2M6KA

Solution structure of the escherichia coli apo ferric enterobactin binding protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
292
structure length
292
Chain Sequence
ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure, binding properties, and dynamics of the bacterial siderophore-binding protein FepB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrienterobactin-binding periplasmic protein
total genus 50
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA02
4MDYA 5KOHA 4IRMA 2XV1A 5GGXA 1L5HB 1G20B 3MD9A 3AEQB 4CL2A 5M29A 4NNPA 3G9QA 4WZBB 3UJPA 4INOA 4H59A 1N2CB 4WESB 2WI8A 1G21A 3HXPA 4OXQA 1M1YA 5M34A 2PHZA 2YNMD 4H0FA 4WN9B 4WZAA 3AEKB 4NNOA 5JOQA 4WN9A 4FILA 1H1LB 4PM4A 1M1NA 1XVLA 2MINB 2PS0A 3PDIB 1QH8B 4ND8B 1K75A 2M6LA 5BVGB 4G07A 4MX8A 2QI9F 3AESB 4TKVA 5KOJB 1EFDN 2AFHA 4WNAB 2Q8PA 3R5TA 1N2CA 3AEUB 5JG7A 1K2VN 1TOAA 1G20A 3BE5A 4HMPA 2ETVA 4PAGA 4DBLE 5HX7A 1QH8A 4ND8A 2MINA 3PDIA 5KHLB 5JPDA 3LHSA 4WZAB 1ESZA 1QH1A 3GI1A 4N01A 2OV1A 3AERB 4UTPA 2XQVA 3EIWA 1N4DA 3MWGA 3HH8A 3PSAA 4UDNA 1K0FA 4TKUB 2O1EA 4INPA 2YNMC 1PQ4A 5M3BA 3ZKAA 1KAHA 1KARA 3CX3A 4WNAA 3AEQA 2AFHB 3AESA 1L5HA 5I4KA 5BVGA 3AERA 1M34B 1M1NB 1H1LA 3K1AA 2M6KA 3ZK8A 3AEKA 2OSVA 3PSHA 4UTOA 5BVHB 3TLKA 3U7QA 4HN9A 4XPIB 5HDQA 4FNAA 2RG7A 1M1YB 2XY4A 4LJSA 1K7SN 4G09A 5AFSA 2Q8QA 2PS9A 2XH8A 3MINA 4WESA 1QGUA 4FKMA 1N4AA 3TEFA 4UDOA 3ZK9A 1MIOB 4GICA 2OGWA 2AFIB 1N2ZA 3AEUA 4WZBA 4MLZA 4TKVB 5KOJA 2PS3A 1MIOA 2X4LA 5GGYA 3TNYA 4K3VA 3EIXA 2R79A 2PRSA 4M7OA 1FP4B 2XDQB 5KOHB 3ZTTA 3R5SA 3AETB 4HMOA 3BE6A 3K1AB 1FP4A 2XDQA 1PSZA 1M34A 1G21B 5M2QA 4B8YA 2WHYA 2R7AA 2XUZA 3NU1A 3MWFA 2OV3A 4BBPA 3MFQA 2AFIA 5FLYA 5B58T 4OXRA 4MO9A 1KAEA 1QGUB 3LI2A 3MINB 4HMQA 5CR9A 4TKUA 3ZK7A 4FI3F 5JJ5A 4XPIA 5CX1B 3U7QB 5CX1A 4OVKA 3HJTA 5BVHA 4LS3A 1QH1B 3AETA
chains in the Genus database with same CATH superfamily
4BLSA 1E7WA 3DAOA 4KI7A 2AQKA 4EB6B 4ENQA 1XMJA 3OLZA 3ZLJA 2FG5A 3BMQA 3CFYA 3ZE1B 3HVJA 4UTZA 2EZTA 2IIVA 3UAGA 1I94B 3QKWA 2IPMA 3DM9B 2A2ZA 4CKBA 3AT1A 4L4YA 2H9AA 4Z8XA 3FBWA 3ZNOA 1IZZA 1XLTC 2J87A 5UKDA 2NVWA 3SX2A 2CNWA 4KYTA 3WRYA 2WKSA 4TQUS 2VPZA 3H8WA 4OXQA 1I9CA 2PX4A 3GNQA 4P7FA 4R2JA 2B7CA 3LHIA 1VL6A 1VRCA 3C3BA 3RRYA 4M1TA 1T9BA 1QKKA 2WMOB 3WB2A 4CF4A 2K7FA 2LUOA 3TK1A 1WUIS 3C3YA 5FQNA 2G1PA 4TSKA 1ZGBA 2LE0A 2VDLB 3D3QA 3TL2A 4YI5A 3AW8A 4YUYA 4XI9A 4ICIA 3E5HA 4WIAA 1QG2A 3KJEA 3KLNA 3OCXA 1UDRA 3PZBA 4J90A 1ZK0A 2E4WA 2FOIA 2FZWA 2H5IA 2IIPA 2WG0A 2ZIUB 1P6QA 2VCYA 1O77A 4LPKA 2EGUA 2IBMA 5IFKA 1NT4A 4UAJA 5HKOA 4KFTA 2X0EA 3OIFA 3DQPA 1Q20A 4AYXA 5C4GB 2Q5QA 1K0UA 2F17A 1QH1A 2NUPB 1UF9A 2FWRA 4FOLA 1D4OA 1Z88A 1QZTA 2I4IA 1BEUB 2DSTA 3N0XA 4B7UA 4MVJA 4RKQA 2NIPA 4RFSA 4PTZA 4F45A 2C0PA 1DBWA 3QW2A 2H07A 1TMGE 3A70A 4FFMA 2UXBB 3C24A 2QR3A 1Y8ZA 2QSYA 4JB2A 4PC7A 4V0OA 1KAGA 1Y3HA 1K89A 1R4NB 3BWYA 1J0XO 3EXAA 3K0CC 4IL5A 4XTRA 5I45A 5EZYF 2JI7A 3TGLA 3JWPA 3LC2O 3GD5A 4GMKA 4HQ6A 3GFQA 2FKAA 1LF5A 4Q3CA 4ROSA 1LJUA 2AR9A 4UTOA 5DYTA 4ENTA 4JLAA 2NW6A 3PL1A 4DLLA 2AKYA 1CUVA 2Y3IA 4LMRA 5KAMA 5ALSA 4IHJF 2IYWA 2XD9A 4Y1RB 5CYOA 5LDDC 5DN6A 4BCDA 5IBCA 4QAJA 1YZKA 3WP0A 2G0AA 3ZU3A 3C7CB 2OLJA 3B3GA 3QE0A 3LD9A 5LSAA 1GL9B 4YDRA 4IILA 3FTPA 1KO5A 5DRTA 3CXUA 4D3ZA 2JG3A 1XZKA 1XPRA 3J80A 1L4FA 3O91A 4CDMA 1KNXA 1M10A 1QZ3A 4M7RA 4JI1B 4DLBA 1BVYF 3G1UA 3U2QA 2NTYC 2DFTA 3NHWA 2PAAA 4URFA 4R1SA 5IM4F 4LCJA 4EY7A 2VH2A 3VAAA 2C4HA 1X38A 4EX7A 4R0MA 1Y1TA 3QELB 4PRZA 2GI4A 2FSSA 1ZMXA 3C6KA 2G83A 2K2WA 3GMDA 1XKTA 3X1XA 4K05A 4EQ6B 4ZP1A 1VG1A 3B13B 621PA 1M74A 3RTEA 4M1EA 3BFPA 5BV8A 4ASUA 2R44A 4KXFB 1E3MA 3BJIC 1RKQA 2OFXA 4V0MA 2ZLBA 1QGUB 2ZB7A 3MEQA 4NICA 4RACA 4RVHA 1QXSA 3LUPA 1F5SA 4DARA 1EM6A 1W0KA 3R9WA 5JJ5A 4IIXA 3T7DA 2QZJA 3K0BA 2BMEA 2F8MA 5E95A 2Y0PA 2FSGA 5KWIA 5CJ2A 4BS9A 4ZKDA 2GSWA 2W2LA 3OEHA 3OESA 1CUCA 3CLRC 2EQ5A 3ZX4A 4AKIA 3V1UA 1MO5A 1ZNXA 4IG4A 5HF8A 2MCFA 4CL2A 4U5QA 3ETLA 3G8AA 3L18A 3UK1A 2WRZA 2Z0MA 3EDCA 2C96A 4P36A 1BKYA 1U2SA 4J07A 3ZG6A 3K4HA 5E8JA 1JQBA 3OZVA 1N2CB 3R7LA 1FDVA 1BN6A 2JATA 2ZRNA 1KDYA 1AJEA 4GI2A 1FP7A 1IUNA 1BJRE 3KIPA 3A1NA 2FW1A 3NETA 5BYBA 1OT3A 4M9UA 2H29A 1WV1A 2QD2A 4CMEC 1I30A 2B1GA 3ZGZA 3MJVA 4QBIA 3QK7A 3ZW8A 2VG8A 1TVEA 4L9RA 4ZI2A 2M6SA 3JQPA 4Z7OB 4ZK2A 1QK5A 1RZ3A 4KV9A 2E3JA 1KDZA 1CV2A 3LOUA 4Z0NA 4K9LA 4EG0A 1G5PA 3CH6A 1NZFA 1Q7GA 2ZAMA 4L08A 2BKEA 3TMKA 4WGFA 2QL7A 2O7QA 3F3MA 3G6WA 4ZARA 5AYVA 3THSA 4B3FX 2DXIA 3ECCA 4IY1A 2HNBA 4PNEA 1S02A 4ENWA 3QKRA 2PQMA 1HLFA 1R12A 2HIAA 2RD2A 1U2DA 4KI0A 4FYVA 1W9HA 5JCPA 4FLMA 1O5IA 1V3UA 2W6IA 4QTXA 3TECE 2EERA 2HT6A 4NONA 1IQUA 3L1UA 4MJXA 3N5CA 1HDRA 1LBTA 3W7BA 5JPIA 1ZK3A 4NU5A 1OH8A 1YAHA 3ZGXA 3C1AA 2QTRA 3O4JA 3QYJA 4JL8A 1YJCA 3LC0A 4M8LA 4D4LA 1XTPA 3LKBA 1R0CA 2R86A 3LK6A 5EY5B 2PMBA 5JT1A 4ZU3A 3T5GA 3QEBZ 4GU5A 4S2EA 1R4ZA 4N12A 1OILA 1OZGA 2KS6A 3TOCA 2R8OA 3KK0A 1AS0A 4LF8B 5ENDA 1AD2A 5JI2E 2O3SA 1E2IA 2XTZA 5LVAA 5KPDA 2PUCA 2RCYA 5IDWA 4MUJA 4IDGA 4BWGA 3E6AA 1ABFA 4KDRA 2ZI3A 3K31A 4QASA 5AK4A 1JBEA 4LQ4A 1OIXA 4QFBA 2WU3A 5GTDA 1LZKA 4BHTA 4YAOA 3IT3A 4Y3UA 1RI2A 2R1VB 4ND3A 3UZUA 5TS3A 1TGVA 1XRPA 5JAHA 4QVIA 1M6HA 3MLEA 1FUUA 3AY0A 3OBBA 5HE8A 3RROA 3EEYA 2JD0A 3MOGA 3AR5A 2QG4A 1T36A 4M8KA 3BVPA 2CUZA 1QPGA 3RJ5A 4B3DA 3EEBA 2NO9A 4EJSA 1G60A 3R7WA 4EY6A 3FVQA 2YQ4A 2HCFA 2MTBA 2NSLA 1EVKA 3ZD8A 2P5SA 5C1OA 1OKKA 4Q16A 5I9IA 2PH1A 1VHDA 1RJWA 1P44A 1U3CA 4U02A 3A2NA 5HF5A 1SKMA 4J94A 3C6MA 3O9ZA 5HMMA 4Y1EA 4A23A 2QIOA 1TXGA 4TUYF 1PRYA 4IGKA 1RNLA 2ZPUA 3PNKA 3RRJA 1QUFA 1OBFO 1L5FA 1D2RA 1JMVA 3AETA 2GYYA 3B6ZA 1IZYA 4NYJR 5LP6F 16PKA 1MPTA 5L6MB 5K8JB 1IZ8A 3F78A 4UU1A 1EE9A 1UBEA 2J3MA 1L5HB 2PLWA 4EB3A 5HIAA 2HXGA 4U0KA 4KGXA 4C2AA 2FPUA 3EZFA 4D96A 1QQBA 2HIHA 1IN1A 3WL6A 2QPLA 2VT2A 1QH9A 4RSHA 1NMYA 3I9MA 4FYWA 3PNMA 4K9MA 2BBSA 1CZOA 2R11A 5CYFA 4CPDA 1A9SA 2H06A 1N2CE 1NRWA 4N3CA 4PFSA 4KPEC 3AVWA 2Y2VA 4IJUA 2Q5OA 5LXTF 4XRGA 5KJCA 5F9FA 1TF2A 2F3TA 4CDRA 1ZM2A 1OV4A 1CK4A 4JNKA 3GMIA 3KAPA 2J31A 5CVEA 4DIBA 1SU4A 3DHVA 4WW0A 3KVNA 4U2FA 1FRZA 2EFEB 1URPA 3OQJA 2WHQA 1INLA 5TQVA 1NQ5A 3CZ9A 1P72A 3HCDA 4PX5A 4CMGA 5JAMA 1HNZB 4OM7A 5E9QA 4BLWA 3M82A 1I2CA 3GZNA 1V71A 1U28A 2ZRAA 1IOLA 3AH8A 1CVRA 2C8JA 4LHWA 2F3SA 2IELA 4C7BA 1H9CA 3KXKA 2JD1A 4UVGA 1T5DX 4KPUA 3WIVA 5IJ0B 1AMUA 4Q3KA 3T9BA 1NMZA 1P2VA 5L4NA 2BI4A 2JRLA 5B2ZA 2XF2A 2QM7A 3QPAA 3IV7A 1C2YA 5H70A 1U1FA 1N9KA 2FMXA 1F6BA 3G2PA 4XGRA 1W36B 2ENWA 3IQZA 3QG5A 3QPWA 2D62A 4R1NA 1VMAA 5C35A 1E66A 4RZ3A 1YVDA 3C97A 3GNLA 4BMVA 3B7GA 3ZCPA 3VDNB 2E4ZA 1CCWA 1YZTA 4BUCA 2RH4A 1PJSA 3M83A 5DEOA 4XOIA 2ZE5A 1D4ZA 1QHIA 4O4HB 1Z0JA 3D6TB 2WM3A 4WCDA 1CR2A 4X62B 1V16A 3M81A 3R7DA 3QEJA 3C14C 4DR5B 2FN9A 3TH5A 2I54A 1T5LA 2P69A 3A6ZA 1AK9A 5AXBA 1QHHB 3I3SR 4HN2A 5EWLA 1F9EA 4ATNA 1KOFA 5EE1A 3SX0A 4RPCA 5KCMA 2WF5A 1JLKA 2P6RA 3S70A 1UJ4A 4YMHA 4KGVA 2NP7A 1OAAA 2GBPA 2CJFA 4AKTA 5KOJA 1Z75A 4IIDA 4NJOA 4KR9A 2DBZA 4PAQA 4G9GA 1CZUA 1PJLA 4RF5A 3TBKA 3V46A 5C5EA 5MDHA 4QXMA 3U5TA 4P4LA 5GJBA 5IKOA 3N7TA 5AJZA 2XUKA 1WZ2A 3AFGA 5HIIA 5HDBB 3CPEA 2PVPA 4TXMA 1M2FA 1PR0A 2F55A 3E9ZA 3GGGA 1CULC 1E5TA 2O8NA 1XEAA 5D01A 4AD8A 5EJ4A 1A4UA 3GCWA 4M1MA 4ZQIA 1IHYA 5BQ3A 3HJHA 3H2YA 1Y1QA 1QRAA 2WZCA 3II6X 1F6DA 3ITNA 3PF8A 4WOJA 4J8PA 1W9MA 4MW7A 5A5EA 3SJZA 5L45A 2B1IA 3MINB 3ZS8A 3BWMA 4DWOA 3SN6A 1BX3A 4MQEA 1XZPA 3MJRA 4QDJA 3UMGA 4FI3F 1JVBA 4C89A 4PTYA 5H9VA 1ZICA 4Y9SA 3VJKA 4KQGA 1H9BA 2C1XA 3VO1A 4KWEA 1IAVA 1Y7TA 3FM9A 1RPJA 2YFQA 4K1LA 2CT8A 4RZHA 3HG7A 4ROTA 1RD4A 3CWQA 3GFFA 4L27A 5BNFA 1SOMA 2AWOA 3GCXA 3KT0A 1A5AB 2ZBQA 3OT5A 1V11A 3TTSA 4BFLA 1D2EA 5T4FA 4KIUA 1C9JA 2AXPA 3EVNA 1TMOA 1CUZA 4L8VA 3RS5A 3ENZA 3HXPA 4P32A 2QL5A 5IT9A 1FQWA 3G79A 2RGGA 5ICGA 1R4AA 3FFWA 2B99A 4FGZA 4O25A 1DPFA 2JJ2D 5JOQA 3D5EA 3WQQA 4F71A 4CLEA 3J81k 3V80A 1ZY2A 2Y05A 1P77A 1ZQ1A 3B1ZA 1GADO 4GECA 2XNJA 1SUSA 3A6KA 3B6KA 3WV4A 4EJ6A 2I6XA 3WRXC 1GZ4A 2CBXA 2N42A 4YRRA 4YB8A 1G0OA 1MX3A 2BJHA 3ZV5A 4G8JA 2J0UB 3ABQB 3HCWA 5HCNA 3SQWA 5AW8A 4KPFC 3QFCA 2Q2VA 1A8IA 3SP1A 2ZYAA 5C8ZA 3DL7A 2EP8A 1N7GA 2JARA 3D02A 2G77B 4N18A 1EK0A 4HDRA 1HORA 3GEMA 2DVMA 3M5CA 4EJ0A 4CIYA 2BFFA 1KYWA 4UEWA 4W9NC 3BEOA 4D46A 3UG7A 2P5UA 2BBOA 3CLHA 1ZKDA 4QDOA 1XQXA 2BCJQ 4HCJA 2BZ0A 3LVQE 3ZCRA 2PD3A 1GM5A 4DR7B 2OAP1 1UPTA 3UOWA 1LXCA 1PQ4A 3EQ2A 4IOKA 4CKCA 2OCIA 4YJGB 3ANMA 4C4SA 1LTKA 1V8DA 1S2DA 4I0WB 2PUDA 1FX0A 3OLQA 4DV0B 4X6LA 3NTQA 4LV6A 2C5GA 4HAVA 1L4YA 3WBJA 4UPDA 2IDKA 4KVGA 4LJRA 1X15A 3UJDA 3DFZA 2WB4A 1N77A 1AKNA 2WPDA 4V0QA 2XHEA 5IZCC 4WESA 2JFHA 2AOUA 3AUYA 3F3KA 3GVIA 2K2QB 2WLSA 1C41A 1ZC4A 3MTIA 2ZT6A 3UKOA 5C5IA 4XVRA 2ZUEA 4CF7A 1XE3A 2BEWB 2IH5A 1NJ1A 1T2FA 5GQSA 3ER8A 4JK3A 3CISA 4OUDA 3KJXA 4MTLA 3EE6A 4Z49A 4C1BA 4US0R 3B36A 3LBYA 4CQLB 1GOTA 1XA0A 1WZCA 3OX2A 3L7BA 4JUIA 4FEAA 3OT1B 4YYEA 1EKXA 1MJGA 4BUJA 4DMKA 4AY2A 2VATA 2HRZA 3D6UA 3PXGA 3IE1A 2CCGA 2ZJ2A 2D7JA 3H1AA 1DRUA 2YY5A 2BGTA 3IKVA 4P7BA 4PIVA 3H42B 4GDFA 1FSSA 1DDOA 3CR7A 4DY6A 3FOBA 3O4GA 5HOEA 3QI2A 3FN4A 4JKOA 4JWTA 4LE2A 1JAIA 1XKXA 2REBA 4JQYA 3FZEA 3SQMA 1M83A 4XQ0A 5HS6A 3G1WA 2GKGA 4UVDA 3RJ9A 3S2SA 3P5SA 2DERA 1C3OA 4U2GA 1YRLA 1U5CA 3I72A 1L5KA 2W7TA 3PFNA 4UUAA 1R4MA 4LNHA 5JJBA 2C4NA 4YUVA 2Y92A 1SU8A 3R4CA 5J3JA 3H5RA 2CNLA 4K26A 2OXRA 3WK4A 1BYUA 1N3BA 1X86B 1HLPA 3RKSA 1AKYA 1REQA 2G04A 1PWYE 1BA2A 1Z16A 4J0GA 4JYBA 3CZAA 4HWGA 3GLIE 2EX1A 3EGOA 3I2IA 1MFZA 2P5YA 5EKXA 1G21A 3W8DA 3V8RA 5JNTA 2PWAA 2ID4A 3IMKA 4D9HA 4QUGA 2ZM6B 2IQ5A 4XWOA 1USKA 3QVJA 2W8BB 4JA2A 1PDWA 4C7JA 2PUBA 4KYVA 1DAFA 3WK8A 1TEZA 2WY2D 1MLDA 1IN6A 1WNFA 1DLIA 3C45A 3KJIA 2Q7XA 4K0KB 2P9EA 2VTKA 4BTVA 4KBGA 4UC0A 1IRXA 2XZLA 4A2PA 3I2GA 4RKYA 1EFDN 1OXVA 2AFHA 2MMCA 1NF9A 4JI3B 1DBIA 2QT1A 5EHNA 3OEEA 4LCBA 1P2SA 3CLUD 2HTEA 1O08A 2IYXA 1C14A 1GZVA 4OJMX 3JXEA 3KQYA 1C8VB 3B9RA 5DBIA 1EP9A 4PZLA 3FR7A 1I4LD 2QS9A 2WZBA 5BXYA 3WLPA 1YK0A 4ZT3A 5ESDA 1J8FA 1CQIA 3B1FA 1NY5A 3KQWA 1D2MA 3ZTWA 1MAAA 4XM1A 1NBHA 3IQFA 2AWNA 2QUAA 4Q1AA 4KTVE 4RF4A 3UANA 2GPAA 4HNUA 1M72A 1DO0A 1NA5A 4Y7CA 1DINA 4F85A 1C4XA 3ZCSA 4CLRA 3KETA 1T1IA 2V4UA 3P4XA 4LG1A 2CMDA 3BFKA 4LZWA 4ZOLB 3L4BA 1S1CA 3QUQA 5PGMA 2YYAA 2Z6QA 4MR8B 1YB2A 1ZCJA 3UK6A 4D26A 2EWVA 4X95A 2H7XA 5KREA 2NU9B 1SVIA 1SPXA 2ZB8A 1M1NB 3LXRA 1H1LA 2I7TA 3OLYA 3EMVA 3VNRA 4ZJZA 4IXMA 3F97A 4D0RA 3VYWA 4TWZA 5CYGA 4XXHA 1P5ZB 1X7GA 3UA4A 2JCYA 2Z09A 2ZYHA 1HDOA 2DCUA 3Q7EA 3QBTA 4V39A 3PA8A 4G24A 3QVMA 4HWSA 4WQMA 1GAQA 4DGSA 1FFWA 1T6BY 2PWPA 1DKRA 3IR5A 1ISMA 2I4LA 3SDSA 2OGUA 2J9ZB 1U8EA 1LBSA 4MP8A 1IHUA 2ZT8A 2EHDA 3P2YA 2AE1A 3SNHA 2ZTHA 3FYDA 4WNYA 2WTUA 2VJNA 3FPLA 3S2UA 1C80A 3LRTA 1V5FA 3EVEA 2AHRA 5F9HA 4W82A 1R4MB 1PD1A 3DBOB 3A37A 3W6NA 1RI5A 1NVXQ 2I2XB 2WTMA 4DSAA 1AC5A 2DPXA 4TMXA 3T1HB 3WMWA 2C9BA 4HVCA 1L4BA 2CZCA 1GAEO 1I6MA 1A04A 4C21A 4FOSA 3SZGA 1QANA 2R9VA 2OD2A 3ETHA 3GFGA 4O2AF 3IJEB 4JYPA 3MZ0A 4IIYA 4UMEA 4XOUA 4LF5B 5CBPB 2LRHA 4WX2B 3E35A 5EIFA 3K5WA 1NW9B 5ER6A 5BPFA 4TT3A 1L7XA 2ZJYA 1XRRA 3EHDA 4CL8A 4QICA 3QG1A 3IRVA 1D1SA 4NECA 3FRJA 4OHRA 2GUGA 4RHYA 4WJLA 3FBGA 3JQEA 4DNOA 2QW8A 1Y6QA 4ZV7A 3AKZA 5TQ2A 3AI2A 2G76A 4JEHA 2R0QC 4UEOA 4LX8A 1ISRA 1YZHA 2NU7B 1BJTA 2EJBA 1GA6A 2QX7A 5AOAA 5D3MA 5H16A 4C0BA 3PICA 3D0OA 2CXHA 3ZJ4A 1KZ7B 5DHUA 3Q72A 5DTQA 1BXRB 1LY1A 1U3UA 1W8DA 2JZCA 3OUZA 4LI3X 1PJ8A 4NL4H 4MLDA 3GRPA 5KVAA 5BMVB 1ZJZA 3KT6A 3FCUB 1CLUA 2AZMA 1K68A 3JAWA 2ZRFA 3QY9A 1NQWA 4KMMA 3N86A 2ZRMA 3OCYA 2JI9A 3R3XA 2Z1NA 5EN4A 3DMNA 5SY6A 4YXWD 3ZDYB 2YIDA 3VM6A 2D7CA 5D85A 1OHHD 2ZR0A 1U28C 4AP5A 3PBKA 2RHBA 3ANXA 1UBFA 2GN8A 3AF1A 4PCAA 1N7HA 2O2CA 1T4MA 3PHLA 3QHQA 4GPEA 4I6JA 1Z0FA 4AJEA 5ARDA 2QI9F 1DIOB 2HU5A 3AESB 1L3IA 4MKFA 5FB3A 1PP4A 4CLXA 1WTCA 2OBMA 1JA1A 2Q6TA 4HEA6 4LWPA 4OB7A 1TQ4A 3FWPA 4QBFA 4CKCB 4HDNA 5K6TA 2JLZA 1K63A 2VEDA 1TL7C 4Z4HA 4OCZA 4Y8VA 4LWOA 3RT9A 1SC1A 4BN0A 4GPBA 1PK7A 4ISBA 4LXHA 3SFVA 4YACA 4TMKA 1P9LA 4Z4IA 2HHAA 4JI2B 1GPH1 4YRQA 2OV1A 1AQJA 5C1BA 4L3OA 4NV1A 1KOLA 1II8A 1JXAA 1OX4A 1ZYUA 4GQAA 2BN4A 3KSMA 4Z4EA 4AMGA 2ZR7A 4YAUA 3SZUA 3AM1A 1ZK1A 3WGIA 1R6TA 2J0SA 2A9FA 1ZUHA 1KK2A 2HA0A 2WNSA 2GPBA 2OVBA 2WYHA 3BGDA 3MW8A 1G8JA 1KAQA 2Q0HA 2ZIGA 4RK5A 4EG1A 4F3CA 2Z2YA 2C61A 1WHSA 4M60A 5K0BA 3TTVA 4G8CA 1CY6A 4KITB 5D2CA 3ONEA 1E63A 4OHXA 3IAM6 4FZVA 1YDFA 4J29A 4KJXA 5AJVB 5DF1A 2FSPA 1QHYA 1WEKA 4Y0VA 5LMUB 3RTCA 3BSFA 2AD5A 3TLKA 5H83A 2ERYA 2VR1A 2OHOA 2IQIA 2YHIB 3WK5A 5F21A 3PJFA 2ZJAA 5ALWA 1TUBB 4PGHA 4Y2TA 1L7VC 3AZQA 4BMOB 4INZA 4AJ4A 4CQNA 1E3IA 3WDMA 4ALLA 1HDZA 4FYYA 1KKLA 2H51A 3G5LA 1Y1LA 3HADA 1Z0SA 2O6LA 1JYEA 3ZHSA 1TAHA 3STVA 1HOXA 4QPDA 2EGHA 2WJIA 3T8YA 2I91A 4TWAA 2Z8XA 3N05A 4NSNA 4C20A 1NNEA 1E96A 5KB3A 3EFEA 1XI2A 2Q21A 2QTBA 2Z3VA 3KEFA 3TQRA 4L8GA 1V8BA 1Z5VA 3G8DA 1M66A 2WHYA 4G0UA 4M87A 4QOFA 5KYTA 1DJNA 4S12A 2F64A 1D5WA 4WOKA 4X7RA 2ACEA 2IYRA 4R9UC 5AJHA 2XX3A 4KO8A 1DAHA 5EKTA 3U0BA 4IJ5A 3R7AA 2DFKB 1CQJA 1ZR4A 1RYDA 2OY0A 1O57A 2C54A 3RPEA 5L6LB 2WZDA 3HXKA 1Z6XA 2CXTA 1W76A 4J49A 1YRHA 3C4QA 5ECWA 3INNA 1J25A 3UJHA 2B61A 3RR2A 4BO9A 3CPHA 1LGYA 3DKKA 2AEJA 1DDGA 3OWXA 2IF2A 4LDQA 1X7XA 1NBWB 2QTAA 4UUNA 5DHFA 3OICA 3RVDA 5KTMA 4KBFA 3R3SA 4R1QA 2R1ZA 5TGZA 3WGMA 4A5SA 4W5WA 3BRSA 3N58A 4FHEA 3RWBA 1U0NA 2AW3A 3C7AA 3UAVA 3JQFC 4E51A 1R5JA 1B16A 4OQZA 1RFLA 1OLXA 1JU9A 5EFOA 4Q5IA 2VJDA 3FCXA 3GJQA 5JD5A 3HBJA 3D8BA 4GD3Q 4IRUB 3RRFA 2H4WA 4YJ3A 1UKBA 4L95C 5F73A 4BGVA 3UJCA 1RTKA 3QXXA 5LUBA 5IDYA 5IF3A 4LUCA 3SWWA 4AG3A 1BH6A 2DP4E 3ZI7A 4WECA 4OEHA 4V0KA 1M54A 3AV0B 1VSBA 3KZNA 1VIYA 3C6YA 3UC5A 3HXMA 4P3YA 1F48A 2FPKA 4YPVA 3ER9A 4NJMA 3HBFA 3E1KA 3P9KA 4QEKA 3OF3A 3OIDA 4C43A 4LGCA 1CDDA 1WSWA 1L9XA 3OM1A 3I9OA 4ZIRA 3AVYA 1OZ0A 5KX5F 1H1DA 1O0BA 3KQQA 3DWGA 5HZGA 3TS1A 3VPGA 4DDWA 2WA2A 5LQUA 4Q66C 2PH7A 4RNDB 2A84A 1GJRA 2A1TR 4ZVVA 2CLDX 3GFBA 1W4AA 2HPAA 1OLUB 3JD0A 1ZXBA 3HY3A 4J43A 1MTZA 1LBIA 1PX0A 4JVOA 3TSAA 3SIPA 2FX3A 2OC9A 4UCXA 1R1DA 5BSMA 1T5BA 4WA7A 4O0LA 1XWIA 3RI3A 5JCJA 4BXOA 1FDTA 4QPZA 4FGLA 1BMFD 5LWQA 3OMXA 4HDKA 3OIYA 1U7UA 4BIIA 4AC9A 4DLPA 1VDMA 3T1OA 4ED9A 4ITUA 4Q37A 3TVTA 4QJ4A 3N9IA 5JH7B 2G08A 2RHMA 4XVHA 2ZWIA 5K0LA 2DQZA 1PKXA 2R8ZA 2IGBA 1WXDA 2R25B 3S2IA 1QAMA 4G1FA 4NP6A 4N0PA 3K1AA 2QGNA 1TPZA 3F4BA 1RAAA 2BCGY 1ZM3A 4OJQA 3TF5A 1XJ0A 2WD9A 4X45A 4YV7A 4CEHB 1IEXA 1K5DA 4MCJA 3HACA 4EI2A 5HVNA 3A3KA 2VDUE 1S8NA 2R6JA 2Z4RA 3Q3EA 2DY1A 1J2EA 2Q8QA 3P52A 1H2AS 1M8PA 3DMHA 3GLFB 2BFBA 3TRKA 1G3UA 3H83A 3NH6A 3NOXA 1A9TA 3DXZA 5LQMA 5KKAA 2X0IA 1GSIA 2ZCVA 4UJ3A 1IN5A 1FDRA 2FR8A 3QFHA 4ZAVA 2FUCA 1YNOA 3HWSA 3LUBA 4WXYB 1D7OA 1DMRA 1Y9AA 2D2XA 3DBRA 5G3ZA 5LXTB 5EVCA 4O02B 4L50A 3B8HA 4G1BA 3NUGA 3FDJA 3M6MD 4RM2A 5EHGA 1ICEA 1EFVA 1SUIA 4JUDX 3HHPA 1XK7A 3RGGA 4ZRDA 2WT9A 5K0JA 2IDJA 1M2JA 1KSHA 3NASA 2N46A 1A95A 5M2QA 3IPLA 3KBOA 1SKYB 3R8FA 1KGSA 2IYSA 2ZYUX 3PZRA 3SZMA 3ZX5A 4RTNA 2O2JA 3QNWA 1YZ3A 3BCSA 2BGUA 1CEXA 5COQA 4HDSB 2IPOA 2RIPA 5ALNA 1EDZA 4Y1FA 4EY4A 4JI0B 1KAEA 2CXQA 1JVNA 1CB0A 3FB1A 3GHYA 3A1CA 5KQPA 4KP7A 2BZSA 3IAFA 1ZN2A 3JQAD 2JW5A 1OI7A 3DTNA 5DN6D 2VWQA 1PTKA 3FB4A 4UBLA 3B9QA 4G2NA 4QPJC 1JDBC 4TKZA 4EA6A 7MHTA 1SVNA 3E3LA 2BGLA 1DFGA 2Q6VA 3AHJA 1HKUA 1M2GA 1CUXA 1NVMB 3DCNA 2OHJA 3IKMB 3AI7A 1WMAA 3A9VA 3Q9UA 3LYHA 1N0WA 1T5TA 2O7NA 2P6OA 3QBEA 5BSUA 4KE7A 4L5CA 3NPAA 1WW8A 1YDHA 4HTFB 3ENKA 4HF7A 4HXGA 4NDNE 4F2WA 3NRJA 4GM0A 2NQTA 3IBCA 4ZV9A 1JG3A 2VDRB 2V5VA 4MZXA 2YICA 5GJWC 4MP3A 1U9IA 4TV9B 3GRFA 5AI6A 5CBPA 4EFMA 1E32A 1V1JA 1VL1A 1KJ9A 4DG5A 1Y9JA 3RNLA 1CS0B 5FYQA 2RGXA 2NXEA 3OD1A 2KW5A 4WN9A 1B8VA 1EFCA 3LUJA 3B82A 3MCTA 5ENZA 1QF7A 4GR4A 3SZRA 4EEKA 4MYDA 1O4VA 1DT5A 3RJTA 3AOEC 5K3FB 4CFSA 4OHKA 3X44A 3KPYA 1RQ7A 3FGPA 2N0SA 2G8LA 5L3SB 1YKFA 4JNCA 4ME6A 4S3MA 3MYRA 3BE5A 5B12A 3PXBA 4R2KA 2GRAA 4RD4A 1QSGA 2I3GA 4IG9A 2XVMA 4Q1CA 5CCBA 3X2EA 2QDXA 1QHSA 3JPYA 2R66A 2J3EA 3BMCA 2QUIA 3K3PA 1ZOPA 2PGNA 3M1AA 3W90A 4JBYA 1VL8A 3P4UA 7YASA 1BJKA 2RB4A 3S1SA 1LPOA 3HCBA 3OFVA 4HFNA 2JANA 4RGQA 3S81A 4MGYR 2F8SA 4LTNA 3LQRA 5IAEA 3WX0A 1N7IA 1RXVA 2XKKA 4B3GA 2Q0XA 4EGCB 2FMUA 3N6XA 2OLKA 4A91A 2R1UA 3GPCA 4S04A 2IHKA 1Z7WA 2NVBA 2BFFB 4RQTA 4RX1A 1CNEA 5J58A 3EZXA 3IJPA 2GZ2A 2YIVX 1TQ6A 1OTHA 1TRKA 2RI0A 3H5TA 3P9CA 3Q3GE 2CUTA 4KQ6A 5LOVB 1XIVA 4ZEWA 4AO7A 4HAUA 3AMVA 4ZREA 1TZBA 4L6AA 3M6AA 4REMA 3FDFA 1U0EA 4PO8A 1Z0ZA 1NAIA 3MT0A 2WJZB 1ZD8A 3OJLA 5KTYA 2RGUA 1ZSYA 1QOZA 1QX3A 1YZYA 3NVKI 1VLQA 1W5BA 2XCLA 1ISIA 3U3OA 4DMUB 4EPVA 1Q1GA 2DU8A 5LLTA 2WQ6A 3BTSA 3F3YA 3I09A 4TKVB 2EBFX 2ZBVA 3HYRA 5FA6A 3K6RA 1XZFA 4YWHA 2I9PA 1HY3A 2OCYC 2C2BA 5BQ5A 3BRCA 4WOBA 4GVLA 3NC4A 1FP4B 4O4LF 1WVIA 5TGTA 4HBZA 1QZZA 3Q11A 4UHEA 4OK5A 5EP2A 4D0GA 1EDDA 4E5DA 1K3FA 5LQCA 1U7PA 1FUEA 5C4IA 5LWHA 4L78A 1N2SA 2QLJA 4PLYA 1GSOA 2SICE 2B94A 1XRNA 3A6EA 4IXDA 8ABPA 1JNXX 1VYHA 2ZWAA 1WQ1R 5KSOA 1JH9A 4BY9E 1SEVA 4PRKA 5AM1A 1I4WA 2OHHA 3H87A 4JLOA 4JT4A 4WFJA 4YONB 3U61B 2Y27A 1NW5A 4IH4A 3TNFA 4LBVA 4JBWA 1GTVA 4YYZA 3LLCA 3L05A 4RY2A 1VG9B 4WVLA 4C7OA 2XQGA 4HQOA 2P27A 3ADKA 5FWYA 2V6GA 1P4HA 2DZDA 3U48A 3H5LA 1GL6A 2VYQA 4Q4AA 4DLZA 1KRXA 1AKVA 1CJMA 4MQEB 3TQTA 4J1QA 5F7ZA 1GG8A 1LEHA 1EFPB 1ESDA 4L02A 3RS9A 3UGJA 4EKNB 3PX3A 2IOFK 1K6IA 4V38A 3RV4A 3ZE9A 1Z4OA 4U63A 1KSJA 3DHWC 2LKDA 2QY9A 3ET4A 3U3ZA 1LVHA 5M29A 1WXEA 3BWEA 4FZ3A 1JF8A 3NJ8A 5KYYB 3PQFA 4MPPA 3BF7A 1W48A 5GVRA 2QRVB 2HBZA 1L5NA 5D00A 4AMVA 2CXOA 5ITZA 4PHFA 5M34A 3BMCB 3ANYB 4WTOA 1E2FA 1JAZA 3CCBA 3QBVA 2O23A 3DZKA 1UZAA 4KXUA 2RJ3A 4F0JA 5KS2A 1GAWA 3HKCA 2NU8A 3ZGVA 2ZTMA 4RD0A 3HKDB 2PX6A 4XCXA 1UDWA 1Z56C 4QOSA 5B2FA 1QB7A 2PD4A 1KEEA 1RZRD 2G06A 1IQ0A 2HQOA 1PHPA 2FV8A 4Y6QA 1GZ7A 2ZJ1A 3MS4A 5KU7A 5K1ZA 2HHCA 3UG6A 4RAOA 4MIOA 1HG0A 1SHKA 3DPIA 3DTVB 4FK8A 4JOSA 2ZKLA 2QQ5A 5DTMA 1D0VA 1X7YB 4ZRNA 5BN5A 5TQ2B 4Q3DA 5LP6B 3MILA 1BX1A 3B6MA 3WMFA 1ZO8A 1VKHA 3L46A 1XU4A 1EE2A 4D8YA 5KSPA 4FKBA 4PIMA 3LUKA 1ATIA 3J7AC 1A4XA 4X65B 1PWEA 4BJHB 5LD2B 3LLVA 5BR7A 3EXFA 4LXUA 1IXKA 5JQGA 1DL5A 2X9LA 1QO0A 3JYHA 4LZAA 1Y89A 4PAWA 3CX6A 3OPYB 2IUUA 2J85A 2QQGA 3BG5A 5JS7A 1Y8QB 1RZRA 5KIAA 2E55A 2EU8A 1Q2XA 3NHBA 1GFSA 1UH5A 4LDRA 2JDIA 1XDGA 4UZFA 5LYJB 4UFPA 3N2LA 1M6VA 3GVHA 3FUXA 3K8ZA 1EVEA 4NCHA 4Y6SA 5F3RA 4ZEVA 4AJIA 4IV8A 4JT9A 3FFTA 1XX6A 4HLQB 1PLKA 4DCNA 1OA0A 2G5TA 5B3KA 3ESYA 3SJ7A 3OX1A 2C20A 2DPGA 2QN8A 4YV0A 1MIOA 1S8AA 2VRWA 1EVYA 1PSWA 3I8XA 4D56A 3COJA 3LCVB 2DQYA 2ORWA 1S2MA 2J6BA 3GZ4A 1W30A 1GTG1 1RJDA 4O2LA 1I51A 2NWQA 3L0CA 4J4TA 3DDUA 1EI9A 1DCTA 5CVJA 3KKEA 1PSZA 2CJYA 4CKWA 4LVCA 2NT3A 1OF1A 3A4YA 4DDTA 3I04A 2OL4A 2YIMA 3NU1A 4FIDA 5EP3A 3D43A 2ZG6A 2A6PA 4FBMA 4F2HA 1VMDA 4E11A 2XODA 3PC6A 3U7HB 3Q40A 3OG9A 3JQGB 4XD2A 1Y7HA 1Q1ZA 2HCBA 2IV2X 2IEIA 2XUOA 1EEXB 4RTQA 2P3QA 5SZKB 4YCSA 4AKGA 1TO6A 4BO4A 2E9SA 2XR1A 2Q3JA 5HS4A 3NLLA 2QXYA 6LDHA 1KO4A 1CQIB 4KK3A 3ZWBA 1H2RS 3G17A 3M0EA 1W5EA 3FOFC 1FMTA 1EH5A 4R2WA 3IUNA 4W5OA 2EFHB 4QFDA 2VP4A 4EH1A 3QOXA 4ARBA 4GSKA 5LP6C 2O8BA 3F7MA 4KFUA 1S2IA 3TFWA 1Q2UA 4P6VF 4QOGA 4N5MA 3KQKA 4JENA 1U0SY 5TXGA 1C1DB 1W29A 1DTSA 1UKVY 2BR5A 4BV9A 2JEOA 2QRQA 2BD0A 3F74A 1P2BA 4DKXA 1JIXA 4D57A 3EB9A 3CZPA 4N1AA 1QF9A 2FF7A 4NVRA 4ECEA 2W42A 1ML3A 1NSTA 2PUVA 2QUJA 4ZI7B 3HNRA 3KHSA 4DGQA 4HAWA 1KI2A 3F9CA 4ZI7F 2V5AA 4OBBA 2DULA 5D6OA 4CT4B 2GCPA 4DV3B 1IUOA 1IWOA 1XTIA 2WABA 5DSXA 1GYQA 2KJQA 3OZAA 3QEKA 3R41A 4M2LA 3U09A 3L6RA 2L0XA 1L7BA 3AHEA 4WI1A 3S27A 1KMIY 5DNEA 1UJ2A 1Y81A 1FJXA 3WV5A 4LZLA 4TLAA 2YV5A 1MB4A 5KHLB 4LJ7A 4ZGWA 2OD9A 1PZFA 5FTKA 1Z6TA 4RMGA 1I6WA 1QFSA 2DFNA 1Q3KA 4KLZA 5E6SA 3EHEA 2D7DA 1Z6GA 1XQ1A 1WOYA 3MCVA 4Q4DA 1OSNA 2C4VA 2HWXA 4QQNA 4F5ZA 1JECA 1CIVA 2VJMB 4GKAA 3W8RA 2I62A 3ZJYA 1XZDA 5J2TF 4EVIA 1KFJB 3ELDA 5FA8A 3AEQA 4FVTA 4TQ9A 2HMYB 3F6EX 5C80A 1EINA 2AMLA 5TIIA 4KKXB 1O97D 2BEUB 1VC2A 2YY7A 3N2ZB 2ZI9A 4O2BA 2JFUA 2CVZA 1R9NA 2FG6C 2R2AA 2J8ZA 4RZUA 1MJHA 3HWWA 3ECAA 4CL0A 4CR8A 3NGXA 4G4SO 3RVJA 1TKCA 3FE2A 4LFCB 3THYA 2HK6A 2A1UB 2W11A 5JE8A 3WBBA 3GDFA 3TLJA 2Q6IA 2ZETA 3M6IA 2MMGA 1RWPA 2X9QA 4PF1A 4GVPA 3HCAA 2YY6A 4RKWA 5F52A 5EUCA 3EBLA 3LPDA 4MARA 5E1DA 1KL7A 2VDWA 3UAWA 3IKLA 4LYGA 4U3JB 5HK9A 1JQEA 2WILA 1LPBB 3W5VA 2HUPA 3PFHA 1OFTA 4KOAA 3RC2A 4DCOA 1FNCA 1KY2A 3GEBA 1W47A 4MWCA 2E1PA 4QL3A 4PHGA 1FU4A 5DTIA 5FNVA 4UKDA 5CCDA 3AF3A 4CU5A 1LK7A 2YL2A 1NKTA 5AHXA 3QI7A 1FX0B 5B53A 3W4KA 4D0NA 2Q3DA 3U49A 3NJ4A 5BQXA 4PC3A 3SOPA 3UPUA 2HB6A 3NCTA 1IQRA 1SK8A 2C97A 3ADBA 1WV0A 2FFJA 1N3LA 2I9KA 1ZXLA 2DH6A 4YN3A 5IUJC 1UMBB 5L7WA 1K6EA 4LNUA 2YCBA 4H2DA 4KO4S 1U8ZA 4URXR 2ZCJA 3S3TA 1P81A 1TMYA 3EPKA 1G5QA 5EMLA 1SD1A 4U9UA 4RH1A 3MJDA 1UBJS 4H15A 4R71A 1MHTA 1ONNA 1P7PA 3R0IA 3QX3A 5CT4A 1Y6FA 3GBSA 3ISVA 3MJTA 3QVGA 5GIOE 5B1EA 3N0TA 4TS9A 3UJBA 4XGIA 1PR3A 4M37A 4YP5A 3DVLA 4A73A 5JXWA 1S2OA 1QO7A 2VL7A 3IJRA 4W1QA 4A3SA 5AOBA 1E69A 2WOOA 1EU1A 5E2IA 1ELOA 3HO8A 3QUBA 1Z47A 4HSGA 3AUUA 2RK4A 4OXXA 2O2DA 4ALIA 2DECA 1WABA 1K66A 4HLDA 4IMPA 4B3RB 1SOUA 2ZUCA 1UBCA 2DHCA 2IYOA 2V97A 1OFIA 5BUZA 4MQ4A 4PWZA 3EZ2A 3GEDA 1W5AA 2QTTA 4D41A 4DCCA 3TI9A 1AQUA 1ITZA 1OAKA 3CLSD 1UJ5A 1W73A 1R9MA 1MEJA 2XNSA 1TCAA 4UQOA 4WXEA 1ZJ5A 1F2UA 4JLDA 1MNAA 4RYDA 4WT7A 1HT2E 2X3FA 3D8TA 4BQPA 4NOLA 4MITA 1BU5A 1I3MA 3HCPA 5A4IS 2GAIA 4IDHA 3MCUA 3VISA 5EKDA 3L6EA 5G3YA 3N8KA 5EZYB 2X5XA 3CKKA 2OYCA 4BBJA 2RHGB 4DVGA 5CDHA 3PD0A 2B9VA 3COYA 4M88A 5K0TA 4J7CA 1H9AA 1IBRA 3SFZA 1TW2A 2B4KA 1JEAA 3BZBA 2OYRA 5IASA 2XCSB 2FI1A 4TKUB 3VNQA 1XMIA 4MV1A 4BZQA 4DV7B 1HM5A 1HA3A 1UKYA 1V8FA 1JDJA 4FR2A 2XCUA 1UDCA 2B8NA 3KVVA 3OWHA 4MV6A 3OD5A 4RW0A 1C7JA 4NOMA 4Y0NA 4YJFB 2J6HA 3RIYA 1R0WA 2CNDA 1KYTA 2ZS7A 2J6IA 2P11A 2VYNA 3TRDA 4NPCA 1S01A 1SCQA 3GT0A 3L1VA 1B8UA 2EARA 2Z04A 3B48A 2QJOA 1ORHA 1J2JA 1NMSA 2PJZA 4TLCA 3X1MA 1IXRC 1NVKA 2FUEA 2QRPA 4YLEA 2BIFA 2V8BA 4LDJA 3SPXA 3JPWA 4K28A 2A9RA 3VVLA 1U65A 4LYFA 1BMDA 3SYKA 3TW8A 1NWCA 2QX8A 2XQJA 1KRWA 3W6ZA 2W4IA 3H8SA 1JHOA 1KYZA 2G7MC 1PL8A 1GQSA 4YRLA 4BO6A 2VF7A 4MRRA 4NAVA 5EIAA 2B69A 4FEGA 1YFKA 1I2BA 4Q4HB 1Y0BA 1OI4A 5E2BA 1PFGA 5TSDA 2I2AA 4KSBA 3I2KA 4RPIA 3B2NA 5C8DA 1I32A 5KVVA 2ESRA 1HGXA 3GDHA 2F9LA 2CNNA 4OMDA 3S0JA 5AUQA 2ZSIA 9LDTA 1OUMA 1UMBA 2B25A 4BZXA 2E5LB 4KIJA 3HFSA 1GL7A 3EWSA 3AP2A 1Q83A 3K5IA 2ZB2A 4E2YA 4HADA 2GEVA 2IX9A 2FMTA 1KI4A 1N5MA 2H1FA 2R96A 3EPRA 1G7RA 4Y7DA 1VZ3A 1IEVA 4ND7A 3BMQB 5KI6A 5EXDA 3DLIA 4EB6A 1ILWA 2N75A 6Q21A 2JFOA 2V7BA 3KV1A 4BNVA 4E33A 2AYXA 3HABA 2YN4A 1SWVA 3X2FA 4JSRA 1MAVA 2Q45A 3QYPA 4LS3A 4RVUA 4L5YA 1HX7A 4IIJA 3QMPA 3ZH9B 5CXQA 1CUYA 1E60A 4MRSA 1W36C 1WUJS 3DWIA 4GGOA 4YJHA 1ZVQA 2YWFA 1L1FA 3IIMA 1WUYA 5JS2A 1JYFA 2FEAA 4TM8A 5JAOA 2VJPA 4TT8A 4U3JA 2W83A 3T4EA 2CV1A 3UHAA 5AVTA 3JWGA 4ARZA 3SOZA 2XD4A 3TZLA 1PE0A 1RRFA 1P6XA 2WYWA 1EPUA 1EDOA 1YQEA 2X1HA 2ZRJA 3DPSA 5A9TA 1P7YA 2VDNB 3USZA 3RC8A 1IIRA 2EF0A 1PTJA 2AXEA 4DWJA 4HP8A 1A9XA 4MS1A 4PZAA 1OOEA 3SE0A 4BB0A 1LPNA 4DLSA 4YRTA 2ZXEA 3KYBA 4H60A 1X1TA 3P45A 3GOHA 4K86A 4LSMA 4Q15A 2IXTA 4MKIA 1GQOA 1NBIA 4TTSA 1AXGA 3V34A 3S7ZA 1JEDA 2G09A 2R8EA 4D6XA 3PIDA 4D9KA 1E2PA 5HQ3A 3L8GA 2C82A 1LTHR 4FQ5A 4BMCA 10MHA 4RV5A 2RIRA 5FD8A 2AB0A 2ZUFA 3VPXA 3Q6IA 2X14A 3K15A 1OU0A 5EJAA 1A8QA 1AKWA 4I9FA 1OH6A 2EYQA 3MRTA 2DUJA 5DGHA 1P33A 1FDUA 1BE1A 3KTFA 2AA3A 1NUAA 2HJHA 4MVJF 3VQTA 1KC3A 2XQVA 1KMMA 2F90A 5EQDA 4C7VA 3EW7A 3EIWA 3FG9A 3OE4A 5EJ2A 1E8DA 4ZJUA 3UWMA 4IGIA 1GP2A 4U7TB 1FRFS 3H2BA 1L4EA 5ABPA 1ZISA 3BD9A 3TCKA 2QGFA 3BB3A 4KN5A 5CW1A 1OJLA 2C2OA 4LZOA 3L7NA 3H9UA 3ZWOA 1R8XA 1XEXB 1J0BA 5JUWA 2BSQA 3ND9A 4IFBA 2AC2A 3LGAA 3AF4A 2PUWA 4DFDA 5EJ9A 5JEDA 2RGDA 2CDNA 1RVDA 2BLLA 2VSFA 2VYND 3B9PA 3LDAA 3ZK8A 3DE7X 1E7YA 5LBIA 2B8EA 2GBLC 3DBVO 4LJ4A 4OYLA 4TX1A 5J1TB 1CERA 1J8VA 1OGJA 3OF5A 3ZH2A 3DUFB 4RK1A 1YL6A 1E9DA 3CSDA 3IOBA 4AECA 2Y1LA 1E9BA 1E7SA 3PUKA 2D8AA 4HYTA 3EC2A 1D2GA 4IZHA 5EWJA 5FWNA 4MROA 4WERA 4BNHA 2WE8A 4CLDA 1S9DA 3H05A 4IVNA 2KSQA 3H1EA 4BEBA 3GEPA 3LG2A 3DE0X 4DS3A 3GDWA 3I2FA 4GWKA 4UD6A 1IEQA 4EL5A 1TGYA 1WR8A 1YH3A 2ZDGA 1GZHB 1ULUA 2FEXA 1NOIA 1ZM7A 3RYCB 5L7TA 1R18A 4HX5A 3WB1A 4FD2A 5JTUA 1E9CA 2FRDA 2GJ8A 3DV0B 3SHOA 1BWRA 2I6GA 3W77A 5HTKA 4EEZA 4RUKA 3S2FA 4IX9A 2PUFA 4O4IB 1EA7A 4ND1A 4KW7A 4Q3NA 1QYVA 2QD4A 4TWRA 2C99A 3JASA 3JVVA 3KDPA 5CK4A 4BRSA 4PFJA 2Q7OE 5I7EA 1Z2NX 4GZ5A 4N9QA 4O4JF 5JZSA 2I2DA 3N7UA 2HJGA 3UJ3X 3IMCA 4ZQGA 1UJCA 4GQBA 1QZUA 4KRXA 2CFIA 4WPGA 5E7MA 1A5BB 1DJQA 1Y8QA 3OFND 2ZIWB 4IDAA 4PRLA 4BQOA 5AVUA 4FDTA 1T6YA 1LUAA 2ALJA 4BVEA 3NYRA 3CLSC 4TTQA 4KRYA 3OI7A 1DIAA 5JR3A 3GVCA 1ONPA 2JS7A 1PR2A 2QTCA 3MCAA 3U7RA 1QR6A 3A1VA 3NKVA 1BMTA 1LV8A 1P2UA 1RYEA 4HUQA 4C29A 4J0IA 3RODA 4ILKA 4JQCA 4E4YA 5DM1A 2AJDA 3VTFA 2Q4DA 3K0SA 2VZ8A 1WQ4A 2Z98A 3FVRA 1OZFA 2Z3WA 1CTQA 1ZIDA 2DAPA 3D7SA 3PFKA 5IW8A 3W9YA 3DTVA 1PJQA 2IYPA 3DDCA 4ZO9A 3BN3A 5IKXA 5CD1A 3AQ4A 1WSAA 4EHDA 4OG2A 2X7JA 2E0IA 3GN1A 3NP9A 4BMZA 3UJNA 4OUDB 4U6NA 3VOAA 3H1GA 1PWHA 5BQFA 1FMFA 1OFVA 4NZNA 2F9FA 3HLTA 4RVFA 3ADPA 4PYJA 1CE8B 1KZYC 3C74A 4GLLA 3ONWA 4EGAA 4C4XA 3BICA 3K32A 2PWBA 3EF1A 1FZQA 2HMAA 1KQFA 2II6A 3C6BA 3ROTA 2CWDA 3L7MA 4QT0A 5B3JA 1TT7A 5A7GA 3A7EA 3F6YA 4C0AC 1RABA 3LKZA 2AKAB 4TXHA 2EKZA 3FX2A 3BXXA 2EC5A 3K0FA 4MQ5A 4R1LA 4B3HA 4BQIA 5C8YF 3BYZA 1WSDA 4BKQA 1A50B 4D8WA 1UMDA 2QRVA 3NM4A 4AULA 4EW6A 1M2OB 2BSXA 3B3JA 1ZGJA 3FYSA 3LZ6A 3NPMA 2GXUA 1U1IA 4C4AA 1V11B 1QIMA 2XVXA 3M33A 5FL3A 4EGFA 1FXSA 1KEEB 1RAEA 2W6ZA 3CX3A 3GXBA 4F8JA 3E0QA 2A59A 1TJYA 3I6BA 1ULBA 3OJWA 3RK1A 4PU0A 4LVOA 5KCZA 1DT3A 1G8PA 1VLVA 1TJ5A 1U5AA 3LZDA 4C07A 4QYWA 1FJ2A 3CLKA 4E5YA 1W34A 4YUWA 1WY5A 1A4RA 4PZ0A 1F1JA 4GI1A 4XVUA 5D5QA 4R2MA 1AY0A 4IWXA 5HFAA 1TZMA 2PS9A 2PV7A 2XH8A 3MINA 3PFFA 3P71T 4G23A 4NFYA 3RKUA 1I2ZA 1PJ3A 3W7AA 1GUDA 1OWLA 3EGIA 1T9KA 1TU3A 1PEDA 2GJ4A 4E5NA 4X91A 4CE6A 2QSUA 2FUKA 5JADA 2QT0A 2RKBA 2BYTA 4MUMA 1HXHA 3LIPA 3O95A 4INAA 1JHPA 1TCBA 3BM5A 4UEKA 2OCKA 2A7XA 2UXCB 1QDLB 4RU1A 4RZIA 5JATA 1Q0TA 2FPRA 1UK6A 4TTPA 6ABPA 1Z13A 4F2DA 4NAHA 1R0YA 2XNCA 4LY9A 5DXJA 5KTNA 3JY6A 4JKIA 1G21E 4BQQA 4RY9A 4ACBA 1NX6A 4H6PA 3KR1A 4PZDA 4HQLA 1TA9A 4B6SA 2J59A 1M2EA 2C2WA 2P9FA 4DTIA 3B78A 5EJFA 4AS3A 1J9EA 4F46A 5ENVA 4YR9A 4QWWA 3LS2A 4P3KA 2R6ZA 4II7A 1QVVA 4RL4A 4TV8B 2B4YA 1H65A 2GZ1A 4ALNA 3BE8A 1UC9A 1YRAA 5AJYA 2VBGA 4KWHA 4ER3A 3NT5A 4TMYA 3ZHTA 4A8JA 5CBKA 2Y1FA 3UOGA 4ZAWA 3I62A 1PU2A 3K1TA 5CU7A 3RU2A 4TRMA 2NZJA 3K0FB 2UZ1B 3ACDA 4M0KA 2RG1A 5TMDA 2QSZA 3N2YA 3QA3E 4E12A 2IYYA 2H1LA 1TJ4A 2CXSA 1IAQA 4R8KA 2BAGA 3DAYA 5A02A 4JXXA 3AR8A 4IEIA 2R6R1 3HN7A 3FHJA 4MRNA 3WZMA 4YY3B 3F0TA 3BDVA 1VECA 5EVJA 3I1FA 2IWRA 2WDZA 4B84A 4IO0A 4AP9A 1NONA 3OCUA 3GJTA 4IVQA 4ZWNA 2NTJA 4BFYA 5AW7A 2YN0A 4U9IS 1V1MB 2PRYA 5LBTA 4UW9A 2GM3A 1ZH0A 3G0DA 1Z2AA 3R3UA 4OJYA 2E49A 2GCOB 3IQXA 3DV9A 3M9WA 4GC5A 1A2QA 1GN8A 3UCEA 4BVLA 5KYXB 1NYTA 3EVBA 2O19A 3O8RA 1E3SA 2VSQA 2ZJ7A 3JALA 2XOKD 1BXZA 2J33A 2YXDA 4EO7A 2JEZA 4EUKA 1AKMA 1FYEA 4F4FA 5HILA 1DEAA 1NVEA 3CB2A 4IDPA 2IE8A 3PFBA 4F5YA 4QOHA 1ZJJA 4X0EA 4FCTA 1QPBA 3ZQ6A 4EMTA 4I1UA 4J03A 1F2DA 4NCJA 4F6RB 4MW1A 4RK7A 4DQVA 3KKNA 4EF5A 3R23A 4PAGA 3UA3A 1Q7EA 3GP8A 1YUBA 3FPGA 4GNKA 4D97A 2D1YA 2R4QA 1FUKA 2D2VA 5IULC 4WXPA 1T1JA 1XWWA 4O3MA 1P7WA 4ZO7A 4FP9A 2N47A 3CMCO 4RVSA 3GRZA 3O8QA 4RWZA 4ZJYA 4UHFA 1YR8A 3BSSA 3LFHA 3A0RB 2H1RA 1OTYA 3HP7A 3DBHA 5G0TA 3D1LA 3OZDA 1B2RA 3AUSA 1GUBA 2JNWA 3GUCA 1QIHA 2C8VA 5DLEA 4Z5XA 1ZIXA 5KYWB 4DPKA 1TZKA 2F7SA 4QDZA 1L5HA 3FHLA 1I4TD 2C0CA 1T2UA 2G9NA 3H7IA 3DDSA 1PV2A 3QFSA 3HM9A 3BCRA 1XMSA 2VUSA 2QOEA 3GJXC 3WXMA 5B5SA 3FNFA 1MMFB 1TIKA 4FFLA 1V6CA 5A1JA 2O4CA 4CFYA 3FFAA 1XZAA 4B74A 1OBOA 1CP2A 3Q3VA 3M3PA 4QARA 5B1SA 2VQFB 4HPXB 3TDKA 3H11B 2QL6A 1FYXA 1GDDA 2YMPA 4UTXA 1DQZA 1RQLA 4ARAA 2OESA 2NSHA 3JD2A 4P7GA 5JDIC 3R7WB 4ZV4A 4HLNA 2BKVA 2VXYA 5E1OA 1JA0A 3UHJA 3ZHCA 1M6YA 3ZWQA 5GGYA 2K5UA 4PZ9A 3U7JA 2P78A 1MDFA 1P5FA 2W71A 1YF3A 4B73A 4BP9A 3DSRA 3TNLA 3PJGA 4HEHA 3GD7A 3FNHA 3SEQA 1RYYA 3H3JA 1I13A 3PGKA 4LZZA 1JFTA 1G1MA 3RUHA 3ZUGA 2NM0A 4E09A 5I9NA 1MO2A 1TADA 3WLRA 3IUSA 3QH4A 1XHLA 5EPUA 2EDCA 2QVYX 9ABPA 1GWNA 3PQCA 5FPKA 2LKCA 5L95A 1IVYA 1GFWA 2C5HA 3LI2A 2QAJA 3FMIA 4JOCA 3CMMA 5E6UA 3WGTA 5CDUA 5IN4A 2XITA 3B3QA 4RD6A 3UAXA 4ZU6X 2WVAA 5ESWA 1VA4A 4OFWA 4YH1A 4PSAA 1EX6A 3P0RA 1KAOA 2O20A 2VYCA 4GYYA 5LXTA 1UFOA 2AFHE 4TV8F 3GLHE 2ZRHA 5DHAA 2JIBA 3L7KA 3EX7C 1T1SA 3F6RA 2GTPA 5IEJA 2KHZA 4JBGA 3EVZA 4RVNA 3A9CA 5ILQA 1T5HX 2UYOA 1QP8A 3L0PA 4KEAA 1T0PA 5FBQB 1T3LA 1UJMA 1NRJB 2GJ9A 3L07A 6YASA 9GPBA 3RFXA 1LRLA 1RC1A 2A5FA 1F0NA 3H1TA 1FTSA 1D04A 1UMCB 3GRKA 4MWDA 2OHGA 2VSOA 4H1HA 2WWVD 1AV6A 2NYAA 1CRWG 4FXPA 1GIAA 2HZ7A 4MMZB 3GPBA 1D5CA 1RWQA 2PJDA 3H6KA 4DLVA 1W0KD 4YWJA 1D2CA 1Z0KA 3WTCA 1Q1BA 3IOEA 4TOIA 3U4QA 1A5ZA 1DJOA 2QVLA 4N5IX 2VIIA 5FPHA 4EFLA 3ICQB 4RA9B 3RSQA 2SCUB 1UKEA 4BYMA 4A0QA 1QFZA 1YCHA 2XUGA 4FHDA 2JF0A 2G25A 1QRDA 1TAGA 1UIMA 5IZCA 4AL4A 3K0EA 4AX8A 4YBRA 4G0YA 1K6JA 1K97A 1JJ7A 4WKPA 4D4HA 5IANA 1N1DA 4Q9DA 2P1DA 2W6JD 3DL4A 3DW1X 3GJ0A 3GFOA 2R6AA 2PZLA 2WP0A 5CIWA 3OE1A 1B8PA 5KJ6A 2RJOA 4OB6A 1JVSA 2P4SA 2ZJZA 3HGQA 3IXLA 3TNDA 3VNSA 4DNQA 4KQEA 3WAGA 3B7WA 4KSYA 1B8NA 3U37A 3VJMA 1SAYA 1XDZA 1KH1A 1JKJA 3SXUB 3TLMA 1A72A 3MWJA 4HPWA 2IGTA 2YCLA 4GZMA 1XC7A 1LLQA 2AXQA 4WLOA 3HVRA 1IBMB 3WGUA 5MGNA 3H2IA 2JLYA 1NMQA 2QAIA 2IU6A 1QRTA 1IN8A 3RRXA 4F4DA 5DU2A 1YDEA 1AUOA 1XFAA 1COWA 3RRBA 1HEUA 4AXBA 4WZBA 4GKBA 3IMFA 1KA9H 5GZ6A 4EHKA 2W9XA 4KO3S 4NBKA 2G9RA 3JALB 5DGDA 4BBZA 4C4ZA 3HKDA 4BVBA 1SUDA 5BR8B 2WF6A 4DMRA 4U7JA 1T13A 4IUYA 3VR5H 1EBFA 1XZHA 4P0QB 1FDOA 1V8ZA 3U5ZB 1QHNA 4FWTA 4TMVA 3PE3A 3WRYC 3PHJA 3QNUA 1CUHA 4A2WA 4AU1A 1AB6A 1AKQA 2W6OA 1PWZA 3I64A 5EXEA 4ARIA 2AN5A 2EIHA 5AK5A 5ALOA 4ESOA 2QN6A 3VZPA 4CT5A 4GOJA 1ORTA 2QORA 1T4BA 2J4CA 1W1WA 4KGDA 2VA9A 4BQNA 1KFKB 2X8JA 1LS6A 2IU3A 4H7IA 3IXQA 3OLCX 5DE3A 1WKBA 1KP3A 3LO8A 4EQZA 2GO1A 2FAXA 4JCOA 1C30B 1KJZA 3OIUA 2B92A 3R3YA 2WYOA 3S99A 1DBVO 1OFHA 4HJXA 4CODB 1ZONA 4HWPA 4MDYA 4CBVA 1FP2A 2UUPA 1KMHA 5B6JA 1UPXA 3MIZA 3VTAA 2PX5A 2NNLD 2O0JA 3MAJA 4LQCA 2W2OA 2C8KA 4NOJA 4LV8B 1J9ZA 1KDPA 4PSDA 3MLAA 1WDMA 5IVPA 3MUFA 4TV8A 2HJSA 1II9A 1WBDA 1IJEA 4H18A 3MERA 4INOA 1G2QA 5HUHA 3D3JA 4QVGA 3TQHA 4GI5A 1B1AA 3WKAA 3DMRA 2X5KO 5IKPA 2QU7A 1Y1KE 1RMYA 4OX9B 2BGRA 4PYRA 2ZKIA 1MDBA 1ZGHA 3I4CA 5CD9A 4HKTA 2XUFA 4DMLA 3PCTA 1U7WA 4H7EA 4LYJA 4BN4A 5HXAA 4QO7A 4XQGA 3AGPA 2CFCA 3U17A 5ALVA 4PM4A 4WLFA 4X7PA 2X0DA 1JDPA 1WM1A 3TUIC 4I5GA 1P4RA 3CW8X 4URUR 5AW3A 2YYYA 2EX0A 4MVCA 1OXTA 4HTAA 3RYTC 3R5JA 1YR7A 4U7PB 1SG9A 1BZYA 1PBNA 2H2GA 1OPXA 5ERXA 3SFTA 3KEQA 3GOQA 3TIVA 5I51A 1UODA 4DBVO 2R8XA 1PT6A 2L69A 4UBNA 4HMPA 2YJ6A 5FPYA 4L4UA 3VR6H 1LVUA 3S6JA 1TJ3A 5SYAA 3O9VA 2SBTA 3LGXA 1P5HA 3KKOA 1JJVA 1UBGA 2OV8A 2DHQA 3ZDQA 3LNTA 3RS4A 2F3UA 1SOAA 1XRQA 2B0JA 2XUAA 5JSHA 2O5RA 2FCAA 4P58A 4UFOA 4DLAA 1PHRA 3DONA 3X1ZA 1K4YA 1U0FA 1W52X 3HH8A 1G18A 1N2BA 3ON5A 5TF4A 3KQSA 2HSWA 5SYNA 3Q3HA 1Q1NA 2PTGA 2X40A 5BT8A 1Q6YA 1P2GA 3AR3A 4YAWA 1NLMA 1WXXA 5H0IA 4R98A 1V2GA 5I7RA 2GK4A 3EVAA 3FETA 5I4KA 3S5JA 1K9SA 3U4AA 3IP6A 4DCMA 2OC4A 3R76A 2P68A 4BO5A 3I05A 4K8RB 3B85A 2I6TA 3OCWA 1E59A 1LPMA 3C39A 3BDAA 5EE5B 1OI2A 1HOTA 5TS2A 1HFEL 3U7EB 3W2EA 3PE4A 1L7MA 3DH0A 1IOWA 1XNRB 3FRIA 3TEFA 4B33A 1HDIA 1S1MA 3U80A 3CRMA 3R20A 2XMCA 4LE0A 2JHCA 3M6UA 1VBKA 4KXQA 3F5MA 1FYWA 1BXRA 2BFWA 4CM8A 3KSUA 1UEJA 3CTMA 1E1CB 1UDBA 2O14A 2ZJ3A 4ZCMA 1GAXA 3ZVRA 2OXIA 3VSCA 4OFXA 3EIFA 4QXAA 2F00A 2SKCA 5GAJA 4WDRA 3QVOA 3QLUA 3HKEB 1JDZA 3AB3A 1S3SA 2MHCA 4COKA 1DJMA 2JGDA 1MOZA 3QEMB 1C9KA 2PLNA 1ZVJA 3NBUA 3H4MA 5MF6A 2OBNA 3ICOA 3V1TC 4KR3A 1KMQA 4N3NA 1M0WA 2WJAA 4NS1A 3KSRA 3QBJA 4OPMA 3MMPA 1JHAA 4CKBB 4XWTA 5GZ3A 2EBUA 3L4SO 1N6KA 1QFXA 1MGPA 2H85A 5EPOA 1P0PA 4F3KA 1RHRA 3M7IA 4PSVA 5G53C 3E3NA 4D3DA 2QRZA 1GCOA 1N8NA 3W6PA 4BKOA 3E9EA 2XGSA 3R8XA 3GLFE 2RAFA 2WTBA 1EFUA 3BSYA 3TOXA 1JGTA 4EFKA 2PR7A 2PZGA 4JWKA 2NU9A 2NXCA 4XYLA 2QIPA 2X15A 1XEXA 4X6UA 4BU1A 1QKIA 1QQ5A 2CMHA 4JS0A 4LYEA 5FEMA 3G2KA 3RHTA 1ULTA 4DE5A 3DJFA 3VR2D 4G5OA 1EWVA 4M0CA 4AVYA 5EXTA 4HVLA 1ZEJA 2GYWA 4CFZA 4HS9A 4C9BA 1K8RA 2Q5EA 3UHOA 3VTKA 3PIRA 3ZIAD 2IPXA 3ES9A 1VGRA 2OBFA 4C2TA 3UOAB 3NYIA 5C2JB 3QVLA 5DKFA 4OH1A 1WF3A 4FS8A 4D42A 1YJ8A 1Z6PA 1Z0AA 4G84A 1PR4A 1J70A 4JLWA 4QFCA 1B0AA 1PR6A 4R1OA 3G2NA 1YHYA 4U7WA 1ZI9A 2H2WA 3C70A 4Q3EA 1UWVA 5DWDA 3PGA1 2IH2A 4UU8A 4IXTA 1TZJA 2B98A 2NXWA 2Q8PA 4ARUA 5EWJB 3TAXA 1YR1A 1YXMA 1J56A 3FPBA 3ZWCA 3RFCA 3N53A 5EMHA 4HK4A 4CTKA 4UZEA 1XLUA 3MSCA 4NZOA 1GNPA 2HSEA 4AJ9A 1SBIA 5E7QA 3DXFA 4Q21A 3T0GA 4DBLE 1NVBA 3GV0A 3ZBPA 3BL8A 3TJMA 2E6UX 3N74A 4BP1A 3HEBA 1NR1A 3SC2B 1BMQA 4OO3A 1PW7A 3E2PA 5FT9A 1ZNZA 1V35A 3G8BA 2WJ6A 3SC2A 3IPXA 2P9HA 3N2IA 3SICE 4NU0A 5A6SB 3TW6A 1Z5UA 2BFPA 5CHYA 4HDOB 3EPJA 2GASA 4R8LA 4H1UA 2KQUA 5JRZA 1PVOA 1KQPA 2UUAB 1IZ0A 3GFSA 3F67A 5SZJA 5E4JA 4MVWA 2ZI4A 1IL0A 1Z34A 1KQOA 3HU2A 3SVZA 1WMFA 4O4JB 4FYHA 4G5HA 4XYMA 3RRNA 1JZQA 4EATA 3PEWA 5FYDA 3Q5DA 1FSZA 2A14A 2O8DA 3EEFA 4RMJA 1V48A 4R83A 4YV2A 4BX2A 2PMFA 3I45A 3K9BA 2V7UA 4M36A 1KEKA 3X2SA 3SF8B 1QP4A 3IERA 1AZSC 1OX6A 1JHVA 4PR3A 1EVQA 1JS1X 3QV1A 4AURA 1O6GA 2DY0A 3HVIA 4D6PA 2I2FA 3TSWA 5JWRA 5CUQA 2C3UA 4GPZA 4ZDJA 3DOEA 2PU7A 1REQB 3LT0A 4M21A 1A77A 3UMRA 2BHSA 2CB0A 1TK9A 5KDDA 3TVYA 1YRBA 2Y8EA 5ECGC 1ULZA 4CIDA 5DGIA 5DX1A 4OI2A 2WU4A 4K88A 2YBDA 3ZWAA 1RXWA 5LYJA 3IT2A 1XTTA 1J0CA 3WY9A 3P4YA 3IRUA 4MWBA 1JG6A 3ZN2A 3BWBA 5E6RA 1E3TA 4I9HA 2ZIZA 1BD4A 4H4DA 4LXTA 1VM6A 2P9CA 2QU8A 4L2IA 3GBVA 2GZRA 4WK2B 3G0IA 3VPAA 3WRXA 3D4NA 1CF4A 1XO1A 3EZLA 2ZJBA 3RJMA 2G72A 4AJPA 1QLJA 4B48A 3QX9A 4Z0TA 1SHJA 2Z3ZA 1CSEE 3OOHA 4MVJP 5JBNA 1S7CA 3BKXA 3H6GA 2JPDA 2C4UA 4G63A 5CX1A 3WLHA 4E1VA 2ECKA 3R0XA 1YVUA 2AN4A 2YJTD 3BFXA 1J2RA 1LNSA 4WY8A 4XARA 3RRZA 1UBMS 1UXIA 4E7PA 3J7TA 2FR0A 5FPQA 4QUJA 3T1NA 2IHZA 4JVNA 4CZ2A 3LKDA 4I1YA 2FDCA 4YAIA 3RE1A 4B7CA 4OQLA 3T0IA 1MG0A 2PBLA 2ZYDA 2VN8A 3ZZ0A 3DB1A 4YJGA 5IG2A 1Q50A 2CYCA 1IOZA 3HB5X 4JD5A 5DZSA 2YFKA 2IVZA 5AI9A 3SS7X 1OH5A 2ZZKA 3FCAA 3VSAA 1B15A 3OQNA 1CUSA 4AIIA 5CPFA 5DM4A 4I55B 3D8UA 3FKQA 1WMDA 3D7NA 4B2LA 2BMWA 4I55F 3GA0A 3RVOA 4MX8A 4GI7A 3UXEA 4DR1B 3JQBC 1HI9A 1ODFA 4MIEA 5CG2A 1UBUS 3LPNA 3N8NA 4NZPA 4QG7A 1T6ZA 3G02A 2CLIB 2Y77A 2OQVA 1ZESA 2YHIA 5JNVA 1ZW1A 2Q9BA 1AF7A 4QJBA 2FRVA 2PSDA 2VJYA 4B3TB 1M7GA 3D9QX 2IJGX 5K0EA 5TPWA 2Y4OA 1F0PA 3PYMA 2YVQA 4XDHA 4WBNA 2CJPA 4LIPD 3O2NA 4GBJA 2Z56A 4M98A 5FWYB 3U81A 3F3SA 3QEAZ 4MWGA 5KYUA 3C85A 3EGWA 4JJZA 1KNQA 1ZLXA 4GRIA 4L5JA 5DULA 5ALZA 3CIFA 3IIEA 2GFHA 4JR2A 4PW0A 2FW0A 4ZHQF 3OFJA 3QVXA 5HIJA 2OBBA 1IUPA 3VZQA 3E9MA 1WCIA 4EPWA 3WA6A 1CY1A 4F56A 1NIJA 4Y2JA 4B6PA 5A4DA 4EGJA 1Y4UA 1LK0A 4CJXA 5EUQB 4RENA 1EXNA 3PDCA 1GPKA 3C5VA 1C30A 1YJAA 4DRXA 1G63A 2E4VA 3ORHA 3DEZA 1KYYA 1KPIA 4HBGA 4JH0A 4JJ6A 3D5TA 3HB9A 4BVHA 1TNDA 2A5YB 2XWSA 4TM7A 3WGVA 4X8HA 1O8BA 1ZN9A 1WD7A 4JEMA 3OT4A 2OK8A 3OOYA 3WYGA 4DAEA 2ISQA 3TGPA 2A5GA 2G9QA 3ILXA 2W98A 4H3KB 4I8XA 1MP0A 5DNAA 3RK0A 4RPJA 3WHKA 5MFZA 1JDTA 1RR6A 1VE9A 3JATB 4WH0A 2DCMA 4Z53A 3PHHA 4ENSA 3R74A 3DEHA 5ALLA 4ZAGA 5BPHA 1TQDA 4GG1A 2A3RA 3OTGA 1V1RA 5SZIA 2Q50A 3SSNA 2AYZA 1HNXB 1R6VA 2YHSA 5I8WA 4WDQA 3FFBA 4E21A 1PDVA 2WQZA 1AQ6A 1M8GA 3CX7A 4H35A 4YFVA 3W2TA 4Y9DA 5IAKA 2BBWA 3SC3A 1MJFA 3KD3A 3P9QA 4DF3A 1THGA 4N0QA 1TTHA 1T9HA 4B6GA 3B6JA 2EW2A 2BOVA 3EULA 1RLJA 1TF7A 5EQTA 5BXQC 3AF6A 4TSRA 4C6HA 2AQHA 4PS0A 3IALA 3U1BA 2PZ8A 3TD9A 4C3VA 1XD2A 3R6GA 4J0CA 3AWIA 3RHSA 4NE9A 3BK2A 3FSGD 3JAKA 1RHJA 4A0SA 1MKYA 2GM4A 4A0FA 4Z2AA 5EHZA 4J3NA 2YZNA 5CVDA 1G20B 1I7NA 1AS3A 3AEQB 3LM8A 3M2PA 3VYUB 1YBMA 1ZUNB 1Z83A 2P41A 4CCYB 2JDID 5ES3A 2FWNA 2FMFA 3EDOA 1X1CA 2EQBA 2GPYA 3VJLA 1RFGE 3UJ9A 4WLVA 2ACKA 4I1VA 5LOVA 4NNOA 3HK2A 3AUKA 2P6UA 3TPCA 3E18A 2C07A 3KLPX 5JMOA 3U44B 1L7EA 1XVLA 1RM4A 2HN9A 1LQUA 1T34A 3KSBC 1Y80A 3QE9Y 2G9ZA 1P1IA 4Z86A 5FBWB 3HA2A 3CWCA 5HR5A 3GRVA 4QM6A 3Q2IA 8ATCA 4G5QA 4CL3A 1BO6A 2NADA 4KFRA 1JZTA 1NI3A 1NAHA 3SEAA 3OU6A 3CC8A 5ALUA 4BC1A 3E03A 2Y1OA 4B71A 1UAAA 4RJJA 3FRHA 1GKKA 2DTDA 2ID7A 3CUUA 2A1UA 5IP5A 3RVPA 2VK4A 5IT5A 4YIHA 3ZXSA 2N9UA 1GFZA 2FPIB 5IJ0A 3I6ZA 1NRIA 4HQFA 3TR0A 2BFNA 3U4MA 4NU8X 2O6HA 3AVTA 3I5UA 1QM5A 3WLNA 4CCWA 5A6VA 3EGDA 4AZ0B 4RA9A 2P1RA 3SYTA 5M5BA 1QDEA 3ICEA 4GMHA 4P81A 1Z6YA 1OI3A 2J45A 4FR5A 4DY4A 2G0NA 1T9CA 4LJ9A 1X9GA 5FI5A 4FJ2A 2VAMA 2O52A 5KNBA 4AT1A 1VHWA 3INTA 3CTPA 4CRWB 1DGQA 3ZD9A 2Z43A 4E3WA 2GN0A 2B35A 2DQKA 2FQQA 3V42A 1BHJA 3HJBA 3EVTA 1RU3A 3PXAA 4MVJD 3QHAA 4V03A 5IARA 5C37A 1CWUA 1K8ZB 2D0PB 3NBZC 5KX5B 3PJRA 2PNFA 2NZ8A 5TGDA 4CM4B 4W8HA 2QV0A 2WIBA 4CG3A 2QMEA 1N6OA 2PGAA 2EBHX 2OM6A 2GEKA 2WAYA 3HBLA 3MTAA 3OMWA 4JSYA 5K0FA 2P6NA 5F7XA 1U9CA 1YJXA 2PV0A 2X86A 2C95A 3M5PA 4PICA 3VR3D 1N25A 3O92A 1AE1A 1MQSA 1GLGA 4MLZA 4ZC1A 1L1RA 4XR9A 4B35A 4CUJA 2O7SA 1U2DC 5KJ1A 3W2HA 2VUIB 2BGWA 1Y4ZA 1SXQA 3HGMA 5A7HA 5ALDA 1ST3A 1XL0A 4HH0A 4WEOA 1ADFA 4B3XA 1G8MA 5CIYA 1JKMA 2NNWB 1R9GA 5AH0A 4LISA 2RGWA 5FUMA 3FCYA 1C3XA 2WB2A 1WP4A 5D6NA 2WIGA 1YULA 3TJZA 3GG2A 1WXGA 3NHFA 1WULS 2WG2A 2W4MA 2G1KA 1OJ7A 1JJBA 3G9ZA 3ETCA 3D3WA 3GLHA 2WHEA 2XXJA 4AZWA 4ARCA 1IM2A 2CVPA 4B47A 2CC2A 1ULSA 1Z28A 1ZOIA 2FWIA 2VP2A 3OJEA 3E8MA 3E22A 3PTLA 4JUFA 4YPOA 5DT2A 1NPDA 2DX7A 1Q0HA 4TXJA 5IT4A 3FZGA 3L6BA 4KSCA 5SICE 3ZR4B 1AK2A 3EUFA 2FPWA 2A9JA 3HWX1 3MELA 2DFPA 4INJA 2FMIA 2FMKA 4EG8A 4OB8A 3JYPA 4ZAFA 3WDSA 4BKMA 2P0YA 2DR2A 3CZ5A 1DKLA 2POCA 1VJDA 3D2AA 5T4HA 2PCLA 3K09A 5JS6A 4PPFA 4A1FA 1I7PA 2JCSA 3QMWA 1G20E 1FDSA 3SQNA 1PI3A 2CLSA 3MCZA 5BOSA 5FXMA 2A8YA 3IPCA 1ZJ4A 4CEHA 3BS4A 3OT1A 1E18A 4B40A 3JTMA 5BP7A 1P0MA 3F49S 5I7UA 1AOXA 2YMQA 3DCJA 1ZCAA 2NZUG 3HI6A 3G68A 3RANA 1SCAA 4QRDA 4GRDA 5LQDA 1SXPA 1BCRA 5CHEA 1YO6A 3Q6NA 5I7SA 1XAGA 4LMPA 521PA 2BEKA 1NGSA 4ZTZB 3Q12A 5CK5A 1UEXC 4R05A 2CJXA 2ZROA 1U1EA 5JG7A 3SE7A 3FPJA 5D7NA 5IF9A 5ITSA 5LNK6 1YDWA 2DBRA 2QYOA 2GLUA 4MUNA 4BE7B 3THWB 4Q7LA 1I1QB 2BE9A 1Y6GA 2IYVA 4QU0A 4MRAA 4HNTA 3V4SA 3TNJA 2XF8A 1JEOA 3NTRA 4S1TA 4WFIA 2QRLA 4G1MB 1HKHA 3ZBQA 3WJAA 4DANA 2W90A 1EFTA 1B7GO 1F8UA 3N2EA 1N6LA 1NN0A 4EB0A 1P2TA 3EXFB 5FOVA 1KZHA 1P1HA 1O6BA 5EJ6A 4MOWA 1YHNA 1OIVA 2A9PA 1R5NA 4KUEA 5T57A 1LSOA 5CT8A 2RAUA 1ZUIA 5TLSA 4HNAB 4S35A 1ID1A 2G63A 2HDOA 2NZXA 3A28A 4H27A 5EL0A 1Q1AA 3P2MA 1RRCA 3BMOB 2IZZA 3NTOA 1MFPA 2D06A 2PXCA 1ISJA 4IJWA 1UQUA 2UZ1A 4B79A 2B21A 1GLVA 3EZYA 4JDPA 4EI8A 2IHNA 6PFKA 1G7TA 1IHPA 1O1YA 2WFLB 3RFUA 1SZJG 3L4EA 1GU0A 2J4DA 2VPTA 1EYZA 3ODPA 1WXFA 2PNJA 5KOIA 1EAYA 8MHTA 1QGUA 2AR0A 1CDOA 3UIEA 3LUCA 2AMVA 3ZIAA 4TYNA 3QTLA 1WUKS 4UM9D 1TTQB 2C84A 5KTKA 2XIQA 4ZT4A 2B7LA 3WGJA 4PG8A 1AN9A 1SXJA 1YRWA 3DMYA 3FOAA 5E8RA 1P1KA 4DG9A 4DUPA 1E5XA 2HBQA 4AKEA 4E94A 3ED1A 3N2NA 3WAKA 4GWLA 2IV7A 2TS1A 2HAEA 5KQMA 1O94A 4DXDA 1PYOA 1IY8A 1X39A 3L1IA 2QBYA 3DKIA 1XTJA 2BW0A 2JBAB 4LBWA 4MRMB 5J5CA 3DZDA 2H5EA 2YWBA 3PL5A 5FHRA 3ST7A 4PX9A 3VH2A 4DOMA 5JH7F 2CNBA 4CN9A 3U19A 4L4RA 3C15C 4X1OA 4AS1A 2PRZA 3DO5A 4WJZA 1YD7A 4QVKA 3HYNA 2Z6AA 5A3VA 5BWCA 5DX8A 4F97A 3NMUF 4PBTA 3AM5A 5DFAA 4YXWA 1II8B 2IIBA 4I4NA 4RESA 1E3WB 3NDIA 4TL6A 1JR2A 4EI9A 2UYHA 4HH1A 3WL4A 1O4WA 3G2QA 4N9WA 1M1YE 1TVCA 5JFTA 1QNLA 5B2EA 4W5JA 3WIOA 2QROA 3HBNA 5JAZA 5H68A 2XB8A 2J48A 2P9QA 3ADCA 1Z45A 3L0OA 2J0EA 5FTNA 3AFNA 2TYSB 1R2QA 3BH0A 4GOXA 4WZZA 5HKKD 3IEMA 1N36B 2D0IA 4YK7A 3UTCA 4POOA 4CMBA 2CJWB 4EB8A 4OY3A 3U4HA 2PT9A 3KB2A 2J67A 2X4IA 5HWSA 1T0HB 2GZMA 4KCGA 3PQ6A 1OKKD 4IKEA 4QBGB 1X70A 1SUFA 2YS7A 1KK1A 2CCKA 2QTGA 2UVPA 1WCIB 3F6SA 4CGYA 1E7MA 2V4ZA 4HXFB 4F93B 3DVAA 3MFYA 3P9ZA 2IEYA 1CY4A 2C2XA 3O38A 4JUCA 4K9KA 4AKSA 5LLDA 3SM9A 4RYLA 1TIBA 1KTVA 1NR7A 1W96A 5FFFA 2YQ5A 4LSWA 1DQYA 1ZCBA 3EVFA 4RVGA 3WGQA 2FVYA 2WFLA 1BX0A 3LY5A 4LXXA 2C88A 4RVCA 4XYEA 2QVXX 4DLUA 4EHBA 4NV3A 4XWKA 3KKKA 3D8RA 4CQJA 3LXMA 4JLVA 4BNXA 1D1PA 1FFHA 3GJ3A 9ATCA 3O9MA 5AMXA 5BT9A 3FWZA 1PF7E 2UVDA 3CW2A 2OZLA 4ONEA 4R31A 3V48A 3RVLA 5K05A 1LQTA 4FKZA 1T15A 5H8WA 1LVGA 3HCRA 2PRIA 3TINA 5AP9A 4O5AA 5JAQA 2IYQA 1XCPA 3IBTA 3BPSA 3LXXA 2VZEA 5TEVA 4CXMA 2XE7A 1NW6A 3VPBA 5FTLA 3ADDA 1TM3E 2QM0A 5I8ZA 1T4CB 3EXIB 1JSCA 3KTAB 3DOIA 4XUCA 1U0BB 2JGEA 2Z83A 4OIFA 4Z1MD 3ASVA 1Q11A 3MRVA 2N3ZA 3ND6A 4L72A 3OM8A 2PZKA 5G0VA 3EMDA 3C7KA 3G23A 5AXDA 3LJKA 4KYUA 3ZK9A 2HDNB 5L3SA 4Q7QA 2XYGA