA 1NHWA 5JCXA 3WGOA 5KJFA 2ZJ0A 4AJ1A 5JC1A 1KEPA 3JYLA 5C5IA 3GHHA 4XQ9A 2WSBA 1GV1A 3MJ4A 2WWRA 3JQ6A 3OJEA 2P9EA 1DOHA 2C5AA 3GR6A 3MJEA 2QYSA 2EJWA 1PIWA 4BNLA 3U4IA 3OMLA 4NPCA 5KCZA 2GYYA 4H16A 5I7VA 5T5QA 1LRKA 3CSDA 4YJHB 3LF1A 3BMOA 1HYHA 1ORRA 3JQAA 3DOJA 4HFJA 1GZ4A 4RLHA 3ENNA 3W8EA 4TVBA 5IXYA 3NAQA 2AA3A 5T67A 5T64A 1R37A 4CODB 4U6SA 2C0CA 3WGHA 4GSLA 1LU9A 1XR3A 2DUUA 5B4UA 1Q7BA 1J0XO 2C59A 1QLJA 3VTFA 4IMRA 4YT5A 3WTCA 4FB5A 2VHYA 4A7PA 1E92A 1PJ3A 1T24A 3MJSA 4FFMA 4RF3A 2VOEA 4J4BA 1GUZA 4MIEA 1E0DA 1JLLA 1I3MA 1P0CA 4OOEA 4QX6A 3DMTA 5CEFA 1U8XX 2Q50A 1A27A 3I4FA 2WDZA 3Q9UA 1Y6JA 2R00A 1WAMA 3TF5A 3FRJA 3UCXA 4AL4A 2P5YA 1KVQA 2D3TA 2QHXA 1NM5A 4YQYA 4Z3DA 3CXRA 5TS3A 5KNLA 2I76A 1ZIDA 3GNTA 3DAGA 4HADA 3RFVA 4MVJD 3H8VA 1YL6A 4U0KA 1VJ0A 5TF4A 3TZHA 4EEZA 2PH5A 3LF2A 4PVDA 1ZSNA 4RF5A 4IMPA 4E2ZA 3NV9A 2DAPA 3WJAA 4BGEA 1ADCA 3PJDA 1JKIA 2Y93A 3BTVA 3EGOA 3FPLA 4BO8A 3PP8A 5HS4A 1NFFA 4QUKA 2FR1A 4LSWA 5ADHA 4MIYA 3UXYA 2Y1DA 3DL2A 3R6DA 3UGKA 2Y1GA 1I10A 3UKOA 5EJ2A 1CQIA 3OIFA 3WNQA 1R12A 4CL3A 4E32A 4WASA 1IPEA 3I9KA 3GF4A 4C7KA 1AE1A 2RHRA 4B3JA 4XA8A 4IJUA 2NQTA 2OFPA 1PJLA 5L53A 3QWBA 1QG6A 1PJBA 2IZZA 3ICCA 4TRNA 1O89A 1GU7A 4I5FA 5BT9A 1DLJA 1LLUA 3D4OA 4BNNA 5A1TA 4BNGA 3FR7A 1PSDA 5DP2A 2AW5A 1DFIA 1G0OA 1ZMOA 5L7WA 3PEFA 3VZPA 3IUPA 2HK7A 3WGGA 1YGYA 4CM1A 3H9EO 4CMGA 4WLUA 1CRWG 1DBVO 3P2OA 1E1MA 1R0KA 1EQUA 3OM9A 4BV8A 3PVZA 1TT5B 1A9ZA 3ONEA 4ALLA 3AY6A 4RQTA 1A4UA 4O63O 4AJEA 1DO8A 3H65A 1LI4A 1YJQA 5IN5A 3B1JA 3ZU5A 4DBVO 3LT2A 3ZV5A 1EE2A 3JV7A 3K6JA 3ANNA 5DBGA 3H3JA 9LDTA 4IQGA 1HXHA 3G0OA 1L7EA 3GMSA 3WGTA 1JKJA 3TQHA 5GZ6A 2WTBA 3H9GA 4ZICA 4CMCA 5JAIA 4XYLA 3GFGA 4BNYA 3V2GA 3QVXA 3V2UA 1EZ4A 3ZN2A 2YDXA 4UULA 4PZCA 1NPDA 4WOJA 1QYDA 4NR0A 4NU5A 4XQGA 2OMEA 1Q7GA 2C7VA 4CQMB 1QP8A 3NGXA 4L9RA 1HSOA 1ZVMA 5JY6A 1JDJA 2EXXA 3ZWOA 2XXJA 3PHLA 1BSVA 3QA9A 3Q3CA 3D5TA 4HV4A 5IJZA 5L51A 1UXJA 2GN4A 1ARZA 1MC5A 1U4SA 1VM6A 1YS4A 3L6EA 1YWGO 3E9NA 4XGKA 5LC1A 4E2WA 5KVCA 2IZ1A 4F6LA 1PR9A 1ZFNA 2JL1A 3WYBA 1TT5A 2YFQA 1UP6A 2DBZA 1AXEA 1FDTA 3WYEA 4YJGB 2Q45A 1A72A 1WWKA 3JQFA 3OF2A 4IBOA 4W6ZA 2HK9A 4FOOA 1FK8A 4BNVA 4CMKA 3GG2A 2OBNA 3ETGA 1ZK2A 5DULA 3HN7A 1FF9A 1H5QA 4IJKA 2D5AA 3BMNB 4I9UA 5KJCA 1F14A 2GZ3A 1B8PA 3U62A 5G4KB 5U1PA 3NDIA 3X2EA 1HWYA 2XF8A 1JQBA 2IYPA 5C7LO 3W8FA 2ZB8A 4WUVA 1Z74A 4Y9DA 4YBZA 1U3VA 3IMFA 4YAJA 3KBOA 3WGIA 3U5TA 3OECA 1C0IA 3AM4A 2GF2A 1PJQA 2VWGA 2BGLA 5TC4A 3ZV4A 4A2CA 4JNKA 5CP8A 5A02A 4R5MA 3GVCA 1GYQA 3OP4A 3EAGA 4PLHA 4CQMA 3L6OO 3QV1A 3WTBA 1ENOA 1LSSA 3ZZNA 5IDQA 5MDHA 2A4KA 4MVJM 3VH2A 3U0BA 3M2PA 1D7OA 1P31A 3DR3A 4JXKA 3HDJA 3RKUA 1YOVA 3O8QB 2HMSA 4JJGA 4AJPA 4IDAA 4Z0PA 4ALKA 1KVUA 2YQ5A 1F0YA 2B4QA 1PR3A 4I08A 4R01A 3PIIA 2AEFA 5TJ9A 2F1KA 4YJGA 3OA0A 4X54A 1JAYA 4IGEA 3WSWA 4XYEA 1XQ1A 1ISIA 1I3KA 1TXGA 3VAZA 3Q2KA 4CMEA 1RPNA 1QMGA 1UAYA 3KYCB 2I66A 3PDUA 1YE3A 3JQCA 3PYXA 1X1EA 5JAQA 3BMNA 5B4TA 4ALNA 1M67A 2QZ9A 5GMOA 3QY9A 4PRKA 5G4KA 2DU8A 1PS9A 4WCFB 4D45A 1ZBQA 1M66A 3QW2A 4N5MA 2Q4EA 4WK6A 4CUJA 5G0VA 1GZ3A 3GGPA 4B8WA 2VUUA 5A9SA 1ISHA 1NHGA 1E7MA 5JLAA 3IIEA 4AJJA 5JSFA 2DFDA 4TQGA 5H81A 1D4FA 2EERA 4FCCA 3BMCB 2X9VA 3VZQA 4LISA 4H7PA 2AQHA 1YRLA 3DZHA 1Q1NA 5AXDA 2PK3A 4ID9A 5JE8A 2BD0A 3PFWO 5EQFA 1K3TA 2A94A 4ND4A 4ZJUA 3OJOA 1T25A 3HDHA 2X9GA 3ZV6A 1RJWA 5JO0A 1QV7A 1ZKMA 3AM3A 3ANLA 1N7GA 4MP6A 4B4OA 1I2ZA 3OEYA 3AJRA 3IJPA 4P4LA 3S2GA 1Y8RB 5JDIC 1YB4A 1KVSA 3SLGA 3BTUA 1NQAO 3KYDA 4HP8A 1XHLA 2Z1NA 2JD2A 1RYDA 3QSGA 4ONEA 3PHGA 3Q11A 3NGLA 3O26A 4OH1A 3OIDA 5TGDA 4EZBA 3H5AA 2Y05A 3GVHA 4JGBA 4XYGA 3KYCA 1ZNQO 4I8XA 1U1IA 3I23A 3DO5A 4J6FA 5A3VA 4DC1A 3DBHA 1GV0A 1CQJA 4TKMA 4XR9A 2FOIA 4WCFA 1A9YA 3GY0A 4BKUA 2Y0CA 2Q1SA 3CZRA 4XGIA 2VHXA 1Z45A 2O7QA 5LDHA 3OQ6A 1HEUA 1LDMA 4PG4A 2IDZA 4RPLA 2HCTA 5GZ3A 3LC2O 3ICPA 4HFMA 5F21A 1FJHA 2GD1O 1C1XB 2VHWA 3MWDB 2VCYA 1PJSA 1E6UA 1LJ8A 4GMFA 2GUGA 4P4GA 1LDBA 1UP7A 4XDZA 4NHEA 1UDAA 4CV2A 1K0UA 3QVWA 5JAZA 3WFJA 1EMDA 3WLFA 5FYDA 1T1SA 3PGXA 1DFGA 5G0WA 4J0EA 1Z82A 4MVJF 1SB9A 1I30A 4RO0A 4LGVA 1ISFA 5AXCA 4EI2A 4WLVA 4GKBA 4R69A 1LA2A 1WXDA 1GQQA 5ILOA 2VRBA 1C3VA 4BO6A 2PZKA 2C5EA 1U5CA 3AFMA 1X7DA 1Z7EA 3EVNA 3QQPA 1C0PA 3LSYA 4G81A 4PGFA 4U6QA 4YT8A 2B5VA 3OQ1A 2WJPA 5DNAA 3GC6A 4EJ0A 3ZU2A 2NVUB 4URFA 3GEDA 4DWVA 1GQYA 2DBRA 3FN4A 4LVUA 4EITA 5KVSA 1NQOA 2VZ8A 1E3EA 1PQUA 5TRTA 4II2A 5L45A 1T26A 1UP4A 1WNTA 4IPTA 5F5LA 4ESOA 4PFJA 4ZVVA 3SC6A 1T2AA 2HRZA 2QW8A 4IJWA 3LYLA 1UJMA 5F1OA 3H4VA 2GGSA 2Y99A 3BHMA 3RBXA 3ZCXA 4QSMA 4CL8A 5FI5A 1ZEJA 3RQSA 3TPCA 2ET6A 2IE0A 2E37A 2DBQA 2NU6A 2HMUA 3JQ8B 1SNYA 3ORFA 4W82A 4E31A 4G5HA 4Q3AA 2JFFA 4D41A 3ENKA 2O4CA 5H82A 4GBJA 1WLYA 3EZYA 3E18A 1Q2XA 2FPGA 3AU8A 4W9NA 4RVGA 5A5FA 4PLTA 4UVGA 1F8GA 4J3FA 3GMDA 2GN9A 4L75A 5CAEA 2QG4A 3WX0A 1FDUA 2FHSA 1HYGA 2O2SA 4LSMA 2EJVA 4P8RA 5T57A 4DIBA 5CG2A 5L40A 2VNSA 4FR5A 2DPHA 4FBGA 3ST7A 1W73A 4RVUA 4CV1A 4IDDA 2D5CA 2DTDA 5C37A 5KVQA 2WD7A 3AI1A 2O7SA 3P19A 4B79A 4S3MA 3PLRA 1B7GO 3ETEA 1H9BA 5DP1A 1BXZA 1MGOA 2AQ8A 1WDLA 2W2LD 3E5MA 4I5GA 2B4TO 4D3DA 5TIIA 3C7DB 5ER6A 2I5PO 3HNPA 3ROPA 5AQ1A 4R1SA 1V3UA 2VUTA 3L4BC 3NX4A 4Q3DA 2ZYAA 4E5YA 4TRJA 4PLGA 2NADA 1U3UA 4L4XA 2JJYA 4BVAA 2Q49A 3ZNPA 3GG9A 2E49A 2YFHA 3RROA 1N7HA 2HU2A 2PTGA 2PGLA 4YCAA 4BGUA 4JROA 2OORA 1KVRA 2X4GA 4AJOA 4LN1A 4EDFA 2C7GA 3M6IA 1E7WA 2ZB4A 1TEHA 3RJ9A 2UVDA 3GDGA 2FSSA 3PHIA 3W4KA 3FBTA 4BNUA 3RAJA 3TN7A 1E77A 3UN1A 4R16A 2QIOA 2PZMA 2YJZA 1GFSA 4CLXA 1EE9A 1Q7CA 1NVGA 1F06A 1RM0A 2X0JA 3WDSA 5DDIP 2Z1MA 2HSDA 1WZIA 3DAFA 4YEDA 3LLSA 5T6BA 3RC7A 1NXQA 4BKRA 2FN7A 3LT0A 4Q9NA 3E82A 1IHXA 4ZQFA 3ZGYA 3GNQA 3E48A 2B5WA 4DPKA 3ZWWA 3I6QA 3PYMA 4WLEA 2GRAA 5GY7A 4QFDA 1VC2A 3DFZA 4UUMA 4YVFA 3U4HA 4MDHA 4Z0TA 1P77A 4MINA 4HX5A 5HTOA 1QYVA 3PWSA 4LCEA 5FI3A 2ZIZA 3D4NA 1PWZA 1P1FA 3GVIA 4WE3A 1IYZA 4PG8A 1T2FA 4HKTA 3SVTA 2NACA 3BTSA 3NEPX 2PA3A 3K96A 3OFSA 4XJTA 1CEQA 3C85A 4JK3A 4KUGA 3FNGA 3B70A 5T8KC 4J1NA 2OXIA 4NIMA 3RUDA 3W1VA 4B7CA 4CM6A 4KZPA 1DXYA 1WMBA 3MZ0A 5JXWA 4MP8A 5BR7A 4Y67A 5TT1A 5IXSA 1C0KA 4PLVA 4XB2A 2P91A 1IUKA 1RKXA 3RC1A 2VRCA 1IOLA 5IF3A 4XDYA 4DYDA 2HUNA 1NX6A 2AEMA 4D3FA 2CUKA 3LQFA 1ZW1A 3P7MA 5IDWA 5B4VA 4J90A 9LDBA 3INGA 3N74A 2GN6A 4DIFA 1RM3A 2X5JO 3IS3A 3WYCA 3BZUA 3BHIA 1U8FO 4KQXA 3GFBA 5L4SA 3E8XA 1SB8A 1ZCJA 3PQFA 3WNVA 2CZCA 4L4RA 4E4YA 2B36A 4OXKA 3JQAB 1LDNA 3GN2A 4L0QA 4OMUA 4IIUA 4Q3CA 3JYOA 7ADHA 5JC8A 2XOXA 4EUHA 2YHIA 3FCOA 4GMGA 4UUPA 2V6GA 3T4XA 1LUAA 4U8GA 2JD1A 3PLNA 1BGVA 1EFLA 1KEUA 1SMKA 1P1RA 1V6AA 2O48X 3IKVA 3KV3O 4R54A 4GVXA 3VH3A 4CJXA 1LRJA 4M86A 1LDGA 1HSZA 5AXAA 1HKUA 5A4DA 4HNHA 1SC6A 1NTOA 4DPLA 1GR0A 3FPCA 2PKQO 4CMJA 1H6DA 5A05A 4JLWA 2YDYA 5EESA 4MP3A 1Q0QA 3EY4A 4N54A 1I36A 4AJ4A 4R5HA 3N7UA 4M8SA 3KHUA 3ZWCA 3TZKA 2YV2A 5CFZA 1XSEA 5ES3A 3DOOA 2YV1A 4LMPA 4YAKA 1Q0LA 1QV6A 3AUAA 3OSUA 1O9BA 1T4BA 4Z6KA 5CDSA 4NU6A 4B7XA 4ITUA 4LW8A 3OHSX 3RKRA 2G82A 5BNIA 5CDUA 4CM9D 3WOHA 2RBEA 1YDEA 3AI3A 2JHGA 1LBEA 1GDHA 3V8BA 3PZRA 2EHDA 2ZKLA 1XLTA 3TDKA 3R0IA 4WPGA 3FTNA 2JFGA 1R6DA 1PJTA 2X7HA 3HDYA 4BO1A 4UUNA 3U4CA 6ADHA 4D0SA 1B8UA 5KOIA 5F1PA 1IPFA 4YYZA 1XWFA 3PTZA 2VQ3A 2P9GA 3A28A 4KUHA 2O2YA 3RUEA 3EC7A 4LRTB 4IM7A 2QRJA 3JQ7A 3DZGA 3LT4A 1GPDG 1SOVA 3GDFA 8LDHA 3DXFA 4OM8A 1DRWA 2FMUA 3ONDA 3JD3A 1BW9B 2JFHA 3KSUA 1PL6A 3DC2A 4GQAA 1PGJA 3LK7A 5G2OA 4NK5A 3ZU3A 1B3BA 3F5QA 3B20A 1LSUA 3IUSA 3VZRA 4PRLA 1GUYA 3ON5A 1JA9A 2EIHA 3HZZA 3PQDA 3ROKA 1O5IA 2NWQA 3JYNA 3NTRA 1LLCA 3FD8A 3BTOA 2Y0DA 1K6XA 3Q6IA 4NDNE 5TJHA 2W4QA 4XYBA 3N58A 2VWPA 1NYTA 3I52A 5A04A 3STHA 4NBUA 2BI8A 2FZEA 3ROQA 1VL6A 3L6DA 3NUGA 1QSGA 2QZZA 4PG7A 2Q1UA 3H5RA 2J3IA 4DPMA 4GH5A 3AUSA 5TLSA 1E5LA 2E48A 2EF1A 1VKOA 2FR8A 2G76A 1DEHA 2VYVA 4FS3A 4XJSA 4XIYA 4CMAA 3MTGA 4CMIA 1NVMB 2C54A 2HMWA 2VUSA 3VPSA 2UUPA 3DTTA 1W0CA 3F5SA 1AHIA 3WJ7A 3BHJA 4DQVA 1ML3A 4BMNA 1B8VA 4HUJA 5JAMA 1Y81A 2NVWA 4BO5A 2CMDA 4YAGA 1H2BA 4RJTA 5FF9A 1U28A 1BW9A 4QO7A 3RUHA 1S7CA 4EEXA 3V1YA 5KJ1A 4R68A 5DT9A 4FFLA 3I4CA 1J6UA 3JYPA 2O3SA 3GAZA 4TROA 2PFGA 1OBFO 3FF4A 4MKRA 1KEVA 3UW3A 1H6CA 1HDOA 5A03A 4RQUA 3GVPA 3RVDA 4J9VA 1DIGA 3PJEA 3FNEA 3F46A 1J4AA 2EEZA 3GZNB 2DQ4A 3TZQA 2IEBA 2AG5A 2AQIA 4YAEA 5COAA 1X0XA 4WEQA 5I7FA 5K9ZA 4BNXA 5J23A 2Y1CA 3WBFA 3IDSA 1PL7A 2C07A 2DLDA 3WWYA 1HLPA 1HRDA 1MB4A 4N5NA 4YAIA 5ITWA 3NDJA 4FW8A 1NWHA 4L74A 2VN8A 3LC7O 3KSDO 4XQEA 1ZMTA 2D0IA 1BG6A 3HHPA 3TWOA 1K2WA 1S6YA 4IDEA 4IUYA 3TFQA 3D3WB 1ID1A 1MG5A 1B3RA 1M75A 2Q46A 1MLDA 1P74A 4UEKA 3MTJA 1YOVB 5L4LA 1K6IA 3BA1A 3K31A 1RM4A 1UZNA 2YUTA 3GEGA 3QWIA 4J4HA 3EHEA 1VSUA 3W4JA 4RDIA 2EKLA 4UUOA 3CTMA 2BI7A 2VHZA 5HWSA 4FFNA 1YONA 2HJSA 5JDIA 1GTMA 4E12A 4ZD6A 2FRDA 4CUKA 3CKYA 2OL4A 3D1LA 3O38A 1KBZA 3VPXA 3ZV3A 4R1NA 1VJTA 5FWNA 4ZQGA 2ZCUA 5TSDA 4OJNA 3DONA 4Z3KA 1YQDA 2B37A 1I01A 1ZEMA 1QYXA 5A9TA 3GZNA 2QRLA 1B15A 2Q1WA 1PJCA 1ENPA 1HE4A 1Q0HA 2I65A 1GQ2A 3D7LA 3WG9A 4AJ2A 4F3YA 3F3SA 4QT0A 1OAAA 4CR6A 2H6EA 4M49A 3ZWXA 1L7DA 2R2GA 1LSOA 1MUUA 1OOEA 2ZTUA 3ITDA 4GX0A 4N18A 1LDEA 3LT1A 3FWNA 3AY7A 3U09A 1UDCA 3KUXA 5L95A 3F4LA 3UAGA 3OJLA 1NNUA 4WGGA 3KO8A 5F3RA 4A26A 1D3AA 5EERA 1F12A 4CQLA 5G0UA 3AOEC 2YHUA 3QRWA 4FJ2A 4L73A 1UH5A 4AJIA 1WDMA 2FP4A 3D3WA 2J3HA 2I99A 1YBAA 2ZK7A 4ZN6A 3VKUA 2Z95A 4NBTA 1Z7BA 1NPTO 3H9JA 1PJ2A 3KYDB 3DBRA 4MVJH 4XB1A 5DBIA 4BL5A 2VYNA 3GQVA 1MFPA 1YL5A 2UDPA 3NTQA 4XRRA 3HADA 3JTMA 1YB1A 1T2DA 2Y1FA 1YJ8A 2VWHA 3B1FA 3EK2A 4GAEA 4PLZA 3HB5X 4HFRA 4M87A 6LDHA 1ULUA 3RJ5A 5ENVA 4CM7A 3MJTA 4K9DA 1XQ6A 1LDYA 2IXBA 4YJFB 5L3ZA 2B0JA 3U4DA 2CY0A 3LZ6A 3DBHB 1GY8A 1HT0A 4UVDA 1R0LA 1PQWA 2I3GA 5JCJA 5IAAA 4WNIA 2PD3A 1DIAA 4QEDA 3FNHA 1F8FA 3IC5A 5I9MA 1O6ZA 4DIOA 5ITVA 2PKRA 1KC3A 2JKVA 3S2EA 3HUDA 3TFOA 3U49A 2NTJA 2I6TA 3VH4A 4JJFA 2DBVO 3I3OA 4FPXA 2PH3A 4RV9A 3RI3A 5IZCC 1ZXLA 4Q39A 5CDTA 4ND5A 1P44A 1BTOA 1WMAA 4ZHSA 4LRSB 1MC4A 1P1IA 4Y6PA 2JCVA 1EUZA 4YA6A 4D3SA 1AN9A 4JBHA 2X0RA 3TRIA 1DC4A 4KDFA 1DFHA 2C2XA 1RWBA 3HJAA 2GZ2A 1ZJZA 1XU9A 4N7RA 4NI5A 3KEOA 3T4EA 4DXHA 4BNJA 3RC2A 2WD8A 2IEDA 3QIVA 1VLLA 2J8ZA 3E9QA 1MP0A 3WIEA 4CLRB 1HDYA 1GZ6A 2ZB3A 4NK4A 1DIBA 1Y8QB 2GO1A 3JQAD 4GX1A 3QWFA 4YPOA 1ZZEA 4JN6B 1EVYA 3FBGA 4MO2A 3JD0A 3D0OA 3V1TC 4DC0A 4E13A 1X14A 3DFUA 4BO2A 3X2FA 1NAHA 1SCUA 1DRVA 3JD1A 1UZMA 4YJFA 4A0SA 1OC4A 2O3JA 4GGPA 4DYVA 4AJKA 5BNTA 5CPFA 1E7QA 4ND2A 2IXAA 5KKAA 4YB8A 2WMDA 1P3DA 3OA2A 5K6AA 2IODA 3NKLA 1HDRA 1LX6A 4BO4A 2A92A 2BKAA 3E1KA 4Y8VA 3L4BA 3HB4X 1K6JA 1P1JA 1MFZA 1E3WB 3AUUA 5EPOA 3CZMA 1A71A 4BKPA 3H2ZA 4CM4A 2G17A 4FC7A 4NG5A 3W8DA 5CG1A 4CLDA 2RHCA 2Y1OA 2BLLA 3OJ0A 1R66A 2C2YA 3BMQB 4YT4A 5HS6A 3H2SA 4XX0A 5U9CA 3KETA 3QWAA 2VNAA 1YXMA 4L76A 4RPKA 3VPFA 1B2LA 1UR5A 4INAA 1HLDA 5IN4A 4YR9A 5C3MA 2Q1TA 4CLRA 2LDXA 4EJ6A 4AG3A 2HQ1A 2GSDA 4K26A 2WD7B 1Y8QA 1KY4A 1HE5A 2WE8A 3AUTA 2LDBA 1NAIA 4XZ3A 4FFOA 2I9PA 5EIOA 4Y6SA 2WYWA 2Y0EA 1JN0A 4S1VA 3W4IA 5AOVA 3H9UA 4BO7A 3A14A 4E5MA 5DOVA 1Y7TA 1Z73A 5JDCC 2EWMA 5HRUA 3C1AA 1X15A 4K28A 2X23A 3JQGB 3IP1A 4G65A 4TWRA 3KZVA 3TOXA 1P1KA 3AW9A 4OQYA 4PZEA 5DBFA 1N92A 4ZU3A 4CR7A 1UDBA 3UH1A 5IZ4A 2WE7A 4LMRA 2RH8A 3JCZA 3R3SA 1M2WA 2Q2WA 3NT5A 2Y1EA 2BELA 1EDZA 1L1FA 1C1DB 1TB4A 1U7TA 3DZJA 5DCWA 4GI2A 4BIIA 4LVCA 4BNFA 3GAFA 1E3WA 5A5EA 3AY3A 1I8TA 1E1LA 3UUWA 3MWEB 3PIDA 3PHJA 4XYMA 3S2FA 1T2CA 2X9NA 3ASUA 5LCXA 4DUPA 4MVJA 2AE2A 1UUFA 4J49A 4LCJA 4O0LA 5T8KA 3BMQA 2EGHA 4N5LA 1SEVA 3PXXA 3ZHZA 2VTDA 2EKPA 5TX7A 2CVQA 1VE9A 5IDYA 1PZEA 4NZ9A 5HBRA 1UXIA 1FDSA 4PG6A 1NBOA 3M2TA 4WKGA 3GPIA 1DHTA 1UZLA 3MJCA 5JPIA 2J5RA 3RUCA 2ZTMA 3KEQA 2IYOA 5EMHA 3I5MA 3SJ7A 5CPBA 2DUWA 1I24A 2TMDA 4E2YA 3Q9NA 2CVOA 3TL2A 3FHLA 1IL0A 1EK5A 1V0JA 2OGUA 4MOWA 4O59O 3ZI0A 2HDHA 4BUCA 4XQCA 2BH9A 4U5QA 2DFVA 4JJIA 3EZLA 1KVTA 3JQGA 5EN4A 1BMDA 4OSOA 4IDGA 5K6AC 1EFKA 2EV9A 5I7SA 1NVTA 2AG8A 4J2HA 1QORA 2V65A 4ZA2A 1SAYA 3C7CB 4I9HA 1FMCA 2Y68A 3ANMA 1IY8A 4ZRNA 4IXWA 3QWHA 3QVTA 4WJZA 1C1DA 1R0SA 3GRKA 5HA5A 3LDHA 4MJLA 3VHRA 5A9SB 1GEGA 4IY1A 4DLBA 3JQBC 4BS9A 2XXBA 4D46A 3ZNQA 3WGYA 4CM3A 3C1OA 4KDEA 5G0TA 1HDZA 3S55A 4ZGWA 3RBVA 5KTKA 1U5AA 3ZNNA 3VPGA 2EP5A 3DWFA 1VI2A 1T4DA 4DBZA 1XG5A 4BNTA 3OICA 1XEAA 4WECA 3VKVA 4ALMA 5TNXA 1B16A 2H9IA 5L4NA 3K9QO 3HWRA 2ZQZA 3S2IA 4FOSA 2VT3A 1EUCA 1CJCA 1NFRA 3DBVO 3H6KA 2W2KB 2B35A 1ONPA 3IOYA 4H3VA 1U7HA 1UAGA 1DAPA 3CH6A 1KOLA 1E6EA 1GUFA 1R16A 4DA9A 3KXDA 1K5HA 5F1KA 4CQMD 3TZCA 3GUCA 5BSFA 4NFSA 1HETA 2X0IA 4K6CA 3G79A 4WLOA 4DLLA 3HE3A 1JU9A 2CF5A 3I9JA 3RFTA 2YHIB 4AJHA 1OC2A 4BOYA 5A9RA 3ZHBA 3Q2IA 4PLWA 2PZJA 2BFPA 3WQQA 4OIMA 1F17A 1BRMA 3FR8A 1ENYA 4KWIA 4YJDA 3ZWAA 1ZK0A 1HL3A 1DC6A 5JYDA 5KVVA 1DSSG 2BF7A 4WOKA 1EVZA 2NTNA 3DHNA 4D42A 4B4WA 1ISGA 4AJNA 1JW9B 4U0JA 4RPHA 1HYEA 1X13A 2XPCA 4OSPA 3DOCA 1JVBA 5IFLA 3I9LA 2AE1A 2HK8A 3IP3A 1DDOA 3SEFA 1WPQA 3G3EA 2P9CA 2G5CA 4RF4A 3GHYA 3ZW9A 4YDRA 4OQZA 4Q3BA 4RORA 5L7YA 1KETA 1DIHA 2YV3A 3ASVA 1I33A 4WLFA 3NJ4A 4PIVA 3DEYX 4Z9YA 2DKNA 2OZPA 2H5LA 1UXKA 1DB3A 5CEEA 2W90A 1HDCA 3HQ4O 4OOFA 1XDWA 2W2KA 1X7GA 1EBUA 2GZ1A 7MDHA 2O4UX 3S8MA 1B14A 3KVOA 1FDWA 4GLLA 3DZFA 5CDGA 1E3LA 1KERA 1SZJG 4NH4A 1G6KA 4FN4A 4F45A 3SJUA 2NUAA 5DOZA 4E5NA 4RCVA 2ILTA 3K30A 3I6IA 3PZBA 3GK3A 1WVGA 2IRWA 2CDCA 4DL9A 4XWYA 4OKNA 3ZU4A 2E6UX 4KUEA 4DQXA 4BNIA 4O5OA 2CNBA 1IE3A 5ER9A 5U4QA 2NSDA 2Q4BA 3E6AA 2VOJA 2I67A 3CINA 4YRDA 2GDZA 3ZHYA 3JQ7B 4OGWA 3I9MA 4TRMA 4GGOA 1I0ZA 1WDKA 3RFXA 4L4SA 2V6MA 1W4ZA 1IULA 2G1UA 3EMKA 1X7HA 3TL3A 1H2HA 1PL8A 2P4QA 3OETA 4R4JA 3F4BA 3NRCA 2WEKA 1ZSYA 4WEOA 1E5QA 1BXGA 1DPGA 1H6AA 4RPGA 1XKQA 4EGFA 4B4UA 3DTYA 4MVJI 1MX3A 1H93A 2HMVA 1Y9EA 5EQDA 1HZZA 4OHUA 5AXBA 3E5RA 4QXMA 3KLMX 3PFFA 3LU1A 3VZSA 1NPYA 4AVYA 5I7EA 3F1LA 1E6WA 2D4AA 5BSEA 4E33A 1KEWA 2H63A 2J6IA 2NLOA 1ADFA 3DQPA 3RU7A 5JFOA 4J7UA 4IIVA 5BNFA 4GPD1 3MOGA 3I9OA 3A4VA 4M89A 2E4AA 2DVMA 3VDQA 3G49A 3WMWA 5B12A 1N1EA 1G0NA 3ZDFA 3K73O 5EINA 4BKOA 1U2DA 4F6CA 4XD2A 1O8CA 2BFMA 4CMIB 4FQ8A 4JP3A 1MV8A 2UUOA 2PD6A 3PQEA 3VVBA 4AJLA 4JCOA 4KQWA 1SO8A 4CMHA 1I2BA 2CVZA 2Q2QA 3BYZA 4RVFA 4QQRA 4MKZA 2EG9A 3L07A 3RUFA 1A4IA 2FPPA 2BGKA 2BMAA 3C3XA 3GGGA 2O3UA 1Y5MA 2FWMX 4EBFA 3GGOA 4I1IA 3KLPX 2EKQA 2OO5A 1CF2O 5JO9A 4UEJA 4ROSA 1GYRA 1LQTA 4TZTA 1JWBB 2H1SA 3A9WA 3A06A 1GYPA 4RVDA 5ICMA 3PYLA 2YW9A 3VC7A 3L9XA 1P33A 4KTVE 5B37A 1ZK3A 2QYTA 3JD2A 1V3VA 3ITKA 1LQUA 1V35A 2EW2A 4O6VA 1LLQA 1AGNA 3GVXA 4NNJA 2ZB7A 4FFPA 3VTZA 4OAQA 1QR6A 1OMOA 4OL9A 4CLOB 4HBGA 4QECA 2UYYA 3KOUA 2ZCVA 4R41A 3AOGA 1U9JA 5CEJA 1JWAB 4FIZA 4WLNA 1ADGA 5LDGA 1VRWA 1ZK1A 3D5QA 5I8ZA 1CETA 1EVJA 1LRLA 5CHEA 4MVJP 3FI9A 4IXTA 4KMSA 4A10A 1BWSA 3K5PA 3JQ9A 3EYWA 1DJNA 1SOWA 4PN3A 3GT0A 4RGBA 5DF1A 1E1NA 4IDBA 2AEJA 4TZKA 5G0SA 1MA0A 4R9RA 2HAEA 4J1QA 3RD5A 1T1RA 3HN2A 5A3JA 2Q2VA 1AXGA 4OXYA 2JD0A 4II3A 4YJHA 3O4RA 2O3QA 4B8ZA 5AVOA 5JNLA 2IZ0A 3DBLB 4RZHA 3AOEA 3CE6A 4CV0A 5BSHA 3I83A 2E82A 2FPIA 4CUZA 3OIGA 4GVLA 4W99A 1T2EA 4NMHA 1ISJA 3OBBA 3PDJA 4PLFA 3JSAA 3V2HA 3SC4A 4J43A 4YWJA 1AHHA 1U3TA 3F6YA 3HSKA 1A5ZA 5DCUA 1N2SA 3W6UA 4K6FA 1VSVA 4UEOA 2C20A 4CLOA 4XEHA 2GCGA 3UCFA 3WQRA 3QVSA 1YL7A 3C1TA 4ZQEA 4EJMA 4DRYA 3BIOA 1OZAA 4J2OA 4R9SA 4QO8A 3WQSB 3ZNOA 1M6HA 4OO3A 1U3WA 3KRTA 4UAGA 4L8VA 3G1TA 3WR5A 1ZJYA 2RH4A 2BFAA 1VKNA 3OH8A 3HDQA 3DZKA 3NTOA 4D0RA 2QRKA 2PZLA 5K0ZA 4NBRA 4D43A 1M6WA 4BB5A 2CFCA 3DB2A 4FFRA 5IZCA 1LXCA 2JAPA 2Y66A 4ZQHA 1NWCA 2ZATA 4AICA 4BNWA 2DPGA 1P9LA 3H3FA 4CQLB 3M1LA 4RF2A 1D1SA 1EBFA 4BGIA 4E30A 4I9NA 1E7SA 1YB5A 1ZSVA 4UVIA 5B1YA 3DBLA 4ALJA 4RVSA 1JKFA 4BQRA 1R4NB 2PGJA 3V5NA 4XCVA 1OFGA 3PWZA 3CIFA 3SXPA 1H9AA 3DBRB 4XR4A 3RUIA 3NT4A 2W2LA 2YZ7A 4R51A 2EW8A 3CUKA 3WGQA 3AM5A 2A35A 3DMTC 3ADOA 4IQ8A 1N8KA 1Z6ZA 3M1AA 4MIOA 4J4TA 3AFNA 3CPSA 3H9QA 3ONFA 4A5OA 2VT2A 2R00C 1W6UA 5DZSA 3ZWPA 4PVCA 4RZIA 2XAAA 2NVBA 2RAFA 4BHTA 1XCBA 5BSGA 2CSUA 4M1QA 3KM0A 1N5DA 4NFHA 5C7IO 2NV6A 3JQ9C 2JHFA 2GR9A 4XGNA 3WLEA 2O3RA 4J7XA
chains in the Genus database with same CATH superfamily
1VCIA 1WEHA 5K8CA 2UV8A 4TTTS 3CZCA 4M8IA 1U2SA 2GJ9A 4LDAA 2WHRA 3CLKA 1PKXA 3NT2A 1RLIA 3D3EA 4IZHA 1FYFA 3D6JA 2NUPA 4Q4HB 2V6FA 3BGVA 3IMKA 3SKXA 4ZYTA 5JAOA 3QPAA 1EQAA 2RGBA 5BN3B 2ZBPA 3C3DA 1TM5E 2NSHA 4ZJPA 1Z0SA 4HVLA 5JECA 2QTZA 2HRDA 1E7RA 5C31A 2EFJA 3AKDA 4QBTA 1NVEA 1HKHA 1X8JA 3BWBA 4IHKA 1HPLA 4CKYA 4Z5XA 2V45A 3P9KA 1SHJA 4YAWA 1IY2A 5K05A 1YKFA 5LXTF 1PJ4A 1ZGJA 2X3FA 2BPOA 1L3IA 2F00A 4KXVA 1LWOA 3D3KA 3KP1A 4EHDA 5A6VA 1CNMA 1C0LA 1PT9A 1Y3AA 2VBFA 3L0PA 4AY5A 3PWKA 4CIDA 5HE9A 4F86A 1U1DA 1P4GA 1J1IA 4HH3C 3TQCA 1Q3HA 2VDUE 3LH5A 3TIGA 3UATA 1R4NA 3G2NA 2YTZA 1N2CE 1CIPA 3IQXA 4LC0A 1T15A 4DJJA 2BUBA 4FXOA 2I1WA 2J9XB 4RA9A 4H7HA 3UQYS 1JHDA 2I33A 4GMDA 4WUTA 2JLVA 4M36A 3LC1O 1XRPA 3JR7A 2WJWA 1A82A 4HGZA 1V6CA 1JTVA 3CF0A 2EWVA 2QY9A 1GCUA 1M1ZA 1KFJB 1KORA 2Q6TA 4EW3A 2PN1A 3RAFC 1RQXA 1IBRA 4XI9A 5K51A 3HFGA 5EJ9A 2Q3LA 4W5TA 1EFVB 2PBLA 2QORA 2QSJA 3FDXA 1Y4AE 5CDHA 1D04A 1OTXA 1L5FA 1OWMA 1CKEA 1QRRA 2EFGA 2H4FA 2WTAA 3CX4A 3EXHA 2HO4A 1MOQA 4O8ZA 3ZW7A 4ZCMA 1ODIA 2FLKA 1SVWA 3OTQA 4FCWA 3FSRA 4JT2A 2QQEA 1G2OA 3QLTA 4INJA 1JEAA 2WI8A 3MBIA 2HLPA 3TNFA 1L5RA 4KYUA 3K0BA 1P1CA 1TVMA 5AYVA 5DX8A 1KJ9A 1I14A 5K01A 1PWXA 3CLUD 3F5FA 4CM4B 4U2BA 2GN1A 5EP4A 3Q98A 1R0CA 3GT4A 4BB6A 3DDZX 4EKGA 2ZUSA 3IKTA 5C5EA 4FD3A 4MPDA 3F74A 4WAUA 4X7MA 5L9AA 1U2GA 4ILKA 5ILQA 3LQKA 3L1JA 2ENUA 4US2R 1AN0A 4AKGA 4EG3A 5HOQA 3LV8A 4IKEA 3QHAA 2B1QA 4G09A 2HIMA 2AMLA 4FNMA 4E94A 1G8AA 2OG1A 1UMKA 2X2OA 3IR6A 4IZIA 4ZVTA 1BGWA 1E59A 3RT9A 2BFEB 2ZJ2A 4P22A 4TM7A 1X1QA 4BN4A 5FEUA 1IAVA 2MDTA 1A7AA 3VKGA 1MN6A 3GGJA 2NZXA 3LUFA 4DLVA 5TQ0B 4X6UA 3RIGA 1XKLA 3IV9A 1RACA 4OU4A 5ICSA 3ZY6A 2BW0A 2DT5A 2ZYVX 4CG1A 1MABB 4LQ4A 3UC9A 3P4YA 2X41A 5DLPA 2ZQYA 3DZBA 4J7CA 2XDYA 2TMGA 2GK3A 4XIJA 3RVMA 1X1CA 1KA9H 1QIHA 2IY9A 2O1SA 3MIIA 3OE1A 3L02A 3OZDA 3GJQA 4PLYA 4AURA 1I2CA 3EOAI 3SBOA 1RAEA 1B6GA 2C4UA 1JDTA 5ERXA 1TEZA 4DA7A 1FYWA 4MTLA 1VHQA 4OQFA 4DM3A 2EYUA 3QEBZ 2O06A 4WL0A 4JSYA 2O8BA 1HNZB 4KIJA 1CDDA 1S0UA 3P0HA 1JDUA 5KSWB 2C97A 1XMJA 2RKBA 4F4FA 1KHTA 5HK9A 3BD9A 3S1LA 5G3ZA 4BNMA 3EXG2 1J5PA 4PQGA 5F5NA 2CXTA 3MWJA 1L8QA 1QR2A 3JQBA 4W4TA 2ZGVA 2VPZA 5ALGA 4FGJA 3L49A 5CA0A 1V7CA 2VXBA 3Q2OA 4WD3A 1PGQA 1NR1A 3QE3A 1U1CA 3ZCVA 1USWA 1YR2A 4Y2XA 3JWEA 1EM6A 3NHFA 1P9NA 1NNI1 2JCXA 5JT1A 2HA2A 4R31A 1H69A 1KEEB 4O29A 4E21A 3EZ7A 1FSGA 5JRJA 2VP4A 4LFCB 3A11A 1OLUB 4S0ZA 4DRXA 1CVIA 4LGYA 4DJ5X 1XTRA 4BJ3A 3OJWA 1MT0A 1RI4A 3OJCA 4JVMA 1AURA 2VYVD 2VSOA 5B55A 4WV3A 2DSTA 1YQXA 3ASZA 1FJ2A 4GU5A 3ZWBA 4I8DA 3CG4A 4F8JA 1A96A 2QLTA 3RC3A 4D4JA 1DJQA 2HPVA 2BZSA 4PZYA 4AKIA 2QX7A 4INZA 4CLHA 1D8AA 4DVJA 1GADO 2HJWA 1OJ7A 3IQDB 2B98A 1LC0A 1XTUA 2C5HA 1UEXC 3MINB 4RPJA 4E07A 5H4GA 3JS5A 5FYQA 1EQ2A 2FQXA 1PUIA 2NZWA 3DVQX 3I5AA 3NTLA 1PTJA 4IMIB 4D56A 4EW1A 1BIFA 4HWRA 1K92A 2V7UA 1LTKA 2Z5LA 1UBNA 2HBQA 3TG8A 4YT2A 1QIFA 4U2CA 1NP3A 1PGOA 2GBIA 4KNWA 4ZVNA 4JJAA 1TKBA 3GOHA 1DLIA 4DCMA 1H3NA 3OU2A 1SUSA 4KGDA 1BDHA 2PMCA 4M9UA 3T0IA 4FYIA 4UCQA 1XU7A 1Y80A 2GBFA 5ECWA 4B7AA 4E70A 1RQ7A 4NSNA 4RMGA 4UM7A 4Y6RA 4AN1A 3ENVA 3DG9A 2GJSA 1XK7A 2DWQA 3L84A 4Q6WA 2NSLA 1B43A 3DFKA 3UVEA 4TSKA 1TUGA 1N7IA 1E9FA 5ENDA 3QUQA 4HQNA 4YMSA 3RTDA 3O9ZA 3HVKA 3QX3A 2Y2VA 4FCTA 2G0AA 5IUNC 2ACVA 1W9HA 2G9ZA 3DWGA 4EG7A 4YCBA 4GL2A 3GFPA 1W85A 2Y4NA 1JDZA 3IDAA 3Q3HA 4ACBA 1ESDA 1G20E 1YH3A 3T7AA 3B1ZA 1GM5A 4JS0A 1UXGA 4IJ5A 3FVVA 1MRNA 2CXNA 3I04M 1YDWA 4MYUA 4ZEOA 2HZ7A 5JS6A 2OK8A 2Z56A 1K5DA 2I1QA 2R6AA 3GMIA 4YRLA 2XCLA 5DHUA 2FZCA 4QBIA 3T34A 1R74A 8OHMA 1CR2A 4OXNA 5BN5A 4X8OA 2WSIA 3RHTA 2ZTLA 2ZBGA 4E1AA 4D74A 1QO7A 4GYKA 1QFXA 3L77A 4GZ5A 2NMVA 2I1VB 3U3KA 1YK1A 1EVIA 3JRNA 1PK8A 4LXHA 2FPSA 1C4OA 4BO3A 5HQTA 1E94E 3TGLA 2PRKA 1BE0A 4RAQA 1VIVA 2NVUA 2YRXA 4X6YA 5J2UA 1XL1A 2C9OA 4EYEA 3U6BA 4BV9A 1FUEA 4EQ6B 1WXHA 3BGIA 3U7HB 1ZR2A 1CERA 4IXNA 1KYWA 1P2VA 1P5ZB 1YZFA 2PIDA 1SOUA 1W0KA 4X90A 4K9LA 1KJZA 4R1OA 4HB4A 4BQEA 2X0KA 5ARCA 2YCLA 2XXAA 1CYEA 2QMZA 4JJZA 1GZSA 1N6NA 3F47A 1MKYA 3B2QA 1NKTA 1JLMA 4P38A 4QXAA 2D59A 3RASA 3FDFA 3N86A 1D2GA 1JEYB 3NVKI 3OZBA 4QFCA 4ZOCA 4YJKA 3KJEA 4NJMA 4BLWA 3QKSA 3T5PA 1Y1TA 4AZTA 2CVFA 4I3FA 4EL5A 2F59A 1IXSB 2PD4A 3ABIA 3OCWA 5AUOB 3SPXA 3N2ZB 1C14A 1YOBA 2H5EA 1KYQA 4H18A 4HWPA 1PT6A 3ILHA 4KTTE 4RVHA 2VPYA 1KIMA 5DYYA 3T5BA 1JBQA 3DDCA 1P0FA 3LUAA 1A5BB 4PZDA 1I6LA 1Z2CA 1ZICA 4DMMA 3U60B 2A1TS 3II6X 2LBPA 3FTEA 1NXOA 3F3KA 3N9IA 4MLZA 2P9YA 4BMPB 2ZTSA 2NXCA 2YMLA 4A03A 2FE4A 3OQBA 3PA6A 3O84A 4NFLA 4IWXA 3E7DA 3UBMA 721PA 3EFHA 1XT6A 1PLKA 2CDBA 3CMCO 3IBGA 2GASA 3SIXA 1WTAA 4JI3B 2JCBA 4CU2A 1M76A 1QDLB 1VPWA 5CFPA 1DAIA 1OFTA 5EHIA 2DTXA 3OJXA 521PA 3WXBA 2J67A 1SD1A 2ZBQA 2JHPA 1RYHA 1A8UA 2LUOA 2V7QA 1U7WA 3PI7A 1TZBA 1CQPA 2ODBA 2V0NA 1QVAA 1VE1A 2ZJZA 3MLBA 3VDRA 2CF6A 1YZLA 4OV6B 3I1YA 2H4JA 4ZYXA 2ZJ4A 1KIFA 2ORYA 3MEQA 1XLWA 3OJFA 2WF6A 1PS8A 1L9KA 1PJRA 3OCVA 3GUYA 4O2BF 1BVRA 1U4OA 1RZRA 1SHZA 2XLBA 3DHYA 2V55B 4PRZA 3GEMA 2J4DA 1FFAA 3H7AA 4IINA 1U9CA 3VV2A 4RYDA 4AULA 4ZTUB 1YI1A 2G8NA 4NJOA 3WS7A 2JGDA 3FPGA 1TMOA 4OQQA 1BXGB 1NDUA 2O3TA 4ARVA 1A7UA 5BRAA 5EKTA 1NC3A 2Q28A 1TKCA 3AWDA 3C4VA 1T91A 3M7IA 1LTHR 4WESA 3QOXA 3SK0A 3SGLA 4AMGA 5ARBA 2FWBA 5KTRA 1SXHA 2K2QB 3DAHA 4ZVSA 3TM4A 3GLQA 3SF8B 1VLHA 2DULA 4C6HA 4QJ4A 5EPEA 3VNRA 4OQXA 2VG8A 2J5BA 3MCVA 4FC6A 1OB5A 4MW2A 4E6PA 3TO5A 3EEFA 3L18A 4A36A 2HL6A 4K40A 5JNVA 1FQJA 2POQX 4JC8A 2J4FA 4LOLA 3ZKWA 4GZLA 2O50A 4LHVA 1BC5A 3IR7A 3D6FA 5JV5A 3OUZA 5AH0A 1WOMA 1Q14A 2FFBA 5F2EA 4Z0HO 4LYEA 4M98A 3EW9A 3AFHA 3L8EA 3ZH2A 2QTTA 1P1HA 3HJGA 4I1RA 4JJ4A 2C5BA 2MSNA 4FGSA 1IY9A 5K8VA 1Y7IA 5FFFA 5I9SA 2W58A 3TZLA 4CLEA 3ZWYA 2B9EA 1QE3A 2C9BA 4Y2PA 2C1ZA 1KY3A 4J0FA 5KYWA 2HKIA 3SX2A 3REOA 3CA8A 3I73A 3BH7A 3GLVA 1SFRA 3MYRA 4GBMA 3RKSA 3TOZA 2FGKA 5DM70 2PIAA 2FUEA 3FTPA 4QFBA 1RWQA 1BDMA 1FXWF 1ZI8A 4N4AA 4E5SA 1H4QA 1AKVA 4JBWA 3KB6A 1BJRE 3R24A 1NFQA 3NWOA 2C29D 3QP9A 4IGFA 4MGYR 1K9VF 2WU8A 1HO3A 1TAUA 4P3KA 3QNUA 1B74A 3RW9A 4FW9A 3Q1LA 3UV3A 2XD4A 2VYQA 3R7WA 2PXHA 1RYEA 4WSOA 2UAGA 2PSEA 1NQ5A 2PUEA 3LLVA 4KOAA 2PY6A 2IX9A 3AIIA 4B73A 5JY1A 3MQFA 3PNMA 4TWAA 1HE3A 3KK0A 5GP1A 5CFMA 1GKYA 1UPTA 2X2PA 4JH0A 5IG2A 5JROA 3A6FA 3O4JA 1V4NA 3T8YA 2CL5A 5IT5A 4Z1MA 1EU1A 2FN4A 4LRXA 2Z98A 4JX8A 1LFAA 1X1DA 3DMDA 4MS1A 1TF5A 3SHTA 3A31A 4FN5A 3QFFA 3U3ZA 2N9UA 1M7GA 3VO8A 3PC2A 1FP7A 1WQ1R 2HBYA 2P2ZA 2WFAA 1I5OA 3FUTA 4G26A 4MCJA 4WN9A 4MA5A 2F2TA 3B38A 3DL7A 5EWJB 4BLPA 4IS3A 2OCAA 2W98A 1QU3A 2OBYA 3LE8A 3TLXA 1V3TA 4HYQA 4XVQA 2PFKA 3OT1B 1TA0A 4IEFB 4XLZA 4ZRMA 3J7AC 2X0EA 1Z8HA 1OZFA 5B2FA 5JHGB 3JARB 2GO7A 3O8DA 3FSEA 3Q7PA 121PA 4QLBA 7REQA 1NHWA 1R6BX 4G6ZA 4HAOA 4ZAGA 4BEJA 2ZJ0A 2BBSA 4PWYA 5JCXA 5JC1A 1TO1E 1UIRA 4L5AA 3U5ZB 2FFHA 2PNJA 4C2BA 1G21A 4XQ9A 2BEVA 3MJ4A 2QRNA 2JH9A 2WWRA 3JW8A 4GPIB 4I8IA 5K8UA 4G24A 2G9NA 2P9EA 2JAQA 4UAVA 1N32B 2F90A 1QGAA 2FEXA 3BD6A 4MK4A 1F1JA 4M1TA 4KLZA 1XZFA 1MQ8B 4MV5A 1H5NA 3EG5A 3ANYB 4Q34A 1XRRA 4UE6A 5I7VA 5T5QA 13PKA 1NKSA 3M1IA 3LF1A 1M9NA 1CZNA 1HE1C 1HYHA 2IPLA 3DOJA 3JQAA 4HFJA 4GQBA 1OCEA 2D0PB 2V1XA 3W06A 4TVBA 5IXYA 3WL3A 4DSNA 2A3NA 4EHNA 1UF9A 3F8WA 2FSUA 2R6FA 1QFMA 3IRVA 1A8IA 3VR5H 3MGKA 3VHQA 2DUUA 1XR3A 5F64A 4CL0A 3PR2B 4ENVA 1M5RA 1OFHA 1X8XA 1QLJA 2C59A 1WZUA 1CPYA 3E22A 4Y2VA 4C43A 4FB5A 1T24A 1A8SA 3L7LA 3LS2A 1XHEA 3LT5A 2EBFX 5D5QA 5M2QA 1IZ8A 2H92A 2ZWIA 1H3EA 1DZ3A 2A0KA 4MIEA 5KYXB 1Z7WA 3QELB 4FNAA 1W5TA 4QUEA 1A27A 3I4FA 4HOYA 1NJ1A 4WBXC 5CJJA 4XLLA 5ITSA 2OFWA 2HA4A 2P5YA 2E4XA 3N5KA 2D3TA 1H2YA 4HN2A 1I4TD 1PR2A 1PSWA 3GIWA 4KQ9A 2VQFB 2I76A 1WETA 1ZA1A 4NEGA 3DAGA 3RFVA 3NTVA 1YL6A 1D4ZA 1UJNA 2HNBA 4R40A 5FBVB 4MUFA 3NVMB 4TV8F 1ID8A 1NXPA 1XUOA 4S05A 1Z88A 3OLYA 4RF5A 1OV4A 4IMPA 5A6SB 1L8LA 3KFLA 2H52A 3WJAA 2BMEA 4B84A 4AWBA 4C0KA 4GZMA 3R2JA 3BTVA 3NAGA 2I2XB 4BO8A 5HS4A 1CTQA 1SUAA 3C70A 3RM3A 3PB3A 2M2IA 4DIMA 3HKCB 4LSWA 4QDJA 2M6KA 1RWOA 3UXYA 5ADHA 5IT9A 3UGKA 1OLXA 1YVUA 2F67A 4TS4A 1LF0A 4OHOA 4EDHA 4FKBA 1CY8A 5EJ6A 1H9CA 3EPJA 4UTVA 1NRXA 1CQIA 3OIFA 3C3AA 3D43A 2ZPUA 4WASA 1IPEA 2WJYA 3GF4A 3QIAA 4W5RA 1WX1A 1IVYA 3R0JA 3OKPA 4B3JA 4IJUA 2NQTA 2G70A 5EXTA 5LWHA 3QWBA 4DG9A 1PJBA 2G9UA 5LNK1 2C4HA 3QU9A 2GJAA 2HYIC 5AJWA 1QWSA 2WUVA 1DLJA 5ALOA 4HAIA 3MBKA 4K8OA 1PSDA 2A88A 2PUBA 2AW5A 3USCS 1G0OA 1ZMOA 4OJYA 4ZVKA 1E9DA 2IEIA 5DWQA 3FUUA 3D6UA 4B35A 4EATA 3MD0A 4CF6A 1E6KA 3TLCA 1LJLA 3C5WP 5C8YF 3IUPA 3ZK8A 1A98A 1ESEA 2G5TA 1KI6A 3CWZA 1EDBA 1E1DA 1L0BA 5IAJA 4TYNA 1Q3KA 1EX1A 1OX4A 1YKGA 1W5BA 1FTSA 3CLUC 4FDUA 1IN1A 4G4SP 2ZTHA 2C03A 4RIHA 2ZDGA 4D0GA 1H8ED 3W04A 4Z3OA 5LMNB 2ID8A 3DE5X 3DOFA 3COPA 1NA5A 2GPBA 3K4HA 1KAQA 1RS0A 1FA9A 1OAOC 2POCA 4ITVA 4K7JA 3WWOA 4MQBA 4DSTA 4EG1A 4ETNA 1RSZA 3ZU5A 3LT2A 1JQJC 3JV7A 4FMPA 5HTKA 2QTFA 4DLTA 1G16A 2IHJA 3JAWB 2O57A 4N76A 3L7KA 1Y5IA 2PS0A 3H3JA 9LDTA 1JPUA 4RTJA 3GGSA 2QUHA 2PQ0A 3MMSA 4KBYA 4QKQA 1SULA 3HCDA 2PR7A 5GZ6A 3AINA 2WTBA 3H9GA 3NTUA 4ENTA 3L05A 2GZRA 5JAIA 3FPEA 2IGBA 4BNYA 2D8MA 3HB7A 3IBFA 3H0CA 2AUMA 2A6PA 1JFSA 1Z5ZA 4MVCA 4RSRA 2WWVD 3ZN2A 5F12A 1GGJA 2GHQA 1TF2A 4GI3A 4PZCA 4NU5A 5L6MB 3I42A 2KBEA 2UZAA 2ZI4A 1POXA 3WKCA 2OMEA 1JQEA 1W2WB 3HM2A 4UNQA 5AIBA 1HSOA 2W6NA 3UANA 1JDJA 3IIIA 3BFKA 2EXXA 3RR2A 3WL5A 2RGUA 3BFXA 4C78A 4EJSC 1GA1A 4DV7B 4HZUA 3PHLA 5I45A 4HV4A 2A2ZA 3Q3CA 3DHVA 4U5XA 5IJZA 5CK4A 4G1CA 3AVVA 3K70B 4MTCA 1ARZA 1MC5A 3PF9A 3L6EA 2AOTA 1YWGO 3FOAA 1JQDA 3RG2A 3UT5A 4RA6A 1YZQA 2PGXA 1PR9A 4QU8A 3PI6A 4CF3A 1DAEA 4TQ9A 4B6QA 1TT5A 2YFQA 3OP1A 4S1NA 1L5ZA 2JDID 5LZ2A 1YR3A 4IYJA 3T1OA 1AXEA 3COZA 3UMFA 2JI4A 3BS4A 2Q45A 5F73A 1WWKA 3JQFA 3VJKA 4W6ZA 5LMZA 2HK9A 2YUIA 2RHGB 5FPHA 1QF6A 3KKMA 4TMKA 3AERB 1FK8A 3WHLA 4KIFA 2O0JA 1XC7A 3L46A 4MPRA 1PZXA 2PBRA 3R4VA 5JSZA 3E3OA 3AEKA 4I1YA 1FY2A 1KJYA 3HN7A 3LIIA 3OOSA 1Z35A 4YMLA 5CT9A 3BMNB 1II8A 1MB3A 3A4TA 3TRJA 4F56A 5KREA 1F14A 1XMIA 3P0RA 4I50F 3DMGA 2A8YA 3D59A 1CUDA 5G4KB 1YZNA 5CB4F 1HWYA 4KIUA 2PO5A 4JENA 2ZB8A 4GM0A 4RESA 4CN8A 2I8LA 4Y6QA 4Y9DA 2VTBA 4M7OA 1MTZA 5JS7A 3IQWA 2OXFA 1ULBA 2XODA 2O8DB 2OCXA 4GP9A 1L5HB 5HSGA 4TTPA 2BBTA 1M1UA 1BMFD 2C5GA 1A97A 3A6EA 3EXEA 3OECA 4AY3A 4BVEA 2GF2A 1PJQA 5TC4A 3TW6A 2GHRA 5KNCH 2YV4A 3LHDA 4R5MA 3OZEA 2WWFA 3O31A 4JOQA 3OP4A 2CKDA 1AY0A 4OHCA 1CUCA 1L7QA 4PC1A 4PLHA 3L6OO 3QV1A 3WTBA 4PNZA 5EZSA 3ZDQA 4FT4A 3RT7A 3WC4A 2ZETA 2HX1A 3L93A 5IM4A 3S44A 3T35A 2FPWA 3HI4A 4PR3A 1HLGA 1FFEA 1NBEA 5JQGB 2G08A 4N0DA 2XWPA 1XNHA 2WF9A 3HDJA 4MUKA 3ZQ4A 3ZV7A 5FADA 1N2EA 3O8QB 2NN3C 1MNAA 1J0AA 1SBTA 3WL7A 1GTG1 4LRQA 4BFZA 1F0YA 4R01A 4I08A 2PX5A 4Q7JB 4R7TA 4ARSA 2VK8A 2FCAA 3PIIA 2RHLA 1U1GA 4YJGA 1UK9A 3NBUA 2OEPA 4A8PA 5K2OA 1JG2A 2YY5A 1U0HC 1J39A 3T5GA 2OZLA 2FSGA 3ZEIA 3W3AA 4MYTA 3UO8B 2Z2XA 1QMGA 1UAYA 2AKAB 3DLIA 5J63A 1Z56C 2BMJA 3K9NA 5ECDA 3FWHA 2Y1WA 4FSXA 1XN1A 2AN9A 3SP1A 3WMFA 2O1XA 1SZDA 1G6Q1 1ZJ5A 4U9IS 2RJOA 1YRBA 4QODA 1ZOOA 2G4VA 2I87A 2R8YA 4FWIB 3NR2A 4REMA 4JI4B 5CDYA 4PRKA 2QZ4A 1RMYA 1J22A 1T5OA 4UDXX 4D45A 1M66A 1KMHB 3FFXA 4YO8A 2D1QA 1JP7A 3FFTA 4K9PA 5LXTA 4U7DA 1P4RA 1XN4A 1G3QA 2C9YA 2JGLA 5G0VA 4B8WA 5JARA 1XCJA 3K3PA 1SCIA 2XT0A 3IVGA 5JLAA 3IIEA 3P9RA 1V26A 2DFDA 2IBSA 3SU8A 4NICA 2X9VA 1ZGHA 1JHUA 4H7PA 5BR8B 2AQHA 3BORA 1CY0A 1Q1NA 3RV3A 2IGTA 2WWXA 1XAIA 3EGDA 1Z13A 3WHPA 1M2GA 2JIZA 5B7GA 4H4DA 1Z62A 5GQSA 2A94A 2VJPA 3ORYA 4LA4A 1OYYA 2VT7A 5SY4A 2VF2A 2X9GA 5KSPA 3ZV6A 3A36A 5JO0A 3AM3A 4YP9A 2R6R1 1WZCA 2C31A 2Q4OA 4B4OA 4UC0A 1N6OA 4R8MA 1VBKA 2GD6A 4E4RA 3IJPA 1XZEA 3M8KA 5BV0A 1HGXA 4P4LA 1SRQA 1Y8RB 3T52A 1GA4A 5ESDA 1V5IA 3SLGA 1ZH6A 3BK7A 4HP8A 5DI9A 4B6RA 3L0OA 2JFBA 4G56A 4GOND 2BSAA 4KFTA 4ONEA 1RR6A 4IOKA 5CXSA 4F1WA 1Q74A 3OIDA 2WR8A 3A0UA 3M4JA 3FJYA 621PA 3NMUF 1JMYA 1ZRNA 1ZNQO 5K0NA 3UJAA 4DMGA 1U1IA 3GUUA 3I23A 4BMOB 1M2FA 5ED4A 3KKQA 1XDGA 4D5GA 3I92A 1TZKA 1GV0A 4QBGB 2BMWA 2HBRA 1CQJA 3HMKA 3BJRA 3ZGXA 2FOIA 1J09A 1OXKB 4WCFA 4B46A 1THTA 3TXYA 2Q3FA 2HREA 2BONA 2VHXA 5LDHA 1X80A 3HGQA 2GEBA 5EP3A 1ODJA 1XRMA 5AHXA 1GCAA 4NATA 1RXWA 1W19A 3QU5A 4N7MA 3WRWA 1VJGA 2WVHA 2HCTA 3KZMA 1WUKS 3LC2O 3ICPA 1U5BB 1FJHA 2GD1O 1TZ2A 3PIRA 1SJ9A 2IKQA 5A62A 2CCKA 2Q07A 4JUCA 4DVGA 2GUGA 2HF7A 2H1LA 5CVTA 5CH5A 1LDBA 10MHA 3A9UA 3MQ4A 4QUHA 4BP1A 1K0UA 3Q5DA 3EFOA 2OK7A 2XE6A 2VAMA 3L8HA 3O8NA 4IVPA 4PFKA 5FYDA 3WLFA 3UXEA 3AHJA 1Z82A 4EZIA 1F48A 4ARIA 821PA 1QB8A 4LGVA 2NNWB 1ZOLA 5KMGA 3UWOA 1ND6A 3A26A 2VP5A 3Q4GA 4FHGA 4GKBA 1LA2A 4R69A 2IWRA 2ISSD 3W0LB 4QDKA 4N12A 1U5CA 4LJ7A 1X7DA 1J00A 3QQPA 1C0PA 3DE2X 1T0BA 3LP5A 3LSYA 3QE4A 1K0FA 4YT8A 1C8KA 3RUPA 5LR6A 3GC6A 4EJ0A 3KT8A 2AWOA 4LI0A 2QNIA 4URFA 1KDVA 4AZ3B 1UFKA 3WWDA 2CJPA 4Q5IA 1K06A 2DB3A 3TLBA 2ADFA 1RD4A 4ECAA 5L45A 1TMYA 3HNRA 3TPZA 3OOEA 2VJLA 1WNTA 2XUKA 3EF0A 3SHFA 4ESOA 4MR9B 4IICA 5FOTA 3ER9A 1T2AA 1Q16A 2WIJA 4UBMA 1E0KA 1PI3A 4AU1A 3H4VA 2PQ2A 2GGSA 2B8WA 2Y99A 5F4BA 1QCDA 2VK2A 3F6CA 3H5TA 1J5EB 1JHAA 1AF4A 4QSMA 5FI5A 1GXSA 4E5UA 3X1DA 5IVPA 3GFSA 3RQSA 4MHOA 2CXPA 2E37A 3ICWA 2NU6A 2AX3A 3AIOA 2ZZKA 2HMUA 1R0BA 2NYVA 2W9XA 4Y9RA 3L8GA 4C4ZA 1PWYE 3ORFA 1QHIA 4ZXFA 1IZ7A 2CYAA 3W9BA 1J7JA 1G291 1QQ6A 2JFFA 2WY2D 4L4UA 2WWTA 5D5HA 1IBMB 3MWDA 2R7LA 2VKTA 1SXJE 4GBJA 4RVOA 1GOTA 1WLYA 3EZYA 2FEMA 1Y4ZA 2V9ZA 1LBHA 4IDOA 1Y1KE 4BN0A 5IYZB 4W9NA 4RTLA 1YA8A 3TNJA 4J2TA 2OT3B 1N0IA 3CF4A 4DADA 1TECE 3FWYA 5IVIA 3MTQA 4FZVA 3G9XA 5G40A 2IPNA 4D9MA 5AVUA 4XSVA 4UUQA 4ENUA 3WX0A 3GLGE 2LCIA 1FX0A 3V4OA 3OIUA 1FDUA 2D1SA 1G8YA 1HYGA 2OBLA 4P8RA 2EJVA 3ZTYA 4DIBA 5FPKA 4YRJA 3F9CA 4FR5A 2DPHA 4FBGA 3AJDA 2J0UB 3BJZA 3M4XA 4YUVA 1W73A 4HWOA 4JNCA 3ODPA 5TMDA 2W8BA 2V0CA 3JWJA 5KVQA 2B8TA 2C2GA 2VIIA 1ZC4A 1QZXA 2VSNA 4PPNA 4I1OA 5LP6C 1U7DA 3P19A 2BSQA 3DJFA 4BC1A 1DX9A 3AT1A 2XCRB 3GJTA 1RHKA 1E2UA 3R0ZA 4QG3A 3ZGZA 1Q7EA 1L7MA 2B8JA 1MGOA 3RB8A 1QO9A 1WDLA 1ZD4A 2YJTD 5EHQA 2R48A 4KIGA 5ER6A 1QX4A 2SICE 4S0XA 4G67A 2OWDA 1E1QA 3ROPA 4ZGGA 3LHKA 4R1SA 5K99A 3N87A 3PNBA 1L5WA 2B61A 4MR8B 4MUEA 1E79D 2PS1A 2AOUB 1YRYE 4PR0A 4Q3DA 4V0QA 3EUAA 3W79A 4TRJA 3SKVA 3G23A 3BWMA 4ZVUA 2JJYA 4UDNA 3ZE0B 3U39A 4NCBA 2WJVA 2IS1A 2PMEA 3U26A 4JJKA 4ZV7A 5B1HA 3GI1A 1TZCA 4GOJA 4P0QB 5CT5A 1AZTA 5REQA 1P17A 3KJHA 2PTGA 3CCFA 1XCMA 1PV1A 4NCXA 2Z5FA 3KKNA 1FP6A 1GHTA 3P0FA 4QBHA 3VR4D 3I9FA 4JROA 4BGUA 2AYZA 2OORA 2X4GA 5MN6A 1ZYUA 1TQ6A 2C2WA 2ZYHA 4AJOA 4F5WA 1VCOA 3OE5A 3NGMA 1E7WA 4L08A 1K7SN 1LS1A 1TEHA 2CK3A 4BWVA 3GDGA 2FSSA 3JASB 3PHIA 2X6RA 3FBTA 3UWDA 2ZJBA 2Q8PA 3IOBA 2BKVA 3C0KA 3UN1A 3ZDEA 5T4EA 4EX7A 3V9AA 2PJZA 2PZMA 4B17A 3ZBTA 5J4VA 3H16A 3VKHA 5KVAA 2GEVA 3A1SA 1ADYA 2Q3BA 2VVTA 2C96A 4N48A 1NVGA 5FUVA 3HPQA 1JLKA 1SKQA 1JDNA 4MCHA 2Z1MA 2HSDA 3I62A 2HU7A 3LLSA 3P9XA 1IRIA 1VZ3A 4L8GA 4P5DA 3MM4A 2H2AA 4PW0A 1NXQA 2ZRIA 4YCSA 3ELDA 1AMOA 2H4XA 2QTMA 3O8OA 1RJ9A 4LKRA 4FHFA 4F7DA 3HBFA 3UWSA 2ZE7A 1RXCA 3GNQA 4IFTA 2Q0SA 4JR0A 3SR0A 4RE5A 2B5WA 4YN3A 2IHTA 2VDJA 2X14A 1SXJD 3DMFA 3LHIA 2GRAA 3AUYA 4QYIA 3AF6A 1THMA 2H2WA 3DDWA 4K05A 1L1QA 1MQSA 3I9V6 4Z0TA 4LTMA 3LUBA 4NBLA 4NU8X 4WNAB 3IGFA 4TWZA 3HKEA 4HH4A 4HX5A 4DR5B 2BP7B 4XWKA 3TIXB 1FRZA 3H1AA 2EL7A 4LCEA 4V0KA 5HDBB 1FMFA 2OZVA 1RRFA 3RS4A 3WNDA 3D4NA 3LRPA 2I78A 4PBSA 1M10A 1O58A 3B5JA 3QUSA 4PG8A 1XF1A 5BURA 1NJFA 3BTSA 3IOCA 3NEPX 4XJTA 2V8OA 2Q8NA 3C85A 1PT8A 3ES9A 4NIMA 4NYMR 3ZDDA 4RZXA 3NBXX 4GC9A 5KC9A 1XVAA 4K3VA 1OIVA 1WMBA 1A69A 2Z43A 3LBFA 4MP8A 4QJIA 1T1EA 4U2EA 1W1IA 5LA6F 5I7RA 1QO0D 1ZAKA 3BG5A 3BMXA 4HDRA 1C0KA 4PLVA 2VK4A 3WRXA 2ROQA 3N2EA 2AZ4A 3RC1A 1T5IA 3STTA 5HKBA 1AF7A 4H60A 2HUNA 2J3LA 4WKPA 1IK4A 2JLWA 2ZRGA 1O96B 2DKOA 2ORIA 4QHSA 1HC7A 1FB5A 2CUKA 2FWJA 4D9BA 1VA5A 5IDWA 2ZDHA 3HXOA 5B4VA 3EVAA 5IH7A 5JFTA 3INGA 3NM6B 3VMFA 3WLJA 2XY4A 4R84A 1EA5A 2R751 2ID7A 4D9NA 4LF6B 5A0VA 1BKSB 3EVFA 4HGQA 4KQXA 1YZVA 3GFBA 4Q1CA 4C05A 4G8CA 3VI3B 5EWMA 1GRQA 4PBTA 4C7OA 2ECPA 1CJMA 3PQFA 3TJMA 4B40A 1RQNA 3P1JA 4D0NA 4L4RA 4E4YA 2EOAA 3IPAA 1TUIA 5FOVA 1LDNA 3GN2A 4OMUA 3ANTA 3JYOA 7ADHA 2YZNA 1SGWA 2V6GA 3TTVA 3WVNA 1LUAA 2C04A 2QLBA 4U8GA 2JD1A 3PLNA 4Q00A 2GS9A 3W6PA 2XR1A 1M7BA 1BGVA 1JXQA 1V5WA 2G9QA 4WZAB 1RYYA 1LRJA 4MHTA 1DOAA 1FFXA 4M86A 4F2WA 4ZYLA 1QP0A 5AXAA 2C7PA 1N5JA 2CXSA 3ISVA 3V7YA 2ASEA 3T0FA 1Y8AA 4O4JF 2J59A 1L4FA 2RK3A 2YS7A 3FPCA 1NVVQ 3LKVA 4TKVA 1VFPA 3U7RA 1E2EA 4WKOA 3B3FA 5FT9A 4LNUA 4LWPA 4P98A 2C42A 4N47A 1IBCA 2ZRQA 3VOBA 4ANFA 2J3DA 1I36A 3SVLA 4G0QA 1JZQA 3QFTA 2E85A 5HIIA 1R6VA 1UEIA 5JD4A 4A8TA 1UKYA 4MCIA 3TZKA 1YACA 3P97A 5CFZA 1E98A 5CGQB 3PPXA 1XSEA 3KOOA 4YLEA 4D97A 5H9VA 4YAKA 2AR0A 3AUAA 4W5JA 2UZ3A 1OFUA 3OSUA 4HEJA 3DKKA 4OLJA 4P08A 4XGRA 1O9BA 1XX6A 5K0FA 1I7DA 2M1ZA 2ZVQX 2FEOA 3BK2A 2XOKA 4NU6A 1NR5A 3LFUA 1U6IA 4RY8A 5DASA 3UJ6A 1VI5A 4B7XA 2ZVDA 1HNWB 1YCFA 5CDUA 4CM9D 1Q57A 1U8CB 1Y42X 2RBEA 4J0KA 4LCBA 5K20A 2CJWA 1U2TA 4JX9A 2JHGA 1LBEA 1PX2A 3PLAE 2O8VA 4NX2A 1FXWA 3L04A 3V8BA 2EHDA 3GRVA 2IWHA 3BWYA 4L0CA 4EHBA 3R7AA 4YROA 3X1KA 1GZ7A 5HIAA 3W2FA 4EP1A 3R0IA 4LGMA 2W2QA 5E1MA 4GNRA 2YV5A 1NF9A 2PS9A 2AXEA 3GIDA 1WHTB 3H1EA 3RABA 2NTYC 5EXEA 1UK8A 4RD1A 4UUNA 2PVCA 2PYDA 1QF9A 2QZPA 1PNTA 3WLTA 4D0SA 1B8UA 3KAKA 5H1YA 2FOXA 1C29B 4KAXA 2V03A 4FMCB 3CISA 2DQSA 4LZWA 4YALA 1U7XA 3LY9A 4FEGA 2QY6A 4EX6A 1U0GA 2OQIA 3NETA 3TKLA 5ALDA 4LRTB 2QRJA 1R1DA 3ABQB 3IQGX 3JQ7A 4G1BA 4AZVA 2GFHA 2XDWA 3LT4A 1GRCA 3MHPA 2ATCA 1ZUNA 2FVXA 2DJ5A 1FNNA 1VMAA 1AXRA 1WMFA 3G9TA 3HVHA 2GBCA 3DXFA 4KXWA 3MRTA 3TD2A 3LECA 1TZMA 3ZHTA 1T8RA 2MR6A 1BW9B 2R86A 3C41J 3KSUA 5KNCD 3FZGA 1YE5A 4JASB 4UU8A 1KI2A 1MDFA 1PGJA 4BJ5A 1ZR4A 2WPDA 1XAJA 2VJDA 3B20A 2W00A 1LSUA 4WI1A 1OXVA 3HCEA 1YJXA 2FUCA 4YWHA 5HDQA 3PQDA 3HR8A 2GFQA 4OQ4A 1EH5A 2DFNA 5FUYA 2PTHA 3P9CA 2SBTA 3SOZA 3I61A 1S2LA 1G17A 3A1VA 3ICQB 1WBDA 1TM4E 3DL0A 1GSHA 1QZUA 2Y0DA 1JKJB 5IU6A 2BZ1A 3EARA 2RBKA 2XTAA 5BVGA 4XYBA 3EZ2A 3NWBA 1ZH0A 2HXSA 3N58A 1ILWA 4WXYB 5H80A 4JI2B 2VWPA 1NYTA 4ERXA 4CT0A 3S8YA 5CB0A 4K9QA 3ROQA 1NURA 3KZ1E 4JVNA 5IHPA 1G1MA 3DVLA 3NUGA 1QSGA 2EP8A 3MXOA 1U0LA 2MYTA 2Q1UA 2Q6IA 2ZIVB 3GXOA 3QITA 2ZSIA 3H5IA 1HQCA 3NP7A 1DRKA 2NAFA 4JUBA 5HCNA 3QVMA 4BN5A 4F4JA 4ZVRA 1QG0A 1CR6A 2EF1A 3L7AA 5J59A 3RK4A 1VKOA 1DEHA 1WCV1 2GD0A 4XJSA 3M3DA 4G4GA 4CMIA 4UPEA 1NVMB 2CLMB 1CK4A 3IXMA 3FM9A 4Y3UA 2ZJ7A 4OBEA 5DHAA 4B2PA 1ZIPA 3ED5A 2AUTA 4TMYA 4ZDIA 2MMCA 2UUPA 3DTTA 3P2IA 5DHRA 1V39A 2FH5B 1QGZA 3FH0A 1AHIA 1GNSA 4NZYA 1IM8A 1IPHA 1AQ6A 1ML3A 1AQIA 1B8VA 4HUJA 4XIFA 1NRWA 3WZLA 5BN4A 1XQYA 4G4SO 5JAMA 1Y81A 3HFJA 1X92A 1R18A 1ZJ4A 2DLNA 3DWIA 2LIPA 4L27A 1H2BA 4YAGA 1G5FA 3ZK7A 4B3DA 4RJTA 3O8RA 4M0CA 1G3IA 1S7CA 5AUNB 1C80A 2RG7A 4N9WA 3ZE6A 4D6PA 5KJ1A 2ORWA 2G36A 3AVPA 3V3KA 4EY3A 1J6UA 5CHYA 5AVXA 3OTOB 3JYPA 4DOMA 1ZC3A 2NTEA 5ECGC 3ZJYA 3KTAA 4NE7A 4TROA 3DKIA 3NM5A 4NS4A 2PFGA 1GN9A 1OBFO 2A1UA 4MKRA 1YU6A 4ZT5A 5SZJA 1JECA 1SHLA 2C5LA 4JT4A 4PS1A 5KBYA 3M6VA 3U7QB 2IYYA 3E7FA 4MYSA 2OXTA 4PQYA 1DXQA 3EQ2A 1Y1SA 16PKA 1DIGA 5AKGA 1VPEA 3F46A 1U8UA 1N0VC 3Q9SA 2WSMA 1AB5A 4CI9A 4YRNA 4ZAYA 1V4VA 3TTUA 5KNBD 2DQ4A 1FUUA 3OEED 5GIPE 2IEBA 2YCBA 1DO0A 5AK4A 3HP1A 3TTWA 4RY9A 1TLLA 1X0XA 3H05A 4BQIA