3RODA

Methyltransferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
259
Chain Sequence
SGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate recognition in human nicotinamide N-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nicotinamide N-methyltransferase
total genus 87
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.1: Nicotinamide N-methyltransferase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3rodA00
2PWPA 5EIWA 3TKYA 1L3CA 2YVLA 2YUIA 4IV0A 5DRTA 1QAOA 1KXZA 4Y2HA 1RI1A 4RTSA 1UIRA 5FULA 1EAMA 2PY6A 3FUWA 3KQQA 4ER6A 5BW5A 4F85A 4R05A 5ICEA 5ICFA 1G55A 3DXXA 5KVAA 2BR3A 2PX2A 4QVKA 2OPBA 3FTFA 4DCGA 5EG5A 2IH2A 2K4MA 2PV0A 3KR9A 5GP1A 2BR5A 4RSRA 3KR0A 3OPNA 2HV9A 1ZQ9A 1XDZA 5E9JA 3G2QA 2FHPA 3R6TA 1O54A 2OB1A 3OFJA 5LQKA 3UJDA 3NVKI 1ZHFA 3ELWA 3GGDA 3PT9A 5FHRA 3G7UA 5K09A 3G5LA 3BWYA 3DOUA 2HTEA 2QYOA 3DP7A 2NNWB 4P7KA 1JTFA 1MJFA 4PINA 5EEGA 3UJAA 3EEYA 4UOEA 3LL7A 3A26A 4EK9A 3B3GA 1JSZA 5HIKA 2VZ9A 3HCEA 5HIJA 3B3JA 3MERA 3BGIA 4XCXA 5FHQA 1WZNA 1ORHA 3LKDA 5ERGB 2PXAA 5KYGA 3I53A 5EOVA 4BY9E 2UYCA 2VP3A 3AY0A 3B7PA 4Z2YA 4YUZA 3UZUA 1I9GA 4R6WA 3SSOA 4M37A 4HGYA 2IH4A 1H1DA 2WA1A 2FPOA 3HVHA 3JWGA 4QTUB 3BWCA 4ZTBA 4DQ0A 1EQAA 5E1DA 4HTFA 2CL5A 4ER3A 5T6BA 1DL5A 4CWAA 3R3HA 3UA4A 4RTQA 4NECA 3DMHA 4C05A 4YUXA 3ER9A 2EJUA 5MHTA 1TW2A 4RVDA 5GWXA 4BLWA 4MWZA 1WXWA 3DR5A 1JTEA 3KHKA 2Y1WA 4P7GA 5DX0A 1M6YA 4ER7A 5GIPE 4EVIA 5K03A 2PXXA 3OZTA 3HNRA 2ORED 1DUSA 4AZWA 3DUWA 1R74A 4LG1A 4LECA 3BGVA 4LWPA 5E9QA 3KPJA 4C06A 1YF3A 2N47A 2AOUB 3REOA 3BT7A 2PKWA 4P7FA 5FTWA 2CMHA 3GIWA 4OQEA 2HR1A 4RVGA 4DCMA 1YZHA 4E30A 2ZWAA 3KPVA 3KPWA 3PS9A 4GOMD 2GS9A 4R8SA 4E32A 1FJXA 2Z6UA 5GIOE 4GOND 2C7PA 5FWDA 3EVZA 1G60A 2AZTA 3R0QA 4U7PB 2DPMA 4ATNA 5BW4A 4FT4A 5DM1A 5CCXA 3CJQA 4RTNA 4YV0A 1R00A 3LBYA 5DM4A 2JJQA 1BHJA 5K0BA 2AR0A 3KQSA 3AXTA 3SSNA 5HFJA 2O05A 4F84A 5DTMA 2O0LA 3GNLA 2ERCA 1AF7A 3IYLW 3GRVA 3P9NA 2NP6A 1FP1D 1FBNA 5E1MA 4RTOA 2JG3A 3BKXA 2PX4A 1NV9A 2IPXA 3BKWA 1D2HA 2I9KA 2G70A 1KR5A 3GJYA 4QDKA 1KYZA 5HILA 3C6MA 3EGVA 3OE4A 4FSDA 3SSMA 4FSXA 5DM0A 3OU7A 5C0OE 4OBXA 2ZULA 1EJ6A 5K0JA 3UJ8A 5CVUA 5D1HA 5C9ZA 3NVMB 5K0GA 2O57A 1ZG3A 5EQJB 4QQKA 2GB4A 2ZTHA 3FPHA 3PFHA 2H11A 4EKIA 3HM2A 3VC1A 4M7RA 1V39A 5EIFA 1WG8A 3C0KA 3OU6A 3I9FA 2QY6A 3LDUA 3OE5A 4L7VA 3P2KA 4WVLA 2UYHA 1VP3A 1X1BA 1BC5A 3FPJA 3SGLA 4YV1A 4C07A 2B25A 1JSXA 1XCLA 3CC8A 3OZRA 5DT2A 2GH1A 3VC2A 3NW9A 1RJEA 3B89A 5F2OA 3C3PA 5EZSA 3KQMA 4GOOD 3NJRA 4QTTB 3FUXA 3LSTA 5FA8A 3GRRA 3FPFA 3IHTA 3KR2A 1KYWA 2ESRA 2GA9A 3EVAA 4IWNA 4GUAA 5DM2A 5EC8A 5EEHA 3LKZA 5FADA 3TM5A 2LD4A 3KPYA 1PRYA 3GDHA 3FYCA 5GM2A 5LQAA 3PB3A 2HMYB 2OO3A 4IKPA 1L3BA 3LPMA 3ORHA 4PYMA 4A6DA 3M33A 5EHIA 3CJTA 2CMGA 1IXKA 4KW7A 4RTRA 3U81A 1SG9A 3C6KA 1U2ZA 3PTAA 5CVVA 1TW3A 3DTNA 1XVAA 3EVGA 5EVJA 3TQSA 3UFBA 4CKEA 4ER0A 3GRYA 5M5BA 2ZZNA 2JHCA 1FP2A 3LCCA 5HOQA 3KQOA 4E2WA 4QVGA 4PCLA 4CKBA 1KIAA 1SQFA 2JH8A 2ZBQA 3Q7EA 4FZVA 4PYOA 2C7RA 3JWJA 4QPNA 2PT6A 1JG4A 2VDVE 3A4TA 3TOSA 5K8VA 4OX9Y 4MQ4A 3T7RA 1D2GA 3G2OA 3NTVA 1N7JA 2DULA 3IV6A 4GC5A 5K0EA 3FUTA 1NW3A 4OA8A 2ZIGA 3NWEA 1AQIA 3ANXA 3MCZA 1M6EX 1SUSA 3A7EA 2AN4A 3DMGA 3DULA 2B9EA 2ZW9A 3KQPA 1WS6A 3E8SA 3G8BA 3MAGA 1NW5A 2AOTB 3TMAA 3PX2A 1L9KA 3CVOA 1D2CA 4MTLA 3DXZA 4M36A 3WSTA 3MQ2A 4OA5A 1TPYA 1NW7A 4H0NA 4E33A 1QAQA 2ZBPA 4BLUA 2NXJA 4QQNA 3IEIA 3FPEA 2XBMA 1P91A 3RODA 2G71A 1ZKDA 4G56A 4EKGA 1Y8CA 3HVJA 5DXAA 5K0CA 3HCBA 3G5TA 4XUDA 2AN3A 3M6VA 3UJ7A 3MB5A 4IV8A 4XUEA 3BWMA 3RW9A 4RV9A 3QOXA 2UYOA 3TRKA 1RJDA 4X63A 5DX8A 1DCTA 4C4AA 3B5IA 5DXJA 2B78A 4E2XA 4JXJA 1IM8A 4FGZA 4YMHA 4PWYA 1HNNA 1HMYA 3HCAA 4U7TB 3HTXA 3O4FA 5E9WA 4AZVA 2PVCA 3KQYA 4YUYA 2P7HA 3A27A 2A14A 2H00A 3GRUA 1ORIA 3FTDA 5DTQA 4MIKA 3LDGA 1SVUA 2HWKA 2P3OA 3O7WA 1SQGA 1WXXA 5E1BA 3EVFA 5K01A 1ZGAA 3GU3A 3PVCA 1PJZA 3MGGA 1G8AA 2KW5A 1VL5A 2OKCA 2Y1XA 5GM1A 5E2AA 5C1IA 2ZWVA 2C7OA 1RI4A 5K0LA 1SKMA 5ICCA 5T67A 3D2LA 3KQWA 3HA3A 5LQUA 1QAMA 4AZTA 4KVZA 3EMDA 3A7DA 4RWZA 1IY9A 1KPIA 2EFJA 4CKCA 1R6AA 2IDJA 2YXLA 3NWBA 5E8JA 4PGGA 1AV6A 3ELYA 4HTFB 1I4WA 5K0FA 4PYLA 4CXMA 3M70A 3LBFA 2NP7A 2IBTA 4FS8A 4DZRA 4CTJA 3G88A 4FT2A 2CWWA 3VSEA 4HGZA 2AVDA 3EEOA 1O9HA 2UZ4A 4MHTA 3B3FA 1JQDA 4GF5A 3P2EA 2B2CA 4KRGA 2AVNA 1QZZA 4LWOA 4EMSA 1RI5A 5DSTA 5HZMA 3E23A 3FUUA 4PGHA 1WY7A 3ELDA 3BUSA 2QRVB 3CCFA 3R24A 3TR6A 4OBWA 4BP3A 5BP7A 3AWIA 5EMLA 3MTIA 5E1OA 2B3TA 3ELUA 4R8RA 3DLCA 1VE3A 1X1DA 1JQEA 2AOWA 2YXEA 2Q41A 5KS2A 2ZCJA 1T43A 2E5WA 4KIGA 2PT9A 3P9IA 5EPEA 5JUWA 4RTLA 3FPGA 1RI2A 1JQ3A 1X19A 2V7EA 3HP7A 3I58A 5FCDA 1ZGJA 3T7TA 3Q87B 3EGIA 3H2BA 2ZBRA 1VP9A 5EMMA 5K0NA 4PNEA 1OR8A 1P1CA 5FUBA 2AS0A 2YR0A 4YV2A 5IH3A 5LQRA 3UJCA 2OB2A 2VS1A 2ZZMA 4X61A 1EIZA 2ZZKA 2HNKA 1KPGA 3BWBA 2G8NA 3EGEA 4X1OA 5F2KA 3QV2A 4C03A 4GOLD 4DMGA 2P1DA 3K6RA 5JR3A 1Q0SA 4PYKA 1NT2A 2O07A 3UJ6A 3BGDA 4C08A 3LDFA 3THRA 2IGTA 1YFLA 8MHTA 3LHDA 1NE2A 1VBFA 3GO4A 3ID6C 5DWQA 3FTEA 3PFGA 4HSGA 4PCAA 1NW6A 3HVIA 1F38A 1INLA 1NW8A 2I62A 2YX1A 1KPHA 5T64A 5LQNA 2OY0A 4BP1A 3CKKA 3SMQA 5GOZA 2IIPA 5D1NA 4F86A 1QYRA 3BXOA 3FTCA 3P9CA 5EHGA 2G1PA 3GCZA 3I5UA 3M6WA 1EJ0A 3HCFA 2BM9A 3M6UA 2Z6QA 1NBIA 3OU2A 4BLVA 2Z6AA 3SR4A 4RVFA 4V0QA 4RTJA 2QM3A 4FR0A 2I7CA 3KKZA 1XXLA 3KR1A 4KDRA 1MHTA 1VIDA 1B42A 1XCJA 1XTPA 2F8LA 2IDKA 3PLAE 4R6XA 3UA3A 3KQTA 1VLMA 3FZGA 2GPYA 4M38A 2IP2A 3LGAA 4RX1A 3EPPA 2YTZA 1YZ3A 2ZVJA 5IKMA 2PX8A 3DMFA 3K0BA 5EGSA 5HIIA 5CD1A 5E8RA 4AUKA 3T7SA 5F2NA 3P9KA 4XUCA 4RTMA 2AN5A 3UJBA 3TM4A 5KQSA 3CJRA 3O31A 2JHPA 4ISCA 5CVJA 3V8VA 2BH2A 1BOOA 2XYRA 4X60A 3VYWA 1EG2A 2ZIEA 4PYQA 4E70A 2QE6A 2FK8A 1RI3A 3HA7A 2AOUA 3HA5A 4GBED 4KDCA 2PX5A 3HEMA 2EJTA 5DSXA 4O29A 4AZSA 5HIMA 2BR4A 3JWIA 2XYVA 3G8AA 3NDIA 4V0RA 3BZBA 3THSA 3MHTA 3C3YA 1N7IA 2P40A 3R9XB 4PIPA 3X0DA 4HC4A 2VDWA 4DA4A 3SXJA 2XVAA 3EVEA 3LECA 1Z3CA 2XYQA 1AQJA 5HEKA 1P39A 2P35A 2YXDA 3ME5A 5DRYA 3SVZA 1BKYA 1KHHA 4A6EA 3OFKA 2GLUA 5LR6A 2BM8A 3RIEA 2YQZA 2OXTA 2CKDA 1G38A 2JH9A 1X1AA 1G6Q1 3TFWA 3E05A 5EKUA 5GINE 1R18A 3UBTA 3KPUA 2WK1A 2OBFA 4PYJA 5LSAA 5EZQA 2PXCA 2AOTA 3MCTA 5H02A 7MHTA 4CTKA 3HCDA 2AOXA 3DXYA 3M4XA 4PYIA 3SM3A 3OCJA 2PGXA 1VQ1A 1RJGA 3T0IA 2PBFA 1R8XA 9MHTA 2NXNA 5CVEA 3P8ZA 2O06A 5CIYA 2XVMA 2FYTA 2UYQA 2IH5A 3SX0A 4GC9A 4POOA 2ONZA 1UWVA 2P41A 5CVDA 1YFJA 2FCAA 1JG2A 2AOVA 5G02A 4HRAA 4QDJA 5DLYA 5DX1A 3LCUA 3PX3A 5U4XA 3EVDA 2JHAA 2OYRA 5CCBA 4K6MA 2NYUA 5LQCA 1Q0TA 1XDSA 3HCCA 3LX6A 2BZGA 3TKAA 1SUIA 4X41A 3M6XA 3G2PA 3F4KA 1VPTA 2P3LA 4P7JA 3JWHA 5ICGA 2P8JA 2ZIFA 4KIFA 2ZLBA 1O9GA 5B1SA 3FRHA 3AXSA 4C04A 3ERCA 3CBGA 4PYNA 2R6ZA 2VDUE 3KQVA 3L8DA 3A25A 2WA2A 3NDJA 4WXHA 4YUVA 2GAFA 4P58A 4E31A 3UWPA 5BXYA 2IFTA 2ZSUA 5EMKA 2FRXA 3EMBA 3TPZA 4GEKA 3S68A 1NV8A 3EVBA 3DLIA 3FUVA 5DPMA 5P8WA 4E2ZA 4B17A 5KQRA 2C7QA 3QOWA 2FK7A 3GXOA 4KWCA 1X1CA 2ONYA 3KU1A 5CM2Z 1M0EA 3DH0A 2R3SA 3E7PA 1G8SA 5FWAA 1L3IA 4RTKA 4RYLA 5FA5A 2PWYA 3GWZA 5CUQA 1JG3A 4PONA 1NBHA 5K05A 4DKJA 2OZVA 1UFKA 3UJ9A 1JG1A 4DM3A 3G2MA 3V97A 2IBSA 3FRIA 2NXEA 2ADMA 4HG2A 4OQDA 5DTRA 2PSSA 4AX8A 1P1BA 2P7IA 3AJDA 1N2XA 2EG5A 2G72A 3LCVB 3OZSA 3P2IA 5FQNA 4YUWA 5EMJA 1XJ5A 4RTPA 4ER5A 4FP9A 1I1NA 1QANA 1YB2A 1YUBA 4HH4A 1R8YA 3I64A 3G89A 4PIMA 5E2BA 2PLWA 1FPQA 1KP9A 2EX4A 2P3QA 2V74B 3TLJA 2QRVA 3P71T 4RVHA 4EQZA 3NMUF 1NKVA 1F3LA 5EKXA 5FQOA 4Y30A 3ER8A 1RJFA 2H1RA 3MTEA 4E2YA 1JR4A 4DF3A 2PJDA 3EVCA 1L1EA 2ZFUA 4QPPA 3HVKA 3FYDA 3GRZA 4GQBA 5LQJA 10MHA 2I6GA 3CGGA 3P97A 2NXCA 1XDUA 4YMGA
chains in the Genus database with same CATH superfamily
1YB5A 4NFLA 1NI4B 2HSDA 5JZSA 5TQJA 1RHQA 3MCVA 2ZPAA 5CGQB 2QNRA 1N6HA 2HNBA 4UJ3A 4LI3X 1I1QB 2QENA 3AEZA 2FP4B 5DYWA 5FULA 1M2KA 4ER6A 5KVSA 1ENYA 1NZJA 2BR3A 3TDKA 4MCHA 1N4DA 3NDRA 4PQRA 1AGNA 5FTNA 1EFUA 4CU5A 2HA2A 3C7CB 4QJ4A 1G3UA 5GJWC 3W9YA 1RC8A 2ZJ0A 1A8UA 1NU8A 2XMRA 1T25A 2FHPA 3IPLA 4TLLB 3UMBA 5ADWA 3ZIAD 5SY9A 3QVVA 4WESB 5B12A 3HA2A 4ROTA 1B6SA 1FUYB 2X1VA 4W9RA 3MZ0A 3FSJX 3BD8A 3M4ZA 3SVLA 2V5AA 4HQOA 4OJYA 1PX2A 1JJAA 5JZVA 4PINA 1PL6A 1BIFA 2H2GA 3VBEA 3HJFA 1Q2UA 4J0DA 1M7BA 1NMEA 2VF8A 5CX1B 5CX4A 4FFRA 3LL7A 3PJFA 1U7ZA 2QRMA 4EENA 4WN9A 4UOEA 5CLFA 3ZXSA 5FTKA 4OB6A 3WKAA 3FSGA 4L07A 4UQLA 2V9CA 3DFUA 2RHLA 1JPJA 2AG0A 3H3JA 1W6RA 2VBCA 3JVEA 3O92A 3Q3EA 2Y4OA 3JRWA 1GKKA 5DYYA 3V4FA 1EE9A 5IVIA 3WIVA 2VL7A 5EFOA 2WDPA 5C37A 1FUUA 1FDSA 3BK1A 3ZBUA 3ZK9A 1S7GA 1Z2PX 2CFTA 3BWCA 3JARA 1LNZA 4QU9A 4WUVA 4RDIA 3TK1A 2A5JA 3VZPA 3ZV5A 4Q0MA 4HDKA 3S27A 1RWBA 4B6PA 1R37A 4NE2A 3UATA 2J3KA 2GAIA 4BS9A 4RVDA 5BSGA 2Y1DA 3CVWA 3R76A 2OV2A 1Y1RA 3O91A 3OSZA 1P1FA 2HC9A 2OGUA 1HNZB 1FNCA 3GFFA 3WV4A 3VNRA 1CE8B 4YRBA 3E3AA 1RCFA 1N33B 3GP3A 1SXGA 1UK6A 1VG0B 2BEVA 4HDNB 5KYYB 4ERXA 3MMSA 2BMJA 4JHLA 1MC4A 2RK6A 4LWPA 4TTSA 5SZKB 3QG1A 5E9QA 1H1LA 1O97D 1MAUA 3HN2A 4QFBA 3U0VA 2ZI6A 4ZI3A 1S7CA 3QVTA 1PZHA 1L2TA 1OA1A 1Z4MA 2CEKA 1TVCA 3H9BA 3K73O 4ND4A 3NYRA 4OBEA 2BP7B 4RO0A 4DCMA 3GT4A 1BCSA 1E7YA 1HNXB 5I48A 3PS9A 1SBZA 4RKFA 3IGFA 5GIOE 3M34A 4GOND 3TKLA 1GL6A 3DSRA 4XGIA 3NG1A 3TMYA 2JCSA 3S70A 2C1XA 2BGKA 4J7UA 2HA4A 3QWHA 4GZLA 4X9XA 3KSUA 2VYND 1ACLA 1HMPA 1JEAA 1DARA 3E7FA 2BRUC 2HT1A 2X4DA 3FHLA 1YB1A 3ES9A 5KMGB 2QRPA 3IP3A 1EE1A 3UMGA 2IZ6A 2J31A 1XRMA 3OECA 5BRJA 3WHLA 3HP1A 1GR1A 1MTZA 4Q15A 5DI3A 5BSWA 3JZDA 5K0SA 3TLKA 4O4LA 3T7CA 1OLUB 1Z7BA 2IODA 4CMKA 1TVMA 4DBZA 4ARBA 1XTKA 2ZUCA 4CG2A 5AIAA 1MZPA 4ZOQI 4G01B 1PV1A 2W9XA 5EPUA 4FSXA 2NP7A 2OD7A 4A82A 5K0JA 3FOBA 3KJHA 3AP2A 1I01A 1CQXA 3ZCVA 3OQMA 3GT3A 4HAIA 2WLTA 1JG7A 1OXTA 3QU4A 4GNRA 1BU8A 3UAWA 3ZWOA 4D0RA 1J49A 3O84A 4GVLA 4HRYA 1A7JA 1OPXA 1QB7A 4Q1DA 1V39A 3RLFA 3DMTA 3QFRA 5HE9A 3ETDA 3K92A 2BIFA 3SWWA 3MWJA 2FN3A 3M6AA 2ZZMA 5A5EA 1WIWA 1X1BA 5BT8A 3SGLA 4BNDB 1RLJA 1JHXA 4MCIA 4ZXFA 4CFYA 2GZDA 2I76A 1FFWA 5EVCA 1A5ZA 2JGLA 5C18A 1X3LA 2AJCA 3G9XA 4JP5A 2Y6UA 2FOLA 3HE3A 4P08A 2WFLB 2ZRCA 3N2NA 2FWJA 1EMDA 3Q8KA 5C1DA 2AUNA 3STWA 2H7VA 4OQYA 2VWGA 1E3DA 4J2HA 3N6XA 1EWRA 5EC8A 3EVAA 4IEFB 3U4HA 3WJ1A 4MWOA 4RK7A 2RHGB 4AZ3A 1V8ZA 2WD9A 3FYCA 4DSAA 2O3JA 3C6QA 2FUG6 4QOSA 3NHYA 2OO3A 3WL5A 3QUSA 2CLKB 4AS3A 1HLPA 4O59O 1KBQA 1M34B 1D5CA 4JBHA 1H2AS 2C9ZA 4MROA 3X44A 5LIPA 4NYJQ 3RT7A 3KJXA 4KWTA 5JW6A 1QTNA 1U2DA 3EASA 3V2GA 4LWZA 4YJKA 4ER5A 4ER0A 3SP1A 5HE8A 3TSZA 4PX9A 3DONA 3RGGA 4LWQA 2JHCA 4R2JA 4JLVA 4JKOA 3WK4A 1RLTA 3ESQA 4LJ8A 4TVKA 4A1OA 2VDVE 4OAQA 3VHXA 3QU5A 4P22A 1VJTA 2HT6A 1GITA 4XAQA 1EDDA 4YMTA 1WUTA 1XALA 2FX2A 4KR0A 3M6IA 1IB0A 1C14A 4RSGA 4BNIA 1YS1X 4WRRA 1XROA 2FRVA 3CIOA 3F74A 3GRAA 1OBVA 4LSZA 2GBLA 1AD2A 3PFIA 4B3CA 4ZHQA 4IS2A 2QL7A 2YQ4A 4D0SA 2B8JA 5JNUA 1YH3A 2YZGA 1TA0A 2JGFA 3PX2A 4KE6A 5JRJA 2HF7A 4ZO4A 2ISCA 2MT9A 1NVBA 3EFOA 4HQRA 2JKYA 1TPYA 3WRXC 4CQMD 4G24A 2ZBPA 1D1PA 1KMHB 5FPSA 2F1KA 2D2EA 2O1WA 2BMVA 3LTNC 2G71A 4HB3A 4EKGA 1Z4PX 1ZMRA 4CYMA 5B2FA 2BVNA 5JAPA 2XJ9A 2O1XA 2G0TA 4B83A 1ZH2A 1XLUA 3EFHA 3LQQA 1FNBA 1V3QE 4RF4A 2XMPA 5D7BA 5E3JA 1MMFB 4BE9A 2EW8A 1JDPA 4ENVA 3MTAA 1RQLA 3FZEA 2PS1A 1U1GA 1VKZA 4HEA1 2HUNA 1ICEA 2H1CA 5KB3A 1NPYA 2FSUA 2IXTA 2RARA 4Z99A 1IHDA 2GEDA 3HRKA 4M9QA 3OWHA 4DNPA 3QKRA 4US2R 2II6A 1IM8A 4IIEA 4C0XA 3KEFA 1T8SA 3BRWA 4I14A 3ASZA 1E2PA 3VTFA 3WSWA 1NXVA 4JQSA 2FKAA 4TKZA 1NQAO 2O9JA 3GRUA 2GN9A 3H1GA 5E7JA 3TQFA 3TXYA 1HFWA 4EPXA 4M1QA 4Q1VA 3MAJA 4BCCA 4Z54A 1NVWQ 1Z68A 3PD1A 1YJBA 2WB4A 4Q7EA 4AJPA 2WU4A 4WAUA 2FQWA 3GU3A 4IDAA 4OM8A 1RMTA 4QUDA 5GJCA 1L5YA 4E1VA 5LVAA 1F20A 3A6KA 1OI4A 2CL6X 2SKCA 3LV8A 5ALXA 2DLDA 3RS2A 2X1LA 1IY9A 1KPIA 1MVNA 3EC2A 3JQRA 4YP1A 3U4QA 1TZ2A 1B0ZA 3N8GA 5LXTB 4D8VA 1ISGA 3OJLA 1EM6A 1YKSA 4CXMA 3GX1A 4P84A 1DTSA 2HLHA 2VJLA 4QEKA 4BVEA 3CLHA 4LBZA 13PKA 5EWLB 5G2OA 3RFTA 3FYUB 2XRYA 3GH1A 1LS6A 4E5SA 2I1VB 2CWWA 2AIRA 2VLBA 4L75A 2IBMA 4CLXA 4DT1B 3PWZA 3N74A 3DTYA 4PZ9A 2WU0A 3QE9Y 4HRVA 1MG5A 3H6GA 1B6TA 4H16A 2B2CA 5CG2A 3CCCA 3WK6A 3PNPA 1G6KA 3LXMA 4JDPA 4Z1MA 5TGTA 1HDZA 5HZMA 2R7NA 3D4LA 2AJLI 3KKNA 4URYR 2CJWB 1BCRA 1FDVA 4KFUA 2VYCA 4WFIA 4FJ1A 1NZDA 4UDYX 4DEVA 4ZRNA 3V2HA 3R8FA 5HVNA 1DJQA 5COAA 2ZCJA 1PQWA 1T43A 4RD4A 2PT9A 2Z08A 4RTLA 3AKYA 4EHIA 1JQ3A 2BFFB 2RHOA 3HP7A 1UJMA 4ME6A 4WXPA 1GTZA 4TV9B 1L6IA 3M9LA 3UAYA 4ASUD 3ZGLA 3CNEA 2GCNA 5H3CA 1DAMA 2E9SA 2UZ1A 3CZPA 3PE4A 1HFKA 4TKVB 3UV7A 2EJCA 5LQRA 5EXPA 2E4UA 4KNWA 4W4TA 3RRNA 3OMLA 1U0SY 3WFIA 2H8GA 2YRWA 2PLAA 3N75A 1ZM3A 3EGEA 4X1OA 2JJ2A 2LV8A 1U4SA 5B2EA 4N6GA 4XCQA 1JG6A 3DZIA 4DMGA 3PNKA 2V6MA 3K70B 3KJIA 4MQLA 3N0TA 4XGRA 1V8DA 2IZ1A 2IY7A 3B53X 3NIWA 3T8YA 5BN3A 4V1CI 4C6RA 1A1SA 1GU0A 1AKNA 1NVXQ 1L5FA 1VBFA 1W93A 2VF7A 3Q9SA 2IS2A 1KTVA 3CRRA 2Y76A 3ASUA 3G7SA 5E6RA 4D97A 2VG8A 2X42A 1QE3A 1C4WA 1UP4A 2GF9A 1NPTO 2V7TA 3BQ9A 3EY4A 1NW6A 3JPYA 4P33A 4FKBA 4Z0TA 3VDQA 3WA6A 4CDMA 2YX1A 4DC9A 2XMGA 2NSYA 1FSFA 4TVSA 4GX2A 4KQHA 2Z3WA 5CX1A 3SJUA 3SD7A 3VH3A 2IUFA 1BGVA 4QDOA 5IBCA 1QH1A 2GN1A 2ATEA 2OHHA 4W5NA 1I3KA 3UK2A 4MVJM 1GNSA 3RADC 2G1PA 1UAAA 3HRHA 3R09A 1U8CB 5B36A 4C2BA 1CG6A 3D3NA 3Q11A 4CKWA 4IDBA 2OBBA 4EGJA 3PUIA 1Y0BA 1IY0A 3AW9A 2QW8A 4TN1A 3T61A 4RTJA 4FR0A 2I7CA 2FPKA 4EJSA 2HWYA 4X97A 3EWIA 5CLIA 3E70C 1OXUA 1YA8A 1L7PA 3OKAA 4ARZA 4CNQA 2J5KA 2NGRA 4ZP1A 2JLQA 4FQ8A 2P2LA 4P35A 4RZ2A 3OD5A 1EFPB 1UXKA 2I4TA 5KPDA 4CEHB 4ZC1A 4ZDJA 4BZQA 3C41J 3GNSA 2PX8A 1NQWA 1WMEA 2FMIA 2GARA 4FWIB 2NTVA 4M89A 1KGSA 1QIMA 3PKZA 3ZUGA 3ZCTA 1G5TA 2ZE7A 3PQ2A 1O5IA 3IOYA 3WVNA 3TM4A 3ZWQA 2I3AA 8GPBA 2BEVB 3N6VA 3OMXA 1FYXA 2PZLA 1QO0A 1ML3A 2D5AA 2ZIEA 4J3FA 4Q00A 4XDHA 5J59A 4B71A 1ZITA 4WL0A 4AZSA 2PKQO 2ZRJA 3H2HA 1KY2A 2YWCA 3PV0A 4CMEC 3G8AA 3OZEA 4WLVA 4F7WA 1Z13A 1CUIA 1ZEJA 4EA6A 3LUBA 4NRDA 4QLOA 1AUOA 2IHNA 4Q4DA 1IEXA 2WWHA 3TLYA 4XW2A 3J7TA 4INZA 1JKJB 2HPZA 2VPWA 1KHHA 1KKLA 2C9MA 1CUHA 2Y3IA 2Z5GA 2A1IA 2ZVQX 3G6KA 3OLZA 1KEEB 3BAFA 2VK8A 1VSVA 4R8LA 5DN9A 5E0OA 1JL3A 1G6Q1 4HBGA 1Z6XA 3OOYA 3L0SA 2P5YA 2AKAB 1U28A 2EERA 1TJPB 2QTAA 3FI9A 5A04A 4YRFA 3K0EA 4G5QA 4FYPA 3V46A 4ZCRA 1KA9H 2XDYA 3BXFA 2WHQA 3CUWA 4HJXA 4EYGA 1JALA 1HYGA 2YJ4A 1SOAA 4IW3B 2CHVA 1GNTA 1OBCA 3T0IA 1YVRA 2H4ZA 4AKTA 4S05A 2O06A 4BO4A 1USGA 2CLCX 5LQUA 1A9TA 4IPTA 3W8NA 2GJKA 4QJ5A 2NUPA 3FDIA 3RUHA 3ZBTA 3A37A 3TPFA 1T9CA 2EBUA 2GRAA 3L6DA 3ZEAA 1YI1A 1SMKA 2H4WA 1YI8A 4RIGA 3W2IA 2C5EA 5HKOA 4L9RA 5CCBA 1IU9A 2F3SA 3EXHA 3GLHA 5CB4B 3HKCA 1PL0A 5BMVA 1CRZA 2W8BA 1VCMA 2AJTA 2GT1A 2ORYA 3PQ4A 2FZVA 1LDMA 3GFOA 2HSGA 1SKYE 2X5KO 5DWDA 3S2YA 3R7BA 3RSOA 1VMKA 3ILHA 4X3OA 1VC2A 1YBFA 2HU8A 3W2HA 5IJXA 3COJA 2XWQA 2C54A 3H1TA 3EMBA 4GEKA 4BGEA 5JI3E 3UAZA 1Z2NX 3GAAA 4NVRA 1U0TA 2FK7A 2YBEA 3MM4A 4CIWA 3IQWA 4KEAA 4JH0A 2QJFA 1T0BA 1HYEA 3A9RA 2WJGA 1PT7A 5AXDA 1J9EA 1G8SA 5FWAA 5IZ4A 1ZGZA 2ODPA 1VLQA 4J49A 1LVHA 3AYZB 3I30X 1HTWA 1XDGA 3A6JA 2O2ZA 3ANSA 4GPBA 4W82A 2A9PA 2FDRA 1UFKA 1AY0A 2FR8C 1VG8A 3UNXA 5SYNA 3V97A 3M83A 3HBLA 2HU5A 4F06A 1CRPA 2WV9A 2NVBA 4L6AA 1Q15A 1Z4IA 2B5OA 4IIFA 5TS2A 1SKAA 4W7IA 2G5TA 2HDWA 3BWXA 3K31A 1SC3A 2EG5A 4L74A 4MHSA 3ETNA 4OQXA 3PJRA 3ANNA 4YCDA 1JWAB 4D02A 5IN5A 5ENDA 1QLHA 3ZWYA 4ZI7F 1C81A 4B3SB 2A0XA 5LLDA 1XG5A 2NNLD 3VAAA 1NF3A 1ZD2P 3FDFA 5KSYA 4IVNA 4NBTA 4NTZA 5A9SB 1I7SB 1JPUA 1I30A 2PLWA 3QQ5A 2MOKA 3FCEA 5AM0A 4EJ0A 2VWPA 5MFPA 5CHYA 1Q1ZA 2ZCVA 4HXEB 2Y0PA 4NDAA 5LB2A 3JVVA 2Q49A 1B8NA 1FFDA 4OI4A 4ZC8A 1CZKA 2NOAA 1C4KA 1QTRA 4IIBA 3WNZA 5HUHA 1KVUA 1XA0A 3Q98A 2OA0A 5A4IS 1CDOA 1USIA 3T4EA 4UTPA 3U1BA 4LXQA 3IVRA 1NGSA 3HVKA 2NO0A 4C0LA 3EXG2 3PFBA 3WRYA 2QRUA 4FX5A 3GZ4A 3DHYA 2RI0A 3P97A 3IELA 4FDMA 3KLOA 5IJAA 3WP0A 1P80A 4C2AA 5JG7A 1GA6A 2GJ9A 3V1NA 3X1DA 2LVBA 5TF4A 1KYQA 4GRAA 3AR9A 1KK1A 4JJZA 3L6CA 2OAEA 4WD3A 1T5BA 1XSEA 1EHIA 1DEHA 3AQIA 5AKHA 2VDLB 2ZS7A 3B8HA 1JEEA 1I3CA 1LPBB 2PY6A 3IPYA 4KVFA 3HXOA 2UUBB 4B3RB 4WZ6A 2ZUFA 1H8EA 1TPZA 4NR0A 5ALKA 2IH2A 3IUBA 4KVAA 1Z0DA 3BYZA 4Z6KA 4X3PA 3MVEA 3ONVA 3KR0A 2ZSAA 4ZQIA 2B3DA 1Y3HA 2CUKA 3N5CA 3LAWA 2HA7A 2XE6A 3R74A 4O5AA 3RU7A 3Q8LA 4IICA 2HTEA 1QYVA 2XGGA 1HZZC 3R7WA 1K8QA 1N2EA 3PEYA 5AM3A 1F8XA 3GFTA 5HP4A 5EEGA 1TADA 3Q6NA 1QVVA 1D2AA 1GZ3A 3IQZA 4V0OA 3GRCA 5A5FA 1JT9A 5A7GA 2L42A 1JSZA 4D4IA 1LTKA 4EK9A 3WWOA 3IT3A 4WW0A 4BMZA 1IZ0A 1JJ7A 2RD2A 3BRCA 3H87A 2DZDA 2FZGA 4MITA 1VSQA 3QHAA 1P4SA 4C4RA 1NIPA 2IHZA 3F8WA 1EQAA 1QORA 2NXWA 3CSDA 3K3PA 4HGPA 4LNAA 4R83A 4JJ8A 5TQ0A 3RIXA 1YO6A 1RMYA 3RYTC 1YZNA 2OV6A 2VYVA 5KQGA 3DL7A 3SQWA 3B12A 1T0PA 5MHTA 2J48A 4LE0A 1YJCA 1HQYE 4P7GA 3UC5A 4FONA 3NTUA 3GPBA 4NC9A 5K03A 2JFNA 1STOA 1IONA 1CUBA 1LPSA 1OFGA 2PXXA 1IAVA 2I5PO 5B1IA 3V42A 3Q15C 1T8TA 2ON6A 1SBNE 3RDPA 2ZUWA 4WXRA 4GRIA 4YWJA 4CCSA 3PEEA 3JQDA 3RVLA 2XVZA 3O4JA 2ID4A 4IFIA 1FQKA 1BCRB 3QEKA 4HKTA 3RAJA 3WLFA 1QBGA 3MLAA 4RHTA 4R8SA 2EW1A 2GHRA 3N0RA 4R4JA 3IBCA 4QG3A 3KEQA 2W0SA 2P69A 2GETA 3STXA 5D7NA 2AZTA 3FHOA 3IPCA 5BW4A 2Q5EA 4RTNA 1MO3A 2RJOA 1WR8A 1F8GA 5DM4A 4CEIB 1ZOLA 4WFJA 3UGKA 5U1PA 2Z83A 4IQFA 4LY0A 4TT3A 1P5HA 2O0LA 3H05A 4I4IA 4L9AA 3VR3A 2O5RA 1SELA 4EPVA 2QNBA 3TI7A 4X7RA 5DM60 1V9CA 2VXOA 3EGDA 1FP1D 1XZJA 4WZBB 5E1MA 3H4IA 3PYLA 1E18A 4RZ3A 4RA9A 2P65A 2EQAA 3KUCA 1KJJA 3VR3D 3HI4A 4P5EA 3ZW7A 4ZYVA 5KWIA 1L1RA 2B8EA 1H8HD 1B23P 3GLGE 1UXGA 3OKCA 2HWWA 2M6KA 5AVZA 1NHWA 2DBZA 1SWVA 3BS4A 3OEHD 1OVGA 2XNDA 4OG2A 2A2ZA 4EFMA 4JZKA 1KH1A 2AMLA 3LA8A 4NPAA 3REFA 3VKFA 3HJTA 3HLKA 4A8JC 5BWMA 4GX5A 4OL9A 1M72A 4DXAA 4M8NE 1BDJA 4XX0A 2WZDA 1K8XB 3BJIC 3SXUB 1LQUA 3SHTA 3SZMA 3UK1A 4U8HA 1CQJB 1MH9A 2QY6A 4MVJD 3PK0A 4WVLA 5FUYA 3ANTA 3OQHA 1SEPA 1PT5A 3MGCA 1BC5A 4M0UA 3U7QB 1KJ8A 3VR5H 4BN0A 3NHRA 4QBHA 4X1IB 4QGBA 2KSQA 2MDTA 4BQFA 2E89A 4BC1A 1J2RA 1G6OA 3JD3A 2QX4A 4QTTB 3FUXA 1U99A 1MA3A 1SZPA 3MOSA 3NGXA 4WXYB 4NKRA 3PRYA 3T0GA 4UM9B 1A9XA 1VCIA 3G17A 2O2JA 3I45A 4EY7A 1TOAA 2LD4A 1FVOA 3LY5A 2G0NA 3GDHA 2HOQA 3B13B 4G0OA 1ADYA 4GR9A 1JIJA 4IKPA 1TIBA 2CHQA 4KR9A 1WU7A 3U4AA 4ZVQA 4PYMA 3UEOA 1JILA 2WM8A 3IFSA 4J0EA 4KZPA 1GP2A 4R40A 3B1JA 3RC3A 3RU3A 1M2OA 3KLMX 1SXJA 1Y89A 1KDYA 4GE0A 3TQSA 4D6XA 3GRYA 3D6NB 3CUUA 3T1QA 3ACBA 1DOZA 3EZXA 3F67A 3EQ2A 4ALJA 4FZVA 2BHLA 2Q50A 1N92A 2F3RA 1C4OA 4QPNA 2O1EA 2PN1A 3A4TA 3H6HA 4BVGA 5DTIA 5K8VA 1ISRA 5A4MS 4EG0A 2DULA 4DJ5X 2OXCA 3R7SA 1JGTA 1NAIA 5HKAA 3NWEA 4XOIA 3D7LA 3KZKA 4R8VA 1OYVA 1J09A 1M6EX 4HH4A 5E9AA 3G8CA 1JE0A 1B43A 3EZ9A 3L82B 5IKOA 3ZY6A 3RAEC 5AVQA 1L7XA 3SKYA 3LL4A 5DP1A 1Z18A 3H1EA 5FPTA 3TXXA 3VR5D 5IABA 4Q19A 1T3ZA 1M54A 2G0AA 2OL4A 2VCYA 3EGOA 3FDXA 1DBQA 1HXHA 3OJ0A 3PDCA 5AXBA 5KPJA 2NG1A 5KX5A 4Q34A 3RS7A 2YRFA 3ZHOA 4E21A 5BMVF 1SQSA 1XCMA 2VHZA 2QSZA 2EGUA 1R10A 2CXSA 2P4HX 2ST1A 2Z5VA 1NVUQ 4U9HS 4Y6QA 4NICA 3RYFB 5BPFA 4AJOA 1N34B 3VVCA 3TYXA 1MQ8B 2FQ1A 3ONDA 4M9SA 1YGPA 3TRJA 3VKWA 3VC3A 5DNAA 3BA6A 3AVWA 1X14A 5JZ9A 3OE7D 4L0MA 3PHCA 1ZZGA 3HB7A 3QEMA 4J1SA 4Y2TA 2PQ6A 5C5CA 4OLFA 1I2DA 3HJNA 1VPDA 4RVCA 4ZHSA 2IE8A 2D1YA 1EESA 5BUCA 4JXJA 3I09A 2R6CA 3SSAA 4O4HA 1PYGA 1UBLS 7REQA 2WTBA 3MT7A 1DUVG 2J46A 2L17A 4X8LA 1WW3A 1RTTA 3GUHA 3Q9UA 1IN4A 4GL4A 4HWOA 4A91A 1BU5A 4B74A 4C6HA 2EIHA 1NG9A 1TK3A 2EFDB 4HNQA 3B36A 4K6OA 5E1BA 3B51X 1EHCA 1RQNA 1TCBA 3PVCA 2ZE6A 1JIUA 4FFVA 3S6JA 5IKXA 2GEBA 2CBGA 3CONA 4YAGA 1FLDA 3NUZA 1QH9A 1SG6A 2HEGA 1CUCA 3VR4D 2XOKD 4FDAA 4CI0B 3T1HB 3FJYA 1P9OA 2C82A 3KOWA 2DWOA 1BO6A 2GCOB 2MSWA 1P72A 1GOTA 3VZRA 4Q39A 4LCJA 3WLLA 1JHZA 4EY8A 5ALPA 4UTOA 4WEQA 4ASUA 3DL4A 3OF3A 4LJYA 4FS8A 4RDHA 1SB9A 2H18A 4ID3A 5G3YA 3GBPA 3QXGA 5AW2A 1NXQA 4J8PA 3TNDA 1JEQA 2J59A 2IT1A 3CPHA 4M9CA 4MHTA 3B3FA 3IUYA 4F7DA 1OH7A 1RAHA 1X7WA 1YRWA 4M86A 1RLUA 4UBNA 4TMKA 5ALVA 1N0IA 5FWYA 4W5TA 4YLYA 4WKCA 3N07A 1UK9A 4ZCSA 1TFRA 5FCDA 3FCAA 5TJHA 3SICE 3T3IA 3PNYA 2OUKA 1RWNA 3BEDA 3QA3E 4OBWA 4G0WA 2Z95A 2VI5A 4PM4A 3WLHA 2PTHA 3ENVA 3WBBA 4LFBB 2PNJA 5K4HA 3C97A 1MNQA 2Q41A 1KARA 4X54A 5KS2A 4B2YA 4S0ZA 5A4KA 4AVYA 1VJCA 1O96A 1I8TA 1KQFA 1KO5A 3EGWA 4OGGA 4BNFA 1GZ6A 2KX7A 2PH3A 3OPXA 2BM0A 4JJ4A 2PM8A 1MJNA 2C9YA 4NATA 2XADA 3O38A 2ZR8A 2PZJA 4FHGA 1MN6A 5K6TA 1Y5MA 2J9GA 2CVFA 1XKLA 3L40A 1A9YA 3FYTA 4CMIA 4YV2A 1VHTA 2FEWB 4OYLA 1RU3A 1U8TA 4UBMA 1EIZA 3RSFA 3RFCA 1M2VA 1EFTA 2C2ZA 2FR1A 4OJKA 1MRZA 2X9GA 1GRQA 5FI5A 2HF9A 2ZDQA 5JYDA 1Q1GA 1WUYA 3VRHA 5LP1A 2NTYC 3LDAA 1Z37A 3SZUA 2GKSA 2F8MA 3W34A 1ODJA 2GVDC 1ISMA 4MS3A 4OMFG 4Z9YA 3HJRA 3OF2A 4LVOA 3HUFA 2WG2A 4OXXA 3SBEA 1SU4A 1L1QA 3LUGA 3T7AA 4QG7A 1EU1A 4JOSA 4MW7A 5DCYA 3JQ7A 2XCQA 2G67A 1INLA 1NW8A 2VUTA 2GF0A 1L7BA 1RYDA 5IC5A 3SU8A 1QRAA 1Z5GA 3FBGA 3JSAA 1WEHA 5TDHA 4NG4A 1ZJ4A 4EAAA 2NU7A 2PD4A 3BXOA 4AG6A 2QLFA 1NM5C 4MI6A 4MQ5A 3C45A 3ZD8A 4WJZA 4EKNB 3ISTA 4J0GA 1YQXA 1PF7E 2XMDA 4DYHA 2DGDA 1Z6GA 2MWMA 3FVQA 4KMMA 1OXMA 2BFNA 2PQ0A 4L2IA 3ZXXA 4B2IA 3BL5A 2F8LA 2PUJA 2R5FA 3F6YA 2BFWA 2A30A 2Z0MA 2Q46A 3K2BA 4TWAA 5D3KA 4UXHA 3KCNA 5JD3A 4BVHA 2GR9A 2QT9A 1HT3A 5KIAA 1ZIOA 4GXRA 2YVAA 1TTQB 5CLQA 4MDYA 5HIIA 3IVGA 4X6XA 4B79A 1Z08A 3OM1A 2MSDB 3AR7A 4I6JA 3F5DA 2CNDA 4Y9SA 4PPQA 2QQGA 3VV3A 1FU4A 4DIKA 1N8KA 1DQNA 2DH5A 3TQHA 3UWSA 4E6EA 3MEQA 4CKEB 3UPUA 3MFYA 2X3FA 2JVKA 3A9VA 3EEQA 2BR4A 1KEZA 2WZQA 1JHRA 2R7MA 4IX1A 1U0OC 2Q5IA 1WD5A 1L5HB 1DTWB 1QGOA 1X0VA 2BDEA 2WJHA 3BGWA 3F6RA 2F3QA 4OHWA 4Q12A 5CFZA 3QEBZ 1T3LA 1P1KA 2XYQA 4KJXA 2QLNA 2P35A 3ME5A 4KRXA 1V8PA 4NL4H 1GPAA 4BJ5A 3OZUA 2OCDA 2JGRA 4KXMA 4D3SA 3X2EA 5DBHX 3KOZA 3HYTA 4XJXA 4QKQA 4MUKA 1NF2A 1KP3A 1W73A 4NI5A 3TIXB 2AFHE 2OYCA 1L7MA 4XIGS 1UKBA 4NJEB 2WHPA 4DB4A 1EVLA 3GJ6A 3NFRA 4GI3A 4IHKA 1CUGA 3KYDA 1QLWA 3HCDA 4H18A 2FW6A 1DRVA 1J2TA 1OV6A 1PX0A 5A9TA 4EHJA 1P2TA 2R65A 4RZXA 3H5TA 2BI4A 4UU1A 3U3DA 1X94A 4EB8A 1BA3A 4OFZA 5KQPA 4P2GA 5IFKA 2ODTX 3GRFA 1U02A 1XAGA 5CA1B 3AL0C 3GVCA 3ZNNA 3CE9A 4PHGA 5CT6A 5AKKA 5EJIA 5FFNA 3S55A 1CP2A 2JGDA 3KE9A 1R3UA 1Z5OA 2JIRA 3H16A 3KL4A 4AC9A 4HGOA 4ZO8A 2VP6A 1HYBA 1BQ4A 2UXBB 1FS5A 4K6MA 3ETEA 1V11A 3HCCA 3QGMA 2BZGA 5DTJA 3RSCA 4C0QC 4E08A 2P2GA 2YZMA 4CIXA 1GTL1 2V97A 1ZRNA 4WJLA 2JZCA 4A03A 3EVTA 4QHSA 4EUHA 5IARA 5C8DA 3GFRA 1TNDA 3FRHA 3LC2O 4OF4A 3VOAA 2YYSA 3SEZA 4PC2A 3L4KA 1HRKA 2VDPB 1CDDA 2R6ZA 3KQVA 1LUAA 2V4ZA 2GESA 2BE9A 3A25A 5DMXA 4DIFA 4OHUA 4JWTA 3INTA 4HWTA 3ADCA 3QLVC 5EMKA 5IULC 5L3RA 4B4WA 2Z8XA 1K3TA 3BDVA 4D3FA 2B5VA 3K4QA 2J09A 3RRXA 2PYIA 3SYMA 4PRYA 2L19A 1A9XB 4DNQA 3K71B 1HKUA 1GKYA 1TTHA 1NI5A 4JL8A 5HGJA 4B47A 3KBOA 1KKMA 3A1DA 1KDZA 3N70A 1JG3A 1UXHA 1ILEA 3G5UA 3IP7A 4DDUA 2WAXA 3P9QA 3GAZA 4C29A 1PBTA 4FYYA 3FRIA 2MSKA 3OIWA 2OFOA 2Q3EA 5FBWB 1JXAA 1M2OB 3NTQA 1TLLA 1RJ9A 2XD9A 1EVEA 1M8FA 3A04A 3GA7A 3H2JA 3FWPA 3Q2IA 4BWGA 5G0WA 1JXQA 3P0EA 1YU6A 4N7BA 4NF2A 1PD0A 1DIBA 3DM5A 4UTZA 5F4BA 4CMCA 1ZXXA 1HYHA 1U0HC 1V4VA 5E6UA 4X71A 3TUJC 2G9ZA 3JVIA 2WJ4A 1SZCA 1V47A 4ALNA 2VJYA 3W1VA 1Z6ZA 5SY4A 3X2FA 1F3LA 5FEMA 1RKUA 3ZX4A 4Y30A 1YBVA 4QTYA 4NK4A 3SOZA 5DNYB 3L93A 3VPXA 3NT5A 1BJTA 1QKKA 1YDHA 3W5AA 3AVQA 1KS9A 3ESDA 4QO7A 4CKZA 2HHCA 4FFMA 4KKXB 1WBJB 4C43A 1J9ZA 3TGPA 3QUQA 1OHHD 4QICA 5HK8A 4ENQA 3HEBA 2QD1A 1TK9A 4KKVA 4JEHA 1O6GA 5DN6A 3UO8B 1E7WA 4HXYA 2VPYA 1QAOA 1JR3A 1RI1A 1G6HA 3FR8A 1ZY2A 1G5HA 1V7PC 4YRIA 5DGCA 1R88A 2G9QA 2VR1A 1QOZA 3V55A 3S8YA 2PCJA 2GZAA 5LYJA 2WF5A 5AVJA 3K0HA 3SEAA 1SVOA 1LBEA 3U7FB 3E7DA 1MIOB 1QIIA 1Y3DE 4N3GA 1EWKA 2CDAA 1O54A 3R6TA 2QTRA 4FZJA 4PLHA 1ZHFA 2BLLA 2HPHA 3GELA 1WNTA 3PT9A 2FMFA 5CA0B 3WKEA 1B16A 4AMYA 5DGHA 5GTDA 2QQEA 4NS4A 2GX6A 3ZDEA 4AMGA 1U3WA 1NLMA 2V4MA 2SBTA 1WSWA 4K2AA 2NT3A 4KH1A 3KD3A 1AMNA 5IMBA 2XGOA 3VU8A 1C7JA 1PBNA 1V6AA 3A26A 1UODA 3ADPA 3IE2A 5BUQA 3AJ9A 4FEAA 3EAQA 1V43A 4AIRA 3JQAD 4L7QA 3AFGA 5ERGB 3U3RA 2CNKA 1CQPA 1G2OA 1XKTA 3OJCA 1QE5A 4NIMA 1QHHB 2RKBA 4OLBA 4ZQEA 5C4MA 2DTXA 5FR2A 4J75A 3EF0A 3LPLA 4CW7A 3DBRA 1FNNA 4UAVA 5DB4A 2X7XA 3K05A 4JOQA 1XDBA 5H83A 4OSEA 2WKWA 3UA4A 4MYCA 1J2JA 1KZ6A 4YAFA 1E1QD 5BT9A 4DYDA 3CT6A 5TQ2B 3HDJA 1MV5A 1OF1A 1QDEA 4AYWA 1CEXA 3F2VA 1MIHA 5DX0A 1RHUA 1FB5A 3W5UA 4KWHA 4EVIA 6REQA 3TCKA 6ABPA 5DHTA 3OCWA 2QWXA 5DMHA 2Z2YA 3SLRA 1GCGA 1R64A 1K8RA 3R7FA 3TW6A 2WVAA 3MMXA 3DBHB 1JU4A 3BIFA 3SF0A 1E2UA 1FTQA 4YMGA 1YF3A 3LT1A 2TMDA 5AK3A 2X0RA 2C5BA 1F3OA 1V1JA 3KVRA 3BBPA 3NANA 1WUHS 4EW2A 2Z56A 4KR3A 1H3EA 2RHMA 1WU8A 3RGWS 2ZWAA 3KPWA 3O8CA 3ZD6A 3LVQE 4BNJA 5JC1A 5FWDA 1KAMA 3VDRA 4B81A 1ORRA 1U31A 2H0QA 8ADHA 5AHRA 5JV5A 5DDIP 3U5TA 1FRFS 4FNAA 1O5OA 1UT6A 2IXBA 4NENB 3GUYA 5ALMA 4CT0A 1BHJA 1XQXA 2PL5A 3WISA 4EM6A 3EARA 2Z8YM 5BSHA 3WL6A 2Z98A 1XAJA 4NBLA 2LBPA 1E2MA 2WG1A 3ZJUA 1P7VA 4EJ2A 1SBHA 3ZQKA 2NP6A 1I33A 4CN9A 3I5XA 2X2OA 3ZZNA 4ZGGA 2YMMA 3LA6A 1H6AA 5GPBA 4HH3C 4NBKA 1OB5A 2D0IA 5K3BA 3ZH2A 2HBYA 3Q9LA 2J0QA 2WHEA 4WBXC 2C0QA 4ZN6A 4DLXA 3OU7A 1BE8A 1GPDG 2Q8PA 5C0OE 4TXNA 4EA7A 1YONA 3PYXA 4HUQB 4QGAA 2H1LA 3QVWA 4FZ3A 5K8CA 3UGJA 3ZU4A 1HNWB 1DHRA 1BW9A 2ZBUA 4IQ4A 1I14A 1R0WA 3FTQA 4PGAA 4WADA 5EQJB 3I8OA 4A8HA 2YIVX 2YWXA 4E5UA 3HM2A 1S2NA 5FXMA 1YZYA 5EIFA 4KGDA 4L85A 3T5AA 3OU6A 2TS1A 2W71A 2WW8A 3T9DA 3L4JA 1D5WA 1U8AA 3EF3A 2NV0A 1OAOC 3UMVA 4F3NA 2VDOB 3VOTA 5DYTA 5HKKD 4AQ7A 4YRZA 2Q99A 3C7TA 3R9WA 5LNK1 4UTXA 5KEIA 3KSBC 3R1IA 2YHAA 1CZUA 5ALZA 1OSNA 3FXAA 4G0UA 5F2OA 4N3AA 1P4RA 2G7ZA 3VPFA 5HBRA 4F45A 3EPJA 2WJAA 5M04A 4MYHA 2YYYA 2PRJA 4KIUA 4PZAA 3GRRA 3PVZA 3R6WA 1EBBA 3HCOA 2RGEA 2GA9A 2EKDA 2V8OA 1GFSA 2ERXA 3WTCA 4E14A 2HXYA 3BGSA 4YAIA 3CVXA 3KPYA 4EUEA 1YR2A 4LZWA 1COWD 1OROA 2QOEA 2ZSIA 4PFSA 1H94A 1DRUA 1GAEO 2H2FA 1GPUA 1L3BA 2QU8A 5IC4A 4UEOA 1H0SA 3M33A 2HQBA 3S2IA 3NHJA 1RYEA 3TIIA 2V55B 3VOSA 4AJ2A 1IXKA 1H23A 5C5EA 3D5QA 1AGRA 2J08A 5CR9A 5HJEA 3LF2A 2WPNA 4N49A 5ILQA 1ZD8A 3DT8A 2JAUA 1JAZA 5IM4A 3EMKA 2RAUA 1T36A 4JQZA 5TXGA 5HOQA 2QZPA 1ZK4A 3L7NA 1HKHA 3VKVA 4C3OB 4E2WA 2BZSA 4B8YA 1RVDA 2XNKA 7YASA 4JXZA 2FWIA 2GBIA 3H1FA 4PNZA 5D3MB 4E7PA 4IV5A 1FX0A 1FC0A 1OY1A 3RBXA 3F5FA 1K3FA 4LHWA 4CLRB 5J4VA 2G80A 3G8YA 4O2AB 3HFSA 3LWZA 2PZAA 3L07A 1FP4B 1R0YA 3CGWA 4P4TA 3ZLUA 4GC5A 4ZICA 4ZJUA 3AF6A 3AVXA 2A4MA 3FF4A 4TTIA 4V03A 5A0VA 1AB6A 4CUJA 5AI8A 1U1DA 3D64A 5B6JA 3LX4A 4F38A 4KDEA 5DO9A 4ZOEA 1X1RA 3FTPA 4RW0A 4AP6A 3EA0A 3CPSA 1DADA 3V4SA 3MS4A 4I4LA 5LZ2A 2IOYA 4FHFA 4OA5A 2GAJA 3IDQA 5ANRB 1JQLB 1JR3E 1PR1A 3WSTA 1EBFA 1PL8A 4Y2VA 3WWZA 2QBYA 3K35A 1KDOA 2VZLA 2QTMA 4C4TA 2WDZA 1N0VC 3IQXA 3WLPA 2QAGB 2OT3B 1HFJA 1WX1A 1A8PA 3LCJA 3OT1A 3RFVA 4PC1A 5IF3A 1JJFA 5DLPA 4D98A 4YRGA 3WGTA 2I8CA 1DC8A 4D96A 5JSUA 3LI2A 1C3OA 2AA3A 1K4MA 2J67A 2VTKA 1G7RA 3OCVA 3VO2A 2PMDA 4BMNA 1Z33A 2IEDA 2IPNA 3EDYA 2ZBVA 2CLHB 5DX8A 2VDRB 5JSKA 4C4AA 2FTKE 4EG3A 1W35A 3RIMA 1RSZA 1Y8RB 2K6GA 4B73A 1H6BA 3BWDD 2HQRA 3AG5A 4J94A 3STVA 2B61A 2YW2A 1T29A 3A27A 4KVGA 2XXJA 4YRRA 3BL8A 2XB9A 4O63O 2HWKA 2P3OA 1ZD4A 2OLKA 1ODTC 4IRXA 4A8PA 1GV1A 4I99A 2D2XA 2H54A 2VRCA 1P7WA 4HN4B 1G8AA 2GZHA 4XD7D 2OO5C 1Z0SA 3RUPA 1Z4QA 2AF4C 4IDDA 1KK2A 4H6PA 4R7GA 3Q0IA 1C7EA 3BDIA 1H8HA 3T4UA 1SNYA 3LQKA 3NWJA 4HNAB 3FF1A 1ZJJA 2CV2A 2DF8A 3R3SA 3RYIB 3W1WA 2VRCD 1DXYA 1RACA 1T4GA 4MJLA 1X7XB 1AKWA 4BJHB 4PLTA 2MYNA 1HG0A 3B5EA 1JVBA 3GBSA 5DASA 3RR2A 3KIPA 4JLDA 3W3AD 4E6PA 1E9DA 3BE8A 2YXPX 3H1PA 1UMBA 4P38A 2DT5A 3HYLA 4FT2A 2X5JO 2AVDA 2W2VA 3MMPA 5IBQA 5K3FA 1ISPA 5BV7A 3IUPA 2XX3A 1DRKA 1W4BA 4HDNA 3GVXA 4JITA 4N0DA 4YA6A 2Z2JA 1KOFA 3DE3X 1G2IA 3O7MA 3UJ3X 5DSTA 4EMSA 5C81A 3FUUA 5JDCC 4PGHA 3INYA 4H7KA 1DG1G 3URKA 3TR6A 3R40A 4E5VA 2DHDA 3G85A 3PQ8A 3L6RA 2WD8A 2BP7A 4C5CA 4RIFA 1ZR4A 3NWPA 4GSKA 1H2ZA 1SC9A 2F90A 2YXEA 1YZFA 1FYWA 4EL5A 3LC0A 2UUPA 4EGCB 4FI3C 1Q44A 2NVUB 1XZAA 1FZQA 1I4DD 2QRZA 3ZN2A 1AN9A 5C8YA 3WKCA 3DWIA 2XRZA 2W2PA 1YIOA 3FCSB 1JTVA 4J4TA 4D1YA 3QWAA 2O54A 1DDGA 4EB0A 4EX6A 2JCYA 1FDRA 3OUZA 2VS1A 4YJ2B 3VZCA 4B87A 4F93B 5LWHA 1C9DB 3AY7A 1N0WA 2QN1A 2G3YA 4QYWA 5D84A 3TQTA 2IC5A 2WJIA 5FOTA 4NSNA 3ZWMA 1QXSA 3L0CA 4AY2A 5JR3A 4Q7LA 3QVKA 1REQA 4RSMA 4BQOA 5KUTA 5IXYA 1FEZA 3CXUA 2ZTUA 4HMOA 4G37A 3COVA 4FB5A 3ND5A 4Q3KA 4J7AA 4F4FA 4OGLA 3ASYA 4XH9B 2OOKA 2Z43A 5FYDA 3O4RA 4ZI5A 3TE6A 1I94B 1B1CA 5AK5A 3D8UA 2H2IA 4W7HA 3K9BA 1OH8A 3OPVA 3FAKA 4UDNA 5TRTA 1P77A 2RHCA 3QWFA 3TW4A 1V5IA 4BP1A 6PFKA 1UADA 4LZPA 5AW1A 4RPGA 1BQEA 1CUZA 2WIJA 4PSDA 3RRJA 3PDJA 1RQGA 5E95A 1PW5A 3BMOB 4MV8A 2GXUA 5AT1A 4TMZA 3PITA 3BTOA 2Z6QA 1HLDA 1AKUA 1MXFA 2FUNB 3RVKA 5ARCA 5I8ZA 3ZVKA 2HA6A 4PSKA 3W79A 4DA6A 3SJBA 3ZWDA 3SC4A 1YDGA 1H22A 3P4XA 4CM7A 4NCBA 5DJ5A 1YTUA 3PDIB 3CE6A 3NYQA 4G5SA 4N76A 3AETA 3KQTA 3DNPA 4RELA 3T94A 4CU2A 2XAAA 2HREA 3H65A 3O9MA 1M6VA 4Q02A 4YC7A 3WGQA 3OE7A 1NFRA 1K6XA 3IR7A 4RL4A 2RBEA 3IUSA 1L4YA 1Z73A 4DILA 3HGMA 1IHYA 3P9KA 4PCUA 1RPTA 4C2UA 1WCV1 4Y6PA 2ZRHA 2R1UA 4QC2A 1KJIA 1OI3A 3CJRA 3VHRA 4M0MA 2FE4A 5ITSA 3GARA 4P82A 1U7OA 2XYPA 3RPEA 3FCYA 4BEWA 1J70A 2H06A 2FK8A 2WAMA 3IBYA 4W5JA 1T4CA 1N0HA 3D4PA 3HEMA 4MGZR 1ELOA 5EUMA 3RUEA 2Y67A 3NDIA 3OQ6A 4DPMA 1C30A 1HYQA 3LM8A 4DZTA 3BG5A 1E5DA 2J9YB 3OMWA 4C14A 4HC4A 2PKRA 3T1YB 3DWGA 3QBVA 1FUKA 3UFXA 3KKMA 3WC4A 3A1NA 3RHTA 4DIUA 2R47A 1SXPA 3EOBI 1W85A 2VDJA 4CJXA 1P0CA 1YL5A 2CKDA 3D7NA 2F59A 3NBUA 2XVYA 5JQGB 1M66A 1B7GO 3N2YA 3NTXA 5EIXA 5F76A 3WYCA 1R18A 4GMFA 2BPOA 1MJGM 1RBYA 1WNFA 4MJ3A 4F9EA 3WLJA 3W7VA 4EB6B 3GGGA 2A3NA 2BGNA 3M4XA 4RD3A 1FPMA 2ZM5A 4ZTZB 4JI8B 3E4CA 1LBIA 1XAIA 2XMSA 2VNJA 3K70D 3WL8A 2RDMA 3FYHA 3ACCA 5EKTA 1L0BA 1NC3A 2XMCA 5GZ3A 3DCYA 4II3A 1BS1A 1HEIA 2FKNA 1USVA 2Q2VA 3GJ0A 4R2LA 3RVBA 1JG2A 1LFDB 5FUMA 2WKRA 4CQMA 4LDRA 2PZBA 1NUTA 4DLWA 2UVPB 3C1AA 2IYFA 2GDZA 2XUAA 3LW8A 4KLNA 4KN6A 1T34A 3F4KA 1J0DA 2AC2A 5HSGA 4BO7A 3A3PA 1W1WA 5HMLA 1NP7A 5K45A 3CVVA 2JFFA 4YMIA 3AHHA 1H69A 3BQMB 1GL7A 2OWEA 2WA2A 2INGX 5A4DA 4P4GA 3RU2A 1I0ZA 4R9VA 4Q48A 4C3UA 1DWQA 3GD5A 4N6NA 2KWIA 4XZ3A 3WZ2A 1GTRA 3GROA 4RE5A 5AO9A 2C7QA 2X0JA 1YR7A 4NCAA 1PEYA 2J3DA 2F17A 2CLMB 2H4HA 1KI6A 3UF0A 2XPCA 1P75A 3O75A 4HN9A 4I1OA 1JAIA 1IH8A 1GAWA 2QLBA 4BEVA 1FP7A 5FA5A 1GUBA 2PWYA 4HAOA 2PUAA 2R6GA 1P2FA 3NYIA 4MMXB 1QKJA 5I7SA 3NTRA 1Y7TA 2A94A 2VH1A 2RSLA 3ZPXA 1VI6A 3G3EA 4QPDA 3ET5A 1PEKE 2REQB 2HW8A 4CPDA 4HUJA 4Q7MB 3IHKA 5CIQA 1K6EA 2IF2A 4NMMA 4OXQA 4ZKDA 2WSMA 3R44A 5BUSA 1TKRA 3A9SA 2XUIA 3NBMA 2HJGA 3GJTA 2DLCX 1RP1A 2XQJA 2ANBA 4NYIR 5DHSA 5H8WA 1UF9A 1YIAA 1XEFA 3PT5A 3KUXA 3WLAA 4CNBA 3LFTA 1H2HA 2PX0A 1HQKA 4R01A 1T9DA 3I2HA 3LNCA 3QE0A 4JSTA 4D4HA 2QRVA 4TT3D 5IXJA 5JFGA 5BYKA 2CJWA 2IXAA 2N42A 3ZS9A 2Y68A 4UEJA 4YLEA 3HXTA 4DNFA 3KQNA 4GDFA 2BMEA 4FGLA 3BMNB 4HGRA 1JMVA 2QAIA 4GYKA 1LRKA 3MT8A 4H9GA 4JNCA 4BU1A 3FI0A 1CXZA 1E6LA 1E1CA 2A58A 4GPEA 4MRAA 4OOFA 4D4LA 4F3CA 3T3NA 3FYDA 1LWNA 4MRMB 3EFOB 1W5EA 1DV1A 4YP7A 2ODBA 1Z5NA 4I1RA 2NUAB 3VMMA 1TRHA 3B1YA 4MA5A 1QNFA 2F4NA 2FFJA 3F3MA 4Q1AA 1UP6A 1Z12A 1THMA 5EZ5A 3FUWA 3N8KA 3QKSB 5EHNA 4RDCA 3A2LA 1IBCA 3WLEA 4H1HA 1FFSA 2CNNA 3QPWA 4FC7A 1X8LA 1Z45A 3HCWA 4MI3A 4D6YA 1P31A 3QBTA 5DHQA 4OFBA 2WAAA 2V65A 2UUOA 4PR0A 1AV7A 1CUJA 1WXHA 3QXSA 2H92A 1Q7RA 3OFJA 4JEIA 2O8VA 4RQAA 3T7EA 5B7QA 1XMQB 2QLLA 4US0R 3NM6B 3UN1A 4N41A 1MQ9A 2F00A 4PZDA 4PAWA 1UWLA 2RGBA 4BNVA 5LMUB 3U80A 3JQEA 4RJ2A 5JHGB 1QH0A 4DUGD 3TECE 1NXTA 1IB6A 3UJAA 5ER6A 5KYXA 1QWOA 2EWVA 3ROMA 3SBOA 5HIKA 2VZ9A 1HE5A 2IPOA 1UFRA 3PSAA 1JFFB 4TRRA 3AY0A 4YUZA 5J23A 4RK4A 3ZKWA 2YWJA 3MS7A 4TTRA 2X23A 5ECWA 3K1AA 1PV4A 2FPOA 2JVIA 1PKEA 1SHLA 2RFLA 4UXJA 3H83A 4BKUA 2V5VA 1NMYA 3ESBA 2WAOA 2FRDC 2ZYUX 3HDHA 3K9GA 1DL5A 3HSYA 3LOUA 4IXNA 4ZAYA 1JHMA 2F9LA 4RTQA 4NYMR 2PZMA 1AGPA 1F8UA 1DQPA 1AG9A 2PZ8A 2JLYA 3AB8A 4X6LA 4X3CA 5LKRA 2AJ8A 5JJKA 3UMMA 5F78A 3HNRA 3ZK7A 4LK2A 1WZCA 1Y5LA 5C31A 3JD2A 3IE1A 4NHEA 1F0KA 2B8TA 2P9YA 2D0OB 2V5UA 1QUEA 2JFYA 3CX8A 3DE0X 3KPJA 4MVJA 4C06A 1FTNA 5IU6A 2PKWA 1X80A 1FBTA 4AFNA 5JEDA 4BBZA 1NYTA 1OASA 2I8AA 1S6YA 4G97A 5FTWA 3RBAA 4J2TA 2BOVA 4EEKA 1R8QA 2JA2A 3T34A 1OLSA 1IQ0A 1ZJYA 1A0OA 1YACA 1ECJA 1NBMA 4FE3A 4FT4A 3W04A 2I2WA 1HPLA 3WYAA 1IG3A 1X9GA 3KKPA 3MQ4A 4QOJA 2EW2A 2AR7A 2J1LA 3FBTA 4AM8A 3FKJA 2ZUDA 2DR0A 3OZIA 4E7OA 5JH7F 4PSAA 2CJXA 2IS1A 2RB4A 4H7HA 4U8GA 4BEJA 4JVSB 3IEXA 3IYLW 3N0XA 3OX2A 4D8XA 1AZWA 2JFBA 1T13A 2JGIA 1FBNA 1ZH0A 4K3VA 2IPXA 4MRSA 1YS6A 2DWUA 2QE7D 3C3AA 2HZ7A 1TX4B 1RR6A 4WN3A 1M33A 1OC2A 2P5SA 1F5SA 1WPGA 4RMHA 4ND2A 4C22A 5E4FA 4C0KA 4FEGA 3PNVA 2HJSA 4ACBA 1PR4A 1XTVA 3R5XA 3OZWA 2BEUB 3LHSA 1XNGA 3RUFA 5ARDA 3GPCA 1M75A 3O1LA 4U00A 4HLUA 3UUGA 5CB4A 3DTVA 2BY4A 4MP8A 5CTJA 4Z7NB 1GQ2A 5FOSA 2HO5A 3RIGA 2ZDGA 3CEHA 4IX9A 2V03A 5HIAA 2B2NA 2AZDA 4GZMA 3WICA 1AKYA 4WBNB 1C4XA 2WICA 2WJPA 2VTVA 5A5GA 3QX3A 2E55A 2OD2A 4I6EA 5CCEA 2WUFA 3GQBA 3K09A 3LUPA 4YCMA 1J5EB 2BLNA 3CC8A 1ST3A 1M9NA 2GHIA 1RJEA 4G6ZA 2BISA 2QIPA 4TSRA 2EC5A 1CWUA 4B3BA 2MHCA 4OQPA 4QAJA 4ARZB 1CJMA 3VZSA 3LSTA 1NJSA 4HWGA 4JN6B 1BEZA 3AG6A 4NBWA 5EEHA 3TVYA 5EE1A 4EX7A 2X3UA 2C7VA 2G4CA 4R71A 1QG6A 1WB4A 5LQAA 5IAGA 1EB9A 1I51A 4QA9A 1T4DA 5A3JA 2GGSA 4BMVA 4A6DA 3I1IA 5F73A 1A82A 1A95A 4QASA 3UCXA 2X86A 4GYJA 3BERA 3H2SA 4COKA 4S1WA 3U81A 4BKRA 1B0UA 2GKOA 3C6KA 3R7NA 3OPYB 2WI8A 3CHYA 3NALA 1LDNA 5L3QB 1OH6A 2ZZNA 1SPBS 1TO6A 3I6ZA 5T4BA 1POXA 1FP2A 3LPAA 4C5AA 1VIYA 4PSVA 3PGLA 1OU4A 1EZ1A 4BPBA 2XLBA 5C51B 3LP8A 1XZQA 5JMPA 1I0IA 1LPOA 4WFQA 3V4LA 3HKEB 4BGDA 4RNCA 3C7DB 5BR8B 1QGED 4K9DA 1NKTA 3K0KA 4GSYA 5DW0A 3VJMA 5A9SA 1ZH8A 1N7JA 2OP0A 3KB2A 3ZWCA 5H81A 4BRSA 3QMVA 1PJQA 2J9FA 5HBGA 2PVSA 1WLSA 4ZYTA 1NW3A 2JBWA 4UVDA 2R4UA 2YNMC 4D9EA 2OMKA 4Q66C 4W1SA 4DLZA 4R68A 1JI3A 3DFKA 2H7XA 3SYRA 4MV6A 1T5LA 1BMDA 4IZOA 3DXZA 2PJUA 3D0KA 5EQDA 5A1TA 3G68A 3QKWA 4M36A 1PFGA 4BFTA 3OQOA 1IQPA 3DDCA 2H4JA 2FQXA 3F2IA 2XDQA 3TH5A 4OUDA 1L5KA 4BLUA 3CUKA 3I92A 1L4NA 1NX9A 2DG2A 2WJJA 4O4JA 5CH3A 4OSPA 1EFHA 3AHFA 5DHPA 1YULA 4AJKA 2C4MA 2ZRNA 3A9UA 1ODIA 2Y1GA 1UJ2A 4NK5A 3W6OA 2A1TR 3CN9A 2X1HA 4NXMB 2QYTA 2WUEA 3KAQA 1B8VA 1T1IA 4F21A 3UOAB 3EPRA 4TKMA 4FFNA 2BE7A 1CIJA 1W52X 3AOGA 3HHPA 4XRRA 3RW9A 3AM5A 1G3MA 2I2AA 3IERA 4G67A 5IZCA 3NHSA 1JBQA 4K40A 1HSOA 3PUKA 4N5IX 5EHQA 4FGZA 4YMHA 4D9HA 4KPEC 1QR6A 3ZOKA 3BDAA 4ZVOA 1O03A 4AZVA 4EYOA 1E94E 1U8UA 5IVDA 2GKGA 4JLJA 1CLUA 1GADO 4V24A 1J00A 4ZREA 1SQGA 1D03A 1M74A 2I4MA 1LCIA 1CP3A 5REQB 4BO5A 2PR2A 5BW6B 5C8VA 4S1PA 4P3KA 2RG7A 4MR9A 3VSCA 4LJ4A 1RP7A 3KQWA 3TI9A 2NW6A 2NTJA 5AHXA 4KX3A 2ATVA 3MF4A 5T7BA 3JRXA 4KVZA 1DX6A 2H85A 3WDSA 4K1LA 1HSZA 1U3VA 3I3SR 5TMDA 2IXGA 4N18A 1R9GA 1TEVA 4RXTA 2R7KA 3SS8A 2FF5A 3TD6A 1W88B 5E3HA 2WKSA 1P29A 4REOA 2R1ZA 3L6OO 4ZI7B 2ZJYA 2OWDA 4GKAA 4ETNA 3FNEA 4QBFA 2G77B 1BG6A 1ZD1A 4EHFA 3NX4A 5A4AA 1GR0A 3EEOA 5JJIA 1N3LA 3B9BA 5JC8A 4R1QA 4O6VA 3T1VA 2ZSKA 4XM2A 4TQUS 5KHAA 2XOXA 5C5IA 4MAMA 1IZYA 1G0NA 1QZZA 1QTIA 2W6NA 3D4IA 4MRVA 4BJ1A 4X00A 4JQOA 4WZBE 5BNZA 1RM3A 3UCFA 4U7DA 4BZXA 2QRVB 2ZJZA 3JATA 4RETA 3RHFA 1CDEA 4I7EA 5TPZA 1VHWA 4BNLA 1BE6A 4G8CA 1EK0A 1R8SA 4J0HA 1AE1A 3H0KA 2O8EB 3QSYA 1Z07A 5EA2A 3G1WA 4ZAXA 1F1BA 1AKEA 2D5IA 2FSHA 4GMGA 1W4RA 3ZU6A 5C52B 4B4UA 2XUPA 3T7TA 4HEA6 4BMOB 2E6KA 2V7UA 2XQGA 1LBTA 2BFAA 1V2HE 3DEHA 3UXEA 4DV4B 1UH5A 3SZ3A 3AEXA 3VOBA 4M87A 2YR0A 3K30A 2QG9A 4N5HX 4TOIA 4KOEC 3P2OA 5FTLA 1SBCA 2FN4A 1YK1A 3VPDA 3TX2A 4WH0A 2P9ZA 1IVSA 2FXVA 4EG8A 3C3MA 1VRCA 5L7WA 1F7VA 3QXHA 4H7JA 3IP1A 4IOMA 3VYRB 1AXEA 2JAXA 3KM0A 3MILA 4Q9JA 1PZGA 3UKOA 4BO8A 3ORFA 5IM4F 1Q0SA 1OLOA 3EYAA 1UM9B 3A9WA 3TX6A 4DVJA 4M0DA 4C08A 1M1XB 4P5DA 3ZLVA 3AYXB 4MVXA 3VR6D 2RGCA 4JLOA 1HTTA 4WESA 3VVMA 3S2SA 4F9FA 4Q24A 1QHYA 1Y8AA 2Q6OA 2HMVA 3R7WB 3RASA 3HVIA 1ZNWA 3IXMA 1HR0B 5A2QA 1UDRA 1KPHA 4ZOLA 1QHNA 4G5OA 5JU6A 1MC1A 1VBNA 1XU9A 1DBIA 1XO1A 3M2PA 1FVFA 5DI9A 3PKJA 4DR2B 4JD5A 3JTMA 3P4UA 3ZYCA 5GOZA 4B44A 5JXWA 5COQA 4MWSA 5KNCH 2F64A 1KQ3A 1PR2A 1RLMA 2GWHA 1VJ0A 3PX7A 1EJ0A 4H3HB 2YL2A 3M6UA 2Z6AA 1PT8A 2VPTA 2FE1A 3K5IA 1FDUA 2NO5A 1S3GA 3DO5A 1CFZA 3HN6A 3PZBA 1VLZA 4YRTA 5D01A 4D3DA 5CXUA 2W6IA 1Z0ZA 4KPUB 4I50A 4KC0A 3AUAA 4KK3A 5TQ0B 2WTEA 1NJ5A 3IQHX 4KYTA 4EGFA 4XWKA 1YQ9A 3C8DA 1N57A 1GRVA 2BFCA 1UJBA 2GPYA 4GHWA 2IF0A 2FUG1 3N2KA 3EPPA 4GWLA 2YTZA 1RM4A 1Y3IA 2DFTA 3QE3A 4RX1A 1GPNA 5E38A 3HL4A 4MKZA 4E51A 3I6BA 3L7KA 1WW8A 1JLLA 1T9AA 2YXBA 4FGSA 3LGXA 4HDMB 4HNSA 4KQWA 3V4PB 2NSJA 1KDVA 4HDOB 5KYYA 1FX1A 3H86A 1H0HA 1LY1A 1M1YA 3USZA 1C0LA 2B7BA 2PWZA 4HGNA 1P0QA 3U48A 5KQMA 3BSSA 1UEIA 1LX7A 5B2ZA 1Z5PA 4IBOA 3IT1A 1QPZA 4DADA 4L4RA 2CEAA 1ZNXA 5IYZB 4WOBA 4DCVA 3ZHRA 4GVXA 4FBMA 1DUIA 3LECA 1KYTA 4TMVA 1GCIA 3O94A 4WKNA 3NHKA 4MVJP 4LTMA 2YQZA 5TARA 1TUBB 5FPQA 3DFZA 1YVUA 4OO3A 3T5GA 1H1TA 2IUYA 3DVQX 3H9JA 3IEUA 4XQ9A 3UBTA 1J33A 1IIBA 2CHGA 3NHWA 1QH8A 1K98A 2A1UA 1GRNA 4HQFA 4XDYA 1DFHA 2C03A 4IIYA 4M3NA 4V0KA 2JFQA 2ZOSA 4JX9A 3TF5A 1PNVA 1OXXK 1J25A 1RABA 1Y4DE 1XTJA 1VZ3A 4JL6A 4LC0A 4MHOA 4O4LB 4YRJA 4AKIA 2PA0A 1ODKA 4C4ZA 2OESA 3MJVA 4GLOA 3RJMA 1SR8A 5LBUA 4IMPA 4BO3A 2ONZA 3QLEA 2ZB3A 3B3AA 1V95A 3WMXA 1MEOA 1MO4A 2GAOA 4U2KA 3HSSA 3RVDA 2A8YA 2TMKA 2PKCA 1C0KA 2IIBA 4QUJA 3TXAA 3GB9A 1UJ6A 1QS0B 2FUEA 4MS4B 1Q0TA 4OB8A 2JZNA 2VSNA 5TR9A 4YJ2A 3K0SA 3G2PA 4EI7A 3OQIB 3VI4B 1VPTA 2EKBA 2IU0A 5A06A 4ESVA 2HJ9A 3E1GA 2HJRA 4J1NA 3G9UA 5JEEA 1L8XA 1ZD9A 4O4HB 4IDQA 3UW1A 3U7QA 1Z5VA 4L8FA 3ZDXB 1XRNA 2GAFA 1U2QA 4IDPA 1BFKA 2XXAA 3L8EA 4JR1A 4WVFA 1R4MA 2H6EA 3LO5A 4F56A 2H1IA 1VJ5A 5DPMA 3BOSA 5HX7A 3PQCA 6AT1A 4MWEA 3GJZA 5I7HA 2DECA 3TZBA 3RKRA 1LTQA 4LJLA 3R7LA 3EFEA 1JKFA 2C8VA 4BDTA 5JQWA 2B37A 2IYRA 4RTKA 3QP9A 4Q4AB 4RULA 3IAFA 3UTCA 2QL6A 3I76A 3KYCB 5BRNA 5B58T 4XLLA 1K27A 2YV1A 4QTXA 3W9UA 2DJ5A 4CL3A 3FW1A 3L0DA 3OSUA 3FGZA 1II9A 2HI0A 2OQRA 3HDVA 4QPJC 2WYUA 2QW0X 3Q72A 3ZDYB 4F4IA 5BQFA 2I1WA 1GNQA 3EIWA 3OZSA 2BFEA 1K7CA 4GBJA 3I8SA 3WQSB 5T8KA 1I1NA 2D8AA 2YHUA 4KLCA 4CL0A 2E82A 2WWTA 2VHUA 4N0QA 3F4BA 3G89A 3GJ4A 4R9SA 3MRVA 2GMWA 3HKEA 4QXRA 3WLKX 3ZUPA 3SC6A 4L5CA 1JFSA 2HGSA 4QIHA 1OGJA 3H97A 3QH4A 2EX4A 5KYWB 2ZUEA 1XR3A 2J9FB 3H9QA 3AM3A 2HH9A 3KYIB 3NEPX 4YDSA 4F1KA 2W6ZA 1AKQA 4IIHA 5JI2E 1NTOA 4KN5A 2HSJA 2RK4A 4AJHA 4Q7JB 1DDIA 3EVCA 5BR4A 2CJFA 2B30A 2C29D 4ENUA 2GO1A 3DHWC 1VHLA 2QM8A 2JJ1A 4BTVA 1CV2A 1C1YA 1EXNA 5HS4A 1N3BA 3ZHQA 4YIHA 2OQVA 3MQFA 1GTG1 1T5OA 2JJMA 4HLQB 2YHIB 3WHIA 4R8MA 5JAUA 1VI2A 2GD2A 3AFIA 4ZEOA 2IYVA 4H1TA 1UIRA 5AKGA 1EAMA 1ZISA 3BFPA 1KMNA 3R3JA 1I1OA 3NT4A 3BAZA 1V25A 4WQMA 3UWMA 1JF8A 1E2EA 1DHTA 1J8MF 4EG6A 1UKZA 2P77A 4XPIA 5KCZA 2Q5JA 1HX7A 1WOMA 1IEWA 3DKKA 3MS2A 4HL6A 5U4QA 4Z4CA 4BNUA 4RSRA 3KKLA 4MVJH 3KZCA 2P2YA 2Q1UA 1ZQ9A 1OWOA 2PTGA 2OUIA 4PQYA 5HKKA 3QKRB 1GA1A 3UJDA 5HJ5A 2PO5A 2GBPA 4BZZA 1Y9ZA 3C8ZA 3RV3A 1W19A 3T12A 2PVPA 4B6QA 1GAQA 1ADFA 2AHRA 1JTFA 4KFTA 1ZHOA 4KXVA 3ENZA 5ALSA 1QOPB 1LTHR 3OTGA 2LCFA 4YRCA 2F8SA 4NQZA 4FDUA 4HWRA 3K32A 2FPRA 1JA9A 9LDTA 2IZ0A 5FOUA 2R8EA 3DFIA 2XCLA 3CKMA 2HLDA 1XD9A 1E1YA 5FKJA 3QELB 3WBJA 5KNDA 1E20A 2BCJQ 2V6FA 3F6PA 1KC3A 2BL4A 3AHEA 2XNSA 1FW6A 3DXFA 4Y18A 4IIJB 3JZAA 5C34B 2HK6A 1IOLA 1ZLXA 1HOTA 2O2DA 5E1DA 4AWBA 1FW8A 4W5RA 4UCXA 3FKQA 3K9HA 4HDAA 5JATA 4DV2B 2HRZA 3EODA 2CN1A 2P1RA 4I55F 4QGHA 5AXAA 1YA4A 3MUOA 4N7MA 1JEQB 4L57A 2DQ4A 2J3EA 2HA0A 1DUSA 2XH8A 5FWYB 2FXIA 1XLTA 4XSGA 3OIVA 1L7DA 1NYRA 1THZA 4DDTA 2QR5A 3I01A 4UATA 5CCDA 5HCIA 2GPNA 4L76A 3KFVA 3OOEA 3AMVA 3UK0A 2XJ4A 3BB3A 1ES9A 1N5LA 4RFSB 2HSZA 4ZIRB 3KPVA 4UEKA 3NP7A 1XPOA 1ZH6A 3MCAA 4FDTA 4Z1MD 4ZTUB 4PQGA 2Z6UA 3OY7A 4EGAA 1RYNA 1FTYA 1SA0A 3PGKA 4NAUA 4C4SA 1TI7A 4MW2A 3RRFA 4CIDA 3UWKA 4YV0A 1R00A 2XUZA 1UBMS 1SQ0A 4GVPA 2GK7A 4AAYA 4PQFA 5CT8A 3E1KA 3EUFA 3F97A 3MTJA 5DTMA 1U8EA 4H6XA 4Q3OA 1Y8QA 4KN8A 3VPSA 5CDFA 3EDCA 2JI9A 3DHNA 3GRVA 1KI2A 3PI6A 4FZ5A 1V7CA 4K9KA 3EWSA 4L4XA 1CD5A 2Y8EA 1G8KA 4RTOA 2HXSA 3OETA 3RNOA 3FOCA 4XIYA 4JP1A 5K3AA 1OT5A 5CA1A 5E6SB 3MCWA 1TYBE 3RBZA 1K6JA 2YVUA 4D9CA 4F8YA 4F4JA 1LC0A 1KYZA 1T1EA 4QDKA 2ZIAA 5ECGC 3EGVA 5HILA 3RTAA 3RSZA 2W70A 3P4YA 3K8QA 3ZDCA 1EJ6A 5AJUA 5CYGA 1NJ2A 3PQ3A 2A1TS 1WB5A 3WLTA 5CVUA 2JDIA 5EWJB 3NVMB 1QGUA 3CMMA 1DLJA 1E3WA 1X38A 1E3EA 1W44A 4EBFA 1NJGA 1NUPA 2QRHA 4U3JA 5CDHA 3BFVA 2BFMA 1T2EA 4INAA 2I2BA 1MJGA 3ABIA 1IVNA 1JQAA 3E2IA 3KLBA 3NGLA 4IDNA 1YA6A 5IUJC 3KOUA 4XB2A 3D7RA 1VP3A 1TJYA 3ESZA 5J1TB 4YRSA 4YV1A 3L3BA 1ZVKA 2G5CA 4OOEA 4M1WA 2AD5A 4N0PA 3OZRA 2AKEA 3M1LA 4IO0A 5AI6A 3P1JA 3NXSA 1KNXA 4XD2A 2L0XA 2Q62A 1LNSA 1QYXA 2WFAA 3HADA 3S7ZA 2R8ZA 5TPZD 3MGKA 1UBGA 3BHJA 3K8ZA 3NTOA 1AXRA 4MI1A 2Q1WA 2D62A 4R9NA 3U61B 1MQSA 1JA0A 3LVBA 2R86A 3N2KB 3OEHA 3I01M 2FW9A 1QZ3A 3JCZA 4FCWA 4FLFA 4RABA 1FCJA 5PGMA 1KETA 1MEJA 1PWEA 3EUWA 4DV0B 5JNRA 3DE4X