4Q1CA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 8 {2,2'-[{4-[(2r)-4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-2,3-dihydro-1,3-thiazol-2-yl]benzene-1,2-diyl}bis(oxy)]diethanol}
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1cA00
1GNPA 3GQBA 3QVUA 4MGYR 2CHQA 2C9CA 5FUXA 5EJEA 4PSVA 4CDGA 5GVRA 1SZPA 1UEIA 3K0SA 2IT1A 4ABYA 1SVKA 4OI4A 1JR3A 5EXPA 4JMPA 2CLSA 4DLSA 2DHRA 2O8DA 2BMJA 1E2QA 1W49A 2VP4A 1BMFD 3QVVA 4HB3A 2ZXUA 1FL9A 3NG1A 5TVKA 3FVQA 3RWMB 2XEXA 5CYOA 3EW9A 2QGZA 3DZDA 5IK2D 2VP5A 2BBWA 1NRJB 2A3RA 5A0FA 3EPLA 1T3LA 3U61B 1K8RA 1LV7A 5K8UA 2RGBA 1Z5ZA 2WJHA 4B34A 2WPDA 4CEHA 2YWFA 5TMPA 1XU4A 3B1YA 3F5FA 4TLEA 4V0MA 2VHJA 2QQEA 2WBLC 3JZMA 5AJYA 1E32A 1CXZA 4D82A 2R8RA 4Q7LA 1BYUA 2JDIA 5FBQB 4YMTA 5C2JB 4TN1A 5CK5A 5DHFA 4FMDB 1CR4A 2ZS9A 2G6BA 5JMTA 3MJHA 3O8DA 3BRWD 2X77A 5AUNB 2FOLA 1W44A 2IL1A 2BOVA 2WV9A 2IK8A 4EPXA 1OPXA 2GXQA 3KJEA 3QKTA 1QBKC 3A1TA 3RS2A 1E2PA 2CK3A 2D2EA 2R6AA 1E2LA 2J3EA 2NPIA 1NJFA 1LFDB 1R0YA 1KYIA 3C15C 4N1AA 3W5JA 5C4MA 5FUYA 5DISB 4R98A 1PLLA 2Z0MA 1TPZA 2P5TB 3D3QA 4LV5B 4UXIA 2IWRA 2PL3A 3B13B 2C99A 2LKDA 4GMDA 2JLQA 1EFHA 2B92A 4TL6A 4FXPA 1KY3A 4HSEA 4OL0A 4JLAA 1GRQA 3UG6A 3U3OA 4LBYA 3CH5A 2ANBA 1NN3A 4G3XA 2A2ZA 5CB6A 3KTAB 1CJTC 4DEYA 2R44A 4I1VA 3RRNA 3QXHA 4XVUA 1Z47A 3B8HA 3BWDD 2RGDA 3KKOA 3LO5A 4MYCA 4NYJR 3GJ6A 5KHOC 2V8OA 4GOKA 3BERA 1OH6A 2OE2A 3VR4A 3PUXA 1MABA 3PUYA 3I62A 1CRQA 4UNRA 1E79D 2ZETA 3R20A 4LJ5A 4G0NA 3ASYA 2XNDA 3UIEA 3ADCA 5E7MA 4KFTA 3MSXA 2GBLA 4RSGA 2GXAA 3VX4A 4RZXA 4B2LA 4II7A 5KPJA 3EPKA 3AVXA 5EXTA 5KNCA 4NYIR 2GJKA 4TT3D 1W2GA 2UKDA 3P4XA 4P0TA 4FINA 5DSZA 4D4KA 2I1VB 4HAXA 2QSZA 3R9IA 1R2QA 1VECA 2CDNA 1WA5A 3W6NA 5H1YA 1E2DA 3NBFA 4PAOA 1JQJC 4B75A 4GDFA 3I3SR 2W2XA 4XVQA 4MYTA 3QXCA 4XVRA 3T15A 1G8HA 2WWIA 4JJZA 2JLZA 3CRQA 2GA8A 3M1IA 3GMTA 3AF3A 4F4CA 1NKSA 2QE7A 2ZU6A 4F92B 3U3MA 4JBWA 2JEOA 1II8B 2OESA 4QJ5A 3ZS8A 5JS7A 4Q4JA 2F1RA 4FMBB 1J7KA 4DLTA 3UMRA 5KO2A 3EWSA 1E98A 1KI2A 4QRHA 5B58C 1TMKA 1YQTA 2ZTSA 2ZI9A 2BC9A 2RGNC 3CR8A 3T35A 3VMFA 1HQYE 4D0GA 3H1TA 2J46A 5EP1A 5FBLB 4Q21A 1U8ZA 4MRVA 1T4GA 2BV3A 4IKEA 4HAVA 1E9EA 1GTVA 4W5WA 2H18A 3BBPA 3N5CA 5EP3A 1WB9A 3Q3JB 3REGA 2HYDA 4DT1A 4KBGA 3SFZA 4UNNA 4B3CA 3WP1B 2CL7X 2D06A 3UG7A 4FW9A 4BFWA 2GXUA 3FB4A 2QROA 3NH9A 3T12A 4BZXA 4KCGA 1JBKA 1XCPA 5KSYA 2ANCA 1E9CA 1TL7C 4KXFB 2ZITA 4OBEA 4ERNA 3Q5EA 4BZQA 1AM4D 3PEVA 2XNSA 1CP2A 3QKRA 4RKEA 1QHYA 2FF7A 2BDTA 3U4QB 1ZP6A 1M74A 4V0KA 4DUGA 3QPUA 1BH2A 2CCGA 1FOEB 3DHWC 1ZIPA 3KUCA 1IJFA 2G77B 1KI6A 2AN9A 3H86A 3HU3A 2IXGA 1OF1A 4P33A 4PZLA 2W0MA 3OF5A 4IOLA 1US8A 5FTLA 2ZJ8A 4DBLC 4U00A 1XPOA 1ZUIA 4CEIA 1KO5A 3G0HA 2O8BB 5JJKA 3UMSA 3TRFA 1D6JA 2ZRIA 4YC7A 2VO1A 2OCAA 4JLKA 2JJ1A 2ZI4A 3FMPB 1TNDA 3ZVNA 4A8JB 1ELOA 3K0FA 2PJRA 4LHVA 1N6PA 1M8PA 3VU9A 2OFXA 1P6XA 2JLYA 4Y0VA 1ZINA 1JALA 1GAJA 2I4IA 2ZRKA 4XWKA 2FWRA 3A4LA 2WTUA 1AZSC 5F98A 4B47A 4N0DA 3QEOA 3CR7A 1YVDA 1KK1A 1QHNA 4Q1DA 1KJYA 4Q5IA 3RSOA 2B8TA 4EFMA 2YOFA 5FPYA 2VP9A 3CKLA 4AKIA 2QTFA 4GI7A 2EFDB 3WP0A 1G3UA 2HT6A 5DI3A 1ZNYA 4A4DA 1E2KA 3IHWA 3FYHA 2AR7A 3LW7A 2ZE7A 1T0HB 4QHSA 2IEZA 4D80A 2DFLA 4M1SA 2RCNA 4ZDKA 3W3AA 5CLQA 3VFDA 2ONKA 2WKPA 1VYTA 2DFKB 2VA8A 3CF6R 3WMEA 4F91B 5KDDA 2WOOA 1T8UA 3B1XA 1CR1A 1K6MA 1UDXA 4MKIA 1N6RA 4AYWA 2BKUA 3S1AA 1SXJD 2A5FA 1R0ZA 1XTJA 2IHYA 1OLOA 3GLIB 1P61B 2CEAA 2CJWA 1P2VA 2G1KA 1DG1G 1COWA 1G8FA 1WXQA 3B1ZA 3CF2A 4RD6A 4I4LA 1R10A 2VYFA 4YDSA 3ZIAA 3WNDA 5K8IA 4W5JA 4JBXA 1Q1QA 4PQFA 4B33A 4PC1A 2EYUA 2X19A 3VR5A 2ZE8A 4ASUA 1DO0A 2OBNA 1AN0A 1GZSA 4JSYA 4LJ8A 3AH8A 4XSHA 4G1UC 1YRAA 4XTCS 3LW8A 4KSBA 3HR7A 3OEED 4LZZA 5H8WA 2FGKA 1TAGA 2EU8A 4G01B 4F4JA 1OXXK 3OIWA 2NO0A 3VX3A 4A8JC 4HZUB 2Z4SA 1CJVC 2R6CA 3UWOA 1F2TA 1KI4A 2VH5R 4M9QA 1OSNA 1ETUA 5HCNA 5FBVB 1FPMA 3THYB 4QJ3A 1A7JA 3KXLA 3B85A 3QE0A 1N6OA 1QG4A 1TX4B 1EX6A 1ESNA 4XJXA 1ZM4A 4AURA 3GD7A 2QAGA 3IKJA 4PSKA 4LSGA 3TSZA 1YR9A 1W48A 3N2IA 2GK6A 2WJYA 1UBGA 1G5PA 3OAAD 1DEKA 1X8LA 4YXWA 2YOGA 5E7JA 3A4NA 5CDFE 1YU9A 3E70C 3Q5DA 4JLNA 3A6PC 2LWIA 3CPEA 1A82A 2WWWA 3U3RA 1NG9A 4PPQA 1OFHA 2C9YA 3DDCA 3BFKA 3RVBA 3UWKA 1G21E 1QF9A 2X2EA 4LI0A 3PEWA 1GWNA 2OCBA 4RD2A 2PH1A 1A1VA 3V4RA 2W0SA 2WMOB 2ZU0C 1CULC 4PFSA 4PX9A 2JLWA 3ICEA 2OZEA 3M0EA 2QQ0A 3WHKA 4MH0R 1U9IC 1J90A 5FOVA 1EWQA 3SOPA 5GJBA 1G8GA 2XJ9A 3QF4B 1DOAA 3IO5A 2ZRCA 3T5DA 2ZSDA 1ANKA 4MITA 3IBGA 3R7WA 1NY5A 1XCGB 5KYKA 3C16C 4NCNA 4LUCA 1NF3A 3FHCB 3GLHE 1G19A 5KPDA 2OEPA 4D6PA 1GIAA 1S8FA 3AVYA 2JIZA 1ZCBA 4PC7A 2O5VA 1W4BA 4Q66C 2OAP1 1J8MF 1OIVA 1BIFA 4B48A 1FX0A 3N70A 3T06B 3SQXA 4KSCA 3D31A 5JRZA 4XWOA 4YMUA 3NBXX 4LJYA 4C0BA 1SXJB 1YZTA 2V9PA 3OE7A 3WMFA 2A5GA 3BAFA 3C41J 2QRZA 3NBZC 1G8YA 3Q72A 2Q9BA 4LV8B 1TEVA 3TJZA 4KO8A 4DCNA 4JLOA 2GJ9A 5D3MB 5LD2C 1ZC3A 3EG5A 1LTQA 4ZIRA 2VRWA 3B6EA 3V4FA 4AK9A 1RIFA 5EP4A 3THWA 2NZJA 2IYSA 3SHFA 3UK6A 1LW7A 5BW8A 3CPHA 3MCAA 4MYUA 221PA 2X1VA 3P4YA 1SKYB 2IW3A 4A2QA 3H0KA 5KNBA 3GJXC 2O0KA 1D2NA 4EQ6B 2CBZA 1G3IA 4XSGA 3A1SA 3SR0A 1TQ2A 2FSGA 3KB2A 3GLFB 1NL3A 1KMHB 3QXXA 5ANRB 5FFMA 2OBMA 1SULA 2BCJQ 3P26A 2BBOA 2HDNB 4M1KA 1XX6A 4HDCA 1KDOA 3W8RA 2OAQ1 4NYMQ 4LWZA 1FW6A 1R0WA 2Q0HA 3P27A 2G83A 3LVRE 3AKDA 1E0KA 1TQDA 3NC1C 2YC2C 4HDQB 5M04A 1P62B 2RKOA 3L2OB 3QPVA 1JR3D 1G41A 2ZYVX 1OJLA 4Q9IA 4HLQB 4PXAA 3B1WA 2W83A 1SXJC 1CJUC 3LVQE 2XOKA 3NBYC 2NO1A 3DEFA 1XWIA 3NVAA 1G8PA 2AFHE 2CCKA 1Q1BA 1NJGA 4TLDA 4TTRA 421PA 1W46A 5J47A 1DAHA 1ZBDA 4I1OA 3U6BA 3GCGA 4ZKDA 1JEEA 2IX3A 2ZAOA 2RHDA 2UVQA 2F1IA 1X8KA 5E7IA 5L3QA 5DYGA 4M53A 1HY3A 2WPDD 4EJSB 5TB5A 4Q03A 4A82A 2J87A 4IOJA 2AKAB 4D4MA 1IY2A 3IBYA 5JEDA 1FTSA 1DADA 1S1MA 4RJLA 1F48A 1E2HA 2AHOA 4P32A 2O52A 4EDHA 1HT1E 4M2LA 2JDID 3IEVA 3HPQA 4C0JA 2ZJZA 3PUVA 1MR3F 4URYR 2F43A 1YR8A 1E1QA 4JLDA 1NBMA 4QJ4A 2HUPA 1HE8B 3WBJA 3ZVLA 1KY2A 4TSFA 4TYQA 2XX3A 4XD7A 1RVDA 2ZE5A 4F93B 3VR2A 1EESA 1R5BA 3QG1A 2CK3D 1PLKA 4DZZA 5JJLA 3KQLA 4RFSB 2XB4A 1LS1A 1AGRA 1QHGA 2JJ2A 3RRZA 1YJ5A 4M8NE 2WWFA 4G5GA 4O0MA 3W6OA 2PT7A 4E5UA 2OM2A 5EE9A 3RS5A 1TUIA 3O8CA 1E0SA 1P5ZB 2GCOB 3PCRB 2W00A 1XPRA 4PQYA 2ZSFA 3WYFA 3EPHA 2VSXA 3QOFA 4PHTA 1OT3A 2PEZA 3CONA 4URZR 1JXMA 5FBRB 5TV2A 5AR1A 3T1OA 2R65A 2Z6VA 4Q19A 1GNRA 4TL7A 3AVPA 2F1JA 3VHLB 1HT2E 1MV5A 1UADA 3EIEA 3K0AB 3T1QA 1JB1A 2ATXA 1E99A 3TBKA 4RZ3A 1MO4A 3VR3A 2H17A 4P4SB 4W9MC 1Z83A 3L82B 1W5TA 2QY9A 2O8DB 2O8CA 2IUUA 5DYIA 2NOAA 3I5YA 1AJEA 2JLSA 1FUUA 5KSPA 2ODBA 5J4HA 2XNDD 3AM1A 1GRNA 2ONJA 1ZNXA 2I1QA 3TIFA 3K70D 2OV2A 3W8NA 5IDVA 1NMYA 4QHYA 4Q47A 5DHAA 1KSGA 4QGAA 3ADBA 5FPHA 2QMHA 3HJNA 5E3HA 1KAOA 4GT1A 4I99A 1VYUA 4IXNA 2JJ8A 1II9A 3WMGA 2X8AA 4KVAA 4Q4LA 4DLUA 1NVVQ 2V6IA 2G9NA 2D7CA 2GK7A 2ZUCA 5GJWC 4OQLA 3SYLA 4ILEA 2AK2A 2NO9A 3L0PA 2AL7A 5FTKA 1VHLA 2Q6TA 1TU4A 3BH0A 4ZDWA 1KI7A 5SZIA 1FMLA 1XMVA 3U7EB 4AKHA 1XD2A 3MFYA 3LD9A 3QBVA 1DAFA 5CK4A 2OO7A 3AUYA 4HLUC 2QT0A 3NIBA 1ZMXA 2QE7D 1GNQA 4DLZA 2OCYC 3EXAA 4ITRC 3U7HB 1CEEA 3I5XA 4DEXA 2FJUA 4NCKA 5KOYA 1Z6TA 1S3SA 4R9UC 3B78A 4Z8YA 1J2JA 1S9DA 2XZOA 2ZROA 5JI3E 1N0WA 1L8QA 2J0UB 1HE1C 4WW0A 3CBQA 2BEKA 3KL4A 3VTKA 1S0UA 3FFAA 1JNYA 4LOAA 3TAUA 5K8LA 1R0XA 3TGPA 2FFHA 2DB3A 3I72A 1BYIA 4LGMA 5CYPA 3ZH9B 1VMAA 1G4UR 5LB2A 1H8EA 4NCIA 4OHWA 3IIMA 4CF7A 1M7HA 1XJQA 3ZGXA 2VF7A 2WAXA 3ZDQA 4HAYA 4BFXA 5EE0A 5KU1A 3KX2A 3I8SA 4LPKA 1PVOA 2QGNA 3OIVA 5CM9C 2IEYA 4C0AC 4MQBA 2BMFA 1RW4A 2ORIA 4ACBA 4BFSA 3AP2A 1XP8A 2QTVB 4MUAA 1TADA 4NHOA 1RJ9A 1Z0DA 2C95A 3AVOA 3ONWA 5KNDA 1EK0A 5BYJA 5C4GB 4CRWB 4DUGD 2VEDA 1ZIOA 4HB2A 1U81A 1PZNA 3PENA 3QXJA 5B2ZA 4KFSA 5J5CA 5FPKA 4JVSB 4POAA 4HDOB 4Q7MB 3UATA 4UXHA 1XJ0A 4H9GA 1U99A 4DKXA 4LRWA 3K70B 1RC8A 4R2HA 4XWAA 3B1VA 1YR6A 1GM5A 3GLIE 4KI0A 1NLYA 4BLSA 1LF0A 3TR5A 2XGJA 3SEAA 2JJ1D 2J41A 2ZRHA 2OHFA 1AQUA 1VKJA 2RMKA 3LDAA 4AG5A 1Q44A 4US2R 1UAAA 1NIPA 4GP6A 3QEJA 4V03A 2KWIA 5CITA 2XAUA 1RKBA 3X1YA 2G0TA 4BRUA 2D4HA 1KI1A 2AWOA 4QG7A 2CLDX 2FNAA 2NG1A 1KDRA 4NCJA 3DOFA 1QRAA 4NCHA 3RAPR 2ZPTX 2CL6X 1IXSB 3F8TA 1WDTA 1KKLA 4YMVA 3QI2A 4BE7B 1GUAA 1VG9B 1Z2CA 4RD1A 1UF9A 2OCPA 2PX0A 2WICA 4Q4JB 1X8JA 3CNOA 4LJ7A 1F2UA 3FMFA 3QENA 3F3YA 4NBSA 5BQ5A 3QXSA 3A8TA 3QJYA 4OKSA 4GFDA 1KJZA 1KI8A 1X1RA 2G0NA 2ZREA 1L4UA 4TMXA 1M2OB 1XD8A 1VCOA 3WHLA 1ZD9A 3N2EA 2RGGA 3B7GA 2WJIA 5EZ6B 2IHBA 2PEYA 4HB0A 2VSFA 3MG9A 4TLCA 4NYJQ 3AVTA 2QAJA 3A1UA 3EZ2A 1COWD 1GP2A 1P75A 3LH5A 3CB4A 5G3YA 3ZIAD 2D7DA 2N46A 1Q0UA 1D5CA 2DCUA 4FCWA 4DT1B 3I61A 1TQ4A 4C7OA 1A2BA 2VP0A 4ASUD 4LX0A 2VSOA 1QHHA 1X6VA 1ZVQA 1M34E 3K70C 4CT4B 1YHNA 4K46A 2QA5A 4LYJA 4WAUA 2CHVA 1IM2A 1KI3A 3KDSE 4ESVA 2ZI5A 1UJ2A 3QKSA 4IDHA 1R7RA 3U6KA 4LJ6A 2V4ZA 3C5HA 1L4YA 2W58A 4HUTA 4FMCB 3QKRB 4NYIQ 1IHUA 3L0IB 2ECKA 4B6EA 1IN7A 2R2AA 1OFIA 4AIIA 3WBKA 3K0CC 2JLXA 4C0SA 3IIKA 4LC0A 1DAGA 4DC9A 1GRRA 1P9WA 1KI6B 1XBTA 2D62A 2GVZC 4Z54A 2QP4A 1OH7A 2HCJB 3CNNA 1SXJE 1US8B 4YXWD 3GLGA 3WNCA 4CEIB 3GJ5A 3RABA 1X86B 3TUIC 1WP9A 2C04A 2GEVA 3UPUA 4TYWA 2O8FB 3LRPA 5BYKA 4US0R 3TUZC 4B2PA 1ESMA 1IAQA 3K0FB 1KO7A 4HAWA 2RAPA 3VU9B 3TUJC 1YRBA 1XMSA 3CX8A 2J0VA 3MWYW 1W4CA 4PANA 3WNBA 1C4OA 4B73A 3WY9A 2X2FA 3LX5A 4A0RA 3B82A 3J81k 1Y63A 4Q7JB 2E9SA 5GVSA 4PC6A 3BS4A 2AKYA 2P6NA 3DKVA 1SKYE 2XXAA 3HWSA 2EFHB 4M22A 4TMVA 1OIWA 1OXSC 3FGNA 3QG5A 1T5IA 4L16A 4M21A 4PO8A 2DY1A 2O8EA 4QNMA 5TDHA 1NY6A 3D6TB 3GLFE 1UKZA 2FZ4A 1KK0A 4KYIB 4DDUA 2JIZD 1E9BA 3SHWA 3H2YA 1JR6A 1HV8A 1DAIA 1SVMA 2ZUDA 3QIAA 4HLCA 2ZYWX 1CR2A 1KDPA 4EPRA 3GJ7A 3S1AB 2RB4A 4OHXA 4LHWA 5AUQA 2ZRAA 4A92A 4B3FX 2FZLA 4Q9LA 3OE7D 2CJWB 2OG2A 1E9SA 2QP3A 1MRSA 1P9RA 4GL2A 1DARA 2FG5A 4GPTA 1P2TA 4C4PA 4RD3A 3BGWA 4A2PA 4MKHA 3OEHA 2WJJA 3RRYA 4LJAA 1LNZA 1UPTA 3RNLA 3U3KA 2IYZA 2ZRPA 3CW2A 3CO5A 2H7VA 3SC3A 2KBFA 5BXQC 3HPRA 5C46F 1UBFA 1DBSA 3ADKA 2IS1A 1IN4A 5FOUA 3WYAA 1HA3A 2Y8EA 1ZM7A 5HPYB 1ZUNB 2Z5FA 3X1XA 1AK2A 1F2TB 3CF0A 4MKFA 4LYHA 1M6NA 4U02A 2ZSEA 1U8AA 2V7QA 1GL9B 2QRNA 4Q4AA 3AGQA 4BFTA 2HCBA 2C5LA 3RWOA 3AKEA 3REFA 3W3ZB 2EW1A 4FWIB 4WZAE 2J45A 2QORA 3NH6A 4E07A 4HYYA 5FUWA 1XTRA 4IOKA 4D4JA 4HLDA 5FTJA 3PEUA 3TLXA 4B3XA 1ZAKA 1OXTA 4Q4HA 3SN6A 4GOXA 4IOMA 4C30A 3LLMA 3M6AA 1VYVA 3W34A 3KTAA 5EE3A 2RGNA 3ND9A 1FFHA 1E2NA 3EC2A 2VTKA 4DJTA 2RHMA 2AD1A 2E87A 1MKYA 2EFCB 1XFAA 721PA 8OHMA 4FWTA 3NXSA 1NIJA 1XTKA 3ASZA 2J0QA 3GJ0A 4MRPA 3W6PA 3DL0A 2XOKD 4TLAA 3PEYA 2OBLA 1B23P 4TTQA 3AGPA 3QKUA 1VCNA 3SS8A 3R7WB 1JEDA 3FMOB 5EXSA 1ZNWA 2GZDA 4UNSA 2GTPA 3TVDA 1S4QA 3X2SA 1P7CA 2V55B 4ARZA 2WKRA 2ZJ5A 4NKRA 3CX6A 4BECA 2JLVA 1YZNA 5FOWA 4KLZA 4CT5A 1ZD8A 1AGPA 1FX0B 1UKEA 4AD8A 2QMUA 4FMDF 1JQLB 1F60A 1DAEA 2A7QA 4CW7A 3MWLA 4YDHB 2ZJBA 1Z2AA 2ZYTX 1O3YA 1XF9A 2EYQA 2V6JA 3L0SA 4UJ3A 3RDPA 4DCUA 1JR3E 4BQSA 1Y3AA 3CRRA 3AEZA 3TSWA 2OFOA 2QSYA 4LHXA 1E1QD 4URWR 5L3VA 1NBMD 2GILA 2SHKA 3LWNA 3IQXA 4KYUA 1QG2A 4ZIRB 4PAQA 3CZQA 2ZRGA 4XTRA 3T61A 4TSFD 4XD7D 4DLWA 3WXMA 2RGXA 5KUTA 4BASA 2CE2X 2IF2A 5H68A 4C3ZA 4TMWA 1MRNA 5DH9A 2AFIE 2WAYA 1RPZA 4H1UA 3PJRA 5JHHB 1XNJA 1JECA 2JJ2D 4DRZA 1KNQA 1BOFA 1D2MA 2ZR9A 3B9QA 4C0LA 4DCVA 1P73A 1TF7A 3SYNA 1ZU4A 2VLIA 3LFUA 2ODEA 2UZ3A 1OV4A 4QBHA 4V0ME 4ZV4A 4UKDA 3GP8A 2YWHA 3MMPA 1NVWQ 4R2IA 1XXHB 4K8OA 1G18A 1OB5A 3ZZTA 4GZMA 1W36D 1VCMA 3OESA 1LS6A 2Q3FA 4N0EA 1NLFA 3KUDA 3ADDA 3BB3A 3LBNA 4QM6A 1KSHA 1GILA 2QBYA 2FEMA 3MWKA 4CZ2A 2F55A 4DLYA 3E5HA 2XTZA 2H16A 4X8MA 2ZI3A 2EFGA 4QM7A 1G7TA 1E2JA 1R6BX 1JJVA 3FKQA 2A5YB 2AXPA 2PLFA 2ZJYA 4A6XA 4L9SA 3MWJA 5J4YA 3DVLA 4MYHA 1I4LD 2DFTA 4DDVA 3U4QA 3C14C 5BN5A 1SGWA 3VHXA 2LKCA 2O0HA 4BLTA 3U44A 4JL8A 6Q21A 3FHOA 3R8FA 2EWVA 3RRMA 1JPJA 3OZXA 3MAAC 4MDEA 2P65A 3EZ7A 4H1VA 1KZGB 2WVJA 4V0NA 2IYQA 5JBQA 1WF3A 3CPJB 3ECCA 5HKKA 4X8LA 2P0EA 5L3QB 4FN5A 2W6IA 3OIUA 1P2UA 1X1SA 3THXA 4TLBA 1UBEA 2I3BA 4EUNA 4EPTA 1E2FA 2A5DA 4LDJA 2GCPA 3B5JA 3GJ4A 4FIDA 3TR0A 4K81B 3U7FB 4PQRA 4UXJA 5E95A 2TMKA 1CJKC 1G5RA 2EQBA 2WJGA 3DM5A 2NTYC 1Z0JA 1VHTA 2F43B 2F6RA 2C2HA 2NZ8A 3PG5A 4MGZR 2MSEB 4GOJA 3W90A 1E3MA 4CIDA 4QXAA 1UM8A 1GSIA 4IFEA 2PX3A 2BM1A 1T6NA 2F3TA 2K5UA 1VG1A 3OFNA 4MKGA 2QENA 4DLXA 5A4JA 3VKHA 2ZRJA 3BFXA 1CR0A 1E9FA 3IPXA 1VIYA 4QNRA 5A5GA 1KO8A 1LF5A 4TYYA 4XIGS 2PLRA 1UEJA 1YZGA 2ZYUX 4AI6A 2BIFA 2XSZA 1Q1EA 4IDNA 1OH5A 4PPNA 3GLIA 3AKCA 1G7RA 5AUOB 2PT5A 2J0SA 1KTVA 1A4RA 1N0UA 1VG0B 1NG1A 1P72A 4QGHA 2IYLD 4X8OA 3QSYA 3AVVA 1TF2A 3HDTA 1WMSA 1QHSA 1H8ED 2VHTA 2YC4C 3NTUA 1W36B 5L3SB 1UBCA 2F9MA 1CS4C 3LQRA 4QBGB 2FA9A 3CX7A 1FZQA 1OHHA 4RY2A 1KO4A 2BJWA 3H84A 3QPWA 4KVGA 2FSHA 1CIPA 2A5JA 2D74A 2ERYA 4Q1BA 5EUMA 5B30A 4WIAA 4HUQB 2O8CB 1HUQA 2IA5A 1J70A 1MO6A 4JVLA 1OB2A 3O8RA 3GFTA 5L8VA 1E4YA 4ZKEA 2GESA 4Q1AA 2ZRNA 5LDDC 5FR1A 1FNMA 2QM7A 1N5LA 2NQ2C 1E96A 1U0LA 5FTNA 2RGEA 2GRJA 1SVWA 4B2IA 1JAHA 1AKEA 1KKMA 2CHGA 3T5GA 2VP2A 4Q7KA 2FU5C 3R9XA 4IEIA 5EE1A 4PPFA 3A37A 3ZVRA 4M0LA 3DMNA 5EZ5A 4EPYA 2IYTA 2ZAMA 4RZ2A 1W4AA 4LPSA 4DCSA 1G5TA 4QFMA 4DSTA 3Q7QA 1SVLA 1XD2B 2RGCA 1RRFA 5IT5A 1E9AA 4LJ9A 2FH5B 2KJQA 4WXRA 1IY1A 1PUIA 3NC0C 4C0KA 4Q18A 1YE8A 1DELA 4TMTA 2ZS7A 5DN6A 2QMOA 4F7WA 4L15A 2PZEA 1T8TA 4OI0A 1P60A 2CNWD 3PUWA 4DDWA 3R8CA 2CXXA 2YNMA 4B32A 2B7BA 2OXCA 3Q85A 4N3NA 4Q9HA 1QZXA 4D0NA 1EFUA 1ZUHA 3K09A 2V1UA 5FBWB 4DDTA 2YVUA 1G1MA 3PVSA 5JSZA 1FQKA 4B74A 4DB4A 3AVWA 1Q22A 1HH4A 1R5NA 2MSCB 1T5LA 2RH5A 3DO6A 3K8YA 5DO9A 4YQFA 1CKEA 3TW4A 5D3MA 3OIYA 1R5OA 4BLOA 2HT1A 1XEXA 4WXPA 2JLUA 2WWXA 4OHVA 1NNEA 1G17A 4US1R 4ZI3A 3KJGA 5TARA 1SVSA 1XTQA 2ZM5A 3VQTA 5F3WB 3LLUA 3EIQA 1DS6A 2FPKA 2WSMA 1Z3IX 3MD0A 1U94A 1VCIA 3LV8A 3ZZUA 1ZJ6A 3EA5A 2ZJAA 4A0GA 4BWYA 2Q9AA 2ZVPX 4JKYA 4EJSC 3EPJA 1RJ9B 2B21A 2IBMA 4G5SA 4EQ6A 2ZSBA 4FCTA 2DR3A 4V0OA 1M1YE 3KXKA 4IDPA 4X8HA 2QL6A 4OQFA 3RS0A 4TZ0A 1KMHA 3R9WA 4I1SA 4NMMA 3BE4A 3BJIC 1DAMA 3KJHA 5CB8A 1G6OA 1I4TD 5DI9A 3U7GA 1SVIA 3EAQA 4EPVA 3L0OA 1N6LA 1Q20A 2CL0X 3KFVA 1UFQA 4Q1CA 4DSOA 4E09A 2DWQA 2OFWA 2IYXA 3T1VA 3A36A 4G5RA 4AY2A 1HEIA 2A30A 2DYKA 2HLDA 3ZQ6A 3ZD6A 2R62A 4Z1MA 4CEHB 4JLVA 5KDLA 2QMEA 3CM0A 1YZUA 5AJZA 1N6IA 2JGNA 1AKYA 3GEHA 2GAOA 4LBWA 1N5KA 1XDBA 4GBMA 4ZPXA 2BHRA 2Q3MA 3JZAA 3NEJA 5CLLA 4IVPA 4GNKA 3K1JA 3GEIA 4WA7A 4PAMA 1Z08A 3MJRA 3AUXA 3CUEF 3H4MA 3PR1A 2J7PD 5IRCD 1NN0A 3U60B 1P2SA 3Q7PA 1U2RA 1F2UB 1Z0KA 3WRYC 3QF7A 3IUYA 3F0TA 4PHFA 5G41A 1MO3A 3K53A 4D4LA 1KK2A 4OQXA 4URXR 1KZ7B 1D9XA 1G9XA 1N0VC 3KQNA 5J40A 1HYQA 3AF2A 4YLGA 4OYHA 1YZKA 1OYYA 4LY6A 1G4AE 1W0JA 2C96A 3KB1A 4A36A 1MT0A 2WIBA 4P31A 3CZPA 1BKDR 3KQKA 3IILA 3NEYA 2ODWA 1I2MA 1E9DA 4Q01A 1W0KA 5JZVA 4PC3A 4I81A 3UXMA 4BFZA 1J8YF 1FMJA 4C7OB 2W6JA 3OEHD 4DB2A 4M1WA 1XD9A 2WMNB 1KMQA 2GZAA 3IPYA 1DAKA 2GXSA 2GF0A 1OFTA 3QNUA 3MRSA 2HEIA 2H1LA 3AVUA 3KKNA 4BZPA 1I2DA 1D9ZA 3AV0B 1TUEA 2Z4RA 1KIMA 4HATA 3K9HA 2OLJA 2V1XA 2FMXA 2FEOA 1Z29A 2BBSA 4OI1A 2W2VA 2FX3A 2V7QD 4JT4A 521PA 1FUKA 2GJAA 4JLMA 3BB4A 4R71A 3TSOA 1MABB 3M4YA 3WRXC 2NO6A 2YJTD 3E2IA 4HLUA 5D3QA 2C98A 4DHEA 2GCOA 4YMSA 5JRJA 1N3BA 3ZD7A 3IQWA 4JYCA 4U5XA 3GLGB 4LCBA 4JLBA 2FPLA 4BRWA 1E2EA 4EFLA 4S35A 3FTQA 4LBVA 4E22A 3ETLA 1FP6A 3EWAA 1TF5A 1VG8A 3CWZA 4OK5A 3X1WA 2WOJA 4IDQA 3TKLA 1ZNZA 5B64A 1XPUA 4TZ6A 2P6UA 4DVGA 1KAGA 3K0AA 2ZVQX 4RD0A 5P21A 2WIAA 4P4SA 3RYTC 1ZM3A 5JS8A 4M1TA 2IWHA 4ACAA 1UKVY 1Z06A 2FFBA 3Q9LA 4OJQA 1IN5A 1CU1A 1N25A 2Q21A 1KO1A 3EC1A 2XXAB 2ZRDA 2GEUA 2IXFA 3O47A 3BH7A 5AJXA 1FTNA 1EGAA 1KDTA 4IXMA 1YZLA 3LX8A 621PA 2O8EB 2NGRA 1AZTA 1SQ5A 2QG6A 2NPFA 3TW8B 1W2HA 1E2MA 2PMKA 3I4LA 3SJBA 4B35A 1N6NA 2Q3HA 1GITA 4MRNA 3U3JA 3VNVA 5TXGA 3V00A 5DNYB 5KSOA 1XXHE 2KB0A 3X1DA 1E0JA 1P9NA 1N2CE 2HXYA 1IBRA 2CNWA 1H8HA 5GJCA 5UKDA 2IS2A 1I4DD 3W9YA 3OHMA 4JT2A 3A1WA 4NTZA 5GADl 1C1YA 5G40A 4B6FA 1GKIA 3FKSA 3HYRA 2IXEA 3EIHA 1E2GA 1O87A 1Q57A 4A9AA 1G3MA 1IXRC 1ZCAA 1ONBA 1ZM2A 5CDFA 4JJKA 5GJVC 3CRW1 2WJVA 3AF0A 1RE0A 2YYZA 4TL8A 1A2KC 2IUSA 3AF4A 4PO1A 5JLJA 2GBLC 4L9WA 1XCMA 1W1WA 1JAIA 1VDZA 1RZ3A 1MH1A 2R6DA 3KFXA 5JHGB 5BWMA 1RRGA 1E1RA 3NKVA 5FTMA 3BK7A 1U8YA 4Q4AB 3LQQA 2J0UA 1NI3A 2ODNA 2HF8A 3MLEA 4HAUA 3G82C 1KGDA 3D8BA 3A4MA 4CEJA 4GSYA 4E03A 3P1JA 2YINC 2WSSA 4NPHA 3GFOA 2FFAA 3A1VA 3GLHA 2FGJA 5SZKB 1Z63A 2WKQA 1XRJA 4NU0A 3KZ1E 3LXRA 4Q4HB 3T34A 5HE8A 1IN6A 4HEJA 2FSIA 1E69A 1FP7A 2FPMA 5JECA 1E9RA 3Q8XB 1OKKA 5DLQC 4PO9A 4B43A 1NBME 4WBSA 4DSUA 3BFVA 3IHLA 1NSFA 4TMZA 2ZSAA 3EZFA 4JLJA 4EKDA 1E0AA 3AVQA 3KKQA 4BFVA 4TTPA 2YKGA 2EVWX 1C9KA 3NHAA 1JPNA 4LYFA 3PV0A 3T1TA 3L8YA 1IOZA 2ASEA 3KQUA 4BEBA 3RHFA 1NMZA 1OXVA 2ZI7A 4PHHA 4TMKA 1HQCA 4IVRA 4XH9B 2ATVA 1D2EA 5FPSA 4JLPA 3IDQA 2F7SA 4GP7A 5DI3B 4HB4A 3ZJYA 5JEEA 2DPXA 3UKDA 2QU8A 2J7KA 4ARZB 4JKIA 5HE9A 2G3YA 3V9PA 2J7PA 5HKKD 1G7SA 2VP6A 2JLRA 5CIQA 3RS3A 2W6ID 5CJ2A 3EA0A 4ZI2A 5JFGA 3LY5A 4CGZA 1EFRD 2AXNA 5LPNA 2C78A 3PQCA 2WWGA 1JI0A 3TAHA 3K0CA 4JVNA 4C0HA 3DPUA 3SJAA 4C2UA 4L4UA 1DG3A 3HP1A 3KKPA 4MRSA 4KAXA 4AWXA 4DSNA 3AF1A 4M9ZA 3NDBB 2VPPA 5JWHA 4AC9A 2BWJA 2W2TA 2VHQA 4AYTA 5EQTA 4AYXA 4BFUA 4IDOA 3SE0A 2ZR0A 2CVFA 1IQPA 1BO6A 3EZ6A 2IF0A 4TQAA 2B6HA 4JL5A 1K5GA 5FOXA 2IYRA 2YZ2A 4CYMA 3KQHA 1TTTA 2HJGA 2IS6A 2GETA 3OFND 4OK3A 3A58B 3TQFA 4DLVA 1WCV1 4Q9JA 3EX7C 4F38A 3THOA 5FL7A 1XZQA 5AJVB 1P3JA 2GVDC 4A6PA 2IS4A 2J5XA 1AIPA 4MA4A 3E1SA 4YMWA 4KITB 3HR8A 3FPAA 3AQ4A 4QL3A 2XSZD 4Z8XA 1KSJA 1CF4A 1EWRA 4Y0AA 4OJKA 2NO7A 1EFTA 4Q02A 3BIFA 3FFBA 3TE6A 3X1ZA 3I8XA 2QAGB 4EPWA 2QUZA 2ORVA 3C4JA 4Q48A 1BS1A 3KXIA 2JAQA 4LHYA 2G88A 1DTSA 4BLQA 2A78A 2ZE6A 1D8TA 3CWQA 3SFVA 2L0XA 1VTKA 2YOHA 4A1FA 5LB4A 2F9LA 2QBYB 2D3WA 1OHHD 3P20A 4IRUB 1R4AA 4WVFA 2BVNA 4CVNA 1U98A 1Q1ZA 1X3SA 1ZU5A 3IEUA 2WM9B 4JYBA 3NWJA 2OXRA 1Z0AA 2ZEJA 3RSLA 4B44A 3GJ3A 1GKYA 1XEWY 4JBYA 3P32A 2FE4A 5JCPA 3VAAA 1U0JA 5HZHA 1NP6A 2QT1A 4PC2A 4QHTA 3SU8A 2JASA 3U44B 3B9PA 5K8TA 5KTYA 1N6KA 1BMFA 4A0HA 4O3MA 1F3OA 1GL7A 1KNXA 3AP1A 1L7VC 4QGGA 5JWRA 1PUJA 2A9KA 5SZJA 2ZS8A 4RKFA 2O0JA 4IEEA 1G20E 4D0LB 5IK2A 4DXAA 1LVGA 2O8FA 2QNRA 3VR6A 2P2LA 2OLKA 2NIPA 5FR2A 2GJSA 1H65A 1Q12A 4EFNA 5FH9A 2KBEA 4A2WA 5F9HA 4JIMA 1KJWA 4KV9A 3LA6A 5KSZA 3PITA 3THXB 1R8QA 2QPOA 2PZGA 4BEJA 2BCGY 1KOFA 4U7DA 4ZO4A 4KHZA 4Z51A 3I92A 1E94E 2QTHA 3NHBA 2QAGC 3G5UA 4M4SA 3SQWA 1VPLA 1SKQA 4HZIA 2PJZA 3BXZA 1EXMA 1QHXA 1RYFA 1KHTA 1TEXA 3ND8A 4A0FA 1S96A 3I32A 5DN6D 2KI5A 4BLRA 4DIEA 2G1JA 2ZIAA 1GDDA 1II8A 2GCNA 1W4RA 1Z0FA 3THWB 3SDZA 1GOTA 3MGCA 4IVQA 1CBUA 1GKUB 4QOSA 4Q00A 4KU4A 4PR0A 4TYPA 3GFPA 3RLFA 3WYGA 1HTWA 3O8BA 2CCJA 1EX7A 4JVMA 4KFRA 4A15A 4DWJA 2EWWA 4GMXA 3FOZA 1DE0A 4FCVA 4G5OA 1EFCA 2PMDA 3QBTA 2WWYA 4M1OA 2QPTA 5DE3A 1ZW6A 3DOEA 4FMCF 3EASA 2RGAA 3RS7A 2QM8A 2P6RA 4TQ9A 5FPTA 3U2QA 4D26A 3FDIA 2IC5A 3ZVMA 4EIWA 2FDCA 1W47A 4HI0E 1XEFA 4C9BA 2YWEA 5CIWA 5FOSA 4DLRA 2C77A 5TY0A 3D7MA 1CJMA 4NONA 1TQ6A 2QI9C 3CRVA 4RFVA 2CLCX 1NMXA 3JVVA 1KI9A 4LBZA 2C8VA 2XJ4A 3UMFA 1E79A 1F5NA 5LD2B 2REXB 1NN5A 4QBIA 1XMIA 1PLJA 2R6GA 2YHSA 3VNUA 2HJVA 4RVCA 3FE2A 1WBBA 1OXUA 3DMDA 4JS0A 1GL6A 1W5SA 3IO3A 5FOTA 5IF9A 4L5BA 1Q3TA 2O8BA 1A5TA 1R8SA 2AX4A 3AB3A 3IGFA 4RD4A 2HLDD 3EARA 1NVXQ 4M1MA 5G53C 1YKSA 2VHCA 4TT3A 4W7SA 4A8JA 4Z1MD 2VL7A 3BORA 4RCZA 3LAWA 4BPBA 3IIJA 2XZPA 5IHPA 4NE2A 1EFRA 3HU1A 1G7CA 1RFLA 5F2EA 2IYWA 3HU2A 4JL6A 5F9FA 2P5SA 1OIXA 1PJRA 1QVRA 1S9HA 4BLPA 2AD5A 4LV6A 2GZHA 3K9NA 4IJMA 4EAQA 3NDPA 2ZI6A 1AS2A 1V5WA 3CIOA 3K0EA 3VKWA 5J4LA 3VKGA 2QPAA 2IYVA 4AG6A 3PUZA 5KDOA 4PPGA 3I1FA 4FD2A 4M9SA 5AWFC 4NL4H 4DIDA 5DGXA 2ZR7A 1CTQA 3PFIA 1FNNA 3GJ8A 4KODA 3GLGE 1UDWA 4O2RA 3TK1A 4B71A 1AA9A 2H8KA 4NDZA 1GVNB 1W0JD 121PA 1Z6YA 1ZC4A 3ZLJA 2GEDA 5EXXA 5FUVA 2E1RA 4LK2A 5JSZB 2ZRBA 4TYNA 1U9IA 4ZDJA 2BEJA 1J99A 2MSDB 1W0KD 5C1BA 2FV8A 1P4SA 1LY1A 1QVAA 1SHZA 1YZQA 2W6JD 3AKYA 3C5CA 4L8GA 5CJPA 5LBIA 2ZRFA 4B3DA 1XEXB 3CNLA 2BJVA 4PHGA 1Z0IA 5DIFA 1G6HA 4QGFA 1M7GA 4Q1FA 5G3ZA 4JSTA 4IFBA 1F6BA 2P67A 2BM0A 4JZKA 3RC8A 1Z6XA 1WBDA 4URVR 1KSFX 2ZRLA 1IY0A 2JATA 4HZUA 5J4VA 4UQOA 3EZ9A 4UNQA 4LJ4A 1RRPA 5ELXA 4OQMA 4ZDIA 3FHTA 1Z6GA 4V02A 3THYA 2PCJA 5JWOA 1IN8A 4ON9A 4D25A 4V0LA 2DFNA 2BKEA 3UANA 4M9XA 2F1HA 4TWZA 2GNOA 2OSBA 2YV5A 4PSAA 1DO2A 1XTSA 1Z22A 2VF8A 2IYUA 1E6CA 2PCLA 1XXHA 2XITA 4XOIA 3SI7A 2JA1A 4O2LA 5HR5A 2CVHA 4AKGA 2MMGA 1PV4A 2DBYA 3TH5A 5C18A 3BC1A 2CMKA 1OW3B 3TNFA 3ZQJA 4W5HA 2J9RA 2GWHA 3GPLA 3PXGA 2VIIA 5JI2E 1ODFA 2AWNA 2BBTA 5H70A 1AQYA 4R7ZA 2MMCA 1WE2A 1ZD1A 2H5EA 3K09C 3CLVA 1S2MA 1T3SA 2ZJOA 2P3SA 4RCYA 3RC3A 2NMVA 4DCTA 3QUSA 4MDFA 4RZUA 3DZ8A 2HXSA 4OQNA 2N42A 5J4KA 3QF4A 4NYMR 1RYHA 3K9LA 1E4VA 2VHUA 4C0QC 4LYAA 1M7BA 2XB2A 4O25A 4GRAA 4IW3B 1SHKA 2QEQA 2REOA 3LBIA 3ZS9A 5JJIA 1W36C 3KKMA 3CRMA 1XTIA 1XEWX 2GF9A 1AS3A 2CE7A 2N1BA 1G64A 3QQ5A 4LHZA 3CH4B 3VR1A 3I73A 4QKQA 3RANA 1WQ1R 4KLNA 4ZCIA 2WZQA 3HYTA 1H8HD 3W5IA 1T0JB 2HV8A 4QC2A 1T3HA 2GDJA 3C8UA 2XTNA 4OHYA 5B57C 4OI2A 3FKSD 1SXJA 4I1UA 1WRBA 4OHZA 1NN1A 3L43A 4MGKR 1SVOA 1YR7A 3SYKA 3ZZ0A 1GG2A 2PBRA 4BUJA 2QZ4A 2HYIC 3GEEA 3MUFA 4PZZA 1AS0A 1XMJA 2F3RA 1IJEA 1IXZA 1NKTA 5HTKA 4IHQA 3OEEA 1FQJA 3TQCA 4FI3C 4MGIR 4D81A 5HZKA 1G3RA 3BOSA 4LC1A 3ICQB 3SJZA 1G16A 3BD9A 3ZYCA 1DPFA 1OFUX 1E1RD 4P4UA 1S1CA 2D2FA 4NH0A 3U5ZB 3C7KA 2Z83A 4P4TA 1Z28A 4KFUA 3TVTA 1T91A 4KJZA 1K5DA 4PTLA 1MO5A 1ZM9A 4WOPA 2WSSD 4WZ6A 2GAAA 5EP2A 3SBEA 2OILA 4B3GA 4WZBE 3GLFA 4AKEA 2R9VA 2V3CC 2ZQ5A 5L3SA 3OAAA 4HAZA 5JCZA 1XZPA 1T9HA 1OKKD 1JXOA 2IUTA 2WHXA 4UNPA 4QBFA 1NLZA 4TL9A 4KBFA 2FSFA 2J59A 2DWPA 1Z6AA 3BH6A 4M1YA 5CM8B 5SZHB 821PA 1EG7A 1GFIA 1U0HC 1Z8FA 3QY0A 2LCFA 2ZJ2A 3BB1A 4HUQA 2YWGA 2XTMA 1Z07A 3FMIA 2R6FA 4YONB 1V43A 4ZCLA 4B76A 2H92A 1MOZA 1KK3A 4D2IA 2BMEA 1B0UA 2QN6A 1ZRHA 5L3RA 4URUR 2GJ8A 1IONA 4ESHA 2EFEB 2WWHA 3AP3A 3K9GA 3PIRA 2FFQA 2IYYA 1XJCA 1U90A 2GHIA 3B2EA 5E4FA 4ZCMA 5AUPB 5EE5B 2PZFA 1LB1B 4NZYA 2ZANA 5FL3A 3DM9B 1CLUA 4C2TA 4J0QA 3LBHA 1TU3A 4EJSA 5FI0B 1UKYA 3JVUA 4P3YA 1W7AA 5BN4A 1N5IA 2ORWA 5AK0A 3TMKA 1RRCA 3SZRA 2ZUBA 1DVRA 1L2TA 1NSTA 2QP9X 2Z43A 2XZLA 1QHIA 2FN4A 4PZYA 3SNHA 3FWYA 1N5JA 1QHHB 2B8WA 2OT3B 2REBA 2UZIR 2GKSA 1Q3HA 2Q9CA 3KJIA 3LNCA 5HCIA 5EUQB 1XB2A 2OUKA 2ZRMA 1NVVR 2ERXA 2KSQA 3B60A 1QDEA 1CRPA 3QKSB 2VBCA 5FL7D 5FI1B 4RFSA 1G3QA 2H57A 4F4IA 4NP6A 1OE0A 4B3BA 5AJWA 1E2IA 2DWOA 2J1LA 2V54A 3DKPA 4MUBA 1II0A 4GZLA 4Q9KA 4CEJB 2KE5A 1S3GA 3RS4A 3SBDA 1ZYUA 2VQSA 4G5QA 1VIAA 2C03A 4BGDA 1G291 1NVUQ 3GLHB 4OK6A 4UJ5A 2AK3A 1JJ7A 1OH8A 4TQUS 4Q1EA 2B7CA 2JCSA 2BMDA 1HURA 2HF9A 3SJCA 4S2EA 4BFYA 1OYWA 1N6HA 1Q21A 2C9OA 3L8ZA 3LXXA 4MRRA 5BN3A
chains in the Genus database with same CATH superfamily
2JCBA 4IXWA 1D1QA 1RWOA 4MK4A 4NS4A 3K16A 2EGUA 2CHQA 3UQYS 1L3IA 4BKPA 1AGXA 2RBEA 1VGQA 3C4VA 3UMGA 2IT1A 4ABYA 5HKBA 4OI4A 1K06A 3FETA 2FR8A 1XTUA 2J6IA 2OK7A 3T0GA 1B8OA 2WHQA 3ZU2A 3QEBZ 2RHOA 3ZE2B 2DHRA 3BJZA 4HEHA 4UBLA 4COOA 3PRKE 1Z7BA 5A2QA 4DQKA 1ULZA 1WCYA 2YIVX 3M5CA 4TV8B 2XF2A 5TVKA 2AJ8A 3FSJX 3N5KA 3PC6A 5EIFA 2WQZA 2XEXA 1P3Y1 3EFOB 4CMIA 4B6OA 5CYOA 3U39A 1RTKA 3EW9A 1SXPA 2ZWVA 4EB6B 3TLYA 3DZDA 4F2GA 1RLTA 3GFVA 1CE8B 3K30A 1I32A 2A3RA 3P9RA 1CWUA 1LVHA 1JDBC 4CMBA 1TJPB 1QUEA 3G2PA 4MEAA 4OMDA 5K8UA 4FIZA 4RK4A 1QGZA 1P74A 1DEXA 1K7FB 5ELMA 3R6DA 4CIYA 4KO4S 4YQZA 1PEKE 1L7OA 3COPA 1HYHA 3AINA 3HNOA 2DVMA 4I5DA 4JHLA 3SEZA 3H5RA 3QUTA 3IAHA 5K3CA 1UBSB 4BLWA 1IWPB 1XTTA 3ESQA 3I2JA 1ZSYA 2H07A 2VH1A 4JP5A 3UKJA 4N7MA 5C2JB 3A9CA 5CK5A 5KHLB 1UP7A 3MJCA 3EDCA 2QJFA 1GPYA 3MJHA 3UQZA 3R0VA 4YV7A 4F86A 5EWJA 1KU6A 1SZCA 2WV9A 4HGQA 2RKWA 4R41A 2C1EA 3S28A 3A1TA 3KOXA 2H5LA 3FJYA 1NZDA 2D2EA 2JHPA 4G5YA 4BDSA 1DTWB 3OQHA 4YUXA 4WEOA 1QE5A 1NJFA 3AF5A 3EXFA 4HHEA 4YRRA 1XAHA 5DNDA 2DT8A 1KYIA 4MXDA 3C15C 5C4MA 2UYOA 4MHTA 4KO3S 2JIPA 5T4EA 2JBHA 3QOXA 2AFHB 1TPZA 5GMOA 1FY2A 1SKAA 1RZUA 5ILQA 2BP7B 5FOQA 3OPYB 5CB4B 2IWRA 4EKNB 1T1RA 3RC9A 2C99A 2FQ1A 1JRLA 1QH8B 3PVCA 1ZCFA 3O73A 4FXPA 5B7GA 5EKSA 1FRNA 1NQXA 3RGWS 5E9JA 4F04A 3AEYA 4W1RA 1FUEA 1HFKA 3FZQA 1QJ4A 1SQSA 4QO8A 2IZ7A 1A9PA 3TYXA 5C8ZA 3I58A 4MUHA 1VRWA 3KQWA 4DIOA 3M1YA 1NN3A 4B5LA 4TV9B 5LQNA 1D2AA 3M3DA 1Z9BA 3IQDB 4F3RA 4I1VA 3RRNA 4RH3A 5EY5B 4RA9B 2CKMA 1Z47A 2Y1LA 2BHNA 4N7JA 2IHJA 5KHOC 1I3MA 3BERA 3GRUA 2M6KA 3EDQA 5ECWA 3WRWA 5HBGA 1P3DA 3VH1A 4OP2A 5HZGA 3U4GA 3NRBA 1I1OA 2ZETA 4OHKA 1C7EA 2AYZA 5AJUA 4IH9A 1H0KA 4WCVA 3JATA 1GZ4A 4NEHB 5H02A 1HG1A 3NV9A 5IJZA 3HP7A 3QU9A 1YB5A 2AW3A 5E7MA 5C37A 2NT3A 5A4IS 3KSDO 4NARA 3GLVA 4MW6A 3VX4A 4RZXA 2HLNA 3VU1A 1M1ZA 4EK9A 5KPJA 1KFKB 3ROGA 1EFKA 4Y1FA 4BMYA 2GJKA 1M0SA 1UXKA 1W2GA 1WZCA 2ZJ0A 4WKBA 2EF0A 4P0TA 1SFRA 4P5DA 5DSZA 1SIBE 1Y6JA 3SIWA 3VH4A 4D4KA 4EHAA 4N9WA 2O2EA 4HAXA 1G5FA 2L19A 1LPMA 3ZWBA 3NANA 2CDNA 3REQB 3W6NA 4BS9A 4LJRA 1JQJC 1E7QA 4OSOA 5KJCA 4IMIB 1AKRA 2W2XA 3FCAA 4XVQA 4B3TB 3PJGA 4MYTA 3KQPA 2LZ0A 5EYPB 2H6EA 4FILA 3CRQA 3EIFA 5KYXA 3GMTA 3E2PA 1NKSA 2QE7A 2ZU6A 1I6MA 3PQ6A 3EWNA 4X90A 3SE7A 5GWXA 2D1TA 4D99A 2JPDA 3BWBA 3SVZA 3UHJA 2NUTB 5IXSA 3ZS8A 4HVAA 3OM0A 1E3SA 2F1RA 3V4VB 1IK4A 3STTA 1KI2A 4CFYA 4M8IA 3KHSA 2H2DA 1RLIA 2XB9A 2PUDA 2X7JA 3SG0A 1Y9AA 2CDRA 3TD9A 4D0GA 3SGLA 1HX7A 1O8CA 1BHJA 4MMXB 4BRZA 4IAOA 5F3DA 1LDNA 3M9WA 1Q50A 1OI7A 2VRBA 1A4IA 3GD5A 2BV3A 3O8OB 4AN4A 2FUNB 2VAXA 2Q6VA 4RVNA 4G24A 1CUJA 4JHXA 1O6GA 3H9EO 5IAEA 5AH0A 2IY7A 3N5CA 4IIYA 3DYIA 3MK31 5K51A 3Q3JB 2EGHA 5J5VA 2KPOA 2XV1A 4KX3A 2AC4A 2R7MA 2WB2A 4QAJA 3LGSA 3G2JA 2QW0X 4HQ0A 2CL7X 3EUFA 2GLUA 3E35A 4NECA 4BFWA 4KHPB 2QVBA 3I28A 1BKYA 4P08A 2QROA 3LFHA 2WT9A 3BGOS 3GGDA 4EHLA 2IS1A 2R48A 1UANA 4KCGA 4NF2A 3BHIA 1JBKA 1R3DA 1FK8A 3PGKA 1E9CA 2PKQP 3E23A 4MW7A 2AJTA 3FMGA 4OBEA 4EHKA 1U2EA 4YXFA 1CDEA 3KVYA 5FRDA 2DSNA 3PEVA 1LDMA 1CP2A 1MTOA 1NOJA 1QHYA 4N82A 3ED1A 3ZWPA 1LEHA 4EUFA 3NBAA 4B6JA 2VDQB 4NCXA 4RFLA 4OA8A 2LV8A 4DUGA 1T5BA 4EW3A 2DXIA 1L5OA 3RASA 3KUCA 1IJFA 2W6MA 2AN9A 3HY4A 3Q9UA 4CG1A 2FK7A 3ZD8A 4R1PA 2PL1A 3A9TA 1THTA 3KHUA 1XAGA 3S2FA 1MNQA 4EO7A 4F96A 5FTLA 4I5GA 3LG2A 4OEHA 4DBLC 4CEIA 3I2HA 4I3GA 1KO5A 1L4BA 1WL8A 5JJKA 4BNTA 2FKNA 2QSJA 1SO8A 2ZRIA 2JRLA 2OCAA 1XRRA 3ZVNA 2ZI4A 2TMYA 1TNDA 3FMPB 1ELOA 2JFZA 4BGVA 2PJRA 5GPBA 1C1HA 1UK7A 2CUZA 4MPPA 1RXIA 3L18A 2BUBA 3SQNA 1G1AA 4YCNA 3WYBA 4G8BA 5K2MA 3A4LA 3OOHA 4ZYTA 1AZSC 5F98A 1UCFA 1H2XA 1J49A 2WWTA 4JELA 4J3JA 3CR7A 4Q1DA 1KP9A 3L7LA 2DOKA 4AKIA 2B8TA 3HADA 1F3LA 1WXIA 2JAXA 5FPYA 2C20A 2OZPA 3D2AA 4FC6A 5FLXA 3KR2A 4A4DA 4JGBA 2COEA 1ZW1A 2AR7A 2QLFA 3RG8A 1RQGA 3HCOA 4MPDA 1ABBA 2VTDA 2DFLA 1NV8A 3AERB 3DP9A 5ENZA 4JYPA 1H2ZA 4ZDKA 4CTNA 5LVAA 4PCLA 3VFDA 2ONKA 5L4NA 3TFOA 2DFKB 3WISA 2VA8A 3CF6R 2PKXA 2X4DA 1W85B 3OPYI 1ZCZA 5DPMA 3BMOB 4F91B 1AKTA 3KT0A 2WC1A 1RYDA 4RJIA 4QYWA 3I12A 2XA2A 3DWFA 3LIPA 3HCBA 4MKIA 1N6RA 4HDAA 1X80B 4CMAA 1UT5A 2RHGB 1TC2A 5C34B 4AY4A 2FWNA 5CT8A 1R0ZA 2HMSA 2PU5A 4FS3A 4UAGA 1VE1A 4Z7QB 2VG8A 1GNTA 3P9KA 1COWA 2YVKA 3MHPA 2VR1A 3GOQA 4RETA 5K8IA 2BKXA 2XNHA 4FU0A 4B33A 2ZE8A 2A9VA 5LU8A 1XA3A 4JSYA 4N5NA 4X24A 4XSHA 4ZCTA 3N1UA 1XDWA 4G1UC 4XTCS 4FBLA 1CUBA 1X87A 4KSBA 2JH9A 2VDJA 4JQOA 4LZZA 1OVMA 3FWKA 1RKXA 2EU8A 5F64A 5ALDA 4G01B 2OQIA 1UIRA 2GPSA 2KW5A 2FMKA 3ZWKA 4EY8A 2OOKA 3P2KA 4A8JC 4YMIA 5KWEA 2NZWA 4INOA 5ALQA 1LX6A 1KI4A 2K7ZA 4YS6A 2VH5R 4CBVA 2V03A 3CNEA 1LU9A 5HCNA 3NP7A 3E3LA 1A7JA 3DCJA 4O08A 4WJZA 4W9RA 1RYBA 2GHTA 1Z4OA 3FZYA 1KEEB 2NYUA 3HJUA 5L3ZA 1HEYA 5AXAA 3N7AA 4YUYA 2Q41A 5CLGA 2FPPB 4MQ6A 1P0PA 1ZLXA 3ESXA 3ANNA 1YR9A 2R86A 1W48A 3M1AA 4MR7A 2GK6A 1TCAA 4IIFA 5G0WA 2WJYA 5CGZA 3JALB 5A5EA 5JAOA 1G5PA 2IYNA 3HNPA 1DEKA 3OAAD 1TKRA 2YOGA 3GDOA 3PJEA 3ZWYA 3MTDA 4FBGA 3CO0S 1KYQA 3BHNA 5FEUA 2ZIWB 1YU9A 3GRFA 1I7NA 3EIXA 2AUMA 4WFQA 2BH9A 4EI7A 3JU3A 1E18A 4PFKA 2GNAA 3UUGA 2I87A 2XT0A 5HMMA 4HWKA 1YGYA 1NG9A 3A6PC 2PYZA 1BX3A 3ILVA 4HDKB 4XDGA 3PEWA 2JKZA 2OCBA 4DFDA 3BA1A 4HEA6 2MT9A 2W0SA 2YWJA 4MB6A 1MW9X 3HXLA 4QPNA 2ZU0C 3QU7A 3SHOA 3OWOA 4TT8A 5HQTA 3TLMA 2DFPA 1ZICA 4CLDA 3F97A 2QQ0A 4KQIA 1XOIA 3WHKA 3PKIA 4JR2A 4MH0R 4RPCA 4W9NC 1WJGA 4EYQA 3N9IA 1NWHA 1DOAA 2IH4A 4OLAA 2KX7A 4OL9A 1VKHA 4EUSA 1J0XO 2JFGA 4CMKA 5EKXA 4WL0A 5D7BA 3R7WA 2VLBA 4XI9A 3C16C 4J7XA 4W7IA 4QU8A 3ZCTA 4HNVA 3N0TA 3GNQA 1NF3A 4P5PA 4RABA 5JS2A 3MTJA 1P7VA 3CE6A 2JGLA 4MW5A 3STXA 4Y2QA 2OEPA 3CLUD 3OT1A 4AMVA 5JZOA 1IG3A 2YZ7A 1ZCBA 4IJKA 4WINA 5LLDA 4GLLA 2OAP1 3I04A 3GYGA 4K9LA 2XDYA 3T06B 3LP5A 3U80A 1I4WA 4XWOA 1VA5A 2B61A 3Q8LA 3AXTA 4F06A 1ND5A 3UOGA 3MTQA 1WX1A 4PX2A 1Q7EA 4GR4A 4II3A 3LQFA 3OJLA 5KYGA 1MJ5A 1QOPB 1JGTA 4JB0A 2M1XA 3OE7A 3SM9A 4KJXA 3L46A 4LMBA 3QRWA 3NBZC 2QRZA 1R00A 3ZGVA 1MV8A 4AROA 1OLXA 4JLOA 2VF5X 5AHXA 4UVGA 4DCNA 2Y77A 1PL0A 1D2HA 1R9NA 3OG9A 3C3DA 3PDCA 3C3CA 3JD4A 4ZIRA 2CSUA 3FNIA 3GQVA 3ORFA 2LNDA 2YHUA 1HLGA 2BFEA 3CLRC 3LPCA 3SHFA 3UK6A 1LW7A 4OGKA 4YWJA 3KEMA 4K03A 5BW8A 3HZZA 4ZEVA 3I9JA 1G0NA 3WOVA 3BGDA 4DNPA 5AVYA 2C2YA 5JCXA 5LP1A 1SUAA 2JVJA 3DZGA 3KALA 4NMLA 3L49A 2X8BA 1YMQA 1SKYB 4A7PA 1SELA 2HA6A 3ERCA 5KNBA 3GJXC 2PUHA 2YY7A 2ZB8A 5AVOA 3ZQUA 2O0KA 2QNIA 4YT4A 4Y6OA 7ADHA 3KCQA 2DC1A 3WWPA 4BO4A 3IEMA 1NKVA 1QK5A 1ZQ9A 1OBFO 1UBJS 2VSYA 4H1HA 2WRZA 4NU6A 3KB2A 5E38A 4DMCA 5ANRB 1LLFA 4PAWA 4M36A 2DERA 2Z6UA 2E6KA 2OBMA 2BBOA 5J2TA 2H7XA 4HQNA 5IASA 4R0NA 4ZC8A 1VSUA 4QDTA 5GONB 2OAQ1 3OZCA 1JDSA 2PXAA 4I6JA 1FW6A 2G83A 2ZSUA 3AR7A 1V9SA 2YC2C 1K3TA 3NQ41 1WD5A 5KYUB 3Q3GE 3VOTA 2OVBA 1T2EA 3HUTA 3AJDA 2OTCA 2AC2A 4DWVA 5CFZA 3DE5X 5LDGA 5IKPA 2OZKA 3TZBA 4TVSA 10MHA 1JEOA 1JR3D 1QCYA 3AYXB 3C3YA 3R7NA 3ILXA 4XQEA 1NT2A 3IBCA 4HYTA 1U0FA 4HLQB 2WM8A 3AJEA 1KMCA 1TM1E 2YNMC 5DIZA 3UJAA 2X0DA 3V2HA 4EG1A 5A1TA 3DS8A 2W83A 1GARA 3EIOA 4MVCA 1NBOA 4JITA 5A9SA 3H4IA 4U8GA 3PFHA 4I1PA 2ORED 3WLTA 3DEFA 5H83A 1G8PA 4J7CA 1K75A 4B0PA 3DOOA 4DR4B 1GFWA 1Q1BA 1NJGA 2A4KA 2Q29A 1IBSA 1W46A 4GEKA 4J49A 4MP3A 4TLDA 5D87A 3TEFA 2IOHA 5E2IA 3SZOA 3DTVD 5CB0A 3HM2A 4U6NA 4P4LA 5MN6A 1DUIA 1WV0A 2O3RA 4X3PA 2YIJA 3ZE1B 4MI3A 5E7IA 5L3QA 3T1NA 5DYGA 3G8CA 3CVXA 1VHDA 1YMUA 3SSMA 2ZIXB 3WIBA 3CKMA 2WFAA 4J0FA 5JEDA 1ZOIA 3WGOA 1DADA 3ESCA 5CDYA 3DKRA 1F48A 2AHOA 2PGLA 1KF0A 3JQ7A 4P32A 2QAIA 3L41A 3TI9A 2K4MA 3FPFA 3OY2A 3O3MB 4C0JA 3DHVA 2ZJZA 1MR3F 1O6BA 1TT7A 1YRQA 2JA2A 4FJ2A 4V2UA 4ZO6A 1U7UA 2F43A 1HLPA 3FNBA 3FPSA 4FEEA 4XQ9A 3H9QA 5GP1A 5SICE 3KUXA 1RQ7A 3HRKA 3O3NB 3ZVLA 2JIOA 4DLBA 3V8RA 4W7HA 3G79A 3V1UA 2C00A 2QLJA 2FZCA 3KQLA 4C7MA 3G7NA 2PRYA 3K31A 3NHSA 1FFDA 1RXEA 2I2CA 2XB4A 3NASA 4RFSB 1Y42X 2AT1A 3ZGOA 4BX9A 1AGRA 2JJ2A 3RRZA 3W5VA 1YJ5A 4LWQA 3AHGA 4LJSA 2DECA 2R7AA 4C4XA 4E0BA 4D0SA 2HTEA 2GFIA 1WPGA 5JSUA 1H1LA 1PO7A 1COZA 2WWFA 3N0WA 3O75A 3P2JA 4O0MA 3F71A 4WN3A 5ALTA 3H18A 5J2TF 4BMDA 4UCXA 4RVUA 3GBVA 4WNAB 2JZCA 3OEYA 4R8MA 5AOAA 1MQ9A 5EJGA 3F5DA 4L4RA 2E4VA 3P96A 1EHYA 3EH2A 2VSXA 3CUVA 2AW5A 3LPAA 3QOFA 2CNLA 4PHTA 2C4WA 1E6LA 1F06A 3IAM1 4NY1A 5TV2A 1ZAYA 3C4QA 2R65A 4Q19A 1YI8A 1L4EA 1UDBA 2V98A 4ZMSA 1MV5A 1UADA 3PE6A 4GHWA 4DC0A 4H3KB 4QUEA 3ULKA 5KTPA 3GDFA 1E4EA 1GADO 1MEOA 2NTJA 3SZGA 1F4LA 4RZ3A 3LY8A 1GY8A 2BGLA 3UGQA 3GBPA 1FFCA 4WFIA 5ALKA 4W9MC 1R16A 2D1YA 3AOEA 4JB8A 3ZKWB 2A1IA 3I53A 2O8CA 2IUUA 4MIOA 5I9BA 4EGAA 1CQIB 1TA0A 3EVDA 3O91A 3OIGA 2I62A 4YWHA 2H4FA 1FUUA 3EQ6A 3D8HA 5KSPA 5JZMA 2OPBA 1GTZA 3JQPA 2XNDD 3ESBA 5AI6A 1Q0SA 4KXYA 1VL2A 3LUFA 3FDZA 1DXHA 1R6TA 3OCYA 4YJ2F 5IDVA 3VJMA 4EG6A 4F5WA 4Q47A 3DCNA 3ADBA 3DTVB 5EZYB 3ZDRA 3OU7A 4WCFB 2C7OA 5C8DA 1E7MA 4FC7A 5K0LA 1NONA 3WMGA 3HKCA 5FWDA 2CVPA 3WMRA 2COKA 4BVEA 4HYEA 2Y1WA 1GZ6A 3IOCA 4OQLA 4QECA 4ILEA 3FDXA 2NO9A 3L0PA 4IFTA 3DMPA 1TU4A 2L2QA 1W35A 2CLLB 2YHAA 3BH0A 4DQUA 4Z4CA 5C35A 2JFOA 2JBAB 4PGMA 3ONVA 1FMLA 4A0SA 2OWEA 5A2GA 1Y82A 3VOSA 1Q95A 5AOCA 5ICGA 1YKGA 3CGWA 1DAFA 3F7TA 2OXFA 2B36A 3FCXA 1CK4A 3WK8A 4D8XA 2VPXA 1DSSG 2ZB2A 1DBIA 2VUIB 4XPZA 3W6UA 2G7MC 1JLMA 1JZSA 1T8WA 2WF6A 3N0XA 4S12A 4BJ5A 4TVOA 1RWMA 2EXXA 2XB8A 4EITA 1DXQA 3GO4A 1BCSA 2IPAB 3I04M 1SC1A 1JIUA 2H3HA 4U6SA 4Z8YA 3FOEC 2MINA 2FCRA 2Q4TA 4FFMA 2OYCA 2IU3A 1C4KA 4W1PA 1J0CA 1N7GA 5DCYA 1V3UA 4PVDA 1THZA 1L8QA 3IXMA 3TXYA 1SG0A 4FE7A 5EG5A 2OBBA 3MWGA 1KARA 4WW0A 4JFRA 3CBQA 1SOAA 3KL4A 3TAUA 3FFAA 4NATA 4PYJA 1GM5A 3A1EA 2FFHA 4UHCA 2DB3A 4TLLB 4LGMA 3KLNA 1XF1A 5CYPA 2C4MA 5K9ZA 2I3AA 2E21A 1USVA 1GUBA 2NTNA 5EL0A 5LB2A 3IIMA 4QUIA 3RAGA 1JSXA 2X7HA 2UZAA 4IJUA 4KIJA 4RADA 3RVNA 4PZUA 3T7EA 3WB9A 3ZDBA 3ZGXA 4Z4GA 1UINA 1VC2A 2N1MA 1OAOA 1S6YA 3WNVA 3S2ZA 4DJDC 1TJNA 3C3EA 5KYWB 2CUNA 4GYYA 1DJNA 3I8SA 3VBCA 2QGNA 5D51S 3OIVA 5CM9C 2IEYA 3D1VA 3EF3A 1T43A 1W4LA 1XP8A 4MUAA 1XKLA 2GYVA 1E9VA 4ZANA 3R75A 4ZOLF 3ONWA 4REMA 1AA6A 2IZ0A 3O95A 3LDGA 1B0PA 3VHQA 4HB2A 1U81A 1YOVB 5B2ZA 3QXJA 1WSDA 3D0RA 4KFSA 3TW8B 4E7OA 1U0GA 2QJWA 1MHTA 4GW3A 1EMDA 1WDMA 5K2OA 1OX5A 2DWUA 5TIIA 4HRXA 2M6LA 3TTVA 3W2FA 4R2HA 3QU5A 4XWAA 3GDWA 3WL6A 1Q11A 1PD0A 3B1VA 3Q7TA 3NIDB 4L9RA 4RPHA 2ZUUA 4JDUA 5AK5A 4BLSA 5C8YB 7AT1A 3A9SA 1E2UA 3K9QO 4OLBA 2IODA 3IB3A 3PPWA 3MHTA 1N2GA 1CJSA 2EZ8A 3GFQA 5ADVA 3CSUA 3AI7A 4XW2A 3RF7A 3C5EA 1YJAA 2PWBA 2RMKA 1FFBA 2ABWA 3LDAA 3EXIA 3W8FA 4AG5A 4NZNA 4AP6A 4YV2A 4US2R 2C2WA 3I30X 4DV3B 5LIRA 5EMMA 3QEJA 2HADA 4AUKA 2JIDA 3S7TA 2GFQA 3X1YA 1RKBA 5T4FA 2G04A 2AMYA 2G0TA 4WX2B 3GNSA 1RM5A 2AWOA 2D00A 2QRQA 4GPD1 5F5XA 2NG1A 2XVYA 1RPJA 1XCLA 5M34A 2ISSD 3GPIA 3MLBA 4L22A 5TQ2B 3LUGA 4Z4QA 3F8TA 1ZGZA 1ZGHA 4JJ7A 1KKLA 1C1DA 4KW7A 1GUAA 1VG9B 4BE7B 4Z0HO 4FEYA 2FOIA 4NQZA 4RD1A 1UF9A 3PF9A 3W3AD 3NFRA 2D5BA 3WSWA 1F2UA 4ZVLA 3HKEA 5FB3A 3QJYA 5F1YA 3SLKA 1DDGA 4GFDA 5B5SA 4MWBA 4HQFA 2J3IA 2P3LA 3G13A 5ALUA 1GGKA 3MT9A 1CUXA 2G0NA 2XZTA 3F7NA 1L4UA 1MB4A 4Y2PA 4IG9A 5CD1A 3BBLA 1SXHA 2V6GA 3G68A 1ZD9A 3R7SA 4UFNA 1GTJ1 4C7JA 2WJIA 1B4DA 1QDLB 2B1GA 4ZHSA 1ONNA 4HB0A 1RHRA 3MG9A 3NTVA 4K88A 8ABPA 3AR3A 2QAJA 4PEVA 3AY7A 4J6EA 5T7BA 1P75A 5G3YA 3ZIAD 4C4YA 2N46A 4DIMA 1D5CA 4FCWA 3L1HA 3I6ZA 3VR5D 1GZVA 3TDMA 4X64B 4ZAVA 2W8BA 1Z26A 1WQ4A 1PCXA 1X6VA 3M4NA 2PGXA 1M34E 3QX8A 2AG1A 3ROQA 1N2HA 3K70C 3RAEC 5C32A 2NXEA 3T0FA 1UZMA 2A1TS 3T5CA 4BO3A 1JTVA 3GVPA 4L0DA 5I3CA 5I9LA 3WA7A 4G9EA 2ZI5A 3LSTA 4IMJB 4MWZA 2QRHA 4ZWNA 4QEDA 4ZT3A 4RVFA 1BE1A 1R7RA 4WGFA 4H4EA 5M5BA 4RMIA 1RACA 1L7RA 1YBFA 3U6KA 4XUGB 5J58A 2NV0A 4FMCB 3QKRB 1NULA 5CFNA 3DXXA 3L0IB 4Z2AA 3A9WA 3G5MA 1KMNA 2BGGA 1OFIA 1BCRB 3ICVA 1FLVA 1MHPA 1PR3A 1V16A 2JK1A 4HDRA 3MRVA 5G4KB 2QD4A 3JQ6A 3LDUA 1PFVA 2CY0A 4M8LA 2B1QA 2C92A 4DGQA 1RI2A 3MB8A 2I8LA 2B2CA 3NHLA 4PU0A 3WLQA 2HCJB 3W9SA 3Q6MA 5TPZD 2Y1DA 1I7SB 1SXJE 1US8B 4UU7A 4YXWD 4TM7A 2CC2A 3RABA 4KZKA 1IJBA 1T2NA 2XDQA 3TUIC 4LNUB 1G38A 2O8FB 3BMNA 4US0R 1Z7YA 3AM5A 3GNTA 3TUZC 3WGIA 4MQLA 1QYWA 3AW8A 3JQDA 2P4EA 3MM4A 4GXNA 1XHFA 3Q2KA 5HS4A 4I9FA 3TUJC 3HFJA 2W70A 1Z6ZA 2EWMA 2TSYB 3CX8A 3UO8B 4EUHA 1JT9A 4MVJE 1ECFA 1MH9A 1W4CA 1SCQA 3QITA 3P0EA 3EH1A 3DUFB 2DH5A 3DG9A 4B73A 1PWZA 2X2FA 1SR8A 1T6YA 3Q3EA 3AYZB 2VS1A 2WF7A 4H31A 1YCHA 1WCIA 3O4RA 4OXIA 3ESAA 4TKMA 3BS4A 4J7UA 4TS9A 4AXBA 2XXAA 1PFWA 4IQGA 3AFHA 2FJPA 4TMVA 3U4HA 3FGNA 1Z8DA 2P9FA 4PX5A 1M1NA 3PR3A 3PT5A 4M21A 5CDHA 1CNFA 2PGIA 4PO8A 1P4JA 4MSUA 1QH9A 1I0ZA 2FQWA 4BNYA 3GLFE 5ARCA 1QPBA 4F46A 4HH1A 4DXHA 2JIZD 1SU8A 1E9BA 1V1MA 2P4HX 2Q5OA 3H2YA 3USCS 4D3DA 5GINE 4KR2A 1JR6A 4HUJA 1HV8A 4I66A 1GD1O 4RQAA 1SVMA 1GQOA 3E7FA 1HQKA 1PQPA 3OEWA 3Q2OA 3S1AB 4OHXA 5AUQA 1MB9A 2NU9A 1M83A 2CJWB 4NFHA 4QX6A 3TTWA 5REQA 4D3SA 1Y5RA 2FUEA 3GZTB 3MWDB 3VUEA 4FK8A 4B31A 4C4PA 5GTDA 2VCHA 4YQYA 2YZNA 4RD3A 1T1JA 3BGWA 5HUHA 4UAVA 1TJYA 2Q5EA 1OGIA 4LF4B 4ND7A 3A7EA 1TO2E 1DAOA 2PA3A 2ZRPA 1K6JA 2N9UA 3HPRA 2DLDA 2C59A 4PLGA 2EIXA 1N5RA 1PEAA 2YQ5A 2IXAA 2H3EA 3ITDA 1ZM7A 3KDPA 2PZAA 2ALJA 5C3UA 4O2BA 5DW0A 3WL4A 2QL7A 1F2TB 1Q1NA 3KO8A 4LYHA 2XQIA 2HH9A 3ITNA 4KQ2A 2YS6A 2OC4A 2ZSEA 3F2VA 4IIEA 5P8WA 3IAS1 4EHNA 2QRNA 3HY6A 3RKSA 4K6HA 5CH3A 1TLLA 3RK1A 3TI7A 5C9ZA 4YRAA 2R0QC 3REFA 3W3ZB 4ARVA 1T1SA 2EW1A 4DY4A 5F7XA 4AQYB 5FF9A 1LSSA 1PIWA 3LT1A 2E2WA 4HYYA 1Y8QB 4E07A 2Q5HA 4IOKA 3GROA 5AK6A 5FTJA 4AW9A 4QOFA 4DRYA 5ILOA 4YO8A 3TLXA 4IJWA 4B3XA 3DCYA 1PVVA 3RM3A 2CXHA 1ZJZA 4JOSA 4MQFB 4Q4HA 5B3KA 4CMHA 1ZN2A 1BJTA 4BMNA 1ZQ1A 4CM5A 1T9ZA 2YJ6A 2YS7A 2J85A 3M6AA 2P9BA 3JRWA 3KTAA 2AN4A 1Z75A 1H4VB 1E2NA 4IDEA 3F49S 4J75A 1P1FA 3PI6A 5LYJA 3V7UA 2GD1O 4B6PA 3HJBA 1GGFA 2PAAA 3EPRA 3IVAA 4CV2A 2XT9A 1ADBA 1CJBA 4DNFA 3ZNQA 1NIJA 5ALSA 5LOVF 1XVLA 3AZQA 4HWSA 1KPGA 3DAPA 5A0VA 3M8KA 4TLAA 3D6JA 4HZGA 2OBLA 2WJPA 2WZBA 4P1ZA 4XFKA 2E37A 3AGPA 4N65A 3RTEA 3ZU3A 1VCNA 3SS8A 3LJKA 2FZGA 3QA3E 3SKVA 1JEDA 1LC3A 3FMOB 4UNSA 2X4LA 2V7BA 3KKLA 3ONEA 3MLAA 4DV4B 3SX2A 2V55B 1KQFA 5DK4A 1N8NA 3BTVA 5SY9A 2ZJ5A 2VT6A 1MIOA 2GZRA 3CX6A 2ZIUB 4FYWA 4ARCA 1SPBS 2JLVA 5FOWA 1NVTA 1HEUA 2VYNA 3HA3A 3JD0A 3UT0A 4TRJA 1UH5A 2EKLA 1GNSA 2G28A 2UV8A 3WMWA 4BO8A 5DMXA 1I3KA 4AD8A 2R4UA 3DMRA 4FMDF 3TOVA 3NLLA 3FOWA 2GPTA 4C5BA 1JUDA 1IQ0A 1JG1A 3KB6A 4G6ZA 4W5OA 5M3BA 3MWLA 3R6LA 1B26A 3BCHA 1Z2AA 2HM7A 4YIKA 5E9QA 5AKIA 4GS5A 3HI6A 2IBSA 4RAQA 3ICCA 5A04A 4DCUA 5JQGA 4KXXA 4B87A 2HJSA 3TDKA 4JXKA 3CWCA 2QZJA 4BQSA 1RFGE 4I1RA 1OA1A 3TSWA 5TGDA 2OFOA 4A73A 4URWR 4MNTA 2OP0A 5IAJA 4E5YA 1I13A 2GILA 1KOGA 3LWNA 2NUAA 4XQGA 6REQB 2PSFA 2GZ2A 2BFPA 2SNIE 3CZQA 4MA5A 3B12A 4XD7D 3UT5A 3VR2D 5CURA 1BGVA 2RGXA 2OO3A 4NBKA 5KUTA 2CE2X 2IF2A 4LOKA 3DMFA 4MAAA 4C3ZA 3K73O 5KC8A 1TAQA 2VHZA 1EE9A 1YS1X 1RQRA 4XGRA 1PTJA 3IBFA 4LF7B 1XVAA 4ZI7B 4O4LA 1BOFA 2PS9A 3WFJA 3EJ6A 1MX5A 1T5SA 2CGEA 3IXQA 1UXHA 3GFBA 3LT0A 4KMOA 4CUZA 2H9IA 3G1TA 4CG3A 4YV0A 1OR8A 4XASA 3ZCRA 2XUHA 1BFUA 4O4HA 3MMXA 1T36A 4YHBA 1LV8A 1OC2A 2B4RO 3KKZA 4ZZ0A 1OV4A 1XKXA 4ZV4A 2JLCA 3HZHA 4E13A 1N33B 5F77A 3MMPA 4YRSA 1NVWQ 3S27A 2C8KA 1K66A 4ROTA 1XXHB 1G18A 1K6XA 3D7RA 2Q2WA 2SKEA 1VCMA 4GZMA 4R7GA 1LS6A 2Q3FA 1F0YA 1G60A 2ZT6A 1BAPA 3KUDA 2ZWMA 4ZARA 5C3MA 4OAQA 5C7YA 4RIHA 3ADDA 1ZVVA 3LBNA 2FEMA 3MWKA 4I3HA 4OXYA 2ZI3A 1JYEA 3KIPA 1UKAA 4MJLA 4KNWA 1JJVA 5LQAA 1YASA 3FYUA 5TE9A 1Z2PX 1EFLA 2CFOA 3D3KA 3D2CA 2GOYA 3PKZA 4WT7A 3BWXA 3MRXA 3GAFA 3DVLA 1AKNA 4S1NA 1C1XA 1IN1A 4K28A 5BN5A 1SGWA 2RI6A 4GMFA 2O0HA 4MWEA 4LG1A 5BWOA 5KMGB 1PJ4A 4JIGA 3ZPXA 1NW9B 3TDNA 2O7QA 3CGGA 4X00A 2ZFUA 4KRGA 2X0EA 5BPHA 1OU0A 2AZMA 1TKBA 2IU6A 3MC1A 4UFOA 1S2IA 5CYFA 1P9OA 3OJEA 3ZY3A 4AZVA 2WVJA 4IYRA 3MRTA 4MLDA 5JBQA 1IATA 3LKBA 3SKXA 1WF3A 2GN8A 2P79A 2XKAA 1LJUA 2P27A 4UNIA 3UZUA 5HKKA 2XOXA 4FN5A 4LRYA 1QO7A 1U0BB 3UYLA 4ML3A 1FRQA 5JQGF 2MSWA 4I6GA 3GRZA 1XAJA 2AMFA 3PF8A 3QUAA 4H6XA 1N8TA 1JIQA 1UBEA 4TLBA 1VQ1A 2ZYHA 4X7BA 1P7ZA 2WEKA 2ZPUA 3CW9A 1IJKA 4L2IB 1E2FA 3KQVA 4LDJA 5TQVA 4ZYUA 1O9HA 4JV5B 1NFQA 3TR0A 1YBMA 3DT9A 4V1CB 1U5BA 5JAMA 4UXJA 5E95A 4H7IA 2TMKA 4QJBA 3EXHC 2W37A 1QGYA 2NTYC 4C3OB 5DLEA 4DNOA 3PG5A 3WIOA 2VXBA 1ULUA 1T34A 1YVEI 4CNQA 2ZOSA 1EBFA 2FE1A 5EVCA 5BORA 1Q0QA 3MT0A 1NR7A 2ICAA 1UM8A 2BEUB 1FP4B 3TX6A 2VTVA 1DRJA 3BIJA 3DZJA 3GF4A 2BM1A 2YWBA 1T6NA 3EAGA 3JQGB 4DLXA 1TM5E 3KZOA 2QENA 4HDNB 4F8EA 3VKHA 2WD7B 3BSSA 4H6WA 3PWZA 4FOPA 5DVZA 3OOSA 4O4HF 5I7WA 3SF8A 2H00A 2ZJ3A 2AUTA 1UEJA 5EVJA 2Z8YA 2GB4A 3T3PB 1Q1EA 4W9NA 1OH5A 3TLAA 1WXFA 5AUOB 3PX7A 3OCWA 2HY7A 4YACA 1KTVA 1N0UA 1VG0B 4FSHA 1RAFA 2EJBA 3RS8A 1MTZA 2QS9A 1TF2A 2HFKA 3S2GA 4E32A 2QD1A 4CF4A 1QHSA 2OV6A 3RSFA 2VHTA 2YASA 4HNTA 2DBZA 4R8SA 5HILA 1NW7A 1UBCA 2D2IA 1QLJA 4ZT7A 4RWEA 5HP4A 1Z25A 4D3FA 4Y2HA 1WZ2A 4KLRA 3CX7A 2XQGA 1RM3A 1G2OA 2VJQA 4G1BA 1F8UA 4RAOA 4X6LA 4ZEMA 3NDJA 2QXUA 4C5CA 4KWTA 1QNFA 1VL5A 4LOIA 1KRXA 4XA8A 2FSHA 1O95A 3PDWA 1MP0A 1CIPA 3QUBA 3CKYA 4MYSA 4FQ8A 1JMKC 3IUNA 4HUQB 5A3QA 1CFZA 3TCXB 3KSRA 3PGA1 3KPJA 5KNDD 1KYXA 3IS3A 3HCAA 1W5AA 4JVLA 5AM2A 3X3HA 3TTYA 1HDYA 3O1JC 1E4YA 4WCDA 3ZBTA 3OTQA 2DM6A 5L8VA 1FS6A 5LDDC 1GU1A 4MZXA 3RBZA 3P94A 4GICA 4COKA 3H2ZA 2XUOA 2A88A 2YH2A 4B3MB 5BW4A 5EJ9A 2GRJA 4ZI5A 7YASA 2Y71A 3FIJA 4JUDX 2VP2A 4Q7KA 4FUTA 4YQEA 4KPEC 4P83A 4PTZA 3HXPA 2AVDA 5AW6A 4IEIA 5EE1A 3TECE 1Y7IA 1UMKA 3A37A 3DMNA 5EZ5A 3D0OA 2Z1MA 4LPSA 3PQFA 4DCSA 2HQ1A 2P30A 5F5NA 4DSTA 1VPVA 9ATCA 1NUQA 3GA5A 3Q7QA 1GT6A 2QVYX 1T25A 4DEVA 1SVLA 5IT5A 1JHPA 3QBDA 3HYSA 2X4GA 3N2LA 2ZYSA 2XUZA 3ILHA 3A6LA 4KMRA 4DR5B 4C1BA 3ELUA 3LT5A 1IY1A 4B9EA 4NQRA 3UK0A 4EGQA 3WS7A 1TYBE 5MDHA 1C0LA 1J42A 1DKLA 2ZS7A 2QMOA 2R1UA 3M9XA 1QYDA 4KNYA 1RBQA 1Q17A 3LY9A 2V65A 4Y9TA 1P60A 2CNWD