4RHFA

Crystal structure of ubix mutant v47s from colwellia psychrerythraea 34h
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
DFNGKITLAITGASGASYAMRLIECLIAANYQLYILCSSAGRISLDTEVGVKIPSSPDAASKFLTEKYQAKDQQITVFGKEQWFSPVASGSSAPKQMVVCPCSTGTMAAICHGMSDNLIERAADVVIKERGQLILMVRETPFSTLHLQNMLSLSQQGVTIMPASPGFYHKVETIEDLIDFMVGRVLDHLGIEQDIMPRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
publication title Crystal structure of UbiX, an aromatic acid decarboxylase from the psychrophilic bacterium Colwellia psychrerythraea that undergoes FMN-induced conformational changes.
pubmed doi rcsb
source organism Colwellia psychrerythraea 34h
total genus 69
structure length 200
sequence length 200
ec nomenclature ec 4.1.1.-:
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4rhfA00
1MVNA 4ZALA 4ZAGA 4ZAVA 2EJBA 4RHFA 4ZAZA 1MVLA 1SBZA 3QJGA 4MWGA 4ZAWA 4ZANA 1E20A 3MCUA 3LQKA 1G63A 1QZUA 4ZAYA 1P3Y1 1G5QA 3WISA 3ZQUA 4ZAXA 4RHEA 4ZAFA
chains in the Genus database with same CATH superfamily
4ZVVA 2Y1DA 3NU1A 3HNOA 4HUJA 3K53A 4MZDA 2NLOA 3F5QA 3OFVA 3CZPA 3AGQA 1THMA 3HPRA 4DCUA 1J0CA 5GQSA 5F3WB 1UDXA 2GT1A 3ZKWB 5I7RA 5IZCC 3PHIA 3M6FA 1WD5A 1CUUA 2JAPA 4HKTA 4K81B 4AY5A 1CJSA 1I51A 1MJGA 3CEAA 3O8QB 4UCQA 3P7MA 5DCYA 1KHTA 1WUYA 5TR9A 1SIOA 1KJ9A 4G9GA 2DY1A 3B7GA 4KN9S 5JZMA 3BT7A 1U8XX 5EJ6A 2GNOA 1DX4A 1T24A 3I72A 3VRHA 1NG9A 4KPYA 1R3DA 3Q11A 2EGGA 4PSDA 5EOVA 4J7XA 4R2XA 1UFRA 1HRKA 1QGUB 2PKQO 2XCLA 3AU8A 2ZB2A 3GFFA 4M54A 4MITA 2VQ6A 1Y4SA 2PTHA 4TS9A 4EELA 3K2BA 3GRCA 5AUNB 4GI1A 3ZWVA 4B74A 3G0BA 5BN5A 4E70A 1P7CA 4IHJA 3QHQA 2ZJAA 4ZVUA 4HMQA 3GCGA 2XAUA 4Z53A 2BMFA 3EF1A 2HHJA 1FDUA 1BU8A 5T8KC 3WKCA 2OCYC 1ZD4A 2QL5A 3IRVA 3NBMA 4WACA 1KIAA 1TD1A 1YB7A 3CZMA 4BQQA 1U28A 2M1XA 3GP5A 3W0LB 4BQPA 4JP5A 3JZFA 1SC6A 1ZOOA 3GNLA 3QMPA 4B2YA 4DCTA 3V4RA 2GWHA 4YRQA 2BFNA 1ORVA 4XI9A 2BAGA 3HZZA 1N5MA 1JZQA 1U80A 2O2CA 3H5IA 3S27A 1LW7A 3AVTA 1W1UA 3GLGA 3EG9A 2QPAA 4XPZA 4YRIA 3GEDA 1U5CA 4HNSA 3QPWA 1XLTC 3K31A 4IFEA 2P3QA 1F4LA 3HNPA 3HCDA 5H83A 3NDBB 1BJRE 1D07A 1P9LA 1GY8A 1JEOA 4R01A 3ZDEA 3DVAA 1VE3A 4C0KA 4IJVA 2JF0A 4BUCA 4FKMA 4IOKA 5KYXA 4DUGD 1KO5A 5C1OA 1WDMA 1CY2A 3JD4A 4KHPB 2XDQA 4IUDS 2GX6A 5KNCA 1QVRA 1IY2A 4P3XA 2JFWA 3PBKA 1LD3A 2UZ0A 1WBDA 4WSOA 1Y3AA 5JAOA 2XODA 1ZMTA 3OZBA 1MH1A 4KG7A 2O23A 5EHQA 1VLHA 3G2NA 4LYAA 3ZI7A 5SY9A 4M0MA 4HXFB 5A4JA 3L43A 4W4TA 1WKBA 9ABPA 3G85A 3NDJA 2QR5A 1VL2A 4W7SA 4YCCA 4ROTA 4WT7A 3ZWQA 4XGIA 1MUUA 2Y71A 1MJGM 1EE1A 1IPHA 3OX4A 3VSBA 3FYHA 4G26A 4D9CA 3AI3A 1DQPA 1ZQ1A 4IMPA 3O5AA 2FDCA 1PL7A 1E2GA 4OHVA 3WX0A 2PJUA 4MGIR 4MCJA 4J0DA 1I3OA 3QOFA 2YVKA 2E4ZA 2V7QD 1Q1NA 1I9CA 3IPXA 2EWMA 3BD9A 3R8XA 1BO6A 1K8XB 1J2UA 3BCUA 1UZAA 3R7NA 3EH1A 4CI9A 3R76A 4ABTA 3HMKA 1UKCA 5AI0A 2WF7A 4TV8A 3QLTA 2P6RA 1KAHA 2YHIB 3TLYA 1VLJA 1RXIA 4DDKA 4DIFA 4CWAA 3QBVA 3U4DA 1PZGA 1Z0AA 3NHRA 3ZCSA 5JSZB 4Q1CA 2HSZA 4YUZA 1QDLB 4AJ2A 3DE1X 2R62A 1JFRA 3FNBA 4HF7A 3ROKA 2C97A 5AM1A 2I1VB 4F2GA 2FUEA 5KTOA 1R9MA 2HWXA 1JU4A 3U3JA 4WZBE 2PZFA 1QM5A 1XF9A 4BYMA 1RWBA 3HVHA 4BXOB 1DAKA 3UWSA 5LQUA 4MIKA 4WKOA 3TLKA 2CNNA 3VX3A 4L4YA 4ARUA 1IRXA 2IKQA 4C1BA 1ETHA 3SVTA 2ERYA 1XELA 2G7MC 2GVNA 3U3RA 4CMEC 4C07A 3GWGA 2X42A 3AH8A 5CDTA 1G3UA 3OTHA 1YR9A 3C6XA 1F2UA 2AN3A 2FPIB 2R5FA 3EIUA 3TECE 2C7VA 3SC6A 1WY5A 3OF3A 4LXTA 3I5AA 3S81A 2XZOA 2Y1EA 3SZOA 3ESDA 1RAGA 1OLXA 4U5QA 1YZHA 4P98A 2P3OA 2YQ4A 3RC7A 4YDQA 1RRKA 1TLFA 1TU3A 1WMEA 3NBXX 4GGOA 4GMFA 4K2HA 4QX6A 1II8B 4DG5A 3FPGA 4GYYA 2HNBA 4DQUA 2Z3WA 2ZK7A 1JA1A 3HZOA 3I8SA 4HDCA 4LF5B 2FMIA 2WMYA 4P84A 2VPPA 4HHEA 5DWQA 2GOYA 1Z4LA 1UMDB 3GGGA 4GXNA 1ABEA 1ULTA 4GXTA 3AEZA 3V55A 2YN4A 3RI3A 3K94A 3VHXB 4QOGA 4LV5B 3LYUA 1F7VA 2ECKA 2XOEA 1UDAA 4IJ5A 3CCCA 4J1SA 3R7FA 1EM6A 1I30A 1NLUA 4HGNA 4UEQA 1RWVA 1GG5A 1E2EA 4MUGA 3UGQA 2A3RA 3IE0A 1J8QA 1XPRA 1PP4A 4RFVA 3T1YB 4CV1A 1L5MA 4BMOB 2D1RA 4RD0A 1U8TA 3BM5A 3CLTC 2NUTB 2VQEB 4KSYA 1GSHA 2BFWA 2CXRA 3CR8A 2R85A 3L0SA 4RLFA 3MMPA 3TZQA 4HTFA 5D85A 5I9NA 5KYYB 1DRJA 3IL2A 1DKOA 1SD5A 1Y4ZA 5TT0A 4A26A 1Z56C 2JRCA 5KNCH 2MSKA 3B89A 3F6RA 2P6PA 4PRLA 4BE9A 4YJFA 2ON6A 2FE1A 1OVMA 1IM5A 3KE8A 3Q7IA 4ZEXA 1KY4A 1YQGA 2NG1A 5DGXA 3OE1A 4MQBA 4W99A 2Q0HA 4KR9A 1Q12A 1IN5A 2XHZA 2CK3A 1QYRA 2AH5A 2WFLB 2XGSA 4C7JA 1E2HA 2KSQA 2ORED 4R8LA 4E1BA 4CKWB 3K2IA 2X4DA 1CEXA 4NCNA 5IUKC 3FZQA 2Q3HA 1B2LA 1QWOA 5FUWA 3B5IA 1V11B 1AK9A 1T5HX 2ZUCA 3LVBA 4KWHA 3W2HA 3K70C 4G0VA 1LBEA 3GJSA 3DFMA 1AXEA 1GNSA 1RCUA 3HJHA 2QG9A 3DXXA 5DM2A 4RFSB 1HYQA 1EAYA 1W5SA 1X1DA 3AFGA 3UT5B 3GEGA 1IWBB 4J1TC 3HDTA 5M04A 2C88A 3UMVA 3EZXA 4MV9A 2O1SA 4QFMA 3RB8A 3HJAA 1BD3A 2HDWA 3M4JA 3PQEA 4ZJZA 1L8OA 4HP8A 3EUEA 4XRGA 2IYLD 1U81A 3FNEA 1FYXA 4MYCA 1B16A 1SVLA 4YPVA 1OWNA 5JCPA 2ZRJA 2J3IA 1KVUA 1GZDA 2ZJFA 3AXSA 4Z7NB 1KMNA 2Y2VA 1LBIA 3GQBB 4MV0A 5EZQA 3H4TA 3OZWA 3VZQA 2ATIA 1EZZA 2NSLA 2YW2A 4PZUA 4F7WA 4G65A 5JQGA 1RI4A 3U4MA 1SXGA 1X9GA 3FF4A 2NYAA 2I33A 4U3JA 9ATCA 1WQ4A 2VBIA 1R6TA 4PO3X 2NO5A 1AGXA 3SHOA 1T9GS 3T5AA 2Q07A 1NBOA 1XEXB 2IHJA 2R6R1 3ZCUA 5AK6A 2IX9A 3OWHA 3RUFA 4MHOA 4FN5A 1Z07A 2BHNA 2VPWA 5K0EA 5E9AA 1Q11A 3KJEA 1PO7A 2C4NA 2VLIA 3IDQA 2OOSA 1PK7A 1L4FA 1LLQA 1G98A 1HYHA 4TM8A 4CUZA 2X9NA 1KH3A 4RXMA 5ISMA 2PU5A 3AR3A 3FUWA 3KPUA 4LMBA 1IQPA 1EFKA 3ZWCA 4AN1A 1CQXA 4F71A 4DKJA 3HKEB 3W8DA 4AJPA 1KZGB 2IZ6A 5J3JA 3HFSA 2MINB 1KO1A 1G6Q1 3IP3A 1PJQA 2YS7A 1GPNA 2GDZA 3L6RA 3VSEA 3KLPX 4RMNA 3RUDA 1P3Y1 4CIBA 3NC0C 4K6FA 3K32A 3H75A 1PQYA 1R88A 3JQBC 3OZFA 4R9NA 3K0FA 5DLQC 1FUEA 3NOXA 3MLAA 1NXSA 3A4YA 1NR5A 3FLAA 5E4YA 2OD2A 1O8BA 1PTJA 2RGCA 3CV3A 4GGMX 5HP4A 1YQWA 5F52A 3DTVD 1CUFA 1VKHA 1A2BA 3IPCA 2OB2A 2YTZA 4Y2HA 2P78A 1G18A 1M75A 3L84A 1W4ZA 2XT9A 4DANA 2BT4A 3ZE2B 1J1UA 4O4JF 2DY0A 1EFCA 5AO9A 2KPOA 1XRMA 1U2QA 3W34A 4LJ9A 4QDJA 4DLBA 4HAZA 3QPAA 1SH7A 2WW8A 5CG1A 3SVZA 3R6DA 4RY0A 4B5LA 3CLVA 1SY7A 3TH5A 3ODGA 5F73A 1KAEA 3BWEA 2DJ5A 1AHIA 2BTOA 4XKJA 2W6IA 3WBKA 1JLSA 3WV4A 2CXXA 2C7GA 4M1TA 3FHJA 2WAAA 4M8KA 4WV3A 5IKMA 2BGNA 3F2IA 2HLNA 3C8UA 1HH4A 1U4SA 4CKBB 4JI4B 1X1SA 2RHBA 3KYJB 3RIMA 3UB4A 1PGOA 3GDGA 4OBXA 2TMKA 4NS4A 2F4VB 5HE8A 1R0LA 2ZRLA 4YS6A 1YB6A 2V1XA 2AWNA 3FB1A 3B1WA 4LMRA 1Z0IA 4FYMA 4A0RA 4B34A 1GSOA 3HWRA 4RX1A 3ABSB 1D6MA 1TK9A 4OIMA 3K1ZA 3N8HA 1Q91A 3D6VA 5FCDA 4X54A 3GJTA 3AR4A 5JS2A 5MDHA 4Y0VA 3K0SA 1GQOA 1I0LA 3HFGA 3KWJA 1C1XB 5LQSA 4ZJYA 3FRHA 4XJVA 1Q17A 5JEDA 1XBTA 3OZAA 4F2DA 3BGDA 5A7FA 4CG2A 1DGQA 3BZBA 3H87A 1T2AA 2Q9CA 3BBPA 1I4OA 4EY5A 4D6PA 3VPGA 4UHCA 1W75A 5DTIA 3DO6A 2CWWA 5CAEB 3RRMA 1EYZA 4HNTA 3TD9A 2NXJA 4MRMA 5A9RA 4E46A 4DIBA 1HFEL 2QVLA 1U99A 3H1TA 2PS9A 3MJDA 3TBHA 3V8RA 2GF2A 2G4VA 3EZ2A 2ILTA 3RROA 3CG4A 4YDRA 1KEVA 4L6AA 1WOMA 3BC1A 1YNSA 1SCBA 2QQEA 3GPCA 3CKLA 5DP1A 4JEIA 4JC8A 1EGMB 3WB0A 2A0FA 2BELA 4U63A 1B23P 1ZL0A 1CQZA 3ZXXA 3NEJA 1SHKA 4MVJD 4EK9A 4O3MA 5JANA 1SIBE 1DAIA 2PMBA 2RGDA 1V16B 1ZJJA 4IRMA 1XYVA 4KL8S 5ALYA 5J5VA 3NHLA 1GA4A 2EATA 3IP8A 1CVRA 4PZEA 4FJ0A 3TNFA 1PRYA 2YYAA 4H6VA 3RK1A 4DB4A 2VHEA 4EB0A 1X1QA 1DT3A 1YUBA 1U2DC 2PIAA 4V24A 4AZVA 1GAJA 1CS0A 2W83A 3HCBA 5KTNA 3DOOA 1VXOA 3R77A 4YIHA 3IMGA 4B75A 3KK0A 3DC2A 4IIEA 4EHJA 5CDHA 1NJGA 4MR9A 5DI3B 4MW9A 5EJGA 4AUMA 1M6EX 1RI2A 1MB3A 3GEPA 1Z74A 1X7XB 1PT6A 3LC7O 2W2OA 1L7RA 4NZNA 4MI6A 3K92A 2Z5FA 4PBTA 3KOUA 5H68A 1QIGA 1CBUA 3OA2A 4LRSB 4BLVA 4KWCA 1OI4A 3A4IA 5DKFA 1M2NA 3EGOA 4B1FA 4F3CA 3MCTA 1XAHA 3GZNA 1G8SA 2OBLA 4QPZA 1IK4A 3DFFA 4FGLA 2EVWX 5ENZA 4BNYA 2FPUA 1UQTA 1WB5A 5LCXA 1G4UR 3TRKA 3KELA 1A98A 3VISA 2FW0A 3QEKA 4KN6A 4POAA 4B47A 2WD8A 5B5SA 1PZHA 3FNRA 3OSZA 3PE6A 4JI6B 3SHQA 1ZUNB 2OPBA 3H6KA 3C5WP 4L74A 3ROTA 3NUQA 2JIDA 2DTEA 3ZHSA 4DCCA 4CNQA 2WM9B 1OFTA 2XB8A 5DBIA 1DQSA 1OIWA 1Z8FA 1WMSA 1RAHA 3AEQA 3E53A 4OQZA 4YCMA 3KJHA 3KTDA 4KQXA 4EYKA 5KSWB 1GEEA 3BWDD 4OF4A 2I76A 3M6WA 2W4IA 4E4RA 4HVCA 2VKTA 2O2ZA 1MEOA 2YOHA 3A4NA 2GD1O 2OAQ1 4IWXA 4UBLA 2ZP1A 3FDIA 3E2MA 1S3FA 4CKYA 2ZB8A 5EP3A 3ZVKA 1XZPA 2VAVA 3ANYB 2GBGA 1V1MB 4UBIA 3LNTA 3O91A 4B0PA 3SF8B 2XA1A 5BRJA 2B4RO 1N1GA 1BMFD 1C29B 1O1YA 5NULA 3L4KA 2DBRA 3NM6B 2GCGA 3V1KA 4B8ZA 3C1OA 3OLVA 2NZXA 3D81A 1QHEA 4C6TA 1YZKA 2BGKA 3QG5A 1UBNA 2EDCA 1YZNA 4YCAA 3RHZA 3TR6A 4CR6A 1BEEA 2GD6A 5KSPA 1TT5A 4F2WA 3QUTA 4EW3A 1AA6A 4LJLA 3ZV4A 5A5DA 4TS3A 2ZATA 3CEPB 1VPLA 2Q9AA 4KLCA 5FPHA 3STXA 5HM6A 1AD2A 4AROA 4DA7A 3G0GA 3TOZA 4LV6A 1FNSA 4NCKA 3RCBA 2UXBB 3K6JA 4BVKA 1M73E 3P52A 4XEHA 4ALMA 1UBRS 4LE0A 4MIYA 5HXAA 1SD1A 3R3WA 1BWPA 4PLHA 1EE2A 1KI2A 3K8OE 3WGQA 3LA6A 1UBOS 1WXGA 3V8QA 1E1MA 1M66A 1M8GA 2AOWA 4UBNA 3VVCA 5BNFA 3CIFA 4BQNA 1Z0DA 3HUFA 3PTZA 3WC4A 4QDTA 2IYAA 4X61A 5TY0A 4DNOA 2Q41A 3RKSA 4RK5A 1IN7A 1DINA 1Z13A 3HO8A 4PFKA 3RYCB 4TMYA 5C53B 1JMYA 5CNMA 2J4FA 1YFLA 1S9DA 3GA0A 1DHTA 4MVJE 5IVKA 4MAMA 1A5SB 1SUBA 3WDSA 4MUXA 1WCIA 5EE0A 1O94A 1P1CA 1W87A 4DDTA 3L0IB 3AOEA 5CHYA 1HBJA 4JNCA 3HYCA 5JDIC 5GADl 4DDVA 1RC8A 4GE3A 4NK5A 1SBZA 1GNQA 2H0AA 4WI1A 2PX4A 1OI7A 1VLQA 1C1YA 4MS4B 4ZC1A 5HCIA 1HZZA 2GM3A 1DRWA 2F17A 3EEIA 3U7QB 3U61B 5U4XA 2EKPA 3DLIA 3JWJA 3O8OB 1C7RA 3EEOA 2YY7A 1ZM2A 4RKRA 5DLYA 3RIXA 4PFSA 4DM3A 4JLSA 3A4MA 2A5FA 3V4PB 4DMGA 1E1DA 1EXWA 1NNLA 3O4HA 4CQNA 4EYGA 1PDOA 2V65A 2YMLA 4DQDA 3HP7A 5E2BA 3PXGA 2FLWA 1O95D 1S1CA 1ZJ6A 2ZJ3A 5EP4A 2W71A 4U39A 2VNKA 3LZCA 5AJWA 5JLJA 4CGYA 2V3VA 4NAVA 3LUCA 3E9NA 4MRVA 4LJAA 5CA0F 1ZWKA 3VH1A 4H4CA 2JLUA 4I5EA 2O0KA 4W7HA 2C3PA 2WJZB 2JH9A 2B78A 5TPWA 4YREA 5CNIA 1HG0A 3BHIA 4BFXA 6YASA 1W0KA 4MI3A 3HH8A 3H1FA 1C7FA 1D6JA 2VJDA 4YAEA 5EGSA 1V5FA 1C5KA 3VH2A 4ZI2A 3ZD6A 2IZ5A 4FIZA 2BEUB 2GLUA 3LXRA 4M0EA 2R25B 1X7ZB 3VPAA 2OE2A 1L3BA 2GM5A 5ERXA 2JBAB 4QQKA 1KERA 2BIFA 1ZIXA 3BMQA 2XBMA 3UTCA 5AVUA 5JBIA 4F3TA 1U98A 3B7PA 2V8OA 2P65A 1N33B 1B0PA 2W90A 5FNVF 5HZGA 2C57A 1DC5A 1HYGA 3BFKA 5EUCA 1CSEE 1Q77A 3AL0C 2F6RA 3KB2A 4UAVA 3DM9B 3V32A 4FLFA 4HEQA 4U7FA 5KPDA 4BRWA 1YR8A 3LKZA 4HGOA 1XWFA 5KI6A 1MRSA 3UXHA 4IHQA 5BSRA 4ACAA 1Z83A 2JB9A 3JVVA 2HDOA 3O3OB 1BXRA 1XXHB 3KYDA 1XHEA 1YU9A 1ZKDA 4FOPA 5K3FB 4L0MA 4QBTA 5FP0A 1XALA 3F71A 3WQHA 4EFNA 4FYHA 5FRDA 3NHKA 2ZUFA 3PNSA 4P4SA 4PONA 4QUAA 4IILA 3ZE7A 4WXHA 3U5TA 3PD7A 5SICE 1N6OA 5JARA 5HCUA 1FX0B 1PZFA 3DBVO 4UD6A 3ZJ5A 4CE6A 2PKYX 1TVMA 3OKAA 1RQ2A 5JD6A 2JIZD 5EXPA 3P1JA 5TEWA 1N2EA 4RVHA 2DSTA 2XW6A 2O8VA 1T8RA 4KDCA 4EKGA 2XBLA 2AJBA 1KJ8A 4J0KA 2GXUA 5FPYA 5MN4A 1OX4B 2P9HA 2QTMA 1BNCA 2DZDA 1AM4D 2OUKA 1XKQA 1SULA 4U0JA 4BAUA 1GXSA 1KARA 2I91A 3N28A 3EDQA 3KG2A 3FXAA 4BX3A 2JGFA 1XZAA 1DRUA 3OLQA 1J5XA 2ONZA 3IR6A 1LK5A 2V58A 1IOWA 1KMQA 1PV1A 2B1RA 3EXEA 3FMOB 3DAFA 3NIWA 1EHCA 2R8BA 4NE7A 1RRVA 1U3GA 4W5WA 1OAOC 2GZ2A 2FLVA 3GLHB 4HQ0A 4Q24A 1Z38A 3W5SA 5CM2Z 1C3EA 1YRLA 1M6VB 2QW1A 4JJ6A 2IS1A 2VF4X 3GPIA 4II2A 3DFIA 1N6KA 4WERA 5FWYB 3U7FB 5JCOA 4C3UA 1T0IA 3H0CA 1ZI9A 5LBTA 1JYSA 3QOWA 2ILVA 3RT7A 1KYTA 1WCWA 2E3JA 2ZR9A 3SKYA 5JYCA 3BE4A 1YB4A 4H7IA 4D56A 1ZSNA 4GZ6A 2PE5A 1CUSA 1C4OA 1TJ4A 3CJQA 3RVPA 3RDPA 3RVJA 2Q9BA 4R1PA 4CM4A 3KT6A 3SXUB 2E37A 2WOOA 621PA 1U11A 3MTDA 4LNUA 2VJYA 3RVLA 4H7JA 1A3CA 2GQ0A 3DD5A 5DDIP 4C5CA 4B71A 4OIFA 1XPOA 4DB2A 1JHDA 2VAPA 2W48A 3GRRA 2LBPA 2ZJ7A 3KSUA 4GO1A 3T5DA 2QVCA 3RAJA 4XYMA 1SBHA 3LQ4A 3D3JA 1GCGA 4DQKA 1ISPA 3G8CA 5GJWC 1YQQA 3DHWC 1E1QD 4ZQEA 2PRZA 3T1NA 3GHHA 1GDDA 2OCAA 2XXBA 3HM2A 4EGSA 1BW9A 3A7EA 2BEWA 1NVVQ 4POOA 3KQPA 3I52A 4LPKA 3JD2A 1FFXA 3B1KA 3EARA 3ON5A 5FWXA 2QHXA 4O0LA 4OFXA 2RGWA 2YYYA 3IUMA 1FQOA 4JJ4A 4ER5A 1E8MA 2LRHA 1UP6A 4DEYA 4L6IA 3IIEA 1S4QA 4UMFA 1MX5A 2SHKA 4IDQA 2A4KA 3IP9A 3RF7A 1M9NA 2HA5A 4FEEA 3T1OA 2AT1A 1SO8A 2RGUA 3B9RA 3R7SA 1ULZA 1XCMA 4BLUA 5K0JA 3SI7A 5JOQA 4F93B 3RTGA 4EA6A 2FZGA 4F7DA 3PJFA 3TKLA 1I0ZA 1HV8A 3PFFA 1ML4A 2PWYA 5HUHA 4JLMA 2X8LA 1V8BA 3FFTA 4A92A 5K05A 2ASEA 5E6SB 3TZHA 3VI4B 2JJ1A 1KTIA 1FS4A 3VR2D 4ZI7A 1AVTA 3ONNA 2IZ7A 4L5CA 3HI6A 3CVYA 3D4NA 3VAYA 4HT3B 3W5HA 3I0NA 4IDOA 5CHEA 3UWOA 4LDRA 2IYNA 4TKUB 4X20B 2XCIA 5EVCA 1C7IA 2IBSA 4DXHA 1FMCA 1TIKA 1HDRA 4BLWA 4IWNA 1W44A 1V1RB 2MYTA 3V4ZA 4BEBA 5A7HA 1VDMA 1YK1A 3W8NA 4C3ZA 4HZGA 2A84A 4PLTA 4XB1A 5F5NA 2R4TA 3UJ8A 1XRLA 2RHWA 4RJIA 4O4HB 2Q4EA 1DAGA 3WRXA 1VQ1A 1XC7A 2XE8A 3D7NA 2WSLA 1QO7A 3D8HA 3DCIA 5I6DA 4CMIB 2HK9A 4R2MA 1F17A 5J9FA 9MHTA 1QH8B 1MG5A 2GPSA 2VDVE 3OLXA 2XCOA 3DFZA 1WV1A 3COZA 2HCJB 1T36B 2BM9A 4PPYA 5E6UB 1J7JA 2BFCB 2EKDA 3WQRA 1Q7CA 1RKXA 1TUGA 2QN8A 3LGAA 3EVEA 5G0WA 2C1EA 1E6MA 1OBCA 1QZTA 3BMOA 1HL7A 3GZ4A 3UICA 1U2GA 2B6HA 3QYJA 1IBRA 1A1SA 1TD9A 1CFJA 1ND6A 1UIRA 2AKAB 2VRBA 4Q3KA 3CNEA 4CMCA 4DF3A 4P83A 2GM4A 5EUQB 5AVWA 4MUIA 2QU7A 4ENWA 1L1RA 2I1LA 3OQNA 2IYVA 1YDEA 2LXNA 1JDBC 2ISCA 1L6RA 3B82A 2Z9DA 4ZODA 4MWEA 2EZ8A 3HWX1 4YMVA 1EINA 4BLPA 2C8LA 5IJZA 3Q0EA 1QFSA 4D74A 1D2NA 3DLTA 4LOLA 3UMRA 3ZUGA 1QQAA 3IQHX 4EW1A 4C4TA 4KWTA 3HXLA 3ICEA 1MEJA 4JFRA 3T35A 1E98A 4KACA 4WN3A 5JO0A 3IAS6 2M32A 4EDFA 4KR3A 2QX6A 3SGLA 2DLDA 4KDEA 3U9TA 4HDRB 4DLWA 1WXQA 1JILA 4GZLA 2EW2A 2H3EA 3UJNA 4LQ4A 2CJPA 5F1KA 2FPGA 2NO4A 2A6PA 3JZIA 3M8KA 3TTVA 1Y3IA 1RE1A 1UK7A 1NBAA 3IEKA 4YUVA 2ZG6A 1VPTA 2GD0A 3T0FA 2B8JA 1Z4JA 2C8VA 2I67A 4O4LF 1MC4A 3FLBA 3QENA 4JLKA 4NCIA 4KOAA 2OSBA 1Z5VA 2TMGA 1CCWA 1E8DA 1K4KA 1QX4A 1GYPA 1M0EA 2FFQA 2I6FA 2MSLA 4LVCA 3GFOA 1QFJA 2YJ3A 4UEWA 1XEAA 4RKFA 4KOEC 3DUFB 3QE3A 3FYUB 2C3YA 4X3OA 5KX5A 3EGDA 2ZTVA 3GJ4A 3T4PA 3GCWA 3M70A 4GNRA 1N92A 2Y76A 4GLLA 1JQJC 3LGXA 2J33A 3O6VA 1Y6QA 3BILA 3IBSA 5KNBD 1P1KA 4JMLA 4PNEA 4PRZA 3W2FA 2CVZA 2BFEB 3B9BA 2OT3B 1SUPA 2P9YA 2FOXA 2Z83A 2ZIXB 5CJPA 3LA8A 3CZ4A 1XCJA 3U6BA 1L1EA 2JI6A 3OMLA 1N2CA 1QRDA 1EUZA 1SXJB 3NKLA 4CW7A 1WW2A 1SU8A 3PICA 4QYIB 2RSLA 1WW3A 2BE9A 4LHYA 1KP2A 4CEJB 3FOEC 3H9BA 4FC6A 4P4NA 1H8HA 5F2KA 3DEHA 4HEHA 4IMIB 4BFWA 3TZEA 3AINA 3H0KA 3G89A 2Q2WA 1T43A 1XK6A 3WLFA 2XCUA 4L3OA 4TT3A 3E18A 4WCFA 3WRWA 2I2FA 2FSGA 1JVSA 3ZU6A 1AZSC 1V3UA 1T3TA 3LO5A 4P80A 1O6BA 4H16A 5J1TB 1RWXA 1TM1E 4RMHA 2LUOA 5KDOA 1A4RA 2QVYX 1ABFA 2F00A 4MR7A 5LDGA 4BU0A 2JFQA 3I62A 1FNNA 3IT1A 1URPA 3A1TA 1NQUA 2ZRMA 4UZEA 3T94A 1E2MA 1ZXXA 3AB8A 1NVDA 4TMFA 3V1UA 4DARA 4EJ6A 2H00A 2HF2A 2QPTA 3IT3A 3L8ZA 4OA5A 2W6PA 4OLJA 4BEVA 3PQCA 2FEMA 2FEKA 1RP7A 3DGFC 3H9CA 4LDZA 3R7LA 1MB4A 3U7IA 4JVNA 4CQLB 4C30A 3ICQB 4G5RA 4EPRA 5ALNA 3I9KA 4J03A 5H3LA 1YDMA 4C2BA 4EHIA 1I80A 2FTKE 4INZA 3ZHBA 4OHCA 3BGVA 1ODCA 4A6XA 1EWRA 3IUBA 1M0TA 5IFKA 3L1VA 2LNDA 1PWHA 3DE6X 4YONB 5HKLA 2NXNA 2W2TA 2P2SA 2PH5A 4L3VA 1M5TA 2X0RA 4RMGA 4X7MA 3B2NA 4FTWA 4Y1FA 5AI9A 2OHFA 3VZCA 4BO3A 4D2IA 2WWTA 2D2XA 3B6KA 2NUBA 1M8JA 4J6EA 5AQEA 3NVDA 3WP0A 3U16A 2QRVB 3DLAA 3A9VA 2WWWA 4MP3A 4Z9BA 1BIFA 1T8WA 3UK7A 4F04A 1ZY2A 4FOOA 1FRQA 1XZBA 5TGTA 3ZHUA 2UUBB 1D4AA 3V2GA 3P9KA 1QG0A 4GZMA 2DKNA 4CTKA 2OXIA 4YC7A 3CX6A 5CGZA 5AVJA 2B1JA 3GD5A 3UHOA 1ZVKA 2HTFA 2NZJA 4KYTA 5ALUA 3PFWO 1E6LA 1QCYA 5KNDA 1E62A 4NJMA 1IOZA 3DVRX 4YA6A 3OM9A 4FGKA 1SC3A 4AKHA 3O4FA 3HQ4O 4GH5A 1VDZA 2F62A 4IJ6A 3RIHA 4BO9A 2LIVA 1JBQA 2Q5IA 4TQGA 4KMOA 5IK2A 3RJMA 3UH0A 4ESHA 5EHXA 5FYQA 2BFMA 3PDHA 4EB8A 2ZKLA 1BYUA 2J9YB 1UDBA 3OOHA 3S2FA 2QG4A 4EWLA 3HKDB 4JJZA 3TW8B 3R5XA 3BVPA 2ZUVA 5HF9A 4LOKA 1U28C 2NVUA 1TKAA 2VP2A 2YMQA 3QOXA 3KHKA 2GFQA 2H2FA 2GTHA 1PFGA 3IP6A 1L5KA 4CUKA 2H1WA 4Z9AA 1PSWA 4BX2A 1D8TA 2E21A 4S2UA 1JV2B 3MTIA 3A37A 4EUKA 3T1TA 4CM6A 4YJ2A 1CR1A 2AI1A 1A27A 1CUDA 1YU6A 3FYSA 4LAFA 3LJKA 4HXGA 5AVRA 4PAOA 4R2KA 1HOXA 4BKRA 4DA9A 4XYEA 4FB5A 1I7DA 3ZLJA 1E9FA 1D3AA 3D64A 3O2JA 4HI0E 1PVOA 1GHTA 2BBOA 1YVRA 2RI1A 4W8GA 4GBED 1JLLB 2GVZC 4ZC8A 2Q8PA 3T7CA 3AJEA 3ZHVA 2FSFA 4HG2A 3DKRA 3JQ7B 1T13A 4A5SA 1Y4DE 2DU8A 4R4JA 2HRZA 4MJ3A 3ZLTA 3K71B 2BGUA 4OBBA 2QZZA 3E05A 3BPSA 3GARA 4AM8A 1Z5GA 2I3ZA 1U0TA 3D4BA 3DNFA 3IDOA 4WOPA 2W6MA 2JHGA 2ZFUA 3OFND 2ZS8A 4JENA 1UEXC 4XDGA 2B5WA 2WPDD 4MJLA 5GV7A 1DBSA 2QF7A 3QF4A 3K6RA 3SBEA 1VG1A 2ID9A 2OCBA 3KPVA 4RSGA 5CLHA 3A10A 1C3LA 1JFFB 4JD5A 4N3BA 5HEKA 3DQPA 3INTA 4AUNA 4EQ6A 4NV0A 1IBKB 1XN1A 3EYAA 1Y7LA 1CUIA 5H5JA 1ZITA 5CFNA 3NAQA 3QRWA 4UEOA 2VZ9A 3THRA 4AU1A 2AJLI 4PINA 1OFGA 1RQGA 5DWDA 3V8EA 3VPCA 3BMXA 3FLEA 3EBLA 3QX3A 3RC3A 1J9GA 1VM6A 2W93A 1CYEA 2O3QA 4MUAA 3VDQA 4YO8A 2ZBVA 1NBIA 5DBFA 1R27A 3C45A 3EA0A 3P5SA 2VSXA 1AY0A 1ZI6A 3VH3A 2AXPA 3UQZA 3HRKA 4PQEA 2R9VA 2WIBA 4MDYA 4CM8B 3AIKA 1XZIA 3GEIA 4DC1A 4QSHA 2JLZA 4FYYA 4OQXA 3R7WB 2NO7A 2OZVA 4CLDA 1HETA 1E3TA 2XY4A 1X1EA 4M8SA 2HBQA 4NOLA 2NU8A 5AIBA 3KZ1E 2VRNA 4YHBA 5AHOA 3CS3A 3NXKA 4TUYA 5AI8A 1J49A 1ODKA 1QTNA 3CRMA 5IULC 3B5JA 3ZVRA 5K99A 4QOHA 3OTQA 2B9EA 3D54D 6Q21A 1X1RA 1QP4A 1H4SA 1WIWA 3FI9A 1NYLA 1TKCA 4JC4A 1SFRA 3R6LA 3KWMA 2ATEA 5DHFA 3O26A 4GD3Q 4R81A 5LWQA 4H35A 3DDHA 3I6MA 1YQTA 1HDYA 5A7GA 5T3YA 1DPGA 4HGQA 3VR4A 3A9RA 1P3JA 1YZUA 2OG2A 3BH6A 4G8CA 4DN6A 4MWBA 4WLOA 3FZYA 5FF9A 2GZHA 1CR6A 4J2OA 4HJXA 4JGGA 4URXR 4J7CA 2IXFA 3HJBA 3HCWA 2M6KA 4C4YA 3JWEA 3WLEA 4ND5A 2B94A 2C83A 4OAQA 2FKNA 1KBZA 5HMLA 3FHTA 2GA9A 3BRCA 3F78A 4DA0A 1ZN7A 1Z4PX 2V98A 1C7ZA 3ORFA 2DWPA 2GCOB 1FX1A 2B8TA 5F12A 1Q1ZA 2OG1A 3FPEA 2MSEB 4Z4FA 3H5AA 1I5OA 3H5LA 1WCXA 2QD4A 1NJ6A 2ZIZA 1NURA 2GRAA 1QC5B 3JQ9A 4XTRA 5L7WA 4NBSA 3EOAI 1TU0A 2QN7A 1BMTA 3MOIA 3DZJA 3ND7A 3STVA 4G0MA 1HDEA 3NT4A 3F9CA 2AEFA 3LVFO 4Q0MA 4OI4A 4UC0A 4XH9B 5BVGA 1BWSA 3RWOA 4MYDA 4MVJP 5JV5A 1V41E 1EJ6A 2C4TA 2V6IA 4J0IA 1ADJA 3CLUC 1I94B 2QLBA 2DUNA 2GEKA 5KYUB 3TG8A 2EYUA 1TPZA 1X92A 1E1RD 4LXYA 3WWZA 3ZCQA 1D4OA 2TMYA 2H85A 2V3WA 3HP1A 3PRHA 4QU9A 2Y1KA 2GPAA 1KF0A 5BYKA 3GJRA 1PKXA 1FFYA 4XGQA 1WSWA 5IJAA 3OCZA 2GJ8A 3FZEA 1JR4A 3BICA 1SHZA 2ZZKA 1HO3A 1PEKE 1FMTA 2E4VA 5B6PA 1SG9A 5BUCA 2PFKA 1NMSA 2ZRFA 4OFWA 3ZV5A 4IEFB 5EY5B 3U1VA 1R5BA 3DDNA 3GGDA 1W47A 2MWMA 3I3OA 2XT6A 5CDYA 4QHSA 1J0EA 2Q4TA 3F4BA 1PL6A 2XE6A 2PKCA 3N6VA 4JSRA 4XIGS 1P2VA 2XCTB 4UU1A 2IDKA 3TG2A 3O9VA 3CVVA 1X7WB 4X1IA 1I24A 3GLQA 1PNVA 2FKAA 4JJAA 4GRAA 1N9GB 2JIQA 3G8YA 2M2IA 4EI7A 5B12A 4BNZA 5KC9A 2BJVA 5AXAA 3PKZA 4N03A 5I7EA 2AG0A 1YFZA 2ZAYA 1YMUA 3C7CB 3NHMA 2WD7A 1UADA 1AK2A 4R1SA 1KOJA 1NU6A 3QXSA 2HX1A 1FDRA 4IVQA 5IAGA 2KQUA 2RJ3A 3QVGA 1MABB 5LZ4A 1QTQA 3AKEA 1KOLA 2HCBA 4EG7A 1MO5A 1Z12A 3CN7A 1BD4A 2JAUA 5CT5A 1XX6A 5FV7A 1FC0A 4BJ6A 5CEFA 2WWRA 4ZPXA 2XNDD 5AW3A 3ZVNA 5CFPA 1HQKA 4I5DA 2FHPA 3CF2A 4H0NA 4LISA 5HJEA 3WSTA 1H2YA 5HBRA 5J2UA 3WNBA 1SEVA 3DBRA 3R0QA 4B4DA 2Q2VA 4B82A 1GT91 2FR8A 1Y9EA 3AIIA 3QUSA 4WKGA 4XQ0A 1JTEA 5GJBA 1CY1A 5AK3A 4XR4A 3ZDZB 1JG4A 4QOSA 4P6VF 4M8NE 4J0JA 1KP3A 4KLNA 5IZ4A 1U7PA 3EDYA 3QU5A 5CM8B 4X41A 2PX8A 3L7JA 4DCMA 1ZHFA 2I9KA 1MA0A 4R0VA 1GAWA 3RBZA 1WXDA 4EKNB 1U7DA 1P2GA 3R3YA 3LSYA 2VUHB 4ZYXA 2H9YA 1Y48E 3B3FA 3LI2A 1P62B 1NSTA 1WQ1R 2FUNB 1T2DA 2FYTA 1RLIA 4C29A 2DR0A 1KEZA 4FHDA 1SQSA 3IVMA 1SK8A 4GMHA 4MKRA 3IBTA 1RXEA 1TPYA 2Q2QA 2IZ0A 3H83A 4HB3A 4UUBA 5DOVA 4BNMA 5TGZA 2XMZA 5FUVA 1L4GA 4NI5A 4TS4A 2OHJA 4HB0A 1NAHA 4I08A 1NF8A 1TMYA 3T12A 1LSSA 2MOKA 2WHPA 5K1ZA 4WK2B 3MW8A 1N1DA 3EJ6A 1V45E 4HDNA 3CE6A 3LVRE 4Q19A 5IBPA 2QAGB 5K45A 3EIOA 3I30X 2N3ZA 3K96A 2XVAA 4HRXA 1A4IA 4M99A 3V3KA 5FA5A 4ZXFA 2QW0X 5DBEX 4ES6A 4AP9A 3AV3A 5CDGA 4Q93A 4CQMB 1EP2B 3T9FA 1BFUA 5EIHA 1RYEA 4GKVA 4PBSA 1N75A 3GJ0A 1Q3HA 3DE7X 1YMVA 2JH8A 5MF6A 2W58A 2EBHX 2Z2XA 3VVBA 1G1AA 1U7UA 4YBZA 1Z2OX 3MJVA 5ICEA 5IXSA 3GJ7A 5BQPA 3DYVA 4Z3OA 1JKXA 1PZNA 1ISRA 2POQX 1E9EA 5F76A 2X2PA 3EXFB 4D79A 4ZRDA 2IPLA 2C9DA 2ZUWA 1YCHA 1IC6A 3D6UA 4BIMA 4DG8A 1RQRA 4KWIA 4MQEB 1J99A 3ORYA 1C3OA 1XZMA 4R8SA 4OAPA 3LT0A 1NJSA 1YT5A 4CRWB 1Z8DA 1IHPA 1XI2A 2DE0X 5FHQA 4RU1A 3AR7A 2Y0DA 4UOQA 5BV2P 3FUUA 3DG9A 3KE9A 1QV7A 1T0HB 2N0SA 2PSFA 4R1OA 3Q12A 3MWEA 5EZ5A 2R7LA 4Y1EA 3NATA 4MTCA 4E94A 2E5WA 1A9PA 1C1DA 1QJ4A 1WUKS 2PH1A 3KETA 4GKKB 3OJLA 5DHSA 5REQA 3UAGA 2EJCA 3F0TA 4IP0A 4TTAA 4CF7A 1E2IA 1W19A 1RJGA 3OEHD 4GEKA 1RZRA 4N8SA 4EZIA 4WWHA 1ICIA 2WKRA 4WA8A 4Z1MD 2UAGA 3AR8A 1QRTA 5EMNA 2BFFA 4NP6A 4PSUA 4ALJA 1GAXA 2JKYA 3U7HB 1JNYA 1WS6A 1YVEI 1E3LA 2ONJA 3BXHA 4FBMA 2V6MA 4F9TA 2L17A 4RJJA 1PBNA 1ZK1A 5EQJB 3WAJA 1Z6PA 5SYMA 1AQIA 1Q1EA 2G67A 5C5CA 1EJ0A 3M0EA 1HEUA 6GPBA 2N46A 2AOTA 2B69A 2Y92A 2X1HA 4GDFA 4P53A 5H02A 4UW9A 1YFKA 5EIBC 4MGZR 4Q4HB 4I7EA 5CH3A 1CEYA 2DOKA 4NOKA 4ALNA 3VKUA 3K2EA 4ZT2A 2RGXA 3R9WA 1WNFA 2Q21A 3QYAA 1UMBB 4GPAA 4RA9A 2ZI6A 1OX5A 1JBKA 4A10A 3VAZA 1B8UA 2WICA 2Q0SA 2W2LA 3FN4A 4YJGB 3Q3JB 4GZ5A 1GEGA 1EUCA 3C85A 2ES4A 1IOLA 1RRFA 3GR6A 3R4VA 4G4SP 4XFKA 1RTTA 2FZ4A 3UKOA 5HM8A 4LFAB 1VTKA 4AS2A 4DOMA 2XUPA 3PUIA 4FFSA 2FCRA 4RKWA 2ISSD 7REQA 4YGYA 3AG5A 4JROA 2R96A 5DTEA 4R7ZA 3NJ4A 2PMFA 2QMQA 3MJCA 4RFLA 1E3SA 4XLTA 1QG4A 5M2QA 4JEMA 1NVTA 3NTXA 4L5YA 3SC3A 5BSFA 5KYTA 2I8LA 2A1IA 4XVHA 3AM1A 4XWGA 1QCZA 1U1CA 4JUAA 1W94A 2BEKA 4ID3A 5FFNA 4H6WA 4RPGA 1A0OA 5K0FA 1P4JA 2BGGA 1DZ3A 5HF8A 1HE2A 4GVLA 3TMKA 4WLVA 2A92A 4KK3A 1MVNA 3J7TA 4F38A 3D8TA 3IVAA 1XZKA 4MS3B 3ZY2A 1RYDA 2FG5A 2ZBUA 3WDKA 4R8RA 3ZR4B 4ZAWA 3L6UA 4YRZA 2BEVB 3ZZNA 1SQGA 1Z7BA 3L1IA 4OGKA 1IWOA 2P4HX 1U1IA 3I9MA 4INJA 5KDLA 4HZUB 3VR6A 1JIVA 1YV9A 3RREA 1Y7IA 2I2CA 2QZSA 2BF4A 2FWBA 2I22A 3QVMA 2QT9A 2X3YA 3PEWA 4WZAA 1C80A 4DIDA 2ZIAA 3U0VA 4HNVA 5KO2A 2VH5R 3FNQA 3MYYA 3QVVA 3EW7A 3VJMA 4DLYA 3UJ3X 4WOCA 2BFBB 4GIBA 1Q83A 1WAMA 4ND7A 3SX0A 1IU9A 3VKFA 2IU0A 2G71A 2ZSIA 3ROGA 1S0UA 5KSYA 3IP1A 4OV6B 1SHLA 1II9A 2AUMA 4YWHA 4AG5A 3RUIA 5HG0A 3OO1A 4R8VA 3TM4A 3LK7A 1YBHA 1MO3A 3LLVA 3ESCA 1SBNE 3O8LA 1TTPB 2ADFA 3DV0B 1QHIA 3D02A 1PJ2A 3UXMA 3WLIA 1OLUA 4KBGA 4UTPA 2OEPA 1QK5A 5CIYA 5IP5A 1A72A 5ECDA 3ZNQA 3ICPA 5J40A 5EXTA 4ZTBA 3MEQA 3QH4A 5LC1A 3DMGA 3WISA 2NU7B 3EUFA 1QIEA 1RW4A 4QJ5A 5AW2A 1NXWA 5LD2B 3T95A 2CNKA 4WVFA 4XPIA 5CBKA 3UJ6A 4JV5B 4NYMQ 1Y63A 3H9GA 2C98A 1X70A 2UVQA 3NPMA 4BQRA 2Y1CA 3DNMA 2R7AA 3JZAA 3E58A 4XUGB 5DCUA 5H4GA 2PSEA 2NU6A 1FRNA 1T6YA 3B12A 1G38A 4M1ZA 3B6JA 4JR0A 2XPCA 1N36B 3L4JA 5DLEA 3GJXC 5IVPA 1IZ8A 4K28A 1OKKD 4NOMA 2R1VB 1STOA 1H6CA 5ERYA 4P7KA 2QPOA 1G64A 3O1LA 3D2AA 1WDWB 1ENPA 2EX0A 3HLKA 1ZBDA 3EZLA 3JARA 3LX5A 4C1NA 4D43A 3ZV6A 1O94C 1X94A 3WS7A 2OESA 1JIIA 3TL6A 1QKKA 5DGIA 3AOEC 3ZIDA 1JJVA 2WFAA 1AB6A 2BKUA 2XNJA 2J0VA 3W9UA 4B6JA 4BV2A 1FP4B 4MP8A 3S8MA 5KNLA 1CJKC 3LOUA 4RYLA 2AQ8A 2BHSA 2G9ZA 1HZZC 2YINC 3CR3C 4HAOA 4KCGA 1NXQA 3Q7RA 4XWYA 3KAQA 1IQUA 1SOMA 4E14A 3OOYA 1E7YA 3ORHA 4F8JA 1Y6RA 3VZBA 4BV3A 4BNJA 4CR8A 4YRGA 3AQ4A 4YB8A 4ZT4A 4YUAA 3FZGA 3UMSA 5KSZA 4DIMA 3MSCA 3MWYW 1NDQA 3TKYA 4EY6A 2WTMA 2OCLA 4JU8A 4OB8A 4WUVA 4MVXA 5K0ZA 2PS0A 3R5TA 3LCUA 4RA6A 5DYGA 4Z2AA 1F8GA 1QUEA 1T34A 4XD7A 2CUTA 3PIIA 4ARSA 1LLFA 4OBEA 1G0NA 2QGZA 2OCXA 3CY6A 2UZ1A 5EIAA 2FHSA 4WBSA 3VC2A 4A2CA 1KZ7B 2A0WA 1KMHB 1F4VA 2RBKA 2WLSA 3K5WA 3C8ZA 4O0MA 1W59A 3OZRA 4LGCA 5EJAA 4N39A 4LZWA 4JA0A 2LDBA 3QVLA 3AETB 3KAPA 3KJFA 3GY0A 2O05A 4B6FA 4L4UA 4FFRA 1IJBA 3RFUA 2MYNA 2OQIA 3EHEA 3H1EA 1BXGA 2J6HA 1LLCA 2ZYAA 2FFJA 4URFA 2OHHA 1OJ7A 3Q1LA 4WLEA 2HJGA 1I9GA 4QBFA 5K8UA 1J20A 4B3DA 2V59A 1JRLA 4EB6A 1GPJA 3PA6A 5D84A 1W52X 5LU9A 5AW9A 4UCWA 4RCYA 3EFBA 2AWOA 4II3A 1LTHR 2YC4C 4B8WA 2O0JA 4BLQA 4LJRA 3M83A 3NBZC 4GFDA 1BA3A 4KBFA 4LSGA 2GAIA 2R4UA 5IWAB 1NKVA 3KHSA 4KNWA 1SN7A 2C58A 2AZDA 2HMAA 2ZBFA 3SQLA 2GN1A 5L40A 1CUWA 4RTPA 2JD2A 2QB5A 1JAHA 1T9HA 3I4CA 1U9ZA 2XUHA 2W0MA 1DELA 4GSLA 1ZRNA 2NO1A 3O2SB 1E61A 4KU4A 5LQCA 3SXJA 1ZK3A 1M1UA 4JLNA 3IUQA 1B7GO 4MV3A 2XUDA 2R6CA 1NVFA 3G9QA 4L50A 4N3NA 3HR7A 4GUDA 4QGFA 4W5TA 1FYEA 2VXBA 2V55B 2O2XA 1LW6E 1ZRHA 4GNKA 5KHAA 4DNXA 2J9FA 4IV8A 3DULA 4N54A 4CCYB 3GLFA 2A9JA 1ZH4A 3HR4A 3R8FA 2ZUEA 1TYAE 5BWBA 4BS9A 1RPJA 4GR9A 4JL5A 3WY9A 2RAPA 1OUMA 3C3YA 4MAAA 3K16A 3Q88A 2XUJA 2EQ5A 1RC0A 3DMTA 3PYXA 1B1AA 2PANA 3DV2A 4ZT6A 3W90A 2PN1A 4BDSA 4YQYA 4RVCA 4TT3D 4RHFA 1XJ5A 5AVXA 3OSUA 1OXSC 3LT1A 4U9UA 4YUXA 4FONA 5KWEA 1A69A 5C52B 1T91A 2YVLA 4YH1A 1M1XB 4J90A 1DPFA 4ZT7A 3STYA 4O2BA 3TIIA 3R7AA 1IVSA 4M8IA 1I13A 1PR4A 4MKXA 4OQYA 4OUDA 3G7NA 4RV4A 2WMDA 2WPNA 1GTMA 4RK0A 3CUUA 5DV9A 1XFDA 5L3QA 1EA5A 2D1FA 1PG2A 5JCOC 1BOOA 3COJA 1SG6A 2A5YB 3MRVA 1T3HA 1WTCA 3W1WA 3FFWA 3I8XA 2FV8A 2XWJI 1LF5A 2XDYA 3CVOA 3D2LA 3FOAA 3KZCA 4P2GA 5IAEA 3X2FA 4G1BA 1WCYA 1OYYA 2CMGA 3D8UA 4B84A 3HCOA 1PR1A 5JNLA 4O3FA 4HCJA 1AZTA 1H8ED 3UWMA 1CG6A 2CNOA 4BP1A 1JFVA 4IJKA 1VPEA 3UJ7A 3GPLA 2J5RA 4I2VA 4UUMA 3Q6MA 3DLBA 3QTBA 3KKEA 1VGQA 1RWMA 2GXAA 1Z5OA 1IHYA 1ZUIA 2O2SA 5D86A 1O5IA 3QBDA 1LQ2A 4PLWA 5D3QA 3WTCA 1YHYA 4UFNA 5F64A 2GXSA 5EKUA 3RAGA 1H4QA 1AH2A 4OJYA 4LJ4A 2I4IA 2V7PA 5LA6A 1KOFA 1PYDA 1KSJA 3H8WA 1YD7A 4MULA 5A62A 1O3YA 2JS7A 2C5HA 4RZ3A 4U9IS 4E33A 4FZ3A 4W1QA 2CKDA 3WGYA 3VU9A 4HWTA 3FOWA 1QYCA 2P5SA 2R1TB 4Y2GA 1XCBA 3ETJA 3NBFA 4II7A 3SVLA 3CUSA 1YBMA 1C9EA 2EWWA 2FQXA 2C82A 1KQ3A 3D5QA 1A8HA 5E9JA 4ZEWA 4DMFA 3QJGA 1DUVG 2NGRA 2D7CA 3IVRA 3OOJA 5IK2D 1C7EA 1DKLA 3GO4A 5E1DA 3ZCTA 2R5WA 1L4HA 5DN9A 3CPSA 3ESZA 2JK1A 1PR6A 3B5EA 3B36A 4DMLA 1VLVA 2B5VA 1RU3A 5IM4F 4JQZA 4U4AA 3AUKA 2DPHA 4A0FA 2HD4A 4I46A 4AY4A 1EEHA 4C04A 3HABA 4WXEA 3G79A 4IRUB 3QVWA 2Q7XA 2FWRA 2NZ2A 1ZBQA 2B7BA 3C6MA 4I50A 4V39A 4B2LA 1WSDA 3WICA 1ZQ9A 1R1DA 1E1CA 3H19A 1TF2A 4M46A 4ITRC 3KDPA 4ROSA 2FGJA 3AVPA 5F2OA 1NJ2A 3OU6A 2PL1A 3A36A 4M9CA 4WLNA 5WRFA 3F8WA 5CVCA 3CO5A 3EVCA 2QBYA 3OJ0A 4MWGA 2H54A 3W5UA 2CWDA 1NBMD 1ZWLA 4JLJA 4TVKA 3TF5A 4KBYA 4Z1OA 1QS0B 4UZFA 3WMWA 1BE8A 4ARIA 2OQ2A 4N12A 1OBOA 3TQQA 4CDGA 4LCEA 1P29A 2ZSBA 3RSOA 5IMSA 3WRXC 2DYKA 5T57A 1SCUB 1X19A 1ONPA 2BGMA 2E89A 3CINA 3O7WA 1N2BA 4R9UC 4DWOA 2KM1A 2YXDA 3IO3A 4M1YA 4PHGA 4H4EA 1PR0A 3ZKWA 1NQTA 1Y0BA 1DWUA 3ETCA 3RFCA 4FIDA 1JX6A 4P3PA 3KVOA 2PBFA 1LK0A 3QELB 4I1RA 2ZI9A 5LJLA 5LQMA 4O1IA 4ZDWA 1J2RA 2H2GA 1AHHA 3RAEC 1XDBA 2CJXA 1DG9A 4WN9B 1B41A 5L6LB 2FU5C 1D7AA 3RRXA 1MX1A 1KFJB 3B6MA 4R98A 3SZMA 4AJIA 2ZJYA 1DWPA 1GQ2A 3LC2O 1U2GC 1VZ3A 1CQIA 3SD7A 3BE5A 2EFEB 1Q2XA 1H1LB 3NHSA 5FUMA 3L5OA 3I6YA 2C7QA 4MQUA 2IXAA 4DJDC 1EFDN 4RZQA 4KJZA 3KPYA 1R00A 2O4UX 4UHJA 1EAMA 5IH3A 5B6JA 2QI9C 1L4EA 1N5KA 3MT0A 2YCLA 3PDIB 1X80A 3U17A 4AG3A 5CEJA 5LMNB 4IXNA 3NHBA 4Y98A 3ZJUA 3U3XA 4XVRA 3OZUA 3A9UA 3JX9A 3NV9A 4M60A 1A8QA 1YUNA 3CQ9A 2IFTA 3I8OA 4Q05A 4BGUA 5LIPA 3G9UA 3QQ5A 3SZUA 3BE8A 2O59A 2QY9A 3V8MA 3WRYA 1T35A 1H6BA 1WMDA 4KTTE 1T29A 4F2PA 1SRQA 4GMGA 3TTSA 2VS1A 4NYJQ 1KSFX 3O4JA 3PK0A 4FZRA 1NW7A 4HQLA 3UAWA 4PF1A 1AKNA 2H5LA 4GLJA 2XZLA 1WMBA 2JKVA 1CR0A 4CL3A 1USVA 1NHGA 5DFAA 4E7PA 1G0OA 1V5GA 3KBBA 5M5BA 4KXMA 5F7ZA 3CH7A 4KDFA 1FU4A 3BJIC 3OE7D 4NYMR 4ZALA 4JVOA 1P4HA 1SQ6A 2Z9BA 1XCPA 1S3GA 4FLEA 4G0ZA 4PTLA 4C14A 2O5EA 3BXZA 3N8DA 2EZTA 1MFZA 1XXHE 2C1XA 3ILYA 4XUDA 6AT1A 2OBMA 1VJTA 3WQQA 1U5BB 2C4HA 3P19A 1SXQA 1N78A 2NTEA 3CX3A 4RK4A 3RU3A 1E7MA 1K08A 2WKSA 3QWHA 3PJRA 4JC0A 4ZV7A 2R66A 3ANXA 5IVIA 1U7XA 2Y8EA 1FJGB 2IF0A 3QE2A 1L5ZA 1YZVA 2AXQA 4EJSA 3W3AA 4C7MA 4ZYWA 1WF3A 3KAKA 3SJ7A 5JC8A 2M1ZA 1P75A 2CXSA 1KY5A 4MW5A 3UYLA 1A50B 3BGIA 3DLPX 1U4OA 3BEOA 5B1SA 4LJ5A 2R48A 4DWWA 3ZTTA 1HRDA 3ESYA 5KQMA 2X1MA 4I55B 1XJ0A 3CX8A 4MUKA 4L0QA 3C41J 4LOAA 4V2IA 3V8NA 4EH1A 2QE6A 3ER9A 1NMZA 3NR2A 5J63A 1DJOA 2IOQA 4KVFA 2CW5A 5DZSA 4N40A 1E7RA 3AL2A 3DB2A 4QULA 2O7QA 4D81A 2EHJA 3FKJA 3HSSA 1CUXA 3RFTA 3GA7A 4ZARA 1C9YA 1NBME 3F6SA 5AW5A 5A4AA 3S5UA 4R1TA 4ND8B 4P32A 4X0EA 1NF3A 1S3IA 3GBVA 3KS9A 4WCFC 1GYRA 3C2QA 1HLDA 2H2IA 2R84A 1B74A 3P0EA 3RS4A 1C50A 1M74A 3KVRA 2GD2A 4BKPA 2Q2OA 5BURA 4F06A 1PHPA 1ZL2A 1GRVA 4I4TA 3IE2A 3RRJA 2AYXA 1NP3A 5ETJA 1M2JA 3I2GA 3HPQA 3ZGYA 1KS2A 3GDHA 1P0CA 2J08A 2WWIA 3O1JC 1G21E 3PHLA 1PFKA 3AUTA 1Y9JA 3ZV3A 4N0DA 4BNDB 4RESA 4BXOA 4REQB 3D3WB 3DMYA 4MWTA 4AI6A 1HX7A 1J1ZA 1DJPA 2HSWA 3NHPA 3RVSA 5FIUA 3HG7A 2WIJA 4Q03A 3KWLA 5K0SA 4PZCA 1HC7A 1JWBB 4QGBA 2RGYA 1W4BA 2FPIA 1X6VA 3C6QA 1R16A 3AF2A 3IJRA 1BVRA 3MJ4A 4CIYA 2DH5A 2QUAA 2GK3A 1V71A 3OM1A 1H1DA 2X86A 3GGPA 4RCVA 3RASA 1OIXA 4IUBS 2D5BA 1W36C 4ZV4A 1Y8CA 4BQSA 1YIAA 4XGKA 4DABA 1G19A 2G0NA 3K0HA 1O9BA 2JFHA 4CT4B 2XNSA 3ZBQA 3I1FA 3I83A 2JI8A 4LXUA 5GAJA 3BMNB 4TTTS 1G3IA 4XR9A 1BG6A 3AKCA 1DBPA 4LFCB 1JE0A 3SQWA 2XZTA 1UMDA 3B8EA 3DTYA 1M8PA 2W2MA 1LK7A 5IT4A 1POWA 2NQ8A 1A2KC 2IYFA 2XDWA 3UANA 3ZU3A 4G01B 4AWAA 2I4LA 3G8DA 4CI0B 3H65A 3LIIA 2NYRA 4HLQB 4MX8A 1P8JA 2VXCA 3UAYA 5IYZF 1AQJA 1NZFA 1DDOA 4KFCA 1CJMA 5KREA 2E55A 3VYSB 3BWXA 3OI7A 3KCQA 1TUEA 1PUIA 1W5EA 2YHSA 4MEJA 1YKGA 4M36A 4B7UA 2PKEA 5IKEA 1HFKA 2NQTA 1UINA 3SZGA 4ISBA 3U9LA 2NUTA 4K6HA 4EG8A 2GHTA 4H17A 3TOCA 4MCHA 1N5LA 4H1WA 1C9DB 1SVWA 2C7BA 3TLZA 1MP0A 1QIDA 1OU0A 3UFBA 2G5TA 2GJ9A 3EXIA 4ZOEA 1F9AA 5KYYA 4WFIA 3O47A 1LDMA 1Z68A 4EY4A 3RVDA 2QTZA 4H7KA 5JSQA 2Z04A 2AG1A 3KL2A 2MJLA 5IAOA 3FPLA 2OORC 3UWDA 3NWOA 3FWHA 2ODQA 4F91B 4IDFA 3H7IA 2WIGA 4G0XA 1AGYA 1O6GA 3ZWAA 2WFLA 2XGGA 3OT5A 2HQ1A 5AUPB 4N18A 4CKWA 4BWVA 3BAFA 1LPNA 3NHYA 1ZAYA 3PLNA 4LJSA 2GYYA 4D3ZA 2AXNA 2Q1WA 4IVNA 4BWFB 1RNLA 3KQSA 4FWBA 1S8OA 2O2IA 3MOGA 3J7AC 2FPRA 1E1KA 2XECA 3A3OA 4MNTA 4PC1A 1JHMA 3WAKA 1EXVA 2X0IA 1GLGA 5K2MA 3PFNA 1FPQA 2OXCA 3P5BA 2PUEA 2HEIA 2D6FA 4RHCA 3UT5A 1VMEA 1UJ4A 2H7VA 3PZBA 1PU2A 3L2OB 3F49S 1L8XA 3O94A 4HFJA 5K6RA 4Q37A 2MYUA 4F11A 2HI0A 1XVLA 1KVTA 2QUIA 1GADO 4JX9A 4WBNF 2BUBA 3EVBA 2OAP1 3DZBA 4NL4H 3HBJA 5G2OA 2NWQA 5CLLA 3ANMA 3WDMA 2A0XA 3HYTA 1SCIA 2I2DA 3WYAA 2BRUC 3GQBA 5HBGA 1T2UA 2P75A 2PCJA 1SPBS 3RYIB 2GSWA 1OTXA 2C7PA 4RD4A 4KREA 5LZ5A 4MV4A 2OBNA 2ACWA 3OCXA 2FUCA 4EYEA 1DBIA 4PQYA 3THWA 2HL6A 2ONCA 2X40A 1SZCA 3NIFB 3NQ41 4GOJA 2AFIB 3VU8A 1EGAA 3TFQA 2B99A 3HXKA 2VTBB 4Q1VA 1WPXA 2ZQ5A 3QVKA 2P4SA 1LDYA 1XEXA 2CXOA 3HDYA 4TTJA 2VP9A 5EXDA 4DLAA 3QPUA 2ZJBA 4MPJA 4QLBA 4JI5B 5A4IS 3FRJA 3QUQA 3VOTA 3G7SA 3FCUB 3W2IA 5BSKA 3K3PA 5ES3A 5LN1A 1ATZA 1EHYA 3LZ6A 5IPFA 3ERCA 1E2BA 1JSRA 1ZONA 1CVIA 3GQVA 2J3LA 3A06A 3ABIA 3RD5A 4WGFA 5IF9A 1H9BA 3LKDA 2P69A 3PQ2A 4I81A 4IG4A 5DNWA 3SIXA 1QG6A 1QHHB 3HKEA 1UC4B 3PR1A 5C4GB 2J3HA 3W3ZB 4DBLC 2QENA 2MINA 2PD3A 2J9RA 3WLNA 2W6JA 3D1JA 1K4YA 3L8FA 3VJKA 3DLHA 1TRKA 4JDPA 1IWPB 3RU7A 2GPWA 4F4CA 1B14A 3O8NA 3OU7A 1VHTA 3U26A 1NPDA 2ZIFA 5E7MA 1GQFA 1RFLA 2Q8NA 4RXTA 5KVCA 1CWUA 1TUBB 2OZLB 2XR1A 2Y67A 4TWBA 4HH1A 2RHLA 4R71A 1RJ9B 1M34B 1XN4A 4RH0A 3PPWA 3DL7A 3RKUA 1X77A 1I1QB 3HI4A 4WLUA 5BQOA 2WJAA 3O8BA 1VL6A 3QWFA 1JDNA 3K4QA 4D7AA 2V7XA 3EJWA 2XUKA 2K5UA 3K30A 4H1HA 4JITA 4DL9A 5CA1F 2YWBA 4MVWA 1TK3A 4PZZA 2UYHA 1M3SA 2GKOA 3IAXA 4NAHA 3TTTA 3HGTA 4ADSG 2B3TA 1QX3A 2GMWA 1ZMXA 2WJHA 1GZ4A 3MWKA 4W9NA 1PD1A 1KFBB 4J0QA 1NI3A 3SSAA 2JEZA 2ZUUA 3DLCA 3G1TA 5I45A 2VHCA 5M3BA 1Q74A 1PJ3A 3JQ9C 3TVTA 2ZT5A 4A15A 1LBQA 1V8FA 5JNSA 5ERGB 3KAJA 2P8JA 3LPMA 3RJ9A 2GXQA 4FCCA 1UM8A 5DO9A 1H65A 4ZVOA 1IG0A 4EG0A 4CKBA 3WR5A 1ANKA 2WHQA 4RF4A 4TYPA 1KBOA 1SVUA 2H1FA 4MDHA 4IO0A 1GPAA 1KMIY 2X0KA 4P9NA 1NYQA 5ADHA 2GEFA 4TX1A 2BDTA 4GC5A 3UFXA 1DEHA 3ZGOA 4RE5A 1FMFA 4MKHA 4Q3DA 5TSDA 4P5PA 1MW8X 3MHPA 2PZAA 2X9GA 3A04A 4BRZA 5IAAA 5AR1A 2JFGA 5DOZA 3LDHA 2B98A 1F0NA 3WWYA 1C1XA 4R5HA 1XNJA 1WDKA 2QDXA 3ISVA 1OZAA 1P0MA 1VIYA 5K3CA 3X1WA 4BZXA 1GDTA 4XTCS 2D3TA 4MGHA 3UA3A 3QKSA 4LE1A 1GCIA 4QUKA 4ARZB 3CH6A 2YFHA 3P96A 3TSAA 5A5VA 4EMTA 4DSZA 4B4VA 6ADHA 3T3DA 3ADBA 3FETA 3ZWOA 3ZXYA 2J5KA 2D5LA 1X3LA 1O6CA 4M9RA 3RS7A 3AHFA 4W5OA 4FUQA 2V1UA 2PAAA 1K27A 3L01A 3HS3A 3SM9A 1WD7A 4LFBB 3EAQA 1OXUA 4UUQA 4XM1A 3QKWA 1A7UA 4R9VA 1EX6A 4UBOA 1E0SA 5I9MA 2RC6A 4UMEA 3ZE0B 1JAZA 4YCLA 1AZWA 4F4IA 1GN8A 3QUAA 1V16A 5F9HA 1AXRA 1ZA2A 3F74A 1CJUC 4KIFA 1NFQA 4XRRA 3TI9A 3FHOA 5HIJA 3DMHA 4O2RA 3ZVMA 4A8JB 4F9GA 3LQFA 3ZXUB 1NW4A 4B3XA 1BCSB 5JRDS 2ZUSA 2ZPUA 4F6RA 4GP7A 4P3KA 5C8YF 4DLSA 2VZLA 4M9SA 1E99A 3ZHRA 1J24A 5KQRA 3AOGA 3QX7A 2GBIA 2HMSA 2JJ8A 2VJQA 3BXPA 3KXDA 4GPTA 3PE3A 5FWDA 3O93A 1IY0A 2GZMA 1O2DA 4IIJA 4G8BA 5DI3A 3SNKA 3M1YA 5ABPA 3QSGA 2A9QA 2FR8C 3R0ZA 5ARCA 3MIZA 1SUFA 4P54A 1X7XA 5CX1B 5BSMA 1CQJB 2D7JA 4IIDA 3WBBA 3IR5A 3C3BA 3H6GA 4M0KA 2ZSUA 1JL3A 3Q98A 4C4AA 5IM4A 3H2IA 3T38A 1CKEA 3B8HA 3OF5A 3GLSA 3KALA 4ENSA 1S89A 1EFHA 3AY6A 4JP8A 2WYHA 3KEOA 3UOAB 2VDJA 3CLRC 2RK4A 3EIFA 3ICCA 1WULS 3ZWNA 4U6QA 4XFJA 4GBGA 3THYA 3R6WA 4R8KA 2VO1A 4E5PA 1KORA 2OFFA 3TL3A 1Y9DA 2RJOA 5ILGA 4H27A 3FNHA 3E8MA 1ZUNA 1FE8A 2O0HA 3P9RA 1ESCA 3CYFA 4OEHA 4C01A 2PUJA 3AJ8A 4K26A 1KTVA 1H2BA 3RV3A 3IOYA 4BGIA 2ZYHA 3EPPA 4S1PA 1GA6A 3AVOA 3I42A 1FP7A 1OXMA 3I2HA 4PS1A 1RIFA 2QTNA 4U6SA 5F9FA 4PX5A 3WKAA 3ZX4A 5KU7A 2Z4TA 4XCXA 1JEYB 1E2NA 1NLMA 3QXHA 3P2MA 2NVBA 4QELA 5F35A 5FTWA 2X1VA 1A04A 5EGNA 3TXYA 1KE1A 2BISA 4KPUB 4B4UA 1KFEB 3HA2A 4OMFG 4RTSA 2HMUA 4EY3A 5B7QA 4H6PA 1IXKA 2FW6A 4MKZA 4URYR 2HF8A 4YN3A 4CTOA 1Z6QA 1ZOLA 2V7WA 2C61A 2HO5A 2OO3A 3KV1A 1H0RA 4QDXA 1FTGA 2OR3A 1AO3A 3FMVA 1V1MA 2KB0A 3ITDA 3SY8A 3WMFA 4C4PA 3SF8A 3ZU2A 2ZZNA 4QIHA 1VB5A 2E85A 1M72A 4QOJA 1QMGA 2PR7A 4AWBA 3EQZA 3KOYA 2QTWB 4NBUA 5SZKB 2NV0A 2P9BA 4Z9YA 3ZLUA 1W9HA 1JFLA 1G16A 4MUMA 3RM3A 1SCJA 1K6EA 1E92A 1P4AA 3UVEA 2I5PO 2Q0QA 4LQLA 4X62B 4RETA 4P0PB 1TI7A 1FLAA 1UC5B 4QPNA 4W6QA 1L2TA 4F6LA 1OFVA 4Q1AA 3U1TA 2RB4A 1NQXA 3U3MA 1E1LA 2M98A 4OM7A 3MZ0A 3QVXA 4YYEA 3VHRA 5U9CA 3F5MA 4AAYA 1R4ZA 4TSFA 1VYUA 2WTXA 4FUTA 2FJPA 4G36A 1GU7A 2QVGA 3DTNA 1TX4B 4UBMA 5GIOE 4RABA 2GCPA 2V7TA 5EESA 1XD9A 4X1YB 4LZNA 3ACDA 5GWXA 3PQ8A 2YV5A 2YYZA 5I7VA 2YQZA 5IANA 1QAOA 2Q4DA 1IN6A 1QIIA 4OAOA 2COEA 3C4QA 3G6WA 1MLDA 3PITA 3R3XA 3VHLB 5LYJF 2CMFA 1VFPA 3S1LA 5EJ9A 1QO0A 1DXOA 4RVDA 4F4DA 2XMGA 1BCRB 4YLGA 3PNVA 5H4HA 3UMJA 3NO4A 1WHSB 4Q4AA 3RYCA 2O8EA 1TQDA 3MMSA 4EW6A 2D1QA 1IAQA 2QW8A 2AMFA 2CNWA 3RYFB 1CY0A 2IY8A 3K09A 5H9VA 1L5HB 4RK6A 1JE1A 2J7PA 1JYEA 2R60A 2ABWA 1R18A 4OYHA 1GD1O 1JEAA 3ETNA 1ADYA 4QWMA 4LOIA 3C5HA 2R0QC 2EZ9A 4MS4A 4X63A 3HB0A 4YVFA 1IHXA 4I14A 1EX9A 4I9GA 3SU8A 1P74A 4DLRA 2JCGA 3QP9A 1DC7A 3JAKA 3KLBA 3Q2OA 3PI6A 1DQYA 4YMHA 5JD5A 3CC8A 5KVVA 2VRCD 7ABPA 1NRWA 1SXHA 2FRDA 2YRXA 2ZPAA 3VBEA 3DR5A 3EZYA 3PUJA 1QP8A 4CKZA 5HGXA 5LLDA 1EFUA 4Z0HO 2YDXA 2XBUA 2GRJA 2CHQA 2V9PA 2V6GA 3H42B 4Q9DA 2XQFA 3V6LA 1AF7A 3GLVA 1SUDA 1I4TD 4EGAA 1CRPA 1C9JA 1MGOA 4IIGA 4B73A 1E66A 2JAWA 1OTYA 3JQAB 1NJ1A 5DNVA 1P1BA 3DL0A 4N5NA 3NC1C 3S55A 3TSWA 4P92A 1Z15A 2YFQA 3AWDA 4QYXA 4NFLA 1Y3CE 1WZIA 2JLRA 3QI2A 5ALZA 1F8YA 2JBWA 1E2JA 1EHIA 1FQWA 1HM5A 1Q0UA 2BEUA 2PX0A 2Q0XA 3IHLA 4N0EA 1X7ZA 1W2GA 4P86A 5IJXA 3U13A 5J2TA 1NI4A 2EEPA 2OYRA 1JECA 1GFZA 3IAM6 5MGNA 1EIWA 2UXCB 1YL5A 1AT1A 4OHMA 5BY2A 1EI9A 3DBHA 3L6OO 3MTEA 4F21A 4DPMA 5K0CA 2O52A 4YRKA 1QE0A 4AZSA 2ZYSA 5BMVA 1WWKA 2P68A 4GI2A 4OHKA 4XDZA 3SEQA 3W8EA 5CDFE 5GTDA 3WSWA 3AIOA 4FCVA 3QU9A 1QONA 4A0HA 4ZYYA 1H1TA 1KK1A 3VGJA 4K86A 1LJ8A 3Q85A 3OCUA 4E07A 3IS3A 3A11A 1PG0A 1U2EA 4GSYA 3JZDA 1GRQA 4AVYA 1N2OA 2FEPA 3OIGA 2DR3A 1KVQA 5C4MA 4KQKA 1U0SY 3VR3D 2XA9A 4YCBA 2O7RA 2NUPB 1YRHA 1GR1A 3FPKA 1GPWB 2XGMA 3RUPA 4Q01A 3AF6A 3N0RA 1MD9A 1RJEA 2VH1A 2NV6A 4ZEMA 3R3ZA 1RI1A 4K5QA 1P60A 1ZZEA 3P2EA 2AFVA 3SZRA 1RMYA 1YZTA 3FYCA 1F0KA 5KOJB 4RTJA 3FWPA 3FSEA 3BKWA 2WVGA 3TZ6A 2WTNA 1PR3A 3ILXA 2QSZA 2XJ4A 2HRDA 1E1YA 4GT1A 3EXHA 3GJ3A 5B1DA 3ROEA 3HVRA 3C7AA 3OD1A 4IDCA 1JKJB 2DFTA 1P91A 4WK6A 2DQZA 4EF4A 2FMUA 1U1DA 4LW8A 1O89A 2YJ4A 5FPKA 2J0UB 3BSFA 1EJBA 3OLWA 4UQLA 1PNTA 3VPHA 4Q3OA 3KSBC 1T8TA 3QUBA 3I23A 1NP6A 1ADFA 1HL3A 1R0XA 1A5TA 1YCFA 2QLNA 4J9VA 1G8FA 2FCAA 4C2TA 1NLZA 4RULA 1H5QA 1LEHA 2BFDB 1U1EA 4U02A 3TUZC 3BX1A 3A6GA 3MWGA 3NAMA 1MORA 2J85A 3TCXB 2O8BB 5CH5A 1C1HA 3GLHA 3IULA 5HA5A 2B25A 1M6VA 1T4MA 2YOGA 3H5RA 3I2IA 2PYZA 2GJAA 2JH3A 2HA6A 3VQTA 5FWYA 1N7HA 3WVNA 5H80A 5IEBA 1ZP6A 4PY2A 5JD3A 1EB8A 2NO9A 3NOQA 1NUQA 3JU3A 2FEWB 2OD7A 4FXOA 5AT1A 5EQTA 3K20A 1AQLA 2AN1A 4I8IA 3OM0A 2IBMA 2Y0BA 1GQYA 4K6KA 3LT4A 2R6ZA 2YJGA 5DLDA 3T7IA 4I9HA 3TPFA 3SXUA 1Q95A 3W8RA 4GOLD 5CB4B 4BGVA 4YPFA 1KQGA 3NH6A 2WBLC 2AZTA 1ECGA 2C84A 4M1KA 3H97A 3KKNA 4HWKA 1KEKA 2CE2X 2D4AA 3ZH9B 4YXFA 1E94E 1W7AA 4QOFA 1HQDA 3DAGA 3DSRA 1ZLYA 4NDNE 1E4EA 5FYDA 1K9SA 3COYA 3N2ZB 1YVDA 1QZZA 4EG6A 3DP7A 3MPUA 1UR5A 3DJFA 2QN9A 3QKRB 5CRIA 1XEWX 5FOTA 1LV7A 4TMXA 1IXSB 2QORA 2H51A 2EKQA 3WNCA 3RJ5A 2PXAA 3C6YA 4CLRB 1QVAA 3CH5A 4QC2A 5I5EA 1N2GA 5JS8A 2BGWA 5LOVB 7MHTA 3Q9LA 2KX7A 2L42A 1COZA 4BMCA 5IX8A 4YROA 1NTRA 3LBYA 4ODIA 4ZK6A 2QZPA 3G13A 5LNK6 3QWAA 4J7AA 2E4AA 3BWYA 3PCXA 1NI5A 2VJOA 4G0QA 4K7JA 2ZYIA 4UU7A 1M6HA 2IGTA 2B4TO 5DM60 1L7BA 4A0QA 3LSTA 2JGNA 5LDHA 1SNYA 3C3XA 1THZA 1QRUA 3GROA 4YLYA 3EVNA 1R2QA 2FWJA 1US8B 4GP9A 3C3KA 3UUGA 5I4IA 2J6BA 1MBZA 4WZBB 4IH4A 5ARDA 4AZ3B 3OZDA 1P7YA 4EZBA 4DR3B 4TYWA 1TF5A 4J0EA 1OZHA 4Y9SA 3I73A 1EFRA 1SBTA 3AY7A 1MPXA 3ZW7A 1C3XA 3AJRA 1DQNA 4HX5A 3U49A 1B4DA 4ECAA 4TKUA 4X20A 1BEUB 2I55A 1A82A 4W5JA 5HQ3A 3BWBA 5TQVA 1JVNA 3JQGB 1E89A 1TK2A 5CXQA 1V1RA 1I7NA 2XYVA 1E32A 1K5DA 1E9VA 1D6SA 1A9SA 2NO6A 1V7PC 4KQCA 5BN4B 4HAXA 3IDSA 2JGJA 4O4HA 2Y4OA 3AEUA 1GRCA 2X5OA 4BKOA 1V35A 3LC0A 3GLKA 5AESA 3GVIA 4MR8B 1S2NA 1WJGA 1Y8RB 1YZ3A 3DZHA 3EEQA 5DI9A 4CMIA 2B3DA 1UQUA 1MB9A 3OCCA 2IYRA 4GLFA 1E9SA 2ZXEA 4ZVNA 3PFHA 5DK4A 3A9WA 4H9GA 5TJ9A 1WM1A 5P21A 4OXKA 2EZ4A 2XD4A 3BFJA 4ZOLB 1ULUA 5JLAA 1U8YA 1T36A 2VP6A 3AWIA 3DVSX 3E9QA 2QUKA 5E6UA 2BFCA 2FA9A 1TA9A 3WL3A 4FW9A 1QZXA 4DT1A 3L40A 5HKKA 3FI0A 4BFUA 3DCNA 1DB3A 4LYGA 3E9DA 4XWKA 2BLNA 4QLAA 1SUAA 3BB1A 2R47A 3ICVA 2DUWA 2W8BB 2QLLA 3E22A 1O4WA 2QMEA 4OP1A 3T3EA 3CNQS 3GGCA 3N39C 4B3CA 3FDXA 4CZ2A 2D00A 1AKTA 2G6BA 3K0KA 5K3SA 1DV1A 1U5AA 4CU5A 4YRAA 5TIIA 1E3QA 2VAMA 4OQEA 5EHNA 2DSNA 2IY9A 3PDCA 3E03A 1J8VA 2YJNA 3Q3IA 4LQDA 4JSTA 4OL9A 3JALB 5AVQA 2D7DA 3UQYS 4DR2B 4OMDA 1CY8A 2XD9A 3DMTC 4JFAA 3RGWS 4F3NA 2CZGA 3L0ZA 3QPVA 4Q4LA 3Q87B 3QFHA 4IV5A 1X8LA 2KYRA 4M49A 2XAAA 4KE8A 3V7WA 3FB4A 2OM6A 1NVAA 5ALSA 3CBGA 4J0HA 5E2IA 2OGZA 4COKA 5BRAA 3ZHQA 3PF9A 4D9GA 4RVOA 4Q9IA 3MCWA 1P2FA 4AD8A 2WG1A 3DDSA 3IVGA 1PW5A 4UPDA 3O9ZA 2JLVA 3VBCA 4NDZA 4V0KA 1KOGA 3HRIA 4ZOBA 4J3FA 1VMIA 2I99A 3QEMA 4X85A 5HK8A 5B3AA 4UCXA 4F86A 1VIDA 2FPPB 3A1CA 3G59A 1UWCA 2IYPA 3HVIA 3VDXA 5A4DA 3OJOA 2Q27A 1M67A 4WFQA 4BOYA 4LZJA 5JAPA 4C7OB 1IBSA 4CDRA 1PGQA 2RKBA 1JEQA 3TEJA 3TLMA 5EA2A 3V1LA 1N4AA 3L8DA 1UBKS 2VYCA 4JLBA 4CLEA 3CB4A 1PSDA 2LW7A 4C06A 4GL2A 2RHGB 2VQ3A 1OAKA 4YRDA 4IIFA 5A9TA 1NE2A 1C0PA 4LRWA 1KI8A 5CK5A 3QEBZ 4PRYA 4AULA 4Z4IA 4JP2A 4RGBA 1H2WA 1AZLA 1P0QA 1Z28A 2I7VA 5LXTF 1HEIA 5J59A 3GMTA 1B1CA 5L4SA 1N2XA 2C5BA 1OJLA 1WTAA 2CHUA 2Z5LA 1X9IA 3DZIA 2IUFA 4XIJA 4K3UA 2N75A 3Q7PA 4LDQA 1JDVA 1X9HA 1BZYA 2ZIXA 1N0HA 1TQ4A 3AVQA 3TIXB 5MN6A 3PXCX 2WHXA 1G5HA 2NP7A 3KPWA 1ONNA 3THXA 2OGUA 1YJ5A 5I3CA 2A1UB 2IYOA 3C3CA 3P4XA 3KHUA 1LGYA 1XTSA 2CNBA 4HVAA 2WKPA 4IKOA 4MKIA 3QY0A 4NECA 1ESZA 2VCYA 4HWPA 4QFDA 3R7BA 3WIBA 2O2DA 5BV1A 2ZUTA 4NKRA 2XUAA 3KOMA 1YGYA 2YCBA 1TLTA 4RSRA 1ZVJA 3L49A 5GY7A 1CQWA 2RBGA 4QU5A 2G7ZA 1P1FA 5HHTA 4FILA 4I5GA 4KV7A 4YTEA 2IS6A 1DEAA 1EIZA 1XTBA 1CK4A 2FZCA 2I34A 3LOPA 4I6EA 2YXLA 5FI0B 3PR2B 3NETA 2Z2JA 1H05A 1Q0RA 1T1JA 4V3CA 5DE3A 1KAQA 4NU6A 1S01A 1L4NA 3QYFA 1MU0A 2FN7A 4DQLA 1L7NA 1ZIDA 2BI4A 4H18A 1A9XA 1T0JB 3HGQA 4RGYA 5C8YA 4AY6A 4PVCA 1BGXT 1TL7C 2XYPA 2JHAA 1P9RA 3EPKA 1CP3A 5DW0A 3TAHA 4CQLA 4E1AA 3DZFA 3NWBA 4HQRA 3KPJA 4YXWD 2GFIA 2ZRPA 3PXAA 5F77A 5DW3A 4FFMA 5D7BA 5EZ6B 4D4JA 1VRWA 5KPJA 2QN6A 1QIHA 4MUBA 5LKAA 3G0HA 3N74A 1W88B 4Z6KA 5CBPA 2JL1A 1JIUA 4JBHA 4QJBA 2C77A 3AL3A 3BB4A 3NHAA 2CD9A 1EMDA 1KVRA 3SEFA 3VR0A 4D8TA 2IE8A 2VJMA 1D2RA 2NV2B 3EEBA 5D5QA 5AQ1A 3TWOA 4EUNA 2ZYGA 3NNSA 3ZU4A 1CJBA 3SX2A 1PF7E 3UOGA 3TOSA 3LY5A 1VKNA 5DK6A 5JJLA 1HA3A 1MT3A 3DAPA 3R44A 5FBZA 2QT1A 2VOJA 5HIMA 1V6SA 2QP4A 3W2TA 5B1YA 3PFGA 3LUBA 5FO1A 3LPNA 2J32A 4Y2YA 4A6EA 4QQ8A 3GP8A 4XJSA 3KCNA 5LP6A 2IK8A 3HVJA 2H59A 2OHVA 3O82A 1UT8A 1NE7A 2XTAA 3H5NA 1Q2UA 3NJRA 4NQRA 1OGJA 2TS1A 3OUUA 5L3RA 1FFGA 1Q84A 3R9KA 4Q7LA 4E1VA 4EKIA 5JPCA 1T15A 3FUTA 3M6VA 1RHUA 2PZGA 4LHSA 5BOSA 3TDMA 1APBA 3RQIA 1NVBA 2X0DA 3E9MA 5BSHA 4NFHA 3DEAA 1LTQA 4Z0TA 2R6AA 3NJ8A 2UKDA 3EXG2 2F67A 1EVLA 1BDJA 2ONKA 3HSKA 1VKZA 3AUUA 1X8XA 4RTRA 3WYGA 3L77A 2NTVA 3ZBPA 3PGA1 1E9BA 5I9IA 2QMOA 2ZSEA 3TW8A 5A3QA 2XRMA 3LH5A 2RMKA 1GPBA 4WKPA 5CLGA 1UBMS 3E2IA 4JS0A 3BZUA 3D3NA 3E8SA 4CV0A 4DM4A 3TNJA 1TJNA 3FH0A 3MYRA 1X0XA 1AS3A 1DIRA 2ZBQA 4G85A 4I3HA 3STUA 3WRYC 1R6AA 4NY1A 4ZN6A 3G5LA 5BQ3A 1YK0A 2PJRA 4JCOA 4N65A 4D98A 3IO5A 1L8QA 5DF1A 3ZK8A 4DIUA 3TRHA 4FJ2A 1B00A 1UXKA 6REQB 1BU5A 2A30A 1WU8A 3IUJA 4IKEA 5ECGC 1L4LA 1JA0A 3MGAA 2XVZA 1JHZA 2PUDA 1LBHA 3K1AB 1OVGA 1F3OA 4W82A 1JLLA 1XMOB 4DMKA 2Q6VA 1KHHA 1TCAA 1S9HA 4A8TA 3JQ7A 2HRBA 3A1SA 5FQOA 1X3SA 2O7NA 2B4QA 1B42A 4HGYA 3W77A 5JMTA 5AM2A 1VPWA 3E0QA 3MHTA 1TYDE 4JUCA 1E96A 4OM8A 1P80A 2HNAA 3GT7A 1AMOA 1WBBA 1K89A 1ODFA 1B26A 3WOHA 4EX6A 2HBYA 2MMCA 3I1JA 3UIEA 3DWIA 5ALFA 2D1YA 3JWHA 1MAAA 3UKJA 2ODAA 3R2JA 2PUAA 3TSCA 2FF7A 1ZJ5A 3HWWA 1A97A 5BSGA 2PX2A 1BS2A 2Q5HA 2QR3A 3UJHA 2ACKA 1T3LA 3PUKA 4I4C