4RHFA

Crystal structure of ubix mutant v47s from colwellia psychrerythraea 34h
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
b'DFNGKITLAITGASGASYAMRLIECLIAANYQLYILCSSAGRISLDTEVGVKIPSSPDAASKFLTEKYQAKDQQITVFGKEQWFSPVASGSSAPKQMVVCPCSTGTMAAICHGMSDNLIERAADVVIKERGQLILMVRETPFSTLHLQNMLSLSQQGVTIMPASPGFYHKVETIEDLIDFMVGRVLDHLGIEQDIMPRWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
publication title Crystal structure of UbiX, an aromatic acid decarboxylase from the psychrophilic bacterium Colwellia psychrerythraea that undergoes FMN-induced conformational changes.
pubmed doi rcsb
source organism Colwellia psychrerythraea 34h
molecule tags Lyase
total genus 69
structure length 200
sequence length 200
ec nomenclature ec 4.1.1.-:
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4rhfA00
3ZQUA 4ZAWA 4RHEA 3WISA 1MVLA 1MVNA 1E20A 1G5QA 1P3Y1 4ZAXA 4ZAYA 1SBZA 4ZAVA 3QJGA 4ZAFA 4MWGA 1G63A 3MCUA 4ZALA 4ZANA 1QZUA 4ZAZA 2EJBA 4RHFA 4ZAGA 3LQKA
chains in the Genus database with same CATH superfamily
4MKIA 3G2MA 2CMKA 3JQBC 1V11A 1W8DA 4QUDA 4AMZA 1M6WA 1R0BA 1SVNA 2FG7C 3DL7A 3VSDA 3AUXA 3P9KA 4YRBA 5JS1A 3GLUA 1HQKA 3L7BA 5JSQA 1TVKA 1E0AA 5JTUA 4G1EB 4B87A 2PXAA 3A2NA 2DFPA 2VPIA 1INLA 1WTCA 3NHUA 2CFRA 4JZKA 4Q7KA 3KQMA 3F8SA 4E4RA 2RH5A 1BXGB 2X1VA 3CINA 3ISVA 4K8OA 5FOXA 2PU5A 3EPHA 1T0PA 3LVBA 3A0UA 1EFVB 1CQIA 1ZISA 2MYNA 1KQGA 4MVJP 1AN0A 3B6ZA 3KT0A 4TV8F 3MRXA 3OSZA 2W2KB 4XR9A 5FF9A 2R1UA 3KTOA 3O91A 2FSGA 2J9ZB 3WLMA 1B23P 2E6KA 2IZ0A 1H69A 1TEXA 4JJEA 3UCXA 4UC0A 1DAFA 1QHNA 1CPYA 1N6NA 1HTBA 2VQ6A 3DMRA 2P6UA 3CZ4A 1FP4B 2NSDA 2BGKA 1JZQA 4OQPA 4RMGA 5FQOA 1SVUA 4ALMA 3DWEX 4AAYA 4EHLA 5JANA 1ZY2A 1FQJA 4A2CA 3SQDA 4AY2A 4MYDA 1BX1A 4HPXB 1P7YA 1U2PA 2J6HA 3KQYA 2XUGA 1EKXA 2WMOB 5EP1A 1ISMA 1YZKA 2WPNA 3PNMA 1FLVA 4YIHA 1B26A 2JFWA 3THWB 1THZA 1WB6A 1A9QA 2Y6UA 5JZOA 1TZMA 3QUCA 1KARA 4Y2JA 2EZTA 1GTVA 2QBYA 4V1CI 3TCNA 4A0GA 4FR2A 2HMTA 3I5UA 3L0PA 4C07A 4CIBA 3V1NA 1U6IA 3MQFA 3ZWVA 5H80A 2P30A 2DFKB 3ABZA 1WSBA 5HJ7A 5I5EA 1KS9A 1F3OA 4DSTA 3QXSA 1JG3A 2WKPA 3ZIUA 4BEVA 1M5RA 4X64B 2EP5A 4JD5A 5CH3A 4O1HA 1LY1A 2IZ1A 3F5SA 3FKJA 3IPRA 4CCYA 5TR9A 1PYDA 3AHIA 4H7DA 1EFPA 2ZYIA 3UA4A 2Z09A 1D04A 3V32A 1I10A 2XMBA 2ZAMA 4GF5A 1HE2A 1RVDA 1R8JA 1VC2A 3KJIA 3ZUPA 5B2FA 1U7XA 5AW8A 3OOYA 3QMMA 3FIUA 2VSQA 1LLQA 5U4QA 1NQOA 5JAPA 1PR5A 5GGXA 2FI1A 3AESA 2RBGA 3SG0A 5F35A 5BNWA 1T9DA 1YHZA 4ALIA 2XGSA 5AI0A 1CJVC 1MABA 1M8FA 4N7MA 5AO9A 1R6DA 1DG3A 4G5OA 5BYJA 1ECJA 2YIDA 1WXXA 3DMNA 1WL8A 2E82A 4IY1A 4B82A 3GWGA 4AZWA 5BUSA 3RUFA 2Q9AA 4F5WA 1CUXA 4DIBA 1IWOA 5E9JA 3R09A 1XPJA 1L5YA 1YL6A 1ECFA 3H17A 4N6OA 5KWJA 2EGHA 1KZHA 4EPRA 1P5JA 5K03A 5JDIA 5AW7A 3CZPA 3E1GA 3R7WA 4P3YA 1Y1LA 4I50A 5KYTA 4AKEA 4OREX 3R7DA 1TYZA 1R4NB 4KP7A 2VH5R 1V6CA 2HC9A 2J46A 2G5GX 4KXXA 3S40A 4FFDA 3GUUA 3G89A 4G0NA 5AJXA 3R7NA 2PXXA 1DAMA 1DC3A 1GTG1 1SHLA 3H42B 1W29A 5CXXA 1C3EA 2QG6A 3F97A 3PSHA 4TRMA 1V4BA 2K6GA 4FU0A 1J5PA 1X9IA 2CLFB 4KKXB 3TRFA 3OPYB 3EK2A 3TPFA 3MTEA 2PZ8A 4QBGB 5BOSB 2XHEA 5A4FS 4EI8A 1PHRA 2XLCA 4JLOA 4Q82A 4JI1B 3U6BA 4FWTA 4D26A 4Z0TA 2CV1A 4ZOLB 4CDMA 5C5CA 1XALA 1KMQA 2NO4A 3B8EA 3PCTA 4GYWA 3STHA 4OUDB 5DNUA 4MQ6A 5JXGA 2WYWA 4MS4B 3L7NA 2M9MA 1UXGA 3OWOA 2OHIA 2VBFA 3MG9A 1IZ8A 1E79D 3DW1X 4UCWA 1VMKA 4AQ7A 4UUOA 3UGJA 3UF0A 3P9PA 3OMWA 3S7TA 3LLUA 1ISFA 3PDHA 2FMIA 1XZMA 4M37A 2I4OA 4LSWA 4XFDA 5BR8B 1COWD 2KLBA 3DE7X 3H2IA 4PG4A 5IG2A 2P6RA 3LC1O 3B3QA 4B6EA 1E6MA 1K0FA 2O0KA 1KTVA 1JGTA 1P44A 3EE6A 3HHEA 3I9JA 3NEPX 4FR0A 1NUAA 4GPAA 1PR2A 2AEEA 2JBWA 3VSAA 2WD7A 3C5WP 3GA0A 4L6IA 1EK1A 1YQQA 3PE4A 2O6LA 3HZRA 4PM4A 3ZTYA 4WKCA 4D57A 2F1IA 4ZAVA 2DQYA 5EHQA 2BEVA 3JQ9C 1OIXA 2B69A 4MJ3A 1RAIA 5LLTA 2IXGA 2E9SA 3SC3A 1W34A 4FK8A 2AL7A 5A4KA 4X90A 3VUEA 1AC5A 3E2PA 3C3WA 2D1YA 1UMKA 4XIJA 1D9XA 4MR8B 2Z2JA 1HZZC 1I6LA 1VE9A 2O50A 4DBVO 4KN6A 4CI9A 4G0YA 3QW2A 4FS3A 1GGVA 3D6UA 1HG1A 4R2HA 1AXEA 1XZJA 2C5BA 1IHPA 3PI7A 4UVGA 2A88A 2ZW9A 1OZGA 4KPGA 4WLOA 4CR7A 3ADCA 1JR3A 1G8HA 4K6GA 5EJ6A 2OQRA 5IKOA 3TPCA 5EHZA 1VYTA 1K3UB 3JWJA 3IR5A 1Z2AA 2BHLA 4FPXA 2WJPA 2IZZA 2WF8A 4R4JA 3TM4A 2ZTHA 1UC4B 1BRTA 4BP1A 1NLUA 3OT5A 2WWTA 1CVIA 2X42A 1CULC 3KZCA 5DNWA 4R2JA 3VO9A 1E3DA 5D5PA 2CLIB 4NVRA 3O2SB 3UMJA 3W2IA 2BGIA 2DYKA 3COJA 3LPDA 3CISA 3NGMA 3UNXA 4F6RA 1XP5A 1ORWA 3DBIA 3BD6A 2R6FA 4FDVA 4K9PA 4O4LB 2C5LA 1N6OA 1VGVA 1JDNA 1G21B 2W98A 3D0OA 1AQJA 1BN7A 5J4YA 4CQMD 1FP2A 1ZJ6A 4B3FX 1MO5A 1REQB 1VMAA 2VVTA 4DQ0A 2H4JA 3AQIA 4GM1A 1LLUA 1IQRA 3JY6A 2PQ6A 4ZT4A 2PHZA 4P86A 2QYOA 4QZVA 5HM8A 2OLKA 3UEOA 3F96A 2X4LA 3WICA 1ZA1A 3E1SA 3RVRA 4ZJUA 2FLKA 1ZLXA 1RXIA 3LBIA 3CPJB 3RF6A 2NXJA 5AI9A 1TM5E 2IHBA 4MEAA 5TMBA 3EJ6A 2RH9B 4JQCA 3JQFA 4RQBA 1RRPA 1TC1A 2CJFA 3WMXA 3UPUA 1P31A 3HDGA 3TSYA 2ZFUA 3EGXB 5FUWA 5IYZF 2Z9CA 3DP9A 2J0UA 1XAGA 4HDRA 5AT1A 5HFJA 4L4XA 2N1BA 1GGFA 2CUKA 3AETB 1JHVA 1MORA 3RJ9A 4EY7A 3NBYC 2FMFA 2W6JD 4K40A 1M6VB 5CLLA 3IV9A 1Q7EA 1YBAA 4DLNA 4FYIA 3N53A 4NBLA 4OHVA 1H05A 4C4ZA 3S1SA 1F60A 4RPHA 1DOZA 2R5WA 5HG0A 3MWYW 1ICIA 4BPRA 1PUIA 2E3JA 4OO3A 3V1MA 2GN2A 5AM0A 4DIOA 1K7XB 2JLXA 2H1IA 1CY2A 3ZHQA 1D1PA 2GPJA 4OP3A 1RBMA 3CCBA 3SC2B 1J25A 3BE6A 3PF9A 5HDQA 2ETVA 3AUFA 4PIVA 5JNWA 1FYVA 4LWZA 2JF0A 2HLNA 4FFMA 3TBKA 5FOQA 4KFUA 1QK5A 2L18A 3HVJA 3MJTA 2C4TA 2GEVA 2I2XB 3NAZA 3QWFA 2GM4A 1JLLB 3UCFA 4WT7A 1U1DA 1TT7A 3URMA 2YQ5A 3GAAA 4BBZA 1EI9A 2OSBA 4IKPA 2FLVA 2GUWA 4P53A 3HWWA 4R9SA 2PX5A 1ZQ9A 2JIOA 1KNQA 2E4ZA 3KJFA 1QKKA 5KYKA 4LHWA 1SBCA 2ZU0C 1JTFA 2G25A 2NACA 5LZ8A 1OKKA 4W1PA 1CRWG 2WHEA 2DVMA 2REBA 4RMNA 3HB1A 13PKA 1N2OA 1QIFA 3DO6A 3HB9A 4YJHA 4XWYA 3H9JA 2O7SA 3LU1A 3GFPA 2WWWA 3NM4A 4KIGA 1SR8A 3S68A 3AM5A 1U81A 2II6A 2C7BA 4RMJA 2WVHA 2XJ4A 2HA0A 2OBMA 3OFJA 3SCZA 3V6MA 3GLFA 4B34A 1L3IA 3U60B 3E9CA 1YS4A 2I0FA 3D54D 1WLYA 2WFZA 4EDFA 5FWAA 4ZOQI 2WQ7A 4G5QA 4HDCA 4UM9D 4MVJG 1Q15A 1R5OA 5CHYA 1I3KA 2PGOA 3VI4B 2PUDA 1JHDA 2FX2A 4D42A 2I7DA 1QWOA 4W8OA 2YBDA 5K3SA 3ZY3A 1WW2A 2IHKA 1G63A 1YB6A 2OCPA 2QZJA 3DAGA 4V24A 4GG1A 3I9KA 1I3NA 3EHDA 3OESA 3QWAA 2IH5A 2DWUA 3URKA 1ISPA 4Q9JA 1SO8A 2WFLB 3H5IA 1JXQA 1QAOA 4H9GA 2BTQB 5D85A 2FZCA 2O2JA 2WG2A 4G5XA 4WJKB 4AJHA 5JAOA 4MV8A 2SCUA 1Z75A 3E8SA 1V9CA 1C9MA 2A30A 4KQXA 5HZKA 2O52A 2OC9A 2A9PA 4GSKA 4HYEA 2Y27A 2HHLA 4ZARA 3JQAB 1Z63A 3L7OA 3MHPA 2OMKA 3RIXA 2H2AA 5KTYA 5K0NA 4PNPA 4M1KA 5F5LA 3E22A 2OORA 1NYTA 1I3LA 1RLMA 3OTIA 4NBVA 2ZR9A 3T0GA 2H17A 5A9TA 3R8CA 2FN4A 1GG8A 1DBWA 1H2BA 3H0EA 1HDGO 2FFQA 1YUBA 3VR5A 1PTJA 1YWGO 1I5OA 3FAZA 1TTPB 1GTJ1 1ZJ5A 2WFAA 3GN2A 3QJYA 5T4BA 1A7AA 2HNAA 3IEUA 3M1IA 2Y4NA 4YACA 5LC1A 1JYFA 1L4HA 4HH4A 2P91A 3NBZC 4A1FA 5LXTB 2WWGA 2A35A 1EUCA 3VYWA 4EF5A 1G6OA 3EUWA 5IZCA 1FBTA 4LV6A 3HCPA 5GM2A 2R751 1EM8B 2V6IA 3OFVA 4D8WA 4IUBS 4MUXA 4HAZA 2YWEA 5L3SA 3IDZA 1PGQA 3EVGA 5E6RA 2PGLA 2VYVD 1M74A 3D8TA 4JR1A 4GMKA 3VM6A 2ZDGA 1MAUA 4L4RA 2EU8A 3Q5EA 3B1XA 3MD0A 3TLGB 3A1DA 3R3SA 3BXZA 4Z1MD 1JIIA 3VTFA 3BZBA 2IVFA 2FE1A 4WA8A 2JVIA 2ZWIA 3B13B 2PN1A 3FKSD 1AKQA 4FYMA 4EFLA 4IX9A 1D4FA 1GPH1 4O8CA 4XGKA 5B36A 2VBIA 2ZE8A 4N9QA 1PJRA 4EJSC 2I33A 4DUPA 1EJ0A 2FWAA 3DOHA 5AFSA 1JEDA 1OBFO 2GLTA 3IULA 4CNQA 2CFCA 4UHKA 9LDBA 1FDTA 4HS4A 1OYOA 2DJ5A 3RC7A 4NENA 3I6BA 4QULA 3PPWA 3P94A 3OQOA 2IUYA 1HO3A 2V9ZA 4RNDB 3FUVA 5TF4A 2O7RA 3G2JA 3ROQA 1YC2A 1NBMA 3FYCA 3ITKA 4E5YA 5DM60 1I94B 2JH9A 3IR7A 1J0XO 2CWWA 2W8BA 1ZRNA 3ZYZA 1O58A 1U7WA 1Q44A 1QGED 3QFFA 3GFVA 2VLBA 4G0PA 2FQXA 1FF9A 1GEEA 2E4VA 4OQEA 3WRYA 2QVGA 4US2R 4DNXA 4DA4A 1OH6A 4V0NA 1RKQA 4REMA 4E30A 1HE3A 1T9AA 2GYWA 2WSSA 1DFHA 5GADl 1MN6A 2A9QA 5TB5A 1CRPA 2V3VA 3IUBA 5KNCA 1D6MA 1BS2A 1LSUA 5BSMA 4DSAA 3D8UA 1Z62A 1GAEO 1XZAA 3P9RA 4MIKA 5CYFA 3GDOA 3UENA 3K0FB 2VDWA 3H2JA 4KITB 1P0IA 3DPIA 4ER7A 2MSCB 4D4LA 2Q62A 5DW3A 3L8MA 3SBDA 2ZYDA 5K3EA 1QGYA 1R64A 2JH8A 3B6MA 3EPLA 5KYYA 1OY1A 4KCGA 1JG1A 3CYFA 2VF8A 3GJ4A 1RT9A 3MTBA 1XQXA 2N47A 5T8KC 1CZRA 1EINA 4RVOA 5L3QB 3PVZA 1NLFA 1VHLA 5ELMA 1ZVMA 2GAOA 5CYGA 3DKRA 3S2YA 1JDTA 1JDBB 1SUBA 1YS6A 3LW7A 1RABA 2Z2KA 1VPTA 3OM0A 3CNOA 3D31A 4J0FA 4RSHA 5JDCC 3A36A 4XX0B 4KKVA 3G2LA 3G5AA 4HUQA 2PSDA 2WT9A 3FRHA 3K4QA 4K9KA 2NZUG 5AJWA 4ZEXA 4PG8A 4WBSA 2B6NA 5DN6D 1GPNA 2D0PB 3U4QB 5G0WA 1N5MA 4L74A 4LRWA 2E4XA 2OHOA 3ETGA 4MCJA 4RFVA 2NUAA 4WA7A 5KJ1A 2ZTMA 2Q46A 4I14A 4MPTA 4MYUA 1RLUA 3DTTA 4MH0R 3DUFA 2H11A 3NOVA 2FPPB 4GOMD 1TJ3A 1VYUA 4YGYA 3CT4A 3BXPA 3FR7A 4XWGA 1V1MA 3GCDA 5GIPE 1WMEA 3GLGE 3QX8A 2QLNA 5SYMA 3BRQA 2CEAA 3BIXA 1RRVA 3TDNA 3BXXA 2WE7A 3JQGB 2NLOA 2CMDA 2VP3A 4N7BA 5CIYA 3DZKA 4N1AA 4DR2B 4CZ2A 1LPNA 1YL7A 3PXGA 1Y5NA 4EUSA 4MS1B 5A6VA 1QGUB 5M7EA 1NIPA 3FGOA 2WPDD 3A05A 4UW9A 1LQUA 2QL5A 5CGQB 2HHHB 5B57C 1V4NA 2WM8A 3ZV7A 3VJRA 2DPYA 4L9SA 3GWZA 1F8GA 3IPAA 1BIFA 1E7WA 3E9QA 1W94A 1SVKA 3IA2A 3I9V6 1RYMA 3MMZA 4KW7A 4WV3A 4E5SA 4DUGD 5H1YA 1L4FA 3N7AA 3PGMA 3R3UA 5L3RA 1AGRA 2QVYX 1FNDA 3L43A 3LT5A 3C3JA 3IV6A 3DCJA 4F38A 1P2BA 3X1JA 3KCQA 4AXBA 1J4AA 1NOJA 2BBWA 1T9ZA 1I14A 4QYIA 2GR9A 2QRMA 2YINC 1W5EA 3WNBA 1OFTA 4C7MA 4GW3A 2KHZA 1EDDA 4XYLA 1U90A 3MT0A 2P8SA 3NAQA 3PHHA 4ROTA 3WLRA 1JG2A 3LGXA 4QLAA 3TOVA 3X1MA 2G7ZA 4PZPA 1EWYA 1T6XA 2CXHA 1T8SA 4AS3A 4FFVA 4M8NE 5IFLA 3KXDA 1QQ7A 3TSWA 3NBFA 2ZATA 3X1WA 4RD3A 3ZD9A 3W5CA 4REQA 3DVSX 2XDQB 3L6EA 4OK3A 3JD4A 4BRZA 1XMVA 1N0WA 3A3NA 4ZALA 2GK6A 5GVSA 5J2TB 2QYTA 2LXNA 3JYPA 2V6BA 4IYJA 4C7OB 5LDHA 2JEOA 3K2IA 1YBMA 2X2EA 3EQ2A 5BSKA 3RSFA 4URWR 2ZTUA 2DR2A 1H0HA 3QY9A 1SG6A 4G8CA 3OY2A 2VDUE 3EEFA 3I32A 1KEKA 1N78A 4U8HA 1GKIA 4JS0A 5ICEA 3ANXA 3N2GB 3N05A 1YVRA 4KAAA 1ZM2A 4R1MA 2A33A 2ZS8A 3ZHVA 4UQLA 3LCRA 3M5WA 4AJPA 1P9NA 3ZGVA 3FYSA 3K0AB 4EF4A 4JX8A 3L7AA 4WOJA 3GGOA 4AUEA 2ZJFA 1FDSA 3Q0EA 1J5XA 3EDMA 3LQYA 1EFHA 3F98A 3P71T 1SIWA 3PHJA 4IW3B 4MITA 2C5FA 5LP6F 4NDNE 3T9FA 1JU3A 4FHZA 4E5PA 3FYUB 4TUYB 2JKVA 3ZXUB 5H8WA 3BWBA 1AK2A 2VFAA 3R41A 4BLTA 3OUUA 1SB8A 3INGA 1W48A 3OETA 1BEEA 1FTNA 1DTWB 2PTHA 3B70A 2C1EA 4G84A 3TO5A 1E4EA 4YDRA 1E92A 2ZRJA 4V3CA 2YXDA 2C7VA 2OXTA 4Q19A 3ZWQA 1I7PA 2Q6OA 2GESA 2Z95A 5THKA 4QNNA 1OHHA 5CA0B 5IJ0B 1KYYA 3OF5A 5JS2A 5T7BA 3RGGA 2EGUA 2HCFA 3ANSA 1OI3A 2HSZA 1WETA 1VZ3A 1CYEA 3BZWA 2CN1A 2QTVB 1PSDA 3OEED 4KO8A 3N70A 2GPSA 4BTLA 4PCVA 2ZCJA 3RAEC 4A36A 3H11B 1GILA 4G07A 4AU1A 2XMRA 4BXOA 3VDQA 3IKLA 3WK5A 1P1HA 3A9VA 2GK3A 4JEIA 5HUHA 5T41A 2PXHA 1G5IA 3RVLA 5KHOC 4QE3A 3ISJA 4NFLA 4B8WA 2RH8A 4WQMA 4L6CA 4V3BA 4WN9A 1NQTA 3NVMB 2W6IA 4HDNB 1RPNA 3OOHA 5HDBB 5JMPA 3K6SB 1E7YA 5FOSA 2ZUEA 4MROA 3V34A 4RA6B 5UKDA 4ERNA 5FP0A 1L7MA 4Q37A 4E7PA 3RO7A 5JAIA 2WZBA 1FSFA 4AJOA 3OHSX 5AW2A 1DELA 3G2NA 4AG5A 2J5BA 2P2CA 3WLLA 3QKRA 2UUOA 1W1IA 1Z08A 4NZMA 1Q0TA 1M1NB 3K3PA 5I47A 2ZJZA 3ETEA 5DVZA 5E3HA 1UPXA 4IIFA 3F2IA 2GZMA 4ZT6A 4P92A 3ODGA 4NZ9A 1YB2A 1QH8A 1CXZA 2HWUA 2H6EA 3I1FA 5TX7A 4CQJA 1E6UA 2IU4A 1N9KA 4NPCA 2FPGB 1SQGA 2WF9A 2VJDA 2IYLD 4LV8B 5F9MA 4LJ9A 5DCYA 2FUG1 4BPBA 3AUKA 3C43A 1TEHA 1XRLA 1M1ZA 4WEOA 5DEIA 1PN3A 5ANRB 2AKAB 3GA5A 5EZSA 3X1DA 3VDMA 5CYPA 1T4MA 1EGAA 1JG7A 2WU0A 4L4SA 1P2SA 3LG2A 3OE4A 1BE1A 2C92A 2BGRA 4JXKA 5JD6A 1LB1B 3V8PA 1U4NA 1LS6A 2I3AA 3TTXA 3OT1B 4KLNA 1WQ3A 4BB6A 5I7RA 3GLHE 3K0SA 4MJ7A 2F1KA 4YRLA 1U0SY 4A3SA 3GJSA 2OFPA 4P5DA 3P4UA 4D9GA 4MWGA 4UM7A 2R96A 1T35A 4CMCA 5BV1A 1BD3A 1VHQA 4A10A 3OAAA 5JH7F 3TZ6A 2R7LA 3GJXC 4J2OA 4S1VA 5C1OA 2JLQA 1RI4A 1DKMA 1KQ3A 1QFYA 2GA8A 1DARA 1O9BA 5HYVA 1EXNA 5D5HA 3JQ8B 1RM4A 3N0WA 5G3YA 3JYHA 2NV6A 1SXJB 2QHXA 3U49A 1KETA 2H7VA 3C85A 4O4HA 3W9SA 4DV3B 5JV5A 2D06A 3G0DA 2HD4A 2Z8YM 1CTQA 3ITEA 5DBHX 3NBUA 1YB1A 3B6JA 4YRIA 3D2LA 4BE7B 2YV1A 4QQKA 3RYFA 3G0OA 1CR0A 3R3HA 1KZYC 1VJ1A 4BZWA 4V1CB 1DJMA 1SKYB 4DA7A 4EG1A 4R1SA 1DT3A 4BO6A 2XXAA 3I6MA 4NMXB 4NFYA 2JLCA 3ZWDA 2GM9A 4PG6A 3CW2A 4KE8A 4PN7A 3F1LA 1ZICA 3OG9A 4POAA 2M6SA 2SBTA 3P32A 4EA7A 2EYUA 3I37X 4EYOA 1EVIA 4KYVA 2RGNA 3LQKA 3SJAA 3FKQA 4P54A 4FUTA 1VBKA 2O59A 4YYZA 2F8LA 3JVEA 3MB5A 3V7FA 1BRMA 1P91A 3IOMA 1Q22A 1XRMA 4Q6BA 5IF3A 5JNTA 2ZULA 4J49A 4YPVA 4F1WA 2Z3VA 3M4XA 1HA3A 3B1ZA 3DNFA 4TRRA 4LF5B 5HWSA 3EG9B 4RHXA 3CLUD 5AM5A 3VPAA 1CJBA 1XN1A 3L4EA 1DOAA 4DNPA 4LHSA 2ZYAA 1Y8AA 1U0NA 3PTLA 5EJ9A 3EVAA 1QIDA 1KAOA 3H1PA 3NTLA 5KKNB 1DKUA 3RU2A 1CQXA 2J5XA 4J0GA 4XD7A 5IEBA 5M5BA 3EPKA 3DLTA 1YRAA 4HWTA 3RARA 1TVCA 1PNVA 3UN1A 4OPMA 4IOLA 3WJ2A 1V3TA 1M10A 1NW8A 1G17A 3IMFA 1DJPA 4BWVA 3CKYA 3D2AA 5F2OA 3LRXA 5IWCA 4RK0A 1E61A 1P5FA 4Y6SA 2PVPA 3GAMA 1H0SA 3O5AA 4UHFA 2BFNA 3CLUC 3DVAB 4FN4A 2BY4A 4JP8A 4ND7A 5DEOA 1VDMA 3AI3A 1OV6A 4N7RA 2NVOA 1A5ZA 1ITZA 2HADA 1C9NA 2Z1MA 3SX2A 4FJ2A 2JCYA 3S2SA 3VH4A 1PWYE 3FCAA 2WM3A 3U2QA 3HJTA 3D3NA 1S2LA 4FZ3A 1ZMRA 4KODA 3VX4A 2J48A 3FNQA 3G1TA 5HILA 2YMPA 3F4BA 1K68A 2A1UB 2QW8A 3F3YA 4I4TF 3UHJA 2CLHB 4NL4H 1MO3A 4JLAA 1P1BA 4EHIA 3IMGA 3O31A 4MARA 2HLDA 4PAMA 3V33A 4OTZA 3GUVA 2BZSA 3MAJA 4EITA 3AEKA 4POOA 2FW7A 1JSLA 2KM1A 2QZ9A 2Z30A 1HDEA 4KXQA 5E6UA 3WB2A 2QENA 5JDIC 3EZYA 4L5IA 1C1XB 4JBIA 5DGIA 2VI5A 3ZBQA 3GRUA 4OJYA 2Q3HA 4XTCS 1Q0UA 4LYHA 4HQNA 3O7MA 4TL7A 4Y2PA 1SUDA 3CVXA 1ZD5A 4K26A 5DK4A 2YXNA 3QKIA 1P7ZA 1NUSA 2XF2A 1E2HA 3OKAA 2YOFA 4L9RA 2JEYA 2SKEA 3IQXA 4LYFA 2RI6A 4A23A 3DFFA 4G1MB 2HRBA 1W93A 4WXYB 4Y6RA 4BQSA 1Z07A 5SYNA 1G7RA 3AIOA 3T3DA 2MHCA 3CBGA 4L9WA 3FRJA 3I2GA 2J9XB 1Z7WA 2C9CA 4I2NA 5DLYA 3MCZA 5L45A 4DQKA 1PZEA 1XIVA 1DCMA 2AOXA 2WHYA 2QX8A 4KQHA 2CFOA 4PSAA 3PGXA 4HH1A 3TK1A 9ATCA 1EZ4A 3NWBA 3Q8XB 3LK7A 3FB1A 1W52X 3LX8A 3AY0A 3P9QA 4IIDA 4YLYA 3B52X 1CE8B 4BEJA 1PQPA 1MVLA 2PLRA 4RKFA 4Z7QB 2ZQYA 4WASA 1N4AA 2VEDA 1E1DA 1G7SA 2FVYA 1YGPA 3M3PA 5JEEA 1VE1A 3BPSA 1EHYA 3EIWA 3BWMA 2Q4TA 1NI4A 1XMJA 3DNMA 4NCNA 1EX6A 1P2TA 4S0ZA 2EFJA 3VYTB 3GEDA 2Q1UA 4OHFA 2YKGA 4KN9S 4MUGA 2B30A 1BCSB 1YR6A 4E11A 5ALYA 5JRJA 4IVNA 5HIKA 4PZAA 5HRUA 1N5OX 2VP4A 2C42A 4JVSB 1UXHA 1UP7A 1J5EB 3ANTA 3S44A 3AHJA 4G8BA 4BGEA 4FN5A 4I4NA 1NN0A 4GZ6A 1JR3D 4KXVA 5EIBD 5TNXA 2MSWA 3SKVA 3SHTA 1YCFA 3QVJA 3B5JA 3WQSB 4N5MA 4LSZA 4YX9A 4GOND 1QRSA 5JNRA 5K6AA 4JKIA 3E23A 4H3KB 1JR2A 4ZV9A 4JXZA 1JJVA 4P3OA 4U5QA 2OV6A 3ROKA 4M7PA 3RR2A 5M2QA 3ONEA 2NUTA 3MCUA 1WNTA 3KG2A 3TM5A 4R9NA 1VMEA 2FMUA 4QJIA 1KI8A 1NJ8A 2MINB 2W6NA 3TKYA 1DMSA 2HHCA 1ODCA 3EAFA 3SZOA 3CGGA 5DBIA 3VTKA 2IU6A 2W48A 2ZJ1A 4BLPA 4DGQA 1ZJWA 4I9GA 2XZOA 5LYJF 4BNGA 2IT1A 3HP1A 3QVKA 4GLOA 5EIBC 3BS4A 3SC4A 4C04A 1L2TA 1QRDA 3D3EA 1GT6A 2Y1LA 5LXTF 4ZI2A 2BEUA 3OZ7A 1FMFA 5AKIA 1HYGA 1MU0A 1OXXK 2VSFA 5DGDA 5JAQA 4X20B 3ZCPA 5B3KA 1A9RA 2J9FA 2QM0A 5I4KA 1UDXA 3U40A 4AYWA 3EHEA 2BDEA 4GSYA 5DX8A 3EBLA 3ZDBA 3GLVA 3AB8A 3K5PA 4H4DA 4K0RA 2FDCA 1KRHA 1GNLA 2ST1A 3PHIA 4E1AA 1JFRA 3R0QA 2P62A 4M1MA 2Q1XA 2ZJBA 4GR4A 3GZNB 1EX1A 1RYEA 3A1EA 3F6CA 4MIYA 4OHWA 1W96A 3DHVA 3B48A 4MQMA 4JI5B 1T1IA 4CMEA 1S02A 3ZN2A 3U3RA 5H70A 1VJCA 4GX5A 1UFKA 3PKIA 5TV2A 1R3UA 3ET4A 2C94A 1G16A 1I2ZA 1NXSA 2QT1A 2OXCA 2LTAA 1I8TA 3IE2A 3F2VA 4MWCA 2JI8A 4KQFA 1B1AA 2ANBA 4ZGGA 2IBSA 1APBA 4YMSA 3R8XA 3L84A 3CW8X 1NG9A 2DWCA 3JQFC 4MKRA 3DBHB 1HUQA 3BKXA 4IDQA 1H5QA 4GRAA 4H6VA 4FGJA 2R25B 1PFQA 2QN9A 4Y67A 3TRKA 5LMCA 4N03A 1MQAA 3IR6A 4O1MA 1FRVA 3TCKA 2IEZA 3D4IA 3TN7A 1KKMA 1RP7A 5EJ4A 3OCCA 1Z16A 5CDTA 5IJ9A 1IBSA 3N3AC 4FYVA 2IXTA 2MIIA 1BTOA 3DDHA 3UAXA 2Q3DA 3RV4A 1YACA 3OE5A 4LHVA 2I62A 5KQGA 1ZD3A 3WI7A 5IRCD 1ZMBA 1TJ5A 2D7CA 5CJ2A 3B1JA 1OKKD 2CV2A 3H13A 1Q1GA 3AR7A 1F9AA 1KVUA 4HMQA 2VOEA 4Q03A 1SCJA 1W36C 2DPHA 5DLDA 2WHRA 2PAAA 4FDUA 1SVWA 1O95A 1PFUA 1ZNXA 1E64A 4UUNA 3AEYA 2JGNA 3UJPA 1FLNA 3KSMA 3DEYX 4MR7A 5ALPA 1XAHA 2G72A 3LIPA 2X0RA 4GPIB 3CE6A 3LHIA 3TJZA 1SY7A 1NP3A 4YMWA 2BL4A 2RK3A 3OO0A 4DQLA 1W2WB 1H6BA 2NXEA 4JGBA 4LBYA 4MWBA 4RTNA 5C1PA 1CUHA 1SU4A 4BAUA 4HDKA 3IUQA 1SCUA 1H5NA 5JCOC 4NRDA 1S3FA 1RPTA 2P6OA 2QGNA 2AEJA 2AN1A 2NVWA 2DE0X 2X40A 4LI0A 5IVIA 3OZCA 5IT0A 2HRRA 2NXWA 1J33A 2FPRA 3PFGA 1N25A 5K3FA 2IYPA 5K8LA 2D54A 4U7WA 4M9CA 4UXJA 4DMUB 3GH3A 3STWA 5K0SA 5CVTA 3G9ZA 3WL5A 1FXUA 3BD9A 3F49S 4MVXA 4RWZA 3RS2A 3K8OE 2CNDA 2ZRHA 4QA9A 5L3ZA 4O25A 3UQZA 3GG9A 3WL6A 2XKKA 3IP7A 3V6LA 1R0YA 2C2KA 1U9ZA 3W8NA 1LA2A 3A6PC 5A6SB 1KZGB 2O8FA 2R00A 3TLMA 2FHSA 5B12A 2GEJA 2NN3C 3C6BA 2Y1CA 4AKTA 5JCXA 3A9CA 5CX4A 1ANKA 2FF7A 2VP5A 3PFIA 4G3XA 4DV7B 1U8TA 2A0UA 3L8GA 2I9KA 4OG2A 3TW8A 2ZB3A 5HF8A 3TIXB 4F97A 3RFXA 2Y66A 3IA7A 5AVTA 1NM5A 2VDRB 4YV0A 2AH5A 3V1KA 4AP5A 3GJTA 1E3WA 1WCV1 2F64A 4Y1GA 1A9OA 4EG4A 1SOUA 4EG6A 4G0UA 4JR2A 4FMCF 3VR5D 1TYDE 1E99A 1E0SA 3PCXA 4ZANA 4YRMA 4DKJA 4MTLA 3ZWCA 4M7RA 1X8KA 2PX2A 5ES3A 2PBFA 2O1SA 2ZTLA 3H3XA 2QUAA 3AF2A 3SD7A 1H0RA 5IT4A 1AH2A 5CB0A 4RK5A 1C9DB 5E7MA 3KVOA 3NI2A 2OORC 3IP3A 1G2QA 2TRSB 3PNQA 1V41E 3HJRA 3A6LA 2DMRA 2Y2VA 4B2IA 5JI2E 4RAOA 3VOTA 1I2MA 2XTAA 4FS8A 4E33A 3R9WA 1S9HA 1JTEA 4QDOA 4GP6A 4MK4A 3IL2A 3G5UA 4UJ3A 4QXOA 1PTJC 1CS4C 1UDWA 1K9VF 2IYOA 5IAKA 5K3CA 3HABA 4HN9A 2XWJI 5ETJA 2GAIA 2IRWA 1P61B 1JLMA 1Q3TA 1LCIA 2K7ZA 5FXMA 3P20A 4G89A 2COUA 4FEAA 5J2TF 4BU1A 5IZCC 2PBRA 2VKTA 3AV0B 1KJWA 4OMDA 4P3XA 3VHLB 4AMYA 3O8QB 1WBBA 1W47A 2UYGA 1O77A 2WFMA 4MB0A 2ZSDA 2EARA 2Q5FA 2X7XA 3BSFA 2HMUA 2HIAA 3GPDG 1Z9BA 3WYFA 2ZSEA 3PKJA 3CWCA 3RJTA 2CXSA 3VNSA 1L4MA 5B1SA 2I4MA 1NBMD 4HK4A 5CNIA 2R87A 1PJTA 2Z98A 3EB9A 4ZYZA 1E2EA 1HSOA 1NNI1 2BMEA 3OIUA 3ND8A 1Z8HA 4A6PA 1GSOA 4ILEA 3OQIB 3NXSA 3UWMA 3U7QA 3MD9A 3I39X 4E2ZA 1P4JA 3O26A 1DKQA 2YJNA 1FX1A 3DFKA 3ZQJA 4PW0A 2A92A 4C0LA 5LWHA 4F93B 4DC0A 4BNJA 5A4DA 2FDRA 2WSSD 2EKBA 3MEQA 1AF4A 5JRZA 3X43A 1JILA 2DU8A 5J40A 4PHFA 3KAPA 4INZA 4DIDA 4TZKA 5KNCD 3CNNA 4PINA 4M1QA 4WHMA 5EIFA 3RT1A 3O47A 4ZEWA 5CDGA 2XCTB 2HDHA 3JCZA 2ZE7A 4U9UA 2HSJA 4YVFA 3CEAA 4Y6OA 4D9KA 1E59A 3L07A 3V48A 4KZKA 5LQCA 2JGJA 4QM7A 3SNKA 1IJFA 4MVJA 5A5DA 1N4DA 3I09A 3IRUA 3U61B 2E7ZA 3GP3A 1ZM9A 1XRPA 1QRUA 2V5AA 2GK7A 8LDHA 3OC6A 5IDQA 4HWRA 2HGZA 4TS4A 3LKZA 3L8FA 3KSDO 4X1IA 3VOAA 3GLQA 1H4VB 2P5YA 3LHDA 4XQ9A 4OKSA 1P9LA 2IYWA 3VU8A 4PCLA 3GLIA 4N0DA 2YXBA 4BVLA 2Z6UA 5L7YA 4Y2TA 1M54A 2JIPA 3TLCA 4C76A 5HXAA 4WNAA 1VYVA 2WK1A 5F52A 4NBWA 2QA5A 3AVPA 1RRFA 4MOWA 2Z6AA 2JFYA 4WZBE 4YCDA 2QL9A 4OI0A 2IP4A 1BKYA 1ZVJA 3L6DA 3ORFA 2TMKA 1UBTS 1C30B 1G3RA 1GTL1 4MKHA 5D84A 5LNK6 2WMYA 4RPCA 3B2QA 2FUNB 3RQSA 2B8TA 5FBZA 5FUMA 1K63A 4HDAA 3OPXA 5AHXA 2O48X 2ZBDA 5GOZA 4LYAA 2PRIA 3M4JA 5C7IO 1XL0A 2Q50A 1RC8A 3D6AA 4JNKA 4LNAA 5CX1B 1NSFA 2JCGA 1M6NA 1R0WA 4M54A 3TD9A 2MJLA 5A3RA 3PQ8A 4HQOA 4UM8B 5KOYA 1DRKA 1XZHA 2C82A 5HIIA 4JR0A 4CIDA 2AQKA 1PCXA 5D1HA 3P9YA 4DGSA 3JV7A 1N7GA 2BKUA 2WLTA 1V45E 1NE2A 1RIFA 4QTXA 1VLLA 4RFSB 5AI4A 1TVMA 4R8RA 5HCUA 1JJ7A 2COEA 3PCRB 5D3QA 3HQ4O 4I9HA 4M86A 4NCKA 2XZLA 1I6WA 3F0TA 4UTOA 2C98A 3LXXA 5FTKA 5HIJA 1G59A 1EHCA 1LC0A 3ZKWA 4N8EA 4Q3DA 4B6OA 1XUOA 2F43A 1M34E 3EGEA 2Q6LA 5C1IA 4I1UA 1SU6A 3JD2A 3LQ1A 1M33A 4P4NA 5DTEA 2IBTA 1TA4A 2GWHA 1MOZA 2JZOA 4W5NA 4NZOA 3H5VA 4O63O 2PUVA 4RPIA 1P0FA 5L6LB 1XZKA 3HYLA 1SG0A 3N7UA 2DECA 5ITWA 2R6DA 4C7KA 3NWOA 3OLXA 1ZJZA 3AP3A 1R1DA 2AOUB 2OO5A 4C6TA 2NPFA 4RL6A 3ZD8A 1JFTA 3PC4A 2LKCA 3NAMA 2BD0A 4OU4A 3QG5A 4IDPA 1WSAA 2BH9A 4ESEA 4MDFA 2IUTA 1NN3A 4ISCA 1EK6A 3ZJTA 1H2ZA 2GXUA 4HXYA 2NXCA 1PZGA 3HUTA 2NO5A 4J91A 1R27A 1K7SN 4R51A 2B4QA 4Q7JB 5AM4A 4KWIA 3U13A 5DFAA 2P9BA 1Z45A 3AVWA 3ANYB 1FQOA 2EBFX 3STUA 4HAVA 2IVZA 1DS6A 4BCBA 2K7FA 2X13A 3BDIA 4H7FA 1E2PA 3TXXA 2PH1A 4MXDA 3WTBA 3TD6A 2HAEA 3PI6A 3W9BA 2GZSA 4OMUA 3S4YA 4ENUA 5EE9A 1T4CA 1U28A 4RIEA 3NORA 1PL8A 1E69A 5HR5A 5FPTA 3ZEIA 3HJFA 3SQLA 1V37A 4LC1A 4ZICA 2YCLA 1TU0A 3KB6A 4EW2A 3AH8A 4P38A 4Q9AA 4R54A 1S2DA 2NUBA 1OHHD 1Z4NA 3ZHYA 4OJQA 2V7GA 2OXRA 5F1OA 3RU3A 5BVGB 2QGZA 3GEMA 4HKTA 1QANA 4J4BA 4F6CA 2O0JA 2A9JA 2ZB2A 4C3UA 3NC1C 3S5UA 3NDRA 1DAGA 2ZJ6A 3OJFA 1UT5A 2GKGA 3WWYA 1T26A 4RFLA 3D7SA 4RYDA 4XXHA 2WABA 2WKSA 1HTTA 3F6PA 4B83A 1KP3A 1IM8A 1EFVA 5B55A 5BR1A 4LISA 4IHJA 3I1IA 4BNVA 3FDFA 1ISHA 4X7MA 1ZN7A 2W6ID 5BPHA 2W2KA 4Q6WA 4KFSA 2HFKA 2VK4A 2V74B 2ZT8A 1N7JA 1X7WB 3WK9A 4M89A 1IDOA 2D0OB 2IPMA 2AXNA 3JYLA 3O4FA 1FP4A 1FZQA 2JLSA 4I8XA 2OD9A 2P9ZA 4WKNA 1EQUA 4F3TA 4PG5A 5L3VA 2GN6A 2G06A 1EDBA 2NU8B 3K9GA 4H18A 2VP9A 3V2UA 1JAHA 2XA1A 4IF4A 1N77A 1N34B 1T1EA 2JI7A 3PYXA 3SYMA 3D8RA 1YZGA 2F3TA 4M36A 4Q01A 3WLKX 3THWA 4DLUA 4N65A 1ONSA 3ZZUA 1GV1A 1C3JA 1R5NA 4K9SA 4EY3A 3U39A 3ZTWA 1GUBA 1YJXA 4M0CA 3E9YA 2H7XA 4O4IB 3RHFA 4D6YA 2I1QA 3EH2A 1QIKA 2HSDA 5DHRA 4DRZA 1N0IA 3PGKA 1U8YA 3WDMA 3WLEA 3DQPA 2B9EA 4FSDA 4Q1AA 3ICOA 5E1BA 4DZTA 3GLGB 4Q4AB 1H2RS 4CKCB 3FOWA 3E3AA 1B8OA 4NFHA 1VCNA 3KLOA 2JIMA 4IWYA 4K6HA 4TSFA 2Q3MA 3S1LA 3QKWA 3ZWMA 1N3BA 1Z29A 4QXMA 3VYUB 2JLWA 2GEFA 2ZTVA 1AZLA 4LNUA 3V7UA 1UIRA 1YBFA 2BCEA 3JASB 1KO1A 3KU4A 2CBXA 4DBLE 5G1NA 3OQMA 4JXXA 3RYHB 3GT4A 4QTUB 2BP7A 2PKCA 3AVOA 1UDCA 1HYQA 3OAAD 4GWLA 4CEHB 4YJKA 3CLRD 1NVVQ 1PD1A 3MTJA 1NQVA 2FFBA 4COOA 1LPMA 2ODTX 1LV8A 1V47A 1V5GA 1P1IA 1OJLA 2GN1A 2RK6A 3O4GA 1AGPA 1PG5A 4IH1A 4YCAA 1OU4A 421PA 4ESVA 2RONA 2YUIA 1KIFA 4ENWA 3ZH9B 3JVIA 4B4KA 4EP1A 4ASUA 2VZ8A 4UREA 3ZQ6A 3TQIA 2CDAA 1ODFA 1YZ3A 2YZKA 1G9SA 1D4OA 5EKTA 2I7XA 3JWEA 1LQ2A 2FW1A 3BFXA 3FYHA 3HUUA 1M2NA 1H5UA 3QMWA 1MW9X 4RA9B 4RENA 4RSRA 4F2HA 4TVSA 3FGPA 5CTAA 5DIFA 1MAWA 1C8KA 1JDSA 1XWWA 4RKYA 1BG6A 1IZ7A 2QDXA 2OCAA 3CLRC 4JBLA 5CK4A 1TA9A 4MAMA 1SD1A 1Z7BA 2IXAA 1RU3A 1NUTA 1PSWA 4N3BA 3U17A 4DDMA 5IAGA 4CRWB 5FPKA 1R4NA 1EXWA 3G02A 5FI0B 4X00A 4I2VA 2N42A 3FDJA 1IEXA 1Y80A 4D0GA 4L0QA 1PL6A 1U0GA 1XKXA 3CTMA 4W1RA 2LDXA 4R3UC 1TCCA 4YCJA 1EG7A 1JA0A 2ZIZA 2Q6VA 4B1FA 2POCA 4BX8A 1XCMA 1Z6ZA 3ND5A 2ZGVA 3OPYA 4KQGA 4DC9A 1FSGA 1NJ6A 5AW6A 4ERXA 5BOSA 5KYUB 1PLKA 2W42A 4DS3A 1I7NA 1LBIA 3HM2A 2B4KA 4H0FA 2RKBA 4ZOLA 3DLCA 1VHDA 3EDOA 3OCWA 4B8ZA 1P5HA 2EW2A 1X9GA 1Z39A 3Q98A 4Y9SA 3NHJA 5ERYA 2BKVA 4OUDA 4XD7D 5I7WA 1VB5A 2OHXA 2RGNC 4J16A 4YGXB 4HDOB 4MS4A 5EE5B 1X1DA 2WJHA 3QLTA 4XRGA 1E3TA 2X3YA 5DWVA 2V65A 4B3JA 1L8QA 5DBOA 3FLAA 2NXNA 4UAUA 4ZHQF 3WQRA 1H2YA 2PT9A 4PSVA 3R9KA 2HA5A 3OH8A 2DERA 3TZKA 2KW5A 3IDFA 2FP3A 3TJMA 4D96A 4F4JA 2H3HA 1B4DA 3QF4B 1YR1A 3QE4A 3ZXYA 4H0CA 4DKXA 3CX7A 5BURA 1E7MA 1A2OA 4D9JA 1XZIA 5B30A 1Y9ZA 2FW8A 1T6BY 3MQ4A 5E2AA 1AK9A 1MRNA 3F5MA 1T0HB 4UZFA 4XDGA 1D3AA 3EMVA 1UINA 5AJYA 2BDTA 5DHUA 1IWBB 3HE3A 3DOFA 1B0AA 5B4VA 2NM0A 4G5SA 4BRWA 2AIRA 3SZRA 5SY6A 3K9LA 4E0BA 2HLDD 3ZNPA 2WJGA 3KVVA 3A32A 3WYAA 2Q5IA 3HP7A 4MR8A 3ZWBA 1M7GA 5H9VA 4C2BA 2XIQA 2AXEA 1UBCA 5LLDA 4W82A 1AQLA 1DKPA 1N3YA 2HJSA 3ORQA 5DYWA 5FTNA 2HGSA 5T5QA 5CCXA 1H85A 1AGXA 3ILVA 3BMNB 1WF6A 3C3DA 1ZHOA 2AOTB 5EIAA 3VAZA 3MFYA 2VPWA 3WWPA 3M1AA 3W2EA 1JLSA 5IJWA 2C4NA 3BE8A 4FDMA 6NULA 1GUDA 3L0ZA 4DJJA 3HUDA 2UXCB 2QMZA 3PC3A 4BFCA 1QYDA 3MTQA 1K27A 3LFHA 1DRWA 4PTYA 2QZPA 4XWAA 3UY4A 4D4HA 3EY4A 1QOPB 3I73A 1VRCA 2KS6A 5F3DA 4NYIR 2B92A 1IN6A 1XVLA 2HT6A 4L9AA 3TR0A 1R6TA 4PCAA 3HB5X 4MA5A 4BLQA 2HLPA 2Q5EA 3EMDA 3I52A 3DMYA 4KGDA 4NAHA 3I8XA 3E58A 1ESDA 4TGLA 3U3MA 4N7JA 1Y8QB 4V0SA 4D0LB 5COQA 3EMKA 1UXOA 1RP1A 5LU8A 5T3YA 3LQFA 5BT9A 1NYQA 1ZITA 3TYXA 4BKUA 4M9UA 4HPWA 1S1CA 4O4LA 1G21A 5JZVA 2R8YA 2Y99A 3AO0B 1J42A 1STOA 1ORDA 1IOVA 4QJBA 4QOFA 5DHPA 4Z9AA 4B48A 5K0JA 1REQA 2I1VB 5EP2A 3ZDXB 3B53X 3EA4A 3HU1A 4A8PA 1A71A 5LPNA 1ZRSA 2O1WA 3KC2A 4L78A 3IQFA 5IN4A 4DG9A 1ECGA 1SCNE 1U0HC 4J94A 4MQUA 2AXPA 3L6UA 1U3TA 2XX3A 5IANA 1HDYA 1UEIA 5A7HA 4FHDA 3TFQA 4Y1FA 3OWXA 1JE0A 1CWUA 2XA9A 3CR7A 2FOLA 1QGZA 5G0TA 1JJAA 3RFTA 5HX7A 1YTUA 2C2BA 3VGPA 1UPUA 3IIJA 1XU9A 1GSIA 1DAHA 1F0NA 1K6IA 4HOYA 4OHMA 4TVKA 2W22A 4ZQIA 3VSBA 1XD2B 2H18A 4JCCA 3JTMA 3LVFO 5AK6A 2WYVA 3SQNA 1ZNWA 4F2WA 5CXSA 3AETA 3RHTA 4QLOA 5C9ZA 1BXKA 2A0WA 1M6VA 4IHAA 4KNWA 4NYJR 4QPPA 3QUTA 2CHGA 5JYCA 1OIWA 4PFSA 4KDFA 4X6YA 1UKZA 3TXAA 1RKBA 221PA 1K8YB 4FD2A 2BEKA 4EHFA 2WC1A 4X1KB 1WM1A 1E5XA 2M32A 1XZQA 3CNLA 2GEUA 3DTNA 4X45A 3ZI7A 4CMIB 3ZCSA 2P2DA 4P3NA 3ZHBA 5C46F 5DT2A 4RVCA 1T3TA 2H1HA 5E7IA 3SC2A 4ALJA 1ZESA 2VHCA 3CZAA 3UTCA 4IRXA 4L8WB 3UWDA 1NVMB 2ZWOA 1GU1A 3LCCA 3ZHCA 6Q21A 5IU6A 1V43A 3EOBI 1ZC4A 4PZCA 4RZUA 2PMKA 5CLIA 3ZPXA 4XUEA 5K6AC 1NVEA 4B3HA 3FCOA 1KYVA 4RL4A 1JLLA 1NU6A 4KGXA 2C4KA 2AFIE 3Q3GE 2Z43A 2ET6A 5JEDA 4P4UA 1DRJA 2ZJ7A 3H9QA 3RIMA 1PJZA 2C00A 5KQRA 4X92A 3BIFA 2IYZA 4XQGA 2VP6A 2XVYA 4PQFA 4H6WA 2BFDB 3T15A 1Q74A 4D9EA 4O5OA 1CRLA 1P0MA 1QBKC 4M8SA 5EUBA 5JUWA 3B1WA 1QU2A 2HLHA 1DWUA 3QTLA 4TMZA 3SJ7A 1NVWQ 4XW2A 4NYMQ 5ER9A 3DVLA 4RTKA 2H1OA 4JYAB 2F4NA 2F3QA 1RHKA 2FSVA 3RS5A 3LX6A 2AI3A 2WZCA 3IT3A 3QFRA 3DKVA 4JQOA 5JC8A 4AC9A 1Z12A 2PSJA 3GDHA 2CXTA 2GCGA 2X8AA 3AG6A 5CU7A 2Q5LA 3O94A 4KR9A 3H6KA 3FCSB 3IEMA 3H8VA 5E4JA 2W0MA 1IBCA 5AHKA 2JZCA 1XXHE 3QVMA 1A9PA 1NFFA 2H16A 4MGKR 4OXYA 4RE5A 3VSEA 1PL0A 1HM5A 4MIOA 3HBNA 4ZCMA 1F1BA 1UZAA 3GB9A 4CMHA 3P9SA 1ZCFA 1U1IA 3FSGA 3NRBA 3NZEA 3ZDYB 3U44B 4LOJA 5F9HA 4US0R 3F1KA 1W4AA 4NX2A 1EB8A 4H4CA 4KXLA 4OOEA 1ESZA 1GEGA 1PFKA 1ULAA 1J9EA 1VA5A 3ONDA 4PLZA 2H1LA 4CMEC 4R6WA 4E2WA 5JS7A 2WFLA 4CW7A 2GD6A 4EW3A 5HHTA 1MRZA 2BTQA 1WZNA 2ZRQA 3GJRA 4B7AA 1X6VA 2EEPA 4L2IB 2H06A 3VBCA 3A0RB 2LIPA 2CK3D 4O2BF 3ROEA 3TRJA 4EFMA 1GPDG 2GT1A 4UOQA 1FP1D 3TTVA 3LA6A 4RJKA 2XOKA 1D2RA 3VPBA 4HLUA 2ADMA 3ZIAA 4JGGA 3JQAA 4IZ6A 4JYPA 1J9GA 1AQIA 1G6Q1 3HO6A 4TTPA 5B2EA 1HDCA 3K0EA 4J7UA 4X7BA 1P2DA 1BOFA 3GRYA 2J5QA 5EXTA 1W9MA 4Q24A 4GI3A 2B8JA 2D8AA 2QVCA 5ALFA 5GIOE 2HBRA 2C5EA 4Q3KA 3BBLA 4H16A 2GBGA 2ZIWB 3JQQA 1W4CA 5C4IA 4K05A 1O95D 7AT1A 3RFFA 3BB4A 2VPZA 3LT2A 4GR5A 4YT4A 3W77A 5LQMA 3NTUA 4GKJB 2AV6A 2QUZA 2VF7A 1CJTC 3GUYA 1YQ9A 2BI4A 3ENVA 3EXAA 3H2KA 3P52A 5FL7A 1GZUA 1HMYA 4WFIA 4P7FA 3HSSA 4YLEA 2D2EA 4ZRDA 3BH6A 4ZQGA 4D97A 4EGFA 1F8YA 2G63A 5AK0A 1PG2A 1Q1NA 2YJ5A 4R2KA 4I1IA 2OAQ1 1EM8A 1NF3A 2QSYA 4HX2A 1AUXA 3W06A 5H9WA 3NT4A 1YNSA 4XSVA 1O95C 3D7RA 3ZW9A 3L7DA 3LQ2A 3CF2A 1XKLA 1S9DA 3VX3A 3IPXA 5CITA 1HEIA 2FRVA 4YH1A 2XBUA 3EC2A 1WUHS 2HPHA 3TLGA 4QQFA 3CWQA 2W2OA 1AHNA 4LECA 3KFXA 3FOZA 2IIBA 3FTCA 3FHTA 1UBEA 2IHTA 2JKYA 3VNBA 1XQYA 2LGJA 3PHBE 4YP7A 3F7MA 4DYHA 3THOA 3BOSA 2IELA 3B5IA 3P5BA 4OMCA 3ZVNA 2XNCA 5F76A 5HUJA 1JG4A 1X1AA 4FYHA 2FXIA 1ATZA 1N2CE 1QYIA 4IRUB 3LV8A 4LJ6A 3SHWA 1UOOA 1S4QA 2PL9A 5LZ4A 1TK3A 2DEUA 2WZDA 2HQOA 3EF0A 2E18A 4OHRA 3GFQA 3NHFA 1D9ZA 1VIYA 1B6GA 1MO2A 1RQGA 2AOVA 1ODLA 4H27A 1CJKC 4GPBA 4QNRA 2PMCA 1ULTA 3MA0A 4LE0A 2CLOB 3PD1A 1SC1A 3EFOB 4LY6A 3OTQA 4IQ0A 1GQOA 3G8BA 2GBIA 2BSAA 4ITUA 2R00C 1JTVA 2J3HA 3LH5A 4NNOA 4Q15A 4HTAA 1RDFA 4BWGA 4COKA 5J4VA 5ESRA 2IY8A 3KZXA 4NCXA 3DDNA 3ASVA 2EW1A 5I4IA 3RFCA 2E5WA 1TLFA 3AJ9A 1S8AA 5TGZA 1OYVA 3AFGA 3IILA 2FMHA 4G0OA 3E84A 1DQZA 2PM8A 1TYEB 4NJOA 5DF1A 4E1BA 1NM5C 4RANA 1RAEA 1HK7A 4KN5A 2QY6A 4GDFA 1SRQA 2IX3A 1DZIA 4DPLA 3AU8A 3CVJA 3OOSA 4R1TA 4ZRNA 3A1FA 3L06A 1YZVA 4MUEA 1K0UA 5IHPA 3K0FA 5I7EA 3WNDA 4QDTA 5ECWA 3ZLJA 1PDVA 1KR5A 1PD0A 1F14A 3OQHA 4Q16A 2HH9A 2J9RA 5DASA 4RSGA 5ICFA 3NFRA 1GAJA 2VH2A 1U0TA 4RK7A 1XLTA 3WGHA 1M2JA 3G17A 5IVHA 3WK6A 4YMGA 3KT8A 1MTOA 2XRYA 4EMUA 4FBLA 3W90A 4RKRA 4HEQA 1T2DA 1BGVA 2F8MA 2H7YA 3PQDA 4WBNF 3CX8A 4Z3DA 5L3QA 5DSTA 4LVUA 2VN8A 5DXAA 2YY5A 1IXSB 2DRIA 3W04A 4DJEC 5K8CA 4ZAWA 2Q2WA 5BN3B 3HWX1 4XX0A 4Y9TA 4A82A 1UK9A 4OX9B 1EVJA 3C24A 3ZY5A 1T8RA 2O1XA 3DBRB 1T1SA 2ID9A 4JLJA 5ARCA 4AJLA 4DCGA 1KDZA 4G56A 3U4QA 2NP6A 5GOTA 4TPKA 1TXGA 5MGNA 2A4MA 4GBGA 4B2YA 1RWPA 2WHQA 3C1TA 1XMQB 4RPGA 4P4SB 4UE3S 1MH9A 4HEJA 4AQDA 1QTQA 2FPPA 5ALXA 3IKTA 4HAYA 2VHYA 1BO6A 3VR0A 3MCVA 3QIVA 2JIDA 2R8PA 4R31A 4OLAA 1XRJA 2W2LD 1RQNA 2OK7A 4X94A 1NXWA 1UJBA 1XQWA 1XTIA 1Z34A 3JQGA 2Y68A 4YAGA 3KU1A 4L6AA 5TMEA 4KU4A 5IKXA 1NW5A 3JQ6A 4CUJA 3ESBA 4RHCA 1ZI6A 2C5GA 2O2DA 1SOWA 1DFIA 3BH0A 3FMPB 3PWSA 3Q1LA 1QGUA 4R69A 5E9AA 4EVSA 4Z5XA 2PGDA 3GFSA 4V0QA 4GZ5A 4MVJD 3R7LA 3TNYA 1ZPDA 3ZLTA 3D7MA 5G41A 4MGIR 2IHYA 2H0AA 4V2IA 4YJ3A 1RZ3A 5IMBA 2HV9A 1JHXA 3FJOA 4OKIA 1V1RB 2X76A 1QHFA 3GIDA 3ASYA 3L04A 3WYBA 2F1RA 1Q7RA 3KKMA 3ZOZA 1JVSA 2AHOA 4CN8A 1CT9A 3OHPA 3NRCA 1E6LA 4GBMA 4BS9A 4HPJB 4LY3A 5EE3A 3V3TA 1OLUB 4BO9A 5F2NA 3KUDA 4M76B 1RI5A 3AWDA 1E2QA 3FA2A 1TF2A 3N8HA 3TDMA 2ENWA 3OE7A 2QD1A 2IE8A 5JJLA 2Q3EA 3DXZA 4GXRA 3U1BA 4JFAA 5KU1A 1UWCA 4DV4B 2QTGA 3G49A 2E0IA 2OLEA 1ZL0A 2EJUA 3QPCA 1BMQA 2QMYA 4QVKA 3JVDA 3LBFA 4F92B 1R9JA 1XP8A 2YJ4A 3L49A 4BKQA 3LWBA 4IFTA 4JYMA 1GADO 1SZPA 1DDOA 1KSFX 4QTZA 4U63A 3EEOA 2XDQA 1OB5A 2VQFB 1SGWA 4DSOA 4V03A 2ZYRA 5A3VA 1R16A 5DCUA 5AVZA 3WKAA 4C7OA 4CI0B 3IURA 1T2NA 3AR4A 1FP6A 2PSEA 4I8DA 1JJIA 2FW0A 3KQTA 4JCOA 5DM2A 1NZDA 4LJ7A 1AZWA 4EGSA 3N2GA 4AUNA 3QPBA 1XTTA 4D4JA 2VS1A 2PRJA 1P8JA 4Q00A 3ZGNA 1QVVA 1T8YA 3A06A 1CF9A 1Z4KA 3K0AA 3WXBA 3NH9A 1T1GA 1PV2A 4JWKA 4PRZA 4EJSB 1TW3A 3BMOB 3FR8A 1RRCA 4G0WA 5TMDA 3RKSA 1NA5A 1HY3A 3L01A 4INJA 3VNUA 2PZKA 3AEUB 3OZDA 1LI7A 4TUYA 1I7SB 1XTUA 1R15A 4J03A 5CTJA 1G42A 3TQCA 1FEZA 1SOVA 1JPJA 2CF6A 4MWEA 3L4BA 4UU8A 1UJCA 5ECYA 3H9UA 4BQFA 1DTWA 4ODIA 2VDKB 3UXMA 1U2DA 3S8YA 1CDDA 4O1IA 2O8BA 1ECLA 4UBOA 5CA0A 1NMEA 4LGYA 3RG2A 4U2CA 2JFXA 3D4LA 5IJ0A 2HT1A 1I5EA 3PIDA 1SUEA 1VIDA 5JD5A 3I01M 4JH0A 4MX8A 4S2EA 3NCHA 4FINA 3EWIA 1TJNA 2QTVA 2JJMA 5LBUA 2GETA 2PZAA 4HGOA 4RACA 2WTUA 2EBHX 5GTDA 1AE1A 3H11A 3NC0C 3JD0A 1ZG3A 2YR0A 2L69A 4ZZ2A 4F84A 2JA2A 2Z2YA 3EZXA 4ID9A 1E8DA 1QJ4A 3A1VA 5FIUA 1BFKA 1SVSA 4JQYA 2OFWA 1KQFA 3RI3A 4DV0B 2ZPTX 1EXMA 2WKRA 4QU5A 3DMFA 1SOMA 3N2NA 1WY7A 3PEWA 3W6PA 2HUNA 5G0SA 1R0KA 1MEEA 4HDNA 3C1OA 3K6SA 3KEOA 3CNBA 3VOBA 3G7NA 2EJCA 4ZEOA 4RA6A 4TV9B 3R6DA 1JMVA 3CLHA 3PPYA 1C8LA 4LXHA 2OO5C 1K6XA 2X3FA 3F8WA 2D1QA 3OZSA 1OASA 2VT3A 1F4VA 4RIIA 5EAIA 1M1NA 1SULA 1M0SA 4Q0MA 3GY0A 3PNBA 4BLRA 1X0VA 1F6DA 1XTQA 3I4FA 5HF9A 1W85B 2LD4A 3A4MA 2PKQO 1QP4A 1YCDA 2UV8A 4P31A 1GCIA 2ATVA 1YBHA 4MUAA 4YMTA 3BIOA 3MJVA 4B2PA 2H1WA 2PSSA 3OO1A 2E4UA 2QM7A 3D64A 3ED1A 3T7JA 2YMMA 1Q19A 1P9OA 4U2GA 5CUQA 3TRIA 2IDMA 5DTRA 1KI6B 5HE8A 3ZHRA 3M6FA 5K8JB 3UMMA 1PV4A 1A8UA 2NUPB 4R84A 2VPPA 2FFHA 3OT1A 1U28C 3PVSA 2JCXA 1EK0A 3K20A 1UXIA 5CR9A 4A2PA 2V6GA 3NUQA 2WINI 1XCJA 2AN5A 3RH0A 4Z7NB 2BGGA 2WOJA 1W19A 4BCDA 2ZROA 4BEBA 2XCIA 3E2MA 1KE1A 3ET5A 3A28A 2PYIA 3CUSA 4OQDA 2AW3A 4JHLA 4OHBA 1O5IA 2Y77A 3QU7A 4I81A 1JXAA 3HDTA 1X42A 3LFTA 1F5NA 2JPDA 3FDZB 3HSYA 2WIJA 3EDQA 3JQ8A 3M2TA 2Y1WA 5FNZA 1SXJA 2FUG6 2GZAA 1MTZA 1NDUA 1UC8A 3LYUA 4YAWA 2LPMA 5FR2A 3NYIA 4UHHA 4D6XA 1W87A 2QLTA 2IEDA 2CKDA 1T9BA 3DF7A 4R41A 1NXXA 4IMPA 5EEHA 3R3YA 4FOTA 3UIEA 5A04A 4Y2UA 5C18A 1NLMA 3Q3EA 3TSAA 4F7WA 4OSOA 4IIUA 4V1CA 2HRZA 5B3AA 1BDIA 5AHWA 4J0QA 4E6PA 1J70A 2HCJB 1GNQA 1T8UA 5JI3E 3FNBA 5ALGA 4WZBB 2R6GA 1CR2A 2NAFA 1KDPA 1QIEA 1C5KA 1TVEA 1G19A 4HO1X 3SS7X 2RCYA 1YOBA 2FSUA 2H4WA 1NJ5A 2NZYA 3D0RA 4HNSA 4F2DA 1RM0A 1QZTA 2H00A 1ZGCA 5IKMA 3NTXA 5ALSA 1GL9B 3P0IA 4QX6A 3ROFA 2PAFA 4TSFD 2CV0A 2GF2A 1UM9B 4Q4HB 1VP3A 3KYCB 1SC9A 5AQEA 3SOPA 3N07A 1XO1A 1FFXB 3OIFA 1S7GA 1UBKS 2PGJA 4DIFA 1FDVA 3CKLA 2V5VA 4PX3A 1IG3A 3P2MA 3Q3JB 5LBIA 1PGJA 4P84A 1VPWA 4Q7LA 1BEZA 2WNSA 4ZREA 5AD1A 3EG9A 5BWCA 4BN0A 1U2ZA 3IIIA 3N2EA 3Q11A 3ZXXA 2BVNA 2FVXA 4WLVA 5TQ2B 2X9LA 2B4YA 3UATA 4EPTA 2IIVA 3GCZA 1FMJA 1XVIA 3PENA 4RXTA 2B94A 1FNBA 2Q29A 3K16A 3K8ZA 3KR1A 4ASUD 1TK9A 3T1YB 1C0KA 3NWPA 2IZ5A 3MSXA 4L5CA 2A14A 4R2MA 2WJ4A 3IMKA 1Z5GA 2G04A 3FPFA 3KZ1E 3L8ZA 1M34B 4I0WB 3MB8A 4ITRC 3H4MA 1KVQA 3ZVKA 4QEKA 3EG5A 1NTOA 3LBYA 1SZJG 4X7RA 2IUSA 4XGIA 1NY5A 3GLRA 4GWKA 4BVHA 5C5EA 3EUFA 2ISSD 3DVAA 1ZYUA 2XQVA 1TJYA 1NJGA 3EQ7A 3HCCA 3GRRA 4GBJA 5LQAA 5FLEX 1ULSA 1CIPA 3FCUB 1WAMA 4OYHA 3DOOA 4H1VA 1M66A 1CD5A 2XZDA 1Y48E 1DBQA 3D2CA 4QRDA 5DGHA 2A1UA 3O03A 4AL4A 4BC1A 4G9BA 4B44A 2OL4A 3KPUA 1CUSA 5CFLA 2KLHA 3PGLA 3TOSA 2W4MA 1MB4A 2AFHE 3HWSA 1SZDA 4XWTA 4DA0A 1HMPA 3K6JA 5ES4B 3ZH2A 3I72A 4RD6A 4LVOA 1MG5A 1P4AA 3MELA 5EA2A 4PQGA 3QWIA 3GZJA 1DWPA 1SBHA 1CUVA 2G77B 4U0KA 1A5SB 1D6SA 1O8CA 5IM4F 1L5OA 5FWXB 1W5BA 5HSGA 3DTVB 4P7BA 3Q4GA 3KKLA 1GPWB 3O83A 3ZOKA 2G17A 4LW8A 3ENZA 4FDLA 4PGFA 1LRLA 2XYPA 4ARSA 5CDUA 1ADCA 1FX0B 1CZHA 4ZK6A 1UZUA 5IULC 3VJLA 3HZHA 3HB7A 4PYMA 4QKQA 5FNVB 4IHJF 3AP1A 2H8KA 2H2IA 1L6IA 1UF9A 1L4UA 3PJDA 2OUIA 3PIIA 4C0XA 3RVKA 3PLRA 3VTAA 3CO5A 4G2TA 3EEIA 3PDIB 4F9GA 3P9CA 3ZI4A 3D3QA 3C5EA 3GNLA 1CE8A 1YS2X 1MQ8B 4GQIA 4YRFA 4YS6A 4FZVA 5FOVA 3UFXB 4EABA 1CV2A 5ARBA 3Q9UA 3KQPA 3E5HA 3NV7A 1XE3A 4J16C 3A1WA 2FWPA 1DU4A 1T5DX 2BRUA 1RCTE 1NMSA 3PXAA 3H65A 1KGSA 4W5HA 5F1KA 2ZYHA 3NHZA 2C8KA 2IHUA 4QDKA 4BNTA 5JD3A 4PTZA 2PH7A 4QASA 3W6UA 3AHDA 5LMUB 2G40A 2LWIA 2O3JA 1AU9A 2XCOA 2XRZA 1J49A 4CF6A 1KK2A 4EWLA 1YBVA 4AF7A 2NYAA 1BCSA 1OFVA 4NJEB 5E8RA 5BRNA 3HU2A 3T4UA 4OJKA 4LYYA 4BP8A 2J09A 4DF3A 4EPYA 4Z4EA 2CVQA 2ZSIA 3X2FA 3ASZA 2DCUA 4YJDA 3ZW7A 4B4WA 4E70A 3CLVA 1AB5A 1P8AA 1JA9A 3W7BA 3QXGA 3IHKA 3ZBTA 4QQNA 4FFRA 1JV2B 2PX3A 2C7QA 4TYPA 2ZKLA 4CLXA 3MGBA 3DAYA 2L17A 3H8SA 4J9VA 4YO8A 3VZSA 1PNRA 3LF2A 3AM1A 5T4HA 1LZKA 4A92A 3F6RA 3G23A 2CSXA 2G9UA 4Z86A 3ZS8A 1CQIB 4HDQB 3RSHA 2X2PA 1KH1A 2DF8A 4JVMA 3LPAA 1A0OA 4M1TA 2VHJA 1DLIA 1CETA 1K7EB 1XMXA 4BLWA 1HQCA 2G80A 2PEYA 4K6MA 2PKRA 2QJFA 2MINA 2P9EA 4D80A 2DUWA 3B12A 4QO8A 1GCUA 4XDYA 3WGUA 5ITZB 2KBFA 1QIIA 2CDCA 3OMLA 1E6KA 4ZVPA 1L5VA 4QOIA 2R7AA 3AG5A 1J2RA 3UVEA 2IYEA 3AFHA 4KQ9A 4YRNA 5DWQA 1JHAA 4GM0A 1VECA 4XLTA 1GPUA 1QK4A 3MT8A 4JI6B 2HMVA 1PEAA 2IYSA 1Z88A 2CZQA 1JI0A 3CX6A 1MV5A 3FRIA 4KG7A 4Y8VA 2R11A 5FPSA 4X20A 1M2WA 1A9XB 1LPSA 4FGWA 3I92A 2VHVA 1VXOA 3DZ8A 3L0CA 1GSAA 1SVOA 3CKKA 1VLVA 3QBVA 1YRLA 4RQUA 1S7CA 2CKMA 4DDHA 5BMVB 2YASA 2ZAOA 2DUUA 3IPLA 2O3SA 2ZRCA 4OFWA 3I4LA 3N5CA 3FN4A 2VK1A 4QEZA 5BUCA 4G0QA 2Q99A 4D6PA 1BHQ1 3A25A 5K9ZA 2BUBA 5BR7A 1RZVA 3QVXA 3V3KA 2A86A 4ZYVA 1Z73A 2C7GA 4QUIA 5JO0A 3GJ8A 3GZNA 4Q4JB 3TIVA 1X77A 4IOMA 4F4FA 1C3VA 5JPIA 1TQ6A 2RBKA 4ZKDA 1CZOA 2BBOA 4K6KA 4BBAA 5TSDA 3IVXA 3HL4A 1CP3A 3NOQA 1TQHA 2DULA 1C7ZA 2ACEA 1W5AA 2P7HA 3U3XA 2KYRA 1TQ2A 2R6ZA 2X8BA 4L57A 1C0LA 5FR1A 1PEDA 1R0CA 3FPGA 4FEYA 1BX3A 3GIWA 1ZLYA 4ZN6A 2WYHA 3ML1A 4UJ5A 4PN3A 5KX5F 2PVSA 3C14C 5JAZA 4ES6A 1Y7TA 3EBPA 4MUIA 1Z5UA 3EWSA 4X54A 2HMSA 3GELA 3EVFA 4EB0A 2J7KA 4IXMA 1YB5A 3DBHA 3EYWA 4EHKA 2YJ3A 2BMVA 2NO6A 4NMLA 2F2TA 2NYVA 4PYRA 2FEWB 1U2RA 4M38A 3QE3A 3H1BA 4AO8A 3HVIA 1X92A 1HNNA 3PZRA 1KFCB 1P74A 1MA3A 4KOEC 1WE2A 1CVRA 4PPGA 4AB1A 2IF2A 4JL5A 4ND8B 4ZVNA 4Y3UA 3VXKA 5C2JB 4HN2A 2VJMB 3U7EB 1LBQA 5HM6A 2B2XA 4LX0A 4DY6A 4GR9A 1QJCA 3B38A 3A6EA 4ZCSA 4PLVA 2L2QA 4S12A 3QHQA 3WB0A 1EAMA 1EYZA 4UVEA 3S1AB 2PY6A 3SXUB 3T3NA 4NH4A 1NURA 4C9BA 2VHTA 2QN2A 3SJZA 3LE8A 1AT1A 4EHNA 2WMDA 4WVLA 2OM2A 2GJSA 2WJIA 4NPAA 4RHFA 4UXIA 3UKOA 3UXEA 1XMOB 1E96A 3MSCA 3FTPA 4CF3A 1C7RA 3MAAC 5A9SB 2OBXA 4XTRA 3WL8A 4F1JA 5CCEA 4H31A 4PLGA 4Y2YA 4ZQHA 4IMIB 3ZUGA 4NKRA 5E3IA 4QBFA 4Q9IA 3W5IA 3ZVMA 1UMCA 1B2LA 3FSGD 3HKEB 2YXPX 4RHUA 3V4LA 1PDWA 1WO8A 2QTTA 3K6KA 4IJWA 1HOTA 4OV6B 5CURA 4AURA 3IUYA 3W1EA 3S8MA 3SWWA 5ALWA 3TZEA 1SVIA 3HEAA 1UPFA 2JHGA 2V8OA 2M6KA 3UJ6A 2FSVC 1KZ9A 1P2GA 4D4MA 4DCTA 1ELOA 3GOQA 2VTBB 1O96B 1CR4A 2IPAB 4EY5A 1HORA 1HT2E 2JDIA 3JPWA 1O03A 1WCIB 5F3WB 3KP1A 4P98A 2EIXA 1LD3A 2XOKD 1P19A 4OMFG 4WNYA 3ZIAD 2J3EA 4B5LA 3JQAD 4LDNA 4GMXA 3V00A 2LUOA 3M34A 3RODA 2H3EA 2A1IA 3RC8A 5AKGA 4DEVA 2GILA 2HA7A 1PYOA 2G8NA 3ETHA 4QREA 4RD4A 5ALZA 5GV8A 1UH5A 4HSGA 1Y9DA 2D5BA 2IC5A 2Y76A 4WDRA 3TL2A 3ZE1B 2GQ0A 5JO9A 3K9FC 3W8RA 5KSYA 4P2BA 5KWSA 1G5TA 10MHA 4BZQA 1GPJA 5FL7D 3DSRA 1I51A 2ONYA 4NEHB 1ZUIA 2B2NA 2FXVA 2Y93A 3BIWA 3HV2A 4HLUC 4MVJH 2CC2A 4Z3KA 4HMOA 2FZ4A 1NI5A 3OF3A 4XUGB 2ODPA 3R75A 5M29A 4NXNB 4KPFC 2AUTA 1IU9A 1FNCA 3VPSA 3ZJUA 4B79A 5HIMA 5K4HA 2NW6A 3RUIA 2GN9A 2V0GA 2W6ZA 4ALNA 4D8TA 4EG3A 3DO5A 1Y7LA 3GDWA 3I61A 4Z51A 3HDYA 1T29A 1QLHA 3F3SA 1N6IA 5AK4A 4N48A 5EIEA 3TLZA 4IINA 4URYR 2EF1A 2I5PO 2PV0A 1TCAA 4YXWA 4DEYA 3VJKA 2P90A 2P9CA 4LBZA 4TZ6A 3ND9A 4PR3A 4W5QA 4WK0B 2GJAA 4E88A 5DP2A 2GEKA 4TKVB 3CVWA 2H1VA 2I6QA 3O8QA 4OD0A 3QVTA 2Y1FA 1SJ9A 1VE7A 2HPVA 2OP0A 4IYRA 4JSTA 5BSFA 3MVEA 1KY2A 3FBTA 4MV4A 1PZNA 3T95A 3FF1A 1UBNA 2DBVO 5DNAA 5H3HA 2GAJA 4LHYA 2G9NA 5L7WA 1HGXA 2I8LA 3D6NB 5HFNA 2AG0A 3FH0A 1O2DA 3QFTA 2FUCA 4V0MA 621PA 3FD8A 1JQJC 4OH1A 2Q5OA 2ZR0A 1F2DA 2FEMA 2PGIA 1JW9B 3L5KA 4KK4A 5D86A 1V2GA 4G1BA 3RSQA 3A1SA 2Y1KA 4PX2A 4M1EA 1NRXA 1Y42X 2IIPA 3OQIA 4N0MA 4QGHA 3O8CA 1RPAA 3BTVA 5EVJA 5J5AA 4BMYA 3K0BA 3JYNA 4B9AA 2MYPA 3TL6A 3DV2A 2H57A 2D7JA 5FBHA 1QGDA 4RTRA 4JL6A 1PUJA 5DXJA 4FDAA 5G1PA 1DINA 3T12A 2QLFA 3LT4A 4MW9A 1Z5PA 2A94A 1N2SA 1L7BA 1DC7A 1L4LA 3LDGA 1BS9A 1AQNA 4NBRA 3ERCA 3G5MA 2FR1A 3THYB 2JJ1A 3LGSA 2UVPB 1P81A 5CP8A 2AFIB 2YHIB 5MF6A 3BCUA 1J8MF 2V4MA 2W43A 3O93A 4IDNA 4E51A 4PNHA 1N5RA 1N3LA 3ZJVA 4LJKA 2I66A 2HJWA 4MUJA 4G24A 2MCFA 4C87A 4BZXA 1PAUA 1E2BA 2PLFA 3DONA 3MXTA 3E7WA 3SDZA 5SZIA 4CMGA 2WAMA 2EKLA 2ORIA 3AJDA 3KHUA 1PJBA 1TUIA 4I5FA 2WLSA 4XEHA 4BAGA 5LU9A 2JARA 4KAXA 3REQB 3WSVA 4B8YA 1W36B 5FBRB 1VCOA 2A7XA 4C5BA 3FGNA 4EBBA 2EWWA 3IAAA 4QEDA 4DJAA 2XYVA 3VYVA 3KQHA 2JK1A 5FEUA 4N01A 1GUZA 2F7SA 2QPAA 1B74A 3H6HA 3R5JA 4V0LA 3KRTA 1TZBA 4X71A 5EZQA 1XXHB 3KJGA 5U1PA 1OB2A 3MERA 1XLTC 3I8SA 2WP8J 4QO7A 2QZ4A 4L07A 3KQSA 1A9YA 5FX2A 3TF5A 3R3XA 3LLVA 2P7IA 5D2CA 4Y2RA 3UANA 1C30A 1I7LA 2W6CX 2AF3C 3LGAA 5DI9A 3V8BA 1EQAA 3A1CA 1NY6A 4UOZA 1JDBC 3DTYA 1DC5A 2Z0MA 2XE6A 2IUEA 2OVBA 3KO8A 2IOFK 3GLSA 4YJHB 3WB9A 3GCWA 4YPOA 1VE5A 3STTA 1I0ZA 3EZLA 3KJXA 4F8JA 3DMDA 5CX1A 5DM4A 2H51A 3CZQA 3IBSA 3VZDA 4NWIA 2P1RA 2G0TA 3D0QA 3PX2A 3GVIA 4TTIA 1ZKDA 4DDTA 1WMFA 2MSNA 2AR0A 3IS3A 3KKQA 1OA1A 4GZ3A 3ABSB 5E0KB 3NYRA 3ZDQA 3H2YA 4FFLA 5I3ZA 1A9SA 5HK8A 5EQDA 1N2EA 2GZHA 4RFSA 5MFPA 4MPJA 2DP4E 4BFXA 2QOEA 3HNOA 3QPAA 1WBJB 1JLHA 1UWLA 3KDSE 3LPNA 3D6HA 2EEZA 3ZZNA 2R97A 2YS7A 3DCYA 3V4SA 3WIBA 5BR4A 3VVLA 5AW3A 4S05A 3BT7A 1ILWA 2MSLA 3IBCA 3NX4A 1E9FA 2C54A 2JHAA 3QKUA 2H8GA 3DOUA 1E94E 2WUVA 3IAFA 2AOWA 3OUZA 2ZBRA 5MHTA 3OE7D 1D2CA 4KMSA 3SYTA 5AUPB 4Q21A 4E32A 2BGUA 5BN4B 3VC3A 3T4EA 2XE4A 2HTEA 2PUWA 3WAKA 1KE2A 1LC3A 1XNJA 4J1TA 1OSNA 4RV9A 1KI4A 4YMLA 2XUKA 4TYYA 5BNIA 4ZVQA 4O4JF 3A9RA 3T0FA 2AOUA 1WDKA 4BNFA 4BDTA 1O4WA 4DWWA 4F11A 3UV7A 3BWXA 5KREA 2YIMA 3DFMA 4NS4A 3H4IA 3AGPA 3F4LA 4YA6A 2V8BA 1SIBE 1L1FA 5BQXA 2JL1A 2NSLA 1FUUA 3LL4A 3SYRA 3ROMA 2ORVA 1Z17A 4ICIA 1Z5NA 2VOJA 3BB3A 4QL3A 1Y82A 2Z57A 1DSSG 2HIMA 1KZ6A 2H59A 2JGAA 2W0SA 5FPHA 5J4KA 4IAOA 5IF9A 3LNCA 2FE4A 1J1UA 1W44A 2WDZA 1L3BA 2FR0A 1A2BA 4P81A 1L5WA 2R8BA 4S1TA 3ELDA 2CFIA 2DZDA 3C39A 4UBIA 1FS4A 4XCQA 3VNAA 3ZTTA 3A1UA 1N2CB 5KNLA 1O6BA 4EYGA 1PWHA 1P33A 1JIVA 4BOYA 4TRNA 4NCBA 4EELA 3KJQA 1PNOA 3N3BC 2YJZA 1EJ6A 4JI0B 5KTNA 2FN7A 2QD4A 3X1XA 4QGSA 1LX7A 4GT1A 2AJCA 2HWWA 4LZWA 1E1YA 1CCWA 1Z4JA 4R9UC 2ONJA 3VAYA 1SCKA 1X2BA 3GP5A 4IIJA 3OVMA 1FFSA 3HZOA 4FQ7A 4E2XA 3T0IA 4QXQA 5BVGA 1A8IA 1BQ3A 2WYUA 1FTGA 5ALLA 4OL9A 4NAVA 4H6XA 4PNZA 3T5CA 1SWWA 4I4IA 1NW9B 4RMHA 3KEGA 4URZR 1TC2A 3RU7A 2UZ4A 2I29A 1KAMA 1IN8A 2OPBA 3MQ2A 3E9NA 4K3UA 4L85A 1AKVA 4RPLA 7MHTA 3CM0A 2AJBA 3ILXA 4NY1A 1VSBA 2XV1A 1TMOA 2VT2A 1Y9EA 3L6OO 3Q3CA 4ZGWA 1SN7A 2C2GA 1MFZA 3L4BC 3AF1A 4TQ9A 1DAEA 1E5DA 5IH7A 2UXDB 2ID8A 5I3CA 2YWCA 1X1BA 3OQBA 4JYCA 1DKLA 3N8NA 2XAUA 5BWBA 1E4VA 1UK7A 3OZIA 1F51E 3MINB 5AVKA 2VF4X 3HKBB 3LDFA 4K9OA 1X7WA 3IOEA 4WXPA 3SVZA 4EMSA 3ZEAA 4WD3A 1CQPA 4AY3A 4JBNA 1LVHA 4ZI7F 4LOHA 3CEMA 4GC5A 1T8PA 4TOIA 5HBRA 3ROZA 3TZBA 4WAUA 5A05A 4J43A 1MX3A 3KVRA 4QU0A 4X41A 2NU8A 1Z8DA 4HQRA 3E3NA 3EEBA 4UUBA 3OTHA 3T5BA 4B35A 4B3DA 2E2WA 4OQMA 4KQJA 3QELB 2HNKA 1D1QA 3EZNA 3VU1A 4NMMA 4DLPA 3T3IA 5HOQA 4M7WA 5KHLB 1SCBA 3ACDA 1MOPA 4W9NA 1OZAA 4RADA 1JL3A 1BJRE 5E1DA 1XRNA 1T9GS 3GEHA 1JIJA 3OUTA 4G26A 4IEIA 4C08A 2EC5A 3DZDA 1FJXA 5EEGA 4RK4A 3SEFA 2AQHA 1FQWA 4MI9A 3QX9A 3K9NA 4O4IA 2ZWMA 4CUKA 4LZPA 4LDQA 4MEJA 5C4MA 1VL2A 1IOLA 1B42A 4FIDA 3T52A 2UVDA 4F3KA 1JR6A 3LHFA 1GG2A 3GLGA 4G4JA 2ODQA 4Q4AA 2GFHA 4CKCA 1F4LA 2H1RA 3H18A 4ZU3A 2ABWA 2Q21A 1ORIA 5JFTA 4FWBA 1B8UA 1XNQB 1Q0PA 2A59A 3MT9A 1LVUA 3U5ZB 2CXNA 2WICA 2IY7A 4PIMA 4Q7EA 3JASA 4FMPA 5C8YB 3ZDAA 4N18A 4MW6A 3S6JA 3RYHA 1I0IA 1MB0A 4LJ5A 1ARZA 1L7OA 2OYRA 5CT4A 4CEHA 1YOVA 4CM1A 4FILA 2PFKA 2QZZA 1US8B 4Q5IA 2ZEJA 2DWQA 3AUJB 3BG5A 3TH5A 4Z0NA 1SXJD 4BJHB 1YCHA 5TIIA 4L8GA 4HSEA 4PONA 1CEEA 4MRAA 3L6RA 4PSCA 4BATA 4BLUA 4LIPD 4F5DA 3W8FA 4YLGA 5JATA 2GHRA 3WGQA 3MOSA 4PU0A 3V4ZA 4ZVSA 2P4SA 2ZIAA 4UMVA 3B1FA 3TNFA 5D6NA 4J2HA 4BO4A 4LKRA 3NXKA 3Q2OA 1MJHA 3EIQA 5LP1A 2K4MA 1JRLA 1SXJC 5DHTA 3RBAA 1Z25A 5JS6A 1SBYA 2EKZA 4JLVA 3OP1A 4DLKA 3WL3A 3ZWYA 4B4OA 2BM1A 3AK4A 4OBXA 5JSUA 3BE4A 1AHIA 3DV0B 4WK4B 5I9NA 2I3DA 4G0ZA 3FBWA 3RTGA 4FT4A 1NBAA 3DEFA 3MOIA 4AJKA 3FF4A 3DMHA 4ZMRA 3RPEA 1E18A 1D2MA 3BF7A 4HCJA 4LOKA 3HCRA 1K6EA 4R2WA 1OLSB 1R37A 1T3HA 4P34A 5TRTA 2A5JA 2GF9A 5IBCA 2RGEA 3BD7A 3MMXA 3HA5A 4XOUA 4CGZA 4UNNA 4NAUA 4QOEA