3O4RA

Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
b'TRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase/reductase SDR family member 4
publication title Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 86
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o4rA00
4WKGA 4DLBA 4BGVA 5FYDA 1NR1A 3HG7A 3LT0A 2NTVA 4R3WA 3GPIA 3EVTA 4UVHA 7MDHA 6LDHA 3BTOA 4NBUA 1TA4A 2E4AA 1VSVA 2JAPA 4O63O 2I99A 1K3TA 3DOJA 4BV9A 1NR7A 4BB5A 1G6KA 4GAEA 2AG8A 3I83A 1W73A 3WS7A 1R66A 2I76A 3JQGB 5DCUA 1Y9AA 3D4OA 5AXBA 3E1KA 4WCDA 3ZWWA 3ZW8A 2DTXA 3AUSA 3TDKA 4UEOA 1NNUA 1RYEA 4KWIA 1F06A 3IL2A 1E3LA 1NXQA 5JO0A 4E21A 2Y0EA 2YFQA 3QSGA 5B4TA 5KVVA 1P44A 1TLTA 1Q7GA 5IJZA 3EMKA 2FHSA 1HYGA 5KVSA 3GGGA 4R16A 2DT5A 4W4TA 4CR8A 2HMUA 2X5KO 4IXWA 4CLOA 3PDJA 4L4SA 2D1YA 1MFPA 1NPDA 4JP2A 4ROSA 3TZCA 3WNQA 4GWKA 1U2DA 3GUCA 1I33A 3HB5X 5DP2A 3V1YA 4PG7A 3PLNA 3PDUA 4J91A 4I9HA 3U4CA 4F6LA 1E3EA 3JD0A 1R0LA 1LX6A 5I7VA 1XG5A 4D3SA 5F1OA 1N9GB 2X6TA 2CNBA 2VRCD 3PHGA 4XDZA 4OKNA 5KVQA 5K6AA 2ZKLA 4XYBA 5ITWA 1ZK3A 2Q4EA 3OF2A 5IXSA 4CMEA 3BHMA 1JKIA 2O3JA 5BSHA 5CDTA 4XYLA 2EP5A 1NASA 1CDOA 3GNSA 1ORRA 1NPYA 4RPLA 1PSDA 1P1FA 4YYZA 1F8FA 2QRJA 2VTDA 3DMTC 3DONA 4G65A 4B3JA 4XQ9A 5IDQA 4RCVA 3ZHYA 1LLCA 1Q7BA 3DHEA 3COSA 2VOJA 1ULSA 1U1IA 1PL6A 3D3WA 4JGBA 3UVEA 4DGSA 4DQVA 3S1LA 1RKXA 1UH5A 1YVEI 2HJSA 2VZ8A 1HDCA 1W4ZA 2AQ8A 4R51A 3H2ZA 4WJZA 3E9QA 3OMLA 1EFKA 3F1LA 4XDYA 3EY4A 2NWQA 3LF1A 3OA2A 4FGWA 1R0SA 1QLHA 5L7YA 3W8EA 1LXCA 4ALNA 2YY7A 3QA9A 5A5FA 4YR9A 1Q2XA 5CAEA 4J1TA 1J4AA 4E6PA 3RUEA 5CPFA 4ZA2A 1PEDA 3FCOA 4FOOA 1GCUA 3JQGA 2CUKA 4PLTA 3QLJA 3STHA 3GOHA 1K6IA 2A9FA 3ICPA 4J7CA 1DRUA 2CFCA 1VLLA 4P4GA 1GL3A 3ABIA 3A14A 3CE6A 4QX6A 5L40A 1OI7A 5IAAA 2DVMA 1X7HA 1YXMA 2RCYA 4N54A 1ZIDA 3T7EA 3M2PA 1I2BA 2BI7A 3WTBA 1BXGB 3JQ9C 5F5NA 5I7SA 5I7EA 1R37A 4CQMD 4O59O 3OA0A 2GASA 4GPD1 4GLOA 3ONFA 5IFLA 2R00C 3RWBA 4XB1A 1PZEA 4WGGA 4BKQA 2OL4A 2DAPA 3MJEA 1EBUA 3AY6A 4UEKA 2AHRA 2BD0A 3JD1A 3NT5A 3GVXA 3Q2IA 2OUIA 5DOZA 2IZZA 4CUZA 5L4NA 1N9GA 4J2OA 2PKRA 4MPDA 2YHIB 1YBVA 4IY1A 4LW8A 1E3SA 2VHXA 2YHUA 3ASUA 2NTNA 4FFPA 4PCVA 4ALMA 4BO4A 3IUSA 1ADGA 2JHFA 4IS3A 3RUIA 2O2YA 4BNNA 4WLFA 3UCXA 3E18A 4OXNA 3PZRA 4IMPA 5I8WA 4D3FA 3HWRA 4CMKA 5F5LA 1GQQA 2CDAA 4HWKA 5COQA 1CQJA 3JQ6A 1GPDG 2AG5A 5KJ1A 3IUPA 5A5EA 2VOEA 4FJ2A 3W6ZA 5A03A 5JSFA 1NHWA 3WWZA 3OECA 2PFGA 4BIIA 2B37A 1B16A 3DHYA 1EUCA 2YYYA 3AOEA 3NDJA 3Q3CA 3H4VA 1J0XO 3C7CB 3D1LA 4XCVA 2E82A 3DBVO 2J5RA 4NI5A 1DC3A 3B1JA 2UDPA 1IPFA 4DIOA 1I3KA 5JAMA 4NQZA 3IKTA 1GD1O 1OBFO 1UZLA 3FBTA 4WECA 1LI4A 1V3VA 4TSKA 3MJSA 4U6SA 1BDMA 4HFJA 4EUHA 4YBZA 1D4FA 1W0CA 4BS9A 5TC4A 1K5HA 4XIJA 5KJFA 1NP3A 3TRIA 2J3JA 1MX3A 2Q1SA 3RROA 1VJTA 1GV1A 2CMDA 3JQ7B 2Y0CA 5A02A 3U09A 1I2ZA 4J3FA 3KRTA 4IQ8A 2I9PA 3JYPA 1U28A 2JJYA 3QIVA 4FFNA 1OMOA 1I36A 1C0LA 3ZV6A 4IGFA 1A5ZA 1BXGA 1ISHA 4IGEA 3WOHA 1OAAA 4MOWA 2EG9A 4BO3A 4WLOA 4AJPA 2DPGA 4S3MA 5T6BA 2V6BA 1FDWA 4NNJA 3PTZA 5JLAA 1GDHA 1LSSA 3H5RA 4IIUA 1PJTA 3FRJA 2VUTA 3S55A 2Q46A 4RPGA 1KY4A 3OJOA 3PP8A 3GHHA 4CMCA 2I3AA 4BNWA 4PN3A 4WUVA 1DJNA 1UXKA 3D5QA 4ZHSA 1BGVA 1GEEA 1NFQA 1PL7A 2CVQA 4Y67A 2G1UA 3IP3A 2R2GA 4O1MA 2HK8A 4N5LA 4YAIA 3HFGA 4YT4A 3HN2A 4Z0PA 4NIMA 2ZQYA 3TZHA 3PIDA 1I8TA 1U4OA 3WGGA 2HU2A 3FI9A 3FWZA 4CLHA 5TLSA 1LDMA 1G0NA 1ONOA 3PK0A 1BDBA 1NX6A 2VZ9A 3O8QB 3ONDA 1ONPA 2Y0DA 1SOVA 2YJZA 5TX7A 1KVUA 3VDRA 4JJIA 4Y98A 3DMTA 4HBGA 3G0OA 3DBRB 4DUPA 3HE3A 1DHTA 5KCZA 4RQUA 4XYGA 4CMJA 4IDAA 4LISA 5DF1A 2C2YA 2HK9A 1KEUA 1SB9A 1DAOA 2HMSA 4I5DA 4BNYA 4IJVA 1HSOA 3VTFA 3QJ5A 5LC1A 1HZZA 1LC3A 4F3YA 1GZ4A 2IXAA 3KHUA 1E0DA 4AFNA 4FFOA 3RSHA 1HE3A 1RPNA 3ONEA 4BNHA 1NAHA 4B4WA 1ZUD1 1AXGA 3K73O 4JQCA 2EGHA 2GRAA 1DFHA 1F8GA 4NHEA 3JQ7A 1TVEA 4MP6A 5FWNA 3AM5A 1WXDA 2NVWA 3Q1LA 4YVFA 3RBXA 4D7AA 2CDCA 2BELA 3WR5A 3ZWCA 3RUAA 1HDRA 1HRDA 2ZATA 3MTGA 1AUPA 1EEHA 2HMVA 3HSKA 3ZWOA 1SC6A 1Y5RA 3FNGA 2ET6A 3HDJA 1QR6A 2FP4A 3DR3A 5AYVA 1ADBA 3FBGA 1BRMA 1WNTA 5G0WA 3JQ9A 4E4YA 4BO9A 1H9AA 2WM3A 3S2IA 2I3GA 2R00A 4AL4A 1GUZA 3CTMA 2IYOA 1O6ZA 4YJHB 4G2NA 3FD8A 1P31A 3RC2A 3OIGA 1BW9B 4GVXA 4KQXA 3JQ8B 4PVDA 4MVJG 3SLGA 2ZB7A 1KVQA 1Z6ZA 3VOSA 2QQ5A 1GYRA 1NAIA 4EDFA 1JKJA 4FFRA 4Z3KA 3NYWA 3W4JA 3IJRA 2PD4A 4B7CA 3W4KA 4R5HA 1JWAB 2C20A 4TWRA 2EW2A 2Y93A 3GFBA 3ZV5A 4YACA 5JNLA 2NU7A 3ZWMA 3GFGA 5DBFA 3MTJA 3NTQA 3C7AA 3O8QA 5GZ3A 3QVWA 4BNGA 2YV2A 3KSUA 3ZWXA 3IP1A 3I9LA 2OP1A 2X0IA 3WBBA 2OBNA 2Q49A 3DBRA 1ID1A 4YRDA 2GN4A 4TRMA 3VPXA 3C1AA 3VZPA 2YDYA 1SCUA 2J6IA 4BOYA 1H9BA 2A4KA 3CPSA 4UUMA 3QP9A 1N5DA 2OBYA 1NHGA 5A05A 2Q1UA 3CEAA 1WDKA 3DZHA 4IJKA 2P68A 2PLAA 4XKJA 3IQDB 1FK8A 4DIFA 4G81A 3O9ZA 1B7GO 3ZCXA 1FDVA 2ZIZA 5EERA 3SEFA 1EK6A 1E92A 3U5TA 3JQCA 1ZFNA 3KXDA 4CV0A 2PY6A 4H3VA 3GY0A 4FJ1A 1LJ8A 2DBQA 4XYMA 1SMKA 4N7RA 5H81A 1IYZA 2BI8A 5FEUA 4ZU3A 1P0CA 3TNLA 4BQRA 1YQDA 4JBHA 3A06A 4MP8A 4FCCA 4O6VA 3GMSA 3CIFA 1I30A 2EV9A 2HMTA 2X9NA 1U7HA 1GU7A 2XXBA 2YFHA 3RUCA 3VHRA 3WYCA 2I65A 2O2SA 3JYNA 2EKLA 3OH8A 1YRLA 2JD1A 2X5OA 3H9GA 4BNJA 2VZ0A 5ADHA 5L45A 2EERA 4YJHA 4GH5A 4BNTA 2G0TA 2A94A 2VNSA 1W8DA 1UXHA 2PZMA 3JQ8A 3UW3A 4XIYA 1G0OA 1GCOA 2Y68A 4I9UA 4Z3DA 4AJLA 2GUGA 3NRCA 3VPFA 1EVYA 5JC1A 1DSSG 3F4LA 1LSOA 2QYTA 3KOUA 4IQ0A 3GEDA 2VWPA 4R01A 2JAHA 3U0BA 4E3ZA 3AU8A 3WWYA 2Q45A 1ZNQO 2NVUB 3L6DA 4R1TA 2A92A 2RIRA 2DLDA 4ZICA 4OIMA 1DEHA 3PJFA 4BMSA 2PK3A 3S8MA 2Q4BA 2EKQA 3BA1A 4J0FA 4M87A 5AXDA 2SCUA 4PZDA 4GGOA 1PQPA 2GERA 1ZJZA 1SNYA 3PI7A 4OYRA 4FR5A 1A72A 1JQBA 3PWKA 2RAFA 2O4CA 3Q9UA 3C3XA 3F1KA 1DDOA 4PGFA 1VRWA 4CM6A 5HA5A 2YW9A 4BO7A 1P33A 3CMMA 2XOXA 5EIOA 4Z9FA 5DZSA 5JC8A 1XQ6A 3BHIA 3QWHA 4ZQBA 4B8WA 1YDWA 2D5AA 4PLCA 5A06A 2DQ4A 1DLJA 1BMDA 1T2FA 4S1VA 3TFOA 3DAPA 1VPDA 4YT2A 5JY6A 1A71A 1ZEMA 1GZ3A 1O8CA 4FSHA 4UUOA 3ZDFA 3M6IA 1E5LA 1TI7A 4HKTA 5F21A 3WGQA 2C7VA 1IY8A 2P9CA 2OO5A 4GX1A 1DIRA 1UAGA 3ETGA 4PFJA 4M54A 4WASA 4GGPA 5CDGA 3PQFA 5TRTA 1QYCA 1IUKA 4NFYA 1LTHR 3GEMA 1YKFA 2Z1NA 4XB2A 3FNEA 3ITKA 3PZBA 5ER6A 2CY0A 3I23A 3G1TA 4NU6A 4XX0A 3WX0A 4KUEA 3TOXA 4JBGA 1BHSA 3QVSA 4CM5A 1VM6A 5JDIA 1QV7A 4FFMA 1PJLA 1MGOA 4RJTA 1YB1A 1LU9A 4Y6PA 2B83A 3C8MA 3HN7A 4LN1A 5DNAA 1UAYA 1R0KA 4OJNA 5H82A 5IDWA 2AE2A 4P4NA 1ENOA 4F6CA 5L7WA 3Q11A 5G0VA 3ROQA 2W4QA 3O26A 5JAQA 4ND5A 2Z95A 5AOVA 2Y67A 1YOVB 3CSDA 3OJFA 4J49A 1B8VA 3GH3A 1NPTO 3ZU2A 4BV8A 2E37A 1GUYA 4L9RA 1E7WA 1LNQA 3GHYA 3L4BC 4IDGA 2GLXA 4J4HA 5TJ9A 3NDIA 5JCJA 5IZCC 1HDGO 3MEQA 1MB4A 4P22A 1E7RA 1UDAA 4OXYA 4D42A 2F1KA 3ENNA 2OORA 1U9JA 1H6DA 1O89A 2B4RO 5CP8A 4BL5A 2O3UA 1OC4A 5THQA 4D3DA 3PWSA 1ISJA 2B35A 4IQGA 4RL6A 1E3IA 3HB4X 2ZYGA 1NQOA 1HDOA 1GAEO 2C59A 2UUPA 3TZ6A 3EC7A 4DC1A 3KSDO 4ILKA 2C54A 5KTKA 1I01A 2X22A 1RYDA 1T2CA 2WYVA 1LSJA 1NVMB 3O03A 4HNHA 4EUFA 1GUFA 3F4BA 4Q3AA 1E1NA 3VAZA 3GVCA 3ZU4A 4QXMA 1YH3A 4ID9A 5JE8A 3X2FA 4QO8A 3AFMA 2NTJA 4W9NA 3ANNA 4ND1A 4QFDA 1T2EA 3GQVA 4DIBA 4Y8VA 3U49A 4M89A 1I24A 4J1NA 4OM8A 3RC1A 1GPJA 5I7FA 3GAFA 4FQ8A 4RPHA 2G76A 2IYPA 2OP0A 3WJAA 4XQEA 4CR6A 4DPKA 3ORFA 2HO5A 4RLHA 1CWUA 2VWQA 1W6UA 2GPTA 2DTDA 1LRKA 3LQFA 4K6FA 3C24A 4XR9A 4DMMA 1DBVO 3H5NA 3M2TA 2PA3A 2PWZA 1TXGA 1E5QA 2VHVA 4BGEA 1E77A 1O5IA 2W2KB 1QRRA 1ZW1A 1ISIA 3SJ7A 1P1HA 2AMFA 3K96A 3HDYA 5IDYA 2YZ7A 4ZJUA 3GVIA 4XWYA 3DWFA 1AHHA 2B4TO 2X0RA 4RGBA 4YQYA 3G17A 1YOVA 3N7UA 5JY1A 4PLZA 4NK5A 3T4XA 3QQPA 4KZPA 4AJKA 3NGLA 3RFVA 1XWFA 1JTVA 4EGFA 4Y6SA 4Z0TA 2YDXA 1E1KA 3E9NA 2BF7A 1ZJYA 4ZVVA 1ADFA 4QT0A 1O0SA 1B3BA 1DIHA 3E48A 3D3WB 4CM4B 2GNAA 1I0ZA 4FB5A 2HLPA 3ZNOA 1EDZA 3D5TA 2ZTMA 3BTSA 4CV1A 1QKIA 3OQ1A 5L3ZA 1CQIA 2RH4A 2VWGA 3K9QO 5TF4A 3RC9A 4EEZA 1EUZA 3AWDA 4IDCA 2GSDA 5BNFA 5JW6A 4FC7A 2NU8A 4B3HA 4W99A 5AQ1A 2ZB8A 4P8RA 4YPOA 3RJ5A 3AI3A 5T5QA 1DHRA 4BNZA 2C7GA 4L4XA 2Q2QA 3DQPA 3ASVA 1PGQA 1B14A 4M1QA 1O95A 1UZMA 4MVJE 5HTOA 4MVJP 4K6CA 4TVBA 4NZ9A 4PZEA 4CM3A 2WSBA 3EYWA 3I6QA 4Q3BA 4TKMA 1JKFA 2O23A 3PPIA 3P2OA 3PFWO 4PG6A 5IG2A 4CMHA 4IINA 3JYQA 1ZK2A 1QYDA 3W8FA 4J9VA 4RZIA 2TMDA 2Q50A 4B4OA 2CF5A 4A73A 1EFLA 5K0ZA 1KVTA 3KVOA 4FPXA 1U3WA 2VWHA 4KMSA 4UULA 2AE1A 4B4VA 5THKA 1LLDA 1XU7A 1U5CA 2BFOA 2W2KA 4Z0HO 4AJJA 2D2IA 4XD2A 1F17A 1T2AA 4L0QA 1ZSVA 5KKCA 1BXZA 1ZH8A 4ALIA 2P9EA 4N18A 1OZAA 4IS2A 5B1YA 4IBOA 2FSVA 3PRJA 5IXYA 1ZZEA 3JQDA 3VZQA 3I6IA 4DL9A 4ND4A 1ZVMA 2HK7A 4TRRA 1PGPA 2WDZA 4HUJA 3PWZA 1U3VA 3QV1A 1B3RA 2ZYDA 1PL8A 1FMCA 4Y9DA 2WMDA 4CM4A 4GLLA 3OSUA 2JFGA 3EGOA 3HJAA 2O4UX 3L4BA 2OHXA 1XCBA 4BNLA 4CMIB 3E5RA 3FNHA 3JV7A 1X1TA 3MOGA 5IZCA 5TQVA 3K5PA 4WLEA 3NEPX 1CJCA 4ND3A 4MKZA 3DXFA 1XQ1A 3LC1O 1BTOA 1H6CA 1GYQA 1U7TA 4E13A 5BQFA 4BO8A 1HLDA 5BSFA 1E3WB 3TWOA 1N2SA 3GDGA 2VYVA 5TT0A 5G0TA 1R4MB 3GMDA 4DQUA 5TJHA 2J5QA 2WJPA 1IB6A 2O3SA 3CKYA 4JBIA 1U8FO 3OETA 3ZWAA 4YAKA 8LDHA 1PQWA 1GFSA 3PGJA 5GY7A 1L7DA 4KUHA 3KTDA 1FDTA 1T1RA 4R1NA 4CM1A 4BNMA 3A1NA 1PR9A 2YV1A 5CG1A 3I4CA 1PJ2A 1KC1A 3KV3O 3PIIA 3OEYA 4Z9YA 4NJOA 3DFUA 1UJMA 3D4NA 4WOJA 5ENDA 1E7QA 4ZQHA 3UCEA 3FN4A 1MXFA 4E5YA 3AUUA 3ZI0A 3AUTA 5B37A 1GQ2A 4AJ1A 2C07A 5KVCA 1JAYA 4RF4A 4AICA 3RC7A 3DAGA 4J90A 3H8VA 5JYEA 3WYBA 4EYEA 4R9SA 4HV4A 4BNFA 2E48A 3TN7A 2IZ1A 4B3IA 1VJ1A 4XRRA 3R6DA 2EXXA 4WLVA 1XSEA 3HNPA 3PHIA 4E2ZA 4UVDA 4PVCA 3ZH2A 2WTBA 3JQAB 5L53A 1AE1A 5KKAA 2DUUA 5JYDA 2ZCUA 3AK4A 3BTUA 1ZEJA 1J5PA 4IDDA 5GMOA 4MIYA 1A4UA 1GYPA 1DIBA 4ZD6A 3BHJA 1GY8A 4WLUA 5C37A 2AEJA 4CLXA 2D4AA 1YGYA 4I5EA 4WOKA 3WYEA 4J6FA 4BGUA 3WXBA 4CMIA 4GX5A 1H94A 2PD3A 3P2YA 3NT2A 4QECA 5ER9A 2H5LA 3KBOA 1HF3A 2IXBA 3AW9A 3ROKA 1BG6A 5T67A 4XGKA 1XELA 3PXXA 3PYMA 2V7PA 5HS4A 3INRA 4KUGA 3AY7A 1NBOA 3HDQA 2EWMA 1E3WA 4ZQGA 4LRSB 1R4MA 4NR0A 1F14A 1X1EA 4LCJA 4TROA 3D4PA 3JD2A 3UH1A 1VI2A 2X7HA 2O50A 4MIOA 2QYSA 3FR8A 3GLQA 4MINA 4ND2A 1N7GA 4MVJA 3U4HA 4CM7A 1C3VA 3NJ4A 3LT4A 2VRBA 2Y1GA 5L4LA 4LGVA 2X9GA 1P1KA 4QQRA 1P0FA 2P4QA 1PS0A 2WYWA 5TT1A 1F12A 3V1TC 2YQ5A 4ZGWA 3H9UA 1X13A 2O7QA 5A4DA 4QSMA 1LQUA 2HRBA 5TS3A 1PZFA 4DYDA 2DC1A 4YDRA 3D0OA 3INTA 2NV6A 3W8DA 1N1GA 3PHJA 4BVAA 1Z45A 1ZXBA 4NU5A 4ALJA 4EJ0A 2X23A 2D8AA 1YONA 5KWEA 1FDSA 2VT3A 3OICA 1WZEA 3GRPA 3WIEA 4E30A 1YQGA 5EL0A 1DOHA 4I1IA 2IEDA 3PFFA 1NVTA 1PZHA 5AVOA 1CERA 1T4DA 1LRJA 2AEMA 3GVHA 3OEWA 3RUDA 1QMGA 2JCYA 4LK3A 2VYNA 4PLWA 3TFQA 3JQAA 3EVNA 2PZKA 3CMCO 3DBLB 5DOVA 4Q3NA 4ESOA 4WEOA 3WQRA 5C5IA 1B0AA 5A3JA 5BR7A 2FPIA 3DZFA 3I4FA 2CSUA 1EMDA 2DFDA 3RFTA 4ONEA 1Y8RB 4LMRA 1YB5A 4FW8A 4CL3A 2DBZA 5IN5A 9LDTA 3WG9A 4CM8B 3JTMA 3L9XA 4YRAA 3L4SO 1X14A 3T4EA 4L4RA 1NQTA 1A27A 2IE0A 3U4IA 2X5JO 1DLIA 1ZO8A 5EQFA 2C5EA 3TF5A 1P77A 2IZ0A 3ADPA 3ZU5A 3M1AA 4C4OA 3L6OO 2VHWA 4G5HA 4RVUA 4EITA 1EZ4A 2TMGA 2WD8A 1UP4A 3OJ0A 1C14A 3I1JA 3LZ6A 4I5FA 4W7IA 5BSGA 5F3RA 2AA3A 4DA9A 3R1IA 1AN9A 1H0KA 2WEKA 1ZKMA 4JCOA 5JFOA 2WYUA 2EGGA 5ILOA 1IZ9A 4K28A 1XU9A 1Z73A 5JDIC 4K26A 3NV9A 2GZ3A 3GGOA 1U5AA 2QX7A 5CEFA 8ADHA 3FPLA 1I5RA 1NTOA 2VT2A 2Z5LA 1Z74A 2RHRA 3AM3A 3P5SA 1PS9A 3LF2A 3OIDA 1L7EA 3AI2A 4DRYA 2H1SA 4YAGA 3GF4A 1VSUA 2ZTUA 5JMPA 4CUJA 1PJCA 3UFXA 3RD5A 3WSWA 2ZB4A 3RJ9A 2ZJ0A 1HYHA 1T4BA 1X15A 3INGA 1GV0A 1NWCA 1U2GA 1R6DA 1ISGA 1X0XA 1K6XA 2C82A 3E6AA 4BUCA 1KVRA 1XA0A 1JA9A 3KUXA 4DXHA 4CJXA 2RBEA 1P74A 3AJRA 1M75A 5BNTA 3DBLA 4MIEA 4GVLA 4YXFA 3L9WA 1G1AA 3A4VA 3JD4A 1JWBB 1Y8RA 1DFIA 4U8GA 1I10A 2B69A 5TNXA 3ADOA 3E8XA 1GR0A 1MP0A 1MV8A 3SX2A 7ADHA 4CM8A 3UCFA 1LDEA 5IZ4A 3DZIA 4HY3A 4LSMA 3EDMA 3VH1A 3WGZA 2IEBA 1NQ5A 2H63A 4GMFA 4I5GA 4PLFA 4K9DA 4A10A 2OXIA 4GX2A 1NM5A 2Q2VA 1XEAA 3G49A 3V2UA 4RV9A 1YJ8A 3W6UA 1IHYA 1P1IA 3ZV3A 4HADA 5JAIA 3TZQA 2AQKA 4W9NC 4YJDA 3ULKA 2D5CA 2WWRA 3JQEA 3C7DB 4EW6A 3BYZA 1HWYA 1TT5A 4WEQA 2BGLA 3QWBA 1BSVA 1U8XX 1WP4A 3CXRA 2EP7A 3OJEA 4HXYA 4PG8A 1FF9A 4NG5A 4W7HA 1I3LA 3VPGA 3HHPA 4B8ZA 1K2WA 2HJRA 1ZBQA 5EQDA 4Z9XA 4BMNA 5C7OO 1T26A 3VZRA 2ZJ1A 3NUGA 1PGJA 3MWEB 4E33A 4R4JA 3E9MA 1IZ0A 2W8ZA 1VJ0A 1CEQA 4PRLA 2PZLA 3WGOA 5L4SA 3EZLA 1V3UA 1PZGA 4IZHA 3KYBA 4J0EA 4BGIA 1LQTA 1A9ZA 4OL9A 3PJGA 2W98A 1C0IA 1WZIA 4OH1A 3P7MA 2I66A 2FMUA 2HRZA 1ONNA 4U0JA 5TGDA 2QRKA 1VC2A 2E6UX 6ADHA 1GZ6A 5EESA 3RIHA 2PZJA 3H5AA 1UR5A 3F3SA 4O0LA 1B2LA 4OXKA 1I32A 4CLRB 3H3JA 1E6UA 1KC3A 1WDLA 4CMBA 3LU1A 1FXSA 1M6WA 3PQEA 4FFLA 4DPLA 3S2EA 1PU2A 3ZV4A 5A9TA 1LUAA 2C0CA 3IIEA 5IF3A 2Y1OA 1D7OA 1HDYA 1HT0A 4RDIA 3OHSX 1SBYA 1U4SA 5C7IO 1YS4A 1PJQA 5JXWA 4OQYA 4XQCA 3U62A 2GN6A 5JCJD 1DRWA 1EVZA 4NBWA 4BMVA 1JLLA 4Q3CA 3F47A 4HX5A 5G4KB 3GR6A 2LDBA 1BVUA 2HSDA 1PJ4A 3RBVA 4CPDA 4XRGA 1Y81A 4PIVA 4CL8A 5EPOA 4ZN6A 4E5MA 4DPMA 2HQ1A 4RVFA 1QLJA 4IDEA 5CPBA 3CZMA 3AUAA 1QYVA 3TL3A 4H7PA 3ZNPA 2IODA 4E12A 3I52A 3VH4A 2P91A 1ZMTA 3KYCB 3WFIA 1DC5A 3WLFA 5HBRA 1PGOA 1X7DA 3ZWPA 5I8ZA 4IDBA 3ZHXA 3WGTA 5CEJA 3ZN2A 1T2DA 3C85A 3LLSA 1Y9EA 4EZBA 2GO1A 3QVOA 3QWIA 5DDIP 1DXYA 5FI3A 3G79A 4C7JA 3QY9A 3K2BA 1B15A 2Y1FA 4AVYA 4XJTA 1LEHA 1S7CA 3HQ4O 4RF5A 4YJGA 2GZ1A 1YBAA 4UUPA 1DIAA 4U0KA 4NFHA 3KZVA 2NLOA 2W2LA 4R1SA 3FNFA 4I08A 1L1FA 3SC4A 5J23A 2POQX 1Q1NA 3JD3A 5DP1A 5L9AA 1RM4A 1XKQA 2AXQA 4PLVA 2EJWA 4CLRA 4CM9D 1BXKA 1UXIA 2Q1WA 5L7TA 3Q0EA 4QO7A 1YL5A 1CETA 2VHYA 2W90A 3BMOA 2Y66A 1DC6A 5U1PA 2QG4A 1E1LA 1ZSNA 3MJCA 4W82A 4ZQFA 3GRKA 3G1UA 3UN1A 1ARZA 1Q0HA 3T7CA 4KTVE 4AJ2A 4PLGA 5HRUA 3U4DA 2IRWA 2NADA 5G4KA 4PLYA 4BO2A 1PTJA 1UDCA 5KJ6A 3IAHA 3E03A 2AQHA 5ICMA 1YBMA 3NT4A 2B5VA 1K89A 1SZJG 4WPGA 1F0YA 1C1DB 2ZK7A 4HFRA 1R4NB 1YL7A 3GZNB 3PYLA 4WE3A 4WCFB 1CIVA 1UP7A 4TKLA 4BKPA 4YTEA 1H2HA 3LT1A 1XLTA 5CFZA 3PEFA 3MJTA 3PVZA 2O48X 2VN8A 3WGHA 1T24A 1LRLA 4YAJA 3ZWNA 2X86A 3BAZA 2X0NA 4OQZA 3UXYA 4R54A 1H6BA 3KYCA 5U9CA 1GADO 3BXXA 3WICA 4JP3A 4CLEA 2WE8A 4KP7A 3TQHA 5JCXA 4JLWA 3IJPA 3P19A 3B70A 3TOZA 1OFGA 4MVJF 1DRVA 4L73A 1Q0LA 4II2A 5G4LA 2WE7A 1C0PA 1MLDA 4KTTE 3CUKA 5C7LO 3MJVA 4RPKA 1T1SA 3SJUA 1DFGA 2H6EA 5B4UA 4E5PA 2EHDA 2JCXA 1WPQA 2BGKA 1Z7EA 4L74A 1IULA 3SXPA 3JQFC 3DHNA 3I9MA 3K30A 4R41A 3JCZA 2P4HX 5DULA 5KJCA 1KYQA 4B7UA 1KERA 4IDFA 4DVJA 5LCXA 1XR3A 3L0DA 5T8KC 1BVRA 1C0KA 1DC4A 2PGJA 3QVXA 3LYLA 4AJHA 2RH8A 3LK7A 4H16A 3SVTA 1RM5A 4Q39A 4GX0A 4NPCA 1ENYA 3V5NA 3W1VA 4E0BA 4FD3A 1TT7A 4LMPA 2NUAA 2HKIA 5C3MA 1AXEA 4CLDA 1E6WA 2YUTA 3B1FA 4RPJA 3B20A 3O4RA 4IJUA 4CUKA 1C1DA 3SLKA 4WCFA 1R4NA 3ZNQA 2UYYA 3GZNA 1GEGA 3PHLA 4BO0A 5CG2A 3WIDA 4D79A 4B4UA 1ZK4A 3DL2A 4ALLA 5CDYA 2DPHA 1M67A 4PZCA 1KS9A 3NJ8A 4PG4A 4E2YA 3UUWA 2UAGA 2PR2A 2VYVD 4IIVA 1ISFA 2O3TA 1J6UA 5JS6A 2Q3EA 1NQAO 3PLRA 2NQ8A 5F1PA 2CVOA 5AXAA 3A9WA 3WTCA 2OOSA 4ZRNA 1LA2A 4JJFA 3QWFA 3VVCA 1E3JA 1M6HA 1BWSA 1SO8A 1ZCJA 2P5UA 1A7AA 3OP4A 4OGWA 5T64A 1HXHA 5CDSA 1N1EA 2A35A 1J49A 4J1SA 1UXJA 3AI1A 3DDNA 1VL0A 3UKOA 4TMFA 1HDXA 2ZCVA 5ICSA 2BFAA 4BO6A 4DREA 5CDUA 2DUWA 1X0VA 3GNQA 3GUYA 1NVGA 4MKRA 4J4BA 2V6FA 3FWNA 4N5NA 3ETEA 1P45A 4NMHA 4TQGA 3DFZA 3WLEA 4R9RA 4TVOA 4WNCA 3FTPA 5DCYA 3DZKA 3EW7A 5BNIA 3BMCB 3EZYA 4CQLB 2JFFA 4DBVO 4XGNA 2J8ZA 1MC4A 2GCGA 3NAQA 2Q1TA 3KLMX 4HP8A 4M86A 4LVCA 1EE2A 2GF2A 1SPXA 3QWAA 4QEDA 4W6ZA 5LDHA 4NK4A 3K2EA 4YEDA 4YWJA 3DEYX 4A5OA 4DMLA 2BFMA 2V6GA 4ALKA 1LC0A 3LVFO 1LLUA 1PGNA 3FHLA 3PJEA 4MKXA 4MO2A 1MA0A 4YRBA 4DC0A 4RZHA 3F5QA 1YB4A 1Y8QB 3IS3A 4D43A 5U4QA 3DOOA 3KM0A 3E5MA 3GDOA 3RASA 2JHGA 1VE9A 1PQUA 2GN9A 2JFHA 2DKNA 2GD1O 4YT8A 3HADA 2F00A 2PV7A 4QTZA 1U3UA 2X8LA 5L95A 1ISMA 5DCWA 4UVEA 1FDUA 1E7SA 4JX8A 1K0UA 1HLPA 2FZWA 4QFCA 5A1TA 4OSOA 4AJ4A 2CD9A 4BNKA 2PD6A 2QZZA 4WNIA 4CQMB 1R15A 3ZNNA 1C1XB 2AW5A 3CZRA 3FF4A 4A7PA 4MVJD 3UAGA 3PJDA 1ZK0A 3NDRA 1V9LA 1WDMA 5AXCA 4EBFA 2LDXA 5IN4A 3N58A 2P9GA 1QYWA 3GGPA 1Y5MA 1YO6A 3I9OA 4GL4A 4KOAA 4BB6A 3RKRA 1KEPA 1Y6JA 1I3MA 2VRCA 3MJ4A 2D0IA 4EI2A 4P4LA 1V6AA 4A0SA 4ZQEA 1UDBA 4BNXA 1DO8A 1XGKA 4PLHA 1V3TA 2ILTA 4A27A 3IOYA 5A9RA 2G5CA 4RVHA 4L76A 5COBA 2C5AA 2J3IA 2OGUA 2X9VA 4PRKA 3AY3A 3WMWA 3ROMA 2RHCA 3V2GA 4YT5A 2AEFA 3GEGA 1EQUA 1RM0A 3K31A 4R3NA 4UUNA 1N8KA 2JD2A 3ON5A 1HKUA 4HNGA 1HSZA 2HAEA 3ITDA 2D59A 2ZQZA 4R68A 2VYND 5DBIA 4AG3A 3Q9NA 3JQFA 3H9QA 4K1LA 4DWVA 2QIOA 3BMCA 3JQAD 1YQXA 3NX4A 4YQZA 4CQLA 4XA8A 1PX0A 3RVDA 1YWGO 4AJOA 3ETDA 3CINA 3I9KA 3GAZA 3LC2O 3GA0A 5G0UA 4X54A 2WD7B 4ITUA 4IM7A 3RUHA 3L07A 5T8KA 4E5KA 3BTVA 1EUDA 3JYOA 2FSSA 2BRUA 4JK3A 4OKIA 3TSCA 4D0RA 3ZZNA 4GQAA 3KEQA 1EK5A 3LSYA 3NKLA 3EHEA 1UUFA 3PQDA 4NBRA 2I5PO 2XPCA 4GI2A 4IUYA 1Y8QA 3U9LA 3GG9A 1NYTA 1PWXA 3FSRA 2DBVO 2QW8A 4M49A 3VPHA 3H7AA 1ZXLA 4RVGA 4F45A 5I9NA 2DM6A 3S2GA 3ANLA 2VUUA 2UV8A 4TZTA 3WQSB 1NWHA 4F46A 3VKVA 3Q6IA 4TRNA 1HYEA 3L77A 2JD0A 2Y1DA 2J5KA 2HDHA 1LDYA 5MGBA 1EDOA 2JL1A 2YQ4A 4OO3A 5BSEA 1B8UA 4AJIA 1ENZA 4CQMA 2NVBA 1DB3A 3HDHA 5ENVA 1JVSA 1C1XA 1D1SA 1ADCA 4J1QA 1WWKA 4XJSA 3WDSA 1P3DA 1PIWA 3BIOA 4Y6RA 2B0JA 3MZ0A 3OBBA 4II3A 2Q99A 3UF0A 5I9MA 3VH2A 2PTGA 5KNLA 4M55A 1EVIA 5KOIA 5FFFA 1JDJA 3OJLA 2Y1CA 4FGSA 4BQPA 3EK2A 4KQWA 1ENPA 1KEWA 3BZUA 4FS3A 4A2CA 5EINA 1EQ2A 1VKOA 3C1OA 4P38A 3QVTA 4NFSA 2O7SA 3R3SA 1IE3A 1V8BA 4Q3DA 2NU6A 3JSAA 3WSVA 4BKUA 4L75A 4DTIA 1SEVA 4CR7A 3ENKA 1X7GA 2YHIA 4GKVA 4BO1A 1OOEA 4MVJI 3AU9A 1JW9B 4JJGA 1M2WA 3ZHBA 2FPPA 4EEXA 3RFXA 4H15A 2EF1A 4JNKA 2Y05A 4LCEA 2PH5A 4IZIA 4RF3A 2XXJA 3GZ4A 3RQSA 1YE3A 4R5MA 2FZEA 2WD7A 1KEVA 1QYXA 1V0JA 3AOGA 1KBZA 1O9BA 3GDFA 4UEJA 2BKAA 3KEOA 3WGIA 2FR8A 5G2OA 3SBOA 5GZ6A 1P9LA 2CZCA 4E31A 3BMNB 3KLPX 4GKBA 3KO8A 1KETA 2JCVA 2DTEA 1QV6A 3OFSA 3FPCA 1TT5B 1CF2O 2NU9A 4RLSA 3ZU3A 3UICA 5A04A 4YAEA 2GN8A 4D0SA 3VZSA 3VVBA 1D3AA 3GN2A 5L51A 2B5WA 2EJVA 4CV2A 1SAYA 1LDNA 5B12A 2X0JA 3QE3A 4CODB 2P2SA 2X58A 4U5QA 1CYDA 4YB8A 2J3KA 3UHAA 4NBVA 4M8SA 5FI5A 3D64A 4RO0A 2YV3A 1UP6A 1PJ3A 4MJLA 4EUEA 3MWDB 3GNTA 1YL6A 4QUKA 1LSUA 3RUFA 4RVDA 2H9IA 3RAJA 3WNVA 3NTRA 4D46A 1EBFA 3H6KA 1MG5A 2B36A 2PKQP 1HE2A 2BH9A 1EVJA 2FRDA 3AFNA 4HFMA 3K6JA 3RKUA 1U3TA 1ZSYA 3ZHZA 4OOEA 4UAGA 4D45A 5MDHA 1XYGA 4BHTA 2CDBA 3FR7A 3KSZO 3GN1A 4E5NA 2I67A 1KY5A 1UZNA 2O3RA 1Q7CA 2V6MA 4R1UA 1SOWA 5JAZA 1AHIA 4XZ3A 2R6JA 3D3EA 3DBHB 4CV3A 1I2CA 3Q2KA 4BKOA 4MVJM 5EMHA 4HFNA 2BFPA 5JDCC 5EJ2A 3F9IA 1KOLA 1KVSA 2FWMX 4NJMB 5A9SB 3U3XA 5JO9A 5F1KA 1IL0A 3G3EA 3E82A 1H2BA 4FBGA 4UVGA 1PS8A 3RBZA 3JYLA 4JIGA 1IOLA 1VL6A 3ZWBA 1QP8A 1Z7BA 1T25A 4KDEA 2Y1EA 1PJBA 4OSPA 4IXTA 4Q9NA 2PKQO 3QW2A 1O94A 4RDHA 2VNAA 3BMNA 5BT9A 5ILGA 1RWBA 3LLVA 5TSDA 5LDGA 4DLLA 2FY8A 1WMBA 3R3JA 2DBRA 2EEZA 3DZJA 4KWHA 2UUOA 2FR1A 9LDBA 4J7XA 4DYVA 1P1JA 3DZBA 3KB6A 2QHXA 1P1RA 4FN4A 4OHUA 4DBZA 4PLPA 1TB4A 1E1MA 2HUNA 4IJWA 5A3VA 3GK3A 2G17A 3B1KA 4XEHA 1R16A 4BO5A 4A03A 1B8PA 4BNUA 3HUDA 3VKUA 3RCBA 2I6TA 3WFJA 2AQIA 2B4QA 3I5MA 4DQXA 2UVDA 3SC6A 3OIFA 2QZ9A 3IMFA 2Q2WA 2BLLA 4J2HA 4GSKA 2PGLA 1H5QA 4YJGB 1JU9A 2GGSA 5ES3A 3DO5A 3KYDB 3DTTA 1XDWA 2EKPA 5G0SA 2C2XA 1E6EA 3WB9A 2BHLA 3M1LA 1H93A 4OOFA 1M76A 2HMWA 2ZB3A 3WGYA 3JQBC 5CHEA 4IPTA 1NFRA 1HDZA 1PWZA 1S6YA 4J16A 1BW9A 4LSWA 1RJWA 4N5MA 3V8BA 4E2XA 3GT0A 3OQ6A 1VL8A 2J3HA 3DBHA 4GMGA 1GQYA 3IDSA 3PHHA 3ZW9A 3BMOB 4NBTA 5COAA 4EJ6A 2ZYAA 4J43A 1D8AA 2W2LD 4RVSA 4OMUA 2X1HA 1QSGA 1Z82A 1A9YA 3IC5A 1AGNA 3DMYA 3LDHA 4NJMA 3RI3A 5A9SA 3V1UA 5KIAA 1GTMA 4XYEA 3H3FA 4BNVA 4Q3EA 4XGIA 2GDZA 2OZPA 5DBGA 2XAAA 1ZK1A 3OQBA 4WCFC 3LC7O 1PJSA 3DC2A 1ULUA 2GZ2A 3MCVA 2EW8A 4XR4A 3F46A 3H9EO 4NDNE 2E49A 4YCAA 3L6EA 1MC5A 1MFZA 3AM4A 1M66A 1LLQA 4I8XA 1N92A 5I9LA 3RU9A 1VKNA 3H65A 2PNFA 3VPSA 4OAQA 4MVJH 5GZ1A 1TEHA 2P5YA 5DN9A 2VUSA 1SEPA 3EUWA 3F6YA 3NGXA 1HZJA 5DT9A 4UVIA 4O5OA 5JMWA 1DAPA 4J9UE 4U7WA 2OMEA 1QG6A 2FPGA 4MP3A 2CF6A 3WJ7A 1WAMA 2NNLD 1JVBA 2OFPA 4CMAA 3QHAA 4L8VA 3BMQB 3ZWYA 2VQ3A 4RQTA 1WW8A 2D3TA 1WLYA 3GG2A 1H6AA 2V65A 1PR3A 3RU7A 1OC2A 1V35A 3UGKA 2DFVA 1WMAA 2FR0A 3GC6A 4INAA 4C7KA 1DPGA 1E7YA 4LRTB 4GWGA 1DJQA 3KYDA 1JN0A 1A7KA 3DTYA 1Y1PA 3V2HA 5K6AC 1K6JA 1LDGA 1ML3A 1KIFA 3A28A 2IDZA 2Y99A 2VCYA 4CMEC 3I3OA 5TIIA 2NSDA 1IHXA 4R69A 3ANMA 1SB8A 3VC7A 1FJHA 2JKVA 4D41A 1UXGA 2GR9A 4RORA 3LT2A 1MG0A 2G82A 2O3QA 4TRJA 3CH6A 1DIGA 4JXKA 5KJEA 5B4VA 3TJRA 5HS6A 2NM0A 4LVUA 4J7UA 1HL3A 5ITVA 4WLNA 3VH3A 2NVUA 4URFA 4B7XA 5JDCA 4KDFA 5H83A 3WMXA 2BGMA 1WVGA 1XHLA 3PGXA 4RF2A 3C1TA 1XIVA 4YJFB 3WBFA 1EE9A 3F5SA 3X2EA 1B26A 2CVZA 2HCTA 4Z6KA 3GPDG 1LBEA 3ICCA 3DZGA 3R0IA 4IMRA 4XQGA 4B79A 4D44A 1D1TA 5JBIA 4GBJA 4YA6A 3ZGYA 5IDXA 3OM9A 4BKRA 1ZMOA 1QORA 3QRWA 4AJEA 4BNIA 1HTBA 4PG5A 3GVPA 3D7LA 2PH3A 4FJ0A 3S2FA 4J4TA 1YDEA 3I9JA 5EN4A 1HEUA 2BMAA 3VDQA 3K8ZA 2FOIA 3DOCA 4I9NA 1RM3A 1Q0QA 4JN6B 3O38A 3EAGA 2PGDA 1YJQA 1Y7TA 3N74A 4U6QA 3VTZA 3DAFA 3ROPA 3BMQA 3W4IA 2VHZA 4EJMA 5HWSA 1HETA 4A26A 1I3NA 1LDBA 5JPIA 3WQQA 2ZTLA 2XF8A 4TZKA 4CLOB 1Z75A 3K92A 3UOGA 3PYXA 2DU8A 4E2WA 1MXHA 1E7MA 4WK6A 4ZRMA 3FTNA 3NTOA 3TZKA 2ZTVA 4MDHA 1HE5A 5T57A 4NH4A 3HFSA 3MOIA 3I9NA 2C29D 3TPCA 1NFFA 1R12A 4GSLA 2EIHA 2Z1MA 1IPEA 3H2SA 3ZWVA 4CM9A 1JAXA 3JQBA 2GYYA 1QXSA 3HZZA 3DB2A 4FC6A 1A4IA 2NQTA 3H9JA 2VTEA 4DLAA 2NACA 1CRWG 3AOEC 4FOSA 4UREA 5CEEA 4CMGA 5K9ZA 3IKVA 2X4GA 3KETA 1N7HA 3B6ZA 4FDAA 4YJFA 3TL2A 4FIZA 4E32A 2FN7A 4JROA 3ST7A 1HE4A 5HM8A 5FF9A 1MUUA 2QRLA 4AJNA
chains in the Genus database with same CATH superfamily
1YQTA 4CKBB 1CR6A 8GPBA 1UM9A 3VC1A 5JSHA 3RS2A 3LT0A 3CF6R 2CNLA 3FUWA 5MFZA 3FPGA 4UVHA 2AN1A 6LDHA 1RI2A 3E22A 2FUCA 3KYIB 1OT5A 1FU8A 5HYVA 2VFAA 5E6SB 1RI1A 5CAEB 4BTEA 3DOJA 5BPHA 5A4KA 3WYCA 4G0XA 5LN1A 1U80A 4PXAA 4HT3B 5BQ5A 4LJKA 5B6JA 3NUZA 2I4NA 3VU3A 1G8MA 2VH2A 3KHSA 3TNYA 1FBTA 1SOUA 1C8VB 3C70A 3OHPA 3PB3A 1JJ7A 2DTXA 4H0CA 2NX2A 4UEOA 3U39A 4ERNA 1NNUA 2JC3A 5K6TA 4EAAA 1F06A 1V37A 5LB4A 1KQFA 3D1JA 3G9QA 3KJQA 4GU5A 4HGRA 4RJJA 1E3MA 3HRIA 1TLTA 1L4LA 2QUIA 1USIA 2HNAA 2ZE7A 1PEKE 1XZBA 3PR3A 3ZGOA 4KVGA 4R16A 2DY1A 2DT5A 1ULZA 3IRVA 3RJMA 4CR8A 1ZHOA 4IXWA 4CLOA 4Z4IA 5G53C 3T1TA 4YRPA 4ECEA 3FPFA 2D1YA 9ABPA 4JP2A 4U2BA 5FORA 2ATXA 2EZ4A 2YBEA 2VAMA 2F1OA 1HBJA 4XFJA 3V1YA 4PG7A 3PLNA 4DWJA 3QGMA 3QX3A 2QJWA 1DKLA 4OHWA 5KPJA 1N6LA 3JD0A 3WYAA 1R0LA 1LX6A 1CR0A 1XG5A 2MWMA 5F1OA 4YMTA 2BHTA 1FVFA 1L9KA 3EPRA 3G0DA 2JVIA 2KI5A 2X6TA 3KB1A 4O4HA 4ZVLA 5J40A 2W6MA 1ZNWA 2VRCD 3TAHA 2O2CA 1ZUNA 3PQ6A 4MUHA 3NO4A 4OKNA 1NGSA 2ZKLA 1MPTA 4QUAA 4XYBA 2XH8A 2XODA 2PQ2A 4JEHA 3ZLBA 3H11A 2WJYA 2QQGA 4CMEA 4P0PB 3QXGA 2GTHA 4ZAZA 1BCRB 1E60A 2UUBB 4W1QA 2OD7A 1EGQA 4WZBB 1ORRA 4RPLA 4X45A 1CQJB 1PSZA 2P4UA 3H2KA 4O5AA 1CZLA 3QVMA 4GYJA 4RZ3A 4XQ9A 4B3JA 4RCVA 1Q7BA 4XOIA 3CONA 3LHDA 1PNTA 2VOJA 1X1CA 1ZD4A 3I2FA 1Y80A 5TGTA 4TS1A 3FCCA 3MXTA 1RU3A 1U02A 4TUYA 3D3WA 1KI2A 2ZR0A 4JGBA 4DQVA 3AVWA 1OXMA 2L2QA 2VZ8A 2DH6A 2C5GA 1D5WA 2MSKA 1W4ZA 3AXTA 1JP7A 1L5MA 4HB0A 3ILHA 3AF0A 3OMLA 4OLBA 1VPVA 4HN4B 1R0SA 4RQAA 3L0OA 5L7YA 1XKLA 2QTRA 1NULA 2VJMA 4XSHA 1HFEL 5A5FA 5J47A 5E1MA 1GARA 1Q2XA 2FNAA 4KKVA 5LL6P 3BKWA 4I4TA 1IEVA 1SVUA 5DW0A 5JANA 2NP7A 5M3BA 2WUWE 4HBZA 3QLUA 4PLTA 1ZYUA 2CUKA 1VHLA 2PLWA 1IN5A 5CUQA 1A88A 3W2TA 2XYHA 4XB6B 1EM8B 2CCJA 5TPZD 3SYNA 2DHCA 3CE6A 1OI7A 4XVQA 4XDGA 3GU3A 3PFNA 3T7EA 3UTCA 2P9FA 3JPYA 4BJ5A 1TUEA 2QZJA 2NO7A 1SM4A 4FUQA 2HB6A 1BXGB 3KJIA 2OTCA 1Z34A 4UOEA 3ODGA 4WMLA 2I03A 5I7EA 4CQMD 1FBNA 5H68A 2HA6A 2C2GA 3SHVA 3DP9A 2PGAA 4MQUA 4F5EA 5IFLA 4HDSA 2ZYSA 5DEIA 4ZANA 5LQCA 2ST1A 5JS8A 3KPJA 1AMNA 5EWJA 1CJMA 2H5EA 4ON9A 4WWHA 2VJCA 3OEED 1MJGA 2DAPA 1F1JA 1H1TA 2JFQA 1EBUA 3G2NA 3MJEA 4HLDA 1JNYA 2Y6UA 4I7EA 4UEKA 3WOVA 3NUQA 2B21A 4CIAA 1XDUA 4W1SA 3F5MA 4ENRA 4E7OA 2J7KA 2VHXA 1PUJA 1IG0A 1F9AA 4RK5A 1YKSA 1KYTA 2DFLA 1XZJA 3R5FA 3VO1A 1V43A 3L1IA 1ADGA 3CLVA 4ALMA 2JHFA 4D2IA 1VSQA 5EE0A 4G0PA 4BNNA 1B23P 5F4ZA 4OXNA 4HX9A 4BX0A 3ITEA 1QB8A 2D6FA 1EX9A 2I6GA 3MJFA 3N0VA 3PGMA 4IMPA 4JLNA 4XCQA 4D3FA 1QTIA 1N2GA 1GQQA 2CDAA 4X6YA 5COQA 5KYXA 2YR0A 1HQYE 5AJZA 1FU7A 2JIMA 4JBXA 4OJQA 1O94C 4QUGA 5D3ZA 1P7WA 4YWHA 1K75A 1CUGA 3QH4A 4MV5A 2X8AA 4RHCA 1Z0AA 2VLBA 1YZHA 2YN2A 1SQGA 3NC1C 2PFGA 2C5LA 3DL7A 1T36B 1O08A 2V3VA 3N5CA 2OHHA 4FX5A 2A1IA 1RP1A 1UT8A 1CR4A 4N47A 5K03A 2JFNA 1GQRA 3TG8A 3TEJA 1UDRA 3N0RA 3NDJA 2J3MA 3HC7A 4EB6A 3C7CB 4X92A 1HY3A 3PQ3A 4XCVA 5L3VA 1PJAA 4C5AA 2J5RA 4FM9A 1XL1A 3K9LA 4PZ9A 1RD4A 4LRWA 4DJAA 3IKTA 5JAMA 1D7AA 1K08A 1BYIA 4WECA 2Q5JA 2X4DA 5AVJA 1LI4A 4QU8A 4TSKA 5KHOC 4EGQA 1F2DA 5KNBD 3TQTA 4EUHA 4YBZA 5FTLA 1ZOSA 1YKGA 1ONBA 3MRTA 1J8FA 2B1QA 2PVSA 2FFBA 1NP3A 2EATA 2J3JA 4GW3A 1MDBA 2G88A 4URUR 3UJ3X 3T7RA 2BKUA 1FXWA 1VJTA 1DG3A 4RM3A 4F4CA 1Z4QA 5TEVA 1K98A 4J3FA 4FN5A 4NL4H 4GMDA 3JYPA 2PKXA 3RREA 1N75A 2AKYA 2MJLA 5SZHB 1COWA 1RCTE 1UPCA 1DARA 2W6OA 3D59A 3LPLA 1C0LA 4EKGA 4IGFA 3WOHA 2ZJ5A 1AHNA 5EE5B 2FP4B 5HJ2A 1CJSA 4QBKA 3ZCTA 1SKQA 2Q6IA 5J1SB 4BMPB 3RU3A 1H2FA 4JGIA 3MRSA 5EFOA 5FUMA 5K05A 3WWEA 2C7PA 4NNJA 3FPJA 4GKKB 3PTZA 5JLAA 1ZMBA 2HW8A 2XMCA 3PC3A 1QC5A 1H22A 4J16C 4Y2YA 1WW3A 4K6MA 1DTEA 4FFVA 4BVBA 4RDXA 3LI2A 1PT5A 1YAHA 4UCWA 3SZRA 1JMYA 1E94E 2CVHA 2I3AA 3FGZA 4M9CA 4WNAA 4PN3A 2WF9A 4G8BA 2NO5A 3TCKA 1DJNA 3RYCA 2R1ZA 3K71B 2OC4A 3WIVA 2QG6A 4DLSA 4QD3A 1BGVA 4QGBA 4XJVA 6GPBA 2XLBA 1LKZA 3IP3A 1JKJB 4N5LA 3HFGA 5TMBA 2OG1A 2B98A 4OFBA 2UUAB 3RODA 3PHCA 4KDCA 2ZQYA 3GBPA 4Z0PA 3PIDA 3TZHA 4AB1A 2VAWA 2YWEA 3I6BA 2OCKA 3WGGA 4I1SA 4N5HX 1GDDA 3PKJA 1U90A 4C07A 4BVJA 3PNBA 5DNCA 1JHQA 3SI7A 2ZBDA 1QQTA 5JJIA 3B7PA 1ZGAA 3UMCA 1JS1X 2IPLA 2VZ9A 3O8QB 4R6WA 3UT5B 4NOLA 4NU0A 2YJZA 1SC3A 1KVUA 4TZ6A 4ARSA 2GJ9A 2B4YA 1IDN1 2IPXA 2NPOA 4OYHA 5KCZA 1J2TA 4RQUA 4XYGA 4IDAA 1XCJA 4YGYA 1CRQA 1RP7A 1VE3A 2C2YA 2HK9A 3OX3A 3O7WA 3V42A 2DBYA 3C5CA 3V7WA 5TB5A 2ZYIA 3PXDA 3WDLA 4JYPA 1HSOA 1MU0A 3D8RA 1FMJA 1FFSA 1V48A 3Q7QA 4BV3A 1WHTA 2IXAA 3KHUA 1FRQA 3GLFE 3FYTA 3SS7X 2YFKA 3ONEA 4OGKA 4WK2B 1NAHA 3QLTA 2OO5C 3HY6A 3CX7A 4OQMA 3JAMA 1DUVG 4H35A 3F49S 2GRAA 3Q6MA 4FK8A 1F8GA 1YUMA 3JQ7A 3UMRA 2XUFA 1KZ4A 4DT1A 4GICA 4I9FA 3S7TA 3WLPA 3IT2A 1YSCA 2BL4A 3E7FA 4KWTA 2TRSB 4WKBA 1G4AE 2P2DA 3ACBA 3G13A 5TVKA 4D7AA 1OZFA 4JYAB 2BELA 2HSJA 1U7WA 3DE6X 4INZA 1NZFA 2Z8YA 3IPXA 3LWZA 3WR5A 2FDRA 3PX7A 4JI0B 3K7EA 3MTGA 2ZJ3A 1EEHA 2HMVA 3HSKA 3TVDA 4ZO9A 3TGLA 4WNYA 4IJMA 3DH0A 2ET6A 2K7ZA 1AQIA 1QR6A 3AYXB 5CVCA 2BFFB 3RV3A 3CE9A 3U9SA 4EMSA 5A1JA 5JZVA 1SHTX 3DOIA 1R6TA 3OIVA 1BDIA 3M6XA 1QOZA 2V8OA 5SICE 4B47A 2GK7A 3B12A 1JFFA 1H9AA 4BO9A 1IUPA 1VYTA 4RY9A 5A0TA 1OFIA 5FOXA 2VF5X 3S2IA 4Z9AA 4AL4A 1T43A 2IS4A 4XM1A 4CN8A 4ZYYA 2GCOB 5TV2A 4REMA 3VOTA 3DEZA 2E6KA 4YUAA 4JI5B 3VPAA 1BW9B 4KQXA 1Q3HA 3JQ8B 4Y2GA 3FFWA 4BJHB 2MMGA 1XTKA 4BQSA 1Z6ZA 3VOSA 1FUUA 4EDFA 4EW2A 4FFRA 3F3KA 5KU7A 3DDUA 3W4JA 4RY0A 4DLZA 5DASA 1L5FA 2WFZA 5CXSA 4HAXA 5JHGB 3ORRA 3V1LA 3OC6A 2ZPTX 2HA5A 3GFBA 3HVHA 3OPYA 1RXYA 3DBOB 5JNLA 1CEEA 4KXMA 3GFGA 4I3HA 2R79A 3NTQA 1TC2A 4Y2TA 5CX1B 3C7AA 3IESA 4ZAGA 4C4PA 5EHZA 5GZ3A 2DB3A 2P62A 2EHJA 1WBDA 4BNGA 3KSUA 3ZWXA 5ALEA 1U8EA 2O2DA 2JZCA 2CHUA 3I9LA 2D1QA 1DAEA 1OH6A 3MQFA 4K86A 4YRDA 4LJ4A 3VPXA 3RS0A 1YC2A 3TW8A 3UMGA 4EECA 1YR8A 5EI5A 5K99A 4L9AA 5IVHA 2YXDA 4JVLA 3CUWA 3MSCA 5AHOA 3P8ZA 5E7QA 2A4KA 3RRMA 2ZYWX 3T54A 4UUMA 2B9EA 1YASA 1ZAKA 2YIVX 3I0MA 4OBEA 1I9CA 3CEAA 3P0EA 4KHZA 4IIHA 4HB2A 1XRQA 3NYIA 3R5SA 4UBKA 3E2PA 1DJPA 2HBQA 2WSMA 4LQLA 3F5FA 1Z7WA 2I8CA 4TLCA 4AY2A 2J9FB 4FYKA 1B0UA 1LK0A 4FZVA 4ABTA 5GWXA 4NCBA 3R3HA 4NEHB 3R24A 4DUZB 4YCMA 3HWSA 3O94A 3FOWA 1GZ5A 1E92A 3AWIA 2PBZA 3MCZA 3HYSA 3RF6A 4IFBA 1EFAA 4BKMA 1XZGA 1ZFNA 5L3QA 2R6GA 1J8MF 3NP9A 4HAIA 5GM1A 4CV0A 2C42A 3ZCSA 1THGA 3K1AB 3L8GA 4Q1BA 5JI3E 5H81A 4CU5A 5FEUA 4H60A 4KO2S 1NE2A 4BQRA 1V7QA 1YQDA 3IAEA 2X8JB 3QVVA 1XJ5A 2IQIA 3H13A 4RK6A 1N2JA 4A5OA 2NVOA 2LZ0A 1FMTA 3CIFA 1I30A 1KAHA 2I4MA 3R7NA 3E7XA 2JLBA 3ZHTA 1U7HA 3CF4A 2AI2A 5AR1A 2QBYB 3DE5X 3NLLA 4KQJA 2A3RA 3JYNA 1H85A 1YRLA 2JD1A 1VE1A 3DM9B 2CSXA 2GMWA 1BGXT 1H8EA 1NN3A 1QCZA 4MTCA 1X80A 1U8ZA 5B3LA 4BNTA 2G0TA 5L3SB 1VHDA 2OGWA 2PEYA 1L8LA 4E14A 4LFAB 1W8DA 2ISQA 3OPMA 3LHIA 3BB4A 4XIYA 3FETA 2WNIA 3SZGA 2GUGA 3K1TA 3VPFA 1H4VB 1JR3E 3DNMA 3F4LA 1LSOA 2EX1A 3C6KA 4R01A 3BXFA 1MO3A 2XB4A 1XDDA 5DYNA 2EQAA 4E3ZA 3AU8A 1DAIA 1VPEA 1SUFA 1KQOA 1YQEA 4H7DA 4U6NA 4K1XA 4YRSA 2L69A 2FW7A 1C0EA 1UL1X 3L6DA 3QU4A 5TMPA 3L43A 2RIRA 4LSGA 3J7AC 1CQZA 1Z5GA 1PFYA 1BS9A 1XAJA 4U2DA 1FZQA 4YJ3A 5ALDA 3PCXA 4P36A 4DHWA 2EKQA 1W1UA 2G8NA 2ZT8A 1W0KA 2JGKA 2WYHA 3JAKA 3OM8A 1EJ2A 3N53A 4M87A 2SCUA 4O4HF 4PZDA 4RH3A 1O96B 5BSMA 2YOGA 3LGSA 1PQPA 4AY6A 1GNVA 1J00A 1SNYA 1AQLA 1SUAA 2QJTA 1E9DA 1V95A 2G63A 3C3XA 5DISB 3F1KA 3ZE6A 1DDOA 1JV2B 1Q0SA 2Y9MB 2P1RA 3S1SA 5B64A 1KZ1A 1DDGA 2PL3A 2J9RA 3V4VB 3NDPA 4S1NA 3BE6A 4FEGA 3GJ3A 2YWJA 5D3MB 1ABBA 4L4YA 3THYA 2IEZA 4MQBA 3ZU6A 3JQRA 2AN5A 4N0DA 4PLCA 4ER5A 4TYPA 1BMDA 4AZ3A 1F3LA 1XROA 3LUGA 1B43A 1N6NA 4TKZA 5JY6A 4JB3A 4UUOA 3KS9A 4HWOA 3RVJA 2EQ5A 2X7XA 4TUYF 1VMAA 1E5LA 4OCZA 3C6XA 4PBTA 1V26A 2IT1A 1MIOA 1IY8A 1PR5A 1ZRNA 2ZB2A 3GJYA 4GX1A 4M0PA 3D8NA 4WASA 1NKVA 5EGNA 5SZKB 3TM5A 4N7JA 4JV5B 3V46A 4TV9B 5AKJA 1GAQA 4AO6A 3W9UA 1ESDA 1M7BA 1QYCA 3FW1A 4MJXA 1RHUA 3F7MA 1WO8A 4NYMR 1PP4A 3GEMA 1YKFA 2Z1NA 3N86A 2IYLD 3SHQA 2DYKA 3HVRA 3PZBA 3DDSA 4MRPA 2VDKB 5ER6A 4DG9A 2PL9A 4COKA 3HKDB 2QD2A 3I23A 3DDWA 4I4TF 4N01A 3HR4A 2GXAA 1X87A 1OLSA 4KUEA 4QPNA 5B58T 3FDXA 4MWZA 3TOXA 4FYVA 3MNFA 4F21A 1SVMA 1VM6A 3H2GA 4RV5A 3FVTA 5JDIA 3L1JA 5C81A 1WCIA 1WX1A 4FFMA 5AI8A 1PJLA 1MGOA 3QF7A 2D54A 3RU2A 3B6MA 1IU9A 2Q7DA 1J2JA 1KZGB 3ADBA 2YKGA 2NO6A 3RSGA 2XDQB 1X7ZB 4TLEA 5H82A 1JQEA 3AF1A 4N7MA 4G4GA 5E9WA 5BSVA 1J0AA 3WL8A 1X6VA 5IYZB 5G0VA 1V4VA 4UHEA 5ALYA 3A1WA 5E7JA 4MYSA 4EW3A 4H0NA 1A69A 5CYOA 2E55A 1Z2EA 2Y67A 2Y6VA 5DLPA 1BOFA 4BLQA 3CSDA 3VMMA 4J49A 4UJ3A 2R0QC 1B8VA 4NCHA 4U00A 2FWAA 1MDFA 1EEXB 5CA0B 3ACCA 3LCMA 4HH1A 4EH1A 4LEIA 4IDGA 4UOZA 4DQ0A 4MR9B 3SFVA 5JCJA 2X9QA 1X2EA 2H18A 5FTWA 3MEQA 3ND6A 5I4BA 5JAUA 2QUZA 5JAOA 4PAOA 3TRHA 1MB4A 2HX1A 4AP6A 4ANFA 2JIPA 4EB8A 5SZJA 3H6GA 2R8XA 1TCVA 2DZDA 1INLA 4L3WA 1QFJA 2JGDB 4FZ5A 4JJ8A 1KAQA 1O89A 2P0EA 4BVKA 5ELLA 2GN1A 2PQ6A 5LMNB 5B6PA 2DWOA 4FUTA 4IQGA 4U7HA 3KJFA 2PWAA 5AJHA 1ZMXA 1YS9A 3UK6A 1ZH4A 3HK2A 1A5SB 1BX3A 1OFHA 1NW8A 4G67A 4K03A 3V6MA 1GAEO 4LGMA 4JUIA 3OUTA 3QHPA 4PRZA 5IKMA 2R1UA 3EC7A 5HFNA 5JADA 5EQTA 2WF6A 3C3AA 1M6YA 1C81A 1NOJA 5AP9A 3ZY6A 1EIWA 4ZK6A 3ZVMA 4EHNA 1RYDA 1II9A 3F74A 3OTGA 4WBSA 4M1ZA 1XN4A 2WP0A 3KQSA 4HCJA 4RA6A 3PT9A 3Q7PA 2I6UA 4Q3AA 1BVYF 3MRVA 3ZU4A 3L7KA 1AOXA 3AXSA 1YH3A 5D1NA 1U3CA 5GOTA 1G21B 2ZT5A 3AFMA 3GX1A 5E6UA 4W9NA 1G8GA 1REQA 3F5DA 3O4VA 3ZBQA 2Z9BA 4NMLA 3RYIA 3TQFA 2ZWVA 4GI3A 4G8JA 4ETWA 3U49A 2BC9A 5K01A 4HPJB 1CUJA 1KXJA 4OM8A 2ZBFA 1GPJA 4D81A 4BFTA 5I7FA 1WW2A 3L2OB 4RPHA 1W87A 4G5OA 3NAMA 1Z33A 2CLIB 4Z8YA 5FBHA 1C5KA 2ZBGA 3GRZA 3IA7A 1A7JA 3IKMB 4LJSA 2RC5A 4CR6A 2GF0A 3DV9A 3ORFA 1FXWF 4RLHA 4TMWA 1W6UA 4K6FA 1B8OA 1LRKA 5CVJA 4Q16A 4DMMA 5KREA 3H5NA 4AUKA 2F2TA 2YV5A 2DHDA 3CRQA 3VU9A 2PA3A 4YFVA 4EYGA 4JXJA 1UC9A 2ATIA 2W2KB 1RDFA 4UBOA 2O05A 2P6UA 3BD6A 3R7AA 1W44A 3K96A 2LCQA 4KV9A 2ZSBA 2YZ7A 5K0CA 4M8KA 4P98A 5K4GA 3DWFA 1F4PA 2YICA 4XH9B 2WUFA 3OPVA 1PFUA 1NXWA 3IEPA 1APBA 3SDSA 1EFTA 2HSWA 5BMVF 5JY1A 1UT6A 2AG1A 3DZDA 3A4YA 3QQPA 4KZPA 4UHJA 3RFVA 1MB0A 4M83A 4BEVA 4EGFA 3WK4A 4HR7A 4Z0TA 1M8FA 4HQ6A 2RG7A 4L02A 4ZVVA 5A6SA 1O0SA 2Z58A 2N9UA 1B3BA 2HQSA 4CM4B 2P3QA 1AN0A 3OZSA 4G0UA 1IM2A 1KMCA 3L4JA 4CV1A 1CZNA 3K20A 3OQ1A 5L3ZA 3RC9A 2XMZA 4A0RA 4KMMA 3AWDA 4MW5A 4IDQA 4V0QA 1QNLA 3A4IA 3AO0B 4ZT2A 5JW6A 5BNZA 3ENWA 2Z1DA 4X5OA 4Y6QA 3D6HA 1M8KA 4UTXA 4W99A 2PE5A 3PRKE 5DHRA 4P8RA 4CRWB 4DA7A 4TYYA 1L4HA 3IP6A 1H2WA 1K5PA 3H5VA 4OXXA 4UMVA 4F12A 2Z6UA 1M1YB 1U28C 4LZWA 1Q14A 1KI3A 1S2IA 3OC0A 1DHRA 4FOLA 4WADA 4BNZA 4IO1A 5ECYA 4JELA 2C5FA 2Q0SA 1A50B 2Q2QA 3SVLA 4C43A 3OZVA 1L5WA 1SU7A 3H84A 1I14A 1UZMA 2GPWA 1E2FA 1OAOC 3U7JA 3ZI7A 1MW8X 4LY6A 4CEHA 4TVBA 1Q1ZA 1PG5A 1QS0A 4F4HA 4PZEA 4AS2A 3QLEA 3QVJA 1PV2A 2XQVA 3EWNA 2F3UA 3B60A 5IG2A 4MH0R 1AUQA 3ZDCA 3S2SA 4BLRA 2J0QA 3AY0A 2BEKA 4DRXB 2VDOB 2Z2YA 3FNBA 1QR2A 4RAOA 1ZK2A 1NVXQ 1QYDA 3W8FA 1DCMA 1RYNA 3BK7A 2TMDA 2CFSA 3NTLA 2DE0X 1PKEA 3ABQB 3W5AA 2FMHA 1WUYA 5EIBD 5C5CA 1GM5A 4X84A 4AKTA 3WJ2A 2RGNC 4KSBA 1UPAA 3KVOA 3OEHA 3TDNA 4Q9LA 1U3WA 5JNSA 2VWHA 1RPZA 1EHYA 2C94A 4KMSA 4YP9A 1SIWA 4RMHA 1XU7A 2OAEA 1T2AA 2D74A 3P2JA 1ZSVA 1BXZA 3TQQA 3CRVA 1YU6A 4RPIA 1M2FA 1JZTA 4LC1A 5B1YA 3MJRA 1V9SA 3BGWA 2RJ3A 3JQDA 1M2VA 4TKUA 3K70C 4NQRA 1RKUA 4K6OA 3HJUA 4C0WA 4KNYA 5I47A 1UQRA 4QYSA 2C2KA 4PHTA 3DV0A 3DS8A 4JWKA 4X1YB 5EKXA 2JI8A 3GJXC 3OD5A 4YRTA 5J43A 5KTOA 2PFKA 4D57A 5C35A 5KC9A 2GEDA 1B3RA 1YCHA 1PL8A 2Q0QA 1V2GA 3QY0A 2WMDA 4GLLA 3KFLA 3VU1A 1JEYA 2F9MA 1M1XB 1OFUX 2JFGA 3EVEA 3OSUA 3HJAA 4UM8B 3L4BA 2IZ7A 1KZYC 3IUYA 3F90A 2OHXA 5DBHX 2FUG6 2HRCA 1NX9A 1XRJA 5D7NA 4RTPA 2ASVA 4HMPA 4Q0MA 1BVHA 1CJCA 3TD6A 1S02A 4G3XA 4Z49A 1QFYA 1R9GA 3VC3A 1ZY2A 2CXUA 4BB0A 1ZXXA 1H6CA 3N6VA 4MGHA 3TW0A 3FCAA 3PNQA 1RZ3A 3MC1A 3B51X 1UBCA 3CG4A 3Q3HA 1E3WB 4YYEA 2WD9A 5BO5A 1BU8A 2IYFA 2D00A 2Q6VA 3MTBA 3TWOA 1R4MB 2WHQA 2QUHA 2WWGA 4DQUA 1Y1LA 2J5QA 3CKYA 4IIGA 4JBIA 4LV6A 1U8FO 3UPDA 3OETA 4HYTA 3ZHRA 5EZYA 1RJDA 4JLKA 4RBNA 1JEJA 1EZ1A 2ODBA 2YJ3A 2HDOA 3PGJA 5LM3A 1KFBB 4KUHA 4Q15A 4R1NA 1DO0A 1WKBA 1XHFA 2YWRA 3LWDA 3NHMA 1F1BA 3A1NA 1TMKA 4FNAA 4RA9B 2PKWA 4A9AA 1HLFA 3I4CA 1PJ2A 3ZE9A 2W4MA 3LDFA 3H83A 1KAGA 2WKWA 1UJMA 3TW8B 5ENDA 5LJIA 2ZIVB 2X7JA 1WOYA 1URPA 3O9MA 1COWD 4E5YA 2GOYA 3DAOA 2DH5A 4RS4A 3H5OA 3ZUGA 3LJKA 4M9UA 2VXCA 3NG1A 5KVCA 5G02A 2PS3A 3O1IC 2YFYA 4RF4A 4RWZA 3DAGA 1GUBA 2K5UA 5EHGA 3H8VA 3IMGA 3JZFA 3WYBA 2PUTA 3TYXA 2A1TR 2E48A 2KYRA 2MSEB 1UK8A 4IV0A 3TLCA 4A3SA 2BUCA 2RONA 4QBTA 3R6DA 1MW9X 4IZ6A 1GWNA 4JEUA 2MOKA 2VL7A 2BDTA 2YNMA 4Y1FA 1TAGA 1M1UA 3HU2A 3ZH2A 2IVFA 2WTBA 5AJWA 5L53A 4NPHA 4ZALA 1DEAA 2JLXA 3JWPA 5LKRA 1NVBA 5JYDA 4EGSA 1V8ZA 1YI1A 2AF3C 2XT9A 1V6CA 3L41A 4JVMA 5LQJA 1RXVA 1M5RA 1JVNA 2CCGA 3ONNA 2E18A 4BE4A 3OLVA 4MIYA 1GYPA 3AHIA 2IV7A 1DIBA 4BP9A 5C46F 1GY8A 4H1WA 2P75A 5DHSA 5DTEA 3LRTA 4AN1A 4CI9A 1CS4C 3LLMA 5D01A 2WMOB 5HXAA 3DJFA 1AZSC 1NVEA 4GX5A 1L1QA 4QECA 1PLJA 4RCYA 3KQLA 3EFBA 4AKSA 3A6ZA 3RG8A 3AW9A 4PAWA 4XGKA 1KL7A 1L4GA 4RY8A 4BRSA 3PXXA 4CKEA 2OUKA 1AZWA 3DTNA 2KMLA 5CU7A 1U3DA 4KUGA 1NBOA 3LDAA 3W5VA 3WWPA 4C88A 2FW6A 5A4JA 3P2MA 3LL7A 4N8SA 1T3LA 4ZDIA 3H0CA 3FZQA 3MUOA 4M53A 1FP2A 4TROA 3PVCA 3W79A 3D4PA 3JD2A 4AZTA 5ICCA 1LWOA 2X7HA 1JEEA 2ZRNA 2QYSA 1N77A 2FZVA 3FYHA 3FR8A 2GD0A 2IC5A 3UAXA 5IHPA 3EXG1 2Y1GA 3GB9A 2XUJA 5L4LA 2CV2A 4FFWA 2X9GA 1CUZA 1WNFA 5EPEA 2P4QA 3KJGA 2CUZA 4E4TA 4EG3A 4FFBB 4ZGWA 1DE0A 1QF7A 2O7QA 3H9UA 5EKUA 3LIIA 1Y82A 3G2KA 4K3UA 1LQUA 3B2EA 4MQLA 3TQIA 3KKEA 2KS6A 1WY7A 2G9NA 4FX2A 2UYHA 1JJIA 2JLSA 5KNCH 4OP2A 2R5WA 3D0OA 2VDWB 1E1QA 2R4QA 3BH7A 2QVCA 1L4UA 5BN5B 1U1DA 4ZJZA 4NU5A 4EJ0A 4II7A 2D8AA 3PE6A 5IH3A 5ADWA 5AVYA 5I01A 3Q72A 3WRVA 3U56A 2CLLB 3CRZA 3GRPA 1AHPA 1NI4A 5EL0A 3TRFA 4UHBA 3PFFA 4J03A 4KBFA 1Q0TA 5AVOA 4P7KA 3OEWA 3GVHA 3V4OA 2J85A 4AXBA 1ECFA 2AOUB 5DRTA 5LUBA 3TFQA 4AUNA 3G0HA 2Q2NA 3EVNA 3WNBA 5DOVA 4LOKA 4OFXA 3WQRA 1VJDA 4DJTA 1R9NA 5JJCA 4IYRA 5LU8A 1IPHA 3AR7A 4RTQA 1EMDA 2DFDA 2IPAB 2JIQA 4EBBA 1O87A 3LPMA 4YGXB 3RSCA 5I7WA 4W5NA 4LMRA 1YB5A 1CLEA 3KD3A 1G18A 4FT4A 1OASA 3T5MA 3VO8A 3IEUA 2H17A 3EGEA 4CM8B 2OCIA 3BA6A 1KRXA 1X14A 4DMFA 3U4IA 4C7VA 1AS3A 2QF7A 4RTRA 3RT9A 1B6TA 4DTCA 5F9FA 3THXA 4I2VA 3GFRA 2ZITA 1P77A 4M0DA 1ODSA 1WZUA 1MJGM 2XMSA 3FFBA 3L6OO 4C4OA 5BVHB 4HDQB 4R8LA 4G5HA 1HR0B 2O7RA 4FKBA 2G6BA 1WMEA 1SPBS 1S3SA 1UP4A 3KT3A 4HNAA 4JLSA 5LYJF 3TNJA 2CT8A 1Y7HA 4A8JC 3OJ0A 1C14A 4H18A 4I5FA 4QPPA 3ROFA 2JIZA 3GLIE 4JP8A 2XA2A 4RS3A 4WN9A 1Q21A 2OKGA 2XUGA 3TIIA 5BSGA 2IZ6A 1P29A 1N6PA 4GPAA 1NVVQ 3DBIA 1VP9A 1C9DB 1Z4NA 1VTKA 1H0KA 1NKSA 3DVQX 3LIPA 3USCS 5JYBA 1ZKMA 4JCOA 1P2BA 1UJ4A 2CD7A 2WYUA 3A3OA 5L6MB 5ILOA 4G0YA 4DMGA 4HS4A 1Z73A 2R4UA 1VMIA 4BVFA 4U7TB 3GGOA 3H1EA 2LWIA 5CEFA 4JS0A 2B3DA 2Z5LA 1V25A 3P5SA 3D9QX 1L5KA 2AOTB 2XJ4A 1JG3A 4JL6A 2NYUA 4U2GA 3VNQA 1T2VA 1ZJ4A 3AI2A 3TQOA 3WLMA 1R0ZA 2H1SA 3ZD9A 5JMPA 1JDTA 1QJ4A 3D8UA 3RD5A 3ZD6A 2GCIA 3WSWA 2NUBA 1IQPA 3HCOA 3EHDA 2V74B 1HYHA 2GWHA 2W93A 5CT6A 6CHYA 5K0JA 2FUG1 1NWCA 3UC5A 2NXWA 2PKCA 3LUAA 1ISGA 2YJNA 1EINA 1K6XA 2C82A 2GI4A 3OQPA 5AK3A 4BUCA 1KVRA 1JA9A 3MMNA 2WFAA 3CH4B 1WUTA 2FH5B 2RBEA 5KWIA 1H8ED 3DBLA 1JFSA 3DSRA 3B5EA 2ZSFA 2JVKA 3L46A 1G1AA 2ZGVA 1HORA 4DFDA 1MZPA 4Z99A 2CMHA 3A27A 2FETA 2X2PA 3CIOA 1L4YA 4PC6A 3BGSA 1ILWA 5TNXA 3G5UA 3C8HA 4XWTA 4HAOA 2P6OA 5ADVA 3OLCX 3OIUA 1OR8A 4J6EA 3UK7A 5KDDA 4LZNA 4GNRA 2HFJA 3UCFA 3VSEA 5IZ4A 1SQFA 3EX7C 3EDMA 1Y4DE 1JLKA 4QXAA 1L4EA 4L5IA 3VH1A 4FDLA 3WGZA 4UFOA 3WV5A 4B46A 4CF3A 4GMFA 1PTJC 1NRJB 5HFJA 4QTUB 3U44B 1MO5A 4L16A 4G1UC 2OXIA 4B9EA 4PS0A 1MD9A 1W0KD 3PNSA 4GX2A 5HK9A 3SM3A 5IRCD 2NO9A 3EZXA 1QP7A 3LCCA 1M10A 1XEAA 1JLLB 4RACA 4WERA 5TQ0B 1S2DA 4R31A 1S2GA 3KZCA 5F9MA 3HPQA 2EC5A 4O4LA 1Z6XA 1IHYA 1P1IA 1S9HA 4OTZA 4XX1A 5P8WA 3ZV3A 4TMKA 5AKGA 2QVYX 3MF4A 4BFVA 4JI8B 5JFTA 2YMLA 2D5CA 4N8EA 3V2IA 3C7DB 3O47A 3KKLA 4EW6A 3DWEX 3Q8LA 1TT5A 4PXYA 3CUUA 3UXMA 1S96A 2BGLA 2GBLC 3QWBA 5HGJA 1P9RA 3LFUA 4HXYA 4ETNA 1KJYA 4PG8A 1CLUA 1A9PA 5AI0A 3DDCA 4JJEA 2G1KA 4B8ZA 1K2WA 4NCKA 2HJRA 1BMTA 4KRYA 1BN7A 5EQDA 4TZ0A 5CXQA 1CY1A 4BMNA 4PHFA 1MEEA 5FHRA 1DCFA 2ZE5A 2I2CA 4LBZA 3VZRA 1RRPA 4YQEA 3ZIDA 4YHBA 4F60A 3KEGA 3C5VA 1BNCA 1QFMA 3AESB 1Z4MA 4CF7A 1VJ0A 1KXZA 2HF9A 4EMBA 2Q3JA 1K6EA 1V3UA 1PZGA 3EZLA 5H16A 4IZHA 3UANA 2QVLA 3LZDA 4Y2SA 1WUJS 2QLTA 1PW5A 2A57A 5D6OA 2JGJA 2W98A 1C0IA 4P3XA 3NFRA 3K1JA 4UU8A 3NBFA 1E61A 1P8AA 1ONNA 1RLOA 2CFOA 1X9IA 2TECE 2D2VA 3G2HA 2QRKA 2ZJYA 3SIRA 2R3SA 1DJLA 4HWSA 5DIZA 2FJUA 3H5AA 3HJNA 2I1LA 3L7JA 4K6KA 3L0SA 4CEIA 1EG2A 1S4QA 1PDVA 1UWLA 3UMBA 4P93A 4YAUA 1B2LA 4OXKA 2AW3A 4CLRB 4UTNA 2BR4A 3H3JA 5JYCA 4ZVPA 5HF8A 1WDLA 1Y3AA 1Y8AA 4G5QA 1X8JA 4EPTA 2WU0A 1J7KA 1M6WA 2HF8A 3LT5A 3LU1A 3OZBA 4OJMX 4YS6A 3R6GA 2AG0A 4HNRA 5REQA 3ZV4A 3NAGA 1IHDA 2I7CA 3IIEA 4WOCA 5IF3A 2Y1OA 2C1ZA 4FHGA 2Q9CA 1O6CA 3C3KA 3SEAA 1ZVKA 1SBYA 5BWMA 2V7TA 3OG9A 2IF0A 2CNKA 2FEOA 5HIIA 4F93B 3F7NA 4IHJB 4ZDWA 5EXEA 3TPZA 2QRPA 5JXWA 5JCJD 4XQCA 2GN6A 2GDJA 2ZRGA 4MS4A 1VG1A 2UKDA 4NBWA 3J80A 4Q3CA 3B1ZA 3GR6A 3NVAA 1W46A 1D9ZA 1UBFA 4LV8B 1PJ4A 2PVCA 2WBLC 4PYJA 4WESB 1ZISA 4KK3A 1RBMA 2I7TA 4JAVC 5LXTA 2E5LB 1DDIA 1YV9A 1W2WB 1W4BA 5DHAA 5KSPA 4E5MA 2HQ1A 5FLYA 3V9PA 2F3RA 3WRXA 1MR3F 1J22A 2FUKA 4IDEA 1ZINA 3CZMA 3AUAA 3PPYA 4IFTA 4DR1B 3CLTC 1T6ZA 1L1EA 2DY0A 1KORA 1UCFA 4PPFA 4H7PA 3RT1A 4TV8A 5IBQA 3HRKA 3QE2A 3ZS8A 4Q00A 4NDZA 4UNIA 3AF3A 1JFLA 4GE3A 2N47A 2ZUTA 4EK9A 4AT1A 5HEKA 2RKWA 3OE5A 2JAXA 1Q50A 4IEFB 1X7DA 3ZWPA 5I8ZA 1XAGA 2VC2B 3FXAA 3GROA 2UYQA 4X66B 5FLXA 3IEXA 1ZOLA 1GPUA 3COZA 3DWGA 3WGTA 2XGJA 3TEMA 3VXKA 4ZHQF 1CG6A 3LDGA 1N1MA 1PFKA 2HA3A 4IQFA 4EA7A 4OK5A 1Y9EA 5C80A 4HGNA 3REQB 2RHDA 3QWIA 4D8TA 1P7VA 3MWYW 5DDIP 1QHYA 2ECFA 1U8UA 5EZYF 4DA0A 2CL6X 1N3LA 2I78A 1B15A 2AVDA 1KQPA 1YE5A 2B1GA 4XWGA 4BAGA 4XJTA 3HQ4O 2BMDA 5L6LB 3PNVA 1RZUA 2JASA 4G5SA 5BQXA 3BEDA 2GZ1A 3H86A 3QMPA 3AFOA 3HM9A 1IXZA 2D5LA 4U0KA 5DXJA 4AQ7A 5F9HA 2C1EA 3FNFA 1QHFA 2Q4DA 3EEBA 1PE0A 1Z08A 4DM7A 1Z16A 3FRIA 1XKQA 4KR7A 1F38A 2FK7A 2QQEA 1HM5A 3D5EA 4PLVA 2EJWA 2IA5A 1M33A 1GXSB 5KTSA 3E9YA 3UK2A 1UXIA 2Q1WA 1J8VA 1NBHA 2E3JA 2HC9A 1XVUA 4B6EA 1W36B 4MI1A 4F3TA 1L5ZA 2WMYA 4S24A 2VHYA 5DWDA 2C4KA 5LUAA 4Q4DA 1LLFA 2G04A 5B2ZA 2QG4A 3LKVA 2AZXA 2R751 1H23A 5B30A 2FV8A 3VSDA 4D80A 3EH2A 2GZAA 3KKNA 2C2OA 4NAHA 3O8CA 521PA 1E1LA 1Q95A 4H2DA 4W82A 5ALVA 4ZQFA 3NOVA 1U5BA 4LJ9A 3SJBA 2GYUA 2Z5GA 2BJHA 2NTYC 1V6SA 4PLGA 5G4KA 2NADA 2Q0HA 4PLYA 5BWNA 4V0LA 2XUPA 2ZIAA 3NM6B 3EVCA 4RXUA 1JSRA 1UBJS 4EHBA 2QTMA 3WBJA 4F04A 1PKXA 2JJ8A 3EWAA 3NT4A 3U7QB 5IANA 3FOCA 1YJCA 3RQIA 2ASEA 1G5IA 1C1DB 2ZK7A 3NATA 1R4NB 1YL7A 1XKXA 3PYLA 3RYHA 2WB2A 1SXGA 2VPPA 4MRRA 3FNRA 4P7BA 3VKWA 2GCPA 3A26A 4LJ8A 2WY2D 3RFCA 4RIEA 4IGKA 3PVZA 4ND8A 4I4LA 4F5YA 4F7DA 4YV0A 2E21A 1G20A 3LTEA 3KT8A 1T24A 3A6JA 4U2KA 1LRLA 4YAJA 3O83A 5EXXA 1W59A 3UXYA 5KTPA 1DTWA 1GNQA 2ANCA 2QVGA 3RDPA 3KYCA 3W2IA 4G09A 2IHNA 1IQUA 3BX1A 3ZE8A 1O57A 2JZOA 4K9RA 1K8YB 3IKJA 2FN4A 1KAOA 1UBGA 1USUA 3BICA 5J58A 5JCXA 4OI2A 1NJ6A 4FBMA 1TJ3A 2GEFA 5CH5A 1F7UA 2O8DB 4NENA 4EENA 1OFGA 4YRJA 3LCJA 5JPDA 3OX1A 4DRZA 3BDIA 1A9XA 1NJFA 3UYKA 4DAEA 4D9MA 3OWXA 3ILXA 3OI7A 1G8HA