4Q1CA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 8 {2,2'-[{4-[(2r)-4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-2,3-dihydro-1,3-thiazol-2-yl]benzene-1,2-diyl}bis(oxy)]diethanol}
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
total genus 81
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1cA00
2X1VA 5K8IA 2ZQ5A 2NO7A 1D2MA 4I4LA 2RB4A 4BZXA 4LBWA 1G5PA 4CRWB 2BCGY 2WAXA 5DYGA 3U3JA 3A4NA 4IKEA 5DE3A 3WYFA 3LLUA 4Q48A 2JLZA 2OHFA 4MUBA 3QJYA 1LFDB 3T34A 4DB2A 3ZH9B 1N6RA 5KSPA 1G19A 3K9GA 1QG2A 4DDVA 5EP2A 1U94A 2GJAA 3GJ6A 2DFKB 2JLSA 3CNOA 3N70A 5H1YA 3RWOA 3U3RA 4EJSA 3KJEA 3GJ5A 1JR3E 1NSFA 5LB4A 1VYVA 3QPWA 4AKEA 1JAIA 1HQCA 2FH5B 4DZZA 5JEDA 5KDOA 2J0UA 4ESVA 3NDPA 2CLSA 4G5OA 1QBKC 1E2DA 2E87A 1W4BA 5FPSA 4OQLA 3LBIA 3LH5A 4BE7B 4C0BA 4MKIA 2KWIA 3ICEA 1Z0AA 4PXAA 2QMOA 721PA 2V4ZA 3V4RA 3LA6A 1A2KC 2ZIAA 4C4PA 3KXKA 4H1UA 4NU0A 2ORVA 3QSYA 4OI4A 4QGFA 4R71A 4AWXA 3LLMA 4MITA 2VP2A 2W6IA 4FMCB 4NYIQ 2GNOA 1LTQA 1EG7A 1ZAKA 4KSCA 4ZIRA 2QL6A 4LBYA 5JECA 4Q7MB 1HV8A 2JLYA 3AUXA 2EQBA 4D25A 4MQBA 4URYR 1G6OA 1FUKA 1II8A 1D2NA 2FG5A 3OFND 3HYRA 5P21A 1AS3A 1PUIA 2FSIA 2IYTA 2BMFA 5FL3A 1PLKA 1TQ4A 2Q9BA 3NEYA 3T61A 621PA 5LD2C 3MD0A 3BH6A 1F2TB 3KB1A 1M7HA 4HB3A 4KXFB 3UG7A 4C0KA 2WJIA 1AS2A 1XEWY 2RHDA 3K0AB 1GIAA 2ERXA 4TSFA 1AM4D 4B3FX 4EPVA 3EPLA 3SYLA 1D8TA 1J70A 4NCHA 1NMZA 1VG0B 5HZKA 4UNNA 3CR7A 1ONBA 1XMSA 2C9CA 4HAXA 5CK4A 5KPJA 2JGNA 2CJWA 3CM0A 4TTQA 3EX7C 2ATXA 5CM8B 1RKBA 3THWB 2GXSA 2VBCA 2P65A 2J9RA 5HR5A 2PLRA 4NYMQ 4B35A 3OAAA 4O25A 4GSYA 2PJRA 1CJUC 2MMCA 2MSEB 1WP9A 4KODA 2GK7A 1IONA 1TL7C 4TTRA 3VFDA 1HY3A 4FINA 2JIZD 4HB4A 1FL9A 5CIQA 3EXAA 1E2QA 2DY1A 2NIPA 3GMTA 3HP1A 3IQXA 3SNHA 5JSZA 3I5XA 2J45A 1EFRD 3L0OA 1EESA 2BJVA 1OXVA 2W2VA 2QTFA 2OSBA 1BIFA 4CEHB 2ZI3A 2ZSBA 2GZHA 4M53A 1OB5A 5D3QA 3MCAA 1G5TA 3B7GA 2NO6A 4LHYA 3TGPA 2ZJ2A 3Q85A 821PA 3SYNA 4ARZA 2W2XA 4BLSA 1KI4A 4MRVA 3VX3A 1W5SA 2RGEA 1AKEA 1TUIA 4GMXA 3ADBA 1PLLA 1TEXA 4HZIA 2F43B 5FBQB 5DN6D 3KKQA 3RDPA 1U8YA 3CRW1 3RS0A 1NY5A 2QN6A 2ZI9A 2XNSA 4L4UA 4BECA 3NEJA 2V54A 4NBSA 4PHGA 2KE5A 3EC1A 3QKSA 2VA8A 1NVVR 3VKHA 2N42A 4Z8YA 2C9OA 1LF5A 4TYQA 2OM2A 3SBDA 1JEDA 3K70D 3AUYA 2G88A 2WM9B 1LVGA 1RRGA 1EFRA 1XXHB 1ZP6A 3PIRA 1XMJA 4JLVA 4XTCS 4EQ6A 3PCRB 5JZVA 5SZKB 1JJ7A 3KUDA 4JZKA 1E9CA 1UKVY 5E7IA 2ZE7A 3WYGA 3BB1A 2G3YA 5DHAA 1QHHA 2GF0A 1OXUA 3SOPA 1IY0A 1E0JA 1ZU5A 5C1BA 1VYUA 4LYJA 4Z1MA 1S2MA 2WJHA 3X1YA 2R62A 1GKUB 2EU8A 4PC7A 2QBYA 1AZSC 2V6IA 1UM8A 4Q7LA 5FBVB 2DHRA 3LVQE 1H65A 3AP2A 3CH4B 4YMVA 2A3RA 2PT7A 4IOKA 1N6LA 1N6KA 3OEEA 4ZDIA 1E9AA 4XVRA 4B3CA 4ZCIA 1VPLA 3DPUA 5FBLB 5FTNA 2Y8EA 4RZXA 2R6GA 3NWJA 4HUQA 1JXOA 2ORIA 5KSYA 3U7FB 1RE0A 1AIPA 3BK7A 3WYAA 5A0FA 1S9DA 3SU8A 1CIPA 3BORA 2ATVA 2I4IA 2MMGA 1F48A 3AF0A 4PSAA 2BOVA 4JT4A 4UJ3A 4B33A 5JHHB 3IBYA 3LV8A 3G82C 5FOSA 4DRZA 2X2FA 3CX7A 3OF5A 4EJSC 2A9KA 3EZ7A 4LX0A 4DJTA 4KYUA 4E07A 1OIVA 1XFAA 3PENA 4RKFA 4DSTA 4O2LA 2J3EA 4BZPA 5CB8A 2WJGA 4HLDA 1KK0A 4HAUA 2Z6VA 1X86B 4TMWA 2A2ZA 2QROA 3EZ2A 2QENA 1KAOA 5J5CA 1ETUA 3KJHA 4YQFA 2ANCA 2YNMA 1Z29A 2OG2A 4LYHA 4LSGA 3TAUA 2RGBA 1Z6TA 3NC0C 1K6MA 3AKCA 1UPTA 2C95A 3QG5A 4Q9HA 3KQNA 1E4VA 4ZCLA 4MDEA 3P4YA 2HDNB 5J40A 2C8VA 3P26A 5FOXA 4L16A 1SVKA 3LQRA 1AK2A 1N0UA 1ZD8A 4HZUA 5TXGA 1BH2A 4HATA 1NBMA 4XTRA 1II8B 3B8HA 3B1YA 3RS4A 2ZJ8A 2CVFA 2YWEA 3AF3A 2H1LA 4M9SA 3H4MA 4U00A 5FL7D 3B1XA 4PPGA 1ZCAA 1ZVQA 1UBEA 2VQSA 2DWQA 5JS8A 2ZJ5A 2WKPA 3BAFA 4UNSA 4OL0A 1U9IA 1ZYUA 4A2QA 5EJEA 4CW7A 1DAHA 2GXUA 2CDNA 3PEWA 3C5CA 2NGRA 1J90A 5KU1A 1ESMA 1E9BA 1W2GA 2VP5A 2W83A 4YONB 5EXPA 3RC8A 2G6BA 3S1AA 3O8BA 5UKDA 2REOA 2IUUA 1VG8A 3PVSA 1KNQA 1NG9A 1H8HA 2YJTD 2GVDC 5G41A 5G40A 3RS2A 3TSWA 4PQFA 4RJLA 2JJ2D 2EFDB 3KJIA 2C2HA 2YOHA 1BYIA 1JXMA 2BJWA 3OZXA 4X8OA 3KTAB 3U44B 4RSGA 4FMDF 4PZYA 4B34A 2J7KA 3LBHA 2ZR0A 3W5IA 5TY0A 1XCGB 2JJ8A 4HUQB 1IN4A 4YDSA 3TSZA 1VKJA 4B74A 1W7AA 2IF2A 3WNDA 3B60A 4B3DA 4AYWA 3SQXA 2AWNA 1X8JA 2J0VA 2JLRA 521PA 1S9HA 1G17A 1XU4A 1P73A 3MGCA 2XTNA 2XSZD 1U98A 3MSXA 2OUKA 2RGCA 1FX0B 1G8PA 1XJCA 2BC9A 5C18A 3SE0A 1SXJA 4F91B 3FMIA 3KTAA 1EXMA 3U44A 2QY9A 1OFIA 1L7VC 4JYBA 2P5SA 3DMDA 4DWJA 1ZINA 4J0QA 4R98A 3BWDD 3KDSE 2OAP1 1ZU4A 3ZVRA 4EPTA 4G0NA 3TJZA 4LJ9A 2OBMA 1COWA 3AF4A 4JBXA 4TYNA 1OH5A 3P20A 1M1YE 3U6KA 4LZZA 4IDHA 4WVFA 3QIAA 3LX5A 1RPZA 4H1VA 1VDZA 3NHAA 4KLNA 2GWHA 3BH0A 4RD1A 1E0SA 1EK0A 1DAIA 1ZD9A 2ZYVX 4HZUB 2YVUA 2RAPA 3R9IA 3CKLA 4JJZA 1G3RA 5LD2B 1VCOA 3B5JA 3TUZC 1Q1ZA 2BKUA 3K70C 4M2LA 3EWSA 2BIFA 4JL5A 4PTLA 2A5GA 1NBME 4QJ3A 3GLGB 3DDCA 3PUVA 4US1R 2P0EA 3SJBA 3W6OA 4PFSA 4YMTA 3IIJA 1JQJC 3I62A 2RGXA 3B78A 2QE7D 1GL7A 4LY6A 5J4HA 3QUSA 1N3BA 4A0HA 2WWYA 1NVXQ 3EA5A 1OF1A 1KSGA 1M6NA 3AVPA 1NN1A 5HCIA 1SXJE 2ZJBA 2P6NA 3RS3A 1KDTA 2VL7A 3FKSD 3KKOA 3U7EB 4XVUA 3TK1A 1JJVA 2CEAA 3VR2A 4DCVA 2IS4A 1XZPA 4B2PA 2J5XA 2Q21A 3GLHA 4TT3A 1W4CA 4JMPA 4Q19A 1OW3B 5B30A 2C98A 3T1TA 3NKVA 1F6BA 2VHJA 4G3XA 2ZUDA 3T5DA 4OBEA 1N5KA 4AURA 1KO5A 4B3XA 3RLFA 4C0JA 4BQSA 2PX3A 3EWAA 2A5FA 4LHWA 3D6TB 1R0XA 2ZRDA 5A5GA 4BFSA 1M2OB 1TQDA 4Q1AA 3PXGA 3K0FB 4RCZA 1TQ2A 2G0NA 4LDJA 1DARA 2FPKA 3E5HA 4KHZA 4DCUA 1E2HA 5H70A 1OE0A 3Q5DA 3KQUA 3P32A 2DB3A 1XEFA 2X19A 2YWHA 4DIDA 3FDIA 3TUJC 5KDDA 1G3MA 2GKSA 4I99A 3U4QA 1YQTA 2OBNA 4A9AA 3IHLA 2XOKA 4D4KA 4IDPA 5LB2A 4Z1MD 2QBYB 4YLGA 3WBKA 4AG6A 2MSDB 4KLZA 2J41A 4NHOA 2R6AA 1DAKA 4HLUC 2YOFA 4W9MC 2GZDA 3IIMA 4D4LA 3CWZA 1E9FA 3R9XA 1E2PA 1XD2B 1LF0A 3A6PC 2JATA 1NNEA 2A5JA 5E3HA 3NH9A 4QBFA 5IT5A 2Q3HA 4Q18A 4GNKA 3NBZC 3QNUA 5TMPA 2QI9C 2QTHA 5CB6A 3A37A 2R6CA 5FUWA 1IY2A 1GFIA 3TVTA 4ZI3A 1DEKA 3Q8XB 4RY2A 3GLGE 4HDCA 1YRAA 4PANA 5AK0A 1S0UA 5J4KA 2FA9A 4LWZA 4NTZA 3R7WB 4GOXA 1JQLB 2V6JA 2IYSA 1KMQA 2OLJA 1GL9B 2FN4A 1FMJA 2BHRA 1XD8A 2HXSA 2ZJYA 1CULC 3HPRA 1P2TA 2VP9A 1T3SA 5E4FA 1N5JA 2FEOA 4II7A 1KI8A 4JKYA 4NE2A 4GRAA 4OI2A 3T12A 1DAEA 3TLXA 2XTZA 3GLHB 4A4DA 1TNDA 2CE7A 2F9MA 1R0WA 1E9DA 2CL0X 1CKEA 1CS4C 1CR4A 3CX6A 1V43A 1JI0A 3PUWA 4RFSA 1A2BA 4CT4B 2ZM5A 1E9SA 2R8RA 4A82A 4PZLA 4I1OA 2RGNC 4FIDA 5K8UA 2CLCX 1WDTA 2PT5A 3KKMA 4URWR 4AI6A 2IYRA 1CR2A 1XXHA 4EQ6B 2QAGA 2WMNB 4URZR 3U3OA 1YU9A 3EASA 1Z6YA 5AJZA 5TB5A 4B44A 1Z8FA 1SKQA 1WE2A 4YDHB 5JHGB 2WWIA 1SXJC 4JL8A 2XZOA 3DL0A 4V03A 4EAQA 1TQ6A 2ZVQX 2HLDA 4RD2A 3DM9B 3QEOA 5CIWA 3FHTA 1DG1G 1MO3A 3REGA 3A36A 3GEIA 3KX2A 5KDLA 5EE1A 2WV9A 1VHTA 1WBBA 2XSZA 3VU9B 1IAQA 1WA5A 1XJ0A 1G7TA 4KI0A 5B57C 2XTMA 3AKYA 2BVNA 3H86A 4JLAA 1JBKA 1RFLA 2FOLA 2ZS8A 4TZ6A 1NG1A 3CUEF 4XWKA 1Z0FA 2VPPA 4N0EA 3T5GA 2YV5A 2ZAMA 3CH5A 4PHTA 2C03A 2XGJA 4ZIRB 4QOSA 1FQKA 4GBMA 5TVKA 2GAAA 2ZSEA 2KI5A 4NONA 4Z8XA 5FH9A 1AQYA 4BZQA 3QXHA 4MYHA 1HUQA 5GJBA 1HE1C 3HR8A 4M21A 3LW8A 2VHTA 1FQJA 1ZJ6A 4KBFA 4CEJA 1IN8A 3IILA 2OLKA 4Q47A 5JJIA 3KKNA 1K5DA 1GP2A 2ZPTX 3H0KA 2XNDA 1NVVQ 1KI1A 4CDGA 3RABA 1RJ9B 3W8RA 4PQRA 1ELOA 2HV8A 1XTQA 3QVUA 2GJ9A 3NIBA 4OI0A 4GL2A 3F0TA 3B9PA 5EZ5A 5LDDC 4MRRA 4LBZA 4NYJR 4CF7A 2QPOA 3ZS9A 5C2JB 3C7KA 3AGPA 4M0LA 1LV7A 2F7SA 1BOFA 4TL6A 4TLAA 1P75A 4G5SA 5IK2A 3W90A 3UMSA 3GFOA 1IJEA 2QORA 4MH0R 3RVBA 1FNNA 5JSZB 3CB4A 2Q9CA 2QPAA 3FE2A 1GUAA 1MR3F 4IVRA 4BPBA 2GETA 1VIYA 1R5BA 2B21A 4HAVA 2A30A 3AKEA 1ZNYA 3I73A 5EE9A 2ZI4A 2QM7A 1KO7A 1D2EA 1R10A 1U8AA 1W49A 1U81A 4HAWA 3TMKA 1TTTA 5AR1A 3MWJA 1E94E 3TBKA 3LDAA 2FFHA 2OILA 4IDQA 2FE4A 2OZEA 3BS4A 2FFAA 2LWIA 4IOJA 2OV2A 1Z5ZA 2YWGA 1G7RA 1NI3A 1P9RA 1SVIA 1W2HA 2IHBA 4GOKA 4PC2A 3VNVA 4POAA 4JT2A 1E0AA 4QM6A 1AA9A 1H8HD 1P6XA 4FMCF 1DOAA 3GLFE 3DZDA 2EYQA 1OHHD 1AZTA 1Z2CA 2RMKA 3U3KA 1E6CA 3SJCA 2GTPA 2IXEA 1NMXA 3SYKA 4QGHA 4JBYA 4EPWA 1OH7A 4LBVA 2JJ2A 2JDID 4AYXA 2D4HA 3QF4A 3TW4A 3W3ZB 1O3YA 1SHKA 1PV4A 4OHVA 3CPEA 2BBWA 3TH5A 3RSOA 2AKYA 2C99A 1XPRA 3WP0A 4V0MA 2VO1A 4A0GA 3M6AA 1QHSA 2F1HA 2ZE8A 2AFIE 1DE0A 3VKWA 3VR6A 3WNCA 4PO1A 2O8DA 5AUOB 3LRPA 2O8FA 1FX0A 4BLTA 1WB9A 1Z63A 1KK2A 2GEVA 2IWRA 3KQLA 5FL7A 4Q7KA 4Q66C 1YR8A 4Q4JB 3PQCA 2ZS9A 1I4TD 2VSOA 4DSUA 2XNDD 2IL1A 3FMOB 2XEXA 4Q4AA 1F60A 1KO8A 4TLCA 5DI9A 5FBRB 3E1SA 3UMRA 1QHHB 2ZREA 1N6PA 5GJWC 4TYYA 4L8GA 1OB2A 2VLIA 5FI1B 4AK9A 1NY6A 3QXCA 1GTVA 2ZANA 3V00A 4WZAE 4B32A 2YZ2A 1BO6A 2ONKA 3C16C 4RD0A 3I8XA 3WBJA 2BV3A 3NBFA 3VR4A 3WHLA 4BRUA 1IXZA 1N25A 3I3SR 3P4XA 1Z83A 1KJZA 4UXHA 4PAOA 3GLIB 2JLUA 4MGIR 3KQKA 4OYHA 2HT6A 2O8EA 4RFVA 1D9ZA 1R8SA 4L9SA 3K0CA 4CVNA 2O8BA 4P4TA 4JBWA 2AX4A 2OO7A 4LCBA 5HE8A 1Z07A 2NO0A 4KFSA 121PA 1MKYA 1ZM3A 2IYWA 4V0NA 3C15C 4GFDA 4BFVA 1AS0A 3WRYC 4US2R 3OFNA 2XXAA 1KNXA 3EZFA 4WW0A 4IJMA 1KSHA 1BYUA 1Q0UA 1R5NA 3QY0A 4C3ZA 3ZQJA 1E2NA 2G0TA 4QNMA 2KBFA 1KY2A 1KSFX 3CO5A 4KVGA 3ETLA 4QKQA 2NMVA 1AGPA 5CYPA 2HLDD 2PCLA 4ZDKA 1SZPA 2Z43A 2QZ4A 2H7VA 3AGQA 3RYTC 1S3SA 1GITA 2QPTA 2FSFA 4TMTA 4BLQA 2CCJA 2YYZA 3EZ9A 1RYFA 1ZM4A 1ZD1A 3QXXA 2A78A 4PZZA 1JECA 4DXAA 1KYIA 1RW4A 2CL6X 3E70C 5GADl 1OLOA 5F9FA 2OE2A 4JKIA 1NN3A 4RZ3A 4TL9A 4UJ5A 1GVNB 4U02A 5BYKA 1CF4A 2IX3A 4M9ZA 4U7DA 2FPLA 3X2SA 4B43A 1U2RA 3FHOA 1KJYA 2GBLC 2RGAA 2ZSFA 4P0TA 4UXIA 3ZVMA 1OH8A 2ZRKA 2ZRGA 2GJKA 4GT1A 2QGNA 4RFSB 3U61B 1DPFA 2DYKA 2HJVA 3DEFA 2BMEA 1GRRA 2OCAA 3ADKA 4R2IA 3I5YA 1W36D 5SZHB 2CLDX 2ZI7A 1QF9A 3QF7A 3MWKA 1EWQA 3THXB 1BKDR 5IRCD 1OJLA 5A4JA 3CONA 4I1UA 4KCGA 2J59A 3RHFA 1SVLA 1ZUHA 4MDFA 1MRNA 1NMYA 1H8ED 2QMUA 1E96A 3P1JA 4OK3A 5J4VA 221PA 4LC0A 4DIEA 1HQYE 3EA0A 3MMPA 1G64A 1KDPA 1U0HC 5CDFE 2EWVA 4RZ2A 4D81A 3RANA 2W0MA 3M0EA 4JLDA 1XEXA 2GCPA 4M9QA 2BWJA 1E0KA 4GP7A 3IQWA 4DCNA 2IUSA 3OE7D 3L82B 5DO9A 4D4JA 1JPJA 1VHLA 5J4YA 3J81k 2FWRA 5JWRA 1N5LA 1N6OA 2IXGA 2OFWA 3SS8A 1S1MA 5DI3B 2VF8A 1DAMA 1LS6A 5LPNA 1Z0DA 2WJVA 3DO6A 1C4OA 1G291 1XJQA 1HURA 1EFCA 2HCJB 4HEJA 4EUNA 4MKFA 1P2SA 4M4SA 4O2RA 4X8HA 4BEJA 3BGWA 3OAAD 3HR7A 4NKRA 1XXHE 4JJKA 4BFXA 3ZLJA 1HYQA 4ACBA 3AVOA 2D7DA 1J7KA 3OEHA 3WP1B 3SJZA 4G01B 3SC3A 1II0A 4KAXA 1X8KA 4TLDA 4GZLA 3O47A 1W0JD 5H68A 1N6IA 4HUTA 4YC7A 3LWNA 2ECKA 2ODNA 1J2JA 4CEIB 4M1WA 1A1VA 2B7BA 2CMKA 1VIAA 5M04A 4LUCA 2HT1A 2IK8A 2VHUA 1S1CA 4FMDB 2EW1A 4RD3A 2GF9A 2LKCA 4AC9A 1UDWA 3KKPA 3RWMB 3QENA 2I1VB 1LS1A 3WNBA 1SULA 3PV0A 5GVSA 4Q02A 3B2EA 3EIQA 4EFNA 2D7CA 1SXJD 2JLQA 3VHXA 4UNPA 1YVDA 4M1KA 4E22A 3AVWA 1G1MA 1T4GA 2JASA 3L8ZA 2OXRA 5C4MA 4Q4AB 3ZS8A 3SN6A 4DUGA 3THXA 4HAYA 3W3AA 4M22A 4U5XA 4JVLA 3SFVA 2WBLC 1YZNA 2I3BA 2QA5A 1NN5A 1JEEA 4Q9LA 4ZI2A 1XTKA 1ZC3A 2HUPA 2P5TB 5HPYB 1KGDA 5AJVB 2W6ID 3AEZA 3I32A 1WQ1R 1GRNA 1I4LD 2XZPA 4AYTA 1IOZA 3AP1A 3D31A 5IK2D 3SQWA 1P2UA 3DHWC 1ZW6A 2XJ4A 4ZKDA 4LJ5A 3Q3JB 4TL8A 3TUIC 2ZRCA 4GZMA 1G4AE 1A82A 5EE5B 1QHNA 5JFGA 1YZQA 3QG1A 2JLVA 2IEZA 3QEJA 2FU5C 2ZS7A 1P5ZB 4B2IA 1OIXA 4P33A 4LOAA 4F93B 1NN0A 4V0LA 4Q00A 3WHKA 2GCNA 2F1IA 2AL7A 2B8WA 2XXAB 2IS6A 2WHXA 4OHYA 4DDTA 2Q3MA 2GCOB 4AD8A 4NZYA 2TMKA 2H16A 3X1WA 2PX0A 3GEEA 4Y0AA 3U4QB 2IC5A 4OJQA 3D7MA 1Z6AA 3AVQA 3HU2A 3K9HA 2IYUA 1YR7A 3NVAA 1HE8B 1E2FA 1W0JA 3ND8A 3WMGA 1E2JA 4CT5A 2CCKA 4RD6A 5E95A 4ZV4A 1FMLA 4DLSA 1RZ3A 1COWD 3NTUA 4A0RA 3N2EA 2REBA 4PPNA 1US8A 3FWYA 5CITA 5IHPA 2VSFA 3AB3A 1R2QA 3HU1A 1G3UA 4LJ8A 3LVRE 4NYMR 1ZUIA 2P67A 1N0WA 1CJKC 5FTJA 1FZQA 1T5LA 2VTKA 3LXXA 4O3MA 4ESHA 5KTYA 4I1VA 5AWFC 5L8VA 3G5UA 4D0LB 4TMXA 1T91A 4PQYA 3RRYA 1UEIA 4R2HA 2Z0MA 3WMEA 5JWHA 1UF9A 4OKSA 4OQFA 3QBTA 3SR0A 3IGFA 3RC3A 2OXCA 3THOA 4QBGB 3I92A 2PZEA 1YE8A 2P6UA 1K5GA 4AIIA 3A1UA 2GA8A 3RAPR 5G53C 3SDZA 3THWA 2BMDA 1ANKA 2ZETA 4JLBA 3LBNA 5GJCA 3ZZTA 1KDRA 1UKYA 4EFLA 2A5YB 4PC3A 4MKGA 2L0XA 3BFKA 5H8WA 4A2PA 4G5GA 1DS6A 3K1JA 4EJSB 4RZUA 3O8CA 2ZE6A 2EFEB 2G83A 2XB4A 2ZJOA 4Q7JB 3EPKA 3QQ5A 1W46A 2CHVA 2NZ8A 3BC1A 3EARA 2W58A 2W6JA 3NH6A 2FDCA 4OQNA 3RSLA 2ZU6A 3ZYCA 1G8FA 4RKEA 1PLJA 1G18A 1OHHA 2V8OA 3IO3A 4JIMA 3U7HB 3AVYA 1SVMA 3O8RA 4F7WA 1EFTA 5FOTA 3LNCA 5EXXA 3FFBA 1GDDA 4QBIA 4M9XA 3JZMA 4HAZA 5AUQA 3ZZUA 1PUJA 3AP3A 2G77B 2FZLA 4UKDA 1F2UA 1EFHA 1ZNXA 3CNLA 1S4QA 1IN5A 1EX6A 3D3QA 4ON9A 3S1AB 2CVHA 3TSOA 1Q1QA 4LJ4A 1KI3A 4QGAA 4TMZA 4F4CA 1UEJA 4C0LA 2VHCA 4A2WA 3QKSB 3TQFA 4JLOA 1OH6A 3THYA 2VP6A 3GP8A 1KK1A 1UJ2A 4KYIB 4MA4A 4XIGS 2XZLA 1UFQA 2P3SA 3IO5A 2GDJA 2C77A 2IW3A 4NYIR 1XX6A 1RRCA 4DLUA 2IS2A 1OSNA 2F43A 1M8PA 4TWZA 1QRAA 3G0HA 2JJ1A 4JSYA 4IEEA 2WJJA 3P27A 4MKHA 1JALA 4M1SA 1WF3A 4PC1A 5FPKA 4AKGA 1G3QA 2BBOA 1IQPA 1FTSA 2FNAA 2ZITA 2OCPA 1KZGB 5EXSA 3T15A 2JCSA 2GAOA 2C04A 3VX4A 5JEEA 4BFZA 3FMPB 3Q7PA 3W8NA 3PFIA 1GKYA 3KB2A 3M4YA 3T1OA 3Q9LA 2ZROA 2AFHE 3L2OB 4N3NA 3UIEA 1E3MA 2JDIA 2WWXA 2GHIA 1XMIA 3M1IA 4DDUA 3L0SA 4QBHA 2QAJA 1YZKA 1TEVA 3BXZA 4Q5IA 3K0CC 2NTYC 1RRPA 2KBEA 1JB1A 4M1MA 4GDFA 1QHXA 1DG3A 3AV0B 3MLEA 2QT1A 1GWNA 2ZUBA 4IOLA 2FPMA 1QVAA 3FB4A 5DLQC 2B7CA 4UNQA 5FUXA 1RRFA 1T0JB 5FI0B 5GJVC 4FN5A 4C9BA 1OFUX 3TE6A 4KFTA 4ILEA 1KKMA 5L3QB 4IOMA 1KKLA 4NMMA 5G3ZA 2CHGA 5F3WB 3AVUA 4D2IA 1W1WA 2XJ9A 3B13B 3GJ4A 4Q4JA 3U5ZB 1QVRA 3TVDA 1E2MA 2K5UA 1QZXA 2WSSD 1PVOA 4D0NA 4LJ6A 1KSJA 2R9VA 4NYJQ 1QHGA 3OIVA 4HB2A 1Y3AA 2IF0A 4WZBE 1YZUA 4DEYA 3NG1A 4G5RA 2DWOA 1CXZA 4XVQA 1U99A 2ZI5A 1T3HA 5AJYA 1VG1A 1Z0IA 4ITRC 1NJFA 1E32A 2QNRA 1G20E 1T6NA 2PMKA 4AG5A 5L3QA 5JLJA 3GLIE 5DYIA 2R44A 1FP6A 2ZRBA 5L3SA 1FP7A 5DNYB 4NCJA 4K46A 1J8YF 3GLIA 2BM1A 3C8UA 3HU3A 1VECA 1P62B 1GG2A 2Z4SA 4WBSA 5FUVA 1G9XA 3ZQ6A 4AKHA 2GVZC 4IDNA 3CZPA 2OCYC 4BEBA 4XWAA 4LPSA 5DIFA 3UATA 1XBTA 2ZYTX 3HPQA 3CZQA 4BLOA 1AN0A 1T9HA 2F1RA 2FSGA 3PG5A 1ODFA 1VG9B 5EP3A 3GLFB 1GRQA 5JMTA 5EXTA 4A36A 3PUZA 1MOZA 3SBEA 2O0HA 3GJ0A 2ZXUA 2CL7X 4BWYA 1Q3HA 4L15A 4ZCMA 1T0HB 2RGGA 4WA7A 2F9LA 2IYVA 4OJKA 3JVVA 3I61A 1R6BX 1XTRA 4QNRA 5ELXA 3CPHA 3DKVA 2AHOA 1B0UA 3EIEA 2BM0A 1RJ9A 1G8GA 3N5CA 4P4SA 4QGGA 5HKKD 3KXIA 2QM8A 5CLQA 2N1BA 2G1KA 1JAHA 1R5OA 4Z51A 2J0SA 2FSHA 4DEXA 1P61B 1DAFA 2Q6TA 5KNBA 3UMFA 2ZE5A 4PR0A 3K0AA 5F9HA 1SVWA 2QRZA 3CRQA 3BIFA 1MABA 1LB1B 2GESA 3A4MA 2B6HA 2BEKA 1GL6A 2D62A 2BEJA 3E2IA 2HF9A 4URVR 2AK2A 1WCV1 1JR6A 2AWOA 2ZRPA 3PEUA 1NL3A 2PLFA 2O8EB 1FTNA 2MSCB 2ZRAA 4OQMA 1X1RA 1C9KA 3CPJB 4LHZA 4LGMA 4DLZA 5JI2E 2CNWD 4BFYA 2NOAA 1E2KA 1CRQA 1NVWQ 4TLEA 4BFWA 1W0KA 2GRJA 2IT1A 1Q22A 4Y0VA 5L3RA 1ZM2A 1DELA 1CJVC 2IWHA 1F2UB 1ZM7A 1M7BA 1X1SA 2OFXA 4QFMA 2UVQA 2R6DA 2XITA 4FWTA 2ZRJA 1KZ7B 2W6JD 3X1DA 5DN6A 5BN4A 1Z06A 4S35A 5JRJA 1SKYB 4QM7A 3TAHA 1E2LA 1X3SA 1P4SA 2PZFA 4E03A 4ZDWA 3VQTA 3ZIAD 2QG6A 2VSXA 3R8CA 2G9NA 4ARZB 2F1JA 5EUMA 1YZLA 3DZ8A 2C9YA 2AXNA 3Q72A 2F6RA 1NBMD 3BB3A 2RH5A 3KFXA 3FKSA 4PHFA 1EGAA 2RGDA 3ADCA 2VHQA 1IXRC 1UKEA 1HH4A 2CXXA 3UK6A 1OKKA 3SJAA 3BJIC 5IF9A 2ZRHA 4LYAA 3K9LA 5EE3A 3ZD6A 4A15A 1TMKA 2R65A 1KI7A 3GJ3A 4V0ME 1OIWA 4JLJA 4UNRA 2QMEA 3FOZA 3Q5EA 2ZRMA 1W44A 4JVNA 1D6JA 3TQCA 4ZDJA 1UBCA 4NDZA 3EIHA 3OHMA 2QGZA 4URXR 3GLGA 1G7SA 2J7PA 4KFRA 2QSYA 4CEIA 2ZJAA 1MT0A 1HEIA 4IFBA 1OPXA 4DLXA 5B58C 5B2ZA 2AD5A 1GM5A 1N5IA 1ZMXA 3T35A 4Q4HA 4DLRA 1KIMA 2GJ8A 3CR8A 3I4LA 3OIYA 2FV8A 2WZQA 1N6HA 2ZRFA 4GI7A 2ZI6A 3ADDA 4GPTA 3FMFA 5TV2A 5KOYA 2P6RA 3GEHA 3IBGA 1IM2A 3R7WA 3RRZA 1FNMA 2DPXA 1P60A 3WRXC 3TR5A 3VR5A 3KZ1E 1CLUA 4PO8A 3TNFA 3QF4B 3ICQB 2C5LA 4IEIA 2JAQA 4JVSB 2WIBA 2KB0A 4ACAA 2VYFA 3LY5A 3C41J 3QOFA 2IEYA 2NPFA 4FCWA 1S96A 4HSEA 2IYYA 4XD7D 1TAGA 2ZR7A 4QC2A 4TYWA 2FJUA 5FTKA 4TLBA 1XEXB 1KI6B 2C96A 1CP2A 4CEHA 4DHEA 3QVVA 1FOEB 1XNJA 4A1FA 4AY2A 3HJNA 3CX8A 1CJMA 5AJXA 3MWLA 4E09A 4D26A 4ZPXA 1Z6GA 3LFUA 4FWIB 2NZJA 4URUR 4OK6A 2UZIR 1IBRA 1VTKA 1JR3A 1E1RA 1ESNA 3A1SA 4MGKR 4B75A 5KYKA 1W47A 2LCFA 3X1XA 3K09C 3WXMA 1NLZA 4MYTA 4TTPA 1XRJA 1Z47A 4R7ZA 3NHBA 4DSOA 5K8LA 2CE2X 4Q03A 3PJRA 1OKKD 3ZJYA 3TRFA 1Y63A 4K81B 3CRMA 4DBLC 3IPYA 2J7PD 2QU8A 2AD1A 4W5JA 1F3OA 1KI6A 1DTSA 1RIFA 1KI2A 2Q3FA 1GILA 1I2DA 4FW9A 5KPDA 1OFHA 4HDQB 2ANBA 1US8B 4JLMA 3VR1A 2FF7A 1G41A 1AKYA 5AJWA 1T8UA 2XX3A 3FVQA 3BD9A 4V02A 5KUTA 2CBZA 2QQ0A 1UDXA 4LPKA 2YC2C 2ZUCA 5FR2A 3AF1A 1NIJA 2Z4RA 3X1ZA 4RVCA 5F2EA 1D9XA 3V9PA 4N1AA 3PR1A 3GJ7A 3RS7A 1E69A 1EFUA 4LJAA 3TIFA 2YINC 1G8YA 1NVUQ 3BERA 4B48A 3FFAA 1QDEA 1CR1A 3LO5A 4Q9JA 2FGJA 4FI3C 3CF0A 4FMBB 5HTKA 2H57A 1U0LA 1GNQA 2YWFA 4KJZA 5FPTA 4PSVA 5K8TA 2J87A 3QBVA 1J8MF 3BH7A 4BLPA 2AK3A 4YMWA 6Q21A 4WXPA 3JZAA 3QPUA 1M74A 3RNLA 4B73A 3AM1A 4DLYA 3AH8A 1S3GA 5EP4A 1OYWA 5J47A 3U2QA 3B85A 1E9EA 3CF6R 4JVMA 1IN6A 2PEZA 4D4MA 3MAAC 4DUGD 3GFPA 2KSQA 4PO9A 1I2MA 1G16A 1HT2E 1L8QA 2QTVB 5L3VA 4WZ6A 4I81A 2WWGA 3VHLB 5JWOA 4QXAA 3K53A 4D82A 4EPXA 5FTLA 421PA 2GK6A 3HWSA 1P9WA 2QSZA 3EPJA 5KSOA 1KMHA 4IXMA 1A5TA 4FXPA 4P4SB 1NP6A 1W48A 2IHYA 4TQAA 2EFCB 4C0SA 1XTSA 2WKRA 1CBUA 3ZD7A 4TN1A 1E79A 4TT3D 1YZGA 3QKTA 4PSKA 2NO1A 4OK5A 3R8FA 3H2YA 3W34A 3OEHD 4Q9IA 3THYB 4Q1EA 1R8QA 3NC1C 4K8OA 2ZEJA 4ASUD 1TU3A 1XP8A 5HZHA 3IIKA 4BFUA 1G3IA 4IRUB 1TF5A 3H84A 3WY9A 1E1QD 2IBMA 1R0ZA 3UG6A 1XPOA 2DR3A 5C46F 5HCNA 3VAAA 1Q44A 5FOWA 4EIWA 4ASUA 1K8RA 4C7OB 2QE7A 4QJ4A 3SHWA 2HCBA 4OHXA 1MH1A 1B23P 2BKEA 2V3CC 2O0JA 4WOPA 3DVLA 4XSGA 4P3YA 1U9IC 2D2EA 1S8FA 3C14C 4OHWA 2O8FB 4WXRA 2E1RA 2OAQ1 4IDOA 2B92A 2JA1A 2X8AA 3QKRB 3ASZA 4MRSA 1Z3IX 1IY1A 1QHIA 1SVOA 3AF2A 3IUYA 4N0DA 2O8CA 2NG1A 5KHOC 3MJRA 4E5UA 1IXSB 3GPLA 3PEYA 1TPZA 4C2UA 3AVVA 3CWQA 1VCNA 2JJ1D 2W0SA 5HE9A 1EWRA 2QEQA 1M34E 1C1YA 2V9PA 3UXMA 2FMXA 3GD7A 4IW3B 5FOUA 2SHKA 3CLVA 2H8KA 1RYHA 2GILA 2YC4C 3C5HA 1XTIA 4RCYA 2DWPA 2FX3A 5BQ5A 4QHTA 3FGNA 4HI0E 2ODEA 1GKIA 2P2LA 1ZCBA 3SZRA 4YMSA 1Z08A 3JVUA 4AKIA 3QXJA 2WVJA 5DISB 2Q0HA 3F5FA 4IHQA 1NJGA 3DKPA 3GFTA 3K0FA 4LV6A 1T5IA 3SHFA 1NKSA 4CGZA 5CJPA 4Q01A 3CIOA 1HA3A 2DCUA 1G6HA 1DADA 1KO4A 3FKQA 1VYTA 1E1RD 3VTKA 3I72A 2J0UB 2W2TA 1SVSA 1NLFA 3FYHA 3EW9A 1NSTA 1MABB 3H1TA 3KJGA 1E2GA 2ZRNA 3L0PA 2BBTA 1Q12A 2GEUA 3A1TA 3ND9A 4YMUA 5BW8A 4CEJB 4DDWA 1QG4A 3CRVA 2VH5R 2YKGA 4LC1A 4C2TA 2EFGA 5JJKA 1Q3TA 1OFTA 2CK3A 1KAGA 1X6VA 2WPDD 1RVDA 3CF2A 4C0AC 3KQHA 1H8EA 3MRSA 2WTUA 4TL7A 1G5RA 2DBYA 3A1VA 5KNDA 4Q1BA 1F2TA 4MYCA 2X2EA 1NLYA 2ZSAA 2HJGA 1HT1E 4ERNA 3QE0A 2ZYWX 5F98A 3SI7A 3K70B 2R2AA 1NIPA 1TUEA 4WIAA 3WMFA 4D0GA 3U7GA 1BMFD 2AKAB 5EUQB 3EC2A 1UBGA 5JRZA 4LK2A 3BOSA 4I1SA 1E9RA 3OEED 4M1TA 4HLQB 2AN9A 4B3BA 2O8BB 3LXRA 4EPRA 1HTWA 1XMVA 3F3YA 1GOTA 2WOJA 1CTQA 1W5TA 3F8TA 1Z0KA 1E2IA 2O8CB 1G7CA 1VCIA 5FPYA 3L43A 3ZVNA 1Q21A 2D2FA 4PAMA 5BN5A 2QQEA 5J4LA 1R7RA 2NPIA 3VMFA 2QP3A 2AR7A 3RS5A 1WRBA 4KVAA 4X8MA 4MGZR 3U3MA 1I4DD 2HF8A 5KSZA 3EPHA 1TX4B 2VIIA 3IHWA 1GNPA 4DC9A 2HYIC 2VRWA 2O0KA 1R0YA 4LI0A 2GEDA 5AUPB 2IYZA 2H92A 4M1OA 3VKGA 2EYUA 2YHSA 1SKYE 1KO1A 2ZR9A 3ECCA 4QJ5A 3B1WA 3DMNA 4DT1A 3IEVA 4NCKA 2VP0A 4NCNA 4GP6A 3L0IB 2OCBA 2RHMA 5FBWB 3T1QA 2ZRIA 5EE0A 1DVRA 3OESA 4W5WA 1W4RA 2A5DA 4B6FA 4BUJA 1XWIA 4IVPA 4C30A 1SQ5A 2IUTA 2DFLA 5CM9C 4Q9KA 3VNUA 3TW8B 3DOEA 3BB4A 3B82A 1N2CE 2J1LA 5FPHA 4Q1DA 3KL4A 1XD9A 4PPFA 4ZKEA 5BN3A 1XD2A 2PH1A 1E4YA 1P2VA 4HLUA 1R4AA 3GCGA 3LD9A 3T06B 3GLHE 2ZRLA 1WBDA 4BASA 2Q9AA 3LX8A 4NP6A 3L8YA 4JSTA 4Q1FA 3GLFA 4R9UC 5CYOA 1E1QA 3CBQA 2D3WA 5BXQC 2V1UA 4G1UC 3BFVA 1VCMA 5FTMA 4XWOA 1IHUA 2CNWA 4JLKA 5SZJA 4KITB 3PEVA 1P7CA 4C0QC 4W7SA 5JCZA 1JPNA 2RCNA 3MG9A 4DB4A 4MRNA 2QRNA 4BRWA 2J46A 2ZYUX 4W5HA 3QKRA 4PX9A 3PUXA 4LJYA 8OHMA 1KDOA 3LW7A 1Q20A 2WSMA 1XTJA 1MO4A 3U6BA 1J99A 2GXAA 2IYQA 4A8JB 2PBRA 4TSFD 1G21E 1N0VC 3KXLA 5G3YA 2XAUA 3EAQA 1P3JA 3TKLA 2WAYA 4CZ2A 4LRWA 3A4LA 4EFMA 2V55B 1SGWA 1ZNWA 3QKUA 3W6NA 5HKKA 4OQXA 4D6PA 3K09A 4V0OA 2OT3B 2QP4A 4Q21A 3A1WA 2RKOA 3RRMA 4LYFA 4Q4HB 4XJXA 3GJXC 3N2IA 2BDTA 4OI1A 4EDHA 5AUNB 2FGKA 4F4IA 4RD4A 2WJYA 2ZAOA 2GZAA 2EVWX 2IYLD 4DLWA 1LY1A 2QAGB 2PL3A 1UKZA 2EWWA 2D06A 2A7QA 3GQBA 2JLXA 4QRHA 2XB2A 4IFEA 4X8LA 2FFQA 1ZUNB 3UKDA 1UADA 2ODWA 2QP9X 2I1QA 1FUUA 1KOFA 4FCVA 3GJ8A 1KY3A 3K8YA 1Q1BA 2JEOA 5DGXA 1FFHA 3ZDQA 4DCSA 3LAWA 1W36C 3OE7A 4XSHA 1PZNA 1X8LA 4DSNA 2FFBA 1OXSC 1YZTA 1IJFA 3QI2A 5EZ6B 5CLLA 2F55A 1IN7A 3B6EA 4JS0A 4PC6A 1II9A 2ZVPX 1O87A 3W5JA 4DT1B 4ABYA 4DVGA 5D3MB 3BRWD 4EPYA 1NF3A 4LHVA 1U8ZA 3AQ4A 4XH9B 3FPAA 3U60B 3ZZ0A 2JLWA 1ZRHA 4BFTA 1WMSA 2WWHA 4B6EA 3OIWA 2GJSA 1ZIOA 4HYYA 1GAJA 1EX7A 1KJWA 1T3LA 3K0EA 4L5BA 3Q7QA 3IKJA 3BFXA 4NH0A 4TQ9A 4TYPA 4P31A 4B47A 1ZM9A 4GOJA 4O0MA 5L3SB 3K9NA 5ANRB 2XOKD 4JLNA 1ZBDA 2V7QA 4G5QA 2WICA 5KO2A 3EG5A 1TADA 2GBLA 2QMHA 2KJQA 2ORWA 3DM5A 4PPQA 5D3MA 2N46A 1WXQA 4B3GA 4V0KA 4QHSA 5DI3A 1G4UR 3CRRA 2X77A 5JS7A 3VR3A 3MUFA 4IVQA 2PEYA 2WWWA 3W9YA 1AJEA 3DOFA 1U90A 4KFUA 1KHTA 2D74A 3ASYA 1XEWX 2GCOA 1W0KD 2OBLA 1YR6A 2BCJQ 4A6XA 1E99A 4DLVA 4UXJA 1L4UA 1OT3A 5EQTA 3NDBB 2BMJA 1CR0A 1CJTC 2AXPA 4QG7A 3UWOA 5FFMA 3VU9A 4ZO4A 2PZGA 2QT0A 4A8JA 1ZIPA 4FCTA 4HB0A 3HDTA 2OESA 5E7JA 4YXWD 3AVTA 4C0HA 3MFYA 1MO6A 1TF2A 1NRJB 4QL3A 3T1VA 1CEEA 1GNRA 4NL4H 4JYCA 3O8DA 2ZSDA 1MRSA 2H5EA 2PJZA 3NBXX 2UZ3A 4A8JC 2R6FA 3NBYC 2IS1A 1SHZA 2F3RA 4F4JA 1GZSA 3I1FA 1Q1EA 5B64A 4NPHA 4TMVA 5JI3E 5DHFA 2C78A 2UKDA 2W00A 5BWMA 4EKDA 1ZNZA 2WSSA 2CJWB 2HEIA 5JJLA 2REXB 4HDOB 3ZVLA 4DKXA 5DH9A 1U0JA 4A92A 1NKTA 1XCMA 3NXSA 4F38A 2IYXA 4MYUA 2YOGA 1PJRA 1F5NA 2V1XA 2OEPA 5IDVA 4JLPA 3REFA 1P72A 3QXSA 3UWKA 1YR9A 3K0SA 4IXNA 1G8HA 2NQ2C 3CNNA 2J0QA 2ODBA 5FOVA 1MO5A 2WWFA 3HYTA 5JCPA 3SEAA 3SFZA 1Z0JA 4L9WA 1JR3D 5KNCA 1L4YA 1DBSA 4HLCA 4LV8B 2ERYA 2IXFA 2HXYA 4QHYA 3V4FA 3I8SA 1T8TA 1Z22A 2ASEA 2RGNA 3R9WA 1RC8A 2ZTSA 4KBGA 1LW7A 1Q57A 4GMDA 1CRPA 4NCIA 1XPUA 1Z6XA 3FHCB 4KO8A 2O5VA 1JNYA 1VMAA 2IA5A 4LHXA 3ZIAA 4D80A 3CW2A 3ONWA 1OV4A 1D5CA 4C7OA 4MUAA 1BS1A 5DSZA 5BYJA 1CU1A 3OIUA 3D8BA 4KU4A 2WKQA 1KI9A 1XZQA 2FEMA 2JIZA 2PMDA 1W36B 2O52A 5CDFA 4M1YA 2WIAA 4A6PA 3AVXA 2ZU0C 4YXWA 3B1ZA 3MJHA 3A8TA 1SXJB 5FUYA 1A7JA 3ZGXA 1DAGA 1E2EA 3IEUA 1V5WA 2FZ4A 3PITA 4JL6A 1YHNA 4Q1CA 2QAGC 2WMOB 4PAQA 1L2TA 2H18A 4XOIA 3EZ6A 1KMHB 4B2LA 3IDQA 2F3TA 4S2EA 1OXXK 2GXQA 3AKDA 1XDBA 4B71A 3PUYA 2V7QD 4CYMA 1DO2A 3UANA 3W6PA 1E79D 2H17A 5LBIA 4BLRA 2Z5FA 1FW6A 3MWYW 4KV9A 4P32A 4MGYR 2CHQA 5E7MA 4DCTA 2O8DB 1KK3A 2NO9A 5FR1A 4TQUS 3FTQA 2VF7A 1E98A 4H9GA 1YKSA 1UAAA 1BMFA 1UBFA 1XF9A 2ONJA 2E9SA 4CIDA 2WPDA 4TMKA 1FPMA 1XB2A 4Q4LA 1QHYA 5C4GB 2WOOA 2DFTA 5CK5A 1M7GA 2VP4A 4BGDA 5JBQA 4P4UA 4M8NE 2HYDA 5GVRA 5CJ2A 3C4JA 4DLTA 2PCJA 2Z83A 1AQUA 3B1VA 3B9QA 2DFNA 3R20A 4LV5B 4XD7A 4B76A 4F92B 2B8TA 3BBPA 1Z2AA 2BBSA 2CK3D 3TR0A 1GSIA 1TF7A 3UPUA 5EP1A 3QPVA 1OYYA 1A4RA 4Z54A 4FD2A 1AGRA 3BE4A 2EFHB 2G1JA 5TDHA 1MV5A 4OHZA 1ZC4A 5SZIA 1YJ5A 4KSBA 1DO0A 3IPXA 4TZ0A 2OFOA 4PHHA 1XCPA 1P9NA 3KUCA 1N6NA 1TU4A 4A0FA 4WAUA 1LNZA 1YRBA 1KTVA 2QUZA 3RRNA 3KFVA 4UQOA 3A58B 2VEDA 2LKDA 5TARA 3LQQA 4LJ7A 4US0R 2ZJZA 1W4AA 1Z28A 2CCGA 1OXTA 4MRPA
chains in the Genus database with same CATH superfamily
3THWB 2IZ7A 3CISA 2H1HA 2RB4A 4BZXA 3U13A 4I4IA 1V0JA 2VVTA 3DVQX 4CRWB 3B3JA 3FTNA 3A7EA 3BIWA 4CI9A 1VP9A 2DF8A 2R8EA 4CL8A 2JLZA 4BMVA 2AI3A 2OHFA 2VZ0A 4HNUA 4KN8A 1LFDB 4C76A 4XPZA 3F90A 2CVPA 1N6RA 3CUYA 3N2LA 3OMWA 4H6PA 4ZO9A 4D5GA 4DMUB 4OXYA 1STOA 5EP2A 3NI2A 3GJ6A 2DFKB 4PEVA 3NJRA 3CNOA 2G1AA 3RWOA 4EHBA 3KJEA 4RKQA 1RKUA 3VO1A 3GJ5A 1U80A 2NU6B 3F4BA 3BGDA 4NV0A 5J5VA 4C88A 2VNJA 3DV0A 3QPWA 5COQA 1JAIA 4FQ8A 4AKEA 4Z4HA 1E5VA 4LA4A 5PNTA 4AECA 5A6SB 3OHSX 4G5OA 1T29A 4MRMB 2EG9A 3HBNA 4WGFA 4PG7A 3P9SA 5FFNA 3MD9A 4RKYA 4DG5A 2PUBA 1K0UA 1BXGB 3P2IA 2C9MA 3GH1A 4KPUB 4TKUB 4C0BA 4JFRA 4LRTB 4ZOEA 1CZOA 2FRDC 1ORIA 3BF7A 2D5AA 1A9ZA 2QMOA 1LBQA 5E4TA 3RRXA 4L6IA 4PGFA 5FI3A 721PA 4C4PA 3KXKA 1CWUA 3QVOA 1DCTA 1SUBA 4HDNA 1GTMA 3ZZ1A 1M6EX 4MITA 2AN4A 3KSDO 1DJMA 1J5XA 4QT0A 4FMCB 4NYIQ 1RJEA 3TRDA 1RSZA 3DUFB 3AM3A 4U5QA 2PGDA 1RXYA 2XA1A 4M86A 4WCFC 3EFEA 4B6SA 4ZOLF 1AHHA 3RT9A 4ZIRA 3PHGA 1HV8A 4WRRA 4UDXX 4JP3A 2EQBA 5AFSA 3SR3A 2DTXA 4D25A 2DFDA 2ICAA 5DGTA 1L4MA 2QJTA 3ISVA 2VPZA 4BX0A 1FJHA 4TRMA 1EX9A 2BKLA 2V5VA 5LQJA 1PNRA 3HFGA 3KL2A 1KL7A 4RZHA 3CG4A 3SC2B 2ECPA 3KPJA 1PFYA 4G67A 4AN0A 4BNMA 3N8IA 1TQ4A 2B4TO 1NPTO 2YJZA 3BMNB 3T61A 3TDNA 4BKRA 1VBNA 3BH6A 3FI9A 1PU2A 3KB1A 2OYRA 2BTOA 5D8DA 4HB3A 4LE2A 3TCNA 1XIVA 2P5YA 1Q0RA 4HVAA 2RHDA 2EHDA 1GIAA 2Q8NA 3C7TA 3WGLA 1T8SA 4FDTA 4ZQHA 1W0CA 4DVJA 2ENWA 1E3WB 4NCHA 3BILA 3WL8A 5HZKA 1IPFA 4UARA 3GIWA 4M46A 4EP1A 4HAXA 1XZKA 5CK4A 1X1EA 2JGNA 2WTMA 1AT1A 1OILA 2VPIA 2WTNA 1EFVA 1MDBA 2WZBA 3GVPA 5GTDA 2YJ4A 3DDSA 2ES4A 3RC2A 1MAUA 1M5TA 2AG1A 1CC1S 3ICWA 2ERCA 4RTPA 4ZI7B 4D8XA 3OAAA 1GFZA 4KEAA 4O25A 5LZ2A 3GEDA 4GSYA 2PJRA 4EVQA 2I55A 2QRVA 2XYPA 3VOBA 1BKYA 3NHSA 1Z6QA 4X63A 1IONA 3CO0S 3BIJA 1R6UA 4FONA 4ENTA 1FL9A 2Z9BA 3SNHA 1E2QA 2DY1A 1O8CA 1YA8A 2FZCA 3GAMA 4HFMA 1UM9B 2ZIFA 2J45A 1BWQA 1EFRD 1YQUA 2NN3C 3CT4A 4OL9A 2W2VA 3ZOZA 1TZJA 3ZYZA 1L7BA 3U7JA 3RK4A 3VDNB 2ID7A 2OSBA 1BIFA 2GAFA 1SRQA 2GZHA 4DV6B 1W30A 5EAIA 4WLFA 3FZGA 3E3AA 4CR7A 1OB5A 3RV3A 1G5TA 3B7GA 4ITVA 3HCNA 1BA2A 4BLSA 1DRKA 3NASA 6PFKA 3FLEA 3VX3A 2RGEA 1AKEA 3GJZA 2F43B 3EOZA 4MCJA 3WKBA 4X64B 5DN6D 3QPBA 4Y1FA 1TJYA 3HK2A 3K5WA 3QV1A 1BCSA 3RDPA 3CRW1 1C9EA 2Z98A 2QN6A 3IR5A 4R16A 1NTOA 3QMMA 2I2XB 1MU0A 3WIDA 1M2EA 4L4UA 1QAMA 4MQEB 2BR3A 1ULUA 3G1WA 3MZ0A 2W90A 4PU0A 1LBTA 3MAJA 3PI7A 2CHEA 4OM7A 1ZCJA 2C42A 3IPLA 1XZIA 3O3MB 3SBDA 4L6AA 1JEDA 1R9JA 4E7OA 1RRGA 2GQ0A 1Q16A 3K92A 4KWEA 1XMJA 4OLHA 1IXYA 3PCRB 4UTPA 5SZKB 4E5SA 1N8NA 1SU4A 5MGNA 4K1LA 4K3VA 4MHSA 1UKVY 5E1OA 3WYGA 2G3YA 1QHHA 1BE8A 1OXUA 2GF0A 2XXBA 1HE5A 3GXOA 3IALA 4N5LA 2I5PO 1ZU5A 2FPIA 4G81A 3SXPA 5K0CA 1VYUA 4D4GA 2A88A 1XXLA 2LE0A 3O2JA 1YDGA 2JFOA 1M1UA 5FNZA 3WGTA 3M4ZA 2V6IA 1M6VA 3EZGA 2PYIA 1UM8A 4WGGA 3HCEA 4ENSA 5FBVB 3AP2A 3CH4B 1MXFA 1FDTA 2PT7A 4IOKA 4Z0HO 1VDMA 4CUKA 4B3SB 3FUVA 4Y18A 3VR6D 1PJAA 3HH8A 1H2WA 4DEVA 4TV9B 1VPLA 1V6AA 3GCDA 5FBLB 1KP9A 4JNKA 5FTNA 3HDQA 1NBOA 3JQEA 4IIUA 1E5XA 4UTZA 4PG6A 2SICE 5LZ5A 3FPKA 4Y2SA 2WA2A 1XNQB 3SU8A 1V3VA 3PGXA 4UM9B 4EJMA 1OBHA 4YBZA 4B1FA 5ADUS 2R00A 4LE1A 3T9BA 2WSLA 3N2KB 4C1BA 3I9V6 2P69A 3MA0A 4HNSA 4O5AA 3K73O 2QLFA 2HFJA 3OPQA 3BGOS 5A03A 3MQFA 5JHHB 2IDZA 1BU8A 3RF7A 3PGMA 3CX7A 3OF5A 4LSWA 4EJSC 3DE5X 4DJTA 4FEEA 4O1IA 3URKA 1OIVA 1SXIA 2CMDA 4F3TA 1Z9BA 2FUEA 4RKFA 1SB9A 5FNVF 4ZQCB 1HC7A 1GEGA 2UZ0A 4TN5A 3VH2A 4HNVA 4TV9A 4BZPA 4I7EA 3MTIA 1KK0A 2BE7A 3M1YA 6REQA 1IDN1 4TMWA 3RFVA 4M54A 2QENA 2YQ4A 3NT4A 4OA5A 1FS6A 1IPHA 1JB9A 3FVVA 1A8PA 3HVIA 5BY2A 4LXXA 3ZGLA 4CFZA 4LSGA 4EEKA 3NC0C 5H4HA 5KB3A 4MB2A 1JAYA 3CEHA 3AKCA 2CW5A 1UPTA 2OCLA 1U8CB 4UPEA 3NUGA 2C9DA 3PQ7A 3RBZA 3SDSA 1L7XA 5JNRA 1JE1A 2CXNA 4AS1A 1PW5A 2HDNB 3A4YA 5J40A 3ZCQA 4OHOA 4FNGA 5FOXA 1FXUA 4H35A 3LC1O 1WDMA 4RF4A 1SVKA 2FPUA 4BQFA 1TCBA 3FW1A 3PLRA 2NW6A 1A8HA 1Z4JA 2YZMA 1W5EA 4J4TA 1XHFA 1BH2A 3A7DA 3EVNA 3U39A 3UF0A 1YC5A 3PGLA 1R4MB 1XRMA 4XTRA 5DGIA 4BJ3A 3AW9A 4TMFA 4U2KA 1NF8A 1WZIA 1EJ2A 3DTVB 1DINA 3J81A 3O6VA 4U00A 3B1XA 4IZOA 1ZCAA 3ED5A 2DTEA 4NQZA 2BEUA 2I2CA 4HWSA 1LLCA 1WX1A 1MN6A 2PWZA 2R97A 2WKPA 3BAFA 3HN7A 4UNSA 5BRJA 5BUQA 4IG9A 5JXGA 4CW7A 1LQUA 3WZ2A 3W7AA 3EBPA 1MX5A 4HDKB 5ES4B 1DJQA 1TVEA 2OZLA 3PU6A 4XASA 1ZLYA 4QSMA 2V0GA 1E9BA 3N6XA 4YONB 3UMJA 4F2DA 2B1GA 3AG5A 3PFKA 4WX2B 3KJNA 4UNIA 4ICIA 5UKDA 2IUUA 3KJFA 1VG8A 2YJTD 4JGBA 1JPUA 1SPXA 1W25A 2IU3A 5I9TA 3S2FA 4RJLA 2JJ2D 1QB8A 2EFDB 2C2HA 1EP3B 4X8OA 4B34A 1IH8A 1N2ZA 1EA5A 1NMQA 1VB3A 3AUFA 5EVJA 5B1DA 2ZR0A 5C8DA 3NRCA 1JLHA 3PF9A 4B40A 1IVSA 4HUQB 3GDFA 3L7LA 1JQAA 2Z3VA 1C2YA 1UMCB 2CSUA 2INGX 3KTFA 1G5QA 5KTMA 2FPWA 2JF0A 2IF2A 4U6NA 3WNDA 1LBEA 4AYWA 4ZXFA 4ZVKA 1HTTA 3M6XA 3SQXA 2GBIA 1CIJA 1X8JA 4QX6A 2OV6A 2QLMA 5AVSA 2J0VA 4QPNA 5ESRA 4UQLA 2C2XA 3BSSA 1ZN2A 4TZKA 1W19A 3GG9A 4HH3C 4EY6A 2CNOA 2XSZD 4EHIA 1TZCA 4HTAA 1H1DA 2OUKA 2RGCA 5LZ9A 4N6GA 5C18A 4LG1A 2EFJA 3IRVA 1GUFA 2H65A 1SUSA 2C00A 3AFGA 3KTAA 1AHNA 5TRTA 3O38A 3D2CA 1OFIA 4BV8A 2H5LA 4JI0B 3DMDA 1T6ZA 3K94A 4J0QA 2UUAB 2OAP1 1ZU4A 3S7TA 4B4KA 1O96A 5D3ZA 1JLLB 4PRZA 3TJZA 1MG5A 2C7GA 3AF4A 3P20A 1M1YE 2W4MA 5IJAA 1CDZA 3NPMA 4W7IA 1RXUA 3CUSA 4IDHA 3ZX4A 3LT1A 4DV1B 2I87A 2V7VA 4P58A 2K7FA 1RPZA 3IP7A 1V41E 1NE7A 4I5FA 1C4XA 1PT7A 3WKCA 3RVPA 1KVQA 4EB0A 2GWHA 4X90A 1E0SA 4LI3X 4DN6A 1DAIA 1MAVA 1O0SA 2JZNA 3OFVA 3OWOA 1I0IA 1L4BA 1ZD5A 2ZYVX 3PNVA 4HQ0A 4QTYA 5MGBA 2YVUA 3GGDA 4CR6A 1G3RA 1YDEA 2Y6UA 2Z58A 4RACA 4DWVA 3N39C 1M73E 3B5JA 3LZCA 1C29B 2VYVA 3FOWA 2BKUA 5AVUA 4FBMA 1JHUA 1K88A 2LXNA 3A9RA 1ONSA 4MZDA 1WEHA 3D5EA 5LXTB 1E92A 4H17A 2FR8C 2H2DA 2VT3A 3U4IA 3GLGB 1ZOIA 2VTEA 3LGXA 2ZTLA 1H2EA 1B93A 4AZ0B 5I9LA 2B4AA 1I3CA 1MORA 2BFEB 1Y9EA 4RF5A 4E94A 1KMIY 1NQUA 2JFVA 3B78A 3GUYA 2NTJA 2QE7D 2YWDA 4RXUA 5ECYA 3I62A 7MHTA 2OBXA 2Q27A 4S0ZA 1NVXQ 4FVTA 1OF1A 5FWYB 3LZ6A 2NUPB 2A1IA 3B5EA 1M6NA 1U2PA 3AVPA 1G5HA 4PS1A 4BU0A 1M67A 3LDUA 2FETA 3N6VA 3M9XA 4XCXA 3ZEIA 2JGIA 5LQMA 1XVTA 4LZLA 4ZODA 5ERGB 1R16A 1M2FA 3V2HA 3ZNOA 1M83A 4XGNA 5LZ8A 3R9KA 2CEAA 3VR2A 2AJ8A 1NR5A 3PTLA 1QLJA 4B2PA 1WPGA 5BN4B 4RK1A 3DS8A 4ARIA 2CFIA 1B74A 1GV0A 5JW6A 3OQPA 3R3HA 4Q19A 4UE2A 1Y3IA 1UFVA 4JXXA 2X0JA 5GWXA 3HUUA 1OW3B 3IUNA 3REQA 1XELA 2FX2A 4E70A 5B30A 4LTMA 4G5FA 1HETA 1F6BA 1ZHOA 2WD7A 1J06A 3A9TA 3SXJA 4N18A 4ZU6X 1HNZB 3VI3B 3FPCA 4RA9A 3W5BA 3RLFA 3GLIE 2PX3A 2ZBRA 3EWAA 3GPCA 5I7AA 1QIMA 1CY0A 2A5FA 3NTVA 4QTZA 2BPOA 3FYDA 3D6TB 4LY0A 5DXJA 1R0XA 4BFSA 3OPXA 4D46A 1TQDA 2JJQA 4HYQA 1TM4E 1GQRA 2BE9A 2HRZA 2I76A 2FPKA 3G2PA 3E5HA 4JVOA 1R1DA 2LGJA 3EEOA 5H70A 2WU1A 4RDCA 1OE0A 3ZTYA 2QTTA 3EQ7A 2RG1A 4ZQGA 3KQUA 3P32A 2X19A 2YWHA 4LYYA 3TXXA 3TTWA 5T3YA 3UICA 1V96A 1BHJA 2GKSA 5DN9A 3PICA 2WWTA 1M34A 1QVZA 2HK9A 3H1PA 2OBNA 3IHLA 2XOKA 4IMPA 3SKXA 1J9EA 1ZRSA 4NZNA 4ZO7A 1N2SA 2MSDB 1NXVA 1DV1A 2FHSA 4NHOA 3GROA 1K7XB 4UE6A 4W1QA 1QV7A 3NYRA 1ISIA 2JGKA 4HLUC 4Y1EA 1H94A 4PFQA 1UBHS 4YJGA 3IIMA 5ESXA 1DUIA 5ABPA 5DYNA 2E4YA 3L0YA 3O1HB 3BZBA 3CEJA 4DARA 2BFFB 4R9SA 3RVQA 1ML3A 1V3QE 1HMPA 1XD2B 2GYUA 4FFLA 4PYMA 4W8OA 4DLLA 5C7YA 2D0OB 1DKMA 1AKQA 1NNEA 2P11A 2OBFA 3LOUA 4PYKA 5E3HA 3BTSA 3S2IA 4DQ0A 4DLPA 1FUYB 3L02A 2JFBA 4QBFA 4BO6A 4W82A 4A8TA 1RVV1 4HZGA 3H19A 1M0SA 3QNUA 4WDRA 3BE6A 2J9FB 2QTHA 5IM5A 3KQMA 3A37A 3I6YA 3UGKA 1D6SA 3I01A 4BGIA 3Q8XB 4RY2A 4B3IA 1IHXA 1H4TA 4XYMA 4UFOA 2I67A 1CUEA 1JKMA 5I8ZA 5BSKA 2GUGA 1SWVA 4MW0A 5EHZA 4PANA 5AVRA 1UBRS 2EP5A 3Q7RA 3V8VA 4LWZA 1WXIA 5C5CA 5I7WA 5J4KA 1JH9A 4DM3A 1IUKA 2LW7A 2DPHA 2X4LA 3AFHA 3WFIA 2OLJA 2O8FA 4IX1A 4LKRA 3ZBUA 1R64A 1IZZA 1U6IA 3DEZA 3RBXA 3R7DA 3HPRA 4KNWA 1P2TA 4QPPA 1VCHA 1SJ9A 2PD3A 3V7YA 5E4FA 1N5JA 4JKYA 3R6TA 4LF9B 4GRAA 3T12A 3TLXA 1BZYA 2IZ0A 2ZXEA 3MSCA 3OF2A 1YJCA 3QUAA 5FWDA 1TNDA 3LCJA 2CE7A 2NACA 3GOQA 1ZVJA 3MM4A 3FUCA 4YMIA 3RU2A 1Y4DE 3UXYA 1ZJYA 2O2CA 1CR4A 1V43A 3D7LA 2BHSA 4UBMA 5EIAA 1EGVB 4CT4B 1B26A 3H17A 1ZEJA 1B1AA 4XDZA 3CVUA 1FCJA 4I1OA 4EI2A 2FWJA 1A3CA 2P7HA 2PT9A 2XT0A 2F59A 2ZSJA 1WDTA 3EF1A 4MHOA 3T52A 4ID3A 4OQDA 3EG9A 3KKMA 2IYRA 5KTTA 3TB6A 3U3OA 1MB3A 3IAUA 1ENPA 1Z6YA 2OCGA 5AJZA 3HM9A 1TJNA 2WTAA 5KOJA 4H1HA 4B44A 1TYDE 1YS9A 5C7IO 1O96B 3R5XA 4HX2A 1BSVA 5KYWA 2B69A 1SXJC 4J7CA 3TQOA 5H02A 2Q1XA 1RWWA 2IY7A 4AO7A 2WV7A 3DL0A 2XZOA 1QONA 1NURA 3GDWA 3EEFA 4RD2A 3PHJA 1QH0A 1F7UA 5FQNA 4EGAA 1EQAA 1DG1G 3REGA 3ZQKA 3DDUA 1ZAYA 3E7XA 3M4XA 1PGOA 1NM5A 5KDLA 1ZA2A 3D0RA 2AEEA 2AOWA 1WBBA 4LOJA 3WYCA 2XSZA 3VU9B 2FW6A 3T6KA 1WMDA 2P2NA 3BQMB 1WA5A 2A9FA 2GZRA 3EMVA 4YRLA 4DQLA 1O4VA 1HT0A 3H86A 2Y68A 1I2ZA 1JBKA 2FOLA 4HNHA 3LKBA 3K05A 4J4HA 4JI5B 3UOGA 3CS3A 1FS5A 2B3DA 4TV8F 1VL1A 3T9CA 4B81A 2NSHA 2WFLA 3CUEF 4XWKA 1XP5A 4J91A 3KLBA 1YVPA 4W8GA 3HKBA 2DQSA 4U3JB 2XAAA 3CH5A 1FXWF 3D1LA 2OCIA 2BEVB 4RHYA 3T7SA 2XGJA 4LSZA 1U04A 1J07A 2J3QA 2LDXA 2BR4A 4G1VA 4Q3CA 4QOSA 1JG7A 1FQKA 1MTZA 5EKDA 4UM9D 4WKCA 5TVKA 3SQOA 3WIUA 1VE7A 3Q7TA 4DRYA 3FVWA 4MYHA 1SIUA 3MGBA 4P93A 5DK4A 4QG3A 1YFJA 1W1UA 3HR8A 2OKGA 3LW8A 4BNYA 5GJBA 4KBFA 3INTA 3OJ0A 3I6QA 2IH4A 2VK4A 2YXBA 1Y8RA 3DOJA 4AQDA 3IILA 5JJIA 1CK4A 4KQ2A 1HDXA 2R4TA 1IWBB 1YJQA 1V47A 3KKNA 3RS9A 1GP2A 4WL0A 3H0KA 1T5SA 2XNDA 3L0CA 3R1IA 1NVVQ 3JAWB 4CDGA 4R8KA 4ZAXA 4CMHA 3RABA 4XYLA 1IOVA 4PQRA 2W37A 3N2ZB 3VOTA 4E2XA 2FFRA 2EBHX 3T41A 2ESRA 3B9PA 4D43A 5EZ5A 5LDDC 3GWZA 4TKVA 4LBZA 4Z3KA 4CF7A 1O7JA 3K6SA 3AGPA 5EMKA 1LQ2A 1YIAA 1UXKA 3EC7A 3OPMA 4XJTA 4RNDB 1NT2A 3UMSA 4YI5A 2QORA 3LM8A 1FNNA 2XVXA 3PX2A 5FO0A 4AJEA 2Q2OA 5JSZB 2FZGA 3I4FA 4KR3A 1GUAA 4GGMX 5CDSA 1YULA 1TGYA 3PXBA 1MR3F 1ST3A 1Y4ZA 2FN8A 1WCXA 1JHOA 1YQDA 2J48A 1VIYA 4QARA 4COOA 2J6IA 3GT4A 4Y6SA 4UDNA 1WMAA 3I73A 1ODCA 2QM7A 1W49A 3HYSA 2EAUA 1U81A 4BNGA 4DCGA 1AX9A 2NZYA 5AR1A 5F7XA 3FPFA 3L79A 1TVMA 1DSSG 3GT0A 1Z5ZA 2W6MA 4XGQA 2WK1A 2YW9A 2VZLA 4GOKA 4XQ9A 3VNVA 3FYUC 4POAA 2Z3ZA 1E0AA 4BMPB 3TJMA 2HLNA 1B23P 3G1TA 5EMMA 2IPLA 3DZDA 5CLFA 4S05A 1E3QA 2ZIVB 1VJ5A 3FTFA 1I30A 3D6VA 3RHSA 2VAPA 1G2QA 2RMKA 1RP1A 1WS6A 1ULHA 2GTPA 2OXEA 3VHQA 3SYKA 1RHUA 4W5RA 2NXJA 3RYHB 4JBYA 5GOTA 1YOVB 1Z5OA 4MW1A 4BYGA 5CXQA 3DZKA 3WA6A 2PXXA 1W4LA 5A7FA 1I6MA 4YCAA 5AKJA 2WNIA 2JDID 3IV7A 3DMPA 3KHKA 4G1EB 4G9BA 5A4KA 3CXUA 1TJ4A 2CD7A 3MMNA 4OEHA 1NR1A 4JC0A 5CB4F 1M10A 2CNDA 1GFSA 2F9FA 3S1LA 3UV7A 5HUJA 1YE3A 1EH5A 1A9QA 2XF2A 2ZBVA 3RSOA 2QTWB 2O50A 2AKYA 2PMEA 3UNXA 1NI5A 1EWTA 3DXXA 3FLBA 4R83A 3ELDA 2O9JA 5EGSA 2I4NA 3D43A 4JGIA 4V0MA 4H3KB 3TKYA 3ZJ4A 5F2OA 5LN1A 1GRCA 3M6AA 5EZQA 3RSFA 2F1HA 3ZBPA 3Q2OA 5H7XA 1M6YA 4EPWA 1E8DA 1DBQA 1KQPA 4YT8A 1KMCA 2GT1A 2ZDQA 4IBOA 3HN2A 3DE1X 5ITSA 5DWDA 5F23A 3KQLA 1WB9A 2P0AA 3KYCA 3HA2A 3G9QA 1Z8DA 4NOJA 2E2WA 4Q66C 3ABRB 4Q4JB 4DC0A 3GBPA 3UFXB 2ZS9A 3I2IA 4A8HA 3R0XA 1F60A 1S2DA 2VNKA 4MK4A 4TVOA 5IT9A 3LTNC 2C8LA 1QHHB 1RNLA 2RI0A 4BQPA 5CR9A 5AHOA 2DP4E 3HKDB 4DIKA 5GINE 4L8GA 3TB4A 4MUIA 5FI1B 4AK9A 5DM0A 2BEVA 2WC1A 4KIGA 4L3WA 4B32A 3C16C 4R8RA 5EXEA 3TM4A 5LA6A 3NBFA 4N4AA 4BRUA 1X14A 5EZYB 1E0DA 3I3SR 3WBBA 3NONA 5DHSA 4PYJA 3Q10A 1P91A 1Q17A 2QXYA 3RCBA 4MGIR 2RHBA 3FCAA 4RETA 5E1DA 1QWSA 1SMKA 5TPWA 1IBKB 2HT6A 1QJCA 3IUPA 1S4MA 2V97A 3PJEA 2O8EA 1D9ZA 1R8SA 5KBYA 2O3TA 1I1NA 1BHQ1 1RWMA 3JD2A 4JBWA 2ILVA 5T4HA 5HE8A 5DX1A 4G5HA 1S5PA 4GGOA 3H1FA 4MQFA 2HPAA 2ZWIA 2YX1A 4HYTA 1XZAA 1Z5PA 1KNXA 3OFNA 4NZ9A 4IJMA 1ZN8A 2XODA 4BO4A 3VH3A 2AJBA 1BYUA 1NXWA 3QY0A 1R5NA 3TD2A 2GRUA 5DLEA 3UK0A 4C3ZA 5L6LB 1FDIA 4BKUA 1VLVA 1JL3A 3E4CA 3W4JA 1AQ6A 2X58A 2P6OA 2ZIXB 1JLRA 2Q2VA 1DAPA 3K5HA 4IF6A 3ETLA 4ZVTA 2NU8A 1AGPA 1B76A 2HLHA 4JEMA 5CYPA 5BOSB 2NMVA 4RYLA 1MFPA 2OHOA 3V4VB 3DMYA 2ZJ7A 4OLFA 2H7VA 3RYTC 1OI4A 1S3SA 1JDPA 3I9FA 2PRKA 4LMRA 4RTQA 4P2GA 5CDFE 1LFAA 4UVEA 5IXYA 1CUVA 1SIBE 2FSFA 4TMTA 1ATZA 4BLQA 1R6VA 2YYZA 5JPIA 1RYFA 1XMXA 4P84A 1H4QA 5I7RA 3KKZA 1QO0D 1O95C 1FQWA 1KYIA 4PX5A 2YRXA 3CLTC 1OLOA 4KDFA 3HHPA 4PNPA 2C7PA 2HRCA 1NN3A 2JEZA 2XV1A 4JKIA 4TL9A 4UJ5A 5DW3A 4CJXA 4Z9YA 2JGLA 3H9GA 4BMYA 4F60A 5IXJA 3PDIB 1OA0A 4U7DA 1X9GA 3IOBA 3WAJA 4PX3A 1JDNA 3PVCA 5INTA 1CEYA 1Y80A 2GJKA 2VI5A 4RFSB 2E3JA 3QLUA 1IZ0A 1XA0A 3DEFA 1SN7A 2YHIA 4M6WA 4M7WA 2BMEA 5K0LA 1CF9A 3JQ8B 3CLHA 4EMTA 4F71A 4E5MA 3I5YA 1W36D 2RJNA 3DVRX 2QZSA 2NUTB 3IQHX 2ZJ1A 1QF9A 2J5KA 3DMFA 3QF7A 1SQ0A 5F4BA 2P4SA 4HYEA 1EWQA 3WK4A 1MAHA 4GWGA 2PRSA 4RVSA 2Y1KA 2QI9F 3FIJA 4R41A 1OJLA 5KREA 5KOHA 5IRCD 4MKXA 3IVGA 2WLTA 3GB9A 3RHFA 2X9LA 2JGMA 4XFDA 1SXHA 3RVRA 3ZCSA 1E96A 2R5WA 3OOWA 2ONCA 4C5BA 4Z9FA 3BRWA 4L7VA 2PD4A 1ORVA 16PKA 3OTWA 4DMMA 4EB6A 4DV4B 1P2DA 2AXQA 5K3OA 3MMPA 1G64A 1PNVA 3I76A 3RW9A 2A1UA 2YFYA 2EWVA 4GQIA 3ZCPA 4MV4A 5I6DA 1KMMA 2X9NA 4NICA 2PZKA 4U2GA 5LIRA 3IL2A 2YHIB 4UU8A 4JLDA 1SBZA 1NXPA 4TPKA 2DXIA 1KVRA 1XAJA 1QCYA 2FG7C 1VJ1A 3IQWA 3QLJA 3OUUA 1SOMA 3OE7D 1HEYA 4D4JA 3J81k 2FWRA 4II2A 4P5PA 4E13A 1N5LA 1JFVA 3AT1A 3KWMA 3IRUA 5KHLB 1PV1A 4J7XA 3JQPA 3V1TC 1TCCA 2GM5A 1DAMA 5TF0A 4XB2A 1Z0DA 3DUWA 5AHKA 1OX4A 5J9FA 4LYGA 2HCJB 3PXAA 4HEJA 1V35A 2P77A 4M4SA 1NBEA 2B6NA 4BEJA 1JTVA 4S1TA 1RAHA 2G5TA 1ZDMA 3HR7A 4UEKA 2I1LA 4NKRA 2LD4A 1E6UA 1JVNA 3ZU6A 1WETA 4RKRA 3T8YA 3CH6A 4KQGA 1Q1AA 3OECA 3IVXA 5LQNA 1I1OA 1SD5A 3FWZA 3ZLJA 2ZWAA 1HYQA 3L1IA 4TKMA 4ACBA 1XJ5A 1BOOA 1VHWA 3RVMA 3OIFA 5JPCA 1II0A 3VZDA 1I3LA 2Q45A 4TLDA 2DULA 4KMRA 5H68A 1EBFA 1W0JD 4M8LA 2XOXA 4BO7A 3LUBA 4FHEA 5AKEA 1AB6A 2ODNA 2VN8A 1BU5A 2CXQA 3C3JA 3SSAA 2B7BA 4DNQA 3IKMB 1AV6A 5HSGA 3LLCA 1U0EA 3DZHA 1PG5A 5M04A 3RO7A 5KINB 4QDOA 5CVEA 4DS3A 2DQZA 4QQRA 1O95D 3O9VA 3QMPA 4RD3A 2GF9A 1J5PA 2FXIA 3NBKA 4FSHA 4Q3NA 3IKTA 1UUFA 1Z68A 1Y3BE 3INYA 2B2XA 2VUHB 3QENA 3VNRA 4JHLA 1AGYA 4S12A 4UDYX 1SULA 3PV0A 5ILQA 4Q02A 3WNBA 4Y6RA 1S8AA 4MP8A 1U3TA 1YVDA 3SX2A 3AVWA 1G1MA 1T4GA 3H2SA 3UHAA 4BVFA 4I4NA 5C4MA 4B7UA 3G5LA 4WKNA 1L5ZA 3SN6A 4F46A 1JW9B 4H6WA 2O7VA 1PL7A 3VUFA 2WF5A 3W3AA 5DYYA 3DXFA 4U5XA 2WBLC 4NPAA 3HG7A 2QA5A 4Q37A 1AZWA 5TLSA 4J75A 1C0PA 1XTKA 3R7LA 3GRYA 3R6LA 3V2GA 4ZI2A 1LEHA 3FMGA 4JP1A 3RVKA 5HPYB 2F90A 2W6ID 1ETHA 3AEZA 1CPYA 4KRYA 4N9QA 4ZK2A 3T5PA 2AMLA 3I32A 5LMZA 4MNTA 4AYTA 4QWMA 5IK2D 4PPYA 3DHWC 2VKTA 4E2YA 1AC5A 4CN9A 3SEFA 1R6AA 2V74B 2YDXA 3MNFA 3Q5GA 2ZUUA 2BGJA 1A82A 5EE5B 5JFGA 3GGSA 4RW0A 1N57A 4Q7EA 3N74A 4JQSA 5EJGA 3RUEA 1PI3A 1UQRA 4F93B 4LOAA 2QHXA 1COZA 4AVYA 4V0LA 1A5ZA 4KDRA 1A88A 4J43A 3CTMA 4O2AF 5KYGA 4OHYA 1JU9A 2EF0A 2XQJA 3KQQA 4NENA 4AD8A 5HZGA 3X1WA 2F4VB 3KCQA 1JXQA 1J09A 2M6SA 3EVAA 3IUEA 1KJJA 4Y0AA 4CTOA 1Y82A 2IC5A 3DBLB 1XZ8A 1NVKA 3D7MA 2ZIXA 3HJUA 3HU2A 1XZGA 2IYUA 3K9HA 1MDFA 4PZPA 1W0JA 1QRRA 2BZ1A 2EGGA 3BCSA 3L7DA 1N2XA 3UUFA 2OSVA 2ZM6B 1PS9A 1GLGA 4G8JA 1COWD 2KPOA 1QRTA 4RVGA 4L22A 2IDMA 1ZGAA 4MVJG 4YJ3F 5F4ZA 3FWYA 5E2IA 4RTJA 5CITA 5KMGA 2GKGA 1DI0A 1XF1A 2VSFA 2QD2A 4WOCA 1R2QA 2CL5A 2XCIA 3NRBA 4NYMR 3VO2A 1Z15A 1OFUA 1N0WA 1UK6A 1FZQA 2IQIA 3HNRA 4L4SA 4NAVA 1WXDA 3NBMA 1I13A 3LXXA 4FBLA 4EHJA 4O3MA 1VMEA 5BUSA 2Z2KA 1XMQB 5FF9A 2A14A 3G5UA 3AOGA 2VJMB 6YASA 5JD5A 1T91A 2YVKA 3DCNA 5KHAA 5DNDA 3QX3A 4X1YB 5TT1A 3D7SA 3A1NA 1L5HA 2O5RA 4EX6A 5C80A 1GKKA 4H0NA 1N3IA 5A5FA 4QYMA 2JHCA 2G07A 5HQ3B 1NNUA 2R86A 3D1VA 3ZNPA 1VSVA 3AJ9A 4D56A 4GBGA 3HDJA 4DPMA 3RC3A 2VYCA 1LX6A 4WK6A 3I1JA 4MZXA 3I92A 2APJA 4R9VA 2PZEA 4R51A 1JT9A 4V0RA 2WIKA 2QWXA 3PK0A 4H18A 1P39A 3CLKA 4IUBS 3TSCA 1N34B 1KA9H 3EUEA 3A05A 4JFAA 4KN6A 2WKWA 1L8LA 3SDZA 1PHRA 4EFLA 1ANKA 2ZETA 4EITA 3STWA 2DBRA 4F21A 1HM5A 3AYZB 1PR4A 4RQTA 3TLBA 3ENKA 3IQIX 4FFDA 3C3AA 3O8CA 2X23A 2ZJOA 2XB4A 2ZT7A 2XUPA 3QQ5A 4L74A 2CHVA 4QLBA 3O2NA 2NZ8A 1LI5A 2HHLA 2R47A 2WUWE 3EARA 4FOLA 4NAHA 4KE7A 5ETJA 3JWHA 1HXHA 3NH6A 3HHEA 3WK6A 4MW5A 1YTLA 4CNQA 5CU7A 1YS4A 1TM7E 4Z6KA 2ZU6A 3D5QA 4RAOA 4O2BF 1OHHA 3PBKA 4G0PA 3AVYA 1PR6A 3WB0A 1N5RA 5ADWA 5SYMA 1XA3A 1B8PA 1YKGA 2JGJA 1P1FA 4HTFB 2XWSA 4AN4A 1P77A 4G2TA 4LW8A 7MDHA 4G24A 3IE1A 5CIYA 5EXXA 4ALIA 3WKDA 2JI4A 2HIHA 2C83A 4EELA 3ZZUA 1NBIA 3OPNA 1CZKA 4L57A 3T3EA 1VPEA 4B82A 3IHKA 3AP3A 3L0DA 5FKJA 2FZLA 2OHHA 4AM8A 5A4DA 3MCVA 4UKDA 2CF6A 2VP3A 3T0GA 3SC6A 1GG8A 1CQJA 1S4QA 3D3QA 2IX9A 4ON9A 4XUCA 4U7FA 2VJBA 4X7PA 3RS8A 1Q1QA 4LJ4A 4KSYA 5A1JA 3DZGA 5B4TA 4R6WA 4DR1B 2G4LA 1EDDA 2OENG 3WHIA 1FMTA 3QGMA 5KNDD 3CR3C 3E7FA 1K9SA 1PL0A 4B9EA 1KK1A 1UJ2A 2H2HA 3A9CA 4XIGS 4DMGA 3EJWA 4EZBA 1UFQA 2CVQA 2GDJA 2C77A 4DV5B 1JS1X 1ZO8A 2B1JA 3STVA 1KEKA 3DFMA 4NYIR 3KPUA 5HOQA 2IS2A 5K20A 4KC0A 4H7HA 2Q49A 3IUBA 3O4IA 4KQEA 2FQYA 4JA0A 4TWZA 1VKNA 3H11B 3WI7A 4C4YA 2WJJA 5EJ2A 4BJ1A 1O8BA 1KFKB 4NU6A 1JALA 2YBEA 4QEKA 2BBOA 4F91B 1FTSA 4MMXB 4YBRA 2OCPA 1KZGB 5F21A 3E27A 5M3BA 4QYXA 5TGZA 4EZEA 6NULA 4OLBA 3LI2A 4X1YA 1C0EA 4BFZA 3W8NA 4MI6A 4EKEA 1GKYA 1G8KA 1U4OA 2ZROA 3UIEA 3LA8A 1N75A 2JDIA 2WWXA 5DSXA 3ZJ5A 3W34A 1YZKA 4JD5A 3IMCA 3B6JA 3QQPA 4RHUA 2XPCA 1RRVA 2ZP1A 4R0VA 4X9XA 2QN3A 3H2KA 1Y5NA 1H1LB 1J2UA 1H9AA 1Z2NX 2AE2A 4TWAA 3ROKA 3RIHA 4GDFA 1YUMA 3VZSA 1QHXA 2BEUB 5AJTA 8LDHA 2RKBA 3AV0B 4IOLA 1GWNA 4MA5A 1QVAA 1YE5A 5GAJA 3ANLA 4M8KA 1XWWA 4GE3A 2DU8A 4RGVA 3PRJA 4DYDA 5FI0B 2DKOA 1FQOA 2VDUE 4HWTA 4XSVA 3GA7A 4OOFA 4ILEA 1VJ0A 1JHDA 3BEOA 3TD9A 1LK5A 1A9XA 2RHRA 2ZQYA 2ABWA 4BP1A 2P9GA 5F3WB 5JYEA 3I39X 4P7GA 3AVUA 1JILA 3V8QA 1AXRA 2XJ9A 1C8KA 5CT8A 3TEMA 4AUMA 4ZJUA 1R9MA 1B3BA 1SZJG 3IX7A 2K5UA 1QZXA 2WSSD 4B4DA 3ANSA 3ZWVA 1GDHA 5IBCA 1ILEA 2P4UA 1KSJA 2R9VA 4TSRA 2EP7A 2BGUA 2DFPA 4Q9NA 3WQSB 2Q7OE 4NBKA 1CE8B 1T8YA 3NG1A 2DWOA 2CUTA 5A4IS 4UTVA 3OZVA 3K3PA 4HQNA 2BHTA 2PMKA 4AG5A 1N4DA 4JOQA 4CQLB 2VPQA 5DYIA 5JLJA 1R0SA 2POCA 3R77A 4RADA 1FP7A 1PJZA 3BHIA 1F1JA 4HG2A 4NCJA 5DNYB 4K46A 5F1PA 2VEOA 1R0CA 1PZHA 3C8UA 4MS1A 4CDMA 1VECA 4IFIA