3RODA

Methyltransferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
259
Chain Sequence
b'SGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide N-methyltransferase
publication title Structural basis of substrate recognition in human nicotinamide N-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.1: Nicotinamide N-methyltransferase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3rodA00
5K0JA 3GU3A 1WY7A 2CL5A 2KW5A 4R05A 4E2WA 3FPEA 4RTKA 3LCCA 4LWPA 5EIFA 3PFGA 3V97A 1RI2A 3SVZA 4AX8A 1RI3A 1XTPA 3QV2A 5F2OA 1XVAA 4GEKA 4X61A 1NV8A 2WK1A 2NP7A 5EC8A 1RI5A 4HH4A 3GRVA 4AZTA 4P7JA 2G70A 2H00A 3LKZA 4HSGA 4PYIA 4RX1A 4LG1A 3R24A 3GJYA 4G56A 4DZRA 3DXZA 3EGVA 10MHA 4YV0A 1VE3A 3HVKA 1PJZA 4C03A 3ER8A 1RJGA 1JSZA 4CKEA 3CVOA 3TKYA 2HTEA 5E1DA 1NW3A 3CBGA 1JSXA 1HMYA 2PXXA 3LPMA 3GRZA 5EKXA 3S68A 4XUCA 1XDUA 2IH5A 3PTAA 3T0IA 1O9GA 2QE6A 3KR1A 4FT2A 4DCMA 4WXHA 3TOSA 4X1OA 5F2NA 5K8VA 3KHKA 4X63A 1JQEA 1AQJA 3FTFA 1F38A 3I64A 2PVCA 5DM0A 2OBFA 3A7DA 4KDCA 4FR0A 2ZCJA 2PLWA 4IKPA 3OCJA 3OU2A 4ATNA 2AVDA 4HTFA 5F2KA 1SKMA 4QTUB 5DRTA 3BUSA 2C7RA 2UZ4A 5EPEA 4PYOA 1EAMA 5HIKA 1F3LA 3IEIA 9MHTA 2R3SA 1Z3CA 2PT6A 4GOND 5CCXA 1O9HA 4RTOA 2O07A 2YVLA 2PXAA 5DM4A 5E9JA 3M6UA 5DX0A 3HCEA 3HVHA 1X19A 2V74B 2GPYA 3NDJA 5CVEA 4KIFA 1NW6A 3G89A 2BR4A 3THSA 5ICGA 3HA3A 2OB1A 5DT2A 4QPPA 5EZQA 2AN3A 3KR2A 1G8SA 5FA5A 4PYQA 1RI1A 2AR0A 2AOWA 3E05A 4P58A 2PX4A 4DA4A 5DLYA 1KYZA 2XBMA 4HGYA 2OZVA 4UOEA 2VDUE 4OA8A 4PYLA 4ER3A 2PV0A 4GQBA 4LWOA 3TR6A 3F4KA 1IM8A 2ZBQA 5LQNA 5DRYA 2NNWB 3VYWA 5FWAA 3LKDA 4F84A 2C7QA 1FPQA 5E9QA 3ME5A 2GAFA 2LD4A 3M6XA 1JG2A 5EMJA 4U7PB 2JHCA 3UZUA 2JHPA 4OQEA 5EEHA 3P9IA 2ZFUA 4CTJA 3ORHA 3DXXA 4L7VA 4C06A 2QRVB 1G8AA 2K4MA 5DTQA 3UA4A 1JQ3A 2PBFA 3MTEA 4GOOD 4CKCA 3TKAA 2B25A 1JR4A 3DOUA 4E32A 1G38A 1QYRA 5D1NA 5EKUA 2P3LA 3BGDA 3MERA 4QQKA 2YR0A 4KVZA 2AOUB 1NV9A 2B3TA 3BWCA 3CJRA 3QOWA 3T7SA 3G2MA 4B17A 4H0NA 7MHTA 4M38A 4RTMA 1VBFA 3UJDA 3GGDA 4EK9A 3M6WA 3V8VA 1IXKA 3DMHA 1L3IA 1AQIA 4Y2HA 3NDIA 3G2QA 4KDRA 4HG2A 4P7GA 2PWYA 1YFJA 2IH4A 4M7RA 4IV0A 2NP6A 3DR5A 5FUBA 2ZWAA 3THRA 3VC1A 3CCFA 1KPHA 3B3GA 3EEYA 1X1BA 3K6RA 1VQ1A 3KQMA 4QDKA 4QTTB 3TFWA 4RTSA 2ESRA 4PWYA 3KPUA 4V0RA 1L1EA 4AZWA 2O05A 5K0FA 2PT9A 1ZG3A 1L9KA 2AOXA 4FS8A 1DL5A 4FSXA 2PX5A 3LBFA 3OZTA 3R0QA 1N7JA 1T43A 4ZTBA 4POOA 5BXYA 3P9CA 5K0EA 2OKCA 4BLWA 4RWZA 1YZ3A 5CD1A 2ZULA 3LBYA 3RW9A 2I7CA 1MHTA 2P1DA 4C4AA 3BKWA 5B1SA 3ELYA 2UYOA 1NBIA 3P9NA 3I53A 4OQDA 2UYCA 5M5BA 3DXYA 5E9WA 5JR3A 1X1DA 5ICFA 1JTFA 5K0CA 2O57A 1NW5A 2ZZKA 2AS0A 2FHPA 2V7EA 3TQSA 4K6MA 3VC2A 2FCAA 3OFKA 1WS6A 2O06A 3EVCA 4OBWA 5E8RA 5G02A 3HVIA 3TM4A 4IV8A 1ZGAA 1R8YA 3QOXA 3A27A 2OXTA 3AWIA 5K0GA 4E2YA 3T7RA 4DQ0A 5IKMA 5LQAA 3HVJA 3JWGA 5DX1A 1UIRA 3P97A 4QVGA 1YFLA 1ZGJA 3GRUA 1KHHA 2I6GA 5CUQA 4PIMA 1N2XA 2XYRA 3BKXA 3LL7A 5JUWA 1KIAA 4MIKA 2P40A 1V39A 3M6VA 2GA9A 1Y8CA 4PYKA 2EFJA 3KR9A 4GC9A 4C05A 4CTKA 1MJFA 1XDZA 4X60A 3RIEA 3MGGA 1TPYA 2EJUA 1VP9A 4XUEA 1Q0SA 1EJ0A 4BP3A 3NJRA 3FRIA 1QANA 2P3OA 3OU6A 4ISCA 5FQOA 1SQFA 2ZLBA 2DPMA 3A7EA 4YUXA 1KXZA 3I58A 1L3BA 3U81A 2I62A 1PRYA 1ZQ9A 2PX8A 3FPFA 3EVFA 3LX6A 4RVFA 5BP7A 3NVKI 3KR0A 4Y30A 4OA5A 3JWIA 4CKBA 1JG3A 2GB4A 3KKZA 5EOVA 1I9GA 4YUYA 3SSMA 2AOTB 4NECA 5ICCA 4PONA 5CIYA 3ELDA 3O7WA 2PXCA 3B5IA 2IBTA 1KR5A 5EHGA 4LECA 3B3FA 1G6Q1 1OR8A 5EEGA 3EVEA 3DH0A 3T7TA 3P9KA 2Y1WA 3KPWA 1YUBA 3HTXA 1VIDA 2Y1XA 3A25A 4PCAA 2QY6A 5KS2A 5KYGA 3EVGA 3HCAA 2QRVA 3GRYA 4YUZA 3P2EA 3R3HA 5C9ZA 3KQYA 5GOZA 4E33A 3UA3A 2DULA 1R18A 1TW3A 3CJTA 3MCZA 3UFBA 1QAQA 3C3YA 1FBNA 3G5LA 1RI4A 4QDJA 2NXCA 2G1PA 3NVMB 1KP9A 1D2HA 2AOUA 5E2AA 5E1BA 5LSAA 5EMLA 5FWDA 2NXJA 1XCJA 1R00A 3KQTA 1I4WA 4AUKA 2IFTA 4PCLA 3LDUA 2UYHA 1BC5A 2ONYA 5LQRA 4M36A 3TLJA 2ZVJA 3G8BA 2ZZNA 3SX0A 3CJQA 5DX8A 5IH3A 2YTZA 4V0QA 2CMHA 3LDGA 3ERCA 2G8NA 2HNKA 3KU1A 5K09A 5DSXA 2IDJA 2G71A 1M6YA 3AXSA 3LHDA 2FPOA 3OZSA 1AF7A 3KPYA 4FSDA 5CVDA 3M4XA 4BY9E 1INLA 1X1CA 3GO4A 2XYQA 5EG5A 4XUDA 1QZZA 3FUTA 1QAOA 3EVDA 1FP2A 1M6EX 3Q87B 3LCUA 1H1DA 3HP7A 2P8JA 2XVAA 4PYMA 5GM2A 5GP1A 5KQSA 2CKDA 5GINE 3LSTA 1WG8A 2ONZA 1NW8A 2ZIEA 3BWMA 3OU7A 5FCDA 1BOOA 3OPNA 3SGLA 3SSOA 4FGZA 2YX1A 3FRHA 4RTNA 3BZBA 2GS9A 2AN5A 3O4FA 3G7UA 3ER9A 3MAGA 3A4TA 2IH2A 1P1BA 2VP3A 3PB3A 2HV9A 3SM3A 3PS9A 5LQKA 3CC8A 4R6WA 4RTLA 5LR6A 2FK8A 1KPIA 4BLUA 5T67A 5K0NA 3GIWA 4YUVA 5KQRA 4MHTA 4X41A 2EX4A 3GNLA 4CXMA 2NXEA 1FP1D 5GM1A 3UJCA 2O0LA 5DXJA 5GIOE 2C7OA 4RV9A 3NWEA 2XYVA 3E7PA 2WA2A 2AOVA 2ZSUA 3MCTA 2BR5A 3EVBA 4KWCA 4WVLA 1EJ6A 3EGIA 4EKGA 4KW7A 2P7HA 4OX9Y 3IYLW 1P39A 1G60A 4CWAA 1JG1A 3P2IA 5EIWA 1SG9A 1JG4A 2YXDA 3FPGA 3FUUA 3KQPA 4GF5A 4RYLA 5DSTA 5BW4A 2JH8A 1DCTA 3MHTA 3EPPA 2Z6QA 1SQGA 2IPXA 3G2OA 4U7TB 1VL5A 2NXNA 3PFHA 2YXEA 4OBXA 4PYNA 4A6DA 1NT2A 3IHTA 2YXLA 1WZNA 4YV1A 3DP7A 2XVMA 2AOTA 3AY0A 2CWWA 5T64A 5DM2A 2OB2A 4ER6A 2I9KA 2GLUA 4YMGA 3R6TA 5EGSA 1TW2A 3FYDA 3DLCA 3IV6A 2R6ZA 2ORED 3HNRA 5E1OA 4GOLD 4EMSA 3HCFA 3UWPA 3X0DA 3G88A 4FZVA 2FK7A 4C04A 3FTCA 5HIIA 3EGEA 3P71T 5FADA 3H2BA 2P3QA 4RVDA 4QPNA 3OE5A 3DUWA 3KQQA 3UJ7A 1KYWA 3LDFA 4DMGA 1NKVA 1N7IA 3BT7A 4R8SA 3KQVA 1M0EA 2IIPA 3FUWA 3ID6C 2Z6AA 4KIGA 3E23A 4FP9A 4QVKA 4F86A 3PVCA 4DCGA 4ER0A 1ORIA 2P7IA 2EG5A 3CGGA 4E2ZA 2AN4A 4JXJA 3TRKA 3DMFA 8MHTA 3EVAA 3KQSA 3PT9A 3HA7A 2BH2A 1NBHA 4F85A 4E30A 3K0BA 1YZHA 2BR3A 1Q0TA 5MHTA 2HMYB 3FZGA 5CVVA 1QAMA 5P8WA 3UJBA 2IBSA 3CKKA 4HGZA 3HCDA 3EMDA 3GRRA 4GUAA 5HZMA 3AJDA 2ZBRA 3RODA 3VSEA 4HRAA 5HIJA 2P41A 4MWZA 4O29A 1HNNA 5CVUA 5ICEA 5DM1A 1R6AA 2PY6A 1P1CA 2BM8A 2BM9A 3AXTA 3D2LA 3G8AA 3HM2A 3PX3A 4P7FA 4EQZA 1ORHA 3GXOA 3R9XB 5DPMA 5GIPE 1R74A 3G2PA 1EG2A 1RJFA 2EJTA 3HCBA 1NW7A 1UFKA 3DMGA 2VS1A 4Z2YA 4BLVA 1D2CA 5E1MA 3M70A 3NW9A 3Q7EA 4RSRA 1O54A 3P8ZA 2C7PA 2OPBA 5E8JA 3JWJA 3NMUF 3HCCA 2QYOA 2OY0A 4PYJA 5T6BA 3B3JA 2YUIA 4R8RA 5EMMA 5H02A 5C1IA 2PKWA 4P7KA 2CMGA 3SMQA 1D2GA 3BWBA 3DTNA 3MB5A 5CVJA 3TM5A 4YMHA 1B42A 2YQZA 2ZIFA 5EZSA 2H1RA 2FYTA 1XJ5A 3B89A 5KVAA 2AVNA 3DLIA 3MQ2A 1EIZA 3KQOA 4RVHA 3BGVA 5DTRA 5DTMA 3L8DA 3TPZA 3PLAE 5EHIA 2ERCA 5HIMA 1WXWA 3FUVA 1U2ZA 3BGIA 2ZTHA 2HWKA 3KPVA 4MQ4A 2B78A 5FULA 1SUIA 2Z6UA 1BKYA 4C08A 4RTJA 1FJXA 2OO3A 2E5WA 3UJ8A 4YUWA 3WSTA 1JQDA 2WA1A 3KPJA 3LECA 3OZRA 5EMKA 3PX2A 3UJ6A 4ER7A 2VZ9A 3JWHA 3HEMA 4BP1A 4GOMD 2P35A 4PIPA 2IDKA 3UJ9A 4AZVA 5LQCA 1KPGA 1YB2A 5HFJA 2PX2A 2B9EA 2GH1A 4HTFB 5FA8A 3SR4A 5CM2Z 1L3CA 2VDWA 5BW5A 3C0KA 5E2BA 3TMAA 3ANXA 4A6EA 1SVUA 2JHAA 3C6KA 5GWXA 3MTIA 5K0LA 4RTRA 1BHJA 3HA5A 5D1HA 4XCXA 2PWPA 3GDHA 3BWYA 1P91A 3G5TA 3SXJA 5LQJA 3LGAA 2JJQA 1AV6A 1I1NA 5FQNA 4RTQA 3OE4A 1X1AA 1ZKDA 2ZIGA 2PGXA 2ZW9A 5EQJB 2N47A 3I5UA 4M37A 1YF3A 2F8LA 1NE2A 4AZSA 4PGHA 2PJDA 3REOA 4DM3A 3O31A 2A14A 2G72A 4E70A 2BZGA 4EKIA 4DKJA 3EEOA 4QQNA 3E8SA 3ELWA 1XDSA 1WXXA 2Q41A 2QM3A 5FHQA 3SSNA 3B7PA 1VPTA 5CCBA 2ZZMA 1EQAA 3NWBA 3FYCA 4RVGA 1RJDA 1VP3A 5C0OE 3EVZA 4GC5A 3DULA 2JG3A 5K03A 4MTLA 1RJEA 4DF3A 3FTEA 5K0BA 3A26A 5DXAA 4C07A 1ZHFA 2AZTA 4EVIA 3BXOA 2ADMA 2H11A 3P2KA 3LCVB 1SUSA 3FUXA 4RTPA 5HEKA 4E2XA 5ERGB 3FPJA 3UBTA 4PGGA 2ZBPA 2OYRA 5K01A 2FRXA 3UJAA 4IWNA 2IGTA 2B2CA 2UYQA 4GBED 3C6MA 5U4XA 1UWVA 3M33A 5HILA 3EMBA 3C3PA 5FHRA 5K05A 2PSSA 5DWQA 1R8XA 4HC4A 5LQUA 4KRGA 4FT4A 4ER5A 4YV2A 4PINA 3KQWA 2HR1A 3FPHA 4PNEA 1JTEA 3FTDA 1DUSA 1IY9A 2VDVE 3I9FA 4R6XA 1VLMA 2NYUA 5HOQA 1XCLA 1XXLA 1G55A 2IP2A 2ZWVA 5FTWA 5EVJA 4E31A 3GWZA 3NTVA 3GCZA 2JH9A 3ELUA 3OFJA
chains in the Genus database with same CATH superfamily
2V6BA 2FHSA 3TVTA 2ID7A 1ZBQA 4E2WA 4K7JA 1E1CA 4ZMSA 2X5XA 3V97A 1Y6JA 2IXFA 4H18A 1OUMA 3QE2A 2QX4A 1EP1B 1QQ7A 5EZYF 1UOEA 4F11A 2Q5CA 1QIFA 1CLUA 1NUAA 4M0UA 1ZIXA 1ENPA 2XUKA 3PDUA 2YJTD 4P7JA 4M1QA 3P20A 4DEXA 3LY9A 1RPTA 1ZH0A 3UKJA 1TT7A 4IY1A 4J7CA 2VBIA 3DXZA 1DJLA 5KJCA 4YV0A 3OPQA 4OLJA 1TZCA 1QP4A 1AGPA 2YWEA 1NXWA 2HI0A 2NZ8A 2FN4A 1FQOA 1ZRNA 4HDKB 5E1DA 1M7BA 4OHZA 3CBGA 4D3YA 5C37A 4ZD6A 2C0CA 2IOFA 1Q7BA 1Q12A 4K6OA 2W93A 4REQA 2PUBA 1PQYA 1ACLA 3QRWA 3T0IA 4DCMA 4ZYVA 1LB1B 1PKEA 5B2EA 1BVUA 2JD2A 3B70A 1IZ8A 1B0AA 3UT6A 2WD7B 1IBKB 4KDCA 3NHSA 4A6PA 1HDZA 1PNQA 3S27A 1KAHA 3VJLA 5EQTA 4B45A 1T8TA 2J6IA 3ST7A 4E5KA 5DFAA 5EPEA 5CJJA 4KCGA 5IBCA 3ACCA 5JBNA 3LLUA 5H3CA 2HWXA 4V0SA 1O9HA 5CFOA 4PQFA 4S2EA 1MEEA 2AN1A 5DB4A 1G1MA 2PXAA 4JN6B 5F77A 3R8CA 3PSAA 4WINA 1EBBA 1FNSA 2BF7A 2QYTA 5CLGA 3ZQUA 3EX7C 1I6MA 3VUEA 4RIFA 3RSOA 2AQIA 3SKVA 5KWVA 5L51A 1YKFA 4QJBA 4L4UA 1JLSA 1DC7A 3QFTA 1TAUA 3J81A 2ZYGA 3RYFA 2ZUUA 3MWEA 3GLGB 4UTXA 5KJ1A 4KU4A 4EY7A 4GX0A 3ROPA 5GAJA 1GIAA 3IBTA 4UXIA 2XBMA 1M3SA 2XQGA 1NJ8A 4KK3A 5JC1A 4QU8A 3TR6A 2GTHA 2QLJA 1ZK2A 3F4KA 3NJ4A 5B3AA 4BAUA 4TQGA 1AM4D 2IHJA 1KP2A 1VIAA 3DD1A 3NHUA 4FKMA 3RBXA 1Z38A 4DDWA 4ZMRA 3AEUA 3ESRA 3H2HA 3M6XA 1JG2A 4RUKA 2JHPA 3ILSA 1E1MA 3W8DA 3KOYA 4MUXA 2C4UA 1E2FA 1K0FA 3OJOA 3HPQA 2V9ZA 3A9CA 5L9AA 4TUYF 1NVXQ 3FB4A 1QWSA 1SXJE 3L6OO 3PZBA 4GOOD 3SHVA 1HYEA 4F72A 1THGA 2C9ZA 1UZLA 1E1YA 2P9YA 4Y6PA 5TGZA 4BZXA 1UAYA 5KNCA 3IE1A 4W8GA 5EKUA 3AI2A 3QUTA 4CKEA 1YR2A 3BCRA 5G1PA 3OHSX 3AVPA 3QBEA 4JLMA 1JHRA 2WWIA 2XE7A 2DR0A 3RTAA 4EK9A 1U0HC 2ZJ3A 3OUZA 4TWJA 4KVGA 3V8VA 3F5FA 4OMDA 1CJCA 3NANA 4P7GA 4Y9UA 3PC6A 3B5JA 4IV0A 1ORVA 4OQZA 3VO9A 2WJZB 4JI5B 3U4MA 2EP8A 4OKSA 5TE9A 1VI6A 3GFSA 3UPTA 1D7OA 1E2JA 3U9TA 4TVSA 3FOZA 2O05A 5FD8A 1G21E 1FTGA 3SS8A 2HCRA 4CZ2A 3L0PA 3H04A 5I51A 5FUWA 1U8EA 2MSNA 4KIJA 2WJPA 3VPFA 5FUMA 1U9IA 2G9ZA 2O2XA 3X1KA 1PZXA 3WSWA 2ISSD 4B3HA 3LZ6A 4MGIR 4GE0A 3LOQA 5JEEA 1P31A 2LXNA 3COYA 2OO7A 3UWMA 4MW9A 4JGIA 4WCFB 1AS2A 2WF9A 4LXTA 2G4CA 5JZVA 4LNAA 3TQSA 4EI7A 2NSJA 5AVQA 2W6ZA 3BHIA 1MBZA 3EXG1 3LS2A 1E61A 4B8YA 4IUCS 4K81B 4DHWA 1J2EA 2E6KA 4L9RA 4Z3OA 4JUIA 4BE9A 1XVTA 2ZCVA 4ZZ2A 4DPMA 5GADl 5ECDA 3BMNB 2XDQB 4KVFA 4FDLA 4C30A 3WKEA 2HQOA 5FUQA 1KWGA 1YFLA 4FB5A 5JUWA 1D07A 4D0GA 2JIOA 3EMVA 4YRGA 3TJRA 2FZWA 1HH4A 2O9JA 2JEZA 1DO2A 2QMEA 4FBGA 4XUEA 2A5LA 3IVXA 1POWA 5I9LA 3K0HA 4YREA 3B1WA 3SPXA 4YWJA 5L6LB 3PHIA 2XMGA 2ZLBA 3I4FA 1W75A 4CG3A 4GDFA 4IVPA 4IJ5A 4ZQEA 4B82A 3AVWA 3CZRA 4P0QB 1NXPA 1DBPA 2ZRDA 2G40A 3OE7D 3UCEA 1QO7A 2GN4A 4HAYA 2NU9A 3V4LA 3ZY4A 4L8LA 3C7KA 2O7QA 2P0EA 4YNBA 4I3FA 4EFNA 4NBTA 1RLOA 4UARA 1Z0SA 4BB9A 4PONA 1TCVA 1UM9B 4AC9A 4B44A 4R8VA 3V34A 4XPIB 3DLPX 1E2GA 1WD5A 1J0EA 1PHPA 3FBWA 4E1VA 1JL3A 3L92A 1EA5A 4A1OA 4KGVA 3HYLA 5DIFA 2LPMA 4LXGA 4LY0A 3W06A 1UQRA 1VGQA 1XTSA 3R0JA 5AKIA 1A8SA 3WICA 4IIUA 3HDGA 4RMNA 2D1QA 4TRMA 2AWOA 3RJTA 3WP1B 3RADC 1J33A 1YULA 1WVMA 2WAOA 1HEIA 1PGNA 1I14A 3GDGA 4INOA 4ZA2A 1MJHA 5FLYA 5LPNA 4DR6B 1KJJA 5BSGA 7MDHA 2BRUA 4LHVA 4IZ6A 4S1WA 1KI9A 4WN9B 1YI0A 3VOBA 3UFBA 3TQRA 1C4OA 2O2DA 2C42A 1WXQA 3VO2A 3LY8A 2V7QD 1SIBE 1YE8A 2I2DA 2YV1A 2ZSHA 2AR9A 4QWWA 2PRKA 1YV9A 3QWHA 3WNQA 1Z5UA 4MRSA 5SICE 3ZIUA 3G17A 4P7BA 3RD5A 3ZQ4A 3AOEC 5FOUA 4BMSA 2VL7A 1PV2A 4CMKA 3HFGA 3ETJA 4HWKA 2EAUA 5TARA 3U40A 2C29D 4I4TA 2J7PA 4JQYA 3PL1A 4DMFA 4EHIA 3FDJA 1SQ0A 2GBIA 5C34B 1E1LA 1PR9A 1HYGA 3V4FA 5HRAA 4PO8A 2K2WA 2PRJA 2V7PA 3TNYA 5D3MA 4GOJA 4M1EA 2IUFA 4UE3S 1SKYB 2IS6A 4TYNA 4BNYA 4OAPA 4R1NA 4F4FA 4ZK2A 5KIAA 3HBNA 2RH4A 3F6BX 5B3LA 4BZZA 2PS0A 4TZ6A 4K87A 4A4DA 2G71A 3AXSA 5JBIA 4KE7A 1IJBA 3RANA 3VNRA 4Z6KA 2DPGA 1GDTA 3HCWA 2WC1A 3P94A 3STYA 1DC4A 2BDTA 3NRCA 4GX2A 4TM7A 5J2TF 4CPDA 1QAOA 4H6VA 3Q87B 4ZODA 5JMOA 4EVRA 3MSXA 3TQFA 4EG3A 2XWBF 3E3NA 1T9ZA 2GS9A 2PQ2A 3G7UA 4R2IA 3TW4A 1KQPA 1PG0A 2JFPA 5M34A 1Z15A 4E14A 1T5TA 4QFMA 3UGTA 3E9QA 4QJIA 4IV5A 3GIWA 3FCCA 1XI2A 2E87A 2EWMA 1WUTA 1KVTA 3OOJA 1U2DA 1EFHA 1D2EA 1K6XA 4IMIB 3T9EA 1ZRSA 3GA0A 2FP4B 3EY9A 4GXNA 4V0MA 5KKNB 2O0LA 3PK0A 4EHLA 1SVSA 2ZTSA 2IIQA 3F4BA 3L1UA 4LDNA 1LBSA 3MJHA 4X8LA 3IAFA 3RSQA 4EW3A 3O3OB 2EZ4A 4JC0A 1VCMA 2XH8A 4D9FA 3DQPA 3B20A 4IR7A 1USUA 3AIOA 1PJRA 2NSHA 3BSYA 4Q4AA 1II8A 4MUYA 2H5JA 2NAPA 1T5IA 2PL9A 3B85A 4MLZA 3ADDA 2GNOA 2WTUA 1RABA 3K2IA 3OIUA 3IHWA 2XMBA 3DT6A 2GBFA 4I5IA 5BW4A 5BR8B 1P9OA 3JCZA 4QDXA 3IDSA 3VZDA 3RRJA 1A0OA 1NY5A 4D3DA 2ECKA 4RSMA 2IV3A 3GVIA 2XGGA 4TTTS 3ORYA 1AHHA 4LKOA 4CVNA 3HYTA 2IZ6A 1NXTA 2GWHA 4ER6A 2GLUA 3BRCA 1TMKA 1Z33A 4RBNA 1K4MA 1V3UA 2IYVA 2OM2A 3AGQA 4I1SA 2X9QA 4WEQA 1EVJA 2IBTA 1IEWA 1I1QB 3WOVA 3DMRA 3N59A 2HIHA 4R7ZA 4X20B 3V2HA 1XCPA 4HQNA 3CVUA 1ZLXA 5HIIA 3GRCA 4XGRA 1QDEA 2FPIA 3H2BA 1R9NA 2DSNA 2NUTB 3KS9A 3DUWA 4G4GA 5HA5A 3TLKA 1CEYA 1S3IA 4IIYA 4QREA 1Z6YA 5KTYA 5JTTA 1DINA 4HFJA 3EIQA 2WJIA 5TSDA 2XMPA 2VJMA 3K4QA 4D81A 3G0OA 4XGIA 4F86A 2HSJA 4OEHA 1Q7EA 1ORIA 2MDTA 1STOA 4LOJA 3K20A 2VDPB 2HHCA 4XSGA 1ODKA 3Q85A 5EKTA 3C4JA 2D3TA 3ELBA 1HYBA 3NT5A 4BNWA 2IX3A 3DBRB 5GVRA 1QRSA 1P0CA 621PA 1NBHA 1AMNA 3U4QB 1W1WA 2OXEA 4C6TA 4XI9A 2AR7A 1EVEA 5IC6A 1X2EA 5G0SA 3ROMA 4IG4A 3GRRA 4HAIA 5DNYB 3B5EA 2G25A 2JGIA 4JBNA 5FPSA 3DE0X 2WMYA 4Q9HA 5BN3A 4P92A 4L5CA 4KRXA 1ABFA 2ZRAA 3DB2A 5AVVA 1EM8B 3HRKA 3FKJA 4ZYTA 1P1CA 4URZR 3JSAA 4FFSA 3I30X 3ED1A 4WLFA 1P2FA 1R74A 1MGPA 1EG2A 1ADYA 2QL7A 3N6VA 1UFKA 2C4WA 2GEKA 3F2IA 1MV5A 4HEHA 3MT7A 3PCXA 2DQYA 4WCVA 1DOAA 2WWTA 1VKOA 1IONA 1UF9A 3A1WA 4MGYR 1G3RA 1N8TA 4FCCA 3UAZA 2XV1A 4RC9A 2F00A 3JWJA 2IQ5A 5LZ4A 4R3NA 4O3FA 2JB9A 4MS4B 2Y71A 3ONWA 4YRLA 3LK7A 3M6LA 2X42A 3RNLA 3KOWA 3LHKA 2FYTA 2HMUA 3ZKWB 4ALIA 4HAVA 4QBHA 3FIUA 1NULA 2WF7A 5ALMA 3ZVLA 5ITZB 3DJYA 4C3ZA 5HGXA 3UMGA 2XZTA 4MYTA 1D2MA 1PSWA 3E22B 1USWA 1MPTA 3NFYA 3LF2A 4YQEA 2I6SA 2JLRA 1JGTA 5D51S 2EDCA 3UJ6A 2OQIA 3ZHYA 4YCSA 1Y5IA 2D1SA 3QJ5A 3REGA 3LUJA 4S0ZA 4Z1MD 1JDSA 1K66A 4MUEA 5TMPA 3SR4A 4ND8A 1VB3A 3RSSA 4HAXA 3EXFB 4WH0A 4KN9S 3X2FA 1C81A 1PEKE 2WTEA 5T5QA 3TTXA 1WPRA 2XBLA 1DOHA 3KXPA 1I7LA 2I34A 3GPLA 5J9FA 5A9SB 2JAOA 3BWYA 3E7WA 1Q14A 3FDZA 4CKXA 1DEOA 4UAJA 3V4PB 1N92A 5L3SA 1MO2A 2AZ4A 3KUCA 1O95A 2PGLA 3QP9A 4OUDB 4B79A 5JW6A 4C14A 2O8BA 5KSPA 3ZLVA 2X9LA 3I5UA 4XM2A 4B48A 2IUEA 5FPKA 1Z0AA 3DDSA 4D7AA 4Y2JA 4UJ3A 3OE7A 4AKTA 5FTJA 5KOHA 3GZJA 5AHKA 4I4TF 1YDEA 1UWKA 3OCVA 4Q4JA 3DBLA 2ALJA 3DBHB 4H27A 3TR5A 4C20A 2FDXA 2HMVA 1BN6A 2PUFA 4LVCA 2H3EA 3RFVA 1FNNA 3WY9A 4BNTA 4GEGA 4NYMQ 2E3JA 3IPAA 4OD0A 4W5RA 1RM5A 1J09A 4XWKA 3HFSA 2NSDA 3C24A 1PJCA 1FP4B 4LMRA 4NSNA 1DAIA 5YASA 2V54A 1B0PA 4E2XA 2RARA 4V24A 3INTA 4U3JA 2DFPA 5AP9A 4RQBA 4N54A 2QM0A 2FX2A 5AOVA 3VNBA 4KP7A 4QARA 4DIDA 2UV8A 3OQIA 4GUDA 5DWQA 3SDSA 1Q6YA 2QZ9A 2V7QA 3ZD9A 2SECE 4G0PA 4LOLA 4RFLA 4HGRA 3TI9A 4BS9A 1H85A 2WTNA 4R6XA 1P80A 3BAFA 3F5MA 4E12A 4Y2PA 2H1OA 3F7OA 1NA5A 1KJWA 2O0KA 3ZI4A 2WHXA 3GP8A 4YH1A 4PSVA 3GU3A 1WY7A 4BVKA 4HDNA 1CQXA 1ZAKA 4OLAA 1GDDA 2XA9A 2AD5A 5FOTA 3NTQA 2ON6A 1AQLA 3H2ZA 3HZOA 1IXZA 5L40A 1BMQA 2OSVA 4FDVA 4MHOA 1ATZA 4D26A 3IAS1 1NVWQ 3NPMA 1KJIA 1HOTA 3AUFA 3ODPA 1D4AA 1GA6A 1UJ4A 2CDBA 3HJRA 5E4TA 4KWIA 1XYVA 3FWYA 4W63A 2C57A 3OCCA 4N65A 4C03A 4X6YA 2H54A 2VJPA 3RBZA 4EG8A 1A77A 4DQXA 1ZJWA 4KE9A 4CMGA 3H2JA 1CUGA 2RGRA 2QP3A 5EIBC 1HMYA 5FFFA 4EYOA 4DJ5X 2VUUA 1VYHA 2Z5VA 5ESWA 4O0LA 4ZCMA 2I9PA 4QEZA 1J1IA 3THXB 1HT3A 1TXGA 1E3EA 2DHCA 2EHDA 2WMOB 2YWHA 3FMFA 3WMWA 3DKRA 1VBKA 3WK6A 2OBFA 1TKRA 4GNKA 1M72A 3DEKA 4UC0A 1RKVA 5JSHA 4AS1A 2AHOA 3N2KA 2ZAYA 1V41E 3PI7A 5LP1A 2UZ4A 1NQTA 4PYOA 1EAMA 4MMXB 2JGEA 3IBCA 3ROZA 4BNGA 4JXZA 5CFPA 3ZVNA 4KAAA 3V4RA 4Y2XA 4DPKA 5CEEA 1OXXK 1SXQA 2O07A 5J63A 4MQLA 5FOSA 3D6HA 2DHRA 1EFLA 2DJIA 2BFFB 3T5BA 3V1UA 4A0FA 4A10A 4GVXA 2PBRA 1NP3A 3ROXA 4I36A 2JBAB 3KFVA 1HG0A 3OIYA 1PYGA 1CULC 4HQRA 3DWFA 2Y93A 3FLBA 4HVTA 3KR2A 5EPUA 1Z4OA 4NKRA 1ZITA 3CWZA 4KAXA 2KE5A 5TXGA 1Z0KA 3IOYA 4H60A 1V5IA 4E6PA 4OA8A 3K1AA 4BQNA 2M6RA 2OAEA 2X8JB 4EG4A 4F71A 1PQ4A 3HZZA 2A58A 1EG7A 1E7MA 3T5GA 4Z4IA 3K6SA 2WIJA 3C3WA 3SXUA 2C7QA 2VWQA 2PVSA 2TMKA 1G20B 2ZXEA 2W9XA 3ME5A 4FTWA 4CM9D 2QZZA 1JA0A 5H80A 1EUDA 4M89A 5J5AA 4GS5A 5BV0A 4N03A 3LRPA 1VRWA 4EL5A 3CLRC 1C1YA 1HE3A 2WFLB 4I50A 1P1JA 4IMJB 1LY1A 1UBHS 4NENA 1JEQB 2ZTUA 3MTEA 4PLCA 4HBZA 4J6FA 1ZI8A 1L9XA 5G4LA 1R15A 3FYHA 1V8PA 3TKAA 2B25A 3OZVA 4PPGA 1TZ2A 3BC1A 1ZEMA 1D6SA 3CMCO 4N5HX 3FOFC 4WGGA 3WGHA 4GP6A 3S2IA 1QIJA 3A6HA 4BQQA 3VVCA 5F23A 4LWQA 4ONEA 2V7BA 2G63A 1Q84A 2AOUB 2B3TA 2IYYA 2W6CX 3BWCA 1QGUB 2BY4A 3B2QA 3FKSD 4YP6A 1G19A 1Y7IA 1Y9DA 3NM4A 4RFSB 3VBEA 4S05A 1QHSA 4MP6A 5AK3A 1TZJA 3I39X 2PMDA 1CR4A 1I2AA 3SHFA 5JAPA 2LWIA 4G1BA 4A82A 3O1JC 3O8QB 4PG4A 5C8YB 3K5WA 5HKKD 4HV4A 1SGWA 3N07A 3CCFA 1PR0A 2DBRA 3GJ4A 3K6RA 4GI5A 1JDJA 2F8MA 3LC2O 1X7XB 3GFFA 2DUWA 4FSXA 1KTIA 2UUCB 1J21A 3INNA 4JLPA 1CNMA 5K0EA 5BXYA 1EP2B 3L77A 3NNDA 4AX4A 4E3ZA 1A98A 3EVTA 5DNCA 3H9EO 3V4ZA 2ZULA 2RAPA 4TLLB 2WSIA 1LRJA 3DW1X 1JFRA 5DH9A 3H3JA 3F0TA 3QELA 4MB0A 1MN6A 1K8XB 3GI1A 1KMCA 5LKRA 4M8NE 3ADCA 3Q7TA 5LP6A 5IXJA 4JQCA 1O7JA 3KJFA 4E2FA 4GI7A 5F4ZA 4U4AA 1YNOA 4G0VA 1ZNWA 1I10A 2CSUA 3VC2A 1W87A 4PIVA 3J7AC 3JAKB 1WS6A 2O06A 3EVCA 3BL5A 1E3TA 1XQ6A 3DE5X 2ACKA 1GY8A 3IUMA 5A0FA 3WYCA 1ZGAA 1R8YA 3RHTA 4PLZA 2X0DA 2QT1A 3V9AA 4OXXA 2FPPA 1V1RB 5BOVA 3RLIA 2J85A 3ZWWA 4EF6A 2HEGA 4OFWA 2XX3A 1QTQA 4N1AA 1VPDA 1XJ0A 4WECA 1L5MA 1IZYA 1P1KA 3M1YA 3TEJA 3TQCA 3EBPA 1EP9A 2DLNA 1MJFA 1R4MB 1Z06A 3DYIA 4L16A 1NN3A 4QEDA 2R4QA 1MR3F 2ZSFA 3E7DA 3CZAA 2CLMB 1I4OA 3TQQA 1BIFA 4HVCA 1Q1NA 4Z1MA 1QMPA 4EEKA 2WQZA 1IN7A 4YRMA 3OO0A 1HT1E 2CUKA 2ZOSA 3FLMA 2O7NA 3K6KA 3SSAA 1UMDB 5IMBA 3BILA 2IV2X 2GRAA 1GQ2A 1XZCA 3O95A 1DJOA 4C0SA 4Q3BA 4CKBA 2WUEA 4ZPXA 4UEWA 2EQAA 2VPYA 3GUCA 4IZHA 1AV7A 1MQAA 3ZOKA 1IY8A 3GK3A 4B75A 5CIYA 3D3WA 4IZOA 3U7EB 2BUBA 4PTZA 1RAIA 3ADPA 3OIWA 3T61A 3COVA 2WWRA 1HEYA 3CLHA 4MYSA 3ZCUA 1E5DA 1NUSA 3FSEA 1LW7A 1TTTA 3GLIA 2P6OA 4EJ2A 2QT9A 4UQLA 3ZE0B 2OVBA 1W93A 1Y9JA 1NZJA 1QC5B 1Z5OA 3P9KA 4I1RA 4ZVQA 3VAAA 2R2GA 4ZQIA 5KKAA 4IMPA 1Q0QA 4AUEA 1BHO1 2DMRA 4DAEA 4YUZA 1NX9A 5EHZA 1EI9A 3AETA 3VR6D 2F55A 2Q1SA 3KJNA 2EQBA 3UANA 5DHFA 4MQBA 3BERA 4HB0A 1KJZA 2W4MA 1AGNA 4G1UC 5EFZA 3NWJA 1SC3A 1QAQA 2H31A 2P65A 4EYKA 2PJUA 3F49S 4N0MA 4MKGA 4L15A 2KWIA 4P33A 1Q50A 4YALA 3VRHA 3HLKA 1FVOA 5U9CA 1W2GA 3AR6A 5EMLA 2G0AA 4HDMB 3K0FB 1QYCA 3WGIA 2EBHX 2O7SA 1GTMA 2QAGA 3EG9B 5JU6A 1J5PA 2J8ZA 5DYGA 1S7GA 1FSGA 2QG6A 1JLLA 2QL5A 3LDUA 3UG6A 5IM5A 4L85A 4S04A 1AG9A 1E5VA 1NRJB 1I3OA 2ZI9A 3QWFA 3ND7A 4FIZA 3LO5A 2B30A 4AMGA 4B5KA 2R48A 1IB0A 2O52A 3E58A 1YQXA 2A86A 2FZLA 1CQIB 2IOQA 2Z5LA 4JT9A 5HBRA 3SX0A 5EE1A 4DMHA 1ODFA 5BSFA 3B1KA 3PL5A 5K6TA 4XFKA 5DSXA 1KI7A 4Z4HA 4JBHA 2MYPA 3VV2A 2Q49A 1TU4A 5KMGB 3KTAB 1DDIA 3E9RA 5K8UA 3B1YA 1RU3A 1WKVA 3GUHA 1O87A 2NADA 1Z8DA 1QLJA 1ZL2A 1JWLA 3GFTA 3LCUA 2JIDA 2PMKA 1LJUA 3GGOA 3HP7A 2A1TS 5GINE 1E7RA 3QUQA 4HF7A 2X2OA 3B6KA 5EIEA 2ZR9A 3G0GA 1G2QA 2Q5EA 4QDZA 4RTNA 2H18A 4QSMA 4G01B 3FR7A 2B4RO 3IXMA 3HO1A 1MW9X 1W88B 3C8DA 5D8DA 4B6FA 4RMJA 4JXKA 4NPAA 1QVZA 2F1OA 3VOAA 5C18A 3ZZTA 4OB7A 4DNFA 1LZKA 3GQVA 2O19A 1YD7A 5BWMA 2O3UA 3QWBA 3PIRA 3DLBA 4CEJA 2Q3LA 4JBIA 1Q3TA 5A3QA 2F59A 1CJKC 5F76A 1AQNA 1GN9A 4PCVA 3IQHX 1VSVA 1C0IA 3KUUA 2Q3JA 1LTKA 3EFBA 4HBGA 4JVSB 3MCTA 3FF4A 3MTGA 5FOXA 3AGPA 3FAZA 3UUWA 4IYJA 3IT2A 3Q9LA 1GTVA 2BT4A 5BV2P 3GBSA 3GG2A 1R0LA 4MITA 1TZMA 3KVYA 4MYUA 5LP6F 3M82A 3VR6H 4D8YA 2P6NA 4I50F 3UOAB 4HEA1 2SKEA 3RFFA 2ZRJA 3NHKA 5E0KB 1H93A 1M7GA 1QFXA 2V98A 4NEGA 2IYUA 1H5QA 2YXLA 3LLSA 1CY0A 3JZAA 2J3QA 3HEAA 3TZCA 4C22A 2OB2A 5BSRA 2X2PA 1CP2A 4Z0TA 1W9HA 1Z62A 3KOMA 4NG4A 4WKPA 2YJNA 3F8WA 4XJXA 1KEZA 1L5HB 4DMUB 1AB5A 1ZN2A 3KJIA 1QNFA 3UH0A 1TW2A 5DIZA 2ZTLA 1PZGA 4BVAA 4JLUA 1NJ6A 4BKPA 1OH7A 3C6ZA 3GP3A 2ZE7A 4RCYA 1MZPA 5BSUA 1CJUC 1IEQA 3GLGE 1BDHA 2YW9A 2PX3A 4LZWA 4QT4A 3L7IA 1E4EA 1LNZA 4AB1A 3WGQA 3AZOA 2C61A 1NI5A 3JASA 3OT1A 1F20A 3O73A 3EGWA 1T5HX 3M6IA 2EX1A 3KQVA 4LMBA 4BFVA 1M0EA 2JANA 5AT1A 4ZYZA 4NFYA 4CM9A 5BVGB 1VG9B 5DI3B 2E48A 3EUAA 3GT4A 4QUAA 1QFJA 3SHWA 4F1JA 1XU9A 1GL3A 4MCJA 4E1BA 5GZ3A 3CLSC 3LWZA 3UAVA 8MHTA 2DPHA 3W5UA 1WETA 1VLQA 3GYBA 1USKA 1U3CA 2ILTA 3K0BA 4J2OA 3ZGLA 1X39A 1YZHA 2IPOA 1J24A 2B0CA 3AC0A 3HSYA 2FWRA 5J4YA 1F0YA 1QVAA 1ZD2P 3DWEX 1ZQ1A 1G3QA 3ZHQA 3EMDA 2CMDA 3M9LA 4E5UA 2GCOA 1EH5A 2VDKB 4EOGA 5ICEA 4BWFB 1JE0A 1HNNA 4V0NA 1VHWA 1BA3A 3DW3X 3SJBA 4RL4A 1YFJA 2RCYA 3D7LA 4ESHA 5A4KA 4YDHB 4L02A 1M2OB 4V03A 1B2LA 3S8YA 4JEMA 2CDAA 5ALZA 3ZHBA 4TTRA 1E2DA 4ZICA 3ZH2A 1H1LA 2BKLA 2DFTA 4DT1A 1P8JA 5HKKA 1D2CA 2ZT8A 5EWMA 4NOKA 1O54A 3GEIA 4RSRA 5JDCA 1M76A 3PNYA 4H1TA 5D5HA 2F67A 1YU6A 16PKA 3ETCA 3SLKA 5HCIA 3NHLA 5CDTA 2BMJA 2P5UA 1M75A 1V71A 4TM8A 4NCAA 3QPVA 3GFOA 5A7FA 2YYYA 4DLWA 1QQ5A 4R0NA 4F06A 1QCDA 1I1HA 1V9CA 2GZ3A 4JNCA 3KQOA 1E5QA 1XYGA 4RD0A 4XWYA 3V46A 4XH9B 2Z83A 1M2VB 1V16A 3P5BA 2QLLA 4QULA 4EO9A 2F17A 4G5SA 1IQUA 2NVOA 5AI8A 1WCV1 4GZ6A 2Z6UA 1QYDA 2YV3A 1T5OA 3F7NA 4KPUA 2MIIA 1HLDA 2E5WA 4RIEA 4RVSA 5T4FA 4AMBA 3ZD6A 2H4FA 2ODEA 4U6NA 3R4VA 4CMIA 4WACA 4R2MA 4HWTA 1EXNA 4EZEA 3QKRB 5ALTA 2GH1A 3UOWA 1D8AA 4B80A 4DWOA 2F3TA 4OHVA 4F0JA 3K09A 1YK1A 5G41A 4II3A 3ZBQA 4TSKA 3ANXA 5IM4A 1F4VA 5ELMA 2OCGA 2JHAA 2PBZA 1L4GA 5EHQA 2QD4A 1E9FA 2Y1DA 2ZSIA 1YQUA 3HGQA 4NEQA 3I62A 4WBNA 1NC1A 1FX0B 1AA9A 3TDKA 5AYVA 3W79A 4I7EA 1H2YA 3SWWA 1WB9A 1P33A 3EHEA 1GNSA 2J5KA 2XQJA 3B9RA 4UZEA 4PLHA 5EJ7A 1TGYA 1X1AA 3G5AA 3QH4A 4YHBA 3WO1A 4UM9B 3KKEA 4QO7A 1OMOA 1UBUS 4DJJA 1B76A 1L7DA 1A5BB 3FB1A 2YN0A 4LXXA 4PGHA 5DNWA 4MVJH 3AOGA 3T5DA 2X0RA 5TJHA 1TYZA 2I4NA 3AJ8A 2G76A 1J2RA 3W7AA 1AZWA 3L9WA 4JJ8A 3N7UA 1MIOB 1XQVA 1ZINA 2D4AA 1O89A 4RVGA 1LF5A 1RJDA 3H7IA 4Q3NA 3EYAA 2ZK7A 1TNDA 3R0XA 2CHFA 1XN1A 3DULA 5HZGA 1I94B 1MUUA 3JSXA 3W7BA 4AKHA 4I1YA 1WBJB 4Z7JA 5KYNA 3NHAA 2XNSA 4CM4B 1W5FA 1UDWA 4GD3Q 5D3ZA 3LCVB 4H7JA 5JH7B 3ZHSA 1PK7A 4OIMA 4RTOA 1JA9A 4PRKA 4UEKA 2LW7A 2L17A 1DG1G 1QRDA 3TH5A 5CB8A 5JS8A 4RULA 4D9HA 1RWMA 2FRXA 4RANA 2UYQA 4WVFA 3MCUA 4O2BA 3VR6A 1Z4JA 5LZ5A 1HSOA 1WB6A 3M33A 1TQ6A 2A84A 4NFHA 1GD1O 5TC4A 1C41A 2I2CA 1DJMA 1VYVA 5FL3A 4AJ9A 1CY7A 4KUHA 3UAOA 2MMCA 1Z83A 3MS4A 5CB0A 2BKXA 1G59A 1DQZA 1NASA 1ZA1A 3QXGA 3FPHA 4JGGA 4QD3A 3LXRA 4N3NA 1XTZA 2HJWA 1I6WA 4A8PA 4DC9A 4IDPA 1T91A 2EHJA 5AVWA 4MAAA 1XQXA 4MA4A 1AT1A 3VH2A 1T5DX 2QN8A 4GMXA 1CVIA 3IAM1 1OLXA 4L5YA 3ER8A 3L8YA 1GPWB 2XA2A 2FEPA 1QLHA 4HAUA 2YHIB 4YRFA 2P4SA 1FUEA 1SKYE 3F71A 5JJ5A 1NAHA 4TQ9A 2PM8A 2KYRA 2VHXA 3UMSA 2V65A 3KAKA 1IBCA 1XVAA 1EU1A 1OJ7A 3RRMA 3U5ZB 4KOAA 4NYJQ 1C4XA 2ZRLA 3QPDA 2VP4A 3MYRA 1NU6A 1GVNB 4NBKA 1YKSA 4GICA 3TRDA 3RC3A 3MINB 3N9IA 4K05A 5F98A 3BK7A 1WMDA 1ADGA 1AHIA 3T99A 3ZHUA 3A4NA 3MD0A 4TYPA 3C3DA 3FFAA 1EBFA 2NZXA 2EDAA 4OO3A 4XUCA 4EG0A 1LPNA 3BH0A 4FYYA 1IL0A 3C70A 1WVGA 3PG5A 1U3UA 1KYXA 1ZMRA 3EK2A 3S40A 3ZDXB 4BDTA 4CN9A 2AIRA 3G5MA 1CLEA 2RONA 4JYCA 3T7SA 3RU7A 1PJ8A 1P1RA 1I30A 3OI7A 4LYHA 2PRZA 3LPLA 3MWDA 2DQ4A 3C5EA 2GN6A 3JD2A 3K96A 4OREX 2WMNB 3IEIA 5KWSA 2R3SA 3FVVA 5CCXA 3ESZA 3TCKA 1CERA 3MTDA 1T1EA 3HY6A 5TX7A 5CAEA 1MAUA 4BO3A 1UADA 1KBOA 3D4BA 4IOLA 3K53A 3FCSB 3UHAA 3CWCA 1DG9A 1XRQA 3MJRA 2H4WA 4F2WA 4I5FA 1T9GS 1DKPA 2NQ2C 3FCUB 2Q4DA 1OFIA 4W82A 5CLFA 5EZQA 3QA3E 2ZJ5A 1NVEA 3JARA 2GEUA 1OKKD 3IIEA 4NZNA 3WIUA 3PXDA 4OGGA 1TTPB 1KY2A 1YAJA 2Q2QA 2O1SA 3MJTA 4O2AA 3E05A 4R1MA 4S1VA 3CPHA 2FZGA 2PX4A 5ULLA 3SU8A 3M2PA 3SIPA 5JVDA 2ZJFA 3WYAA 2IEGA 3TOVA 4JP1A 4NLLA 3WQBA 2I3DA 3ZLUA 2ID4A 3I0NA 3CRNA 3N76A 1Q57A 2VP5A 4G07A 4IIBA 3D0QA 1X1SA 1FC0A 3AEKB 3Q3HA 5EMJA 3C1TA 1GGNA 4LV5B 4ZDWA 2ZYSA 4FQ5A 4AY4A 2GYUA 2QRVB 4MGEA 3VU1A 1U2TA 1W5BA 1JQ3A 1OA1A 4ML3A 1OH6A 2JGDA 1BA2A 5A7GA 4QOGA 2PNFA 1KF0A 2ZYDA 3K8QA 4C21A 5AKLA 4YYEA 1U02A 1QSGA 4WOBA 3RSCA 2YIDA 4WZ6A 4H6PA 5EJMA 2VSXA 3TGPA 5C5IA 4DM7A 1BX3A 1QGED 3N8NA 1KEPA 3ADKA 4EYEA 2BLNA 1M5RA 3DM5A 1DIOB 1J0BA 3QIAA 5A3SA 1ATIA 1E6UA 4J2HA 2YFQA 2QJOA 2AJ8A 2H5LA 4KYTA 2B20A 2D06A 1U8FO 4B6RA 1KJ8A 1VJTA 2K87A 5FUBA 1SJ9A 3THRA 3CSSA 3ZGXA 2P2GA 5KJ6A 1M34E 2Y77A 1PLLA 3QY0A 3CNNA 1DUVG 5IDXA 4DLLA 2BGKA 3ESQA 1RWXA 2YBDA 4MAFA 4MP8A 2EIHA 4MWTA 4EX7A 3B38A 5DGTA 4YCMA 2J0QA 3KD3A 2HFJA 3L41A 4RWZA 4JY7A 3PXXA 2XCOA 4Q0MA 5IM4F 5FJIA 2AHRA 2FJ0A 1TYDE 5K3OA 4CR6A 1P73A 3QX8A 2X4GA 4I19A 5MGBA 3DZ8A 4FC6A 2HF2A 3HKEA 2BPOA 2HKIA 3MWKA 4WBNF 1QIIA 4KPYA 2Y3IA 2HY7A 4OHKA 2NVUA 1W5SA 4DG9A 4BASA 5AJHA 4RADA 5TQ2B 2VZ8A 3Q11A 4C87A 3I2HA 1NBAA 5THKA 3HJNA 3LDHA 5IUKC 4AXBA 1HNZB 5FLEX 2ODNA 5HDQA 4EQ6A 2Q5OA 2DCMA 3AOEA 3TM4A 4ZGGA 2Y1KA 1WNTA 1UXIA 4DV7B 4ZQCB 1DHTA 3IQGX 2Y05A 2C00A 1XF1A 1ZUD1 4U7HA 1PL6A 3ZHZA 3TR0A 4DYDA 5L3VA 4WAUA 4EZIA 2Q5IA 3GDFA 2CLCX 1UT5A 3E70C 1CU1A 2QD1A 3Q5GA 3C6BA 2YYSA 3EF1A 3GAMA 5DYYA 4PYKA 3UPDA 1YTLA 5AW0A 5CNMA 4KQEA 2C4VA 3EPRA 1TO6A 2X9NA 2A2ZA 3LYUA 1BVHA 1GFWA 1H9AA 1GCGA 2HTFA 5C3UA 2H1SA 1QANA 3KSDO 1SY7A 5AMXA 3USES 4RDXA 1WDWB 1E18A 1TM1E 1H2HA 5C51B 1UBGA 1SG0A 1CV2A 1KDOA 3FPFA 5BP7A 3DOEA 2ZUVA 1XK6A 3NT4A 4O2BF 2IHZA 2HSGA 3HB5X 5DN6A 3RU2A 3HKBA 4FN5A 1C9YA 3P9ZA 2AV6A 5EIBD 3HYNA 5BQPA 4PTYA 3N53A 3WLNA 3LM8A 3LY7A 4FUQA 2AFIA 2H92A 5K3AA 2NQTA 3A37A 3EISA 1JKMA 3UYKA 5B3JC 3GT0A 4AD8A 3OFND 3DE1X 4MLPA 4QU0A 2C1ZA 1V7CA 2XDWA 3HTXA 2X76A 1TEHA 2VJNA 3GJXC 5CYFA 4TXMA 1VZ2A 3UIEA 1ZW6A 4DBVO 3QOYA 3SQLA 4W9MC 1KKUA 3BM5A 3COWA 2ZIAA 3IELA 2NU9B 3TCNA 3EXHB 1MU0A 1RAAA 3QHAA 3ZZUA 4DMRA 1Z07A 1UKAA 1D2HA 1YJAA 2QS9A 1B41A 1VCIA 2VCYA 3IMFA 1DCKA 3BTSA 2XYGA 5CXXA 1DCFA 5E6SA 2NXJA 5JJIA 4XDYA 3PENA 1XCJA 3V7NA 3VU3A 1P61B 3ZJ5A 3JQDA 4YAUA 4DL9A 4BIIA 5HK8A 4GGPA 1BX1A 4RF5A 4Q9KA 2VNSA 2QN9A 2ZVJA 1JRLA 3T6KA 2Z58A 4BMYA 3OTOB 4H1WA 3BXHA 3AB3A 4DREA 2QENA 4M9RA 1V25A 3WYNA 1FFXB 1TM3E 3LCMA 3CLRD 3TNDA 4FDAA 3FOEC 5K45A 4YBRA 1MNQA 5FJJA 3GO4A 3ABOB 1GPH1 3IP6A 4JASB 4FMBB 3WIBA 4MUBA 4X1KB 4XB1A 1U0SY 5KQSA 1YSCA 1EUCA 2PH3A 3LQQA 4RSGA 3LOUA 5GP1A 4HN2A 1RVV1 3NNSA 2ONZA 2DGDA 2OHXA 4X92A 3W1WA 1CS4C 2YHSA 1KY3A 4MINA 4JBLA 3SGLA 1LLUA 1BFUA 1TECE 1P19A 2IYZA 3NAGA 7ABPA 3G2NA 2NZUG 4N5LA 5CDFE 1X86B 4TRRA 4S0XA 4CNQA 2QB5A 3PS9A 1BXGB 1T9HA 2UUOA 3E9MA 4O4IA 3ICQB 3U1BA 2FK8A 3HWSA 1QQ6A 4KHPB 3E82A 3FXAA 1BXZA 3MQ4A 4MO2A 4O2AF 3N5CA 6GPBA 1MAHA 4IF4A 4MUHA 4OXQA 2ZBVA 1WIWA 5JVDF 3V80A 3PIIA 3OURA 2A5DA 1Z2PX 2FGJA 1M8JA 2ROQA 2FMUA 3JAWB 3EVBA 1EYZA 4Y2SA 1CR6A 4U7GA 3T4EA 3BIJA 1R6BX 3U4CA 3C1OA 1T15A 3I42A 4CODB 3F9CA 1GL9B 2WUGA 2FQXA 2FG6C 3DP9A 3PEVA 4QKQA 2J9FA 2BEUA 4IDNA 4KLAA 1X0VA 2IYOA 2VDOB 3MTJA 5H7XA 2TYSB 2Z6QA 1KHTA 1CW2B 3NH9A 4OK3A 4G36A 4X5OA 5T7BA 1BD3A 2AXPA 2KLHA 2Q6KA 3DO8A 3SCZA 2IUUA 2F3QA 4ZO7A 4L5JA 3RRFA 3LAWA 3DP7A 4NV3A 4B2IA 3L7YA 4DLSA 1ZCFA 3NGMA 4J8PA 1NMXA 4JLVA 5T57A 1P9WA 3M5CA 4HOYA 4NXMB 4KMRA 2KB0A 3ICWA 1MH9A 4GHWA 3DNFA 4A8JB 5C3MA 2MMGA 1GCUA 1OLUA 2PDAA 3DLCA 3L7NA 2C95A 3T1OA 3JZIA 2VBFA 2O2HA 2VH1A 4LOKA 3RUEA 1UT6A 5CNKA 1I3KA 1KFBB 1OKKA 2OO5C 3ZK9A 5F3WB 1V47A 3W7VA 1NHGA 5FADA 2JGKA 3GGSA 3GNTA 3JW8A 4Q47A 1PR6A 4QPNA 1KY5A 4M1OA 4XR4A 3DVQX 4PQGA 2Q7DA 4AN1A 4BWVA 1FMLA 5ICSA 2VZ0A 5IUNC 2HO5A 4JUCA 1WCYA 3EQZA 3RTCA 5ERYA 3UHFA 3WKCA 4JODA 3L6CA 1JNXX 1QTRA 2IIPA 3NASA 1D09A 4HK4A 4Q4HB 1QFMA 3O9ZA 3ONFA 1DXQA 1FFBA 3JQFC 4KR9A 4QGSA 4KXWA 3CH4B 3NV7A 4RF4A 3ESCA 4EB0A 3N2GA 1ABEA 1PK8A 1XCBA 1GP2A 1WAMA 4JXJA 1LX6A 4N01A 2IHKA 1ZSVA 2G88A 3EVAA 2QJFA 3RV4A 1JJ7A 4J4TA 1GOTA 3ZBPA 3ZDZB 5I7WA 1RPNA 5KZMB 1VPWA 3UWOA 2FN9A 5D2CA 3TTVA 4UMDA 1GUBA 1AQUA 1DKQA 1EB9A 1V11A 2RIPA 2W0SA 4DDMA 3UTCA 2GJSA 3RVRA 5D87A 3PXAA 3C98A 3VSEA 4RK6A 4OJTA 4DDHA 3O4GA 3IT3A 4PV7A 1DZ3A 1P7YA 4TYWA 2V7XA 1QK4A 2R62A 4HH0A 1NLFA 3EBOA 3M4YA 5CIWA 1BKSB 1V8OA 4FNOA 5BOSA 1GAQA 2PLRA 1LK5A 4PZUA 5D3KA 3Q41A 1CB7A 1EE2A 2O2YA 5GIPE 3G82C 3EJ6A 1JAHA 3T3PB 1RJFA 2EJTA 4OOFA 4BMXA 2I6TA 2VJMB 3U7HB 4FXOA 2F43A 2PIAA 1NW7A 2ODBA 1GGFA 1PD0A 2E9SA 1C0EA 2DHDA 2E18A 2PPLA 3GLSA 4M8LA 4C3UA 3NW9A 4UFPA 2B36A 4DSNA 2DQKA 3P8ZA 4IL5A 2FPXA 4RD1A 3WHLA 3AL0C 1MHPA 2RHOA 1RBYA 3KVVA 1IQPA 1EGMB 3BRSA 3FWZA 1RWKA 1MVLA 3O4HA 4UM8B 3TCXB 4P7KA 4ALMA 1DAKA 2GEFA 3RLFA 4X62B 1V5FA 4PVDA 4JMPA 1B1CA 3A4YA 3LI2A 2ZIFA 1QG6A 1Z4IA 2H1RA 4NBRA 3HMQA 1VMEA 3DTYA 2AI3A 1IM5A 4GPBA 2W37A 4IFTA 1I2BA 2J9GA 1TT5A 1TUBA 3PHCA 3A6EA 2BP7B 3ZV6A 1ZMBA 4U39A 1P6UA 2HREA 3DZKA 2V4ZA 3V48A 4YUWA 1H05A 3GP5A 3R23A 2DFVA 2A7XA 5I01A 1XPUA 5B7PA 4LTNA 3QFHA 4CU5A 4C4XA 4A26A 1ESMA 1M1YE 2K5UA 4AZVA 1TVKB 3I2GA 4K88A 4V38A 3SP1A 4CM6A 5HQ3A 1L6RA 3F2VA 4L1KA 4DRXA 1UOQA 1OU4A 1HZZC 2DH5A 4M99A 4FEAA 3A58B 4IBOA 4ZAGA 3IAS6 1BH2A 3ZWAA 1ZXXA 4AMVA 2QN3A 4CQMB 3AK4A 3QWAA 2ZWPA 2ZR8A 1ZCJA 3S2SA 3UK0A 4HQLA 2PZ8A 3GLFE 4GKAA 1MX9A 4HDOB 3Q8MA 2XAAA 5T4BA 2XVXA 1J5XA 4QO8A 4L5IA 2HBQA 2A1UA 3K2EA 4EB3A 4XIJA 4EKDA 3ZI0A 1NE2A 5A6SA 1DC8A 5KTKA 1YGPA 2PJDA 4XOIA 4EHHA 2WVJA 3L4EA 2GAOA 3RS7A 1B26A 4EKIA 5JANA 1RAGA 1OD6A 4L0QA 2Q29A 1XDSA 1V6CA 2FUEA 3ZX5A 4WY8A 3TW8A 2VF8A 4C3VA 2A4MA 3O90A 3WBFA 1IK6A 2NO6A 3A3NA 1QWOA 1ULBA 3GMTA 2YJ4A 5C0OE 4NX2A 3ITEA 1Z5PA 4ERXA 2YVUA 3K35A 4GPEA 3L0CA 2YMLA 2XF2A 2B1GA 1OGYA 4GC5A 3PHBE 4MW6A 4V0LA 1OPXA 1DV2A 3CG0A 3K92A 2CJWA 1YVDA 4J75A 4PLPA 2PMEA 1AKRA 2J07A 1Z8FA 1AGRA 1XVUA 2DR3A 2HZ7A 3OFNA 5AWFC 1IN5A 1MT0A 4LZZA 2YZGA 2GRUA 3Q12A 4Z4GA 3MPOA 1PNTA 2GPSA 4FYVA 4HDQB 3TK1A 1F6BA 2Q3FA 2BEWA 5K01A 2Y2VA 5K8TA 4TYYA 3EFHA 3GCDA 1IYZA 2VI5A 2A9JA 3C3PA 5CDSA 1ZCZA 3IRUA 3UM9A 2WV9A 4RE6A 4LISA 1R6VA 3EDCA 2OZLB 2WFZA 5H82A 4R3UC 2V96A 2XUGA 1GPYA 2F9FA 2PFSA 2QPTA 2SCUA 1RE1A 5LLDA 3QI7A 1G2OA 5KPDA 5FDFA 4O4IF 2JFFA 1S8AA 3MA0A 3ZZMA 4DDKA 1I2MA 2DC1A 5HOQA 3C6YA 3WK5A 1U8CB 1IBSA 1ESEA 3BBPA 3JALB 3AEQB 4PNZA 3WIOA 2N75A 4AFNA 1FCJA 2MSWA 3VO1A 5BRJA 1A97A 1N78A 3F8SA 4YS6A 4Q37A 1JXMA 1Y1PA 4KLRA 1QU3A 5B6PA 2D1YA 3CH5A 4MPTA 4XDHA 5KKCA 1GPMA 3PHJA 2JCXA 2XT6A 4NCXA 1KOGA 4D3XA 3QYAA 1SXIA 1NDUA 4N47A 5ADUS 1OROA 3CLSD 1XPRA 2BKEA 4ZC8A 3GNSA 1Z08A 3TFOA 4DYVA 3HJGA 2A3RA 4DZRA 121PA 1WY5A 2XA1A 3R1IA 5K6AA 1CUWA 3LV8A 5A1JA 4K03A 2OEPA 3NDRA 1CB0A 3MTAA 2JEYA 1WLSA 3WISA 2WTAA 1ADBA 2ATIA 3ZQ6A 1NW3A 4DV1B 4XB6B 1GZ3A 1YE3A 3U7GA 3OM1A 3S68A 2BN4A 4UXJA 5G0TA 4BKRA 5F52A 1V1MB 1Y8RA 4WK6A 3PTAA 4YJ3A 2YIJA 2IH5A 1GRCA 5JS6A 1K7CA 2FUG6 3VNVA 1SU8A 1UWLA 1K89A 4BKOA 4GKBA 4EMTA 2O3QA 3U7IA 4LQDA 2PS1A 1GO2A 1CZUA 4UMEA 2A9OA 4QYIB 4X85A 2AVDA 4IJUA 3PPYA 1Y1RA 5IZCC 4D45A 4FI3C 3V8RA 3WJ2A 2GPJA 4MUAA 5C81A 4Z2AA 4EO4A 1F3OA 2R5WA 4G1MB 1YS6A 4MGKR 2VT6A 3PDIA 4RF3A 3V8EA 1C9JA 3E7FA 4Z8YA 1T3GA 1SD2A 1SUFA 4GZMA 2OTCA 1K3TA 4JOBA 4UEOA 1V3TA 3O47A 1BFDA 4KQKA 2PA3A 1CYEA 2CHEA 2YZMA 3G89A 1KU0A 2QDKA 2Q3BA 3QJGA 4HUJA 3HA3A 1YVPA 1YQGA 4V1CI 2LRHA 1T4CB 1UMBB 5HFAA 3OECA 3D7KA 4FGJA 2NN3C 2RI0A 4IINA 1V35A 4BN5A 1EK1A 4DA4A 4HZUA 2XSZD 2VDUE 1N0HA 4GX1A 4YQFA 4GMHA 4D4HA 2AKYA 4BAGA 4R1PA 4IKOA 1XX6A 2QNRA 3GFQA 2X5NA 4LPKA 4PNHA 3GH1A 4DR2B 1HL7A 2FPLA 3G1TA 4GOXA 2ISQA 4LGVA 2HDWA 1KEEA 4WFJA 2QIPA 3ESAA 2FUKA 5E7IA 5L6MB 1CEQA 1NWHA 3NJ8A 3Q9SA 4HRXA 2B0JA 3RVMA 3E27A 3NP7A 2Y67A 1E2NA 1FRNA 1CCWA 1VE1A 3E2IA 5EPOA 3VNUA 2CFOA 4B3MB 2L42A 5IVHA 3D4LA 1U8XX 3ROEA 1ZSNA 5D1NA 5JADA 5DW0A 4HQ6A 4R01A 1L5LA 3U4GA 1XFAA 3ILXA 3LRXA 3NUZA 3PE6A 3E3AA 1KK3A 1VHJA 2ZG6A 4MW2A 3N58A 4DKXA 3L7MA 5ITVA 4KPFC 1X38A 2WFMA 3PHHA 3O91A 4RPIA 4IGIA 1ISRA 2BJHA 2BMEA 1VBFA 1SCBA 2ZVDA 3BRWD 4QBIA 1IXKA 5EIAA 1P2GA 4NJMA 1QRAA 4JLOA 3NDIA 4RAQA 5DWDA 1N7GA 5F5XA 4EW6A 2PWYA 3SJUA 2AKEA 2AXNA 1W35A 1ZD3A 1L7BA 1H0RA 2A57A 4OFXA 2NP6A 3AW8A 1MVOA 1ZMXA 4QDKA 2ZDGA 3TSZA 4C4TA 4IDDA 2FZKA 2HCTA 3EVNA 1VFPA 1E2IA 3CRMA 3KNZA 2R6CA 3W9UA 1WOMA 4BRZA 3KB1A 4X1IB 3OZTA 4LI3X 5JI3E 2V4UA 4YMIA 1IUOA 1YZUA 1N5JA 3LPCA 2OKCA 3OJ0A 3QFCA 1G9XA 1YNSA 4YJFB 5DYNA 2IF0A 4MVJP 4BLWA 4E88A 4LMAA 2P1DA 5ALFA 1LWNA 3PGVA 2C8VA 1BGWA 1T5LA 2ZRQA 1YHNA 5FYQA 1QYIA 2ERYA 1JPJA 3DZFA 3W4KA 3AINA 1VGRA 3D5QA 1PBTA 3NYQA 2W4QA 4UUNA 1GRRA 4NU8X 1P7WA 2AX3A 1DKMA 1EFVA 4M0LA 2FHPA 4US2R 2IITA 4OJNA 3R7FA 3F47A 1W6UA 2XJ4A 2WE8A 3HP4A 3DLAA 3DNMA 3UBMA 3AP1A 3M89A 3LLVA 3QOXA 2RSLA 3NXSA 5HF5A 2OXTA 4B4VA 4GMFA 5JOQA 5JG7A 1JX6A 5LQAA 2VAVA 3L4JA 2RHMA 4MR9B 3P97A 3ED5A 4IRUB 1V43A 1KHHA 2Q3DA 1SCJA 2XYRA 2NU7B 2ZRCA 3PVZA 5LB2A 1AS0A 2P40A 2M6LA 3GJ3A 3E5NA 4YT5A 3TAXA 1TJYA 2C3UA 4CLEA 2DWUA 2YZ7A 3HBMA 4C76A 1RYDA 3IA2A 4RH1A 4F5WA 1ODCA 1QNLA 3I6IA 3UMRA 4F45A 4LF9B 2GLXA 4FJ1A 1BDIA 4QGGA 5JNWA 1FU7A 4DIMA 4ZMBA 1NUTA 3L82B 4MJ7A 3HXKA 4HXEB 4MI3A 4UOQA 2QX7A 3A7EA 4ZVVA 1O57A 2D74A 3B60A 1JECA 2F64A 2H17A 1K63A 2P9QA 3CZ4A 3LYHA 1Z9BA 4L28A 3CCBA 5TQVA 2ZXFA 1U2QA 5BN4A 5E3JA 2ZQYA 3ZXUB 1SCKA 2R8ZA 3KKZA 1R9MA 4XTRA 4DBLC 2AOTB 1DAGA 3EYWA 2WJHA 5FBHA 1TO1E 5EXEA 2BL4A 5SZJA 5IH7A 3MW8A 2XOXA 4ECAA 1CRLA 5C4MA 2JCBA 4HCJA 1RXEA 5IBPA 2FWNA 1OR8A 3KB6A 2GUGA 4AIIA 1U4OA 1Y9AA 2QTWB 1VA4A 3TTUA 2ZRPA 4IH1A 4IDBA 1YUBA 2QTRA 1WW3A 2RHGB 3NYRA 4FYIA 4NZOA 4TTQA 4BVGA 3K70C 4FN4A 2QY6A 3AQ4A 3NIDB 5FUVA 3VHXA 4EUFA 1NNEA 4HEA6 4KLZA 5C9ZA 1GGKA 2PQMA 4COKA 2II6A 5DM70 2HK8A 4MW7A 1XMVA 3LCRA 3MCZA 3UMCA 3FHOA 1JALA 5C7OO 1Y6FA 1JPNA 1U0JA 5DYWA 3VJMA 5TS3A 3DPSA 3PGKA 2VOJA 5KC8A 3STVA 3LZCA 1Q7CA 2YZ2A 2O54A 2HPHA 2CNKA 3EEQA 3O5AA 5JTUA 5FWDA 4FCTA 3CIFA 2ID9A 1POXA 1VJDA 3E5MA 1QG2A 3LVQE 3WVNA 5EN4A 1M8GA 1SKUA 3T3MB 1ND6A 4AUKA 1RWBA 1FDUA 2VWPA 4F9EA 2QHXA 4JEIA 3HCNA 4X45A 2W8ZA 3QHQA 4AZ0B 1GL7A 1X0XA 1SVKA 2OSBA 1WPGA 1YIOA 3OTQA 4HN9A 4YJ3F 4AMUA 3A2MA 2OCDA 2HBRA 2PL1A 4AP9A 3RAEC 3EIEA 4JELA 5HQTA 2EL7A 2HWWA 5I3CA 2RHHA 1P5HA 4R1OA 3S8EA 1TADA 1TK3A 2O8CB 1FTYA 2JJ8A 3GLHE 5FFMA 3FFWA 3X1DA 4C2BA 1PL0A 1R4AA 4OATA 3L1JA 2ZROA 1ODIA 2CXSA 2Z2JA 1V4NA 5K4HA 4D8TA 2D00A 2VWHA 1L7AA 5ELLA 3OU7A 1MPXA 3BA1A 2V0NA 1MJNA 1ODLA 4ZZIA 1WU8A 3O4RA 1VPEA 3LHSA 2P6MA 3OJWA 2ZCUA 5L7YA 1C3LA 5TT1A 5HUJA 4NFLA 5AKZA 1X6VA 4B3XA 3H5LA 4GYJA 4P0TA 1ECCA 5FT9A 5LR6A 4MP3A 1XLWA 4NMWA 1NP6A 3DL7A 5KQRA 4LW8A 1OXKB 2EX4A 3TNJA 3IKVA 1B43A 2VBCA 1ZRHA 1ULAA 1LDEA 3UJCA 3VDMA 1A7UA 2BTQA 3ZIDA 1FFCA 4AYTA 2XE4A 4B7CA 3MJDA 4CT0A 1C0PA 5DBEX 1N0UA 1U6KA 3H0KA 5LN1A 2AOVA 3EZYA 5KTTA 1ULZA 2G6TA 1EGHA 4HN4B 5IW8A 4EPVA 5EE9A 5M2QA 1LNQA 3GRAA 4HSEA 4R9RA 1Y82A 3U31A 3IYLW 5C8DA 3IC5A 3AFGA 4HJRA 1GPBA 1SVIA 5EJAA 3EQ7A 3FPGA 4L9WA 3ZWOA 2O7VA 5EUBA 2JH8A 3B7WA 4PZPA 3ONEA 3EPKA 2ORIA 3IAEA 3O6VA 2V97A 4MS1B 3ZCXA 5C1PA 4CRWB 2DH6A 5ALVA 5G4KB 1KI8A 2PX0A 3OZIA 4W5JA 5DLQC 4CKYA 2G67A 5G0UA 2W71A 2IV7A 5I3ZA 4U7DA 1Y3FE 1C3OA 2CJPA 4MYRA 2E4UA 4LHZA 4QXPA 1Q95A 3SQMA 4BV2A 4ENPA 4OYLA 4RK1A 5AVSA 1OH5A 1I5RA 2BHLA 2BGUA 2O3SA 3EGDA 3H5WA 3V8BA 4UJ5A 1XP8A 2ZB4A 4QBFA 2ZJ4A 5I47A 1JNYA 1OF1A 1MB3A 1YQQA 2V7WA 1PWHA 1U0RA 3HCFA 3LP5A 5E1OA 1FVXA 4G5XA 3WC4A 2RBEA 1PJLA 3KKMA 4ZYYA 1HM5A 4FHFA 3FCOA 4QGBA 1XOIA 5L95A 3FPBA 4BMDA 1RD4A 4D57A 2P79A 2YZKA 4BQIA 3F7MA 3EC1A 3KQQA 2XSZA 4IFIA 3PE3A 1KYWA 1RKQA 2OCLA 3CF6R 3E35A 3MMNA 4CDRA 1UBJS 2W6PA 1C0LA 1FDVA 1N75A 1SB9A 3B6ZA 2A7QA 3TOCA 1NR5A 3AHJA 4OMFG 4ZAFA 1U9JA 1WXFA 2Q4OA 2P7IA 1NG9A 1CDEA 3O8LA 4DIKA 2DUNA 1O03A 2UVQA 3IJ5A 4EY3A 3PDCA 4LBZA 4B4KA 3KQSA 5KOJB 2R1VA 3DC2A 1YA6A 3MRSA 1XTBA 2VH5R 1MENA 2BGWA 1D8TA 5IDYA 1QHHB 2VXYA 1RPAA 2CC2A 4QDTA 2GPNA 2WJGA 2DR2A 4RM2A 3SI7A 4YVFA 2QTLA 2R7AA 3DFZA 2Y9PB 2ZTVA 2G7ZA 2ZP1A 3JQGA 3L3BA 3OESA 4GPIB 5KPJA 2P41A 3DZIA 1ST2A 1YS7A 3L1HA 3NIGB 4Y9DA 3Q3GE 1UODA 3IPLA 2REXB 3FGNA 3G8AA 4AY2A 2W2LD 4NZMA 2B82A 3BRWA 1B6GA 1NKTA 4LDJA 3IUYA 4TMKA 1PJAA 4KKVA 4MPPA 4ZHQB 1IUKA 4TWZA 4C9BA 3GD7A 1NI3A 4NBSA 2MSCB 3B1JA 1OZGA 3EARA 2X1HA 2XRYA 1GVHA 1GPUA 4NAVA 5CFLA 3PJGA 1CQPA 2DKNA 3FROA 2VQDA 4Y67A 3IJRA 5K4GA 4RV5A 2PCJA 3NI2A 1TYCA 4U0KA 3HCCA 2LDBA 3T9AA 1R88A 4G26A 4C5AA 4EB6A 1L5OA 1XMPA 4IEFB 2ZYRA 4R8RA 1SKQA 3R3UA 5M7EA 4DUYB 2PKWA 3W4JA 3I6BA 4YCDA 3BWBA 3SMQA 5C4GB 3U6BA 1FRVA 2ZPAA 2R8OA 4PZZA 4P0PB 4LDPA 1VIVA 1C7QA 2CLKB 2YRWA 1G8KA 3HUTA 1PQPA 4RLHA 3HJTA 3L8MA 2KI5A 3TPZA 1AKVA 1JPUA 2PGNA 3OOSA 2QV0A 3CRQA 1X7ZA 3RARA 4I4IA 3U56A 1SUIA 3EUWA 1UXHA 2FFHA 2VSYA 2F90A 1BG6A 1YUNA 3OZDA 1BYIA 2PO7A 4ZU1X 2G07A 5EJ4A 3RYCA 4HDSA 1JQDA 3ABRB 2WA1A 3OJCA 4FE3A 4K8RB 4ME6A 4Q18A 2GM9A 4FZ3A 4TOIA 4TSRA 2IE0A 3DFMA 1JJAA 4YRJA 1LPPA 2XECA 3I2YX 4PCUA 3K32A 1ZL0A 2EEPA 2X5OA 4BKQA 2QTVA 1IG0A 1KPGA 1SAYA 3O74A 5FWYB 2Q6TA 1UXOA 3ITDA 1LLDA 4JBGA 4V1CB 3JD4A 1TCCA 2NO1A 1JIUA 4BNIA 1ENZA 1GWNA 2DERA 4ZVTA 4QLAA 5DU2A 1RLIA 1JV2B 1TM2A 3GVCA 1SOAA 1UPTA 2Q5QA 4ZCSA 4PC3A 2O5CA 3PJFA 1DWUA 1RKXA 2HXSA 3KHUA 3IA7A 3HU1A 2IYRA 2QSZA 1I1NA 3A3PA 1S4MA 4GBGA 4BFWA 4DG8A 4LK2A 4YMLA 2H9YA 4BXOB 4Z8XA 2WG2A 4QFDA 3ZYZA 1FU8A 5G1OA 4MRAA 3O31A 4NJOA 4OSEA 4BNDB 3O9VA 3A31A 1F2TA 2HIAA 4I2VA 3P45A 4N3CA 1BW9A 1ECJA 3ZZNA 2HD4A 3ELWA 3IOMA 4L4RA 4L8YA 2ZDHA 2WT9A 3AM1A 3KYDB 2ZITA 3TLMA 2VNKA 3S55A 1N0IA 4F4HA 1AZTA 1EQAA 5C32A 3AVTA 1B6SA 4QAJA 3H13A 5ALWA 1Z8HA 2CNWD 1H94A 4F9GA 2QR5A 4ILKA 3RGWS 5K7SA 3T0GA 5AKHA 4MTLA 1SBIA 2QROA 2YY5A 2PO5A 1YQWA 3LKVA 4KQ6A 3EPJA 4MDFA 3ETEA 1VRVA 2N1BA 1W47A 3I2IA 2NVBA 2H11A 2VKTA 3PGXA 5F1KA 2ECQA 1SUSA 5FAXA 4HWRA 4DADA 1FFWA 5DHRA 1NSFA 4TV8A 3S29A 2FQ1A 1GQSA 1AUQA 2WYIA 3NETA 4H15A 3RVLA 3B6JA 1XCGB 3OZCA 4JL8A 5IZ4A 4NABA 2QBYB 3CW2A 4BE7B 1SOMA 1E99A 5C1BA 5B1HA 1RNLA 1X7HA 5C46F 4PVCA 5IDVA 2Z1DA 1O77A 1ZIPA 1PNVA 2GXSA 3OQPA 2PLNA 1Y1TA 1AK2A 3GT3A 1GFSA 4YV2A 4N3AA 2BDEA 2A1TR 1FUUA 1EAYA 2G0TA 3KZKA 1H5NA 1NTRA 2QUAA 4FPXA 1RMQA 1ZK1A 2YS6A 5JQGA 3AFHA 3BMCB 5FA6A 2GJ4A 1L4UA 1WX1A 1UK6A 1L5ZA 4L76A 2OG2A 3MVEA 3KQLA 2WW8A 5KX5A 5GJBA 1HE1C 4UBOA 1OFVA 2R751 4BTEA 4F6RB 3IDFA 5F21A 3VDRA 4WD3A 3N8GA 4H6WA 1OXVA 4RL6A 1XTPA 2D1FA 1VKNA 3VV3A 1RC0A 2Q3HA 3A9TA 3DMTC 3P27A 2TS1A 5IJWA 2OWDA 3QEMB 2R65A 3QEOA 1YBFA 4BQOA 2H00A 4G1CA 1D7AA 3R24A 1QIHA 1Y6GA 2ZI6A 2R7LA 4BHTA 5K3BA 4H3HB 2G6BA 1F9AA 2JJYA 2FR0A 4J0HA 5AM3A 3DDNA 1W73A 3KYCB 3B3QA 3KU4A 3M3DA 1IM2A 1JSXA 4QXRA 3CVXA 4RHEA 4E4RA 3M34A 1XMIA 3DVAB 3A6DA 3KKOA 3C45A 4HY3A 2RGNC 1AHPA 1S8OA 1YQ9A 3C3KA 3EA4A 2O8EB 4DNQA 3RG2A 2I7XA 3MJEA 2GOYA 4OBBA 3DAFA 4UCXA 2PLWA 4ID3A 3OU2A 3V8QA 3ZCRA 1WTAA 4HTFA 1NKSA 5F2KA 1YJBA 3SFZA 4ENUA 4Q1VA 4G0UA 2CSXA 5I9BA 4GLLA 4C29A 2O8DB 1S2NA 2WG0A 4ARAA 1RHMA 5KTMA 5E6UA 5B64A 2Q9CA 3O8CA 1W9MA 1OAAA 4WLNA 5K3FA 5DHQA 2M6KA 5C1DA 1D04A 3FGPA 4OJMX 2Q45A 3FYUC 3HVHA 3TWOA 1BROA 1NAIA 1X19A 4CTOA 3P4UA 2Q27A 4MDEA 3KEMA 4UAUA 1PVOA 4JBXA 1OWPA 1S6YA 2EGUA 1KO5A 2ZATA 2QTFA 3AG5A 4H6XA 4M55A 5GGXA 3V7WA 3Q7RA 4NZYA 4RYDA 2VOEA 3BX1A 1FQWA 2BHRA 1YK0A 1U2GC 3VTZA 5G0VA 4K9OA 2I29A 1E3QA 1W0KA 5T8KC 3T15A 4QG3A 4JR2A 4U6QA 1G4AE 3ZU2A 3L9XA 1P2UA 1KQFA 3L7JA 1Y3BE 1Y5RA 1UDCA 1SHJA 3OZFA 4O2LA 4QXQA 5LA6A 4N3BA 5CH3A 3WA6A 5J47A 3UMMA 5H3LA 4UAGA 3K9WA 1YZVA 5F2EA 2RH8A 4WXMA 3RYIA 1KP3A 4B2LA 4L7VA 3MJVA 1KE2A 4JB0A 3RVBA 4A2QA 3UA4A 3VZCA 3PUKA 4QRDA 1SOWA 1E1QD 2YVQA 4WBSA 3THWB 1JVBA 1S2DA 4LC0A 1WEHA 2GILA 3DS8A 3I1YA 4EO7A 3AUTA 3WWDA 1I7NA 1RYEA 3EXEB 3GLVA 5BYBA 3DF9A 1MABA 5TGDA 1FXWA 3SZLA 2CE7A 3S0JA 4G4SO 2XB2A 2F8SA 1KIMA 1EIWA 1N2BA 3F3KA 2FW9A 3AH8A 4L57A 2YBEA 3W34A 3UJDA 5JASA 4W7IA 3O8OB 5A3JA 3I83A 1JHOA 4KDRA 3KYJB 3WBBA 3NUGA 3ZU6A 4KB5A 4R8MA 4TKVA 3G23A 3G59A 5KVQA 2J45A 5AOCA 3VXKA 2WYWA 4IP0A 3I1JA 5K3CA 5HBGA 2WT8A 3KWMA 1PDWA 3W9SA 1DTWB 3SVTA 5A3VA 2MTBA 4DM4A 3U2QA 4EHFA 4TYQA 3E03A 3VR3D 1W4ZA 2RFLA 2W2LA 1XXHB 3FI0A 5F7ZA 1C3XA 5B3JA 3P9CA 4CR8A 1AMOA 4YIHA 4LTMA 4UNRA 2GSWA 1GL6A 2VTVA 5AJWA 4CIVA 1T0IA 1K6EA 4LKRA 4Q7QA 1WZ2A 1NBMA 2B7LA 2UYOA 2H63A 5JBQA 1EXDA 3H6GA 3OFSA 3AB7A 3ANLA 4P5EA 4LXUA 1LQUA 1QDUA 3FETA 1W0CA 1L4NA 1R9JA 1UFRA 4O4HA 2F3PA 4PQYA 2H9AA 3N7TA 1QVWA 1NW5A 3S4YA 3VH4A 4DTCA 4H7DA 5JSUA 1JKFA 4YJGB 4CM3A 1NYLA 4MMYB 4NESA 4BN4A 4D99A 5EZ6B 3AR3A 1KAOA 4GX5A 2OK8A 3OOHA 4WNAA 5K0SA 2FPUA 3DTVB 3RQSA 3QLUC 3OLQA 3K0AB 4O59O 4DQ0A 4FW8A 2ZIVB 3INRA 4PZAA 1P0MA 2CXNA 3ZJVA 1QM5A 3WZMA 4PHFA 4ZI7B 1J8DA 3M7IA 5CH5A 3NBUA 4J0IA 1KGSA 2EFJA 3JYPA 1U9YA 1BRMA 3KDPA 1E2EA 4C05A 3SJCA 3OY2A 1XTUA 5F9HA 3QUAA 3NJRA 1W0JD 4BVLA 2OFOA 3AF6A 2HRQA 1SQ5A 3HDHA 4NHEA 1MIHA 2H1CA 3GCWA 3MLAA 4HDRA 5E95A 2R7MA 2OYCA 4BCCA 4AWXA 4TV8F 2PX8A 2XOEA 3H87A 5LZ8A 2PYIA 4BTLA 2XIJA 2A6PA 4MEJA 4MA0A 4Z9XA 2HA0A 3ZJ4A 4B7UA 4C1BA 4WKOA 3G6KA 2I2WA 1K0UA 4XFDA 2GCPA 4A15A 5EWJB 1LJ8A 1RWVA 2ZIXB 2PD6A 4TGLA 3O1LA 3H86A 4H3VA 2X7XA 5DXFA 1LQ2A 4AU1A 3F73A 2OG1A 4QASA 2HB6A 2OZEA 4C7MA 1G6HA 4O6VA 2OVFA 1A5AB 5JQGF 2XUIA 1PIWA 4GXQA 3VH1A 4CIYA 1H4SA 1G2IA 2FPGB 2XNKA 2Y1XA 2IE8A 1RHKA 3JVDA 4EW2A 1K08A 5HJEA 1WXHA 3LZDA 4AKEA 5JNLA 1U7TA 5KX5F 2FQWA 1H66A 5JD4A 1KAGA 2OHOA 2CNWA 5CD9A 3TZ6A 1QORA 1X9IA 4ZJUA 1YH3A 4UUOA