3O4RA

Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
TRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase/reductase SDR family member 4
publication title Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 86
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o4rA00
1QYVA 3GC6A 4CLRB 4J49A 4OO3A 3MJTA 4EJMA 2FY8A 2P4QA 1YQGA 2ZB3A 4IGFA 2CD9A 1NBOA 5GY7A 2E6UX 3EUWA 2GASA 3F3SA 3JQ8B 1H2HA 4PLVA 4BNIA 5F21A 3EVTA 2WEKA 4AJJA 2HK9A 3AUSA 1ZK1A 3FI9A 3OH8A 1E7YA 2W90A 3RFVA 4DRYA 2HSDA 4YTEA 1X13A 1SPXA 2VHWA 1HDGO 4DUPA 5CDTA 2QX7A 4YT8A 4DMLA 3D0OA 3OIFA 3LK7A 4CLEA 5TT1A 1LNQA 2YZ7A 3WNQA 3L9XA 2BKAA 5DBIA 1MG5A 2I3GA 2VHXA 4IDFA 2X22A 4PLTA 4PG6A 4BB5A 1DIAA 2G0TA 1G0OA 4RL6A 5KJCA 1ZCJA 4JXKA 1HWYA 3U62A 1EFLA 4PVDA 4I5DA 4AJKA 4UVIA 1DFGA 2BI7A 2BGKA 2V65A 3H9JA 3WX0A 1GDHA 3B1KA 1EQUA 3JYLA 5CDSA 4Y6PA 2VTDA 1FDUA 3QWFA 3OP4A 4RPGA 4L76A 1Y6JA 1C1DA 3KV3O 1LA2A 3IS3A 5T67A 4BKPA 1E5LA 1ENPA 3QY9A 4RDIA 2C2XA 4B79A 3AW9A 1FXSA 4BNNA 4P8RA 1YL7A 5DBGA 2Y68A 3KXDA 3QHAA 2X23A 3INRA 3OQBA 4UULA 4WCFA 3N58A 1OAAA 1ULUA 2W2KA 2Y99A 3GPIA 4IMPA 4QFCA 2NTNA 5TC4A 5ADHA 3GEDA 1D1TA 1PGOA 5BQFA 3BMQB 1U4OA 2O3RA 3G0OA 5G2OA 5T6BA 3E8XA 4J2HA 3H3JA 3H3FA 4NJMA 1Y1PA 1MA0A 3KBOA 4BNMA 4RJTA 1L7DA 4YB8A 4NBTA 3GDFA 5BT9A 4U6QA 4OL9A 5L4SA 1P0CA 3PHLA 4FN4A 4EUFA 2GRAA 3C1OA 3ZW8A 2YDXA 5C7OO 4F46A 2CFCA 3FPCA 4BS9A 4MVJD 3E1KA 1UAGA 5CG2A 1FF9A 1A9YA 3BTOA 4ID9A 3C8MA 3PQDA 1HE2A 5JO9A 3TOXA 3F5SA 1QORA 2AEJA 1LBEA 2VYVA 4BQRA 2VTEA 3VTZA 1Z75A 4K1LA 1BXKA 3LU1A 1DC4A 1XSEA 3ENNA 4ND1A 2CUKA 2YHUA 1GUFA 1GQYA 3F47A 3HHPA 3C7AA 5ITVA 3SLKA 3BTUA 3BMCA 3PVZA 4XX0A 4XA8A 1ZKMA 2NV6A 4KWHA 4ALKA 5EESA 4Q3NA 3EK2A 2GDZA 1JN0A 3DZHA 1KC3A 3GVCA 4CM4B 4ZQEA 4QT0A 5COQA 3MJCA 3E18A 4FS3A 3GNTA 3N74A 1IOLA 1LUAA 1YE3A 3K2BA 2C20A 4JP3A 1PJ3A 4DLLA 4X54A 3ZV5A 3RU7A 3WGYA 4GSKA 3E03A 3HB4X 3EZLA 1WXDA 4HX5A 5FI3A 3ZU3A 4BUCA 1HZZA 2W98A 4P4NA 5CP8A 1OI7A 2E37A 1I2ZA 1MB4A 1N7HA 1VJTA 4MVJH 4CM7A 2GCGA 2NU9A 2W8ZA 4BO2A 1YOVA 2VQ3A 1YL6A 3UICA 5LDGA 5A05A 3RKUA 3WXBA 3F1KA 3ZWNA 3KEQA 3ZWCA 4NHEA 3ZH2A 4FJ1A 3TNLA 3RFTA 4YRAA 4S1VA 3W8DA 3FBTA 4NJOA 4OYRA 3RVDA 3KSZO 3GUCA 2C5AA 2X9NA 1XELA 3BYZA 4H15A 4OHUA 3ZU5A 2X9GA 5DULA 3IJRA 5ER6A 4WLUA 2H1SA 5G0VA 1QYXA 1PJCA 5KVCA 4J43A 1P9LA 2NWQA 3GZ4A 3IP1A 3WTBA 3JQ7B 3L6DA 3OIGA 2O2SA 3HDHA 5MGBA 4QFDA 4DQXA 3B20A 1DHTA 5AQ1A 3G79A 2Z5LA 3LT1A 2D5CA 1DHRA 3IUPA 3P7MA 1GD1O 2JCYA 4BV9A 4PN3A 4E4YA 1P1JA 4Z0HO 3IC5A 1KVUA 4RF2A 4ZICA 3DFUA 2P9EA 4DYVA 3U5TA 3GN2A 5HBRA 2IXBA 2XOXA 1A27A 1ADFA 3MJEA 1WMAA 1A9ZA 3VKUA 4CMIB 3E9MA 4J4BA 4XYGA 5JYDA 2GN4A 1FJHA 4KTTE 1P44A 2HAEA 3JQ8A 4OQZA 4A7PA 1GCUA 3PHIA 1F06A 1PJLA 1HDRA 2A92A 2JD0A 3K2EA 2QRKA 1OBFO 2JKVA 4H3VA 5JE8A 1VLLA 1GV0A 1H94A 3DAGA 1GQQA 3DZJA 1ZVMA 1P33A 4A03A 4KUEA 4D46A 4YT2A 3JCZA 1CYDA 4GGOA 4D0SA 4BMSA 5I9LA 2VCYA 1U28A 4DC0A 5JMWA 3E6AA 5ENDA 4BO7A 2V7PA 3ZNQA 1JVSA 2X0NA 2ZQZA 2I3AA 2LDXA 4MVJP 2YV3A 1YQDA 3NT5A 2BFAA 4FBGA 2JHGA 3DBHB 3LLVA 3CUKA 1DC6A 3OBBA 3GMSA 4A73A 1O6ZA 1YJ8A 3ORFA 3FN4A 2YV2A 3ZHBA 3DTTA 3AI1A 4IBOA 3WNVA 3T7EA 4C7KA 4JIGA 3WB9A 4MVJI 1B8PA 1PGJA 3CH6A 1BVUA 1XQ6A 3ETEA 4FOOA 4WCFC 4NU6A 3RIHA 1BSVA 1Y8RB 3I5MA 1V6AA 2A94A 3PP8A 4IS2A 3FR7A 3RUHA 4R9RA 2YY7A 4GGPA 3VOSA 3Q3CA 3PEFA 4RLSA 1RM4A 3KUXA 3UGKA 3WLFA 4I9UA 4WCDA 4PLWA 3ST7A 4ZQFA 4M8SA 4LRTB 4UEJA 3WMWA 3ZU2A 2V6FA 3S1LA 1ZBQA 3R1IA 5DBFA 4Y6SA 3WIEA 4UEOA 2VYND 3DBLB 1HSOA 2WWRA 1OC4A 3PYXA 1JQBA 5AYVA 4IJVA 4WGGA 3L9WA 4G65A 3A1NA 4JK3A 1R66A 3HQ4O 3RWBA 2HK7A 5KVVA 4YYZA 4JJGA 5B4TA 3VH2A 4XQ9A 2H63A 2GN8A 4DPMA 4E5PA 5JCJD 3H9QA 4ZGWA 3ICCA 5JSFA 3ZU4A 1NPYA 2D2IA 3L0DA 1PZFA 4RVGA 2H9IA 4FFOA 4F3YA 4J91A 3TQHA 3TWOA 4WECA 2PD6A 3OFSA 5MDHA 4W99A 1GEEA 5CDGA 3RQSA 5A9SA 1EK5A 1SO8A 1MXFA 3CTMA 5A06A 1KYQA 1S7CA 3GG9A 3ENKA 4KOAA 3VVCA 3WDSA 3GGOA 3D4OA 5AXAA 3JQAB 3NTRA 3WLEA 2ZCUA 2ILTA 3WWYA 1CEQA 1V9LA 2O7QA 4PIVA 8ADHA 9LDTA 4UVDA 4N7RA 2QYTA 2CF5A 2R00C 3CEAA 3DWFA 2HMUA 1ISHA 1E7QA 1CF2O 4GVLA 5T8KA 5BSEA 1VI2A 1KVTA 2IEDA 1WPQA 1H2BA 2XAAA 4A2CA 4MVJF 5EIOA 2WYWA 1SEPA 3HDYA 1PGQA 3WICA 3NJ4A 4NG5A 3VZQA 1QKIA 2X7HA 1FMCA 1OC2A 5TJHA 2FR1A 3RJ5A 1KS9A 3HUDA 1WDLA 1NASA 4FD3A 4BNKA 3EZYA 4IJWA 1O94A 3WGIA 3ZHYA 1DFIA 4PG4A 3TJRA 2NVUB 3KVOA 3OF2A 4M89A 2DM6A 3DZBA 4R16A 3V1YA 2XXJA 2YJZA 3NT4A 5TSDA 4RZHA 2CDBA 3BMOB 4KUGA 3M1LA 1X15A 1BXGB 2IZ0A 4RF3A 3VH1A 2CSUA 2J5QA 3GN1A 4IIUA 4BO3A 5AXCA 4E5NA 3U09A 1W73A 3DB2A 4FFMA 3E48A 1R4NB 3PGJA 2DTDA 3UCXA 3FWNA 2X8LA 4EI2A 1WW8A 2Z95A 4DL9A 3KYCB 2PY6A 3K6JA 3I9JA 3LDHA 3W1VA 5L7WA 4IDDA 3MWDB 1U2GA 4AJ1A 3PWZA 3DBRA 4I9HA 3C7CB 3GRKA 1GYQA 2JAHA 3H2SA 4MIEA 5TQVA 1FK8A 1XQ1A 3A14A 2GNAA 1DOHA 1ZK0A 2FZWA 2TMGA 3FPLA 5C3MA 1IE3A 4DQVA 1NWHA 5JO0A 4BKOA 4ALMA 4RPLA 4JJIA 3JD1A 1PJ2A 5I8ZA 3Q9NA 2PV7A 4EJ0A 1EE9A 1LRLA 3RAJA 3JQBA 5C7LO 3GDOA 3AUTA 1Y9AA 4O0LA 4NR0A 1PR3A 2NQTA 2B83A 2NADA 4CLXA 2J3IA 4IZHA 4OOFA 3O38A 1Q0LA 3I4FA 2AQ8A 3GVXA 2XF8A 2VUSA 4PCVA 4FB5A 4LK3A 1E3LA 3H5RA 4FC6A 4J1NA 2IODA 5IF3A 1CERA 4M55A 4NI5A 4M49A 2PH5A 1V3TA 1T4BA 1R37A 2AQKA 4PZCA 4RQUA 4MIYA 2EF1A 5THQA 4XEHA 3PDUA 4CQLA 4RDHA 3LSYA 3AM5A 5ES3A 1JKFA 1X0XA 1U1IA 2B4RO 3K5PA 4TZTA 1RKXA 3DFZA 3OSUA 3E5MA 1T1SA 3WYCA 3JYNA 4UUPA 2BLLA 3JD4A 2C2YA 4G5HA 4N5MA 4CL3A 1KVSA 1SB8A 3VZPA 4L8VA 2WDZA 3GRPA 4CM8A 3O8QA 4QUKA 4GI2A 5DDIP 4CM6A 1AHIA 4YJGA 1E7WA 4ZQGA 2UUPA 3ZWXA 3C1AA 4PG8A 4NBVA 3PK0A 1IL0A 4RVSA 1B2LA 2X5KO 3M1AA 3F6YA 3VTFA 2P4HX 1RM5A 4I5FA 3GY0A 5FF9A 1NAHA 4CQMD 3FNFA 4LCJA 1C1DB 5I7EA 1B3BA 2B5WA 1M2WA 2O48X 3FTPA 3PFWO 1E6WA 2AE1A 3ROMA 4YEDA 5KJ1A 5JDIA 3EW7A 4B7CA 4D0RA 1E3JA 1Q7GA 1WWKA 3ASUA 3V2GA 5IAAA 2Y1CA 3RASA 3WG9A 1NQTA 4II3A 7ADHA 3WYEA 4OXKA 3KHUA 4K9DA 4LMRA 1XIVA 4UVHA 3W8EA 3ANLA 3DBLA 3WTCA 4WCFB 3GHHA 3W4JA 3PTZA 1GEGA 3LVFO 1ZJYA 4BNJA 2EIHA 1V0JA 2W2KB 1ZH8A 4YPOA 4I08A 4YJFA 4KQWA 5HS6A 4E32A 4MO2A 2DU8A 3JQGA 5F1OA 1EDZA 4XIYA 4NJMB 5IDXA 1UUFA 4AJOA 2Q45A 1WNTA 2DUWA 4BGVA 2X9VA 1LX6A 2B69A 1M6WA 2GD1O 1Q1NA 1C0IA 4XQEA 5ITWA 1E5QA 1SZJG 2VT2A 2Y67A 4OH1A 2EXXA 3TZHA 4OKNA 4BKUA 2RCYA 3JQFA 4MVJM 4CJXA 4IM7A 3GA0A 5T8KC 3DHEA 4XYMA 1J0XO 4ZQBA 4FW8A 3BTVA 3DOCA 5I8WA 4YAEA 3GT0A 3JQAA 1UXHA 3U4CA 3GQVA 1UDCA 2BFPA 1YBMA 4D3DA 4FSHA 4UUOA 4OGWA 3PLRA 5T57A 2J3KA 1EDOA 1XDWA 2V6GA 4Z0PA 1JA9A 1QRRA 1Y9EA 1F0YA 2O3UA 5U9CA 1TEHA 2P91A 3TL2A 3TZ6A 4A5OA 3BMCB 1PIWA 1GYRA 4TVOA 3RCBA 3H5NA 3NJ8A 3PIIA 1H9AA 4TRRA 4YCAA 4E5KA 4HV4A 5L53A 3PYMA 2C29D 1H6BA 4LRSB 4WJZA 4QXMA 3AFNA 1G1AA 4CMEA 3WSWA 4ESOA 4XRRA 3ROKA 3JD2A 2VOEA 2H6EA 3ZV6A 2OBYA 5FWNA 2O50A 1R4MA 3GPDG 1P1KA 4UVGA 4UUMA 1EVYA 1ISJA 4K6CA 4CMCA 2B37A 1PU2A 2VNAA 1XHLA 2GGSA 5L7YA 4E2XA 1LC3A 3B1FA 1U2DA 3KO8A 1YOVB 4XJSA 3HG7A 4J7UA 2Q49A 1Z45A 2FN7A 4Y9DA 1QV6A 4Z3DA 1UDAA 4L74A 4XZ3A 5HWSA 3KSUA 4D3SA 3WYBA 1YB4A 2GN9A 3C85A 4BO0A 1X0VA 4INAA 4CUKA 2HO5A 1E3WA 1BDBA 3BMNA 4WKGA 1HDXA 5DZSA 1AGNA 1KETA 1AN9A 4R1UA 1ZFNA 3ETGA 3OETA 1U8XX 3JQBC 5IDWA 2OUIA 4E33A 1KVRA 3NGLA 1CWUA 3ZWMA 3BHIA 4XGIA 3AU8A 3QVXA 3SXPA 3GVHA 4Z9YA 2OL4A 1E1KA 4EW6A 5EINA 1RJWA 4U8GA 2VHZA 3B1JA 2PKQP 5IN4A 2IEBA 3ZCXA 5ICMA 1B15A 3FNHA 1U3TA 3IMFA 2YYYA 1G6KA 2C7GA 3AI2A 1RPNA 4R1SA 3WWZA 4E30A 2WE8A 1M75A 4XRGA 6LDHA 3LT4A 1KY5A 1XWFA 4W4TA 4P4GA 1G0NA 2NSDA 1NNUA 4XKJA 2P5UA 3P19A 3E82A 4MOWA 3Q0EA 4DBVO 2BFOA 4BO9A 1DIRA 1QYWA 3UOGA 2JAPA 1F12A 3Q9UA 5JC8A 4W9NC 3VPGA 4WOKA 4J16A 3RU9A 3SC6A 3RSHA 4TVBA 2WMDA 3VC7A 4RVFA 4ALNA 1P74A 3NTQA 4MVJE 1QLHA 1HT0A 4JBIA 3F9IA 2EKPA 4FFLA 4LMPA 1PZHA 1TI7A 2DUUA 4XQCA 4ZRMA 1WP4A 4XDYA 1AE1A 3ULKA 1V35A 3C24A 2RIRA 3GFBA 3WR5A 3GR6A 2C07A 3CMMA 4Z9XA 4L4XA 3ZWPA 2Q2QA 5JDIC 4A10A 1TLTA 1YQXA 3ROQA 3AUAA 3BAZA 4C7JA 5A3JA 4HKTA 1HDYA 2QRJA 5CEJA 2YHIA 1QLJA 3PXXA 3QLJA 2I67A 3IIEA 2DBQA 5KIAA 1ONNA 5CEEA 4ALIA 5KKAA 2AW5A 1MC4A 1LRKA 2BGMA 4J1SA 3GFGA 4Q3AA 5U4QA 2UYYA 1Z7EA 3HDJA 1GUZA 2I66A 2YFHA 4IIVA 4XQGA 5I7FA 1EVZA 3A9WA 2AQHA 3NTOA 3TZCA 3TN7A 3WGHA 1NHWA 2Y05A 1P45A 4GMFA 4Y8VA 3D5QA 4O63O 3FF4A 5L3ZA 3DZIA 1E77A 4JP2A 3BXXA 2V6BA 1CQJA 3JSAA 4CL8A 3QWHA 3GAZA 1T4DA 4UREA 2FSSA 5A3VA 4JNKA 4WE3A 1ADGA 2VOJA 3LC1O 1E6EA 3JQFC 4WNIA 4BNFA 4OXNA 4IDAA 1O9BA 1RM0A 2BELA 5IDYA 2E82A 2HK8A 4BO6A 1VRWA 3G1UA 2PNFA 4E13A 4A26A 3HDQA 3U9LA 2Q3EA 4GH5A 2UDPA 3DMYA 1DDOA 4CM9D 5GZ3A 3NV9A 2CVQA 3K9QO 4PLHA 1DRWA 1GPJA 5JAQA 4NH4A 1SNYA 1B26A 3WBFA 2GZ2A 3QE3A 2JL1A 3ON5A 4Q3BA 4BNTA 1FDWA 3GUYA 3K96A 1I30A 4O5OA 2D1YA 4O59O 5A9SB 4CR6A 3FSRA 1XGKA 4PFJA 1YJQA 2WD7A 4R01A 4PLCA 3RC9A 4E2YA 4CMEC 3H9GA 3UW3A 2OHXA 3JQEA 4R1NA 4J1QA 3RI3A 4CMKA 3PWSA 1HF3A 3M2PA 4AJLA 2D0IA 3QWAA 1K6XA 4OOEA 3ZW9A 3H2ZA 1WAMA 3L6OO 4G81A 3CIFA 3IDSA 3WFJA 2ZTMA 1SB9A 2AMFA 3WOHA 5L7TA 2D3TA 4BNUA 4FJ0A 2DBZA 2E48A 2Y93A 5KJ6A 2J8ZA 2WE7A 1KEVA 1ENZA 1PSDA 3AFMA 1HLPA 5TGDA 4RCVA 1ZSNA 4D45A 2YUTA 5JAZA 3H65A 4CMGA 4MP6A 5G4LA 5JDCC 2X5OA 3RUIA 5K9ZA 2D59A 2EG9A 2G5CA 4LW8A 3ZWAA 5CAEA 4GLLA 4ZRNA 4JQCA 2X1HA 2R00A 4WASA 1DLIA 5GZ6A 4ITUA 1ARZA 1UR5A 4DQUA 2IYPA 4FGSA 2PTGA 4JBGA 3QV1A 1EUZA 1N92A 2HDHA 3MOGA 2IRWA 1LJ8A 3V5NA 4U5QA 3A4VA 3IQDB 1CIVA 1OOEA 1K0UA 1DLJA 3X2FA 1QG6A 3W4IA 3VPSA 1YL5A 1B14A 4AICA 4HADA 3OQ1A 3DONA 4WLNA 4FR5A 1EVJA 1ZXBA 5F1PA 4ZN6A 3B6ZA 3DC2A 4IS3A 3K92A 4N54A 3PFFA 3AJRA 3DBRB 4BMVA 1R6DA 4JLWA 3FHLA 4Y98A 2CVZA 4YBZA 3O4RA 2EV9A 4CV1A 2ZK7A 5T64A 1UDBA 2X0JA 3FR8A 1EMDA 1IHXA 3NT2A 1UAYA 3WJAA 4D43A 3KM0A 1EFKA 4K26A 2J5KA 2OGUA 2O3QA 2VWQA 5A9RA 5ILGA 2UV8A 1H0KA 4MP8A 2NTVA 2RH8A 3V8BA 3S2GA 4FGWA 2Q2WA 3S8MA 3STHA 3Q1LA 4CMBA 3DEYX 2ZATA 2AHRA 3GZNA 3LT0A 4GX0A 1P31A 3KZVA 3I6IA 4MVJA 2DVMA 2Y1DA 1HL3A 4CV2A 5KTKA 3PJEA 5TF4A 3GEGA 4XJTA 4EJ6A 3OA0A 3DZFA 3KETA 5DCYA 2EERA 4CM3A 1PL6A 2VT3A 1ADBA 4NU5A 1IY8A 3I83A 3NDIA 5COAA 3ROPA 4CUJA 1ADCA 2PGDA 5F3RA 4BO8A 4DPLA 1P3DA 3CZRA 3PYLA 1PS0A 3EMKA 3UVEA 2Q1TA 4YQZA 4CQLB 1U3VA 3P2YA 2J6IA 2CZCA 2O4UX 5KJEA 4TZKA 4C4OA 4QO8A 5TIIA 5B1YA 5I7VA 4J1TA 4HFMA 1DPGA 3UUWA 1LC0A 3GDGA 4JJFA 3ZZNA 3Q6IA 1NM5A 2NACA 1DXYA 1LLUA 2UUOA 3G1TA 4CM8B 2Q4BA 3O8QB 4XGNA 2Y1GA 4RQTA 4YJGB 1Z6ZA 3QW2A 1UXIA 3ICPA 1HXHA 1D1SA 3QJ5A 4URFA 3ZWVA 1C1XA 1HDOA 1GQ2A 4RLHA 1YDEA 1NQ5A 4R3WA 4OJNA 1I3NA 1VE9A 1KVQA 2HMTA 1VJ1A 1LEHA 5K0ZA 5K6AA 1HETA 2VZ0A 2CDAA 2ZTLA 2OFPA 3WS7A 4II2A 1PR9A 4OKIA 4KDFA 1JW9B 3ZV3A 4WLVA 3FCOA 4HWKA 4ILKA 2FHSA 3PWKA 1WMBA 2DC1A 2EEZA 3OM9A 4O6VA 4AVYA 4ZHSA 1VSUA 3R3JA 4YACA 1UZNA 1UXJA 4Q3CA 1O89A 1HYHA 3FBGA 4YAKA 1YBAA 1TVEA 4BB6A 3R3SA 3UF0A 4R4JA 1PL7A 1KY4A 4E5MA 4WLEA 4YJFB 2NNLD 3NX4A 1YBVA 3GG2A 1Q7CA 5C5IA 3JQGB 3RD5A 3OIDA 5A5EA 2GZ3A 4H7PA 3IUSA 2B4TO 4AJ2A 1AXGA 4XR9A 2B35A 1NXQA 4R41A 4W6ZA 3UHAA 2CY0A 2EKLA 4D44A 1D3AA 1DAOA 4IDCA 3MZ0A 5HM8A 3U3XA 1VL8A 4Z0TA 1ZK2A 2Z1NA 3JYPA 1EUDA 3UN1A 1TA4A 4YXFA 1PL8A 3OJEA 3FNGA 3ZWBA 4HNHA 4YRDA 1X7DA 2JD2A 2JHFA 4YA6A 2CMDA 3OECA 2GPTA 5G0TA 3ZI0A 2Q1SA 5CDYA 1EBFA 2OZPA 5COBA 2HLPA 4Q3DA 4WNCA 4Q9NA 5TX7A 2VUUA 1MFZA 4W7HA 2O3TA 3JYQA 5CHEA 5BNFA 3K30A 4B4VA 2Q99A 3MCVA 4CUZA 3TF5A 1R0KA 2Q50A 2PA3A 2AA3A 2EJVA 3AK4A 2G82A 4CMHA 4F45A 4ZU3A 3WJ7A 2PGJA 4GQAA 4J4HA 2BD0A 3DXFA 1R4MB 1E6UA 1BMDA 3DO5A 4FFNA 2H5LA 3PJDA 1R0LA 4I8XA 5TNXA 2X86A 2ZQYA 4I1IA 3D4PA 2PKQO 3GMDA 1DO8A 1I36A 1ML3A 5EQDA 4ALLA 3HWRA 1BW9A 2GSDA 3AM4A 1HTBA 3LYLA 4OSOA 4R5HA 3NRCA 1N8KA 4GX1A 1T2AA 2FMUA 1UP6A 4RVHA 1P1HA 4TMFA 4E12A 3CXRA 1E3WB 3ADPA 3BMNB 1SAYA 4TSKA 6ADHA 1JAYA 2XPCA 3DQPA 1V3VA 5I9NA 8LDHA 3SC4A 5DP2A 2DPGA 3QQPA 2O2YA 3IP3A 2Y66A 2GN6A 3W6UA 2DT5A 4NZ9A 4U0JA 2YQ5A 2X0IA 2JCXA 2VYNA 4UAGA 4W7IA 4B3IA 1YWGO 3OHSX 1NTOA 3DHNA 4NBUA 3WGTA 3GNSA 3X2EA 1QMGA 1NWCA 4F6LA 1HZJA 3UAGA 5DCUA 4YJHA 4YWJA 3VPHA 4M54A 2VRCD 3AOGA 5JCJA 4KP7A 3WGOA 5HS4A 4OXYA 3I23A 2BHLA 5B4UA 4BNXA 2B4QA 2DLDA 4BV8A 1E1MA 2BGLA 4RVDA 2NVWA 1Y81A 1GFSA 5A4DA 3RUDA 1PZGA 5JXWA 4EUHA 3NEPX 1FDSA 2AXQA 3F4LA 1N9GA 1BRMA 3GOHA 4BNWA 2I65A 1Z73A 3LF2A 4QX6A 4DREA 2VWGA 3JQDA 3DBVO 4DLBA 2P2SA 3AUUA 5LC1A 3L77A 1SOVA 3ONEA 4FFPA 2AE2A 4J6FA 1YXMA 3DR3A 2IYOA 4KTVE 4UUNA 3TDKA 1N5DA 4QTZA 1ISGA 1U9JA 4Y6RA 5G0SA 1QSGA 1UZMA 3D3WA 3KLPX 5DOVA 4BNZA 1OMOA 4W9NA 4CODB 2W2LD 4O1MA 2EW8A 1SMKA 3ZHXA 4BKQA 3MOIA 1ZMOA 5K6AC 3WQQA 3O03A 2ZTVA 4CLOA 1A4UA 1DJQA 3AI3A 4L4RA 3ZHZA 1DJNA 1DBVO 5AXDA 3I9MA 3KB6A 2YHIB 4XB1A 1K6IA 4ROSA 4AJ4A 2EGHA 4PLZA 4RZIA 3PRJA 3F1LA 4EBFA 1T24A 2O3JA 4B4UA 2WYVA 1K5HA 4E2WA 3U4HA 1NX6A 5B37A 1K89A 1CRWG 1PWZA 4DLAA 1GZ4A 3UH1A 1CETA 1N1GA 4R69A 4B8ZA 3H6KA 4BHTA 1R15A 5AOVA 2X0RA 4HXYA 3VKVA 3FNEA 4GX5A 5JNLA 4JROA 1OZAA 5G0WA 5ENVA 3ZNNA 1ZZEA 4ND5A 1YB1A 2O4CA 3P5SA 2HQ1A 5EN4A 1MFPA 3JYOA 3LQFA 4GL4A 4U0KA 1ZNQO 1ZSVA 4D7AA 4ZVVA 3EY4A 4NFYA 1L1FA 3NDJA 1M76A 3A28A 1IULA 2IE0A 1EK6A 1GL3A 4XD2A 1ZXLA 1ZSYA 4E0BA 5C7IO 2I6TA 3ZNPA 4CPDA 5TLSA 3LC2O 3DZGA 3MTJA 4EEXA 1GPDG 1LLDA 3DOOA 2RH4A 1BTOA 4IQ0A 5BNTA 1ZK4A 3RUAA 1IPEA 4OAQA 4MKZA 1VM6A 1Y8QA 2Q4EA 4XCVA 4HY3A 4G2NA 3RUFA 2FR8A 1C0PA 1PX0A 1Q0QA 1ZK3A 1X7GA 2BRUA 1GR0A 4Q3EA 2WD7B 4D41A 3HFGA 2X4GA 2G76A 2ZYGA 1PJBA 2P68A 4IUYA 4R54A 3TOZA 3V2HA 3KSDO 1B7GO 4GSLA 4DWVA 4R9SA 3Q11A 3GAFA 3RFXA 3HSKA 1SOWA 2JFFA 5JC1A 3BTSA 1U5AA 3DDNA 2FPPA 4MDHA 4NMHA 2E4AA 4IGEA 3SJ7A 3RKRA 4MKXA 2ZIZA 2UAGA 1YS4A 2GF2A 3K8ZA 1VKNA 2BMAA 4GX2A 1XG5A 1E1NA 4IJKA 2AEMA 1LDYA 2VWPA 4BNYA 1JAXA 1KERA 4NBRA 1I32A 2GLXA 3L6EA 3TL3A 1J6UA 1EVIA 1H9BA 4MINA 1AHHA 1T1RA 4PG5A 3FRJA 5G0UA 5TS3A 3ITDA 4YAJA 4GWKA 4BVAA 1JKIA 5JDCA 1E92A 2ET6A 1EE2A 1WZIA 2XXBA 3NKLA 4CQMA 1VPDA 5J23A 1B8UA 1DB3A 1PJ4A 5GMOA 2Y0DA 4WUVA 4PZEA 2CVOA 3QA9A 3WBBA 4YT5A 1M66A 1PQWA 2B5VA 4RF5A 1SEVA 2NVBA 4GPD1 2JFHA 2HKIA 2WSBA 2ZB8A 4IZIA 1ZMTA 3V1UA 5L4LA 2QIOA 3VH3A 2VHVA 2FRDA 4S3MA 3B70A 5AVOA 4IDGA 5DOZA 2OO5A 2BFMA 1E7SA 3I3OA 5BSGA 1WDKA 3VZRA 1PEDA 3QVTA 4R3NA 3HADA 4LSMA 1MXHA 1A72A 2NUAA 2YW9A 4H16A 2DPHA 4HBGA 3CSDA 3KOUA 1GZ6A 4EZBA 1GY8A 1MX3A 4DIOA 5KVQA 5ILOA 1B16A 2PLAA 4YAGA 2AG8A 4E3ZA 1P1FA 3QWBA 1DC5A 1PZEA 3I4CA 1BVRA 3GZNB 2PFGA 2VHYA 4CMJA 4BQPA 1ISMA 3EHEA 3V2UA 1JLLA 5JS6A 3QSGA 3AM3A 2IZZA 4IXWA 3R6DA 4AFNA 1FDVA 3NYWA 1UP4A 1YGYA 2Y1OA 1R16A 2VYVD 4WEQA 1HE4A 1PQUA 3T4EA 2E49A 1SCUA 1JTVA 4FPXA 1HKUA 3DTYA 3T7CA 1T2DA 4MVJG 3ZNOA 1LXCA 4B3JA 5JBIA 2NLOA 3ABIA 5TT0A 1YONA 4GKVA 4QO7A 4U6SA 2OP1A 4PLYA 1I24A 3RROA 1QV7A 3AWDA 5A04A 4KUHA 3H8VA 5F5NA 4YT4A 3KYBA 4OQYA 3RBZA 4MKRA 1D7OA 3ZWOA 1BDMA 1O8CA 1C1XB 1IZ0A 4P4LA 1MC5A 4BKRA 3TFOA 1I10A 2FSVA 2ZYDA 3KYDA 3PI7A 5L4NA 3A06A 1T25A 4Z9FA 3M2TA 3CE6A 3PIDA 1LQUA 4WK6A 4AJNA 4CM1A 4L0QA 1DSSG 4ND2A 3ANMA 2RHRA 1LQTA 2AG5A 4TKMA 4L9RA 1I33A 3AOEA 2QZ9A 3QWIA 4PVCA 2DTEA 3GEMA 1LSUA 3Q2IA 2C0CA 4HFJA 4PGFA 2YV1A 1ZW1A 3HZZA 4AL4A 4HFNA 3PPIA 4A27A 1I0ZA 4TRJA 4LVCA 1MLDA 3F46A 3NUGA 4KQXA 3IOYA 3CINA 4GAEA 1O5IA 4AJHA 1GCOA 3LT2A 5A1TA 5KOIA 1J49A 3EAGA 4JCOA 4E5YA 4XYBA 2PGLA 4BL5A 4XIJA 1ZO8A 5DP1A 1E7RA 2PZLA 2RAFA 1LSOA 3ZN2A 4BO1A 2YFQA 1HE3A 3L4BA 1ENOA 2NU8A 4CV0A 4NFSA 4Q39A 5HRUA 2X58A 2RBEA 2HCTA 1K3TA 2OP0A 4F6CA 1U3WA 1D8AA 1C3VA 3ONFA 3HN7A 1PTJA 1PJSA 4YQYA 3PZBA 3I9NA 1AUPA 1I2CA 2HU2A 4DPKA 1PQPA 3MTGA 5U1PA 5BNIA 2F1KA 2O7SA 4MP3A 4NFHA 1B3RA 3D64A 4ZJUA 3JD0A 3S55A 1LDGA 4ALJA 2FWMX 1E7MA 1NQAO 1ENYA 5JFOA 4XDZA 2GUGA 1CDOA 2OORA 1QXSA 3IKTA 1LLQA 3O26A 4J0EA 5JAIA 2HMWA 4L75A 3BHJA 3KRTA 4YAIA 4BIIA 3HE3A 4ND4A 1NFQA 1RM3A 5CPBA 4PRKA 1E3EA 3FD8A 3QVWA 1U4SA 1QYDA 2NM0A 3G17A 4B7XA 7MDHA 4YDRA 4LVUA 3PHJA 4CR8A 3D3EA 4DIFA 5JCXA 2I76A 1HDZA 2EJWA 4FQ8A 4BGIA 4K28A 1OFGA 1CQIA 2IXAA 1BG6A 3PGXA 4HUJA 3BA1A 1DIGA 2B36A 1IB6A 2SCUA 1HE5A 2VZ9A 1ZEMA 3RC1A 4L73A 3RBXA 4AJEA 3R0IA 1BW9B 1SBYA 3UFXA 2WJPA 5L51A 5FEUA 4DC1A 1V3UA 1MP0A 3TZKA 3RJ9A 4AJIA 4J3FA 4KWIA 1GV1A 4IPTA 1IPFA 3AY6A 3INTA 3D1LA 4RPJA 2W4QA 1X14A 1F8GA 4IQ8A 1ONPA 1TT5B 3L07A 3OA2A 4OM8A 4GLOA 5JMPA 1XR3A 4P22A 5IJZA 4FC7A 2PK3A 1E3SA 4KMSA 2Q46A 5EERA 1NVMB 5IN5A 4TQGA 2C59A 4UEKA 3ZWYA 2EHDA 3E9NA 1ISFA 4QECA 1D4FA 4XR4A 4EEZA 5L45A 4J9VA 3DHYA 4D79A 4YJHB 4GMGA 4R5MA 3OJOA 1X1EA 2ZB4A 3JQ6A 1RYDA 2CDCA 4GVXA 1M67A 5HA5A 3VPXA 4DBZA 5EMHA 1WZEA 1U7HA 2DKNA 3Q2KA 5A9TA 3DOJA 4CM9A 5B12A 3ZV4A 1TT7A 4Z6KA 4IINA 3I52A 3SX2A 1NAIA 1RWBA 1P1RA 1ORRA 4XYEA 5G4KA 5HTOA 1KC1A 1NP3A 2D8AA 2ZCVA 3BIOA 4XWYA 3H7AA 4FIZA 3D4NA 1N9GB 5DNAA 1PGNA 1HEUA 3TPCA 1TB4A 4ZQHA 4CLRA 2GO1A 3OJFA 3VHRA 2PH3A 2I99A 1HSZA 4R68A 4B4OA 3TSCA 3N7UA 1WVGA 3RBVA 4RO0A 3GHYA 3U49A 3NDRA 1N1EA 4JGBA 1TXGA 4DXHA 1ULSA 1PJTA 2HMSA 1C14A 4E21A 5IFLA 3LLSA 4NK5A 3LF1A 3JQ9A 4Y67A 4YRBA 5L9AA 3D3WB 4BMNA 3QIVA 4WLOA 5JY6A 1J5PA 2BH9A 1WDMA 2VRBA 2VNSA 1JKJA 3VAZA 3WGGA 3ANNA 2QZZA 1LLCA 4TRMA 1YVEI 1LDEA 1LSSA 2P9GA 3QVSA 2AQIA 2B0JA 2QW8A 1X1TA 3AOEC 1YO6A 4CLOB 1BXZA 1UJMA 3I9KA 2J3JA 1SC6A 4N5NA 1A7KA 4N5LA 3QRWA 2DBRA 4WEOA 4XYLA 4BO5A 1LTHR 1I01A 1DIBA 3DZKA 3GGGA 3H5AA 4FCCA 5JPIA 1O95A 5LCXA 3F4BA 3GNQA 4RV9A 1EUCA 1VSVA 3HNPA 5JYEA 2A35A 2GERA 2HMVA 5DCWA 4EYEA 1RYEA 1GYPA 4FJ2A 2O23A 3L4SO 1MUUA 4ZA2A 4XGKA 2JD1A 3C3XA 1N7GA 3EVNA 4MPDA 2HJRA 2G17A 1NVGA 1Z7BA 3L4BC 3IL2A 4IQGA 5BSFA 2OMEA 3G49A 2IDZA 4RPHA 5EQFA 2GYYA 2P5YA 2WTBA 5L40A 2VZ8A 2PR2A 1ZJZA 1NQOA 2HJSA 1F8FA 2ZTUA 3K31A 1GADO 4IJUA 2J3HA 4LCEA 4MJLA 4A0SA 4WLFA 3GLQA 1L7EA 1MV8A 4TWRA 2VN8A 4RORA 4B4WA 3OQ6A 3SVTA 1I5RA 1PJQA 2R6JA 4PLGA 3S2EA 2R2GA 4U7WA 9LDBA 3EYWA 3TRIA 3ZGYA 3PHHA 3GVPA 3BMQA 3T4XA 5IG2A 4DMMA 1H93A 3GH3A 3VDRA 3DAFA 4J2OA 1UXGA 4IDEA 3ZWWA 5L95A 1P0FA 1N2SA 4EDFA 5JLAA 3GVIA 3OEYA 4PLFA 5IDQA 4LN1A 5FI5A 1IHYA 1Y8QB 1QR6A 1IUKA 3DL2A 2BI8A 2PD4A 1YB5A 1NR7A 3OICA 3WSVA 1XLTA 4IY1A 4N18A 1ID1A 2QG4A 3EDMA 3FWZA 5BR7A 1CJCA 2DFDA 4LSWA 5ER9A 5AXBA 3RC2A 5KCZA 1PS9A 4HP8A 1H6AA 4WPGA 2UVDA 2X6TA 4PZDA 1LU9A 5H81A 5A03A 5I7SA 2PWZA 3DMTA 3TFQA 1S6YA 1B8VA 3AY3A 1DAPA 4NDNE 1X7HA 2FPGA 4I5GA 4DA9A 5CG1A 3BHMA 1ZUD1 1QYCA 2Y0EA 3AY7A 1K2WA 1U7TA 4CLHA 5LDHA 1BWSA 4CM4A 1YH3A 5GZ1A 4RGBA 5FFFA 2TMDA 4YR9A 2GZ1A 3MJ4A 5F5LA 5IZ4A 2OOSA 3G3EA 3D5TA 4RPKA 4CV3A 1P77A 4LGVA 1VL6A 5JAMA 1C0KA 3PQFA 3CMCO 4M1QA 3TZQA 3OMLA 4B8WA 4CQMB 1M6HA 3RUEA 3JQCA 4FOSA 1UZLA 2FOIA 3ADOA 4ND3A 2HRZA 2QRLA 3WFIA 1TT5A 1LRJA 4L4SA 4CR7A 1KOLA 1R0SA 3QP9A 3SBOA 3W8FA 4DIBA 2Q1UA 1NHGA 5EL0A 4CMAA 1NYTA 5CFZA 3COSA 2ZB7A 1Z74A 1Y5MA 3PJFA 3F5QA 2OBNA 3UXYA 1BGVA 2Y1FA 3ITKA 3IKVA 1QP8A 3JV7A 2FPIA 1DFHA 1FDTA 4B7UA 3P2OA 3ETDA 4IDBA 3JD3A 5CEFA 2FP4A 1ZIDA 2PKRA 4KDEA 3JQ7A 2CF6A 4QEDA 1PWXA 4RVUA 3GGPA 4PRLA 2WM3A 2LDBA 4ONEA 1XU7A 4NQZA 1T2EA 4R51A 1MG0A 1ONOA 2IZ1A 3ZDFA 3HFSA 5IXYA 1Q2XA 1NFRA 1BHSA 3U4DA 4E31A 4YJDA 1R12A 3E5RA 1YKFA 3OJ0A 3WGQA 3JQ9C 5KWEA 1PGPA 4I5EA 2VUTA 1KEUA 4CMIA 1XA0A 2Z1MA 1GU7A 2HUNA 2EWMA 3I9LA 4BGEA 1HDCA 1A7AA 1C0LA 2NTJA 3PZRA 3HJAA 5IZCA 2EGGA 4TKLA 4BNLA 2DAPA 3CKYA 4MIOA 4OMUA 5I9MA 4DGSA 1I3KA 1DRUA 3JQAD 1JU9A 3HB5X 1YRLA 2DQ4A 4HFRA 3VZSA 2VWHA 4M87A 3KTDA 4AJPA 1F17A 4I9NA 2BF7A 4XB2A 5TRTA 2CNBA 3JTMA 2C82A 1XYGA 2JFGA 2P9CA 5JY1A 2NU7A 4BOYA 1YDWA 2PZMA 3I9OA 1I3LA 3H9UA 3BZUA 3NAQA 5IXSA 3KEOA 4E2ZA 3WMXA 2A4KA 5ICSA 2D4AA 3VPFA 2EKQA 5FYDA 1GAEO 4TROA 1VL0A 1U5CA 2QYSA 3DBHA 1KBZA 1I2BA 2PZKA 4Z3KA 1LI4A 3D7LA 1I3MA 3ASVA 2C54A 3WQSB 5EPOA 1JWBB 4J7CA 2POQX 1Q7BA 4JBHA 1DC3A 1NVTA 3KYDB 3OJLA 1XCBA 1E1LA 3MEQA 5KNLA 2Q1WA 5A5FA 1F14A 1KIFA 2PD3A 3I1JA 3WQRA 1NPTO 2YDYA 4WOJA 1Y8RA 3VVBA 4D42A 1LDBA 4QSMA 5F1KA 2C7VA 1EBUA 1NR1A 4BO4A 3IJPA 3EGOA 3PQEA 1K6JA 1LDMA 5KVSA 1B0AA 2Y1EA 1Y7TA 2OXIA 3DAPA 1W0CA 4PLPA 3H9EO 1AXEA 4E6PA 1E3IA 3LC7O 2I5PO 5B4VA 2ZJ1A 2DFVA 1H6CA 1KEWA 1H5QA 2HRBA 3PLNA 2D5AA 1HLDA 5EJ2A 2RHCA 2VRCA 3V1TC 3VDQA 4FDAA 3I6QA 2DBVO 1VKOA 4W82A 3W4KA 3DMTC 4R1TA 2X5JO 4LISA 2WD8A 2JCVA 3MWEB 2JJYA 5DT9A 1XKQA 4NK4A 1V8BA 1GTMA 4CM5A 2J5RA 2YQ4A 3EC7A 4KZPA 4NIMA 2EP5A 2EW2A 4DTIA 4BNHA 5KJFA 4BNVA 4QQRA 1KEPA 4RF4A 1XU9A 1J4AA 2V6MA 1ISIA 4JN6B 3AU9A 3PHGA 4NPCA 1VJ0A 4IMRA 3FTNA 3C1TA 2A9FA 3O9ZA 3MJVA 4B3HA 3QVOA 1DRVA 4DYDA 2Q2VA 3S2FA 4EITA 4NBWA 4DVJA 1A4IA 5DN9A 3E9QA 1UH5A 1GZ3A 1A71A 1T2FA 5JW6A 1EEHA 1LSJA 1UP7A 3PDJA 2W2LA 3CPSA 4UVEA 5H83A 1PS8A 1VC2A 2ZJ0A 2AEFA 1U8FO 1UXKA 4HNGA 3W6ZA 3LZ6A 5A02A 2NU6A 4GWGA 5BSHA 3RC7A 4J4TA 1T2CA 3GF4A 5THKA 1JDJA 2WYUA 1MGOA 5H82A 1Z82A 4PG7A 4NNJA 5DF1A 3UCEA 2FR0A 2FZEA 2GR9A 4BGUA 3U4IA 1W4ZA 2EP7A 1DIHA 2ZKLA 1XEAA 3GK3A 1JVBA 4EUEA 4TRNA 2NVUA 3SLGA 1GUYA 2QHXA 1Q0HA 3BMOA 1O0SA 1P1IA 1HYEA 5C37A 2G1UA 1BXGA 1HRDA 3MJSA 1NFFA 4OSPA 3UCFA 1R4NA 1NPDA 3KLMX 3WIDA 3S2IA 4J9UE 3KYCA 3SEFA 4J90A 3C7DB 2DTXA 3PJGA 1JWAB 4CLDA 3CZMA 3ONDA 2Y0CA 3K73O 3HN2A 4M86A 3RUCA 1H6DA 5CDUA 4AG3A 4FFRA 1I8TA 1WLYA 3U0BA 1LDNA 3UKOA 5T5QA 4J7XA 2ZYAA 3VH4A 3WGZA 3NGXA 1HYGA 4IXTA 1A5ZA 4J0FA 3SJUA 5IZCC 4JX8A 1Y5RA 4GBJA 1ZEJA 4K6FA 5CPFA 3H4VA 1DEHA 4GKBA 4YVFA 4P38A 1T26A 1IZ9A 4D3FA 3OEWA 2C5EA 4BNGA 3M6IA 3INGA 1E0DA 1U3UA 1W8DA 2F00A 1IYZA 2PZJA 2NQ8A 3IAHA 5TJ9A 5G4KB 4OIMA 2QQ5A 4EGFA 1EQ2A 1EZ4A 5KKCA 4ZD6A 2O3SA 1W6UA 2I9PA
chains in the Genus database with same CATH superfamily
4NESA 1PBTA 1GNRA 4UXHA 1FE8A 4CN9A 4ETIA 3ZY2A 1H2RS 3PL1A 2ZB3A 4AYXA 3MTBA 2I4OA 2IX9A 3P4UA 5GY7A 5FPYA 3REQA 3EUWA 1QRTA 4UHKA 3AW8A 4KITB 1BHQ1 5CFNA 2I55A 4K0KB 5JD3A 2G1JA 3EVTA 4AJJA 1CV2A 1DBRA 3AUSA 1ZK1A 2B78A 3G2MA 2YZKA 4Y2JA 2L42A 3OH8A 3U7EB 1WX1A 4EUSA 4DRYA 2HSDA 4M9SA 3L18A 1WXFA 3T61A 3SE7A 2VHWA 4F5ZA 4P83A 3BWYA 5H7XA 4DUPA 5CDTA 3TLKA 3VYTB 5AW4A 1L8XA 3TRJA 2AL7A 2VCEA 1YDGA 3OIFA 4PZ0A 4CLEA 1W35A 3H4MA 1O97C 1PZMA 2BKAA 4AY3A 4CCYA 5AVXA 5DBIA 4LRYA 1CUHA 2DPYA 2VHXA 4IDFA 4QGBA 1F2TA 1RQ2A 4PLTA 1A97A 3HUUA 3NAZA 4BB5A 1YIDA 3LMKA 5KJCA 4QQFA 3NANA 4LSZA 2QL5A 1PEYA 3D8RA 1E4EB 3OEED 1IBRA 4HYTA 4PVDA 3EF1A 1DFGA 4G9EA 3OE7D 2QSJA 1BX3A 4Y2QA 1JE1A 3LAWA 3H9JA 4M1ZA 3B1KA 4P54A 4YCNA 2VTDA 1IMOA 3K5WA 5E9WA 1WM1A 3QWFA 3F97A 1Y6JA 5F12A 1LA2A 3IS3A 2IEZA 3RV4A 3ESRA 1ENPA 3QY9A 1NMXA 1CDZA 2Q6IA 4B79A 2GLTA 5ICGA 3PT9A 2JI4A 4C0SA 3HU2A 3G68A 1BYUA 4O25A 3QY0A 5IYZF 5L3QB 5A2GA 4KXNA 4P8RA 5DBGA 1N0IA 3WC4A 2Y68A 3OY2A 4YP5A 3SC2A 4CIBA 3WGJA 2EOAA 2VK8A 1WPGA 3H1TA 1Q17A 5DLYA 2X23A 5DFAA 4UULA 3TJMA 3GLFE 3ABZA 3WNDA 1W9MA 1TVMA 2FEXA 4IUDS 1U9IC 3U56A 3NAGA 3C0KA 2PX2A 3PFKA 3PQ6A 2PQ2A 4QFCA 3G23A 5TC4A 1XJ0A 4HWOA 1L1EA 3T5TA 3WK8A 1D1TA 3AZQA 4ZJPA 1U4OA 4XXHA 4YRCA 4TWAA 3E8XA 2FUNB 4G1BA 3W5JA 1TYBE 2EARA 2J33A 1T4MA 1RSZA 2VJKA 1Y1PA 3AEKB 3BWEA 3H3JA 4UEQA 3RIGA 3EUEA 2HJVA 1L7DA 3KC2A 4KXQA 3GDFA 1OREA 5BT9A 1QFSA 1SXJA 3FCAA 4U6QA 1P0CA 3E4DA 3F73A 1A4RA 4BTLA 1IDOA 2I29A 1FSZA 4OHZA 2Z83A 1KDPA 2I1WA 2BFBA 1NLFA 1OBOA 2YDXA 4C7OB 2CFCA 3FPCA 1Z3CA 4GR4A 4KLRA 4MVJD 4TT8A 2OMKA 4D8VA 2I4TA 1CUUA 1MCZA 1VRCA 3HY6A 4MA5A 2AYXA 2Z0MA 4XPIA 2PL1A 2ZS8A 4WXPA 3BTOA 3TLMA 5HKBA 4LZWA 3FOEC 2Y76A 3PVCA 1L7PA 1TM3E 2AEJA 4BQRA 1SELA 3VI3B 2QLJA 2O06A 4H1VA 4MEAA 4RTPA 2XNKA 1JT9A 1BXKA 2RHOA 3SS7X 1EWYA 4YRNA 4H6XA 4O2BF 1CRLA 4RZUA 1TCAA 4PXSA 1SU7A 4FDLA 4ND1A 4RXMA 2NO7A 2C3MA 2PIAA 1JP7A 3SSNA 4X66B 5HQTA 1P5RA 1KAGA 3GFPA 3BMCA 1QDUA 3HI4A 4HWSA 3WO0A 4AG5A 1SUFA 2RJ3A 3CRZA 4ALKA 3ED5A 2BONA 5SZHB 2HU8A 4BQFA 1UWLA 2OHOA 5COQA 4JWKA 4C9BA 1K98A 1EFDN 4FS3A 1IOLA 1M9NA 2R4TA 3NM6B 4OXIA 4BIMA 2AC2A 4YO7A 4V3CA 4RHCA 5KCMA 1UDRA 1G98A 3EVZA 1DI0A 1UT8A 3CPJB 3UHOA 3H11A 3KFVA 1RRGA 4BASA 3U31A 3A6GA 3EZLA 4B6JA 3URKA 3IBGA 2LIVA 4DGQA 1RC0A 5JAHA 3E35A 2W98A 4GI3A 1DTWA 5C4GB 3RNLA 5LNK1 1E1QA 2FVYA 5K6TA 4TYWA 2ORVA 3CQ9A 1I2ZA 4MSUA 5JALA 1VJTA 4MVJH 3OKPA 1EP3B 4BO2A 4CM7A 4LF8B 1YOVA 2GJKA 4I1RA 3LK6A 2QN3A 5AJZA 3UICA 3UJBA 2H08A 2HH9A 1YMUA 4XASA 3RKUA 1QP0A 3QBJA 1OQAA 4L5BA 2V5AA 4NHEA 1X94A 3OLCX 1GRNA 5BNWA 1UMDA 2ZDGA 5EWJB 4U9UA 3S2ZA 4YRAA 1IONA 4D9HA 1TQ4A 1PWEA 3RVDA 4CM1A 5JRJA 1IM2A 3K5HA 3GRYA 3HJUA 2X9NA 1XELA 1E4VA 1W2WB 2C3UA 3O0DA 2X9GA 2GNPA 3IJRA 4KX3A 5AKHA 3MB5A 5CT9A 4LDAA 4TMKA 4X8OA 1PJCA 3QYAA 4J43A 1OT3A 4ZYLA 2XUKA 5DV9A 1EDDA 3WTBA 1AOXA 4L4UA 3OIGA 1SU6A 4JITA 3ZR4B 5C32A 2O2SA 4KNVA 4C6HA 3M3HA 3SSAA 3SFVA 3I09A 3FYSA 2BJWA 3OZEA 3SFZA 2ZSKA 5GM2A 1XT6A 5LB4A 3Q10A 4XM1A 2ZZNA 3G79A 4JXZA 1ZS9A 2Z5LA 4PQYA 2D5CA 1D0SA 1Y8AA 3BM5A 2JCYA 3GEIA 3R3HA 1KVUA 4G3XA 1QRSA 3F5MA 3HSSA 3ELDA 1L4EA 2F1RA 3EQ2A 1LF0A 2GDJA 5HBRA 3PPVA 2IXBA 3R23A 1GA1A 5FL7A 3HY3A 3IVAA 2XOXA 4G86A 1QF9A 4LF7B 3VKUA 1N32B 2X9LA 1GQOA 3X0DA 3MMSA 1PYOA 3AV3A 3DE4X 2G9RA 4XYGA 3HP1A 5H80A 7REQA 1T8PA 1P44A 3EPLA 4A7PA 3L01A 1X19A 2JIRA 2WG2A 4LKOA 4JP1A 1D4OA 4W8HA 3CR3C 3PHIA 1PJLA 1V43A 1XQYA 1XDGA 3K2EA 4JJ6A 2LCQA 3NHBA 3BN3A 4C5BA 2W11A 2DQYA 4L15A 3A3OA 3QYJA 4OHXA 2JKVA 1R6AA 4FYWA 1E3DA 3QLVA 4DG8A 3DAGA 1ZVMA 3I2GA 4DLZA 1CUFA 3DUFA 1P33A 1N3LA 3Q9SA 3QUSA 3GFRA 3TR0A 3D9QX 4JVSB 2NV2B 3JCZA 5BPFA 2WBLC 1PK7A 4LGMA 4BMSA 3H1AA 1Z4QA 3L4KA 1WZ2A 2ZQZA 2I3AA 1SC3A 1MMFB 4ZVTA 3WDMA 1FPQA 3QUAA 4BP9A 3HKDB 4PQEA 1O9HA 1OWOA 2ZRHA 3R7NA 4DR7B 4R8SA 4X3PA 5KSWB 2XITA 5FBZA 4B4KA 4OHPA 1G20B 4BWFB 4PS1A 1YJ8A 1I7LA 5AICA 2E55A 3DTTA 4IBOA 3HSYA 2IHKA 3JTEA 4L9AA 1T9GS 5AJXA 3O95A 3ENQA 4O29A 4UZEA 3WB9A 3V4PB 4RAQA 4JY7A 3SVZA 1B8PA 4BFUA 2IU0A 3CH6A 2IXEA 2GJ9A 3VQTA 1SIWA 1H5NA 2ISQA 3ETEA 3A04A 3PUIA 4FOOA 5EHNA 1YULA 4LMAA 5B7PA 4J0IA 5HG0A 3WLAA 3IJEB 3EX7C 2FMTA 4TWJA 2A94A 3EXG1 3S29A 2K6GA 2BFEA 3ZBTA 4R9RA 5KU1A 3CUUA 3MW8A 1T0IA 1WHSB 4GGPA 3PEFA 3PC8A 1RM4A 3NG1A 4I9UA 2FK8A 4FMCF 1F7VA 1QGED 2GK3A 4HDKB 4JKIA 4EFMA 4M8SA 3S2UA 3JAMA 4UEJA 2BTQA 4K7JA 2IQ5A 5PGMA 5E6SA 2ZTHA 4AS2A 1QQ6A 1WUHS 2J4DA 2QMZA 2RCNA 1O6CA 3R1IA 5ECYA 5EUBA 3WIEA 5E7QA 1AGRA 5B7NA 4I55B 2Q5FA 1EM8B 1OC4A 1P2TA 2GKOA 2VXCA 3VYRB 4D8UA 1VP3A 3H2JA 1QRUA 4IIXA 4WGGA 5ELMA 5TGZA 3L9WA 2Q8QA 5HOQA 1R66A 2CLMB 2HK7A 3HM2A 2VH1A 3T5GA 1S4MA 5KVVA 2CCGA 2IXFA 4XGRA 1UK9A 1U3GA 2N42A 3WAKA 1VIDA 2O2ZA 4C0WA 3GCXA 3H9QA 5FKJA 2VP0A 5FOWA 3TUIC 1XF9A 2YZ2A 2GWHA 2Z56A 1NPYA 3A6EA 1XTVA 4FOLA 1W19A 3V6MA 4EELA 1P1CA 2OSVA 1OAKA 2NZUG 2XCRB 4J91A 5JISA 3NIGB 3EGVA 2YOGA 1KEEB 4NS1A 5J2TB 3PG5A 5AM0A 1PR6A 4JP8A 3H0KA 5SICE 3RQSA 2JZNA 4BEVA 5A4JA 3KU1A 1MXFA 2X41A 5JZVA 5CA1B 5A06A 4KREA 1YR8A 1FVXA 2HXGA 3VVCA 3SX4A 2X5NA 4JOSA 3GGOA 3FLEA 1QAQA 2ASEA 2ZCUA 3WLEA 3G5UA 2ILTA 3PQ5A 3IIMA 4YLGA 2Z9CA 1V9LA 2HLNA 2X7XA 3AESB 3ORSA 3HEMA 2VF7A 1ULBA 3QTTA 3KAJA 5CVDA 4Z4GA 1C7FA 1D0IA 2CFRA 4B0PA 2O8BA 3CEAA 3CLTC 2Y92A 1E7QA 4NRDA 1CF2O 1E2NA 2H9AA 4GVLA 4NOLA 3DTVB 1NXSA 2AXEA 3GJ4A 5KMGB 4EARA 3IV9A 3VDXA 2B4YA 2WP0A 3N0VA 4MVJF 2TSYB 1WU7A 4BJ1A 1XJCA 1LX7A 1PGQA 4KSCA 3VZQA 4B6PA 5DTJA 3MCWA 2IOFK 1S1CA 2YMPA 4AX8A 2FR1A 1Z7YA 7ABPA 1XEWX 4FD3A 1L4NA 1O4VA 3DEZA 3FYUA 2R6CA 5BV8A 4DV0B 1JYFA 1W5EA 4PG4A 4L50A 4RKYA 1ECPA 4YONB 2CB9A 2NVUB 3OF2A 1F6BA 4M89A 4O2AF 4R16A 2QLTA 2OGSA 3VKFA 5TSDA 3PTLA 2R79A 3W2IA 2IZ0A 5KU7A 1J20A 1Z17A 2A5YB 4EMUA 4KGDA 1UK8A 4E5NA 1FJGB 3DB2A 3O7WA 3EDOA 2BZ1A 3E48A 3PGJA 5K2MA 3BWMA 3SN6A 3FWNA 4G56A 3CH5A 4GHWA 4UOQA 1WW8A 2AZTA 2HGSA 2QG9A 3IAEA 3EG9A 3LWBA 4QPZA 2PY6A 3UO8B 2AB0A 3LXXA 4ZJYA 3SIPA 1DTEA 4IG4A 3R3WA 5KYWA 1PFKA 4PNHA 5HZKA 4DLKA 2JEOA 4AJ1A 4CL0A 1EFTA 3U7JA 4QJBA 3D3JA 3QXHA 2QTLA 1Z13A 3V8MA 4TS9A 1GYQA 1E0JA 4NVRA 5EY5B 3H2SA 4MIEA 1XQ1A 3GAMA 4FYYA 4FMDF 1JFTA 4NMXB 2VSNA 1BH6A 1DOHA 2GNAA 3EY9A 3I76A 3JY6A 3WLIA 2AFVA 1Z2AA 2TMGA 4BKMA 1G42A 4C4TA 4RIEA 4KNYA 1XQ9A 4PPYA 5B1IA 2XDYA 1NWHA 3C3CA 3LX6A 4OQXA 1YZYA 1XAIA 4L6AA 2JAWA 5TPWA 1CY2A 1GQSA 1M74A 3B6JA 5I8ZA 2PV7A 2YYSA 3NKVA 4EJ0A 2VYFA 5IK2A 4KPUB 2IXGA 3AB7A 1BS1A 4X9XA 4GSYA 4EGAA 3TOCA 4O0LA 3I8OA 1PR3A 4NR0A 5JSKA 1S89A 3QU2A 4CEHB 4M0PA 4P82A 2B83A 5U4XA 1E9CA 2BEWB 3VHLB 5C1OA 2H4WA 4EVQA 4RH1A 4M99A 2JGJA 3GJ0A 1WE2A 2HF8A 5BV0A 2DH6A 1O6BA 1QKKA 3GJRA 3HWX1 3OQHA 5DHQA 3MWLA 4UPEA 1TRKA 2V1UA 3QE9Y 4FB5A 4TT3D 4FC6A 3PUKA 5E6RB 1CERA 1P8JA 3ZS8A 3VZDA 3DDZX 3E3AA 3EAFA 3G7UA 4IMIB 3M5PA 4KLCA 2R1TA 3DSRA 4M49A 4NI5A 5CLGA 4BQEA 3KQLA 2VDNB 2X2PA 1R37A 2J3LA 4PZCA 5BV7A 1OV4A 3TPZA 4UCWA 4YLEA 4URZR 5THQA 2ACVA 2F8MA 1UJNA 1JTEA 3DWIA 1GN9A 5A4FS 1OZFA 2OXTA 4PHGA 1U1IA 2FQQA 4XOUA 3RSGA 1ESNA 3RYHB 4LDQA 2R7KA 1ZY2A 3OSUA 5D3ZA 3EBPA 4OREX 4CHTA 4D4GA 2DERA 3FMVA 4X20A 1CQXA 4MI1A 1RQNA 3JD4A 1KKLA 4ZC1A 3TQCA 4MQ6A 3ORQA 4L8VA 3GRPA 1OW3B 1J33A 3V48A 2IYLD 1QZZA 2CLSA 3FYDA 4PONA 5EHGA 3OLWA 4ZQGA 3ZWXA 3I5AA 5FT9A 2CNKA 1VLVA 4ZVOA 3PK0A 2P90A 4WNYA 2J9FB 4RVSA 3WWDA 1PO7A 3DGFC 2A33A 2XWJI 4HS4A 3F6YA 4EI9A 2OUKA 4AWAA 1FP6A 4ZCMA 4I5FA 4L0CA 3W5UA 4CEJA 3ZLTA 3FNFA 2B5WA 1UKYA 2YOHA 5GJBA 1FNCA 5GIOE 3C3KA 4BN5A 4M1TA 2TYSB 2G8LA 3LOPA 4W5HA 1Y3DE 5KJ1A 2VH5R 1OV6A 3K8OE 1OPXA 1Q0UA 1IY9A 3NBZC 3AINA 3KPJA 4ZYTA 4DHWA 3T99A 2WNIA 5H16A 2Y1CA 3GXOA 3IMGA 3TLYA 1UFOA 3DFIA 3AF1A 3WYEA 2CHGA 3KHUA 1UWVA 4QWMA 2QXUA 4WH0A 3SY8A 4ZV4A 3PTZA 1NW7A 4S1NA 2EIHA 4J0HA 2OWDA 4D4IA 1ZR4A 3SOPA 2PCJA 5EXXA 4QA9A 5FTNA 1A8PA 1L6RA 2FPMA 2OWEA 3UOWA 1X8JA 3M6FA 2BJHA 3HXLA 4MO2A 5CLLA 2VDKB 4Y0AA 4C0JA 3BA6A 4ZAWA 2R7NA 4BJ5A 4IFTA 2V7EA 3OFJA 1AV7A 4RZSA 1N0HA 1LD3A 2AMJA 4I4CA 4OG2A 3WO1A 1ORDA 1FP4A 1YVRA 2GD1O 4XAQA 5AI8A 5ITWA 2VJDA 1E5QA 1ZYUA 1Y7HA 1OFHA 2Y67A 3HCCA 1V5EA 5EWMB 4OKNA 3VU9B 4BKUA 2EFCB 4L5JA 1Y89A 2DSTA 5C18A 3DHEA 1PE0A 3A1SA 4XYMA 4YUXA 4FW8A 4PO8A 4NZMA 4BMPB 1I7DA 3BTVA 4KQ9A 5I8WA 5MHTA 4X1IA 3SMQA 4V1CA 4DR6B 1QFJA 2BFPA 4E3WA 4M7PA 5E8JA 5HKKD 1MIOA 5JXGA 4RW0A 4FSHA 3PLRA 3C87A 3R24A 3LHIA 1EDOA 1XDWA 2V6GA 4WKBA 4Z0PA 5KAPA 1QRRA 4G5SA 3MWKA 3OZSA 1E0KA 4RMIA 1PT9A 2CCKA 1TEHA 4EDFA 1P7CA 2Z8YA 4TVOA 2P3LA 3CNEA 3PIIA 4HV4A 5JS8A 1YRBA 1Q7EA 4Y2GA 2C29D 1H6BA 4MKHA 1CY4A 1G1AA 2PPLA 2PWAA 4HMQA 3HBMA 3O4JA 3ZZ1A 1XI2A 5IYZA 5FV7A 2BOVA 2H6EA 2ZRLA 2FKAA 4K87A 3D6JA 4Q1CA 1AS3A 1XVIA 5FWNA 3TRDA 4F60A 3GPDG 3E53A 3TDNA 3UMCA 1LPAB 1ISJA 1GXSB 3CUWA 3V8VA 4B47A 4MAAA 4YJ2F 4E2XA 4LQ4A 3QXCA 4GM1A 3A36A 4N3AA 2NU9B 3G0CA 3KO8A 3MHPA 2DBYA 3V4VB 3TVDA 5KNCH 5H8WA 3RYTC 4J7UA 4L8LA 3X1WA 1Z45A 4MWEA 1JEJA 1V8ZA 2FN7A 1SIBE 3GP3A 4KV9A 1GUAA 4PZYA 5BOSA 3KXPA 3MJDA 4UAVA 5HWSA 5LZ2A 1BWQA 3R7BA 3MLAA 4BO0A 1ZGJA 1S01A 4MUKA 1U0TA 1CY0A 3L7YA 4N0MA 5DZSA 1JJAA 1KETA 1AN9A 1ZFNA 1PD0A 3ETGA 3NYQA 3O1JC 3O2SB 1RJEA 2OGZA 3RVNA 5CJJA 1VI5A 2FCAA 2OCKA 1W88A 2OSBA 1CWUA 4R05A 4S12A 2NO1A 3BHIA 3ZWMA 4RANA 1K86A 1JQDA 3AU8A 4GUAA 2FF5A 4XGIA 2IXDA 3GVHA 3SXPA 2ES4A 4PPNA 4XJVA 3IV7A 4I50F 2ZWVA 4PNZA 1YV9A 4ZZ1A 2A0UA 2W8BA 3V42A 4U8GA 2VHZA 3GCDA 2HV8A 2GEBA 2TMKA 3PUHA 5IN4A 2IEBA 3A6HA 5T3UA 1Z37A 1GA6A 1ZM2A 5ICMA 3AKEA 2WHPB 3QELB 2E5LB 3MGCA 4O2BA 4LFBB 1PR0A 3K0FA 4LX8A 1KYTA 4E30A 5HQJA 2WE8A 2OC4A 6LDHA 3LT4A 1CUYA 2XNCA 1KE1A 4B45A 4W4TA 4P4GA 1G0NA 2NSDA 1NNUA 2B8EA 3NC4A 4HB0A 4OV6B 3E82A 4MOWA 4RD0A 2BFOA 4BO9A 2GTHA 3UOGA 3PC7A 2JGIA 3T7SA 4GFDA 3OPYB 4IIEA 5MN5A 5BVHB 4HR7A 4Z9AA 4WOKA 1M0SA 1I51A 3DKKA 1YB6A 4RIGA 3SC6A 4EPRA 4KAAA 4TVBA 2WMDA 5F98A 5BSVA 5JNRA 3VAYA 3IBFA 2GFQA 4WXHA 4JCCA 1GGMA 2HW8A 1P74A 4HNQA 1QLHA 4ZOEA 3QPDA 4OQLA 4M21A 4HRVA 3ZBQA 1QE0A 5FBRB 1BH2A 1C1HA 4XX1A 2JGFA 3DEFA 4LXYA 2QWXA 2ZRCA 2IXTA 3K7EA 4XQCA 5K3FB 3AVTA 3HZOA 1P4AA 4QFBA 5D3QA 4TV9B 3C24A 2RIRA 1B76A 2ACWA 3G5LA 2AC7A 3IT2A 1NUTA 3GR6A 4FS8A 2MSNA 2VDPB 5FR2A 3U37A 4E7PA 5JHHB 1GVHA 4X97A 4FZ5A 2I80A 3U3MA 1KJ9A 4BBZA 2BDTA 4EKIA 2ODWA 2F62A 2HBRA 4HMPA 3ZQKA 5KHLB 1Z8HA 2KBEA 4EZEA 3HXQA 3PXXA 1W7AA 2GRJA 4NZNA 1L2TA 5CEEA 3FB1A 2JFQA 4ZCQA 4M7OA 3DLTA 1AU9A 4B1FA 4DUZB 3ZTWA 1LRKA 1U9YA 4J1SA 5TQ0A 4AZ0B 1R18A 3W5DA 2UYYA 4ZHSA 5T6MA 1H8EA 4N4AA 1OX4B 4H3KB 5ALYA 1EVZA 4AQYB 3TZCA 3H18A 3BL8A 1MNAA 2WW8A 2C2MA 2H1RA 1ZD5A 4Y8VA 2HHCA 1SY7A 3D5QA 1N2CA 3GZTB 2IHBA 4DR3B 1EFAA 3TGWA 3WZ2A 4KWEA 3DZIA 2H17A 1WG8A 1E9FA 4JP2A 4D96A 2WFZA 1K8XB 4ZEWA 3JSAA 1QUEA 1VGRA 1Z36A 1CB7A 2HWUA 2WPDD 3GAZA 3QFSA 1JFVA 1M1ZA 1NBHA 3MCZA 4LOJA 5CXQA 2REXB 2CJXA 4GZ5A 3DMNA 5A3VA 3OZCA 3TLBA 3PDHA 3WL5A 5JZOA 4S2EA 4XWTA 1XF1A 2B82A 2VOJA 2CXPA 2W2OA 3JQFC 3U7RA 1KSGA 1HI9A 3F3MA 3IIKA 3RWOA 4IDAA 3RYFA 4BNFA 1O9BA 1RM0A 4LOKA 1N2BA 5AW8A 2FMKA 3G1UA 4Q24A 2XUFA 4E13A 3HDQA 4ARVA 2NZYA 4YBRA 3ONVA 2BRUC 4MAFA 4GKKB 4ZT2A 4CM9D 3Q3GE 3THXB 4FCTA 4IWXA 1MAHA 1CNFA 4G5GA 4PLHA 3BRQA 1DRWA 2E5WA 3RT1A 4EY7A 1KI6B 5M5BA 2ZJBA 5U1PA 1SNYA 1YS7A 3USCS 4BRUA 3GLRA 2EG5A 3H42B 1OX6A 4KN9S 2CMFA 1E5DA 2VSFA 2PXHA 2JGRA 6GPBA 1H1LA 1R27A 2FAXA 3DDHA 4O5OA 3OT1A 3RQIA 3UY4A 5A9SB 3FSRA 1XGKA 2O8EB 2C9OA 2HHJA 4JUBA 3M3PA 4DV7B 3R3VA 4MV4A 4CMEC 2EU8A 3UW3A 3ICQB 2I4LA 5KQLA 4JEHA 5B6JA 4BUJA 1HF3A 4YI5A 4K8OA 2LNDA 2OZLB 2HWYA 4OOEA 1WAMA 4RJJA 5I4BA 2ABWA 4HDRA 1OFVA 1MO5A 1JXOA 1T0UA 4BX8A 1CUAA 4L3VA 4BNUA 1X80A 3W7AA 2J0SA 3ESYA 2GAFA 3PKZA 2HSWA 5KJ6A 4PAQA 3DL4A 2G3YA 4P3KA 1M0EA 5TGDA 3HB7A 3OZGA 4IHKA 3HUFA 3SEAA 2FB9A 1T1GA 4LC9A 1IZ8A 2EZ4A 3ZE7A 4FZ3A 2C1XA 2RGNC 4G0VA 4MP6A 1VJRA 2CE7A 2IYYA 4TTVA 2CLOB 2FPSA 5CYPA 3RUIA 4Y2HA 3SBDA 5JXIA 2OAQ1 5L6MB 2A1UA 2TRSB 2YW2A 2UYQA 1EX9A 3Q88A 2ATIA 3PPYA 2E6KA 2HUPA 4GLLA 4JQCA 1TM7E 1F2UA 2X1HA 2YY5A 1XRNA 4Q19A 4AZWA 1J0EA 1V5FA 4A16A 4DMGA 4PC2A 1O95D 2JIMA 3OEEA 5CCEA 4JBGA 3QV1A 5FTMA 3T9FA 1W6RA 3OE7A 4XVQA 5JWOA 4JC5A 1B74A 4J0GA 4PGMA 3HGQA 1NW3A 2CXSA 2HEIA 1C7IA 4A8JC 3SD7A 2Q3MA 2KW5A 4U5QA 5EYPA 1G5IA 1M6EX 1CIVA 1OOEA 1K0UA 1DLJA 2JBHA 3G0BA 4WZAB 4XSHA 1QG6A 3ZXSA 4I4IA 1UJ6A 1M2KA 2LKCA 4REOA 2FSFA 1NI4B 1GTJ1 4QL3A 3OIYA 2C96A 2BR4A 3CB2A 5DM70 3ZBPA 1ZXBA 2Q5HA 4RIFA 4QYTA 5BYJA 1HQCA 5JASA 3B6ZA 4IS3A 5B3JC 5CH5A 3KB2A 3K92A 5F73A 1E59A 1JSLA 1CQPA 1QYRA 1QTNA 3AJRA 4UNQA 4Q03A 3DBRB 3ODPA 1QPZA 1DMSA 4X7BA 1S2GA 1PUXA 4GECA 3L8YA 1AS2A 1RZUA 1ZAKA 2JDID 4KLZA 3U81A 3RYIB 4RH0A 2AFHB 3AEQA 3O4RA 2V0NA 3L1HA 4C3OB 3MS2A 1XK7A 5EWLA 2ZITA 5DE3A 4R2HA 1N57A 2VTVA 2ZJFA 3VUEA 3BQ9A 2YBEA 3BH0A 4LSGA 2O3QA 2GD0A 5ILGA 2UV8A 3K32A 4C08A 1EFVA 4HNTA 2QN8A 4H7KA 2Q2WA 2WF5A 5WRFA 2VDUE 4C4AA 3OFKA 2P41A 1C9EA 3C5WP 2QN9A 1MT0A 2QJOA 5IRCD 3R9WA 5ELLA 1IG3A 1X7XB 1T5SA 3TM4A 3RVPA 1KYVA 5B6PA 1OLXA 4DDMA 4MVJA 2DVMA 3DWGA 3IEPA 5LA6B 3EG5A 1UEIA 4CV2A 5EE0A 3IDQA 3NRJA 4HC4A 3PE6A 4N65A 3OA0A 2WSSD 1TYCA 5C80A 3L7DA 3KETA 1XMXA 1TE2A 4KXYA 3ZD8A 3ETHA 2VDWB 1IY8A 3VSCA 1JG1A 2FRVA 1WQ4A 5CURA 4AYWA 4CUJA 2AD5A 2PGDA 1NXTA 1T34A 2WKSA 2EVWX 1NVVQ 1E89A 3DQQA 1IHPA 5AOCA 4B6GA 4O2AA 2L17A 4C4RA 3AFIA 3Q7TA 3AIOA 3HDGA 4YQZA 3UVEA 3ZWKA 3NOXA 3P2YA 1Z6TA 1ESCA 1KPHA 2O4UX 4L2IB 5KJEA 4XIFA 1RYZA 4RVNA 5BSMA 4QEZA 421PA 1OXVA 3T3OA 1Z47A 1XFAA 4LFCB 1E1YA 1LC0A 3FUWA 1N7IA 5CVTA 2OK8A 4I1UA 4BMYA 3I5XA 2B61A 1NM5A 3RHZA 3V46A 5BN3B 2OM6A 3M5WA 3G1TA 4LC1A 4NMLA 1TUIA 3RSZA 3VZBA 2R1VB 3IKLA 2WF6A 3HJHA 2VUHB 1PDVA 4XGNA 2XT6A 1Z6ZA 3QKSB 4RK1A 2I0FA 5T4HA 3SXJA 5HR5A 5KTNA 4URFA 1HXHA 5E2BA 3CEPB 4EL5A 1NOJA 1C1XA 1HDOA 3HU5A 3IEIA 3U7HB 1GQ2A 2J9XB 1D5CA 3BE4A 3E7PA 1EHCA 1E79D 1UBMS 2QTMA 1YDEA 2X9QA 4PBRA 4RSHA 4WHMA 1L8OA 1NQ5A 1QV9A 3K6KA 3NHYA 4X8MA 4OJNA 1IIRA 1AUOA 5EMJA 1JG3A 3ZY3A 5LVAA 1HQDA 2J87A 3NHUA 4RA6A 2F1HA 5HJEA 2EQAA 4JBYA 1AUQA 2A7QA 2MYUA 1U6JA 3I28A 5AQEA 3O8CA 2PQ0A 1PI3A 1HETA 1YZTA 5DM2A 4TSRA 2DFNA 2G5TA 3WS7A 1KAHA 1KDVA 3UT5B 1X8LA 2WIJA 3CGGA 1W25A 4ILKA 4C29A 4YRKA 1BDIA 1L7BA 2YRFA 1UBGA 3PWKA 1WMBA 2HZ7A 4B40A 3GCZA 2JGAA 2EEZA 2WM8A 5C1IA 1NDUA 2A6PA 2QTCA 5GAJA 5IBRA 4AVYA 2GEFA 2XTAA 2YL2A 1NULA 3FBGA 1T91A 3PFCA 4BE7B 3F8TA 2C9ZA 2EF0A 3MYRA 1QGUB 4WLEA 3NX4A 2IY9A 2IK8A 5LR6A 4OUDB 5DKFA 4B82A 1HQYE 1NZDA 1K4KA 5BWOA 2COEA 3AP1A 3RD5A 2OO7A 5FPSA 3OIDA 4HDSA 2NYUA 4RIHA 5EHQA 1GM5A 2CMGA 4XVCA 5D8DA 3IUSA 2PAFA 3JATB 2BDEA 1SVMA 3MPOA 4IUBS 2OILA 1Y48E 1NXQA 1RT9A 3T06B 1TZJA 3UHAA 1H05A 1Z2OX 3SQWA 2CY0A 2EKLA 2FEWB 4P33A 2EJCA 3PUWA 3RK0A 5LQKA 1XZJA 2J0EA 3B7GA 4Q01A 4R0NA 5IM5A 1JYSA 2Z1NA 4LXUA 1CF9A 3QNWA 1TAHA 2W00A 3E7WA 4ZV7A 3SU8A 2E4XA 1A3CA 3ZD7A 1GR1A 3TKAA 3MWYW 3ORRA 1TYEB 3H2YA 4YXFA 5KVAA 2Z98A 2BMEA 3DVAB 1SQFA 3MTEA 4FMBB 4MW5A 5BQ5A 2C9DA 2VK2A 3ZI0A 4FHGA 1EBFA 5CLJA 1OZGA 1M6VA 4Q3DA 4L16A 3R3UA 4UE6A 3DLBA 5JATA 1IBMB 1Q1QA 2VUUA 2JFUA 3L1KA 2QUHA 2XVXA 5J4HA 1RWVA 3QF4B 5CHEA 4TTTS 5BNFA 3TMYA 3A3NA 5B58C 1NUHA 3ONWA 1BMFD 4IWNA 4CUZA 2P1ZA 4WGFA 3TF5A 3LA6A 1Q3HA 3DV0B 3IAFA 4OXQA 4OFBA 2EJVA 2HL6A 3A9RA 1P8AA 1L5HA 2CHUA 3HB0A 2HCRA 3MA0A 4Y2RA 3PFNA 2IHVA 3NBAA 4Q93A 4GZ3A 5B1DA 3W90A 1MAAA 2JIQA 3L02A 3TLCA 2HD4A 1E6UA 2IYWA 2J31A 3KFXA 4G37A 3WLQA 3DO5A 3NWPA 4M6WA 1E3QA 3AHIA 1H3NA 4KMRA 5TNXA 5SYAA 5KWSA 4QC2A 2ZQYA 4I1IA 3PXUA 2ODEA 3M89A 3GMDA 4EW1A 1ML3A 3W04A 3ER9A 3OJWA 4KO3S 2AKEA 3LYLA 5BW5A 1FFEA 1UBEA 4OSOA 3QOXA 1VCNA 1QO9A 2RHBA 2WJHA 2FMHA 4MV7A 5ALRA 2GNOA 2P6MA 3KWMA 1UIRA 1A95A 1G8FA 3PX3A 3IODA 4GIBA 3COVA 4TMFA 1YZGA 4QQKA 2BH2A 3CXRA 1E3WB 3ADPA 1VIMA 3BFKA 1M2VB 4EIWA 2XZDA 2IKQA 2K5UA 2XPCA 1N6IA 1A9XA 3G7NA 4JLSA 4QM7A 1N0VC 3P2KA 1JL3A 2NGRA 2O8NA 5DP2A 4A0HA 4RTSA 4KR6A 2DPGA 4JT4A 1Z0ZA 3O6VA 2GN6A 1ZC3A 1QHIA 4NZ9A 3WAGA 1HK7A 4C6RA 2GSWA 2ZYUX 4A8JB 1E6LA 5KWIA 5REQA 5B1HA 3EZXA 3LPCA 4KXXA 4W7IA 1D2CA 4B3IA 2I78A 3OHSX 4X6LA 1RLJA 5GP1A 4CG1A 3QG1A 2A9PA 4ZHQF 1NWCA 4F6LA 3UENA 3UHFA 4JXXA 4YJHA 1QIHA 1W48A 3WJ2A 5HW0A 1NVBA 2VRCD 3AOGA 2YVUA 3WGOA 2CV2A 1E18A 2K7FA 2P9FA 2ZVQX 2I7DA 2F67A 4OXYA 1B93A 2ZSDA 3K4QA 5F2KA 3TTWA 2XUIA 1YUBA 2VRWA 2WJYA 2X40A 5DIZA 3VJMA 3O8LA 1SBHA 1E1MA 5J1TB 1Y81A 3EQZA 1SD5A 4FNMA 2F1OA 4AO7A 1RAAA 1OPRA 1Y7IA 2ONKA 4R84A 3NEPX 4NZOA 3DMGA 4AKEA 3BSYA 1OFUA 1OXTA 2HADA 2AOTA 2I65A 4M1YA 4QX6A 3C3YA 1IM5A 4K9MA 1XDSA 2G04A 2V3VA 2VWGA 4MGHA 4C0QC 1I6LA 1V11B 3EGEA 3FSGD 5EZYB 5LC1A 1KH3A 1SVWA 2ZANA 1SOVA 4Y9RA 3TNYA 1TK3A 5IT0A 3IQZA 1FU4A 2AE2A 4PWZA 3U4QA 4PCUA 4YJ2A 3N3BC 3MD9A 2UXCB 5B30A 1SRQA 1UZMA 3C7TA 1XXHE 2JCBA 3G2JA 3KLPX 1DT5A 5CM2Z 3U3JA 4W9NA 2W5UA 5GWXA 3CLUC 4RXTA 1CD5A 4M9RA 2BFCB 1HYBA 4ZKEA 3RS9A 4M46A 4EFLA 2BCEA 2C9MA 2GTPA 1SMKA 3VNVA 4JLOA 4FGUA 2D74A 4ZCLA 4BKQA 4MWTA 4WK2B 4F7WA 5K6AC 2XJ9A 1VE1A 2ZTVA 3WOVA 2OLKA 3X1YA 3PRYA 1GRQA 3WL3A 3KJEA 1T9GR 1ZUNA 4KE9A 2FSPA 3KB6A 4O1IA 2YHIB 4XB1A 1M54A 5I9TA 1K6IA 3FZQA 2XVAA 3R41A 4U2KA 3UXEA 1APBA 2UYHA 4F8YA 1AUVA 1Z25A 3ASZA 4AJ4A 2EGHA 4PLZA 4LF5B 4I50A 2JI7A 5D87A 1T24A 3FOFC 2WYVA 2XWBF 4ESHA 5H5JA 4H1HA 4DTCA 2HPVA 4LK2A 1JFFA 3U4HA 3ZQ6A 5B37A 4DLNA 3OZTA 4KXMA 2IUFA 1CRWG 4WX2B 3RDPA 4BX2A 3N0TA 3CRMA 3H2GA 3H1EA 2PAAA 1D8TA 3DCYA 5TF0A 3DYIA 4DLAA 3UH1A 5B64A 1OLUB 5DSTA 3RS3A 4B8ZA 3TZEA 2ZR8A 3EIWA 3Q72A 4HS9A 3H6KA 3NPMA 3T7JA 1E0AA 1STOA 4LVNA 1KFKB 2X0RA 2EL7A 3SSMA 3FNEA 4FDUA 4N1AA 1JH9A 1OI2A 4TTRA 1I7PA 1OZAA 1W5SA 3Q8LA 4HLNA 5KWVA 2GS9A 2OG2A 4RFSA 1YB1A 2O4CA 5CFPA 5EN4A 2QAGA 1SD1A 4KBYA 4JL8A 1YHNA 2CHEA 3JYOA 2R25B 3CIOA 1EESA 3ILXA 4YRLA 5NULA 4NFYA 4IZ6A 1L1FA 3NDJA 4L28A 1HFJA 1BHJA 4XD2A 2JASA 2IE0A 1EK6A 2PYIA 2F9MA 2RI0A 1JEOA 3FF1A 4MUYA 4EGQA 3ZNPA 4CPDA 1XZEA 4K6GA 4F5EA 5KOJB 1ZH6A 2XNDD 4D6XA 1BMTA 2XCLA 3DZGA 1GPDG 3EEQA 1LLDA 4DM7A 3VR6D 2RH4A 1BTOA 3H84A 3RUAA 2VQFB 4B3SB 1CUWA 5BMVA 1F5NA 4BEJA 1VM6A 4HTAA 2F1IA 1UPUA 1Y8QA 3HBFA 4FDVA 3S1AA 1TF5A 4XCVA 1J9GA 4HY3A 4ZZ2A 4G2NA 5JWHA 1EGVB 1A88A 1Q0QA 2FR8A 3RUFA 3PA8A 2NO4A 4RV4A 5FBLB 2Z2JA 1NTRA 1FJXA 1J0CA 1EJ0A 4D41A 3HFGA 2C42A 2X4GA 2G76A 4ZI2A 5JWRA 3JALA 1ODJA 4IDOA 4IUYA 1A76A 1R0CA 1J70A 1J8VA 1W59A 3LPMA 4F2GA 4TT3A 4CFYA 4E15A 2ZIFA 1KH1A 4D9CA 2OYSA 3Q2OA 2YHAA 3OLZA 5K3BA 1V47A 3RFXA 3LO5A 3QGMA 4KIGA 3BTSA 4UDXX 1XQXA 2HK6A 1EFUA 1U5AA 2HCJB 2XVZA 5JC1A 2VYQA 1UBTS 2ZSEA 3G9XA 1QBGA 2RAUA 3U61B 1P60A 2JI8A 2Q4DA 5LBUA 1FFHA 2DHRA 2IYSA 4M76B 3SJ7A 4DKJA 4MKXA 2ZIZA 3KJQA 4F85A 2OV2A 4QLAA 1D7AA 3DW3X 4CT0A 2CXOA 1YS4A 4GYKA 4ND8B 2H1CA 3H7IA 1VKNA 3MLBA 3PUZA 1T0HB 3ZY4A 4DCMA 1U1CA 4LNAA 4AY5A 5CAEB 2GT1A 5BUQA 3NO4A 2AEMA 2VDMB 3VR6H 4CKYA 1JAXA 3WRVA 2X15A 1CJUC 2ZJOA 3TL3A 2QBYA 1D2RA 1ZCAA 1NLYA 1XMJA 2IOHA 3TD9A 3CBQA 3HKEB 5G0UA 5LMZA 2W6NA 3DPUA 3EIEA 2XKKA 1USUA 5TS3A 1BA3A 3QKRB 5G40A 1QGZA 1H1DA 5LP6C 4D4KA 2ZJ5A 3WHKA 1ZZGA 4BVAA 1U2EA 3FE2A 1FX0A 2ET6A 3CH7A 3ELWA 4NQRA 4TQ9A 1YQWA 3O4FA 4WA8A 3S28A 2CJFA 3NKLA 4KXLA 1K06A 1OTXA 1VPDA 5DTQA 1B8UA 1WKBA 5J23A 1PJ4A 1U7UA 2NPIA 4X94A 5DRTA 4V0QA 1MBZA 3KJZA 4QNNA 5GMOA 1E2DA 4F11A 4HRYA 2BKVA 1IIBA 2EYQA 2O2EA 3KHKA 5UKDA 3QYPA 4V1CI 3K0EA 3QBVA 3QU5A 4JDPA 3QVLA 1CPYA 2B5VA 3QOYA 2WSIA 3D8UA 4GPD1 3FYCA 4HI0E 1BCSA 2HKIA 1C8LA 2WSBA