4Q1CA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 8 {2,2'-[{4-[(2r)-4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-2,3-dihydro-1,3-thiazol-2-yl]benzene-1,2-diyl}bis(oxy)]diethanol}
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1cA00
2KJQA 3C14C 5AWFC 1SXJC 1Z8FA 2WSMA 1E2IA 3OEHA 4IOLA 4OI4A 2NO6A 2W6JA 1Z22A 3CM0A 2BKUA 1Z06A 2RAPA 2V3CC 3OHMA 1W44A 4US0R 1FQKA 4DLTA 1Z0KA 3K1JA 3AKCA 4OHVA 4C0JA 2HYIC 1AQUA 1NVVR 2J0UB 2WICA 2BM0A 2D62A 3KQHA 2X1VA 2QT0A 2WOOA 4XTCS 2D7DA 3GFPA 1SHKA 2B7BA 5J5CA 4Q4JA 3ADDA 3CZPA 4HLCA 5JBQA 8OHMA 1LB1B 5D3QA 1IN7A 1BO6A 2G1KA 3R20A 2OESA 3B13B 1ZC4A 1KOFA 4JLKA 4PR0A 3LX8A 2J0SA 2OT3B 4HI0E 5L3QA 1GG2A 1G41A 3CRQA 221PA 3CRRA 4WZBE 1YQTA 2D06A 4LV8B 4Z1MA 2AXNA 1IN4A 2OCBA 2R6GA 3AB3A 4WXRA 1OYWA 5KSYA 2YC2C 1N5KA 1ZW6A 1T5IA 1S4QA 4NHOA 3NBFA 2J87A 2I4IA 3SJBA 4Q03A 2AXPA 1GVNB 1H8HD 3FKSD 5FPTA 5F3WB 1W0KA 3P4YA 4R9UC 1XBTA 3QPWA 1S96A 5JCPA 4A6PA 4V0MA 1SXJB 3DOEA 1WBDA 4GBMA 1E0JA 4HYYA 3C7KA 2KWIA 3PUYA 4L9SA 3ZZUA 4DCTA 1TNDA 3CRW1 2BBOA 3NEYA 1SZPA 4DJTA 2GZAA 5FOWA 1M7BA 1OXSC 1GIAA 2OFXA 4NL4H 3KKPA 4PC7A 1SKYB 2QTHA 3SYKA 5G53C 1KO7A 2WJHA 3R8FA 2WAXA 3W34A 4Q7KA 1KNXA 4G0NA 2TMKA 2R8RA 4UNRA 4RZ2A 1BYIA 1CKEA 1EX6A 3T12A 4RKEA 3RRYA 4OHXA 2O0JA 1SVMA 2WMOB 1VG8A 1N25A 4M1KA 4AIIA 3K70C 3U3RA 2WJGA 4LJYA 5F2EA 4QJ3A 5JS7A 3U6BA 2WJJA 1A7JA 1OKKD 3FVQA 4LYAA 5EXPA 3UWKA 2ZIAA 3D6TB 1M34E 2CVFA 4TMXA 3L0OA 4OI1A 1Z6TA 1PUIA 4FMCF 4I81A 5FH9A 3LW7A 3U4QA 1AS3A 1F60A 3LVRE 4LY6A 4TYNA 2ZRNA 5DSZA 1IN8A 1GL7A 3AUYA 2VIIA 4GDFA 5FTNA 2RGBA 4P31A 3A8TA 1J70A 5J4LA 1PJRA 5CB6A 5K8TA 3QKUA 4MITA 4GP6A 5BXQC 5EP1A 4Q4LA 4TMVA 4ZCMA 1SVOA 1GTVA 4LBVA 4Q5IA 4XJXA 1KI1A 1EWQA 4QG7A 3NBXX 2XXAB 3RS2A 2XZPA 1JR3D 1E79A 4C7OA 2QZ4A 2FOLA 3WBKA 3RRNA 1RVDA 5B57C 1GRNA 3VR6A 4OI2A 4AK9A 5BYJA 3IIKA 1NY6A 2IC5A 3EG5A 4NCHA 1DBSA 1K5DA 1E1QD 5JJIA 1N6OA 1U0LA 1XD9A 4I1UA 4M1YA 3SR0A 2EFHB 1M2OB 1LV7A 2P0EA 1Y63A 2P5SA 4AYWA 2BJWA 3U7HB 3LLUA 1OIWA 4ZI2A 5J40A 4IOKA 2QBYA 4M2LA 1WCV1 3BFKA 4PAOA 1Y3AA 4Q01A 3K70B 2OFOA 4JKIA 4N0DA 3B85A 4AKGA 4YMSA 4ABYA 2FF7A 1E2FA 1EXMA 2R65A 3W90A 4D80A 1Q21A 3ZQJA 1ZIPA 4BLQA 1OB2A 3LLMA 3K0SA 1ZBDA 4W5HA 1UJ2A 1MV5A 1GKYA 4US2R 3V4FA 1NKTA 4IOJA 3R9WA 2G1JA 2K5UA 4CYMA 1M74A 1XMSA 4LJ7A 3I61A 1YZTA 1CBUA 2LWIA 4JLOA 1G291 1VG0B 1RRGA 1GZSA 1UFQA 3GEIA 5C18A 1CTQA 3IDQA 4D4MA 3BXZA 3U3MA 3BH0A 4UNNA 3GJ7A 4JL8A 1AS0A 2FN4A 3WYFA 4G5QA 3ZGXA 2KBFA 3TE6A 1LS1A 2GAOA 3K0EA 3VR3A 4IHQA 2ODNA 5K8IA 2L0XA 3B5JA 3WP1B 2QU8A 3AVWA 2BMFA 2J46A 4TTPA 1OIVA 1OJLA 1OPXA 1NP6A 4D0NA 2FDCA 2OO7A 2C04A 3HPQA 4QKQA 2O8DB 3SI7A 5KSZA 2F6RA 1RRFA 2PMKA 5P21A 3EX7C 1E2EA 3NBYC 2F43B 4LRWA 3SE0A 3TR5A 1COWA 5FOXA 5JECA 1TAGA 1HUQA 4B74A 1QVRA 1Z5ZA 1CEEA 2IHYA 1Z83A 4B32A 4URWR 3THYB 3OF5A 2CMKA 1T8UA 2JLRA 5HCNA 2JCSA 5UKDA 5L3SB 2AWNA 3W3AA 2PJRA 2ZE5A 3KXLA 4FINA 2KSQA 3BWDD 2AK3A 2GA8A 1G7SA 4JVMA 1DS6A 2W6IA 5FUVA 1L7VC 4X8OA 5FPKA 1EFRD 4KJZA 1IN5A 3EWSA 2D74A 2CJWB 4HDQB 3T34A 4J0QA 4KAXA 5JEDA 4Q48A 4F4JA 1IJEA 3BD9A 3CNLA 2ODEA 2IYUA 1JR6A 1ZUNB 4HSEA 4Q9KA 2ORWA 4HB2A 1T91A 4D6PA 4HDOB 2JASA 4MGZR 1Z0FA 1ZNXA 3CX6A 3F0TA 2FEMA 1TU3A 4LZZA 3LV8A 3QSYA 2AK2A 1CJVC 2OLJA 1KAGA 3WNBA 3QKRB 3TLXA 2MSCB 4LC1A 3F8TA 1UEIA 3PFIA 1X1RA 4D0GA 3DHWC 4NTZA 3GPLA 2FZ4A 4D4JA 4TL6A 1IONA 3IEUA 3R7WA 3WBJA 4NZYA 3DMNA 2RKOA 3KDSE 1KHTA 1G20E 4NBSA 4LYHA 2V7QD 3C4JA 2O8CA 1E2KA 1S0UA 2CHVA 4L5BA 2ZJBA 1IN6A 3TQFA 2QMEA 3GP8A 2QPOA 1UKYA 3NTUA 2ZS7A 1KI4A 4MYCA 3CR7A 3KJGA 3OEED 5IHPA 4EPRA 3UPUA 1E4VA 2C9OA 5C4GB 3CWZA 3B60A 1E9RA 3N2IA 2KB0A 4JLPA 5D3MA 1FZQA 4B2PA 1D2NA 2C5LA 3AF3A 2GBLC 5KDOA 1YR8A 1TADA 1EFTA 4A2WA 2BBSA 4IXNA 4LOAA 2JJ2D 3TJZA 5DO9A 2O8EA 1XEXA 2Y8EA 2VP0A 4PPQA 2IYTA 1IBRA 1JR3E 4XWKA 2V4ZA 1EFHA 4LGMA 2QMOA 1TX4B 4DSUA 5CLLA 2R9VA 3GLGB 1CR4A 4R71A 2BBWA 1IHUA 1TMKA 2VHTA 2QM7A 3PXGA 2ZVQX 5DISB 3K0CC 2GJAA 4O2LA 4DLZA 5F98A 1ZCBA 3WRYC 3CNNA 3OEHD 2WKRA 4TMZA 1XTIA 1AZSC 2W6JD 3K9GA 4P33A 1ZD9A 2GVZC 1NIPA 1Q20A 2ZEJA 3B6EA 4DKXA 4AYTA 1OT3A 2J7KA 5GJWC 2PX0A 4OQNA 3FB4A 3KQNA 2ZXUA 2GXAA 4HLDA 4D0LB 2JLXA 3ZDQA 3RVBA 1HE1C 1SQ5A 4M1MA 2C78A 4EFMA 1YZLA 1R8SA 2CL0X 1KI6A 4AURA 4FCVA 4M9ZA 1QG2A 3PCRB 1VG1A 4B2LA 1TF2A 3B1ZA 4ZKEA 5JEEA 3VKHA 1J7KA 5EXTA 1CLUA 4IFEA 4QXAA 3DZDA 1U0JA 2D4HA 4PZYA 4F7WA 2BIFA 1VCNA 3ETLA 2ONJA 2ZRBA 4BGDA 1KNQA 1YR7A 2ZJ8A 4TYQA 3REFA 1QF9A 4FIDA 1AM4D 4URYR 4C2TA 1TPZA 2W83A 4BLOA 3L8ZA 1FQJA 2O0KA 2P5TB 4CT5A 2DWOA 1BKDR 2D2EA 1MH1A 3LO5A 2B92A 2ZI4A 2PEYA 3IBGA 4Z1MD 1W4BA 1ZIOA 4RD6A 4A6XA 5FR1A 1D2MA 2Q9BA 3AKEA 721PA 2ZANA 5JI2E 1NVVQ 1NVWQ 2ZJ5A 4GOJA 1K8RA 4XTRA 3T1OA 2BC9A 2B6HA 2C77A 1US8B 2V6IA 1OH6A 1KIMA 1W0KD 4W5WA 5KNCA 4YXWA 5DI3A 4BLPA 4CEHA 4B3GA 4LUCA 2JJ1A 5AUPB 2ATXA 2YWGA 3N2EA 5H68A 1ZM9A 3G5UA 3T1VA 3VNVA 1Q12A 3S1AB 3U7GA 4OQMA 3WY9A 3ADKA 4GPTA 4JLBA 1GITA 4NPHA 4KSCA 1VCMA 1CF4A 4QGAA 1E9SA 1MRSA 4IW3B 1XJ0A 1OW3B 3LNCA 5DYGA 2XSZA 1T6NA 1U8ZA 4KV9A 5CDFE 3Q8XB 2FFBA 2XNSA 2J5XA 2VYFA 1GRQA 4E09A 4BE7B 521PA 1N0UA 3BRWD 4UKDA 3NDPA 3TW4A 2MMGA 3P20A 2QP9X 5JHHB 1NN1A 3ZQ6A 1FMJA 1W49A 2CHQA 3LA6A 3GLHA 5DHFA 3THWA 4A8JA 3KUCA 2HXYA 1WRBA 1X3SA 2IYXA 3H0KA 1G16A 2V1UA 3TUJC 1VHLA 4QJ5A 1NF3A 3B8HA 2Q9AA 4Q7JB 3WMFA 4BFSA 4QJ4A 2GETA 4W9MC 5FL3A 1G8FA 1Q57A 1ETUA 3NWJA 3D7MA 5CYOA 5DI9A 3BB3A 1RKBA 3BC1A 3SFZA 4GZLA 3EPHA 2DB3A 1YHNA 2GCOB 1G3IA 2JLZA 1CRQA 5JMTA 4NYIR 3BH6A 1RYHA 1LVGA 2ZU0C 4KVAA 1CR1A 2EFEB 4C0QC 4C4PA 3A1VA 4Q21A 3U7FB 3I5XA 5H1YA 3SHWA 4M4SA 1T0HB 1C4OA 2IYVA 4O2RA 1XPUA 3EAQA 3W6NA 2GKSA 3GJXC 5EE5B 3OIVA 1E79D 4NP6A 1EESA 2CEAA 5LPNA 3A36A 3RS4A 3JVVA 5HTKA 1L4UA 4BPBA 4UJ3A 2NIPA 3X1YA 4NYMR 2VPPA 5EP3A 1GFIA 3LXXA 1ZRHA 1J90A 2REXB 3KX2A 2FU5C 3AF4A 1H8EA 2GK6A 2O8FA 2IA5A 2ZROA 4XWOA 1F5NA 2IYRA 4CEIB 3MG9A 2CE2X 3OIUA 1GNQA 2UZ3A 3CW2A 4EKDA 1E9EA 1SHZA 4K8OA 1G8GA 4YMTA 1JB1A 1HQCA 2C8VA 3PUXA 3Q7PA 4HB0A 4JYBA 4B3XA 1P9NA 4DXAA 2P3SA 3EC2A 1HTWA 4ZCIA 1R6BX 1F2UB 5JCZA 1IAQA 4XD7A 1KO8A 4AWXA 2KI5A 1ZC3A 4I1OA 2EQBA 5FBWB 3W6PA 1UEJA 1OFUX 4M8NE 2KBEA 4RVCA 2GTPA 1R8QA 4JLAA 3AVUA 1OXUA 2VHQA 4FI3C 4HUQB 1IJFA 2XZOA 3QXJA 5KDLA 3C5CA 1KY2A 3ONWA 2GF9A 4IXMA 1FNMA 4TWZA 5CJPA 1IOZA 3FTQA 1QG4A 2OBMA 5DN6A 3B1VA 2WBLC 4BFZA 3B78A 4NYJR 2F55A 2ODWA 4GMXA 3G82C 3B1WA 5KUTA 4ZIRA 5FOUA 4X8MA 2GF0A 1G17A 4LHYA 3I5YA 1XFAA 1RJ9B 2OCAA 4Q4HB 5GJBA 2D2FA 2RGNA 5M04A 2AFHE 3OESA 3O8DA 1RRPA 1G6OA 1HE8B 2GCNA 2FA9A 1XEWY 3T5DA 1D6JA 1DTSA 4JBWA 3VFDA 3LBNA 1NLYA 3P32A 4RJLA 3K0AB 5CDFA 3KL4A 4FW9A 4TZ6A 3T15A 4DWJA 4WA7A 1COWD 2ONKA 4KSBA 3GMTA 1RW4A 3ZVMA 1EK0A 1DEKA 4TTRA 1Q1ZA 1EX7A 2GESA 3RLFA 4E5UA 4HZUB 5GVSA 1PLKA 5EUQB 1DAIA 4F91B 4V0ME 1C1YA 5BN4A 1OFHA 3UMSA 4YC7A 1S1CA 2VH5R 2YOFA 3TSZA 1ODFA 3QKTA 1E2LA 2W6ID 4HZIA 2NZ8A 1TUEA 2GEVA 4D81A 2NPFA 1NSTA 3GEEA 3CZQA 1QRAA 4Z8YA 3KQUA 1SULA 1ELOA 4A0RA 5JJLA 4G1UC 4RD4A 2ZSEA 3W5IA 2C96A 3A1WA 3GFOA 4FCWA 3WRXC 5J4KA 4B76A 1DAHA 2WMNB 4BRUA 2QMHA 2AWOA 4QBGB 1SXJA 4NCIA 4W5JA 3ZLJA 1X6VA 3N5CA 1D9XA 3HWSA 3BS4A 4M9XA 3SBEA 4GRAA 2F3RA 4RZUA 4DDUA 3A1TA 3OFNA 5CLQA 3ICQB 2QTFA 3W8NA 4OYHA 1K6MA 4TN1A 2P67A 1W47A 5C46F 1JI0A 1KTVA 3IO3A 3THXB 1DAEA 1P73A 4TTQA 1UAAA 2F1RA 3IILA 5FPSA 3ADCA 1E0SA 4C30A 5IF9A 2QAJA 2XNDA 4PQFA 3I8XA 5AK0A 1KMHB 2QPTA 2ZRIA 2PL3A 2GRJA 2R62A 5BWMA 4Q1EA 3A6PC 3MJRA 2ZE8A 4MUAA 3AH8A 1II9A 4OL0A 4TL9A 5J4VA 2A5JA 3AVQA 2OAQ1 4PC2A 4R7ZA 1CXZA 1NN3A 4V0LA 3P26A 3KTAB 4S2EA 4L15A 3C5HA 5CJ2A 3P1JA 3BE4A 2W2XA 5FUYA 2FX3A 5G3ZA 1ONBA 1X1SA 2FSFA 4L8GA 2QUZA 4A1FA 1W2GA 5H8WA 2ZAMA 2NGRA 3OAAA 2FV8A 2MSEB 3B1YA 4ESHA 1S2MA 4RFVA 4YDHB 2H1LA 2HLDA 2BKEA 4JSYA 1MO4A 1NI3A 1NKSA 1N0WA 3K8YA 5DH9A 4Q47A 2IWHA 4QM6A 4P4SB 4C0SA 1ZM3A 1CJTC 4ON9A 3FOZA 2PT7A 3LDAA 1ZU4A 1T9HA 1E2HA 3BIFA 2XXAA 1P72A 2ORIA 2RGXA 3CF0A 1NJGA 3SYNA 1HEIA 3UMFA 1F2TB 1Q3HA 2DFLA 1KK0A 3WNDA 1L2TA 3GEHA 1AQYA 1S3GA 4LV6A 4MYTA 4RD3A 3TW8B 1RYFA 2J0QA 4WIAA 2X8AA 1Z0AA 3AVPA 2OM2A 3CRVA 2F1IA 1J8YF 4M21A 2BHRA 3SS8A 3LW8A 4YMWA 3QVUA 4PHTA 1OH5A 1OXXK 5BQ5A 2DWPA 1ZNWA 1RIFA 2DWQA 2CE7A 3IBYA 4Q18A 3NHAA 4TMKA 4EPXA 3U60B 4PPGA 2WVJA 1QBKC 1WMSA 1J2JA 1G8PA 2PLFA 5DIFA 4ZCLA 4TZ0A 4QBHA 3C8UA 4I1VA 1OV4A 2GEUA 4XSGA 4HB4A 4M1OA 3PUVA 3MRSA 5JWHA 5G40A 821PA 1YVDA 1XPOA 2JLYA 2BWJA 1UKZA 3RC3A 3RS7A 3CWQA 1S9DA 1KO4A 3AP1A 3UIEA 1I2MA 3GLIE 2WM9B 3W3ZB 4LX0A 1ZM2A 2IX3A 3VR1A 2OXRA 1JEEA 1R10A 3I8SA 2EFCB 3M1IA 4OK6A 2LKDA 4RZXA 4DDVA 3RHFA 4CEJB 3IEVA 3IHWA 1YR9A 2JLQA 1E1RA 1TU4A 3K9LA 4KXFB 4YXWD 1R0ZA 2AD5A 1I4TD 2X19A 2JJ1D 3NC1C 3O8BA 3Q5EA 4PQYA 1R5BA 4Q4AB 2JGNA 3ASYA 4XVQA 1XD2B 4KLNA 3GD7A 2OCPA 4QOSA 2O8DA 3WNCA 4DDWA 1P60A 5EE9A 1WQ1R 1P4SA 1AA9A 3RWMB 2GZHA 4P3YA 2XSZD 1CR0A 4A92A 2GK7A 4JMPA 3HP1A 1E0KA 1Z28A 4GI7A 4WW0A 3THYA 4AI6A 3KKQA 1G8HA 4KFUA 2AKYA 4MH0R 4Q1BA 1E2PA 1UBGA 1ZMXA 2QA5A 3HYRA 1M8PA 4BZXA 4DC9A 5L3SA 3EPJA 4JLMA 4IDQA 4TYWA 2QORA 3I4LA 3B82A 1OE0A 1E2QA 2FGKA 3WHLA 4HAZA 3KJEA 2BJVA 3UG6A 2F9MA 2BDTA 4V0NA 4Q9IA 4A0FA 1WXQA 4GOXA 1W36D 3CUEF 2PJZA 2EU8A 2O8BB 4DLXA 2CJWA 4JYCA 4TMWA 3QY0A 4RSGA 1CJKC 1P3JA 1X8LA 2OAP1 4IJMA 5L3RA 4EQ6B 3Q5DA 1UM8A 4DCSA 1GKUB 1FUKA 3EXAA 1M7HA 4RFSB 2HCBA 4JL5A 5EZ6B 4G5OA 1DG3A 1XXHB 1YRAA 3CH5A 1QHNA 2VP9A 4H9GA 1OH7A 1E2GA 3IQWA 5DYIA 1E2DA 3QKRA 4ZO4A 1JALA 3JZMA 4IKEA 2GILA 1G4AE 2GVDC 4URUR 4ZDJA 2OZEA 2WSSA 3U61B 5SZJA 3FHOA 3Q7QA 3EIQA 5C1BA 4AY2A 1P2SA 2IF0A 2OXCA 1XDBA 2DFKB 2J59A 3EA5A 3T1TA 1GNRA 1S8FA 1SVKA 3FDIA 2BCJQ 1N5IA 2EFDB 4TLAA 2HV8A 3HJNA 3TMKA 1X8JA 1XU4A 4FCTA 3ZVNA 5EXXA 4EPYA 2BM1A 1YRBA 1G21E 3GJ8A 1XP8A 2LKCA 3CONA 4BFVA 1AJEA 1F48A 1KO1A 4E03A 1N0VC 4QHSA 1U99A 2GXQA 4NYIQ 2EYQA 1A4RA 2IEZA 4B3FX 5JWRA 1H8ED 2OE2A 4S35A 4B3CA 5BW8A 3GLFB 2R6DA 2WWYA 4HAWA 3IKJA 5KSOA 1JAIA 2JDID 2ZS9A 1XZQA 4NE2A 1JBKA 3A37A 2N42A 4JBYA 2ZR7A 1X86B 2RGAA 3VHXA 3GLGA 4XD7D 5A5GA 4M1SA 1OXTA 2ZI7A 4IOMA 1OHHA 3GFTA 2C03A 2CCKA 3GLIA 3CH4B 1KZ7B 1QHIA 1VYUA 5B30A 5EP4A 2P6NA 5JI3E 4D26A 4NYMQ 4OQFA 3UANA 4DSTA 3KJIA 1XJQA 2FJUA 4GOKA 2AD1A 4DRZA 3DZ8A 2GJKA 1IY1A 2QGNA 4DHEA 2QAGC 4ACBA 3H86A 4GFDA 5FI0B 5DN6D 1YKSA 2BMJA 4N0EA 4JLJA 4QL3A 2AX4A 3SFVA 1BH2A 5JS8A 4BFYA 4H1UA 3FE2A 1TTTA 4ITRC 2IYSA 2YJTD 1MRNA 4LHVA 1Q3TA 3B2EA 1KI9A 5JZVA 3JVUA 5FOVA 1PUJA 1KDTA 3RNLA 4Z8XA 3RABA 1B0UA 2FG5A 2XX3A 3UKDA 2GBLA 3TKLA 4AG6A 2ASEA 4FMDB 5G3YA 1NVUQ 1T4GA 2VQSA 3GCGA 1FOEB 3F3YA 3U6KA 1OLOA 3E2IA 1ZJ6A 4KO8A 5HKKA 4GL2A 1DAGA 5SZIA 2EW1A 1T3LA 2OBNA 4KLZA 3B1XA 1G9XA 1ZM7A 1WBBA 1VMAA 2G83A 2CHGA 4NH0A 1US8A 3K0CA 4HLUC 5EZ5A 4MKIA 2GHIA 2QP4A 2J1LA 4MDFA 5EE3A 1M7GA 1HA3A 1SXJD 2IHBA 1S9HA 1Z6YA 2ZPTX 3ICEA 5LB2A 1HT2E 2R44A 2QAGB 3Q3JB 3U44B 5SZKB 1U0HC 3CX8A 4PXAA 3OFND 5FUWA 2FSGA 3FMPB 1PV4A 4KBFA 1W7AA 2YZ2A 5LDDC 3GLHE 5IT5A 3MWLA 1YJ5A 3A4NA 4P32A 1T3SA 2Q6TA 5CK4A 1FUUA 1HYQA 3I3SR 3SOPA 2XNDD 1TF7A 3EZ9A 4JBXA 1E99A 2HDNB 2Z5FA 3IHLA 2XTMA 2PMDA 1NRJB 2PCLA 1J8MF 1ZUIA 1XTJA 1MO5A 1XTKA 2DHRA 1XX6A 1M1YE 1U94A 4G01B 1W1WA 4KYIB 4Q1FA 5KTYA 1KYIA 2EVWX 2ZRJA 3CPEA 3MUFA 1JEDA 5EUMA 4B44A 5J4YA 1GDDA 3FPAA 4F4IA 5JHGB 2WPDA 4TQAA 4EFNA 2CL6X 121PA 3GJ6A 5HZKA 2QT1A 3DVLA 1JQLB 2N1BA 421PA 4U02A 1R2QA 3U3JA 1BYUA 3AF1A 3RWOA 2EYUA 2VO1A 4L16A 1A5TA 1CU1A 1OXVA 4I1SA 2DCUA 5TMPA 2NO1A 4GT1A 1RPZA 3GQBA 2GCOA 1XF9A 1PLJA 4IDHA 3OAAD 1XCGB 1W4AA 1IXSB 1KKLA 1I4LD 1ZNZA 2J3EA 2RGDA 4DT1B 1ZD8A 1U90A 1T5LA 2HLDD 2RB4A 2NMVA 4GNKA 3PEVA 1NG9A 2IS1A 2KE5A 2C95A 4C9BA 3AVXA 3QEJA 3VR2A 4PSVA 2VA8A 3CF6R 1L8QA 3MJHA 2BV3A 3T61A 3DMDA 1DE0A 1QHHB 3NIBA 2ZVPX 2IEYA 4PX9A 1II8B 3ZIAA 5DNYB 3CKLA 3DEFA 4D25A 5E7IA 4OBEA 1D8TA 2QI9C 5IRCD 1D9ZA 4Q9LA 2CVHA 4JS0A 3IIMA 4PHFA 3VKWA 5CIWA 2UZIR 4E22A 2V9PA 4Q00A 3WP0A 4CDGA 5KPDA 3DM5A 4PHGA 1D2EA 2ODBA 3THOA 2P6RA 4M0LA 2ERYA 4BEBA 3NDBB 5KSPA 4CEIA 3ASZA 2OUKA 3K70D 4Q1AA 4TMTA 5DE3A 1UBFA 2VHJA 4LJ8A 1SVLA 4EPTA 5HR5A 1HV8A 1U9IC 2HF8A 5AJVB 1KI7A 3KZ1E 2ZSFA 5KNBA 1GUAA 1WB9A 1GAJA 1Z2AA 1N5LA 1F2UA 2FMXA 2WHXA 3F5FA 3PEWA 1DADA 3QKSB 2WJVA 4PTLA 4DBLC 2GNOA 3ZD6A 2PCJA 4UNQA 5FBRB 1ZM4A 4DB2A 4JT4A 4DLSA 5TB5A 1LF0A 1U81A 4IVPA 3SDZA 3SC3A 2FFAA 4G5RA 4NCKA 2E9SA 1UF9A 3ND9A 2VHCA 4C0AC 2FPMA 2H92A 2ZUDA 1E1RD 2W2TA 3QF4A 4A4DA 2ZRAA 1XD8A 2QQEA 3ND8A 4Q4HA 3B9QA 2CK3A 1KKMA 4C0KA 2ZR9A 4DIEA 3QNUA 4AC9A 5E3HA 4A15A 3GJ3A 3CB4A 4LSGA 2PH1A 1AGRA 4MYUA 1U98A 4EFLA 4NMMA 1VG9B 2CNWA 4RCZA 4UXHA 2JEOA 3K0AA 3W6OA 2CLSA 1NLFA 2CCGA 5AR1A 4JKYA 4BUJA 4OK3A 1G5RA 2IT1A 2NQ2C 1YR6A 1YZQA 2QMUA 1LF5A 2HEIA 2C99A 4G3XA 4A9AA 3HU3A 4D4KA 4BFTA 1KDPA 4HZUA 1MABB 4HATA 2ZRCA 5K8LA 1MO6A 1KGDA 1SXJE 4JVSB 4O25A 4JLNA 3WXMA 3U7EB 4RD2A 4HB3A 4P4TA 4MKHA 3X1WA 2GXSA 1GM5A 1UBCA 2ORVA 2C9CA 2QQ0A 2WWGA 4HDCA 5CK5A 1VYVA 1MR3F 1ZUHA 4MGKR 3EASA 3PUWA 4D4LA 4ZPXA 4DLYA 4UJ5A 4FD2A 1W0JA 1OH8A 1SKYE 2AN9A 1D5CA 1FPMA 2OEPA 1FTSA 5L8VA 2ZYUX 2C2HA 5AJXA 3P4XA 1QHYA 2H8KA 3AEZA 5FTKA 1WE2A 4B73A 3K09C 4FWIB 1NNEA 1AKEA 4HAYA 2RGEA 4C0BA 3AV0B 2RH5A 2JLVA 4LHWA 1WA5A 1ZAKA 3W8RA 4XOIA 4AD8A 2CLCX 1G5TA 3FFBA 2ZUCA 4B43A 4M1WA 4QGFA 3SU8A 5CB8A 2ZREA 1LY1A 3LD9A 3THXA 1ZVQA 3LQQA 2WSSD 2O0HA 3FHCB 3LQRA 1ESNA 2WAYA 4MUBA 4JZKA 3QBVA 4CGZA 2R2AA 2A5FA 1KK3A 1TQ2A 2WIBA 1KMHA 1ZYUA 2IYLD 3L2OB 2YV5A 2ZTSA 4FXPA 3V4RA 2F3TA 5A4JA 1RC8A 4TSFA 3PEYA 2NZJA 3TH5A 4DVGA 3AQ4A 2WWHA 3KFVA 3DOFA 3TSOA 4RCYA 3QENA 3T1QA 2YINC 4LJ9A 4PSKA 5SZHB 4B48A 4CW7A 5GVRA 1JJ7A 3KTAA 1V5WA 1NVXQ 3EWAA 3EW9A 3CF2A 3RSLA 1FTNA 1HQYE 1SGWA 3H2YA 1XTRA 3MAAC 1B23P 2Q3MA 2VEDA 2IF2A 2XTNA 4Q7MB 3B9PA 1C9KA 4ZDIA 2BCGY 5FBQB 1AK2A 2FPKA 4BZPA 1XTSA 5A0FA 1VIYA 3SQXA 3MSXA 2WZQA 3CIOA 4HEJA 1Z29A 3IPYA 2P65A 1I4DD 2ZSAA 4URZR 1P9WA 3RAPR 3FHTA 1ZINA 2V55B 2J0UA 4KFRA 1KSJA 4XVRA 3EPLA 1OHHD 2XEXA 1O87A 4PHHA 1P2TA 1KMQA 1CP2A 2J9RA 3AP3A 5E95A 4JIMA 1PZNA 1Q44A 1SVWA 1XCMA 1V43A 3EARA 1GL6A 3R9XA 1XNJA 4B2IA 4A0GA 3MWKA 3PEUA 4B3BA 2I1VB 1VCIA 1ZCAA 2ZITA 1TQDA 5HZHA 3SZRA 4NCNA 4PO1A 1GL9B 4G5SA 1E6CA 4LJAA 1P9RA 3MGCA 3ZS9A 1W36B 1E2JA 1N6NA 5FL7A 4ZKDA 4F38A 1BMFA 1IQPA 2ZE6A 1DAFA 2HYDA 3K0FB 1IXZA 2H5EA 3SJAA 2A9KA 1W4CA 3K9NA 5KYKA 1G19A 4POAA 4FMBB 4Z54A 3LY5A 1HY3A 1W5TA 2IUSA 1N3BA 4OJKA 4MRVA 3NXSA 4P0TA 1T0JB 2RHDA 4WOPA 3AVTA 4WZAE 3VX3A 4QC2A 2VTKA 2XOKA 1UDWA 1R0WA 2X77A 2YC4C 3CPJB 5KOYA 4TT3A 5HKKD 5IDVA 3H4MA 2JLUA 4YDSA 3LWNA 2Z43A 3BB1A 5EE0A 1SVIA 1VKJA 1R4AA 4CEJA 5DGXA 2W0SA 3OE7A 4URVR 1XMVA 4OKSA 4JL6A 3UATA 1E3MA 3VHLB 5H70A 5EP2A 2H17A 3UWOA 1VIAA 4GMDA 2OFWA 4Q4AA 1O3YA 2FSIA 4M9SA 3WYGA 5JRJA 1XD2A 2JATA 3WHKA 4EJSC 4TQUS 1NMYA 2C9YA 2O8FB 5FTJA 1KJYA 5TY0A 4PAQA 4CT4B 2F1HA 3EIEA 2ZRFA 2FPLA 3MCAA 4M9QA 5JSZB 4ERNA 1II0A 2G88A 3IQXA 4MDEA 3BAFA 2EFGA 1T8TA 2PLRA 4IVQA 1R7RA 4V0OA 1MKYA 2GJ9A 3C41J 3REGA 4YMUA 1KDOA 1VCOA 2IS6A 2JA1A 2QG6A 2VP5A 1KI3A 3FMFA 2A30A 2IXEA 1XEWX 4ARZB 2WPDD 1XB2A 1LTQA 1S1MA 4FMDF 2BMDA 3I1FA 4M22A 2O8BA 2W0MA 1G7RA 3BORA 3LVQE 4B3DA 5KNDA 3ZD7A 1G5PA 1TQ4A 2GDJA 3I73A 1Z47A 1LS6A 3OZXA 4B75A 4EQ6A 3CBQA 2WKPA 1E0AA 2XGJA 3DL0A 3U2QA 4AKHA 1TL7C 1QDEA 4RFSA 2V54A 4TYPA 1KDRA 5FR2A 4AKIA 4ZIRB 2AHOA 2ZJYA 3ZS8A 3ZVLA 1XXHA 2P6UA 2HUPA 2DFNA 1NN0A 2BBTA 2G3YA 4K46A 3T5GA 4DLWA 6Q21A 1E9FA 2RGGA 1HURA 4MRSA 1FFHA 4Q1DA 4IFBA 1NSFA 1W2HA 1XWIA 3VU9B 3IPXA 1FP6A 3QG1A 3TBKA 4EJSB 4DIDA 4JT2A 3R9IA 4MRRA 2IUTA 2E87A 2CL7X 3ZIAD 1RFLA 3LBHA 5ELXA 1Z6GA 5B64A 1XTQA 4DSNA 2PX3A 2CDNA 3X2SA 2YWHA 4WAUA 1NG1A 3DKVA 2PZFA 5G41A 3QXHA 3GLGE 3AF0A 1P62B 2VSXA 3QG5A 4I4LA 4LK2A 2B21A 3AVYA 5KO2A 2J45A 2Q3FA 4MA4A 1VYTA 4KYUA 1FX0B 3GLFA 4XVUA 2PT5A 3GJ0A 1NLZA 1R5NA 1ZNYA 2J0VA 2QNRA 4QRHA 2D3WA 1G64A 3SN6A 1BS1A 2IK8A 1E9DA 2IYQA 2AKAB 2YWFA 2J7PA 3PIRA 1FP7A 3A4LA 1G18A 4A36A 1NBMA 2WJIA 4KBGA 4RD1A 3AVVA 2JJ8A 2QY9A 3BH7A 3FWYA 5HCIA 4BASA 2NO7A 3NG1A 3KXIA 2Q9CA 2FH5B 4XIGS 1EWRA 3NBZC 4B33A 1Z0DA 2OBLA 2F43A 2JIZA 1IXRC 4FN5A 1E69A 1CS4C 2QN6A 3H84A 621PA 1R5OA 1ESMA 2ZE7A 3RS5A 1LW7A 4PZLA 1NIJA 1DAKA 2QE7A 3RS0A 2OCYC 2IYWA 3BJIC 3EA0A 3QIAA 5AUQA 5DLQC 4QFMA 1NMZA 3KJHA 3BERA 3TUZC 2CK3D 1MOZA 4TLEA 5L3VA 3M0EA 2REBA 4LWZA 1DPFA 1AKYA 2Q21A 4G5GA 3TNFA 2O52A 1QHXA 2CNWD 3CR8A 4IEEA 3VAAA 4B6FA 2J41A 1AZTA 1GNPA 2ZI9A 1NN5A 2IBMA 2DY1A 2E1RA 2VP4A 1JXMA 4IDOA 4PZZA 4BZQA 4DZZA 1IY0A 1E94E 2A5YB 4PO9A 4LC0A 1Z6AA 4LBWA 4OQXA 1DOAA 4RY2A 2NOAA 2Q0HA 1A82A 2CBZA 2A5DA 4U00A 4OHZA 1P2UA 1AIPA 4DLVA 2CCJA 1OB5A 2BVNA 4BLTA 3KB1A 5BN3A 2BOVA 4YQFA 3TGPA 1JNYA 4WBSA 4ACAA 1NL3A 2VRWA 2GJSA 2QEQA 2SHKA 2ZJ2A 3LFUA 1UKVY 3O47A 4BWYA 1W0JD 1W5SA 2JLWA 2FFHA 2WJYA 3MWYW 4Q4JB 4KITB 3KB2A 3X1DA 1H65A 4LYJA 1VHTA 5FTLA 3I62A 3MWJA 4IDNA 2R6AA 3J81k 2OSBA 3GJ5A 2Z4SA 4Q66C 4O3MA 1GRRA 1FMLA 2BEKA 3UG7A 5L3QB 4C0HA 3I32A 2QAGA 5C2JB 3U44A 1GSIA 5FFMA 4D82A 2ZRLA 1RE0A 1FNNA 1PVOA 5IK2A 4QBFA 1VTKA 4KFTA 1QVAA 3CLVA 1WF3A 3PENA 3WMEA 3FMOB 1LFDB 2O5VA 2V8OA 4Q7LA 3PR1A 3LBIA 1YZKA 1E2MA 1DO0A 3K53A 4BECA 4EIWA 2G77B 3NHBA 3RYTC 2FEOA 1OYYA 2ZRGA 3E5HA 4V0KA 3TUIC 4YMVA 2GXUA 4ASUA 3DO6A 4TSFD 3L82B 5TXGA 2AL7A 2VLIA 5F9FA 1E9BA 4AKEA 1W4RA 3QEOA 2HJVA 2HXSA 4C0LA 3V00A 1RRCA 2HF9A 1VECA 1N6RA 2VBCA 2IWRA 5KHOC 4DLUA 1J99A 4I99A 2R6FA 3L43A 3TVTA 1G6HA 2WIAA 1BOFA 4MGYR 2VF8A 2A5GA 3IIJA 3JZAA 2PZEA 3ECCA 2I1QA 3TSWA 2ZYTX 2QL6A 4KHZA 3QPVA 4MKFA 4DCNA 3U5ZB 4PANA 4PQRA 4OK5A 4BQSA 4C3ZA 4N1AA 4DT1A 5LD2C 1TQ6A 5AUNB 5CM8B 4DUGA 4HLUA 3TIFA 2Z6VA 4WZ6A 2GWHA 2FNAA 2XAUA 3AF2A 3EZ2A 1BIFA 1ZP6A 1Z63A 4QNMA 1ZD1A 3PG5A 4P4UA 5GJCA 2ECKA 2IUUA 1QHHA 2ERXA 3E1SA 3TR0A 3U4QB 3AVOA 2RMKA 4PPFA 1II8A 3CPHA 1KJWA 4MYHA 4PC3A 3ZVRA 2ZRMA 4Q02A 2H16A 4DB4A 1QZXA 5LB4A 1JPJA 1N6IA 4KI0A 1N2CE 4PC6A 5E4FA 3AM1A 4HAUA 3EZFA 4XH9B 3PQCA 3VNUA 3KUDA 3N70A 2V6JA 4LPKA 1UKEA 4NYJQ 4OQLA 1MO3A 5FL7D 2WOJA 1KAOA 3O8CA 1BMFD 1P7CA 3BFVA 2A78A 2OV2A 3QOFA 2ZM5A 4BRWA 3HDTA 2ZRPA 3LH5A 5FUXA 4Y0AA 1P2VA 3T35A 4B47A 4UNPA 2QROA 2VP6A 3D8BA 3QF7A 1E4YA 4C7OB 4JLVA 4BLRA 3X1ZA 4B34A 3M6AA 2NO9A 4H1VA 4NKRA 2V1XA 1YU9A 2F7SA 4KODA 5EJEA 3SYLA 3QKSA 1KSGA 2AFIE 2GCPA 4PC1A 1E9AA 1N5JA 4X8HA 3KKNA 4DLRA 1AS2A 1EFUA 4RD0A 3S1AA 1W46A 2ZU6A 4NONA 5FPYA 4LHXA 2XOKD 2IS4A 1QHGA 2DBYA 1TEVA 1UBEA 1KSHA 2ATVA 2C98A 2DPXA 1GWNA 2QBYB 4TT3D 5LD2B 2RGCA 3KKMA 2B7CA 3FGNA 1A2KC 2YNMA 4K81B 1EGAA 1WDTA 5KPJA 4ESVA 1FL9A 3GJ4A 2HT6A 2VP2A 1Q1EA 1X8KA 3BGWA 3OE7D 4CZ2A 2FGJA 1YE8A 3C15C 4M53A 5K8UA 2FE4A 2WKQA 4II7A 3R8CA 2EWWA 1AGPA 4Y0VA 4BEJA 4Z51A 2GEDA 1G4UR 1W48A 2OLKA 3AKYA 4TLDA 1CJUC 3HR8A 2BEJA 2UKDA 3KKOA 2QENA 3D3QA 3Q72A 4DDTA 1I2DA 4QGHA 4DEYA 1HH4A 2ZAOA 2X2FA 3L0IB 4GP7A 2YOHA 1IM2A 1A2BA 5AJYA 3ZYCA 4CVNA 5J4HA 3A4MA 4ZDKA 4F92B 3C16C 2OHFA 4LHZA 4IRUB 4ZV4A 1MABA 2N46A 4B6EA 1KK2A 3HPRA 3H1TA 4W7SA 3U3KA 1VPLA 2ANCA 4BFXA 1Q22A 3AGQA 4HAXA 1XRJA 4DCVA 2A3RA 1U9IA 2YWEA 3UXMA 3IO5A 4C2UA 1UADA 3GLIB 2QRZA 5FOSA 4JSTA 4NU0A 2JLSA 2QPAA 2WWFA 4HLQB 4OI0A 2ZUBA 2ZYWX 5FOTA 1KI2A 2FFQA 2FWRA 4A2PA 3KXKA 3SEAA 2PZGA 2VHUA 3BOSA 3I72A 3ZZTA 3HYTA 2VSFA 1KO5A 3TVDA 3MD0A 1Z0JA 2ZR0A 1SKQA 4ZDWA 3BK7A 4BLSA 2VF7A 4FMCB 1YZNA 4LDJA 4LJ6A 5DHAA 4Q1CA 4RKFA 1PLLA 3EZ7A 3Q9LA 1Z07A 4BFUA 4UQOA 3NKVA 2ZJAA 3NEJA 2PEZA 1E2NA 4D2IA 2EWVA 2XZLA 2UVQA 1P5ZB 4MGIR 3I92A 1H8HA 3FKSA 3PJRA 4GSYA 4Q19A 1KY3A 2IXFA 1KJZA 3VMFA 1G3MA 2ZRDA 2YKGA 4MRPA 1S3SA 1GP2A 5EQTA 1XPRA 1IY2A 4TL8A 4R2HA 4CRWB 3LRPA 4WVFA 4PPNA 2F1JA 4PFSA 3SHFA 1E9CA 1E96A 4ILEA 1P75A 3RC8A 3DDCA 3UK6A 3EC1A 2PBRA 2QGZA 4HUQA 4EDHA 3L8YA 5BN5A 2IW3A 4LYFA 3R7WB 4CF7A 1NJFA 1GILA 5FBVB 1DVRA 2GAAA 2XB4A 2O8CB 1AN0A 1P61B 2REOA 5TV2A 1E32A 3NH9A 2FZLA 2J7PD 1XMJA 3VX4A 1NBMD 3CRMA 5CM9C 1RJ9A 1G7CA 4BFWA 2XTZA 2H57A 2FSHA 3MFYA 4KU4A 2QSZA 1G3UA 5D3MB 5AJZA 3T06B 4LJ5A 3K09A 1OKKA 2B8TA 1T3HA 3DPUA 5FI1B 4GZMA 4OJQA 1FW6A 1KZGB 2RHMA 3BBPA 3HU1A 3RRZA 3PV0A 3G0HA 3SQWA 3DM9B 4JVLA 2WWXA 3E70C 3IGFA 2ZSBA 4X8LA 4UNSA 3TQCA 2O8EB 3LX5A 2JIZD 1XEXB 1JJVA 3AGPA 3MLEA 3FKQA 1XZPA 4MKGA 3A1UA 1JECA 3FFAA 2DR3A 3ADBA 2OILA 2QE7D 4MQBA 1N6PA 5TARA 3RANA 3QE0A 4MRNA 5JJKA 3IUYA 3QBTA 4XSHA 4L4UA 2YYZA 3VQTA 2CXXA 1N6LA 2WWIA 2Z83A 4EPVA 4Q9JA 5AUOB 2R6CA 3TAHA 3NH6A 4US1R 4CIDA 4JJZA 3DKPA 3KFXA 5EE1A 3VKGA 2ZYVX 3MMPA 2ZETA 5BYKA 3P27A 3K0FA 1G7TA 1JR3A 1XMIA 4JLDA 2AR7A 2XJ4A 1XCPA 2G0TA 3ZZ0A 1DG1G 4WXPA 4EPWA 1LNZA 2WV9A 1GKIA 1ZU5A 4RZ3A 1OSNA 3BFXA 2ZSDA 1E1QA 3EIHA 4R98A 2W00A 4QHTA 4LCBA 3LXRA 5CYPA 1DAMA 1Z2CA 3KQLA 4B35A 1CIPA 3NVAA 2W2VA 4LBYA 1KI6B 2XJ9A 2XITA 3RDPA 2BMEA 1RZ3A 2ZI3A 5B2ZA 2VSOA 3RSOA 4TL7A 3K9HA 4JVNA 3ZH9B 1YZGA 1Q1QA 2A2ZA 1DARA 2WWWA 3FYHA 3L0SA 1N6HA 4A2QA 1G8YA 4A8JC 5CITA 1W36C 2P2LA 5ANRB 5CIQA 1R0YA 2ZS8A 5HPYB 1Q1BA 2ZRKA 3D31A 3LAWA 4IDPA 3AKDA 3V9PA 1TUIA 4YONB 5JLJA 4R2IA 2W58A 2QRNA 3QXCA 4QNRA 4L9WA 4V02A 1DELA 5KDDA 2ZJOA 3M4YA 5IK2D 2JDIA 1JAHA 2ZI6A 5E7MA 5JSZA 1G3RA 3HR7A 2CLDX 4AYXA 4EUNA 3RRMA 4TQ9A 1EG7A 3O8RA 4F93B 5DI3B 2MMCA 4CEHB 2H18A 1NY5A 3AUXA 1F6BA 1KI8A 2HCJB 4LI0A 3X1XA 2GJ8A 2Q3HA 3OIYA 1N6KA 4LBZA 3QXSA 4U5XA 4ASUD 4Q9HA 1XXHE 1KK1A 1WP9A 3CX7A 3HU2A 4JJKA 3A1SA 3L0PA 4ARZA 2IXGA 2A7QA 4P4SA 4PO8A 1Q0UA 2MSDB 3FMIA 1M6NA 5C4MA 5TDHA 1UDXA 2G6BA 1P6XA 1KSFX 2DYKA 4LJ4A 3PUZA 1TEXA 3EZ6A 4KFSA 1OF1A 4TYYA 4F4CA 1F2TA 5LBIA 5TVKA 4NCJA 2X2EA 2IYZA 3SBDA 3QF4B 1U8AA 3Q85A 5EXSA 3TK1A 2HT1A 4UXIA 2IYYA 3OIWA 4PAMA 4LV5B 2QM8A 1MT0A 4A0HA 4DEXA 1UPTA 4DUGD 5J47A 3U3OA 1R0XA 1TF5A 3QVVA 3EPKA 3THWB 2OG2A 3PVSA 3GLHB 1EFRA 1NMXA 4A8JB 4IEIA 2NO0A 4UXJA 1CULC 3RS3A 3SJCA 2F9LA 2YVUA 4N3NA 5AJWA 2GZDA 3VU9A 3GLFE 2D7CA 1JQJC 4EJSA 3CO5A 1HT1E 4EAQA 4HAVA 2NG1A 1CR2A 4FWTA 1CJMA 1YZUA 4O0MA 1OIXA 1VDZA 3VR4A 4A82A 4B71A 1F3OA 3UMRA 2LCFA 3WYAA 3QPUA 4IVRA 2XB2A 2WTUA 2ZRHA 3VTKA 1NBME 4QGGA 2I3BA 1GOTA 2QTVB 4QM7A 5F9HA 1CRPA 3SNHA 3PITA 1Z08A 4OHYA 4QHYA 1E98A 1FX0A 2Z0MA 4V03A 4HUTA 3SJZA 1DO2A 1G3QA 2ANBA 2HJGA 5GADl 2V7QA 1EFCA 4KVGA 2B8WA 4ZI3A 2NPIA 3QXXA 4TLBA 2RGNC 3ZJYA 4AG5A 1XJCA 2H7VA 4QBIA 3OEEA 3NC0C 4E07A 1QHSA 5HE8A 5JRZA 1U2RA 2DFTA 1U8YA 3A58B 3B7GA 3QUSA 2IS2A 5GJVC 1G1MA 5FTMA 2QSYA 2JAQA 3QQ5A 1Z6XA 5E7JA 4LPSA 1XEFA 4OHWA 4PSAA 4YLGA 3KQKA 2ZI5A 4DCUA 3QJYA 2G0NA 2ZJZA 4U7DA 2G9NA 5FBLB 2JJ2A 3W5JA 2IL1A 1JXOA 2VL7A 3TRFA 3TAUA 1A1VA 2YHSA 3CNOA 4TLCA 4DSOA 3AP2A 1OFIA 2YOGA 4URXR 1K5GA 4XWAA 1JPNA 5HE9A 1OFTA 3BB4A 1SVSA 1L4YA 2ZQ5A 5KU1A 5FPHA 5JWOA 1Z0IA 5B58C 4KCGA 2RCNA 1Z3IX 3QI2A 3W9YA 3WMGA 5JFGA 2NTYC 3VR5A 4NDZA 2QP3A 4M1TA 2Z4RA 1ANKA
chains in the Genus database with same CATH superfamily
4JWTA 2DCMA 3JYQA 2WSMA 4QDXA 3QZUA 1EJ6A 3BSFA 3HV2A 4IOLA 1O6ZA 3RARA 4XX0B 2PSJA 3F6PA 4O2AA 3U17A 5KTRA 5L53A 1YC2A 3DO5A 2HLPA 3I76A 2PWPA 3K6KA 2I4RA 3BE5A 3PNSA 4RE5A 5K2MA 1WCIB 3RG2A 3TG8A 2LR0A 1MP0A 2XHZA 1FQKA 1ZJJA 3R7NA 3V1MA 1T4BA 3R1IA 3LPCA 5JBNA 2X0KA 1ZH8A 3DAHA 3QMPA 2WM2A 1JQAA 3BSYA 1G2PA 1P39A 1X9IA 4AJNA 1XOIA 2XLBA 2D62A 2SKCA 4GX5A 1AOXA 4E6PA 5HF9A 3OWOA 1V3VA 3VVBA 1ICIA 3W5UA 2XCRB 4HVTA 3WA7A 2JL1A 2AN1A 2EATA 3D2AA 3NBQA 4K6KA 4MIEA 1MEOA 3GFPA 3JWJA 3TJMA 2Q2QA 3FXAA 3O1IC 4JHLA 3M6XA 4Q4JA 3ADDA 3QMVA 4OL9A 4HLCA 3MGAA 3WDKA 2XF8A 1NC3A 1M0SA 2G1KA 3R20A 1YKGA 3BFPA 4Q9NA 4TYMA 4CMAA 5AICA 1KOFA 3S44A 4YAOA 1JEYA 1R0SA 1PEDA 1YB4A 3LX8A 3P9ZA 4OU4A 4HI0E 4ZAGA 4AWAA 5FWNA 3M81A 5L3QA 1A98A 5TPWA 3CRRA 3V5NA 4PZAA 1PK9A 3MT8A 3G2JA 4GEKA 4LV8B 4P82A 1RKUA 5DMHA 2R6GA 4WXRA 3QV1A 4CUJA 4XB2A 1S7CA 1GNTA 1T8RA 2XBUA 1ADBA 2PM8A 3IOMA 3EXFA 3LUAA 4LZAA 1DTEA 3SIRA 2R25B 3SJBA 4KO4S 2KX7A 1SOVA 1H8HD 3QRWA 4GM4A 4QYIB 3UTDA 3LCVB 1OX4A 4JB0A 5FV4A 4M7PA 1HDYA 3QPWA 1S96A 5G4KA 5JCPA 1T2VA 1XZIA 2ZGVA 4WJKB 1U3VA 2HJHA 3CCCA 2ISSD 3E48A 4O4IB 1WBDA 1CC1S 4A8PA 6NULA 3LI2A 4E6EA 4ARIA 2HXGA 5CA0F 2FOIA 3BJRA 4L76A 4ZI7A 4L9SA 5EJ6A 1TNDA 5FI3A 1MORA 1FYDA 1Z8HA 1SZPA 4LS3A 3WLFA 1JHQA 1QYWA 2GZAA 1M7BA 1OXSC 5BXYA 4J1TC 4LF8B 3KKPA 5GQSA 1S2LA 5L6LB 3DC2A 4PC7A 4EVQA 1HNWB 1N8SA 1QONA 2AF4C 4F97A 4N7JA 3SYKA 1LTHR 3ZDAA 1Y34E 3JAKA 3LMKA 2OKCA 2YWRA 4Q7KA 4HGPA 2ZM6B 4D96A 1ZVKA 3W77A 1AO3A 1GG8A 2TMKA 4N4AA 4ZVNA 4NSNA 1PK8A 3LUBA 3NS7A 5FPQA 2O3SA 3U0BA 4UMFA 1DXOA 5ICFA 1BYIA 5JANA 1C0KA 1U7OA 5HQTA 3FKJA 4OYRA 2O0JA 3K70C 2X8BA 2YN0A 4Y67A 3U3RA 2DHQA 1Q2XA 3SHOA 4LJYA 4ALNA 1KYYA 3ORYA 4DMKA 2P2SA 1OKKD 3I2IA 4GYYA 3ETGA 4AO8A 3G0IA 3L1IA 3RKRA 1M34E 2CVFA 3H97A 3SGLA 1Z4MA 4FMCF 3WLIA 4EB3A 5FH9A 3LW7A 3NT4A 3V8RA 1IBKB 2TECE 3LVRE 5A3SA 4TYNA 1PJ2A 3LZDA 3B1JA 4GXQA 2X9GA 1EP9A 4ZQGA 1IN8A 2AUMA 1ZQ1A 4M46A 4RGQA 2Q50A 4GDFA 3L9WA 3AETB 1H4VB 3K32A 3A8TA 1S6YA 1J70A 5J4LA 4HGOA 5CB6A 2V97A 3KJZA 4B6OA 1GDTA 1YMQA 1QVWA 1X7WB 1ZNQO 2GI4A 2QL7A 2Z1NA 4GP6A 4MITA 5BXQC 1NM5A 2BI8A 2W4MA 4Q4LA 4S04A 4TMVA 4ZCMA 4LBVA 4DMGA 2P4HX 2AIRA 2DX7A 2NO5A 1B6SA 2PH5A 1GR0A 1FIUA 1NFFA 5HOEA 2X3YA 2Y0CA 1KI1A 2DJ5A 5C8ZA 1FFYA 4QG7A 5F9MA 5REQB 3GDHA 3KVVA 1PU2A 2PTGA 2YS6A 4G89A 2BTEA 2XXAB 4KR2A 3IVRA 2V9CA 5KMGA 2EFYA 2QZ4A 2FOLA 4UBNA 2OOKA 3RPEA 4S1NA 4QOGA 3CN7A 5KOJA 3DP7A 1TIKA 4KI7A 1NY6A 2IC5A 5E1OA 3ZVKA 2K2QB 3MMZA 3E8MA 2J6IA 4I1UA 3RHZA 1DCMA 1NASA 2EFHB 4L27A 1LV7A 1W6UA 5HZMA 2A7XA 1Y63A 3VSAA 4CLRB 1WB5A 4OUDB 1OIWA 3QEBZ 4M0PA 4R05A 1NZFA 1OLSB 1OMOA 1PQUA 3JYOA 4IOKA 2XUAA 2GAFA 5K6AC 1KTIA 4M2LA 1WCV1 2A9RA 4PW0A 4Q01A 2G82A 4YRTA 4JKIA 1R37A 1L1EA 1U3WA 4C29A 3VBEA 3B85A 3UAXA 1N9GB 1GT91 4YMSA 2FF7A 1CUXA 3W90A 4OQYA 1Q21A 1OB2A 2J5QA 4JJ7A 5JMPA 5AVXA 3K0SA 4W5HA 4L57A 2P4EA 1D6NA 4WZBA 4OXXA 2RGRA 2PJUA 1DXQA 5CVDA 1NQOA 1VLMA 3V4FA 3LCRA 2LW7A 1GSHA 1OVGA 4BVAA 4ND5A 1ISRA 1E3TA 3I61A 4J8PA 2XXJA 3A4VA 1NYQA 1VG0B 1JILA 2O2HA 2E37A 3SVZA 4D41A 1JWBB 2JCXA 3BXZA 3TZ6A 1V4BA 1VKRA 4CIVA 3BH0A 3GJ7A 2QJRA 3KJXA 1W59A 3SLKA 2PZBA 1UBKS 4G5QA 4NAVA 3DR5A 1ISSA 2PMCA 4IHQA 1FUEA 3MF4A 4OB6A 1B74A 3W6ZA 3IDZA 4YN3A 2WE8A 4JI3B 4B46A 2J46A 5K8IA 3ESRA 4XVHA 3AVWA 2WTMA 1OJLA 2R86A 2YDYA 4D0NA 2J32A 3RRJA 1W75A 1WMAA 5D8DA 3NTVA 5K45A 1O5TA 3K5PA 1YUNA 3K1AB 4IH1A 4JT8A 3LUJA 1TT5A 2C2XA 2PMKA 5P21A 1FU8A 1AQLA 2B1QA 3DF7A 1SKBA 3HA3A 1M3SA 3CCBA 1E2EA 3C3YA 3BF8A 5FTWA 3BGOS 1COWA 3RFFA 3GI1A 5CFLA 2D5IA 1FRVA 1IRXA 1RQ7A 1TAGA 4IDAA 4XOUA 3WLSA 1IWPB 1M6HA 1YTLA 1Z83A 3AHHA 3G6WA 3I9V1 4URWR 3NIDB 1U3TA 4MW9A 3T9EA 2JLRA 1AKVA 3V8VA 1SUDA 1QGUB 3W3AA 2OAGA 3W78A 1I6LA 3VAZA 3KXLA 4FINA 3UV7A 4C6RA 2D00A 2J3MA 3RVOA 5B7PA 4M0FA 2HN9A 1L7VC 5FPKA 1L4EA 4ZVOA 1EFRD 4YJFB 2A35A 2ZYDA 4L5YA 4B3MB 2B69A 5KKNB 4KRFA 1T25A 3KJNA 3EAFA 3R3UA 2CJWB 2LE0A 4FONA 4HFMA 1VJ0A 5AVZA 1OZAA 3HCDA 3T34A 3DE4X 1YDEA 3QVMA 1GNSA 2FPGB 4FFWA 4NS4A 4D8VA 3UBTA 2O1EA 3BD9A 2PUDA 2ODEA 2P6PA 1E4EA 5LU8A 3R0QA 5ER9A 1EK5A 4MR7B 2JAXA 1ECCA 3H2SA 3M5PA 1DCFA 1CQIB 4QUEA 3AWIA 3O92A 2XDWA 2XYQA 3AOGA 1Z0FA 1RACA 2IU0A 2OK8A 3OPQA 5K3OA 4TV8A 4BO2A 3QSYA 3W7VA 5AHOA 4QPPA 3NR2A 5JJBA 2YZNA 1L1RA 4L07A 1RIIA 2Z2JA 3EEBA 4K28A 3F8TA 3F9CA 4MTLA 3TLXA 1WZ2A 5BN3B 4GLFA 3VUFA 4JR0A 2A9QA 4BJ5A 3TF5A 4D4JA 5C5DA 5ALDA 3WBJA 2A0YA 2F8TA 4MULA 3ZWAA 3IP7A 4GI3A 2JJYA 4M7WA 3T3DA 1KHTA 5GMOA 4LYHA 5B3JA 1DBVO 2XMCA 1E2KA 4L5BA 2ZJBA 1G0OA 2NTJA 1FYWA 3GP8A 3QVWA 1EHCA 1N1MA 1W87A 1P0FA 5EHIA 2FJ0A 1UKYA 4DLLA 4OPMA 5J3JA 1GAXA 2YXLA 3P9RA 4G1FA 1E4VA 3RSHA 3RGWS 3BL8A 2FQ1A 1FZQA 3JYNA 3TOSA 4EG5A 5AIBA 4DCJA 2W70A 2NSDA 2P27A 5KDOA 1W30A 5EVJA 1TADA 3ZHXA 4A2WA 1UQUA 3IXQA 2F64A 3I5AA 2O48X 2Y05A 2IDJA 3OA0A 3ROPA 2ONCA 2Q4DA 4MS3B 4R7TA 1JHPA 5FO1A 2NUBA 2QXYA 3ABIA 5IWCA 4X65B 5TR9A 1MG5A 4ARSA 2VP0A 5ALWA 2I91A 3EUWA 1T3TA 5FJIA 2H7YA 3PCXA 3TLKA 2VJCA 4TVOA 1GUBA 5ALYA 3DA8A 3ZJ5A 1DC3A 3T9DA 3MLBA 5K7SA 2GHRA 3VJRA 3NGMA 2O59A 1SRQA 4R71A 2BBWA 4NZ9A 1RHJA 2VHTA 1OLXA 1P7PA 4BVGA 2QM7A 3Q7IA 5MGNA 1MT3A 2EGGA 2JFXA 2F17A 1XHEA 2CNOA 4PFJA 4DQKA 3QEMB 1SUSA 3AY6A 2PL9A 4O2LA 2X8WA 5DEOA 2P9EA 2AW5A 1B14A 3PDCA 1U8CB 4L9RA 1DEAA 1ZO8A 3PVZA 3MXTA 4YREA 4TMZA 1XTIA 1QZUA 1TC1A 1LXCA 2ERCA 2W6JD 3EXHC 2EFJA 3N2GB 2QM0A 4J1SA 5CVEA 1ZD9A 2A4MA 2VBFA 5FBZA 1Q20A 2P2CA 1O6BA 3B6EA 4MJXA 4WFQA 2N3ZA 1OT3A 4R41A 2V3VA 3FB4A 4S2UA 4D45A 2ZXUA 4D0LB 1Y3CE 3JAWA 3ZDQA 3WBBA 4YRBA 5FP0A 3RVBA 1HE1C 3FTFA 1O94A 2C78A 3JW8A 2X40A 3T95A 5IBQA 4AURA 2C3PA 5JATA 1XNRB 4M9ZA 2ODAA 2ST1A 5T4BA 1CIVA 1QG2A 1EMDA 1DIBA 4B2LA 1P80A 2B1IA 3Q7TA 4YLEA 2VJLA 3R5HA 4HTAA 1CLUA 5EXTA 4BTVA 5C1IA 1M2WA 3K05A 5D1HA 5B6IA 3CKMA 1YB2A 3ZHQA 2ZYGA 5C9ZA 5ESWA 1NJ6A 1A7KA 4YRDA 4ZHQF 4I5DA 1KNQA 1QP8A 2VNKA 2Y76A 1WXHA 2W83A 3REQA 1ZUD1 1PN3A 1YCGA 2YXEA 4HX9A 1MH1A 1WZNA 2JIQA 3D81A 3QITA 2SBTA 4KOEC 4BKQA 4CCAA 4DCOA 3IBGA 3S2GA 1B0AA 3Q9UA 5CA1B 4EO9A 4EVIA 4RD6A 3JCZA 2OQ2A 3RVPA 3PXCX 4ZJPA 2PMWB 5JQGF 3RRBA 3I0ZA 1NP7A 2OVFA 3H8WA 3RBZA 4XTRA 3T1OA 4CR6A 4Z3OA 2C77A 5JO9A 1OH6A 2Z1DA 1C1XA 1KIMA 3JQDA 4RK7A 1J25A 4NR0A 1JB9A 5GZ3A 2XCSB 3GZNB 4MV9A 4ZOAA 2CYBA 3EVTA 5DKFA 3HDQA 3ROKA 1ZM9A 2R4UA 2YBEA 1FXWA 3G5UA 4JCCA 5KNCH 1I7SB 5CURA 3VNVA 2JBHA 1C30B 2WUVA 2X0JA 4JLBA 4KSCA 4NPHA 5CNKA 4QGAA 1E9SA 5JZOA 1MRSA 4IW3B 1NYRA 1VRWA 3LNCA 4QATA 4MUYA 4DADA 3TGWA 3OZVA 4ALKA 4DM4A 2ZYIA 2JGDA 1V5FA 4EMBA 2JFBA 3I0MA 4FT2A 1R3UA 4FSDA 4PINA 5KOIA 1KETA 1NX6A 1ZHOA 2IXTA 3T7AA 4BX0A 1KEEA 2JLBA 3CURA 1GQYA 2PV7A 3MMSA 1A2QA 5FKJA 2BLLA 1RZRA 2P9QA 3TBFA 3V1NA 5IDYA 1HPLA 2V5VA 3FJOA 2AMLA 1JSRA 2B8JA 1T36B 2CHQA 1AU9A 3GLHA 2ZYSA 3HEAA 1CY4A 1W8DA 1ULHA 3KUCA 2HXYA 4GOOD 5TQJA 1X3SA 2WUGA 3HLYA 4JEIA 1UMDA 5HKAA 2V1UA 3WMFA 1NF3A 2WMDA 3B8HA 2HJRA 4Q7JB 2ZIXB 4BFSA 1EDZA 2CKDA 3RAEC 2C0PA 4MTCA 1Y6FA 4BXOB 1E7RA 3DBRB 1DIHA 1JKJB 1Q7CA 2DAPA 1ETUA 1X1QA 1VI2A 1I30A 2GTIA 3BTVA 3H9JA 3CEHA 5DI9A 4ZVRA 4YWJA 3BC1A 3SEZA 5E2AA 3GK3A 1ESZA 3EPHA 4WUVA 2DB3A 3GQBB 4AT1A 1ISPA 1Z38A 2AN4A 1G3IA 1CPYA 3GF4A 4H7KA 3BWEA 4PRZA 3E35A 4RYLA 4RPLA 4CJXA 3GWGA 5BWLA 3KR1A 3VKFA 5JD4A 4NYIR 1N75A 5EWMB 1K89A 2PFGA 3M9XA 4CU5A 5KOHA 2XCOA 3WLEA 2VP3A 3LDUA 2ODPA 4CT0A 2FLVA 1KH2A 1LK7A 3V8MA 2PK3A 4J16A 4PONA 7ADHA 2YHAA 5B4TA 5I7FA 4QDOA 1X7YB 4CTMA 3U7FB 3I5XA 3CLSC 2OCDA 3F8SA 4M4SA 1IDN1 2ZPAA 4CKBA 4LNHA 3KZOA 1M2KA 2JHPA 3V2GA 1TK9A 4BO0A 3LUDA 2GKSA 3GJXC 3ZXUB 4BNFA 5LQAA 1E79D 4NP6A 3AR7A 3S8YA 4WA8A 3A36A 1H5NA 5TQ0A 3W04A 1X80B 3JVVA 4EHIA 2VYVA 4U9UA 4S12A 1SZCA 1DWUA 3L6OO 1W4LA 2NIPA 3X1YA 4NYMR 4BP1A 2VPPA 1IZ8A 1ZRHA 3PD7A 4KL8S 2WDZA 3VM6A 4EL0A 1G38A 1A96A 1LLDA 2CE2X 4GPEA 1GNQA 5KU7A 3EEYA 1L7QA 4B6QA 4RKWA 1CCWA 4K8OA 5AM1A 4AF7A 4WEOA 4ED9A 3GT4A 3MCVA 3RIGA 4PZ0A 2C8VA 4XDZA 1VIDA 1O2DA 3Q7PA 3LKDA 4HB0A 1YTUA 3IQDB 4F1WA 1RC1A 2L19A 2P3SA 2XUGA 1N2CB 3GVHA 3HDJA 3RIHA 3S2IA 4B0PA 5JTUA 2RK3A 2EQBA 2EXXA 1UEJA 3JQ7A 4JLAA 4BMYA 3GJZA 1KIFA 2QMQA 4ROSA 4D0RA 1OXUA 2QXTA 3LQ2A 3OZRA 4EYGA 5I51A 3T5AA 3RKUA 4H27A 1P1KA 3TMAA 4I5GA 4DPKA 5TMBA 5CCXA 3FWHA 2VQEB 3E58A 3U3ZA 5I8PA 2W42A 4DNOA 4RTJA 4BVFA 4EELA 4Y2XA 2OBMA 3CKKA 2Q1YA 2ZSJA 2WBLC 2RK6A 4NYJR 1WCIA 2QTMA 2WUWE 3E4CA 5JD3A 5KUTA 4ZIRA 1JAZA 4X8MA 5EPOA 5FOUA 3VR3D 1GQOA 2V7VA 1EFKA 2D2FA 5I7RA 1YB6A 2RGNA 3B38A 1P2BA 1B43A 2YRWA 5EPEA 3O4RA 1I1QB 2O0LA 3DAYA 3O8DA 2XECA 1G6OA 3HLKA 3I1IA 2GCNA 4B3RB 2AI1A 3T5DA 4JBWA 4QDZA 3RYHB 3I53A 3VFDA 2YMPA 4N48A 1LH0A 1C50A 3UJ6A 4KTVE 3E9YA 4HDMB 4OA8A 1RBMA 2VJMB 1DSSG 4YV2A 3MS4A 4BCCA 2ONKA 4KSBA 4RVGA 2W90A 3GMTA 2AVNA 5I8WA 4LRTB 1ACJA 4RZIA 5EIOA 5EWLB 3ZVMA 1DEKA 3ZPXA 2CLHB 3C0KA 1Z68A 4IWXA 4TTRA 4U2DA 5EYPB 4BBJA 5HIKA 2GESA 1SEVA 1TOAA 2VPYA 4HZUB 4R2JA 1M5RA 1NQ5A 1SQFA 1DAIA 4ZOBA 3CE9A 8ABPA 1MC5A 2PYDA 2V4UA 3G8CA 4YC7A 3TSZA 3QKTA 5FLXA 2K7ZA 2W6ID 1NQAO 3DT6A 4NEGA 1GL3A 2LGJA 1M66A 1QRAA 1BA3A 4Z8YA 3NBAA 4U4AA 4Y1RA 3T4PA 4HVCA 5JJLA 3AZPA 3IP3A 4G0ZA 3OQ6A 1V5EA 3W5IA 3A1WA 3FUCA 4QYIA 5J4KA 3TPFA 4JU9A 4O6VA 4RK4A 4F5YA 4W9NC 1PL8A 4PXYA 2X5KO 4B76A 3UMYA 5DNVA 1U8XX 3NYQA 2QMHA 2AWOA 3B36A 3LHFA 3JVIA 4HD8A 1T9ZA 3SC6A 4O4IA 1VPWA 4IMJB 3FDZB 1XZKA 3KJFA 4ZALA 3PPXA 3AT1A 4MW1A 1MO2A 2WT4A 4RZUA 1J2UA 4JUFA 2HU7A 1WXFA 2HLHA 1WR8A 5ARBA 3ML1A 4OYHA 3AFHA 4TN1A 2W11A 3GDFA 5IWAB 1L7NA 4B4VA 4PU0A 3PJDA 4TM8A 4TTQA 3LCJA 3IILA 1ISIA 5DLEA 5CFMA 3NHRA 4L51A 3AJ9A 5IF9A 2EBHX 2QKYA 3HZZA 5JPIA 4NV0A 5EA2A 3HJGA 3I8XA 3OI7A 1YWGO 4HO1X 1KMHB 2AJLI 2P91A 1Z5NA 1IWBB 3HABA 3O0TA 4IDCA 1EVQA 4OJTA 3P2JA 3RV4A 4UC0A 3UCEA 1NI5A 2ZT8A 1FY2A 4HNRA 2KS6A 4Q1EA 3KU1A 3ZG6A 4DPMA 4YCNA 3FGZA 1ID1A 1A76A 3EVNA 4TL9A 4YPOA 1JNXX 2A5JA 3MFQA 4G6ZA 2WG2A 3FHTA 4PC2A 1GADO 3E53A 3VOAA 1DOZA 3V7WA 3WLRA 3V8PA 2HSZA 5D3KA 4L15A 3C5HA 3P1JA 3IAEA 4FBMA 1XN4A 2W2XA 3NUZA 1KQOA 3FYDA 1NXXA 5JY1A 2FX3A 3LDGA 3RUCA 2J6BA 4L4YA 1SCJA 1ONBA 1Y4SA 1YS4A 3NHWA 3ZYZA 4LZWA 4F9EA 3HBMA 2JVJA 3D64A 5IDQA 3AETA 3PDWA 4H7EA 4ESHA 1S2MA 4YDHB 1U7TA 4U5QA 1DHRA 1O0CA 1UJ5A 3EVZA 1MO4A 1X7WA 4UEWA 3QHPA 5DTMA 1FLDA 3N8KA 1GZ6A 3E3OA 1EI9A 1AT1A 3HDVA 4P5PA 3OOWA 5C0OE 2CWDA 1QG0A 2QU7A 3L7CA 1MD9A 4HR7A 5ALHA 2BKAA 4OU5A 5IAGA 3F97A 3VDQA 4H7HA 1OBVA 4XQ9A 1NBHA 4GP9A 5REQA 1R9JA 2MDTA 1T9HA 4BIIA 2XXAA 1IEQA 1P72A 3O4FA 4UQPA 1UBSB 4YBZA 2ACKA 3W2FA 4LG1A 1XZDA 1I3LA 1F2TB 1XWWA 2R7MA 4L9AA 3ZI7A 3U1BA 1KAEA 4KAJA 3HVIA 1AQYA 4E5NA 4HNQA 3QVOA 2C7GA 3V7UA 1Y98A 3C7TA 1RYFA 2PKWA 2J0QA 4WIAA 5IZCC 4HNGA 4CLRA 3AVPA 4OUDA 2UV8A 5LZ9A 2WB4A 2WF6A 3PD0A 1J0AA 4M21A 4MS1A 4OSPA 4AFNA 2XMRA 1VPTA 3C74A 1YZ3A 4IXWA 1LQUA 1OXXK 1UXOA 1WXWA 2BGTA 5ALXA 2FZEA 4L85A 2I6TA 4PNZA 2GD6A 2DWPA 4DYDA 1C0EA 2BM9A 2BFNA 3GB9A 4IKOA 4PRLA 3G7UA 1A5ZA 3U3DA 1PKXA 1N9GA 2GM3A 1DX4A 4GE0A 2CE7A 2FQXA 3IBYA 3KVRA 4EPXA 1XK6A 3C1AA 4WXMA 3S6JA 4AN1A 3AHFA 1J2JA 5K0BA 5DIFA 1VE1A 2AT1A 1YS7A 4F21A 2VTDA 3C8UA 1K4MA 1UZUA 3OUZA 4FBGA 3QY9A 3I2JA 3PUVA 4Q3OA 3EVCA 821PA 1YVDA 5ALNA 2Z09A 3P0IA 2YJ4A 4LDNA 1V5GA 1JAYA 2BWJA 1UKZA 4QLOA 5BSTA 4EJ6A 1S9DA 2HPHA 2DBQA 1U0BB 3AHCA 4OF4A 3KHSA 3GLIE 2PX2A 3K1TA 3UG6A 3V2HA 3W3ZB 3W5AA 4LZJA 4KGDA 3HDYA 4ZYTA 2FE1A 1FDTA 1CQXA 1U28C 3DMTC 3F74A 4OHOA 4YWHA 5K01A 3Q6MA 4DNFA 4P7GA 3IEVA 1E3QA 1M72A 4RZXA 1QE3A 2Q41A 4F12A 3D7LA 1OREA 4JITA 5KNCD 4U7GA 4RESA 5DCYA 3N3BC 3I6IA 10MHA 1Q7BA 2JJ1D 3C3DA 3EODA 3GFVA 3MJTA 3GLVA 3OLXA 4KDCA 5HFAA 1FDUA 4XQ0A 3ASYA 4XVQA 2JF0A 3DFMA 1XD2B 3E27A 1ENYA 2IH5A 4DDWA 3K1AA 5EE9A 3PQDA 5FWYB 3KOYA 4ETNA 1WQ1R 3EVDA 4C3UA 3D7NA 4P7JA 2GZHA 2NV6A 4P3YA 4RZQA 4RGBA 4YPVA 1SBTA 1CR0A 1SMKA 1G2IA 3DMGA 2GK7A 4ENSA 3WAGA 4GI7A 1Z28A 3IMKA 3X3HA 1N9KA 4UQLA 1NR5A 2VT6A 3KKQA 3M82A 5KIAA 1CFZA 2UVDA 4MH0R 1E2PA 1ZMXA 2QLMA 3KYDB 1QGUA 1M8PA 4HRXA 4BZXA 2WSYB 4LOHA 5B4UA 4IDQA 1T43A 3WHLA 3HYNA 4NDNE 7AT1A 1E2QA 4JK3A 1S7GA 2V6BA 1Z37A 1Y1LA 2BJVA 3KJEA 3KVYA 2BTQB 2FSVA 3QSGA 4Q9IA 3T7RA 3T94A 3Q3EA 4GOXA 4YJFA 2AG8A 2IUUA 3WISA 1PTKA 3FIJA 3ZGOA 1WDLA 2CJWA 3DEIA 3O3MB 1CJKC 1P3JA 1X8LA 4P8RA 1K3FA 4I3HA 1GD1O 3VOBA 1MOPA 2XE4A 4MR7A 1VE3A 1OFVA 4DCSA 2Y1CA 2REQB 4X7RA 4NCAA 1QLWA 1CQIA 4TXMA 5JAIA 3C39A 3PQ3A 5CA1F 1M7HA 4RFSB 3UOAB 2HCBA 3D5TA 3AFOA 5CEFA 1SUCA 5EFOA 2VP9A 3KSMA 5DYIA 3DH0A 4ZO4A 3SPXA 2IKSA 3F6BX 3RASA 1ST2A 1J1ZA 2ADMA 4BNZA 5B1SA 2GUGA 2F3QA 4ADSG 2QZPA 4NFHA 1KQGA 4ZDJA 3PU6A 3DV2A 1P3DA 4PBTA 3U61B 3IEXA 1FSFA 3Q7QA 1QKKA 2D5CA 2ZIWB 3Q98A 4HDAA 4TUYF 5BWOA 3IAAA 5LVAA 3C5VA 1ZGZA 1DIOB 2J59A 3B6JA 3EA5A 4ER5A 3IX7A 1JH8A 4M98A 2CBGA 3BDAA 1AQIA 1Y8AA 4K9NA 3P2YA 4TLAA 1RPNA 5JC1A 2VSNA 1QWSA 2YTZA 1KOLA 3PVCA 1XU4A 4CE6A 3GUZA 3OD5A 3QTLA 3LQYA 3UH1A 5JAPA 1A69A 1EBBA 3FM9A 4FJ1A 2HQ1A 1XP8A 2O2XA 2HLNA 4RADA 4BFVA 2QB5A 1N0VC 3ZI4A 5JAOA 4HP8A 2EYQA 1SC3A 4Q3EA 5AW6A 2WWYA 1H8ED 2OE2A 4B3CA 4H6VA 4HAWA 5BSHA 3IMFA 5AVJA 3SMVA 4MS3A 3W9UA 1GPWB 3S8MA 2EEZA 3LK7A 4C76A 3SX0A 2CFIA 1BRMA 4NMWA 2B36A 3G9XA 2R87A 1ZGCA 2BGUA 4C87A 4TVSA 2C07A 1F0NA 3CLRC 3GYGA 2GO1A 3EGIA 2IGTA 2RGAA 4GGOA 3ONFA 4R1PA 3ZE2B 1P7WA 4M1SA 3O9VA 1RAGA 5B7QA 5TQ2B 4B6JA 3IS3A 1LPPA 1DOHA 4U39A 3G13A 2CCKA 3QEMA 2ZJ0A 2QOEA 3EXIB 1QHIA 2PSSA 4ZVMA 3ZBUA 1ZXBA 3CZCA 5EP4A 1FXUA 5D84A 1BD4A 1JZSA 1U4OA 4DSTA 3CY6A 1TJPB 2AD1A 5IFKA 4MR8B 2OCLA 2P3OA 4PS0A 3V34A 3KSDO 2CXRA 4GZ6A 2XH8A 3FPEA 4C7MA 3HM9A 1LJLA 2YJ5A 3GZTB 2BLNA 1QTRA 5DN6D 4GFDA 4OFBA 3A11A 1QTNA 3GRFA 4JLJA 4M7OA 2PMBA 3SFVA 3L0BA 1BH2A 4AY5A 1TAHA 4LXIA 2P40A 4BFYA 3D59A 3FLBA 3TGLA 4NV3A 3WWDA 3DEHA 3KAKA 4I4NA 5HZGA 3AF6A 2FMHA 4BFLA 2Z6UA 2H1RA 4LHVA 3RU2A 1Q3TA 2E4AA 2FKNA 2WK1A 1KI9A 2FLKA 3L4BA 5ADHA 2A0UA 3ER6A 4MGEA 1KBOA 3JVUA 3BMOB 3HZOA 2WD7A 1KDTA 3RNLA 4HC4A 3ZNPA 4N54A 3P8ZA 2XX3A 3NAGA 3UKDA 4AMZA 3ANTA 1ESEA 2BTOA 4IINA 4CKYA 4FR0A 3GP5A 4AG6A 1HSZA 3P9IA 5KYNA 1DMSA 3I2FA 2UVPB 3VR4D 2FN3A 3WRVA 1D2CA 2WLSA 2CFTA 4WLEA 3FETA 3MJEA 1PCXA 1CIJA 4O3FA 3E2IA 1ZJ6A 2W37A 1M6VB 1YZHA 2VUSA 5E6SB 2QTRA 4MQFB 1VRCA 4G2TA 5CA1A 3V8QA 5SZIA 3QU5A 2GAIA 1Y1RA 3OKCA 2OBNA 4KLZA 1C9MA 4LSMA 4OH7A 3BKWA 1BDHA 2ZUUA 2JAOA 1NZDA 2G83A 3ONEA 1PWYE 2DQZA 2LNDA 2XGSA 4WN3A 1PIWA 2GHIA 3KCQA 2J1LA 3GZNA 4CF5A 3OTOB 4MDFA 2PLWA 2QQFA 4BV9A 1HA3A 5FWDA 4TTVA 2OLEA 3ZHSA 1PFWA 1S9HA 2ZIEA 2ZPTX 3FCYA 3W7AA 4YO7A 4NNPA 1HT2E 3U44B 3LUKA 1TYCA 1C30A 1U11A 4PXAA 5KVAA 2X5JO 4FTWA 4KMSA 2I29A 2C4MA 5LDDC 1UBNA 2C2GA 3GLHE 4D42A 4B7CA 1YJ5A 3PQ6A 1GARA 1UWCA 1TK2A 1P31A 2AN5A 4P32A 3ZHCA 4AQDA 3F6CA 1G2QA 1HEYA 4YACA 2RBGA 3ECAA 1D0IA 2OQVA 3FHLA 3EZ9A 3EDYA 4UPVA 5KWJA 2JHAA 1OTXA 2MT9A 2XTMA 4I6GA 5TF4A 4OLBA 1SIWA 1USWA 4CIWA 2GARA 3C3PA 5D6OA 4B0OA 1SCDA 1U94A 4UOEA 3K9FC 4G01B 1W1WA 2NXNA 3QNMA 1LLQA 3UW3A 1RWKA 2Q6IA 2B20A 3W4KA 3ILXA 3CPEA 1YT5A 3WL5A 1T36A 2PGOA 2W7TA 4O29A 3FPAA 1E92A 5JHGB 3ZDEA 2JK0A 1U2PA 2R751 2H2HA 4X9XA 4EFNA 121PA 2IGBA 5HZKA 1ATZA 5K99A 1OILA 5U4QA 1UXGA 2ZIXA 2ZSUA 3TM4A 3ROMA 421PA 3QVLA 1BYUA 1YVUA 4FOLA 4BXOA 3DBRA 4CBVA 2O5EA 1JKJA 4ZVPA 1RWNA 1X7HA 4L16A 1A5TA 3L6CA 2DCUA 1ZOIA 3FTPA 4QASA 1RPZA 3MCTA 3GQBA 1NXSA 1X0XA 2A86A 4FW8A 2OR3A 4JUBA 3RV3A 1PLJA 3A3YA 3H5LA 3M3PA 4I9UA 4L95C 3OPMA 5B1IA 1QQBA 5EWMA 4F5EA 3CLUC 4LN1A 4WX2B 1K63A 2QTZA 3M9WA 4CQNA 3VUEA 3LWBA 4D5EA 1NG9A 2G7MC 4QQ8A 1K27A 5D00A 5MF6A 5EMJA 1A8SA 1X7YA 1RQPA 3VR2A 1E3EA 2B9EA 3C3MA 4FN4A 4PSVA 2CZCA 3CF6R 1CRWG 2BV3A 2PQ2A 3MTAA 4PLTA 3FTEA 3DMDA 2DPHA 3QLTA 3SQDA 1O08A 1YR2A 4BNUA 2FPWA 4HADA 2WABA 4PX9A 4HUTA 4A0QA 3ZIAA 1YHZA 2Z04A 3DEFA 2R6HA 4D25A 3ZHVA 4OBEA 3NWOA 1X38A 1X80A 1HETA 4G07A 1NXWA 2QN3A 4WXHA 4B8YA 4PHFA 2OO5C 4W5QA 3D9QX 4A03A 1IB0A 4D02A 4G5YA 1X15A 8GPBA 4PHGA 1D2EA 2CVQA 4JWKA 2MSKA 1KJJA 4PHCA 1I36A 4X0EA 9LDTA 2G6TA 3O03A 2X15A 4M0LA 1B26A 3LUGA 3NDBB 3DKKA 3PA6A 2HSWA 5K4AA 1T2FA 4HXGA 4OAPA 5LXTB 3K70D 4PGGA 4OIFA 3W5BA 3OWHA 1UBFA 2VHJA 1B0ZA 1J9ZA 1DBPA 1DCKA 4RA6B 2BGNA 1U9IC 2HF8A 1ND5A 1VSVA 3OOSA 3RSFA 2N75A 1N2CA 1GUAA 3K6JA 1GAJA 1Y4AE 2FMXA 2G25A 2EX4A 3F5FA 4H77A 4DA6A 3EUEA 2PBFA 4IH9A 5DOVA 4DAEA 2AXEA 3P0HA 3BA6A 2G06A 3TIVA 4OQPA 4D4GA 5KNBH 4B80A 2GEKA 1U9YA 3B20A 3VPGA 4JAVC 1BKSB 2OMEA 3QHAA 5FBRB 2RGYA 4IG9A 4E32A 2XR1A 1SWVA 5HCUA 1U81A 4C4SA 3JQFA 5KCZA 2IE8A 4KXYA 2FFAA 3BCHA 4NCKA 2R8XA 2JFHA 3C45A 3RJ9A 4C0AC 5HA5A 1O7JA 1IK4A 1TM4E 1E1RD 3C6YA 13PKA 1YIAA 3RQIA 1NR7A 3QF4A 2PNFA 2NZXA 2ZRAA 1FU7A 5K3BA 3TQQA 3ZU6A 2VYND 5ER6A 5CDGA 2CK3A 3E81A 3T3GA 4F1KA 1CUGA 1XKXA 2R6ZA 4A5OA 4MMYB 3RYHA 4L50A 2OA0A 4RCZA 5I4KA 4Y2PA 1U6IA 2JEOA 4HDMA 4UXHA 5CH5A 2CLSA 1NLFA 2VJMA 5A4FS 4UM8B 1CUYA 3BXOA 3FNGA 1EA7A 3DZKA 5I9LA 1G5RA 4GU5A 2AZ4A 4EHHA 1YZQA 2QMUA 1K66A 3SOZA 2C99A 5EWLA 5G0VA 3RVSA 5HRAA 4A9AA 1TRKA 2FK8A 1GAEO 2WYOA 2YIJA 3A9VA 5EYPA 3SC2A 1UBHS 4JASB 4FHFA 3UUEA 4HZUA 4BFTA 4BWVA 4C05A 1HG0A 5T8KA 4CI9A 2I2BA 4PXSA 4DIOA 2W2LD 5KYXB 5K8LA 2D3TA 1NNLA 2IJGX 4UUQA 4BMOB 2HCRA 4O25A 4FLFA 5GOTA 1YBHA 3GPDG 4Q4DA 2WLTA 3X1WA 3N76A 4OO3A 1WSBA 2ORVA 2QQ0A 1W8IA 1BSVA 2GTHA 2EOAA 3UJ3X 4D4LA 1ZUHA 2BL4A 4OX9B 4OXQA 1K3TA 4LJRA 4DCPA 4ZI5A 1OU0A 4YASA 5GV7A 2ZIFA 4F3TA 3MZ0A 4YR7A 1SUPA 1JV2B 2OEPA 4LJSA 3F1LA 2QYOA 3P4XA 3FCUB 4EENA 4CMEA 1UT6A 1WE2A 1JFSA 1AKEA 3NHJA 5JLAA 2FWPA 1TA0A 1NVBA 1Z5PA 3FDZA 3HM2A 3IUSA 3NI2A 4HBGA 4JUDX 3NVDA 4KSYA 1NMQA 1WA5A 1ZAKA 2G63A 2I71A 2X8LA 4G8JA 4N82A 4ZGWA 3L4JA 4GM1A 5DBHX 4XOIA 1KF0A 4RACA 1RM5A 2RC5A 1QX4A 4ZVTA 1Y5NA 4N3GA 4QGFA 1XF1A 1P6UA 2C20A 1RJGA 1YR3A 3LQQA 2WSSD 2JFQA 2A1TS 1ESNA 3ZHOA 4Z4IA 2YDXA 4MUBA 3QBVA 1FC0A 1KK3A 2WIBA 4QU9A 1KMHA 1CT9A 2IEAA 4D3ZA 1N57A 4E11A 2Z30A 5AI4A 3AY0A 2F3TA 2YV3A 4G0YA 4PBRA 3TDMA 4H3HB