3O4RA

Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
TRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Dehydrogenase/reductase SDR family member 4
total genus 86
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o4rA00
3U3XA 4PLFA 3GHHA 2H6EA 3NTRA 4WNIA 1LEHA 5BSFA 5IN4A 2D2IA 3E1KA 2EP7A 4J4TA 1SOVA 2NUAA 3JYPA 4IM7A 5KKAA 4F45A 1DIHA 4FS3A 1K6IA 2NU9A 1QORA 5EQDA 4P8RA 4QFCA 4BB6A 1FDWA 1ZSVA 3L4SO 4W9NA 4XWYA 3M1AA 1HLDA 1XHLA 3QQPA 4D3FA 4OKIA 5K6AC 3BMNA 2PGDA 1PL8A 5A06A 1HRDA 4A7PA 1CJCA 4B3HA 3EVTA 3JD2A 4PG6A 3DONA 5CDSA 5B37A 1K3TA 3DEYX 7MDHA 5FI3A 5JYDA 3STHA 2DUWA 4R1SA 4L73A 4CM3A 1UP6A 4DBZA 1WDMA 3QV1A 4BMVA 3T4EA 1RYEA 1WZEA 1XWFA 5JDCA 3WJAA 4DPLA 1V0JA 2FPPA 3WFJA 5TRTA 2AQ8A 1ZH8A 4QEDA 3HZZA 4BV8A 3GPIA 1UUFA 3SXPA 4WOJA 1LDNA 1WZIA 1YO6A 1QYCA 3DOJA 3JD1A 3LLVA 4OXKA 1A5ZA 4YVFA 4A2CA 3C1AA 4RVFA 5IG2A 1O9BA 3X2EA 1UZNA 4YT5A 5TT0A 8ADHA 2FR1A 3QWBA 3VKVA 1GPDG 4PN3A 1E6EA 5L53A 5ICMA 4E4YA 4B4UA 4IIUA 1DC6A 2WYWA 2D8AA 3X2FA 3CKYA 4WGGA 5FYDA 1GR0A 4FPXA 2X4GA 5EPOA 4GSLA 1MLDA 4EEXA 1ZVMA 1ZW1A 1K6JA 3JD4A 2X86A 1I30A 1GY8A 3GFBA 4QX6A 4YCAA 1QYXA 3GK3A 4HY3A 4QT0A 4RPJA 1IUKA 1WXDA 5IFLA 1NWHA 4NH4A 2HAEA 2JJYA 3COSA 2I66A 3W8DA 4UVEA 4JP3A 1JN0A 3PGJA 3U9LA 1R6DA 4GL4A 2PK3A 1XR3A 3RUDA 2VZ8A 4DYDA 5GMOA 4P4LA 4CPDA 1PL7A 4XQCA 1EBFA 3IMFA 5I8WA 4BNXA 2C5AA 1YGYA 3RU7A 3LC2O 3H5NA 3C7AA 2C29D 3I1JA 3LK7A 4J3FA 3WMXA 4YJFB 3AY7A 2HK8A 4BMNA 1CYDA 3VPHA 2BMAA 4Z9YA 1XIVA 1Y9AA 1BSVA 3DZIA 1G0NA 2BHLA 4TROA 3DTTA 2OGUA 3F9IA 1MGOA 4IINA 3ZCXA 4I1IA 2VTEA 3W6ZA 3SJUA 1NFFA 2ZYGA 3VOSA 4XZ3A 3ZV6A 4INAA 3JQGA 4NDNE 2JCVA 3K8ZA 4BKQA 1DBVO 7ADHA 3D3WB 4KDFA 4E3ZA 2X0RA 1A4UA 1X1EA 1YWGO 4RF4A 3KBOA 3VPXA 3FBTA 3RI3A 4FJ2A 1ZKMA 4OQZA 5ENDA 3JYNA 1P1HA 1KEWA 2IZZA 3UHAA 3ZWCA 3DOOA 2PKRA 4AJNA 1B3RA 1QG6A 2VHYA 4R51A 4OM8A 1SAYA 5C5IA 4MDHA 4DUPA 3ZZNA 5IAAA 2Q99A 2X22A 2DLDA 2QG4A 4EUHA 2F1KA 2D1YA 2PFGA 1PJCA 1PJ3A 4GX0A 2EF1A 3HSKA 1KS9A 3KSZO 4RF5A 5DOZA 4BUCA 1ZO8A 4IDAA 2CF6A 3EW7A 4GWKA 4YACA 1ADCA 1I33A 2Y1GA 2QIOA 3UOGA 2C82A 3WGTA 3RROA 4DTIA 2AXQA 4WLOA 5KVVA 4Y67A 2WWRA 2Y66A 1IB6A 2DTXA 4BNHA 1WW8A 3D5QA 1IY8A 4B8ZA 1U8XX 3ADPA 4J2OA 2QRJA 3RD5A 4ZICA 4PLHA 1TI7A 3I9LA 3I9MA 3QE3A 1E1KA 4J0FA 4MP3A 4M86A 5KNLA 4E5PA 3JQGB 1CF2O 4J91A 2EJVA 2X6TA 3Q9NA 2O7SA 4R5MA 1I10A 1ZMOA 3R3SA 4QFDA 5CPFA 1UXGA 3LC7O 1BVRA 2DBRA 1PTJA 1HETA 1DLJA 2X0NA 1EVYA 1U3TA 4DQVA 3DHEA 3AW9A 3UICA 1HKUA 3KYCA 1EFLA 1ZXBA 5COAA 4AJ2A 3WGHA 3VTZA 4WLVA 4XRGA 3O8QB 1GADO 4Z9FA 1YH3A 4JBIA 1YBMA 2FZWA 4PLTA 3VPGA 5K0ZA 5DBGA 3WBFA 1NQ5A 2EG9A 4LCJA 1A7KA 2I3GA 3ZU5A 5DCUA 3NT5A 4CQMA 3WSVA 1SZJG 1HZJA 1K0UA 1JQBA 1P9LA 4NU6A 3G3EA 3PWZA 4PLVA 3C7DB 2NTNA 3WWYA 3ROQA 4CL3A 1YRLA 2EKLA 3KEOA 4P4NA 1AGNA 3ZHXA 5DNAA 3FPCA 1JAXA 4P22A 1HYGA 4NK4A 3A4VA 1ZXLA 2BFPA 3V2HA 2VRCA 3GVXA 4L4RA 5IDXA 5HA5A 1GDHA 1TT5B 1A9ZA 4ZVVA 3OIGA 1JWBB 5ER6A 4BHTA 4DA9A 1YBAA 3RUCA 4FFLA 4NU5A 1NHGA 4MIYA 3F6YA 2AEJA 1HDGO 2RIRA 1NASA 4D7AA 4ZN6A 3AI1A 1IE3A 2IDZA 2PZLA 5A03A 3AK4A 4B3IA 2D4AA 3DC2A 5I9LA 2OP1A 3GA0A 4CLOB 1ENPA 3INGA 4YJHB 4E5MA 1C0LA 2PNFA 4XGIA 3G17A 3AFNA 1SEPA 3G1UA 3MWEB 3SLKA 3GUYA 4GMFA 2VYNA 2HJSA 2ZKLA 3I5MA 4NFSA 1M67A 3TPCA 1I3KA 2D59A 3WOHA 3PJGA 2VOEA 2OHXA 3GZNA 2UAGA 3WX0A 5L51A 4BNNA 1WMAA 3DDNA 4OXNA 2X23A 4NBUA 5EQFA 4F6LA 3C8MA 1DRWA 3GC6A 4O0LA 4RPLA 5A4DA 4QECA 4PIVA 2O48X 4E33A 3TOZA 1LX6A 3I83A 1Z6ZA 3ZHYA 4CODB 1FJHA 3N74A 4PLZA 2DPHA 1AXGA 5DCYA 3IUSA 2FWMX 3H9EO 3U4DA 4BKRA 3Q3CA 3JSAA 1LXCA 2Y1CA 3EZLA 1I3LA 1LTHR 4GGPA 1E3WA 1I5RA 2TMDA 1WDKA 2VRBA 4O63O 5AXAA 4FFRA 5JLAA 5JY1A 1EQ2A 5HWSA 1O5IA 2CUKA 3K2EA 4FR5A 3IKTA 2GD1O 4OYRA 3VDRA 3JQDA 5ILOA 1ZK1A 2DTEA 3NGLA 4AJ4A 2Y1OA 4TMFA 4OJNA 3IDSA 3S2GA 1MFPA 3JQAB 1XU7A 3HADA 3PHLA 3KTDA 1VJ1A 2NACA 1ORRA 3O26A 5B4VA 4CLOA 3LDHA 2C2XA 5CEEA 3H65A 3V1UA 5DOVA 4Q3EA 3CTMA 3FNHA 3DBLA 1U1IA 2HLPA 1W0CA 1ZEMA 5LC1A 4NFHA 3WQQA 5A9RA 1E6WA 1AE1A 1U9JA 5JO0A 3MZ0A 4D3DA 3JD3A 3T4XA 1Y7TA 1C1DB 1YDWA 1QP8A 1T1SA 3K73O 4IJUA 4RVSA 3BIOA 1ZK2A 1C0IA 2IYOA 4IDCA 4J49A 1NBOA 1Z73A 1QRRA 2P2SA 1Z45A 2ZATA 4AJHA 4R1TA 3ZNPA 2B5WA 2WD7B 2Y1DA 4XB2A 3WLEA 3HQ4O 2OZPA 1JVSA 1MC4A 4K6CA 3PIIA 4LVUA 2C2YA 2PLAA 3G0OA 2DQ4A 4KOAA 3GRKA 3GOHA 4IJVA 1DC3A 5F21A 3UKOA 3B70A 1OMOA 4EJ0A 2G1UA 4ALLA 2LDBA 2BFMA 3FRJA 4PVDA 4XB1A 2NQ8A 1F0YA 3JYOA 3KXDA 5BNFA 4HNGA 3KEQA 4HX5A 3UCFA 3MJTA 3ZDFA 3G79A 4CMAA 1BVUA 3BMOA 4MVJI 3FD8A 4P38A 3HN2A 1JKJA 1KVUA 3EUWA 1LRKA 2VHWA 4I5FA 3H5RA 4YT8A 4WNCA 2VHVA 2YQ4A 4LRTB 2JD1A 5TJHA 1UXIA 1VJTA 4D41A 5MDHA 4YRDA 1NP3A 1NX6A 4GX1A 4YYZA 3H9QA 1U4SA 1R4NA 4DLBA 1YQGA 3ITDA 5CEFA 1PIWA 3T7CA 3WMWA 3CINA 3WGQA 4D3SA 2FY8A 5KOIA 5B4TA 2X9GA 4BNZA 1P1JA 2FMUA 5IDYA 1Y9EA 1DC5A 3NTQA 3TNLA 1X14A 3JQ6A 1PGJA 2Y0CA 1H6DA 1E5LA 4Q3CA 1OAAA 3RVDA 3DBRA 3NTOA 4GLLA 2VWPA 3RU9A 3F5SA 4CMIB 1GTMA 4Q3BA 3ASVA 1ISFA 2RH4A 3NEPX 4JJFA 4IGEA 2WE8A 3NJ4A 4QTZA 2ZB4A 4ND3A 3TFQA 4TSKA 2WYUA 4PLPA 2A35A 4RZIA 1ISMA 2HMUA 3PQEA 5G2OA 1KERA 1T2AA 3BHJA 4DMMA 2YV2A 4IXWA 4CLRB 3E8XA 3TQHA 1PL6A 2X0JA 3I4CA 1ZK3A 1O95A 2H9IA 1BG6A 2E4AA 1ENZA 4LGVA 2J3KA 3W8FA 3JD0A 5L3ZA 3PWSA 4AJEA 2HK9A 1U3UA 5JO9A 1B3BA 2BD0A 3PGXA 4FIZA 1X7GA 3WYCA 2VWHA 4R3NA 3AUSA 3DFZA 2ZJ1A 3JQ7B 4Y6RA 3LQFA 4WASA 2D5AA 3CIFA 2X9NA 4JJIA 5GY7A 4N54A 2BGKA 3E9QA 4MVJM 4BS9A 3SX2A 2RCYA 1H0KA 1VE9A 3PJEA 2C7GA 4I9HA 4FOOA 4U8GA 3JQAA 1DRVA 3RWBA 1KY4A 3KZVA 4RDHA 3GDFA 4MKRA 5EL0A 4YAEA 2O4CA 1GQYA 4AVYA 4YJGA 4Z0HO 4CUKA 4ZRMA 3NT4A 2IZ1A 1KEPA 3WFIA 3JQBA 4XYLA 2P68A 1F12A 2AG5A 3AOEC 3JYLA 4CM7A 5CG2A 2NNLD 1GAEO 2VT3A 3FPLA 3K30A 1AHHA 5KTKA 4WLNA 3GAZA 1QR6A 5F1OA 3WGYA 5JE8A 3H3FA 5L4SA 3GMSA 1DIAA 4KP7A 5LDHA 5IXYA 1J49A 1IHXA 2DBZA 3KLMX 4RPHA 2CD9A 4PLYA 4BKUA 1YJQA 2SCUA 3WGIA 2YHIB 1ZSYA 4G65A 2V6FA 4BKOA 2PTGA 2DUUA 4O6VA 4BO5A 1NHWA 2AW5A 4GQAA 1YL5A 5I8ZA 3JQCA 4FBGA 4WEOA 3WNQA 3F4BA 4RF3A 3RBXA 3A1NA 2QZZA 1YXMA 3KYDA 4KZPA 5EESA 4MO2A 1GQ2A 2DT5A 3M1LA 5IF3A 1UAYA 3M2PA 3DL2A 4XD2A 4GX5A 1H2BA 4HKTA 4JK3A 1DHTA 4OH1A 3W6UA 2IZ0A 3OFSA 5C7LO 2VNSA 3BMOB 5C3MA 2FZEA 5KWEA 1XQ6A 4CL8A 1I3MA 4PLCA 3WTBA 4CM1A 5JNLA 5TC4A 5FI5A 3HFSA 4Q3NA 1U2DA 3RFVA 1H6CA 3HDYA 1P3DA 4LW8A 2VZ0A 1ZIDA 3LC1O 5CG1A 2BGMA 4G2NA 1UXHA 4BVAA 4J0EA 3NV9A 3H3JA 4IDBA 3ETGA 3QJ5A 1YL6A 3PHGA 4JX8A 5A3VA 1JVBA 1C14A 3PXXA 4NFYA 5KJ6A 3JTMA 4MJLA 5J23A 4E5YA 2WMDA 4Z6KA 3INRA 3ZWXA 2E37A 4FJ1A 1SMKA 4FD3A 3GRPA 2RBEA 3ITKA 4M1QA 3CH6A 2O3UA 3D0OA 1Q7BA 2GDZA 4B7UA 4RVGA 4NBTA 2HMWA 2FP4A 4W6ZA 4CQMD 4K28A 2J6IA 4J2HA 5FWNA 3I4FA 3PLRA 3AY3A 3FTPA 1LSUA 4EI2A 1UXJA 3V1TC 5EINA 3ORFA 1NWCA 1WLYA 1ONNA 5JCJD 4A27A 3GHYA 3GEDA 2EHDA 1U2GA 3NAQA 5TF4A 4M8SA 2FR8A 4M89A 4MP8A 2P9GA 3VVBA 3E5MA 4BL5A 1EVJA 5IN5A 5T8KA 3JQ7A 2Q2WA 5G0TA 3RJ5A 2X8LA 4RQTA 1GEEA 1H93A 4Z0PA 3ANMA 4MP6A 1IZ9A 5B12A 2PKQO 1ZNQO 5CHEA 4NZ9A 3LF2A 4F46A 1EE9A 3A9WA 3WXBA 2IODA 1RJWA 1E3SA 4XA8A 4JLWA 2X7HA 1LDBA 1GPJA 1N1GA 1B2LA 2IRWA 4XR9A 2Z1NA 4DPKA 3MWDB 4BV9A 1E1LA 3HB4X 2IXBA 2OBNA 4I5EA 1QMGA 4RLHA 2J3IA 3ST7A 4GVLA 4BNLA 1Q0QA 4UEJA 3FSRA 1P1RA 3ZNNA 1T1RA 3H2ZA 3OIDA 4L76A 3D4NA 2DBVO 5A5EA 2GYYA 4PG8A 3BTVA 3RUAA 1RYDA 5EJ2A 3VKUA 3OEYA 1YB4A 3JQBC 2ZCUA 2VHZA 1H9BA 4BO3A 1F14A 2NTVA 1DFGA 4K6FA 4OGWA 3WYBA 3KYBA 4EITA 1BRMA 2BELA 5I9MA 4ZU3A 4W7IA 2FRDA 1Q1NA 1Y8RB 1ISIA 1OC4A 2HO5A 3PDJA 4A26A 1PQWA 1QV6A 1MC5A 2AE2A 4GBJA 4RF2A 3U09A 3OETA 3BZUA 1LSOA 4YJFA 2ZYDA 3PPIA 3E82A 4JCOA 2BFOA 3UUWA 2PD6A 3GDGA 4C4OA 4EJ6A 1RWBA 1LRJA 1CQJA 2B4RO 4B4OA 3B1KA 2P5YA 2PH3A 2FSVA 4RV9A 3IJPA 4ZQGA 2CDBA 2E6UX 1DIRA 2VUSA 1MA0A 4HWKA 1D1TA 1B8VA 4LCEA 4RPKA 3OECA 4N18A 4GKBA 3GAFA 3UCEA 1DEHA 1BMDA 3EGOA 4AJIA 4L4XA 3ZHBA 4E6PA 3OJEA 2Y93A 1HEUA 2XAAA 1C1XB 5FEUA 4NMHA 3PVZA 1GYPA 3DAGA 2UUPA 1EVZA 1IHYA 2PGJA 2WD7A 3UN1A 4DVJA 1PJQA 4FC6A 5TIIA 2V65A 3ZWMA 3LSYA 3KOUA 5IJZA 4WCFB 1SC6A 1BW9A 3GN1A 4Z3DA 2ZTMA 3GEMA 2R2GA 3OA0A 3S55A 2C5EA 3BA1A 2V7PA 3DB2A 2HMTA 1V35A 4CM5A 2W98A 4IDEA 4BGUA 2NM0A 1JWAB 1I3NA 4J16A 1VRWA 2NSDA 1O8CA 4XEHA 4BO4A 4CLXA 3NDRA 1Y81A 2B69A 1PJ2A 1E6UA 5A05A 1E7RA 3ZNOA 4YQYA 1IYZA 3TZKA 2WDZA 3RKRA 3RC7A 3IOYA 2HMVA 4MVJG 3CEAA 1Q2XA 1W6UA 4J43A 5I7VA 3EYWA 3IJRA 4HFMA 5EERA 2XPCA 3SVTA 5K9ZA 4E13A 4RJTA 2CVOA 2I99A 4PG5A 4NI5A 1NQTA 4XJSA 4BNKA 1LRLA 2JFGA 3AUAA 3WBBA 1DJNA 4RO0A 2Z95A 4ESOA 5KCZA 1HL3A 1E7MA 1GQQA 5BNIA 3AI3A 1N5DA 3L07A 4BQRA 3C3XA 4B3JA 2V6GA 4FFPA 2B36A 4MINA 4N5NA 1B7GO 2DBQA 4MIOA 4D0SA 4EDFA 3GUCA 4IMRA 4ND1A 3ZWVA 1EVIA 3MOGA 2VNAA 2C07A 4PZCA 4WE3A 3H9GA 2NVUA 2JCYA 3DWFA 1XG5A 4QSMA 3KLPX 3FR8A 4Q3DA 1HSZA 4FGWA 1D7OA 3NJ8A 2GASA 3CZRA 3GVHA 4WECA 1J0XO 2X5OA 2UYYA 1NM5A 3GF4A 2Q3EA 3WICA 5JAMA 1F06A 4WJZA 3DBVO 3RAJA 4II3A 2O3QA 4BNWA 1XYGA 4CM4A 3BTUA 3K5PA 5A9SA 2B0JA 4FCCA 3P2OA 2RAFA 2HDHA 3GZ4A 3ZWNA 1QXSA 4YRAA 5DCWA 1R4NB 3INTA 3PHIA 5CDTA 1KVSA 1P44A 1P1IA 3ZWOA 3I3OA 2YJZA 1RKXA 1R0SA 1Y6JA 1S7CA 4CLEA 4CR8A 3GG2A 5F5LA 2Q2VA 5U4QA 4NG5A 3L9XA 3WB9A 2NU7A 5B4UA 4QUKA 3C7CB 2OMEA 3DBRB 4JQCA 3EZYA 4J90A 2QQ5A 3IP1A 1RPNA 1UP7A 2GGSA 3BMCB 1V3VA 3L0DA 2J3HA 1HDZA 1ONPA 2QYTA 3AWDA 4E2ZA 4W4TA 1DSSG 4UEKA 4OXYA 2PWZA 3H4VA 1HE5A 3ZW8A 1O0SA 1PQPA 2CMDA 3F1KA 2NVWA 1LDGA 1DRUA 4ZJUA 2AMFA 4UEOA 3H9UA 4MKZA 2BKAA 4ND2A 1EZ4A 2Z5LA 2DKNA 1N8KA 5HTOA 2X1HA 3OJFA 4BIIA 1P74A 2R00C 4XYMA 4IS3A 4RLSA 3GN2A 2BRUA 1FDVA 2P4QA 3I9KA 1EBUA 1I8TA 1YDEA 4IS2A 4CM4B 3D3EA 3NYWA 1MV8A 3LLSA 5CDGA 3HE3A 1X0VA 5I7SA 1OI7A 5A04A 2P5UA 5JDCC 4GPD1 1GU7A 3FBGA 3O4RA 2VQ3A 4FN4A 1V3TA 1ZSNA 3RIHA 3RJ9A 3C24A 2W2LA 1A9YA 3E6AA 4FFMA 4HXYA 4RVDA 3KETA 1N2SA 2TMGA 5AXDA 2C54A 1Q0LA 4L8VA 5AQ1A 3TL3A 4CV1A 5K6AA 3MJEA 2UUOA 5ITWA 1O6ZA 3H7AA 4DQXA 3FWNA 2CVZA 3BTSA 1YQXA 1E3JA 4YWJA 4O5OA 3KVOA 3ZU4A 4DBVO 4GGOA 1N1EA 2DC1A 2H1SA 4DWVA 3JQ8B 1H9AA 3GNQA 2B37A 4XKJA 1PWZA 2B4QA 2CF5A 1WP4A 1PJBA 1UDAA 2G17A 4OIMA 1LLDA 1EE2A 3M6IA 3R3JA 2JAHA 3IKVA 4PGFA 3GVCA 4ALJA 5L7WA 3AOGA 5KJ1A 1T24A 2H5LA 3CMMA 3FCOA 3UAGA 4K1LA 3RQSA 3PYXA 3WTCA 4DGSA 2E49A 3NKLA 1AXEA 2CNBA 3AM4A 2G76A 3JQFA 2PH5A 2O3SA 5AXBA 2D3TA 1UR5A 3IS3A 1DAOA 3E03A 1KOLA 4UVHA 1VKNA 4YAJA 3WG9A 2VYND 4YPOA 1J4AA 2PZKA 2ZK7A 4WCFA 5L7YA 3WYEA 5L4NA 3P5SA 1M2WA 3ZV5A 3KSDO 2NU8A 4RPGA 1UJMA 3OMLA 3DR3A 3QVTA 4NBVA 1LC0A 2I65A 3JCZA 4GVXA 4YAIA 4HADA 2VUTA 1W73A 4H3VA 3ZWYA 2YDXA 3P7MA 4LISA 4Y98A 1ZK4A 2FOIA 3B6ZA 5JBIA 4DLLA 1IPEA 2VWGA 3WIEA 1BXKA 1GCUA 3W4IA 5CDUA 5KJFA 1I01A 2W2LD 4J1NA 1FK8A 1XSEA 4R3WA 3QHAA 3VVCA 1QV7A 9LDTA 3OQ1A 3UXYA 1CRWG 2OO5A 1ZJZA 4B4VA 5DF1A 1ZFNA 2YYYA 1JW9B 1D4FA 4B7CA 4NJMA 3RKUA 4IGFA 2VRCD 1HDOA 4JN6B 1SPXA 5CEJA 3HWRA 3IAHA 4DPMA 5U9CA 4D44A 3ONDA 5KVSA 1KVRA 1LDMA 1Z74A 2I67A 4IJWA 4XYBA 1P33A 4CLDA 1LLQA 1GUZA 4XQEA 2PZMA 3H8VA 1VSUA 3WWZA 2JHGA 4PZDA 2AEMA 2W2KA 1X1TA 2GZ3A 4PFJA 4QQRA 3OBBA 1X0XA 3SLGA 3TRIA 1HT0A 1HDRA 4YDRA 1VSVA 2GLXA 2JAPA 2E48A 4AICA 1PGQA 1NPDA 4IDGA 1N7HA 4U6QA 1GEGA 3RASA 4UUMA 1UZMA 5C7OO 1NYTA 1V9LA 3MJ4A 3N7UA 5DZSA 3W8EA 1Q7GA 1T26A 3U5TA 4ZA2A 3DBHA 5JPIA 4E21A 1KBZA 4BB5A 1TT5A 2JFHA 3GVPA 5EIOA 1B16A 1Q7CA 3QW2A 1OZAA 3JQAD 1HWYA 2O2SA 3KYCB 1KC3A 2Q1UA 4CV0A 3DBHB 5KIAA 5AOVA 1SB9A 2OP0A 4GSKA 3QVWA 4RZHA 4F6CA 3HUDA 3ONEA 3I23A 3OHSX 4QXMA 4JGBA 3UW3A 3DMTA 1I2ZA 1VJ0A 3K96A 3ZU3A 3ZWPA 6LDHA 1U7TA 2DFDA 4IDFA 1PJSA 5G4KB 1GYRA 1FDUA 4ND4A 4UREA 5MGBA 5A1TA 5A3JA 3QVSA 4UVIA 2XF8A 5LDGA 1CDOA 3TZCA 2JD0A 1LSJA 3PJFA 4L74A 1UH5A 1XCBA 3JQ9C 4P4GA 4DC0A 4ITUA 4E2YA 5JCXA 2W8ZA 1OC2A 3P2YA 3HN7A 2ZTVA 3OIFA 1M6HA 3VZSA 1TA4A 4O1MA 3RCBA 1ZZEA 3V2UA 4XR4A 3WLFA 5JSFA 3MTJA 3ZHZA 1GZ6A 2J5QA 4BMSA 3ON5A 3AM3A 1GZ3A 4ZHSA 4ROSA 2IE0A 2Q45A 2VWQA 2YUTA 1G6KA 4H16A 1GYQA 1YL7A 5G4LA 2Q4BA 3W4JA 3E9MA 2NVBA 2QYSA 3GLQA 3NDIA 4Q39A 1TXGA 4FGSA 3PEFA 3RFXA 1V3UA 2ZQZA 3QWHA 5T67A 3T7EA 4D79A 1EK6A 2D5CA 3E9NA 1PX0A 2X5JO 1KEVA 1LUAA 2HUNA 3PTZA 5KVCA 4GH5A 5T8KC 4KUHA 5I7EA 2HCTA 3KSUA 1DC4A 5TNXA 1NQAO 2A9FA 4BNUA 1NNUA 1VL0A 4CQLB 1A7AA 1B8UA 3PDUA 1HZZA 4D0RA 3RUFA 4Q9NA 3IL2A 4BO9A 1MG5A 1LI4A 4DIBA 4XYEA 3GT0A 1DFIA 2CY0A 3D5TA 1HE4A 3LT2A 4XCVA 1FXSA 5DULA 4URFA 4ZD6A 3TDKA 4AJKA 4XIYA 3U4IA 1MX3A 1VPDA 4W82A 4XJTA 4BNMA 2ILTA 1ZBQA 3NT2A 3EC7A 2HQ1A 4JIGA 2B5VA 3I9NA 4HFJA 3H6KA 4FB5A 2C7VA 5U1PA 1C1XA 4BO6A 2IYPA 4J7CA 1JTVA 3Q9UA 4J1TA 4CQMB 3ROPA 2I6TA 1A72A 2FHSA 1MXFA 3JV7A 1EUZA 2YHUA 3QWFA 2DTDA 3VPSA 2PV7A 3GFGA 2AHRA 1ZK0A 2EGHA 1FDSA 1JKIA 2EP5A 4J4HA 3LT1A 1T4DA 4E0BA 4BO2A 4UULA 4W7HA 2O3JA 4IMPA 1L7DA 4RGBA 2UVDA 4FQ8A 1DHRA 5FF9A 4XYGA 1ISJA 3UGKA 3BMQB 4DREA 2JD2A 3GMDA 3SBOA 5ENVA 2P9CA 4AJOA 4YTEA 2RHCA 2C0CA 1P0CA 5HS4A 4AJPA 1IPFA 3IP3A 4ID9A 4UVDA 3TJRA 4BNJA 4LRSB 1Y8QB 4NK5A 3ZW9A 1IULA 1EDZA 4HBGA 2B4TO 5BNTA 3FN4A 3K9QO 3RFTA 1L1FA 2A4KA 3VDQA 1MB4A 2XOXA 3GY0A 1GUYA 3DO5A 3KM0A 2GERA 4YAKA 3MJCA 2NWQA 1Z7EA 3FF4A 3FNFA 1PEDA 1K6XA 1GFSA 4DIFA 1Z7BA 4XDYA 1VM6A 4R1NA 2C59A 3L77A 3O8QA 4XX0A 4CMEA 5L95A 1Y5MA 1UDBA 4ILKA 3W1VA 1KETA 3LT4A 1I2CA 4HNHA 3CMCO 2HMSA 1PS8A 4UUOA 1LQTA 1EDOA 2ZTLA 3HDQA 3TL2A 4CLRA 4M54A 1P1FA 3QRWA 3WR5A 1CIVA 1KEUA 1ISHA 3JQFC 3DXFA 4MKXA 2EJWA 1B15A 4D42A 1SB8A 4I08A 4ND5A 1ULUA 4UVGA 1C3VA 4RVUA 2DAPA 3OA2A 3ICCA 4YBZA 3NGXA 3NDJA 4GI2A 4TRNA 1RM4A 3ZN2A 2ZYAA 5BR7A 3HJAA 3DZJA 4OAQA 1GL3A 5H81A 3SEFA 3PP8A 2I3AA 3TFOA 1YOVB 3GG9A 3WDSA 3O03A 5JC1A 2EW8A 2OFPA 1RM0A 5GZ3A 4WOKA 2AQKA 2HU2A 3FI9A 4IDDA 1CEQA 4JBGA 4NBRA 3ZNQA 3K31A 2WTBA 3GDOA 4HFNA 4KWIA 2DFVA 5L45A 2D0IA 3WQSB 3NUGA 2AG8A 3H5AA 2PD3A 3PWKA 4LVCA 2Q2QA 1IZ0A 1R37A 5TQVA 1NAHA 5L40A 1XKQA 1LNQA 1PWXA 1PZHA 5I7FA 3JQ8A 4NHEA 1MG0A 2YQ5A 2PGLA 2PY6A 1D1SA 2Y05A 3RUIA 1JA9A 4WEQA 4PZEA 5DDIP 1BXGB 1G0OA 2I9PA 1YJ8A 4QO8A 1KVTA 1SNYA 5JW6A 4GWGA 4E31A 3C1TA 1LBEA 1P0FA 1R16A 2PR2A 5A9TA 1D8AA 1N9GA 3E5RA 3QWIA 4J9UE 1JAYA 2VOJA 4I8XA 3ASUA 1EMDA 2ZB8A 1K2WA 1DB3A 1X15A 5T5QA 1NR7A 4OOEA 4BGIA 2PZJA 1E7YA 3ZWAA 3QY9A 2QHXA 1X7DA 3VZPA 3WGGA 5G0UA 3VPFA 2GN6A 2A92A 4IXTA 1P45A 1TLTA 3UF0A 4E2XA 4WK6A 5C7IO 4IBOA 1YB1A 2OL4A 5FFFA 4FFOA 3K2BA 4PLGA 3DZGA 4R41A 4XGNA 3U4CA 2WD8A 5CFZA 3EY4A 3TN7A 3D4PA 3OQBA 2EXXA 1E7SA 1BGVA 2Q50A 3TZ6A 3DOCA 4ZQFA 2J5RA 2FN7A 4PG7A 4KDEA 1LA2A 4I5GA 4MVJP 2QRKA 4II2A 2YW9A 3BMQA 2X5KO 1NFQA 3DQPA 3ENKA 4DC1A 4E12A 3B20A 3AM5A 3Q11A 4KUGA 2PD4A 4QO7A 4WUVA 3KHUA 3ETEA 3DAPA 4CLHA 1I2BA 3D4OA 1CWUA 1EQUA 3NX4A 1CERA 3ULKA 1TVEA 3PIDA 3EDMA 1ID1A 2RHRA 1B0AA 3KUXA 5L9AA 3OICA 1E5QA 3ANNA 3CSDA 5THQA 4L9RA 4FDAA 5C37A 4TKMA 3HDHA 4NJOA 3F47A 1QKIA 3GNSA 2HRZA 5DN9A 1NVTA 2Q1TA 4RL6A 4YT2A 1X13A 3VZRA 4BNIA 1NVMB 5JC8A 1DLIA 3BMNB 3IC5A 2AEFA 2G0TA 2Q1SA 3ZI0A 3I9JA 1J6UA 3IIEA 1H6AA 2CZCA 2GRAA 4S3MA 2B83A 2GCGA 4H7PA 4FW8A 4LK3A 4TRRA 2ZJ0A 3DBLB 4LMRA 3S8MA 5JDIC 3HB5X 1H94A 4Z9XA 4CMCA 1M76A 3BHIA 3V2GA 2OBYA 1PJTA 1XELA 1HE2A 2Z1MA 4FFNA 4ZGWA 2WJPA 2A94A 5A9SB 4MVJA 1ONOA 1E1MA 3EVNA 3SJ7A 1E77A 1NFRA 2ZCVA 1IOLA 4ALMA 4BKPA 5CAEA 4WLUA 1EK5A 4NNJA 2YV1A 4BNVA 3PZRA 5HBRA 5G4KA 1YOVA 4WCDA 2ET6A 1PGPA 2Y0DA 5T64A 3AOEA 9LDBA 1L7EA 4OSPA 2W4QA 2G82A 1U3WA 1HE3A 1UAGA 2NLOA 1BXZA 3PFFA 5DP1A 1MXHA 4TQGA 5ILGA 1E0DA 4YJDA 3AFMA 2J3JA 1GD1O 2C20A 1EEHA 2W2KB 2WSBA 5DBIA 4DLAA 2HSDA 3I52A 3PI7A 4CMHA 1DAPA 2GZ1A 2O3TA 1O94A 3VHRA 2E82A 2EV9A 2DPGA 1ENYA 1JDJA 1H6BA 3DMTC 5H82A 3OH8A 2AA3A 5H83A 4D45A 3C1OA 1JKFA 2VCYA 3H9JA 4NPCA 3Q2IA 5DT9A 5TJ9A 5TS3A 2WEKA 3CXRA 5JAZA 3Q0EA 4RVHA 2ZTUA 2YY7A 4OKNA 4LSWA 3AU9A 4FOSA 4IZIA 4M49A 1PS0A 3RC2A 5JYEA 1C0KA 1T2DA 3U62A 3EMKA 3PHJA 4FC7A 4R16A 4XIJA 4AJ1A 1JLLA 2X0IA 4X54A 3MJSA 1E3LA 4YJHA 2O50A 3GPDG 4W9NC 3GH3A 3KYDB 3VH2A 1UZLA 1F17A 3BMCA 3BXXA 3DZHA 2JHFA 4Y6SA 2WM3A 5JFOA 1K5HA 2Q46A 1T2FA 3VH4A 1M66A 2O7QA 1LLUA 1YB5A 2GN9A 1YVEI 4UUPA 4YXFA 3RUHA 3BYZA 4BO8A 3JQEA 3JYQA 1BXGA 2ZB7A 4U7WA 2RH8A 1SOWA 3IQDB 5T57A 1PQUA 1XGKA 4BNTA 3I9OA 1MFZA 4E2WA 1EFKA 5JAIA 1A4IA 1DIBA 4R54A 3RBZA 4AJLA 3BAZA 4CM9D 1I0ZA 4CM6A 2GF2A 2V6MA 3NRCA 4I9NA 4DRYA 1HDCA 1WVGA 5BQFA 3F4LA 5L4LA 1DXYA 4IZHA 4J1QA 1N9GB 3RBVA 3FNGA 5IXSA 3S2EA 2WE7A 2GN4A 3S2IA 1PS9A 4CMEC 5TT1A 5ITVA 4C7JA 2P4HX 4WLFA 1QSGA 5TGDA 4R5HA 1P77A 1E3EA 4U6SA 1VC2A 2Y99A 3V8BA 1JU9A 1VI2A 3TSCA 1G1AA 1SO8A 3Q6IA 4CQLA 2EIHA 3OQ6A 2BLLA 2QZ9A 4BQPA 2CDAA 3ZV4A 2OOSA 2Y0EA 2YV3A 2NTJA 3G49A 2CSUA 4OQYA 2VN8A 1OOEA 4CMBA 3ANLA 4TRJA 1C1DA 3GQVA 4J7UA 3L6DA 4ZQEA 4EEZA 2VHXA 4MVJE 2Y1EA 5KJEA 1FF9A 3UCXA 4NIMA 1ZCJA 2BI7A 1H2HA 1AUPA 2JFFA 4B7XA 3H2SA 4E30A 3VTFA 1D3AA 1YQDA 2YFHA 4E5NA 3FNEA 1BW9B 3UVEA 5HS6A 1AN9A 1PSDA 3OEWA 4WLEA 3VH3A 3OJLA 2NV6A 5HM8A 3C85A 1H5QA 3AUTA 3O38A 4R9SA 1XA0A 4R1UA 2ZB3A 3AJRA 3FR7A 1ENOA 1HYHA 2GPTA 5G0VA 4O59O 4MVJF 4TWRA 1GCOA 1T4BA 4BO1A 3ZU2A 4BGEA 1U28A 1OBFO 4I5DA 5KVQA 3ROKA 3GVIA 3QIVA 4A0SA 3PYLA 3DZBA 1UDCA 5THKA 4JROA 1Z75A 3RC1A 4ZQHA 4CMIA 3I6QA 4OHUA 2GSDA 1BDMA 1KC1A 4CM8B 1V8BA 1DPGA 4EW6A 2BI8A 3ZGYA 3PHHA 4A03A 4NQZA 3UFXA 4EUFA 1VLLA 1YONA 3CZMA 2O4UX 3QVOA 4Q3AA 3EAGA 4LSMA 5G0SA 3EHEA 4A5OA 3FHLA 4GLOA 4RDIA 4EYEA 4YT4A 3SC4A 3HHPA 3RC9A 4GX2A 4BNYA 3KB6A 2JL1A 1NTOA 4AL4A 3PJDA 1U5CA 2IEBA 3DFUA 5TX7A 2POQX 3CE6A 4GMGA 4WKGA 5JS6A 4L75A 4M87A 4HV4A 3K6JA 1F8GA 3IUPA 4CV3A 4IQ0A 2YDYA 3DZFA 5CDYA 1NPTO 2GR9A 1UXKA 4HUJA 4J7XA 2GZ2A 4BNFA 3FTNA 4ONEA 1ULSA 1PZGA 4EBFA 4XRRA 2Y67A 2F00A 3QP9A 1U4OA 2GO1A 3ZV3A 1R0LA 1NQOA 5IDWA 3LT0A 4KUEA 4BNGA 3GEGA 4PG4A 5COQA 5AVOA 4ALKA 4BO0A 4DQUA 3DHYA 1QYVA 4TZTA 3EK2A 5L7TA 4U0KA 3DTYA 4CM8A 1ZJYA 4Y8VA 3Q2KA 1PGOA 2V6BA 3D7LA 3PFWO 4XGKA 3TZHA 5LCXA 4JNKA 1MUUA 1NPYA 3W4KA 1DO8A 3F5QA 5F1PA 3U4HA 3JQ9A 4R9RA 3OM9A 1E92A 2H63A 3S1LA 3F46A 3HG7A 1HDYA 4KWHA 2BGLA 2HRBA 4R68A 4K9DA 2Y1FA 3WGOA 1DOHA 1RM5A 1R12A 2IEDA 2PKQP 1DIGA 5JCJA 2R6JA 1E7WA 2OUIA 3A06A 1PR3A 4HP8A 4D46A 4YQZA 2G5CA 2O23A 4TZKA 1B14A 1HLPA 1LSSA 3D3WA 4ZRNA 3VC7A 2BH9A 1W4ZA 3U0BA 2LDXA 3PYMA 1LJ8A 3AI2A 3A14A 1CQIA 4YJGB 1ARZA 2NADA 5DBFA 1T2EA 3FWZA 1IL0A 2W90A 4CM9A 4Z3KA 1XU9A 4BOYA 3TOXA 1ADBA 3L9WA 1ISGA 3WQRA 3PZBA 5JY6A 4KMSA 3SC6A 2CVQA 3GZNB 3KV3O 4J1SA 1OFGA 1PZFA 4CR7A 1HTBA 2P9EA 5BT9A 1TB4A 2HKIA 1NR1A 2XXJA 2WYVA 4EUEA 3A28A 3F3SA 2FR0A 3QA9A 1YE3A 3QWAA 1DJQA 2NVUB 1LQUA 2I5PO 1LC3A 3PQFA 4Y9DA 1XEAA 1LDYA 1GUFA 3D64A 4PLWA 1ADFA 3PK0A 4KQXA 2VYVD 4E32A 2GN8A 2EERA 4JBHA 3CPSA 3TZQA 1N92A 1P1KA 4CMJA 4JXKA 4OSOA 1Y8RA 2DM6A 4CUZA 1NXQA 4UUNA 3ADOA 1DFHA 4KQWA 3OSUA 4S1VA 1Z82A 4B4WA 3VH1A 1BWSA 3OJOA 3DZKA 1PU2A 2JCXA 4AFNA 5AXCA 1KY5A 4M55A 4BO7A 1E7QA 4RQUA 4AG3A 3N58A 2BFAA 1A71A 1E3IA 4OOFA 4YEDA 3GR6A 3DHNA 2FPIA 4EJMA 5JDIA 4N5MA 5BSHA 2CDCA 5ICSA 4U0JA 5TSDA 1SEVA 1ZUD1 3ZWBA 1FDTA 4E5KA 1Y8QA 4OMUA 4ALNA 3WIDA 3L6EA 4DMLA 4AJJA 2FSSA 1UP4A 1C0PA 2VUUA 5BSGA 4JJGA 5IZCA 1SBYA 3LF1A 5A5FA 3B1FA 2GUGA 1TEHA 5B1YA 1KIFA 3GGPA 1KVQA 1T25A 2NU6A 4OL9A 4ALIA 1E1NA 4IQ8A 1VKOA 1TT7A 4K26A 1EUCA 1XQ1A 2EGGA 2PA3A 3WSWA 2HK7A 4CMGA 4UAGA 1Y1PA 5KKCA 2QX7A 3AUUA 2FPGA 4MIEA 5ES3A 4G5HA 2X58A 3L4BC 1VL8A 3CUKA 4B8WA 1NAIA 1T2CA 1N7GA 1VL6A 4DXHA 1ZEJA 3AY6A 4XQ9A 4PRKA 5F3RA 3OP4A 1B26A 5TLSA 1GV0A 3G1TA 4J6FA 4OO3A 3MCVA 3MJVA 3I6IA 4DYVA 1R15A 1AHIA 1QLJA 1NVGA 1YS4A 1W8DA 4HFRA 4WPGA 1WDLA 4J4BA 1R0KA 3S2FA 5EN4A 1WAMA 5HRUA 4Y6PA 3QSGA 5G0WA 2UV8A 1MP0A 3PLNA 2O3RA 4Z0TA 3WNVA 1FMCA 3BHMA 2EEZA 5GZ6A 4YA6A 2QRLA 3DAFA 1I32A 2GNAA 4YAGA 3F1LA 4EZBA 3LU1A 4C7KA 2HJRA 1WWKA 5AYVA 5COBA 3R0IA 4H15A 3ETDA 5F1KA 4TKLA 4BGVA 3RSHA 3VZQA 2OXIA 1ADGA 1M75A 3VAZA 1M6WA 1Q0HA 4RORA 5A02A 1I24A 1HXHA 4KTTE 2UDPA 2B35A 4NBWA 3WS7A 4FJ0A 2J5KA 1WNTA 4D43A 2VT2A 4J9VA 5GZ1A 4U5QA 2I76A 4KTVE 4YR9A 1X7HA 2R00A 4N7RA 3V5NA 2Y68A 3LYLA 1ML3A 2AQHA 4PRLA 3PRJA 4LMPA 3WGZA 3QLJA 4MVJD 1P31A 4GAEA 4R69A 1E3WB 4EGFA 4N5LA 3OJ0A 1BTOA 3KRTA 3UH1A 1GZ4A 3KO8A 5IDQA 2P91A 4CR6A 5IZ4A 4YB8A 4RCVA 3V1YA 3R1IA 1J5PA 1I36A 4TRMA 6ADHA 5BSEA 1WPQA 1YKFA 4JP2A 4CJXA 3D1LA 3ENNA 3QVXA 2EKPA 4IPTA 4XDZA 1LLCA 3LZ6A 4IUYA 1QYDA 2EKQA 5ADHA 4IJKA 1BDBA 3BTOA 1R66A 3L6OO 3ICPA 3M2TA 1GV1A 3MEQA 2AQIA 3ZH2A 4A10A 4R01A 1R4MA 2EWMA 1K89A 1KYQA 1DDOA 4CMKA 3TF5A 3Q1LA 2BF7A 4TVBA 5T6BA 4A73A 3RUEA 1CETA 3B1JA 5JMPA 2EW2A 2XXBA 4MVJH 1PJLA 1XDWA 4L4SA 1U7HA 1PR9A 1F8FA 1HF3A 3E48A 3U49A 2ZIZA 5I9NA 1V6AA 4XQGA 1U5AA 2YZ7A 2VYVA 4B79A 4DL9A 3HDJA 4FSHA 1QLHA 4I9UA 5JAQA 3L4BA 2QW8A 5JXWA 4W99A 4G81A 1PZEA 1S6YA 1LDEA 4ZQBA 2ZQYA 3MTGA 8LDHA 1U3VA 4NR0A 2DU8A 4DIOA 2VTDA 1B8PA 3ONFA 1EUDA 1XLTA 3R6DA 3K92A 1HSOA 1A27A 1LU9A 4MOWA 2NQTA 5IZCC 2YHIA 2CFCA 4IQGA 5CP8A 4CV2A 2IXAA 3OF2A 1ZMTA 2JKVA 1PJ4A 1PGNA 2O2YA 1Y5RA 3TWOA 4IIVA 1HYEA 4NJMB 2DVMA 2VZ9A 3ABIA 5EMHA 2X9VA 1RM3A 4YRBA 4L0QA 4WCFC 2Q1WA 3P19A 4TVOA 2AE1A 5F5NA 4PCVA 1R4MB 1SCUA 3AU8A 4CUJA 3GGGA 5ER9A 3E18A 5DP2A 3PQDA 3MOIA 3O9ZA 3ZWWA 4LN1A 4MPDA 1QYWA 4R4JA 4F3YA 1WMBA 3HNPA 3LVFO 3GGOA 4GKVA 3HFGA 4IY1A 1U8FO 1HDXA 5KJCA 1YBVA 3DMYA 5JMWA 2Q4EA 3ROMA 2YFQA 2Q49A 2J8ZA 4PVCA 1BHSA 3WJ7A 2OORA 3GNTA 1O89A 5CPBA
chains in the Genus database with same CATH superfamily
1J07A 1H5UA 4PRYA 5E3IA 3NO4A 5C80A 1AQUA 4Q18A 3GHHA 2H6EA 3WMEA 5A4AA 4P93A 4JT9A 5DGCA 1YA4A 4G09A 5EE0A 1FSPA 3QITA 2WJ4A 1SOVA 3JYPA 4O4IA 1G2PA 1N2CE 1F3LA 3WBKA 4F45A 3THOA 4TSRA 1CPYA 3L8FA 4HEA1 1XX6A 2NU9A 4D3YA 3NAMA 5LLDA 2YV5A 1Y4AE 1UJ6A 2NT3A 3W0LB 4XWYA 4LRQA 2V0GA 4DLRA 5A4FS 4AKIA 2R8RA 1X7WB 4OKIA 3K1TA 3PEVA 1FRZA 5A06A 2PGDA 3VU9B 1N3LA 2ZBUA 1XTTA 2D7JA 1HRDA 1EUQA 3OAAD 4B3HA 3EVTA 2ESRA 4W8GA 4JJEA 2QD4A 3K9GA 5CDSA 1Y80A 4FYXA 3DDCA 4J0IA 4RTQA 3DEYX 5FI3A 3Q10A 3CUTA 1XZJA 4L73A 5HCNA 1EXMA 1UP6A 4DBZA 4GMKA 3T4EA 1XWFA 2MDTA 3AG5A 3AHIA 3ROZA 4DPLA 1V0JA 2DGDA 2FPPA 2HNAA 5EMLA 5G1NA 1I94B 5TRTA 4QEDA 1ZH8A 4H1TA 2AOXA 1V7PC 2D1FA 2Q4DA 3T4PA 3SXPA 1UFQA 2WSIA 3DOJA 1MPXA 2X9LA 4PC1A 1A5ZA 1KNXA 3ZPXA 4A2CA 1O9BA 3LPNA 4OHWA 8ADHA 3S5UA 1N6IA 1UK7A 1UBLS 3HYCA 1GPDG 4UBOA 1LPBB 3UJ7A 2QI9F 3ORRA 4F7WA 4PN3A 5L53A 3QJGA 1ULHA 4CEHA 1PO7A 4EG4A 2BH2A 3IJEB 2WYWA 3G2OA 4D9JA 3X2FA 3CKYA 1GTJ1 3HXPA 4J03A 2QP3A 3HVKA 1JTEA 2R44A 2X4GA 5CNMA 5EPOA 2VQSA 5BMVF 4ZEOA 2FMFA 1QPZA 1ZVMA 1ZW1A 1GNVA 4IZ6A 3SMQA 2QRZA 2X86A 2AI2A 5LYJB 4UHHA 4BP9A 1GY8A 3GFBA 3A1DA 3C3BA 4QX6A 2ZUFA 1HNZB 2N46A 2H1FA 2ZWVA 4EX6A 1QYXA 2F59A 1V96A 2A1TR 4HY3A 3GFVA 1ABFA 4ZVUA 2PKCA 4L5YA 3PWTA 5FV7A 1QYRA 3K09A 1QG0A 3KB2A 3SF8B 2HAEA 3FWHA 3HJCA 3COSA 4DBLC 2HJGA 3T7RA 2I66A 4L5BA 5KTTA 2Z43A 3E3MA 4JP3A 1JN0A 3PLAE 2A9OA 2WQZA 3U9LA 3MWDA 1XR3A 3L1JA 5P8WA 2HJHA 3AKEA 4GU5A 2ZUEA 2Z30A 1E3DA 1ESNA 3V8NA 2CXUA 3VO1A 5KU7A 1OSNA 4LTMA 1YHZA 4BMZA 1EBFA 1F9AA 4JKOA 4H7EA 4FEEA 4BNXA 3CRW1 2C5AA 3RU7A 1W4LA 3WZLA 3C7AA 2C29D 3ETHA 3VZBA 3W9SA 2C4NA 4V2IA 1M5RA 1ZDMA 4LWZA 2BFDB 4URUR 1V1MA 4YJFB 1L7QA 1Q1GA 2VAXA 4RTPA 4ROTA 3SZ3A 3AY7A 1EFAA 1CYDA 4O25A 3QBDA 3IQWA 3NCTA 1WDWB 1WJGA 3CZPA 4OJMX 4RFVA 5FWAA 1BSVA 3FZYA 1IBCA 1X1CA 5ALXA 2FQXA 3JVDA 4NF2A 2WIJA 4QXPA 1O94D 4RH3A 4C7BA 2W2NA 4YCJA 1MGOA 2MSNA 4IINA 3ZCXA 3PT9A 4I1IA 2VTEA 4GHWA 1KQGA 1R6UA 2HC9A 2VJMB 3SJUA 1NFFA 2DY1A 4MWOA 1ILWA 2ZYGA 3VOSA 3THSA 3Q7EA 3I01A 2ZT6A 2JIZA 2JCVA 7REQB 1OHHD 2PKYX 5KQLA 1Q3TA 9MHTA 1QGAA 1X1EA 4LTDA 4C30A 4L4YA 1UFRA 4FJ2A 3RI3A 1GPYA 3CV3A 4HZGA 5TGZA 4B6OA 4G4IA 1I6LA 2WHYA 3LKBA 1Z06A 4JYBA 4NAUA 4WXHA 5REQB 3AEKB 5D3QA 3SGLA 2FQYA 1KEEA 2CJYA 3DOOA 3CURA 2PKRA 3SHTA 1OFUA 4OM8A 1SAYA 3TMAA 4MDHA 4FWIB 1SG6A 1QPGA 2J07A 3D1VA 4H6XA 4ZCIA 1C8VB 2B6HA 4RPIA 1CP3A 2X22A 2WUVA 3OKPA 1KYIA 2F1KA 4MGZR 1X86B 2D1YA 2OCAA 3QF4A 2PFGA 4MV0A 4WCVA 2C99A 1KS9A 1TC1A 2BTQA 3JR3A 4UM9B 2B8TA 1RE1A 1ZO8A 1GSIA 3O5AA 2HA5A 4MB0A 2Y1GA 3UOGA 3THYA 4H7FA 4ATNA 1XUOA 2NGRA 2AXQA 4LZJA 3W2GA 1ZCZA 1T1GA 1X3LA 4BNHA 1C3JA 2FSUA 2OXFA 4B8ZA 3HWSA 1CUAA 2BMJA 5DMXA 2IYRA 3KKPA 4ZICA 2IYTA 1K7XB 1ZJJA 1YNSA 4PLHA 1TI7A 2JPDA 3I9MA 5BP7A 2R8XA 1YULA 1E1KA 1CS0A 4MP3A 3UKDA 1JQKA 5K8UA 4YMWA 3LW8A 2NUPB 3UA3A 3CUSA 4HS4A 4E5PA 1QH8B 2BCEA 2D3WA 3LX4A 1AS3A 5AW0A 4NS4A 4Q66C 4ZMRA 1JDUA 3KAJA 4C2TA 3AR6A 1D03A 1F4LA 2WJWA 1BVRA 3E70C 4GP7A 1UBOS 1N7JA 4MO9A 4YAOA 1TQ8A 1JG4A 4WA7A 3AW9A 3HV2A 4QNRA 3WZ2A 2QY6A 2O2GA 4AJ2A 2VJLA 2OCYC 1K68A 4WLVA 2YN2A 5BUSA 2LIPA 4DEYA 3U16A 2OKCA 1YH3A 3IB6A 2Z3ZA 4U1RA 1OIWA 4GI3A 2XXAB 4QJ3A 1O0CA 5DBGA 2WD9A 4RVNA 4ZZ1A 5I7HA 1HX7A 3CS3A 3RRXA 4D02A 4LCJA 4DA8A 2X5NA 5EEGA 5KC9A 2WWTA 1OU4A 3WSVA 3PQ2A 2PX2A 1FLNA 1UFKA 5JNVA 1AZSC 2PWPA 1P9LA 1F5NA 3CNQS 2VXOA 4YO8A 4ZREA 1K5DA 1QS0A 3G3EA 3PWZA 3C7DB 3FZGA 3ROQA 1SU8A 2HEGA 1WBJB 2HHCA 2W2TA 2J0UB 1EUCB 3V7YA 5CYGA 3E8SA 3DVAA 3IOEA 3FVTA 4RABA 3AHHA 2AN1A 1KMHA 4LYEA 1W1UA 2QMYA 4IFTA 2OHFA 4U8HA 4NK4A 3H2JA 1OHHA 2D1SA 2OO7A 5LU9A 3EDOA 4HRVA 1XEWY 4OAOA 5HA5A 1Z5ZA 1ZIPA 1GDHA 4MSUA 4DZTA 1A9ZA 1I4TD 3D3JA 4DA9A 4NU5A 4GM4A 1NHGA 4NDZA 1Z4NA 2WT4A 1M5TA 2HPAA 5TEVA 2EFDB 2RIRA 4D7AA 4RETA 1H2EA 1IE3A 3CR7A 4RXUA 5A03A 4DW8A 1P73A 1XKXA 3DXZA 2C4KA 2CJXA 4TSFA 3ZE7A 4B3IA 2D4AA 5LQAA 2WLTA 2EW1A 4J0JA 1PLLA 4URZR 1ENPA 3INGA 1Z4LA 2H06A 3GEHA 1V9SA 4XGIA 1AMUA 2HRQA 4BBAA 1FYXA 5KBYA 1I7LA 3G17A 4UCQA 4N6OA 1CQJB 4L9WA 4QICA 3VSEA 4TT8A 3EGWA 4FNAA 2JS7A 3KC2A 4AO6A 3V4PB 5KINB 3LQ2A 2J1LA 4MCHA 4NECA 4GMFA 2R4QA 1ML4A 2CHQA 3TPCA 4JC0A 4ZAYA 1DO2A 2NU7B 4MW9A 3ZK8A 4CKBA 5C4GB 4DR1B 3F6CA 2VK1A 5L51A 3CUUA 1OFUX 1SCIA 2QMUA 2X23A 3UJ3X 4FYKA 4B6QA 4ZI7A 2QN9A 4UTXA 4O0LA 4W1PA 3U7JA 2I3BA 5K01A 3AL0C 2Z58A 2O48X 3CLVA 5J2UB 3TOZA 3B9QA 1ONBA 2QL5A 4CODB 1D6SA 3N74A 4PANA 2DPHA 2REQA 4PTLA 3IUSA 2QX9A 2FWMX 4HB4A 1HE1C 4RAQA 1MEOA 3Q3CA 4UFNA 1LXCA 3WV5A 1VDZA 2KHZA 2Y1CA 4OBXA 4X85A 1KI6A 1LTHR 5J43A 5TE9A 1I5RA 3FZEA 1K7CA 3TRDA 1VGVA 4GR5A 3U4MA 2P4UA 2TMDA 4ISCA 4FFRA 5BW5A 1XRMA 1EQ2A 2VDNB 1MGPA 1MDFA 1WF3A 2CUKA 3NBZC 4EW2A 1PN3A 3L43A 1G21E 2EJCA 2INGX 4D9MA 2H2FA 5EJAA 3NGLA 3QFTA 3UT5A 4AJ4A 2Z57A 1FRNA 1H2YA 3M6LA 1A9QA 3G9ZA 1VPVA 3LFTA 2Y1OA 4LXYA 4TMFA 3UJPA 1MQ8B 1FS5A 1E1DA 3M83A 1MD9A 3I2FA 5LWQA 3JQAB 2Y9PB 4QYIA 5AKKA 2I7VA 4HNAA 1M10A 2ZI4A 3I92A 3LVBA 1VJ1A 2NACA 1ORRA 3HUUA 4RJKA 4CLOA 1Z83A 4M0EA 3LDHA 5BMVB 3FOEC 5CEEA 2BMFA 5H1YA 4CTJA 3TZLA 4B3BA 4HMQA 2C4VA 4EQ6B 3DL4A 3NHAA 1YZKA 1PWEA 2JGKA 3EZ9A 3HS3A 3IQXA 4OQPA 3DBLA 3TQCA 1B8NA 4B1FA 1U1IA 4NEQA 1Y33E 1W0CA 1ZEMA 4I50A 4NFHA 1XZMA 1NP6A 1AKUA 4ML3A 5HRCA 3K70B 1M2FA 1U04A 1U9JA 3MZ0A 1Z6PA 1Y7TA 7REQA 1C1DB 1YDWA 3WRYC 2YWXA 4CTNA 5DN6D 3LCMA 2C04A 1UM9B 2AJDA 5ALGA 4MRAA 4GBED 1ZK2A 4HGRA 4B2YA 1NVDA 3CUYA 4EW1A 3WJ1A 4DCTA 1X74A 4MW0A 3WK7A 1Z73A 1PCXA 2F1IA 5EKSA 2J6BA 3GWGA 1ZI6A 4IIJF 3FHCB 1SKYB 3LDAA 4MLZA 4UJ5A 4KPFC 5I7RA 1ZONA 4R1TA 2B5WA 1YRWA 3HJBA 2Y1DA 3BK7A 1YC5A 3WLEA 2AD5A 3HQ4O 3PBKA 4KLZA 4WTOA 2OG2A 1FYDA 3V80A 3GH1A 5I5GA 5FLXA 1MW8X 1NMXA 4LVUA 5DYWA 2NYRA 2C2YA 5E8RA 2PLAA 3U39A 1WW2A 4BTLA 1U2EA 3KOOA 3KZXA 4N9WA 2SKEA 5D8DA 1DC3A 3GZJA 4R8VA 3HVRA 3PUXA 1G5QA 4OQMA 4YONB 3UAZA 1TF2A 3QFCA 4ALLA 4FDLA 4HWRA 2CDRA 5JJIA 4PVDA 3L8ZA 2B2XA 1ZUNA 2R8YA 1W47A 3OD5A 1PVOA 3MBKA 4C0WA 5AVUA 5F7JA 1F0YA 3C87A 3MPUA 1QCZA 4H3HB 5J5CA 3KEQA 3UCFA 1IWOA 2KW5A 3CJTA 4CMAA 1XYYA 1G7SA 5KX5F 1QFZA 4PGGA 3KJEA 3DMRA 3BMOA 1GFZA 3RTEA 4BGDA 5EKXA 1G4HA 4RHXA 1JKJA 2E21A 1KVUA 5K3FA 1LRKA 4I5FA 2VEOA 3CWQA 4G0YA 5J5VA 3UK2A 2I6QA 5KPDA 3F97A 2E4WA 1PR1A 2YQ4A 1TCAA 1GG2A 4LRTB 1U11A 1U65A 3RSSA 5AW1A 1VJTA 1WEKA 5JCOC 4Q4JA 1N25A 1NP3A 1YR7A 1GKKA 3DULA 1BGWA 1U4SA 4WZ6A 2FE1A 4RS3A 2Q7OE 1Z5NA 5BWLA 5JJCA 4NOKA 4DLBA 3R41A 3C98A 1L1EA 4ZCQA 2PEYA 1W34A 3LIPA 3WLJA 3WMWA 1NI4B 1YVRA 1LI7A 1L7OA 4IKOA 4KLNA 3ZXIA 1O9GA 2P2YA 1KA9H 2Q9UA 3KR9A 3R3HA 2FMUA 4I1OA 1X8LA 3MUNA 1H6DA 2QE6A 3EFEA 1VP3A 2ZIUB 3LYHA 4AZ3A 4HQOA 1OAAA 1KOJA 5BVGB 4GLLA 1NBAA 3F5SA 1GTMA 1L5RA 1ISFA 2Q2OA 5FUYA 5KQSA 2WE8A 1NKVA 1Y37A 2ZB4A 1LF5A 3M33A 4PLPA 1KO5A 2EEPA 4Q05A 4RK5A 4BX3A 2C8KA 1U0RA 3NVKI 1QE3A 5KHAA 1T2AA 2A88A 3OEEA 4D5EA 4OHYA 4UHBA 1TM5E 2ECFA 3DZCA 2R5NA 5TMDA 3LBIA 2DERA 1G60A 3U44B 2JGJA 3VV3A 1Q50A 1WKBA 1FQJA 2ZITA 5CHYA 1F2VA 3C45A 4EG8A 3I4CA 5D86A 1SUEA 1TZ2A 1U9IC 1YS2X 4TTTS 3T5TA 3W8FA 2TS1A 2ZI9A 1JBKA 3JD0A 1SQGA 2HK9A 4AJEA 1TJ3A 4QFBA 1N4DA 1JQ3A 1SG9A 2FW1A 2BD0A 3EF3A 4LHXA 4WACA 2WU4A 1X7GA 5DSXA 4BFLA 5GV8A 4DV1B 1QR2A 3M1IA 2OAEA 2WSYB 1J0CA 4N40A 4RELA 5B58T 2CCKA 2O8FB 1OGIA 1G3UA 1XNHA 2QTMA 1H2FA 3W7AA 4O3FA 5GY7A 1SFRA 4N54A 4X5OA 1HGXA 3BWEA 3SX2A 3RYCA 2QE7D 1JQDA 1LZLA 2OCPA 2RBGA 3PJEA 3UG7A 4FOOA 2M2IA 3OD1A 4U8GA 3RE1A 3PNVA 2C97A 3H5TA 5TARA 1KY4A 2FRVA 2G36A 4NJEA 4PPGA 2FSIA 4MKRA 3DEHA 5EIBC 2O4CA 3ER9A 4HO1X 5AVKA 2IZ1A 3WL7A 1KEPA 3N28A 3VR5H 1DCFA 2P68A 1H9CA 1F12A 4US0R 4V1CI 4M0FA 1GT6A 1P29A 1IXRC 5LL6P 2NNLD 2OORC 4K87A 4MAMA 2VT3A 1OLOA 3CSSA 3K30A 4J0QA 5B57C 3IT0A 3J80A 1HNXB 5KTKA 1NDQA 2OD7A 3B5IA 4OBBA 1QR6A 5F9MA 4E03A 3E5NA 3R6GA 1TTTA 2QM3A 3FYHA 3H3FA 4P6VF 4BAGA 2BGJA 3HHEA 3JVUA 2E18A 4EG5A 1GG9A 3OCYA 3VNUA 3P0HA 3N1UA 2H7XA 4DAOA 1ZPDA 1O58A 3HB7A 3IILA 3RBAA 3WIBA 2DBZA 3L0IB 3KLMX 4PLYA 4LY9A 4LHEA 1N0WA 3KJNA 1BVHA 2GPJA 1Q5PA 2I8AA 2CNOA 3EIHA 1OF1A 2ZT5A 5TVKA 3WGIA 2YHIB 2EZTA 1NUUA 3N07A 4R1QA 1VPLA 3FTCA 1N2BA 3SQNA 4BO5A 1N1DA 3V6LA 1NHWA 1Z36A 2Q5OA 3SSMA 3WNQA 4WEOA 4CKEB 3A1VA 4AG5A 4OXXA 3VI3B 1NNSA 4LUCA 3H11B 1ZLYA 4A9AA 1IAVA 1RWNA 3A1NA 5TMEA 1GGJA 1ZIYA 2FPRA 4GD3Q 1T8YA 1WSWA 1NQUA 2WYOA 4G0PA 4KZPA 3FSGA 3O2QB 4OJTA 3SVZA 1EXNA 1YA6A 1L5GB 3RRZA 4BLQA 3LRPA 2HD4A 1K27A 3FFBA 2BJHA 3HLTA 4HKTA 3ADBA 2A1UB 3CNBA 5CJJA 4IFEA 3W6UA 1MABA 2XVXA 3OFSA 3PL1A 2BLNA 4KK4A 5JI2E 1XJ0A 6ABPA 2B7CA 1PNTA 5JG7A 2FZEA 3K9BA 1KZ6A 4CL8A 1I3MA 1XI2A 2FPIB 3LCRA 4HLDA 1TUEA 4A8JC 2VP5A 3G13A 3HFSA 3KPYA 4AIIA 1XZBA 1H6CA 2QTNA 2G6TA 5HFNA 3TLGA 1PJRA 2VZ0A 2ZWOA 1VYTA 4JL8A 4LI3X 4MQEB 1A4RA 3PFCA 4R31A 4OLBA 1Y98A 2H8KA 2BGMA 4G2NA 4PCUA 5HF6A 4BVAA 2E3JA 2FWBA 4O4IF 4Q16A 1FYWA 3L7DA 4XOUA 2A1IA 4FYJA 1AIPA 5H7XA 4YIHA 5C5DA 1Z18A 3H5WA 5JOQA 1Q0TA 2GMWA 2J45A 4UQOA 3QJ5A 1YL6A 3N6RA 4WWHA 3D59A 1RQPA 1FP7A 1X9GA 3D6VA 3DDUA 3LX8A 1DARA 2EGUA 4Q37A 1RVV1 2BGUA 2X13A 3TW4A 3URMA 1JVBA 4H3KB 5KKNB 1KKMA 1XMOB 1A8SA 1C14A 2PNJA 5ALKA 2I2BA 2WMDA 2HHAA 3NEYA 4Z6KA 3L0YA 2VJAA 1XMIA 5JPCA 1EWVA 2BISA 4FJ1A 4CCSA 4JS0A 2R47A 5AI6A 1ZRMA 2H16A 4M6WA 4M1QA 1EB9A 3I76A 1SBCA 2XDYA 1N9KA 1AXRA 4OYLA 1Q7BA 1BNCA 1JIIA 4IMIB 2PS0A 4M9CA 1QFJA 1WB6A 3HP4A 2CL7X 1RQLA 4K28A 2G9RA 5CYPA 4IFBA 4KO2S 4DG5A 2CLMB 3AY3A 1HLFA 1VJCA 1TZKA 4EI2A 1UXJA 4NU0A 5JNTA 3L8GA 2IUYA 5JCJD 5KEIA 3PQ3A 2I6UA 4GOMD 4LX8A 1G63A 2ON6A 3GHYA 4QYTA 3BERA 3V33A 5JZ9A 2EHDA 1U2GA 4O2BF 3NBAA 2PLFA 4KACA 2QTVA 4M8SA 5DU2A 2X3YA 5JD3A 5LXTA 2ISSD 3GWZA 3HL0A 1IRXA 4BLPA 3VVBA 1VG8A 3E5MA 3QFSA 3HFRA 1Y4DE 3TM4A 5CA1F 1P0MA 1P2BA 3JW8A 1M8PA 1UBCA 4FCWA 1VCOA 2ATVA 4ZV4A 1U0GA 1P19A 2X8LA 1ZA1A 3JRXA 4G5GA 3R8XA 4Z0PA 3HR7A 5DWQA 2P9ZA 1ZC4A 1IBSA 2AVNA 2NOAA 1PV1A 1NXTA 1QTNA 1ODIA 1WXHA 1ZNQO 3LF2A 4NZ9A 5CHEA 3VR4D 3LECA 5JTUA 1QHGA 3BA6A 3EZ2A 4UNNA 1BX1A 5EUQB 1NVKA 1Z2EA 3QQ5A 4MA4A 3IIJA 4XA8A 3TKLA 3CE9A 2I4NA 4O2AF 4JXJA 1GPJA 2QGFA 1YCHA 2PRSA 2QPAA 2ZPTX 2RC5A 1GGEA 3HY4A 1MJHA 4QODA 2XQIA 3HMQA 4H1VA 2IK8A 4IL5A 5FUXA 2DFNA 1U8AA 4E4RA 1R2QA 3H2IA 3LSTA 2IXBA 4MHOA 4I5EA 1QMGA 2JA2A 1W4CA 2J3IA 1YQEA 2XMSA 5BN1A 4BNLA 4LHWA 4UUBA 2HGZA 5LB2A 4EBBA 5BSVA 4RQBA 4MS4A 4X7BA 3OIDA 4L76A 1BXRA 2FN3A 4JAVC 3D4NA 5A5EA 1FDOA 3BH6A 2GYYA 2HU8A 3CNLA 3EPJA 1UADA 2FJPA 5EJ2A 5EHQA 3OEYA 2ZU0C 5ULLA 3B1ZA 1PAUA 3JQBC 5BVHB 5KQPA 2JIZD 2QPTA 4JUAA 4KE6A 5JNSA 3U37A 1JS1X 3ABRB 6GPBA 1T3ZA 2BELA 3C6QA 3AUXA 3C3EA 1EP3B 4O2AA 4X1YA 4M9UA 3UUGA 3UUEA 1F8XA 4EG1A 1M6YA 1Y8RB 5E6UB 4F56A 4X6XA 4QBGB 4A26A 1YE5A 3U09A 3DZ8A 3K5WA 5L8VA 5GM2A 2O20A 2QV7A 3G5MA 2HA3A 1FUKA 1E9EA 1E5VA 2YXEA 3RHTA 3OE4A 1C81A 1M7BA 1DX6A 1Z07A 2X2OA 3K0HA 4F96A 2JJ2D 5AKYA 2BDEA 2WQ7A 4IIYA 2B4RO 2JGNA 4F3NA 3B1KA 1E79A 1GAQA 3CONA 2YJ6A 2P5YA 4ZO4A 2H31A 2OAGA 2ODWA 4ZQGA 2CDBA 4AUEA 5BN5B 1DIRA 2H4YA 2VUSA 3IVGA 4N18A 3LVRE 3ZQ6A 4H1UA 5DHQA 5LA6F 2BT4A 4B3DA 4E6PA 4EB6A 4L4XA 3ZHBA 4N5HX 2G77B 2FFBA 5A1JA 1Z63A 4DUYB 1GQRA 3MCZA 4EHNA 2XMGA 4GOJA 1NX9A 2PGJA 3IPYA 4OL0A 4DVJA 1PJQA 2IF0A 4MCIA 4ZOLA 1IOVA 1K2VN 2V65A 1C50A 3DP7A 3MRSA 3QM1A 3ZU6A 4JLBA 3ZWMA 1P6UA 1C5KA 3AERB 3OPYA 3UK1A 1NJ1A 2O57A 3ZXXA 2I03A 1SC6A 4TUYB 5FBLB 3GELA 1KP3A 2KLBA 3R9XA 1RD4A 3E22A 3GJ4A 1FPMA 2C5EA 3BA1A 1KPIA 3B6EA 4CM5A 1RC0A 2Y9MB 4BGUA 4J07A 2NM0A 2AOWA 1I3NA 4J16A 1VRWA 2NSDA 2GHTA 3BWVA 4K88A 3JTEA 4I50B 4XEHA 4Y0NA 3VOBA 1TYCA 4MVCA 3RIXA 1Y81A 5FT9A 3EVFA 5I9LA 1PJ2A 4HHEA 1JB9A 1J56A 1VL1A 4N8SA 3TLCA 3UMBA 1E63A 3OHMA 2PM8A 3DTNA 2BYTA 3GLVA 1Z4OA 3AH8A 4OVKA 1QP4A 4GWLA 4MVJG 3LUJA 1D0SA 2Q41A 5GONF 4KIJA 4DV2B 3FKQA 4DA7A 1Q2XA 1BA2A 1YDHA 2GVZC 1SCUB 1M6EX 5KYTA 1EDEA 3FMGA 4EHIA 1DL5A 4RMNA 1PUJA 4TYQA 1P9WA 4BXOA 5K9ZA 4X92A 4RJTA 4PG5A 2XECA 2EJBA 1GGKA 3H1AA 1NQTA 4XUCA 4CETA 4KW7A 4RZUA 1BVYF 4H35A 3GP8A 2JFGA 1JHQA 4DLUA 4YRMA 2ZDQA 4MTLA 4ZZ2A 3CUVA 3DD5A 2XUPA 1JJFA 1KJ8A 2HBRA 3SK0A 3WBBA 1E7MA 3KZCA 2W58A 4Q1CA 4B3JA 1RYZA 5CM8B 1YE8A 4MINA 2O52A 1XRPA 3I72A 5LXTB 4EDFA 4ND1A 3U17A 3DOUA 3MTAA 1XMPA 5DE3A 3OKAA 3ZJVA 4IHQA 1NURA 3DWFA 3QJYA 3EG9B 3KLPX 1J21A 3IR5A 1HSZA 1PT8A 4LZOA 3IMCA 3CNNA 1PG0A 2ZSKA 2MU1A 3NJ8A 4KR9A 2DHCA 4LQ4A 2IEIA 2HMYB 3HWWA 2UYYA 1NM5A 4FGKA 2Q3EA 4LJ7A 4XPIB 4NOMA 4UCFA 1UKZA 2YWGA 3VO9A 1F06A 1R5JA 2FEOA 2AFHB 4X3OA 4EYOA 5KJFA 2D62A 2OESA 4II3A 3ACCA 1XYGA 4QGFA 4NCKA 5B1DA 1RFLA 3ELWA 3PNYA 2HDHA 1BEUB 1B00A 3FW1A 1GNLA 3CJQA 3LRTA 4YRAA 1ZHFA 1WXXA 3B36A 1DKMA 3FYTA 1RKBA 4N3BA 1UINA 2YW2A 4BLOA 2R8EA 1IY2A 4N03A 3DEFA 3VHLB 3I3OA 2YJZA 5KAPA 5IYZB 4M1MA 1R0SA 1S7CA 4CLEA 2JZOA 3OY7A 1MC1A 2WUWE 4F92B 3OOYA 4KODA 3H2YA 2Q2VA 4ZO8A 3L9XA 2IQ5A 1ZRNA 3W34A 3NKVA 1YR9A 2ZREA 5B4UA 4CF7A 1LW6E 2OMEA 3DBRB 3R3WA 3EZYA 4JVMA 4XWGA 4YCNA 4AN1A 1RPNA 4NESA 3JY6A 2GGSA 4QFMA 2GVNA 3GJQA 1JMKC 3RIYA 5DGIA 3JPWA 1JR3E 4EUNA 1G3IA 1VI6A 3MOSA 2QYTA 4QUAA 4BC0A 3A2LA 1NKTA 1DSSG 5EMMA 3GPLA 4HPWA 4DSAA 2KQUA 4PYMA 4NKRA 4BNDB 1X8KA 1PQPA 4GXTA 4XWWA 4PQYA 1J0DA 1YVDA 2AMFA 1TMKA 3H9UA 4MKZA 4UEOA 3EY9A 2BKAA 4XX0B 2JIRA 3UJBA 5F4BA 4FYYA 2QZ4A 3NYRA 3E2IA 1Y3AA 1VPTA 1YRQA 2I80A 3OJFA 4OP2A 5ESDA 1CP2A 4LMAA 1H1LA 1P74A 1E2PA 1JDPA 1JQEA 2DPMA 2H5IA 2C3OA 1ZRSA 2R00C 3G6WA 3NFYA 4IS3A 4KO3S 3TIXB 4WADA 3I9KA 2ZAIA 4NVRA 3SBXA 1E4EA 1YDEA 4QVIA 2HUPA 3D3EA 4CM4B 1CZOA 5EOVA 3K1JA 3N6XA 1GCIA 2O8BA 1OI7A 3LBNA 4X24A 5HJEA 1CUVA 2QJFA 4GPD1 3FBGA 1G8SA 4IGIA 4R8KA 3R7WA 3TLKA 5AVWA 4RTMA 4FQ7A 3VXKA 1A7UA 1YVUA 3I1IA 2MJLA 1QYIA 3RW9A 2JLWA 3CRQA 3TUJC 4BC1A 1ZSNA 3RIHA 3RJ9A 2NMVA 1ZS9A 4CKZA 1Z34A 1A9YA 3I1FA 3LHIA 2A5LA 2HBZA 3NIWA 4ZCTA 2RE8A 1PK7A 2HWUA 2BCJQ 4E7OA 1YQUA 1Q0LA 1YACA 2C54A 3KAPA 3SS8A 5AQ1A 5HKOA 3MJEA 2IHZA 5DTRA 5ITWA 2R6CA 2W8BA 4DQXA 1IOZA 4JJZA 4A4DA 3AVPA 1E3JA 2FQWA 2XYVA 4AYTA 3MNFA 1FFDA 4DBVO 1MQAA 3WKAA 2GNOA 3IHKA 3V4SA 4Z1MD 5B2EA 1F8YA 2NUTB 5HQ3A 5LR6A 1H05A 5LUAA 1TYDE 2FX5A 4DSZA 3RKSA 2GXSA 1H9AA 1SXJE 3GNQA 2B37A 3OPYI 4TWIA 5DEIA 3FGZA 2B4QA 1UDAA 2ATIA 4OIMA 2JAOA 2GEJA 1KTIA 2BWJA 4DUGD 4QATA 3M6IA 1F4VA 3DHVA 2BFCA 2ZE7A 2W6JD 3CZCA 4JC4A 4M9SA 4EKYA 5C18A 1EP2B 3HJUA 4YFVA 4ALJA 4DLSA 1CLUA 4MH0R 5L7WA 2PUBA 5FA6A 1Z3CA 3C97A 2CNWD 4C2AA 1QIEA 5KJ1A 4MQFB 1T24A 1PK8A 1Z7GA 2H5LA 4KXVA 3GCZA 1UWVA 4K1LA 3U7QB 1JHAA 3WAKA 1XROA 1U6KA 2YS7A 4JJKA 4MGIR 4EP1A 4BVHA 2JLQA 3L1HA 4JLUA 1AXEA 3AM4A 3JQFA 2G76A 1JU3A 1XQYA 5IHPA 3I61A 5AXBA 2FU5C 3OE7A 3IS3A 1AUXA 1O97D 2GTIA 3E03A 3TD6A 5I7OA 2BE7A 4H6WA 1GPMA 4C4PA 3PC2A 2VYND 2PZKA 3FMPB 5L7YA 2G63A 1M2WA 1DOZA 1FNNA 1JSCA 1PHPA 3L8DA 1SELA 2Z1DA 3QVTA 3LQRA 3EB9A 1I4EB 1W5BA 4ZVSA 3JCZA 3NOXA 2AOUA 4LQDA 3RS8A 3UQYS 4AM8A 4CE6A 2GJSA 4Q4HA 2PUTA 2YDXA 3NHSA 5EAIA 4EOGA 3Q3IA 5EP3A 1PW5A 1NYQA 4M1WA 4YRPA 3UTCA 3B6ZA 5JBIA 4CNQA 1X1SA 3IV9A 3WIEA 1GG5A 2AZDA 1T5DX 3IB3A 3VFDA 1UJCA 2P9YA 1I01A 2W2LD 2PSJA 3U48A 1OTXA 2OLJA 1PZXA 1QG2A 1U2TA 4GXRA 1VG0B 4KRYA 3W5AA 3UXYA 5IBRA 2E89A 5BPHA 4KHPB 3NBUA 5SZJA 4B48A 1CRWG 4B4VA 5JAPA 1QAMA 4OJQA 1ZFNA 2VHEA 4Q3KA 5DF1A 5IVIA 3FOFC 3LRXA 2DXIA 2O0HA 4LTNA 1EA5A 1RSZA 4FILA 1C4WA 4NJMA 4B7CA 2Z2XA 5FTMA 2VRCD 5BWMA 7AT1A 5I6DA 3K0KA 3U81A 1CVIA 4MUKA 1SPXA 2VF4X 1P9RA 4HX2A 3IAHA 1EU1A 4CCWA 1UKCA 3K0EA 1L7NA 4GOLD 1Z13A 1KVRA 1LDMA 1Z74A 2I67A 4RJJA 3KJGA 4YASA 1QAOA 1C41A 3DE3X 1NJ6A 3DM9B 4MUBA 3EARA 1LLQA 2D74A 4N7BA 1DINA 1Q3HA 4RA9B 4NYMQ 5GOTA 1PSWA 4ZYWA 5ITSA 4MS1A 3RG8A 4ZYYA 5BXYA 3RVOA 3PCRB 3VA7A 4EI9A 3H8WA 3VR4A 3WK4A 2XUQA 4KMRA 4BLRA 4QQRA 4MUGA 3P2MA 3TIIA 2JGEA 2C2OA 3Q1KA 1HT0A 1HDRA 4YDRA 1ZCFA 4G1EB 2GLXA 1XZDA 2C03A 4HJXA 4Z1MA 5AVJA 1FUEA 1AMNA 1N7HA 3PC4A 2BFEB 2I6SA 3WP1B 3RYHB 8ATCA 4FCTA 2J0SA 1NYTA 2WP8J 4XUGB 4BEWA 3MJ4A 1PDOA 4LWQA 4NARA 4RHCA 3WGLA 1M2OA 4DR5B 3K16A 1DWPA 4TTQA 1J90A 1JLHA 1Z5PA 4ZA2A 2A84A 2RG1A 3GJYA 5FBKA 4BQIA 1M1YE 1APBA 3EN0A 4PINA 1RADA 1GKLA 2R6ZA 4D81A 5BV2P 1RAAA 4YNBA 2CHUA 5E6SA 4M7PA 4NE7A 3LAWA 1E5XA 3DBHB 5ALFA 4B75A 1QIKA 1U9IA 3QVWA 1YQWA 2O8BB 4J6EA 3UC5A 4YX9A 2C5FA 3OHSX 1R0YA 3DMTA 1I2ZA 4OQXA 1M1ZA 4RKFA 4DS3A 1E6KA 1TL7C 4DQDA 4ZI7F 5IC4A 4ZHQB 1PJSA 1GDTA 4ND4A 4NLLA 4PX2A 4OB7A 4D25A 2PSHA 1G5RA 2G1AA 3SNHA 5B7NA 2PAAA 1CDOA 1SIWA 4N6NA 5EC8A 5JPDA 5KSZA 4EARA 4ER5A 3TTYA 1Q0RA 5EUMA 1KO4A 3MB8A 3PJFA 5FWXA 4YR7A 1UH5A 1XCBA 4N01A 2EATA 4WFQA 3CB4A 2W8ZA 3P2YA 4IICA 4DZRA 3HN7A 3K20A 3FBWA 4IJMA 4A8HA 2UYOA 4HGZA 3GCXA 1GN8A 1QHYA 2OYSA 4RHYA 2ZUUA 1D5CA 2G1JA 2WNHA 2IGBA 3KZKA 1GIAA 1QOQB 1WU7A 2TMKA 1ZW6A 2IHTA 5HF9A 5JHHB 1GZ3A 4XLLA 1P60A 2VWQA 2YUTA 1Q0UA 4CRWB 3LGAA 4NCIA 2WAAA 3W2TA 1FB5A 1L7MA 2YFKA 3W78A 1QQBA 3MHTA 1GYQA 1YL7A 5FB3A 4YLGA 3RRYA 3COJA 2FK8A 5HFJA 4FGSA 3EQ9A 1I6MA 1IMJA 2QN3A 3T7EA 4ZYVA 2BTEA 1PX0A 1ZUWA 2X5JO 2WT9A 1T0IA 4HC4A 1KEVA 2OFOA 3DTVD 3ECAA 4LEIA 2MIIA 5EJ7A 4PAOA 4IVPA 3PTZA 1QMPA 1YR6A 2H48A 3HR4A 4JR1A 2UYCA 2JIPA 2YQZA 4KUHA 2IU3A 3QKRA 2X8BA 3ET5A 1NQAO 2A9FA 3K05A 4YWHA 1QE0A 1QO0D 5IARA 4CT4B 2UZ1B 2XGSA 3DLCA 3KFXA 4CNBA 1NNUA 2Q3CA 1VZ2A 5I8PA 4D0RA 2JZCA 3B52X 3FDIA 2ZW9A 4WI1A 3IL2A 1Y7IA 2VVTA 5CXUA 1LI4A 5FWDA 4BECA 2FDCA 3MS2A 3V9AA 4FMDF 1OBHA 2BZ1A 2FI1A 4TUYF 4XYEA 3DYVA 4WL0A 3VJLA 3I8SA 3D5TA 1HE4A 1QIJA 3O8BA 1IONA 1H23A 5BQXA 2RHJA 4URFA 4C5AA 3TDKA 2AMLA 4AF7A 1XZAA 3BIWA 4K6HA 1GAXA 3ET4A 1VPDA 2CMHA 4INZA 4W82A 421PA 1XPOA 3ZJYA 1GUAA 1EH5A 4YN3A 1QHSA 3NH9A 4RL4A 3PDHA 1UKAA 3LHSA 2FN9A 3I9NA 2A9PA 2VDRB 3H86A 3H6KA 4HFJA 5U1PA 3ZVRA 4BO6A 3LXMA 4LDZA 3DMPA 4PSAA 4WKOA 4TV9F 5B1HA 4UASA 3H13A 1AQYA 4LYHA 4NAVA 4J1TA 1LTKA 4DDVA 2O1XA 1PW7A 1C7RA 1RJDA 1EUDB 2REXB 2Y1LA 2FHSA 2JIDA 3FE2A 5JIBA 3JATB 1GPNA 2YHUA 2IL1A 1JEDA 1V39A 3C7KA 2GXQA 3CA8A 1JFVA 3D4LA 2QUZA 1RWKA 1LI5A 2EP5A 1DPFA 1M9NA 2PMWB 3TNDA 2OM2A 4I46A 2I33A 4ZIRB 4KR7A 1XFDA 3LT1A 4R7GA 4M46A 3RJZA 3GJ8A 1ZN2A 4CDMA 4W7HA 4YAWA 2LCFA 2OAQ1 5IFKA 3V8QA 4TTAA 2IF2A 1KDVA 2ADMA 4B5LA 4RGBA 3X43A 4CTKA 1XC7A 3QOFA 1DHRA 3I2YX 1B2RA 1KNQA 5HEKA 1ZMBA 3ZR4B 3BMQB 3AF0A 5K2OA 3DO6A 1CF9A 4IAOA 3UTDA 2DHQA 1DZ3A 4YTEA 1K1EA 1KJYA 3O3MB 3L1UA 4ID9A 2BCGY 4UVDA 4AJPA 3K1ZA 4B71A 4L0MA 3LLMA 3T7JA 3IUYA 4ID3A 1SUWA 2EC5A 2GD6A 3HXLA 4NX2A 4RESA 3TGPA 3SEZA 2B4TO 2JBHA 1OWNA 1Z6TA 2ECQA 2FTKE 2PMDA 4MWBA 5T41A 1KFJB 1U5BA 3K9QO 1YCDA 4MS3B 4OI2A 3UAWA 3L7KA 4GP9A 5GVRA 2EKDA 4HEHA 4LJ9A 1DTWA 1J8QA 1YI8A 2HLDD 4C3OB 1IN5A 4LDPA 3EIUA 2XSZA 1FOEB 2EBWA 2GERA 2NWQA 3E5HA 5AKZA 4ZVNA 4CEIA 3G59A 5AR1A 1VFNA 2UVPB 2QOEA 4DIFA 4C7OA 1Z7BA 3BORA 1XOIA 2HIGA 5AHKA 4C88A 4R1NA 3L1IA 3L77A 4QPZA 2ZPUA 4WSOA 4B80A 4CMEA 3T5BA 3ICEA 2R86A 3HACA 3W1VA 2WPDA 1I2CA 3RHSA 1ZJ4A 1XZHA 3CMCO 2HMSA 3IT3A 4G5YA 4UUOA 4L9AA 5D1HA 3KTAA 1J23A 1A8IA 3GLSA 1SZCA 3ONWA 4RVOA 5AI9A 1LB1B 1NOKA 1ZUHA 1T9GS 2FZ4A 4AIRA 1AQ6A 4CYMA 2G1PA 4H31A 2IS2A 2ZIXB 4RVUA 4MLDA 3ICCA 3ESAA 4YBZA 3B7GA 2I54A 3NGXA 3NDPA 4HSGA 3VYSB 3NDJA 4TYWA 4TRNA 4FSDA 1IQRA 3DZJA 4L72A 4OAQA 5H81A 3ADDA 4JOQA 3PP8A 3SZMA 1MH1A 5C5CA 2I3AA 1K98A 2VP0A 1A9PA 3QXXA 3UEOA 3TFOA 3GG9A 1FCJA 2RAVA 3GT7A 3QY0A 2OFPA 1JALA 4YUZA 4PE5B 2AQKA 2HU2A 4WOKA 4YRTA 1RJEA 1CEQA 2BONA 3DEJA 4NBRA 4LE2A 4WOPA 4F97A 4X7MA 5C8ZA 5K0EA 1LZKA 4HFNA 4ZAFA 3KXLA 1Z6YA 2D0IA 1ODKA