2M6KA

Solution structure of the escherichia coli apo ferric enterobactin binding protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
292
structure length
292
Chain Sequence
ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferrienterobactin-binding periplasmic protein
publication title The solution structure, binding properties, and dynamics of the bacterial siderophore-binding protein FepB.
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA02
3LI2A 3AEKB 3TNYA 1G21A 1MIOB 5I4KA 2R79A 3ZK8A 3TLKA 5GGYA 2YNMC 1K2VN 4FILA 3NU1A 3BE5A 1ESZA 4CL2A 5BVHA 1FP4B 4WN9B 1K75A 4HMOA 2OV3A 3ZK7A 4UDOA 1L5HA 4WZBB 4HMPA 4LJSA 3AEKA 3R5TA 4H0FA 1MIOA 4BBPA 2PS3A 4MDYA 4TKUB 4FNAA 1QGUB 5KOHB 5CX1B 5GGXA 3PDIB 3EIXA 1FP4A 1QH1A 1M1NB 4WN9A 1QH8B 2PS0A 3MFQA 5JOQA 3HJTA 2RG7A 4XPIB 2Q8QA 4WZBA 3G9QA 5AFSA 1H1LA 3U7QB 3MINB 3HH8A 1TOAA 4FI3F 1M1YB 4TKUA 5KOJB 1QGUA 5M3BA 2XQVA 2XY4A 5CX1A 3AESB 3PSAA 3MWGA 4WESB 3MWFA 3ZKAA 1KARA 4UTOA 5HX7A 1N2ZA 3R5SA 4H59A 4FKMA 1M1NA 5FLYA 1QH8A 2XH8A 2M6LA 2OV1A 1KAEA 5M29A 2AFHB 4XPIA 2WI8A 4MLZA 2XUZA 2YNMD 2ETVA 1KAHA 4DBLE 3MINA 3GI1A 5HDQA 3AETB 3AERB 5KHLB 1K0FA 1M1YA 1M34B 4IRMA 1N4AA 2Q8PA 3AESA 5JG7A 4WESA 3HXPA 4WNAB 4LS3A 4TKVB 4ND8B 3MD9A 4N01A 2OSVA 4OXQA 1XVLA 2AFHA 5M34A 4WZAB 4B8YA 1N2CB 5KOHA 3AEUB 2WHYA 3K1AB 3UJPA 2AFIB 2O1EA 2OGWA 1PSZA 3AERA 4OXRA 3PDIA 1M34A 3BE6A 4NNPA 3PSHA 5JPDA 2MINB 4G07A 4PAGA 2XDQB 1G20B 4WNAA 5M2QA 1PQ4A 4NNOA 3U7QA 5BVGB 3EIWA 4HMQA 4ND8A 3AEQB 4TKVA 2PRSA 3ZK9A 1N4DA 5KOJA 4MO9A 4WZAA 3CX3A 4UDNA 1N2CA 4K3VA 3AEUA 2R7AA 1G21B 3K1AA 1QH1B 3ZTTA 2AFIA 4PM4A 1K7SN 4M7OA 4UTPA 4OVKA 3TEFA 3LHSA 4INOA 1H1LB 2MINA 4G09A 4INPA 5JJ5A 2XDQA 1G20A 2M6KA 5BVHB 4HN9A 5B58T 2PS9A 5CR9A 5BVGA 4GICA 4MX8A 1EFDN 2PHZA 3AETA 3AEQA 2XV1A 2X4LA 2QI9F 1L5HB
chains in the Genus database with same CATH superfamily
2F59A 3ZWWA 1YMUA 5GPBA 4HB0A 3WSWA 3MJTA 1BA3A 1W19A 3B7GA 3DEFA 2CMFA 3VC3A 5IJXA 2QUHA 5JI3E 1VHTA 1HT2E 2VJYA 2XCIA 1IBCA 3DOIA 3TKAA 4FVTA 4BMOB 4ENSA 1J23A 2A0FA 2B1GA 2W2XA 1DKNA 3FCXA 4FWBA 4OFZA 4YJHB 5DB4A 2UZ1B 2I1LA 1G2IA 4PGMA 4J7AA 3RLIA 1BX1A 3B13B 2RBEA 4GBJA 3ZVMA 2HHJA 1TJNA 2FE4A 1U1DA 1W5AA 4QHTA 3FZEA 3SY8A 3AF3A 3FA2A 2GKGA 5E3HA 1PS8A 3VH1A 1EMDA 4RABA 4TMKA 3T7EA 3R5JA 2BC9A 4PAQA 1MVOA 2XCTB 1H2EA 2C8LA 2AJBA 2FMXA 1JPJA 3N7UA 4CDRA 3BF7A 2Y0CA 1P91A 5ETJA 4ZJPA 2D4HA 3AWIA 3KQOA 1S89A 1ZZEA 3UJBA 3E48A 3ZWXA 3X1YA 3DSRA 4RTMA 4B85A 1ZNQO 2G1KA 3LUHA 1XJ0A 2I4MA 4FE7A 4FHZA 2C04A 2IYUA 4WUVA 1KDOA 1UH5A 3V33A 3ZIAD 4DA6A 3T5AA 5I7SA 1IFXA 2YHUA 3T5GA 3WZ2A 5AFSA 3PDUA 3GG2A 1J21A 4P80A 4JR2A 3EGVA 1ZCBA 1O54A 1O97C 1WCXA 2XUPA 1CG6A 4KG7A 4CIWA 4D92A 3B1JA 3MWFA 3A8TA 3QBTA 4PG8A 4C2BA 1K97A 4BFWA 5KZMB 5I7RA 1C3OA 1L5KA 4MUNA 5CFRA 1N2JA 3P7MA 2EAUA 3T5MA 1A1SA 1N7JA 4LOKA 2DFLA 5DFAA 1KRXA 4G4IA 4BGIA 1WMDA 4FNOA 2X0DA 2ZITA 3FMIA 4LYAA 2AG1A 3GHHA 3ISJA 2VQDA 5EJ9A 5ICEA 3H1GA 3MINA 2ZIEA 1A4RA 5LQMA 1SC6A 3L6RA 4MKRA 2ZAYA 4NOJA 1A27A 4ZU1X 4ALIA 4CR7A 4UFPA 2BR5A 2ODEA 5I7FA 5CA1B 3FRHA 2ZKIA 5E7IA 1X1BA 4RLQA 2YS6A 3AHDA 3W9SA 5F2KA 4XDGA 1F4LA 3OF3A 3C97A 2NO1A 3TL6A 3EDMA 3F3YA 4GX5A 2W9XA 4ESEA 5GTDA 1FTGA 2G67A 1SK8A 3H9GA 4TWJA 4TWRA 3V1UA 1O9GA 1L4FA 2Z4TA 4PRKA 5DIFA 2WD8A 5CH5A 3U44A 3W4KA 3MBKA 5A0FA 3RG2A 1T6XA 2JEOA 1O8BA 2XNSA 4OH1A 4S24A 2PR7A 2IPOA 3OMXA 4F4FA 4S1PA 2V7QA 3AR8A 1ZMTA 2X0JA 5UKDA 1H0KA 2IYZA 4L50A 1DJOA 1GUZA 4KPYA 1FP6A 2V6GA 2EG9A 4JJ4A 3TIXB 3COJA 2WFMA 2H63A 1E1RD 2QD5A 3LBFA 4EKNB 1BU5A 1SXIA 3NFRA 4JIGA 3CBGA 1LRKA 2CDBA 4HDSB 2EKBA 5ECWA 3S1AA 3SFTA 4BQSA 4Z4FA 4RIFA 1Y4SA 1ORTA 1XEWY 2Q0SA 5EP3A 3OX4A 3RYCA 3W2IA 5J3JA 2PS9A 1KDRA 5BSFA 3OM1A 4YAWA 4EW3A 4BEWA 3KEOA 4N82A 2V45A 2Z30A 1CUBA 3EJWA 2QY9A 2VF2A 3PCXA 4NY1A 5F9FA 2PUHA 3DOHA 4BVAA 1U11A 1UBSB 2CMGA 1MO5A 3PKIA 4LZPA 2HC9A 4F93B 5E1OA 3LBYA 1AK9A 2HDNB 4FILA 2BKEA 4D3FA 1HE3A 4FEAA 4QPZA 4E6EA 5KNCH 4G9EA 2O19A 1B1AA 3S5UA 3X2EA 1O5IA 1BKDR 3D3JA 2ZATA 3FOAA 1W36D 1C9KA 3PP8A 1N36B 1CFZA 1P1CA 1M54A 1WXHA 5JZMA 3MMSA 2Z58A 3O1IC 4IYRA 3IJEB 3FETA 3HPRA 1G8JA 1BVRA 1NSYA 4GKBA 4D9FA 2JLWA 3AFHA 2OHIA 4HUJA 1IXSB 4Q19A 3ZE1B 3BSFA 1M34E 1T1JA 4A23A 1GNSA 4F06A 1I36A 2W93A 5AKGA 3MRTA 2GDZA 2VPXA 4GH5A 1E2KA 3SBEA 1C3OB 3M1IA 4AFNA 1ILWA 1JXOA 3ABOB 2BGMA 2RDMA 4CCYA 3S99A 3SQMA 5B6PA 3VI3B 3MSCA 1N5OX 1EDOA 3ZHQA 2JW5A 3MINB 1BCSA 3F96A 4HDQB 2FK8A 2VUSA 3D6FA 1XN1A 4DKXA 5KDOA 2VDNB 1XZEA 3BL8A 2DLCX 3KR1A 5JDIC 3PPYA 3ESXA 5AVYA 1OOEA 1MJNA 1MXHA 4RTJA 2YRWA 1Y89A 3AP1A 1JEYA 3AUYA 4AWAA 4WDQA 3O4RA 4RK5A 4KGVA 4OQ4A 4YJGA 1AJEA 1MPXA 3FPHA 1TFUA 5EMHA 3UENA 1FSFA 2YN0A 4HFJA 4EKYA 2Q29A 5C18A 1Z0FA 1PKEA 5AKJA 2G09A 1E79D 3U44B 4ND1A 4C0HA 3SF0A 2ZUEA 3TSWA 3X2FA 2J0UB 1SHUX 4PR0A 3KLPX 3IB3A 5KNBD 4XI9A 5KVVA 4EA7A 1MQAA 1ZVKA 2ZJ3A 3Q40A 1BVUA 2F1OA 2C5EA 4OHMA 2WWVD 3I0NA 3I3SR 4MTCA 3ST7A 1H5UA 2FF7A 2GN2A 2H9YA 2NO9A 4F11A 4YCAA 1JFSA 4H6WA 2NTVA 5TB5A 4F4JA 2BN4A 4IIJB 3V8NA 3L4KA 3ELBA 3MJ4A 4Q3DA 1J9EA 3M82A 3F6YA 3BXPA 3PE6A 3INGA 3HV2A 1NW9B 2PKRA 5IANA 5K05A 1D1PA 3C3JA 3LY5A 1N5LA 2HMVA 3PFWO 3DTYA 5GMOA 3RYCB 2JDID 3QBEA 3OY2A 5CVDA 4OFBA 2PTHA 2PAFA 2IYOA 1U7PA 2ZJ7A 4INAA 3P0EA 4NNOA 4LRSB 5F3WB 3W6OA 2O8FA 5CCDA 4UAUA 5JAZA 3E5RA 4CMBA 3RASA 1XQWA 3RVLA 3TQRA 2LR0A 2HTEA 4UE6A 1ZBQA 1Q0QA 1EAMA 4FFOA 1I01A 3RSCA 5BUSA 3ZWAA 4P08A 5JCJA 1OZ0A 1O96A 1GNTA 1Y4AE 2A0WA 2XAUA 1TQ8A 4GGMX 4R1LA 4DZRA 3SDZA 3VSDA 2HRRA 3OE7D 4P32A 4QM7A 3N2NA 4QJ3A 5KJEA 4M9SA 1JQKA 4WPGA 1S01A 4RTRA 1J9ZA 3WGHA 1BGXT 1NNEA 1V0JA 2FQYA 3FFAA 2BZ1A 1E2PA 3LC1O 3QMPA 3VR6D 2J9RA 1MJGM 4NV0A 1ONPA 1HDYA 3T4PA 4N3GA 1WKBA 1EJBA 4PHTA 2E4WA 2PX8A 2FPUA 2D1SA 3D0RA 3EPJA 2PCJA 4LJ5A 3WKEA 1HYBA 4CDMA 5IT4A 3AB8A 4O5AA 4EUKA 3I2HA 2OB1A 1KEEB 2A9QA 3RSHA 4JEMA 4CCYB 4BE7B 3GPLA 2QTBA 4X62B 3AJEA 5A02A 4NXNB 5C4MA 1BCSB 2JFXA 5K8JB 3ZHCA 5K2OA 2EFJA 3BIXA 3DAYA 4ZICA 1Z56C 2J9FA 3KU4A 3PHCA 4IYJA 4WNYA 3HUUA 1CR0A 1YA6A 3ZV7A 1WEKA 3TWOA 3LLSA 4RHXA 3GWZA 4EG8A 3L2OB 4L3WA 4KSBA 2GEFA 1RQNA 4YJGB 1J8QA 3QITA 1TCAA 1C8BA 1GNQA 4CM3A 3LZDA 3D64A 4JEUA 3LQFA 1P81A 2HA5A 5JALA 2HJWA 2QRNA 4HX9A 4MVJD 5FBZA 3VU9B 2IYAA 4TLMB 1KHHA 3VOTA 4F46A 4CEJA 1UEIA 4E5MA 5L3ZA 2E37A 4Z0NA 4E22A 3NETA 3LKBA 1Q11A 2B9EA 2CZQA 3O38A 2DTXA 4FONA 2C2OA 4HNHA 4OBXA 4YMSA 2A0XA 3DBIA 3QVLA 5G4KA 4RPLA 1NBOA 1DUVG 2X1LA 2GD2A 1OI4A 3AGQA 4TTTS 4GKJB 3HCCA 4LYHA 3WDMA 1WB4A 2H51A 4YFVA 2DFDA 1T5TA 1VPWA 3K9QO 2QZ9A 5KMGA 3G5AA 1T8RA 3DV2A 4DNPA 1Z3CA 2DUUA 4F91B 5DGXA 4GUDA 1SQFA 1KK1A 4EZBA 3GLUA 5KVSA 2YRXA 5JAIA 2C5GA 4HJXA 1D0VA 4QQ8A 2EX0A 5KYUA 1EEXB 2X3UA 4EQZA 5JSZA 2O8FB 2M6RA 4YECA 2HD4A 3WDSA 1G5IA 2HNAA 1TAUA 3HZHA 3SFVA 3PA8A 2VFAA 2V7PA 4BGUA 4MITA 2OK8A 4X61A 3EIQA 4E88A 1Y9AA 2B1QA 2Q5JA 3N2KA 4LXHA 4R3NA 2I99A 4QOIA 1O96B 3PIDA 3CKKA 4D4LA 1JT9A 1RFLA 1L5VA 3HC7A 1D6NA 2HYDA 4Y18A 3WGGA 2V0CA 1WWKA 3ZBQA 3PRJA 1NXPA 1WKVA 2WT9A 4HQKA 3EOZA 3DOFA 4LY6A 5HFNA 3BMXA 2B2CA 3AR4A 4A73A 4Z7QB 2QTCA 1P6QA 1S8AA 4MWTA 3VR0A 4G81A 3ER8A 2X8BA 2FV8A 5F7ZA 1DBIA 3HCBA 3TEMA 1WB5A 1Z2AA 1P77A 2QAGB 1W581 1UKBA 2DERA 3WLAA 2GNOA 2M1ZA 1RI4A 4RTOA 3NBQA 4G23A 3TJZA 1DSSG 3T1HB 1I30A 4QC2A 4RZHA 3EW7A 3OKPA 4LYYA 4CHGA 2HK6A 1T2AA 4RZSA 5K1ZA 2OWDA 5K0LA 3EQ7A 2QX9A 2A0YA 3ABSB 4XFDA 2GJSA 2O4CA 3M4NA 4KIJA 4AMYA 1VE6A 1YOVA 1DC6A 3TTYA 4ZYUA 4BGVA 4YAUA 2MSLA 4UOEA 1Y98A 3IIJA 1DTSA 1T5DX 2OUIA 3RKRA 2KHZA 3IUEA 3RSGA 2WA2A 4AY4A 3VTAA 1PNRA 2WAOA 3PI7A 4NAUA 1NT4A 4KDRA 3OJXA 4YCLA 1BJKA 1MB3A 1GPUA 3LIIA 3TLJA 3EIHA 4MV3A 2Z2KA 1ZUNA 2GO7A 4ZDKA 1BMQA 1TJ3A 4J49A 1Q12A 4UNNA 4RCYA 4EKGA 1Q0PA 2ECPA 3CGWA 1A72A 3N2YA 3IV6A 1QH0A 2H54A 1SXQA 4FX5A 4RSHA 4GM0A 4EGQA 3GNLA 1GA6A 1JA0A 2EDCA 4CV3A 4LCJA 1GUDA 2RHDA 2OORA 5G4KB 4ZYXA 3OKCA 4NZYA 4CGYA 5I7EA 3C24A 1FZQA 3OTHA 1N5DA 3QVTA 3SK0A 4FXPA 3DKIA 2X9NA 2NG1A 4KTTE 3N59A 4D9BA 2D7JA 3BMNA 3LUJA 4RLHA 3PJDA 1SKYB 1Z6TA 4CE6A 1SQ5A 2H4JA 5GZ6A 2R1UA 3F5SA 2XBMA 3MHPA 2XYQA 1GL3A 3NHBA 5AOBA 5SZJA 1HPLA 3DOUA 4M0CA 4Z4CA 2OYRA 1NYTA 1GQOA 1G3RA 3FBGA 5KMGB 2P6RA 1T0PA 2GMWA 2NU7A 1PHPA 2VT7A 1EP2B 3FPJA 3JSXA 5KYUB 3HO1A 1GKKA 4D6XA 5JSZB 2EQ5A 2NW6A 3AUSA 2YWHA 2ZLBA 4IINA 4OJNA 4ZVTA 4ZMSA 1R8SA 1Z4LA 3HPQA 2OXRA 4XOIA 2C82A 1G42A 2ETVA 3LLMA 4MRAA 4PTLA 1Q0TA 4J0JA 4TMWA 4MGKR 2DM6A 2ZCVA 3OPYA 4US2R 2GCNA 1XAGA 3U1TA 2X41A 3UK1A 3N2KB 3MLBA 1DCFA 3UWPA 5E1MA 1IHXA 3OE4A 1C7ZA 4EKEA 1FNMA 2YR0A 4N9WA 3W9BA 1JFFA 3AW9A 2AD5A 2EIHA 2PL1A 1XR3A 3MD9A 1FFXA 1GG2A 2OYSA 2RGCA 1IXRC 3C3MA 4NS1A 1NXWA 2AKYA 2FDXA 2TECE 1RHKA 3F78A 1M8FA 3H9QA 4RK7A 2HIAA 4YN3A 2Q1UA 1XA4A 3KNZA 3VH2A 1N77A 4O2BF 4OB8A 3ILXA 1COWA 3WWYA 2P9QA 3W6PA 4OK3A 1CZLA 1MBZA 4TKMA 3PIRA 4IH1A 3IUQA 2X13A 3OQBA 4L8LA 4ASUD 1HURA 2AS0A 3EXAA 4D3ZA 1YU9A 3GCZA 1ZNZA 1WXXA 3U7GA 2Y1DA 1X1DA 4S3MA 4H27A 4XM1A 2G4VA 2ILVA 2J30A 2O3UA 2HCTA 3F8WA 3R09A 1JSCA 4GKVA 4IDQA 4QTZA 4U5XA 3TJRA 2V0NA 1SC9A 1TM7E 3AEUA 3IPYA 3IAHA 1C0EA 1WNTA 821PA 1GNRA 2ZRBA 3JQ8A 1GL9B 1NUUA 1WQ1R 1LWNA 4D26A 4HWSA 2HREA 2X3FA 5AJVB 4BN5A 1JIUA 3V1LA 2JAOA 4MIYA 1AU9A 2PUCA 4KOEC 5FI5A 4K9SA 1AD2A 4EY8A 1IBRA 1ZUNB 2YFYA 1A69A 1E69A 2HA7A 1K98A 1GILA 3SBXA 3SVTA 2AA3A 1GR1A 5EJ6A 1SVKA 1ZHOA 4BLTA 3LI2A 1TIBA 3TG2A 2O50A 4UEOA 1PJ8A 4KQCA 2HUNA 4Q9JA 4CL8A 5IJ9A 3LCUA 3JS5A 1QG0A 3W1EA 2D1RA 1JAZA 1H2RS 1U2TA 5BMVA 1SXJA 3WL6A 1VTKA 1G8MA 5CB4A 3DMYA 5L3SA 4FCVA 3ZZNA 2HCBA 4BNFA 1NLUA 4F86A 4QOJA 1QZUA 2XD9A 3SQLA 4YT8A 4OLBA 1ECBA 3U56A 3HUDA 4I4CA 1PL7A 5AKIA 4EHDA 2WYVA 1B41A 1ZDMA 4C7JA 3OPNA 4OBWA 4XARA 4BJ3A 2O8CA 1UOEA 4ZALA 5AUOB 1QDEA 2YV4A 4EHAA 3PQ7A 5KX5A 1GZDA 2NU7B 5EVCA 2VNHA 4KAFA 1V4BA 4NABA 2VTBA 3WWCA 2FZGA 1PZMA 1RSZA 4UHEA 3P52A 1NYLA 5JYBA 1CZOA 2XCRB 1GHTA 1SHKA 4H08A 4LHYA 1KI2A 2G1UA 1CUIA 2QLTA 4MWBA 4ZMRA 3HSKA 3MMPA 1H4TA 2XTZA 4YT2A 2XLBA 1X14A 1IPFA 5AHKA 1E59A 1VKJA 1KNQA 4MP6A 1F51E 4ROSA 3N8NA 5T4BA 3UH1A 1WS6A 3D0OA 4E2ZA 3STXA 2QJRA 3CPJB 4M88A 1XZKA 4Y30A 3QX9A 4Y2PA 4MS4A 5HIIA 1JFFB 1BMFD 2VAWA 3UMBA 2QUAA 5ALDA 4EVRA 4FKMA 3SS7X 5BN3A 1FFXB 3KR9A 4Y6PA 3RK0A 1XAJA 2NYVA 4EG3A 5LP6F 2QAIA 3RK1A 2CJYA 4LJAA 2PSFA 3DDZX 2GYUA 2X6QA 1GXSA 2QEQA 2FETA 1K7YA 1WXWA 3M0EA 4QQRA 2Q4DA 3FYSA 4C3UA 3WY9A 2WW8A 2QRPA 1BGWA 3LFTA 2PRJA 4G0MA 3VKVA 3WDKA 2XUJA 1E2HA 2XUFA 1FE8A 1U7UA 3CUUA 4EF6A 4IW3B 1OA1A 2H08A 3OFSA 4FX2A 1EFHA 3TQOA 2VJLA 4HVAA 2IZ7A 4JLUA 4UCWA 3L77A 4XGRA 4JUIA 2IYLD 5AM3A 3LDAA 3O47A 3EK2A 3FWYA 2REQA 5DNUA 3AEUB 3ZGXA 3U39A 1PFUA 1QHNA 2QNRA 4O3FA 2QTHA 2IFTA 1OBFO 1GKUB 1UP7A 3JQ8B 1DX4A 3KKMA 4WX2B 3OSUA 1Q1BA 3FLEA 1IZZA 4YCDA 3FRIA 4J1SA 2ZAMA 1C3XA 2AJCA 3OEED 4UMVA 5AUNB 4A1OA 2DPXA 4IX9A 1Z8HA 3CNOA 2R8PA 2ZETA 2XITA 1S96A 4HF7A 4B9AA 1L8LA 1EVKA 1M1YE 2GYYA 3M49A 1ST3A 4BDTA 4EHJA 2B82A 2R85A 2F3SA 3M6LA 5IJ9B 1HF3A 1MF7A 3SGLA 5CDTA 5D1HA 2R5NA 5HILA 3N0TA 5BMVB 1SXJB 2CXHA 1GQQA 2LCFA 3EASA 4BVLA 1C7EA 1TF7A 5TVGA 1C9MA 1SAYA 1NUHA 5DKFA 5CB4B 5L3SB 2B98A 2WSSA 1CYEA 3U37A 2ZUBA 4CQMD 1ZIPA 3HR8A 3DV0A 3I2JA 4QU8A 4CKYA 1C1DB 1SGWA 4KFTA 4RFVA 5G1PA 2JVKA 1SNYA 4OP2A 1UEJA 4QASA 2ORVA 3FNRA 4KN6A 4JROA 1RRPA 2UUPA 4ZI2A 3SYTA 2J07A 3DZHA 1O95D 1OYVA 2A94A 4UPVA 1UUFA 1MJGA 3DM9B 2PBZA 3SPXA 1C1XA 1RT9A 4KBYA 5CA0A 4QT4A 1DMSA 1KI1A 3M6IA 1MB0A 1HYQA 1BJTA 2I78A 3RS7A 1TYEB 1HE4A 4RADA 1NW8A 3USCS 4UU7A 4IGKA 4DNQA 2NVBA 4E5UA 3O93A 5A5VA 3OX2A 3VPBA 1WMEA 2ZTVA 4LN1A 4PEVA 4DBZA 4F3TA 1P33A 5FFNA 3DP7A 4M8LA 5CW1A 2RIPA 4EFLA 1II9A 4K40A 4E2FA 3WAJA 1HQYE 2VO1A 3ISTA 3TTSA 4DWVA 4FQ8A 4C06A 3ICEA 2GLTA 2AN5A 4RM2A 4EK9A 5EFZA 1B16A 4MS4B 3KZCA 3I04M 1UDBA 2C29D 4XVRA 1JR3D 1KJWA 1M8PA 1ZAKA 4TM7A 4U0KA 4Z9XA 5J40A 4Z2YA 3WQRA 2FYTA 2OENG 3ZV6A 5BN3B 2RG7A 5JJBA 4RTPA 2ZUSA 1JIJA 1XRRA 3L6OO 2HFKA 3BRWD 4HTAA 1GXSB 3VU3A 1KY2A 3GEIA 4BFCA 2Z5VA 4HH3C 4U63A 3T38A 4OHFA 5B7PA 2V7WA 4B6OA 1POXA 2X8JA 3HM2A 3UK0A 4PYQA 4LBWA 4JSYA 5IXYA 3TTXA 1O7JA 3CIFA 3Q7PA 4R9NA 4EARA 4NBSA 2JGAA 2FN3A 2ET6A 2FN8A 2XRFA 3HGQA 4ZAYA 3ZVRA 1CUXA 1LPMA 2BF7A 2FRDA 2R62A 3MRVA 3PG5A 2PANA 1JSLA 5HCUA 2AIRA 1QONA 3L9XA 1IAQA 2YV3A 1AM4D 2AXNA 2REQB 3T7KA 4RS3A 2ERXA 1DQSA 2W2LA 1J2UA 4EO4A 4PLGA 1UADA 1RIIA 3KOUA 5FRDA 4YWHA 4FNMA 1IYZA 2PZLA 2ZVJA 4EHHA 5HE8A 1JQJC 4I1UA 4I9GA 2AW3A 4PCUA 1R0SA 3H1BA 3ROKA 2AKAB 4OHPA 3VVBA 3HABA 4JR0A 5HFJA 2PGAA 4GOJA 1M5TA 3UAVA 3K09A 5IDWA 1OFUA 3SXJA 3K9LA 3NS7A 5DCUA 1YKSA 3S8EA 2HA4A 1WRBA 2J5XA 1C7FA 2QRJA 1TUGA 5LYJF 2GBLC 2E21A 1LPNA 5IHPA 1D6JA 3HUFA 1TK9A 4Q24A 1J1ZA 4DANA 4CPDA 3EXG2 1QE3A 2ZXEA 5IF3A 3KQLA 1EM6A 1GG5A 1V6CA 1KMQA 4EGFA 4DCUA 3ADOA 4FCTA 4WMLA 4FMPA 3S8YA 3ADPA 3CCBA 1RQ2A 1ZG3A 4KIFA 5AO9A 4ZJYA 4UHBA 2XB6A 3DV0B 3VSAA 5HYVA 3BWYA 3VHLB 3ZDAA 3FGOA 3UMGA 5ITVA 1Z82A 5J2UF 1I4EB 4TS1A 1SG6A 4LE1A 3ELUA 4M49A 3VVLA 1YUBA 3ZTTA 4BMXA 1TIKA 1XV5A 1N1MA 1C1XB 3B5EA 4LQLA 4UCXA 5CA0B 2MMGA 3FCUB 1UK6A 3WJAA 4BVHA 3EGCA 3ORQA 1SUDA 4JVMA 3TDMA 5ABPA 3WISA 3Q12A 4J4BA 4PICA 4XCXA 1J8DA 3WYNA 3WMGA 1C0IA 3V7WA 3EXHA 1PTKA 2ZI3A 3U9LA 3F47A 5ALEA 3QFFA 5CBPA 1T2CA 2QVCA 2WM3A 1PR9A 2KI5A 5JWOA 3M3PA 1WSDA 1YE5A 1PGNA 4YJFA 3JVIA 5C5DA 5JROA 2PGIA 5FUXA 5AJHA 1V8FA 3DVAA 4MCIA 4RH3A 4K6CA 5GONF 1QNLA 2JFZA 1ATIA 2I80A 3BWVA 1CUWA 4QPCA 1ESZA 4G5GA 3LDHA 4KXQA 1TLLA 1FLNA 1ZJZA 5CUQA 1MLDA 3DBHB 2XA1A 3L7MA 4IZHA 3QFSA 2Y27A 1C1HA 1MEJA 2VS1A 4C43A 2W6OA 3OJLA 3PGA1 1ZQ1A 4WGGA 3D4LA 3Q7SA 4H7DA 4NU5A 3U81A 5GIOE 3OMWA 2X8JB 4IDOA 1RM0A 4YAJA 4LX8A 4RZUA 3DOEA 4MGZR 4NG4A 2JIZA 1IQRA 2X15A 1U7TA 2AUNA 2WAXA 3ITEA 3W9YA 3OFJA 3T5BA 2QOEA 1CQXA 4PV7A 4RIIA 1XTZA 3RVSA 2W42A 1L7XA 3NM6B 3KL4A 4ML3A 4KSYA 4FR2A 3A2LA 3ZGYA 3LVBA 2AE2A 2HIMA 2IUUA 2I62A 3PQ4A 4DIUA 5TQ2A 4JLOA 4R69A 3ZNQA 2VYNA 4EY4A 5CU7A 1ODIA 3WGVA 3K1JA 5AHOA 4X91A 4RGVA 5CYFA 1KI6A 4HPJB 2CGEA 2YX1A 1DOAA 3EGWA 1EWTA 3ID6C 4MA4A 2EERA 1R0WA 4QHYA 2I8CA 2MCFA 3PU6A 4TMYA 2HF2A 2YC4C 3Q0EA 1G4HA 1Y42X 4FB5A 5AI5A 1UJ2A 5DHPA 4EY3A 4CKBA 1CUZA 1Y8QA 1USGA 3DDCA 2SBTA 3K05A 3L0IB 5BN1A 5KHLB 3ZHSA 5KNCD 1W7AA 4ZVSA 2Z6QA 3C3YA 2CB9A 2IX3A 3PZBA 3AESA 2Q28A 2V5UA 3ZDDA 4LDRA 1E89A 1ZK2A 1MAVA 2YXEA 1AF4A 5DTQA 3SAJA 2UXCB 4P1ZA 1QLJA 4YFYA 1DHRA 3L7CA 3FYDA 1NVWQ 1NBWB 5LMUB 2GT1A 1NOJA 5E7QA 5T41A 3SEZA 1XQYA 1QKKA 4KXMA 1ZHHA 5DBGA 4UPDA 4XAQA 1N0UA 2JCGA 3LHFA 3L0OA 1XF1A 2JCVA 3T5PA 5DM4A 1F48A 2VAXA 5I5GA 2A7XA 4ZV9A 1ECCA 1E8MA 3EXHB 1T9BA 2JATA 3LPCA 5JAMA 2D1TA 4KYTA 5CBPB 5KOJA 1PCXA 1Z12A 3BJZA 3N5KA 3K2QA 3ZQJA 2QUKA 1UZAA 3R7DA 3U17A 3JR7A 3U4HA 4DLRA 1A8SA 2FE1A 2NZ8A 1FMCA 1GIAA 2HEGA 2FW8A 2WWXA 1C29B 3EB9A 3PQ2A 4YJFB 3PKJA 1X87A 1VQ1A 5GIPE 3DVAB 3QX7A 1TM1E 2PUJA 3T94A 2ZAGA 4CQLA 2F90A 4M8SA 2PPVA 4QGGA 2X1VA 4UU8A 4BVGA 3EMKA 3NHMA 4Z51A 3ESYA 3U6BA 2A67A 2NVUB 3KJEA 1KXJA 4C03A 1Z2OX 4L75A 1UINA 4KQMA 4TLAA 1QGOA 1J07A 1AGXA 2WKPA 2Z09A 5FBWB 2EJTA 3IPRA 5FFFA 1MT0A 3CN7A 2HGZA 4YJ3F 2Q5CA 2TSYB 4OXYA 1P44A 3BE5A 3ZGLA 2XQGA 1XU9A 2CDCA 2ZEJA 4H1TA 5TEWA 5J43A 4BO7A 1T29A 3M83A 2O2SA 1QPGA 3LQRA 5DO9A 1ZISA 3GT4A 4YHHB 4DV2B 4O8CA 3UQZA 4R0MA 3QHQA 2AX3A 4KWEA 5D7BA 4Z6KA 5TQ2B 2G82A 1E6CA 2LDXA 3N3AC 3OMLA 3PFFA 1VI6A 1RJFA 5B2EA 5AKKA 1RP1A 4PSUA 3UK7A 2IYRA 1GTRA 1W59A 2IYSA 5HHTA 1KI6B 2QWXA 5BQ5A 2AFVA 1DFIA 4RJJA 3ZOKA 4MQ4A 5A3RA 3GRPA 3V4SA 4DUPA 1X7XA 3QLTA 1A9ZA 2I3ZA 3U0BA 1Q3HA 1W9HA 3PUWA 1DP4A 1MT3A 4IFBA 3WO0A 5M04A 3B3FA 4RMIA 3PJFA 3V9PA 2AMYA 3KZOA 1Z0UA 2IELA 3B6ZA 3HMQA 1Y8QB 1W5BA 1TUBA 1YA4A 3C3PA 1KBQA 3OLCX 2IIVA 5C5EA 4IJKA 4G89A 4F1WA 2KS6A 4W9NA 4IIGA 2FPLA 3MLEA 5EJ8A 2M9MA 3AESB 3I45A 5AKHA 2QMHA 3VOSA 2CXNA 4YS6A 3V8PA 5C9ZA 3RIYA 4NL4H 4WSOA 2O7QA 2P69A 3KJHA 3TRKA 3U3MA 1NVBA 2C94A 4LF7B 4BQFA 1QAQA 4MCJA 4BTVA 5BO5A 4ARSA 4TTQA 5L9AA 4B7XA 2EEPA 4V0ME 2VBFA 3DAHA 2VK2A 3FNGA 1A9PA 3GEMA 4CM9A 4E4YA 5JR3A 3TB4A 2JIMA 5ALLA 1MJHA 4E14A 3ZU4A 3I28A 3OPYI 5ALOA 3SZUA 2CV1A 5KYKA 1PUIA 1W8IA 1KP9A 4FN5A 4TQAA 5D1NA 1D2HA 1KI3A 1QE5A 4RJKA 1L9XA 3AJAA 3ZWMA 5A62A 1FFGA 3T3PB 3UVEA 4PSKA 4MPPA 5F73A 1HDXA 1Y4UA 1PSWA 1WJGA 4ES6A 1SJ9A 1IWBB 4FGLA 1RWPA 3LT0A 2HT1A 1TYDE 3ZDBA 4UC0A 3UHFA 1O0CA 1PK7A 1DAOA 3ND9A 1DU4A 3VR1A 5DTEA 1Y7PA 2HUPA 4G4JA 4CQLB 3HZZA 3B78A 1CD5A 2WAAA 4JX9A 2TMGA 2AXPA 5DYNA 4YUVA 4RJTA 5JANA 4G9BA 5B55A 1EZ4A 4RVNA 3H2HA 5DYWA 1HLGA 4HEJA 5AOCA 4OP1A 5JQGA 3PRKE 1DV2A 3ROFA 3GYBA 4M9RA 3IEIA 4WFQA 2GBIA 2JNWA 2QGNA 5DHUA 5ECGC 1YO6A 3ER6A 1WNFA 1P31A 1TYAE 3A3YA 4A6DA 2AOXA 1C3EA 1MEEA 2J31A 2Y0EA 4GR4A 3EEBA 2G80A 2WTNA 4PFJA 5F4BA 4RQTA 4XQGA 4F4IA 4RKWA 1CT9A 1NW4A 6YASA 3PENA 1D6MA 3EG9A 3NHKA 3EN0A 4EQ6A 4F9FA 3E23A 1WDKA 2C31A 4E12A 3VUEA 2VKTA 1ICIA 4JGBA 1JVSA 3UGQA 2PUAA 5FYDA 4I36A 4TQ9A 2C78A 3EWAA 2WILA 2IBMA 2IK8A 4AQYB 4WXMA 1T3ZA 2A1TR 5BSMA 2Q5EA 1CX9B 3GK3A 3ED5A 4N7RA 2QQEA 4O6VA 5E1BA 1LLCA 1O6ZA 2D2FA 3T7RA 4ZVOA 3ZE6A 2BHLA 4BZXA 2NT4A 4Y7CA 2RD2A 1TDJA 1X7XB 3B48A 1FBNA 2NV2B 3BFJA 5ALSA 1SG0A 1ULUA 1WP4A 2OCIA 2QZSA 3AUFA 3W78A 3QPUA 4B32A 5G53C 4BO8A 2RGYA 1KERA 1S1MA 1TUBB 4JGIA 1YRHA 4HLCA 4D42A 1OASA 1YZKA 5IVDA 2F00A 3WADA 1UBKS 1JWAB 4N76A 1X38A 2IDZA 3L6UA 3DLPX 3TOCA 3RV4A 1JHQA 3G82C 1WZIA 1I9CA 1E1MA 1U6KA 1PQWA 3MVEA 2OCKA 2BMWA 3NDIA 3WAKA 3CVVA 4DR4B 3SNKA 4S0ZA 1FFEA 1KJ8A 1R1DA 4WFIA 4JC0A 3QVJA 5TMBA 1PEDA 4B2PA 5EE5B 1G9TA 3NTQA 4JBHA 4DVJA 4OHKA 5H9WA 2ZBUA 4MIOA 5KWIA 3BA6A 5FWYA 5AIAA 3WLMA 5MGBA 2BH2A 1FNBA 1ZI8A 4N5MA 1V16A 4QVGA 1U7HA 4B4KA 1N2BA 3FSGA 5TARA 3H2YA 1QZ3A 4L4XA 4W9RA 5IP5A 1MQ9A 4LQ4A 2J4CA 2PR2A 1ZMXA 2A58A 3OEHD 5DCLA 1E2DA 4B3CA 3BZUA 3CH5A 3OJOA 4AKIA 1EQUA 5J1TB 3CUYA 1GFZA 3W8RA 4S1WA 5BW8A 1QHHA 1RPAA 3ACDA 2JJ2A 4M37A 3QOYA 2Y1KA 3OZXA 4YAIA 4DM3A 3FOBA 1K8RA 3DQZA 3JRXA 2Y66A 3LUFA 2O8DA 5L4LA 1JUDA 4EF4A 4IDFA 2RHOA 1BROA 4YGXB 4ND5A 4BIIA 5ITZB 5ENDA 2FU5C 1HE8B 2GI4A 2Q49A 3CXUA 1ORRA 2PKQO 3WNZA 4J0GA 4HGZA 3H97A 4NJMA 3UJDA 4Z49A 2MYUA 1CR6A 1QR6A 2DY1A 3GBPA 4O29A 4U7WA 4OHXA 2HA2A 2B99A 4MCAA 4WKBA 2VJNA 4Y9DA 3EGIA 4TTVA 2VP0A 1F17A 4I9NA 3NTVA 1XNGA 4GQIA 2J5RA 2Y1OA 2H9IA 1GPLA 2QTTA 4P5PA 3UT0A 1MGPA 1OB2A 3EJ6A 4JYBA 3UXEA 2P6UA 4US1R 1T26A 1DRVA 3NPAA 4JBLA 2CLCX 3F6RA 2MSWA 4ZRMA 3ILSA 3R3SA 3EG9B 1Y7TA 1LJ8A 4CLEA 2A3RA 4E5NA 4EQ6B 4RTLA 3H19A 4OV6B 3TFQA 3VKUA 2IUFA 2IVFA 3DD5A 3ES9A 2IYVA 3QVGA 2Z8ZA 3R41A 3ZU2A 3ZYZA 1Y1RA 1FBTA 1H3NA 1HUQA 2WEKA 2WF8A 3LBIA 3LNTA 1R8JA 1LV8A 2HFJA 1NBME 4NATA 1Y80A 1Q17A 4Z9AA 3DZFA 4UEWA 1PNVA 2XMGA 3ABQB 3RJZA 4AL4A 4QG3A 3U26A 3MB5A 2ECOA 2VP9A 1ZSNA 2M98A 5ALYA 4C4TA 2PQMA 1Y6GA 2EZUA 2MYTA 1B8UA 3KT3A 3RODA 5BQXA 3AETA 1TZJA 4GW3A 4JQOA 4B4DA 5JTTA 1XBTA 2IHTA 3W8NA 3EVEA 1XWFA 4TTSA 2NSJA 4L78A 4AWBA 1SKAA 2BHNA 1FMFA 4G5SA 4BBZA 3KFXA 2J6IA 4QYSA 1WUTA 1W52X 1Y9ZA 1KYIA 3PHIA 1SG9A 3TI9A 2O5CA 3KJXA 4GRAA 4JLDA 5JSFA 4ZN6A 4IIJF 4JWTA 4JXKA 5EJ4A 1JQDA 2X5OA 2ZI6A 5DPMA 4WCFC 3CF2A 2O07A 2YHIA 4QBFA 2Q1WA 4QXPA 4X71A 2ZUTA 4B2YA 3SWWA 4RFLA 1PHRA 2QLFA 1VLHA 1S2DA 1YD7A 4RA6A 4D4KA 4WBNA 1UP6A 2WKSA 4BNXA 3DO6A 5FWYB 1H3EA 3L8FA 5CEJA 1C80A 1V16B 1WCV1 5H82A 5THXA 3RTAA 1VLVA 4D4MA 4B7AA 1FUUA 3KPJA 3JQBA 1OVMA 4UXHA 4XOUA 3ELWA 1N8SA 1UM8A 1Q0UA 3C15C 3REQA 1WSBA 4Y6RA 3NWOA 4IG9A 2BUAA 4CMEA 1RXSA 3GJTA 1HEIA 1QHHB 2VLIA 5DEIA 2VBIA 4U7HA 1E64A 3JD3A 3LXMA 5LUAA 1F0PA 2BT4A 3X2SA 1G63A 2L42A 4TVOA 2VRNA 3A9UA 1FTWA 3TECE 1ISRA 3ESCA 4EG6A 2O8DB 4NTZA 2DPGA 1NNLA 1QPZA 3F7OA 2M6LA 1ACJA 1DQRA 4UJ3A 4OGLA 4BX8A 4JC8A 1P6UA 3C7KA 3HXLA 1X7ZA 2CN1A 3M6UA 5J4LA 4NJMB 5TE9A 1HE2A 4P4GA 2GM3A 1DINA 2I7CA 2C9MA 3Q2OA 2A5LA 5CFQA 4UQLA 5J2TA 3GRZA 3Q11A 3DE4X 2YCBA 3NLLA 1DAHA 1PT9A 3UK6A 5A5EA 1BS1A 1SUBA 4QECA 1OH6A 4LFBB 4YI3A 2Q5QA 3QM1A 2OL4A 3RKSA 4DREA 4HLQB 3BYZA 5EXEA 3WYAA 4Y2YA 4L8GA 4PIMA 3HU1A 2GR9A 5HDBB 4WJLA 2QX6A 4RZIA 3QVGB 4LSZA 1EFKA 3PTZA 4II2A 2UUBB 3PYLA 3GO4A 3W05A 1XCJA 3H7IA 5TJHA 3PQ5A 1U0NA 1THZA 2EJVA 4BB6A 3W7BA 3DHWC 2XKJE 1N1GA 2FEAA 1JDJA 1MPTA 1R10A 3QU5A 3TD6A 1G4UR 1XUOA 4HMQA 3CA8A 4OYRA 1XC7A 1SQGA 2GKSA 4MI3A 3TRHA 2I91A 1P0MA 3GB9A 1INLA 3OJWA 5ALPA 2H4XA 2E5FA 2O2IA 4S35A 2DKNA 3D02A 1K06A 1NATA 1G7SA 3GZ4A 2VZ8A 1PT5A 1X0VA 2XNJA 3V80A 5AW6A 5I4CA 3DTTA 4JX8A 1IUNA 1PNTA 2UZ3A 2F1HA 3F7MA 4KI0A 3VR5A 4BVEA 1A5BB 2FUNB 5KNCA 3TRFA 3VSCA 2O1SA 2QTLA 5JZBA 1Y1PA 5LDDC 2PPLA 1RZRA 1JQLB 3NYWA 4F5WA 3CKMA 1EAYA 2YHIB 4RSRA 1L5NA 3TZCA 4W6ZA 3X0DA 3ET4A 1SBTA 3SG0A 1SCQA 3BJEA 3PEFA 2XNDD 3CFYA 1L5FA 2EFEB 2P0YA 4WBNB 4C4AA 2V1UA 2QUIA 3HYNA 4FD3A 3NMUF 1Y6ZA 2G0NA 3GUHA 3PI6A 2P1RA 2UZIR 3NU1A 4JKOA 1XIVA 4EI9A 3CZ9A 4DILA 4URXR 1MQSA 4Z7NB 3T3GA 1JFTA 2IEYA 2OBBA 2IU0A 4B09A 5T7BA 2P7IA 1XQ6A 3L43A 3REQB 3WMFA 1G3IA 3IAXA 4I6JA 1VCHA 2YY5A 3G88A 3BBLA 3T3HA 1O2DA 3OAAA 4GSLA 4YB8A 2YJ4A 1KTVA 1UIMA 4PNPA 5L7YA 4IUYA 1WIWA 4QJ4A 4V24A 3LC2O 3MT9A 5IWCA 1VBKA 3Q8WA 2QT0A 1F8XA 1NXOA 4OKNA 3QPDA 4Q01A 3VPAA 1L7DA 5B36A 2X5NA 4KN8A 5E9QA 2ZRLA 3U1VA 3WZLA 2PUWA 4DEVA 1I24A 2A9RA 3OD5A 3S2ZA 2AZMA 1U9YA 1X7ZB 3LVQE 1R74A 2EJCA 3UJNA 4CLDA 4K6FA 3L4BA 4ZXFA 3GRKA 2JJQA 4AJ1A 3MIZA 5J2TB 1KK3A 4JZYA 1PR3A 4NHOA 4B6SA 1C9YA 2YZKA 3NNSA 2PKXA 4DQ0A 4UPEA 4ZHQA 1GZUA 1KYYA 2GRJA 2JGFA 4IWXA 3KCNA 5CT9A 1SCBA 2CKMA 1Y5IA 4X8LA 1IJFA 1HFWA 2TS1A 2NZ2A 1XKXA 2QJWA 3PNSA 3S27A 1R0KA 4F0JA 3T4EA 5HGJA 1SHTX 3WFZA 1E1LA 1NQTA 1NVFA 1T0JB 1E62A 3B6EA 2GESA 3K4QA 3Q98A 3Q3EA 3WLIA 3P0JA 4UDXX 5SYNA 2WIDA 2H16A 4DBLE 4IQ4A 3BSSA 1JI0A 4PWYA 1B2RA 1QVWA 1VE3A 5H70A 4BQIA 3EXIA 4EHLA 2MR6A 4MI1A 4D9KA 5JCPA 5ECYA 1TO6A 3H2SA 2BTEA 1L4EA 5BPFA 1Y4ZA 3O4JA 2F43A 4B3RB 1E5TA 3M3HA 1X8JA 5DI3A 1DUIA 1FP1D 2V5VA 4ZU6X 1HG0A 3JWIA 4BNZA 1JPVA 3KLBA 2Z56A 4LVNA 3OTWA 1JN0A 4BO4A 5HIKA 3FUWA 3OQHA 5IBQA 2VAVA 1U2ZA 1TW3A 4D44A 4ZO6A 4JB8A 1MV5A 1TC1A 2X4DA 1HNZB 5JARA 1J6UA 5JJKA 1DADA 4R1TA 2XTAA 3KTAA 4YIKA 4B74A 3H9EO 1AQIA 1QYXA 1E2BA 2E5WA 3WWDA 3DE5X 1JXAA 1XP5A 1NG9A 3IHTA 3CLRC 4PC7A 1XOIA 1PTJC 1AO0A 2V74B 3UV6A 3AJ8A 4ISBA 1YE8A 2VJQA 1BMDA 1SUAA 3TR0A 4C30A 3UAXA 1G66A 4YMLA 2CZGA 3G17A 3RIHA 3MERA 1S7CA 2GJ4A 1JEEA 3SKVA 5AKZA 4COOA 3BGWA 4FEGA 2JFNA 1I4DD 2H6EA 2A59A 3D1VA 3N8DA 4WDRA 4Y98A 4ZODA 4ETIA 5LQDA 3WP0A 1Q7GA 3EH1A 3RAPR 2HMSA 5F35A 2EQBA 2PFSA 4Y0NA 1CE8A 3VM6A 4MMYB 3UHJA 1UDWA 2XEXA 2XDQA 3V42A 3HXTA 4TWZA 4O2AF 2EQAA 3OCVA 3LK6A 4P3PA 3SMVA 5BR8B 3HWRA 3UMFA 1L5YA 3OZFA 4KDFA 4RETA 4Y8VA 5FT9A 1TCUA 2R8OA 3L82B 3LO8A 4M1WA 5CEFA 2AOUA 1WDLA 4P38A 5CLFA 2QMEA 3SOZA 2W2KA 4CQNA 2MYPA 4J3FA 1J8FA 1ZMOA 3FVVA 1TTPB 3A3KA 4LAFA 5ALWA 5E8JA 4B5KA 2CW5A 2Q3EA 3K9NA 4KWHA 4LVOA 1MABA 3SYKA 5L7WA 1TU0A 2Q27A 2Q5LA 4MEBA 3UC9A 1YJBA 2J9ZB 5IAKA 2FUKA 4EHBA 1LV7A 3OM8A 4IGFA 2NP6A 3UPTA 2IQIA 1QG2A 1WSAA 3FYTA 3HEMA 3V4FA 3IVXA 3ZCPA 2GTHA 2FR1A 3C7TA 1ZBDA 3C5HA 5F98A 1SVIA 4M9QA 4WOKA 4IDBA 3MELA 1ABFA 1HDGO 1OKKD 5JDCC 5NULA 1YBFA 4BKOA 5C7YA 4Y2GA 4EUFA 3ENQA 1AS3A 1Q7BA 4GYKA 5KJFA 3TIIA 3ETDA 4ZHQB 1YS2X 4FOTA 5L7TA 4AWXA 1T2EA 3F46A 1GTMA 2W2MA 2ZP1A 5E1DA 1GSAA 3BM5A 5DBOA 2OCPA 3PDIB 3R5XA 4L8WB 1LGYA 4KE8A 4EVSA 3DLCA 2IP2A 4NH0A 3OZIA 3QUBA 3WKCA 2O8CB 3CWZA 3EZFA 1HLFA 2UZ0A 1FTYA 4MUHA 1B0ZA 3DF9A 1KJNA 5IM4A 3BS4A 4DCGA 4P92A 3BAZA 3EXIB 1GGFA 3JZDA 3P5SA 4GL2A 2EW8A 2FW7A 2QPTA 3IP5A 3IRVA 3PSAA 2EGGA 3LW8A 4IRXA 2YDXA 2INGX 2YUIA 2WY2D 5HKKA 4B6JA 5DI3B 1M3SA 1OFHA 3UUGA 4B3FX 1RJWA 1OILA 3G7UA 3AI3A 3EHEA 3I61A 2D3WA 1DL5A 1M72A 4XX1A 5DNEA 8AT1A 5IKPA 4N3CA 1E1DA 1D0IA 3CB2A 2CXUA 3N58A 1SZCA 3KTAB 4JBGA 1KDZA 3U16A 3G0HA 4MUXA 3T3EA 4PN7A 4X6UA 1CZKA 3QSYA 1K68A 2UUAB 3ZCTA 2QE7A 5JCXA 2VVTA 1HORA 2RE8A 1AZSC 5LJLA 1ISGA 2HIHA 2DFTA 5I9NA 2HEIA 2Z83A 3Q3CA 4I5EA 4MWCA 5JPCA 5JS8A 3WJ7A 5FL7D 4JYAB 5ITSA 1MC5A 5HJEA 4JOCA 1CHDA 2BGUA 2FZKA 1LLDA 1P0CA 3UZUA 1TMGE 1MHTA 1VA5A 1E63A 3HL0A 2VF7A 2ZSBA 1WUJS 2B61A 3BWMA 1NJ2A 1U04A 1CE8B 2SKEA 4RVFA 4UM9B 2J3JA 5JO0A 4OMCA 1GCGA 1K9SA 4LE0A 2AZDA 2XDQB 3I2IA 1C4XA 4CF4A 1MVNA 1NMYA 3W3AH 3M4XA 3KYDA 2ZRHA 2P2DA 5B3AA 1BE1A 1L4LA 1FUKA 1N8NA 1HYHA 3OVMA 5AQ1A 3MTAA 2AOUB 4FYXA 4G4SO 4QARA 2C97A 4LV6A 1R9NA 2HCJB 4OI1A 1LDYA 1QVRA 2JLUA 2W2KB 4IJWA 3FPBA 4PM4A 6Q21A 3SD7A 2D2EA 5BSGA 1HFJA 3WTCA 1N9KA 1E18A 3W1WA 3KKLA 4PSVA 3L8ZA 1V9CA 1ADJA 5JXHA 3FHOA 1V2HE 3OHSX 3C6YA 4EGJA 2REOA 4PXSA 3MQ2A 2WJHA 5L95A 2OT3B 1R66A 3PNMA 3GWGA 1AO3A 1ESDA 2ALJA 3A1EA 1T0BA 1G7TA 4MI9A 4H2DA 2C4KA 4M0UA 1KF0A 4ALMA 1YDFA 4CMJA 2HL6A 4B3HA 4IJQA 1BMTA 1C2YA 2VDWA 4R8LA 3AB3A 1RI2A 1YZHA 2Q2WA 3U61B 1H9BA 2PLNA 3N3BC 2VHCA 3AR5A 4AMUA 2AHRA 4PHCA 4AYWA 2DRIA 1LA2A 1STOA 1JQ3A 2ACKA 5IG2A 4RPJA 4PRYA 2R6AA 2I71A 3SHOA 2C57A 2YBDA 1B76A 2FXIA 2WWWA 4HDAA 3W5VA 4G01B 3MRSA 3NWPA 4DZZA 3I9KA 1II8B 4X8OA 3ROPA 1L5HA 4Q7JB 2FH5B 1Z4QA 2XUDA 3GJ0A 2B3DA 1E2UA 2PZAA 1U5BA 3TM4A 4UBNA 5AM4A 3NAZA 2Q1SA 4M99A 1R8XA 2ZJ1A 1NVEA 1NE2A 3FVTA 3FM9A 1GGHA 4XZ3A 5EMJA 3I5UA 1AS2A 1Z2DA 1GCUA 3V7UA 3NORA 1YCDA 3LUDA 1XAIA 3EXFA 1L5ZA 2G6BA 1UMBA 1CNFA 2XGJA 3PJGA 3WJ2A 1FU4A 2WYWA 3HB9A 1KEPA 4C21A 4DJFC 4MW7A 4I5FA 2W8BA 5K0TA 2YOFA 2FEOA 1SQSA 4YH1A 4D41A 2JJ8A 5BMVF 3BIOA 5A05A 4DQDA 3T7SA 5FPKA 3ED1A 5CB4F 4S04A 4PZDA 1ETUA 3X3HA 2BKVA 2AKEA 2I6QA 3VXKA 3SC6A 5LZ7A 2BR4A 2ZBVA 2ONJA 2HADA 3N74A 1A2KC 3SXPA 3T9EA 3AL0C 1D8AA 2AFRA 1KARA 1MOZA 3E15A 3GXBA 1CUVA 3QVKA 5ES4B 2WZDA 4R84A 5JUWA 2A7QA 1GP2A 3MAAC 2VATA 3TR6A 4ERXA 2WZQA 5F5NA 2PS1A 3RTBA 1F4PA 1KZ7B 3GDWA 1KAHA 3J81A 1PZNA 4E5VA 4KPFC 5KTOA 1QHGA 2ZI9A 5FOVA 2ZBEA 1BC5A 3ZY4A 4BWVA 1NE7A 2RBKA 3HLYA 4WLUA 2VWHA 3L1UA 2AXQA 4TRJA 3UN1A 3ZOZA 4B7CA 3UTDA 3AVVA 4K3UA 3O8CA 4UTZA 1H1DA 2WABA 1XRPA 4B0PA 2Z2IA 1C41A 2RAPA 3MS4A 1TMOA 3KYDB 4AS2A 3A4TA 2OHGA 1E58A 1YCHA 3N2LA 3H8JA 4WLNA 1P73A 2B8JA 4LJ6A 4RENA 2GZ3A 2I3AA 2JS7A 4BVBA 1J33A 1PNQA 4PG7A 3BGIA 3INYA 2IODA 3OM9A 4B0OA 1GTSA 2ZVQX 4K5QA 1JHDA 2HNBA 3LPAA 2KLBA 5JPDA 2GRUA 3GLHA 2CE7A 3RTEA 4ZMBA 2GX6A 4A8JC 3NR2A 2PLAA 2AQIA 1A4XA 5E6UA 2Y1EA 3KZXA 4H1VA 1OGYA 5ED0A 1ZPDA 2I3GA 1TJ4A 4J2OA 3C8MA 3PS9A 1TD9A 5EMKA 5F76A 2CEAA 3RBAA 3RS0A 1TZBA 1CUSA 1QGDA 1YUNA 1CJBA 4BUCA 4MMZB 1NVMB 1DUSA 1PR5A 1WM1A 3FTPA 2WPDA 2VDWB 4LUCA 2F7SA 3CR7A 4QFDA 3S7ZA 2G17A 2DSNA 2PZMA 3EW9A 5EXTA 1Z73A 1TQDA 3F90A 1OXUA 3BHMA 3NIBA 1FMTA 3MT8A 4LYEA 1JBQA 1FS4A 1WZUA 4X0EA 3VZSA 4BMCA 4NCBA 3ONVA 5DWDA 4RS4A 3CLVA 3GMTA 3ANYB 3OFND 1L5HB 4FUTA 4IUCS 3F7TA 4CUZA 1U5BB 3EXEA 4RH1A 4GHWA 2R79A 4D25A 4JEHA 2HRDA 3LTEA 4I1VA 5FTKA 3S3TA 2YNMC 3VNAA 1K63A 3ENVA 4PYOA 1VHQA 4QGAA 3TUJC 1XCBA 1BZYA 3SJBA 5JAHA 1BAPA 4AMGA 4JYZA 1AQUA 2PVCA 4OFWA 4AZ3A 4CU5A 3DCJA 2PYIA 5KS2A 2M1XA 1HFKA 2JLYA 3EXFB 3FGPA 1U9ZA 1L5MA 1NSTA 2QR3A 3OZBA 1D2NA 4EUEA 3IDZA 3EY9A 5EWMB 3F3MA 5K9ZA 1X70A 3I2GA 1IM2A 2Q3CA 2W8BB 1M1XB 1V35A 1QOQB 3IIMA 2P6NA 1G1MA 4KMSA 3IT1A 4Y1FA 2ROQA 1KOJA 4QVKA 4BBPA 3ADKA 1KWKA 1GGJA 2CUZA 5JXJA 4FNAA 2C99A 2HJHA 3PX2A 4R1SA 1T5BA 3IUYA 1OXKB 5JISA 2PNFA 4LMBA 2WHQA 2G76A 2GASA 2XQFA 4HI0E 2IEDA 2VHTA 3L6BA 1Y6FA 3OZ7A 5EVJA 2X5KO 3ABRB 4I8IA 1PR1A 4K05A 1RDFA 3ORHA 3VPCA 1KVTA 3CT4A 2P2GA 4X6LA 1JA9A 5FI3A 4E0BA 5IKMA 4MVJP 3QYFA 5JTUA 5D51S 3B38A 2HDWA 1S8FA 2OCAA 3D7SA 3R0XA 5CM8B 2BMJA 2QYSA 3JYPA 3GD7A 4D43A 4J3JA 3TLGA 1W5TA 4EB0A 3I76A 2EBHX 4I9UA 1ATZA 4OKSA 4NBRA 4TLCA 2ICAA 4WNIA 1WB9A 3KUCA 3STYA 5EMLA 1YNSA 2J41A 3KJGA 4POOA 2QN7A 3ZKAA 2XB2A 5D6NA 4CR8A 2PX0A 2Q45A 2GZSA 3FB4A 2I2WA 2VPWA 2BFEA 4M1TA 3N7TA 4OUDA 4W1PA 3L8HA 3TMYA 3LFHA 1WTCA 1W49A 2P75A 1RQGA 4LHZA 3S1SA 2A0KA 2WVHA 3W2HA 3Q85A 4IEIA 1FNNA 4P4SA 5FI0B 2I29A 4I2NA 4XWOA 3WRXA 3C7AA 1LBQA 2E48A 4GLJA 4MV5A 4GEGA 2CFRA 1QX4A 2JEYA 3FJ1A 3Q7IA 3QHAA 4FXOA 4QUAA 5EIWA 3I52A 4DMGA 4TYNA 3GLHB 3MS2A 3CMMA 5A6VA 2NZVG 5F4ZA 2ZAOA 1FYWA 3HCPA 1DE0A 5AJUA 5E6UB 1JKXA 3LBNA 1NOKA 5EP1A 3LQKA 5EZYA 3MEQA 2ENUA 2QXUA 3QWBA 5D87A 4EEXA 5M34A 1A7UA 2AOVA 4RKRA 3AEXA 2DQYA 1PJAA 3JASA 3T35A 4JASB 2YYYA 5BQFA 1KYQA 4LA4A 4X1KA 1JG1A 1ZKDA 4YDSA 1MCZA 1KYTA 4I3HA 2XUIA 4B6FA 4BP8A 1IBMB 5F1KA 1RWNA 2QRKA 4HGOA 2J08A 1L5GB 4JDPA 4I2VA 1U2EA 1J2JA 1NNI1 3BMCA 4M9CA 1KI8A 4MUGA 5IZCA 4BV8A 1J0CA 4AJEA 3OFVA 4X00A 4WZAA 4Q7QA 3KAJA 3GJ6A 2P2CA 5JVDF 3QEAZ 1VLZA 4UHCA 4O4HA 3EXEB 1M74A 3DBOB 4K9PA 3VV3A 4MUYA 2HNKA 3S4YA 3RRNA 3JW8A 1ZR4A 3INNA 4G1BA 1ODJA 2FGJA 3SX4A 5BR7A 4AZ3B 5C5IA 5B2ZA 3UGTA 4BXOA 2XE6A 3O90A 4AUMA 2FPKA 2QQGA 1O57A 3KT8A 5F64A 2A57A 5TQJA 3O3NB 4DC9A 3MTJA 1T9KA 2RGBA 3U7FB 2RAFA 4M9XA 1T1GA 2OAP1 2ZSUA 3HHEA 3X1DA 1VJRA 1EG2A 1U2QA 4AJNA 4E08A 1IU9A 2IIBA 5F3DA 2BR3A 3K9GA 3L7AA 1JEJA 1SM4A 1LCIA 2P9GA 3BERA 1GZ7A 1SKYE 1EP3B 3C8UA 1IZ7A 1A77A 3H75A 1RAIA 4OSEA 5CT4A 2Z6UA 2F3RA 2JI9A 2O20A 4LEIA 3TXYA 3EDYA 3S70A 3D1JA 4CL2A 3NATA 3JQCA 3DOOA 1H23A 2PWBA 3DBLA 3KOYA 4EW2A 5JSHA 2C7PA 3HCAA 3UMSA 3CLUD 2GK6A 3PUYA 3QPBA 3IOEA 1OH7A 3TUZC 1WU7A 1OYWA 1UL1X 2P27A 1YUMA 1AKMA 3TLGB 3CF6R 3LYHA 4AY2A 3HBFA 4LXTA 2KLHA 2BZ0A 1D3AA 1FTSA 5B1YA 2OKGA 3DMRA 3ZDRA 4MJ3A 2KW5A 2QVZX 5JYEA 4UVEA 3PQEA 2CNLA 4KYIB 4O1MA 4MDHA 3LY8A 3R0VA 1RCTE 4IIEA 1FW8A 2YW2A 1ZX1A 2BFEB 4PLHA 4UMEA 3UJ6A 4OUDB 4F60A 1ZU4A 1PUXA 4JBYA 3AVXA 2EKLA 1EKXA 2ZBPA 1RQXA 3TNLA 1FSZA 4L0DA 1XLTC 4XR4A 2FXVA 1JS1X 4P4SB 1O0SA 1TOAA 3CHYA 2HBQA 3MTIA 5FPYA 2O2HA 1V43A 4FT2A 4KRGA 4QDXA 5HTOA 1ODKA 2JKVA 4LOHA 2XT0A 3I2YX 1VPEA 1COZA 2HV8A 3FNIA 3OIGA 4FQ7A 3P2OA 2N0SA 2GAFA 4IFTA 2Q6VA 1XGKA 2ZRFA 4EVIA 1P6XA 1WMFA 3VR3D 5CXSA 3NONA 2WIAA 3JQ7B 4ZO8A 1JYFA 3EODA 3GLGA 4I55A 5TLSA 2G72A 1YJAA 3C1UA 4KX3A 3HJRA 2Y05A 4J29A 3ZVKA 3AILA 2BFCA 1RRCA 1DDIA 3T9AA 1UFRA 2QXYA 4R8SA 4TKLA 4X1KB 3ZR4B 1XDZA 1VCOA 2H4WA 4FOLA 1PSDA 1ZLXA 4IPTA 1P39A 5A9SA 4MARA 3AJDA 3NBFA 5EZQA 2Q9BA 3BMCB 1YF3A 1NPTO 5LBIA 3IUMA 4CLOA 1H8HD 3A06A 1UJBA 1QF9A 4CW7A 2RH8A 4WZAB 1C7JA 1I3NA 4JKIA 4O4HB 3S40A 3DB2A 4J6EA 4BFTA 3OCWA 4CUJA 1KVUA 3KTOA 1N6RA 4BMNA 1EESA 3EDCA 3GLFB 5K0JA 4DTIA 2ORED 4JMLA 4BXOB 1Y3FE 3L02A 1V9LA 1XTKA 2C4HA 2FX2A 2RC5A 4N5DA 4Q7LA 4RNCA 3JYNA 2PLWA 5AOVA 4L5IA 3O2JA 1OPXA 5FOQA 4NE2A 4KFUA 5CDHA 2VSQA 2O05A 3CVJA 1XD9A 2WU8A 1J22A 5KTPA 2QKYA 4MULA 5K03A 1FP7A 4NBUA 2H1LA 3M6XA 4GZ3A 3A32A 1EGQA 4OQZA 1XL1A 4RK6A 4CTKA 4INOA 4UMDA 4WNCA 2LCIA 3E7FA 4X7MA 1GAXA 2FLWA 3FNQA 4MGIR 2EVWX 4R7TA 4NMMA 5CCXA 1A9OA 1Z45A 2EX4A 2VP3A 1SHLA 4GICA 4V0LA 3RVNA 3UAOA 3V2UA 6AT1A 2OM2A 3C6XA 5JNLA 1Y0BA 2AR7A 2EHDA 2VHQA 3EF1A 3KAKA 3NGXA 1JJBA 3PDCA 4XQ0A 1PV1A 4A6XA 1RWXA 4DQUA 1AC5A 4DA0A 3ZXSA 2JK1A 4H1HA 4K6OA 4Q37A 2E55A 1Q0SA 3MUFA 1W5EA 3GN1A 3H16A 2CJPA 4UBLA 4DUGA 4MVJM 3ILHA 3CISA 3E82A 4W1QA 5LL6P 1DOHA 4GYWA 4QNRA 1XEXA 5K0NA 5LN1A 2EBFX 3CUKA 1GPKA 1KBZA 4V02A 1LPOA 2WJGA 5MN4A 4XM0A 4RHTA 3G2HA 4IICA 3DAPA 1PBTA 3M8KA 3LVFO 1DLJA 3AHFA 3ZQUA 2IYNA 4LF9B 2BONA 1EGAA 2PIAA 4DA7A 1ISSA 1RQ7A 1MDFA 1JGTA 1XCMA 2ZYRA 3I6BA 1AS0A 1DQPA 1O3YA 1A04A 3OZGA 3VNRA 4M0MA 4H0CA 3VNBA 1ZN9A 1OCEA 4IF4A 2X77A 3JQPA 4YQZA 4OAPA 1CUAA 1RPTA 1VL6A 2NYAA 4ZREA 3EDOA 1LSOA 3GLGB 2BL4A 4I55B 4XJSA 4WZBA 5EGSA 1HEUA 2J5QA 2PMWB 2BFCB 3C3KA 1XZIA 2D59A 4LJ7A 4OY3A 4FDVA 1W0CA 4JMPA 2V9PA 2YJZA 121PA 3EFHA 2RI1A 3VC1A 1P2GA 3RWOA 2HQRA 1H4QA 3QLUA 1OZFA 3OZEA 5A9SB 4BX0A 1TVEA 1NJSA 2YFHA 3KSRA 1Z0ZA 2K2WA 4R9VA 1UC5B 4D96A 1L4NA 1NXQA 2VSYA 3H1EA 1NP7A 4CLOB 1TLTA 2XPCA 2VJAA 2X76A 4H18A 4LFCB 1IXKA 2GB4A 3KJQA 4D5EA 1Z39A 4KUEA 4DCMA 5JZ9A 3IE1A 3H17A 1TO1E 3HCNA 3O4GA 3KQSA 1H1TA 1I2BA 2JGJA 4OM7A 4YXWA 3RUPA 5K45A 5E8RA 2G4CA 1SRRA 2UU9B 3U13A 3T3OA 2ZRCA 1HZZC 1A3CA 1NFFA 1NP3A 2B7CA 3F1LA 2A86A 4LJ9A 1RXEA 4RK4A 4KPEC 2KQUA 2ZIAA 1YZLA 1C7IA 1IPEA 1NWHA 1T6YA 2FQWA 4V03A 3VH4A 1SXJE 1T8SA 1T1SA 1ZVMA 3GUZA 3QMWA 5PGMA 4CEHA 2D62A 1TM2A 1QKJA 4R8VA 4Y6GB 4FP9A 1U5AA 3NBKA 5HF5A 3RBXA 3TSZA 4GYYA 3F3SA 2HA0A 1ACMA 1XVVA 3B82A 4GOOD 3DVLA 5I7WA 3PFIA 2F3QA 1WHSA 2G88A 3M6MD 3L4EA 4M8IA 2C2YA 2YVLA 3A2MA 2ZS9A 3M7IA 2P3OA 2HBZA 3OZSA 3WNQA 1JIQA 1S3IA 4IDEA 2HA6A 4WVLA 4OSPA 4TV8F 4LXXA 5EIOA 4J0QA 4OHYA 3AU8A 1TQHA 2XF2A 3GGCA 1MA3A 1VI2A 4H4CA 2BP7A 5HCNA 4DBLC 5JZSA 1J25A 3H9BA 1WV0A 1U02A 3JVEA 3D6AA 5KYVA 1N2SA 1Y63A 4B3TB 4LQCA 3V1MA 4MW5A 3NGLA 1MC8A 2GN6A 3GLRA 4JT4A 1RU3A 2VNSA 5DM60 3MNFA 2Q0HA 1E3WA 3VR4H 3HO8A 1XEXB 2W11A 5IHXA 4Q3EA 4RWZA 3T7TA 3NDPA 2Z4SA 4A0GA 3PD1A 3CZMA 1CQJA 4PC6A 1HC7A 5EINA 3R3WA 3ZIAA 3TUIC 1SBZA 3QQPA 4I4TF 1I3MA 1KPIA 5LDGA 5GVSA 1ADYA 1QQ7A 1YK0A 1H0RA 3CCFA 2E5LB 1H2FA 4RGBA 1HM5A 3DV9A 5JNTA 1W85B 1M73E 5LA6A 3TINA 2C8VA 3DBVO 5JXIA 1QLWA 3N86A 1L1FA 3TD2A 5BN4B 4C07A 2B1JA 1RMQA 4UUMA 4WZBB 1USUA 2UAGA 1YIDA 4OIFA 3ONEA 1Z5WA 1AF7A 2V7TA 3G89A 3NALA 1YB4A 3X1KA 1G3QA 2O1XA 3E3MA 1Z5GA 4OOEA 1B8OA 4IFIA 1LPPA 4LK2A 1H8ED 3IEUA 3KJFA 4ZT7A 5IVIA 4QYIA 3X1ZA 5FBQB 1B0PA 1YHYA 2R00C 2FUG1 2PS0A 2C2KA 2JVIA 2QENA 4I81A 5H16A 4LW8A 5KOYA 2X5XA 1SD5A 3BQNB 3QTBA 4WBSA 4AY3A 6PFKA 5K6AC 3DZJA 3B7PA 4GE3A 3U5TA 2JASA 4CM7A 1NJ6A 4NPHA 1A1VA 1QNFA 3Q5EA 1Q1EA 3UOGA 2ZI5A 3KKKA 1T2FA 2C3YA 4A92A 3W5UA 4HATA 1C9NA 5FHQA 2FLVA 2VRBA 1ZRSA 2C3UA 3V8QA 2JI6A 2PQ0A 4YLGA 4CEHB 3OIUA 5PNTA 3K16A 2HQBA 3VNQA 2C92A 1SBCA 2XOKD 3UYLA 5FR2A 1KOGA 3ZXIA 2UYQA 3NRBA 4ZHSA 1AA9A 1K0UA 3WLTA 3CG4A 3H8VA 1FNCA 4NYJQ 4KPUA 3V8RA 5ILOA 1WHSB 2WHPA 1JE0A 1PJCA 2J4DA 4PBRA 5SY4A 4XB2A 3LOUA 3RB8A 4BYGA 1E1RA 3KHTA 5HIJA 5IKOA 5LQAA 3OEYA 1TTHA 3ND6A 4FINA 4CU2A 4E6PA 3KQWA 1VJ5A 5LWHA 2OG1A 4WKPA 2DF8A 1JEDA 5AW1A 1YFKA 2VJDA 2AFHA 4WZ6A 1SCJA 1PZHA 4CMGA 5ELMA 2BP7B 3JQDA 1ZM4A 4BZQA 1CEYA 2Q8NA 2R6ZA 4KQFA 4QU5A 1RI5A 4XKJA 3W04A 3LY7A 4XGKA 1HYEA 1RW4A 3K4HA 2R7NA 3R24A 4HWPA 2IDJA 2PX5A 4ZVRA 2CNBA 1G2OA 2X2PA 1G17A 4YMGA 3G6WA 4V1CA 4CIBA 1E3WB 1A71A 3UWKA 1SD1A 4KMMA 1DPGA 2CBZA 1LLQA 3R1IA 2WBLC 3SQNA 2R751 5BV0A 3ZPXA 2N47A 4FSXA 4QU0A 2H5IA 1YJXA 2Y2VA 3L0BA 1U3CA 3QU2A 2OYCA 5DHSA 5IULC 3T12A 3ET5A 2A1TS 2EEZA 3B1ZA 4CG0A 1EJ0A 4W5TA 2PJRA 1X8KA 4NOLA 4LZAA 1NZFA 3KB6A 5DN9A 3VO8A 1JDZA 1LRJA 1VECA 1VB5A 2CK3D 3ZD8A 1FFWA 3C74A 5JJ5A 3B52X 4ETNA 5LA6B 5JWRA 1OAKA 1V4VA 1AKNA 4IG4A 3IL2A 3DL4A 3IAUA 4MUIA 4OJYA 4OH7A 3SZMA 1JH8A 4DCPA 4QQKA 4CBVA 4GDFA 3PQ6A 2ZJYA 1BOOA 2HJ9A 3HVKA 4GMHA 3HJFA 1GNPA 1A7JA 5C7LO 3JTMA 5EHXA 1YQTA 3GDGA 1JHUA 1YZYA 4LTMA 5GQSA 3S2UA 1RRVA 1YRQA 4JL5A 4B2LA 4WI1A 4EDFA 1G7RA 1M6VA 1L1EA 2W6JD 3V7FA 2O23A 3U62A 3JQ9A 4TUYF 4LK3A 1R88A 1ISIA 1JAHA 1R27A 5B4UA 4LYDA 3AM4A 3BH0A 3LH5A 4I1OA 1X1EA 2C7BA 4EBFA 4ZI3A 1HDZA 2ADMA 2WZCA 2ZYVX 3FMVA 3OO0A 3BJRA 4ZOAA 4AURA 5KTKA 3K71B 1FXWF 4B84A 2VYVD 2IKSA 1JHMA 5IM5A 3NW9A 3ADDA 1TQ6A 3PICA 4RF5A 1Q21A 2IOYA 1E79A 4UTXA 3UT6A 2ZR7A 2PSEA 2VHJA 1YR3A 4A6EA 3RS4A 2QYOA 3HO6A 2Y6UA 1I3CA 3R8XA 2JCXA 4I3GA 3HUTA 5HKAA 5KNBA 3IKTA 4DFDA 1Y3CE 3FVRA 2C5AA 2HPHA 2V6JA 5BV8A 2X4IA 2QIPA 1N34B 3E0XA 5IBCA 2XZLA 2VHZA 4PY2A 4COKA 1JBKA 2OLJA 2OQ2A 2HSEA 1QRAA 2VSNA 2BMFA 2FF5A 1V48A 4QHSA 5EN4A 3ESAA 4AB1A 1ES9A 1NZJA 3SJZA 1H1LA 1TMKA 4DIMA 4LF8B 2QVXX 4KPUB 1R5BA 4DJTA 2WHPB 4S1OA 4MDFA 3F2IA 3BJIC 4JVLA 3BD6A 3ZE9A 2G9VA 5CRIA 5ICSA 5HKOA 1KP2A 1YXMA 2JDIA 4TT3D 4WWHA 5BUZA 5IDYA 1QIFA 2BHRA 2JLAA 4DJAA 2DBRA 1TGVA 3OI7A 4ZDIA 2PLFA 1QRUA 2AFHB 4QDOA 1PJZA 3HMKA 4RPHA 4A0QA 4AMBA 4D81A 2AJLI 5DVZA 5J63A 1JLHA 2FSUA 2AV6A 2XE4A 5KNDH 1YZVA 4D45A 3AINA 2QNBA 3AY0A 3DAOA 4ZCTA 3LX6A 1ZXBA 5DNWA 5EZSA 1AX9A 5F51A 3TCKA 5F23A 1Z5ZA 2UYHA 2HJVA 4MB6A 2RG1A 2ZANA 3GT3A 4FHCA 4JOQA 3INRA 4YP1A 4MRSA 4V1CB 3HKCA 1P7ZA 5KQPA 4Q9AA 3BFXA 3OIFA 3OOWA 4AZTA 2D1QA 3HJCA 1IB0A 1M2NA 4HADA 1E2QA 3OLVA 3DDHA 3OE7A 1MXFA 3UJAA 2GCGA 2H11A 3IMFA 2OC9A 4MGEA 4NEHB 4PSDA 4ZOBA 2OHHA 3VYWA 3LWBA 5ERYA 1V71A 2ZM5A 2CDAA 4KQ2A 3NAGA 1FYVA 3VR6A 4GBED 1OFIA 2D8MA 1U9IA 1D03A 1UBLS 3I42A 5IMSA 4FBGA 4ILKA 3E7XA 2B3TA 4H7IA 4BNJA 3T34A 2C9YA 5CHYA 1O0BA 4J75A 1NLFA 2GFIA 2Q9UA 3KG2A 1DNPA 3BDVA 2YYSA 4TN5A 1EX6A 2VI5A 4IMPA 3RWBA 3T4UA 2JGRA 3H99A 5CPFA 2NSDA 1ISFA 3HY4A 1N2CA 4P86A 5E4FA 5J2TF 2FSGA 5E4JA 4S1TA 5JU6A 1ZRNA 4Q3KA 4D82A 4KK4A 4QIHA 4EI8A 1ENPA 3H5WA 1MO6A 5JBIA 2VHUA 4ZT4A 3A3PA 4BKMA 1WQ3A 3A7DA 1U2RA 5JFOA 1A95A 3JV7A 1L8XA 1M6VB 4GQAA 1UQTA 1X77A 5ALMA 4MUBA 4UHHA 2HXSA 2UYYA 3Q9SA 3R23A 4KQ1A 4LMAA 2FMIA 3LT4A 4A2WA 5HW0A 2Z6VA 1J39A 2YWGA 1T9ZA 2Z5GA 5YASA 4F6LA 5L40A 3R7NA 1LDBA 1RAGA 3E9ZA 3C3WA 4JLJA 4O63O 3ULKA 2F8LA 2X22A 5CT6A 5A4FS 1VCIA 2GPTA 2P8JA 3DTNA 4XCQA 5AI4A 1PL8A 3I6IA 2JH3A 4ZRNA 5B4VA 3N8KA 1YRYE 4IMIB 2BTQA 3COWA 2XXJA 2I7XA 3ZV3A 4AJHA 2ZQYA 1ZD8A 4TYWA 1K2VN 2DCMA 2GEBA 4LY3A 4MVJA 4UCFA 3IAFA 1Y33E 2NADA 5BPHA 1K7CA 4OYLA 3CLHA 4JA2A 2IX9A 2QR2A 1ABBA 1HQDA 2RHGB 3Q1KA 4G25A 2FZVA 2JLVA 4HMOA 3WGQA 4CMHA 4HVLA 4L5YA 5FOXA 1LFAA 1WY5A 2A8YA 4MUFA 1ILEA 4UDOA 3C5EA 5C1DA 4JJEA 1FF9A 3BCSA 2ETXA 3CC8A 3CRNA 4ED9A 3A6KA 2HQSA 4NAHA 4P34A 4QDTA 2DWUA 5AW3A 3L6CA 4LJLA 1CUYA 1YIOA 4FLFA 3WS7A 1M2HA 1QS0A 1A9RA 3GJ7A 1LDGA 3NP9A 5CH8A 3D6TB 4CF3A 1GY8A 2YXLA 2N46A 3HN2A 3IKJA 4NXMB 4HGQA 4KAAA 2QD3A 1YDEA 1EHIA 2DUNA 3PWZA 3TIVA 1PZXA 4BC0A 5AM0A 2RHMA 4D6YA 1ZD4A 4X9XA 1QQTA 5F7XA 3SYNA 3LLUA 4JI2B 3RTGA 1MNAA 1QVAA 1YWGO 1CK4A 2WNHA 2VHVA 4L8YA 3GCXA 3T9FA 3S81A 3RT9A 1S2OA 3EIFA 3HKCB 3B2EA 1AK1A 3K9CA 4XB6B 5B37A 5LMCA 3MJCA 1FUEA 2HSZA 2IKQA 5A3VA 2BI8A 3KJZA 3TLZA 4HAYA 4MUJA 1G5FA 2YDYA 2P9YA 2BISA 1H2XA 2XODA 1GSOA 1MV8A 2JCBA 3QOWA 1DEKA 2O0HA 1N32B 4DYDA 1I51A 4CNBA 1IL0A 5C8XA 3HFSA 4C5CA 1EUQA 1Z2PX 3OPVA 2VNIA 4MYCA 4QRDA 2Z8YA 3KX2A 5AM5A 2PNJA 4WERA 1EG7A 5CM9C 3OEWA 3EVZA 2YJGA 4DAEA 3O94A 3UJ7A 1WX1A 1Y4DE 4IV8A 3M3DA 2CCGA 4JU8A 3A37A 1ST2A 4LDPA 3NTXA 5E2BA 2ZW9A 4B80A 4DLNA 3SN6A 1QHIA 5EHQA 1N2CB 3LRXA 1U0JA 2BM0A 1MZPA 3Q3IA 4PC3A 3CUTA 3HYTA 4RSGA 1ESEA 3PPXA 2GLUA 4DOMA 1A50B 1K7XB 4R31A 4ZAFA 3RGWS 3CQ9A 3RO7A 4LRXA 1VSUA 5HJ7A 1FX0A 1LI5A 1ZCFA 2PH3A 3ANNA 4PAGA 4RVOA 5FIUA 5TEVA 5T6MA 1DWPA 1OT3A 2WE8A 2MHCA 2AF4C 1RABA 3IR7A 4G56A 2NU8A 4RO0A 4WJKB 1QP4A 4C29A 4XFKA 1AN9A 2Z04A 2DJIA 4M53A 3THXA 4GI5A 6CHYA 1XTRA 1VFNA 4ZVPA 5LNK6 5TXGA 1P1JA 4PZUA 4PAWA 2BTQB 3K9HA 1NQAO 4D3XA 2NUBA 1W36B 2G63A 1EYZA 4OM8A 1TA4A 5KSPA 2SKCA 3MJFA 4R83A 4GU5A 2VNAA 4HK4A 2WWIA 1NMZA 3IBSA 3NUGA 3JCZA 3D4NA 4Q82A 5F9HA 2OD7A 3PLNA 3JQEA 3PQDA 4RV9A 4HNTA 4BO5A 3PT9A 1BDBA 4BO6A 1E8DA 2R0QC 4YI5A 5JCOA 3V8EA 1AUXA 3MQ4A 1N6KA 4Q9IA 2CV0A 3IODA 1Y3DE 2DYKA 3LF2A 4V0RA 1BXZA 2FSVA 3IP1A 4XJXA 1QS0B 2WUDA 4YRRA 3OT5A 5IEBA 1N6LA 1CF4A 4D9MA 4YK7A 4I1YA 5BW6B 2Z2XA 3A4LA 1YJ5A 1TA9A 2QVLA 3CWQA 4ACBA 1I1OA 1LX7A 4DIDA 4N8DA 1XMXA 1JMYA 1U7WA 1R5NA 2J0EA 3CW8X 2VDJA 1AT1A 2VYQA 3JWJA 4JU9A 4H3SA 4BQPA 4PQRA 3GW8A 1NURA 1HFEL 4D99A 4IP0A 3RARA 2JK0A 3C8HA 4NZPA 1VRCA 3DMGA 1Y1LA 4KFSA 4DDTA 5BQOA 1E6KA 1K66A 1NDQA 2BD0A 5A2QA 1ULTA 3PB3A 3D2BA 1V7CA 3B2QA 2GHQA 3QA9A 5AW5A 4W5HA 4PG6A 1N6NA 4IJVA 3T7CA 2PE5A 1UC9A 4GF5A 5BSVA 1OLXB 1JFLA 3ORFA 3W6NA 4FYKA 1VA4A 1X19A 1NFRA 1AGRA 3HA5A 4O0MA 4J3NA 3ZHXA 2B69A 4XWYA 3K92A 3SSAA 5FO0A 3I0ZA 3A1NA 2DKOA 2LRHA 2PRKA 3VHQA 1RMYA 4I4NA 4TGLA 1S5PA 2HR1A 1JL3A 3E81A 3ZG6A 2ZJ5A 3AF2A 4KN5A 1KI9A 5JY1A 3UBMA 3B3QA 4ZXPA 5J1SB 3WYEA 1DKMA 4V39A 5I9TA 1CR1A 1ZEMA 2G25A 4AICA 2GKOA 3VH3A 1P5JA 2Q8PA 1FX0B 3NEJA 1J2EA 1RCUA 1WW3A 5EZ5A 2XCQA 5U4XA 2NU8B 5IM4F 1WO8A 3IDQA 3N5CA 4XVQA 1JZSA 3THXB 2OBYA 1KH3A 1MH1A 3IGFA 5IAEA 4II7A 3MYRA 3OC6A 5AI0A 4LSGA 1E5LA 1NAHA 2YMQA 2Z3WA 2GZRA 5FPQA 2YJ6A 1TPYA 4A6PA 3X1JA 2A84A 2XDAA 1K6XA 3TTWA 3WKBA 2XBLA 4AG3A 1DKLA 2Y4NA 4JXXA 3EULA 3KWFA 4RE5A 4IIDA 1SY7A 4L95C 2BTOA 3K5IA 1QU3A 3BTSA 4AJ4A 2C0QA 3A7EA 4GWLA 2MSEB 1YQWA 3L7LA 2I3BA 3BWDD 3PUHA 4M0FA 3VO2A 5M7EA 1IJEA 2O3QA 1HQKA 4FS3A 1O77A 1QB7A 2IUEA 3C3AA 1EE2A 1NMXA 1UXJA 5IXJA 4BJ6A 1VKHA 3WWPA 2C5FA 1XCGB 5EL0A 2BBWA 4HO1X 5KIAA 2RB4A 3OCXA 3TG8A 2NZWA 1PI3A 3UW1A 4QBIA 1E9VA 1EI9A 2O2EA 2WFAA 3R5FA 4PCAA 4AX8A 3FOCA 1Z2EA 1JDSA 2CXQA 3TNDA 4D97A 2IHBA 2VN8A 2CJWA 4DCJA 1M7GA 4N48A 2GUWA 3CV3A 1QTNA 1CIVA 4NPAA 4RXTA 1ZC4A 2P3SA 4EW1A 2OORC 2WP0A 4CMIA 1NV8A 4ENRA 1OF1A 4EM6A 5CDGA 4R54A 5SZIA 3RQSA 2I2AA 5CVUA 1SU8A 3D1LA 1BMFA 2Q07A 3DTVD 3KD3A 4Z8XA 1E20A 3H87A 1D9XA 4ZV4A 1F2TB 1QH9A 1EVJA 3FKSD 1BW9A 1UT8A 2PX2A 2V6FA 2XMCA 3EVGA 1F9AA 3G3EA 1WD7A 4FDAA 4MICA 5DTJA 5HZMA 1G291 3UWSA 2X9LA 1U1IA 1U7XA 3I8SA 3NB0A 3T9CA 3GJSA 1V3TA 5DXJA 1U3VA 2ZUDA 4DSOA 1USKA 3W0LB 4NEQA 5DMHA 1A9QA 4NULA 1L4GA 1N1EA 1XD2A 1C7QA 1L3BA 2CYCA 2PT9A 4AUNA 5A4AA 3HJTA 5AIBA 5BUQA 3LV8A 1KFBB 4M0DA 3EEQA 3SVZA 2QN6A 4S0XA 4HC4A 4R1NA 1WR8A 4MV6A 1VMKA 1NDUA 4BBJA 4GOLD 1QGUA 3T1OA 3IP6A 2CVOA 2QLJA 5AM2A 3OUZA 4RKFA 5CNIA 1ZGZA 2NNLD 3OEEA 5D5PA 3V1NA 2EG5A 3WK4A 3NG1A 2QIOA 4DCNA 5A04A