3RODA

Methyltransferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
259
Chain Sequence
SGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate recognition in human nicotinamide N-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nicotinamide N-methyltransferase
total genus 87
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.1: Nicotinamide N-methyltransferase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3rodA00
4P7FA 2FPOA 2PX5A 2Z6AA 2IPXA 4ISCA 2GAFA 4X61A 2PGXA 3HVIA 5H02A 5DSXA 3SM3A 3R24A 4QDJA 5HILA 2ZIGA 2PXXA 3HA3A 1P1BA 5EHGA 2OBFA 2XYRA 4GOOD 4PIPA 1EQAA 4A6EA 1KPIA 3LBFA 3T7SA 3KPWA 2PXCA 3EGEA 3GRZA 2P35A 2AR0A 3HCBA 4E2YA 4P7GA 3KR9A 2CMGA 3HVHA 4NECA 2HWKA 3EVBA 4POOA 1VQ1A 3REOA 3NVKI 1NV8A 2NP7A 1Z3CA 4WXHA 5DXAA 2PVCA 4KIFA 5DM4A 5FTWA 5ICFA 2O05A 4RTJA 3CJTA 5DXJA 1DCTA 1Y8CA 3WSTA 2ZZMA 5KYGA 4HGZA 3KPVA 2C7QA 5K05A 2NNWB 3PFGA 1YZ3A 4QDKA 4YMGA 1M0EA 1NE2A 2EX4A 3DMFA 3DXXA 2BM9A 3KQQA 4HTFB 4RWZA 2NXCA 3KPUA 4FZVA 4YMHA 3HA5A 3TRKA 3FYCA 3KR1A 4C03A 5KQSA 5DX1A 3CJRA 2UYOA 3FUTA 1WZNA 2B25A 2ADMA 3ME5A 2IBSA 4X41A 2V7EA 2FK8A 3BKXA 5CVDA 4C05A 4PGHA 5IH3A 3TR6A 4QTTB 1SQGA 3UWPA 1QANA 1TW3A 2FHPA 2GS9A 2QRVB 3LKDA 2YQZA 2AN3A 1OR8A 3SSOA 4ER3A 3P8ZA 5EZSA 3IHTA 3NWEA 1VLMA 2OB1A 4KDCA 4LECA 3FPJA 2O07A 2OZVA 4F85A 1P91A 4HGYA 1R18A 2QY6A 2ZWAA 2HTEA 2GA9A 5FHRA 3C0KA 3NTVA 5BXYA 5F2OA 2NXNA 1MJFA 2CKDA 5E8RA 5GP1A 1JG2A 2I62A 2ZIEA 3HEMA 1HNNA 1X1BA 2VS1A 4RTNA 3SSMA 4EMSA 4V0RA 1F3LA 1B42A 3GO4A 4UOEA 4YUXA 3OU2A 4BLWA 3OCJA 2ZLBA 2NXEA 1WXXA 2AS0A 4PYLA 2GLUA 4OA8A 5FHQA 2OO3A 2YUIA 1JTEA 4C07A 1L1EA 4HRAA 3OE4A 5FULA 4Y2HA 5EG5A 1X1DA 3THRA 1QZZA 5HOQA 2IGTA 4X60A 4GF5A 3CCFA 2WA1A 3SR4A 3FPGA 4MHTA 4PYQA 1JQ3A 3C3PA 4LG1A 5C0OE 4G56A 3LDUA 5LQJA 1H1DA 3G8AA 3KQTA 1EAMA 3O4FA 3LDFA 3Q87B 4PYIA 5K0LA 1ORIA 4OBXA 2YXLA 3GRYA 2YX1A 3KQYA 4IV0A 4EVIA 4CKCA 2PBFA 2XYVA 1ZG3A 5CUQA 3NWBA 3TPZA 3PX3A 2O57A 5EEHA 4FR0A 5K03A 2O0LA 5E1BA 1G8AA 4C06A 2AVNA 3MHTA 1KPGA 1G55A 1JG3A 1VP3A 2HNKA 2G8NA 3SX0A 3EVFA 3OZTA 2IP2A 4C08A 1R74A 4QVGA 2ZTHA 4EKGA 3EMBA 3P9NA 2AZTA 2QRVA 1ZKDA 5D1HA 4AZVA 2PX4A 2HR1A 1KR5A 2AN5A 2AOTB 3PS9A 2VDUE 3FRHA 5DM1A 1XDSA 3QOXA 4M37A 2E5WA 1M6YA 1SUSA 3BWBA 3G5TA 3HNRA 2CL5A 3IYLW 3OU6A 3ID6C 4Y30A 2C7PA 5ERGB 1RI4A 4FP9A 5P8WA 2ZWVA 3B3GA 5DLYA 3ER8A 4DM3A 5CD1A 4RTLA 1RI5A 3VYWA 3ELUA 3A7EA 3C6KA 3P71T 4V0QA 5K8VA 5EHIA 2IH4A 2K4MA 4CKEA 3R6TA 4PYJA 10MHA 4R8SA 5CM2Z 5EVJA 2F8LA 4A6DA 4GOMD 4M7RA 3CBGA 3KKZA 1D2CA 3UJCA 3PX2A 2P41A 3MERA 3E23A 4O29A 5CVVA 4RTPA 2AOWA 2UYHA 2VDVE 4PWYA 3MB5A 4RVFA 3T7RA 1FPQA 3G5LA 3ELDA 3HCEA 5ICGA 2P3LA 3TLJA 5K01A 1BKYA 3DULA 3AXTA 3G8BA 1WXWA 5DWQA 3G2QA 4XUCA 1V39A 3FUVA 3NW9A 4P7KA 4E2WA 5EGSA 4LWOA 3P97A 5DX0A 1JR4A 3G7UA 5K0CA 1RI2A 1XTPA 2AOUB 3O31A 9MHTA 4YV1A 5CIYA 3DOUA 2O06A 1INLA 2IH2A 4OX9Y 1ZGJA 1QYRA 2QM3A 4H0NA 2NXJA 3DTNA 1BC5A 4RYLA 4L7VA 3UA4A 4QPPA 3EEOA 2HV9A 5KVAA 3GIWA 4E2XA 5GM2A 1EG2A 2NYUA 1NW5A 5FUBA 5CCXA 4R6WA 3UJDA 4CWAA 1XDZA 4RVDA 3R3HA 4LWPA 4PIMA 4X1OA 2DULA 4DCGA 5K0EA 3M6WA 1L3BA 2PX2A 3ER9A 5EZQA 3TOSA 3PB3A 3EVEA 3KQWA 1NW7A 4R6XA 3JWHA 2B78A 1N7IA 4WVLA 3BZBA 5LQKA 3U81A 1UIRA 3BGVA 3CJQA 3GGDA 4HSGA 1RJEA 4FSDA 1VBFA 4E30A 4R8RA 3KQSA 2BZGA 3BWMA 3DXZA 1L3CA 3G88A 2BR4A 4PGGA 2Z6QA 3OU7A 4ATNA 3LPMA 4QTUB 3FYDA 3BGDA 3HVJA 2IIPA 2Q41A 3EEYA 4KVZA 3KU1A 5DTRA 3E7PA 3KPYA 1AQIA 2OPBA 3EVCA 3LCVB 3UJ7A 1FBNA 3DXYA 4R05A 4KIGA 4YUZA 1JG1A 2ZIFA 3ANXA 2R3SA 2OB2A 3AWIA 2AOXA 3TMAA 2QYOA 3OFKA 5K0FA 1WG8A 4AZSA 5DM2A 4EK9A 1X19A 3UJBA 4DF3A 1UFKA 2B3TA 2OY0A 4RV9A 3V8VA 2YVLA 4QVKA 2HMYB 4M36A 2AOTA 1XCLA 2PV0A 3PLAE 5G02A 3UJ6A 1BHJA 4HC4A 3DLIA 3TM5A 4C4AA 3M6VA 2JHAA 3LL7A 3I9FA 1JQEA 1SG9A 1TPYA 4QQNA 5E8JA 2XBMA 3LKZA 2OYRA 4DMGA 4FT2A 2PWPA 1XDUA 1QAOA 4RTMA 2BH2A 3SGLA 8MHTA 3EGVA 2PSSA 4Z2YA 5T67A 1HMYA 2R6ZA 2ZBPA 3KPJA 4PYKA 1YFLA 5LQRA 2B9EA 4U7PB 4GC9A 3HM2A 1JSZA 4XUEA 2EJUA 3THSA 1FP2A 2IH5A 4XUDA 1KP9A 2I7CA 1AV6A 2OKCA 1NV9A 3AJDA 4ER6A 5EKXA 4BP3A 3EGIA 4PYMA 2JHPA 3B89A 5DTQA 3JWIA 4RVGA 3M6XA 5LSAA 2ERCA 3A4TA 3C3YA 1XCJA 4OBWA 3OPNA 1XVAA 2FK7A 3RODA 4OQDA 4IWNA 5K0GA 3MTIA 3CVOA 2FRXA 3D2LA 1Q0TA 2IBTA 3GNLA 3FPHA 2PLWA 1JQDA 4KDRA 5DSTA 2XYQA 3R0QA 1WS6A 5CVJA 5EEGA 3UJ8A 5EMKA 4P58A 3DMGA 1NW8A 5B1SA 4DZRA 2XVAA 2CMHA 2VZ9A 2N47A 1RI3A 2ESRA 3OE5A 4RTRA 1MHTA 2UYQA 1JTFA 3BWCA 4CTJA 3DMHA 1NKVA 3FTDA 5T64A 3A25A 1VE3A 3PT9A 4HG2A 3V97A 5C9ZA 5MHTA 4ER7A 2P40A 3FZGA 3GRUA 1X1AA 1KYWA 1YUBA 2AVDA 2GPYA 3GU3A 4K6MA 4YUWA 2G70A 2NP6A 3MCZA 4PYNA 1G6Q1 4MTLA 2DPMA 1SUIA 3PTAA 3HTXA 1O9GA 2JG3A 5IKMA 4MQ4A 5K0NA 5ICCA 1FP1D 1L9KA 3KQMA 2ONZA 3EVDA 3K0BA 3NJRA 3X0DA 5GIPE 2P3OA 3P2EA 5EIFA 1I9GA 1I4WA 5DPMA 3GXOA 2GB4A 5EMMA 5BW4A 4RVHA 3SXJA 5DTMA 3CKKA 2JHCA 2UZ4A 4QQKA 3E8SA 4F86A 3JWJA 4KW7A 4C04A 1L3IA 3T0IA 3TKAA 4E31A 3FTFA 3EPPA 2ZVJA 1G38A 2JH8A 3OZRA 2Y1WA 4CXMA 1YF3A 2CWWA 5HEKA 2AOUA 2PJDA 1O9HA 3NMUF 5M5BA 1NT2A 3M70A 3MTEA 4CKBA 1Q0SA 1N2XA 3CGGA 1F38A 2P7IA 2PX8A 2ZW9A 1VL5A 5CVUA 3EVAA 5DRTA 3TM4A 1RJFA 3MGGA 2BR5A 3LBYA 2YTZA 2I9KA 1IXKA 5GIOE 3LCUA 4DCMA 3B3FA 1NBIA 5E2BA 5EIWA 3KR0A 4OQEA 5EMJA 2ZULA 4YUYA 3R9XB 4EKIA 1JG4A 5E2AA 2JH9A 3DLCA 5ICEA 3EVZA 5E1DA 4RX1A 5HZMA 3SVZA 2Z6UA 3BXOA 1YFJA 2EFJA 3M6UA 3TKYA 2G71A 3ELWA 2QE6A 2P1DA 3M33A 1KYZA 2FYTA 5T6BA 2ZFUA 4PNEA 5EQJB 2G1PA 4XCXA 5DX8A 3ERCA 7MHTA 3B7PA 4GUAA 1YB2A 3ELYA 5E9JA 5BP7A 3NVMB 4YV2A 2VDWA 3LECA 3OFJA 5HFJA 2IDKA 3OZSA 3GRRA 2XVMA 2PKWA 4GBED 2V74B 3F4KA 2PWYA 2ZZKA 4GEKA 4X63A 4E33A 3FPEA 4FSXA 3KR2A 4DQ0A 3KQPA 3NDJA 3UZUA 3LDGA 5FCDA 4E70A 3FRIA 5FQOA 3KQVA 1G60A 5GM1A 3PVCA 4PONA 3RW9A 3UBTA 1M6EX 4PCLA 3G2PA 3DR5A 5HIMA 2B2CA 2ZBRA 3P9IA 4YUVA 4OA5A 3RIEA 2PT9A 1RJDA 3UA3A 2ZSUA 1ZHFA 4PINA 5EMLA 3PFHA 1R8XA 1WY7A 2EJTA 1KIAA 1AQJA 2AOVA 2YXDA 2ORED 4ZTBA 1QAMA 3ORHA 1SKMA 4HTFA 5EOVA 2JJQA 2P7HA 5K0BA 1P1CA 3BUSA 3A7DA 3C6MA 3E05A 5LQAA 1BOOA 5CCBA 4MWZA 5CVEA 1N7JA 1SVUA 3LX6A 3MCTA 3K6RA 2OXTA 2Y1XA 4E32A 3HCCA 3L8DA 4YV0A 3UJ9A 2C7OA 4HH4A 3I53A 3EMDA 4BY9E 4GOLD 5JUWA 5K0JA 1ORHA 1YZHA 4ER5A 2LD4A 5C1IA 3G89A 1NBHA 4RTKA 3IEIA 3P2IA 4PCAA 3DH0A 2IFTA 2BR3A 3HCDA 2WA2A 2H1RA 3BT7A 1EJ6A 5F2KA 5HIJA 1D2GA 2A14A 1ZGAA 1R00A 3BWYA 2EG5A 4GQBA 3GCZA 4FT4A 1R8YA 3LSTA 3NDIA 1D2HA 2ONYA 4RSRA 2PY6A 3FTCA 1DL5A 3B3JA 3O7WA 1DUSA 1RI1A 2PT6A 2UYCA 1JSXA 2I6GA 3BGIA 3B5IA 4E2ZA 5KS2A 3S68A 1IY9A 2ZCJA 3LHDA 1VIDA 2H00A 3FUXA 1SQFA 3JWGA 1IM8A 1KXZA 4CTKA 4MIKA 3QOWA 3VSEA 3P9KA 4AUKA 3HCFA 3G2MA 4IKPA 5GWXA 3FPFA 1RJGA 5GOZA 1VPTA 1TW2A 4KRGA 3TFWA 1UWVA 4RTSA 3BKWA 4RTQA 3HP7A 1R6AA 1T43A 4EQZA 3UFBA 5E1MA 3EVGA 3SSNA 4U7TB 3FTEA 1EJ0A 3LCCA 3P2KA 5EPEA 3I64A 1P39A 5FADA 4JXJA 3I58A 3I5UA 4ER0A 2G72A 3SMQA 3VC2A 2PXAA 2P8JA 4GC5A 2BM8A 1U2ZA 3AY0A 3GWZA 1KPHA 4P7JA 3G2OA 3HA7A 3A26A 5LQUA 2VP3A 3P9CA 5FQNA 1EIZA 4DKJA 1XXLA 5FWDA 4FGZA 5LQCA 5FA8A 5JR3A 1X1CA 3GDHA 1FJXA 1PJZA 4IV8A 1QAQA 2WK1A 3CC8A 2H11A 4FS8A 4AX8A 3VC1A 5DRYA 5K09A 4KWCA 5LQNA 4GOND 1KHHA 4BLVA 5HIIA 1NW6A 3M4XA 5KQRA 1NW3A 5E1OA 4RTOA 5DT2A 2KW5A 1ZQ9A 2IDJA 3AXSA 1VP9A 3Q7EA 2P3QA 5E9WA 3MQ2A 3T7TA 5HIKA 4F84A 3IV6A 3DP7A 4PYOA 2ZZNA 2GH1A 4M38A 5EC8A 3TQSA 5U4XA 4B17A 5BW5A 5GINE 5FA5A 1G8SA 2FCAA 3KQOA 3MAGA 4BLUA 4DA4A 3LGAA 1AF7A 5E9QA 4AZWA 5EKUA 3DUWA 4AZTA 1O54A 5D1NA 3HVKA 2YR0A 3HCAA 3A27A 2C7RA 3GJYA 1I1NA 1XJ5A 2AN4A 5FWAA 2YXEA 5LR6A 5DM0A 3H2BA 4QPNA 3GRVA 3QV2A 3FUUA 3UJAA 1PRYA 3FUWA 4BP1A 2ZBQA 3KHKA 5F2NA
chains in the Genus database with same CATH superfamily
2FPOA 4PVDA 1QG2A 2PGXA 2ZRQA 3L1IA 4H6VA 3T5BA 4EGSA 2J3JA 5AVOA 1YRQA 2VNHA 1K7FB 3CSSA 1GNTA 3Q5DA 1ID8A 3L8MA 2JFNA 2PX6A 3H9CA 4J16C 3QIAA 1J39A 2JI8A 4MSUA 3ENWA 2DF8A 3EWNA 2ECOA 5AI5A 3WGTA 4FFWA 3UWKA 2SCUA 4US1R 1R0WA 3EGEA 3OIUA 1BCRA 1U80A 1F06A 4TN1A 1QDLB 3RSQA 2RHHA 3PPWA 3TDNA 2I80A 1HGXA 4PZ9A 2OLKA 5A5VA 1PFYA 5BSWA 1FUEA 3U37A 2B6NA 4BMNA 4RCYA 4OLJA 1N7HA 1S96A 2YJ3A 4Y6LA 2G0NA 1AQLA 1QPBA 3SE0A 4DXAA 1DCTA 4U2EA 1T4CB 3GJRA 4IJQA 5KYGA 1EFKA 1UJMA 2L69A 3OT4A 1USUA 1RRFA 3T38A 1C1XA 1E8NA 5F5LA 5BYJA 1WEHA 4WA7A 4E2ZA 4QD3A 4AN4A 4BVHA 1E66A 1XLUA 3NU1A 1YJBA 3TSAA 4MDEA 2I2CA 5F5NA 4N1AA 1T0IA 1H66A 2JFZA 4NEGA 3CVXA 1B14A 4WY5A 1HRKA 4EGCB 2QRVB 4R0MA 2DQKA 4L5CA 2QPLA 4YJFB 2ZQYA 3I1YA 3OZVA 4CL3A 2AZ4A 3IBTA 4C2AA 2Y76A 1GRRA 1KBQA 3WHIA 3OLXA 3WGHA 3N7UA 1L4YA 3EY4A 3OURA 2IJGX 4PZAA 4HGYA 1WUYA 2RHRA 3MWEA 4QYIB 1B16A 1ONOA 1XQ1A 3B3QA 4XWGA 5NULA 3T3IA 3U2QA 4BMOB 4GMHA 3T3HA 4J16A 1EXDA 3MTGA 1W49A 1L7NA 3OZAA 1J8FA 3BDAA 1KF0A 3ZVNA 2OLEA 3D9QX 5JASA 4B83A 1Q22A 1ZSNA 2GTPA 5SYMA 4BBAA 2R5FA 2X14A 1US8A 3HDVA 4R9SA 3RT7A 5IX8A 3CG0A 1U02A 3LKVA 2V8BA 4NI5A 1ZM2A 1E62A 4ZT4A 1K0FA 4IIJF 2XSZA 2C03A 3OCJA 3D0OA 3RV3A 4WXEA 5IWAB 4PHTA 4JU9A 4KHZA 1JTEA 2CDBA 1AUPA 3QPVA 4J29A 4TVBA 2BGGA 3G5UA 4CEJB 3L0ZA 4DSOA 1DIRA 1QYDA 3AU9A 3UB4A 3HDTA 4WJZA 3WGZA 5GOTA 3ZTTA 3NNNA 4LG1A 3GLSA 2HRZA 4G56A 1QRRA 1T2EA 4KAFA 4ETIA 3S6JA 5IRCD 4EEXA 4NZPA 4JR1A 2X2OA 3AUXA 3KZXA 1QF9A 1YZLA 2QVCA 5T4EA 4L6IA 5ESDA 1VG9B 1IONA 1JQ5A 3DEZA 4FEAA 3ZK7A 3IT0A 2CJFA 4NDZA 3KEOA 3IE0A 2PZKA 1CFJA 1OMOA 2IYSA 2DJIA 2IC5A 4EHLA 3UOWA 1YO6A 4BNTA 3MHTA 3O8OA 1QONA 2GEJA 2CBZA 3FGZA 3QVJA 3HKEB 3PNQA 2GCIA 1NG9A 4OHMA 1DRUA 2CMDA 2AZTA 4LTDA 4M7OA 3GPLA 1N5JA 2P78A 3EMVA 4CMHA 1XJ0A 2I3GA 2OTCA 4ARZB 3TVYA 2YYYA 2QRPA 3KJGA 1QYXA 1K92A 4HNAA 3M81A 3QEMB 2GXQA 4PXSA 5HRCA 3M5CA 5KJCA 1DUIA 1EVKA 1ZIDA 1R6XA 2QUAA 3I9OA 5CD1A 1DAGA 2OHGA 2BE9A 3P71T 3JV7A 1GZDA 5AT1A 2AFIE 2X8JA 4UMFA 4Q3OA 1UL1X 4KWHA 3WGKA 5K8VA 1H9BA 4CM6A 2C4VA 2GCEA 4RHFA 4Q7LA 5C5IA 3STUA 2GAOA 1T9BA 2FPSA 3A0UA 4J1TA 1KS9A 4AXBA 5EJEA 4EO4A 3BZWA 2QN7A 4JC8A 1EFTA 1SXJE 4NNJA 5DHQA 2DAPA 5E3HA 1GV0A 5CVVA 1IUOA 1K4MA 1VPEA 3TUIC 3VISA 4RTPA 2VH5R 3ANNA 4QHTA 1IE3A 1NASA 1EA7A 3TLJA 4ZMRA 1YQ9A 2PR2A 4LRXA 3CLSC 3NW9A 2GK3A 3NM6B 1X7HA 2XLCA 2XV1A 3HBLA 3K2EA 5JDIA 3I6ZA 3OPMA 3UT5B 1I9CA 1G17A 1HDOA 1IPHA 3M4NA 1QVZA 4IJ5A 1NNSA 5BNTA 4Q9IA 4R16A 4IKEA 3HYTA 4YV1A 1FYEA 2V1XA 1XF1A 1D03A 5GJVC 3DTNA 1BC5A 1KO1A 2BKVA 4MRAA 4ND7A 3REQB 8LDHA 5HZGA 5LCXA 2ZUFA 2VSYA 5DHFA 4JOBA 3IRUA 5CFRA 1FNSA 4NENA 1W0CA 4PANA 1ZP6A 3AIKA 4QUIA 2JLWA 2HQSA 3EHDA 1CS0A 1WQ4A 2W6PA 3I0MA 4IIHA 2C95A 4QQRA 5LDDC 1R6UA 4A6PA 1XD9A 5BUZA 1I0ZA 2BTQB 2PAFA 5AI0A 1YU6A 4QRDA 3S7TA 1BX1A 1U3GA 4MJ7A 5EUQB 2VDLB 2PUFA 4JX8A 4L16A 4ZEXA 5KSPA 6LDHA 4HN9A 4F7DA 2JIZA 5CG1A 1XQWA 4ZIRB 4WVLA 2OXRA 4ZVMA 4B35A 3H5OA 3BGVA 2OV6A 1BEUB 1Y9AA 3L41A 2V98A 1RJEA 1P7ZA 3H65A 1I7SB 2Z95A 1L5VA 1E7RA 3AZQA 3DBVO 3H7AA 4LZZA 2WWVD 1DAFA 1FMCA 2VC2B 4FR2A 3GB9A 4FZJA 3R2JA 1VOTA 1NY6A 4GX5A 4PZDA 2GPTA 3H18A 1CDZA 1OFVA 1GKKA 2BBTA 2ZVQX 3EEYA 4KVZA 4RCZA 4QATA 2VBCA 2CT8A 5G1PA 3TLGA 3AWDA 1OTYA 4Y9DA 3RYTC 2VRWA 1Y8RB 3I2FA 1CC1S 3IEUA 3LY8A 4RVNA 3JD1A 1QO9A 3HUDA 3OC0A 4ZA2A 3GW8A 3SC3A 4HEQA 4IHJB 2CV0A 1SD2A 2HPVA 5DZSA 1FZQA 2XYPA 3P0RA 3WMFA 5KTOA 2V8OA 4IIFA 3LKBA 4AN1A 4EUEA 3CVUA 3EX7C 1E7YA 4BX3A 4I66A 4LBVA 3A37A 4MYRA 3X3HA 5A03A 2HA6A 4I4LA 5T7BA 2P6RA 1FXSA 3PLAE 2NIPA 3M9WA 1C81A 5DGXA 5AM4A 2XTNA 4OSPA 2BFMA 2PTHA 3WDKA 1I30A 1UBEA 5E8JA 2XBMA 1MOSA 1EX7A 1J0AA 1R4ZA 1A9OA 1R0BA 4M1QA 5D5PA 4GNRA 3X1WA 4TMFA 2IYFA 4D43A 4EI2A 4IJ6A 5AW0A 2J0VA 1E1RA 3RUFA 1RMQA 5HFNA 1TZ2A 3B5JA 3FJOA 3S7ZA 3IIKA 1A69A 4ZXPA 1NMSA 4LYJA 5L6LB 5CDHA 3NHZA 2QVXX 1PLLA 4UQOA 4I5GA 2X58A 4IM7A 1ZQ1A 3NBZC 4KK4A 1AGNA 1LZKA 1T8WA 1JG6A 3N0RA 1Q1QA 1CZRA 1KFEB 2EHJA 4X00A 1XSEA 4F11A 4L8WB 1F4PA 5HUJA 1PNVA 1CZUA 2XNHA 4FKZA 2VP0A 4Q9JA 1YV9A 1JAXA 4V39A 1GQOA 3PEWA 4IRMA 2GESA 3HLKA 3RFCA 1BH2A 1PT5A 1G3QA 5F1OA 3HRIA 3TZQA 1PSDA 1KZ4A 1RVDA 4FYXA 4IWNA 2W6JA 3CVOA 3HYLA 3S5JA 4B87A 4F38A 1J97A 1XQYA 2IBTA 3DBHB 3FPHA 5GVRA 4XH9B 3VZPA 1XI2A 4D9BA 4HXYA 1R6TA 3UGKA 2QGNA 4HEHA 3UPDA 5G1OA 4QE3A 4DMRA 4DZRA 2AJTA 13PKA 2CMHA 3DLAA 2ESRA 4P3XA 3FSGA 3BREA 4B3MB 4CQMB 3OTOB 4L4ZA 1RQPA 2XW6A 4B31A 3VUEA 3E22B 1SBQA 3AERA 3LC1O 4Q4JB 4Z9YA 2R7NA 1TVKB 3WO1A 4ALJA 3SNKA 3ZTYA 2QJWA 1DINA 1SR8A 2Z43A 3KTAB 4K2HA 5L8VA 5M2QA 4AY6A 4BCCA 4PPYA 4PNZA 2OSVA 5H83A 4ZYUA 4Y6PA 2VHUA 4M60A 3L9WA 3T1NA 4E5SA 4UM9B 3FHCB 3UOGA 1LS6A 1NJ8A 1CK4A 1XZAA 1J5XA 1A9RA 2JK1A 3RTEA 4PPFA 2GFQA 3NJRA 3K0SA 3AB8A 5HF8A 2OGSA 3GXOA 1P4SA 1U0FA 2ZJAA 5DTMA 3PDHA 3U9LA 2EW2A 1L4FA 4KTVE 4IV5A 2PANA 2Y0CA 2H18A 1Z36A 3NMUF 1O9HA 3LRTA 4A91A 4X6LA 1Z4QA 2D1FA 4P53A 1C9JA 1JA0A 2JAHA 2R84A 3PQ8A 2IYEA 1B93A 2PUGA 4J0DA 1U9YA 4FZ5A 1JILA 5HM6A 5ICSA 2PZEA 1QKIA 1AQYA 3LE8A 1Z5WA 4F4IA 3TTTA 2B7BA 2P2LA 2W6OA 3RM3A 1L8XA 2CEKA 4U2FA 4C7OA 1AGXA 3WIDA 2FN3A 1X80A 2H1VA 3MTDA 2EFJA 4TZTA 3RAEC 3QVXA 1T26A 4WBSA 4ZJZA 3T52A 2CV2A 4IQFA 1JH8A 2FWJA 4ON9A 3QYFA 4LJ7A 3M1IA 4QUEA 4PNEA 1CERA 3EIXA 3GNSA 4TLCA 4GE0A 4OF4A 3PUJA 2H92A 2DQSA 1N1EA 2VYVA 4NG5A 2ZRNA 2JGEA 2YZMA 5EE3A 1GPJA 1VLQA 2ZRGA 2WIGA 4DMLA 4W5TA 4Z54A 2WJWA 2ZIXB 3LHIA 2XUPA 4Z4QA 2OZLB 2QKYA 1P5ZB 2PKRA 3PD0A 1PQYA 1IBLB 2XKKA 4ESVA 1G60A 5GM1A 1ITZA 5JJIA 1FFXB 3TQCA 4F2HA 2QZPA 1XA0A 1X0VA 4R2MA 5GADl 1DFHA 1PE0A 2QRMA 4AUNA 1CJSA 1JFLA 1FY2A 1MFPA 4YUVA 4EB6A 2PT9A 5FIUA 2CF5A 4PO8A 4DQXA 1CF9A 4W4TA 1V5FA 2BL4A 1CJMA 2ISQA 3V7FA 2GJ8A 1AQJA 5FR2A 4HH0A 5G0VA 4A9AA 2J3DA 4NC9A 3ZVRA 4AUEA 1P17A 4P2GA 2I4TA 2VJMA 3TGWA 2PD4A 4KKXB 3J7AC 5AOAA 1QH0A 3BB4A 2R11A 3THYB 2X2PA 1U3DA 1Y6RA 4GZ3A 2Q1TA 2H4YA 2XBLA 3MINB 1OBHA 3EMDA 4Q1AA 5EWLB 3TZBA 1DEHA 4MI3A 5JUWA 3UG7A 5F33A 3IUQA 4RK1A 2RCYA 3H97A 2IUEA 4I46A 4ZVRA 1WCIA 3FZQA 4Q66C 3MNFA 1TC2A 4NJOA 4ABYA 1K6MA 1YB4A 1ZSVA 2BR3A 3NR2A 3COVA 4ZVQA 4RKWA 5MDHA 4AAYA 3GJ6A 3DMYA 2APJA 4BQRA 1PR0A 5J43A 3IDSA 3PHJA 4M9RA 3BWYA 3HU1A 3AFOA 1HEYA 2KHZA 5KOYA 1X1EA 1Z88A 2PA0A 2E85A 4A2QA 2PY6A 4N54A 2A88A 4QFBA 5F73A 4JJGA 4TXHA 1B6GA 4H6WA 4ZC1A 3IUSA 2P90A 1ESDA 3BJIC 3T99A 4FBGA 1ZH8A 5B7QA 4Q1CA 5JPDA 1F2TA 1VIDA 2H00A 2J9XB 4ZYZA 1E99A 1XQXA 1FLVA 2KBFA 2ZJ5A 1MC4A 4ARUA 3IMKA 3OIVA 1E8MA 5GWXA 2Q0HA 4GYYA 4TZ0A 3PNMA 1SHZA 1X2BA 1SK8A 2XDWA 1R6AA 3BKWA 1SXJC 2WYVA 3KUCA 4RA6A 4YV7A 3LUGA 1L4LA 2V6BA 1Z25A 4EG6A 3WYGA 5B58T 2R0QC 1UJ5A 1FLNA 1XPJA 1I1QB 1Y33E 3V1MA 4ZAYA 3K9WA 4YBRA 3CW8X 3DVAA 4E5MA 1FZTA 2CUNA 3DV2A 1HETA 1QTIA 1UOQA 3AR2A 4U3JA 3RTBA 4FFOA 2OORC 3C3EA 3NC0C 4YAWA 2Y1EA 3T34A 1WZUA 1XCGB 1XDBA 3FFTA 2M6KA 1AKEA 4KBGA 2Q27A 4UCWA 4AY4A 5JR3A 3GDHA 3AI3A 1XJQA 2VJDA 4IIJB 4JNCA 2H11A 1U94A 3PI6A 3K73O 4MV9A 5IK2D 2VZEA 2Z04A 1P9LA 1Y81A 5FAXA 5MF6A 3ZHZA 5KU7A 2XITA 1NUTA 3IX7A 1QUEA 3AVQA 2ZIZA 2MJLA 1X94A 2E37A 4REQB 3ZD8A 3I9JA 2ZZNA 3MT9A 4AG3A 1MJNA 3L8HA 1J0EA 1OAAA 5FA5A 1G8SA 2YWFA 3EQ2A 1Z5ZA 2ZTUA 1PFQA 1H6BA 3AMVA 3KM0A 4GP9A 3TR5A 3AGPA 4BVKA 2F8SA 3DMNA 2QLBA 1W4BA 5FPYA 2G4CA 2J46A 2IU6A 1PQUA 4DM4A 2YR0A 2GDZA 1XJ5A 4N3AA 2VTDA 4LF5B 5SICE 2ATIA 4GOXA 1MU0A 3EEBA 2IYTA 1RP7A 2Y1KA 1YB5A 4WNAB 1DKUA 1QJCA 2A9KA 3D6UA 4CIVA 3PLRA 5F1PA 4EMUA 3W7BA 2VYCA 7ABPA 1Q1NA 2KX7A 3L7MA 3FSJX 3CIOA 4JJ8A 2HIGA 1U0LA 2XOKA 3CTMA 1KI2A 4GOOD 2YIMA 1Z0FA 3RSSA 1EQAA 3IAS6 4RJKA 4BFTA 2CNBA 1E3TA 2GEKA 1DHTA 3AIOA 2IX3A 1F9EA 2VH2A 2J6HA 2XYHA 5D3QA 5DNAA 3HCOA 4AK9A 4YGYA 1NBME 4C7JA 4POOA 5ES4B 1OZFA 4PPNA 5ICFA 4TWBA 1PZFA 4YN3A 4ZPJA 3VR6A 3WVNA 1Y8CA 2FEXA 2Y92A 1PS0A 1YI8A 4IILA 4XB2A 2QNRA 1Y34E 3PNBA 4COKA 1S2LA 4EF4A 2C7QA 4MUGA 1E3JA 7REQB 1LVUA 2BHSA 2FEAA 2Z8YM 4Q1BA 3TIVA 1NE2A 1Z0ZA 1CTQA 1I0LA 1NONA 2VRBA 3KPUA 3JRNA 1C3OB 2QN1A 4O4IA 2B2NA 3NJ4A 1V11A 4YMHA 4AVYA 1QPGA 4H18A 4M7PA 2GJKA 4GI5A 4AWAA 5K7SA 4FYMA 2AA3A 4H7IA 2QZ9A 4U2KA 3LDAA 5FORA 4EG0A 3HKCA 4I6GA 5IF3A 4ARZA 2FLWA 3TI9A 2J4DA 4BO7A 1HF3A 3KG2A 1RQNA 2Z2ZA 1MB3A 3CN7A 4QOHA 3R3ZA 4DCTA 5JY1A 5F51A 4CEIA 3IL2A 2H85A 3A3KA 1TB4A 4NCXA 4PX3A 3I8OA 5EJ7A 2I4OA 2W71A 2WFZA 3K1AA 4OV6B 1YR7A 2O23A 3A1UA 2X3UA 1HDZA 1OI4A 2O6LA 3CPJB 4XQGA 3E5NA 1P33A 3DEIA 4ZQCB 2WE7A 2AEJA 3D59A 2X7HA 3DAHA 3L0YA 4DPKA 2GA9A 5C1OA 4OLBA 3N7TA 3ORSA 2NVUB 3DEFA 3DFIA 3ZCUA 4RTNA 2VDKB 2ZIEA 1N0HA 3JQFC 4EMSA 2VUUA 4V0RA 1J49A 1B42A 3GO4A 4RK4A 1LV7A 3FGOA 3CMMA 3M6LA 1NVWQ 1TAHA 1J5PA 1OWMA 2KLBA 2JC3A 3IMCA 2VDJA 4MW6A 3TLKA 5LWQA 4KRFA 2CGEA 4MUIA 1HC7A 1UR5A 2OV4A 2OUKA 4QUDA 5IAEA 4AY5A 5IDXA 4Y98A 1MC1A 3FZEA 4GF5A 4AX4A 2AD5A 2C1ZA 3KZOA 1PW7A 4OHPA 4MIEA 3VPFA 3UMYA 3RRMA 4A15A 2JA1A 3EQ6A 4UM5A 2VZ8A 1FTYA 4KVFA 4F9FA 1RJ9A 4XYLA 3GPDG 2H1HA 1XMJA 4IGIA 5IBRA 5K0LA 4OYYA 1FXUA 1WPXA 1YDWA 4N9QA 4M1WA 2ZE5A 2VAMA 2PBFA 2F9FA 1Z6QA 4H0FA 3UB3A 5SYAA 3UWDA 3V3KA 3MN1A 2P6UA 3K5PA 5CUQA 3ADPA 4BMVA 2Y2UA 2JFOA 1YJAA 4HDKA 1L9XA 5T4HA 2AVNA 1XFAA 3L79A 4HQOA 3O5AA 2G9ZA 2JFXA 3EVFA 3G9UA 3MCUA 3PF9A 4G37A 2B92A 4FJ0A 1Z0DA 2WSIA 4OL9A 1OPRA 2AC2A 2AOTB 3OQ6A 2Q4EA 2IV7A 4EITA 4XGKA 1RABA 3U44B 1JEOA 3ZIUA 1NY5A 1SUSA 1VG1A 2FMUA 2H1LA 2LGJA 2XX3A 2NYVA 4HB2A 1AKUA 1CIVA 1JNXX 1TFRA 3S1AB 4TS9A 4ERXA 3HBJA 5K3DA 3WYDA 3IGFA 4FNOA 1FSSA 2I0FA 1QC5A 1J8MF 3E9DA 3QJYA 2ZCUA 4QU0A 1EM8B 1W6UA 4WZBE 5CLLA 5ER9A 1OZGA 2JLSA 3DMPA 5FNVF 3T1YB 4WLVA 4MWGA 4BVLA 1N36B 4U63A 2WWRA 2OHOA 2V0CA 2WJIA 3P2OA 4RIGA 4HYYA 4P0QB 1RXYA 4JP8A 4U2BA 1QZUA 5IVKA 1E9RA 1N4DA 2BSAA 5KO2A 4P4NA 1P31A 5DF1A 3VRHA 2I4RA 5IJ9A 3D2CA 4TV8B 1II8A 1HXHA 1ODSA 4J4HA 2HNBA 4WGFA 3TTVA 3V3TA 4DIKA 3MA0A 3AXTA 2QIPA 5IJWA 4OPMA 5FI1B 4GDMA 5I7FA 2G5GX 3L7BA 3FPKA 2ZPAA 1MEEA 3D5EA 1A4RA 2QAJA 4EY4A 3SAJA 5I4BA 4TQGA 2CLOB 2KLHA 3EIOA 2PKYX 4PFSA 2QMEA 3LVRE 3OOYA 5HIAA 1G18A 3EHEA 2NYRA 2X3YA 4D0RA 3DYBA 2Z2XA 2OAP1 3K4QA 3EGWA 5C7LO 5IYZB 3EEOA 2BWJA 1LLQA 1V5GA 1UEJA 3JQ9A 3KB1A 4DPMA 1KZ1A 3N8NA 3PIDA 3NBMA 4MMYB 4WBNB 1RRCA 1W5BA 2ZR9A 3PYLA 1SO8A 3F7MA 1RWNA 4X1OA 2ATCA 2Y1FA 2ZYTX 5CNJA 1HURA 4BQQA 2ZXFA 4JROA 3LWZA 4B45A 1SRRA 1T5LA 1ULUA 4R6XA 4S2UA 3RYFB 4DC9A 4I1UA 3U81A 1SOUA 3CY6A 1R6BX 1P7PA 3CJQA 3I8XA 1KQFA 3PUXA 4NXMB 4JU8A 5F9HA 5JXJA 1W36C 2IKSA 2P2CA 3GBSA 1E4OA 2OCXA 4Y6GB 2CVFA 3LLSA 1QRAA 3WK4A 3ZWDA 4KHPB 3ZZ1A 4II7A 4JVNA 5AOCA 1YA4A 3LT5A 4RACA 2GCOA 3C7DB 1Z2OX 3FYUA 2WD8A 1KEWA 4UAGA 4TMTA 4W9RA 1JQKA 1WJGA 3EDQA 4LV6A 1E20A 1O95A 2V97A 5AUNB 2FFHA 3MD9A 1O94C 1UXGA 4X1KB 5I45A 1V37A 5AH0A 2FSHA 2BJHA 3AWIA 3ANXA 1TKBA 2OK7A 2H4WA 4G85A 3EPHA 4MYHA 3EZ2A 3T7CA 4MQEB 3B38A 1XEFA 5LKRA 4TTJA 1Y98A 3JY6A 5C8YA 2RMKA 2XGMA 2P9ZA 3JWEA 1ZK4A 4NYMQ 2COUA 3T0GA 4HQ0A 1IHUA 4LKOA 1T1IA 2YVLA 4MV8A 4DYDA 3G7NA 3PYMA 1OA1A 4POAA 4AMYA 3GI1A 4WW0A 4Y2YA 3G2KA 4MR7B 4IOJA 4JV5B 1F0KA 1JDTA 1X1TA 3LL7A 4J03A 2EKLA 3H04A 4FQ5A 2WFLB 5ARDA 1DKRA 1FC0A 1L4UA 3Q8MA 2K2QB 3C2QA 3PL1A 2WSSD 4DLVA 1PLKA 4QOSA 5CITA 2HK6A 3WWCA 4M98A 1PZGA 3QMPA 3IVAA 5JDCC 2WM2A 5C8YF 1U1IA 2A9RA 4YMUA 2RAFA 2QD5A 5FNVB 2ZVPX 4BGDA 4GL2A 2WICA 1V9LA 1TTTA 4PCUA 4WN9B 1NV9A 3TO5A 1UBCA 4RU1A 2PUBA 4CE6A 3EGIA 5HDBB 2O8FB 1AKRA 4G9BA 4EHAA 2ECPA 4F2WA 5FOQA 5JO0A 1DBIA 2ATEA 4ZI3A 2Q99A 4CLOB 1O5OA 1EUZA 1T0UA 5K0GA 4LNUB 3EH2A 4CDMA 1KVTA 2VNAA 3AVTA 4KPEC 3F5MA 1VZ3A 3IEXA 2PLWA 4URWR 3RFTA 2XYQA 1SCNE 1Y8RA 3LC7O 2BLLA 2JCSA 1NPYA 3ZU5A 5EMKA 1P1RA 1HPLA 3QVGB 4O2RA 2XSZD 4HWKA 1ZRMA 4XFDA 4MUXA 1P0FA 3DQPA 1NKVA 4QASA 3S1AA 1XRNA 1XRSB 1RYHA 2OXCA 3B6ZA 4B4DA 2WU1A 5KOIA 1G7TA 2ZYIA 1PGQA 5F35A 2A86A 1YCFA 3HK2A 3T4UA 3UKJA 3E3LA 2EKPA 4RDHA 3VR5H 2B37A 1CNMA 5IU6A 3RHFA 4RPCA 3HTXA 4P31A 1BHSA 5F4BA 1ZZEA 3QFFA 4HMOA 3WLEA 3D7MA 3I3OA 2VUHB 2PKQO 4HFNA 1QGUB 4XGIA 1Z68A 5BYKA 3MWFA 3IQDB 3OZXA 4IDDA 4IVRA 2R5WA 1V6CA 2X5OA 3JD4A 3HB5X 2VF8A 1TJ5A 2JCVA 2QR2A 4PQFA 5GQSA 2JGDB 1NURA 5DT9A 1PNRA 3C3DA 3VAZA 3DD1A 1JFFB 2OGWA 2SHKA 1Z0AA 3F78A 5CYPA 5REQA 4D9KA 1YI0A 1DC8A 3I1IA 2Z3WA 4NYJQ 4HB4A 1P4HA 4MEBA 2BC9A 2ZDHA 5GJCA 3TKAA 4U4AA 3EPPA 3JX9A 3NB0A 4DCOA 2JH8A 4EYEA 1LRLA 2Y1WA 5H9WA 3QVOA 4DBZA 2B34A 2QPOA 3C6BA 3BEOA 3SFZA 5C8ZA 4QULA 4W5RA 2VPYA 2H3EA 3FX2A 1DTSA 2PK3A 3IAM1 1N2XA 4UZSA 1LSUA 3EPRA 4UU0A 2GILA 1LTKA 2IXDA 3I9LA 4LHXA 2H1IA 1EG7A 3LBYA 4L6CA 4QYXA 1WNFA 3R76A 1IXKA 5AKHA 4DG9A 3RSLA 3DT8A 3KCNA 2C78A 3IV7A 3AETB 3U3KA 2XKAA 5AIBA 2GBCA 4KR3A 5I4CA 1WSBA 1J8QA 4JC5A 1D6MA 1DRKA 1IJFA 3EULA 4FE7A 4RY0A 4ARBA 3CCBA 1KAHA 2QXYA 2XNDA 4P82A 4QYWA 1J8VA 3W5JA 1ZLXA 4K9KA 1RYYA 4YR7A 3B70A 1X7ZB 4RSHA 3T1TA 3YASA 1V3UA 1PT8A 2A9FA 3EXG1 1ODTC 4UXHA 3R3JA 5CD9A 2QGZA 2IQIA 6REQA 2GWHA 3QU9A 1IXRC 2XWJI 4BTLA 4BQFA 2EGHA 2YBEA 2B6HA 2YRXA 1TQ6A 4KC0A 5FPSA 4UHJA 4J6EA 4YRKA 2RC5A 4D8YA 5FBZA 3WE7A 3HU2A 4MW1A 1HKHA 1MGPA 1EQ2A 5IN5A 3HJUA 4TTSA 3IODA 5I8PA 4JLNA 2KYRA 1P0PA 1TZMA 2ZYSA 4GPEA 5TR9A 3GLIE 4LHZA 5FBLB 2JJ1D 2NZXA 5LYYA 5BRAA 2C4TA 1LTQA 4DR5B 4FVTA 3OO1A 1A9PA 5IUJC 1NNUA 1VJRA 4E1VA 2AOVA 1ZL0A 5E38A 1FVHA 4Z4GA 3QVVA 4H2DA 4LBYA 1W0JD 4LBWA 1VHLA 4HADA 4U6QA 3C4JA 4LGYA 2P68A 1BOOA 1EFRD 5BRJA 2D5CA 2BMAA 1DAPA 4Q16A 1V7CA 4MS3B 4E32A 2H9IA 4UUAA 3K8OE 3UJ9A 4BY9E 4GOJA 3WIEA 1Q77A 2QNBA 1M72A 3C7TA 2ZXUA 4QDUA 4AJ2A 1NBHA 4RTKA 4WA8A 2X8AA 1WUTA 4Y0VA 3OQ1A 1YJ8A 2BGIA 2GSWA 2H1RA 5F2KA 4FGUA 2X7XA 5GJWC 4CMIA 1Y8ZA 1ZGAA 2JGKA 2P6MA 2EG5A 4G8BA 1D2HA 1Z4PX 2PT7A 3TBHA 3F6RA 3UW1A 3DNPA 4LHEA 3PNPA 5GV8A 5C31A 4BZXA 4V1CB 1BROA 3LHSA 5IKEA 1EHCA 1P77A 3QTBA 4FHFA 5CFQA 2B8NA 4I5EA 4MYUA 3BRSA 4HRYA 4QYTA 1FYXA 1U81A 2Q0XA 4AQ7A 3L40A 1BS1A 1TZCA 3QEMA 4RPLA 3I76A 4B47A 4X1YB 4D45A 4GYKA 3B1VA 4XYGA 2VXYA 3RRFA 3TE7A 1EIWA 4Y8VA 2QXUA 2R8ZA 3KKKA 4KPFC 4ENVA 3VU0A 1X7WA 4MMZB 1BWSA 4QECA 1H94A 5IVPA 1UWVA 4C87A 2ZSBA 1USGA 5DYNA 3ANTA 5BV7A 2B7CA 4QDZA 3OFNA 2QW1A 3ZG6A 2YYAA 2FA9A 5FADA 2YZKA 5LQSA 4DOMA 5JNSA 1T1SA 1OH8A 1PUXA 3H2IA 2W2LD 2P8JA 3CRRA 1UDWA 1IBCA 4XGQA 4ZVNA 3QWIA 2I6UA 5JAQA 4C4PA 2OO7A 3JVUA 3A1FA 4FJ2A 4DLAA 2WAMA 4JL5A 4F5ZA 5KI6A 3U4DA 3DWEX 3FETA 4JP1A 1AIPA 2BEKA 4LGCA 3VVMA 4J0FA 4BFYA 1HDRA 4PV7A 4FC7A 1KO8A 1NVAA 4RHEA 1EFLA 2PGNA 1H2YA 1K5DA 1XTSA 3E9CA 3IELA 4BMYA 1D4OA 1NW3A 1TVEA 2O2ZA 3HWSA 1T13A 3N53A 3Q3VA 4B46A 4D9GA 5KHLB 1CNEA 4JBYA 1WB6A 3PD1A 4TL6A 2CYBA 1RU3A 3GR6A 4LWQA 1PVDA 4ML3A 2O14A 1NGSA 4V0MA 3R3SA 2BFAA 3OD5A 2X8LA 3D8BA 1HDGO 4RA6B 1B41A 2O2HA 3BBPA 1M2WA 5IDVA 3E0QA 1VYHA 5DU2A 1IHDA 1ZWLA 4Y9SA 4BLUA 5JCJD 1WXIA 4DA4A 2QJRA 2F4VB 2JAPA 3PNSA 3H3FA 2BFBB 4Y2TA 1IBRA 3A6HA 3PCTA 4YALA 3ZW9A 1OPXA 4DHWA 8ABPA 4Y2GA 1CUHA 5JSKA 1PRYA 2WWHA 1ENYA 2X1HA 4RE6A 1FK8A 3ZBPA 4M99A 1CIPA 5E0OA 5JC8A 3IMEA 3F3SA 4HFJA 1ACMA 1PJAA 1D07A 3BD6A 3IR5A 1S4QA 1GRCA 4J2OA 3NM4A 4J0GA 4PRKA 2BSXA 3DZKA 2YWGA 4WT7A 4XWYA 3R24A 2NSJA 3RRJA 1EP1B 3U4GA 5EHGA 4ARSA 2JW5A 3TZCA 4O4JA 1KJQA 4BLRA 1KPIA 1XZMA 1SOAA 4MA5A 4YRRA 2Z4TA 3GIDA 2H8GA 5KNDA 1U28C 3BFPA 3C24A 3KR9A 1WCIB 5SZKB 3W9UA 3DTYA 2V5VA 3K9GA 4YI3A 4L2IA 2FSUA 2IP4A 4BX0A 1Z3CA 2H16A 3ZGYA 5DM4A 2R87A 2Q5HA 1XTUA 5A3RA 4BO5A 1LS1A 3KL2A 3ZDDA 3GEMA 5F9MA 2MYTA 2GD6A 1ESZA 2NNLD 1UT5A 2D3TA 2XA9A 1NYTA 2A9OA 3C39A 4F1WA 1OWLA 3AYXB 1A5BB 3HR8A 5HW0A 4O25A 1U8UA 5KVCA 1G8GA 4CKXA 5EWJB 2WHXA 5KQSA 3L6EA 4QXRA 4EECA 5HF6A 1FMTA 1PU2A 4UDXX 1UBRS 1XZEA 4HZGA 1F8YA 1P72A 4MDYA 1JF8A 4S24A 1UCFA 3IBYA 1XZIA 3ASVA 3NJ8A 5TPZA 1PZHA 1S7GA 3NWJA 4ZARA 4IHJF 2OQRA 4XVUA 4H0CA 2NUPA 3TXXA 3WLSA 3KNZA 1QIGA 2GVDC 3PE3A 3R8CA 4MEAA 3BXPA 4P4LA 3SQDA 3WGYA 5EJ6A 3OBIA 3X2EA 4R84A 3VPSA 2VP6A 1KORA 5BORA 3CPEA 4NARA 2ZAOA 4Q4HB 2QRUA 1EVLA 2WIJA 3FPBA 1JBKA 4KXVA 1ODCA 2YW2A 1BWRA 3OF2A 5BQOA 4DR4B 2RGUA 2ZPUA 4X3CA 2NO4A 3EK2A 1KI4A 1XU4A 2VXOA 1H42A 5TC4A 2PMCA 3ESCA 5KYTA 2HPHA 3ETHA 1LNQA 5K3BA 3SFVA 1XMSA 1AE1A 1G4HA 3MMXA 1H5NA 4R2IA 3T9FA 3HG7A 3OC6A 4Z7OB 1D9ZA 2G40A 2P4QA 4BTVA 4BLTA 1WXXA 4WKBA 1U9IC 3PQ3A 2DEUA 2JAWA 2P65A 3IFSA 2B36A 4HRAA 1SUCA 1VSBA 2XMDA 2QT9A 2ZRLA 3NTXA 4RZQA 5H80A 3TINA 2WYUA 5B6JA 5JXHA 8ADHA 3BA1A 4GECA 1ORWA 1W0KA 5ALUA 4KLRA 4ZOEA 3IUMA 1FNCA 1WSAA 1GQSA 3IP9A 1ZGBA 5LQJA 1KAGA 3LDUA 2PU5A 2BGUA 5BSUA 4WZBB 2W2OA 3LDFA 1N92A 3F5QA 1T8TA 5JH7A 1S4MA 3W2HA 1HK7A 4NU6A 1ZDMA 1FUKA 5KYYA 2ORIA 2NTYC 3IH5A 3OHSX 4MQFA 5CXUA 4EA8A 2WDZA 1J06A 4ALLA 4Y1GA 4U0KA 1QRUA 1F1JA 5DCYA 1KPGA 1O4VA 4AS2A 1G55A 4HKTA 1L4GA 2CN1A 1PR9A 3VI4B 5JNVA 3A2LA 1BDJA 3HXLA 5AVZA 1ABFA 2WYWA 3VUFA 4UTVA 3BJMA 1SQ6A 4AG6A 3NYQA 1ESEA 3U3RA 1PYOA 3AEXA 3GZTB 1B6SA 1OU0A 1ULZA 3MMZA 2OT3B 2LCIA 3PS9A 3Q3EA 4FDLA 5JFTA 5TLSA 2G9UA 1C4KA 4IDBA 4URUR 3BD8A 5TB5A 3ROPA 5CYGA 1SOMA 1U2GA 2YFHA 1WSDA 5IVDA 3IAEA 4L22A 4TYMA 4TL7A 3CIFA 4IMPA 1N34B 5IJ0A 1P9WA 3F74A 1AZLA 1TFUA 4H7HA 4D9CA 1ES9A 2C4NA 2K4MA 3TMKA 2Y99A 4B3TB 1V1MB 4MI6A 4J75A 2CHEA 5BSKA 4X62B 4A8JB 1IY2A 2GF2A 1WVIA 3LQFA 3VBCA 5LL6P 1OIWA 2ZROA 2AN9A 4D3ZA 3BFVA 3U7QA 2NQ2C 4AO7A 5KYWB 3MB5A 1SXQA 4RVFA 4XA8A 1K9SA 4XLTA 2BEWA 3WIBA 1BKYA 2C3MA 1U0JA 3DLPX 3PSAA 3G8BA 3RSHA 4AP6A 1NI5A 2W2QA 3AY6A 4X6XA 3AR6A 3ZGOA 3VKWA 4B8WA 3B53X 3I9V6 4C3VA 5A5FA 4DIFA 2QTBA 2B1QA 1V9SA 4I55A 4QQFA 3E61A 3VMFA 4KNWA 3KEMA 2CLMB 3WJAA 1DTWA 1P4JA 3AKCA 3QEBZ 2YCBA 4JWKA 5ECWA 4H9GA 5SZIA 4H0NA 1DG9A 4O4LB 3N2KA 1Y3IA 5BMOA 5A4AA 5CCXA 1NVVQ 1YVEI 4DDTA 2VJQA 1GADO 4R6WA 1H1LB 1NE7A 1T3LA 4DLUA 1OYYA 4EZIA 4DA0A 1DG1G 1CPYA 3KFVA 3IPRA 3LZ6A 4XDGA 1IB6A 4ARCA 3G6WA 3DVSX 3HZOA 4C6RA 4MRMA 3AUYA 1E1QD 1QCCA 1XRQA 3PXXA 3RSFA 3T35A 3J81A 3LLVA 1XDWA 3L6DA 1CJVC 2GEUA 1NFFA 2RCNA 3M0EA 3G9TA 2DE0X 1DC3A 3E5RA 4HDKB 4RNCA 5H7XA 4A23A 4A8TA 1XK6A 3P27A 1T4GA 4EDFA 4RMJA 5DHTA 4R8RA 2C3UA 1JIXA 1NMZA 4E12A 2JGFA 3ZZMA 3CM0A 2BFFB 3DMDA 1RZUA 2R2AA 1V8ZA 4LYYA 3E9YA 5LNK6 2XJ9A 4GM4A 1ABBA 1HNWB 4F93B 1E0SA 1P18A 1FTNA 1SVNA 3NIWA 4D0GA 4GKKB 1V25A 4W9MC 1WLYA 3STTA 2C8KA 1R5OA 3BF7A 4AO6A 3ORYA 4IIGA 4MROA 1O4WA 3GYGA 4KIGA 3JD2A 2OBBA 3SZMA 1SZPA 3LVBA 2Q4TA 3IJPA 3JVEA 1G41A 3QY0A 4K3UA 1AG9A 5ITVA 1I2ZA 3TG8A 5K0FA 3MWYW 4ZT7A 1JWAB 4X94A 2XF2A 1UOEA 1CXZA 1CUFA 1HEUA 3U4MA 1PL8A 4MIYA 3NOQA 1XU7A 1QR6A 1EMDA 3SHOA 1TXGA 2AX4A 1XCLA 1YONA 1QHEA 1AUOA 2ZP1A 3OWHA 2HK7A 1YCHA 1HG0A 1U3WA 3HM9A 1W581 2YHIA 4OIMA 3BILA 2F8MA 5IZ4A 3GLGB 4KIUA 3UHOA 1ISGA 1SM4A 4QOJA 4O2LA 1SVIA 2POCA 1O94D 2V7WA 5JSFA 3H19A 1PX0A 4FR5A 1UBJS 4DDUA 3KSZO 3H6KA 1H0RA 3MJCA 5T67A 1YQGA 1LDBA 3IHKA 5I51A 3UENA 4P5EA 1E5LA 4WDQA 3V1TC 4D82A 5D85A 5LQRA 3DTVD 3AFNA 3QP9A 1TU0A 3OF5A 2QK4A 5DVZA 3HCPA 1KP9A 1ZVJA 1RYZA 3SYNA 1LJUA 3VOTA 3GVCA 3RVMA 3AI7A 4CT5A 5J2TF 3WYAA 2JI4A 1KEUA 2YYSA 2FSVA 2P5TB 1MHPA 2XTZA 1Y1KE 3CF2A 4ZXFA 1MD9A 2O3JA 5G1NA 1N2JA 1XVAA 1Q0RA 2QSYA 3QKSA 1J2EA 4KOAA 1V11B 4NV1A 3RRZA 2FRXA 5FL7A 4YRNA 1PEYA 5CYFA 3KB6A 4B44A 3L4JA 3OCYA 1JDPA 2FCRA 2X0EA 1K6XA 2ZSDA 5H9VA 3L1JA 3K70B 5JVDA 4IO1A 2W0MA 3GRKA 4NNOA 3B20A 4JB3A 4GL4A 4I1IA 5CFZA 2VZ9A 2HLPA 4L9WA 4J0HA 3VNBA 5A3QA 1PEAA 3ZNQA 3KC2A 1XR3A 2HO5A 1DS6A 2UYQA 3BWCA 3H7IA 1C1HA 4FDUA 4ZDKA 2GERA 2IVZA 4P4TA 1WUHS 1VE3A 2PRJA 3DJFA 4YPVA 1V5EA 3AHHA 4RO0A 3WTCA 3ZHUA 2VH1A 4L9AA 1DKMA 3C5EA 2EBUA 1D7AA 3KAJA 2C0PA 1OC2A 2AXNA 1FDIA 4PYNA 4NATA 4JA2A 2A5LA 3N76A 5GONB 1UP4A 1C9EA 1VCIA 2H1CA 3FLBA 1UXJA 4LRYA 4B85A 1LTHR 4CF4A 4UULA 1U7UA 2VXCA 4LDPA 2I8CA 3GRAA 2WIFA 3GLTA 2WTXA 1D5WA 3PNKA 1MIOB 4I4IA 1YZVA 3W5UA 1Z06A 2YRWA 4YCSA 3WJ2A 2JIDA 4AJPA 2EDAA 4O8CA 2C2OA 1J9GA 4J1TC 2B35A 2FW7A 5EKSA 4ZEWA 4BO9A 3UBMA 4F06A 3FH0A 4PFKA 1ORTA 4O4IB 4U1RA 5I9TA 1E2JA 1VC2A 5HEKA 1YF3A 1D4AA 4KDFA 5KKCA 3HXTA 1W4CA 4CRWB 5LZ4A 3DE6X 1UPBA 1FNBA 1SCKA 2FNAA 3HYRA 1YU9A 4ZVPA 1M2HA 3C3JA 4GXNA 2E89A 1ZXBA 1UT6A 2ZRFA 3PUVA 4OYRA 4CTOA 2HSZA 3R7FA 3PWTA 2FPXA 4PAMA 5EMJA 3FAZA 3ZJYA 1I6LA 3BSWA 3RJMA 1XMOB 5CBPA 3QITA 4QU9A 3R9XB 2CDAA 1U4SA 5A05A 1OU4A 2QMUA 4MW0A 1U8XX 2NAPA 4LMAA 1Y3BE 2AJCA 1X39A 3BXOA 3QPBA 4BGVA 1D2MA 5LQMA 4MW2A 4BC1A 1R64A 2H0AA 2WKPA 1FX0A 3OETA 3O3CA 1UM9B 4J3JA 5AP9A 2YOHA 3ERCA 4GUAA 4YXWD 7MHTA 5IEBA 4BGIA 1YJXA 2XCLA 3AW9A 1H5UA 4QUGA 5KOHB 2HLNA 2D5LA 3FOCA 3N86A 2QTGA 5H5JA 4UXIA 2IDKA 3EH1A 4NMWA 3PLNA 4WNAA 4ZTZB 1MB2A 1SCJA 1W9MA 2QAGA 4EARA 1SUAA 1W75A 5GAJA 4YC7A 4QKQA 1YQTA 3QE0A 4HB0A 3C3XA 1R9MA 3FRIA 3KSRA 4P36A 2Y68A 3KQVA 2FDXA 4Q5IA 3N2NA 3ZE6A 4BX9A 4IG9A 1TCUA 1M6EX 4PCLA 1OFIA 1U3CA 3EBLA 3AF6A 4NESA 1GOTA 2A58A 3AF5A 3EUAA 4LNAA 4OA5A 4Z9BA 1DQRA 2PG3A 4R2XA 4BLPA 3SC2A 3TRJA 3S8YA 4A2CA 3H86A 3TRHA 5CDFE 4ZTBA 1VKZA 1QAMA 5HBGA 2PQ2A 3AM4A 2JBHA 4MWCA 1AU9A 1OOEA 1ZUIA 4P4SB 1CX9B 3V55A 3TLXA 4BFZA 4BNGA 4YP1A 3BMCB 1EWYA 1NC1A 1NF8A 1X7ZA 3EC7A 1WUKS 2AJ8A 4IIJA 4QELA 2HJRA 1A8HA 2RHBA 1T2FA 1Q17A 1VPDA 2AJBA 4JELA 4KGXA 3UUFA 4E5PA 1RHKA 2Q1WA 3WRYA 1XX6A 5FX2A 1A9SA 4G0YA 1VHJA 2IUUA 1XALA 3P2IA 4DRXA 5CEJA 4L3WA 2LBPA 3DE2X 1NVFA 3C8MA 3FPLA 2IFTA 1IEXA 1ODIA 1XA3A 1GUYA 2A0WA 2XKJE 3FJYA 3NC4A 5HIJA 1WETA 4DA9A 5HUHA 1MNAA 1N2CE 1VPVA 1STOA 2XKBA 1PHRA 2N0SA 3GCZA 3HYNA 1DIAA 4YYEA 5T5QA 2A67A 2HKIA 3ZU4A 3M9LA 4D8VA 1DL5A 3IKVA 2IOQA 3D64A 1DUSA 4URYR 2BYTA 1HDCA 1TQ2A 2GM3A 5B1YA 1GVNB 5J1TB 2I6GA 1LDEA 4ZODA 4K5QA 2UV8A 3KIPA 3ZTWA 2YMQA 4JDPA 1BQ4A 4QHSA 3TG2A 1CSEE 5JAMA 2HRRA 5CX4A 2IIBA 4EOGA 2MYUA 4YDQA 4G1CA 2EZ4A 3BXEA 3GJ0A 5BWCA 1XTVA 2V3WA 1DNPA 1F2TB 3OQIA 3PWSA 2XB9A 3Q6IA 5CMLA 5BOSA 1ELOA 2WKRA 5THKA 4C0KA 3TFWA 3K0AA 3F67A 3CCCA 1DWPA 3ED5A 4GLLA 4NVRA 1NQOA 4INAA 2IYQA 3OZUA 5JD4A 2IYRA 3COWA 1UBLS 1TIBA 2KQUA 4ENWA 2QYSA 4MP3A 2WWGA 4MYTA 2ECKA 1GZUA 3X1ZA 3AY0A 3EAQA 4OQXA 5G0SA 4HDRA 3E0XA 3L9XA 1B74A 3HA7A 2CC2A 2HUPA 4K9PA 1PN3A 3TDMA 2CVHA 4DV3B 3B6EA 2OMEA 3MWDB 1XXLA 4XM2A 5FWDA 1V35A 4HLNA 4LXHA 3NHUA 1L7EA 1X0XA 2CNDA 3SVLA 1W7AA 1QAQA 4WZZA 5KKAA 2Q3JA 3DAGA 1O6FA 1K5HA 1MH1A 2UVPA 4FHDA 5C3UA 1R1DA 1QX3A 5JD6A 5JAZA 3VJRA 5HIIA 3OPYB 3UANA 3KKEA 2VJMB 2ZRIA 3JQEA 2X0FA 5DOVA 3UXYA 1JEJA 5LJLA 3AXSA 4UMEA 3EXIB 3Q7EA 9LDBA 4D0SA 1QP0A 3IP3A 1E2HA 1AK1A 2A4MA 4AWXA 2FAXA 2P69A 1M83A 5H4GA 4D9IA 2OM2A 5HCIA 3ZDXB 5AJXA 3UTDA 1Z15A 3VSCA 3D2BA 4Z1MD 3WNZA 3PDJA 4FYPA 3ST7A 2QLJA 4JT9A 1BMQA 2J6BA 2NVUA 2C83A 3FRJA 4FS3A 3CWCA 2GGSA 4O59O 2RGEA 4ND5A 1BMTA 3DUWA 4HWSA 4NH4A 4AZTA 2VPZA 4IO0A 3SEZA 3NCHA 4URVR 5BO5A 1C7EA 3WSWA 5DM0A 2ZU6A 1TMKA 4XWTA 2DWUA 4WI1A 4UPEA 1JHXA 4JJKA 2AXQA 1DC5A 5KDLA 4XQ9A 4Y6OA 3KLNA 4FEYA 4RK5A 1KEKA 3W6NA 4INZA 1K86A 3CLUC 1A71A 1ZUWA 1P1IA 2GXUA 2NT3A 3S5UA 1B8OA 1X14A 2WTAA 4WFKA 2PXXA 3N5CA 4RFSB 4UCXA 1NI4B 2Y1OA 2J5QA 2O9JA 3O84A 1F4LA 1PG5A 1IOWA 3KKPA 2IE0A 3HVHA 4HX9A 1L8AA 1W5TA 3PUYA 2F3RA 4X7BA 4JKIA 1VQ1A 1NV8A 1O5TA 1KETA 3EQ9A 4P0TA 2OD7A 4DSZA 5FTWA 1ZW1A 4HVCA 1T35A 1GYPA 1VIMA 4BNXA 1D4ZA 1IG0A 3CEJA 2ZZMA 4B74A 4NBUA 1PUIA 4UJ5A 3ZY4A 4XRRA 1LZLA 2Q5OA 4C1NA 4HTFB 2BM9A 5BMVB 2IOFK 1BW9A 3BX1A 1T4BA 1QP7A 1PSWA 1P9OA 4EI9A 1X1RA 4DRYA 1H5QA 2QJTA 4BXOA 1WTCA 3BKXA 3CUYA 4G07A 3OE7A 4IY1A 3V4FA 4E3ZA 3BTVA 2PH3A 4LRSB 3MCAA 2P5UA 421PA 1ZH6A 3D4IA 4XTCS 4MQ5A 5B37A 3TVTA 3TYXA 5H8WA 3A6PC 1SUEA 3FLAA 4ZMSA 1JI3A 2QBYA 5FV7A 3TW8A 3EG9A 1OR8A 2YV5A 3WQSB 2BUAA 1WCV1 2W6QA 1WP9A 1ESCA 3PC8A 3SK0A 3NWEA 3TQFA 3H0KA 4FBMA 4OL0A 2Y0BA 2OB1A 4LECA 3RKUA 1ODLA 5LA6A 1VB5A 1ORDA 1RWPA 2ON6A 2VG8A 4LYDA 4NFSA 2OHXA 3RROA 2R44A 4BNFA 5JISA 1G2PA 1C3LA 3ASUA 3U3XA 5D3KA 1B0UA 3GRPA 1RD4A 2CD7A 3K15A 2ETVA 3GQBA 3PRJA 3MW8A 4JI5B 4DLPA 5KDOA 2PUAA 4HUQA 1EFCA 1GAEO 4URHA 4WXYB 4FCTA 2XNDD 3GUZA 2F00A 1TZJA 2GZRA 3UFBA 5HJ2A 1Z26A 4LF4B 3PHLA 2BFDB 3BH7A 3OOWA 1F3LA 3TLMA 1TL7C 4MIOA 3HKBA 3WRWA 1NBEA 5LU8A 1NVVR 1UK6A 2NXEA 5I7WA 5C51B 2O3SA 2OO3A 4A03A 4DARA 5KJ1A 1JT9A 3OE4A 2D4AA 4NX2A 1JIQA 1ZU4A 3VR5A 1II8B 5BQXA 3HMKA 4ENUA 1KOGA 3EMKA 1SQ5A 4CQMD 3F97A 3E9MA 4RQUA 3IVCA 1SU6A 2Q6KA 2BBOA 2AFHE 2EGUA 4DMKA 1CF4A 1ZONA 4CM9A 4BECA 3U19A 3AR3A 4QGHA 3G8AA 2XQGA 3Q87B 4PYIA 1H05A 4HWTA 4ZO4A 3GRYA 2IS6A 2FG5A 3DSRA 1DSSG 3SEAA 1KWKA 2RHGB 1N32B 8ATCA 3GVHA 2CWDA 3MJ4A 3TPZA 3UAOA 5EHZA 2AHRA 4RL6A 4LQ4A 1LK0A 3AJ8A 2HC9A 5J58A 4TQAA 1A4IA 5JYCA 5F77A 1VE7A 3JQ7B 4G9EA 1QH9A 4UBNA 2Q5EA 4ZRDA 3QXSA 3D7RA 5HMMA 3VSBA 1NMEA 2CNWA 5BSTA 3EMBA 1QIEA 1PT9A 3UJHA 5J2TA 3STHA 2NO9A 2FMIA 5K20A 3LPNA 5KTNA 3C6ZA 3UMSA 2KPOA 3L8EA 2BTOA 3FRHA 4DR7B 1VI5A 3LCRA 4CGZA 4Q7KA 3RGWS 3DV0B 3OU6A 2X6RA 3EDCA 1NRIA 3B3GA 1NUPA 4BNDA 4B82A 5IFKA 4N39A 4H3SA 3KU4A 1YS7A 4H1TA 3P9XA 4F8EA 4A0HA 1UZNA 5JMOA 1BD3A 4RJTA 4ERNA 1KS2A 3B13B 3ZWKA 2FTKE 2PGOA 1O6CA 3PE4A 3O1JC 1UM9A 4JCCA 4Q3CA 3UF0A 10MHA 1E2UA 4FWBA 5DMHA 4OQZA 4LSMA 5T4BA 4HVLA 3EFHA 1G0OA 3KWLA 4CCSA 4LF9B 2WKWA 1MO2A 4OP3A 4RF4A 1YQXA 1ZJZA 3OZEA 1E9DA 4YRPA 3INRA 4NULA 2R8EA 3O2SB 3R7WB 4BQPA 2R1UA 4Z7NB 1NUUA 4DJEC 5G3ZA 3CNBA 5LB4A 2JHFA 4NNPA 3VTKA 4OVKA 1QGOA 1QTNA 1W30A 2C9BA 2HZBA 3B1WA 3GP3A 3MRSA 5EGSA 3MGAA 5L3ZA 3VSDA 4MCHA 3BMQA 4B2LA 3HXMA 4HGOA 3F6SA 1M2VA 3WHKA 2QL6A 3G0GA 4B5KA 3S81A 3WGVA 4D4IA 1ZGJA 1CUXA 5IJ0B 1WMFA 3NRJA 3JVDA 4L7VA 4QDTA 4ZQBA 3R40A 2BI4A 1JPNA 1VJDA 1KO4A 1MH9A 1XDZA 4QBHA 2WVAA 4WDRA 5E4YA 4MVJM 3U44A 1N1GA 3ZCXA 1I5OA 5ETJA 3U4HA 1L7RA 2E82A 3VH1A 3WRXA 4DIOA 1G2OA 4W8HA 2ZIXA 5DYIA 2A5GA 1EU1A 4WKNA 4UM9D 2F59A 2O7RA 2PKQP 3GGDA 1CY1A 3SC4A 4US2R 3FKQA 1K3FA 1ZCZA 3TLAA 4DAOA 3LFTA 1N5IA 1VCMA 2EFEB 2JJ8A 4S3MA 1G9SA 2QSZA 4EA7A 3PUWA 5A62A 3IP1A 5A9TA 3MT8A 3GUHA 2FF7A 2I34A 3CONA 5COBA 1ILEA 2VP2A 1DB3A 3LCVB 1A8IA 1RXIA 3RQSA 1KAMA 1PJBA 3VKFA 2W8BB 4BMXA 4JEUA 2RH4A 1BA2A 5FUYA 2OVFA 3TMAA 2DVMA 1JEYA 1QB7A 2W00A 3CO5A 2QT0A 5JV5A 5ALSA 3KT3A 4P9NA 3G79A 2GEBA 1D6SA 5PNTA 4H4DA 1G9XA 2GCGA 2PBZA 3H2ZA 3A3PA 3QEAZ 1K75A 1US8B 3HADA 1I24A 4YXFA 3JW8A 3UJ6A 2ZI3A 4RJIA 3QFHA 3GA7A 3TD6A 4TL9A 2Q3EA 3NHBA 1EP3B 1I7LA 4R51A 3SBOA 5A5EA 4OD0A 3EPJA 2D5AA 1T36B 2ZR0A 2D74A 1T9GR 2MMCA 2JRCA 4IRXA 5EGNA 6CHYA 3L7CA 4BLQA 2HSJA 4RDIA 5AICA 1WKCA 4WESB 4Q4HA 2PKXA 1I33A 4MZXA 1E5VA 1C2YA 4P93A 4RXTA 5JS1A 2WTBA 4RZ3A 3A9SA 4BEJA 2EX1A 2R6ZA 3DZDA 3HCRA 2E4ZA 5FL7D 1LWOA 3U3JA 4YLGA 4TV9A 3AHJA 1AZSC 2ZRAA 2IH5A 4XUDA 1KQPA 4HNRA 3OX4A 1KC1A 1QG6A 5AW7A 1PK8A 1Y5MA 4TYNA 1SPBS 3CZAA 5DTQA 3G1WA 2DKNA 1A1SA 3T7DA 3JPYA 3T54A 4RULA 4HY3A 4R8KA 2HJGA 2FK7A 1BXZA 3OFND 4OGFA 5TE9A 3RODA 1A2QA 5JS7A 1ZAYA 4I9GA 2WWXA 1QG0A 3P4YA 4WY8A 3OX3A 3JSXA 4W6ZA 1SN7A 4N6NA 5PGMA 2JAOA 1EDZA 3RVOA 1P2BA 2DZDA 1F6WA 3OIYA 4CU5A 4Q12A 2A3NA 5FTMA 2PH5A 4D6PA 4F4HA 5JH7F 4IXWA 3W2GA 5JI2E 4TTRA 4FDVA 1Y4SA 1T6BY 3QK7A 2GJSA 2ZXEA 3DBHA 5AVJA 3REGA 1EXVA 4F8YA 4Z0PA 4B4KA 2GK4A 3UUWA 3RUCA 1X1SA 2ANCA 1Q74A 2XCTB 1EK0A 2VJAA 1X1AA 3PQEA 4WHMA 4HNTA 3DGFC 4GE3A 4HLCA 3SX2A 1L5YA 4BVAA 1R3DA 5HKBA 4DDWA 1WWKA 2CVPA 4RY8A 3TB4A 3G9ZA 2FRDC 1M34B 1UPTA 4H77A 4KZPA 4NBSA 2EDCA 2HHAA 1FP1D 1L9KA 3IP8A 3JARB 4FX5A 1OAOC 1ZUNA 4Y2VA 3RJ9A 1GT91 3QU2A 2Z30A 4JUBA 1NW9B 1RWMA 4WCFA 4IH1A 4A3SA 2BIFA 5EIFA 4H7JA 4LW8A 4DIEA 1R10A 3URKA 4B3JA 2XXBA 4RDCA 4RHCA 4I5FA 1U3TA 2ZB8A 1BU5A 2VTEA 3TFQA 4O4HF 2OOSA 3RKSA 1LPMA 1K7SN 2B30A 3ELBA 5DP2A 1KJ9A 4TSRA 4WINA 3EA5A 1NBMA 2WQ7A 2NGRA 1NT2A 1E9FA 3M70A 2WEKA 2QX9A 3ZHRA 5I9BA 4ZMBA 3QF7A 3HKDA 3D3WA 2V6FA 2P6NA 2WJAA 4IHJA 3QW4B 4RKFA 2X0RA 4NOKA 1D1PA 3KYJB 3RWOA 1BDHA 4X97A 3KR0A 3QLJA 4IDFA 3WLQA 3AKEA 2R8XA 4BLOA 1NPTO 2QQGA 1MP0A 1QLJA 3EVZA 3S55A 1AMNA 1JDZA 4Q19A 1G7CA 1D7OA 1V3QE 3ELWA 4XVCA 4JBIA 4OXYA 1Y4AE 1KZ6A 2JJ1A 3NTUA 4RQTA 4ZT5A 3VNAA 3VYSB 1OWPA 4MWBA 3ZE7A 1P4GA 3GJQA 4B3XA 2XDQA 1KZ9A 2O48X 4GGOA 1YNSA 3FI0A 4RD6A 4TLDA 4KK3A 4EQ6B 4PLWA 4GR9A 4PHCA 2QENA 3ZHOA 4EP1A 1HT2E 3FSGD 4LS3A 3GRRA 2XVMA 3AB3A 2PKWA 4MVXA 4PNPA 3LPDA 3WB1A 4IS3A 4E33A 1XVVA 2J85A 2WZDA 4X9XA 4B7UA 2W6NA 2R1VA 4K6GA 4AS3A 2ASEA 1TVMA 4ZU3A 3TXAA 4XD2A 1WM1A 3X44A 4DMHA 1UKYA 3VR3A 2PS0A 3MXTA 1WVGA 2B2CA 4BNUA 4DB4A 1PR3A 3W0LB 4BN5A 5I3CA 3JD3A 1NT4A 3CLRD 2VKTA 4MYDA 5KKNB 3BC1A 4IJUA 3SCZA 1H2WA 1OLXB 2UZIR 3W5AA 5IBQA 5EOVA 1NQ5A 4F12A 3K71B 1P1CA 5JMPA 3A7DA 1RKVA 2H65A 2O3RA 3VX4A 3GUUA 2VA9A 2Y1XA 3BZUA 1ICIA 1SU7A 2Z9BA 3I53A 2D0OB 1SKYE 2HDOA 2VSOA 3EGDB 3G2IA 3R74A 4YRZA 1JBEA 1QCDA 3IP6A 4GLJA 1T5SA 3SQOA 2ZYGA 1KI3A 5C1IA 3ROQA 5HQ3A 1J5EB 3AKDA 2GBLC 4Q3KA 2GM4A 1T9GS 3CEPB 3DKKA 3RG2A 2AMJA 4EKYA 3ETGA 2PDAA 4HDOB 1RAGA 4PWZA 3ITEA 1VM6A 2BEJA 2ENWA 5IZCA 1N25A 1Z83A 1DQZA 1KI7A 1DKLA 1R00A 1W59A 2I8AA 2IRWA 1GZVA 1AC5A 1O7JA 2FEPA 2XUIA 2PLFA 1XZJA 3AEQB 3NDIA 4RC9A 4B4WA 3HJCA 1EFDN 5TQ0A 2HBRA 5ALYA 5F2EA 1MB0A 1B76A 4TV9B 1VLVA 4ZVVA 3WMGA 3MOGA 4C7KA 1Y63A 1JSCA 2A78A 2I67A 1BYUA 3ZEAA 4CF6A 1K68A 4UJ3A 4YP7A 2W2KB 1GGEA 3AILA 3A9WA 2OO5A 3K1TA 4FYIA 1QCYA 4Q4AB 1N2SA 3S27A 3WWYA 2X0JA 1GU7A 4EJ6A 2OV3A 3D0RA 1V2GA 2ASVA 3GBVA 3Q11A 4JLSA 9LDTA 4ROSA 4IMJB 3SHQA 4EVSA 5J23A 2W2KA 1P60A 1NJ2A 3ZZUA 1VPTA 4KGDA 4KN5A 1TW2A 3MTAA 3HO1A 3I9MA 4H35A 3PT5A 5EIOA 1Y5NA 1WQ3A 2P2DA 3STXA 4DFDA 3LCCA 3KOYA 5ALTA 1EB9A 1QS0B 2QM0A 3QVTA 4JXJA 3I5UA 4WZAB 5KIAA 3H8SA 2QJOA 2Q1XA 3H0CA 3F6EX 4JGIA 4GPAA 3TSCA 5A4MS 1BCSB 1MB9A 3KTAA 1MAVA 2A5JA 3H6HA 3TSZA 1Z07A 1CHDA 3KOUA 4ZU6X 5LN1A 3P9CA 1B6RA 1BIFA 1RVV1 2JCGA 2RH9B 3NOOA 4DLKA 4DKJA 5IANA 4ZV9A 1E4VA 3HUFA 3QU4A 3NLLA 2RHJA 3V7YA 4FS8A 1HTBA 3AM5A 2YQ4A 4J9VA 1NXOA 2XNSA 5I7HA 3M34A 4YRFA 2BFCA 4AIRA 1PDVA 4PZ0A 5CU7A 4UVDA 3GXBA 2I3AA 1VMIA 5KYXB 2VSXA 3OQNA 2R5NA 4IHKA 4RANA 4CCYB 3H83A 5HIKA 4TWJA 2RFLA 4L3VA 1GQYA 3AONB 3K0FB 1WZCA 5J4YA 2HEIA 2O8DB 4AROA 4LHYA 4JLOA 3RS0A 2AEMA 2MYNA 3RIGA 5BN4A 2ZUDA 3LCMA 5JJKA 4E0BA 3PC4A 4WN3A 2ZBEA 4FFBA 2YS7A 3NI2A 2PO7A 3T15A 1S01A 1N5OX 2C7RA 4JI2B 4G23A 3W06A 2QVBA 1LI7A 3D3EA 4ILEA 5FXMA 1AZTA 2IYUA 1JR3A 1HNXB 3K6SA 3U4AA 5DGIA 3A10A 4R40A 4HWPA 1PHPA 2X9LA 1WMBA 2BCEA 4KO3S 1OLSA 2DFTA 3C15C 3OHMA 3G5MA 3OUTA 5ALNA 1R5NA 3QV1A 5H02A 4LZPA 3BMQB 3H9BA 2DPHA 1XGKA 2WJ3A 4QTYA 1ONBA 1KO7A 2L2QA 3LNCA 3MGBA 4GWLA 3CX7A 5CH3A 4IUBS 2OBFA 5AKIA 4DMUB 4KXNA 1JE1A 1QE3A 1UMCA 1KI6B 1FLAA 1RRMA 1MVOA 1DIOB 3WKCA 4E2YA 3EUFA 4HDMB 1Z5VA 1TX4B 3NT2A 5JNUA 1P73A 4J7CA 3PJRA 4MUFA 1H65A 2VNSA 3M89A 1NVXQ 4GO1A 1DVRA 4YQEA 2RH5A 2J30A 1M1NB 3ETDA 1UFVA 2H2AA 2JJYA 5DHPA 2R79A 5I7OA 1CBUA 3D8NA 1WLSA 3BL5A 1OROA 2P6OA 2DH5A 3E9NA 3LYHA 4HXGA 4AJOA 1S0UA 4RD0A 5D7BA 3RRYA 5DFAA 2R00C 2F1HA 4M8IA 4MRRA 3DXXA 4KJXA 3WV4A 5KTKA 3HV2A 3I23A 5T57A 1OB5A 3R44A 1AJEA 2NMVA 1RMTA 1YZGA 1WZNA 3RNLA 4EW6A 3S2EA 2V7EA 1HO3A 2C3YA 1NXWA 4TYPA 3NEJA 2UVDA 2FMKA 1VDMA 3S1SA 2G09A 2WRZA 2JFQA 5JD5A 3PXBA 1TW3A 5FR1A 1E0DA 2A9QA 2BBSA 3K31A 4WXRA 1HI9A 3OEHA 4J91A 4JYMA 4XD7A 1GTZA 1HT1E 5ESWA 2R8RA 1AKWA 3O4VA 3RTAA 1XNGA 5J2UF 5DN6D 5G41A 1L7VC 3BG5A 2J3EA 1XXHE 2H52A 3KOOA 3PITA 3GAFA 1E5XA 4KACA 2KJQA 4O3FA 3WQRA 2ATXA 4D4LA 1R18A 3P4XA 1VA5A 2XCRB 5I5EA 1OHHA 1S7CA 4UFOA 2GEVA 4MHSA 4X92A 3TTUA 1QV6A 4JCOA 2JA2A 4KQWA 4NAVA 2GI4A 2Q4OA 2XQIA 4G0MA 1U4NA 2NZYA 5IJ9B 4W9NA 5BXYA 3DE0X 2O20A 2OK8A 5KCMA 1T25A 1QR2A 3VH2A 4LSZA 4Y9TA 3CR8A 1NBOA 4N41A 3DHWC 1FFBA 3ZR4B 1XJCA 2O8EB 3I2YX 3HB9A 1JIIA 4HDSA 1TLTA 3KZVA 5BR7A 1ORVA 2Z8XA 5EQTA 1RWWA 1ARZA 3PICA 2GBFA 4FZ3A 4QGFA 4A8PA 5HS4A 1PJRA 1X1DA 2UYGA 2SKEA 2VUIB 3FBTA 3O3OB 2M98A 3PEFA 3GEEA 1E2EA 3ROKA 3SR4A 4BNHA 4D6XA 2ZBGA 3V2UA 3CUEF 1H9AA 2FHSA 4QIHA 3O93A 1YZTA 1TKRA 1YKSA 1WPGA 4OLHA 1GZ5A 1NMQA 3U48A 4DLBA 4HNUA 1CZNA 4FLFA 5IKOA 2BM0A 4JYBA 5JJCA 4F2GA 4B6QA 1L5MA 2CCKA 5EP3A 4EYGA 4N0MA 3AESA 3V7WA 5TIIA 2VOJA 2QVGA 2G3YA 1PG2A 1ECBA 1FFCA 2HMSA 2XTAA 1A98A 3HSSA 1W34A 3IBGA 3KYDA 4GPIB 2R6HA 1UPUA 4CEHB 1VL8A 3AZOA 1JG3A 5J5AA 3WR5A 3CFYA 4NU8X 1UC4B 1R74A 4I1SA 1YUMA 4XEUA 2ZYVX 4XFKA 1C30B 3DG9A 3LLCA 1AGYA 1JSLA 5K99A 3EXHB 1DXHA 2G4VA 2C3OA 4PEVA 2OWDA 4UAUA 2EW8A 1YRAA 4XYBA 5JZSA 1X15A 4BS9A 1H2HA 2Q49A 1I7NA 5ALFA 3SYTA 4C4RA 1K63A 2CFCA 1BOFA 3A36A 2VVTA 2CUZA 1CQXA 1V6SA 3GGCA 3OAAA 4XOIA 1J7JA 2W8BA 2Q5JA 3ZEIA 1S3FA 1TJNA 4ZT3A 1ZX1A 1UBKS 4M1EA 1ZI8A 4BV9A 5CM2Z 1YSCA 1ZO8A 2PRKA 4M7RA 4BO0A 4JLMA 1MFZA 2IT1A 5D5HA 3ZY5A 2V6IA 1NI3A 4OGGA 4CG3A 1MZPA 2Z4RA 2UYHA 1NYQA 2XB6A 3JQPA 3ELDA 2WUDA 2HXSA 3C7AA 1Q2UA 1K1EA 4L74A 1NU6A 5DW3A 5A9SB 4F92B 5CLFA 4P7KA 1FFDA 1MTOA 3IJRA 4JOQA 1IXSB 3SF8A 4EJMA 5HOEA 1RYEA 2YVKA 1TE2A 2QUJA 1RI2A 1V5IA 2XUZA 4DWJA 4ARIA 2B3DA 1KEEB 2AOUB 1UJBA 1YS2X 2PM8A 1ODFA 1UWLA 2PMEA 2ODNA 4RJJA 2H08A 5M34A 4RM2A 5LZ7A 3ZHVA 3WAJA 4OX9Y 2GO7A 2ZT8A 1LDGA 4IS2A 2N1BA 3GLIA 4FOLA 4QPPA 3O4IA 4HYEA 2WU3A 1SEVA 4G0OA 2ANBA 2WU0A 3L1UA 1DZ3A 2X77A 1RPNA 4TUYF 3L7JA 3ZE9A 3TX2A 4D3XA 5EA2A 1OW3B 2N9UA 5DNDA 3SOZA 3L5KA 3WP1B 4FMPA 4ZJYA 2VHQA 3KQWA 3Q2KA 4JVOA 4L8LA 4X64B 2H1SA 2IXEA 4B7CA 2CJWB 2B78A 5K3FB 4YJ2F 3UXHA 4BJ3A 5DASA 2XB8A 3OEHD 5EJIA 4LXIA 3OOEA 3KDPA 3N28A 4JHXA 3SJAA 5AMXA 4M8NE 2R96A 2BZGA 1N8SA 2ZSFA 1XMXA 3DYVA 4Q18A 1OD6A 4PGGA 4A0GA 2IUSA 2V54A 3C14C 3MMNA 3EY9A 4C78A 3ANYB 3FYDA 2BV3A 4YAEA 1J0BA 3UAYA 2XUQA 3JQCA 5B7GA