3RODA

Methyltransferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
259
Chain Sequence
SGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide N-methyltransferase
publication title Structural basis of substrate recognition in human nicotinamide N-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.1: Nicotinamide N-methyltransferase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3rodA00
3RW9A 5FHQA 2K4MA 5K05A 3JWIA 2IH2A 3FYCA 4KWCA 3THSA 5BP7A 3CJRA 3A4TA 4RTQA 2R6ZA 4RTOA 3MERA 2FK7A 2YX1A 1M6YA 5BW5A 3EMDA 3HVKA 4H0NA 2NXCA 3HVIA 2G71A 3UFBA 1VP3A 3M6VA 1P39A 2FRXA 3OFJA 4MQ4A 1X19A 1X1DA 3VC1A 3TMAA 2ERCA 1Y8CA 1JG1A 3CGGA 1EIZA 3GJYA 5GP1A 8MHTA 3LBFA 5K8VA 2OXTA 1VL5A 4AZWA 2IGTA 2QYOA 3KR2A 2P7HA 2I9KA 3M70A 4GOND 3A7EA 2HMYB 3CVOA 4X63A 1JSXA 3THRA 3F4KA 5JR3A 2Z6AA 3KQMA 4BP3A 1O54A 3KR9A 2DULA 2EFJA 3UJ8A 2YUIA 1KPHA 4DQ0A 1YUBA 2QE6A 5LQKA 4C08A 1SKMA 3CKKA 2UZ4A 1G60A 1L9KA 4ER7A 4RSRA 5ERGB 1KXZA 5DM1A 1RI1A 2PXXA 1R00A 4YMHA 4M7RA 2LD4A 4L7VA 2PX8A 3R9XB 2G70A 3G8BA 2JH8A 3SR4A 2XVMA 3I58A 5DTMA 5FWAA 3MAGA 4DMGA 3KQPA 5FQNA 3KQVA 3UJCA 2PXCA 2EG5A 3B3FA 5FCDA 3SXJA 2HR1A 2EX4A 1EAMA 4LECA 4KDCA 4AZSA 4C07A 2Z6QA 2BH2A 5ICFA 1FP1D 4P7JA 5F2NA 2P8JA 1I9GA 3A25A 5K0GA 4HGZA 5K0BA 1XXLA 2AZTA 2JHPA 1G6Q1 5EHGA 2IH4A 1BHJA 5EPEA 5U4XA 2ADMA 2NXNA 3REOA 1U2ZA 3WSTA 4YUXA 3KPVA 4AUKA 5GINE 4LWOA 2YVLA 5K0LA 4DF3A 2FK8A 2JHAA 3KQTA 4E2YA 2BR5A 3ANXA 3FPGA 5HILA 1RI5A 3ID6C 3DXXA 3LCVB 5GOZA 1FPQA 1INLA 4OQDA 4BY9E 3FUWA 1B42A 4RX1A 3DULA 2B9EA 2BR4A 1L3CA 3M6XA 1RI2A 3G5LA 5HIKA 1RI3A 2IDKA 1V39A 3GIWA 5EMKA 4QQKA 4QVKA 1WXXA 3EVZA 5CCXA 2ZZMA 1NBIA 1FJXA 4FR0A 2NXEA 4MIKA 4YV2A 2FPOA 3QOWA 2H00A 3IEIA 1M6EX 5CCBA 4ISCA 2G72A 4RVHA 5G02A 3KPUA 5DPMA 1EJ0A 3TKYA 5K0EA 4QVGA 3I5UA 1JQDA 5IH3A 2AN3A 2C7PA 4DM3A 3HNRA 1ORHA 2YQZA 5FADA 3TQSA 2O0LA 3EVDA 4GUAA 5KVAA 1I1NA 3R6TA 2IP2A 3NDJA 3UJBA 1WG8A 3OZTA 1NW3A 5EEGA 2JH9A 3V97A 3BZBA 4F85A 5LQCA 5E9QA 5DX1A 4X60A 3T7TA 4O29A 4FSXA 3I53A 1VLMA 4HTFA 1QAMA 1VQ1A 5D1HA 3HTXA 1I4WA 3MCZA 3FTEA 5EMLA 1NV9A 4HSGA 4M38A 3UJAA 1SUSA 2B78A 3P71T 5EC8A 1AV6A 5CVVA 4QTTB 1JSZA 4OBXA 3KPWA 3B7PA 3Q87B 4MHTA 3P9KA 5K03A 3BWBA 5DLYA 5T64A 5MHTA 1L3BA 2P40A 3AXSA 4PONA 1M0EA 3FPEA 3OZRA 2IPXA 4X41A 4EMSA 3ELYA 3M33A 3OU2A 2ONYA 3MTIA 3ME5A 3OPNA 2P3OA 4K6MA 2HWKA 1UIRA 3FUTA 3OCJA 3R24A 3DOUA 3G2PA 4KRGA 5EMMA 3ERCA 4IKPA 1TW3A 2PLWA 3LPMA 1JG3A 5CUQA 1PJZA 3HVHA 4DCMA 4PYJA 2GS9A 4CXMA 1IY9A 2P1DA 4FT2A 3BGIA 3AXTA 3B5IA 1TW2A 3EVEA 5H02A 1NV8A 4MWZA 2PXAA 2PT9A 3BUSA 4GOOD 5EZSA 5T67A 1JQEA 3H2BA 3MQ2A 4IV8A 3SM3A 4HTFB 1VE3A 1X1AA 4R8SA 2FCAA 4YMGA 2AOWA 3DTNA 5LQUA 3LDFA 2B3TA 4PWYA 5CVJA 2CMHA 3DMHA 3BKXA 3CJQA 4POOA 2I6GA 4C06A 4R8RA 4E32A 3GCZA 4B17A 3TPZA 5FA5A 5EHIA 3EGIA 3I9FA 5EMJA 1MJFA 2ZW9A 3X0DA 2YXEA 5DM2A 4RTJA 2VZ9A 2OKCA 4OX9Y 5EKUA 2H11A 2UYHA 2CMGA 5F2KA 3EEYA 4F84A 1SQGA 3OE4A 1XCLA 3FRHA 3MB5A 1VIDA 4YUZA 4OA8A 1OR8A 3C3PA 2G1PA 3G5TA 2AR0A 2IDJA 4GF5A 4BP1A 4A6EA 3GWZA 5EOVA 4FZVA 1HMYA 2PBFA 3E7PA 1F3LA 2NNWB 3MTEA 1VP9A 4PCAA 2P41A 1NW6A 3OE5A 5DX8A 4DZRA 2AVNA 2B25A 3EVCA 4E2ZA 1EG2A 3PT9A 2AN5A 4PYQA 3FTFA 2XVAA 3LL7A 2PGXA 2KW5A 2NYUA 4ER3A 2QRVA 1X1BA 2FHPA 3O4FA 4ZTBA 4EKIA 5ICCA 3NW9A 3SMQA 4E31A 4E33A 1MHTA 4E70A 2BR3A 1KYWA 3AJDA 5ICEA 3MHTA 4OBWA 3RIEA 3LECA 2G8NA 4DKJA 2ESRA 3DP7A 1JTFA 1DCTA 2ZZKA 3DR5A 2GAFA 4JXJA 2VDWA 2CL5A 4U7TB 1BC5A 3A26A 3GRYA 4WVLA 4ER0A 4YV0A 2YXDA 1JR4A 1XCJA 3A7DA 4FT4A 1Q0SA 3KKZA 5CVUA 1QZZA 4UOEA 4E30A 4EVIA 5EKXA 4Z2YA 1RI4A 4M36A 3HCCA 3P97A 3UZUA 4RWZA 2QY6A 3CJTA 3KR1A 3TR6A 4RVFA 1G8SA 1R8YA 1G8AA 1P1BA 3OZSA 2PY6A 4PIMA 5HFJA 3SX0A 2ZVJA 3LKDA 3T7RA 3BT7A 9MHTA 1ZGAA 1DL5A 3KU1A 4PYLA 2VS1A 4QDJA 3DLIA 5LR6A 4PGGA 4YUWA 5E9JA 4BLUA 2OY0A 2WA2A 3BWMA 3CC8A 2QRVB 3G89A 3LBYA 5DRTA 3B89A 1ZKDA 2GH1A 5FA8A 3HCBA 2AOUB 4PIPA 4RVGA 4RTMA 1JQ3A 2E5WA 4EQZA 4HH4A 3NTVA 4PCLA 4QQNA 5C1IA 3K0BA 5HIIA 1L1EA 1XDUA 4QDKA 3SSOA 2GA9A 4A6DA 5KS2A 3KPYA 2ZCJA 3UJDA 1P91A 1ORIA 2ZIFA 3R3HA 2C7QA 1Z3CA 3SVZA 4R6XA 1JG4A 2BZGA 3DLCA 2C7RA 4C4AA 4KDRA 5DM4A 3R0QA 1EJ6A 5EEHA 2ZBPA 3BXOA 1KHHA 1KPGA 3EVFA 1AQJA 2OB1A 5GIPE 5DSTA 4FP9A 5K09A 2PWPA 2OO3A 1G55A 5DXJA 5LSAA 3PFGA 3C6KA 3IHTA 1RJGA 3V8VA 3TM4A 3SSNA 2EJTA 2ZZNA 3BWYA 1HNNA 3PLAE 2Z6UA 1IM8A 1AF7A 4PGHA 1N7JA 3GRUA 2WA1A 3M6WA 4P7FA 2XYQA 2VDUE 3B3JA 3P9IA 5FQOA 1XDZA 3HCAA 1XTPA 3EVGA 4Y30A 5EGSA 5GM1A 2O57A 4YUYA 5GIOE 4FS8A 3NVMB 4AZVA 5LQAA 3ELWA 2I7CA 3EGEA 3T0IA 4CKEA 2OPBA 4OA5A 3HM2A 2O05A 2XYVA 3GXOA 3VSEA 2XBMA 1BKYA 3FUVA 3O31A 4PYOA 4GOMD 4KVZA 1YFJA 3LHDA 4EKGA 5EQJB 2DPMA 1FP2A 3FTCA 2IH5A 1RJDA 3M4XA 2PSSA 1YZHA 2EJUA 1TPYA 2PVCA 5D1NA 5LQNA 2AOTA 4XCXA 3UJ7A 4RTRA 3FTDA 5DTRA 3Q7EA 3LGAA 5CVDA 4RTKA 1N2XA 7MHTA 3UJ9A 3LCCA 3PTAA 2PT6A 2OYRA 2BM9A 3BKWA 10MHA 3MGGA 4XUEA 4KIFA 1QYRA 4P7GA 3HCDA 4PNEA 2ZLBA 3GGDA 3O7WA 5CVEA 3RODA 4IV0A 2HNKA 1O9GA 3CCFA 3DMFA 3EVAA 3FRIA 3FUUA 3NMUF 4HG2A 3G7UA 4RYLA 2YR0A 3MCTA 5KYGA 2AOVA 3UA4A 1QAOA 3OFKA 2IIPA 4AX8A 2PWYA 3TFWA 3JWGA 3FZGA 2PKWA 3OU7A 4GBED 3JWHA 3OU6A 2FYTA 5M5BA 4GEKA 2HV9A 3EMBA 2YTZA 2AVDA 5E9WA 3UJ6A 1FBNA 1ZG3A 2ZULA 3EEOA 3AY0A 4E2WA 2OBFA 4FSDA 1WZNA 2AOTB 2F8LA 4PYKA 2UYOA 2N47A 3NJRA 5GM2A 5ICGA 2BM8A 3P8ZA 3FYDA 3LX6A 4GC9A 5HZMA 4ER6A 3HVJA 4QTUB 2OZVA 2ZWAA 3CBGA 1R6AA 5DXAA 5E8JA 1WS6A 2CWWA 3HA3A 1VPTA 3NVKI 5K0NA 5EIFA 3KHKA 2YXLA 2P3LA 4E2XA 2AOUA 5T6BA 2WK1A 1DUSA 1KYZA 3KR0A 3C0KA 3PS9A 3GO4A 3DXYA 3DMGA 5DX0A 2JHCA 3P2EA 3E23A 1ZQ9A 2Y1WA 5E1DA 3JWJA 1YB2A 3PB3A 3U81A 3HCFA 3L8DA 4BLVA 2JJQA 1RJFA 1KP9A 1WY7A 4WXHA 1X1CA 4C04A 5K01A 2P35A 2ONZA 3E05A 3PVCA 5DTQA 1O9HA 2P3QA 5C9ZA 3PX2A 1Q0TA 5FULA 2PJDA 3P9NA 2NXJA 2ZBRA 5EIWA 4CKCA 3LCUA 2NP7A 4P7KA 5GWXA 4ATNA 2O07A 3PX3A 4P58A 3FPJA 5LQJA 3A27A 2PX5A 1NW7A 2QM3A 1YF3A 3KQYA 3ELDA 3HA7A 1L3IA 5E1BA 5E1OA 3TKAA 5FWDA 3ER8A 4RV9A 5K0JA 3HEMA 3ELUA 3EPPA 3P2IA 3NDIA 4MTLA 5E2BA 1H1DA 1NT2A 1R8XA 4U7PB 5CM2Z 2ZBQA 3DH0A 5CD1A 2UYCA 3GNLA 4R05A 3FPFA 2NP6A 4HGYA 4KIGA 3G2MA 1JTEA 3IV6A 4V0RA 4HC4A 3T7SA 2VDVE 1WXWA 5BW4A 1ZGJA 1D2CA 1JG2A 2H1RA 3KQWA 1R18A 2V7EA 3KQSA 5EZQA 2Q41A 5HIJA 3C3YA 4CTJA 1EQAA 1RJEA 4NECA 1KR5A 1SQFA 5DWQA 2ZIGA 4GOLD 4GQBA 3LDUA 4LWPA 2P7IA 3SGLA 5KQSA 4KW7A 3EGVA 3KPJA 1D2GA 3S68A 3P9CA 3TRKA 1PRYA 1VBFA 5DM0A 3AWIA 1ZHFA 4FGZA 2I62A 2AS0A 3GRZA 4IWNA 5EVJA 1G38A 3M6UA 4YV1A 1D2HA 2VP3A 4R6WA 4YUVA 3FUXA 5DSXA 5BXYA 3DUWA 2IBTA 3QV2A 5HEKA 2XYRA 2PX4A 2HTEA 1AQIA 2R3SA 4PYNA 4EK9A 2JG3A 1SUIA 3G8AA 4PYMA 4QPPA 5CIYA 4X1OA 3UBTA 1T43A 2UYQA 3QOXA 2PX2A 3C6MA 3LKZA 2Y1XA 2B2CA 3TOSA 3TM5A 4Y2HA 3BWCA 3GU3A 4HRAA 1P1CA 1XVAA 2CKDA 2PV0A 2ZFUA 4PINA 4BLWA 5FHRA 1KPIA 4CKBA 4C05A 2C7OA 1NW5A 2ZSUA 5K0FA 1YFLA 5FUBA 3VYWA 4AZTA 3B3GA 3BGDA 4QPNA 3FPHA 5DT2A 1SVUA 2O06A 4XUCA 4RTPA 4CTKA 5EG5A 4RTSA 2AN4A 3BGVA 5LQRA 3ER9A 2GB4A 3K6RA 5F2OA 3LDGA 3KQQA 5IKMA 5KQRA 4V0QA 1QAQA 3SSMA 1UWVA 2IBSA 2A14A 1NW8A 5B1SA 3NWBA 3UWPA 4LG1A 2ZWVA 1NKVA 3IYLW 1YZ3A 2ZIEA 3G88A 4C03A 1UFKA 1NE2A 5E2AA 2GLUA 4GC5A 4DA4A 3DXZA 3HP7A 1IXKA 4X61A 2IFTA 3KQOA 4RTNA 3GRVA 3G2OA 1F38A 4M37A 3D2LA 1QANA 2GPYA 3I64A 3E8SA 4RTLA 1KIAA 3TLJA 5JUWA 1SG9A 3GDHA 5DRYA 1N7IA 3G2QA 3PFHA 4RVDA 5HOQA 5FTWA 1XDSA 1R74A 2ORED 2V74B 2ZTHA 5E1MA 5HIMA 5K0CA 3VC2A 5E8RA 4XUDA 4CWAA 1NBHA 1BOOA 4OQEA 5C0OE 2OB2A 3HA5A 3HCEA 4DCGA 4ER5A 2AOXA 3NWEA 3UA3A 4PYIA 3EVBA 4G56A 3ORHA 1XJ5A 5P8WA 3GRRA 4F86A 3P2KA 3LSTA
chains in the Genus database with same CATH superfamily
2COKA 4E1VA 2CHVA 4RULA 1TU3A 4AO7A 3HYTA 5DZSA 3WYCA 2GETA 3OJEA 1IXYA 3DLTA 1FLVA 5I8ZA 4CIYA 1QFMA 4E4YA 4XGIA 2C04A 5M34A 4HO1X 2O8DB 3FNGA 1HMPA 4DR7B 2BFPA 1D0IA 1XLWA 2QPAA 5A9RA 1KGDA 4P84A 3ZGLA 4EVRA 2CHGA 5CFPA 1P4JA 3UK7A 2ZRBA 4FHZA 1RCUA 4PVCA 1Y1PA 3PI7A 3FCOA 5F35A 3KB2A 3Q10A 2BI8A 4C76A 2ZUBA 3UMCA 3DKVA 4GI1A 4XWAA 1PGNA 4EI9A 1S8FA 1V8FA 3MVEA 3NHPA 4HATA 4G0VA 1P0MA 4IIDA 2AX4A 3OQVA 2Z6AA 3TLXA 5BV1A 1NE7A 5A6SB 2XXAB 1ZBQA 1UK6A 1Z39A 1CR2A 1CQJA 1DKRA 2GCEA 1C4OA 3GL9A 3CW9A 2IELA 1EWYA 1F2TB 1PTJC 2MMCA 5IVDA 3V6LA 4CU2A 2FN9A 1RI1A 1SMKA 1DIGA 1XWWA 2H4YA 2JD0A 2WBLC 3AG5A 4IVPA 4LK3A 2P2SA 2PX8A 5JMTA 1I0IA 1B15A 4OREX 2CDAA 1OH5A 1JDZA 2FEWB 4V0ME 1EDZA 5C31A 2HMAA 3O75A 1XTZA 3BGSA 1RHQA 5DE3A 2WFAA 3AM1A 3DBLA 2X41A 5F3DA 4ARSA 4UMDA 1IOWA 4WGGA 3V1TC 3WWPA 3N39C 3Q2IA 4C07A 1LNZA 2CXHA 4TRRA 4AROA 2G7ZA 2FN8A 1KAHA 2IIQA 3A1WA 3PNLA 5L51A 2WTUA 5K8IA 3K9HA 4XDGA 3O8QA 1IBKB 1U7WA 3WVNA 3E9YA 1NI3A 2AZTA 4P5EA 3PC8A 3ZDQA 3AOEA 3H1AA 5AMXA 3ZE8A 1PX2A 1FDUA 2JAXA 2E89A 3A9SA 4LWOA 3KQTA 3Q6IA 5YASA 3RIMA 5LQMA 3UV3A 5GOZA 2X8AA 5EJ7A 1VHDA 13PKA 2F1RA 2ZT7A 4F0JA 5EWMA 4BO8A 3JZMA 3R3ZA 1HKHA 1T4MA 3FHCB 4C87A 1WW8A 2C84A 3DZFA 4ZO8A 3II6X 5HIKA 5BMVA 2IOFK 2QW1A 1NYLA 1CP2A 3BRWA 4Q4JA 5J59A 2JLWA 1AA9A 2DQSA 3HJAA 2OPHA 1Z37A 1TCUA 4L27A 1G3IA 1O94D 2GYVA 2XITA 1G3RA 5IHPA 3RYCA 4D46A 5B6JA 5FOSA 1ISHA 2IOYA 3SVLA 1IPEA 2GK3A 3HXMA 3L9XA 4WD3A 5KTKA 1II8B 1VJTA 2XCTB 5J5AA 2II6A 3DVRX 5JTTA 1C7JA 3O83A 4FIZA 5DNAA 1FQOA 1IB6A 1Y98A 3K32A 3UHAA 5KVAA 1FTQA 1OA1A 4YNBA 2WB2A 3LU1A 2RHLA 3ZZ0A 1IZZA 2YY6A 1GCOA 2GBFA 2O6LA 4FBGA 4DLLA 3C5VA 5K8TA 3LH5A 1C5KA 1BXGB 5JSYA 2QRPA 3B85A 3T7TA 4O29A 2FZKA 2QRHA 1NF2A 1N92A 1KWGA 3ND6A 5IAJA 4X1IB 1NG9A 2PGLA 1EDOA 2PUDA 3BILA 3F6SA 2ZAGA 4HYQA 4PFSA 4RMIA 1FX1A 1DLJA 3G8DA 3ZIUA 2OOKA 3W6PA 2BGWA 3AVXA 2K87A 3UWKA 1JSZA 3H0EA 3B7WA 1PE0A 2P2NA 1HG1A 2CB9A 3X1XA 3ZZ1A 4ETNA 3WLLA 1FVHA 1MAWA 3WRXC 1GTJ1 4ENQA 4KAFA 2O8EA 3VQTA 1HURA 2RARA 3PFKA 5CK4A 3WV5A 1ZOPA 2VJCA 1X14A 2X19A 1EYZA 1GNPA 1JV2B 4YJ2B 4LPKA 4QGHA 3HRHA 3LG2A 5COAA 1YK0A 3FOEC 1EWKA 1G42A 3ERCA 3GD5A 5GJCA 1BJKA 2WSLA 4BFYA 1LQTA 1MCZA 2XCLA 3LPMA 1Z74A 1KI8A 2AW5A 2X5NA 2WWXA 4CT0A 3ESQA 1Z6GA 2BUAA 2P67A 2J5XA 4O4JF 3IE2A 5F1KA 2ZRJA 3RNOA 1JR3A 2H4ZA 5HCUA 2QX7A 1Z16A 3ZWMA 4PW0A 1IC6A 1KS9A 4DCUA 3SC4A 5BWBA 5IYZB 2CK3A 4JVMA 1BRMA 2CUTA 1WPQA 1LY1A 1Q1QA 2DUNA 3DMHA 1FFAA 1EFDN 1U4OA 4IJMA 5F2EA 1ULZA 4V02A 3VHQA 4RKFA 4G4JA 3W6ZA 3C4QA 4BC0A 3PXBA 1V9SA 1AUPA 3Q3CA 4WADA 1D0SA 2O4UX 1ZXXA 3I34X 3O38A 3QVWA 4RPKA 5EHIA 3OZWA 3HI6A 1YB1A 3DWFA 4ZOCA 5LP6C 3M6IA 3K9QO 2OKCA 4G01B 5EKUA 5F2KA 1EA5A 1AKUA 3QVOA 1ENPA 4U2KA 2PGNA 4AZ0B 3AJ9A 4LGYA 1PR0A 2EWMA 2PFSA 3AUKA 2PGDA 2XZDA 4FUTA 4ARUA 1MW8X 2G1PA 3OFSA 4M6WA 1XTBA 1SG0A 1YIDA 1HDEA 3KWLA 3WRYA 4NU5A 3QBTA 2Q6KA 2DKOA 1YHYA 3GN1A 3L6RA 3RS0A 3ZGNA 5KVVA 2BE9A 2D6FA 2GZSA 1R9MA 3D4NA 4YP0A 2FPIB 2WY2D 1D4FA 5LQDA 4G4SO 1K2VN 2BFBB 5ERYA 4ER3A 1YMQA 2P0YA 3K2EA 1K5HA 3KJHA 1T8TA 4IDEA 4KRXA 3LOQA 4LV8B 5A3VA 3SEQA 4R9SA 2CYAA 2YXPX 4RIIA 1NRJB 3V7NA 3GJQA 4WXPA 5HUHA 2EZ8A 3HKCB 5KNCD 4DV0B 5DNUA 2EFHB 3S2IA 4M54A 4Q3LA 3QYJA 1BWQA 1CB7A 2CB0A 3DP7A 4QASA 4N0PA 3A1VA 2VDWA 1XU9A 4HDRB 3EODA 3ND8A 4R5MA 5A9SB 5AM3A 2ZKLA 1WHSB 3RRXA 1G21A 4FT4A 4L0MA 1OFIA 5K3FA 1L4HA 3ON5A 2AWNA 4MLZA 3O26A 4QBTA 1OXTA 1YQDA 3C2QA 3D3WA 5F7ZA 5BWCA 4LXUA 2WZDA 1N25A 2P4QA 3P97A 4CV2A 3WG9A 3P7MA 2P5UA 4ZO6A 3CJTA 3TR6A 5KYYB 5TEWA 2JBAB 2XW6A 3EA4A 2H4WA 3WK8A 1QQBA 2LXNA 1FP7A 2VJPA 4TSKA 4DPKA 1KI3A 1FFHA 1WSDA 4K6KA 2QL9A 3KVRA 4TXNA 3HDTA 2GD2A 2Y66A 3ZH2A 1VRCA 2M98A 3OQBA 4DM7A 1DAPA 2ZSJA 2TMKA 2J87A 3GBPA 3DHVA 1XMIA 2WVHA 4EZBA 1ZKDA 1AKYA 3HO1A 2AOUB 3RG8A 2NVOA 3HUDA 4JWTA 1DARA 3OOSA 4EEZA 1Y6ZA 2DTDA 2Z1DA 5TRTA 3K9NA 1YDHA 3KJNA 1CWUA 1HA3A 1PKXA 5BSMA 4CIAA 5H3CA 3PXCX 4GLBA 3W8DA 3ZDEA 3KJQA 2DBQA 3H8VA 1V47A 3K9GA 3OOWA 5B57C 3TGLA 3OCYA 4B73A 4YR7A 3UJNA 4OHYA 1S8NA 1KQOA 1IM2A 1R4AA 4TRJA 5JCXA 4KH1A 1KPGA 3QH4A 3HNPA 4KITB 2P9CA 2W9XA 5G1NA 5BUSA 2KSQA 1UFRA 1XN1A 4ZICA 3NUGA 1W1WA 2DETA 4GGMX 4H2DA 4HXYA 3SDSA 3OAAA 3QXGA 3CSSA 1R27A 4I36A 2WT4A 2TMDA 5DEOA 1AK9A 1N7JA 4OHZA 2ECFA 5CVCA 3K2QA 3FCSB 4IXMA 1V6SA 2G4CA 3INNA 3P0IA 1KU0A 4Z54A 3OZFA 5CH8A 3F97A 1K1EA 3GT4A 4N40A 2AYYA 5DISB 4GXQA 5FUXA 5HBRA 3ZD9A 4EPTA 4DV4B 4YIHA 4C2UA 4DOMA 1J7JA 3KDSE 1ITZA 4E3WA 1JB1A 1LI5A 4I6JA 4UNQA 2DFKB 2QAIA 4KC0A 4REMA 5JSQA 4LF8B 4PPYA 2QL5A 1TZJA 1ZMOA 4A5SA 4RTRA 5DHTA 3QF4B 3DLHA 2VNIA 4PIVA 3AVUA 1MRZA 2J7PA 4QIHA 2FA9A 3JX9A 1Z36A 4KR0A 3BRSA 4LTNA 2NYRA 1H0HA 1PJLA 2BDEA 5A0FA 2OO5A 1TTTA 1A5AB 3BERA 3NJ4A 3TR5A 4F38A 5KREA 3VX4A 1FIUA 1ZS9A 4D4HA 2C8KA 3RIGA 1U5BA 4PRZA 1R10A 1P5JA 4UCFA 3O0DA 4EHFA 5ALVA 2OC4A 3O7WA 5H70A 4OVKA 1Z83A 2QSZA 2Z2ZA 2QDKA 3K8ZA 2MSCB 1ZZGA 3IPAA 4CGYA 2IK8A 1GZVA 4HG2A 2RK4A 2A9RA 2ZYHA 5M2QA 1EKXA 4MVJG 3S5JA 2BISA 1AQNA 2D00A 2JFPA 2O2ZA 3FCEA 3WGLA 1NONA 1PL7A 3KM0A 3RNLA 4MVJH 3SG0A 2R8ZA 4JJ7A 1A98A 4EQ6A 2QRNA 2QRKA 4ISBA 4E5UA 5IANA 3L02A 2M6KA 2R8EA 1KI2A 4IFBA 1KO8A 2DPHA 5EQTA 3PD7A 1AVTA 3MCWA 4O1MA 3LY7A 4HZGA 1S4MA 1S2LA 1Q77A 2AOTB 3PNBA 3PE3A 4HPXB 3ZE9A 4M4SA 1BE0A 4DEYA 3HVJA 4QTUB 2ZWAA 3DFMA 1OI2A 3S0JA 3SD7A 3ZXUB 5J5VA 4Z7JA 1QX4A 1EQUA 2H63A 3LC0A 2CLHB 3OEED 1M66A 4RDCA 4I9GA 4NYIR 4MUGA 4FOTA 4JJZA 3AQIA 2PBZA 2YRXA 2ZCUA 3R20A 3JAWA 2QE7D 1IVSA 2J0QA 4OU5A 3W2GA 1JR3D 2Y93A 3FWHA 3THXB 3VKVA 2F64A 2P3QA 1TNDA 1KORA 2OCIA 2XMQA 5T4BA 3PL5A 1GU1A 4OK6A 3V4LA 4AP9A 2FPXA 4UPEA 1NQAO 2K2WA 4LYYA 3A27A 4ZVQA 4OGFA 5EAIA 1Y82A 4HGNA 2C4HA 2HRCA 3LBAA 3LPCA 4RV9A 5JAUA 5K0JA 1IE3A 1OXBB 1Z34A 1NVVQ 2C1ZA 4R98A 3R7SA 1R8JA 2HSGA 3I4CA 4DDHA 2QJRA 4Q12A 3LYLA 2ZBQA 3WZMA 5CD1A 1N5LA 2PIAA 3K70B 2WJJA 3KL4A 1L5VA 1ZICA 4ZI7A 2ZRMA 1E1MA 3K2IA 5BW4A 3EX7C 1DKLA 3OPYB 4O4IB 2I6FA 2V7EA 3EQ2A 2NSJA 4PBTA 1IM5A 1ZN8A 3JVDA 1E3WA 2FP4B 1QVVA 2REBA 1RMQA 2ZIGA 4EFMA 3FMPB 5CA1A 4KW7A 5D51S 2H17A 4MCAA 4DUGA 1CY0A 2REQB 3GT7A 2B2NA 2F8TA 1WPXA 1RLJA 1UM9B 3C39A 3ESYA 2I62A 1F0KA 1HYEA 2B0CA 4EA8A 1W34A 1FK8A 1Z88A 4KFSA 2RB4A 4B2YA 4OHKA 4LF6B 3ZD7A 2R4QA 4YAWA 1KIFA 4MAFA 5C1DA 4MPPA 1SUBA 5LJIA 2IBTA 1OIWA 4F5WA 3M6AA 4INZA 1PFGA 2B5WA 4HP8A 1AQIA 1WCIA 1FFGA 2R48A 4WASA 5CIYA 4XUGB 1YKGA 2E49A 2PZ8A 2QTCA 3DTVA 3I39X 3OWOA 3Q6MA 1T26A 4FINA 2POQX 1YWGO 4DSNA 2RDMA 2H2DA 3VSDA 3E9ZA 4WKPA 3ZBPA 1P1CA 2E6UX 2K7FA 3KYCA 2FTKE 1DAMA 2GAOA 5KIAA 4M0UA 5FEMA 1FVFA 1LVUA 4DMHA 1E1QD 3C6XA 4BVEA 4DV7B 5JNUA 5K0FA 3G0DA 3N3BC 3X2EA 4DREA 2J85A 3ICVA 3FLAA 2HW8A 2O06A 4RHTA 3TB6A 3SLKA 2GZ3A 4PCVA 3FUCA 3I76A 4B75A 5D00A 2XXJA 4QVIA 1N5RA 3DVAB 4YP5A 3T1TA 4AJNA 4BNWA 2BMAA 4A73A 1JSCA 2BD0A 4NBKA 3RQSA 4ZMBA 4B8ZA 3E22A 3KFVA 1TCAA 3FOWA 2QR3A 5KPDA 4B7ZA 2OHVA 3HN7A 2EEZA 2NOAA 4LBWA 3DDOA 3GRVA 1NVDA 2IEIA 1B8VA 1COWA 2O2SA 5A5GA 4AUEA 4JNCA 3PNYA 5ECDA 4ZV4A 2EKLA 3FYHA 4Z86A 3TVDA 2BFDA 3TQFA 4PCUA 4RKQA 4Y2GA 2HPVA 4JLVA 1PTJA 4LBZA 2J8ZA 1XKXA 4NH4A 1MH9A 5TS3A 5FA6A 3RWBA 4BU1A 2VH2A 1QIGA 1L7NA 1U6JA 4J1QA 4ER5A 4NABA 4JFAA 4KAJA 3G2HA 4E1AA 1FSPA 3GUZA 4W63A 2P0AA 4L08A 2C5HA 2J3JA 3OAAD 3PVSA 3LF1A 3LGXA 1ELOA 1U1IA 3LBIA 4M0KA 2B5VA 2IUUA 4EJFA 5HPYB 4HDNA 3FDJA 5FHQA 1UH5A 4UPVA 3SZRA 3DW3X 3GG9A 2IGBA 1TM4E 5ER9A 2A9JA 3FNEA 1SC6A 3JAKA 1NY6A 1T9HA 1NXXA 1U3DA 5JE8A 3HVIA 3NP9A 4BC1A 3N86A 3BJEA 4C4SA 3R8CA 4IO0A 4CTOA 4EYEA 1WNFA 1P4AA 3VKUA 1U7ZA 3BSWA 3V1UA 5EJFA 3ZGXA 1IU9A 4J29A 4O2AB 4MVJA 3A7EA 2HMYB 3CX8A 5EWJB 1H93A 3LUKA 5ALFA 1DKMA 4B82A 2AJDA 1NXWA 1FXUA 1ODKA 1CUCA 4MA0A 4NTZA 2HXYA 4UVEA 1L8LA 5AVYA 1X7HA 1Z4NA 1PBNA 2GHRA 4ITRC 2PFKA 2IY7A 1DKOA 1MP0A 3PPXA 1Z8FA 1FS4A 4H15A 4Q1CA 6CHYA 2ZKIA 3ENNA 1NPDA 4P3OA 2CV0A 3D54D 4DIMA 5I7AA 4UU8A 1NPTO 1BS1A 1H6DA 4OQXA 2BGMA 2XVMA 4Q3DA 4K9PA 1SWWA 1XMXA 2BBTA 3LXUX 3CLTC 2FZVA 3GJ6A 4RQUA 3KS9A 4E5YA 3INRA 3CR7A 3B3FA 3L7KA 4RZUA 5I5EA 3CNQS 1N2CB 1UOEA 2G9VA 3DEIA 4YMIA 2X5OA 3OT5A 1PFQA 2QBYB 2X22A 1OY1A 2ZP1A 2IYOA 4IFIA 4QRIA 1JFVA 3DZ8A 3R3XA 4Y6SA 1F3OA 4FYYA 1OFVA 1O5OA 5ITZA 3CF6R 2A7XA 3T4PA 3CNBA 4G1EB 3ISTA 5SZJA 1QIFA 4OHMA 4FGKA 4WY2A 3T95A 2P2YA 2X15A 5BN4A 3VPAA 4N6NA 2JLAA 3VYUB 3WRXA 4YUXA 1YRYE 5GINE 3FM9A 3DTTA 1LD3A 3JTEA 4FHGA 2PMBA 2Q99A 1GGHA 7YASA 2VTVA 1ZL0A 1CS0A 3FH0A 3QGMA 1H6CA 4Q7EA 1W8IA 1TF2A 5T4HA 2AUNA 1K66A 1U0OC 1Z5OA 1ISRA 4GM1A 5KVSA 4JJ6A 1PGPA 2N3ZA 1XZQA 1Z6ZA 3A1FA 3N6RA 4JP3A 1WXXA 3LOUA 3LUJA 4IRXA 3CR3C 1SVKA 2NXEA 4D5GA 5JTUA 1Y7PA 4AJOA 3L0SA 3EXAA 4ZAFA 2NO9A 3DAFA 4O4HF 3PI6A 5D85A 1EJ0A 2OKGA 4N54A 3T41A 3WO1A 1JEAA 3I5UA 4EHBA 1HDZA 1MF7A 3FIUA 1SZDA 2OV1A 2R2AA 2V7VA 1T9GS 1W5BA 2ZIVB 1EVLA 3D0OA 1IBSA 3HRKA 3I2KA 4L9RA 4IQFA 2G0AA 4GBJA 4MOWA 1N0IA 4QJBA 2JANA 4QDZA 3TQSA 2C59A 4JS0A 3JZIA 1Y9DA 3TNJA 1G4UR 1X0XA 4Y2TA 3MWEA 4KHZA 5E9QA 3ZWNA 1P7WA 5LP6A 4UC0A 5GPBA 1W5AA 1UBFA 3OPMA 4L4RA 2YMMA 4RJ2A 4WZAE 4JBWA 6ABPA 2XJ9A 1K6IA 1HORA 2GM9A 3UEOA 1GQ2A 2QX4A 3FTEA 3VYTB 3EWNA 3CRVA 1E5DA 3DA8A 4HUQA 1E60A 4M38A 4FILA 3MRSA 4N49A 4OM8A 3KVNA 4P08A 1HUQA 1FQWA 1QHSA 3E5NA 2QRGA 2JIQA 4DUGD 3BWBA 5DLYA 1R6UA 1L4MA 1GFZA 2ZPAA 3KV1A 2Q21A 3OP4A 4NBSA 4NENA 4UUOA 2ZIZA 4JGGA 4DA9A 4II3A 2O19A 2WTAA 3NWPA 4A2QA 3PP8A 3SLRA 5MDHA 2ETXA 1ID8A 2PUAA 3IT1A 5DF1A 4I4LA 3Q41A 2YHSA 1YRAA 4BNIA 1NI5A 4K6MA 4OJYA 1Z0SA 3FHJA 1SU4A 3G2PA 3EGWA 4L16A 2BWJA 3ESZA 4RIGA 3QU4A 3SKYA 3OP1A 4KXYA 4FFOA 3SNKA 2XCSB 1TPZA 2XTJA 3GW8A 4X65B 3N2IA 3EVEA 2RHCA 1TW2A 4ZHSA 1PIWA 4RESA 4Y2QA 1NXOA 2VDQB 2Z3VA 3P5SA 3PEFA 4QU9A 1ZR2A 1EFRD 5F4ZA 1UC9A 3HB5X 5HR5A 3D7RA 1RDFA 1T8YA 3K9FC 3CJQA 4POOA 2WJWA 1J9ZA 1EEXB 2X6QA 3JD4A 3KFLA 4A8JA 3R7LA 5FA5A 1PQWA 1XCOA 1BFDA 2IY9A 3RADC 5CFMA 2FFAA 5K3EA 2ATXA 4JI8B 2W4QA 4MVCA 3MD0A 2UYHA 4Z9AA 2GLTA 3QKRA 4ZCPA 2Z5LA 1EXVA 1VG8A 2Y71A 1MLDA 3JQ8A 4JBLA 1ZGHA 1L7VC 4XLLA 1FDRA 1NF3A 4YLEA 1PK8A 2AR0A 2HV8A 4IIJF 4UEKA 4YRDA 2PUBA 1XALA 3E7PA 3HKDB 3G2NA 2BMFA 2FMFA 3DPIA 3BB4A 1AT1A 4XB6B 1II0A 1COWD 1R7RA 2EKZA 3U31A 3F7TA 2HHAA 3DUFB 3PT9A 3TRIA 3W2HA 2DEUA 4PV7A 5CGQB 2VTDA 4LJ6A 5HA5A 1VE9A 2WAXA 4FWIB 1O6BA 2JJMA 3NPMA 1EP1B 3G8YA 3WLJA 3JR3A 4B4OA 3MRXA 4MYDA 4F5YA 2ZT6A 1HWYA 3EGDB 3PJRA 4WSOA 2GAFA 3QEJA 2GAIA 4B31A 4ER0A 3GRYA 4HEQA 3LE8A 2G5GX 1SOVA 2ZI5A 5CH5A 2WQ6A 5DGTA 2B7CA 2DUWA 2V7QA 4WBNF 5HP4A 2OBXA 4ZV7A 3ZIDA 3IO3A 2WYIA 1AQLA 3B1WA 4HQNA 2FLWA 1X15A 1U28C 1U3FA 1TLLA 1XD8A 1C30A 3QU7A 2ZIXA 3ZKWB 4Q1AA 5JMPA 4C3VA 2B37A 4N3GA 3H2HA 1ECFA 3O8OB 1UJNA 3RTAA 4L6CA 3TSAA 1G8AA 1D0VA 5HFJA 4B0OA 1CR0A 1K5DA 5L8VA 1ZGAA 2FZGA 4MZDA 5KOYA 5DIFA 2LE0A 2VS1A 2YIMA 2C98A 3HV2A 4NK4A 1BFKA 2F4NA 4PGFA 1ESZA 2C5SA 2RH8A 2VRBA 4L9AA 2OY0A 3QJYA 3G9QA 4CTNA 1HX7A 4D4MA 3RAFC 2XZPA 1M1YB 3TJRA 4MVJD 2PVSA 3LPAA 1B6GA 1A8IA 4EB6B 1MR3F 1THMA 2AQHA 1U9IC 2O54A 4D9IA 3VU0A 1JYFA 2FLKA 2JDIA 3BB1A 3I9V6 4NULA 1ZRNA 4Q3AA 5K3CA 4R2MA 3EXHB 1F2DA 2UUPA 2OHJA 2Q1SA 2HX1A 3CPEA 4LQ4A 4TLBA 4BJ5A 1XDUA 1V3VA 1LPBB 2VHYA 2ACEA 2IYEA 3JYOA 4DJ5X 1TL7C 1D4ZA 1ODLA 1OLUA 1PGQA 1TK3A 3F47A 4PAGA 1HZZC 5J4KA 4R6XA 1WVMA 2LP4Y 3L07A 4BMVA 2OTCA 3A10A 4IDHA 4RJTA 3S2FA 5B30A 2XE6A 2H0RA 1T6BY 3T5PA 3NVDA 4PANA 2W2LA 3BL5A 1WZCA 2PWPA 1AUQA 1BE6A 1GY8A 1J09A 2DFDA 3QQ5A 3H2GA 3ZW8A 5IFKA 2X3YA 4MRRA 2CFSA 2HK6A 3ULKA 4UM9B 3QUBA 2B8EA 2GKSA 2OVFA 4ZKEA 4BVKA 5AIBA 1ADGA 3OCVA 4UCXA 4U6QA 1DC6A 4LHYA 1HYBA 3TQQA 3T5CA 3MN1A 3GYGA 4L78A 1NVFA 1GCIA 4MR9A 4N9QA 4I50A 3U3KA 4WWHA 4ENUA 2HQ1A 5AW0A 1QRRA 3Q2KA 5GM1A 5CBPB 5AW1A 1O9BA 4UXJA 1PFVA 1V1MB 2HYDA 2P75A 2IIVA 4YWHA 4FS3A 1KVRA 2OENG 2JHGA 3ITNA 4ZVSA 1VMEA 3ZNPA 4R9VA 2GXSA 4RHUA 3THYB 5CEFA 5A6VA 1BKYA 3EDOA 5AI5A 1LLQA 1FPMA 1Z6AA 4G4SP 4OB6A 4X64B 3OM9A 1NATA 5DK6A 3M4XA 4G6ZA 4KUGA 1Z5VA 1YZHA 2EJUA 4F92B 3GLHE 5J1TB 3UJ7A 1FSGA 3SSAA 2C9DA 3W6OA 1EFVB 3LGAA 3P9YA 5ALSA 1UP4A 4UOZA 1O5IA 7MHTA 3TXYA 3LCCA 3W1VA 5EHQA 1P17A 1SEPA 2JVJA 1U6IA 3BOSA 3QE2A 3UCXA 4CM8A 3DB2A 2GN6A 2RG1A 2WJ4A 3AUTA 2PX0A 3BL6A 3CNLA 10MHA 5JRDS 3MGGA 3SQOA 4RA6B 4XRGA 1AX9A 5FBKA 1XZAA 1USVA 4RGBA 1U2GC 3KG2A 4HB2A 3FRIA 4U0JA 3S70A 4ALMA 3QE9Y 3A6FA 2H1IA 1VLHA 4A8PA 3DZIA 4V1CA 3MCTA 4CDGA 1L7BA 3C70A 4ZQCB 3V5NA 5LYJF 3MELA 1W36C 1U0GA 4DMLA 1UZAA 1AZTA 4UQLA 2O50A 5DHFA 1EVZA 2B1IA 2D5IA 2PO7A 4JLOA 5L40A 3U4QA 1AHIA 1XTJA 2HV9A 3GLSA 1Q84A 1SD1A 3Q9UA 4FE3A 5F1YA 2B5OA 2D1RA 4LCEA 1J70A 4YEDA 2F1HA 3RC9A 3NJRA 4DLNA 5AI4A 3C85A 5HUQA 4I9NA 1Z28A 4OYYA 5DK4A 3T5GA 3T7DA 1BMFD 1FNSA 2HJSA 2EKDA 5L3RA 3SY8A 3LFUA 5E0OA 3UUEA 2EJVA 1HDYA 1UOQA 2R7AA 2O3TA 2UXBB 3C24A 5IUJC 4XB2A 4OI1A 3FFXA 5A06A 1U3CA 3LW8A 4YRFA 1UDXA 1E63A 2ZRPA 2QYHA 2YWEA 2DH5A 2ZBDA 3PS9A 1YRHA 2Z2YA 2N1MA 3EGXB 1YE3A 3LUCA 3F5SA 3LZ6A 5E1DA 3JWJA 3U7IA 1K4KA 3WQBA 3U81A 3W5JA 3K09C 3FGOA 3WWYA 1P77A 2AR7A 3SE7A 1JFFB 2NZXA 1O9HA 1YD7A 2OORC 5KVCA 3VA7A 4QXRA 2CBGA 5J4VA 2GF0A 3PT5A 2QV0A 3PV0A 2P0EA 3A36A 5I7SA 1TVKA 1HRDA 2XVYA 2KM1A 3B3AA 3NAGA 4P58A 4YJDA 3V8QA 4DMMA 3E61A 3LOPA 5JBIA 3E9MA 1OC4A 1VI6A 1H8HD 2QM3A 3VVBA 4IFTA 4D1YA 2Z43A 2VSYA 4G07A 4KQ1A 3CX4A 4UU1A 5D6OA 4EDHA 2UUAB 2JKZA 1W0KD 3OA2A 4I8IA 3ESCA 3REQB 1WHTB 3H3XA 3GJSA 3RHTA 3U19A 2IW1A 2VN8A 4RMGA 4BJHB 4GQAA 4R3WA 4TT3D 2Q5CA 5LOVA 1N3YA 5TVGA 3ABIA 4BQPA 1OV4A 2NSHA 4F4JA 3V4SA 1E9AA 4KSCA 1WU8A 4JP8A 5DWQA 3CEAA 16PKA 2Q1WA 4GYKA 3LDUA 721PA 5JISA 2C2WA 4BMPB 1OHHA 3ZCVA 2VL7A 1T9BA 2ZI6A 4F4IA 2ZREA 1BS9A 1J1IA 1P18A 4Z4EA 1ZHFA 2AHRA 1DX9A 5KI6A 1XEXA 1ARZA 3TUZC 1YZGA 3K5WA 4DJJA 2P6RA 5EYPB 1LW7A 2C57A 3H8JA 5FUVA 2D59A 3A6LA 4JUFA 5LB4A 3T7IA 5EKTA 3ZWOA 3FPSA 4BX3A 2YZKA 2MSNA 2OAEA 3I1YA 1WL8A 3OO1A 4X1OA 3RTEA 1T43A 9GPBA 3WK5A 3HXTA 4Y67A 1HLFA 2PRZA 3F6YA 3ZK7A 4I4IA 2J0SA 1K6MA 4FFSA 4MB2A 3W3AH 1OZFA 2CZQA 4LRTB 4ANFA 1NBME 1RBYA 4G09A 1U2SA 2C07A 4EG5A 5D7NA 2HU5A 2NO6A 2PYZA 2UZAA 4P4NA 3C7DB 4DSOA 3GRPA 2PL3A 2FLVA 1OLSB 4HNHA 4W9RA 3PGA1 4CV1A 2DH6A 4MMYB 5EG5A 1KMIY 1XZLA 5IK2A 6AT1A 4A23A 3H83A 4ZJYA 1ISGA 1CR1A 1OTHA 1W94A 5FYQA 2C8VA 3S2EA 3F7OA 2VHJA 4Q1FA 4B09A 5ADUS 3VPHA 4QPCA 5LUBA 5CYGA 3NIWA 2FEMA 2PZFA 3BS4A 3LA6A 3L7JA 4H16A 1NKVA 2ZJOA 1ST2A 1YZ3A 3BK2A 2PD6A 3CB2A 3CVJA 1W47A 3HBAA 4H6PA 5E2AA 5IBRA 4HADA 1KKLA 3F6BX 1KKMA 1CLUA 3THWB 1WBBA 3TZHA 1F38A 2HLNA 3DW1X 4AECA 1QE0A 3GGGA 2JI9A 3QUSA 5KYVA 4JEHA 5LQSA 4YLYA 4RTLA 1XOIA 3E4CA 1K4MA 4BFXA 3FMOB 3EUWA 1OBFO 4EGQA 2R00C 1NBHA 4LV6A 5HM6A 3L8FA 1T24A 4IQGA 4O4LB 4QYIB 1JQAA 1T5IA 2OBLA 2R6GA 4IJVA 5EJIA 4F86A 4EW1A 1J21A 1UKEA 4L02A 3IXMA 1ML4A 1VCIA 1X80B 2LDXA 5AJWA 2WF7A 2FDRA 4GOXA 3FYCA 2C54A 4WT7A 3G0OA 3E3OA 1Y6RA 1FRNA 3LQ1A 4F60A 4OGLA 4V2IA 2J6CA 2FK7A 2Z1NA 1UP7A 4RHFA 1GQQA 1A5BB 3M6VA 2GZ1A 1ENZA 4QHTA 3L0CA 4QARA 3ZI7A 1RZ3A 5BWMA 3HLTA 2A84A 4UD2A 2P5TB 1YQQA 3NO4A 4HDSB 3VHRA 4I9HA 1N9GA 1I94B 2W48A 1F4LA 3L79A 3D1VA 3CUTA 3O2JA 1D7OA 4BNLA 2BEUB 3V3TA 3W1WA 3CYFA 2B4YA 1CUIA 2BF7A 1SKQA 1YVUA 1V45E 2WZQA 3OWXA 2VOJA 5JFOA 2ZB3A 1MGOA 4HL6A 2WNSA 2W8BA 5AO9A 4C08A 1SKMA 4YROA 1DTWA 3BA1A 3LLVA 1IPFA 4A0HA 5C35A 5LNK6 4XJSA 4NLLA 2PSDA 3F9RA 4X44A 4N8EA 2XDQA 2I54A 5JY6A 2GF9A 4BNHA 4EFKA 7REQA 1G7SA 1EVQA 4OSPA 4J3NA 4TM8A 1KJQA 1EPUA 1QO0A 4DMGA 3KQVA 3GF4A 4BMXA 1SUCA 3LUAA 2PXCA 4TLMB 5CFZA 3MMPA 4KMOA 2Z2XA 3RVOA 1QQ7A 1G7CA 3H9JA 3I2JA 4MWOA 1N2CE 2P4SA 4B47A 3R7DA 1M2OA 1W93A 5ICFA 3PENA 4IWYA 1V7QA 2Q27A 3HU3A 4J0HA 1XXLA 2HJGA 1RWOA 1V4NA 1XD2A 5U4XA 1BX0A 4LMBA 3REOA 3R1IA 2WYUA 3QW2A 1LX6A 4DJFC 1E20A 1SKUA 5LMUB 3ANXA 1CQJB 5ALNA 4DUPA 3KHTA 1INLA 3DKPA 4PHFA 1ZIDA 2QN1A 5KKNB 3W9UA 4U8HA 1B93A 1J56A 2X13A 1L5OA 3EOAI 3GQBA 3PNPA 3MJVA 3RSHA 3RS7A 1RI3A 2VDJA 9LDTA 3GEEA 1C2TA 3BICA 4ZCTA 4HHEA 1BA2A 2AB0A 4QUAA 1QC5A 3BWXA 4DQLA 2FPOA 1G8MA 2JRLA 1LDMA 5I3ZA 4S1WA 4C4PA 3MWYW 1EDBA 2R85A 2ZS7A 2C9BA 3HHEA 2H9YA 3IGFA 1FFBA 5EQFA 3V42A 3DBLB 5FLKA 1QLHA 3CSUA 1NU6A 1ZN7A 1AKVA 2XIJA 1KR2A 1AB6A 1Q16A 4XIJA 4TLAA 1PZNA 2Z2JA 5JWOA 2CNOA 3O8QB 4CT4B 1U8UA 4GT1A 2UYGA 3PFIA 1WD5A 2EERA 1CX9B 1W6RA 2HJWA 3ETGA 4Y1RA 3V97A 2V98A 4RLSA 5BYAA 2EU8A 3IV7A 1KO5A 3QF7A 5EMLA 1FFDA 1RZRA 2ODBA 5HF5A 2EQBA 4GBGA 2J6BA 2A5GA 2NLOA 5EWMB 4E5SA 4D0RA 1DIRA 3Q87B 4X3PA 1CT9A 1PWHA 4FFPA 5K03A 1Z9BA 1JLSA 1SWVA 3MTAA 3W3AA 4R31A 1U0HC 5T64A 5FYDA 3WYAA 1G2IA 1UEXC 2Y6VA 4OOFA 4Q4JB 5IZCC 5MHTA 2BHSA 2I7DA 1T35A 4XTRA 4C4XA 4WKOA 5EIOA 4D4LA 4TV9A 4GYWA 4AY5A 4D8TA 1BMQA 5JRJA 1H42A 3RYCB 1TQDA 3IIEA 4FC6A 1T2DA 2WIDA 3D6MA 4RETA 5FBHA 3OJFA 5HKKD 1TJYA 5EMMA 4TQUS 1FP4A 2FEKA 3M1LA 4FKZA 4KO3S 2F1KA 2FFRA 3DSRA 3LKVA 3FDZA 4TKZA 4Z3KA 2QA5A 4PYJA 2TYSB 4UMFA 3F2IA 5B58T 1IY9A 1SIWA 2VVTA 3ZS9A 3SFVA 4DR1B 3ADOA 2P2GA 5H02A 2A9PA 2PXAA 2WPNA 5CB8A 2HCTA 1ZSYA 3MQ2A 621PA 1EK2A 1F8FA 3QX7A 1BOFA 4Y6QA 3B1KA 2X14A 3TZLA 1MABA 4FNMA 1U28A 2NPIA 2Z58A 4QJ3A 1XDGA 3COVA 5FI1B 1NJ8A 2D7CA 3MNFA 3DE1X 1ATZA 1OZGA 1TQ6A 4G1MB 5BNTA 5A5DA 4X66B 4RLQA 3AR5A 4LMRA 1MJFA 1P81A 3A1TA 3KXDA 2O8EB 1PNOA 1R6DA 2HBYA 4WK4B 3TLYA 5BSEA 2B4TO 4DM4A 3WWDA 3OE4A 4LVUA 1NXQA 3RYFA 4LHXA 2HMVA 2M9MA 2YIJA 3N8IA 4CMEC 1X7ZA 2A1UA 3D8NA 4QODA 3MQ4A 2O7RA 2W58A 3B5JA 4YWJA 4L5YA 4Y0NA 5IT5A 3HM9A 3O5AA 1U9IA 5IUNC 5ILQA 1ZM7A 2OZKA 3EXEA 1BFUA 5DX8A 5LXTF 1L1FA 5CGZA 3V2IA 4IF6A 4OHVA 3B6KA 1SPXA 4PYQA 3V8EA 3SHQA 4L5BA 1MIOA 4ED9A 121PA 1N3LA 1HZZA 1DG3A 2FHPA 4RNDB 3JSXA 3OZAA 2QG9A 2X0NA 1ISIA 5EZ6B 1ZXBA 1IWOA 1RJ9A 2XUPA 3O3CA 5UKDA 4GG1A 3TZ6A 4CZ2A 1UBSB 1IN8A 5JJ5A 5JNVA 5AHRA 3D2BA 4PXAA 1YK1A 4JT2A 2C2YA 1VCOA 1QGYA 4WVLA 4C0HA 1EUZA 3LDHA 2NYVA 3SBOA 2C1EA 1SOUA 1KP3A 4QJ4A 4XYGA 2E4WA 1CUFA 4KBFA 5TQJA 1QIJA 4RANA 1TJNA 3U2QA 4Q1BA 2EEPA 2CC2A 3KAPA 4RZXA 3USES 3D3JA 2IJGX 5L3SA 3GEPA 3I1IA 1EFLA 2JEYA 3K72B 3AILA 4N3AA 1TD9A 3H2IA 4QOIA 3V4ZA 5K6RA 5LWQA 2BYTA 1Q0LA 3C7AA 4FFRA 3VYSB 4M6WB 4LZJA 3RS9A 4E5MA 1FUIA 1R0KA 5I51A 4TTSA 1BE8A 1EG7A 3B5EA 2RH9B 5ALLA 5FTMA 3BZWA 4QPJC 3LHFA 2XE8A 3ZUGA 4Q00A 1PDOA 4JR0A 3SU8A 4CKYA 2J59A 4Q37A 2PQMA 4ZK2A 1TRHA 3CC8A 5H82A 3WXMA 3PNVA 2WTMA 3NHBA 3U1BA 3O3NB 1M1YE 5FAXA 1PQYA 2CLCX 4GZMA 4GZ6A 1NZDA 1CDZA 5AJYA 3HCBA 1PFYA 5DHUA 1RFLA 2Y0BA 3QRWA 2P4UA 5JD3A 3TLGA 3WMGA 5F76A 4DFDA 4QQNA 2JVIA 1NJFA 2V5VA 4OXXA 3ZS8A 2VDWB 5BO5A 2GPWA 1G21B 3LAWA 3DLCA 3P4YA 4DSZA 2W2TA 1FUUA 4G5FA 5DM4A 1U2GA 3RS4A 1F4VA 1V9LA 1PN3A 2AEJA 1BVRA 4DWJA 3D3WB 3UMYA 3EZ2A 4CIVA 2P2ZA 1XPRA 1EWVA 2B6HA 4ERXA 4F6LA 5EIBD 5FWYA 1VB5A 2F9FA 4IOMA 5EJ6A 5C1BA 3AEUA 1QVWA 3DQPA 4ZANA 1U2RA 4NJMA 2QX8A 4F1JA 1HNNA 2JARA 1SQSA 4M9ZA 1P8JA 2AFHE 2XNJA 1L7QA 2W2VA 4YRPA 3UMGA 4BNZA 2XYQA 2ZUSA 3WKAA 2IUSA 4G0PA 1JDTA 3MT7A 4ZFNA 2UKDA 3EVGA 5A9TA 2BEVA 5HS6A 4JLSA 5KYKA 3IKJA 1BDJA 3KKPA 4YP7A 4EG3A 2XB4A 1GUZA 2DSNA 3R0VA 4RD1A 4FFNA 1Z2NX 2V9ZA 5BORA 2ZJYA 5B2FA 1XNGA 2IL1A 5J43A 4G4GA 4P83A 5AKKA 4GP7A 2R11A 2GVZC 2GYWA 3FTCA 1CVRA 1U98A 4FI3C 1K8RA 2QVZX 4K9MA 1TM1E 2BGUA 2GRAA 2XYPA 4KQ2A 4CN8A 4R69A 4ALIA 3MJHA 4XCXA 5FOVA 1TCBA 5C34B 1V5WA 1JKMA 1VL1A 3IERA 3NBXX 4IDOA 3JQAD 1GZSA 4JKIA 2Q7OE 2WOJA 1BH6A 2BELA 2PH7A 5JO9A 1GGFA 5AOBA 2RHHA 3L7DA 3X1ZA 2G1UA 5JSKA 3MT8A 2QU8A 3K09A 4N4AA 4PEVA 3E5HA 2W00A 1JJIA 1V37A 1H4TA 4P1ZA 3B2QA 1QYRA 3WWEA 3IOYA 3GGDA 3FDXA 1BMTA 1CD5A 1I2CA 4Y7DA 3OESA 4XFDA 2JIPA 4DV2B 1FJGB 3AIKA 3NVAA 1I8TA 2MSLA 1QG4A 2YWGA 3VYVA 4Z4HA 2WJIA 1H22A 4LAFA 4R7GA 3ZPXA 2PJRA 1CKEA 1GFWA 2ZYTX 2PKWA 3FZYA 1SKAA 4XTCS 1Y7LA 3VPCA 2GYYA 4YAKA 3UC9A 1NJ2A 4N5NA 1F7VA 3R0JA 3ZLUA 4FCWA 1ZG3A 1NYQA 4UBMA 2Z3ZA 3T5MA 2YWBA 1KZ9A 2HU7A 2FF5A 3FCAA 3T7EA 3GFRA 3W3AD 2XQKA 3DCNA 4MHSA 3AUUA 2ZK7A 1UUFA 2PKEA 1TAGA 3P8ZA 1GDHA 4OSEA 3V1NA 5HZMA 4O1HA 1RMTA 4NCNA 1U8XX 3BTVA 3VU9A 1SH7A 1AKMA 1YBHA 4BV3A 2EDAA 4FFVA 4JC5A 4RPGA 4B6PA 5EXDA 1U5BB 1CNMA 3KHKA 4IUDS 4RVNA 1EK5A 4OQYA 1XRSB 1CJCA 1JPJA 2AUMA 2CCGA 1QYVA 4UMEA 1UJMA 3OFND 4M0MA 5EP4A 3V2HA 5ITVA 2YOGA 4PPGA 4CL3A 1G17A 3P2EA 4LXXA 4V24A 2V0GA 3T7JA 5K3AA 3ODPA 1X1SA 4KO2S 2JJQA 1DNPA 1KP9A 3IQDB 4MYSA 1GSHA 1X1CA 4BLVA 4C04A 1NG1A 5ESDA 1Q12A 3I3SR 3IQGX 2WIJA 2Q46A 3TUJC 5TY0A 2FSHA 1TJ3A 4J0FA 4CQMD 4EQ6B 1E9VA 4BQIA 1TUIA 3AKZA 4B7XA 4EJSC 3MHPA 4D41A 1Z0AA 3KQYA 4MGYR 3TKAA 3WAGA 4IRMA 5FWDA 3P2YA 4XR9A 3QVXA 2PG3A 5E2BA 2JA2A 4TMYA 3GLIE 1XQYA 4HWTA 3MLAA 1EXNA 1W75A 2QD3A 2XF2A 5BVHA 5JWRA 3IJ5A 4HGYA 1PZMA 1Z26A 1ZGGA 2B7BA 2FFBA 4TZ0A 2VDVE 4NEHB 1CEYA 1T3HA 1NJ5A 1JG2A 1J0DA 2X1LA 3UK2A 1MJ5A 4RENA 1J0AA 2HJHA 3DMYA 3C3YA 2C29D 3IODA 2CJWA 3KSUA 4BVFA 2VSNA 3V55A 4JBGA 3NR2A 4E21A 2Z4SA 1E7MA 2I67A 4OQZA 1QKIA 5JCJA 3WLSA 4A2CA 5GONF 3R5FA 4RK7A 3NOOA 2Y2UA 4OYLA 2ARKA 2QJWA 2TMYA 2Q9AA 2J33A 3DE0X 3JAWB 3IR7A 4FCTA 4Q05A 3X1KA 2OQIA 2ZRKA 1LU9A 4L72A 2HLHA 4XYLA 1AHPA 4B48A 5A4DA 4JT4A 1ULSA 3QFHA 4X6UA 4QBIA 1POXA 3FUXA 4IP0A 5SICE 4C7VA 1G59A 2R00A 2ZBVA 1NM5C 1E3DA 2JG3A 2XCRB 3PWKA 1O5TA 1Y4AE 4QPPA 1LC3A 2QG6A 4FZJA 4RXUA 3MZ0A 3B9BA 1VE5A 4OQPA 1KZ1A 3U44A 3AZPA 2ZFUA 2GOYA 4PINA 5FF9A 5FHRA 2ZAYA 4ZI7B 2CFOA 4CODB 2AI2A 3DBRA 4MULA 4HT3B 1AC5A 1AV6A 4LVNA 2Y1DA 3BSYA 5HNKA 1NW5A 1A7AA 3C7TA 3AY7A 4TTTS 2O0KA 3R9KA 2YQ4A 1SUWA 1N6PA 1E3WB 2R8OA 4QATA 3I23A 1JVSA 4K0RA 3G1WA 5FL7A 2L82A 4PTZA 1XQ6A 5F2OA 3TTSA 5CA1B 2OO7A 4LK2A 4G85A 4NATA 4YQZA 5EFOA 4DC1A 5KTMA 2QXYA 3RVQA 2YS6A 2H5JA 3DAPA 1XQ1A 4FFMA 3SSMA 5IT4A 4M9XA 5CCDA 3ECAA 5LZ8A 1PWZA 3CNEA 1OAAA 5JLAA 4D6XA 2CLDX 5C8ZA 2X1VA 2XWJI 2PANA 1NE2A 4G5XA 4M2LA 4GC5A 4PO9A 1Q44A 3UWMA 1ATIA 1HH4A 3PKIA 4DR5B 1CDOA 1MJGA 3EXG1 3U6KA 1PL6A 1WCIB 1OBVA 2FW0A 4GWGA 4Q3CA 5DCUA 4LDNA 2AXPA 4IJUA 1E3SA 3DTVB 2HTFA 2XHZA 4KODA 1XNJA 2ATEA 3O3MB 4Y2SA 4CR6A 2EZUA 1HQKA 1LRLA 3C4VA 3UV7A 3KYCB 3LVFO 3UOGA 1UINA 2VH5R 5LP1A 4E46A 1AO0A 5C0OE 2D06A 2DKNA 1NU8A 3EZYA 4Q82A 1IIBA 4PSAA 2HLDD 1E9RA 3D4BA 1SXPA 3AINA 1XP8A 3SZUA 2P9GA 1KF0A 2JI6A 3IQWA 4DYHA 2CVQA 3Q0IA 1CW2B 5LIPA 3Q11A 3GAMA 3CJRA 2H54A 4HGOA 1JHRA 4IGFA 4Y9DA 1PZEA 4BB0A 4EECA 5GVRA 2WAMA 2XGSA 4U2FA 3I52A 1Q1AA 2E55A 2L17A 2NQTA 3E22B 1J8DA 2E9SA 3EMDA 1GGMA 1P5FA 2F3QA 2ZR7A 3HVKA 1EFUA 3H4MA 3TINA 1REQA 3ZHXA 5EJGA 1LEHA 2B2XA 3EYAA 4YRZA 1F12A 3TIIA 2HK7A 4C3UA 4E5VA 1EHCA 2DUMA 2YJ5A 4NE9A 4PZZA 2GD1O 3I5MA 1EIZA 3Q7SA 2QI9C 4YAJA 3L1JA 8MHTA 3LBFA 4IHJF 2BFDB 1HZJA 4QG7A 1RM3A 4EGSA 4TKVA 3BYZA 4LS3A 5B7GA 1IHYA 3RJMA 2ZPUA 2IXDA 1GDDA 4WBSA 1RR6A 3WQRA 5JR3A 1XEAA 3E1GA 2HSDA 3EEQA 2C2XA 4D3DA 8GPBA 2NGRA 3DL0A 3UJ8A 3GBVA 5ADHA 1BHO1 4IY1A 4C2AA 1S0UA 1JKXA 3N53A 3VJKA 4RF2A 3UMRA 4F06A 4RSRA 2LKCA 4DNQA 1ORWA 4R71A 3ZDAA 1CUDA 4HDNB 5E9AA 1QH1A 3HCPA 3I0NA 2EZ4A 3TPFA 5BSVA 2YBDA 1WZUA 1PJQA 3CE9A 3SR4A 1Q57A 3VH2A 3JAKB 4YRMA 5AR1A 3IMCA 5CEJA 4FDAA 1BD3A 1J2EA 3NHYA 4DV5B 2IHYA 3K7EA 1XU7A 2XNKA 5JS6A 4FM9A 3R9IA 5FCDA 1ORDA 1EDEA 3ABZA 1D6JA 5GADl 4K6HA 2OWDA 3A9CA 4G0QA 5C8YA 2AL7A 5AVTA 2VPWA 3TNLA 3D8TA 1YQTA 1RBZA 5ESWA 2ATIA 3N7UA 3U6BA 2ENWA 1JIUA 4OXKA 2GEFA 4TWRA 4AUNA 2C9ZA 3VJLA 5JT1A 1FX0A 4OXQA 1DQPA 3R6DA 2NXNA 1Y8AA 3PQ5A 5IZCA 1L4LA 1JAHA 4JA2A 5GV8A 1DPFA 2EKBA 1XAGA 2FK8A 2JHAA 4J4TA 4W4TA 3VPSA 2M2IA 4Y2RA 3PDHA 2QV7A 1HYHA 4N9WA 4ZVVA 5ADWA 1FPQA 1GLNA 1U80A 2W6JA 1SHKA 3JVIA 4HX9A 5G0WA 4WGFA 2IZ0A 1P0CA 3HH8A 1Z0DA 3GN2A 2CBXA 1UPTA 4TUYA 3ODGA 3IVMA 2ZZMA 1ECPA 2O0HA 3L6EA 4MV1A 5AXCA 1RXVA 3L18A 1QZ3A 1NLYA 3IEIA 3NZEA 5CW1A 4AG3A 4C0WA 4HJRA 3TXAA 3GJZA 5CCBA 4QO7A 2A5LA 1HPLA 4QYTA 2JW5A 1MAUA 1UQTA 2JB9A 2C7PA 3MGKA 3BHJA 1M5TA 1YTLA 1IQ0A 1ZSVA 1QE5A 2JI7A 3JZDA 4HCJA 5F4BA 1GL6A 2ZIUB 5FNVF 3TD9A 5KNCH 1XZPA 3GLRA 3KLMX 4TYWA 4M1KA 5ITZB 2CVFA 2J0UA 2CD9A 4HWRA 4C3OB 2XKAA 5CPFA 5LYYA 4IMIB 3G1UA 3IOMA 3ZQ4A 3HY6A 4IDBA 1LDGA 5BN4B 2IY8A 4KN8A 3K9LA 4C1BA 2V8OA 1FW8A 3LT2A 1QAMA 1C4KA 1VQ1A 1ZZEA 2XYHA 1IATA 3EHDA 1I4WA 3OX3A 1COZA 1CS0B 3MCZA 3STWA 2DUJA 1RE1A 1NNLA 1NV9A 2LR0A 4LISA 5ALQA 3ZXSA 5I4BA 3GPBA 3E2PA 2WWVD 4CMEA 2JGIA 1Z4MA 1AGXA 5JCJD 2E18A 3VUEA 4ARCA 1ZHOA 3QKUA 2IEDA 1T5OA 1ZONA 1H1LA 3UAYA 4QULA 1DKQA 4BKMA 5BWOA 4DB4A 1LI4A 4RJIA 4TXLA 4WDQA 4MS3A 3HADA 2KE5A 4A8TA 2ZTSA 4ML3A 3ZHZA 4QPDA 4GICA 1DOAA 1VL0A 2FWIA 2OCPA 4QO8A 1I4OA 2HADA 2O8BA 1E4YA 3TKLA 4HNGA 1D1SA 3GUCA 3R41A 3HG7A 1G2PA 1I3LA 1TIKA 1NV8A 3IBFA 2GX6A 4HFNA 4XW2A 5T67A 5LP6B 4XI9A 4IV8A 1HDCA 3N2GA 4XLZA 2JAWA 4N7JA 4UZSA 1CF4A 2M1ZA 2O3RA 4DIEA 1Y81A 3T35A 1JSRA 4HUQB 3ZE6A 2I6GA 3MBIA 4C0BA 1CPYA 3WAJA 3E81A 1I5OA 4WFQA 1QTIA 2VOEA 5FL7D 5AUQA 5H0IA 2ANBA 1VG9B 5BSGA 5JSZA 4L9SA 4NENB 3DE6X 2QJTA 5MGBA 5EHNA 1TM3E 3L7BA 2BIFA 1QVAA 3T0FA 4MR8A 3O2NA 1VIDA 4YXWD 4RELA 2W83A 3WGTA 2RG7A 2V59A 3O1IC 5AKLA 3MTEA 3CUVA 4C4YA 4XVCA 4CL2A 4B3DA 1QPZA 3ONEA 1XZJA 1Q1BA 2KI5A 3FFAA 1W5SA 3O82A 3OE5A 2QTAA 4G41A 1QYXA 1KEVA 2QLFA 3HXKA 3R3YA 1VZ3A 2XVAA 3BXGA 1BROA 4UBOA 5I4KA 1QO7A 3U9TA 2KW5A 1H0KA 2DE0X 1IG0A 1ZVJA 1AOXA 2FFQA 2I87A 1S2GA 4ZAGA 3O4FA 2O4CA 1ZD2P 1QDUA 1JR3E 1NIJA 1VFNA 1YONA 1KYXA 2NUAA 3GZNA 3L4SO 2CNLA 4MGZR 1IXRC 4RMJA 1YVDA 4BGIA 2FZEA 5BWLA 1DUIA 2ILVA 2G8NA 3NKFA 4NAVA 2Y1GA 1KYYA 4EUHA 3S8EA 1DCTA 1YJ5A 4A8JB 4NAHA 4Y9SA 5HK9A 3H42B 1FRZA 1I6WA 3FHOA 5ILOA 1J39A 5FTJA 1TXGA 2FQQA 5KHAA 1UDBA 4CKXA 4DILA 1NXVA 2CKMA 4IGKA 4YASA 1IPHA 2YJGA 3CLUC 3QKRB 2CHQA 4ZVLA 4S04A 1XAJA 3HCCA 3JQ8B 3K8OE 2W0MA 1R0RE 3OSZA 4QGBA 4BQFA 1MB2A 2I6TA 2IX9A 2JKVA 3KR1A 4RWZA 1PLLA 2CMDA 1C8KA 2OXCA 4OMUA 1G8SA 4RVFA 3RRNA 1OROA 5ITSA 2PY6A 5KZMB 1PJCA 2DAPA 5KYTA 1IXSB 1ODCA 1A9QA 1DL5A 2XWBF 4NZPA 4H0CA 4M0FA 4X54A 4PAWA 3NFRA 3HL0A 1P45A 2ZIAA 3HYRA 3CF0A 4NKRA 4NU8X 4PGGA 2M6LA 3ZK9A 4R1LA 3KV3O 1OLXA 2FG6C 3DOJA 3FIJA 3GROA 4H1WA 5I3CA 2NNLD 2E85A 4X20A 1YRBA 3C15C 3PQ8A 1JEJA 3BDVA 3GCDA 5EI5A 5JNLA 1I1OA 3R5SA 4PCLA 1TMYA 4BECA 1NQ5A 1CP3A 3K6JA 2WI8A 2Q4BA 1UBLS 4E03A 3LRXA 1HKUA 3C7CB 4RSHA 4B4VA 1JG4A 1PKEA 1WDMA 1JR2A 3L7OA 4MNTA 4N5DA 4A7PA 5ELXA 2C7RA 3ZNNA 1Y3CE 3VJMA 1IJKA 1W59A 1K86A 3JQ7A 3AB8A 1FMLA 2FPUA 3HSKA 3U39A 3AF6A 2OLJA 1D4AA 2FE4A 1YOBA 1HE4A 1C30B 2K2QB 2OCXA 2WF8A 2ZIXB 3AWDA 3PGVA 3SIRA 4AKGA 1A97A 1DBIA 1YAHA 1ABFA 4EI2A 2X5KO 4Q7KA 1L5ZA 4A0SA 4MUAA 4FGWA 4WN3A 1MQ8B 1LFAA 5AM1A 3V8VA 4EDFA 4M86A 2BEWA 4JP2A 5C52B 2HF8A 2BFFA 3RFFA 4P7FA 3WK9A 1U2EA 2B92A 4YK7A 4BRSA 1OWPA 3NC0C 4O0MA 1SK8A 1V4BA 3LZCA 5FNZA 1IZYA 1D2RA 1JXQA 2DLNA 2FQXA 1C3EA 1QUEA 3CB4A 4FS8A 4WFIA 4AZVA 5SYNA 5LQAA 1XZFA 4Q39A 2DUUA 1HT2E 3C1AA 1IAVA 3LPLA 4TQGA 2C31A 3I8OA 4DLBA 4M88A 3RVLA 3E7FA 1WVGA 1Q1NA 3AHCA 3LRPA 3PQ2A 4GMKA 3W2EA 2WT9A 1JI3A 5C7YA 5JD5A 2W6JD 5KNCA 5BN5B 4LRSB 1OLUB 3LUBA 3VR3D 1OBCA 3CPSA 3ER6A 4H7DA 3TMYA 5L4LA 1DKPA 1CRWG 5ECWA 1CEEA 3K35A 3KJGA 5DN6A 2RCNA 2QMQA 3F73A 1TX4B 3V2GA 2FX2A 2J48A 4HAOA 3K8QA 4DR3B 4DBLE 2PA0A 1X9GA 2ZVPX 3LTEA 1T6YA 1YR2A 1QH9A 4EOGA 1HOXA 4TROA 1L4BA 1SIOA 2IPNA 2R1UA 3BREA 4L0QA 2LBPA 4DLZA 5I9LA 3EAQA 1KC1A 1PWXA 4I4CA 5ALOA 1N6HA 1LTHR 1W5TA 3I1JA 3I6MA 4C5CA 1GYPA 3AJ8A 4EA6A 2LNDA 1FVOA 2OGWA 5CNJA 3OZXA 5B4TA 4X62B 2DPXA 1O9GA 3I42A 2VYVD 5B3KA 2IPAB 5FORA 4BQSA 4EJSA 4MR9B 2YVKA 3H05A 2QG4A 3GFGA 1XZGA 2C9YA 4I50B 4LPSA 4D0SA 5GZ1A 3VBCA 2QTRA 3B1XA 3SHFA 1X2EA 3C97A 3MILA 4IHKA 4B6SA 1WXDA 3FXAA 4J0DA 2ZYRA 2FKAA 3MUEA 1ZSNA 3DM5A 1Z0FA 3GDWA 4BYGA 1NVAA 4R0NA 2XJ4A 4IGEA 1LBEA 1WCXA 2FYTA 2HCRA 2QJFA 3PNQA 5F23A 1JIJA 3R8XA 4QGSA 1MFZA 4X7RA 1UADA 2PCJA 4UU0A 3T1VA 2R6JA 1FBNA 2OESA 1UMCA 2R25B 1YC5A 5A62A 2WIAA 1QRAA 3L0OA 1NVEA 3A58B 2B1GA 1T5TA 4B6EA 4HAXA 2HA6A 1QIIA 4Z2AA 2QLJA 2LV8A 4IDDA 2N47A 4WZZA 1P5HA 3H2SA 1J0EA 1NURA 1C1YA 2HDWA 2WTXA 1KH2A 1M67A 1T13A 2OZVA 3H97A 4KVFA 4IX9A 2H08A 2B8WA 3GUYA 3NTOA 3UUFA 3OEWA 4CM8B 5CB4B 3EMKA 1ESNA 1POWA 1YKFA 2PLAA 3PQFA 3WTCA 1NDHA 3E3LA 1AN0A 3JQDA 1C4XA 4N3CA 2VP4A 2VXYA 2BY4A 2RGXA 4MUEA 2DQYA 2Q1YA 2GZMA 2CMFA 4RK0A 5AHWA 1W4LA 4AQ7A 4V1CB 1G8JA 3ANSA 1ZUD1 4OGWA 4I5IA 4KPYA 2IE8A 1RJFA 3CBQA 1A88A 3D4PA 5FPPA 3U60B 4M7OA 5DTQA 3U5TA 4FDTA 1CQIB 2W4MA 3GEDA 2OD2A 2ZBRA 5GJWC 4JVSB 2JIZD 2XRFA 4XM2A 1NOKA 3U4QB 2AXQA 1IMOA 2YIVX 1JN0A 1QOQB 3DFZA 1XWIA 3NH6A 4Q3OA 1BKSB 1CUUA 3MS2A 2OT3B 4JDUA 3ZKAA 4QUEA 4HSEA 1T10A 1F2UA 4ICIA 4OKIA 5CFRA 1NMEA 5ENDA 3VVMA 1OKKD 4XIIA 3B52X 1R12A 2SKCA 4Z9XA 1J9GA 1ESMA 3CV3A 2H1LA 3LQ4A 2W0SA 3PA8A 1VHTA 4NE2A 4GSKA 3I6YA 2WAOA 1WOYA 2X0EA 4I2VA 4D9NA 1RXUA 3G9ZA 3IUBA 2C5AA 1IMJA 2C61A 4QYXA 4AJ4A 3DT9A 3NM4A 2P9TA 2FP3A 3MTDA 1VMDA 1KR5A 4NY1A 5HK8A 3TW0A 1WW2A 1GILA 4LHVA 3HPQA 1ZESA 1D6SA 1TRKA 3RFTA 1U8CB 3G13A 3S68A 4ZYZA 5IF3A 4C14A 1QSGA 1YNOA 2WTEA 2AEEA 4YO8A 3WMFA 5KWSA 3F1KA 2QLNA 2XA2A 3GP8A 4RH0A 4YPFA 2DRIA 4P86A 4UKDA 3VO2A 1HLDA 1V1RA 4WCDA 4WACA 3IB6A 5ADVA 1P3Y1 3NG1A 2G07A 4MDEA 1TVKB 3N2EA 5BXYA 2IOHA 1TKCA 3KTFA 2AA3A 4HDKA 4UVIA 1XQWA 2ACVA 2GESA 5JASA 3O95A 3K73O 1OH7A 1FE8A 3U7HB 2ZE6A 2JAUA 1R0WA 1IYZA 2Y1XA 3BJMA 1KYQA 2RAPA 4PBRA 4WERA 1YDFA 3V4FA 3F8WA 3VZDA 4XIFA 4ZGBA 5LMNB 3GU3A 5GJVC 3A4VA 1GGJA 3PR1A 1KEZA 2EP5A 2QM7A 3DBHA 5LOVB 4ROSA 5JD4A 2F59A 2JGMA 5EIAA 4DCPA 4DA8A 2VDKB 2VNHA 3KTOA 1W44A 4C6SA 4AIRA 3CNHA 2FH5B 3K92A 4PAMA 3CG4A 4CTKA 1DGQA 2AN4A 4S0ZA 1RXCA 2P3SA 5CHEA 5IMSA 2EFDB 1P0QA 4ZI2A 1ZHHA 3BPSA 2A14A 4EG4A 3BK1A 4RL4A 1PG0A 1XEXB 4UOQA 1K98A 4XSGA 3WI7A 2GK6A 4D9KA 2ZWVA 4BGEA 4CIDA 1HETA 2HHCA 2ETVA 3OM1A 5FUYA 3DXZA 2Z56A 3AYXB 2XKKA 4BE4A 4CIXA 3AL0C 1TT5A 4OIFA 4K9SA 2IFTA 3TVTA 1DTEA 1RQ2A 2VBCA 4D4JA 1NBWB 4JYMA 1AU9A 3E8SA 1Z33A 3ZV3A 4MW1A 1WQ1R 2ZANA 5G40A 1P2SA 3K96A 4H7JA 1N7IA 1PD1A 2C9MA 1LJLA 1W0JA 4XFJA 1FB5A 4AJEA 2PHZA 4ZREA 1ZN9A 1DFHA 2H48A 2LCQA 5JZ9A 2WPDA 3FSEA 4DSUA 4HVLA 4WA7A 3QXSA 2LWIA 1I0LA 1WABA 5CHYA 5GOTA 4BE9A 1EB8A 2HA2A 4M21A 5P8WA 4MLDA 1JLHA 3BH6A 1J1ZA 4V0LA 1EFAA 1K9SA 4L76A 2PS0A 3G5UA 1PL0A 2C4MA 4ALKA 2FN3A 5EJAA 3KJFA 2QENA 1L7PA 4Q4HA 3A4TA 2QN6A 4RTOA 4Z1MD 1DO0A 1ADFA 2MYUA 3MWJA 1PTKA 3HN2A 2NWQA 1C7FA 5IS2A 1L8AA 1P39A 3LFHA 3UW3A 4FOPA 2FQWA 2FPPA 4BJ1A 3VC1A 5JW6A 4UE3S 3NV7A 1JG1A 1YS4A 4N3NA 5J3JA 2GKGA 3GJYA 3FVRA 3KALA 4K2AA 5K8VA 4ZVOA 2IEAA 4DRXA 1R1DA 1YDGA 4YPOA 2I9KA 4XDHA 1YJCA 1KEPA 4AJ2A 2YKGA 4ZIRA 1JSXA 1OJ7A 4OEHA 3RH0A 3U40A 4BFLA 4J6FA 2AW3A 3R40A 4MB0A 2DULA 3IKMB 5IDVA 4ARBA 1F7UA 1AV7A 2ZRFA 5D3MA 1B6TA 3IEKA 2NU7A 2WV9A 1H2YA 1EWRA 3IX7A 3LX5A 3OKPA 4JJIA 1CYEA 1EXWA 4B3IA 1CJKC 1NRXA 2JEZA 3ZGVA 4DNFA 3M4ZA 4OJQA 4DJDC 1L6IA 2F62A 4HH1A 1WZEA 1DQNA 1I2ZA 2LD4A 3DOEA 3KKEA 4M7RA 4F5EA 3QKWA 2QP9X 1UBNA 4MRMA 5FOQA 1AMUA 4US1R 2QX9A 2XUDA 4S0XA 3N1UA 2XD4A 1XVIA 3KVOA 5E38A 5LJLA 3P1JA 1Q0QA 1Q0HA 3WLMA 2O7QA 1EMDA 5SZIA 5KSZA 5CVTA 4KDCA 1HT1E 1CVIA 4R2KA 1KI4A 3FG9A 2IIBA 4M1QA 4Z7QB 3B6EA 2TRSB 2I7XA 3G2IA 3DV2A 1I9GA 1N9GB 1W4BA 1RXWA 3SNHA 1YDMA 1E7WA 2DPYA 3H1EA 3HXQA 4R8LA 3KNZA 2BBSA 4MVJE 5EPEA 4AS1A 4HX5A 3NYQA 4JENA 3WSTA 4AUKA 1LJUA 1UJ4A 4DF3A 3RBVA 1Y1SA 3FPGA 3F6RA 2BW0A 5BSTA 1IHPA 1QOPB 2YV5A 4NCXA 2W8BB 2D7DA 2JAOA 1U7UA 5GONA 1DTWB 3AERA 4RX1A 5BR7A 4F3TA 1RI2A 1G20E 3HBMA 2JATA 3WYEA 2UVDA 4LEIA 1KSFX 4GKAA 2VJBA 1AO3A 1XO1A 7REQB 5I6DA 4R9UC 3PU6A 2PBLA 1YKSA 2A5YB 4OI4A 3RC7A 2G9UA 2OUIA 221PA 4K6OA 3D02A 3QI7A 4NE7A 5U1PA 3PR2B 1U3WA 1MO5A 1LFDB 3BTSA 3GA5A 3HNRA 1DG9A 1RJWA 1V71A 1H2WA 3MGBA 4FGLA 1E9SA 4M1WA 1MT3A 4W1SA 4QT4A 4ZTZB 1M2OB 4CF7A 4INOA 3UJBA 3BJRA 3MINB 3RSSA 2H8KA 2BMEA 1NBAA 3KC2A 3ASUA 1O03A 1PJ4A 2RGDA 4HDAA 1XD2B 3E15A 4QDXA 4X60A 1CZRA 4NYMR 1PUXA 1LSSA 5FJJA 2GPTA 1NZFA 3MUOA 3HKEA 3O1HB 4M8NE 2FW6A 2IYRA 4E94A 1A2QA 3MS4A 3KSDO 1V1JA 4XQ0A 4A0RA 3CRNA 1EZ4A 2O2XA 2QEQA 1UKZA 2B78A 1RPAA 1E98A 3MS7A 4LUCA 1N2JA 3ITEA 4OBXA 4OH7A 1Z5GA 2DT5A 3TD2A 1XF1A 2HC9A 5HRUA 3GQBB 2DXIA 4YRKA 1A9XA 1QB7A 1Y33E 3OZEA 4LZAA 4M9RA 3EPRA 1UT5A 4EF4A 1FMFA 1L3BA 4LOLA 4BLSA 5NLLA 4QUGA 1QC5B 3FPEA 1OXKB 1KWKA 1LNQA 3BCUA 3FJOA 4FLFA 1SVSA 3IMFA 1JIXA 5JS2A 1ISJA 4RVSA 4YJ3F 3OF5A 3PUIA 4FN5A 4QDTA 4LFAB 3OPNA 4Q6WA 1R4ZA 4J90A 1T36A 4IIXA 4KRGA 5CTAA 1SUPA 4YTEA 5CDSA 1U9YA 1MT0A 1T4BA 1LTQA 2R8XA 5B2ZA 2QOEA 5CUQA 5TSDA 1CY8A 3UKOA 4JEUA 3HB4X 1O0CA 4E15A 3BVPA 3WGGA 2JJ2A 3EZ6A 4FT2A 1MORA 2WD9A 3BSSA 1G5IA 1XCMA 3ICPA 4AC9A 4YYEA 5DN9A 2YOHA 4DQXA 4M1OA 4P4TA 2V65A 2ZSDA 3JD2A 3IH5A 4X45A 2W6ZA 5FOWA 4JC4A 4R8SA 1TADA 1VPLA 3EIHA 4NZNA 1BVUA 4XJTA 5CMLA 4DMKA 3B1ZA 3HB9A 1YASA 4DDTA 3EIXA 1V3UA 1L8QA 1YH3A 4IRUB 1HQDA 1AQJA 1KQPA 1SBZA 3VZPA 4EO4A 1BO6A 4UM5A 1UC8A 3ORSA 4M7WA 4Q9LA 2JIOA 4RLHA 1IUOA 5FD8A 3ZU4A 1CZHA 5KUTA 1YIOA 4CFZA 1XTRA 3A3NA 1MD9A 4XWOA 4C30A 4X85A 4TV9B 2JD2A 5B3JC 2Q3MA 1LSUA 3L1KA 1NVUQ 1WKVA 2IDJA 2H2GA 1SA0A 1RRPA 1RKUA 4YIKA 4E6EA 3D8BA 1UAYA 1FP4B 1WEHA 1KZHA 1T8WA 3DEJA 2YYZA 3BIFA 3P20A 4RE5A 3FDZB 1QHYA 4CHTA 4DZRA 1HBJA 4N41A 3QPDA 3B60A 3QUTA 4JJKA 4KXQA 3IE1A 1K4YA 3NKVA 3NHSA 3F5MA 2I34A 1W0JD 3IT3A 2H2AA 2ZT8A 3HPRA 2ZJ2A 4KIWA 3KZCA 3TQHA 2XNDD 2YY5A 1MABB 1P44A 1T9AA 2Z9BA 2GM3A 3CZPA 4NOKA 4TZTA 4DIFA 2ZZKA 2P2DA 1LB1B 1BC5A 1G66A 3OHMA 1AQ6A 3DVLA 3V80A 5B5SA 1O0BA