3RODA

Methyltransferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
259
Chain Sequence
SGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate recognition in human nicotinamide N-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nicotinamide N-methyltransferase
total genus 87
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.1: Nicotinamide N-methyltransferase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3rodA00
2I7CA 3EVGA 4C06A 1ORIA 1L3IA 2F8LA 3NTVA 4E32A 4YMHA 1SG9A 3TQSA 4A6DA 2YX1A 3OZTA 5GINE 1DCTA 3QV2A 4MTLA 2OY0A 3FUTA 3NJRA 1EAMA 2PV0A 4FSXA 2P35A 1JG1A 1X1BA 4U7TB 1FBNA 5K0NA 4CTKA 3M6WA 2ZULA 4PIMA 4PYKA 3LBFA 1JG2A 1ZGAA 3EVDA 2XYQA 3V8VA 1QAOA 3GCZA 4HGZA 1YF3A 3KQSA 5EEHA 5FCDA 3IHTA 5DTMA 4YV2A 1VQ1A 5E2BA 5E9QA 1VE3A 3GO4A 1X1DA 2ZBQA 3KQWA 5F2OA 3TOSA 1MHTA 3PVCA 3I53A 2QRVB 2KW5A 1O9GA 3QOWA 2H11A 2Z6QA 2N47A 4OQEA 5FULA 2Z6UA 3P9IA 1M0EA 2HV9A 4PNEA 2NXJA 3GDHA 3AY0A 4RTKA 2UYCA 4DM3A 5E1OA 2BR5A 3I58A 5EHIA 4EK9A 2IDKA 2XVAA 5DM4A 5GP1A 4E33A 1NW6A 4BP3A 4A6EA 1NKVA 3LDUA 5EMMA 5H02A 3HVHA 2R6ZA 3AXTA 3M4XA 3K6RA 4BLWA 5E1DA 2CMGA 2VDWA 3A27A 5BW4A 3KQYA 3ER8A 1TW3A 3FUUA 1FPQA 3EPPA 1I4WA 4HTFB 3RIEA 1JTEA 3NWEA 3T7RA 4EKGA 1UFKA 3CJTA 4HC4A 3LPMA 5LQCA 4HSGA 1G60A 4OBWA 1YB2A 5EG5A 1QZZA 5G02A 3NW9A 2E5WA 1YZ3A 1DUSA 4AZVA 2WK1A 4KIGA 3OFJA 4ER3A 5MHTA 2AOVA 4ZTBA 3UJ9A 3R24A 1N2XA 4RVHA 3C3PA 1YFLA 3KR9A 3C6KA 1IY9A 1P1BA 1R8XA 3G89A 4RTJA 1SKMA 3KR2A 3AXSA 3KR1A 1XCLA 3C3YA 4MIKA 4OX9Y 1WZNA 2I62A 3LHDA 3NVKI 2PY6A 4V0RA 4PYIA 5HILA 2QM3A 3SXJA 1EJ0A 1KYZA 5DM0A 5DT2A 4DCGA 4PYOA 3FPEA 3OFKA 4QQNA 1R00A 1P91A 4IV8A 3B3FA 4U7PB 4ER6A 4FGZA 1INLA 1XDSA 2IP2A 5DXJA 1WG8A 8MHTA 2AOUA 1ZQ9A 1KP9A 3FTCA 3PB3A 4IWNA 2V74B 5E9WA 5HFJA 3P2IA 3KQTA 4QPNA 5DTRA 5EQJB 4GC5A 3UFBA 4YUYA 3LBYA 3NVMB 2AOTB 4AZWA 3JWIA 2YVLA 1SQFA 3BZBA 3P71T 4R6XA 5CVVA 3AWIA 2OXTA 1RJDA 3E23A 1YFJA 4RTQA 2UYQA 4GOMD 5T67A 1ORHA 3FUXA 1G8AA 3BWMA 4HGYA 5DSTA 5DTQA 4FT4A 1L3CA 4XUDA 1AV6A 4R6WA 3NDIA 1MJFA 4AUKA 3T7SA 1TW2A 5ICFA 3A7EA 3P9CA 4O29A 3FTEA 3DLCA 3CJRA 4H0NA 4RVDA 2PVCA 5E2AA 2B3TA 5EEGA 4PYMA 3T7TA 1R18A 4RV9A 2GH1A 3PFHA 5K0LA 1Q0TA 3OZSA 1O54A 2CKDA 3PFGA 2EG5A 4Y2HA 1IM8A 2EJUA 2QE6A 4AZTA 1RI4A 2P41A 3HCAA 5DM2A 2OKCA 1BKYA 2FHPA 4HRAA 3ME5A 3TKYA 2NYUA 2P3QA 3HNRA 3GRRA 5LQRA 3HA5A 1RI5A 2PT6A 2Y1XA 3KQPA 3KQOA 4KWCA 3LCCA 2B25A 2GA9A 3OPNA 3RODA 4CXMA 2ESRA 1G6Q1 2PT9A 4RVFA 1B42A 3PT9A 2O57A 1EIZA 2ERCA 3P2EA 10MHA 3O31A 1TPYA 1JSXA 4QTTB 4DZRA 3VC1A 3UBTA 2AOUB 2HR1A 3BUSA 3HCDA 4PYJA 3P8ZA 2YXDA 5IH3A 3VSEA 5EMKA 4PIPA 5KS2A 2GS9A 3LDFA 2P3OA 2ZZKA 5FQOA 7MHTA 4C07A 5CCBA 5BXYA 3CJQA 2O0LA 2VDUE 1EG2A 2CMHA 4ER7A 1G38A 2LD4A 1ZG3A 5HIJA 2PX4A 1X19A 3DR5A 3G5TA 3KPWA 3G2OA 1PJZA 2ZSUA 2PX2A 3KPJA 1NT2A 2IIPA 2H00A 3E7PA 4FSDA 4BLUA 3MB5A 5K0BA 1NW3A 4M38A 4RTMA 2PWPA 3HA7A 3UA3A 3MAGA 3Q7EA 1Z3CA 4M7RA 1G8SA 3HM2A 3CGGA 3M6XA 3K0BA 1QAMA 4KDRA 2VDVE 3G2QA 5CM2Z 3TMAA 3SVZA 3ELDA 3HVJA 3GXOA 4FS8A 3ORHA 2O07A 3A4TA 4RX1A 3TLJA 9MHTA 3FUWA 5IKMA 1P1CA 1YZHA 2AOTA 4HTFA 3MHTA 2ORED 4F86A 2YR0A 1UWVA 2BM8A 2JG3A 2EFJA 2QYOA 3GIWA 4LG1A 3DXXA 3Q87B 5GWXA 1JSZA 2DULA 2JHPA 3GGDA 3NWBA 4QDJA 4QQKA 5EOVA 4DF3A 4DA4A 4RTRA 1JQDA 2PBFA 5K05A 2IBSA 3JWGA 2YUIA 2H1RA 3B3GA 3B89A 2HMYB 3LKZA 4V0QA 5DX1A 5FADA 5FWAA 2PJDA 1SUSA 3KKZA 1HNNA 3G8BA 5LQNA 2NP6A 2G70A 2P3LA 1D2CA 4IKPA 3FUVA 5EPEA 1DL5A 3HCEA 2G72A 4PCLA 5HIIA 2QRVA 3JWJA 5T6BA 2OB1A 3MCZA 2QY6A 1WY7A 2A14A 4GF5A 5EHGA 1O9HA 5DRTA 5KVAA 2XBMA 1T43A 4M37A 1FJXA 2PXXA 3A25A 3AJDA 3BGIA 3FTFA 4DMGA 3LCVB 3EEOA 4OA8A 5LQJA 3PX3A 4C05A 5K0EA 3HA3A 4FZVA 1I9GA 3BKWA 5CUQA 5DXAA 3M33A 3UWPA 5FHRA 2ZIFA 4Y30A 5ICEA 5LQAA 4QDKA 3UZUA 5K0FA 2PSSA 5FQNA 4X1OA 5K01A 3EVZA 3EVAA 1JG3A 1KPGA 3CCFA 1JQEA 4E31A 5CVUA 2PLWA 4LWPA 3R3HA 4EKIA 3LDGA 5DLYA 5BP7A 3FPHA 4R8SA 4OA5A 2IH2A 2AOXA 1Y8CA 4XUCA 2CL5A 3CC8A 1RI3A 1HMYA 1JG4A 3FYCA 3TFWA 1VBFA 4YUZA 4RTLA 2YTZA 3I9FA 2PXAA 2WA1A 3G5LA 3GNLA 5E1MA 5FHQA 3SGLA 3PS9A 1WXXA 5E8JA 1XVAA 4PGGA 1SVUA 5JUWA 4YV1A 4GOND 4ER5A 2ZIGA 5EKUA 2AVDA 2HWKA 2GPYA 2NP7A 4Z2YA 2IBTA 3EVEA 5GIPE 1XDZA 1U2ZA 3L8DA 1N7JA 4UOEA 2ZFUA 2BM9A 3EGVA 3SMQA 3P9KA 2GAFA 3LCUA 3LSTA 2XYVA 4GOLD 4LWOA 3SSMA 3MGGA 3DOUA 5GM1A 3GRUA 3M6UA 4GBED 5GOZA 2ZBPA 3KPUA 3D2LA 5K03A 2B78A 3NDJA 3R0QA 1L9KA 3P97A 3KR0A 2OYRA 3DLIA 5LQUA 5ICCA 3X0DA 4E70A 3KQVA 2OB2A 4ISCA 5FA5A 3G2PA 5LSAA 3EGIA 5GM2A 2ZTHA 2YXEA 4CKBA 4YV0A 2UYOA 3TM4A 3UJAA 4RYLA 5B1SA 5F2NA 3F4KA 2YXLA 3LECA 5DPMA 3I64A 4ATNA 4MHTA 3ID6C 2OBFA 4KW7A 3OE5A 1AF7A 3P9NA 4HG2A 3G2MA 2AN3A 3M6VA 4PWYA 4E2XA 1QAQA 2ZZNA 1RJEA 5E8RA 1L3BA 1G55A 3OE4A 2NXCA 4MQ4A 5EVJA 3E05A 2JH9A 1VPTA 2OO3A 3CBGA 3B3JA 3MTEA 3HEMA 3A7DA 2G8NA 3GRZA 1F38A 2GB4A 4QPPA 2IDJA 4EMSA 1ZKDA 3DH0A 3BGDA 4XCXA 4HH4A 3U81A 1H1DA 2IPXA 1VP9A 2PX8A 3C6MA 3EEYA 3LL7A 5E9JA 5HEKA 4C08A 5DSXA 5K0JA 1X1AA 2EX4A 3NMUF 2UZ4A 4DCMA 4PYLA 3UA4A 1KYWA 1UIRA 1VLMA 2BR4A 4EQZA 3TPZA 3OU7A 4GQBA 4KDCA 2ADMA 1JTFA 5K0CA 3P2KA 1WS6A 2JJQA 5U4XA 4BLVA 1NE2A 4RVGA 3EMBA 5C0OE 4AX8A 4X63A 3GRYA 3UJ7A 1V39A 1NBIA 3GU3A 4YMGA 3PTAA 5DX0A 3BWCA 2AVNA 4WVLA 3G8AA 5CVDA 3QOXA 3TM5A 4C4AA 2IGTA 2VP3A 2Z6AA 3HVKA 4K6MA 2BR3A 2P8JA 3KPYA 4BP1A 1XXLA 2ONYA 3MERA 3OU2A 5KYGA 3HTXA 3DMFA 2ONZA 2Y1WA 4M36A 3UJCA 2B2CA 3FZGA 4E2YA 5K0GA 1SQGA 2P1DA 3THRA 4PGHA 4POOA 4YUVA 1P39A 2IFTA 3HCFA 5DM1A 3SX0A 3T0IA 3TRKA 4OBXA 4BY9E 4FT2A 2FPOA 2ZVJA 1NV8A 5DX8A 1RI2A 2FCAA 3FTDA 1SUIA 1VP3A 2Q41A 3DXZA 3MTIA 3TKAA 3BGVA 1NBHA 2JHAA 5F2KA 5EKXA 3GRVA 1OR8A 2PX5A 2CWWA 3B7PA 2ZW9A 1JR4A 3G7UA 1BHJA 3KU1A 4JXJA 2V7EA 1NW8A 3I5UA 3UJ6A 5CCXA 4P7GA 2C7QA 4P7KA 2P7HA 4OQDA 1D2GA 4GEKA 5HZMA 3IEIA 1KPHA 3G88A 2AN5A 5C9ZA 2AR0A 1AQJA 4X61A 4X60A 5FWDA 2GLUA 3JWHA 5LQKA 4C04A 3FPFA 4B17A 5K8VA 3PX2A 5D1NA 3WSTA 3SM3A 2P40A 4DQ0A 3UJDA 3ELUA 5EIFA 5HIMA 4KIFA 2VS1A 5CIYA 3HP7A 2G71A 5EGSA 5CD1A 1XCJA 3HVIA 2OZVA 1I1NA 2AOWA 3FYDA 5FA8A 2IH5A 4E30A 2NXEA 4RTOA 1PRYA 3BKXA 4FR0A 5EMJA 1ZGJA 5FTWA 2VZ9A 1KIAA 3DMGA 4NECA 2OPBA 4WXHA 1KHHA 3DUWA 5ICGA 2EJTA 1XTPA 4L7VA 3O4FA 2AZTA 2BZGA 2G1PA 3A26A 3KHKA 3FRIA 5DWQA 3KQQA 3GJYA 1XDUA 2O05A 3SR4A 5LR6A 3VC2A 4MWZA 1VL5A 4P7JA 1FP1D 4PYQA 5T64A 3R9XB 5M5BA 3BWBA 1IXKA 3LGAA 4F84A 4LECA 3DULA 3BXOA 3REOA 4GOOD 5EMLA 3THSA 4DKJA 3DTNA 5DRYA 4E2ZA 4IV0A 3EMDA 4C03A 5HIKA 2FYTA 3BT7A 4CKCA 3B5IA 3GWZA 5D1HA 2DPMA 4FP9A 4PYNA 1JQ3A 2AS0A 2XVMA 4P58A 4R8RA 4X41A 4F85A 3FPJA 2P7IA 4P7FA 1D2HA 3S68A 3UJBA 3VYWA 3HCBA 4R05A 3ER9A 5P8WA 3TR6A 5JR3A 4YUWA 2ZWAA 3ELWA 5GIOE 3SSNA 5CVEA 2IH4A 1YUBA 3KQMA 1RJFA 2JHCA 3EVBA 1BOOA 2NNWB 2NXNA 2ZBRA 2ZLBA 2XYRA 1RI1A 3PLAE 3OU6A 4QVKA 4AZSA 5KQSA 3MCTA 1R8YA 4PONA 2ZCJA 3HCCA 4CWAA 1KR5A 3SSOA 2FRXA 5BW5A 2C7PA 4E2WA 1ZHFA 4RTPA 3DP7A 3LX6A 1KPIA 5E1BA 1N7IA 2O06A 3C0KA 1FP2A 2WA2A 3UJ8A 3OCJA 3O7WA 2FK7A 4GC9A 4XUEA 1RJGA 5EZQA 4CTJA 1R6AA 1Q0SA 3IV6A 5EC8A 1KXZA 4RSRA 3ERCA 2JH8A 3OZRA 1NW5A 5C1IA 1EJ6A 3EVFA 4GUAA 4EVIA 2I6GA 3RW9A 4CKEA 2I9KA 1F3LA 2HNKA 1EQAA 4PINA 3EGEA 3FPGA 1M6YA 4G56A 1BC5A 1QANA 1QYRA 2PXCA 3R6TA 3CVOA 4QVGA 4RTNA 2BH2A 1R74A 3FRHA 2UYHA 2PKWA 2FK8A 5CVJA 3H2BA 1NV9A 2PGXA 4ER0A 2C7OA 4KVZA 1NW7A 5ERGB 3DXYA 2PWYA 1L1EA 3E8SA 4QTUB 3MQ2A 4RTSA 1M6EX 3EVCA 1WXWA 5FUBA 5KQRA 5HOQA 2YQZA 5EIWA 2AN4A 3IYLW 1VIDA 3LKDA 5EZSA 1X1CA 3KPVA 4KRGA 4YUXA 2HTEA 3BWYA 2ZZMA 2ZWVA 3CKKA 2ZIEA 1AQIA 4PCAA 3M70A 2R3SA 3ELYA 3DMHA 4RWZA 2B9EA 5K09A 3V97A 2C7RA 1XJ5A 2K4MA 3ANXA
chains in the Genus database with same CATH superfamily
3F3MA 2FDCA 4R54A 4D97A 4IJMA 3NTVA 4NENB 4NZYA 2QMQA 3W3AH 4P2BA 3CNNA 2D5IA 1GPWB 1MNQA 3PLNA 5AK6A 1YNSA 1G291 1D9ZA 3JD2A 5JCOA 4MQBA 4PG7A 3V1LA 4J94A 2J6BA 4GH5A 3N8HA 4G25A 4OKSA 1SCDA 3GC6A 2PL3A 3U2QA 4F9GA 1Q1BA 1T5IA 2J09A 3B2NA 4JELA 3RSQA 2CFOA 2OM6A 3EAGA 3OQJA 3PQDA 3EN0A 3Q3GE 1ESMA 4NJMB 3T9DA 4FX2A 2QTRA 1P1KA 2UZ0A 3JQ6A 4S04A 5IXSA 1RIFA 1O58A 2OGUA 3AZQA 4BVGA 2PGOA 5IRCD 1P2VA 3VBEA 4HNQA 3W9SA 1W85B 1XEWX 2I71A 3I3OA 1XA3A 2MSLA 4YJGA 2P4UA 4V2IA 3KDPA 4PLFA 5BW6B 3L18A 4MMYB 4MW2A 5AW5A 1NVWQ 2GZRA 4BYGA 1PLLA 4ZOBA 6ADHA 3AV0B 2WQZA 4AS3A 2PAAA 1QK4A 5M7EA 4AY5A 5AVSA 4CODB 3T9AA 1EDZA 3GNQA 1N8KA 4MS3A 5KJ6A 5KSYA 2OCYC 2NG1A 3I4LA 3RRMA 1EXMA 1N1DA 2Y1EA 3UWSA 1NA5A 1Z6TA 4LRYA 4BX9A 4ZI7B 1AMOA 2L42A 3ER8A 4GQAA 5JH7F 2Z2XA 2C2ZA 2B1JA 2IKQA 5TPZA 3NWEA 2O3JA 1NR5A 1E1MA 3ST7A 3H9QA 3BXXA 1E8DA 1IPFA 1QBKC 3PG5A 4B7XA 1XRSB 3KZCA 2KLHA 3QLVA 1A2BA 5ENVA 4HVLA 4YYZA 1GDTA 3A2NA 4MI1A 2UVPA 3FYSA 3PD7A 4L7QA 3WS7A 3RT1A 4ENTA 1WETA 4ITUA 2MR5A 4JR2A 4RDIA 3D4BA 1FFSA 1P4HA 2DU8A 2O7VA 5AIBA 1W29A 1J2UA 1R8XA 1SKMA 4O0LA 3R8FA 3G9UA 1QORA 1V2GA 2IYUA 3Q9NA 4CM3A 4EZIA 2L82A 4NATA 2C5EA 4Z9YA 3W5IA 4H77A 2H63A 1BEZA 4RKWA 3EISA 1EJ0A 3FBWA 3OQ6A 3GGOA 3PQ5A 3S2UA 5I9IA 5EUBA 1JU4A 1VRVA 3TECE 3KQKA 1PEKE 4PX5A 4CM8A 1MAWA 3I8SA 3UHPA 3U4AA 3K9BA 4UMVA 1R64A 4C3ZA 2XQVA 1OZAA 3RFFA 3ADKA 3FTCA 5E9WA 3KFLA 4BWGA 4DR7B 2PG3A 2V6FA 3R7LA 4WN9A 5J59A 2F9FA 2RGBA 1TYDE 2CHVA 3WKEA 3UV6A 2DBVO 2ZJ5A 3KEQA 3AERA 3RVOA 2EL7A 2NPOA 1Z2CA 3C7CB 3L7BA 1B73A 1SA0A 3P0FA 5DBEX 5LLSA 3RQIA 3SHOA 3ZW8A 2AEEA 1ZUD1 3OX2A 4L73A 3QPDA 2WHYA 3EXHA 1PYGA 1OZ0A 2UXBB 4BVBA 4F8JA 2BT4A 2YV4A 2W2MA 2ZPUA 3TCNA 1VL8A 4L0MA 5KSWB 4EHAA 3D8TA 1X8XA 1CJUC 1NF2A 1GPKA 1Z74A 3DLCA 1Y5MA 2BN4A 1ZOSA 1Z63A 1SCNE 3I2YX 3IAS6 4ZU6X 3VU9A 1FFYA 4R83A 3W8EA 4RD0A 3GT7A 2O0MA 2JLQA 3PWSA 5DBOA 1PNQA 2VUSA 3D1JA 4E3WA 2OBLA 1IWOA 5ALYA 2G9NA 4GGMX 1RRCA 4NYJQ 4BKOA 2WAAA 3V33A 4L3VA 3FAKA 4RY2A 3SF8B 3UB3A 3R5FA 3WYAA 4XUGB 4RZQA 2YV5A 5J2TA 4QBGB 4BTLA 4FYWA 4DM7A 3GMIA 1XMVA 3KQOA 4QSHA 2J5RA 1SZJG 4TKUA 2I91A 3H8JA 4TMFA 1U1DA 1MAHA 4AJIA 1VBKA 2HKIA 2Z2YA 1DC5A 1T1RA 3FFBA 3OMLA 5FOTA 3X1KA 3C87A 2XUQA 4ETNA 3N9IA 5FTKA 3UBTA 2IHTA 3NC0C 2ORVA 3V00A 5HR5A 4C3UA 4E12A 1JHDA 2OO5C 1SU6A 3WV5A 4Z51A 4QTYA 1JALA 2Z3VA 3JV7A 4G4GA 1W73A 4Z1MA 1OVMA 1QFZA 3PLRA 2CMHA 3GDGA 1GZ7A 3BH0A 1K7FB 1C9EA 3U09A 2PSDA 4JLWA 4PTLA 5IMBA 5KVCA 3VBCA 3FNQA 2V9PA 1WP9A 3PSAA 4S0ZA 3H8SA 3VZBA 1RYYA 2PX2A 2H9AA 2WDPA 1RZRA 3S8MA 5LBIA 4HWSA 5LKRA 3GARA 3MB5A 4ZQEA 4Y2QA 2C95A 1P33A 4FFDA 3EXEA 4BB6A 4CIWA 3W3AD 5IVKA 2AEMA 3UGKA 4KUEA 3OQHA 3TIXB 4JJKA 4KZKA 5MN5A 2HLHA 3KJFA 4L8VA 3VO2A 5DYTA 5BUCA 4OXRA 4MHOA 1SULA 2YYZA 1IY2A 3WBBA 2I3AA 1FDSA 3A4TA 3TLJA 1R6TA 1OFVA 1WJGA 3IOEA 3X1DA 1YJAA 1YZHA 2IYSA 3HN6A 4W7HA 4HV4A 1XT6A 3NXSA 4V1CA 5I7VA 4REQA 5AVVA 2QYOA 3C2QA 2VP0A 3D0OA 4IGAA 4NV3A 2DQZA 1R3UA 1U6KA 1D2AA 2B99A 2DULA 2MHCA 2ZBFA 2AG8A 3AHJA 5BPHA 4DA4A 4D02A 4XGIA 5K05A 1L7MA 2PM8A 1ZOIA 2X0IA 3FDZA 2WSMA 2HXGA 3H6HA 3JQAB 2LCIA 3JX9A 3G0DA 4NC9A 8LDHA 5I47A 1SCJA 4ND1A 3RAJA 1HNNA 2IPAB 1SQ5A 1ZLYA 2HIGA 5FPPA 5F51A 1QRRA 1S8FA 2XDYA 1FNSA 4J0JA 4BRUA 3LDHA 5TC4A 2G72A 5KJEA 1XRNA 5JNVA 2DBQA 3BTSA 4RD1A 1LDYA 4D9HA 2QAGC 3N76A 1QDLB 1YRLA 3K30A 4D7AA 4BYMA 4Q47A 3F2IA 4P3OA 3R7WA 3ZE8A 3LUKA 5T3YA 2XWJI 2YWEA 4NDAA 4DC1A 4E3ZA 1E2JA 3VKFA 4DMFA 4QODA 3HUUA 3LC2O 4W5TA 2YN4A 1DLJA 1HG1A 3R7DA 4GSKA 1A72A 3CTMA 5C8ZA 1GY8A 3EVAA 3HR8A 3RIHA 3S8EA 3KTAB 3R3HA 3V7NA 4CHGA 1BS9A 2P9HA 3QBEA 1Z8FA 3GZJA 1JHRA 1U6IA 1SKYB 3FPHA 4OXYA 1LBTA 2RC6A 3S99A 4YQYA 4D5EA 1DJOA 4RKEA 1BVRA 3A6ZA 3W2FA 3CUVA 5A5DA 1GD1O 1EI9A 2X0RA 3P0RA 3VMMA 5CDHA 1ILEA 1BKSB 6NULA 2BBTA 2VN8A 1BX3A 3FOBA 2CUTA 3BAFA 3N0TA 5J5AA 5AVTA 3IODA 2NSJA 3AHCA 3K15A 3SS8A 2IODA 4H27A 1N6LA 1U7WA 1Y82A 2G4CA 4RWEA 3BB3A 3VRHA 3E70C 3W2TA 5KHOC 4QD3A 5LPNA 1P7CA 3L8DA 1L5OA 4WN9B 4F4CA 3RARA 2M98A 4ENUA 1KI9A 2FW0A 4HNHA 3FI0A 3KB2A 4E4YA 4ZZ0A 2VLBA 5DMXA 5PNTA 5GOZA 2HDNB 1NBWB 5AXDA 5L3RA 1YDHA 4BNMA 3STXA 3X0DA 2QTWB 1S3FA 3NGMA 4FYKA 3BMCA 2RHMA 4Z9AA 3VO8A 4UM8B 5IN4A 3ZWWA 3TL3A 1R0YA 1J2YA 2PGAA 1I0LA 2AG1A 1V1RA 3GLHB 4LHXA 1YL7A 1L4MA 3BA1A 3HFSA 3NTXA 4GS5A 1L7AA 1YASA 3MUEA 4ILEA 3IUPA 4B31A 4E09A 5NULA 4KO8A 5KYUA 2J4CA 1E1QD 5ALFA 4AJ4A 4YFYA 4MQEB 5D51S 5FTNA 1ULSA 2ADOA 3L0IB 2Q8PA 1GZHB 4NU8X 4D0GA 1EEXB 4F6CA 4UEQA 5FOVA 1QAQA 1P45A 1UOOA 2F59A 4OQNA 3H2HA 5AHWA 5I9BA 4OI1A 4YMUA 2BFBA 4MQ4A 3ELBA 1U9CA 1Q2UA 5K51A 4F71A 4K9DA 4IFTA 1ISGA 4B76A 1IZZA 4L50A 3NBZC 2E4AA 2Y66A 4G2TA 3D59A 1FJHA 4QJ5A 4IZHA 3AESA 4XCXA 5AKYA 3TW4A 1N78A 3U81A 1TVCA 3C6MA 5HEKA 3OOWA 3CX8A 1V35A 5KYWA 1KJIA 4DXDA 2NU7A 4N8SA 5BSUA 2HD4A 4UUPA 5JQGB 4PCUA 2PIDA 2CT8A 3ZJTA 3MNFA 2TMYA 4EQZA 3C3JA 4UAVA 4XJVA 2NZJA 1YWGO 3OU7A 3TQIA 1CR4A 2ZXFA 4N65A 1ABBA 1G3MA 1F6WA 4RVGA 5GAJA 1KFJB 2JFBA 2WC1A 1O4WA 1Z4NA 5DISB 2GHIA 1NBIA 4MP8A 3LDAA 2IYOA 2ACKA 3BWCA 3L07A 1CF2O 1EG7A 5IUJC 3ZWBA 2XTNA 4QUHA 3F49S 3HS3A 4TLEA 2IEYA 4KI7A 1J42A 3P94A 4B85A 4MARA 1THMA 1XLTC 4K9LA 1LX7A 3RVDA 3WMFA 5JSZA 2HIMA 5LLTA 1N0WA 2HM7A 2C4TA 3NAGA 4C0JA 4GVLA 3H4TA 4O4LF 1PV4A 1C7FA 5BWNA 3L1KA 3ZIDA 4XYBA 4EYKA 2XHEA 3KZMA 1G1AA 1O3YA 1QYXA 4IBOA 5DX8A 1UPFA 2N1BA 4BUCA 5FOXA 4CDRA 4ENRA 3UMRA 2GK7A 2XTJA 3RUEA 1SUDA 2FFRA 2WU0A 2XTMA 1J0AA 3KTDA 4GI7A 1MCZA 5HQJA 1OA1A 1UOQA 3GRVA 3KV3O 5F5NA 1C1YA 4RHUA 1I4DD 2D5CA 3LUHA 1CEEA 2V7EA 2VK1A 2QJOA 1SN7A 2JFVA 2ZANA 4P7KA 4YMTA 3A3NA 3CWQA 1ECLA 1LLFA 2D3TA 4MQLA 3SYTA 4JODA 2QD4A 4ALLA 3IVCA 2W5UA 3W9UA 1G5TA 4B3IA 4D9KA 3VX4A 4RA6B 2R1VA 1XP8A 1A76A 1JAXA 1M9NA 1RYNA 1P81A 2Y9PB 1JJVA 4BQFA 1B6GA 3AJEA 3AX6A 3L4SO 1ZN7A 3QSGA 2G5GX 4BAUA 3B6ZA 3QGMA 4KQCA 3W5AA 1EEHA 2EDCA 2FFQA 3QUAA 3RRJA 4CCAA 5CD1A 1T9DA 2JGLA 2SKEA 2XCIA 3G9ZA 2ZQZA 1BOFA 1JEEA 1GTMA 1O9BA 2I2AA 2O2SA 3ZGXA 4F4IA 4W8HA 4X1KA 4FR0A 2Y77A 3L46A 3RBVA 3HVRA 4XM1A 1CUAA 3DOIA 4OSOA 3RKUA 1A88A 5JQGF 4DM4A 3SE7A 2O3TA 1G7TA 2DKNA 3C16C 5JZ9A 3GLSA 4AMZA 2IW3A 3GP3A 4C30A 1IPEA 2AG0A 4JASB 1CY0A 2JJ2A 4L5YA 5JOQA 2FP4A 3BAZA 3ZWPA 3M1AA 4IJ5A 5GJCA 5JARA 1JJIA 5JDCA 3TG2A 3LP5A 2ZXEA 2D5AA 5I3ZA 5LL6P 2DWUA 2I7DA 2Q5LA 1NT4A 2VEDA 3OPXA 4HAYA 3T1VA 4DDTA 2F55A 4DV1B 4DXAA 1E1CA 1J0XO 1RWPA 2Y76A 3QVGA 3R8XA 2FX2A 1RMQA 5HIKA 3OC0A 4BLOA 1KMHA 5C46F 4BO6A 3PA8A 2VWHA 3VYWA 3F7MA 5L40A 4B44A 3RADC 4F2GA 2X5NA 4RMJA 3AVOA 3PC3A 4UHHA 1YDMA 1ZN9A 1MPTA 1DKNA 1GFSA 2R85A 2ZAYA 4BTEA 1MV5A 3A11A 1LXCA 4Y2VA 5FJIA 1E9RA 3PEEA 5DHSA 5F76A 3WYCA 4Z6KA 5HKAA 3EPJA 1DRUA 1U2GA 2I8LA 2JARA 4BDTA 4L4UA 4U02A 2OFFA 1RWVA 2V9ZA 3L7AA 4D42A 1ZH8A 3IELA 1KVTA 1ZIYA 2GTPA 2PKRA 2IYWA 2QUHA 4OHXA 4PONA 3V4RA 2QTMA 3BSSA 4QAJA 4E2WA 4BNKA 4LJ6A 5I4IA 1KEEA 5IJ9A 2CYAA 4K6CA 4M8LA 4JOSA 4PLWA 4BQEA 3WQQA 2IOFA 3GRKA 2VHXA 1T5SA 5JYEA 4V38A 3MRSA 5JAZA 5FJJA 3EZ2A 4PS0A 5JSZB 5KNCH 3D1VA 2PUGA 1K7YA 2Q3JA 4GM4A 3IV6A 4BBAA 1QGAA 1R9GA 2CMKA 2E4UA 1RWMA 2PSHA 2EX0A 1N6IA 2R7KA 3DOJA 1A97A 4JB8A 1JVNA 4RSRA 3V48A 3EH1A 1FFAA 2Z9CA 3M4ZA 4MR9A 3L92A 2EFEB 2YJTD 3ENVA 4RCZA 3MRVA 1E3QA 4LRWA 2HDHA 1JGTA 2BEWB 1BWPA 3OUZA 4O4JB 4Z8XA 2NZUG 2BH2A 4F3KA 3DV0B 2EZTA 1G17A 5KTSA 2C9YA 3EQ6A 5TT1A 3Q5GA 1GGHA 1Q6YA 2TMKA 1KERA 4R1NA 2V1XA 3CNBA 4ARCA 1NOIA 3LHFA 2NUAA 3RD5A 3RWMB 1Z75A 4MEBA 5DWVA 4JT4A 3KALA 1ZM2A 2YQZA 3OSZA 2ONCA 1OBFO 1ADGA 2EBUA 1NY6A 1AGPA 1X7YA 4DV2B 1L7RA 3KD3A 3PC8C 3DCYA 1K4YA 3CTPA 1CUWA 4JN6B 5ITZA 2OORA 3Q3IA 4K87A 4KVAA 2V7GA 2YRFA 3D7SA 2J9GA 3MCUA 4KCGA 4WVFA 5DCYA 1X9HA 3ES9A 1NMSA 4R9UC 1G2PA 5T6MA 8OHMA 1U7DA 2B9EA 4IDDA 4MTLA 1T8UA 4N8DA 2C7RA 3HWX1 5JDIC 1DAGA 3JY6A 1KFBB 2LE0A 1SOWA 2E89A 4IRMA 3MELA 4IDNA 3S2EA 4AD8A 3DZJA 3SLGA 2CE7A 3OZXA 3IE1A 1U7OA 2KLBA 3IAFA 4CLOB 2EFDB 4X1YB 3HY3A 5IAJA 2VQ3A 1MMFB 4FEGA 3QFHA 3A31A 3GV0A 4YQZA 1SD2A 1UUFA 5FORA 4YCAA 1RNLA 3E3MA 4HNRA 3PD0A 4Q4JA 1FS5A 5L3SA 5EEHA 1P5ZB 4TL6A 3EFEA 1Z8DA 4IF6A 2MT9A 2ZAIA 2MU1A 1JEQA 1QG6A 2FTKE 2V03A 3TE6A 4B6RA 5HDQA 2G67A 1L5SA 2PKQO 3MT9A 3CEPB 4B3GA 4QX6A 3TOSA 4XGRA 1E7WA 4FMDF 4HI0E 3OJLA 3A1SA 3PVCA 2SCUA 3LLCA 4MVCA 4OYHA 5GONF 1QV9A 4GU5A 3NASA 4O0MA 4ACAA 2CW5A 3PF9A 5FX2A 3DBHB 1GG8A 3L49A 1EM8B 2XKKA 3C1AA 3SJZA 3G1UA 3X2EA 2Z6UA 1GNSA 3BICA 4TYYA 2IIQA 1X3SA 9ABPA 5LM3A 4W5QA 3LP6A 3L4EA 3GDHA 1DCKA 3B9QA 3RNLA 4E4TA 2QSYA 4X97A 3GJSA 2R68A 3R5KA 5B7QA 4EK9A 1KWKA 2W2QA 5FFNA 2CL7X 2FVXA 4D6PA 3O4JA 2FMTA 5CEEA 3DUFA 4C4OA 2QTVB 4TZ6A 2ZBDA 5F5LA 4INPA 3HCRA 3AR2A 3ZH9B 3FFAA 1PJ2A 3VDMA 1QHFA 4PZ0A 3VQTA 1RM4A 2VJQA 4RC9A 4MVJI 2HRBA 3BYZA 3DM5A 4YLGA 5E6SA 1VFPA 5JVDB 5KYNA 1KH1A 3ZE6A 3U1BA 3K92A 3X44A 1CRQA 1ULAA 1BMFD 3R4VA 1COZA 4V3CA 1IZ8A 4ZAZA 2JAUA 4PW0A 2WK1A 3FKSA 3OFJA 1CZUA 2PKQP 3TLYA 5MHTA 3EEIA 1L4HA 1E5TA 1T2EA 1W59A 2XECA 3H2YA 4YI5A 1CUEA 2E4WA 4R3NA 4H35A 5CG2A 3B1FA 1Z83A 1AE1A 1D5WA 2ZIVB 4GHWA 2EATA 4W7SA 1D8AA 1L5QA 1MO6A 2YQ5A 3L8ZA 1WULS 1JH9A 1BGWA 5KX5F 2GK3A 4R8LA 4ZT6A 3CX4A 4X3CA 5LOVF 1CJBA 3FPEA 3MTAA 3PEFA 4R3UC 1N8TA 1M6HA 4K3VA 5EJ6A 2V98A 1G9XA 1CS4C 1ZH6A 1S1MA 2R6CA 2Z30A 3GW8A 3ESXA 4FOPA 4TRMA 1JLSA 1TFRA 2XX3A 3H1TA 4OIMA 2JIZD 5A4FS 4OUDA 2Y0EA 2XUOA 3VNSA 3DDOA 5KJFA 1Z4QA 1NQ5A 1MABB 2AC4A 1VLZA 1Y9ZA 1N2IA 2VT2A 4IOLA 1P5FA 2WJ6A 3WDKA 4YUYA 2VHUA 2BISA 3COJA 4FC6A 5K8JB 4CYMA 4ZYZA 2UUOA 1R37A 4R6XA 4F5DA 3AWIA 1QTQA 2HCBA 3CUSA 4IVNA 3KHUA 2Q4OA 4M22A 4BVFA 3IVRA 4QBTA 1E62A 1KYYA 3V4PB 2JBAB 1ORHA 2D62A 3H16A 4TVKA 4DW8A 3UMFA 4QGAA 1GIAA 3N5CA 4J4TA 3NIGB 3RAGA 3W5HA 1WLSA 1C81A 4R6WA 1CDOA 1KK2A 3OZEA 4H0FA 2GARA 1DIRA 1E8NA 1YOBA 2NSHA 2R8YA 3T7SA 1XEXB 2Z4RA 4OAQA 5AJTA 3AVXA 4DPLA 2F1KA 4WOJA 5CPBA 2J9XB 2PJZA 1LSSA 3TI9A 4MXDA 3ZWXA 1CR2A 3ITEA 5LD2B 3ICCA 2HHAA 2QUJA 4X90A 2CNWA 1XO1A 3HLYA 5CT8A 4QXMA 1KI8A 2FGKA 1RC8A 2F3QA 2ECQA 3EEQA 4JP1A 4DRXB 3GLKA 2YVQA 5CNJA 5IYZA 2QE6A 3G5MA 1KQFA 3WLMA 2OKCA 1W30A 5EXSA 4MUAA 3VVMA 1QF6A 5DVZA 4WH0A 5TPZD 3FOCA 3LVRE 1PHRA 1QIEA 1BG6A 4KQWA 4KWCA 1G5FA 1YULA 3PZRA 3I01M 1EBUA 4AP9A 1DX9A 4RESA 1Z5VA 5F98A 4MQEA 2I2CA 3QNMA 5JJCA 3FTQA 3N8DA 4N0EA 5JAPA 5KYUB 3SF8A 3ZQ4A 3HXKA 4M1QA 4LI3X 2WV9A 1LA2A 1IBCA 4ZTUB 1BN7A 3QOYA 2RI1A 2WM2A 3T9BA 1A9OA 4UNRA 4JY7A 3HRHA 1QGUA 2Q2QA 4A8JB 1G63A 4L9RA 4ISBA 4LGMA 4BNZA 1HLFA 4ZGWA 2AW3A 2Q5HA 4IS3A 2Z2IA 3VYUB 1P2UA 2HWYA 3BQMB 3W8RA 3U44B 4KX3A 4RF5A 3U3OA 1BDJA 2ENWA 2F3TA 3W5SA 4A27A 3M3PA 5EUMA 2F1HA 1AKNA 2C20A 2O8CB 3Q7EA 5IT0A 2PZBA 5JISA 4IWYA 1VSBA 2IZOA 3VSAA 3W04A 2JHFA 4LW8A 3AQIA 5J1TB 1C1XB 2D4HA 1U0JA 1I2CA 2FPMA 1HQYE 1FDOA 2KE5A 2QW8A 5HIAA 5KYYB 4A23A 5DFAA 3HVJA 1XTVA 3GLIA 4C5BA 2D1FA 4XTRA 5KTMA 1XF1A 1CRZA 1W44A 3I6YA 5HW0A 2VDLB 4RHTA 1N2EA 4DB2A 1Z28A 3L01A 3CLUD 3DVQX 2VRCA 4LBZA 4DYDA 1J0EA 1Z4JA 2CN1A 5C4IA 1WMFA 2ZUFA 1POWA 1CEQA 2MMCA 2Q3HA 1RHUA 4YJDA 4M99A 4RM2A 1LBHA 3KHTA 3P96A 2PBFA 3FH0A 3GX1A 5ICSA 4RTRA 3T7RA 3B3GA 1YHYA 1Z8NA 4PE5B 5DW0A 1L5HA 1RM3A 3EVNA 1VMIA 4OI4A 2ZREA 4TMXA 3LW7A 1K2WA 1CDZA 1D2CA 4DLBA 2EGGA 3SNHA 3Q1KA 1O96B 4BC1A 5HIIA 3ZV3A 5FBRB 1RAAA 3FNEA 4PQFA 3JWJA 5C7IO 3OZFA 2OSVA 2XEXA 2QY6A 4EP1A 2C61A 3UAYA 3U80A 1O95D 3GFOA 1IXSB 1KXJA 3HUDA 4KJZA 3F96A 5DRTA 4M37A 3ZHZA 4B6PA 4B87A 3AVVA 5EAIA 3VJRA 2R7LA 4F6RA 4OA8A 1HOTA 1JR3D 3TSAA 1ZZEA 2BSQA 2ZI4A 4BZXA 1JZSA 2UZIR 1O5OA 1SVIA 1M8PA 4RY0A 4CM1A 1LLDA 1K7SN 3IPRA 3M33A 4HK4A 5FHRA 4ZKDA 5HFNA 2ZJYA 2FSSA 5K0FA 2PSSA 4IHKA 3FMFA 4K26A 5FQNA 5EWJA 3U0BA 3OCYA 4PZDA 1AKTA 1KPGA 2CFSA 2JFNA 5EA2A 1JQEA 5BQFA 1QX4A 1M83A 2NVUA 2KS6A 2VJLA 2PBLA 1C4WA 3T34A 2ODTX 3LDGA 3ROEA 3L6DA 3SDZA 3LMKA 1XD8A 4YPFA 2HI0A 1QM5A 2IXBA 2YN0A 1NQAO 2W90A 4YUZA 4D9NA 1SCQA 4J07A 2O54A 2PXAA 4TWAA 1YR9A 3VYRB 1PZNA 1G21E 2J0UA 2XCUA 3L4KA 3KV1A 5LP6F 4AB1A 4LYHA 3A36A 1W4CA 5F3RA 2JGJA 4Q19A 3GZTB 1GCIA 4ER5A 4C1NA 1SK9A 2OLKA 2WVHA 1JX6A 2R66A 5IF9A 5KEIA 5D7NA 4ZMBA 4LV5B 3CX3A 4OY3A 1M0TA 4F56A 4YJGB 1EJBA 1NXQA 3ZNQA 1JPUA 3LCUA 1WQ3A 4LWOA 2XEDA 4AJPA 4L0CA 1NWHA 2AJBA 2H2FA 1M75A 4M87A 5D01A 4Q4LA 5KOYA 2B92A 3EZ7A 4BNDB 1QZTA 3HBNA 3T3DA 1KGDA 4NPCA 5ES4B 5GV7A 4EX7A 5AOCA 1FK8A 4JH0A 2OBXA 1E5VA 5IXJA 3PC6A 1QGED 1RXEA 4N3BA 3NBQA 4V03A 2BKEA 4YV0A 5JY6A 4MP3A 2XB8A 4UCWA 2F8TA 1AUQA 4XX0B 3ZX5A 3ZZTA 1FB5A 2X7XA 4OQMA 2C1ZA 4Y2SA 3TRDA 1D4FA 3RIMA 4EBBA 1AF7A 4X20A 1W7AA 3NAQA 1L0BA 5E8RA 4CDMA 3L7MA 3LL4A 3OZAA 5H83A 5HG0A 1A1VA 3GMSA 3EDRA 2JH9A 2OO3A 1VGQA 3QMMA 4U2KA 3PPVA 1K8RA 4RELA 4CG3A 4PZLA 2WUVA 4Y9SA 4LF4B 3I6IA 3OY2A 3WA7A 1ZIPA 2R79A 2LW7A 1T2FA 3OCUA 1UXOA 1UXIA 4BEJA 1XVUA 2HJSA 5DNVA 3HYSA 1G98A 1RU3A 1YS2X 3C6YA 4ON9A 3FJ1A 2EX1A 1U7UA 1JQAA 4UTZA 3RWOA 4MR8A 2FFAA 3VR1A 2XZPA 3OPYB 1N2GA 5B7NA 1XZPA 3ENZA 3IOCA 2ON6A 1Z6ZA 3PNLA 4JD5A 1CNEA 3ZX4A 4QO7A 1NI4A 1FU4A 1I24A 1NRWA 4XB1A 1VSTA 2VA8A 5HCIA 2UUAB 2W8BB 3Q7TA 3SYRA 3L7LA 4JLOA 1J0DA 3NWOA 2PMKA 3F5FA 1A9TA 3KYJB 4R2LA 1W5SA 5DX0A 4ERXA 2AMFA 4EPRA 3GGJA 1N0UA 1W5BA 3R3SA 1UQRA 5DWDA 4NX2A 4RIIA 3EIEA 4BQNA 3FZYA 4K6MA 4PZZA 3IQIX 4EA9A 1Q0HA 1QYWA 1S2LA 2V45A 5G0SA 3ZKAA 1KI2A 4M36A 2HL6A 1Q84A 1P9NA 3CUTA 3O8BA 3UJCA 5JS2A 4UKDA 3PT5A 2PUCA 4PGHA 4YA6A 2GPJA 1P39A 1KFKB 3ZLBA 1T4GA 2I4OA 4YECA 4G41A 2Q4EA 4N40A 1THTA 1E4VA 2X4GA 2QMUA 1D9XA 2Y4OA 4OD0A 3WOVA 1C9KA 1ZK0A 5LYYA 3NBKA 1D5CA 7AT1A 1EUYA 1KR2A 1D7OA 2VRCD 3P2MA 1B41A 1ISJA 3EGWA 2FPIA 4RQUA 2J46A 3DDUA 5DN6A 3RYFA 5HYVA 4GLBA 4QG7A 1NW8A 3WYNA 2QN7A 1YDFA 5KCMA 3TDMA 4FFLA 2P6UA 2X3UA 3QJ5A 4MW4A 1L5GB 3I2FA 4MZXA 4AN1A 1F51E 5HZMA 1OAAA 5FWDA 2GLUA 3IPYA 4XM2A 1Y8QB 3OFSA 1LDEA 2XVYA 3COSA 4NBUA 3RUDA 1WTCA 5DNUA 1TM2A 4C7KA 1LBSA 3B1ZA 4FYIA 1PJQA 1CPYA 1ZNWA 2CHUA 3ELUA 1LB1B 5KAMA 1O0BA 4KRFA 2UZAA 1GN8A 3BXHA 3LUPA 2GJSA 4H1UA 5CNKA 5FA8A 1JQ5A 3VC3A 4BNFA 2IH5A 1Y5LA 4UAUA 5DASA 3K1YA 2FWIA 1C7RA 1NM5A 1UK7A 3L0BA 4WOBA 4JENA 1Q7BA 2Z1DA 1A2OA 1A5ZA 1Z4OA 1LPNA 2BZGA 2COEA 2JGAA 3O4FA 4I55A 2IHNA 1P62B 1JW9B 1P0CA 3NU1A 1MX1A 3PVZA 4MW6A 5AK3A 1XBTA 3IP3A 5B7PA 4P0QB 4K2HA 1MA0A 3IOYA 2XBUA 1W52X 3EQ2A 3MJTA 3SR4A 2BF4A 3K1JA 3NPMA 1BS1A 1AZTA 4BMPB 4BXOA 3HL0A 4RAOA 3G2HA 1K7XB 1YR2A 3CZ5A 4PX9A 3TDKA 3L8EA 3K70D 2C57A 4DC9A 3T1NA 3RSCA 2QVZX 4IHAA 1N4AA 3U7RA 1U4NA 5AJZA 3V8PA 4ETWA 5A9SA 1KZ4A 2FX3A 3WRWA 4JJ7A 3T7AA 1AGRA 3GAMA 4PXAA 2A1UA 2OLJA 3HJTA 2XIJA 2QSJA 2XKBA 1I6KA 2P7IA 1ADYA 1T5TA 3TZQA 3D64A 5IVHA 1SVWA 1SU8A 1TOAA 3GFGA 4LMAA 1M1YB 2MCFA 3V8QA 3EVBA 5CX4A 2NU8B 3BS4A 5FDFA 4OLJA 4KXQA 1EIWA 2VDWB 4R3WA 4TSFD 1PR5A 1F4LA 1N32B 1FLAA 1R8YA 1P7PA 3DQPA 2IUFA 4ZVPA 4FDVA 5C32A 3VZRA 4PZAA 1PU2A 5K0TA 2RAVA 2X8AA 3MD0A 3VR5H 4EDHA 1PQUA 4JYAB 1A9SA 1ZESA 2WYVA 3ZY2A 1OHHA 3W34A 1P2BA 4F60A 5E3JA 1XQ1A 4JR0A 1KK0A 1U4OA 3CPEA 2ONJA 1YZNA 2PHZA 3JYQA 3UMSA 5HVNA 3OQMA 3PD1A 4QRIA 3X2SA 1R6AA 3R7FA 2ZTLA 1FNDA 1YCFA 4BFUA 3DAHA 3V7UA 2UU9B 4DCOA 3OWXA 4JYPA 4YP6A 2H2GA 1J1IA 1DC4A 1F3LA 1XTRA 1ZCZA 1EPUA 2IELA 2JDIA 2J32A 1SVSA 1OLXB 4M8SA 3ZEIA 4BJ3A 5KU1A 2RH9B 4ASUD 1KAMA 3HJBA 2O19A 1MVOA 4I55B 4YFVA 2E87A 3F97A 4ER0A 1PS0A 3X43A 4JEUA 1T34A 3QQPA 4QTUB 4V0MA 1EVZA 4INJA 1NSTA 3ZGVA 1TU3A 3F3YA 4P0TA 2PAFA 3I6ZA 3NEJA 4XDYA 4HEHA 2VYFA 5B58T 1SBQA 2QSUA 3VNAA 3JZIA 4YUXA 3EWAA 1Y4AE 3UC9A 4X71A 2DT5A 1Q3TA 3G68A 1TO2E 4UEJA 3V7WA 4GG1A 3U5TA 4YVFA 4DCPA 1UQUA 2ZKLA 5HZGA 2O2DA 1ORTA 4RVOA 5A05A 4A92A 1WCYA 4C4ZA 4CV1A 4RWZA 3JVEA 5BR7A 1N25A 1VE6A 7ADHA 2W37A 4R69A 2JRCA 2IOQA 4TN5A 4D9FA 5TQVA 4G07A 1NSYA 3H1PA 3KK0A 3GDOA 2P35A 4IDPA 3PXEA 4DL9A 5M2QA 4FJ0A 5BWOA 3QXJA 5J47A 1A9PA 1XIVA 1NLUA 2XYQA 3OQPA 4MULA 4OP1A 2B4RO 1YFKA 1DQSA 2X1MA 3TB4A 3TTYA 3IMKA 2DY0A 3DHEA 3WL8A 1YF3A 1E3JA 2J6CA 3GFBA 1V7ZA 3CRZA 3HC7A 5FCDA 3K1TA 5K3DA 3REQA 3RTDA 4E14A 1Y9EA 2VTDA 2D59A 5ALXA 3WFIA 5CT4A 1RLUA 2VH1A 1VE3A 1YI8A 3DL2A 1AB6A 3OLYA 4BMXA 2XF8A 1LPSA 1NYQA 2CDBA 1DV1A 1Z22A 5IZCA 4MEAA 1KIMA 4A03A 3ZK9A 3WLLA 4N7BA 1DKLA 2R751 1UJNA 2KW5A 3PUHA 4L5CA 2CDNA 5I9MA 3ISJA 4BMNA 3CPHA 3ESAA 3D8HA 3VISA 1FX0A 2VNSA 3IDZA 4F7WA 1Q3KA 2JCSA 3QUTA 3AY0A 1GWNA 4HF7A 4BU0A 3EYWA 3OCCA 1RD4A 2JJ2D 4TVBA 5AKEA 4ZICA 3OVMA 1XFDA 2WZBA 3CH4B 5GP1A 4FW9A 5B1DA 5BOSB 5GJWC 4J0HA 2X5XA 4G67A 4U5XA 2PN1A 2NUTB 3NEAA 3C3MA 3LXRA 3Q41A 1EK0A 4XI9A 5TSDA 2XIQA 4R1MA 4EITA 3RIEA 1NJ2A 3CLHA 3F78A 2PVPA 3Q10A 1X7ZB 4F8YA 1ZJWA 3CMCO 4RS3A 3M3HA 4FMCB 3UMGA 4PN3A 2GFIA 1XF9A 1YB2A 4WL0A 1QR6A 4X9XA 4FE7A 3AUYA 1COWA 5FA6A 1K8YB 1PR1A 2IA5A 4IDGA 3RU9A 1SBYA 4ER3A 1T91A 3W4KA 4NMLA 4YJHB 1NPTO 4D46A 2R44A 1HEYA 5IC5A 1QJ4A 1HC7A 2IXFA 3RLFA 1CY7A 1O6BA 1G2QA 9LDTA 3JAKA 1GZ6A 2RIPA 3STYA 2ZRLA 3VZPA 5ARDA 1QYCA 2WTXA 4EYEA 2BM1A 1O6GA 3K4PA 1HMPA 2O50A 4FSHA 3ETGA 3MS7A 4K6KA 3W78A 1X38A 2QM3A 2JLUA 3I4FA 1KYZA 3NDRA 5DT2A 2LIPA 2GXQA 5LA6A 2I6TA 4NU0A 2WUWE 1DC3A 1E6UA 1JYSA 4ZJPA 2OENG 3OIGA 3EF3A 2R1TA 3HFRA 4KUHA 5D3MA 5ELMA 4OHFA 1IXYA 1XG5A 2JASA 3ITNA 2G04A 4B40A 2AF3C 3F6CA 1EAYA 2P9EA 3ND9A 3RK0A 5J4KA 2J45A 3MT8A 3FIJA 1Q0ZA 4PGMA 3MWEB 2IZ5A 3G17A 3A6EA 1JA0A 3I9OA 4WADA 4B5LA 4RTQA 4ARZA 3MCWA 4DB4A 4HGYA 5ALUA 3FYUA 1M1YE 2WHXA 3BJRA 2J6HA 3T5GA 3LCMA 4ZCIA 4J2OA 1MO2A 1EK2A 1YVRA 1ZJJA 1YU9A 2D7CA 2FZVA 4M9UA 3B9PA 3E5RA 5IM5A 4NCBA 2XQKA 4M76B 3SHWA 2OYCA 3CNLA 3ZXSA 2HXYA 5GGYA 1EWTA 3D6JA 3WKBA 3DAOA 2Y2VA 3TQTA 1FSZA 4RD4A 3QUSA 4DWJA 3SC6A 2CC2A 1YQXA 4DCVA 4S1PA 4GOJA 4TX1A 4BEWA 4Z5XA 3DE7X 3E9RA 1RLTA 1TQ4A 4OHWA 1KU0A 2JAPA 1VFNA 2YW9A 2A86A 2B0JA 3KS9A 4PR3A 5K0LA 4YMVA 1NURA 1YZQA 2EFCB 4OK3A 3SIXA 3QPBA 5JNUA 2QTCA 4AYTA 3RHFA 1OAOC 1E18A 2ZRHA 1IHYA 4RH1A 3TZEA 4B47A 1HSOA 1Z7GA 4QL3A 4BFSA 3UFXB 4C4XA 1QF9A 4O2AB 4Z7QB 1W0KD 1HQKA 2ATVA 2PT6A 2Y1XA 3LZDA 3LCCA 1PZMA 2VP6A 3O8LA 4XM0A 1EIZA 4BKQA 1KSGA 1J7JA 2BHSA 1L7DA 1M2JA 1OQAA 5J4YA 5JJ5A 2FWNA 4P31A 3RS7A 4R2HA 3O90A 1O5IA 2DG2A 2GK4A 3A58B 3ADPA 1WMSA 3OOEA 1JPJA 4URZR 5TQJA 4ANFA 3JAWA 2ZSFA 2JAXA 3SZOA 1N34B 2DXIA 5A4MS 2AMYA 4FOTA 1Q1NA 3QFFA 3V4SA 6CHYA 4G0WA 3CJQA 1NC3A 3QRWA 2FRVA 1N5RA 2L0XA 4XASA 2AXQA 2BFEB 3PYMA 3RS8A 3NTUA 2PX4A 2I76A 2XCQA 2BBSA 1ELOA 3LQKA 3UQZA 5JEDA 2HF9A 4II7A 3LLSA 4OXXA 3JWEA 1BXZA 1ZGCA 3QPCA 5BO5A 4BOYA 1JZQA 4CTMA 1PLKA 2NZYA 3DBRB 3HLKA 5CFRA 1QK5A 1QR2A 2VHQA 3SYMA 1Y37A 4F3NA 3HM2A 4MVJD 4I1PA 3NNSA 1JFSA 3NP9A 2IPNA 4KFCA 3HJNA 3ADBA 4LA4A 2HJGA 3WIVA 1BHQ1 5GZ1A 1EDEA 2PMCA 2PL5A 3IB3A 5JYBA 1BCSA 1J2EA 5DI9A 4RVUA 3PU6A 4RVCA 2VSQA 3LO8A 1ACMA 2AZ4A 2V7VA 1AGXA 5JZMA 2NZ2A 3Q2IA 3K4QA 3OEED 3OTOB 3SOPA 2IUSA 1SXJC 3Q87B 3JQQA 4QDJA 5D3MB 1FRVA 1PFWA 4S1VA 4HNSA 1GQQA 4TKLA 4MYUA 1YE3A 5FNVB 3EZGA 1XEFA 2SKDA 2XMBA 3AHHA 3B9BA 1BWRA 1XWFA 1SIWA 1Z39A 2O2GA 3HV2A 4L27A 2PNJA 2X3YA 3N2EA 2P3LA 1D0IA 4Q00A 4Z4HA 3IQDB 4YMLA 5DK6A 1SUFA 3TPCA 3WB1A 4LMBA 3HDHA 1IJBA 3SPXA 1QB8A 1YL5A 1SOMA 1EX1A 3QVSA 3O8QB 5ELXA 3RS9A 3JYNA 4EYQA 4J75A 1B0UA 5ALMA 2C9MA 1NU6A 1ZXLA 1FC0A 2ZAGA 2IUUA 1I4TD 3GT3A 3ZBQA 1CE8A 1G4AE 1I9GA 2IEZA 2PFKA 3LQFA 4IX1A 2OCPA 5DCUA 1V71A 4HHEA 4QDKA 3RSGA 4DLXA 5H82A 5KYXA 3EXFB 4K9MA 5GGXA 3CX6A 4PPQA 3QEMB 2DZDA 2HPZA 1X7ZA 3NDPA 3PTLA 3QV1A 3KZKA 3RUPA 1AHPA 4AKTA 3AKEA 1E4YA 3ZY5A 5A6VA 1UAYA 5CIQA 1MAUA 4E6EA 2GPBA 3WL3A 2X1HA 1O57A 4AZ0B 2F17A 2RHJA 2QP9X 2FJUA 3KLNA 3ZJYA 4ROTA 2ZWOA 3LVQE 2QMHA 4UARA 1WTAA 5E1MA 5K8LA 3IDFA 3EXIB 1LKZA 4CMAA 4MRMB 1WXQA 2CFRA 4RGVA 4DIMA 4E6PA 1AZWA 4Z9FA 3DLPX 1HORA 4OK5A 3P9PA 4F4FA 1KEZA 1YMQA 3CNOA 3JYHA 2GPYA 3M5PA 4TXMA 3VR6A 4EUNA 2PUAA 1MRZA 5F7XA 1IWBB 4I6GA 3C5VA 2FG7C 4Q4AB 3OCVA 1VCOA 4TYNA 1V9LA 3PGVA 4ONEA 2PWAA 3MGGA 4P6VF 5G4LA 3T52A 1M66A 3SE0A 3PDWA 4EF6A 1JDUA 1HDRA 5IAAA 5JG7A 1MORA 5EZYA 3KR0A 3NYIA 1Q91A 1X80B 3A4VA 1MQSA 1L6RA 4XOIA 1QCZA 3I09A 5E6UA 1EA5A 5KYVA 2BFPA 4E70A 1HE1C 2HA7A 3VV3A 3TTXA 4AMGA 3AYXB 3KSZO 2V65A 3VOBA 2FWMX 5TR9A 1CLEA 1NTRA 3PNPA 3I64A 1D6JA 4OVKA 4RGQA 3T3IA 2MYTA 1UPTA 2G0TA 3PKJA 4YP9A 5BY2A 3ECAA 5GONA 3QYAA 3OE5A 4U4AA 3PFFA 5D5QA 3UB4A 1FRZA 5JAHA 1XCBA 3EC2A 1YZUA 4PWYA 2AZXA 1H5QA 1WUIS 2OD7A 1IRXA 3R5JA 4R84A 1KAEA 4MV1A 4AG6A 1JWBB 4CQLB 4O08A 2R8XA 4EPWA 1IULA 4JSTA 2F43A 3WYGA 2EFYA 2MSCB 1ZUIA 2WJHA 4IYJA 3ZTTA 2FEOA 1YCHA 4OU4A 3GUZA 3QVKA 1UKCA 2Y1GA 3JD1A 1Q20A 1X1RA 5E7JA 3S2FA 4BCDA 3FY4A 4KPGA 5EYPA 1ST3A 3RB8A 1X1AA 1QRAA 2EX4A 5ECGC 2H1SA 1JSLA 4WZBE 4DCMA 5DGHA 2K87A 3BPSA 3HYTA 4HGRA 4BKRA 2BR4A 1CQIB 3UK1A 5K8CA 4WFKA 3HKBA 1UJMA 3C1TA 5AD1A 4JQSA 4B5KA 5AK5A 2WSLA 3PBKA 3OHSX 1G3RA 4DLPA 4D41A 1RBQA 2QQEA 5BV2P 4YHHB 4ETMA 4X63A 2J9FB 4BEVA 4RLHA 1AA6A 4AO6A 2IDZA 4IIDA 3VYVA 4R5MA 5SYAA 4R1TA 2HU8A 4QFMA 2NUBA 1VJGA 4Q1AA 1AUPA 3PNYA 4GBJA 4H6VA 2CXOA 4Q03A 3KPYA 5ALVA 2HX1A 1QHEA 5LBTA 3WGTA 1CNMA 3T5TA 5EIOA 2BFDA 5E4FA 4OBEA 5B6JA 2ZIAA 1FLDA 3B82A 4E5MA 3OURA 3U3KA 3PQ6A 5FKJA 5FXMA 2H85A 1DZ3A 4BY9E 4PHHA 1WXGA 2ZVJA 2WVAA 4TTQA 4ZYXA 1IFXA 4XX1A 1Z26A 4ZREA 4TL8A 3UH1A 1HFEL 1GPLA 1GGMA 4HYQA 1Z73A 3HPRA 2ZT8A 1VHDA 2HO5A 4FFRA 1USWA 1URPA 4Y2TA 4DADA 4E5UA 2CBXA 5KQGA 4NBLA 1UBSB 2QPLA 4KYVA 4PAQA 3R23A 5EKSA 4YJHA 4QM7A 5LZ5A 4GEKA 2PYZA 4CQLA 3HI6A 1KO4A 1OGIA 3QU5A 4JCCA 2QRGA 2P5TB 4JUCA 4LI0A 4K6HA 4EJSC 1LFDB 3JWHA 4OHOA 3KKLA 5LQKA 5TGTA 5ILGA 1NMQA 3GD5A 4I5FA 4IINA 4TMZA 4QU5A 4B17A 4DUGD 1VBNA 1MOQA 1AHIA 3CEAA 3JATB 4DEYA 16PKA 1NVAA 2YXBA 4C7XA 2UUPA 1TYAE 3ABQB 4QDXA 3SJ7A 3TOCA 4HXEB 2PU5A 2G71A 1P7YA 1TLLA 2PK3A 4Q66C 3TLEA 4AFNA 4TT8A 3SEAA 5AW6A 4RY9A 1PRYA 3LOQA 1QP7A 1JB1A 3I83A 3PCRB 3DMGA 3NJ4A 1YS4A 3RTEA 2AMJA 2FKAA 4C7VA 3GEDA 1A8HA 1DTEA 3RC1A 5KWEA 3W06A 2X5KO 2FN9A 1IHXA 3DMDA 1T9AA 1OFUA 2CGEA 2X8JA 3MF4A 1MB9A 1PJTA 4Q3NA 1U0LA 2PUFA 1VL5A 2WB4A 3DBLA 4G1VA 4LRTB 2VJYA 1Z08A 1IXKA 5DCLA 3K0FB 3JAKB 5K2OA 4HXFB 1RMTA 3DULA 3H9EO 4LXXA 2HU2A 4P84A 1CQWA 4ML3A 3ICWA 1SQ6A 2VZLA 2ZYIA 3RRXA 2QX7A 2GYYA 2ADFA 3A10A 5IX8A 1ZUHA 2G9ZA 3Q7RA 1T35A 1D6MA 1G18A 2I9PA 2HA0A 2HZBA 2PKYX 4PYNA 4MRMA 3LAWA 4DSAA 2KBEA 4P81A 2AWNA 2Y2UA 3B1WA 2JZNA 3QY0A 4NHOA 4A0HA 1Z2EA 1K0UA 1AG9A 1RTTA 2C3YA 2ZGVA 4JQCA 4QU9A 1I2AA 2IVZA 1NMXA 3U4QB 3VJLA 1EUCB 3KB1A 2FR1A 5CX1A 3HGTA 1XZMA 4DLRA 4H0CA 1C8BA 2C9ZA 1FEZA 3RT9A 3SK0A 3FG9A 3G8YA 1P3DA 3H5WA 1LQUA 2VZ8A 3I37X 3KT6A 3QLUA 3RFCA 3VHXA 4BNVA 3ZDBA 4MTCA 4O3MA 1IUPA 4UMFA 3HCCA 2MMGA 3L6RA 3WSWA 4B83A 4XVUA 1L8QA 4WDRA 9LDBA 4MYHA 1TTTA 1ZHFA 4P92A 4CR8A 2FSPA 5C80A 2X8WA 5DYGA 2MYUA 2LCQA 3ESYA 4Y67A 1C5KA 3DGEC 1KZ9A 2Q6VA 3EQ9A 3IUJA 4KJXA 3PQ2A 4RIHA 2FOXA 2Y92A 3AEQA 3MAAC 2B8TA 5MDHA 1JIVA 2VL7A 3DKKA 4RSMA 1R4NA 3MJEA 4A8JC 4EO4A 1U0OC 1RXCA 4DIDA 4F9TA 2G6BA 1NVDA 4MUJA 4WXRA 4K7JA 1JAHA 1JIKA 3BMXA 1BW9B 4P3XA 4IIBA 5ECWA 2FQYA 1ZVKA 5A7HA 3LM8A 4CTOA 4G89A 1QVWA 2A0UA 1BCRB 1LI5A 1LRLA 2X3FA 3HDVA 2O8DB 1KEEB 3OT1A 2HSJA 3GLRA 1FTQA 4G4SO 1XK6A 4G1UC 1D7AA 2JIPA 2HCTA 4N5HX 3IE0A 5H9VA 2GPNA 2PX6A 3IP6A 3HXTA 2Y1LA 3PPIA 1V8FA 5JADA 5MGNA 1JDBC 5LOVA 1WXWA 1W4RA 2JLWA 1TA9A 2UZ1B 1AT1A 1SIBE 3N6VA 1U3GA 4MIEA 2ORIA 4JLDA 4EARA 4PX2A 2HTEA 3BB4A 4N54A 2YOHA 3D7LA 1FL9A 4BECA 2ZIEA 5F4ZA 4CT0A 2ZROA 3GJRA 5CFQA 5DSZA 5AVXA 3ML1A 4JJ6A 2I6QA 4UE2A 2VJDA 2Q5JA 3NC1C 3WNCA 3RUIA 3ZNNA 1KMHB 1W6UA 2AYZA 2EKDA 3HUTA 2K2QB 3GWGA 2B6HA 3IQHX 1Q0QA 4QAQA 3Q2KA 3V97A 2X19A 1HR0B 2VJMA 5AKZA 5HUQA 1AC5A 1UL1X 3AM5A 3M5CA 2XAAA 4M8NE 3UMJA 2H92A 1R6BX 1UJ2A 3V3TA 2O2HA 4DIBA 5KX5A 1HG0A 1Z0UA 3TNFA 3BL5A 2HGZA 4TXNA 3RRFA 4AIIA 4HPWA 1B0PA 1FRNA 3PP8A 4H1TA 1YTUA 4OM8A 4UBLA 4LBWA 3DFIA 3O1IC 2WF6A 4HLCA 4D9MA 4H1WA 4RAQA 3VXKA 1EKXA 3NKFA 4PGFA 1S4MA 4H17A 3BIJA 4DA7A 1B74A 3COYA 3FHJA 3A6FA 3TBFA 1PIWA 3CW9A 4WY2A 1QIGA 3B2EA 4W1QA 1V11B 3ESCA 3ZKWB 3G0BA 2VDNB 4EHFA 1N33B 1GRQA 2DH6A 4GX1A 4LY0A 1QQ6A 1E9BA 4JBIA 1BXGB 1V8BA 3BE5A 4IHJF 4HDKA 3Q12A 4R31A 5JS8A 1NXVA 1E9SA 1E5QA 3ZV5A 3F1LA 1T5BA 1TT5A 4J0FA 4TLLB 2B8WA 3A9VA 1IDOA 1LD3A 3Q15C 1IAQA 1ES9A 4M83A 3I58A 3V8BA 4ZGBA 4BAZA 2BEUA 4E33A 1OW3B 4V24A 3IUYA 1E0JA 3F2VA 3QWBA 1M6VB 1UJCA 1IJEA 2R60A 3DDHA 3TFQA 4PLPA 5AVWA 5E1DA 4AUEA 3RH0A 4DJ5X 4A16A 4EMBA 4KQMA 1UFKA 1SMKA 1X0XA 1PYDA 1XQXA 2HQOA 5LDHA 2IKSA 4F91B 4X24A 4KQJA 3SHFA 4LXUA 4JVNA 2H51A 2HRCA 1K27A 2JJMA 4MYDA 5BSRA 1VLQA 1E94E 2WWGA 3PDJA 2XZOA 2HHHB 4EJ0A 4HRYA 3FDXA 1DXHA 3AILA 1PW5A 5KWSA 3Q5EA 5F33A 4PQYA 1OUMA 1P1BA 4HBGA 4HADA 3O1JC 5H68A 1EZZA 5CK4A 1GA6A 2ATXA 4Q9HA 1F06A 2BFOA 1ULZA 3LA8A 4V0RA 3GJ5A 4LOIA 3VYTB 2HWWA 4JDPA 1P0MA 3C4JA 1XR3A 3EX7C 3LVFO 4NYMQ 3T8YA 1L5HB 1GAXA 1DS6A 4OKNA 4CZ2A 4NQZA 3RGGA 4HDNA 2E0IA 4K0KB 3DOCA 3WWCA 1T13A 4IWNA 2R7AA 3E3AA 1D09A 2MDTA 4Q18A 3RASA 3K4HA 5AI6A 3KJQA 1Z0DA 4DYVA 3E9NA 4HFNA 1JIIA 1E3SA 3VNUA 2IZ1A 2JA1A 4B8ZA 5CW2A 2JDID 3B2QA 4L8YA 1EHIA 4K2AA 4ZT3A 1ZQ1A 3KOXA 2OXTA 3E23A 4A0FA 3M8KA 1P1JA 3S55A 4W99A 1OMOA 2FH5B 2BE7A 121PA 3QKIA 5TVGA 2FWRA 1NXOA 2DFDA 4I19A 2G6TA 3SP1A 3K6SA 3BM5A 3TJMA 1SM4A 2AUMA 2NNLD 4KFRA 1DSSG 3ZV7A 4TTPA 1FYEA 4K9PA 4HZUB 3VSDA 4BMVA 4CM6A 3CLSD 4DQKA 3PKIA 4DY6A 3I5XA 1ZBQA 5JCXA 2ICAA 3LRTA 2PPLA 2ZRIA 4KWEA 3F6PA 3DSRA 4LXGA 1VCHA 3L0PA 1G64A 3UCFA 2YKGA 3RK4A 1R5OA 2GXSA 3T12A 4RH3A 3K8YA 4NH0A 3MSXA 2B5OA 1KDPA 3W7VA 2IW1A 1SOUA 3PHJA 5DGXA 3FHTA 5CLIA 4KQ9A 4RBNA 2Z4SA 5DM2A 4LHEA 5KOJB 1H3FA 1US8B 5JAMA 1TJ4A 2BGWA 4YRPA 3GDWA 4FVTA 4TV8B 2R7MA 1TIBA 2HNBA 4P32A 5BRAA 5THKA 5EJ7A 1A27A 2PT9A 3GJ7A 4AO7A 2AFIB 2O57A 3IUQA 4P3KA 1KOGA 5F4BA 3OJOA 2BHLA 4WUTA 2HR1A 1FE8A 3L84A 1H05A 3EDQA 3TSYA 2X4DA 3JW8A 1WOYA 1X7XB 4ND2A 5KKNB 1BZYA 5IYZB 2GS9A 3LDFA 2BFCB 2P3OA 1YAHA 1FTGA 4TS1A 1N5MA 3KEMA 4UQOA 1E1YA 1EU1A 4L9AA 1U9YA 3KELA 3SF0A 2D8MA 5BYAA 4AJOA 2OL4A 2Q07A 1G8JA 3B60A 4WBNA 4R9SA 1VTKA 4J7AA 3TQOA 1RAFA 1SC6A 3CLRD 4KQ2A 2GESA 2FSHA 4B3MB 2JHGA 3PYLA 1GSOA 5EJ4A 3K70C 2ORWA 1DEAA 1JL3A 4H3SA 5AXAA 1IY8A 2JRLA 2AR9A 3O93A 4QNMA 1TKRA 1LF0A 2C96A 1YXMA 1JS1X 4GBGA 4UBNA 1I3MA 3LQQA 3OJWA 3CMMA 1KEVA 1NLYA 3CGGA 3K0BA 3DC7A 4JSYA 4OTZA 5HF8A 5IKOA 4Z3KA 5LWQA 3G2KA 4WE3A 2ASVA 4D9CA 1GQSA 1II8A 1XQWA 2QWXA 5LYJF 5JD5A 1QHIA 4RHEA 5KKCA 1EVKA 2WQ6A 2WJWA 4B9AA 2SHKA 3MTBA 4OQZA 1ZN8A 4XOUA 3ONWA 4HQNA 4HTFA 2NT4A 2WF8A 5EXPA 1O97D 4WMLA 3MRTA 4NCXA 4N3AA 3N1UA 2ERYA 4W5HA 2QZ9A 2QQGA 4FPXA 4I9NA 4EG5A 5DV9A 1CUFA 2ZYDA 3AG6A 2D54A 3DFUA 4HAVA 4REOA 5KMGB 3U19A 2H5IA 1KJ8A 1Q19A 3CFYA 3P2YA 5LN1A 1QH1B 2H59A 2O8FA 1L1FA 3CSSA 3DLTA 3TR5A 1QCYA 3HSYA 5BR4A 2BTQA 2PZJA 1G5IA 3QELB 1YZGA 2SICE 3LWZA 3AP3A 4IFIA 1D07A 1VKNA 3LRXA 2V59A 4DNXA 4F93B 4GLLA 4AK9A 4HGQA 1TTQB 3KJZA 4IXDA 3BXPA 3DO6A 2BMDA 2YWBA 1AVTA 2I67A 4JGGA 2IU0A 4B6JA 5CAEA 5CDSA 3WE7A 4MKHA 1JDNA 1UANA 1UK8A 2ETXA 3C97A 3DYIA 2VYVA 1O89A 4L15A 1JHPA 3EE6A 4M4SA 3UKJA 1LC0A 3FROA 2ZJBA 4KPYA 2Q3CA 1JG3A 1NATA 3H0KA 6PFKA 1ZK3A 3CCFA 5CVUA 1E7MA 1R16A 3AF3A 3BXFA 2RGAA 2VTVA 4UBMA 3FNIA 1FDWA 3FLEA 5AR1A 5UKDA 4UPVA 2IH2A 2H1CA 1KEWA 4NF2A 1JG4A 4DT1A 3AU8A 1U7HA 2WWXA 1VBFA 3N8NA 1TM7E 5EWMB 5B3LA 3I1JA 4EW6A 1YS9A 3RC9A 5JO0A 5IPFA 3KE8A 5GQSA 3PEYA 1B8PA 3I9LA 4V02A 5JATA 4CKCB 3BK2A 1N6PA 3SWWA 2FOIA 1CZOA 2C84A 3Q3EA 4G8CA 5ICMA 3MEQA 4A0GA 1H22A 4AWBA 1SKYE 1JKXA 1XLWA 2CFTA 3I4CA 4ZU1X 3UHJA 4KNYA 2ZTUA 4G6ZA 2IX3A 4GOLD 2WM3A 1RYBA 4IUBS 4X7PA 2FJ0A 1X1EA 1YQTA 5KVVA 1LRKA 4E1AA 2P2ZA 4JX9A 4DLYA 3F47A 3M9XA 4CMBA 1C2YA 1QYIA 3HU5A 1UKAA 2QAGB 1XDDA 5ICCA 2CFIA 4MUFA 4Q4JB 1S01A 2PIAA 3QXGA 3OEEA 2WKRA 5CLLA 4AECA 3NORA 4M3NA 4BMDA 2XQIA 1QVAA 2C3OA 2KSQA 1KWGA 2YN2A 4KACA 3DMPA 1BE1A 3KZNA 3OIWA 5F1PA 4GM0A 3NGXA 1BU8A 3GGSA 4NZ9A 4EJSB 1GCAA 2XA2A 1JVBA 4M1TA 3V4ZA 4XWTA 3LPAA 2HJ9A 1XMJA 4TWIA 4HRXA 4EHKA 3N8GA 1RBZA 1XRPA 3B3JA 3HEMA 3A7DA 4CPDA 4XD7D 1C1XA 3EQ8A 4YN3A 3FSJX 3QXCA 1Y5RA 5IANA 2FZWA 3AERB 2GEFA 3DH0A 3PIIA 4OHRA 4UHCA 3RFTA 1CY4A 3VH4A 4AJ1A 3KYDB 4BWYA 1VP9A 4O4HA 3RWBA 3LPCA 3IBCA 1XRJA 1YC5A 1M2GA 2NO0A 4DVJA 4V0OA 3ZI0A 2HNAA 3L82B 2NIPA 1R0CA 1GU7A 2QI9F 4A8TA 5JCJD 2K7FA 3U60B 1Y42X 3VGJA 4DR6B 4UE6A 4G2NA 4M0MA 2ZR0A 2Q6OA 1W2GA 4QUBA 3H04A 4JI1B 1RPAA 1TC2A 2PGDA 1W46A 2H08A 4XEHA 1KVQA 2Q29A 4BLVA 4UU1A 3FBGA 1HSZA 2AJDA 2X6QA 3GLFA 1ZPDA 4JFAA 3W2HA 3HU1A 4PLTA 1E8MA 2HRQA 1FMJA 1ILWA 4TROA 1U3WA 3LH5A 1PVVA 2BHRA 2F64A 3SQNA 5TLSA 2F8MA 2H52A 2D6FA 5AVQA 3F8TA 2XBLA 3HKCB 2PUDA 4BP1A 1F2TA 1TTHA 2EXXA 3SHTA 5KYGA 5ENDA 2WWHA 3FMPB 3G9XA 4Q7EA 4X8HA 3VR6D 3KVNA 3PHBE 4KQGA 5AW9A 1YUMA 2QRNA 2RCYA 4G0VA 1VI5A 1OT5A 1FY2A 4QEZA 5C3UA 1VL1A 2JBWA 4B75A 4UVGA 4ZYVA 1AU9A 1OE0A 4HD8A 3UXYA 1SXHA 5KWVA 4AX4A 1SUIA 1NBMD 5HWSA 1VP3A 1IUKA 3DXZA 2JVIA 3ZD7A 3R3ZA 4QUEA 4X5OA 3SJAA 3USCS 3OCXA 4V1CI 1A98A 3ODPA 1J7KA 2BD0A 3S28A 5LB4A 3NVDA 4KI0A 3B7PA 2ZJ7A 1KH2A 4MVJE 4WCVA 4G84A 4YMWA 4ZHSA 2VNHA 2VHJA 1NQOA 2X40A 2C7QA 3D3QA 4HMPA 4B0PA 3ZHTA 5CLGA 1J4AA 1ZCFA 3I72A 4DMRA 3DTVB 4HVCA 5JRJA 1BD3A 3LCRA 4C04A 2PMBA 4FW8A 1HE5A 3QW4B 4DNFA 4QUAA 5JCOC 3S8YA 3M0EA 1SD1A 4IVPA 3DFFA 3EMVA 1N92A 4FKMA 1PQWA 3UXMA 1HO3A 1DGQA 3AIMA 1EFRA 3RSSA 5CIYA 2WVGA 4Q9NA 3E8XA 5A5FA 1HBJA 4UCXA 2AOWA 2Q28A 4E30A 1DE0A 2P6RA 4M0PA 2B20A 4BNJA 3A6HA 1KJWA 3L8CA 1JHMA 1DTWA 1M1UA 1M2VA 3A26A 3AKYA 5CB8A 3GGCA 6REQA 1FVOA 3E9YA 1BMFA 2RB4A 5DWQA 3PR3A 3AEKB 3GLUA 4JU9A 4ND8B 2VHTA 1QGDA 9ATCA 2HHLA 5GPBA 2E6KA 3WJAA 4MWZA 1V41E 3GB9A 3HBFA 2V5AA 5EQDA 5H7XA 4RZ3A 3RFUA 5KX5B 1VZ2A 3ED5A 1F0NA 4UTXA 1HFWA 3UPDA 4DR1B 3ADOA 4I1OA 4TGLA 2F3RA 5DDIP 1B7GO 4XD7A 1FQOA 4QOSA 3SIPA 1GVNB 2ID8A 5FV7A 2ZIXA 1XNRB 4FK8A 1LS6A 3UAVA 4GQIA 2IQIA 2J5XA 4W9NA 1P9RA 3D8SA 4KB5A 5IBQA 4JU8A 2PH3A 1N77A 1JLMA 1XXHA 2FJPA 3A6JA 3IO5A 3D2CA 3HJGA 3IV7A 3X1JA 1OLUA 4XIGS 2YY6A 1PQPA 1OX4B 2DRIA 1O87A 3AO0B 5BR1A 5GOTA 1T9ZA 3BMQA 3VPXA 5GIOE 3HK2A 1RQLA 3OEHD 4K6GA 4F4JA 1XCMA 1Z5OA 4O5AA 1OIXA 1GPJA 3W6ZA 2XYRA 2GX6A 4YROA 5JS6A 2NSYA 1U0RA 3OU6A 1OI4A 1WU8A 4C9BA 2AHRA 2BZ1A 1HLPA 4YP7A 3WNDA 3WLPA 3RVJA 1QONA 2WIGA 4PSKA 3SKVA 3Q9LA 2GDJA 2XE8A 4NDZA 1ZCBA 3VNRA 2A59A 2EZ8A 2VBCA 5LXTB 5KYTA 4GI5A 1XCPA 3O74A 2WWYA 2WB2A 1NJSA 2JKYA 1OFTA 4R9RA 4N0PA 5E1BA 2VQSA 3R7SA 1J20A 1N2CB 5ALGA 4G0UA 2Q3BA 3IRVA 5HCUA 3OCJA 2LDBA 1GCGA 2HJHA 3L5OA 1YQ9A 3LLMA 5THXA 1V47A 3WK7A 4BQSA 1BW9A 2BHNA 2RHTA 2M1XA 3LW8A 3QU9A 1LQTA 4ZEOA 3ZHUA 1XTQA 5M5BA 1Y8RA 3GLHE 1IZ0A 3KOZA 3OZRA 3QPUA 4WKBA 5C1IA 4YCLA 3D81A 1YUNA 1BQ4A 1ZMOA 4FFWA 2P3SA 4HB0A 4KQKA 1GJRA 4UVHA 1KDYA 3TTTA 3URKA 3D54D 2AG6A 1U94A 2DAPA 3ANMA 4GICA 4PINA 2XQGA 3VM6A 5JPDA 2ODBA 4DMLA 4DLUA 2GEVA 1F4PA 4EELA 5L3QA 2EF0A 2ZI3A 3CVOA 3JQBA 1YE5A 1JEQB 1P9LA 3DD1A 3PXCX 2XGOA 2ATCA 3BREA 4JR1A 1M8JA 1S8AA 4XLTA 4CETA 1UAGA 1OC2A 5DBIA 2F6RA 1G8MA 1DAIA 4HAXA 5IWCA 4RTSA 4W1RA 1Q1AA 1DWOA 2ODEA 5F7OA 2C3MA 3IEUA 2J4FA 1ZRSA 1J5XA 5AYVA 1KNXA 1Z16A 3UICA 4G1CA 1JU9A 1U3TA 2BYTA 1ECPA 2WR8A 3OX4A 4EL5A 1DJLA 3OBIA 2XOKA 4Z86A 2HYIC 3P9XA 2O8NA 1IN6A 2QTNA 2D00A 2I4IA 3ASUA 3CF0A 1SCUA 3K05A 2OMEA 4S1OA 4UC0A 4ZI5A 1DBRA 2CXQA 1T3SA 3TGWA 3TW8B 4YMHA 4CKWA 2ETVA 5GINE 1E2PA 4WX2B 1JJ7A 4JBYA 2P0EA 1V16A 1W36C 1OBVA 5BV1A 5IBRA 5L45A 5IW8A 2XGJA 1KOFA 4OJYA 5A3VA 2ZIUB 3ZHSA 2JEOA 2PRIA 4PIMA 4KPFC 1OCEA 1ZGAA 4FGWA 4U7JA 4WLFA 3QLJA 3NFYA 2A0FA 4NV0A 2P68A 4YRBA 1HNZB 1E4EA 2NTEA 2POCA 3Q3HA 4P38A 3TR0A 1J8FA 1R0ZA 4UUMA 1P8JA 1HK7A 5EXTA 1AZLA 5H3LA 2Z5VA 3U3RA 2PTGA 3U7HB 2BEWA 5SYNA 2MR6A 1U1CA 5DJ5A 3ZWMA 1S2NA 1SUBA 3C3WA 5B57C 2F1IA 4L8WB 1L8XA 4I1UA 4QXAA 4AP5A 4MVJG 1T8TA 2ZYUX 1GA1A 2UZ3A 5HS6A 1VL6A 2QROA 1Y8RB 2Q2VA 2OQIA 1SBHA 3D6UA 3IJEB 2GZ1A 3QITA 5FULA 2PUJA 2A1IA 2W4QA 2HV9A 3H5IA 2UYYA 1C0EA 1CY6A 3PC8A 1USGA 4I6EA 4IXNA 3R7NA 5BN1A 3VR4A 3M83A 2WMDA 4P08A 2XD4A 2F4VB 1V95A 4MA4A 1J5PA 4YLYA 2D7JA 4BP3A 4C1BA 5FAXA 4LCEA 1FIUA 2FN8A 5AW8A 4G5YA 3IR7A 4BQPA 4OPMA 2HF7A 1X2EA 2BSXA 1V3VA 1W581 2AE1A 2GN9A 3E8MA 2AJTA 4LDJA 3ASYA 5I6DA 5KNBH 2XZLA 4KXUA 1FZQA 4Z2AA 1JXQA 1C3OA 5K2MA 5KNLA 3R5TA 1QKKA 3DF7A 4HUQB 2I4MA 4KL8S 1QG0A 1Z5PA 4FB5A 1M8FA 4DSUA 4MS1B 1Y3BE 4QE3A 3X1WA 1IPHA 1OYVA 3R24A 2WTNA 4WK2B 5D3KA 4DAEA 2PR2A 5J63A 1OGYA 1U2TA 2I33A 3KB8A 2QDXA 1T3ZA 1KS2A 1NJ5A 4CIBA 3DEJA 3CSUA 3MTDA 3OZWA 3PJRA 4JIMA 4ZO9A 3TUZC 2C2OA 5FPSA 4TYWA 1Q16A 1W34A 1YK1A 3BD9A 2PD6A 4OHBA 2H06A 3FCSB 2DWPA 4O8CA 3WRXA 4WASA 3CRNA 4CBVA 1RE0A 1QIJA 1HFKA 1BJTA 3EGOA 4MIOA 4O2BB 3AOGA 1FXWF 5IDWA 2R96A 4G97A 1SVOA 1WP4A 1DG3A 4UEOA 1QLJA 3C8UA 4JLKA 5ECDA 3LPNA 2CL6X 3NWPA 2I4NA 2X42A 1KQPA 2C4WA 3KLBA 1H0RA 4IIJB 4C0LA 3IBGA 1B6SA 2RH5A 5EYPB 1WHSB 3P2IA 5ALJA 1J2RA 1JWAB 1N57A 3CPSA 4BX3A 1NG9A 1U02A 3Q1LA 1GQYA 2X9QA 3HCOA 5I3CA 3AVYA 3JALA 2FQWA 3KP1A 1ECJA 4QLOA 4GXQA 2OHOA 2AQIA 5FHQA 2GBFA 3B36A 4NV1A 2YRXA 4FGUA 2C00A 1UT6A 4ZA2A 4ZCTA 3FVWA 4R1SA 4WNCA 3B70A 3GBVA 4DMUB 2RBEA 3NHSA 1S4QA 4OXKA 1MB2A 3G79A 2R86A 4AUKA 5HBRA 2NTJA 4I4TB 4JLNA 4ID9A 4DDKA 1Y6ZA 2A9RA 4WKNA 5B1IA 3JAMA 1VCNA 1ETUA 1DOAA 1QKIA 3GFRA 2Q4TA 1RPJA 3K7EA 5DLDA 4Y1RB 5FBLB 4PWZA 2O8VA 1X39A 1DWUA 2TECE 2WD7A 1KS9A 3BTOA 4MPRA 1S8NA 4LXYA 1ZCJA 1G3IA 2CYBA