3O4RA

Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
TRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dehydrogenase/reductase SDR family member 4
publication title Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
rcsb
source organism Homo sapiens
total genus 86
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o4rA00
1JWBB 2DVMA 5JDIC 3WQSB 4DYVA 5B12A 4CV0A 3E9NA 1Y8QB 1RYDA 4MINA 4JNKA 4KQXA 4LCEA 1RJWA 1R0SA 4XRRA 3DL2A 4CODB 4D3SA 1EE2A 4PG6A 1JLLA 1Q0QA 4N7RA 1FXSA 1K6XA 1X1EA 5L95A 2VYVA 1LDNA 1E1LA 1HT0A 2DBZA 4HX5A 1NWHA 3PIDA 1EVJA 2EW8A 4W82A 4PG4A 1JTVA 2OP0A 3OIDA 2CDCA 4D42A 1AHIA 1E7RA 5ENDA 1K3TA 1KVTA 1T2EA 2DT5A 2VWPA 4OMUA 3UCXA 4OL9A 5CFZA 3D7LA 2NU8A 3ZDFA 2OBYA 3HWRA 4DLAA 2UDPA 2NM0A 2YQ4A 2JHGA 2O48X 3AUUA 3KTDA 4E5PA 3LDHA 3W4IA 4LVUA 4CM1A 4J7UA 1NPYA 3RJ9A 2BH9A 3NTQA 5COBA 4A27A 5JXWA 2HSDA 2O50A 2GN6A 3JQ9A 3TZQA 3WLEA 4BO0A 4BNNA 1R0LA 2AQIA 2QG4A 4KDFA 3WQRA 3OQ1A 5ADHA 3JQ9C 3IP1A 1BWSA 4AJOA 1DC5A 1VL8A 5C37A 4FIZA 4R51A 3LT0A 3DBRB 1BSVA 1UXJA 4YJHB 4YRBA 1E7YA 3OQ6A 3KVOA 1WMBA 1GAEO 2FY8A 2LDXA 4E32A 3DAGA 2AQ8A 2E4AA 3RBVA 4U5QA 5KWEA 4WLOA 1DC3A 2ZTMA 4CV3A 1NQTA 2H9IA 3U4DA 4H15A 1UJMA 1LRKA 3E1KA 3ANMA 3TN7A 3CKYA 2DTEA 5DCWA 3WG9A 3PJDA 5FEUA 2B83A 1ZSYA 1PIWA 3OBBA 1KY5A 1B16A 3MCVA 1Y5MA 4EEXA 2BMAA 1DDOA 1EDOA 3G0OA 4GKBA 5IXSA 4Z3KA 3E8XA 2NACA 4GVXA 5KVQA 4OSPA 1I5RA 2DU8A 3WLFA 3GN2A 5EQFA 4BNLA 1KVQA 2DPHA 4E4YA 3GFGA 1P1HA 3EGOA 1LBEA 1XCBA 1GDHA 2CVOA 2DAPA 2YDYA 3E9QA 5U9CA 4IDBA 2X0IA 1D1SA 2IYOA 2VUSA 1XA0A 3F46A 3KEQA 1LQUA 4YB8A 3H9UA 1R4NA 2ZB8A 2O3TA 3GZ4A 3NT2A 5AXCA 5AQ1A 3DBLA 4F6LA 2OMEA 2P2SA 5CDYA 4ND3A 2BI7A 2ZTLA 2OORA 3M2PA 3LQFA 4YT5A 1YRLA 2PZMA 5DCUA 4BGVA 5BSGA 4MIYA 4F46A 5H82A 2PKQO 2HDHA 2I65A 3GG2A 3B20A 4WCFA 4P22A 1CYDA 2BKAA 1I01A 2GZ2A 5IN5A 4D79A 4PFJA 2GZ1A 5C7IO 4BNFA 1YJQA 1Q7BA 3AUTA 2OOSA 4RPJA 2H1SA 3WMXA 4WNCA 3JYQA 1YDEA 1J49A 5CEFA 4LISA 3IIEA 4CMBA 4CUZA 2FR0A 4ROSA 1QG6A 2O2SA 4IS3A 4JIGA 3EW7A 3OA2A 4YJGB 3MTGA 3WYEA 4CM7A 1KEWA 1XHLA 5TQVA 3WTBA 4CUJA 5ICMA 5IFLA 1DFIA 5BSFA 4CMHA 4ZHSA 4YAJA 5KVCA 4JJGA 1RM5A 3WJAA 1U3TA 2X9VA 1QORA 4NJMA 3F4LA 4BO4A 3T4XA 2B35A 4Q3CA 4EW6A 3K8ZA 2VT3A 3GVCA 3B6ZA 1C14A 3O4RA 2BGMA 3BMNB 2YW9A 3LSYA 2HJRA 1BDBA 3H6KA 1DAOA 2I9PA 3CE6A 2RAFA 3L9XA 4OXKA 3FPLA 3DOOA 1UDCA 1SOVA 3ZHBA 2EJWA 4Q3BA 4BGUA 2UUPA 2Q4BA 3TNLA 3NAQA 3WGOA 4CLOB 2QZ9A 2B4TO 1W4ZA 4BUCA 5EIOA 1ISGA 1NBOA 4MKXA 1LLCA 1SBYA 4PLVA 1GUYA 3H2SA 3QWBA 1GZ4A 1JQBA 5B37A 4R4JA 4Z6KA 3P19A 1PWXA 2P5UA 2WM3A 3G49A 3FBTA 3KYDA 3WX0A 2AEFA 3JD2A 4URFA 2PV7A 2JD2A 3PLNA 1T25A 2Y1EA 2V6FA 3NT5A 3V8BA 3WXBA 3K30A 4OIMA 1QYXA 1PL6A 3JQAA 1AGNA 3FTPA 3O26A 5FF9A 3M1AA 3I83A 1ADFA 3KSDO 1NAHA 4II3A 4DC1A 3VZRA 4BMSA 3W1VA 3I4FA 4B4UA 3RVDA 2EGGA 3GZNA 3PYMA 2NVUB 2QW8A 3VVCA 4DPMA 4U8GA 3HDHA 4FJ2A 4NJOA 3UUWA 3WOHA 2JL1A 4KTVE 3P2YA 3DMYA 4OO3A 2RH4A 4FC7A 2WD7B 2NWQA 3W6UA 1LUAA 4BMNA 4CQLB 1YBVA 2YDXA 2C5EA 4JQCA 3L4SO 3HN7A 4YT2A 1X14A 5JMWA 3VZQA 4E3ZA 3TOXA 1DPGA 1SCUA 1Y6JA 1YL5A 3BXXA 3WFIA 2Q49A 3U4IA 1PR3A 5CHEA 1C1XB 5DDIP 4HFMA 1SOWA 3OHSX 1ONNA 4A5OA 1ZW1A 4Z0HO 2DC1A 2QZZA 3CEAA 1X1TA 3QIVA 1WXDA 4BO6A 3LT1A 1EEHA 5L40A 5A9RA 1H2BA 1B14A 4I5DA 3GDOA 4E2YA 4J4BA 3D5TA 2B36A 4R68A 2VYVD 1XG5A 5JYDA 2G17A 1E1KA 1R66A 1YXMA 3E5RA 3I9JA 3PRJA 3IL2A 1XR3A 2F1KA 1T2DA 4BNXA 3UHAA 2Q2VA 3DFUA 5FI3A 3RAJA 1U7TA 1YB5A 4CMAA 1HLDA 1E3JA 2OFPA 2OHXA 2WDZA 4JJFA 4WOJA 3EC7A 4PG7A 1VL6A 1N1EA 2X22A 4CLXA 2AE1A 4XB2A 2IZ0A 1WNTA 3FPCA 4KUGA 2NVWA 3VDRA 1DIBA 3WIDA 4ZJUA 3KYCB 3ZWYA 1HE4A 4NZ9A 1ADCA 2VTEA 2GNAA 2ZK7A 3WNQA 1KEVA 4I5EA 4GWGA 4IMPA 2TMGA 3SC6A 5T8KC 2EHDA 2XXJA 1ENYA 3NV9A 4XYLA 4E2XA 1B7GO 1GCUA 4FS3A 2W8ZA 4CMIA 1G1AA 2JAHA 3F9IA 4DQUA 4Y98A 5FI5A 2GGSA 2P9GA 2CFCA 5TRTA 2E37A 4PLYA 4CLRB 3WYBA 4NBTA 1Y8QA 4RVHA 3H2ZA 1ONOA 3ANNA 4PG5A 1GL3A 3KHUA 5G2OA 4S1VA 1HL3A 2VOJA 1W6UA 4WK6A 1HDYA 3PXXA 3WIEA 2VQ3A 1ULSA 2P5YA 3PFWO 1HDRA 1P1JA 1YL7A 1E6EA 1HSZA 3AJRA 3E9MA 4TSKA 1PJBA 4RZHA 1Z7BA 3ZCXA 4J16A 5JFOA 3ADOA 3ASUA 1ISHA 5TS3A 5I8WA 1E6WA 4D43A 5IG2A 4GMFA 2BFOA 5HS6A 2NU9A 4P4LA 4DYDA 1ZMTA 2PGLA 2I66A 3IDSA 4WEQA 3A9WA 5CDSA 1HEUA 2IYPA 3W8DA 3DOCA 3ST7A 4UVDA 5L45A 3OICA 3GVHA 5KTKA 1JVSA 3ICCA 3MJSA 3RKRA 3S1LA 2CSUA 1QYDA 1AUPA 4DLBA 9LDBA 3PFFA 1UP4A 1B8VA 1B3BA 3FNEA 1KVUA 3RROA 3DTYA 2VWQA 3UCFA 3D1LA 1OC2A 1E3IA 1MV8A 1OZAA 4NK5A 2RCYA 3GVPA 1PQWA 3PDUA 3DO5A 3ROKA 1YQDA 2CUKA 5C3MA 2ZB3A 2EP5A 2HMWA 3U4HA 7MDHA 3K96A 3EZLA 4A10A 3WBBA 4A73A 3S2EA 2HCTA 3QSGA 4KOAA 4KUEA 4BNTA 4E6PA 3MJEA 1LC0A 4YACA 4L4SA 3ZHZA 5F3RA 1Z73A 1GR0A 4J3FA 1GV0A 4E30A 1R4NB 3DWFA 5EJ2A 3IJRA 5ES3A 5FYDA 4E31A 1IL0A 4R3NA 2DUUA 3K2EA 4QEDA 3VZPA 1U4OA 1KOLA 1QKIA 1FDTA 3M1LA 3SJUA 1J5PA 2XOXA 1YQGA 4Q3AA 5JAIA 3BMOB 4OH1A 5F5NA 3GHHA 3QLJA 3ZNNA 4GMGA 5LDGA 4KMSA 1HDZA 3GDGA 3PJGA 3NEPX 4OOFA 4PRLA 2FPIA 2X0NA 3FD8A 4ND1A 4NR0A 4GPD1 2VHVA 4PLCA 4BGEA 5JY1A 5ER9A 4BNIA 3GFBA 3HZZA 3PZRA 5TX7A 4ESOA 3DONA 1GZ3A 2O3JA 2DTXA 3AWDA 2Y99A 4D0SA 2Z95A 1PZFA 1ZBQA 4GLLA 3B1KA 3DAPA 4YBZA 4IDEA 3KM0A 3C1AA 3UOGA 3LF2A 5G0TA 4LRTB 4XZ3A 9LDTA 1WDKA 4N5NA 4FW8A 1NPDA 1SNYA 3TJRA 4MVJH 4YAGA 2NU7A 4HFJA 1IZ0A 1UAGA 1BGVA 5A5EA 4LMPA 4M89A 1DSSG 1HDOA 2DPGA 1NPTO 3ASVA 2EKQA 5KJFA 5IDYA 1V0JA 3LYLA 4CM8B 4O63O 4DBVO 4DL9A 2I76A 2C7GA 4O0LA 2OXIA 3LLSA 1P33A 4PLWA 2DBRA 3QVOA 4C7JA 1EK6A 4J2OA 4LGVA 1DFHA 2X5OA 4ALNA 1ZEMA 2P4HX 2ZQZA 2PH5A 3PVZA 4JX8A 3I6QA 4M49A 3U62A 4BMVA 4BHTA 1D3AA 1PGJA 5BSHA 3K73O 3A14A 3I3OA 3MOGA 5AOVA 2RBEA 3BHJA 1PS8A 3RUCA 1KS9A 4YJGA 3SXPA 2ET6A 3G1TA 1GPDG 5JE8A 4LW8A 2HU2A 5G4LA 3JQAD 1FK8A 1J6UA 1BVUA 1BXGB 2I3GA 2O3SA 3H5AA 5IN4A 2H5LA 1HF3A 3AY7A 4EUHA 8ADHA 2RH8A 4LMRA 5IDQA 2ZYAA 1I3MA 1UR5A 1VRWA 4UEKA 3KSZO 1VM6A 2Z1MA 2VZ8A 5EMHA 4Q39A 4KP7A 3FSRA 4O5OA 3BMNA 1I24A 1H94A 3K6JA 5AXBA 4XB1A 4NDNE 1BVRA 1P44A 1NHWA 5TC4A 1NAIA 1GFSA 3PDJA 1D7OA 4P4GA 4CLOA 2EKLA 2O3RA 4A03A 3DBHB 4IDCA 4NFHA 4NBWA 3T7CA 5ILOA 4RPGA 5BSEA 1E1MA 3DEYX 3SJ7A 2FR8A 5C7OO 4PG8A 3PJFA 3JQ7B 3LVFO 4GL4A 4YJFB 2WJPA 2JD1A 1I2ZA 4LSWA 2XAAA 3A1NA 2FSSA 3Q9NA 3ZNPA 4Z9FA 5A9SB 3QRWA 5U1PA 3AFMA 4XDZA 1ORRA 2IODA 4ZQGA 4IJUA 5B4VA 3OJOA 1LLUA 4MDHA 1PX0A 2AMFA 4K6CA 4OKNA 4B7CA 3ZGYA 1JKJA 5G0VA 4AJ4A 4DIFA 1RWBA 1N1GA 2GD1O 5TF4A 3T7EA 3DZKA 2JFHA 3NJ8A 1BG6A 2PH3A 1OC4A 2VT2A 4I5GA 3E18A 3AM5A 5EPOA 5CDUA 3KETA 5TJ9A 2W2LA 4E5YA 5U4QA 4ND4A 5KIAA 4MP8A 3H5RA 2NVUA 3QV1A 4YRDA 5BNTA 3AY3A 3CZRA 5JLAA 2ZB7A 4TZTA 4AG3A 3P5SA 3GAFA 2YHUA 4OJNA 4UUPA 1IZ9A 1NQ5A 3F5QA 2WD7A 1EBUA 4RLHA 2EP7A 3ZNOA 5I9MA 1JKFA 3HFGA 1YS4A 1EVZA 4CQLA 3KYBA 3K31A 3NYWA 1MGOA 2AQHA 1T26A 1GYPA 4IIVA 5ITVA 3TL2A 1PJ2A 5A3VA 2C82A 3AI1A 4WEOA 1E6UA 4MVJI 4B8WA 3L9WA 1FDSA 5EN4A 4TKLA 1Z74A 2QRLA 2ZIZA 1U2GA 3U5TA 1PR9A 3DZGA 4L4RA 4DMLA 5JO9A 5JDCC 4BNJA 2AHRA 3EVNA 2Q1WA 2GZ3A 2UUOA 1B15A 4JCOA 2BLLA 2PKRA 2C2XA 3FN4A 1UZLA 4HXYA 3AU9A 1G6KA 1T4DA 1YOVB 3HB4X 3WDSA 5BQFA 3PK0A 2VYNA 3ZU5A 4M55A 1QYWA 4IZHA 5ILGA 3GT0A 4D3DA 1PJCA 3IKVA 4BS9A 5CDTA 3IUPA 1I3NA 2D2IA 1PJ4A 3GVXA 4PLTA 1R0KA 5ICSA 3FWNA 5JBIA 4B4WA 1VJTA 1ML3A 3D4NA 3D5QA 4LVCA 4TKMA 1PQPA 4IDAA 5IXYA 3IJPA 4TRMA 5KNLA 3KYCA 1ENZA 2VCYA 3CXRA 2FZWA 3OA0A 3GMDA 4I9HA 3GA0A 2GYYA 2Y93A 1KYQA 4P4NA 3WFJA 1NP3A 3PQDA 1Q0HA 1EZ4A 2O3UA 5HRUA 4WECA 2X0JA 3FCOA 4R9RA 4TRNA 3V5NA 1ZXLA 3E6AA 4EDFA 3RBZA 4L74A 3IUSA 4JK3A 4R01A 1ZK4A 4YWJA 2WWRA 2Q50A 2DFVA 4BB6A 3GEMA 3NUGA 5CDGA 1PJQA 5AYVA 4CLRA 3VPSA 1UDBA 1VSVA 4J1NA 3GN1A 1SEVA 1HZJA 4FB5A 1M6WA 3KZVA 1YONA 3ZWVA 3GVIA 1E3WA 4P8RA 4UEOA 1LDYA 3CZMA 3GY0A 4DTIA 3UFXA 4BQRA 3OEYA 3BMQA 3MWEB 3TZ6A 3I52A 1LRJA 4Z3DA 1OFGA 5JAZA 1DLIA 3ENKA 4XKJA 2CDAA 3U09A 1YBMA 1A9ZA 3OJ0A 4UVGA 3U4CA 1U5CA 3ROQA 4JBIA 1JN0A 5T5QA 4MVJP 1H6DA 3V1YA 4B79A 5IF3A 3QA9A 3ONEA 2HQ1A 2P4QA 2PKQP 4GX1A 3JCZA 1Z75A 1R4MB 2DQ4A 3RUAA 4MVJG 4QFCA 3X2EA 3DBVO 3WMWA 1ISFA 1WLYA 1MC4A 1E7SA 5ENVA 4HFRA 4ZRNA 2TMDA 2Q1TA 4IM7A 1U7HA 1WWKA 4QTZA 4IQGA 2HMTA 1V3VA 1ZJYA 3ETEA 1X15A 4F6CA 4XA8A 4W9NA 4DGSA 3F6YA 1NVTA 1IE3A 1U8FO 2EWMA 2HK9A 2BD0A 3COSA 2BRUA 3HN2A 3JQFA 3C7CB 4W9NC 3BMCB 3LC7O 1QRRA 3JQFC 4IXTA 3JQEA 1U8XX 1E3SA 3WJ7A 1N5DA 2FMUA 3NRCA 1VC2A 4MPDA 4PLPA 5HA5A 2VOEA 2YUTA 4AICA 1U28A 1CF2O 3JSAA 1ISJA 4BGIA 1XGKA 3AI2A 3T4EA 3KO8A 5JAQA 3HDJA 1IB6A 4E2WA 1V3TA 2BHLA 1UAYA 3GLQA 1VSUA 4XD2A 1DAPA 4BO2A 4HADA 3VTZA 4W7IA 4PVDA 1PJSA 3BHIA 4M54A 3D4OA 4J90A 3BMOA 4Z0TA 3ZV5A 4NH4A 4IJWA 4CR7A 2LDBA 4DREA 3DHEA 4OSOA 1TI7A 2J3HA 3GPDG 4J1SA 3PWSA 1MFZA 1D4FA 1BXZA 3R3JA 4B7UA 5JC8A 4BQPA 4Y9DA 2ILTA 3GNQA 1Q1NA 4J1TA 3FBGA 2QIOA 3MJ4A 2P91A 4GSLA 4XQGA 1J4AA 4BO5A 5DBIA 1H93A 3ABIA 4BKRA 2ZYGA 3WSVA 1BW9B 1DC6A 2OL4A 2WMDA 3GPIA 3JQ8B 1I3LA 3QHAA 4Y8VA 4HUJA 3UCEA 1F06A 1SB9A 5AXDA 2ZQYA 3RU7A 1E3EA 5A1TA 3SVTA 3F5SA 5C5IA 4H7PA 1V8BA 4CV2A 1QLJA 2QQ5A 4CM8A 4DMMA 2Q2QA 1RM3A 4RGBA 4J49A 4II2A 4DQXA 5HM8A 2NTNA 1PWZA 3N58A 4UVIA 1HKUA 1ZIDA 3O03A 1L7DA 4YXFA 4QUKA 2PZKA 5K0ZA 2C59A 3CPSA 1BMDA 1RPNA 1E92A 1C0KA 5G4KB 4PGFA 3IQDB 4KDEA 2HO5A 3VPXA 4EEZA 4BNHA 4KWHA 1CJCA 1ZSVA 2ZCUA 4PIVA 1DOHA 2DFDA 3C1TA 5L51A 3GNSA 3HUDA 2GN4A 2HK8A 3NJ4A 5FFFA 2YV2A 1BXGA 3M6IA 4GX2A 4GAEA 3JQCA 2W2LD 2CMDA 1N92A 4N5LA 4PLGA 5L4SA 3RFTA 1DXYA 4QO7A 1I8TA 2B0JA 1M6HA 2C7VA 4MVJM 1VKOA 4EUEA 5AVOA 3CSDA 4GWKA 3DMTA 3JQDA 5K6AA 4FFMA 3PP8A 4CLHA 1ENPA 4JBHA 3EDMA 2NADA 2GN8A 3DMTC 5K6AC 2PD6A 1F8FA 2PK3A 5AXAA 3JYPA 1UP6A 4IQ0A 3RU9A 2AW5A 1ARZA 1ZK0A 4TZKA 2CVQA 3IP3A 4ZGWA 4NIMA 1QV6A 1N9GA 4WLEA 2DKNA 2HRBA 4R16A 3DBHA 1P45A 2Y1DA 3GRPA 2V7PA 1BHSA 1JDJA 2G82A 1N2SA 4B4VA 1U3UA 1LI4A 3Q2KA 4E5MA 1I2CA 4BO1A 4HBGA 3JQ7A 4YJFA 3TL3A 1MUUA 2VRBA 5KKAA 5A9SA 2VUUA 3GC6A 1GYQA 2W2KB 1LEHA 4Y67A 3B70A 3FNHA 3NGXA 4ZRMA 4DIBA 1U9JA 2X23A 3AK4A 3VHRA 1ADBA 4NU5A 2IRWA 4J7CA 3ZU2A 3V1UA 2PD3A 4TVOA 1LSSA 4M86A 4WOKA 2FPGA 1VI2A 1O9BA 3G17A 1UXIA 1MG0A 2VYND 2VZ0A 3VKVA 1ENOA 1UXKA 2V6MA 3ZWCA 2D1YA 4K1LA 1A4IA 4DIOA 3H9GA 4FGWA 1FDVA 2NSDA 2QYTA 2CZCA 2O4CA 3JD4A 3PHGA 3N74A 4FPXA 4Q9NA 4Q3DA 3GQVA 1JAYA 2GLXA 4EBFA 2O3QA 5CP8A 4Q3EA 2W90A 2D59A 3K9QO 1TT7A 4FOSA 3ZWMA 3ZW8A 4HP8A 4JROA 5L4NA 1C0LA 2JKVA 3H9EO 2ZB4A 3GGOA 3DDNA 1Y5RA 2P9CA 1GD1O 3WNVA 1B2LA 2UV8A 3KLMX 1AXGA 2I67A 2POQX 4R5HA 4CPDA 1PJ3A 2DBVO 1QR6A 4ZA2A 1ZMOA 3Q0EA 3WGZA 1DIGA 5IDXA 4CM6A 5T8KA 1YL6A 1TB4A 2JAPA 3L6EA 1SO8A 1CEQA 5IZ4A 2QHXA 5DP1A 4XYEA 4BVAA 4S3MA 1MB4A 2CF6A 2JFGA 4ND5A 1DBVO 3UH1A 4L4XA 1VPDA 3ZI0A 3ZWAA 3MWDB 1V3UA 2D0IA 4QFDA 3ZNQA 2PR2A 5CG1A 2AG5A 2J3IA 1Q7GA 3TZCA 2X58A 2Y66A 4FGSA 3JQBA 1YOVA 4U6QA 5KCZA 2Q1SA 3AY6A 3WTCA 3PGJA 1E1NA 2Z1NA 2B4RO 3JQBC 5IAAA 2GRAA 4PLHA 2Y68A 3RUEA 3SBOA 1M75A 3ZV4A 4IJKA 5I8ZA 4RDHA 1E3WB 1I2BA 1P0CA 3ITDA 4Y6RA 1Z6ZA 1P31A 2YJZA 3BMQB 2FR1A 2GR9A 1PQUA 3SX2A 4MVJE 3PIIA 3PJEA 3Q3CA 3V2UA 5I7EA 3NGLA 4CMGA 4JP2A 4OYRA 1MLDA 3OFSA 1HDCA 1ID1A 1SPXA 1EQ2A 1M76A 4IS2A 3ULKA 5COQA 1O8CA 1E3LA 4R1UA 3RASA 4FFOA 4R1NA 4RVUA 5F21A 4I08A 2RIRA 1K89A 1PJTA 2C54A 3U3XA 1E5LA 4X54A 1X7HA 3C8MA 4ALMA 4BO9A 1D1TA 5L7WA 3RKUA 1HRDA 4CM5A 3AOEA 3O38A 1UH5A 4JGBA 2GCGA 5GZ6A 4CR6A 3AOEC 4Q3NA 4OGWA 4WNIA 1MP0A 3DQPA 3KLPX 1C3VA 4ALLA 5MGBA 1Z45A 1LC3A 1X7GA 4EZBA 5TIIA 1R12A 1KETA 3CUKA 4ALJA 4XGNA 4RO0A 3OSUA 1O5IA 5A3JA 7ADHA 1U3VA 4BNKA 4ILKA 3L0DA 1ZZEA 3EHEA 5EESA 1UUFA 5G0SA 1CWUA 1T2CA 1OOEA 4FFRA 1KVRA 4E21A 4MKZA 3IAHA 4MP3A 2PZLA 4RORA 3HNPA 3ZU4A 5T64A 1GTMA 1R4MA 3RC1A 2R6JA 3PEFA 1EBFA 3WS7A 3L4BA 1DO8A 3QY9A 4H3VA 2WD8A 4NHEA 5DBGA 4A26A 3V1TC 1ZO8A 2BGLA 5JW6A 3L4BC 1EQUA 1P77A 1R6DA 3F1KA 4RVFA 1T2FA 4WLNA 1LJ8A 3D64A 1O6ZA 5JC1A 1DRWA 4M1QA 1TLTA 2EV9A 3LK7A 1H6BA 3PQFA 3QE3A 1A72A 2B5WA 4J7XA 1C0IA 1EE9A 4U0KA 2ZJ1A 3ZWWA 3HFSA 4OQZA 3JYNA 4FBGA 2GPTA 4YQZA 3ONFA 3BMCA 4CLDA 4YVFA 3HDYA 1LX6A 2J5KA 3U49A 1DRVA 5JMPA 2IXAA 1NR7A 4YAIA 1F14A 4BNYA 1N7GA 3LC1O 5GMOA 1NX6A 1XSEA 2NU6A 1QYCA 3AOGA 2YZ7A 1H5QA 2B69A 4JP3A 3N7UA 3HQ4O 4QQRA 3IC5A 3K5PA 1E7MA 4DC0A 3EMKA 4IINA 5JPIA 4LSMA 4ZU3A 1HDXA 3VKUA 4EUFA 3LU1A 4IUYA 1N7HA 4U0JA 3AUSA 1I33A 5L7YA 3C24A 1RM0A 4P38A 2EF1A 3RFVA 4BKUA 1A4UA 4TMFA 3JYOA 1B3RA 3AUAA 1NYTA 1XYGA 4XR4A 4ZICA 1GUFA 5F5LA 1GQQA 4YEDA 1HYEA 3TFOA 1LDBA 5DCYA 3MJCA 1DHRA 1Y81A 3IMFA 2O7SA 1SZJG 4NFSA 2G76A 1H2HA 1IHXA 1MC5A 5LCXA 2EW2A 2Y1FA 3OETA 1B26A 2PGJA 3F3SA 4YRAA 4WLVA 5THKA 4OHUA 1FF9A 1OAAA 2GDZA 4GX0A 4BO3A 3SLGA 3IKTA 1NFQA 3B1JA 4XIYA 3WICA 1YO6A 4CL8A 1WZIA 4BB5A 3INGA 4A7PA 2OO5A 2BI8A 5A04A 1MX3A 1KC1A 1CRWG 4BO7A 3NDIA 3H8VA 1BW9A 1Z82A 5F1PA 5F1KA 3JQ8A 4W7HA 3UKOA 1Y8RB 4C4OA 2VNSA 4K9DA 2VHWA 4RVDA 1M66A 5K9ZA 4LN1A 1ZJZA 2PGDA 4ZQFA 1PJLA 4FCCA 5T57A 4EJ6A 4Z0PA 3WSWA 1GEGA 4D3FA 1C0PA 3I23A 4GBJA 3WGQA 4TQGA 3GH3A 1TA4A 2FOIA 3HG7A 2C2YA 2IZ1A 3DZBA 3W6ZA 2WE8A 2XPCA 4F45A 2EGHA 1YH3A 1N9GB 2VN8A 4OQYA 4UUOA 5G4KA 4IDDA 2IZZA 3ETDA 1LXCA 4E12A 5L3ZA 3GAZA 3MZ0A 3C3XA 2W98A 5EL0A 5TT0A 1PS0A 2YFQA 3GHYA 4E2ZA 5HWSA 1QLHA 2VRCA 4AJHA 2JJYA 3H3FA 4J2HA 1U5AA 2X5KO 1NVMB 4FJ0A 3BTVA 1Z7EA 1ZKMA 4ZVVA 1XWFA 1YBAA 3ROPA 3VVBA 3ZWOA 2FZEA 3VC7A 1WDLA 1GUZA 2PA3A 3R1IA 4OXNA 1ZK1A 1YQXA 5BR7A 2YY7A 2CDBA 4KQWA 2GF2A 3ZV3A 5THQA 3I9KA 3TRIA 4KTTE 4TVBA 3RUDA 2Y67A 2A35A 4XDYA 3JQ6A 4NK4A 2JD0A 4B7XA 3PGXA 1FMCA 1K6JA 1P74A 1XLTA 4MP6A 5TNXA 5J23A 3TOZA 1EDZA 1HE3A 2X7HA 1A7KA 4BKPA 3VH1A 4FSHA 3QVWA 1I10A 4QX6A 1I32A 5COAA 1LDGA 4W6ZA 4RV9A 2D5AA 2X4GA 1S6YA 1PSDA 3G79A 1DIRA 2EERA 3H9QA 3HE3A 3NT4A 3OECA 4G81A 4CMJA 1D8AA 2NTJA 2Q4EA 2W2KA 3RD5A 4NI5A 3GF4A 5DOVA 2FRDA 5GZ1A 4XX0A 1EVIA 2HUNA 4I9NA 2WYVA 3ZV6A 3PHIA 4MJLA 2JCYA 5B4UA 4BNVA 4NG5A 3ICPA 3VH4A 3H4VA 4WCDA 4PZCA 2BFAA 5A02A 2D4AA 1W8DA 3Q1LA 5JDCA 1F8GA 5IDWA 3JQGB 2HKIA 5T67A 1DIHA 4INAA 1IHYA 4RVSA 2PFGA 3FHLA 2J3JA 1CERA 1UXHA 2FN7A 3GUYA 3D3EA 1ZK3A 4NNJA 4WGGA 1H6CA 3RWBA 3WYCA 2FSVA 3PWZA 2QYSA 1AN9A 1JVBA 1OBFO 3V2GA 3VOSA 4XIJA 5HS4A 1ZFNA 4EGFA 3L07A 4GX5A 3UXYA 4CM4B 1KIFA 1T1SA 1EFLA 4IXWA 4AJPA 4XR9A 3G1UA 1Q2XA 2GERA 4PCVA 4FOOA 4YQYA 5JCXA 4Z9YA 4GKVA 2Y1OA 3ROMA 2D8AA 1ZVMA 4CJXA 1P0FA 5H83A 1Y9AA 3OF2A 4M87A 8LDHA 1LSOA 2FPPA 2UVDA 5F1OA 3KEOA 1S7CA 2G5CA 4HNGA 5TSDA 3X2FA 2J6IA 4OXYA 3JD1A 5CEJA 1LA2A 1L1FA 3ORFA 1MXFA 3K2BA 2NNLD 2GUGA 1NASA 2HMUA 3UF0A 4ID9A 1VJ1A 3SC4A 1R16A 2J5RA 4XQ9A 2AE2A 3KUXA 4G65A 4BNWA 2PTGA 3VH2A 2X8LA 1JAXA 3D4PA 3H9JA 3ZHYA 1QP8A 4BO8A 1GEEA 1PGPA 1DRUA 1T1RA 4EITA 4UEJA 1VLLA 3AFNA 4YTEA 1U4SA 3DXFA 1T24A 5DBFA 4DQVA 1ISMA 4CMKA 1W0CA 3H65A 3FWZA 3FNFA 2A92A 1ZSNA 4QXMA 4KWIA 5LC1A 1WZEA 1BXKA 1EVYA 3RFXA 4YPOA 3STHA 3ZZNA 4OM8A 3EUWA 3RUIA 2X86A 4H16A 1GYRA 3KBOA 1PGQA 4GGOA 5JY6A 3Q11A 2ZYDA 4QO8A 3ITKA 1Q7CA 4FFNA 4FQ8A 1XQ1A 3DOJA 3FRJA 1QV7A 1ZCJA 2CF5A 1IPEA 3AW9A 5A03A 1QSGA 3E48A 4XCVA 3P7MA 3PZBA 4WE3A 1TVEA 4PRKA 4D41A 3K92A 4N5MA 2Q3EA 1EUCA 1HZZA 1V9LA 1A9YA 1Y1PA 2AEMA 4ITUA 2GO1A 1A7AA 2YV3A 4L8VA 2E6UX 2JFFA 3R6DA 1TEHA 1DHTA 3WBFA 1P1RA 3VH3A 2VHZA 2WTBA 4F3YA 2RHCA 5I9NA 3S2IA 4XJTA 1LLQA 4IIUA 3FTNA 3QVSA 3I9LA 3CIFA 2C20A 3WB9A 2B5VA 4ZQBA 5KOIA 2NV6A 5FWNA 3RUFA 2X9GA 1OI7A 1EK5A 3I4CA 1BRMA 1BTOA 2Y05A 1KEUA 1YB4A 4CM9A 5HTOA 4J0FA 2UYYA 1DC4A 1DJNA 2AQKA 2X9NA 2YHIB 4GLOA 4MKRA 4N18A 4WASA 4YYZA 2P9EA 4AJNA 1WAMA 3KSUA 4HFNA 1IUKA 1F12A 4GQAA 2ZTVA 1I36A 2OGUA 4ZQEA 2PD4A 4C7KA 3E82A 2YFHA 4DXHA 2BFMA 4Y6SA 3GOHA 4ONEA 4XRGA 2ZCVA 4AJEA 3TWOA 3TF5A 4O6VA 6LDHA 3MOIA 1E5QA 2Q99A 2CY0A 2HLPA 1HLPA 4O59O 2V6BA 4XYGA 1C1DA 1LNQA 3DZFA 1YE3A 3GEDA 1VJ0A 1O89A 2G0TA 3OMLA 4CM3A 3HDQA 1XEAA 5JO0A 3C7AA 2DUWA 4GVLA 1LSUA 4HNHA 1GQYA 1NQAO 4J43A 1NM5A 3QWHA 2VWGA 4NMHA 4MVJA 4TWRA 2NQTA 2B4QA 4XJSA 3QWAA 1KC3A 1BDMA 4XGKA 4R69A 4AJ2A 4HWKA 4WLUA 5ER6A 1PU2A 2HMVA 1G0NA 2Y0DA 4DUPA 2EIHA 1RYEA 1E7QA 1I3KA 4GI2A 2E48A 2BFPA 1PGOA 4FDAA 4PVCA 3GMSA 3C7DB 1Q0LA 1P9LA 4WCFC 1X0VA 3DAFA 3ON5A 1YDWA 5A9TA 4HV4A 4E5KA 5DOZA 3RBXA 1NWCA 2VHXA 1JWAB 3IOYA 4B4OA 1GQ2A 5EERA 2BGKA 1L7EA 4O1MA 4Z9XA 1MXHA 1RM4A 4YT4A 2PZJA 4BNGA 1CQIA 2VTDA 5TJHA 2WEKA 1U2DA 1PTJA 4RPKA 4PLZA 1YWGO 4FR5A 1LRLA 1Y9EA 1V6AA 2AG8A 2SCUA 1DJQA 2NVBA 5DT9A 4CUKA 2VRCD 4G2NA 4MO2A 3QWFA 3S2FA 4UREA 1NVGA 2Q1UA 1YVEI 3QVTA 3H3JA 3Q6IA 5T6BA 4E5NA 4RJTA 4I1IA 1RKXA 1LLDA 5I7FA 1Y8RA 4J0EA 4IGFA 2VWHA 1T4BA 3O8QB 4DVJA 2X6TA 1E77A 1AXEA 3AM3A 3BA1A 3PLRA 4DLLA 2Y0EA 3KXDA 3TZHA 1R37A 5L4LA 1HDGO 1KEPA 4K6FA 5DP2A 2WYWA 4RF3A 3FR7A 1QYVA 4J4HA 3B1FA 4W99A 1SB8A 5KJEA 3UW3A 5CPFA 1HWYA 2D3TA 1P1KA 1WVGA 3WGHA 5CPBA 3WGTA 1DEHA 2PLAA 2Y1GA 2GSDA 4RQTA 4MIEA 3PPIA 2OUIA 1XQ6A 5DN9A 3AU8A 4ZQHA 4UAGA 2VUTA 3INTA 5TGDA 4KUHA 5C7LO 1XELA 2NLOA 3RC7A 4GH5A 1LTHR 3VZSA 3E03A 2Q46A 5H81A 4EI2A 5KJCA 3BHMA 1QXSA 1SC6A 2O4UX 1PL7A 4TRJA 1U3WA 2WE7A 4FFLA 5GY7A 1LQTA 1X0XA 4AJIA 3E5MA 3I6IA 4L75A 4EJMA 2HMSA 4W4TA 2EXXA 3EY4A 3P2OA 4IDFA 3GNTA 1IY8A 2C29D 4MOWA 4NBVA 3GUCA 1MFPA 3D3WB 1XU9A 4DWVA 3NDRA 2DBQA 2AA3A 2C07A 3AM4A 3SLKA 4UVEA 4JJIA 4YR9A 5JCJA 5JAMA 2H6EA 2I3AA 2JHFA 2DM6A 4AVYA 4R54A 4RDIA 1ZK2A 1K6IA 3GR6A 3OJEA 1P1IA 4RL6A 3S55A 3WWYA 5KJ1A 5HBRA 4R3WA 3L6DA 2IXBA 2FHSA 3CINA 3H5NA 3TZKA 4LCJA 4PZDA 3NKLA 3OIFA 3PHLA 3ZW9A 1TT5B 4ALKA 2DTDA 2J5QA 3S2GA 1YJ8A 4J9VA 4UULA 3ZWPA 1H0KA 1E7WA 1NXQA 4OKIA 3RI3A 2J3KA 4M8SA 4MIOA 1PL8A 5A5FA 3RIHA 2HK7A 3UN1A 5GZ3A 1AHHA 4ZN6A 4DPLA 4OOEA 2XF8A 3UGKA 1VE9A 2VHYA 2D5CA 1O0SA 3OEWA 1ZEJA 5MDHA 1FJHA 4IQ8A 2W4QA 4R1TA 1W73A 4QSMA 3U9LA 5KKCA 5KVSA 4BL5A 3INRA 3DC2A 3G3EA 3RSHA 1N8KA 2FP4A 1JA9A 1GPJA 3I1JA 3JQGA 3ZWXA 4BOYA 4B3IA 4E33A 3NTOA 4BV9A 6ADHA 4G5HA 3TQHA 2Q45A 1KY4A 3NDJA 4BIIA 1U1IA 3FR8A 3GEGA 2AXQA 1XU7A 3RJ5A 4I5FA 3KB6A 4AJKA 4UVHA 1MG5A 4CM4A 2WYUA 1V35A 2NTVA 4JN6B 2CVZA 4CQMA 1UP7A 3VPHA 1PZEA 2UAGA 2R2GA 2OZPA 2R00A 3DHYA 4TRRA 3EK2A 3FF4A 2O2YA 2R00C 2XXBA 2QRKA 2E49A 4I9UA 4RPLA 4FN4A 4IPTA 1ZNQO 4R5MA 2VZ9A 3W8EA 4XWYA 2HJSA 4CMEA 5EQDA 3GGPA 2EEZA 1VL0A 3GGGA 3PYLA 5G0UA 5BNFA 4CMEC 3I5MA 2V6GA 3PHHA 1KBZA 3JYLA 1FDUA 4RQUA 2WSBA 4NPCA 4WKGA 5KJ6A 4RF2A 1ULUA 5B4TA 3L6OO 3BTSA 3EVTA 4BV8A 4GSKA 4CR8A 1IPFA 4TROA 4JLWA 4XYMA 1B8UA 3LC2O 1AE1A 2EJVA 2G1UA 3OM9A 1CDOA 3QWIA 1WP4A 3OJFA 1NHGA 1UDAA 4CM9D 3LLVA 4JXKA 4J91A 3CMMA 1EFKA 1F17A 4NBRA 4EJ0A 1GADO 4IMRA 3PTZA 5CAEA 3QP9A 3VDQA 4B3HA 1T2AA 4DPKA 1H9AA 3EAGA 5LDHA 1KVSA 3A06A 3F1LA 3EYWA 2GASA 3DZIA 3A4VA 2I99A 5I7VA 1GU7A 1A5ZA 1HYHA 4DBZA 2AEJA 3CMCO 1LDEA 2PY6A 4Y6PA 4YDRA 1EUZA 3NTRA 5IJZA 2JCXA 3UVEA 1PZGA 4D0RA 3DHNA 3JTMA 1ADGA 3F47A 4GGPA 3QW2A 3BIOA 4AJLA 3DFZA 4R41A 3HADA 4A0SA 4RF4A 3A28A 4AL4A 3UAGA 1XIVA 4MVJD 4ZD6A 3Q2IA 4IZIA 1WMAA 3I9NA 1NFFA 1JKIA 2NUAA 2QRJA 3DBRA 4J6FA 4PZEA 4YJHA 4AJJA 4CV1A 1C1DB 1UZNA 1GCOA 1XDWA 1SMKA 1G0OA 3OH8A 4XQEA 4DRYA 2QX7A 1I0ZA 4CLEA 2GN9A 3RC2A 3BZUA 4QT0A 4YCAA 4RF5A 3Q9UA 4IDGA 2YV1A 4XEHA 4UUNA 1PS9A 4FFPA 1Y7TA 4IGEA 3BTUA 3DBLB 3ZWBA 5B1YA 1E0DA 4U7WA 4KZPA 3JD3A 4K28A 3OJLA 4D7AA 4J9UE 2YHIA 3ZH2A 2FWMX 4YA6A 3WQQA 2CNBA 3VPGA 5G0WA 5I9LA 3O9ZA 5L9AA 4ALIA 2NQ8A 1H9BA 1DFGA 3OP4A 3PYXA 4RZIA 5ITWA 1HE5A 4WUVA 4WCFB 2Y1CA 3C1OA 4XQCA 5L53A 1CIVA 3DZHA 4IBOA 3HB5X 4L9RA 4IJVA 3VAZA 3HSKA 1HXHA 2Y0CA 3KV3O 2BELA 5KVVA 3UICA 1NR1A 3LT4A 1CQJA 1NNUA 3M2TA 5CG2A 2BF7A 4MVJF 1ISIA 4WLFA 5DF1A 3F4BA 5DULA 5DNAA 5BT9A 3PQEA 1MA0A 2RHRA 3TFQA 4BNZA 3TSCA 1UZMA 3GRKA 2C0CA 1I30A 3OIGA 4N54A 3H7AA 1EUDA 4NJMB 1FDWA 2I6TA 1HYGA 2O23A 1M67A 1EMDA 4AJ1A 3U0BA 3PWKA 2P68A 2A4KA 2OP1A 3DR3A 3FI9A 1X13A 3EZYA 2C5AA 1IYZA 1K0UA 3LZ6A 4IY1A 4A2CA 3ANLA 4XYBA 2X5JO 4DA9A 2VNAA 4AFNA 4PN3A 4RCVA 4E0BA 3AI3A 4WJZA 2JCVA 3GG9A 4YAKA 3WR5A 5I7SA 1M2WA 1ZXBA 3CH6A 3RQSA 3MJVA 1LU9A 2I5PO 3DZJA 3TPCA 3L77A 1HETA 3PHJA 1HSOA 3V2HA 2PWZA 3JD0A 2HRZA 2EKPA 4HKTA 2A9FA 4B3JA 1H6AA 2V65A 2E82A 4CL3A 1X7DA 2ZTUA 3DTTA 1SEPA 3W4KA 4UUMA 1F0YA 1WPQA 2Q2WA 3RUHA 1CETA 3KYDB 1OMOA 4BKOA 5A06A 3KOUA 4NFYA 5JYEA 3ADPA 1NQOA 4NQZA 4I8XA 2IE0A 4NU6A 4BKQA 3QVXA 1GV1A 2EG9A 1TXGA 5JSFA 3ZN2A 3JQAB 3S8MA 2IDZA 4U6SA 3JV7A 4L73A 3KRTA 3ZWNA 5JCJD 2A94A 1P1FA 2HAEA 3O8QA 1JU9A 5TLSA 2OBNA 3CTMA 3GZNB 2IEDA 4YT8A 1ZH8A 3GK3A 3R0IA 1A27A 4OAQA 4D44A 1WDMA 1GY8A 1HE2A 3ZU3A 3C85A 4D45A 4EYEA 4WPGA 4RLSA 1NTOA 3IS3A 4R9SA 3DB2A 1YB1A 3MJTA 1A71A 1IULA 3QJ5A 1O94A 1DIAA 3GDFA 5IZCA 3VTFA 2PNFA 4FD3A 3WWZA 3RC9A 5IZCC 4J4TA 4QECA 4XGIA 5A4DA 4R1SA 2IEBA 2J8ZA 1JW9B 1KERA 3MEQA 3R3SA 2DLDA 4ND2A 4RPHA 4YJDA 3QQPA 3VPFA 4BNMA 5JNLA 4LK3A 5CEEA 2F00A 3FNGA 1LDMA 3WGYA 4LRSB 1DLJA 3PI7A 5DZSA 1K2WA 1LSJA 1R15A 4RVGA 1PZHA 5BNIA 1UXGA 4K26A 1YGYA 3BTOA 1ZUD1 1XKQA 4L0QA 3ENNA 3D3WA 4FC6A 4NBUA 2Z5LA 3I9MA 1K5HA 1B0AA 3OQBA 2YQ5A 5A05A 3W8FA 1J0XO 4E13A 1GZ6A 1ONPA 1SAYA 3RCBA 4CQMD 1PEDA 3TDKA 5EINA 2B37A 3WGIA 3LT2A 5JS6A 2O7QA 3MTJA 2ZKLA 4CMCA 4FJ1A 5TT1A 2YYYA 4L76A 1YKFA 4D46A 2ZATA 3NX4A 3HHPA 3SEFA 1NFRA 1TT5A 2X0RA 4YAEA 2H63A 1WW8A 3WGGA 3ETGA 3BYZA 3I9OA 1C1XA 2X1HA 3D0OA 4CQMB 2ZJ0A 1VKNA 3HJAA 3ONDA 4HY3A 4JBGA 4B8ZA 4PLFA 3BAZA 3W4JA 5L7TA 1DB3A 2CD9A 1P3DA 1IOLA 1QMGA 1O95A 3LF1A 4J1QA 4BNUA 1PGNA 4CMIB 5JDIA 3ZHXA 1HTBA 1B8PA
chains in the Genus database with same CATH superfamily
3ILYA 4CDNA 2DVMA 2PVPA 3WLSA 4DYVA 1B0ZA 5B12A 4JODA 1G8JA 2H2DA 3CH5A 2WJWA 2XTAA 1HKHA 4MINA 4EG5A 1Z6AA 1YRYE 3EIHA 5B53A 1L3BA 1R0SA 2QGZA 1QQ6A 1VIDA 3QEMA 4R3UC 5E4TA 3UMBA 3WK6A 1R8XA 2G88A 2QEQA 4HPXB 4JXXA 1EE2A 4JS0A 2AZDA 3EOZA 3KD3A 3T99A 1KRXA 1VA4A 1XZ8A 3K5WA 5CNJA 2VYVA 3QKUA 3QU9A 5EJIA 2ZSJA 1LDNA 1UK7A 2OM2A 3TLEA 3TTWA 2DBZA 2N1BA 3ZD9A 1NWHA 2VDPB 1EVJA 4TXLA 4JD5A 2JJQA 5ICFA 1P9RA 4W82A 2HZBA 2VP0A 2GEDA 1CUHA 4JLAA 1JTVA 2QSYA 3GEHA 5E4FA 3REGA 4EP1A 3EOBI 5J59A 2NZ2A 1AHIA 2XH8A 3D7KA 3G59A 2ZOSA 4MV0A 4OMUA 3K0HA 4MKIA 5CYOA 4OL9A 2PNJA 1CQZA 4JY7A 2NU9B 4ZO9A 1VP3A 1OILA 3LUHA 1FYWA 3UMCA 4D3XA 3U48A 1S2LA 3C3AA 1UIMA 2OBYA 3HWRA 4J0IA 1OW3B 2FAXA 3D6TB 2QI9F 2W2XA 3SBDA 3ONWA 4DDTA 5JADA 3KWFA 5GVRA 3SZOA 2X8JA 2BEWB 5JNSA 1BFKA 1SOMA 4YJ2F 5B3KA 3DHVA 3OQVA 4IXDA 5NULA 5JR3A 2QBYB 2O48X 3KTDA 1J8QA 3W06A 4H1VA 4EFLA 5KYUB 4GPAA 1O1YA 4DLNA 5JRZA 2Y27A 4X8HA 1NPYA 1F6DA 5G1NA 4P92A 4DJ5X 4YY3B 3BS4A 5ADVA 3D6AA 3D6FA 5COBA 3EZNA 5JXWA 2HSDA 2E18A 4QAQA 1QK5A 1I13A 3EEQA 5FPPA 5ALOA 2H0AA 1JG1A 5ADHA 2KWIA 3IP1A 1DJLA 3BL5A 3Q5GA 4OL0A 4MWTA 4E09A 1J2TA 3ERCA 1VL8A 1KK2A 1M9NA 2EWWA 4LJRA 3LT0A 4NEGA 1SQFA 3F98A 2W58A 1BSVA 4HXFB 4RHUA 4FEAA 4YJHB 3RTCA 3FCCA 2CXSA 2MJLA 2GHIA 1E7YA 2VQDA 3A2LA 5D3QA 3KIPA 2PCLA 1S3GA 1LPOA 3DQZA 4EQ6B 3Q8MA 1R0ZA 2WYOA 5JS7A 2AQ8A 5T4HA 2NYRA 3CS3A 5KYYA 1DV2A 2AZMA 1E5DA 5A0TA 2R48A 1OX4A 3VDNB 4WLOA 4CV3A 4ENUA 2WVAA 1T9AA 4OSEA 3SR0A 5IK2A 2NUPB 2XUGA 3N6RA 1UJMA 3IPYA 3L1JA 1Z2PX 4FI3F 3RK4A 4ZFNA 1YQEA 3PGKA 2P1RA 1WMEA 5JS1A 3WG9A 3L7JA 4E5UA 1NVDA 5FA5A 4PS1A 3TIIA 4ASUA 3ZUPA 3OBBA 1WABA 5JQGB 3UJPA 3NYQA 1EVQA 4Q1EA 5CTJA 4Y9UA 1PVDA 2ZROA 1DDOA 2JI7A 1W8IA 1KARA 3SIPA 4GMDA 2HWXA 3HKCA 4GVXA 2QRVA 4IVNA 3KTAA 5KVQA 2XIJA 1SURA 4ZT4A 5I9BA 3UT5B 3GN2A 4PYNA 2QM3A 2YCBA 3K0KA 1P17A 1ZOPA 3AONB 1Z56C 4H6VA 3T9CA 1W6RA 4DDKA 4DQLA 3GFGA 3H18A 1L6RA 4G0VA 1Z2AA 5KYKA 2Q5QA 1LBEA 4JOSA 1WQ3A 3JQPA 4WINA 2YOGA 1EHCA 5F4ZA 3TOCA 5C1PA 1U02A 2XAUA 5U9CA 4IDBA 4YB8A 1PCXA 3PLAE 1S2GA 5HZGA 1GRNA 1G8AA 3R6WA 2ZB8A 2O3TA 3ZW7A 5AQ1A 1PKXA 5M29A 1G98A 1NIJA 5F23A 1IU9A 5EKDA 2QZJA 2VTKA 1RAIA 4JFAA 1WETA 2I1LA 1F5NA 2UU9B 1SHLA 1TEXA 2CLCX 1VRCA 5AVXA 2PZMA 4ZMRA 1GVHA 2PT5A 3ZYZA 13PKA 2ZRGA 3HLKA 1E1YA 1L4UA 5G02A 3VRHA 4BGVA 4WXMA 5E7MA 3TEMA 5BV8A 1S2MA 3C0KA 1L4KA 2DWUA 4FNAA 5FB3A 2G08A 2IWHA 1OV4A 2GZ1A 1JZTA 2GBIA 1Q7BA 2BMEA 3PUZA 4JR2A 3FUWA 3WMXA 4R6WA 4WNCA 3WGVA 4JX9A 3C8UA 1J70A 1CLEA 2I4RA 5CEFA 3DNMA 3O2NA 2ODAA 5KYTA 1C3LA 4FD2A 4NXMB 3EFEA 2Y71A 4IS3A 4J1TC 3EW7A 3TB6A 4RK0A 4BJHB 4LZPA 2PMEA 1RXSA 4D92A 1KEWA 1XHLA 3P9PA 4K9NA 4RV4A 3H8SA 3LKBA 5ALPA 2F1RA 5CB4F 4CMHA 4ICIA 2IP2A 3VR5A 4QL3A 5C18A 3T9DA 3WJAA 4RE5A 1O8BA 1QH1B 1W85A 2G8NA 4NBKA 4G0XA 2X40A 1XHFA 1XP5A 3UJBA 4B8YA 4D96A 5JSHA 1JDVA 4Q9AA 3GRRA 2XQGA 3CRZA 4HWOA 2NSLA 1C14A 3NIFB 1G3MA 4D5GA 3GJ8A 3O4RA 4BBAA 4DDWA 2C9BA 5BSTA 3OCWA 3LSYA 2I9PA 3PUVA 2QENA 1GARA 2GPBA 1K86A 1P0PA 1O58A 1Q50A 2M6SA 2D74A 4H9GA 4C22A 4HEQA 1MN6A 3NO4A 4Q3BA 2UUPA 1QIDA 2Q4BA 4R98A 5EJ4A 1SG6A 2AK3A 1AX9A 1Z4KA 3IQXA 1TA9A 2B4TO 4FYMA 3R7WB 4MQMA 4O08A 2VBIA 2VUIB 3WHLA 3RODA 5J2TF 4JLUA 2C8LA 5LVAA 3AQIA 4B31A 2AG0A 2TMYA 1ISGA 1LV7A 3L0IB 1J23A 2VZEA 3H2BA 1FTGA 1RJ9B 5EIOA 1DP4A 2EX4A 3WWEA 3H2SA 1SA0A 1E2PA 5KSWB 2LE0A 5B37A 1V7PC 5CU7A 4MV1A 3I5YA 2ZTSA 3G23A 3EEOA 1Z4IA 3VU1A 4Z6KA 3P19A 1VBMA 2QUIA 3WRXC 1KAEA 4UM8B 2V7TA 3KYDA 3JD2A 4URFA 3UFBA 1QHHA 2V6FA 2Y1EA 4YAOA 3NT5A 3MUNA 3BRWD 4KGVA 3WXBA 1ONBA 3L8HA 3IKMB 1RIIA 4X61A 1QRUA 1QYXA 3AZPA 1WSWA 2QORA 3ZBTA 1ZGGA 1AGNA 1DAMA 2PEYA 3DOEA 3M1AA 4UDYX 3A1SA 3I83A 5FF9A 1NAHA 1U1CA 1SD5A 3KSMA 1US8A 4FHEA 3HB9A 4II3A 1XTBA 1D0IA 1KSHA 3W1VA 5BVGB 2HWYA 5B1EA 3TE7A 3RVDA 1O4WA 3B85A 3GZNA 4JV5B 5F51A 4V0ME 1EHYA 5K1ZA 4BN0A 4DPMA 1BXRB 4U8GA 3VTKA 2AR7A 4IRMA 2JL1A 1Y98A 1SK8A 2HBRA 3SYMA 2QTLA 5HQ3A 4FC7A 3TBFA 3EA5A 4BQOA 4QVIA 2FW6A 4WXEA 1XTPA 3EZ7A 4HQFA 4NPAA 4TSRA 1NMZA 3TW6A 3H2HA 3D3QA 4UC0A 1O6CA 2Q3FA 2PGXA 3N28A 3B3JA 4YT2A 3SEAA 4ZEMA 3MFQA 4JZKA 1H42A 4FU0A 5KPJA 1GZSA 1F48A 4JQOA 4E3ZA 5HUHA 1O95D 4FMBB 4WCVA 1PK8A 1PHRA 1DPGA 1CFZA 2NO1A 5TPWA 3ZTWA 2AB0A 1MCZA 4Q4CA 4GF5A 3SMQA 2RG1A 3DBIA 2Q49A 3U4IA 4ENRA 4MMXB 4OHZA 1SHKA 1PG0A 1UBKS 1ONNA 3OHSX 4O25A 1ZW1A 4A5OA 4QM7A 2HC9A 2JIOA 2DC1A 2QZZA 4TMWA 3VR4D 4BYGA 3SHQA 4CG0A 2AIRA 2FQYA 1WXDA 4BO6A 1T9ZA 2IIPA 2ECKA 2BFBA 3JVIA 3LT1A 3MYRA 1ZONA 2FPXA 5EQTA 5J5CA 4DHWA 4E2YA 5IJ9B 5K0FA 1FTSA 3D5TA 1VHWA 4GXTA 1XG5A 2V4MA 1KR5A 2QRMA 1OZ0A 2D1QA 3E5RA 4PZZA 3IL2A 1YS1X 2QJRA 2QY6A 2JA2A 2A1TS 1XR3A 2F1KA 2QMUA 2VAWA 4Y2VA 7REQB 1TIPA 3UHAA 5KTMA 3KVRA 3NRJA 3QMMA 4NYJQ 1W4AA 1KQPA 3DFUA 3JSXA 3A32A 5FI3A 1T35A 1U7TA 5JXHA 3BGSA 3CNNA 4FZ3A 2CLMB 4G0PA 2PX4A 4XUDA 5EOVA 3QMWA 4FYVA 4PG7A 1M8KA 1QAQA 5CX1A 5IAKA 3ZY6A 1Z2CA 1QCYA 4MV7A 3QPAA 1T4CA 2G5TA 1YKSA 3DCJA 2AE1A 4CLXA 1P18A 5IS2A 5J2UA 1T4GA 3RSOA 4FYYA 1I1QB 3FHCB 3VR1A 1VYTA 1WNTA 2CCKA 3VDRA 1X9HA 4FHCA 2WHQA 3NBYC 4DWWA 5EEHA 5KTYA 2VDWA 1WQ1R 3P2MA 1HE4A 3ZHRA 1T5SA 2HI0A 3ZQ6A 5FWXA 2GNAA 3TLCA 1XB2A 1KEVA 1UFQA 3MB5A 3P97A 3FBWA 2BFWA 4JSYA 3WNQA 4GWGA 4WJKB 3SC6A 4EKYA 1JG6A 5CHYA 3ABZA 2EHDA 3NTXA 1JXMA 1ENYA 4JP5A 2PX0A 1Y3CE 4ZQCB 4E2XA 5AKJA 5AFSA 1C7ZA 1P29A 3PVSA 3TYXA 4P2GA 4REOA 4Y98A 2G36A 2C3PA 1XJ5A 4WUTA 3RRXA 2P9GA 5TRTA 3MLEA 2IUFA 3G6WA 3MBOA 2XUDA 4ZDKA 5K3DA 9GPBA 1ONOA 3ANNA 421PA 2XB6A 4IJQA 1VBNA 2XADA 2BP7A 3KHUA 5G2OA 4DJDC 2YRXA 2D1SA 2WSMA 3OPYB 1RRFA 2I4LA 3HGQA 3HS3A 3UFXB 1HDYA 3VPBA 2TSYB 4L2IB 1S96A 2Q5CA 2VQ3A 2K2WA 1HDRA 2F67A 4YMLA 4I50F 4E03A 2ZW9A 2G4CA 2AOUA 3ZX4A 2PKXA 3OQJA 2ZSAA 3VC2A 3OZ7A 3U9TA 1PTKA 1E6WA 1MB2A 4D43A 4GMFA 1QVRA 3W6OA 2J0QA 2HX1A 2W2QA 4D8WA 1Y82A 2K87A 5HS6A 2J6BA 5KNCH 4P4LA 4DYDA 3LFTA 2PGLA 5KTNA 2ADOA 2W37A 5FUVA 4TM8A 1W5FA 4PU0A 3T7IA 2GAOA 1GGFA 2IYPA 4DM7A 4MPPA 3GJXC 1NF9A 3VVMA 3W8DA 3DL7A 3QH4A 1G5TA 2HA7A 3EQ6A 3OICA 5KTKA 3LUAA 4B71A 1JVSA 3BWXA 3MJSA 3O8OB 3HBAA 3TKAA 3RTAA 1QYDA 1AUPA 1GNTA 3G5UA 3PFFA 4DLBA 4Q19A 1UP4A 2XIQA 5DWDA 3ROFA 5C32A 4R81A 4UXJA 1MABA 4WESB 3DTYA 3KOOA 1N6RA 5KYXB 2FZ5A 3LVQE 2WHPA 1N32B 2PJUA 3DO5A 5C81A 1YQDA 2WF9A 5I9TA 2ILVA 5C3MA 2C4WA 3O8BA 4QDZA 3K96A 1RAFA 3RLIA 5ED0A 3P0EA 3O83A 5BSKA 1PEKE 1UCFA 3WBBA 1FSSA 3S2EA 4LOAA 1JHAA 1C9KA 1PNOA 2MOKA 4KOAA 2ZI4A 4KUEA 3PXDA 3M34A 2QMYA 1UBJS 3BXPA 5G3YA 3IP7A 4NJEB 1CDZA 1AGXA 2GPNA 3W0LB 1TJ5A 1AMNA 4JC4A 4J3FA 5LIRA 4I3FA 1E0KA 4D80A 3DWFA 1XA3A 4JQYA 3GA7A 3H4MA 2PJDA 2HEGA 2XEXA 3A6EA 3FUTA 3KLBA 4FQ5A 4QQ8A 4Z54A 1KSJA 4QEDA 4DMUB 1DDGA 2HJHA 1FDTA 5ALVA 4FFDA 3PA6A 3K20A 2XOXA 4BFLA 1YQGA 3VYUB 5BXYA 4CKZA 5LOVF 1RJDA 3ELYA 3LUKA 1F7VA 1G17A 2XYHA 3B1ZA 3S2ZA 5FPSA 3FOCA 1B23P 4YP0A 1QYIA 3O3MB 2QTTA 2AI1A 4OOFA 4PRLA 1EJ2A 3S8EA 3IPXA 1MW9X 4MGIR 4BLWA 4NR0A 2WG2A 1Y1QA 3DL4A 3CUVA 5ALUA 3N8IA 2VHVA 4YR7A 4BGEA 2CHEA 4EG3A 3U3RA 1O9HA 4RS4A 3HZZA 2VTBA 3PZRA 5JISA 5CT5A 1RAHA 3L0CA 4IGIA 4TL9A 1M1NA 3HCDA 2FA9A 4D0SA 1JSCA 2Z95A 4EA8A 4L8GA 4LVOA 4F04A 5IKPA 5DIFA 4EHFA 4RTMA 3KM0A 3C1AA 2QUKA 3GW8A 3NCHA 4JUBA 3RRJA 3F71A 1XMOB 3IXMA 3VX3A 4LRTB 3K72B 1F4PA 2C3OA 4N5NA 3E3OA 2ZYIA 1SNYA 4A8JA 2FGJA 5DV9A 3TJRA 3DO6A 4V1CA 1ZA2A 1VOTA 2R2AA 3C3WA 3QFCA 4LJAA 4HFJA 5KC8A 1LH0A 5ERYA 3WLOA 1PR6A 2H52A 3TEJA 1HDOA 1UPCA 1VKRA 2I80A 2VPQA 3ASVA 4X41A 5HCNA 1QZ3A 5IDYA 5HYVA 3NVKI 3LYLA 1SHZA 4LE0A 2C7GA 4O0LA 1QQAA 2PQ0A 5HE9A 3WYDA 2NXCA 4ARVA 5AHXA 2O2JA 2YZNA 1E0AA 4J2OA 4OLHA 4ZALA 3MXOA 4DAOA 4ZOLB 2VF2A 3JAKB 3ZR4B 2CNLA 3AG6A 3UHJA 4DV0B 2ZQZA 2H2WA 4X6YA 3HK2A 1XX6A 1D3AA 4K2AA 3RFCA 4QD3A 3IE1A 2BF4A 2ZE5A 4UBJA 2F9LA 2XDWA 5A2GA 3CRVA 4C88A 2BJHA 2P78A 5BRJA 5FBQB 4UE6A 1JYEA 1M2GA 3BHJA 5CA0B 3I8XA 1KH2A 3VHXB 1JHZA 1KS9A 4YJGA 3OZGA 5KSPA 4DCGA 5JE8A 4YS6A 3JQAD 1I6KA 2GEKA 2JI4A 4AMVA 3DEAA 4G01B 3ROGA 3K0BA 4R2MA 2WINI 3RS5A 2H5LA 5IN4A 4J0HA 4GW3A 4KG7A 4L28A 3ICQB 2H0QA 3IH5A 4EUHA 3K16A 4IDQA 1U5BB 2RH8A 1QU3A 1T3LA 2H59A 5EE3A 1SVOA 2ZWVA 2ZYAA 4UHBA 3GGDA 1MEOA 1VRWA 4DIEA 1U7XA 1VM6A 3L40A 4M7OA 2VZ8A 2YL2A 5HK9A 3CTPA 2JAOA 3MCWA 4F38A 1NVVR 5CVTA 4JYBA 2GEVA 2IPXA 1H94A 4KXYA 1WD5A 1R4ZA 2B2XA 3PNMA 3QITA 2QUBA 4MO9A 1BIFA 5DGHA 1XVVA 1BVRA 4EG6A 3HUTA 1ORWA 3OAAD 4LZOA 4MH0R 1QAOA 2IH2A 4Q82A 2PUDA 4DR7B 5EWJA 3K05A 2A84A 1LD3A 4HUTA 1H65A 4ZAFA 1UT6A 2PHZA 2ZGVA 3DT9A 3FYCA 2Q6TA 1TQ4A 2O3RA 4KXFB 3FTQA 4BYMA 3L8DA 3DAHA 1O0CA 3DXZA 3QGMA 1SXPA 2VRNA 4X84A 4NBWA 3MUEA 3R23A 3MLBA 3K4QA 1MX5A 2GWRA 4H6WA 1E1MA 1IM5A 3SJ7A 2BR4A 4AO8A 4R6XA 5C7OO 3PJFA 5DFAA 3UMYA 4G8JA 4QNRA 1SBTA 1MENA 4RSRA 1D9ZA 2XAAA 2BWJA 3A1NA 2FJ0A 2FSSA 3KQYA 1A8QA 4QHSA 3KX2A 3H87A 4ZP1A 3STYA 5U1PA 3AFMA 3M81A 3F8WA 1T9KA 2BT4A 3IOCA 4IVQA 2IODA 4KXWA 4NPHA 5B4VA 1E1QD 3TW8A 1LLUA 1NBIA 2QTFA 1JU4A 1S3SA 4K6CA 2B20A 3COYA 5B64A 2C2WA 2NOAA 5AJTA 3EEYA 4U7HA 4KMMA 2HT6A 3L79A 3VKGA 4HRXA 2WA2A 1CV2A 2FUKA 1QX3A 2G4VA 2V9PA 2W6JD 5C8DA 2O0LA 4G0NA 2IYLD 2I54A 4JU9A 2O7RA 4YP6A 5TJ9A 4Y9TA 1AKVA 2IHJA 2W2LA 4QJ5A 4FOTA 1JG4A 5T7BA 1E69A 1YJCA 2L2QA 4WZAE 5KIAA 3GLIB 2Z08A 3LQYA 3KXPA 2WABA 2NVUA 5BNTA 1QC5B 1XLTC 1YB7A 2VBFA 2XA9A 1B8NA 5JLAA 2ZB7A 4DA8A 4YLYA 4H4CA 3GAFA 4UUPA 1E3TA 1IZ9A 3F5QA 3AXTA 4FS8A 4RLHA 4M0FA 5CVVA 3IDFA 4GZ6A 4QYSA 4OFXA 1E5XA 1Q20A 2ZJBA 5TXGA 3OI7A 1BJTA 3FUUA 3BDIA 3ZKAA 3KYBA 3NYWA 1P2FA 3OIUA 5I4IA 4U9UA 3IJ5A 1V8FA 4EJ2A 5AW6A 1PSZA 1THZA 4X60A 3TL2A 5A3VA 4ZHQA 2C82A 4WEOA 1FQWA 1E6UA 3BGIA 2P8JA 3L8FA 1E20A 4UCQA 1W44A 1KQFA 2FPWA 1FDSA 4TKLA 1PDOA 2AI3A 4ZCIA 1AQJA 4OHXA 1Q12A 2QL9A 2EZ9A 1U2GA 1YZLA 4BVFA 2CFTA 1UMBA 4FTWA 1TAQA 4BNJA 1QBKC 5IEBA 4GXRA 3CSUA 1Q0PA 1YUMA 1IJFA 1CY6A 3EVNA 4OUDB 2RB4A 4S1WA 2BLLA 4N3GA 4ARZA 3DC7A 4M99A 3SPXA 3VJMA 5DM70 3T35A 3JU3A 5J1SB 3CWQA 3D4IA 3ED5A 3WGUA 1G6KA 4MJXA 4AO7A 1OYYA 1RS0A 1YOVB 4X63A 1J25A 3TGPA 4YAWA 5BQFA 2RFLA 1T6NA 5F7JA 1KHTA 5FEMA 5HEKA 4QOFA 1D2MA 4WY5A 3VR4A 3DOIA 3GT0A 4D3DA 1OB2A 1WBDA 4BS9A 2GBLA 2ZBDA 4FNGA 1E94E 3DDWA 5BQ5A 3TZEA 4EKIA 5LYJA 4ETNA 4EVIA 3VBEA 1PJ4A 2W2TA 4QJ4A 5SYMA 4ARBA 1Y4ZA 2JJ8A 5ESWA 1R5BA 5JBIA 4KHPB 3ZVNA 2WIAA 3UJHA 4B4WA 1MD9A 1XZPA 2BL4A 1CP3A 4LVCA 4IYRA 5KTRA 4TTIA 3AETB 1I2AA 3U6KA 1N0VC 5IT9A 3RGGA 4YJ3B 5J3JA 4AG5A 4Z4HA 1QPBA 3M3DA 1N7JA 1PR2A 2E4WA 2FF5A 3H17A 2EFGA 3H5TA 3KVYA 3AEKA 3DM5A 2FZWA 5ELLA 5F2OA 3V9AA 3OA0A 4F5DA 3A2NA 4K9QA 4OB7A 2R60A 4EZEA 3HBJA 1KYQA 2YNMD 3PQDA 4FGLA 2QTVB 3LA8A 5DXFA 2MSEB 1EZ4A 2O3UA 2PKCA 1D07A 2ZUCA 3DWEX 3FCOA 3KJXA 3OT4A 4WECA 5IASA 4PXAA 1DXQA 1ECFA 1V1MB 4ZIRB 1QH8B 2E4UA 1WULS 3JZAA 4EDFA 2QU7A 4Z2AA 3II6X 1QIFA 1SCDA 3IQGX 5AKYA 2GBPA 1CZNA 1JEOA 1XMQB 1BJRE 1KPGA 2DFVA 2JGMA 2Q50A 3GEMA 4D4IA 2C2BA 2WJ3A 1Q16A 4L51A 1UDBA 1BQ4A 5CH5A 5FPTA 4CLRA 1HZJA 3ILXA 4XWAA 1M6WA 3OJWA 3HVKA 4M98A 4I8IA 1YONA 1RCTE 1E3WA 4UEOA 3GY0A 2FMXA 1TTQB 2RAVA 4BQRA 4BX2A 2JH8A 3IQFA 3OEYA 2DG2A 3B3AA 5EYPA 1D6MA 4H0FA 4KQCA 1VE5A 2B78A 2DPMA 3I52A 2WU8A 4QUGA 1RRCA 1LRJA 1NYRA 3GZTB 4PPNA 3KQLA 1EDEA 5ALNA 4POOA 2EX0A 3G02A 3IPLA 3ENKA 2BFDA 1Y9JA 2I7XA 2DLNA 2VF8A 3OO0A 3N0TA 5MFZA 2CEKA 3R0VA 3AESB 4JBIA 3WRVA 4MVJP 4UHEA 5A71A 5LJLA 3RYCA 3D9QX 3QA9A 3AVVA 1E60A 4UNSA 2PQ2A 2P4QA 3FVQA 3ZHCA 1SELA 3TI7A 4NBLA 1QQ7A 1QZXA 1DWUA 2CVHA 4I6JA 3CR8A 2LW7A 2FN4A 1SUAA 1D09A 3DV0B 4MVJG 3UMJA 1E7SA 3R0QA 3DKKA 4HFRA 2AG1A 4KLNA 4V0NA 1MV5A 3EYAA 2X9LA 2OK7A 1U7HA 1C9DB 1WWKA 2BMVA 1AQIA 4MKGA 1LV8A 5BN4A 1A2KC 2IPAB 3ETEA 5KQGA 4I0WB 1KE2A 4F6CA 5CFOA 4XA8A 1FS4A 5K0TA 4MI6A 4DGSA 1VL2A 1NJSA 4H08A 4NEQA 1OBOA 1IEWA 3F6YA 5B1SA 1NVTA 5T3YA 1U8FO 3E7DA 3COSA 2HK9A 1PZMA 3COVA 3HN2A 4W9NC 3C7CB 1IIBA 4P4SA 3SXJA 3LC7O 3V33A 4MR9B 1EFRD 4OLBA 1LTKA 2BRUC 2QAGA 4IXTA 3JQEA 5D01A 2GJKA 3TSZA 2GVNA 1TZBA 1VC2A 5JU6A 5BR8B 2XQFA 4LWOA 3WB1A 1PE0A 3F3KA 4NL4H 3SQXA 4Q48A 2NU6B 2GD0A 3N2KA 3PC3A 3S68A 1P2VA 2EWVA 5AIAA 4BUJA 4KXNA 1U28C 3DOFA 1E9FA 4R2JA 1VE1A 3EXEB 4P1ZA 3T4EA 5CVJA 3KSRA 1VPEA 3NJRA 3KO8A 1OKKD 4G8DA 2W6MA 4L9SA 5CM2Z 3PD1A 4Z4IA 1USIA 1VSUA 1XJCA 4YCBA 2L69A 1PQ4A 1UQUA 2ATXA 2HU7A 3VTZA 3B6KA 4P4UA 4PVDA 4FMDF 4GOLD 3VQTA 3D6NB 3NHAA 1N5OX 1R3DA 2GA9A 1AIPA 1T5DX 1TW2A 2EARA 3BMOA 4J90A 3RVOA 3TNYA 4AF6A 1ZMXA 2A1TR 2BEUB 5FPYA 3I61A 1U2TA 3B1WA 3ESAA 3ZV5A 4JI7B 2B0CA 5LIPA 1Z0ZA 4IJWA 1DWPA 2G8LA 3DHEA 2Q8NA 4AMBA 3C70A 1TI7A 4CETA 2P0AA 3LQQA 3GPDG 3D8TA 4J1SA 1MFZA 3TE6A 4QATA 2JGFA 3D3KA 1BXZA 1CUAA 5JC8A 2PX3A 4E11A 1V1RB 1QZTA 4WHMA 2GWHA 2JAQA 4Y9DA 3TNDA 2NO5A 1FMFA 3TOVA 1L5YA 4Q1BA 4MR7B 4PSKA 2O19A 2FI1A 1N25A 3AR8A 3CCFA 4XQGA 3Q3VA 1ECJA 1J4AA 4GOKA 3CG4A 4HMPA 1CS0B 3I9FA 4CHGA 1KXJA 1G5HA 1CIJA 3C48A 2RGUA 4HMQA 1FVXA 2H2FA 2QMOA 1AUOA 3WSVA 3F67A 3GPIA 4Y8VA 3SOPA 1I3LA 4Y2JA 1F06A 1V39A 3B12A 2V7WA 1RP7A 2ZSDA 1SB9A 4JR0A 4NYIQ 4IO1A 2YV5A 1E3EA 1NBHA 5A1TA 5INTA 3F5SA 2CUTA 4ZI7B 1RXCA 4CBVA 3RRFA 1TZJA 1QLJA 1B41A 1VHDA 2VBCA 1XA4A 5E95A 4CM8A 2Q2QA 4DMMA 2XB9A 5A5DA 2OFFA 2BN4A 2ECFA 4EB0A 2WPDD 5HM8A 1U8YA 3FOWA 1TUGA 3Q7PA 4HWTA 1XVIA 2PU7A 3DLPX 1HA3A 1XAIA 3DKPA 1U98A 2XNKA 4NCBA 1KJWA 4GUAA 3P4YA 3L0SA 4N41A 5CFNA 3MT0A 3FH0A 5K0ZA 2KS6A 4KSBA 1H1LB 1BS1A 2Q5LA 1RPNA 4B75A 4FDTA 4OHRA 1D9XA 2BCGY 1UINA 5I7AA 2HO5A 4EEZA 3P2EA 4PX3A 1KZHA 2CCGA 4IFTA 2ZCUA 1ZITA 1Z4JA 2JZOA 3EGXB 4KX3A 3C1TA 3R40A 3V1NA 3OFKA 1J1ZA 2B98A 4OH7A 5IH3A 2HK8A 2HDNB 4HDSA 1EZ1A 4QOSA 2PSEA 3CLKA 3ZPXA 3W2HA 3N87A 3AI7A 3FETA 4PYKA 4EI8A 2GHTA 3WIOA 1N92A 1FYDA 5JZMA 3RFTA 4S05A 2XGGA 4EGJA 2AG6A 3WLHA 2GCOA 2HZ7A 2VHQA 3LHKA 5EVJA 4TYYA 1JYFA 1H2EA 5HE8A 3BFKA 2OHHA 2VXYA 3FGZA 4EUEA 2OBFA 1NXOA 3K1AA 1LVUA 5EC8A 1RI1A 5K6AA 2VQSA 5GQSA 3CSSA 4JBHA 4N4AA 3NM6B 2IEAA 4WGFA 4XIGS 3DMTC 2GN8A 2ACWA 3NNSA 2BFCB 5AXAA 4HGOA 1YKGA 2XUFA 2VSNA 1UP6A 3JYPA 3RU9A 4QT4A 4JC5A 4DSOA 2R7AA 2WJZB 1ZK0A 4HUQB 1U8CB 1X2BA 2CVQA 4TZKA 5A0VA 4JOBA 3GDHA 1Q6YA 3LGXA 1K8QA 1X19A 2FMIA 2HRBA 3FOBA 4PGAA 3QMVA 4R16A 4WLEA 4ENSA 1NQUA 3DBHA 5LU9A 3SHOA 1P45A 2J9YB 3I01M 1J0EA 2SKEA 4ZDIA 1BHSA 1JDJA 2G82A 4PFSA 3HTXA 3ORHA 3Q2KA 4ZHQF 4OXXA 3UOAB 1AKMA 4BO1A 2Z98A 2PBZA 3JX9A 4HBGA 4EL0A 2E9SA 1YA4A 5FPQA 4CEHB 1MQ9A 2VK2A 5KKAA 3PSHA 3GC6A 3R5TA 1UM9B 3E22A 3V4ZA 1CY1A 3B70A 1L6IA 1T0BA 4HZIA 1U9JA 4JASB 4XDGA 1RACA 4NU5A 5HILA 1WW3A 4RD0A 1Y8CA 2JK0A 4O5AA 4HYTA 4M9RA 2G70A 3V1UA 2OT3B 2YJ5A 3Q0IA 4M86A 4QOGA 2FPGA 5DK6A 1NXVA 4DMCA 2HOQA 3G17A 1RRGA 1UXIA 1DARA 4N3CA 4C4XA 4AF7A 4AZVA 2VZ0A 1H4QA 3S44A 3BCHA 1FTNA 2VJQA 2WM2A 4OF4A 2XT9A 3T3MB 2ODNA 4LF7B 3PDIA 4X3PA 3NIWA 4L3OA 4DDVA 2AZ4A 2JGJA 2D1YA 4R8VA 1A4IA 1G8FA 2HPHA 4B85A 2CZCA 2QN8A 3B82A 3TR5A 1KTVA 1U8AA 3F3MA 1N5JA 3IHLA 3IOMA 4N5DA 1N7IA 3R7NA 3RVBA 3TCNA 1H69A 2CV1A 1TO6A 2MSKA 4Q3DA 4Q9NA 3GQVA 2E2WA 2W6JA 3BIFA 4DRXA 4K40A 3TL6A 4L5YA 3UMFA 4EBFA 2UXCB 5DGDA 4Q3EA 3K9QO 2I3ZA 2Q62A 4ODIA 2BI4A 3UPDA 4E70A 1C0LA 2JKVA 3BK2A 3ZQUA 1OHHA 1XDSA 1COWA 1NRIA 1IHPA 1CUZA 2IYTA 3TG2A 3AYXB 1FVFA 3FHJA 4M8LA 1YE5A 4MPRA 1TNDA 3WNVA 1DCKA 2FPPB 4PNZA 2M1XA 1QR6A 4XOUA 1L5SA 3WK7A 1WDWB 3TXYA 1CY0A 2GS9A 3CLSD 3UHPA 4C01A 4JKOA 2ENWA 2WVJA 3BD6A 4DCOA 3AVPA 5LZ2A 4IEFB 4EGAA 1FXWF 1YL6A 2AFHE 2VNHA 4A8PA 1JQDA 1OXKB 2C4TA 4RFSA 1TX4B 2QE7D 1MB4A 2G6TA 1YNOA 3E35A 3MCZA 2JFGA 2QD1A 2ZAOA 1DKOA 1K9VF 4L4XA 4YMSA 4KPUA 4DSAA 6PFKA 3MWDB 4QFDA 1JI3A 3SLGA 2BZSA 1N0HA 1Q7GA 5F2KA 3TZCA 1OA0A 2X58A 3HO8A 5IULC 3FSGD 3ND5A 2CXHA 3HKBA 1SXJB 3AY6A 5KCZA 1H9CA 1E1NA 3WNBA 4DMKA 2B4RO 3SIXA 1XPUA 3JQBC 1OXVA 2GRAA 1M75A 4AZTA 4DN6A 5I8ZA 4Z2YA 4KQ2A 3FDZA 1I2BA 2XVAA 2ZSIA 4D8TA 3SCZA 3M8KA 1P31A 1MJHA 3OTWA 2PFKA 2YJZA 4ZVOA 3TLAA 1TZ2A 4QODA 2HA6A 2QTWB 3Q41A 3M3PA 4MVJE 1QHIA 4LXTA 3FYSA 3PIIA 5IVIA 4TXMA 4WBNA 1J8MF 2FG5A 2I2BA 2G0NA 4XAQA 3SZUA 4CMGA 4JP2A 4YO8A 1R88A 1ID1A 1IN5A 1RNLA 3C5VA 3HCFA 4IS2A 1RVDA 2OAEA 2YX1A 4B3FX 4C2AA 3NOQA 1M2OB 1QFMA 3PEWA 1E0SA 1VSQA 4INPA 4HXGA 2O06A 4H6XA 4D97A 1SUEA 1BH2A 3NC1C 4I08A 5AK4A 2GM5A 2R11A 1RPAA 3L7AA 2ZI5A 4XWTA 1IZ8A 4X54A 2Q8PA 2WTAA 3C8MA 2W2NA 1D1TA 1DEKA 4RYDA 2I62A 3BM5A 3KKKA 2OA0A 3RKUA 5L7WA 2PUGA 1JIQA 2GN1A 2Z2XA 2ZSUA 1K7YA 1BE1A 3O92A 1E2FA 3AOEA 1HORA 5BOSB 1I5OA 4PPGA 3WKAA 2MHCA 3DE0X 4OGWA 4Q3NA 3EDQA 4F8YA 3DQPA 5EJ7A 4EVRA 1MAHA 1A0OA 5E3IA 1BYUA 4EG4A 2W2VA 1DWQA 3MWEA 1Q0SA 4BAZA 1N2HA 3HKDB 1R12A 3IBSA 1QO0D 4OCZA 4XGNA 4L02A 2ERCA 2PRIA 1NF3A 2VJDA 2CJWB 2WF6A 4BNKA 4BN5A 3VSDA 3PIRA 4O4JB 2GAFA 1CSEE 3TDMA 4Z9BA 4HD8A 1OOEA 1XEWX 3O7WA 4Q1CA 4E21A 4PN7A 821PA 1ID8A 3IUNA 3AILA 2EQBA 3KYIB 3MBIA 6GPBA 1A7JA 4II7A 2ZT7A 4M9XA 3HNPA 3LW7A 1KAHA 4D9GA 3KVNA 1TMKA 2R4UA 4HYYA 3ZU4A 5C8ZA 4ZO6A 4RDXA 3RC1A 2R6JA 5T4EA 2FOXA 4DUGD 1USGA 2OHJA 1HFJA 1A5BB 3QY9A 5TDHA 1UPFA 5DBGA 2NYUA 2NXJA 3MOSA 2C58A 3V1TC 1P4RA 5JW6A 1YNSA 2C83A 1Y8ZA 2RK3A 1AMUA 1SRRA 5JALA 1CHDA 3BOSA 1TLTA 2C88A 3PQ4A 2QR5A 3LK7A 3AX6A 4C0KA 2P1DA 1H6BA 3VNQA 3QU5A 1M1ZA 1ZD5A 3PQFA 1WE2A 2B5WA 3QE3A 1J8VA 3SZRA 3PV0A 3SS7X 4O2AA 3I09A 5BN1A 2ZJ1A 1ZCZA 4OQZA 4H59A 1UBCA 4YQZA 3ONFA 3TLZA 2NXNA 4YVFA 5ALGA 2V9CA 1IAVA 3PDCA 5EXXA 1LX6A 5DTQA 5E6SB 3U49A 3HVUA 2XMPA 1JIKA 1WPXA 3BL6A 1FQKA 3PFKA 1N7GA 2QTBA 1KOFA 3PPVA 2OBXA 5LPNA 1U8TA 2H1LA 3A0RB 4Z1OA 1QYCA 1XROA 3A1VA 3WZMA 5IVDA 1F9EA 1BOFA 1H5QA 3KUUA 3M6AA 4F1WA 4B9EA 3K53A 3FDJA 4MAAA 2YWEA 3N7UA 3OEHD 3CV3A 3ADCA 1NOKA 4QQRA 1W25A 2REQA 1G60A 1Q3KA 1E7MA 4TZ0A 2PZAA 4ZU3A 3RWMB 1NN5A 2RMKA 4QPCA 3VKUA 3LK6A 2H4WA 3LU1A 4EUFA 1CQXA 2FZCA 1I33A 2D7CA 5LSAA 1R0YA 2H7YA 3AKYA 4YRJA 1GFWA 5AI5A 3RFVA 3RVKA 5CD1A 3TQOA 1N2JA 3JAMA 1E9DA 1UBSB 1Y63A 2N3ZA 2VSOA 3DPSA 4J76A 4TMFA 4D02A 3IVXA 2B92A 3B3GA 4E88A 1NYTA 1NC3A 1XYGA 2A9RA 2FFAA 2R62A 3DDOA 4XR4A 4YRCA 2AZTA 2O8EB 3SBXA 4AY6A 2YBEA 1VLZA 1GTL1 1JR3E 1Y81A 1OFUA 1V16A 2CNNA 5MFPA 1X8JA 1SOAA 3GLIE 1JNXX 3ZGZA 2G76A 3STTA 4GDFA 1H2HA 1IHXA 1RZ3A 1V7CA 3G8AA 1A9TA 3GWZA 3HJCA 2YIMA 1B26A 5LCXA 2GTIA 3IP8A 4YRAA 4WLVA 4FE4A 1FF9A 1OAAA 3S4YA 4GICA 1CB7A 4GX0A 4JYCA 4RZXA 3ROXA 3W90A 4CL8A 4FMPA 4IDOA 1YO6A 2DF8A 2Y9PB 4EECA 4QEZA 2JIQA 1QAMA 1XAGA 2R96A 5FXMA 4BB5A 1W30A 2QN9A 3EWSA 1O96A 3PNYA 5H59A 1MX3A 4K9OA 5K3FB 4B0PA 3TAHA 1FP7A 2C5FA 3H5LA 4LXHA 1Y8RB 4YMVA 3L05A 3LQ2A 2QP4A 3ZUGA 4B81A 3TLGA 4FYWA 1VBFA 4PGHA 1S1CA 1OWMA 4Q4JA 5FBLB 4FCCA 4D98A 1SWVA 2Z6VA 2FZVA 4TTSA 1Z13A 3WSWA 3ETJA 3IMGA 3NHBA 4O4LA 4GBJA 2E5LB 3KOYA 2IY8A 3P1JA 1RDFA 2EFHB 3BORA 4GC5A 1XEXA 1CUCA 2C1ZA 4M0LA 4G89A 1ZU5A 4QVGA 4F45A 4U2EA 4EH1A 1H8HD 1XF9A 4HGQA 4PBSA 4YRIA 1RLJA 1N9GB 3G9XA 1DUSA 1QIHA 2H1RA 3BQNB 2YWGA 1G4HA 3BQ9A 4IL5A 2G1AA 1M6YA 4FXPA 4RMGA 2WPDA 3B2EA 2MSNA 2IZZA 4IDDA 3HLYA 4LDAA 4OXRA 1HI9A 2CBZA 2VEDA 3PFGA 4P98A 2BZ0A 4E12A 4Q7QA 1XTVA 3LECA 1LCIA 3AGPA 3C3XA 3MZ0A 3OX1A 5EL0A 4ZXFA 1TDJA 1T0IA 4R05A 3AF1A 1GPUA 2D5LA 4P3XA 1MIHA 4AMGA 4C3VA 2X5KO 4BLQA 1NVMB 2E89A 1EFPB 4DM4A 4NZZA 4FJ0A 4H35A 3SJAA 5TE9A 3H5VA 2BVNA 1YBAA 2M6RA 2YBDA 2DZDA 3PNPA 3QXSA 2PLRA 4FE7A 1WDLA 2Z57A 4L15A 5TV2A 3VC7A 4RTSA 1F0PA 4LFBB 1ACMA 1P5JA 2CDBA 2DHQA 3F7NA 3LVRE 1ZR4A 2XNHA 3B6MA 3NEJA 4HEJA 4N1AA 121PA 3O8DA 4MEAA 4TVBA 1E99A 2BZ1A 2Y67A 2A35A 2QMZA 3HY6A 3T9EA 2XMCA 1ZOOA 2ZRMA 1P74A