2M6KA

Solution structure of the escherichia coli apo ferric enterobactin binding protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
292
structure length
292
Chain Sequence
ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure, binding properties, and dynamics of the bacterial siderophore-binding protein FepB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrienterobactin-binding periplasmic protein
total genus 50
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA02
4HMQA 4OXRA 4WZAA 2AFIA 3TLKA 4INPA 3PSHA 4WN9A 5JPDA 5HDQA 4ND8B 3AERA 4TKVA 1QH8A 2RG7A 4G07A 4NNPA 3ZK7A 2AFIB 1N2CB 5GGXA 2PRSA 5KHLB 1FP4A 5AFSA 1XVLA 3HXPA 1N4AA 4DBLE 3MINB 3AESB 4WZBA 4H0FA 4FILA 1N2CA 4TKVB 1K7SN 2XY4A 3K1AB 1QGUB 1G20A 3HH8A 4LS3A 1QH1B 3EIWA 1M34A 4LJSA 4MLZA 1N4DA 4NNOA 4GICA 4WZBB 2R7AA 1G20B 1QH1A 1TOAA 4G09A 5CR9A 4INOA 1N2ZA 4K3VA 2OV1A 3MINA 1L5HA 5M29A 1K75A 2MINA 3AEQA 3K1AA 5FLYA 1QGUA 2XQVA 4OVKA 2AFHA 2PHZA 1KAEA 4H59A 1M34B 3AETA 1L5HB 3MWFA 2XDQB 5KOJA 5M2QA 2MINB 3AEQB 5CX1B 3R5SA 3UJPA 1M1YA 2AFHB 3TNYA 4UTPA 2XDQA 2M6KA 5KOJB 2Q8QA 4IRMA 3TEFA 3ZK9A 2R79A 1M1YB 1H1LA 5I4KA 5BVHA 3EIXA 5HX7A 4TKUA 1ESZA 2OV3A 3AETB 5BVGB 4CL2A 5CX1A 1EFDN 1G21B 5BVHB 2QI9F 3LHSA 1MIOA 4WESB 3NU1A 4MO9A 3AEKB 3GI1A 3PSAA 4PAGA 4PM4A 4TKUB 4UTOA 2PS9A 2XV1A 4M7OA 4UDOA 2PS0A 1K2VN 1M1NA 3MWGA 4OXQA 4XPIA 4UDNA 4MX8A 3U7QB 1MIOB 1H1LB 2PS3A 2OSVA 5JOQA 3ZKAA 3ZK8A 3AEUB 4XPIB 2OGWA 5BVGA 2WI8A 2ETVA 1G21A 2Q8PA 4FI3F 3LI2A 1K0FA 1KARA 4WESA 3AEKA 2XH8A 3ZTTA 3AEUA 2O1EA 4MDYA 1M1NB 3PDIB 5JG7A 4B8YA 3HJTA 4WNAA 2YNMD 3CX3A 3U7QA 5KOHB 3G9QA 3BE6A 3MD9A 2X4LA 4HMPA 2WHYA 4FNAA 4WNAB 5B58T 4WZAB 2XUZA 3R5TA 5GGYA 4WN9B 5M34A 4HN9A 4HMOA 1QH8B 3MFQA 3PDIA 4FKMA 4BBPA 2M6LA 1KAHA 1PSZA 1FP4B 5KOHA 2YNMC 4N01A 3AESA 5M3BA 5JJ5A 1PQ4A 3BE5A 4ND8A 3AERB
chains in the Genus database with same CATH superfamily
1G3IA 3CUWA 2B6NA 1FU7A 3B3JA 4JLSA 1NLFA 1KI4A 1NDQA 2ZSJA 5CVJA 3O1HB 1ZH4A 1Y6QA 2QVXX 4NNPA 4ZDIA 5LU8A 5AOAA 3NHKA 3O9VA 3V8BA 4MVJH 1UIRA 3CR3C 2WQZA 3QK7A 1J21A 2ZRMA 3M4JA 5HF6A 1Y7PA 2I7CA 3H5NA 3KLPX 2BR5A 3HABA 4ER7A 3JW8A 2HSGA 4TKZA 1WQ1R 2OCYC 4PU0A 2NTYC 1L7NA 3CUVA 5B7NA 1Q3HA 4YAWA 2R1TB 1R5JA 4EMTA 4MS4B 4QYIA 5TGDA 1MAHA 5ILQA 4BAZA 3N2IA 3I61A 3DC2A 3CKLA 2BP7A 4BO5A 3TCNA 1I4WA 4RTLA 2M9MA 1LKZA 4LDAA 1R8XA 3AM3A 4B6FA 4DR6B 1C7RA 1UKAA 2QTGA 5CLFA 1Q14A 4RV9A 5DISB 4H6XA 4XOUA 3GBVA 1EKXA 4IMRA 4BQFA 1K5HA 4GMGA 1RAEA 4B84A 1N75A 3B1YA 4RM3A 4GI3A 5F35A 2PYZA 3R5SA 2PGJA 3DAHA 4O4JB 5GONA 3QI7A 3WNCA 5BXYA 3JSXA 1XTJA 4L16A 2OFPA 5LQCA 4F4IA 4NFSA 3L7CA 3KQLA 4YT4A 5AI4A 3EGDA 1WXEA 1TCCA 2QPAA 2V7BA 3FPCA 4LISA 4MV9A 3MA0A 3EVFA 1PJ4A 4Z49A 1VRWA 5BN4A 1C7IA 2AIRA 3OCJA 5HEKA 3COJA 3OA2A 4CMEA 3SZLA 3CWCA 5I7OA 4O59O 1E2LA 3RRBA 3VC7A 1XCPA 3I5MA 3CO0S 3ORHA 2OVFA 1KZ6A 3NHYA 4RELA 2QMQA 2XBMA 2V5VA 2BFDA 1OKKD 3HJHA 3HZRA 4XVUA 1GSIA 3U49A 3K5HA 1N6HA 4V3BA 3OVMA 4ZOBA 4AMZA 2Y68A 1R6XA 3JWHA 1EX9A 2ODQA 2ZB7A 4HGNA 3IIKA 5CLHA 2O07A 4ZD6A 3RVNA 2TRSB 4KV9A 2PSJA 3ELDA 4LYJA 4I1RA 2C42A 2Z6VA 1NTOA 2R2AA 4GZLA 3WJAA 3M6UA 1MKYA 1V8DA 3KTAB 3E7WA 3O0DA 5E9JA 2CHVA 5CTAA 4AWXA 4XVRA 4LDNA 3ZIAD 3FOEC 2B1GA 3KOZA 4HB0A 3MJRA 4BJ6A 5CDSA 1CB7A 1XPRA 5BUCA 1UJ4A 2J46A 3PDIB 3ZJYA 1P74A 3MJTA 4IJWA 2JZOA 3D8HA 5F1KA 4CR8A 1TZ2A 4Q39A 1SU4A 4B0PA 3S2SA 3BX1A 1M8GA 4LK2A 1BS1A 4R2JA 3K09A 3EGCA 5E9AA 2D5BA 1FRQA 3HJFA 4ADSG 4XD7D 3UBMA 4E09A 4RULA 4P3XA 2JFPA 1OA0A 4UAVA 5HSGA 5IRCD 5C37A 5EYPB 3JQQA 1NXPA 3WZLA 2RHHA 3NIFB 2G1AA 1GLGA 3JQDA 1AO3A 1UINA 1XEFA 2G1UA 4QGFA 1SQFA 1Q1NA 1Q2XA 3VR5A 4HTFA 4MQ6A 2FPLA 2C4UA 3ZXXA 4QVIA 2O23A 4JBLA 4CF3A 1PZMA 1E79D 4KFTA 3SSAA 1VKHA 2E18A 3WJ2A 1PWXA 4XIYA 5L3QB 3K9WA 1CZNA 4FC6A 1GQRA 1RVDA 2W48A 1Q83A 1PL8A 3V8EA 3H5TA 2FMIA 4YV1A 4FONA 5L6MB 3GVHA 1LY1A 1ELOA 5IKMA 3Q3GE 1T0PA 3K2EA 3WRXA 1NHWA 2RHRA 4ZEMA 4BATA 5K0TA 3V7FA 1NFFA 1KWGA 4LF5B 4XR4A 5HBRA 2H4XA 3BM5A 2C5EA 4C6RA 1X9IA 2BSAA 3DZDA 4NFLA 3G5MA 4CL3A 3SE7A 2VJMA 2HDNB 2AGVA 3F3KA 4BJ5A 3LJKA 3MELA 3PQCA 1GDDA 4BB0A 2IXTA 2YXPX 1GG9A 4BFWA 3EDRA 3G1TA 1IY8A 5BOVA 4JEUA 2BEJA 1V8ZA 4PSUA 5TQ0B 5CDFE 4XUDA 3VH4A 3GWGA 1LVUA 3G2OA 3KYJB 2WUVA 3OPYI 1SXJE 1EVEA 4Q3EA 2EJTA 2YZ7A 5AO9A 5CFNA 4NOMA 2O4CA 2JKZA 3FLEA 3WOHA 1JE0A 1CKEA 1Z4KA 3PNOA 4Z3OA 4HH0A 4NENB 1GTJ1 4PYQA 3VVMA 4X61A 1M7BA 1X0XA 1XRRA 3PHLA 4NX2A 2P5TB 3ZGXA 1MRZA 1P0PA 1SOVA 2RK4A 5E9WA 4MWDA 3ZWPA 1YCHA 3Q15C 2Y1EA 3EC2A 1V1RA 3GFGA 3NHZA 4TL8A 2QJRA 4MQ5A 4G56A 1A71A 1OA1A 1R0ZA 3KLNA 2Q8QA 3NHUA 4KQJA 3U3DA 5I4CA 2R79A 5BPHA 3RR2A 3EODA 4IXMA 3U3JA 4QX6A 4UM7A 1AQNA 1Z4PX 4WNCA 1W4CA 1MQAA 2GTIA 2P5UA 1J99A 1OLXB 2NUTB 3AXSA 3EWSA 4MI9A 3V4VB 3WQSB 1QU3A 2IC5A 1TTTA 1AUOA 3HNRA 4DANA 2OL4A 3E7XA 2HMAA 1HETA 3UKDA 3IT1A 1QQ6A 2VTDA 2Z1DA 4UHKA 4S05A 4PY2A 1FNDA 1UBLS 5FWXA 4RTSA 5DTQA 3WLMA 5LLTA 4QTTB 4FYXA 4JP8A 1RWWA 2G4LA 2H2IA 4XXHA 3QU5A 4FP9A 3JASB 1IE3A 3WAJA 2EW8A 2O1SA 4H18A 3ZQJA 3NEAA 5IT0A 3PGA1 2WI8A 1K4KA 4MWBA 2CEKA 1L5LA 1Z2OX 3VGPA 5IZCC 3LH5A 3ZE0B 2H57A 5K9ZA 1BN6A 3SIXA 4EA8A 4G8CA 5CT8A 1GTMA 5C8YF 1S2NA 5KYKA 3U4HA 2D8AA 1SD5A 2DVMA 2WSYB 4IJ5A 4ITVA 4OAOA 4CFSA 2P2NA 3ROKA 1Y8ZA 1A1VA 2VUSA 2LE0A 3IE2A 1BQ3A 4GW3A 2FWNA 3HB9A 4NDAA 4IXNA 2GO7A 4BGEA 5JNVA 3IJEB 4E1AA 3VHQA 4UMDA 3FUWA 3ZDRA 4B7AA 1IDOA 1T0JB 3B82A 3TSZA 2BHSA 2H5JA 1SO8A 3QW2A 2XLBA 1OQAA 4HO1X 3EXHB 1YA4A 2FEAA 4ZVUA 4EECA 1CP2A 5K2OA 1IXYA 3DCJA 2AR9A 3WIEA 2BGNA 5EEGA 1GD1O 2Z0MA 4CKWB 1E7SA 1HPLA 3NBYC 3QTLA 4AF7A 1BDHA 4DHEA 3GGOA 4INZA 5EPUA 5HZGA 1J24A 2RGDA 3ZLUA 1G2OA 4TUYF 1B26A 1JWBB 1DG1G 2ZPAA 2OXCA 2PX0A 3E5HA 3IQIX 2H7YA 2XAAA 1M8JA 2A92A 3AERA 1PT8A 2D6FA 1VIDA 4Z51A 3T7CA 1ADFA 1FDUA 4HWOA 4OQ4A 5FBLB 3O8BA 3A9VA 1ZQ9A 3AG5A 3ROXA 1DT5A 1C9YA 1SRRA 3TLAA 3JYPA 2GPNA 4Q3AA 2H4WA 2PRKA 4ISCA 1WSAA 1VTKA 2D7JA 1KP2A 2O6LA 4WINA 1O95A 2QUBA 3KKOA 4EMUA 1P33A 4B8WA 1W87A 4OYYA 4O4JA 2RIPA 4IO1A 3SS8A 5LDDC 3Q1LA 2VLIA 4F1WA 3SQMA 1JHZA 1KEPA 5CB4F 4U00A 2EOAA 1VOTA 2OV1A 2PV0A 1BWQA 1YKFA 1AG9A 2AHRA 3SHTA 3Q6IA 3K6SB 2P9JA 1OASA 2Z1NA 3HXQA 5KJEA 4YYZA 3SVTA 1Z0JA 1X7XB 3HEBA 5FADA 2OCIA 3E9NA 4EA6A 3MHPA 3ONWA 3LTNC 3VAAA 3O5AA 1V41E 2DPYA 3RVSA 1CY0A 4CF4A 1ESNA 1E32A 1OGYA 1VZ3A 4BTEA 4KR2A 1SHUX 5FWDA 1K8RA 4NH4A 1IOWA 3QKSB 5I9BA 1C2YA 1C8KA 2X6QA 3OM8A 4MPPA 3USES 4Q7EA 2ZJ4A 2W42A 1VHQA 5BSRA 1EDBA 1O97C 2OV3A 2QAJA 5TEVA 1EVKA 2JBWA 3VC3A 4S0XA 1QDUA 1KYIA 2CEAA 2WWFA 4L4SA 3PGJA 3CX8A 1P31A 4LOIA 2DFNA 2XUHA 3UOAB 2JDIA 4PRKA 2IX9A 2QJWA 1HQCA 2MSWA 1KP3A 3DBRB 4OFZA 1JV2B 4ZPJA 3DXFA 3U13A 1GO2A 4CKXA 3KJHA 2HMTA 4MX8A 4M1WA 4FHZA 4GKBA 3CEMA 2VYNA 1CZKA 2IUTA 2P11A 4YX9A 4J0DA 3EZ6A 1G7CA 2IFTA 4R1NA 1RMQA 4DADA 3OE7A 3OZEA 5IASA 2PSEA 3B53X 4WESA 1XPUA 2J0UA 5B1HA 3AWIA 3LMKA 3QKIA 2X5OA 3AF1A 5JJLA 2NACA 4LX0A 3SHQA 4P0TA 1NZJA 2DF8A 5H81A 3TVDA 3AI3A 1HDYA 4CN9A 5LD2C 1LRKA 5HS6A 5LDGA 2PEYA 4WBSA 4A8JA 2A9QA 4F1KA 2V54A 4S3MA 4BNUA 1N0WA 2OENG 4EO9A 1BHSA 5LOVF 4M60A 4PZAA 4OEHA 4P2GA 4EGCB 2WR8A 4BNZA 2C8VA 3LFUA 4A4DA 3BTUA 1M2VB 3PA8A 3CVJA 2H1SA 2HSEA 5G2OA 2C9YA 2YUIA 1B15A 4K9SA 4DSNA 1HGXA 2GBGA 3AUJB 1YB2A 3LHFA 4KK4A 4NBNA 4OGFA 4RPLA 3I2KA 1B0ZA 4RPHA 3DHVA 1TM1E 1UFRA 1AX9A 1YACA 4RLHA 3GBPA 1OOEA 3ZOKA 4E33A 5JT1A 3JYHA 3OY2A 4AN1A 2ZBFA 4ND8B 2VYVD 3F78A 4CF6A 4FYWA 4KR6A 2FG7C 1I33A 3C6KA 1EFPA 3AV3A 3LBFA 4HH4A 1RYZA 2VEDA 4TRRA 4EVIA 3PNLA 1QYCA 2YFYA 3D4OA 3VKUA 1WCV1 3ZBTA 2WG2A 3KT8A 3A10A 2REXB 2J1LA 4KG7A 5E1MA 2BM0A 1K2WA 3IMCA 3SS9X 3BH7A 1IATA 3WWZA 1LX7A 1YGYA 3RFUA 1NF9A 4JQCA 3ADOA 4BVFA 4DMRA 4OF4A 1OZ0A 1QTQA 3VU8A 3G1UA 5KNLA 2DBVO 1PR3A 1IHPA 4L6CA 2Y76A 1MB0A 1RKXA 1V1RB 2Q62A 4I4LA 2N0SA 4PO3X 4Q7KA 4ZDKA 1SG6A 3BJRA 3NCHA 1NL3A 1UK9A 2WUGA 1IY1A 1YHNA 4LXXA 4F11A 2PT5A 3OZBA 3SJUA 4JMLA 1SXGA 4ARZA 1S3SA 2YZMA 2ZJBA 3CPSA 2DWQA 2ZXUA 4J6EA 1ECGA 1R27A 4KQCA 5CBKA 5L3SB 2O7QA 1XZFA 1DEHA 1BS9A 3H1EA 4P4SA 4R9RA 2P30A 2KBFA 1VXOA 2FWJA 2C57A 4GM1A 4EENA 5KAMA 1NT2A 1PQPA 2ZULA 5MF6A 4LE1A 4ZI3A 2AMJA 2HV8A 3KQKA 1Z4MA 1ADJA 2E4AA 3NOVA 3TFQA 5CFMA 4Q7JB 2FFRA 1IY2A 3SHFA 4B82A 3F6EX 1IC6A 221PA 2GNAA 1E9CA 3PHHA 4TYPA 5KWIA 4DV4B 1E3MA 2MSCB 4BY9E 2GCOB 5CXSA 1MMFB 2GD2A 3JQ8B 3RWBA 9ABPA 4IHJB 1DGQA 1FSPA 1UMKA 3UPDA 3HC7A 4PFJA 5AKYA 2XVAA 4Q1AA 1VBMA 1T3TA 3UZUA 2QROA 1CUXA 3K70B 2D2FA 3GEHA 3UTCA 2MJLA 1V7CA 4PN7A 1UEJA 2CMHA 4HNRA 3KZCA 4UPVA 4UTNA 3B1JA 4OHFA 1VRVA 4O4IF 3E27A 4R8VA 5A62A 3CBQA 1JSCA 2ZIGA 4BHTA 1XQXA 2IODA 5IW8A 3FA2A 2C0PA 2P5SA 3ZDFA 4YNBA 1T13A 1JQLB 4Q9DA 4C7BA 1H05A 1DBQA 2PUAA 3IPYA 1R64A 3TQOA 5F98A 1SQGA 1KARA 2JI9A 4HH3C 3HNOA 2WWRA 3FG9A 4WQMA 3ROQA 2HRQA 3ZZUA 1AK9A 5IDXA 3I3OA 2QR5A 3DMYA 1E0KA 5ES3A 4P81A 2NPOA 1P6XA 3NVMB 1BO6A 2JFYA 4JLUA 5AP9A 3EPJA 1MAWA 1QYDA 3ZPXA 4NYMR 3TRIA 1RYYA 1W5SA 2PS1A 4C7OB 3TQRA 1Z74A 5EFZA 1DARA 1BKYA 2JGIA 4AUNA 1S1MA 1M2HA 4JI1B 3QMPA 1J1IA 2DPXA 4OUKX 1GRNA 5FORA 4EJSC 2I1VB 3ESAA 4CIBA 1OXBB 3JQFC 4K6GA 4ZT6A 1SZDA 2LKDA 3ICCA 1X7DA 4J1TA 4F3CA 3BRSA 1F7VA 2PKXA 4BFTA 4HLDA 4MRPA 1IRXA 4NY1A 2OXFA 3A6EA 2R6GA 3BJZA 3G88A 3GDOA 4XAQA 4D2IA 3JAKA 4YALA 3RSHA 5IHXA 4MYCA 3OIFA 2HDHA 2PGAA 4FGSA 2VSYA 2X5XA 2J4DA 1R5NA 1Z7YA 1KC1A 4K9DA 2ZIUB 4OQXA 5HJEA 3GQBA 3I83A 3LA8A 1ZMOA 2ZKLA 3AHCA 5JD3A 2ZAMA 5J59A 3RS3A 4G41A 2C4MA 4QOFA 4AJ2A 2J0QA 4ILKA 4HP8A 4MKRA 4PLCA 3WAGA 1LV7A 2JA2A 4OB8A 1N0IA 2CDCA 9ATCA 5KS2A 1RWMA 4DDHA 3DD5A 3G5TA 2ROQA 3H3XA 4KYIB 4QL3A 3SAJA 4HB3A 3T5AA 1DBIA 1KOLA 5FFMA 4LJ8A 4JSTA 4GEGA 3ZW7A 2K7ZA 4EPXA 3NIDB 5HF8A 1H8HA 1ZUIA 1BVRA 1APBA 1U8XX 1OUMA 3MGGA 2P2SA 5HRCA 3LY8A 3OF2A 1PT9A 2B20A 2V7TA 4JASB 1J56A 1FU4A 4MW1A 3IA2A 4LZNA 2JHFA 3GT3A 4U9UA 5CP8A 5JWHA 3TAUA 3OQIA 2I2FA 3WLRA 1MOQA 4HV4A 2HA0A 2HHCA 4IXDA 1FP6A 5D3MA 3U44A 1Z0SA 2O7NA 4Q1DA 5JD5A 2A4KA 1QDLB 1RTKA 2YVLA 3G2IA 4JUFA 1P9OA 2Q7DA 2XYGA 1XG5A 2LW7A 4EEKA 4FR5A 3LO8A 4MHOA 4R9UC 1TCBA 1YC5A 2XEDA 2Q4EA 4YLEA 5EMJA 2K6GA 1L5SA 1RJFA 3LQYA 4RHUA 1G5QA 1UZAA 1AZWA 3MOIA 4OU4A 1XLTA 2GLTA 5JZVA 5IAOA 3DXYA 3KQOA 4HX5A 4J76A 4DQLA 2GAJA 3F9CA 2WF6A 2VJOA 1V45E 1A69A 5K3AA 4V1CA 1U2GA 2EKQA 1Z5GA 4F2WA 5AUOB 1SQSA 4MKIA 2WVJA 3Q3CA 1A9QA 1H2ZA 3LIPA 1K97A 4Y1GA 3T7AA 3VMMA 5KMGB 2QSJA 2HT1A 1TMOA 4MV6A 4GBED 4M8KA 3R3ZA 5DK4A 1XNHA 3SZ3A 4I4CA 5DLDA 4BQPA 2V1UA 1JR4A 2VWQA 1ZRHA 2WTAA 4GX5A 1HDCA 3LY5A 2H0AA 3PRYA 2PR7A 1Y33E 4OJMX 5IC5A 2PMDA 4ZJZA 2XWPA 3NMUF 4UU7A 1K5GA 1KRWA 1DKLA 2CVOA 2FGJA 4AC9A 4HUQB 2VUTA 3WL6A 4J7XA 3HUDA 4MVJF 2WC1A 3JASA 1EUDB 3MBKA 1KIMA 4FI3F 4MTLA 2NO9A 5CYGA 3JVEA 3CCBA 4HWGA 4O4JF 2Z2ZA 3CF0A 2QSUA 5D3KA 3L8FA 1DOZA 4JLPA 3W2FA 2O1EA 3A6GA 4BQNA 1MQSA 4DV3B 2FPGA 2YS6A 5I9TA 2CE7A 2GPAA 5JNRA 3ZJ4A 2QT1A 4R16A 1WVGA 1GTVA 3G5AA 3GRFA 4JB2A 2WIAA 1U0BB 4HYTA 3IQWA 1D09A 5JY6A 5KYYB 1CXZA 5ALEA 1QG6A 1FRFS 4L8VA 2PH3A 1R2QA 1E7MA 2C9MA 1GQQA 3QMMA 1G7SA 1NZFA 1E9FA 1C8VB 1NI4B 1R4MB 3TFWA 1M1XB 4W1SA 3A1EA 4BNHA 4JB8A 4ZAFA 2WWXA 1WKCA 2P6PA 1E92A 1YZKA 1SCAA 2OM6A 3I0ZA 4DAOA 5EJ5A 1YS6A 4R4JA 4MVJE 2QS9A 3N05A 3B20A 2ZUFA 1RP7A 4B7XA 1UL1X 2COKA 2AFIA 1UBRS 4HQKA 2QPTA 2W5UA 1Z7EA 2XUPA 3ECAA 3EC7A 3GG9A 1SCUA 4HXYA 1L7PA 3VSDA 1QC5B 1DX9A 2O6HA 5CFOA 5HGXA 1FXUA 2A7XA 4LJ6A 3VJRA 2LPMA 2NOAA 5KVAA 4JJFA 3PUWA 1REQA 4XSVA 2VK1A 1QLJA 2RGNA 1DBWA 2OBMA 1GL9B 2G25A 1NBAA 3M5DA 2ACVA 4LYHA 5BW8A 3RIGA 2H9YA 3HCNA 1O96A 1YAJA 5JS1A 4GZ5A 1NOJA 4I08A 3K1AB 4MQLA 2HA4A 2PH5A 3PT5A 4N3GA 5JCJA 5CD1A 5DM0A 4W9MC 2EX1A 4MIKA 1OLUA 3PFIA 3UKJA 3A4VA 1DEKA 2JAHA 4MQMA 1CDDA 1F1JA 4GKAA 2AN5A 3RM3A 2J7PA 5EIBC 5J3JA 4CV1A 1QTNA 1I2ZA 5EQTA 5G0VA 2QN3A 1OH7A 3JZIA 4I1YA 2YRFA 2MU1A 5IEJA 1T5LA 1KSGA 2GN8A 4PLPA 3E3OA 1CIJA 4QQ8A 2YMPA 1C7QA 1V39A 4OATA 2P3SA 5AICA 4RY2A 2XX3A 4RLSA 4ZOQI 3FVVA 2IHUA 4GOOD 3KEMA 1Z88A 1G1MA 2YICA 1WTCA 3EVZA 4FLFA 4MCHA 4P83A 4WCFC 4JLWA 3R9KA 3WBKA 5I9LA 1PFQA 3KQHA 5K3BA 3AM1A 3HDJA 4I9HA 1QH9A 2D8MA 4WLFA 1H2XA 4RKRA 3T0IA 1C3JA 1BE0A 1A72A 2A57A 2PPVA 4IHQA 4J94A 5DT2A 1MB3A 4D8XA 2HLNA 2JBHA 3B3GA 5C4MA 1DUIA 4UEKA 2CLMB 1KMQA 2ZVPX 2PWBA 1ZLXA 1V37A 3HDYA 3LPCA 4K26A 1Z4NA 3TSOA 2NVWA 2ZEJA 5KNBD 4OQYA 3LZCA 3Q5GA 4KE6A 1TLLA 1OLOA 1EFDN 2A1IA 2AUTA 3L01A 4IF4A 5DBIA 4CDMA 4ZYVA 1ZISA 2QY9A 5DSXA 3VSAA 3VFDA 1XXHA 3KCQA 3E4CA 4XQ0A 4QLBA 5GJCA 3ZHUA 4C07A 1XDSA 1AXRA 1H1DA 4ENWA 2YDYA 2C88A 1FP7A 4NQZA 4KIUA 3A9CA 3A58B 4E30A 1QV7A 1P72A 1GL7A 4RK7A 2HTFA 5IAJA 4F5YA 2YXLA 2N1BA 2WZQA 1H8HD 1IVSA 1YK0A 3PV0A 4WEOA 4YN3A 4QBFA 3WIOA 4COOA 3KKZA 1TQDA 4AJEA 2HUNA 3R7LA 1YA8A 2Y92A 2J67A 1ODIA 4MV8A 1QKKA 3IULA 3GMTA 3QOFA 3ET4A 1YQEA 4LY3A 5I47A 3OQPA 3VHRA 1PK8A 1H5NA 5JASA 1T35A 4F6CA 1PVOA 5ALHA 5F33A 1Y3CE 1Q1QA 3R4VA 4U2FA 5HIKA 5JSFA 4MUHA 4OFWA 1MG0A 1T3HA 4FFSA 4L5IA 3NAZA 3H0KA 3JAKB 2PT9A 4OHZA 2IEZA 4UHCA 1O4WA 3OMLA 1UUFA 3EXEB 1ZSNA 2H9IA 3DF7A 1UJ2A 1ZHFA 1QH8B 3D59A 3GFRA 4Z1MA 2E4YA 3UQZA 1ISJA 2JAOA 1COWA 2FMUA 5FTMA 2GBFA 2PGDA 4BUCA 1OLSA 3U3RA 1J1UA 1E69A 4EJ0A 1BGVA 3Q72A 5CCXA 1H5UA 3OX3A 2NU6B 3W8RA 3G2NA 4BUJA 5GONF 4GL4A 1EUCB 4ER3A 1R7RA 3Q2IA 5LZ2A 2WICA 3DEJA 2Q4TA 5C8VA 3ZUPA 4KZPA 1M6YA 4YPOA 3Q1KA 3RS0A 4NATA 3NANA 1D4ZA 4AMBA 3SF8B 4QJ4A 5DTRA 5GGXA 3W5VA 5AVYA 2F4VB 2DHQA 1E1RA 2OZLA 5JHGB 4HDAA 1S9HA 2XCTB 3OCWA 3EPHA 4YQFA 4DXAA 1CR6A 1H1TA 1UFQA 3EXG2 1I0LA 1F06A 5FL7D 2G63A 4MWOA 3T35A 3R9XB 5EG5A 3GRZA 3UM9A 4NU6A 3AP2A 2WWHA 3G8BA 4B3HA 5LU9A 2JJ1A 4EZEA 4FX5A 5ALJA 5CG2A 3BGVA 2XRYA 5HFNA 2BKLA 3IB3A 1O94D 2HO4A 3ESYA 3LXRA 4UTVA 4WK4B 2PH1A 1S89A 5J5CA 1D7OA 3UJHA 2GZSA 4IO0A 1XDDA 1SBQA 5DNDA 1TU0A 4L2IB 4ENUA 1L4KA 2NUAB 4G1FA 3CPEA 2ZYVX 2GEVA 1GPMA 2BLLA 4W7SA 4G4IA 4K6MA 1N6OA 3F49S 1DO8A 1V3TA 3VZPA 2Z58A 3ODPA 3ASYA 4DC0A 3D6AA 4RH1A 1MTOA 4MV0A 1U4SA 4OI2A 3AGQA 4Q34A 3JQ6A 3C39A 3O21A 3OETA 5A06A 5JZBA 5CXXA 1M72A 2ZSUA 3PPWA 3R5KA 3BIJA 4WLNA 1HDXA 2WZDA 2PBFA 4UTPA 4C2TA 1R1DA 4A5SA 5LYJF 3H11B 2C78A 1QZUA 3G2HA 1WUHS 2OQVA 3IKVA 1MO4A 2EHJA 3GD7A 5K45A 4KREA 3NC1C 4QUEA 4EK9A 5BUZA 1NUHA 4L85A 5BVHA 1H4VB 2PUGA 3ESDA 3CEJA 1BA2A 2P4EA 3CSDA 3KEQA 4BP3A 3O7MA 5SICE 2GJSA 4YUWA 5I01A 5BPFA 3L8DA 2EQ5A 2DWUA 4PZEA 4C5BA 1SVUA 2I0FA 4NCAA 4JGBA 2NT4A 1PFUA 4UTXA 4JSRA 1E5LA 1XE3A 3FCOA 3E5MA 1EGAA 4G9BA 5GV8A 4ENRA 3ISTA 3NJ8A 4RMHA 3C6YA 2O7RA 4G1CA 4LFAB 3KPUA 5CCDA 2Q7OE 1MAUA 2QLFA 3FETA 5LA6A 3ZVMA 1Z6TA 3G2QA 3SDBA 4A7PA 2P9TA 2WJGA 4I81A 4N49A 1ZSYA 4BNYA 3I52A 1PF7E 2FPWA 4WECA 1L4BA 3SQDA 4PGMA 1B3BA 3NTUA 1QWSA 4F4UA 4Z9FA 1DZIA 4WXHA 4QOSA 2GS9A 3BE8A 4R05A 1VJGA 2AT1A 2Q5EA 4N5DA 4MUXA 3KO8A 4CMEC 4BB9A 1JMYA 2ZYSA 1FOEB 2B8JA 2QT9A 3HZOA 3TR0A 3UW3A 5BNIA 4QXRA 1TTPB 1G21E 3JALA 4K2AA 1JHUA 3E8MA 1U3FA 2AC4A 2P0AA 3EWAA 1NUSA 3IBGA 1QHNA 4FCCA 2BTQA 5ED0A 3WO0A 4F8YA 5LNK6 1IBMB 2YVQA 2UXBB 1SCUB 4C1BA 1QC5A 3OAAD 5LBIA 3ZVRA 5EIXA 3VU9B 4GMDA 1NBME 3HDTA 4E5YA 4UHJA 4BBPA 1HKUA 2NWQA 1VLLA 3SHVA 3FZQA 1Z6GA 2G71A 2P75A 4PZPA 4NFYA 5K3CA 5C4GB 1QFYA 3RQIA 3S1AA 3T5GA 2M1XA 5U4QA 5IJAA 2CDNA 2Z95A 1N0HA 1A9TA 1XA3A 3IDFA 5HE8A 3S8MA 4CIDA 5JJ5A 5JXHA 1OX4B 1ZOOA 3R7AA 5CT6A 4CKYA 1CQIA 4EJMA 1W34A 2WJPA 2OLEA 2O7SA 3B1KA 2H1WA 1K06A 2AFVA 4G85A 1FLDA 1VCOA 5B3AA 1NZDA 2EFEB 2A0XA 2MHCA 2Z4SA 3RVRA 1I10A 3G49A 1GKLA 3GHYA 1XQ6A 2R7LA 4A03A 1YBHA 1GFZA 1QAQA 1UPAA 2HQRA 5DSTA 4UBOA 2IA5A 5H02A 4ZKEA 1WEHA 4HDRA 5LMZA 2C7PA 3KSMA 1H8ED 2JC3A 1QZTA 4DLBA 4XYBA 1P7ZA 1KY4A 1HO3A 2I29A 2WB4A 2Z3ZA 2ZUSA 3TLCA 4AY6A 2BEUA 5CPBA 5DDIP 2CXUA 3S2YA 2AMFA 1BGXT 3FPFA 1DQYA 1F3OA 2TMYA 5JSZA 1X70A 4MUYA 1MOSA 3JQEA 4YHHB 3JPWA 2IEBA 1QFXA 5IJ9B 1SKQA 1XZCA 1DTWB 1UBGA 1GU1A 1DCMA 2DP4E 4PC1A 1Z5VA 1Z0IA 1DB3A 4EB3A 4E13A 1QGUA 3M9WA 5J5AA 4JXZA 1W94A 4QHYA 5AW2A 1E1CB 4MW9A 1DWOA 3B48A 3AHFA 1XLVA 2QM3A 1J1ZA 3EOBI 3U3OA 2VTBB 3FJOA 4FINA 1EVLA 3A6KA 4R1UA 1ZN8A 4YMGA 4DR7B 5H5JA 3X1XA 1H9AA 1GNPA 1USUA 1QF7A 3M82A 4L5YA 5E38A 3VV2A 1P29A 1SC6A 1ATIA 1KZ1A 2HL6A 2JLXA 3O1LA 2C1XA 3LECA 1M8PA 3PNVA 4P35A 1JXMA 4RVNA 2POQX 2WE7A 4EEXA 1T36B 1LDEA 2D1FA 2P1DA 4KVZA 1EK0A 2FFHA 4PYKA 5DYNA 4ZCSA 4BUZA 4RIGA 1K68A 2ZQ5A 1N6LA 1SVIA 2EJVA 2NVBA 3E70C 3MGAA 1HC7A 2H92A 2O48X 2VRBA 4L0QA 3SDSA 5KQPA 1W25A 1YOVA 3KC2A 3GI1A 3HN2A 1SIUA 1EGVB 1A5BB 3M4XA 2EYUA 1EA7A 4YCLA 2JJ1D 5BSFA 1PP4A 4ZQFA 1TAQA 2I62A 3IESA 4Y9DA 1ID1A 1OZHA 2ZLBA 2A7QA 4YH1A 3IELA 1GKKA 1FSGA 3QI2A 5ICGA 2QIPA 2H4JA 3M6AA 3AEUB 3WWEA 4IV0A 2BTEA 1ULHA 5CFLA 2V7VA 4UHDA 3T9DA 3FYCA 4P86A 3NYWA 3R6WA 4IQFA 4OLFA 4RK6A 3TTUA 1WQ3A 1YCDA 4MGKR 2IIQA 2PKRA 3VOSA 4DIEA 2MWMA 3ZY3A 4OKIA 1V2HE 3PKIA 3G3EA 2O9JA 3QJ5A 1QFMA 4P92A 3P9QA 1H5QA 1G8YA 1FBNA 4IJKA 1JDZA 4PNHA 1Q7RA 1IEQA 2CLOB 2QTMA 1IQUA 4HG2A 1G2IA 2X2OA 1VGRA 3MNFA 6CHYA 4J7UA 1WMDA 4HVTA 3LKZA 4B9AA 3OF5A 1WCXA 4LHVA 2BGIA 2FG6C 2WW8A 3VKWA 5EJ7A 4PHFA 5EC8A 2OZLB 2NO5A 1Z8DA 4C1NA 3ZE9A 3LCVB 1A5AB 3RU7A 3NORA 1GGJA 1S01A 1K98A 4MQBA 2ZBGA 2GK3A 4B3BA 2GFIA 3ZVLA 1XEAA 4OPMA 1P77A 1XJCA 2B37A 2EFGA 2B7LA 3IUPA 3RGGA 3O93A 5AVRA 1MC4A 2NXNA 4ETNA 1MH1A 4YJ2A 1KYYA 4KPYA 3ZBPA 2AFIB 1LGYA 4FE7A 2V59A 5DFAA 4MZDA 4CEJA 4P22A 3U5ZB 1DU4A 4RGVA 3QXJA 2BMVA 2N9UA 4MKHA 2JK0A 5ITSA 2OCKA 2YMLA 3C41J 4F5WA 4PSKA 2QX9A 1W49A 4GGOA 1FRVA 1UBEA 3OP1A 1WNTA 4DWJA 4CLEA 1YS9A 3ORFA 1Z4JA 3ESCA 3H2HA 4EKNB 4EVRA 5JZSA 3IP9A 1IZYA 2OCAA 4DXDA 3IALA 4DMFA 1H6DA 4QU8A 4BE7B 4I2VA 3VNUA 3SM9A 1P2BA 2PM8A 1D2EA 4MQEA 3F4LA 3IX7A 3D6TB 3Q8XB 1NP6A 1H6AA 1W6UA 2FVXA 4K1LA 5AKZA 4IIYA 5FLYA 3WQRA 1C4WA 1AGXA 3A1TA 1UZUA 1NUTA 1U63A 3JR3A 5ALNA 3L46A 1OVMA 3LW8A 2HWXA 3MWFA 1E4YA 1P3DA 3TTSA 1WY7A 5LMCA 4DT1A 1XDGA 2X1VA 4RZQA 5GV7A 3ITNA 4NONA 2FAXA 3LXXA 3U1BA 1U5AA 5AI8A 3WYNA 3ER9A 1NQWA 3PENA 2BL4A 4FW9A 1Q0TA 1TA4A 1XBTA 1U7ZA 4L8GA 3RVMA 3D5QA 3GJZA 3U5TA 2GJKA 1ZM9A 1U0LA 2F62A 2W2QA 1SVLA 1YFKA 3AM4A 2R85A 3HSYA 4LC9A 4JJIA 4MZXA 3GLVA 4RA6A 3ZX5A 2FZVA 3UV6A 3MIIA 1NW8A 4OREX 3UK2A 4PC6A 3U4MA 4I6JA 4KVFA 1KBQA 1TJ3A 4P80A 1LH0A 3KAQA 1P1CA 3NU1A 5AK3A 2J32A 3GLHA 5ER6A 1Q6ZA 2GRAA 1GZ3A 4B4OA 2BH9A 1CJSA 1OKKA 5FI3A 2UZ4A 2VDWA 1PK7A 1WXDA 1QVRA 3U39A 1B93A 5I4BA 5LDHA 4C0WA 3IB6A 4O3FA 4WK6A 3T9EA 1KQGA 5FB3A 1D1PA 3DPSA 2PUDA 1C41A 1ZD2P 1E2BA 1VE5A 2HRDA 4C7KA 3BWCA 4E11A 3CZAA 5FF9A 1ISMA 3LRTA 4UCFA 3EZLA 4OJKA 1JQJC 1E66A 3GLIE 3ME5A 4MDYA 5K3SA 4O0LA 2QJOA 4YONB 2CJWA 1PW5A 4WLVA 3RTEA 2FDXA 3IYLW 3SJ7A 2IDJA 2JF0A 3C8HA 4LG1A 2YWCA 1G2PA 2DFVA 2MSNA 3AI2A 5DHRA 1JKJA 1YRLA 2YN0A 1THMA 3CNOA 4M0FA 2HPZA 5H82A 2AEJA 2OZEA 1FFCA 1Q0LA 1KYXA 5ILOA 5DCUA 1P4JA 1GA1A 3QVMA 4JN6B 1PLKA 3UAOA 4RJ2A 1N1EA 3OE1A 4BLRA 5J4VA 2FRDA 3HB0A 4MB0A 3ZDAA 4B2PA 1EUYA 2ZT8A 3D7MA 1YE5A 3A4MA 1P3JA 4R81A 4AP5A 1CQJB 3G0HA 1P2FA 1UBHS 4B34A 3RHZA 3KYDB 5AH0A 2ZUUA 2LZ0A 2Y3IA 2JLZA 5CB0A 2YASA 4V0KA 2SCUA 1VMAA 5DYWA 5KYNA 1SELA 3I0NA 4J8PA 2ZIEA 2ZR0A 3JQAA 2VP3A 3AYXB 3TOZA 4JEHA 4W63A 4O5AA 3CUSA 5FQNA 1LI5A 4TOIA 5TV2A 3RARA 2RH9B 8LDHA 2AE1A 1ST3A 4YB8A 2IXDA 2WWTA 3EIEA 4F06A 4E3WA 5JDCA 4G97A 4IOLA 2QYOA 2UYYA 4Q9NA 5REQB 1NMEA 4IWNA 5HW0A 5BQFA 3VR5D 4LNAA 4M46A 2JRCA 2P3LA 3NTXA 2HO5A 4LTNA 4OGWA 3R9XA 4MRMB 4L15A 3W34A 3F2VA 5IMBA 1Q0HA 5T3UA 1FJGB 4X8HA 1UDCA 3RFCA 2LVBA 1PQYA 2O1WA 3FCCA 3OQIB 5KNBA 4CGYA 4P8RA 2GR9A 1P1FA 3MLEA 1MPTA 3MINA 2UXDB 2O8EA 1O9HA 2V0CA 2IZOA 3FCAA 5FBRB 2ZITA 2JFVA 1SC1A 3AT1A 4DLWA 3SQWA 2V6FA 1XCJA 4M9QA 2JGNA 2AN9A 3QQPA 4NCHA 2CFOA 4Q9HA 3WLPA 2XDQB 1N5OX 1PQUA 3KXIA 1USWA 4MYDA 3UMBA 4LJYA 2I8CA 5K3EA 2DHRA 1KEEA 5T7BA 2BKUA 1COZA 2QVCA 3E48A 3JZDA 3VR2D 1YDMA 3ACCA 4OG2A 4WN3A 1MC5A 2E7ZA 1XTKA 1HOTA 3TB4A 2JB9A 1JBKA 2OZPA 2GJAA 5LBTA 4DQ0A 3NV7A 1UIMA 3ZD7A 4ARZB 3HKCB 5E7JA 3H11A 1FUIA 2EDAA 2AZ4A 4IDAA 3VJLA 5L3SA 2OG1A 3OMWA 4IV8A 5CM9C 1SVKA 1KJJA 1NAIA 4KLRA 4AROA 1VLQA 5JS7A 4LJ9A 2YH2A 1PEDA 4Z0NA 1VJCA 2GAAA 2MSLA 4TXMA 3I32A 2JAWA 3BDIA 4CCWA 3TRDA 3CXRA 4F9TA 1QSGA 1IRIA 2ZUDA 1QYWA 4BFXA 1UXIA 1YZNA 4IMJB 1ZHOA 4XQGA 1LK0A 3F0TA 4F93B 2EKBA 4MEJA 1CUDA 3ZWAA 1N2GA 2JANA 1ZU4A 3MCAA 1XHEA 4NHOA 5FPHA 5A5EA 2ASVA 3EF3A 4KHPB 1MJNA 4FZ5A 2ZJ5A 2XXAB 1JDSA 2R6DA 5ALQA 2A67A 4C22A 3KJFA 2EAUA 2C3UA 1KEWA 3C8DA 2NP6A 1LQ2A 1EQAA 4UXIA 3B70A 3O38A 4BECA 4M8IA 2OR3A 3LWBA 4EFDA 2H1LA 1NYTA 2VQ6A 1V1MA 5K99A 1DWPA 2HBYA 1VB3A 4QBKA 4TRMA 4YHBA 2AMYA 5A9SA 3NTOA 3H87A 4AG3A 2CLFB 3OX4A 3ABQB 2HQOA 4HEJA 5DNYB 3GZ4A 3LKVA 3TFOA 1JVBA 1L1EA 1H2AS 5K05A 3IT2A 3WIBA 2EQAA 4OXNA 4PO8A 1XDBA 5CCBA 4DR1B 3GA0A 4HN9A 1P4AA 1ZESA 1SM4A 1C29B 2A9VA 2CYCA 2QMZA 3IUBA 1QHYA 3KYBA 4YIKA 3K0SA 2D0IA 2HHJA 4L9WA 4MI6A 1KAHA 3AJAA 3AEXA 2QX4A 5K3FA 3NCTA 3F5MA 3LT1A 3STWA 5TSDA 1MABA 1WKBA 4B85A 3EN0A 4GMHA 3DLTA 3WWPA 3RYFB 3EXHC 3SX2A 1UXKA 3W77A 5H4GA 3D7NA 2YJZA 3KLBA 4OIFA 1P1HA 2XJ4A 3S28A 3JQBA 4AQYB 1TTQB 3A6HA 4HGYA 4M1ZA 2O8BA 5L7WA 3UG7A 2Q5CA 4WVFA 1DAHA 1KEVA 2AK2A 3D3JA 1YMQA 4QPCA 1XK6A 3MWKA 1GEEA 5AHOA 1VKZA 5GP1A 2BUAA 4ZREA 2SKDA 2P8JA 3IVRA 4AULA 2X15A 4CMIB 4QAQA 1E0AA 1U04A 4BJHB 2OGZA 1ESMA 4YMSA 4JJAA 1Z6AA 3UJDA 1R8SA 3OJXA 4DOMA 4ZT7A 1GPLA 1QX3A 2FSUA 4I55B 1JTEA 2P9GA 1IAVA 4MW7A 4ND5A 1XV5A 4CKCA 3D3WA 3WLTA 2OGTA 1E7QA 4ZN6A 5IX8A 2ZI4A 4UQLA 3CTPA 1P1BA 2W4QA 4GI1A 1J8MF 2HY7A 3K0BA 3WLJA 4BKUA 2PV7A 1K75A 3AEQA 2L19A 5JSZB 4XWWA 3E84A 4D4JA 3VKGA 3RAJA 2YW2A 1E20A 2PLWA 2C03A 2ZJAA 5DYIA 2HUPA 1BE1A 1Y4ZA 4K6OA 2R68A 4S1OA 4WA8A 4A26A 5E8JA 3RBXA 1SUIA 1FFXA 2NXWA 1VJTA 4B3TB 2EBHX 1EBUA 2XF8A 3D6NB 3PCTA 4QD3A 4NS1A 4AXXA 4RHCA 4K1XA 4HJXA 2YX1A 3LVQE 2WU3A 1P5JA 2VJLA 1IIBA 1HQDA 3EA5A 3RASA 3MCWA 1HNWB 3PXEA 3E2PA 5DIZA 3LUKA 4YGYA 2WHEA 3VSEA 1UOPA 4O2AB 4CPDA 1BS2A 1OXMA 3KVOA 3EBLA 1HFKA 1ZI8A 1DRVA 1K5DA 1X7ZB 3FR8A 1KORA 4JLAA 1PDVA 1ZCZA 3NONA 3I9JA 3GA7A 4L5AA 4MO9A 1W0KD 1VPEA 1EFUA 3DEZA 1GDHA 1M5UA 1QANA 2BMWA 3HKBA 4YQEA 5BRNA 4DDMA 1YL7A 4LRXA 2WAAA 3LQ1A 2W8ZA 3W3AA 3SNHA 1U0OC 2V6GA 1JIIA 1G5PA 2ZAOA 1N33B 2P4HX 4Z4HA 2PO7A 4IH9A 2OSVA 3CEPB 3ESBA 4MRRA 5ALIA 3WMEA 5E1OA 4HX9A 2Q9CA 4LOJA 3RJMA 5BYJA 1B41A 3OIYA 2VUHB 3ASZA 4NJOA 2DQSA 1GYRA 3O92A 4EFNA 3K9HA 4XQEA 2JBAB 1QF6A 1F1BA 1QCYA 1GHTA 2RHLA 2P2ZA 1SVNA 2DUNA 4M1KA 5U4XA 4HS4A 5JTUA 3GHHA 3KR1A 1W2HA 2VDJA 4I5FA 4NZMA 5EUBA 3S70A 3UG6A 3Q5DA 3FYTA 2J3MA 1TUBB 2WU1A 3QE0A 1WR8A 2ZETA 4MQFB 1E6MA 2PWPA 2RHDA 2G1KA 1GWNA 2JAXA 3ICVA 2DWOA 5DGIA 3ZHYA 3KWLA 4EELA 1KE1A 5KU7A 3RO7A 1SUAA 3W5AA 1JXQA 1ORHA 1ZS9A 2O0JA 1ONPA 1XJQA 3HCWA 3ZS8A 3U16A 1Q17A 1P6QA 1QH0A 2PXCA 3WLHA 2R8EA 2VYCA 5JQGA 2WSLA 2RGNC 3C7AA 3DE2X 2FOLA 3E03A 3OA0A 3UICA 2RHBA 4LJAA 3IOYA 1C14A 1C0LA 1JYEA 2QTWB 1G8HA 3ZE7A 3Q7EA 2NSHA 4ZTZB 3GUCA 1JLLA 1VMEA 3E5NA 4Q12A 1XP5A 4G2NA 1G7RA 2XMGA 1DLIA 1L5OA 2E4ZA 3AF5A 3OHMA 1XEWX 3ETLA 3PC8C 1HNZB 2QRVB 2FN9A 3CF2A 3PJGA 4UEJA 5JH7B 3P32A 4DJDC 3Q9LA 1RP1A 2HF2A 1IOVA 3CMCO 1QVAA 3EIQA 2SKCA 4HQRA 4N7RA 1SG0A 4HI0E 1QNLA 4YROA 2VS1A 4P54A 2XKKA 2FWMX 4J1TC 2BKVA 3LNCA 1E8NA 2X0IA 3AU8A 1ZOLA 1NG9A 2C59A 2X1HA 1R6AA 4BDTA 1L8OA 4ZZ0A 1PR1A 3NXSA 3QFHA 2W2TA 1P7YA 4GO1A 3ITEA 1A9RA 1L8QA 3W8EA 4EQ6A 4H1TA 2YYZA 2QMYA 4DY4A 4BNKA 1JFFA 2ZP1A 3NASA 1K7CA 4CNQA 4XUEA 5IK2A 4ETIA 4G0QA 2HZ7A 4H3HB 1TO2E 4PS0A 2IV7A 4D0LB 3BEOA 3FRJA 1DHRA 3EPRA 5PGMA 1K08A 1TYZA 1U7TA 2VF4X 4KSBA 4YO8A 1OT3A 2DFTA 3IQDB 4ZCPA 4M8NE 5HWSA 3MBIA 5KOJB 4ZARA 1ZGBA 1T5HX 3CZQA 2PU7A 4WZ6A 2F43B 2QKYA 2CHQA 3HA3A 3CW2A 3MGKA 2LD4A 3SLKA 4HQFA 1WMBA 4WLOA 5AUQA 4ZQCB 2IH2A 2B30A 1CUZA 2VHJA 3KBOA 2CCKA 5GOTA 3BFPA 4FNOA 2FSGA 4GECA 5AKJA 2J59A 1MJGM 4BFZA 4F2HA 3UCEA 3GGJA 4HUJA 2O8CA 2XNCA 4RDXA 4NESA 2HHAA 3P9KA 1Z3IX 1G9XA 1D0VA 1DBPA 4W9NC 4WXEA 3C3WA 3BERA 3DFMA 3TI7A 3C70A 3WJ7A 2H1RA 3NTQA 1LBIA 4TROA 3IQHX 2XIQA 4MJ7A 2EP8A 2R8OA 2PMCA 3HY6A 1NMQA 2C31A 2PH7A 1RM3A 3NB0A 2IEGA 4Z4FA 5A9RA 1GUDA 5J4HA 2WINI 3JQBC 3WI7A 3UO8B 1F38A 2Z9CA 2JGDA 1HT1E 2Y1DA 3CZRA 1PLLA 1KEUA 4UCWA 4XARA 2C0CA 5AW4A 1OH6A 2RIRA 1IPHA 4ZQIA 4BGVA 5DYYA 1NC1A 2BY4A 3DT8A 3N7UA 4KOEC 1SUWA 2OG2A 2X7HA 3AF6A 1QAOA 1RPAA 2FMFA 3DVSX 4REMA 3IEPA 4TT3D 1N77A 2FK7A 5B58T 3TPCA 4RPGA 2ZJ8A 4PR3A 4XB6B 1EVQA 2W6JD 3AFHA 4HNGA 3CB4A 4IDBA 4MW0A 1ABBA 1PJ2A 3O1JC 3MZ0A 4IDNA 1A5ZA 1P0QA 3MWYW 3SY8A 1M75A 2PJUA 1BRTA 4M8SA 4DS3A 1A8IA 3EFBA 3TPZA 1KJ9A 5JBIA 5DSZA 4DV7B 4KBYA 1SB8A 3AL2A 4BC0A 3AESA 3B6KA 3N2GB 1K6IA 4AD8A 5T4FA 1KA9H 4YT5A 4UUQA 5IM4A 5K8IA 3WK8A 1TJ5A 4QXAA 4TV9A 3F4BA 3GLIA 3FAZA 3D31A 2I80A 1R8JA 2H29A 1R18A 3M6FA 4BNVA 1LSOA 3G7NA 4D5GA 4I4TF 5BOSB 1Q2UA 2AQHA 2ZYRA 3AY7A 3IS3A 4JENA 4WW0A 5TDHA 1J9EA 2YJ3A 3W90A 3LUGA 2R25B 3DBVO 4AJPA 2FX5A 5AFSA 2CNOA 3GEGA 4DIDA 3NH6A 4RZIA 5EESA 1QIIA 3TTWA 1NI5A 4DYHA 2SNIE 3Q2OA 3RYTC 4GLFA 1FSSA 1ZNZA 4KR3A 3SXUA 4BNLA 3U7JA 5HJ2A 1FNMA 2Q5OA 1HUQA 2OBXA 5I8PA 5HTOA 3D8RA 3OZVA 3GU3A 3WBFA 3JATB 3TQTA 3PC8A 4UM9B 1Z22A 5ALOA 4MRNA 3R74A 2NVOA 1QH1A 4LSWA 3QOWA 1UZNA 2G08A 2F59A 2O19A 4L8WB 2O4UX 4WKGA 1HE5A 4K3VA 3SEQA 4ZV7A 3X1MA 1L7XA 3HKEA 4EOGA 4EFMA 2HJGA 3D02A 4O4HF 4RCVA 1KQOA 5AR1A 1B8NA 3LBNA 3HU2A 2I3ZA 3H4IA 2FSHA 4ITRC 5H1YA 5LBUA 3T95A 1X7ZA 4D9CA 2YRXA 1C4KA 4X44A 4RXMA 4ZVNA 1RC8A 5EIFA 2GZAA 1NQAO 3CY6A 3JARB 3DA8A 1UM9B 4DLPA 3FE2A 3DMNA 2GHTA 3HG7A 1ZGCA 1VA5A 1S4MA 4UBIA 3WGVA 2CCJA 3OF3A 4V0ME 3SZGA 1GXSB 3FFAA 4IR7A 4KE8A 5J2UB 5AVKA 4Q1CA 3ZU6A 1F9EA 1TEHA 2I6UA 2O0KA 3ANSA 4F8EA 2HWKA 1O2DA 3OZCA 2FPKA 4LZJA 1J0XO 5EXEA 4D4HA 3ADBA 3HJRA 3DLAA 4WESB 3UYKA 4LWQA 4FW8A 4LE2A 4GHWA 5CT9A 1LDGA 1MNAA 3HL0A 4YRFA 3GXOA 3RKRA 5ARCA 4UPEA 2WPNA 2QI9C 3HLKA 4R9NA 5T8KA 5C1DA 1TUBA 4N9WA 1X80A 1J00A 1T9HA 1Y9ZA 2A0WA 1AKTA 3PR1A 1KE2A 1X39A 2ECPA 3BSYA 1JF8A 4A8JB 2QD5A 3TNFA 1AUVA 1XL0A 5DNCA 1XXHE 1EP2B 4N0EA 5JNTA 3UGQA 1GA6A 4BWYA 4V1CI 3ERCA 1AKUA 3LQ2A 5HBGA 1W96A 1I3LA 2JI7A 3REOA 4DM3A 3PEFA 4TMTA 4EM6A 2G4CA 1KI8A 2XEXA 1X9HA 5IBPA 3PUXA 2E3JA 1XZKA 1IWPB 3I12A 1JQDA 2D3WA 4XX1A 5KOHB 2YR0A 4I50F 3IP6A 1WSDA 4YQZA 3WSVA 1DI0A 4EZBA 3CV3A 4H1HA 1J9ZA 4XM1A 4LYEA 1BJKA 4KWHA 1PG0A 5DYTA 2V4ZA 1AKYA 1RKQA 4YP0A 1X38A 2X5JO 2ZBRA 3O8OB 1ZI6A 5HXAA 3ES9A 5E3HA 2BFPA 2FOIA 4DEVA 2FFJA 3BZBA 5DLQC 4MPRA 3V8PA 1LF5A 2I4RA 3DBHA 2IEDA 2NXEA 2ZZKA 5BN5B 5IF3A 2VQEB 2YNMC 1NF8A 1KFEB 1OROA 3ETNA 1EK6A 1XCBA 2B82A 2E89A 4Y6RA 3SWWA 3PG5A 2CC2A 3JRNA 2ZIAA 2AUNA 1Z4QA 4INJA 2PD6A 2QORA 2ONKA 4Q1EA 3LOPA 4RBNA 4RYLA 1DQRA 4B44A 4IKOA 1MFPA 1YF3A 2ENUA 4JP1A 1L5YA 1FP4A 3OLXA 4BVJA 3L7YA 4FE4A 4W4TA 3EB9A 1USVA 1ML3A 3BCRA 3PS9A 5HTKA 3QUAA 4QTXA 4F6RB 2P9HA 4FBLA 1AKRA 2C2BA 1PZGA 2OD2A 1S7GA 2YV4A 3LF1A 1F0NA 5HE9A 2CKMA 1K9VF 5LQUA 3NTLA 4CCSA 3LKBA 1KI2A 1SHZA 1ZHHA 2W6QA 4EF4A 4P4SB 4BE9A 3NH9A 1WA5A 1KZYC 2RGXA 3BTOA 1X8XA 3X1WA 3O2SB 4KLCA 4EI9A 1MVLA 4I55A 3O8RA 1VBFA 2G5CA 3EQ9A 2CBZA 3H8WA 4BRSA 1MRSA 4AG5A 2AR0A 1CDEA 3RSFA 4JCCA 2RGAA 5K2MA 1CJCA 5F73A 3RFTA 4CQMA 1ZI9A 5A6SB 5JYCA 2DQ4A 4DDVA 4E2YA 2A33A 5JD4A 4KO2S 5LN1A 3WV4A 2VPIA 1SZJG 1F8FA 4IDHA 5CX1B 2G5PA 4ZAGA 2WHPB 1ZGZA 2ONCA 2IYNA 2YWEA 1BCRA 3KG2A 5AIAA 4FTWA 4DABA 1XP8A 2ILTA 3OCVA 1Y1SA 4MV4A 4GSLA 3QVVA 4D4GA 5JZ9A 3W5SA 1GUZA 4NZNA 1TEXA 3CCFA 3TEFA 3U7GA 2AXNA 2WWYA 2J30A 3KQSA 3OQHA 4KQ9A 1BH6A 5EQDA 2YZNA 3D43A 4D9EA 1JKXA 1V96A 2NZXA 3C8UA 5FTWA 4ABYA 4BEWA 4Z53A 2P7IA 3LT4A 3GOHA 4Q3LA 4V0LA 5DWVA 4N8EA 4EGFA 1Z6XA 1ZK1A 4JLVA 4YJHA 4AK9A 3TRFA 5K51A 5B64A 2ZM5A 1P5HA 4PVCA 5BNFA 1KVRA 1LW7A 5LP1A 2HN9A 4FLEA 1J2RA 1E1MA 4J03A 4OBBA 1PFYA 1V25A 4NJEB 3B7WA 3FUTA 2ZRJA 5CIWA 1RJWA 3I45A 1SCNE 3K7EA 2OSBA 2ZGVA 1T9GS 4BNDB 1F6WA 4C76A 4TTAA 4UNRA 1CRPA 4XYGA 1T2AA 2UXCB 3T06B 3C97A 5EGNA 4X71A 3X1ZA 1FMFA 1YR7A 1ZKDA 2A78A 3KSUA 3UWOA 4UVDA 2RGBA 3WJ1A 4R0NA 1RXSA 4FYYA 5D86A 2F4NA 4WFIA 1N25A 4WZZA 4E5DA 1H2BA 1LS1A 2GF2A 1CW2B 3NKVA 5AJUA 3RBVA 4RK1A 3UJ9A 4L8YA 1OFIA 3BXEA 3QVSA 1DBSA 3L0ZA 1CQJA 3LBIA 3WZ2A 1J49A 1B42A 2JAPA 2JJMA 4CM5A 5L3QA 1JU3A 1I7LA 4IHJF 2V0GA 3KQNA 3URMA 3IO3A 2OFXA 1ISSA 3EVTA 4A8HA 5BNTA 1D6SA 1E2MA 1PGPA 3IAHA 3E1GA 1BW9A 5A4KA 1LK7A 1W5FA 2ZQYA 4WZAA 3QF7A 3TLKA 2FQXA 4XX0B 2JJ8A 4W5QA 1O4VA 3JQAB 1XZQA 2G9ZA 1JAZA 1VL6A 4EGSA 4BP1A 1I7DA 2O2XA 3FPKA 4M83A 3A3NA 1XMJA 4GDMA 3K30A 1HMPA 1TDJA 2FRXA 2OCPA 4EFKA 4QYTA 1FTNA 1MC1A 2JIPA 4RXUA 3REGA 5JH7A 3I9OA 2B8EA 2I3BA 3GEIA 3HKEB 4I4NA 2AJLI 3JXEA 3K0CC 3AWDA 4QRDA 4EA7A 1M34A 3JRWA 3N74A 3MMSA 1TUEA 2QD3A 4E4YA 2RHMA 3ZHOA 4JSYA 2XTZA 2RBEA 3GH3A 2WIBA 2M2IA 2YWXA 5EE3A 1XVTA 1IZZA 1P1JA 2RH4A 2TS1A 1BWPA 3IKLA 4PAWA 4A73A 4BPRA 4DJAA 2GYVA 4EYOA 4HWTA 2V3VA 5KX5F 1Z15A 3DL7A 4L4RA 3C6BA 4RGYA 4UUPA 2IEYA 2DTDA 5AVJA 4GQIA 3N2EA 1GZ6A 3ADPA 3GLFB 4F04A 3EWIA 1G19A 1JSZA 2YVAA 4CG0A 4CMHA 4CV3A 4QZVA 3FVWA 3TSWA 2I3GA 4NOJA 3ZGLA 1QNFA 4GLOA 3I2HA 1CZOA 1G8FA 2L0XA 1VL2A 1M2FA 1D8TA 4P58A 4ZVOA 4K81B 4M8LA 3P0HA 3WLLA 4CM1A 2HK7A 2OHXA 2WG1A 1XZGA 2IRWA 4PLFA 1QP4A 3THYA 1OAAA 6PFKA 2H1IA 2J6IA 4WJLA 1Z35A 1N8KA 5BMVA 3CR7A 4B3IA 3TG8A 4TLLB 3DUFA 3RUAA 4B6EA 2NNLD 2OBLA 3IMKA 1Y7HA 4JWTA 3F98A 1JLHA 4I8DA 2PUJA 5B4TA 2ZYWX 3NQ41 1SD1A 3W6NA 1II8B 4YRSA 1NLUA 1ZGJA 3DO5A 4WLEA 3ZNPA 2KB0A 4YT2A 2GVZC 1W36C 4QQNA 3BKXA 2CFTA 3JZFA 2I2CA 4MVJM 3C4VA 2HA7A 2ZRBA 2F3SA 5KPDA 3RF6A 1E8DA 3FLAA 4KN5A 2C1ZA 2X8JA 2NPFA 4YCDA 3V55A 4N18A 4BKOA 3QPUA 1Z07A 3MGBA 3NBZC 1CS0A 4F56A 5JNWA 2I9KA 3AK4A 3NW9A 4B17A 3GLGA 4OB6A 1HTWA 3M3PA 3NHFA 1N2OA 2M1ZA 2R751 4QBIA 1PZFA 1KYQA 1WXIA 5G3YA 3V48A 1J07A 2BKEA 1UJ5A 4HPXB 4TKLA 5TEWA 4QXOA 4O25A 3W6UA 1JXOA 2XB6A 2IGTA 2O06A 2W93A 2J0VA 4GGPA 2A58A 1BNCA 4EYKA 1UQUA 3AUYA 5L51A 4W6ZA 1O58A 4A3SA 4W5TA 1JEYA 1KAOA 2P8SA 4Z54A 3S7TA 3FOFC 3DCNA 2KHZA 2P6MA 4QT4A 2CFCA 4MW4A 3DWIA 1R0RE 1FJHA 2Y9MB 2ZSKA 3BZWA 4G63A 4Z3KA 1GZSA 3AUXA 3AVOA 2CYBA 3RABA 1ENYA 3TS1A 3E81A 4PS1A 4UEOA 4UFNA 1O96B 2TMGA 1WZNA 4EQZA 3AERB 3WRYC 3W5DA 1Z0DA 1VLHA 3ON5A 1I36A 4Q9KA 5EMMA 1FRZA 2ZJOA 3CLRC 1G7TA 4YK7A 4C0SA 4GOMD 3I9KA 3KJZA 4LWPA 4OHCA 4Z2AA 1SBNE 2XQGA 3IDSA 1Y8CA 2QB5A 2DUUA 1SQ6A 2JJ2D 3FBWA 4H4DA 3WGOA 2Z2JA 2BFCA 1TYCA 4WT7A 1T3LA 1UDWA 1RDFA 5PNTA 4CMIA 2ZI5A 4F4FA 3IXMA 1M2EA 3RFFA 4UKDA 5AUPB 3VDRA 2FQQA 4E70A 5KTTA 5E7MA 1KMHB 1QO0D 2GBLC 2NYVA 1WKVA 1SCDA 2WVAA 1RWXA 5HCUA 4M1YA 4QUKA 2X58A 4I9GA 2HGZA 4L3WA 1W1IA 2CD7A 4QBHA 2Y1GA 4PX5A 4EB6B 2YWJA 4KQ2A 5CAEA 3BFJA 1B2RA 3JWGA 1ZIOA 1KC3A 4GPD1 1GAWA 4TWBA 3SP1A 1J23A 2YJNA 3BQNB 1MR3F 2FA9A 3URKA 2ZR9A 4CT4B 4X91A 3QEOA 1O89A 4GX2A 2VXCA 1ONSA 4HLNA 4P5PA 3HXLA 1HMYA 5COAA 3IJ5A 3P9ZA 4YMWA 3ETEA 1DX4A 3I37X 4AZ3B 5MN6A 5JC8A 4ANFA 4Y67A 3DOFA 4NARA 3OEEA 3ZQ4A 3STXA 1H3FA 2PYDA 3FPHA 4ZDWA 4ITUA 3GWZA 4W99A 3WS7A 2GBLA 3GG2A 3I4CA 3SXJA 1WDKA 4GXQA 4B6QA 1PG5A 2I99A 5FBHA 4B40A 4ZVTA 4JVNA 2F3UA 4N3AA 3ZGNA 4YAKA 4MQ4A 1C1DB 2BONA 4FFBA 4X7RA 1Y80A 2DR0A 3BVPA 3A3OA 1MO3A 3P26A 4GYJA 4HT3B 4PO1A 3DKRA 4GOKA 4HDKB 3PWTA 1NLMA 4AQ7A 3QM1A 4RQTA 1D6MA 3NZEA 1NM5C 4HFJA 1GXSA 4QYMA 1JDVA 2ZJ6A 4OUDA 4RK0A 4UTOA 1II9A 3ELWA 3OZUA 4U4AA 2QTLA 2VPWA 4IZOA 3RD5A 2XCSB 4M89A 4Z8XA 2BR4A 4ED9A 1I4EB 2Q46A 2JG3A 1YA6A 1PV2A 3FTPA 2I33A 3GJ7A 4YJ3A 2PS3A 4KO1S 4HZIA 3TLGA 2Y2VA 3PXGA 3G68A 3DMTA 2AXPA 4KKVA 5KINB 4JBIA 1Q19A 4P7JA 1ZYUA 3EJ6A 5AW3A 3RQSA 3STVA 3DTNA 1IZ7A 2IIBA 2ZWAA 1JLKA 1EJ2A 2BKAA 3DE3X 5EJMA 5HIIA 1W19A 5JD6A 4HEHA 1J8FA 2FX3A 3P96A 2ORED 1SJ9A 1XZIA 1PYGA 3M7IA 5MFPA 1KDTA 1OLSB 2GYUA 4N65A 5C2JB 2YVUA 5FOSA 1U7DA 3WMXA 2NZYA 1V6SA 4IQ0A 4YR7A 1CJTC 4MDHA 5EMLA 2FPGB 1MP0A 5D85A 3PWKA 3RVOA 3IDOA 1A76A 4MV3A 1SD2A 4WN9B 5AKXA 4BU1A 1FJXA 1G8GA 3CF6R 3AOEC 3D3EA 3LQFA 3TZCA 3MFQA 3W5HA 3N6XA 5BXQC 2C9DA 4KP7A 2M6LA 2ONYA 2G17A 2Q2OA 3QXGA 4IAOA 2ETXA 1V5EA 1OI4A 1V1MB 2AOVA 2QE6A 4U6SA 4XSHA 1XR3A 3UAYA 1K7XB 3SXPA 5J40A 3BJEA 3UMMA 1IXRC 1OW3B 4KQ6A 4Y8VA 2UU9B 2II6A 3ED5A 2C2ZA 1UBFA 3PXCX 5C5EA 1J5PA 2V8OA 4JDUA 5DO9A 1RBZA 4C4YA 5K8JB 4XM0A 3E5RA 1QCZA 4LQ4A 3D2AA 4C0AC 1RVV1 1TVKA 1QRRA 3OCCA 5E3IA 1JEQB 5MFZA 2L17A 2WQ6A 1G59A 5HCNA 3KETA 3ELUA 2I2WA 1WD7A 4HDMB 3QSGA 1RI3A 3D2CA 1EG7A 3M34A 5DULA 5G4KA 4AL4A 4DVJA 4EJ6A 2HQ1A 3AVPA 1CRQA 4A6XA 3ZTWA 3AOEA 2YV3A 3IBCA 5DTEA 2XRMA 2IEIA 4JUAA 2VHTA 4IVPA 3VO9A 2C07A 4RKYA 4NNOA 4MICA 4Q9LA 1M6EX 1G20B 2VZLA 3EOAI 3AZOA 5GQSA 4ZQHA 4WJKB 5TQ2B 1WOYA 4U7WA 2QNBA 1P17A 2HJSA 3THYB 4BPBA 1BXGB 3L1HA 5EJGA 3CH7A 1ISHA 1U8EA 1RI2A 4BMYA 1MA0A 3DTVD 1OFUA 2JLQA 5CFQA 2QDXA 3ZWKA 1XAGA 2OO5C 2PIDA 2FW9A 1XA4A 4MR7A 4BZPA 1RQ2A 3IEIA 4NC9A 2H8GA 2PT6A 2ZCUA 2WLSA 3GJ6A 4ZO7A 2OE2A 1JMKC 2NSYA 2PL9A 2J7PD 3H9CA 3PCRB 5KYUA 4HVCA 1BFDA 4HNSA 2UUPA 2W90A 4ZEOA 3UUGA 1U6JA 1FNSA 3MUFA 3R40A 5AK5A 2AVDA 4G65A 1QYXA 5J63A 3ND8A 2OWEA 2W2OA 3HGMA 4HLQB 3K6SA 5BV0A 5KDDA 1FA9A 2L69A 3DE0X 2R86A 4R7ZA 1K4MA 3TGWA 1IOZA 4QELA 2R3SA 3ZD8A 1MEEA 2HD4A 4K6HA 1E2EA 1FS4A 4JJ7A 2BUCA 4E5NA 2VYVA 2ZQZA 4BJ1A 1GIAA 3MPUA 4XD2A 3PVZA 2Q4DA 4YS6A 1UC4B 3E9DA 4J3JA 4UU1A 4GWKA 4J43A 7MDHA 4TXNA 5JROA 4DV0B 1FW8A 4E88A 3E18A 2JLYA 1RRVA 4URZR 4DVGA 1AKNA 1TMYA 1FUEA 1WHTA 4U39A 2PMWB 1G1AA 2RE8A 1X8KA 4OKSA 4IIJB 3VTFA 1R9GA 3PR3A 4FZVA 3JCZA 2C7BA 3ZYCA 4US2R 3DE4X 5A3QA 1GP2A 2BZSA 2CXRA 3HKBB 4Y2XA 3QELA 4FMPA 2IH5A 2WSMA 1NQVA 1WPXA 2COEA 2GZHA 3F6CA 1KJQA 1OHHD 4PLHA 3ZD6A 5AW6A 2VQDA 2OC9A 4X00A 4UNPA 1Z06A 1PVVA 2H8KA 4RTJA 1YTUA 2CNWD 3SZOA 3KU4A 3WIVA 3NBXX 1DC7A 4LOKA 3WRWA 1I3CA 5I7EA 2TYSB 3D4LA 3NATA 5M34A 1E60A 1SNYA 3KZXA 5BR7A 5HDBB 2JFOA 1VKRA 4G0VA 3CRW1 5FTLA 1TF5A 4URHA 1VJ0A 4P0PB 3H6KA 1NWHA 1B3RA 3HGQA 4X6YA 5B6PA 3F7TA 2WB2A 1NXQA 2QTNA 4PHTA 2BTOA 3AH8A 1U2RA 1PL6A 5KBYA 2ZRKA 2QVZX 3EDOA 3K1JA 3R1IA 2EG5A 2FETA 4DJ5X 2JLUA 4N54A 4OLHA 3P4XA 1LBEA 1N7JA 2VP6A 1SBCA 4G67A 4RMNA 3VDNB 4NDNE 4RTPA 1EUCA 5LL6P 2GBPA 2QTBA 2JGJA 4P4LA 1FZQA 1COWD 5I8ZA 2GCGA 3K35A 1M2VA 1Z8NA 2RH5A 1T4CA 4DNOA 4DBLE 1PUJA 1R4ZA 1JLLB 3B78A 3T7EA 4AUMA 1C4XA 1JP7A 2H4YA 2OD9A 3C1OA 3O8DA 5CU7A 1PSDA 3T3MB 1GILA 4JA0A 3ZXSA 6ADHA 4KH0A 1KHTA 3T5MA 1W85B 1I2MA 4Z4IA 4KB5A 1I4LD 4XVCA 4NEQA 2GRJA 1TB4A 4HHEA 1EHIA 3IUSA 3H1AA 1S2GA 4D42A 5KREA 4X45A 1GZDA 4YRMA 2B99A 2BF7A 2H6EA 4IYRA 4Y18A 2UZ1B 2BI7A 1TX4B 1JPVA 3MERA 4J16A 4KFUA 2JATA 3OIGA 4NV1A 3T5DA 1I5OA 2FZ5A 2GNPA 4PPFA 2UVPB 2WSIA 1PFGA 1YO6A 2WKSA 3EISA 3L8YA 1Q7EA 2CXHA 4YREA 3QU9A 1UWCA 3ETJA 1LSJA 1UBSB 3MRXA 4FFBB 1IFXA 3UPUA 1BE8A 2HJRA 4K46A 4Q4DA 3JQ9A 1QZ3A 2CLKB 7MHTA 2OP1A 2AN4A 1FXWF 4MW6A 1ZOIA 2DTEA 3EH1A 2H1FA 1J8YF 2D00A 1HSZA 2QUJA 3C3XA 4IS2A 2AZDA 1L7EA 3IL2A 3ZQKA 1C8LA 4MP3A 1A9PA 2DTXA 1T6YA 2P2DA 3IMEA 4MSUA 3TLEA 1V71A 4KIFA 2QRZA 3PTLA 4HLCA 2WJIA 1LJLA 2Q6OA 2BBSA 3H97A 3ZUGA 2ZVQX 3CT6A 5CT4A 9LDTA 3EIFA 3QUQA 4XW2A 4BWGA 2FFBA 1ZJJA 5JISA 1J2EA 1BXRA 3CM0A 1VL0A 4F96A 1DG9A 1M9NA 4LRWA 4NEGA 5P8WA 1SG9A 2VXBA 3WFIA 1NUQA 2ZZMA 3IVMA 1NMXA 1OXUA 1VE3A 1VSVA 3NNDA 4PCAA 5ER9A 1E0SA 5KYXA 2WFLB 1IJFA 5C1BA 3JD1A 1VCMA 2VJBA 1KI6A 2X7JA 4B4WA 4R3WA 1EK1A 1PQWA 3OU2A 2ZBQA 1VC2A 2FF5A 4F86A 4TV8A 4GR4A 2FWRA 3DAYA 1LJ8A 1NVUQ 4G2TA 2R9VA 3WL8A 5I7RA 2VOEA 1L4UA 3GFSA 5TVGA 3FKSD 3OH8A 5FUWA 5ICSA 2C7GA 2VHQA 5CD9A 3ZTTA 2JEYA 3Q3EA 4CG1A 1ZW6A 1ILWA 3MCVA 4WD3A 3FX2A 3TE7A 1Q3KA 1US8A 3NFYA 3F7MA 4AYWA 3VSBA 4JR2A 1XZBA 1KU0A 2OECA 2RC5A 3I5AA 3K92A 4FB4A 5JRDS 2AOWA 1QU2A 1PWZA 4YLYA 2GPYA 4HNAB 2NVUA 1GFWA 1HORA 5H7XA 2OO7A 4RA9B 3U3KA 3R5TA 4GH5A 2DLNA 1UXJA 1JDJA 2P0YA 3MT9A 4GPEA 4OSPA 5EZ5A 1OFHA 1Q0PA 4LXYA 5INTA 3NO4A 2H2AA 3QEAZ 2P6UA 1ZITA 3P9PA 5DTIA 1JEQA 1PSZA 2OFFA 1XZDA 1X94A 2EFDB 2ZJ1A 2EATA 3UJ8A 2VQFB 4IY1A 2C20A 3R3UA 2CBGA 5B1EA 4MKXA 1PJLA 2OO5A 2W71A 2XKAA 4GQBA 1KY2A 2REQA 4E2WA 1PX2A 1XCLA 3QPCA 1NDHA 4B31A 4FSHA 3LCCA 3RJZA 4RIEA 3OAAA 4GIBA 1L9XA 4TMWA 5JATA 1GYQA 4FMCF 5ALZA 1A8SA 4PHHA 4N4AA 1JAXA 3AFOA 3Q10A 1A1SA 4NU8X 2F1JA 5CVCA 4UXHA 3BCHA 1XU9A 4KQWA 4OB7A 4P1ZA 3DO6A 5DGTA 2DKNA 5EUQB 1N6KA 3BMCA 1JTFA 2BFCB 3HYLA 4UE6A 1W5AA 4RV5A 3OZAA 1BMDA 3AW9A 1GNQA 1LDNA 2HIAA 3BK2A 4HLUC 4TV9B 4DL9A 2C84A 4YIHA 2EBFX 2X6RA 2ID9A 2C4NA 1BEZA 2ZI9A 3DOUA 3SK0A 2YY6A 2RK3A 1KIAA 3QG5A 3RUDA 3N1UA 4ZQBA 1N5DA 2IPXA 5A6SA 1M0TA 2YIJA 4PC2A 1AXEA 1GT91 1RI1A 2V9PA 3ZDDA 3GPCA 2J31A 3NOQA 3AKEA 5HM6A 4JIGA 3CVWA 2P62A 4UFPA 3OIVA 5FXMA 1CNMA 4UUBA 2BZGA 2BZ1A 1NW5A 4U0KA 5C1PA 2PJZA 4M1MA 4RS4A 4G5OA 3L84A 1Z56C 1RC1A 4TYYA 5IABA 2PPLA 1ZBQA 4FVTA 3BAZA 3EF1A 4JXJA 3LP6A 1R8YA 3ZK9A 4DIUA 5JADA 5JW6A 1M76A 2F1HA 2HRCA 4R8MA 4U2KA 3BIXA 2I7VA 2Z8YM 4D9MA 1K3UB 1WG8A 2XCUA 3B3AA 2WJHA 2YY5A 2O5CA 1IH8A 1NR7A 4MWSA 3LM8A 4MAMA 1OPXA 1YAHA 4DLUA 2Y05A 3KTAA 3ZH2A 3UMFA 2O1XA 2FH5B 3AF3A 4KXQA 1GTZA 4A0GA 5JJKA 4PZDA 4DJEC 5E4FA 2XZLA 2HA5A 1FQKA 3OIDA 4Q19A 4RHEA 5JXWA 3H6HA 1VKOA 3BG5A 2W6NA 3B2QA 1L7QA 1L1RA 3NUZA 4FGWA 1QPZA 1MIOB 3MYYA 4RLFA 4L0CA 1XRSB 4BKPA 4M2LA 4OH7A 2Y1OA 3QQ5A 4G1BA 5CYFA 4HQ6A 5DMXA 1OJ7A 1F2TA 1W4BA 5KKAA 5LZ5A 5HZMA 1FX0A 3K0EA 2A14A 2REBA 3IQEA 2BIFA 4OI4A 5SZJA 5BVGA 1U5BA 2QYHA 3L8EA 5E6RB 5BSKA 4JJ8A 4RHFA 1UPXA 2BJHA 1Y5LA 1U0NA 4HEA6 3N3BC 3JWPA 1KSJA 3AEUA 3G59A 3EEOA 1E2PA 5DI9A 2BYTA 5EYPA 1BCSA 3E6AA 3IAXA 1OC2A 2RGGA 5A4FS 1P2UA 2CNKA 2BDTA 1IUPA 2C94A 3BSWA 1Q44A 4MVXA 2FW6A 2WU4A 4V2UA 1WW8A 1ZWLA 1TW2A 1U3CA 2FYTA 1YR1A 5CX4A 2FLKA 5ALUA 4B9EA 3MD0A 4FEEA 3RNLA 2Z8XA 1Y4DE 3AI7A 1T2UA 2V98A 2WD7B 1N1GA 3RC2A 4YEDA 4EJFA 4XIJA 1FTWA 3UUFA 3OURA 4RHYA 1ODCA 3M6IA 1SN7A 1J5XA 3PEEA 4D98A 2IL1A 5KCMA 2DH6A 5BN3B 3HFJA 4RFSA 3KZOA 4RABA 4TQ9A 5DBHX 5FO1A 5K3DA 1FYEA 3LG2A 2GGSA 5JI3E 3B2NA 10MHA 1XZMA 4HRXA 2CZCA 3A26A 1YVDA 3HU3A 3L7DA 5HKLA 3SSMA 4CR6A 4Y2VA 1HA3A 5AM0A 4GNKA 4ALLA 1JR3E 1WUIS 2QLNA 4JI3B 4DQKA 3K2IA 3O94A 2VKQA 5CNIA 2OYCA 1MO2A 4KK3A 3EASA 2EBWA 1V9SA 1AZLA 3QBTA 4JL5A 4LOHA 2JHCA 4RX1A 4US1R 5B1YA 1F0YA 1S8OA 4X93A 3THWB 2ZUEA 2RKWA 2QRJA 2W22A 4TVKA 5F1PA 3WHIA 5JS6A 3IBFA 3TUJC 5I45A 4RPJA 1UP4A 4OHRA 3VO1A 3QENA 1G6OA 1WB4A 3GGDA 1SVMA 3KOYA 3RRZA 2IBSA 4WACA 3AL3A 2V6BA 4FDTA 3EG5A 4LJSA 1BQEA 4YRCA 2VT2A 4LAFA 3U80A 4TZ0A 2H59A 2VATA 4ZEVA 3A2KA 2ZYDA 1XMPA 5LPNA 3AP1A 1IMOA 1HKHA 2Z09A 2YV1A 1RYFA 2WFZA 1IJEA 3EYWA 4INOA 3X1KA 2ZROA 4AKSA 4D3SA 5B3LA 4FHCA 1L7RA 5JAOA 3QVTA 4FGKA 4R41A 2FZKA 3RWOA 3KHSA 2BBWA 4EG1A 3D6FA 2FZLA 4H59A 2WJJA 1RWVA 2INGX 3STHA 1OD6A 4P6VF 3VUEA 3QE2A 4CMCA 5BO5A 3TW0A 4LXGA 3Q3IA 4MS3B 3W05A 3K9NA 2JA1A 2G4VA 2WJWA 2Q41A 4KAFA 2HXGA 4RPCA 5I5EA 4P53A 3KWFA 4ZVKA 4N5NA 4EO4A 4FEYA 2F3RA 3P2KA 3RH0A 3ZG6A 5KHAA 1INLA 1RRPA 1H1LA 2QRNA 3DQZA 3I2IA 4CLRB 1II8A 4LVCA 2DYKA 1X77A 1NOIA 2WIFA 4KWTA 1O8CA 5FBKA 4ZYTA 3FKJA 2A1UA 4NCXA 2HWWA 2D0DA 2W4IA 3BHJA 1H23A 2WFMA 2WHPA 3E9EA 4W8OA 4BLOA 2VEOA 4ZKDA 5C7IO 3DEIA 4OK5A 5DBEX 2C4VA 4BNFA 2X22A 4ZAWA 2FFQA 5FWYA 5JEDA 4GI7A 4IW3B 3RROA 4EHHA 1K2VN 2QQEA 2H11A 2HEIA 2XPCA 3DV2A 2A5YB 4ZA2A 4ZYWA 4IBOA 1DSSG 4HLUA 3QHPA 3RKUA 3DMDA 4XFDA 3HADA 4D6XA 3A6LA 4UM9D 5EJ2A 2VRCA 2NQ8A 4KUHA 2IJGX 4A15A 2QLLA 1QWOA 4NECA 2OCDA 4LWZA 4WXPA 4INAA 3OQVA 5J2UF 4E4RA 3Q87B 2ACEA 1CYDA 1TT7A 4G4JA 1R4NA 2C9BA 3RC3A 4G89A 1P5ZB 2QG6A 4U5QA 2XXBA 1VP9A 2Q5JA 4MWTA 4BNNA 2CL6X 4EBBA 4CKBA 1C1YA 3FGOA 4MA5A 3KUKA 4QEZA 4HWPA 3HI4A 3DONA 3SZMA 5L53A 3PYMA 2HHHB 3PQFA 1P4RA 3A28A 4AKGA 1FLVA 2A9RA 5FPTA 3VJKA 1PEYA 3WWCA 4NZOA 4AB1A 1MO6A 4ZVSA 3EFEA 2EZ9A 3G9UA 4JVMA 1KRHA 3I9V6 3UUEA 4DE5A 2HCJB 4O4HB 1A8PA 2IF2A 1DDGA 3PX3A 1Z2AA 4MP6A 2MYPA 2IBMA 3UB3A 1WZIA 2C3PA 1Q0RA 3FYSA 4LDRA 1HY3A 1T9ZA 3ICOA 5CT5A 5T64A 2J0EA 3EVAA 4BX8A 5LSAA 1PR4A 2ET6A 1F14A 2JARA 3RODA 4LZOA 2KW5A 3KTDA 5IYZB 2F8MA 4J0CA 3EW7A 1OJLA 5ED4A 2VNHA 5K20A 1GSAA 2CLIB 5HJ7A 4GNRA 3FPAA 5DP2A 2NUBA 2PMFA 1ZJ6A 3NWOA 2QW8A 2PKEA 4RD0A 3OBBA 4RADA 5ALTA 3QUTA 3ZHRA 1UFKA 2WTUA 1R15A 2PEZA 2PTHA 1QH8A 3PGMA 5I7AA 3KJGA 3RCBA 2G09A 2PZMA 2XUQA 1N2CB 2CE2X 2AJCA 2PX8A 4RGBA 5CNMA 3ZHBA 4RJIA 4O08A 1EUZA 2P2GA 4UVEA 1N4AA 3P19A 1JHYA 4CIXA 2P9ZA 4QJIA 1E77A 2VF8A 1YOBA 5KYGA 1GNRA 2O3SA 2OESA 1UKZA 3G0CA 4PZYA 1F8YA 5ALLA 4CUZA 1E2IA 1V26A 1WDLA 1EBFA 2G40A 1JDBC 2P90A 2R44A 4HAOA 3HCOA 4A8PA 8GPBA 2FGKA 2JCGA 3VBEA 3WGNA 3LX6A 1XYYA 3LDGA 2IEAA 4AS1A 1JHRA 1Y1RA 4DDWA 1R0KA 2UYHA 1L7OA 1I24A 3SMVA 1DEAA 3A32A 4P5EA 2OMKA 1GL3A 3WAKA 1Z45A 2LRHA 3MTGA 2JZCA 4D46A 1SBIA 4TL9A 3PKZA 5JFGA 3ZNNA 1NRJB 4FYKA 4JA2A 4J2TA 5JAIA 2J4FA 3CUKA 1M34B 3HEMA 2ZW9A 3VJMA 3GL9A 1YL6A 1QE3A 3ZCTA 1R9MA 1JIKA 3GH1A 4RAOA 2VF7A 4UCXA 4EHIA 1YUBA 2RAPA 4UW9A 1I1OA 4JBWA 2B4AA 1MVNA 1DG3A 3DM9B 4M1EA 4M7PA 2VP9A 4DILA 3CVYA 1OTHA 1E5VA 4QVGA 1G66A 1B6SA 1Q15A 2JI6A 4IH4A 1XKXA 3TSCA 4O0MA 5JDCC 1J2TA 1NVMB 3U1TA 5KZMB 2GCIA 2P27A 2RFLA 1WBJB 2GM9A 1Y4SA 4ECAA 1NFRA 4ZI7A 2Y0EA 1IM8A 1EX7A 1NXVA 4LF8B 1LPAB