4Q1CA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 8 {2,2'-[{4-[(2r)-4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-2,3-dihydro-1,3-thiazol-2-yl]benzene-1,2-diyl}bis(oxy)]diethanol}
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1cA00
1JR6A 1OLOA 3VU9B 4WOPA 1YZNA 3FGNA 4KFUA 2ASEA 2VP9A 3RC3A 1G19A 2YV5A 4BRWA 4AD8A 4F7WA 2ZI3A 2ZYWX 5DI3B 3B1YA 2OEPA 1B0UA 1XCMA 1A7JA 2R8RA 2F43B 4YONB 4KYIB 1J90A 1KSHA 2IF0A 4ERNA 4P31A 1E9EA 4LCBA 1X3SA 4EAQA 1YR6A 3B8HA 2AK2A 1MH1A 2QGNA 3NBYC 1GP2A 2BMEA 4NP6A 4BEBA 1LS1A 1UBEA 4QJ5A 1J99A 1N6PA 1E1QA 2VHUA 2PLFA 2FGKA 5A0FA 3X2SA 1NKTA 3KTAB 3VX3A 3NEYA 3DPUA 4FMCF 4FINA 1RE0A 4A8JA 1P61B 4IVPA 4EUNA 1YHNA 2CLSA 5GJWC 3TUJC 4OI4A 3TSZA 2MSEB 1FP7A 3F3YA 3W6OA 2ZRGA 2IYQA 1W36B 1JPNA 4GDFA 4B3GA 4C0BA 3VR5A 4QNRA 4ARZB 1E2NA 4PC7A 5HR5A 5FTJA 2OLKA 4RSGA 1DO0A 2O8FB 1JAIA 1IHUA 1KO1A 1US8B 1SKYE 2ZSAA 4TLAA 1YQTA 4G5SA 4IEEA 4LV8B 1GRQA 2OE2A 2REBA 3HYTA 3O47A 1E99A 1VKJA 3QQ5A 4B33A 1RJ9A 2JJ1D 4GNKA 2EFGA 1W49A 4LUCA 3RDPA 1M7HA 1KMHB 1NMZA 2HT6A 5CB8A 1NL3A 1WXQA 4IDHA 1H8HD 2JIZD 3HYRA 2FE4A 5G40A 1XEXB 4MA4A 4OI1A 1XWIA 4D4KA 5CITA 3NWJA 1SXJD 3KKPA 3PUZA 5AR1A 1YZKA 4DEYA 1IN8A 2ODEA 3OEEA 3VNVA 1A82A 2GXSA 4XIGS 2W2TA 4RJLA 2GEUA 2X8AA 3I62A 4LBVA 1HY3A 3OAAD 1T4GA 1UKVY 4JBYA 5D3QA 1R0XA 1S9DA 4M1MA 1QF9A 2DFNA 1G4UR 4M4SA 2R6AA 1E6CA 3THOA 1QG2A 2BEKA 3OIYA 1DS6A 2X1VA 1KDPA 4LC0A 4M1SA 3AF2A 4XH9B 3ZIAD 5JS8A 2JLYA 1VCOA 1MRNA 3CPEA 3R7WA 4EPVA 1G3RA 4PC1A 2ZI6A 1G8FA 2V4ZA 3SR0A 4TMXA 1J70A 2VYFA 2P6RA 1TL7C 4QGAA 4OHWA 2FDCA 1K5DA 3QXSA 4MRVA 4Q9JA 1Z47A 1JR3A 1U0LA 4NCIA 2MSDB 1NY5A 2AD5A 2EYQA 5EE0A 2ZE6A 4Q1CA 5FTMA 1XFAA 3GLHB 1NBME 3GJ8A 4I1UA 4TTRA 2QQEA 3KXIA 5JI3E 4G0NA 4Q47A 2R2AA 3TLXA 5JWOA 4LJ7A 4Q9HA 4MKHA 5FH9A 1OXTA 2PCLA 3QKUA 2PH1A 3WP1B 4UNNA 1ZC4A 1IJFA 4W7SA 1E4YA 1EGAA 2AKYA 3MUFA 1TUEA 5CIQA 4C7OA 2ZJOA 3FMPB 1X86B 3QUSA 3PR1A 1CBUA 4JVLA 4R2HA 4FMDB 2QAGC 4CW7A 4R2IA 1E2KA 1G8YA 1DPFA 1U0JA 1A1VA 1HA3A 4HZUB 1W48A 4HLQB 2BBOA 1R8SA 3RHFA 3EAQA 4PQFA 2IS4A 3D31A 1C9KA 1P73A 1XD2A 1Z6YA 1LTQA 2V54A 1W0JD 2WKQA 2AWOA 5LDDC 2XJ4A 1AA9A 1OIVA 1UKYA 1KJYA 3BIFA 2JATA 4PC3A 5DLQC 2L0XA 5FUVA 4Q4HA 1N25A 1UBGA 3L2OB 2GJ9A 4FWTA 2QPOA 2ZE5A 1GUAA 4WAUA 2IX3A 2ZU6A 1RIFA 4LSGA 4DXAA 1L4YA 1OHHD 1XU4A 1WRBA 1YRBA 1MO6A 2RHDA 4ZIRA 4A15A 3LXRA 5FTLA 3X1DA 2GK7A 2ZI5A 1ESNA 2BBWA 2BEJA 2HEIA 3U5ZB 4TL7A 4PAOA 4KXFB 1HH4A 2QY9A 1DBSA 4G01B 4CIDA 5GVSA 2PMKA 2CE7A 2BM0A 4DC9A 2QMOA 1KDTA 2XITA 4MRNA 4ZI2A 2GBLA 3SFVA 4RFVA 5CM8B 4GSYA 2I1VB 2R6FA 4TL9A 4L5BA 1H8EA 3ZZTA 3BWDD 1P4SA 4TWZA 3U7GA 3K0CA 3THYA 3U6BA 2IHYA 2QU8A 1E3MA 4MITA 2I1QA 3Q7PA 1O3YA 1NVVQ 1RRCA 3OIWA 4Q66C 3NBFA 1P6XA 2F3RA 1KO5A 4LBWA 4A4DA 1KY3A 4AKHA 2ZS7A 1CR1A 5FBQB 3L0SA 3D6TB 3VR1A 3LX5A 3K0FA 1CLUA 2HCBA 4B3FX 3TAUA 2R9VA 4NMMA 2IYSA 4URVR 3AV0B 1ZM3A 3KX2A 1ZIOA 2W2XA 2J0SA 3PV0A 2ZVPX 1WCV1 3MGCA 4B3BA 2O8EA 2ZRHA 2YWEA 4TMZA 4EPRA 1LVGA 4JL5A 1L8QA 1MO3A 3CH4B 1P60A 2QPAA 5HPYB 3UMRA 5EUMA 1RRPA 2VHJA 5LB2A 2QSZA 5AJYA 3MAAC 3OEHA 1EG7A 5TB5A 5D3MB 4OQMA 2QPTA 2EVWX 1VDZA 3G82C 4EDHA 2Z4SA 2FF7A 4DCNA 4D82A 3W3ZB 821PA 3RWMB 1GZSA 4QGHA 3DHWC 5EXTA 2R6DA 4KI0A 2R6GA 2BCJQ 1GOTA 2O52A 3Q8XB 1E96A 1KI9A 1OJLA 2WMNB 3EWAA 3SEAA 1PLLA 1G8PA 1T91A 3GLFA 4A8JC 1OB2A 2RGGA 2IEYA 3IEUA 4B43A 3B7GA 1P9RA 1BH2A 4XVRA 1GDDA 4PSKA 3FMIA 2NO6A 1NG9A 3VMFA 2QM7A 2WPDD 4RZUA 4A0GA 4W5HA 1WF3A 2ZI4A 1FW6A 4Z54A 1AZTA 1IQPA 2FGJA 3TW8B 4OI0A 4BFZA 3NG1A 3TNFA 3GPLA 2J3EA 2DFLA 1UPTA 5FFMA 3V9PA 3AVTA 1CRQA 3TIFA 2OFXA 4M0LA 4XD7D 3B9PA 4LJ6A 5A5GA 3ZD7A 2IYRA 4BRUA 3QPVA 4URXR 2Z0MA 1Z08A 3GCGA 2OBNA 2IF2A 4ILEA 4C0AC 4JSTA 3EIQA 3LD9A 4B3DA 5DN6D 4GRAA 1DAGA 1JECA 2GF0A 3B85A 5CJPA 2QP4A 5E3HA 3QPUA 1F6BA 5DYIA 3OIUA 4KITB 2OESA 1NRJB 1PUJA 1R8QA 4PO1A 3EZFA 2PT5A 2C95A 3CBQA 3FWYA 4TQUS 4RZ3A 2GDJA 4DSOA 2ZI7A 3LY5A 4CEIA 4G3XA 4BZPA 1IY1A 1ZNYA 5KDLA 1Q1EA 3QF4A 4OK5A 1KI1A 2ZJ5A 1GNPA 2BMFA 2J0UA 1OW3B 2RHMA 2YZ2A 1XZPA 4ZKEA 2ZQ5A 4JKIA 3W5JA 2H1LA 2J87A 3W9YA 1K8RA 2RAPA 2JJ1A 2UZIR 1T8UA 2QN6A 1UEIA 1SVKA 1XPRA 2YC2C 3B78A 1H8HA 2JIZA 3MJHA 3SN6A 3NC1C 4O3MA 1SXJA 3WMEA 3AQ4A 2QTFA 2RGAA 3W90A 2C5LA 5KNBA 3MSXA 1TQ6A 1N5KA 1WBBA 4MYHA 1TTTA 1R0YA 2K5UA 3EARA 4JLAA 4PHGA 2QBYA 3OAAA 2AFIE 4IFBA 5AWFC 1KO4A 3U3MA 2GEVA 1XTIA 4D6PA 1J2JA 2GXQA 2ZJBA 2AKAB 421PA 2ZR9A 4UXJA 3MWKA 4U02A 4A8JB 5JHHB 4C2UA 5FBLB 3BC1A 1U9IC 1E9SA 3ZIAA 3O8BA 5B58C 3OE7D 4AG6A 1KO7A 3BB3A 1XJ0A 1KNXA 1LNZA 2IYWA 3MMPA 1CP2A 3QVUA 3VKWA 3W8RA 3TUZC 1ZNWA 1N2CE 4GL2A 4E07A 4PSVA 1SVIA 4OKSA 2PZGA 3NHAA 2HF8A 4RD4A 4MKGA 1FNMA 5AUQA 4Q19A 4DCTA 5FPKA 3N2IA 3QG1A 3EPJA 2GESA 1W5TA 2AFHE 5HE8A 4B35A 3KKOA 2D7CA 4D0GA 1E9RA 1NJFA 4JZKA 2OAP1 3L0OA 4E09A 4TLBA 1RJ9B 1W46A 2CCKA 4LJYA 4A0FA 3BD9A 4JLOA 4C0LA 3QKRA 3S1AA 1HT2E 1MRSA 2IC5A 1A2BA 5KU1A 2PBRA 3KZ1E 3VTKA 4B2IA 1DE0A 2I3BA 1YVDA 2QENA 4NH0A 1R4AA 2GAAA 5JEEA 1NN1A 2GWHA 1SGWA 1ZYUA 3K8YA 1W7AA 2WWXA 1G7RA 2VPPA 2QT0A 4FCWA 2IUUA 3K09C 4YQFA 3FOZA 3EZ2A 1ZVQA 1ZCAA 2CDNA 1WBDA 4LV6A 4ZDWA 3CRRA 4L4UA 2H17A 1GM5A 2O8CA 1Z83A 2JLZA 4PSAA 5IT5A 4E5UA 1SHZA 2QMEA 4HAWA 4R9UC 1G7CA 3BBPA 2H5EA 4IOMA 1W0JA 4G5RA 1GNRA 4NCHA 3NBZC 3R7WB 3VR6A 4DEXA 5GADl 1KJZA 4OQLA 3AVQA 1D9XA 1IN7A 2IYVA 4TT3A 5DI9A 1L4UA 3LVQE 2IXGA 4JL6A 1NLYA 2WJIA 3IPXA 1GG2A 4A0HA 2FSFA 3P4XA 1KK0A 3K0CC 5FR2A 2FFQA 4E03A 3W3AA 1I4LD 1OHHA 4MYCA 4FN5A 4LK2A 1GVNB 1WQ1R 3C16C 1HTWA 4XWOA 1S1CA 2QL6A 2OT3B 4TYWA 4Q1EA 4RCYA 1OYWA 3FHTA 3AGPA 4PZYA 4A36A 2IS6A 3EIHA 1R10A 3NIBA 4EFNA 8OHMA 1S9HA 2ODNA 2VQSA 3CRW1 2E9SA 4LY6A 2J7PD 1M7BA 2IBMA 3FHOA 3EXAA 1NIPA 1GAJA 4TZ6A 1EX6A 3FDIA 3SQWA 1D6JA 3KB1A 2X77A 5BN5A 4C7OB 1C1YA 4V02A 1HQYE 1CR2A 2ODWA 2Y8EA 4Q4JA 2YOFA 1G291 5DNYB 5FL3A 2CL6X 3IHLA 4BECA 2YINC 3IILA 4DLYA 3TMKA 5K8UA 4BZQA 2YJTD 4NYIR 4XVQA 2ZR7A 4Q01A 4U00A 3R20A 4XTRA 4WXPA 1XD2B 2GHIA 2IXEA 4GOXA 3VAAA 1ZBDA 1P75A 1P3JA 4KVAA 1S2MA 5CJ2A 4HDCA 1FMJA 3RS2A 1EK0A 3UWOA 1X8LA 2A5DA 3N70A 1BOFA 4M9QA 2PL3A 4Q4HB 3UWKA 3QXHA 3K0AA 3A6PC 1GKYA 4XSHA 1Q1ZA 5LBIA 2YNMA 3IBGA 1E0SA 2CHGA 4GOJA 2OZEA 4ZIRB 4RZ2A 5B30A 2ZRJA 2EFHB 3QVVA 1HE1C 4R98A 1T0JB 2J46A 5E7IA 2XEXA 2NTYC 2QMHA 5BN4A 1P72A 3AUYA 5F3WB 2CXXA 3Q3JB 3AKEA 1CF4A 2ZU0C 3LQRA 4TQ9A 1VYTA 2VBCA 4IVRA 1G1MA 4IOKA 4ZDJA 4HAVA 4EFLA 1ETUA 1SVSA 3C7KA 3CB4A 4JLMA 2BJVA 2IK8A 3RVBA 2WVJA 3D8BA 3THYB 3WHKA 4GPTA 5CB6A 2J9RA 3VNUA 1AJEA 1NVXQ 3TKLA 2ZRBA 4CEJA 1SVWA 2JASA 2PLRA 2WPDA 4OJQA 2OBMA 2EU8A 2REOA 2A5FA 4TQAA 1W4RA 2ONKA 5AUPB 3E1SA 5TMPA 2B8WA 4OHVA 5J4VA 3K0FB 2J45A 2H57A 1VCMA 3EZ6A 3MRSA 3UIEA 4ZDKA 4XD7A 4JSYA 4V0OA 3R9XA 2ANCA 2NO9A 3LLUA 5BYKA 2W6ID 2OCAA 3GP8A 3PEYA 2CLDX 3QI2A 1OIWA 3RS0A 2ZXUA 1W1WA 2QAGA 5DN6A 1KKMA 1T3HA 2F9MA 2FEOA 2GTPA 4AY2A 2EWVA 3ND8A 1CEEA 1XB2A 1Q3TA 5L3SA 3O8RA 1VMAA 2O8EB 2RGDA 3MJRA 1XCGB 5GJVC 1E79D 2O8BA 1IONA 4QM6A 1UKEA 3ASYA 2ZRIA 3CF6R 1SXJC 4PTLA 4WZAE 2BJWA 3TGPA 2CEAA 3CX8A 3GJ3A 1HE8B 4IDQA 3TE6A 2ODBA 4Z1MD 4XSGA 3PQCA 3KKMA 1VHTA 4R71A 2NO7A 2WAXA 2BM1A 5CDFA 1QVRA 3CR8A 1EFHA 1GILA 1FUKA 4JT4A 3PFIA 5FL7D 4LBYA 3EZ9A 4TYNA 3WYAA 1G64A 4O0MA 5KOYA 1CJTC 1NF3A 4LYFA 1ZNXA 2ZS9A 3A36A 3ONWA 3GLFB 1RW4A 1F2TA 2V7QD 2GZDA 3SQXA 1U90A 3KQHA 1X8JA 2Z5FA 1D2MA 1DAEA 3A58B 4N3NA 4EIWA 5G41A 2C03A 2YYZA 3PUVA 3FVQA 1W4BA 1N6RA 5DIFA 2R44A 1M2OB 1AS2A 3U44B 3RSLA 3T1TA 3AGQA 3KJIA 3LAWA 5FI1B 3VFDA 2CLCX 2C8VA 5E4FA 1R0ZA 2ERXA 4DCUA 2R65A 2PJRA 4FCVA 3KQUA 1KI7A 1Q22A 4HATA 3WYGA 2ERYA 1E0KA 2FNAA 3E70C 3OE7A 5JJKA 5FPYA 2JDIA 3RRZA 1DAIA 2P0EA 3H4MA 1D2NA 3CF0A 3K9NA 3NDBB 4JLVA 4B32A 2MMGA 1HT1E 2JA1A 4CEIB 4AURA 1E0AA 4LJ8A 1WP9A 2FH5B 3ADDA 3B13B 3QF4B 2CHVA 4RKEA 3CR7A 4GP7A 5IK2D 3NTUA 1V43A 3CPJB 1DEKA 5HCNA 2PX3A 1YE8A 4US0R 1NMYA 1P2VA 1W2GA 1XJCA 2IYUA 1D5CA 2WSMA 4K46A 4LJ4A 3CPHA 2DWOA 3SHWA 1FX0A 3QENA 3QY0A 4CYMA 1XPOA 1KIMA 4NZYA 4Q1FA 2WOOA 1G18A 4QGGA 4X8OA 2W83A 4PFSA 3K9GA 1J8YF 1DAHA 2G6BA 2GNOA 2BMDA 3SZRA 2QBYB 2WM9B 3ZLJA 5KUTA 4E22A 1Q3HA 2GXUA 1QVAA 4V0MA 4Q18A 5AJVB 5EUQB 2RH5A 5FPHA 3MCAA 3AM1A 3EPHA 5EP4A 4WA7A 1XD9A 1Z6TA 2QE7D 1NJGA 1U0HC 4C0SA 2YC4C 2IUTA 4MKFA 4U7DA 4AKIA 1XBTA 1P2UA 2B21A 4CEHA 1KYIA 3QXCA 1ODFA 2Q9BA 3SJAA 5JHGB 1F48A 3GLHE 4US1R 1IN6A 1BYUA 1LW7A 3IHWA 2CJWA 5JRZA 4TLCA 4XWAA 1CJKC 2BIFA 4PO8A 2EWWA 1E9BA 4Q1BA 1X1RA 3L0PA 2F9LA 1E2LA 1ZD1A 3WXMA 2XZLA 3JZMA 3N5CA 3SFZA 4P4UA 4V0LA 3I5YA 2EFCB 1KMQA 3AF1A 3NH6A 1KSGA 1YJ5A 3KKNA 4D4LA 5KTYA 2QT1A 1VHLA 3T1OA 3QKRB 3S1AB 2BC9A 2IWRA 3UPUA 2OM2A 2FA9A 3QBTA 4JVNA 5L3RA 2F1HA 4DWJA 2GZAA 2QA5A 1VCIA 3VHLB 2J7PA 1DAMA 2Z6VA 4B6FA 4Q9LA 1FQKA 4MDFA 4FCTA 4UJ5A 2PJZA 1K5GA 3GFOA 4IHQA 4HUTA 3GLGA 2RGCA 4WIAA 5FTKA 2YKGA 1N6LA 4IDNA 2OFWA 2O8CB 1LF5A 3OIVA 5K8TA 1CIPA 1ZC3A 4CT4B 3AB3A 4JT2A 3U61B 1CRPA 2O0KA 3SC3A 1XNJA 4QG7A 1YZQA 1KDRA 2GF9A 1Z22A 4L15A 3BFKA 3LNCA 2XB2A 4JLNA 3TW4A 1E32A 1JQJC 4HAZA 4QRHA 4UJ3A 4EPWA 1TAGA 3H84A 1GL7A 1K6MA 1U2RA 2NZ8A 2RGEA 3FKQA 3T1VA 2G88A 5HKKD 4AC9A 2HT1A 3TR5A 3P26A 1CR0A 2ZJYA 1UDXA 3LQQA 2D74A 1UJ2A 5FOUA 5IHPA 1L2TA 3I8XA 3ND9A 4NCKA 1DO2A 4Y0VA 2NMVA 2AWNA 2CCGA 1OXXK 4PPGA 1QG4A 3H0KA 1U9IA 3MG9A 1W36D 3PVSA 3EZ7A 3WRYC 4F91B 2VSOA 4C2TA 2GCNA 1WMSA 4ACBA 4HLDA 1AM4D 2PT7A 3D7MA 3VX4A 4IXMA 1GKUB 1N0WA 1YRAA 4B75A 4NYJR 3LW8A 2ZITA 2J59A 4M1WA 2DCUA 2RGNC 2EYUA 2ZYTX 3R9WA 4UXIA 4US2R 1TF2A 1MOZA 3ICEA 4UNRA 1Z0AA 4PHHA 2XZOA 3RAPR 1OPXA 3I4LA 3TR0A 3WNBA 1TQ4A 5TXGA 4PQRA 3M4YA 2ZYVX 4Q4JB 2WJYA 4MYTA 1HUQA 4X8MA 1XMVA 5HCIA 4C0KA 2ORWA 5L3QA 1ZP6A 3PJRA 1J7KA 1F60A 1JBKA 4A92A 3SJZA 5CLLA 2OXRA 1QBKC 3EA5A 4I4LA 4EQ6A 3FMOB 2FMXA 3B1WA 4QBIA 1JXOA 1W47A 1NN0A 4WXRA 3CRMA 3A1TA 4MGZR 2WKRA 3I5XA 3IO3A 2F3TA 3K09A 2W6IA 5BW8A 2IS1A 3CWQA 1SVLA 1T5LA 2JAQA 2CNWD 4MQBA 3UK6A 3DO6A 4C4PA 2W00A 1MT0A 4IJMA 4BFUA 2CVHA 5KDDA 1P9WA 2VRWA 1KO8A 3K0AB 1E79A 5CDFE 1W44A 3ADCA 2OG2A 1W4CA 3GFPA 3B5JA 2MMCA 2WOJA 3QIAA 2E87A 1R5NA 5CYOA 3VKGA 1DAFA 2FN4A 4M2LA 4QC2A 1ZM2A 3QF7A 1Z0DA 3HU3A 1HURA 2A7QA 1ZIPA 1EX7A 4Z1MA 4D2IA 2Z43A 1S1MA 2E1RA 3SBEA 5JEDA 3ZJYA 5IRCD 1IN4A 5AUNB 3SBDA 3RS5A 3DMDA 5FL7A 2XXAA 2QQ0A 2JJ2D 4RD3A 5JJIA 2EFDB 4V0NA 5TDHA 2ECKA 4EKDA 3NKVA 2V7QA 5SZKB 1TQDA 2FG5A 2RGBA 3P27A 3X1YA 1FL9A 1KSJA 1VTKA 4I81A 4H1UA 4D4MA 4CEJB 2HF9A 3BXZA 3E2IA 4JLJA 3PUYA 1JI0A 1VPLA 3LVRE 4GT1A 4B48A 2WJVA 2P3SA 4G5GA 4UXHA 2P5SA 4QHSA 1S8FA 5FUXA 5KNDA 2FFBA 4NBSA 2G9NA 2ZIAA 2YHSA 3EG5A 2GRJA 4BLPA 2MSCB 5FOXA 4Q00A 5HE9A 1QHIA 2NO1A 3QXJA 2CVFA 3U2QA 2OO7A 1T0HB 3KQNA 1M8PA 2GJSA 4IDPA 1PZNA 3GLIA 1KI6A 3IDQA 2QAGB 4LWZA 2DY1A 3RWOA 4KV9A 5BN3A 1YZUA 3ZS9A 4ZKDA 3REGA 1W4AA 2IYYA 4BLRA 5L3SB 5A4JA 1J8MF 1Z0FA 2NPIA 3CRVA 1MV5A 1OFIA 2WHXA 3NC0C 2O8BB 1LY1A 2X19A 3LV8A 3LH5A 4M9SA 4OK6A 3J81k 3W6NA 4ABYA 5CK5A 3T5GA 3DMNA 3I73A 4S2EA 1G3UA 4OHYA 1CU1A 1GL6A 2IYXA 4WZBE 4B2PA 3AVUA 3CUEF 1OF1A 3ZVNA 1E2GA 2HYDA 4FD2A 4PO9A 3K70C 3AKYA 4FMDF 5IK2A 1HEIA 4PHTA 3T06B 2ZETA 1G20E 2WWHA 2FPMA 2XNDD 3UXMA 1Y63A 2QNRA 4Q03A 4KSCA 4HAUA 1KAOA 2CL7X 5FOSA 1F2TB 1G5PA 1PUIA 5EP3A 1M74A 2WWYA 4EFMA 6Q21A 3OFND 2FV8A 4FW9A 5SZHB 5HZKA 2ZTSA 3CO5A 1IXZA 4TTPA 5M04A 2JJ8A 3ZDQA 1NBMD 3WY9A 2Q6TA 3A1SA 3RABA 1RYFA 1G4AE 4CT5A 5KDOA 1OH5A 1W2HA 3NVAA 4YMSA 1RFLA 5JSZA 3ZVMA 4FI3C 1ZU5A 2WKPA 1UEJA 5DHAA 2D3WA 3WMFA 2QE7A 2AHOA 2XOKD 1Z6GA 3GEIA 3CW2A 4DJTA 2ZJ8A 3ZYCA 1Z29A 1BMFD 1NP6A 1NG1A 2H16A 2RGXA 2NQ2C 2LKCA 4I99A 3X1WA 4DB4A 3B6EA 1QHSA 4JYCA 5JBQA 1IY2A 3WYFA 2ZE8A 2QUZA 4KSBA 3KJHA 2HJGA 2D7DA 1ZU4A 4MGKR 3SDZA 1G5TA 2IYTA 4ESVA 3C4JA 2O8DA 1SZPA 3CF2A 3E5HA 2BVNA 3KJEA 4JYBA 2GKSA 3PUWA 1XCPA 2AXNA 4WBSA 1M1YE 2FX3A 5KPJA 3A4NA 2C9CA 3PCRB 3GLGE 1XXHA 2IL1A 3JVUA 1ZJ6A 1UADA 1N6IA 1KI4A 2D2EA 4HUQA 3PG5A 1CJMA 4LRWA 5DHFA 5L3VA 3GJ6A 3C8UA 3GJXC 3ZS8A 1EFUA 1GITA 5G3YA 3IPYA 5FOWA 3SJBA 1RYHA 1XMJA 4BFSA 2A5GA 3AH8A 1BIFA 3CONA 5CM9C 4DUGD 2V3CC 3KJGA 3OZXA 2G0NA 1IBRA 2QTVB 1OFUX 3AEZA 4HAXA 4IDOA 3NEJA 2H92A 3QBVA 1E69A 4MDEA 1JR3E 1BS1A 1GTVA 1N0UA 2QGZA 3FFAA 3CH5A 1AGPA 4URZR 3RANA 2ZRCA 4CEHB 4KJZA 4LHWA 2X2FA 4GZMA 2JLVA 3F5FA 1Z0IA 3TRFA 5HKKA 5KSZA 4JIMA 3TK1A 1ANKA 2CJWB 3V00A 2WIAA 2Q9AA 1GL9B 3RRNA 4DLUA 3CWZA 5EE1A 3VR4A 1XRJA 5H8WA 1N3BA 4KVGA 2JGNA 2B8TA 3T61A 1RRGA 3TAHA 2VSXA 2QRZA 4ACAA 2WJJA 2KBFA 2OSBA 2VP6A 1XMIA 4Q9KA 1C4OA 1UBCA 2IUSA 2BBSA 2ORIA 4YMTA 5H68A 1X1SA 3K9HA 3T1QA 1IY0A 3PEVA 4DDVA 4JBWA 1QHNA 1NMXA 1TMKA 2UKDA 3DVLA 5H1YA 5JCPA 3L43A 5JLJA 2JCSA 2CK3D 3K70D 1NNEA 2GZHA 4W5WA 3ZQ6A 1OXVA 3GLGB 4BFXA 1A4RA 1DARA 1U94A 4CF7A 1ONBA 2AD1A 4BFVA 4B34A 2I4IA 2B6HA 4NPHA 4BPBA 4TZ0A 4KAXA 1NSFA 5P21A 3KQKA 3W5IA 2ZEJA 1E2MA 3RS4A 2AX4A 2D4HA 2YWHA 1JEDA 1KGDA 1OXSC 2XX3A 1DVRA 2XSZD 1PV4A 1QZXA 4LZZA 4TL8A 4BLQA 4D80A 3T5DA 4AYTA 3H86A 4JLKA 4XTCS 3CLVA 4A2PA 3Q9LA 2XZPA 1G3MA 1N6KA 2CNWA 4TLEA 5FTNA 3LA6A 1P62B 4PZLA 3EW9A 4JLDA 1Z3IX 1KNQA 4PPQA 4Q9IA 1FNNA 3G0HA 3GEHA 1GKIA 2P2LA 4NCJA 4DBLC 2QRNA 2JLXA 2ZANA 5G53C 5TVKA 1EESA 3LBNA 1X6VA 3MWLA 4G5QA 1TEXA 2P65A 2FFAA 2PEZA 2ZPTX 3QNUA 4DCVA 4GBMA 2ZREA 4Z51A 1XEWY 1XZQA 2JLSA 1N5JA 3IQWA 4DLRA 2DB3A 4CGZA 4M21A 4RCZA 2QM8A 3AUXA 4TSFD 3EX7C 4PANA 2VEDA 3A8TA 1Z6AA 1FFHA 1Z2CA 3THXA 2V6IA 4II7A 1JJVA 3GJ5A 2JJ2A 2IYLD 5EE5B 2AN9A 3GJ4A 1FP6A 4KLNA 5DYGA 2ONJA 2WMOB 3ETLA 3Q85A 4DLSA 4YMUA 5CIWA 1MABA 3X1XA 1Y3AA 3B2EA 4XOIA 1Z0JA 4NYMR 5DISB 2C96A 3GLIE 3QPWA 5L3QB 4URUR 4N0DA 3DEFA 3SNHA 4TYQA 1G9XA 4EQ6B 4CZ2A 2P67A 4NONA 3BORA 3A4LA 3ZZ0A 2QMUA 1TU3A 2CHQA 1E0JA 3HU2A 2JLWA 2NO0A 2CMKA 3CZQA 4DSUA 2EW1A 4TTQA 4WVFA 4C30A 4TMKA 4LHZA 5TV2A 5J5CA 3AVOA 1CTQA 4C3ZA 1P5ZB 2GVDC 5F2EA 2WAYA 3U60B 721PA 3C41J 4EPYA 1LF0A 3A1WA 2N46A 1I2DA 2P5TB 4PX9A 5TARA 3GLFE 2HUPA 2PMDA 3BAFA 3EA0A 5LD2C 2B7CA 2AR7A 3ZVLA 4DIEA 4M53A 4HYYA 2ZVQX 2BCGY 4URYR 1ZD8A 1XDBA 4TMVA 3VR2A 2FSGA 4B71A 1EXMA 2XXAB 2XNDA 2B7BA 1Q21A 1NVUQ 2LCFA 3GQBA 4AI6A 4LYJA 3LX8A 1YR7A 1Z07A 3LW7A 4DLTA 1UDWA 2VF7A 3PXGA 1Q1QA 4GI7A 1TADA 4FIDA 2JEOA 2WV9A 3OFNA 4B76A 4C0HA 4C0QC 2N1BA 1OIXA 3QEOA 2NZJA 2RGNA 4K8OA 4MUAA 1NBMA 4AK9A 2FSHA 3T12A 5KHOC 4JLPA 1XEFA 2ATXA 1KZGB 3FFBA 3QEJA 3FB4A 5KO2A 3LDAA 3FKSD 4NU0A 1DAKA 1TU4A 3ECCA 3V4FA 5JMTA 3GLIB 1KI6B 1CKEA 2XOKA 1SQ5A 2HCJB 3P32A 1BMFA 3KB2A 2CCJA 2ZRFA 3DM9B 3CX7A 5AJWA 5H70A 4OYHA 5C46F 4F92B 3BH6A 2A9KA 2ORVA 2VHCA 1KJWA 4N0EA 1P2TA 4EPXA 1E2DA 1SXJE 4PAQA 5EQTA 4FMCB 5FBWB 3IIJA 2HV8A 3W8NA 2EFEB 4MKIA 3WNDA 1JNYA 2KWIA 5ELXA 2VF8A 2QAJA 2WWIA 1SVMA 3TH5A 1ELOA 4BQSA 3AKCA 2DFKB 3GJ7A 1XTRA 5AJXA 1T6NA 4Q4AA 2FPLA 1MKYA 3TSWA 1CXZA 1FZQA 1DOAA 4DIDA 1N6NA 2C78A 2NGRA 2RCNA 2WSSD 3GMTA 4V0KA 2UZ3A 3REFA 3OHMA 4PC2A 1QHHA 4UNPA 2B92A 2G3YA 2V1XA 2BDTA 2F55A 1TF7A 4DT1A 4DUGA 5JSZB 4PPNA 3U3KA 4EJSA 1W36C 3UMSA 4RFSA 5IF9A 3TBKA 3I1FA 3L8YA 2XTNA 1IJEA 1D2EA 1NSTA 3HR7A 3HU1A 4P4TA 4YMVA 3OESA 3BH0A 3MWJA 5K8LA 1YKSA 4Q7KA 5CK4A 4JBXA 3CNOA 2GCOA 4RD0A 4BE7B 4CDGA 1E2QA 1OXUA 4UNSA 1NVVR 2Z83A 3Q5DA 1AKEA 4V03A 2BKEA 2J0UB 5DO9A 3THWA 2O8DB 2PZFA 3GEEA 2H18A 1LV7A 2Q3HA 5FBRB 2OLJA 2V8OA 2Z4RA 3A1VA 5LPNA 1DTSA 4LJ9A 1N0VC 3T35A 2WWGA 2DYKA 2WWFA 1T9HA 3QSYA 2CE2X 3H1TA 2R6CA 2ZSBA 3CNLA 1XXHB 3QJYA 4QOSA 1OYYA 1SXJB 3DKVA 4UQOA 2IS2A 3QKSA 4P32A 3SS8A 4GOKA 1G7SA 4HUQB 1YU9A 3TVTA 4D0LB 3D3QA 3RRMA 4LBZA 1SULA 4LYHA 2CK3A 2ZYUX 3AF3A 3K9LA 1E9CA 4ZCLA 4LOAA 2ZRDA 4Q4LA 4IOJA 2G83A 4A6XA 4RD1A 1ZNZA 3TQFA 1ZAKA 3I8SA 4Z8YA 4ESHA 3WMGA 5JWHA 1W0KD 4RKFA 2CL0X 1ZMXA 1KK2A 1OV4A 1FPMA 1HYQA 1G17A 4LHYA 5LB4A 1XTKA 5EZ6B 3Q5EA 3KXLA 2ZAMA 1VCNA 4LHVA 1QHGA 2XSZA 2V6JA 2VH5R 2KE5A 2KSQA 4F4CA 2DBYA 2JLRA 3C5HA 4K81B 2VTKA 3DZ8A 3B1XA 5ANRB 4KHZA 1E4VA 3MLEA 1F2UA 4D26A 1ZUIA 1JALA 3UANA 3IQXA 1E2JA 2P6UA 1VG1A 2WTUA 3KUCA 2V55B 1KSFX 1SHKA 2ANBA 3EC2A 3BJIC 4DSNA 1KI2A 5AUOB 1CS4C 3H2YA 4IW3B 3AP2A 1P7CA 1R5OA 4LHXA 2DPXA 1KOFA 1N6OA 4Q7LA 4LX0A 4NYMQ 4NYIQ 2O0HA 3PENA 4TSFA 3BB4A 5DGXA 3U4QA 5FUYA 2PX0A 2QSYA 3N2EA 1SVOA 4N1AA 3BOSA 2KJQA 3U7HB 4HSEA 3TQCA 2QTHA 3KL4A 4URWR 2BV3A 4X8LA 3BERA 1PLKA 3HPRA 5FPSA 3JZAA 4A0RA 3X1ZA 5TY0A 3SJCA 3QOFA 2WIBA 2OV2A 4PZZA 1MO5A 3RC8A 4Q1AA 1BO6A 1D8TA 3AF4A 4QHTA 1JXMA 2DR3A 3HP1A 2ZRMA 1QHXA 4LYAA 2PEYA 1WA5A 4OQFA 3R8CA 3CKLA 3ZVRA 1I4TD 3CIOA 1TF5A 1E94E 1Z5ZA 1EFTA 1IAQA 4POAA 2EQBA 4LDJA 5AK0A 1EWQA 4F4JA 1IOZA 1P9NA 1E2PA 4D81A 2C04A 3IO5A 3UKDA 5IDVA 2X2EA 4XVUA 3EWSA 1M34E 4NL4H 2OCYC 4BEJA 4JS0A 3RRYA 4O2LA 5JJLA 4BFTA 2RKOA 1II8A 3CM0A 3VQTA 4Q5IA 2FJUA 1ZUNB 1JPJA 3GD7A 3MFYA 4IRUB 3CNNA 2DFTA 4QFMA 1Q57A 4HDOB 3SE0A 3IIMA 3HDTA 1VYUA 4OJKA 5SZJA 1COWD 4QM7A 2DWQA 1WDTA 4L16A 3THXB 4B47A 4BFYA 4LI0A 4D4JA 4M1KA 2ZRAA 5B57C 1U98A 1ZM7A 4B74A 2D06A 4JLBA 4GMDA 1O87A 4HI0E 2CBZA 4I1VA 4A82A 2VP5A 4A9AA 1UBFA 1Z06A 1M7GA 1R7RA 1SKYB 1MABB 1PLJA 1VIYA 1ZCBA 3K53A 5JI2E 2ZAOA 3ADKA 3LWNA 3MD0A 4Q02A 5L8VA 4BZXA 1A2KC 4AKGA 2ZRNA 4A2QA 1NLFA 1X8KA 4QBGB 2P6NA 1NN5A 4OI2A 2GJKA 1ZM4A 3WP0A 5DH9A 3FKSA 1G21E 1U8AA 1DG3A 2Q9CA 4QHYA 4RVCA 2IA5A 1GRNA 3AVWA 1FOEB 4RD6A 4Z8XA 1E2FA 1DG1G 2LKDA 3Q7QA 3M0EA 3RNLA 1AN0A 4O25A 2OBLA 3IKJA 4TYPA 5F9FA 1NY6A 1EFRD 4Y0AA 5EJEA 4P4SA 2O5VA 3KKQA 2N42A 2G0TA 4M22A 3AVYA 3LFUA 5J4HA 4H9GA 4TT3D 3FHCB 4FXPA 3EASA 4F93B 1Z8FA 2ZUDA 1TUIA 3RS3A 2ZJAA 1BYIA 4M8NE 3LRPA 2DHRA 2BWJA 3VR3A 4DZZA 4NDZA 5SZIA 3V4RA 4ZV4A 3B60A 1T3LA 2ZRLA 3ZD6A 2KB0A 3ASZA 1S3SA 4O2RA 2VO1A 4EJSC 1MR3F 1KTVA 4P33A 4CRWB 2IHBA 2ZS8A 4QJ3A 2GJAA 3C14C 3DL0A 3IBYA 3PIRA 5C2JB 3IIKA 1YZGA 1F3OA 2OAQ1 1EFCA 2KBEA 2W6JD 3SYNA 3AVVA 4XJXA 3PUXA 2WSSA 2VSFA 5KSYA 4I1SA 3HJNA 1G16A 5EP1A 2PCJA 1ZM9A 1OKKD 2HDNB 4ZDIA 4JJKA 3AVXA 4F4IA 2VP2A 2W0MA 4MUBA 4ASUD 4QL3A 4AIIA 5BWMA 5GJBA 2YVUA 1F5NA 3RSOA 4IFEA 3K0SA 1GFIA 1L7VC 2ZSFA 2FEMA 2W58A 1AS3A 3FYHA 4BLSA 1XTSA 4PHFA 2HYIC 1HQCA 3ZGXA 4L9WA 2FU5C 5CYPA 5J4LA 3LO5A 2VIIA 3AP1A 3ADBA 3TJZA 4BUJA 1Z28A 2IXFA 4GMXA 5HZHA 1NKSA 3B1VA 4OBEA 1G6OA 2AXPA 4UNQA 3WBJA 2VHQA 4ZCMA 2JLUA 4M9XA 1FQJA 1ZW6A 2GVZC 1XEWX 1VIAA 4GFDA 2GXAA 4HZIA 5C4MA 1HV8A 2C77A 1GNQA 4QKQA 3VKHA 2RB4A 2ZSDA 4BASA 3O8CA 4G1UC 1OB5A 4JJZA 1UAAA 4KFTA 1AS0A 1LFDB 2NIPA 4ON9A 3SYKA 4V0ME 2HLDD 2ZJZA 2OHFA 3OF5A 4HLUA 1EWRA 1S0UA 4Q4AB 4TN1A 1XTQA 5KPDA 2Q3FA 3FE2A 1OH7A 3AP3A 2F1RA 1DADA 5KSPA 3A1UA 3B82A 2OILA 2LWIA 4BLTA 5EE3A 1QHHB 2ZR0A 4Q7JB 4JVMA 5FOTA 2J0VA 2OFOA 3TSOA 4BLOA 4YMWA 1W5SA 2V9PA 3BH7A 3M1IA 4IEIA 4W9MC 4DT1B 5GJCA 1U8ZA 3I92A 4JKYA 3DKPA 1G8GA 3DDCA 2XGJA 1H65A 1W0KA 2YWGA 4JL8A 1UKZA 4C0JA 4EJSB 4QNMA 3ZQJA 2ZUCA 4KFSA 4RFSB 2FWRA 1YZTA 4B3XA 3KQLA 3HPQA 3P1JA 1OH8A 1E2EA 4U5XA 4IVQA 1QHYA 2WICA 2ZUBA 1E2IA 3KDSE 2G1JA 3U44A 2V1UA 3QXXA 3UG7A 2ATVA 2GCOB 1DELA 4L8GA 1GIAA 5UKDA 5KNCA 1AQYA 1GWNA 2PZEA 2XTZA 3THWB 1XP8A 2ZI9A 3C5CA 2QI9C 1XF9A 4JMPA 4A1FA 2WJHA 4DKXA 2A5JA 2YOHA 4DVGA 4D25A 1JJ7A 1IM2A 3U7EB 4M1YA 3TVDA 5FBVB 4YC7A 1T5IA 2YOGA 1FX0B 1E1RD 3VU9A 4LC1A 5BYJA 4IKEA 1G41A 4AKEA 3U3OA 1UF9A 4C9BA 3QKSB 1E9DA 2R62A 2ZSEA 5DI3A 3I72A 1TPZA 2C9YA 1B23P 2IW3A 2HXSA 2F43A 4QJ4A 4RD2A 2IT1A 2RMKA 3LLMA 2W0SA 3LXXA 4QGFA 3K70B 5FR1A 3NBXX 5JWRA 2WWWA 4RZXA 1BKDR 5EXSA 3CZPA 5FPTA 4YXWD 1U81A 2NOAA 4TMTA 4NE2A 4OK3A 1TNDA 3BK7A 2ZRPA 3AF0A 3SOPA 4KO8A 2AL7A 2Q0HA 3EIEA 4PAMA 3P20A 3PEUA 2XAUA 4OHZA 4B2LA 1G5RA 4AWXA 3BFXA 1CJUC 2FFHA 3T34A 3KTAA 3ZZUA 521PA 2ZM5A 4LPKA 4G5OA 4MGIR 1OE0A 4NYJQ 4TL6A 4MRRA 2FPKA 2QP9X 4AYWA 1KK3A 2GCPA 1QRAA 4LJ5A 1UM8A 1XTJA 3SYLA 1JAHA 2F1IA 5B2ZA 5JS7A 1F2UB 2QG6A 5E7JA 3U7FB 1R6BX 2H7VA 3JVVA 1QDEA 1S3GA 3SHFA 1I2MA 1RZ3A 2JDID 1S4QA 4ARZA 121PA 4W5JA 1N5LA 5DE3A 2KI5A 5KSOA 1S96A 5BXQC 2J41A 3T15A 4KYUA 1G3IA 2O8FA 4DRZA 1US8A 3B1ZA 621PA 2H8KA 3WRXC 4R7ZA 2Q21A 3R9IA 4ZI3A 1KAGA 1Q12A 1Z0KA 3LBHA 4DCSA 1COWA 4X8HA 1KI8A 3U4QB 1XPUA 5DSZA 2J1LA 1JB1A 4NCNA 2HXYA 2WBLC 3P4YA 3BB1A 2F6RA 1KMHA 1GSIA 3IGFA 4M1OA 2A30A 4LPSA 1XEXA 3FPAA 4M9ZA 4HEJA 3HWSA 4OL0A 5JECA 2BHRA 1Q44A 1TX4B 4FMBB 4PC6A 1WE2A 1YZLA 4H1VA 1T8TA 2VP4A 2ZRKA 4HLCA 2VLIA 5FUWA 4WW0A 2A78A 1E1QD 5J40A 4TMWA 3RLFA 1IXRC 4AG5A 1NIJA 1KHTA 1XX6A 3F8TA 2REXB 3FMFA 3I32A 5F98A 1VG0B 4MYUA 3ZH9B 4IXNA 3I61A 1M6NA 4HB2A 3CRQA 5F9HA 3W34A 1EFRA 1Q20A 5J4KA 4DLWA 4MH0R 1II9A 5C18A 1Z63A 1Z6XA 5CLQA 5JZVA 4LGMA 1NVWQ 4DB2A 2UVQA 221PA 5FI0B 1KY2A 1II8B 1RPZA 4MGYR 3A4MA 3AVPA 4ZO4A 1G6HA 2F7SA 5EXPA 2GBLC 2BBTA 3IUYA 4PPFA 3EPLA 3M6AA 3WHLA 3R8FA 3K1JA 1N6HA 5BQ5A 2C2HA 4QBHA 1ZD9A 2QROA 4TLDA 3QKTA 2BMJA 2A2ZA 3GLHA 4WZ6A 3IEVA 2OCBA 4TYYA 2J0QA 3DOEA 1E98A 1E9FA 2QEQA 1YR9A 2IWHA 1KK1A 4B6EA 2GK6A 3MWYW 5EXXA 1Q0UA 1TQ2A 2XJ9A 3LBIA 1FTNA 2Q3MA 5G3ZA 4Q1DA 2GAOA 2W6JA 4DDTA 3OEED 4ITRC 4KBFA 2F1JA 1GRRA 3U3JA 4M1TA 4OQNA 1OKKA 3UG6A 1ZINA 4GZLA 2C98A 4DHEA 2J5XA 4ASUA 1ZRHA 1VG9B 4Q48A 4B44A 1OH6A 3W6PA 4HZUA 1I4DD 3NXSA 3TUIC 1ZUHA 5JCZA 3U6KA 4DDWA 1AK2A 4HAYA 1XMSA 1V5WA 1XD8A 3BRWD 3I3SR 5E95A 2GJ8A 1E9AA 2J7KA 4YDHB 2FOLA 1VYVA 4NTZA 3ICQB 4B3CA 4JVSB 5J47A 4P4SB 4HLUC 2D62A 3DOFA 1JEEA 1Q1BA 4DLZA 2FSIA 3WBKA 5EE9A 3F0TA 4P3YA 1FMLA 3B9QA 2TMKA 1T3SA 1FUUA 1VG8A 4EPTA 2G1KA 5HTKA 1PVOA 1JR3D 3DZDA 2FZLA 2WJGA 3AKDA 3G5UA 1U8YA 1RVDA 2W2VA 1E2HA 3EPKA 3FTQA 1YR8A 3VHXA 4YLGA 1RC8A 1R2QA 3NDPA 1RKBA 4HDQB 2HLDA 1G7TA 2IEZA 2C9OA 4GP6A 1MO4A 4PQYA 5EZ5A 1TEVA 2XB4A 4DDUA 1XJQA 1U99A 1AIPA 2ZROA 2VHTA 3KFVA 2GEDA 3K0EA 5JFGA 4A6PA 1N5IA 1CULC 1AGRA 1P2SA 3NH9A 4I1OA 5J4YA 4D0NA 4IOLA 1FTSA 1NI3A 1NN3A 2BKUA 2IYZA 3SI7A 3RYTC 5FOVA 3NHBA 5AJZA 3L8ZA 3O8DA 2NPFA 1R0WA 1PJRA 3SU8A 2SHKA 2GA8A 3KXKA 2OCPA 4J0QA 1OFHA 2NG1A 3RS7A 2C99A 5KYKA 3PEWA 2QORA 2ZJ2A 2OXCA 1D9ZA 4B73A 3DM5A 1XXHE 4KU4A 2GETA 3GJ0A 4KCGA 5E7MA 1II0A 2YWFA 3C15C 4KFRA 4QXAA 4DLVA 1UFQA 2O0JA 5C4GB 4NKRA 4QBFA 2XTMA 5D3MA 4AYXA 4LV5B 4KBGA 3UMFA 1CJVC 1VECA 3BS4A 3EC1A 4MRPA 1G3QA 5B64A 2VP0A 4BFWA 1E1RA 3CX6A 2VA8A 4P0TA 4FWIB 5JRJA 2JLQA 3WNCA 5LD2B 2A3RA 1AZSC 4L9SA 3HR8A 2BOVA 1ESMA 2WZQA 4OQXA 4Q21A 1SKQA 3GFTA 1H8ED 1LS6A 1OT3A 2HJVA 2OUKA 4PXAA 4UKDA 1G8HA 4KODA 4XWKA 4HB0A 1LB1B 3BGWA 4S35A 4DSTA 4YXWA 4A2WA 4ZPXA 4BWYA 2AK3A 4LJAA 3UATA 4YDSA 4BGDA 1A5TA 1JQLB 1OFTA 4HB4A 4ZCIA 1KZ7B 2QP3A 3A37A 2G77B 1KDOA 2FZ4A 3PITA 4Q7MB 5K8IA 1WB9A 4OHXA 1KKLA 1RRFA 1AKYA 1NLZA 1CR4A 3KFXA 3QE0A 3KUDA 1IN5A 3Q72A 3BE4A 2ZE7A 2A5YB 4RY2A 1KI3A 1OSNA 2QZ4A 2VL7A 1Z2AA 4DLXA 4F38A 3L0IB 2GILA 3U3RA 4CVNA 4PR0A 1AQUA 3QG5A 2XNSA 1IXSB 3BFVA 2DWPA 4MRSA 4KLZA 3OEHD 2D2FA 4NHOA 1R5BA 3L82B 5GVRA 5C1BA 5EP2A 4HB3A
chains in the Genus database with same CATH superfamily
1A5AB 1OLOA 3N0WA 2PD6A 4XIIA 1JIKA 1JIVA 3NHFA 2F1OA 3BZBA 2VP9A 1SRQA 1DX9A 2CKDA 1G19A 1BA3A 2O3RA 3QY9A 3RC3A 3HSSA 1MBZA 3IP1A 3O6VA 4UMFA 4KXMA 1DDGA 2XCRB 4MQEA 1Y9JA 2G9UA 5CNJA 4IDCA 2R8RA 2F43B 2ZSJA 3JQ7B 3CLKA 4JI6B 3H6HA 4HOYA 4PRLA 2QW1A 1IULA 1RC0A 1C1XB 1RVV1 1LQTA 1Y9DA 4NR0A 2O3UA 4ZYXA 3L4JA 3PJFA 1RAEA 3HY4A 2JIDA 5LMCA 4WZBA 1E9EA 3GUHA 3H7AA 3I39X 3JRXA 1XZDA 5M3BA 1Q6ZA 3ZNOA 1G6Q1 4AP5A 1YR6A 5GWXA 1L5LA 3HXMA 2AK2A 5CT4A 1FSPA 5LOVA 2B82A 2CYCA 3FZNA 3SZ3A 4GBGA 2BMEA 1G20A 1VQ1A 2F1KA 1A27A 3R5XA 4NP6A 4WLEA 4BEBA 4F2GA 1N6PA 1N1EA 1SPXA 1E1QA 2PXXA 1ODCA 3I05A 2A67A 5DSXA 5CFOA 2FGKA 3ELYA 2BM9A 4KP7A 3KTAB 1V7QA 1SCIA 2J5RA 3HM2A 4A8JA 2X4GA 2XUPA 4HPWA 1YHNA 3O4FA 1AUOA 3OBIA 5CFQA 3WLQA 4G97A 1ZBQA 3DMGA 1DQYA 2C2BA 3L7KA 1CZNA 2R5FA 5CLHA 2PMEA 3W6OA 3B70A 3DTTA 1JPNA 4GDFA 4CHGA 1QORA 2WTBA 3OZIA 4BGVA 1GAWA 2H31A 4F3KA 4FLMA 1T3ZA 1N3LA 4MW0A 3AV3A 3KR9A 4D46A 5JFOA 1SBZA 4PC7A 5BNTA 2NVUB 1CZKA 5GZ1A 4AFNA 1YQEA 3A9UA 4NAUA 5KYXB 1QIFA 1C50A 3GROA 1FYDA 4TLAA 1YQTA 3PFNA 1MX5A 4IS3A 5AW6A 2BFPA 4LV8B 1IQUA 3HNOA 3JD4A 3VUFA 2REBA 3HYTA 3MCTA 1LFAA 1E99A 1VKJA 3A6EA 2NXWA 1BGXT 1TFUA 3BAZA 3O47A 4PU0A 5A7HA 1RJ9A 1JJAA 2B5WA 4GNKA 5ALDA 3RDPA 3ICPA 3WWOA 1M7HA 1NMZA 2VJNA 1AB5A 2HT6A 3LOUA 3WFJA 4CT0A 3MT7A 5CB8A 2IE0A 1WXQA 5K6RA 1H8HD 2J30A 2I6UA 4LGYA 3NWJA 1RHKA 2P9GA 4IFIA 2DF8A 2Q7XA 1ZH2A 3VNVA 4KX3A 3MXOA 5FTWA 1A82A 1QIEA 2BFEB 2GXSA 3OJ0A 4BKOA 1PJ2A 4RJLA 2X8AA 3WL4A 2GN6A 4LBVA 3OAAD 1Q83A 1UKVY 5D3QA 1M1YA 3CSUA 3NEPX 4RMGA 2XDYA 1KGSA 3U4GA 3TZ6A 1Z88A 4QLBA 4JBIA 4AQ7A 1MZPA 1SPBS 1QF9A 2DAPA 1P7YA 3SLRA 3W5AA 3CLRD 2R6AA 4AROA 2AB0A 2GKOA 2XMZA 2GT1A 4HQLA 1SUEA 3WGVA 2X40A 2IDJA 3TBHA 1CHNA 4GECA 3LQFA 3SHOA 2V6FA 1Q5PA 3BRWA 3EVEA 2WIFA 3CB2A 1O95C 2JF0A 1Y4ZA 1A9OA 2V98A 4LE1A 5K51A 2OD2A 2OHOA 2OCXA 3CQ9A 4ZI7A 4PC1A 4LFCB 3U4CA 1BMQA 1O6BA 1PJCA 2CWDA 4JX8A 4TKUB 1Z4PX 3DF7A 4EP1A 1XNGA 1K9VF 3WLOA 3TPFA 4UQLA 1TL7C 1IZ7A 3NTXA 4EB3A 1CQIB 4OHWA 1JTFA 2H63A 1K5DA 3VC7A 4MRVA 1E5LA 1Z47A 4OBXA 3VTZA 4COKA 2PX5A 1U0LA 4GXNA 1C3OA 1EZ4A 2H1OA 3CJTA 4GM1A 4W7IA 1MF7A 3DB1A 4K26A 5KWEA 1WOYA 2WQZA 4FYVA 3TLAA 1UCFA 4Q1CA 3ROTA 1XFAA 1ZOIA 2H2WA 4O2AA 4DJDC 4R8SA 3HCCA 4MYDA 2P9QA 1PWEA 1LDBA 3K9WA 2C92A 3MRVA 4I1UA 5JASA 3HL4A 2QQEA 3TJMA 3P0RA 3D4OA 3S55A 4G0NA 4Q47A 3BZUA 4HH1A 4XUDA 2QD2A 3CPSA 4OA5A 5IAAA 1JVBA 4LJ7A 4GI1A 2AXQA 5FH9A 4H3SA 2RG1A 2H1IA 4HWKA 5EWJA 4CLRA 1EGAA 1IEWA 2B4AA 4FE7A 4HSGA 5KX5A 3EDOA 3AR5A 5FOQA 4W8OA 1ZG3A 3RHTA 4DV5B 5AESA 3JQ6A 2A1TS 4HZUB 1W48A 3RHFA 4UM8B 4XA8A 1JAXA 3L1KA 3L93A 4YCNA 1C29B 1DFHA 2R00C 5AOAA 1RAFA 4ZO7A 3MS7A 1Z6YA 1VIVA 1MEJA 1PE0A 4L9RA 2XOEA 5TMDA 1EK5A 3LCCA 4L07A 3GRYA 5JSYA 1ADYA 2AWOA 5DYYA 2XJ4A 4ZTBA 5C34B 2J31A 5L4SA 1WW3A 3DZHA 4YRBA 4ENVA 4XQ9A 5DLQC 4UHKA 2L0XA 1MENA 1KERA 3DEYX 4BGIA 4Q4HA 2BZSA 1JH8A 1CY0A 5EGSA 2BMAA 1JUDA 4ZN6A 1HQKA 5FA5A 4GP9A 1JHYA 3I9V6 1XVVA 2IX3A 3EQ7A 4BE4A 2N75A 1L4YA 4JU9A 1RI2A 1YRBA 1MO6A 4GKBA 5FTLA 4UTNA 1ESNA 2PGJA 3VHXB 2C1XA 4NK4A 1ECJA 1RZUA 1T1GA 4QSMA 2Q2WA 2P9FA 3FAZA 1XEAA 2QTWB 2QMOA 2XITA 3ETNA 1HZZC 5K5EA 1F9EA 4EY7A 5FV4A 3HUDA 4JGBA 4OCZA 4MI1A 4RFVA 3VTFA 2R6FA 4TL9A 1GFZA 1W73A 1P39A 2G5TA 5EZYF 1P4SA 3THYA 1U8FO 2QU8A 3HFGA 3OE1A 3EHDA 3DZCA 3Q2OA 2ADOA 3B12A 3R1IA 4HJXA 5TPZA 2GYYA 2XA2A 1EFDN 1RRCA 2TS1A 3LIIA 3UJ3X 2SCUA 2F3RA 4PNHA 4WL0A 4XRRA 4A91A 1VLHA 3KBBA 1CR1A 5ELMA 4NMHA 5FBQB 3W7VA 1RYEA 3GDGA 4JP1A 2C8LA 1TTPB 1RQRA 1WNFA 3MVEA 1T8PA 3H1BA 5JNUA 5ENDA 1JVSA 4LWQA 3WGOA 2R85A 2AMVA 1JL3A 3X0DA 1SCKA 3HB7A 3KX2A 2LVBA 3A2KA 1V39A 2J0SA 4G1MB 3S0JA 4OHFA 1CRLA 1W1IA 4EAAA 4WNYA 2L2QA 4B3BA 2ODAA 3IEIA 5KTKA 5E0KB 4EPRA 1NWCA 1MO3A 4HMQA 2Y1LA 1Z4KA 4KDRA 1KEWA 5IC5A 1IUPA 3UHPA 4UE2A 1RQ2A 1C4WA 2QSZA 3MAAC 5AJYA 3U7QA 3BRCA 5IM4F 4IIJF 4OQMA 1BD4A 2HFJA 1N3IA 2QPTA 2EVWX 3EZLA 4NOMA 2INGX 4ENTA 1UJ6A 3PZRA 1QV6A 3KYDA 4LYDA 1RQXA 3RWMB 1GZSA 3ETJA 4WXMA 4CF4A 3KZCA 1J8FA 1NUAA 1M54A 3IT1A 4XIJA 2IYAA 3DHWC 4DABA 4E31A 2OWDA 1MT3A 1EQUA 1KYVA 2R6DA 3EGDB 2BCJQ 2UVPB 5D2CA 5A02A 1KI9A 2P1DA 2VCYA 2WMNB 3EWAA 2CV1A 1T91A 4NNOA 2HXGA 1BHQ1 1E6MA 1K2VN 4B43A 1ZHOA 1BH2A 1ZKDA 3HSKA 1NVMB 1NG9A 3VMFA 1R0LA 4E70A 2ZI4A 3MBKA 3LYHA 3OQIA 2R3SA 5F1OA 2VQ3A 4CFSA 1AZTA 3N6RA 4LHSA 3TW8B 3P2OA 3P9YA 5A3SA 3GPLA 3ND5A 1U2DC 2DFLA 3QUBA 1UPTA 4MIOA 4AULA 1IEQA 2KLHA 3O4VA 4L78A 5DNEA 3TB4A 4W5TA 2R97A 2QSJA 2OFXA 3AOEA 1M2OA 4M0LA 5L95A 5E2AA 5A5GA 1PK8A 1SUIA 3QVSA 2PTGA 3GAMA 4Y1EA 4EHJA 1EXVA 1GPNA 3AQIA 4C0AC 5K09A 4JSTA 4B3DA 2XCLA 1UJBA 3L41A 1ISHA 1JECA 5B1YA 2H3EA 1TI7A 1D7AA 1XQ1A 2YMLA 3QPUA 2CFSA 4H17A 4CM3A 1P5RA 4R1MA 4DZTA 3SZLA 2CKMA 2OESA 1NRJB 4Z9XA 1NXWA 5EGNA 3EF0A 1DBQA 1F38A 5DOVA 3MTGA 4PZDA 4D4GA 3GT7A 5IJXA 2ZIFA 4FYWA 1XDWA 4O1MA 1R0RE 2OORC 4HGZA 3LY5A 2GZRA 4L8FA 1IY1A 2PGOA 4RA6A 5TRTA 3URKA 1DIOB 3QF4A 4OK5A 4C7BA 2W6OA 2Y9MB 3FM9A 2ZIXB 2BMFA 5HNKA 1OW3B 2QN8A 3OQNA 4LDPA 3GVPA 1ABEA 2D5CA 3PDUA 2X7JA 4HRXA 4K03A 4JV5B 5JXHA 3NGXA 1F7UA 4Y6RA 4F7DA 2IZ6A 3HA5A 3MLAA 3ZD8A 2UZIR 1T8UA 2QN6A 4FUQA 4I9NA 4XJTA 4AT1A 4UOZA 4BNFA 1MHTA 4HGPA 3Q1LA 4DPLA 3ZHVA 5LYJA 1M1ZA 2HEGA 3B78A 3WGUA 1S89A 4X9XA 3SN6A 1NFRA 4UUNA 4AMZA 2UXDB 2OB2A 3PGJA 3K4QA 2C5LA 3DEJA 1UH5A 4QTTB 5KNBA 1TQ6A 3JXEA 1WCIB 1JEYA 4DJ5X 1G98A 4N0QA 1WBBA 5FAKA 2FPWA 2ZSHA 1REQA 4FPXA 4PHGA 3ZCUA 1CP3A 1WBJB 1D7OA 2BUAA 1WU8A 3G1TA 4IILA 4E14A 5TQ2B 4FR5A 5CT6A 1KO4A 4FN4A 4DRYA 4N65A 3JQBA 4WN3A 1XYGA 5EXEA 5HRCA 2V9ZA 4LKRA 1A3CA 3H4VA 1WZIA 4LXTA 4UXJA 4U02A 3ZN2A 3NHYA 2H54A 5K0NA 4C2UA 5FBZA 1C30B 3M4NA 3K5IA 2ID9A 4IZ6A 4IQ0A 3O8BA 1LTKA 3SQLA 4FYXA 3ZIAA 3OE7D 3V8VA 4EW3A 3WV5A 5B58C 4F9TA 3BB3A 1M5UA 2C1EA 1LNZA 3AL2A 1VE3A 2WNIA 3AEUB 3MMPA 1E5TA 3NVMB 2PL5A 2EGUA 4E07A 1A2OA 1IDOA 1BC5A 1AQLA 1SVIA 2PLAA 1NW9B 2HHLA 4TXNA 3E18A 4WOKA 4CQMD 4DLBA 4P5EA 4R7TA 2P1ZA 3KLMX 4MVJD 3N2IA 3QG1A 4PXYA 3TI9A 5ES3A 3NP9A 1TIBA 5K03A 5L53A 3KKOA 4MPTA 2VYQA 3CLHA 2X0JA 4AZ0A 4ZZ3A 2BSAA 4HGRA 1E9RA 2HADA 4LWPA 2OAP1 3WGMA 5T8KC 1NF8A 4LMPA 1PT9A 4JLOA 1AZLA 2OKCA 3QKRA 2XVAA 4K05A 2PBRA 1B76A 1AGXA 1KJ9A 2QENA 3QFCA 4WY5A 5I8WA 5BQFA 1JFFB 1F6WA 3OTGA 3PXEA 3DPIA 1W7AA 5F23A 4R8RA 1C1DB 1QYDA 2YJGA 4ZAZA 2TSYB 4XCXA 5DHUA 3BXGA 1P0IA 1PJAA 2FMFA 3OZFA 3MT0A 4DW8A 2NM0A 3STWA 4X63A 4K1LA 1X7ZB 2ATEA 2H17A 5I4IA 5JY6A 2H1CA 3F5DA 4D8YA 1O94A 1KR2A 2ZUSA 4S1OA 3GUVA 1PT8A 2IUEA 2B0CA 2P2ZA 4TS3A 3VBCA 3VNRA 1G7CA 1N2BA 4KRXA 4BOYA 1ZGJA 2H5EA 3D2AA 4IOMA 2JJMA 1GNRA 3MS4A 3NBZC 1GYQA 4NCHA 4YRLA 2HRZA 3WKCA 3IYLW 4K9DA 4DEXA 1KJZA 5KQPA 4TWAA 3SSOA 3GZ4A 4LVNA 2IYVA 3FSEA 4BVJA 3G5TA 2XMSA 3LVQE 4DBLE 1Z4OA 1NBHA 1HMYA 5EI5A 1O9HA 2FSFA 1JDUA 3OF3A 3ZHRA 1UC8A 4IGEA 4CHTA 1KK0A 2HHJA 4CTOA 2EG9A 5FR2A 3I37X 2PZJA 3KPYA 1K7YA 3TFQA 3W3AA 1V4VA 2PA3A 2QY6A 1GVNB 1KVUA 1PNTA 2QDXA 1S8NA 1EHIA 1GZ3A 2G1UA 3A6JA 3FXAA 1KYQA 1TB4A 2F3UA 4FSDA 4IYJA 4Q1EA 4RCYA 4L4ZA 5FYQA 2PT6A 4C4TA 1JFRA 3TXXA 4AN0A 4EFNA 4Z4FA 4JI3B 4DCMA 2ODNA 1RMTA 4R1UA 1WDKA 3M82A 4TX1A 5TS2A 2E9SA 3FHOA 3CVUA 2VHWA 4JI5B 2OPHA 1M2EA 1OVMA 2TECE 4UBMA 4ZOLB 3UEOA 2MR5A 4E5KA 2Y1KA 3D7RA 4CKWA 4U4AA 1HE3A 4N3BA 2K2QB 4V02A 4F0JA 2P9BA 3ESXA 4XM2A 1SCJA 1YKGA 2Y8EA 1AK1A 2VHYA 3CEAA 3N8GA 3SE7A 1EP2B 5DB4A 2YINC 4QZVA 3FKJA 1C9YA 3TMKA 4BX2A 5K8UA 1QK3A 1OA0A 4NYIR 1P1KA 1VSVA 4Q01A 2EZUA 4WXPA 4KR0A 1U0RA 4PWZA 3D8SA 4IF4A 3BMQA 1ENZA 2PKWA 4P92A 3UWOA 4C3ZA 3D6MA 4GAEA 3HKCB 4AP6A 3F3MA 3DHYA 4L2IA 1J22A 1C8KA 1ZICA 3N70A 3VUEA 4M9QA 5A6SB 3HA2A 1TCCA 2H1HA 2WHQA 4BKRA 4BO9A 2WWVD 4BNYA 1MB0A 2HJ9A 1Y1TA 3EDQA 1AF7A 1GPH1 1GKYA 2YS6A 4TWIA 4XSHA 3E58A 1RWBA 1VL8A 1YL7A 4D74A 5KJCA 4KPGA 1E0SA 4GOJA 4ZIRB 4MWTA 1P1FA 1P2DA 2ZRJA 3CVYA 2NU6A 3GC6A 4N0MA 1HE1C 4R98A 1T0JB 1NQOA 3SC2A 4OUKX 2OXFA 4L0MA 5I7FA 2XEXA 3N2ZB 4XGIA 2QMHA 4BCDA 3AUYA 1JSCA 1TXGA 1CF4A 1YFKA 2J3QA 2QN3A 2ZU0C 5H3CA 4AKTA 3SG0A 1G60A 1M34A 1ZNQO 4JK3A 1GPYA 1GQ2A 1VYTA 4OLAA 1DTWB 3G89A 5MGBA 4IOKA 3J81A 4WXYB 4EFLA 4ER3A 1ZVVA 1LZKA 3CB4A 1IJKA 3HJBA 3LWDA 5ENVA 3ZV6A 3D8BA 1E0DA 2WMDA 1YQWA 4OHRA 1XIVA 3WHKA 5CB6A 1NXOA 5KB3A 3TYXA 2IDMA 4AJJA 2JPDA 4CEJA 4F71A 1SVWA 2X0NA 3IC5A 3IUPA 4JYMA 2O7RA 2OBMA 4M0KA 4O4JF 4PINA 5AI5A 3ZBUA 1MDBA 3A3KA 4QVKA 4ESEA 3MC1A 2LR0A 2ONKA 4QBTA 2ACWA 5TMPA 1MEOA 1ECGA 3R4VA 5C81A 1VCMA 3MRSA 4AUNA 3ILYA 3EULA 4JSYA 4LRQA 4XD7A 1DQSA 3ZZMA 3R9XA 1AMOA 3LLUA 1XMXA 5BYKA 1JQ3A 2W6ID 3ZYZA 3JPWA 4OLJA 3SEFA 4HXYA 2EC5A 1O5IA 1QC5A 4GUDA 4X64B 3VU8A 1WXWA 1ZOLA 4N0PA 3T54A 1YE3A 1XB2A 5JMOA 4IJWA 4B9AA 2A9JA 1X80A 2EJTA 2VDKB 2WJ6A 3QVWA 3VBEA 4RZIA 4PYRA 4QM6A 2GFHA 2H4WA 3OO1A 4MAAA 2ZRIA 2JKYA 1H2BA 2GAJA 1E61A 1QH9A 3WLEA 3RPEA 3CX8A 3R24A 2HKIA 4F3TA 3GEMA 1HE8B 3DOJA 4CKEA 4MW6A 1OYVA 2C0PA 1UC9A 4QUDA 4W5NA 4Z1MD 1BFDA 3H5LA 3IS3A 3P71T 4GC9A 2Q4DA 2HSEA 2J48A 3D4BA 2BM1A 4TM8A 1FUKA 2X8JB 5FL7D 4LBYA 1U7TA 3EZ9A 2GH1A 4REQB 5ILQA 1SU6A 4GMHA 2OP1A 2HSDA 1LRKA 4O0MA 5KVAA 5ICFA 4AL4A 3GLFB 3K1YA 4FHEA 1PR1A 3E2PA 1IMJA 1IZZA 1YQGA 1RC1A 2I78A 3H9QA 4HDRB 4RFLA 3JU3A 3JYHA 3RIGA 2Z5FA 1YI1A 4TROA 3A58B 3MJVA 4QXQA 1IB0A 3GK3A 2JI6A 1F14A 2QN1A 1BA2A 3IALA 1NXXA 1ZVMA 4UBLA 3VYWA 5JAHA 1KJJA 5KNDD 2WLSA 2YYZA 2J9FA 1P9LA 3FVQA 4QA9A 2YWXA 3VKFA 1Z73A 1YCFA 2WWRA 3T0FA 3FNEA 1CE8A 4KQGA 4B79A 3RSLA 4RPGA 5HKBA 5KMGB 3ESDA 1E7WA 3S6JA 1LDEA 3VFDA 1DCFA 5E4FA 3SXUA 4KIUA 4FX2A 4JYPA 3UUGA 3CGWA 3N59A 1OYOA 1KI7A 5CTJA 3L8HA 2N0SA 1Q22A 1Y1PA 1WD5A 1E0KA 1RQGA 2GYWA 2XT9A 1FUYB 1USVA 4K5QA 2OTCA 2XKBA 2V5VA 2JDIA 4E0BA 3QX8A 1C8BA 1DAIA 2CXSA 2IITA 2WF5A 3N0TA 3N2GB 3V48A 3GZJA 4QYIB 2OGUA 3CVXA 3EGOA 1YMQA 4WN9A 1F9AA 4PIPA 1QR6A 2JAWA 2BN4A 1HT1E 3NHRA 1N8SA 3LSTA 3WMWA 1X8XA 3LVBA 2O1XA 1IXYA 2BZ1A 4XFJA 2O7SA 3ADDA 2PXAA 3MCVA 2QOEA 4YMGA 1Z13A 3CR7A 2GVNA 4CTKA 1BXRB 5ES4B 5LVAA 3DWIA 4GP7A 4H7HA 5IK2D 5LLDA 2NZWA 4UZFA 1C81A 1VJGA 2HIAA 2FF5A 5HCNA 4DY4A 2UYHA 1YE8A 3A4VA 4WEQA 4M1EA 1W2GA 4K46A 5DYWA 1NXSA 1NI4A 3SHWA 4JFAA 2DWOA 4MVJP 3MJCA 4FFWA 4Q1FA 4ARIA 4JA0A 4R1QA 2OD7A 2W83A 2XRYA 3K9GA 3QFHA 4EGQA 2G6BA 1QGAA 3CMCO 2Z04A 4CV0A 2XYGA 3TL2A 4RACA 4HLNA 2LNDA 3OECA 4QRDA 3L4SO 4GOLD 2ONZA 2GXUA 5IVPA 1J4AA 1HZJA 4ZO6A 4QFBA 1I1OA 1QVAA 4YWHA 5H02A 5AW2A 1V7PC 5BPFA 2V4MA 3AM1A 1CUIA 2EF1A 3WYEA 1ZK0A 1XQ6A 2FKAA 3BGIA 1Z6TA 3G0BA 1XVLA 3A4YA 4KXUA 5K4AA 3Q3IA 1NJSA 4N6GA 5GPBA 5B7PA 3NASA 5AVRA 2WU3A 3BE8A 4QT4A 1OXMA 3GXBA 4NMLA 4JKOA 2C4WA 4YCJA 1JR2A 4OJMX 5A3QA 3SJAA 3IVXA 1GAQA 5LYYA 3LM8A 4GGMX 1AQIA 3CZ5A 3GLHE 5I47A 3AJAA 2ISQA 5JRZA 4XWAA 5C3UA 4I1PA 4TTSA 2CNOA 3WRVA 1CUJA 1E9BA 2IOFA 1NNLA 2M6SA 3FWPA 4JP8A 4LSWA 4MW4A 1X0VA 2SNIE 1M76A 3DEKA 3UCFA 3PYMA 4E4RA 5CVTA 3JZMA 1YOVB 3WR5A 3SFZA 3G17A 5IU6A 2HA6A 1ZXXA 1I3NA 3BCSA 1BAPA 3WE7A 3O74A 2X0IA 3SPXA 5H4GA 5JCOC 2V65A 3KQTA 3FYDA 2XMGA 3S1AB 2IWRA 3QU5A 1C7QA 3QBTA 3PUJA 3LC2O 4PYMA 4ZT2A 2QA5A 3DOCA 3VHLB 2Q7DA 2XMPA 4B6FA 5AVYA 4Q9LA 2FN8A 3R9KA 3ROGA 4MDFA 4YASA 2FUCA 1W93A 3VH4A 2PQ0A 3GFOA 4IHQA 4HRYA 4YT5A 4I4NA 1B73A 4WIAA 2FPIA 2VXOA 2IYPA 1D2AA 4EY6A 5KVVA 3EAGA 2OFWA 4RF3A 3IPAA 2CDRA 1LF5A 3O9VA 5K8TA 3HV0A 3DFZA 3RD5A 4CT4B 5ICSA 4G5FA 1CRPA 4KFCA 2G9ZA 3HJTA 4QG7A 3PEFA 4G25A 5C5CA 4JT9A 3P19A 4ZYYA 5CXUA 4MZDA 4U3JA 3LNCA 4EATA 3TW4A 3K6JA 4Y2JA 1IZ0A 3DBLB 1JQJC 1YT5A 3D59A 1Z6PA 1JZQA 5E6UA 3WKBA 4WESA 4YJ3A 3FKQA 2G88A 4AC9A 2BDUA 1CR0A 2ZJYA 3DVAB 4QAQA 4XYGA 1YU6A 2QXTA 3HDHA 3LQQA 3ZPXA 3KD2A 4HDKB 2WB4A 5A06A 1VRCA 3ME5A 5IHPA 1DB3A 2AOWA 2Y1OA 4NCKA 4ZWNA 2N9UA 1EK6A 2E0IA 4QD3A 5M7EA 2AWNA 2YRWA 4DGSA 1TD1A 3H0KA 3FWHA 3H9UA 4RMJA 5DHRA 1O08A 3SF8A 3VJLA 1OGYA 3PIDA 4F91B 4C2TA 4CPDA 1WMSA 2IYOA 2WG1A 2Q5FA 4D45A 1I24A 4DR2B 4Y67A 4O6VA 2NU7B 4KQMA 3VX4A 1E1NA 4IXMA 3K8QA 2PD4A 4ES6A 1YB2A 1YRAA 3E4CA 2WNHA 3FF1A 5DKFA 1TAUA 2WUWE 1EBBA 3HP4A 3I01A 3GRCA 1RDFA 3X1MA 3W5VA 4UXIA 3W2TA 5IBCA 5BSRA 1M1UA 3O8OA 3ONDA 1PG2A 3JWHA 2F64A 4M8IA 4MIKA 3RAPR 2JRLA 2FOIA 4YO7A 1TQ4A 1V48A 3IX7A 1CB0A 3MM4A 3NTLA 1ZK4A 5IANA 3M4YA 4F46A 1NM5A 4AAYA 5JD4A 1K7FB 3QMPA 4N5IX 4WUTA 1AUPA 5GQSA 1N5RA 2PRKA 5KI6A 2ZZMA 2WG2A 2AH5A 3JAWA 1R3DA 1RYBA 3EMDA 2WIKA 4A92A 5JSFA 1EVJA 2Z08A 3SJZA 3X44A 1XMOB 5TF0A 2OXRA 4I4LA 2ADFA 4FX5A 4EQ6A 5AVZA 1IMOA 3FMOB 5JG7A 3U5TA 2RHHA 4DF3A 2YVAA 3BJRA 3P2JA 3KJFA 3WLKX 5C8ZA 3CRMA 4OO3A 1Y3IA 3HYSA 4KO3S 2HJRA 1MXHA 3ZCXA 3I5XA 1DKLA 1E7MA 1H6DA 3DP9A 5BSWA 4J7CA 4CMCA 1RMQA 2JAQA 3QNWA 2CNWD 3JZIA 4IEFB 2GZ3A 4UTZA 4XLZA 1MT0A 4C4PA 4DIBA 2V3WA 1WHSA 4IJMA 4FC6A 4ZXPA 1QIMA 2CVHA 4BP9A 4D3ZA 4ZGGA 5A3VA 4EG6A 4JXXA 4DR3B 1E79A 2BONA 1CUHA 1W44A 3CBGA 3WFZA 1W4CA 5CDFE 3EEOA 2PH7A 3B5JA 1SBNE 4P7JA 4WCFA 5CYOA 1DAFA 2HQRA 2Q28A 4CKXA 1KMIY 3UK1A 1QKJA 3VR5H 2W2KA 1QOPB 5LXTA 2QLNA 1KR5A 4TUYB 1ZIPA 1JS1X 3O3NB 5BN4B 4XEUA 1HFWA 2CNKA 1GL3A 1KA9H 4WINA 5EMKA 5JEDA 1XUOA 2KLBA 3ABQB 5AUNB 5U9CA 3G88A 1GEGA 1QNLA 4NBWA 4DNOA 5DYTA 3ZX5A 4V3CA 3M5WA 1V41E 1F2DA 3B3FA 3EJWA 4V0NA 2W6MA 3HLTA 2BHLA 4RK0A 4EKDA 1CY2A 4LS3A 1TQDA 2RGBA 3ZLBA 1UPCA 4LFBB 4PY2A 4H1UA 4D4MA 4DREA 1D1QA 2ZKIA 1CZLA 1U2SA 3E2IA 3PUYA 1VPLA 4GT1A 3UKJA 1KQPA 2BUCA 3UT6A 2CGEA 4B48A 2WJVA 4YRGA 4MB0A 4YA6A 5BT9A 5FUXA 3VHRA 3ZOKA 2FFBA 4NBSA 3G13A 4YJ2A 2RAUA 2FSUA 1QRRA 4QUGA 2ODQA 1QHIA 2NO1A 5BWOA 1TVCA 2V9CA 4X3OA 3P2KA 4X1YA 1U2EA 1V16B 2VT7A 4ZCRA 4BC1A 2IEIA 2QAGB 2QS9A 3HCAA 1RLOA 1RWVA 2PXHA 2Z9CA 1L5SA 4W7SA 1FMCA 3REGA 1OUMA 1OTYA 5A4JA 2QLLA 2QUJA 2Y2VA 2XYRA 1LNQA 2PFKA 3F2VA 3IJPA 4B6PA 1YQXA 3NC0C 2WHXA 4UTXA 5JSQA 2O8BB 2YV4A 1CQJA 1CETA 4V24A 1L8OA 3LPDA 4G0QA 5J2TB 3PQ5A 2HZ7A 1KF0A 2FW9A 4BNJA 3ZK9A 3KXPA 3KQQA 4WZBE 5C53B 1OF1A 4ZK6A 3QLVC 2ZAYA 4FD2A 4TS4A 4U2FA 4FMDF 4RF5A 3T06B 4Q1VA 1CT9A 3HBAA 5ALFA 1YA6A 2ZETA 4EKYA 1G20E 3VOTA 1HNXB 2XNDD 4ZOBA 3TNYA 4D6YA 4PZUA 1GZDA 4Y2RA 1UZNA 1XYYA 4KIFA 1X1BA 3NORA 4I6JA 2O2ZA 1YNSA 2CL7X 5FOSA 1F2TB 2HDWA 3I34X 3JX9A 5L4LA 3GDHA 2H51A 1WB5A 1KJIA 1DEHA 4PRZA 2Y4NA 4D44A 2DQSA 3MYRA 1SIUA 4L9AA 1SOUA 5E6SA 4ZC8A 4R8MA 4FW9A 1IDN1 3GY0A 4PZEA 5BSFA 3HE3A 4XPIB 3H8SA 5E9JA 3T9DA 4CMHA 5M04A 4TYMA 1HNNA 2YIJA 1RYDA 1MOSA 2D0DA 2X2PA 5CMLA 1W96A 5KDOA 1OH5A 3BIWA 4KQFA 4CXMA 1Z2EA 4YI5A 4Y2HA 4O1IA 5B53A 3VNQA 1HNZB 3WIOA 2VQEB 4FI3C 2VQFB 4E4YA 1UEJA 3FYUC 3PVCA 3L7CA 2QE7A 1USKA 4D3FA 1CB7A 4JQOA 2VHZA 2QMZA 3BXEA 1OI3A 1DUSA 1Z29A 3IQIX 1D03A 3OFSA 4O4JB 5E4TA 3RYCB 1NBEA 3CV3A 1U7DA 1XRMA 4JJ4A 3U31A 1PTKA 5L45A 5LLSA 2VNJA 3PBKA 4JYCA 2F8MA 2ZE8A 3UAVA 3GFGA 3IE0A 2Y3IA 4KSBA 4G0VA 4DS3A 1M6HA 2JFZA 3I76A 2D7DA 1GPDG 2HA3A 1KIAA 3MW8A 1ZVJA 4ESVA 2HRCA 3C4JA 1QLJA 2DX7A 4TOIA 1DKQA 1XRPA 2FSVA 2J0EA 1XQ9A 3E5HA 3KJEA 4LZNA 1H0SA 2GKSA 3H65A 3OQJA 4H4DA 4MP6A 1J39A 4OAQA 3O7WA 1XCPA 4G85A 1NYTA 1M1YE 1ZJZA 2FX3A 1J0XO 4IM7A 3RHZA 1SKBA 3A4NA 3SLKA 1YBMA 1V11B 2WD7B 3PCRB 2FDXA 2C84A 2C42A 4DA9A 5LFAA 5CLFA 1IIRA 1NF2A 5AI6A 3ER8A 4RK7A 4AS2A 2C82A 2D2EA 4HUQA 4YB8A 3PG5A 4DV0B 4GI2A 4LRWA 4HKTA 1O5TA 5DHSA 3B6KA 3D43A 3ISVA 3ZS8A 2VN8A 3NALA 1EHCA 1GITA 4UU0A 4Z5XA 5FOWA 3FCXA 3UNXA 5AXAA 1KOGA 1XMJA 3SICE 3ZHYA 3INNA 4JOSA 3RVRA 1MDFA 3CONA 3S1LA 1HL3A 5COQA 1SD2A 5TQ0B 2QTVB 3FPBA 3ZCSA 4MV4A 3G2HA 4P9NA 3NEJA 4F2HA 1GGFA 1RPTA 2HMYB 2PKXA 5AI4A 4JQYA 2PWPA 5I8ZA 1OI7A 1BS1A 1N0UA 4TV9B 4URZR 3CH5A 4LXYA 4X92A 2CMGA 4WTOA 5GMOA 1ZISA 1UIMA 2BR5A 3UAXA 3F5FA 5FUMA 1IYZA 1XWWA 4JUCA 3SEQA 7GPBA 5HKKA 1AA6A 3HCPA 3SBOA 5CD1A 3V00A 1PWYE 4BNWA 1ZN2A 1LA2A 2DFPA 3DV9A 1NXPA 1ZWKA 4Q9DA 4M7RA 5G4LA 1QZUA 2XUIA 3QTLA 4R1OA 5CH3A 2RBGA 4OSOA 4B7CA 4HX9A 1VSTA 2B8TA 3FCUB 2GD0A 1KDYA 3TAHA 2R48A 2WJJA 1EP9A 2OSBA 3OT1A 4MS4A 1XMIA 4Q9KA 4K0RA 4PLYA 1U6KA 1KP3A 1DNPA 2IUSA 4UM9D 1S02A 1H3NA 1X1SA 4DHWA 1B4DA 3K9HA 5LQSA 3T1QA 2XWBF 1O6CA 2W6PA 4DWWA 3AC0A 2EKBA 1QHNA 3K0KA 4PW0A 3DVLA 3C74A 1JVNA 3ETEA 5H1YA 5JDIA 3WK7A 3HXOA 1DZIA 2VYVA 4INAA 1LK0A 3CY6A 2XCSB 3F6SA 2JGRA 1OXVA 5LMNB 1ECPA 4H59A 4KR7A 3O21A 4IUBS 3ZWWA 2R7LA 2RDMA 4WT7A 4NCBA 5CFPA 1DARA 1TT5B 1GPMA 4RDHA 2B2NA 4XEHA 4CF7A 4FU0A 4BFVA 4B34A 2JIBA 4NPHA 2A9OA 3E7XA 3GUZA 4DN6A 5E2BA 1E6KA 3LCMA 3RS4A 2MYPA 3QU2A 3R5TA 5E3JA 2BFMA 1MAUA 4JSRA 2YHIB 4LA4A 2QTZA 1O97D 3NTVA 3V33A 1OXSC 5CD9A 5A3RA 1PV4A 1T2CA 3LGSA 4P82A 2WNSA 2FUG1 5TF4A 3T5DA 3H86A 4JLKA 4AYTA 3CLVA 5AVWA 4TRMA 4KXWA 5YASA 3MOSA 1ILEA 2EJVA 5LQJA 2VJQA 3MTBA 2G8LA 2E82A 3EW9A 2RGRA 1KEKA 5JQGA 4ZOQI 3OFKA 2P2LA 2A0WA 3I0NA 5K4GA 3EFBA 2Q1XA 3DJYA 4ND1A 1IOVA 1X6VA 4G4GA 3OF2A 1ZUNA 2ZPTX 1TKBA 5DDIP 4LZAA 1BVYF 1OBFO 2QRPA 2ZREA 4E6PA 3DE4X 5BVGA 1F0KA 2ZYIA 2NO5A 1SBYA 5BMVA 3FPKA 3EPPA 4RXMA 5KQRA 1KP2A 5EESA 1NHGA 3A9WA 4UAJA 4CMBA 1I7QB 1Z2CA 3VI3B 1HDCA 1DXYA 1PYDA 4C08A 3GJ5A 1T5SA 2JJ2A 4KWTA 1KWKA 1I0ZA 3CNQS 3BG5A 3N3BC 1SCUA 4J03A 3GJ4A 3GW8A 1FP6A 4J2HA 4AMUA 3PGVA 2E4XA 2BTQA 4JBLA 5DBOA 2ONJA 5CEFA 3ETLA 4MI9A 1MB2A 2AJBA 1FJGB 1HFEL 3AERA 4RNDB 3RV4A 4B3HA 5CIYA 3A3OA 3EGCA 1FFXB 2C96A 3GLIE 1JHDA 2FN9A 4FEYA 4OATA 2DJIA 3P0EA 4HTAA 2Q3EA 2OZLB 3QM1A 3NBKA 5MGNA 3CZ9A 2VZLA 4CZ2A 2YXNA 2P67A 3PLAE 3BORA 3A4LA 4AY3A 1OFGA 3WBBA 1C4XA 2CHQA 3FTPA 4GM4A 1OGJA 4RE6A 2NO0A 4BB5A 1FFWA 2I3GA 3DLAA 2EW1A 2PL9A 4TTQA 4IP0A 5DP1A 3W1EA 2CXOA 4TMKA 3PDWA 2CMHA 3AVOA 4Q3LA 4E30A 4JB3A 3KR1A 1UC4B 2BZGA 3DD1A 2VDOB 2BH2A 4EPYA 1LF0A 3A1WA 1SWVA 2I55A 3GFVA 3DUWA 5ARDA 1I36A 4IWXA 3OURA 1U65A 2P5TB 4PX9A 5TARA 2UDPA 2PMDA 1NMSA 2B7CA 2EJUA 4WH0A 3GGOA 4M53A 5LZ7A 1ZQ9A 2ZVQX 2J3LA 4GKJB 3UXHA 4XAQA 4GPEA 1QONA 2I4NA 3U4MA 1MQSA 1P0MA 1W6UA 1XDBA 1Z82A 5CURA 4KYTA 4AUMA 3UCXA 1RRMA 2XXAB 2G4LA 3LCUA 2JKZA 3GQBA 3CZ4A 1NSYA 3GMSA 1PKXA 4LYJA 5IWAB 1FW8A 2HPAA 4J0DA 4W5OA 2PUBA 1YR7A 1QH1A 3OCVA 3NXKA <