2M6KA

Solution structure of the escherichia coli apo ferric enterobactin binding protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
292
structure length
292
Chain Sequence
ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrienterobactin-binding periplasmic protein
publication title The solution structure, binding properties, and dynamics of the bacterial siderophore-binding protein FepB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 50
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA02
1G21B 3NU1A 5BVHA 1L5HA 5KOHA 3R5TA 3PDIB 3AESA 5HX7A 1QH1B 2Q8QA 3MD9A 1KARA 4WNAB 5M3BA 4XPIA 3TLKA 2X4LA 5CX1B 1N4DA 1M1YA 4INPA 4INOA 5KOJA 1K7SN 3LHSA 2WI8A 1N2ZA 3BE5A 3AEKB 1N2CA 4WZBB 3ZKAA 2AFHB 3ZK7A 5BVGB 3U7QA 2MINA 3TEFA 4G07A 5AFSA 3BE6A 1KAEA 4WN9B 1PQ4A 2XDQB 3AEUB 1K0FA 5FLYA 3ZTTA 5M2QA 2XQVA 1XVLA 2XV1A 1FP4A 5GGXA 3UJPA 3ZK8A 4WZAA 5CR9A 1G20B 2AFIA 2Q8PA 2M6KA 4MX8A 1L5HB 4UTOA 4TKVA 5BVHB 3AEQA 3PSAA 5KOHB 4HN9A 3AESB 4WESB 1H1LB 5KHLB 4UDNA 4LJSA 1M1NA 4TKUA 3ZK9A 5JG7A 4FI3F 4XPIB 1M34A 4CL2A 2PHZA 1M1YB 2PRSA 2WHYA 3K1AA 4FKMA 5KOJB 3AERA 3MINA 1EFDN 3EIWA 1N2CB 2OV1A 3U7QB 2MINB 1MIOA 3AETA 4FILA 4HMPA 1K2VN 4ND8B 2XH8A 2OV3A 4GICA 4OVKA 1PSZA 1FP4B 2YNMD 5I4KA 2XUZA 1QH8B 1G21A 2YNMC 4OXQA 1QGUA 2AFIB 3EIXA 4TKVB 4DBLE 2PS9A 4NNPA 3AEQB 4UDOA 3G9QA 3HJTA 4MLZA 3CX3A 2OSVA 1M1NB 4TKUB 5CX1A 2ETVA 1TOAA 4LS3A 5M34A 1M34B 5JJ5A 3K1AB 5GGYA 3AERB 3MINB 3MWGA 1KAHA 4OXRA 4H0FA 3HH8A 5M29A 1MIOB 2PS3A 3AETB 2R79A 3LI2A 4H59A 2OGWA 2M6LA 5JPDA 1ESZA 5HDQA 3GI1A 4PM4A 2XY4A 3HXPA 4HMQA 4WZAB 3TNYA 4B8YA 1QGUB 4HMOA 4MDYA 1H1LA 1K75A 3PDIA 4WESA 1QH1A 4IRMA 2RG7A 4WNAA 3R5SA 4PAGA 4UTPA 4K3VA 4MO9A 5JOQA 5B58T 4FNAA 2O1EA 2PS0A 3AEKA 4M7OA 4WZBA 2AFHA 5BVGA 2R7AA 4NNOA 4N01A 4WN9A 4ND8A 4G09A 2XDQA 3AEUA 2QI9F 3MWFA 4BBPA 1N4AA 1QH8A 3PSHA 3MFQA 1G20A
chains in the Genus database with same CATH superfamily
2QDXA 4HGYA 1E2UA 4BN0A 1IYZA 2CLLB 4XWGA 5ALNA 4NBWA 3RW9A 3T5DA 4RKFA 1XEXA 2YS6A 1JDZA 2I1WA 2VH1A 3OCZA 3IAFA 3T7AA 1H3FA 1Z7YA 4FYIA 4AKSA 3KFXA 5DSZA 1U8EA 2FG6C 4RZXA 3RVRA 1GA6A 1T5SA 1OPXA 3EG9A 3MUFA 1N5MA 4O4LA 4DLAA 4UOZA 3E53A 2W6MA 2ISSD 1VG0B 1ZD5A 4A10A 4ZZ1A 1QLHA 1PDVA 3R0JA 4ZI7B 2EFGA 4LJ7A 4RQTA 5I3CA 3NAGA 1Y80A 1NA5A 5ELMA 4R81A 5TSDA 2NUAB 3MJCA 1MO5A 2YWCA 3A2NA 1NI4A 4ER0A 4H15A 4XD7D 1ZNWA 1CW2B 1CF2O 3VH1A 1BS1A 3MXTA 1TC1A 1U3CA 3LUKA 3UQZA 4ARVA 2OKCA 2X4IA 3LKVA 3PS9A 4K6KA 3GYGA 2Q0HA 4XQGA 5ADHA 4C76A 5ALWA 2PG3A 4KRFA 1J2UA 2C8KA 4QFBA 1X9HA 3L7JA 3IO3A 4DZZA 3SDZA 1GN8A 4JMLA 5A9SA 3K3PA 4YJ2B 1ZIYA 5ALOA 3VDMA 1L7VC 4OFXA 4QDXA 2NT4A 5AVUA 2YN0A 3ZDYB 1J8YF 1X0XA 2H1HA 1E7SA 4LMBA 1XL1A 4UXIA 3JU3A 3I04M 2PZAA 2WIKA 2Z8ZA 1H2FA 4IFEA 2GFHA 1XZAA 5IW8A 4F4CA 4IL5A 4M7PA 1SQ5A 2AN9A 3LCJA 3VKFA 1TCCA 2OB2A 1MJGM 4H6PA 2AXPA 1UAGA 4I50A 5DXJA 1P8JA 1DUIA 5LDGA 3S29A 1HM5A 3STVA 4ZCRA 3SXUB 2C82A 3TDMA 2JBAB 5K0EA 1LBIA 3ESCA 2NTNA 4WE3A 3ZHYA 1L7QA 4XWTA 1OJ7A 1RYNA 3M9XA 2E4AA 3VPAA 5EKSA 4RSRA 3OOJA 1WCYA 4BNGA 3O4JA 4OO3A 1UDAA 3DAFA 5FEUA 3S1AA 3H2JA 2E5FA 1AGNA 1X9IA 3RVSA 1KYIA 3ROKA 2VTBA 3PTAA 4L8WB 1FFHA 2E87A 2FWAA 4TKZA 4LDNA 2Q5EA 3EH1A 4A23A 2KE5A 5C5IA 4OLHA 2OQ2A 3O74A 1X8KA 2PUDA 2WV7A 2ZQZA 4PZAA 2I1VB 3BTOA 1YB5A 4TYPA 3L6DA 2MSWA 4BNUA 2X5OA 2K2QB 4GYJA 4CNQA 3QX3A 3KHSA 4QOJA 1OA0A 2QJOA 9ATCA 1TM3E 3GROA 5G3ZA 2HQ1A 3HO8A 3RSOA 3FB4A 5CFNA 3AR3A 1AS3A 3ZDDA 1PR3A 3NXSA 1IBKB 4U63A 4BVAA 4C4OA 3QF4B 2XB4A 4UM9D 2J31A 4BTVA 5BWNA 6AT1A 1J1ZA 4JJEA 1TVMA 3B6IA 2HWWA 3M1IA 4ZVOA 4AZ0B 3M6AA 1K89A 4JLPA 4R1LA 1YDWA 5HK9A 4P6VF 1I14A 3W06A 1L5VA 3IP9A 4X94A 5EP3A 3ZCXA 3CUVA 5DHAA 4DMRA 3AYZB 3OP4A 2KWIA 2Q27A 2ST1A 3CKLA 4DA7A 2YHSA 3IO5A 3DDUA 3V4VB 5KAMA 1KY4A 1P7VA 2IKSA 2P67A 3GJSA 3GNTA 2E4XA 3LFUA 3MOSA 4A6EA 5BVHA 3D3EA 3QVJA 1BA3A 4WWHA 4YNBA 3TIVA 2BCJQ 3ZY5A 2LNDA 3GRPA 3EEOA 4ZMRA 1JYFA 3COVA 3R5HA 4IXTA 5GONA 2X1HA 1KIFA 4HUQB 1LWNA 3D5TA 1N4DA 4IGKA 3UICA 4WKPA 3C7KA 3GGPA 3OE1A 2VJAA 1YVUA 4LYGA 3ZVLA 1XWWA 4KODA 3VNBA 4YTEA 4BNHA 3PE4A 4FKBA 4XFKA 3DQPA 3LZDA 5LCXA 2ZKLA 3F7OA 5DTMA 4UMEA 4DMKA 2O8EA 2R1VA 3HVRA 3DTTA 1LBHA 2JGEA 3KTAA 2FEAA 1XDDA 2JLUA 5M2QA 5K0SA 1UBNA 2WA1A 3QXGA 2VC2B 4KITB 3BMCB 3B7WA 3WIOA 1TO2E 4EPRA 5B6PA 4W7IA 1E6CA 1R2QA 1J5XA 1ZL0A 2UVQA 4PQFA 2VAMA 4A91A 4MVJG 2PKYX 4B35A 1ZKMA 4L4ZA 5EJ9A 2OHXA 1UAAA 2PSEA 2C9OA 1VIVA 5LQAA 2XSZA 4EG5A 2O1XA 1WV0A 2P75A 2VDPB 5AOVA 4BE7B 3AHHA 5E7IA 3LHIA 3AUUA 3JATA 4OXXA 2UVPA 5ITZA 4MKXA 2EKPA 2ZIWB 3BM5A 1KAGA 1PK7A 5IDVA 1DLJA 1OFGA 2WJ6A 3IUPA 1KHHA 1MRNA 3PPXA 4YLEA 1IBLB 4IM7A 3GEBA 3HEMA 4DYDA 1KEKA 4D46A 1NZFA 1N0IA 4YV7A 3P52A 2NVUB 2ZXUA 2QYTA 2J4DA 2HTFA 3FNEA 4NEGA 4OGFA 3LBHA 4PU0A 4TMZA 4Z6KA 1XZNA 4FK8A 4ZN6A 2OBLA 3RSGA 1HEIA 4YLYA 5FUQA 5I4BA 5AKYA 5ENVA 5AKEA 1CB0A 3R3SA 1E2BA 1KE2A 4PX3A 1GTMA 1FFDA 1UPBA 1ZNYA 3SIXA 3B52X 5IAAA 2GPWA 2JFFA 4H4EA 3NTRA 1B23P 4NCAA 1X1TA 4KH0A 1O9BA 3RS7A 3OA2A 2XE8A 1EGAA 2PA0A 1A9PA 1U7TA 2G5GX 3KL2A 3IKLA 5KVCA 4BNLA 1C0IA 1KY5A 3B1WA 2CLSA 4DLTA 3TN7A 4AM8A 1IQPA 1W4BA 4RMIA 3QJ5A 5BSFA 2IYLD 4TLAA 4K6MA 3IMFA 2IIBA 5CVTA 4JXJA 4YS6A 1DSSG 4PCAA 4TPKA 3ZZTA 4DV5B 1RWXA 3IPRA 1ICEA 4IWNA 4ZEWA 5KO2A 1EE1A 1P3DA 4GX1A 2YWDA 2XF8A 1KDYA 4R84A 3ZOZA 1REQB 2E6KA 4HMOA 1V5FA 4W5RA 3MPOA 3OU2A 1O58A 5HJ2A 5C2JB 1V71A 1T26A 2PR7A 4OJYA 2WP8J 3WWOA 4AYXA 1TF2A 4F0JA 1U4OA 2W2LD 3V5NA 4IHJA 2WAAA 2FMIA 1GCAA 4EKDA 3SHOA 1DEAA 1ELOA 4BMDA 4YEDA 2ZDGA 2P27A 5DYIA 1NQ5A 1YDMA 1ZWLA 1ZY2A 4DLVA 5IJWA 3KCQA 1G21E 1NY5A 2G82A 3R77A 3EGWA 3LF2A 4LEIA 9GPBA 3DV0A 1EP9A 1BGWA 3ELUA 4GOXA 4QEZA 3TLXA 3JQRA 1QQTA 1SHUX 3STXA 1TLFA 1JA0A 1ZJ4A 3FHTA 3F5MA 1XVUA 5JNVA 5CIYA 3U4IA 4P5EA 4LYHA 4AJNA 4LFAB 4N3BA 1ZQ9A 3UFXB 1BOFA 1QZXA 3L7YA 2PRYA 1M6YA 1E2GA 2BLLA 4GI3A 3ZTYA 4B5KA 1WY7A 4RE5A 1XP8A 4UMVA 1LLUA 4TZ0A 1UPCA 2ZS7A 2LWIA 3MMNA 1NTOA 4LOAA 1VKNA 2GASA 3ZQUA 4HNAA 1C0EA 4ZI2A 4PZUA 3FPKA 3OZGA 4LMAA 1YQGA 1RYBA 1Z2DA 2XOEA 1IWOA 4N8SA 4F6RA 4HQRA 5DMXA 4G26A 3AG5A 4BX0A 5K5EA 1XA3A 4KQGA 4A8JB 2YUTA 2IYXA 1UANA 2ZP1A 3KQNA 3BZWA 3BGVA 2XPCA 1H2BA 1OKKA 1ZOLA 5I7RA 4UFOA 4QNNA 1BD4A 2GPNA 2DB3A 3KBBA 2J33A 3N86A 3BEOA 5FI0B 5EXPA 3DFUA 1TCAA 1XZDA 1Y3IA 2QSJA 4AD8A 5KTYA 3ZLJA 3KYCB 1IATA 4MVJF 3V4ZA 4EG1A 1FYXA 3WLQA 3A7DA 4KGZA 5FL7D 1L7EA 1UBMS 2DHCA 4JSRA 4BDSA 4D41A 3A4TA 3KUUA 3AERA 5HJ5A 1WZCA 1FUEA 3IB6A 3IVAA 3TW0A 4AYTA 1FSZA 2Z1MA 5JAPA 1M2OB 3GJQA 4EVRA 4ND3A 2OGZA 1G8HA 1H6DA 3IPXA 3Q8XB 4NECA 1F12A 1XZLA 1S8NA 1NXPA 1BA2A 1TYEB 3CBGA 3DDOA 1A9TA 3I42A 3BYZA 4ZQCB 3U3XA 1D1SA 3KVNA 3HACA 2RI0A 2W4IA 1P7ZA 1XU7A 1SIBE 3QLVC 4QU8A 4G63A 5ERXA 3VO9A 3HGQA 1FTSA 1KQNA 3G59A 3R6DA 1GFZA 5CLFA 3AJ9A 4A5OA 1NNLA 2PN1A 3M1YA 1EP2B 2KPOA 2WSSA 2Z2ZA 3AEQB 3HJTA 2ORYA 1K63A 1YULA 2A9JA 3EIUA 3H9EO 3R8CA 3H5WA 3TL6A 4CMKA 1K7YA 2VRBA 3TQFA 5AVTA 2R7MA 3MYYA 1KMHB 1USGA 5I8PA 3VZSA 1M6EX 3ENWA 3G1TA 2MMGA 2AE2A 2OZLA 3Q41A 1CY6A 3PFGA 2DSTA 1DWUA 4O29A 2NYUA 4EVSA 3IGFA 2UUOA 4IOKA 5DM4A 4MWBA 2HJHA 4XLTA 1KJNA 5ARCA 5TQVA 5MFPA 4L76A 1MO6A 3PVSA 3N7TA 3SX4A 5BNWA 2FG5A 2GUGA 5BUZA 2QORA 1L5WA 3AQIA 4W5WA 1ZUNA 5B6JA 2WILA 3KSMA 4AP9A 4RGVA 4FONA 2XY4A 1JZSA 4R71A 5KMGA 2CZGA 3CPJB 2AJBA 2GXQA 3NRJA 2XUFA 4Q39A 3R9KA 3TFQA 4TTTS 1T2NA 1KS2A 4GOLD 4A6DA 4FCVA 5B7QA 3EDMA 4NC9A 1JDSA 2A5JA 4ZQFA 1UK8A 2DMRA 4FDLA 3T7DA 2FETA 1GAJA 1KOLA 1R9NA 1A1SA 1KAQA 4YJDA 3HRIA 3R5SA 3L0DA 1S02A 2D0IA 4G37A 5JECA 1NG1A 4WBNA 4UXHA 1RI1A 2Y1DA 1AGPA 3WGZA 3VGPA 3ZGOA 4AXXA 1U99A 2PMKA 4QU5A 4EHFA 4JI3B 2OZPA 5DLEA 1O08A 1AV7A 3V4LA 1Z88A 3G79A 3GZ4A 2QSUA 2QTNA 2VSNA 4K6CA 4PC6A 2OYRA 1EUQA 4X1YA 4D92A 3ANSA 3MS4A 3CTMA 3QBEA 4G0MA 1N9GA 1R66A 4MR9B 4MVWA 4OLFA 3S68A 1DC5A 2OLEA 3MMXA 4CV0A 3R5KA 4D25A 3HDTA 2Y9MB 3AR5A 2ZR9A 1JR6A 1E61A 5H7XA 3LNCA 2C77A 5KNBH 4PLVA 3EXFA 4TQUS 3TKAA 2EOAA 3EXHC 3HKCB 4P8RA 2YMLA 1OASA 3F9RA 2OG1A 3RT7A 1JJ7A 1DAHA 2I6FA 2L42A 2G1AA 5CB8A 5HJEA 1P2BA 3BE5A 2G80A 1N2CA 1C9NA 4AYWA 4G5QA 5DTQA 4WKBA 3GLTA 4PHFA 4FS3A 2JCBA 1R6AA 2R8BA 4JNKA 1T9CA 1BRMA 3GARA 4OFZA 5KBYA 4DHWA 3BT7A 3KU4A 4FN5A 4YMVA 2QHXA 2WWFA 2WZBA 4GX2A 3RUIA 3RS0A 3UAVA 4ZOBA 3DOCA 4X3CA 2WWWA 2HRDA 4TKMA 3WWYA 4KC0A 3V48A 3DF9A 5EHZA 5JG7A 1ZIPA 3SP1A 4FZRA 1YRQA 1EEHA 1ZJ5A 4HXYA 3B3FA 1JKFA 5D00A 2Q21A 1JVBA 3E3AA 4HAZA 1G64A 4A0HA 1TA0A 3ZY6A 4B48A 4F7DA 2EKDA 2CHVA 3TSWA 4QOSA 4E4RA 3U7QB 3W5BA 3D0OA 1FTNA 3H99A 4HTFA 3B2EA 1XIVA 1D1QA 4PRKA 3KYBA 1RJGA 4MPDA 1A7KA 2QY6A 4DIBA 3HI4A 3D4IA 4D0GA 4WLEA 4A36A 1YQ9A 1PK9A 5KVQA 5KYVA 1JG1A 3ENKA 4GNKA 5D6OA 2OBMA 1Y0BA 1IWPB 5K0BA 3JYOA 1AQJA 2AWNA 2PZJA 2DM6A 4GKBA 4OG2A 1WZIA 4CV2A 1FDWA 4QOFA 4FZVA 1W9HA 2HCJB 4KYVA 1AUQA 5HKOA 2JFVA 3FDJA 3MGAA 4QA9A 2VTEA 3WGTA 3WR5A 4DAOA 4E33A 4Y0VA 1H0RA 1PZFA 3DWFA 2A9OA 2JHCA 3K1AB 3IEIA 4R2HA 3TQHA 3CNNA 1Y5NA 5A2QA 3II6X 3M4NA 3PQ6A 3DLIA 3RFFA 4J7UA 5EIWA 3VDQA 3ZUPA 3GRRA 3HXTA 2VTVA 2I9KA 2LVBA 3GV0A 1MIOB 2ZRIA 1WUYA 3V33A 1WWKA 4F8JA 2HF2A 3PRJA 2YX1A 5M5BA 3AP2A 4FW9A 3BMXA 4NK5A 3LKDA 2QGZA 4LXTA 2CLOB 4GM1A 2VSXA 5LYYA 1UBSB 4BJ3A 2YZ2A 4IG4A 1D5WA 1DQYA 2J87A 3C16C 3SI7A 1JDUA 1HE3A 2Q6VA 3KOXA 4LISA 4B3CA 4YRZA 3DVAB 1U9CA 5IBPA 3EZ2A 4B79A 5CAEB 1BCRB 4CM7A 1FUKA 3JQAB 2E4YA 5IAOA 1O0CA 2J3MA 5GTDA 4N3AA 2QD2A 1Q6YA 2YVAA 3EMDA 4PNPA 2C57A 1H2XA 1Z8HA 1O6BA 4H7HA 3LY8A 4DLPA 1BE6A 1PKEA 3H5VA 5JSYA 4BO7A 3BXXA 3E22A 3U2QA 3ZC3A 4JVNA 4Q4AA 4ZVMA 3ONWA 1U90A 5JXIA 2GBLC 4BQQA 3HRKA 2YXDA 1AZWA 1Z74A 3WRYC 2PBRA 4I4TB 1G6Q1 5AW6A 2RE8A 1A8QA 4Z51A 2P3OA 5D86A 1U0JA 3DMTC 2I29A 4GC9A 4EX6A 1UC4B 1E6WA 1JDNA 4JJKA 3V8EA 4RHUA 4ML3A 1YONA 3KT8A 4RH0A 1JHVA 3RU3A 2UZ4A 2W6ZA 3BJIC 2CVPA 4G41A 1PZNA 2C4MA 1ECGA 4BX2A 5JMTA 1KZYC 1SG0A 5DN6A 2I4OA 1BEEA 4AS3A 4CM5A 1PV4A 3W2EA 3KQQA 1QNFA 5T3YA 3BQMB 3NGMA 4R5MA 1WUTA 2PL1A 2EARA 4WZBB 2HRCA 1K98A 2OBXA 2PUVA 3OUZA 4F4FA 5ES4B 1KI6A 1SUIA 5AKJA 2CF6A 3ZWKA 1OB2A 3T3GA 2E4VA 1C7IA 5JUWA 1E7RA 2YHUA 4OGKA 1L8AA 4M53A 4AAYA 1MB4A 3GGCA 2XQGA 3HB1A 5ALSA 2J3HA 2JAWA 2Q50A 5TQJA 2VDJA 4FYWA 3PUYA 5F5XA 1BX1A 4YT2A 4CKWB 1KERA 4DA4A 1JNXX 2QP9X 5FWXB 2WM9B 2G63A 5IYZF 3KJFA 1GPJA 5BR4A 4QT4A 2IXAA 5DIFA 2V0CA 3HCCA 4YCJA 1Z56C 2P79A 2PMCA 3X1WA 2ZBGA 1IG0A 4X45A 3K0BA 4LXHA 4LRQA 4MYTA 3Q85A 3HKDA 3D4OA 1NI3A 4GNRA 4TKLA 1NL3A 2YYSA 4V0RA 4EFLA 1YUNA 4JUFA 4OHYA 1TFUA 2Q41A 3DPUA 4P3YA 2VNJA 3NHKA 5E6UA 3IP8A 3DR5A 3P2IA 3D0RA 5TT1A 2RAFA 1Y6JA 1PEDA 2IC5A 3OZSA 3QBVA 3UAXA 4OXIA 4FJ2A 3E3NA 2HIHA 3M5WA 4HB3A 4HVCA 3GHYA 1T43A 4DR6B 4ND5A 2X2OA 1CQJA 3QU4A 2DPGA 2DWCA 3JRXA 3PHCA 1IB0A 1O7JA 3U80A 1N9ZA 3EEBA 2XZOA 2GJ4A 1Q0QA 4ER5A 3GF4A 1RVV1 1SKYE 3RDPA 2WF7A 3VPXA 4J0CA 3QK7A 2OQIA 2XD9A 2DTEA 1LPSA 1ONPA 2JA1A 4NMHA 1A5SB 1J0EA 2GWRA 2QXUA 3K9GA 1QIKA 1ZONA 3AY6A 3LUAA 4LWOA 2A78A 3RHZA 2GHQA 4TV8A 3SZLA 1PJ8A 3OF3A 5FP0A 3G7UA 3LQ4A 2ORIA 4K9LA 3EXEA 4N8DA 4Y2VA 3NTQA 2XRFA 3MN1A 4DCCA 4N48A 1ISIA 3ZIDA 1A7UA 2N0SA 4EJMA 1DAOA 3FVRA 2WFLA 2P3LA 3AM1A 4GM4A 4G97A 1VE1A 1Y3AA 4CM4A 5M7EA 2ODBA 5BOSB 2B2CA 1NX9A 1P3JA 3B1KA 3D2CA 1NW3A 4JL5A 1E3SA 5JJIA 2R8RA 3MT9A 3WHLA 1P2GA 2C2BA 1JSLA 3UT5A 3PA8A 2VBIA 1RLOA 3D3JA 3D2LA 3FTQA 3K9BA 3ZY2A 4HDRB 4W9NA 1UBOS 4IDQA 2MHCA 2P62A 4JFAA 3NJ8A 4TZKA 2DE0X 5B2ZA 1YV9A 4C7XA 4JI8B 1O94C 3UMSA 4C21A 1J9EA 2XSZD 4DMUB 3QA3E 3H11B 3TAUA 3UAGA 3U44B 2UUBB 2X0FA 3QA9A 4G67A 4CEHB 3IDOA 1PT8A 2ZTVA 4YONB 3RVJA 2VCHA 1E7MA 3G8DA 3GY0A 3RNLA 1CULC 2BMJA 4QQRA 4E30A 1UEIA 3G17A 4ZO8A 3KR0A 1Z36A 1BW9A 2OP1A 4PSVA 3NP7A 2VP4A 3QOFA 5H83A 1BE8A 2IIPA 3MJFA 1DQNA 3EHEA 4LOKA 3C7AA 2PZGA 1BCSB 4RVHA 1HOTA 4U7PB 1ATIA 1UZLA 2IYNA 4RIGA 4EQZA 2A0YA 1MX1A 2Z8YA 1NVWQ 4BBZA 2G1JA 4HD8A 4PX2A 3GLFE 1VTKA 2ZYDA 3IFSA 5BR8B 4II3A 1C3XA 1LF5A 4FM9A 8ABPA 2QN8A 4M1SA 2GTPA 2PZ8A 1SXQA 4KQMA 1Z83A 3AEKB 1T8RA 3CJTA 3D3WA 3PP8A 3QKSB 2XE6A 2NUPA 3OF5A 3RVQA 4BNZA 3AVYA 1XRRA 3GJZA 3V1NA 4EYKA 2GZSA 3A0RB 3OCVA 1VYTA 3U0BA 1BHQ1 1JWBB 2Y93A 2ZWVA 4YQEA 3KQHA 2D2VA 4NBKA 4EX7A 1Z4JA 3FWPA 4RVGA 1OE0A 3WQRA 2AQHA 5HOQA 2CJWB 2FDCA 3KALA 1DBSA 1LQ2A 4Z9FA 1YOVB 3G85A 4AZTA 1U63A 2I3AA 2PQMA 4LJ6A 4Y8VA 4F72A 4CTMA 4JODA 1TCUA 3X1MA 3WNQA 4XUGB 3VU1A 3KUCA 1FL9A 5IT5A 2W5UA 1ZSVA 2FRVA 2HMVA 2QR3A 3Q6IA 4AI6A 3OEYA 2C00A 1GAEO 3CBQA 3PX3A 1H1TA 5B53A 3OQVA 1YCFA 1T1GA 5JDIA 5KSWB 1HMPA 4GECA 2JAPA 3GEMA 3RRXA 3RJZA 3KDAA 1AG9A 5AHWA 1GU0A 1U8FO 2JI7A 1U3GA 4IAOA 1XRSB 5EWMA 1O6CA 1UBLS 5K05A 2Q2QA 5I7EA 1L5KA 3GLVA 3CNQS 4ZAWA 4A8JC 2F62A 2LR0A 5K09A 4QYWA 2GD6A 1UMDA 5KTRA 5G1PA 1JTEA 2FQYA 4M98A 1J00A 1GCIA 4HTAA 2O07A 3WLSA 3RKUA 5L7TA 3LUCA 1IAQA 4TXJA 4A2WA 3DDZX 3PI7A 3PHBE 1KYVA 1P29A 1S9HA 4AWXA 1M0TA 2J32A 3FPLA 3WJ7A 2I7DA 2E89A 4CCYB 2YJ6A 1EWRA 3DOJA 4M0FA 3ESDA 3NM5A 4FNGA 3HO6A 3G9XA 2CFSA 5IJXA 1QHSA 1VYHA 5C52B 2Q3LA 3H5NA 4EYOA 4M55A 1UMBB 4M37A 1X7YA 3JRNA 1S3IA 3RTGA 2I7XA 2VJDA 3N2KB 4EOGA 1AKQA 1E64A 5IKOA 3IDFA 3GEEA 4F1WA 1NBHA 4R7GA 3DKRA 4K6HA 1E4OA 3EXG2 2C3MA 3Q9SA 1OKKD 2P7IA 1T25A 1YQWA 3KKEA 4LE2A 3ZNNA 3H2GA 3WYCA 1QGUB 2R6GA 4Z54A 2B4YA 3T9FA 5CBKA 4YJFB 1FLAA 2QPTA 4INZA 3EVEA 4KWCA 4FHFA 4RCZA 3TG2A 3ACDA 2C29D 1JEOA 4LDQA 1I2ZA 2QTBA 4RENA 1Z6YA 3A11A 3LYHA 1HORA 3OEEA 1GWNA 4ID9A 4RNDB 4UUAA 1Z5WA 2IEAA 2HC9A 2QN3A 1HV8A 4Q7JB 3Q1LA 3EGDA 1F6WA 4TSFD 5TXGA 2AMYA 4GEKA 4RD1A 4ES6A 2F1HA 2B8TA 4EGJA 3UJHA 2ZB8A 2ADOA 3IYLW 1CFJA 2QT9A 3I0NA 1EFUA 2BMEA 4RVOA 1NLUA 2GCOA 1E9DA 1FYVA 3N2NA 3L7AA 3IBSA 4A7PA 1KWKA 2R751 2Y66A 4FLMA 2QZJA 2YXPX 2ZG6A 3UXYA 3I58A 3CUSA 1JFVA 1UMCA 4HNRA 4P4NA 4BP9A 1P4GA 5G1OA 2BFBB 2WSSD 2CFOA 2QYOA 2ZT7A 1B6TA 4FWTA 3JALB 4L0CA 1PQUA 4MRAA 3WGYA 2QBYB 5IBQA 2P68A 2EF1A 5GQSA 5K8UA 4J75A 5JE8A 3EG5A 2ZQ5A 3UWDA 1Z7BA 4Y2QA 4YCNA 4AO6A 5CJ2A 4G9BA 4MS3B 5TPWA 4MVJH 1IXKA 3UY4A 1NYRA 3HKBB 3SAJA 3INRA 5GP1A 4E2ZA 2GMWA 1LS6A 3T5AA 1P4JA 3GX1A 3LKBA 1SWVA 2O57A 2P1DA 2D1RA 4EHBA 1GSHA 3I3SR 1T8TA 1SUDA 2HA6A 3TAXA 1NQTA 2FZ5A 3G2LA 3RRNA 1QIDA 1OFHA 1ORTA 1Z17A 1CNEA 4X7BA 1LDGA 4AO8A 3BFJA 4MYCA 3EGXA 3OIDA 4MVJI 2R7NA 3QEMA 1PK8A 5B3JA 2C7OA 3UA4A 4BQEA 1ORDA 2OXTA 5KYUA 4EFDA 4YGXB 3VR5A 4ABTA 4GW3A 4J0HA 2EX0A 3BJZA 1B6SA 3OZRA 4XIYA 2NU8B 2BF7A 4EJSB 1OFIA 3EH2A 1CYDA 2JD1A 4X8OA 1VHQA 1ZN9A 2DT8A 2GO7A 3K92A 2WYIA 3LCVB 4ILKA 2BE7A 4MCHA 4RU1A 4BNWA 4C7OB 2WICA 4MIKA 3LY9A 4CI9A 2BR3A 3SJBA 1QV9A 4P7JA 4Z99A 3R0IA 2AXNA 2NO1A 3IA2A 5DGIA 3FZQA 1AGXA 2FF5A 2ORWA 4Y9TA 2FW9A 1IOVA 1OHHA 3U7JA 1DOZA 4JI7B 3EVAA 3C3XA 3F9IA 4KMRA 4MDHA 2QPLA 4U02A 3DWIA 3WQHA 3QY0A 4FN4A 3N8HA 3VPGA 1OX5A 1WW8A 3NOVA 3ZCVA 3NB0A 1FUYB 4AZ3B 3ROPA 1D04A 2QMZA 2P5TB 2PUFA 3DZKA 5C4IA 3OPYI 3I72A 5TGTA 4GPAA 4E03A 1CT9A 3DCNA 4PNHA 4RPCA 5JVDB 3VYVA 2H0RA 2MYTA 1QIHA 3WLEA 3HXMA 3KPYA 4MVYA 3E9ZA 2HT6A 2X9VA 2YWHA 3BTVA 4UFPA 2R8XA 3SLRA 3LW7A 2VYQA 2HHJA 1Q74A 3OE5A 2WVGA 4ZQEA 4CT5A 1PSWA 2I62A 4I3FA 3T7SA 3T9BA 1QH1A 3JZDA 5ED4A 3GFFA 2CDCA 1N5DA 2MTBA 3F47A 5FBWB 2VF4X 2C4HA 3PXAA 4LSZA 1KIMA 4UULA 3A6FA 4HS4A 4C2BA 4ZDJA 3GFTA 1H85A 2YOFA 2RCYA 4UUPA 3M5CA 2WUVA 4ZZIA 1KK1A 3FBWA 1I4OA 3QELB 4PNZA 4C6TA 3FDIA 4YUVA 2QI9F 2WOJA 2WUDA 1GCUA 2JFXA 2OFWA 2IDKA 4B3JA 1A77A 2QTWB 3ETGA 3P94A 1LUAA 1V4BA 3CLHA 3SF0A 1WS6A 4HATA 1XTSA 2CHQA 4C0AC 5JZ9A 3WFZA 4LSGA 2Q2OA 1LNQA 3HWWA 5B55A 1X7HA 1RJ9A 1YZLA 3COZA 3K1TA 5CNJA 4B4OA 1LDNA 1WOMA 4Y1RA 4XVHA 1GTRA 1ZGCA 3TO5A 2V6FA 3BXHA 1GVHA 4OIFA 1OBOA 1XRQA 3T7EA 3B3GA 9ABPA 3UBTA 2FW6A 4INOA 2WMDA 4O4HA 1FDSA 2WIJA 5DXAA 3SQLA 5GVSA 5C5EA 4DRXA 1BWPA 2AZTA 3GDGA 4H7EA 3QU9A 5TEVA 3LD9A 3T4PA 5GJBA 2QTFA 2PWYA 2YZ7A 2WAMA 1EJBA 4JLOA 2XDQB 4BMCA 5BYAA 4J7XA 2OV6A 4BV8A 3LFHA 3ZHBA 4C20A 2ENUA 2JKZA 3E2MA 1FP4A 3N75A 1KU6A 1K8QA 3B48A 4PC2A 3E81A 5I01A 2YJ5A 4TTIA 4X54A 5HRUA 1B8NA 2P4SA 1PFKA 4H6WA 2NP6A 2I1QA 2YIDA 3E4DA 3GT7A 5DNDA 2C0CA 3JQ8B 3CRW1 4X90A 4XPIB 2F1RA 4HDKA 4BN4A 1OLXA 5DGTA 5EE9A 3U7RA 4AJOA 2RGGA 4UBOA 5DISB 3MTIA 3QU5A 4B7UA 1CNFA 5FO1A 3A4NA 1A8HA 2V7QA 3KDSE 4U3JB 1KH1A 2FLVA 4D96A 2RGNA 3BXGA 3LIIA 3EIOA 5E7MA 4L57A 4X97A 1FE8A 2ZB7A 3GOHA 4MQ4A 4RW0A 5SZJA 3CXRA 2C3UA 1TKAA 3I04A 1ZK1A 4IDPA 4YDRA 4B3FX 3RC8A 1TDJA 1SB8A 4RPKA 1RHJA 1K3UB 1OAOC 1Q1QA 2PWZA 2V4ZA 3K6RA 4V38A 4WFQA 5B5SA 5LIPA 1YL7A 4DCJA 2E5LB 1QVAA 1YIAA 2B37A 4MCJA 4C03A 1TJNA 4CF6A 1XKXA 1D0VA 1X8XA 2PGJA 3GZNA 1K68A 3PQCA 4GRDA 2HREA 3BH7A 1XPJA 2P9YA 1PNQA 2HA5A 4MLZA 4L9RA 1IZYA 2HNBA 4MV4A 1HETA 5HQ3A 3F6CA 2C2MA 3CCFA 3CTPA 4RWZA 1IOWA 4L15A 4WOJA 1F0NA 2CW5A 4WAUA 5CK5A 5DN6D 5G1NA 3ZHRA 1SKUA 5KQMA 4G5SA 5EHXA 2Q9CA 3HH8A 2FEOA 2GDJA 3DJYA 3DP9A 3IQWA 3LIPA 2EJUA 4REQB 2RK6A 5JSUA 3BRWA 3CS3A 3VRHA 4W82A 4E3ZA 1KZ7B 1YZNA 1XGKA 2PLAA 3DOIA 1V45E 3IAM1 1RU3A 4L8VA 3VSBA 2A7XA 4DLWA 4LHXA 1A9ZA 5CB4A 2QUIA 3V4OA 1MT0A 1SEVA 3PDCA 5A0FA 1OJLA 2QUKA 2R87A 4KAJA 2FOXA 4PG7A 3RIGA 5HM6A 1MF7A 3QBJA 4MV8A 5EZSA 4A0RA 5JD4A 3RIYA 3ZIAA 5BNTA 4LHSA 4J0EA 4XVQA 3LPMA 4PO1A 1N2EA 1Y5RA 1Q50A 3RJTA 1Y8CA 1F2TB 1V25A 5K3FA 2L69A 4NI5A 2NO6A 1TJ3A 4IBOA 3ZE1B 4XZ3A 3RVNA 5KDDA 1NVGA 2JGDB 2WQ6A 1EUYA 3DEKA 3B53X 4XDHA 2BM8A 4DADA 2VJMA 3O93A 4EUSA 2Y2VA 2I4MA 3V80A 3UENA 4LVCA 3EF3A 3FOCA 4UE3S 1HYGA 1X7XA 2PH7A 4RV4A 4ZOEA 2B30A 4BLSA 3DMDA 4B8WA 5JCOC 2H11A 4DQKA 5MN4A 3QEOA 4IVRA 2ZIUB 4MS4A 2JNWA 2ZWPA 2X5XA 3IVMA 3SOPA 3W5SA 3L6RA 1JIVA 5B1HA 1NJ8A 4KE9A 1P60A 2I76A 3HWSA 4G0QA 1XLVA 5B1IA 2WF8A 3WP1B 1BXKA 1U65A 4HZIA 1FUIA 2B6NA 4CQMB 4MUGA 3M1AA 3E7DA 3EGCA 4MJ7A 3CRZA 3AGPA 3MRTA 3OT1B 3OUTA 5KVVA 1UEJA 2VSOA 3PFFA 4XQEA 3WWCA 4EKIA 5LBTA 2H29A 4PO9A 2QIPA 4BO3A 4A2CA 5BWOA 4HNQA 1PFQA 2GHIA 4CL3A 2JZCA 1GPMA 5A0VA 1MRZA 2BZ1A 4L0DA 4A4DA 3MWEA 1NJ5A 3RBVA 4BASA 3WDLA 1JMYA 2PAFA 3D6TB 2O2YA 1NMSA 3DEAA 4C3ZA 4BLUA 1MAWA 4NABA 1TF5A 1E77A 1NC1A 3IEPA 1E5DA 1U1GA 3K0FA 1KP3A 5CVDA 4J0IA 1TAHA 4D3ZA 5BN1A 4KQ9A 4OYYA 4KXQA 2DLNA 4JVLA 3GRAA 1J4AA 2FUEA 4V03A 1WZNA 5CA0F 2PHZA 2VRCA 1UXOA 2ZSUA 3GJ5A 4F5ZA 4KR2A 1C0KA 3NV7A 4IDAA 1SVOA 3HBMA 5A3RA 1FMFA 4CU5A 1IL0A 1NM5A 2OBNA 2BMFA 5T6MA 3VV3A 2YL2A 4RMHA 4CMJA 1W59A 1LPBB 4CETA 2H85A 3NVDA 1NUQA 2X0NA 3C3PA 3R3XA 4HDSB 4V0MA 5EZYF 1CZRA 2OV3A 3LCUA 5I9SA 2R8OA 2PKXA 4N0EA 4C14A 5IF9A 1LKZA 3NC4A 3N0TA 4J29A 4L3OA 3UHJA 2DX7A 1PHRA 1JHQA 3EWAA 3WIUA 1MEOA 4X7RA 1NMYA 5FUYA 2A94A 4TVBA 3VR4H 1EFRA 4BO6A 5E6RB 4EHNA 3QUSA 3FR8A 1E1DA 4L07A 2HF7A 4UDXX 2RGUA 2C7VA 3EFOB 1F0PA 3C5EA 3BERA 2CV2A 4X93A 4G0VA 2C2ZA 1CRQA 2GI4A 2GXUA 3BMQA 4HI0E 5F7ZA 3WGOA 5IANA 1UQRA 3IMCA 3P1JA 1ZQ1A 4GG1A 1X3LA 3OFVA 4RK4A 1J1IA 3DMYA 3F7TA 4HRYA 2OHVA 3DZGA 2PGLA 2WB4A 2X2PA 2YZGA 2JLWA 1EZ4A 1GD1O 2ZUVA 4L72A 1F60A 1TJ4A 1Z7WA 4HLUC 5CXXA 2R0QC 3NBZC 4OA8A 3LG2A 1FSGA 1R5JA 1L7XA 4E88A 2HMUA 4KPUA 1WDWB 1Z25A 5ALJA 4Y2UA 4AP6A 3ZCQA 2O8CA 1Z18A 2FMHA 2IYAA 2ZR7A 4HY3A 5KYTA 2P40A 1JR3D 5K8VA 3IIIA 2AXEA 1CYEA 3T1OA 5LQNA 2NTVA 4ARCA 1D7AA 4PAWA 1O8CA 3S55A 1CY2A 2RGXA 3H86A 4P4SB 4ESOA 1JEYB 3DDHA 2YCBA 4NJMA 4KAAA 4JLNA 1T91A 2H6EA 3D3NA 3NHSA 4KIJA 3IOCA 5DEOA 4BQSA 4DCNA 4TM8A 2D59A 4ZC8A 5BVGA 1V7PC 1KP2A 1VSUA 1AZTA 2HI0A 4WD3A 2JCXA 1SBZA 3EOAI 1QORA 4CL8A 4OU5A 3DBVO 3W5UA 3GN1A 3FYUB 5DGHA 4BIMA 4ZHQF 2C3YA 3GLHA 2OWDA 4IZ6A 1P0FA 3RIMA 4NCBA 3RAJA 1EX9A 1UXJA 5AUOB 7ABPA 5ERYA 2HWYA 3NHPA 3WS7A 1MZPA 2FYTA 3ZNOA 4DTIA 2VPZA 3C3DA 4BAZA 4C43A 1H8ED 2NSJA 3ZCUA 4K9RA 3H75A 3SKYA 1ZVKA 1G0NA 1PLJA 2AJTA 1KKLA 2VK2A 1GGEA 4EQ6B 3GJXC 3UCEA 4BVBA 3LK6A 1UPAA 1XDWA 1GRNA 1JFSA 4O33A 4D44A 4D8VA 2XCRB 4WVLA 5ALZA 1JHDA 4BU1A 3PHJA 2VJPA 4NXMB 1U9IC 1ZVQA 4FX5A 1KAOA 5BMVA 4ZTZB 5E4TA 2XMCA 1WUKS 4ZPXA 4B40A 1SVIA 3FYHA 3TL2A 1GZSA 4FYVA 1CUIA 2X22A 3GP3A 3CVWA 3AL0C 3FH0A 4RLSA 2DUMA 3JQFA 4RADA 5DNAA 2DHQA 3AVQA 4QRIA 2DUUA 1IBSA 3L8GA 4HGQA 3MGKA 3VR2D 2WMYA 2YN2A 5KHAA 1H2WA 2EXXA 4AUMA 2HUPA 2XYPA 2R5NA 2AC7A 2I2BA 2A2ZA 2P2SA 4LZNA 2HUNA 1EG2A 3O1IC 5A7FA 5LZ9A 2R11A 4S1PA 1WCIA 4A3SA 1QDLB 3N0VA 4P58A 3OEED 1FBTA 3G88A 3QEJA 3H9CA 2QU8A 3PNPA 3PZBA 4DNFA 3REQA 2H06A 4NKRA 2CDBA 2FWMX 2WG1A 1OXSC 4F06A 3K0AB 5IT0A 1CUHA 2ASVA 4K2AA 1AX9A 3W8NA 1H8HA 1HE1C 1VLQA 5LQSA 3VVMA 3GGJA 1DAPA 4INJA 4GBJA 5LU9A 3FYDA 4NNPA 2CB9A 4ZVVA 4F60A 4ENWA 4WXPA 1F0KA 2DFLA 4KMSA 2OP0A 5IBRA 4HGZA 1C7EA 1FFBA 5A05A 3RIHA 3COWA 2FSFA 4BQRA 1N2XA 1TO6A 4BAUA 1VLLA 1YB4A 4RHEA 3FA2A 2EQBA 5SY9A 3U4HA 1VA4A 3MWGA 4JBXA 2HQBA 4O2BA 3VVBA 2RG1A 3FAZA 2Q8NA 1W85B 4LRSB 4PLWA 4AU1A 5JYDA 4P86A 4YUZA 3TPZA 4MUXA 1M8JA 1A97A 2VAPA 4FLEA 5TPZD 3T5MA 2CXQA 4UNRA 4TYNA 1TYBE 1OU0A 3OIVA 4TSKA 4EZBA 2O5CA 1MZVA 3R7FA 2KBEA 4Y2JA 4YIHA 2BDEA 1JJAA 5H82A 4EYEA 3VO2A 3JQ7B 1LBTA 2NP7A 4O2RA 1O5IA 4IPTA 1VPTA 5DK4A 4BV3A 3SSMA 4EABA 1G59A 2QQFA 1W35A 1ENZA 3HVUA 3OY2A 5HF9A 1D2CA 1C7RA 2HMTA 2NX2A 2V7XA 2VA9A 2ZSBA 2R4QA 3DUFA 5DBEX 5F9FA 5FWNA 2F4VB 5DBHX 3R74A 4FSDA 4HBZA 5EHIA 4JK3A 2ERYA 2BDUA 1XA0A 4UD2A 3UATA 4HGNA 4JKOA 4LJYA 3GPDG 2EIXA 3ORFA 1XAJA 4HHEA 3OQOA 4OI4A 1CZOA 5ICFA 2W6CX 1OVMA 4CLRB 4PEVA 3TX2A 4AMVA 4DV1B 1VDMA 4D3XA 1A9XB 3KWFA 5EXEA 5DPMA 3L18A 1F1JA 4J1SA 4Q7QA 2V0GA 2I65A 1P1BA 5E4YA 5KQSA 1ZCJA 2C5GA 4FE3A 3BCRA 3JXEA 4LKRA 2ZE8A 2FKNA 5D87A 3SC2B 4BFWA 2P78A 3E5MA 4XR4A 3TRHA 5HX7A 1QP0A 2IOFK 1KE1A 5IJ0B 1II0A 2GYUA 4UNNA 1JHOA 2MSKA 1ZSYA 4R9SA 2ZATA 1P31A 1RJWA 4MTLA 4UVDA 1JHZA 3SBOA 4Q21A 5DTEA 4AX4A 4KKXB 4EF6A 4AUEA 1R6TA 4LVOA 3BSWA 5EIBC 2XITA 1P7WA 4C6RA 1EMDA 3OZIA 5F77A 4AN1A 4G23A 1Q17A 5ICCA 4NG4A 1RWWA 1ZFNA 5F64A 2J3EA 4EY8A 3P2EA 5F51A 4F46A 2PXHA 4K28A 1OR8A 2VRNA 1JFFA 4I9GA 4LPKA 4CG1A 1HYHA 1VKZA 4BLVA 4DDUA 2YJNA 3DLAA 1TAGA 1G5TA 4MVJM 3HXKA 8MHTA 1CY0A 3ZLBA 3FPHA 3KG2A 4WOBA 1SCUB 4IIJF 4EK9A 1M1NA 1PR5A 3A6DA 4O63O 4BQFA 3G2HA 3SQNA 3H9UA 1VJTA 2YS7A 1PJLA 2V3WA 3BGOS 4HQ0A 1G7SA 2X6RA 1QGAA 2IJGX 3ZWBA 2NO5A 3AVTA 2AHRA 1JR3E 1Q1EA 1ODFA 4RXMA 3AOGA 5JY6A 2H9AA 1X3SA 1IXSB 4DN6A 4HDMA 2PNJA 2MSDB 4GF5A 3BSSA 5TV2A 2CJFA 4EF5A 1YDEA 2CCJA 2JFWA 2ILVA 1O77A 2J9GA 3KT3A 2HMWA 1I4WA 1UFKA 3OFKA 4TMYA 1C4XA 3FVWA 2YHIB 3G0IA 2QL7A 3LBIA 3CJRA 3CLTC 3O7MA 2WAOA 4JJGA 4M9SA 4R1QA 3V55A 5A6SB 1RPAA 4GR9A 4RTLA 1ND6A 2RI6A 2QLNA 4NDNE 2ZS8A 5CA0B 4G0YA 5K8TA 3EQ8A 1SUSA 5K3DA 2FFJA 1TEHA 2B5OA 1IY1A 1J07A 3K2QA 1SG9A 4KWIA 1O89A 1VSBA 2G7ZA 2JVJA 4BKQA 2F3TA 4IJWA 3DFFA 1MC8A 2L17A 2AF3C 4O8ZA 4XX0A 1ODTC 5IC5A 4R1OA 4RH1A 1PWEA 1GUFA 5EZYB 3EASA 3QY9A 3BBPA 3ND6A 1A8IA 4NARA 1YCGA 3C1AA 1ISGA 2AFIE 3OUUA 4C08A 2PQ6A 4D42A 3X1XA 1Z29A 3CXUA 4XWOA 2V5UA 3KTFA 5ILQA 4N8EA 4F85A 4DJDC 2AW5A 4GX0A 2R6DA 4LC0A 1ULAA 3UMMA 1CPYA 5EKDA 2F9MA 3URMA 2BEWA 1NYLA 2J9ZB 2RG7A 3U7IA 4F4IA 4JEUA 4XH9B 3RAFC 2BEKA 3WIVA 4N18A 4KNVA 2OZVA 1XRJA 4CF5A 2C2YA 3H2HA 4RA6B 4EFKA 5BNFA 3H7AA 3WADA 2XLBA 2YCLA 3S8YA 2JBHA 2IXTA 2YRFA 2ZJ7A 4K6OA 4LIPD 3N9IA 4R41A 3PQFA 1U2SA 3NC1C 1CRWG 3L7LA 1JJVA 2X8JB 4P3NA 5H0IA 2SBTA 4TXMA 1M33A 2PQ0A 1J6UA 1BD3A 2ZI6A 1YDFA 2AOUB 3K30A 4JR2A 3NEYA 3OZUA 5JYEA 3BICA 3KAKA 5K1ZA 4UDYX 3UWPA 4EL0A 1Y7IA 1ZCAA 1ZIOA 4R1MA 3R6LA 4R51A 5TVKA 4JX8A 1W36D 1Z4PX 3BL6A 4RAOA 4Q18A 3UM9A 4FEAA 4DM7A 2N46A 4GZ3A 5DASA 4FZJA 2BONA 2H4XA 3GFPA 1GCOA 3OZFA 2VSFA 4CG2A 1J7KA 1S3GA 3BFXA 4E1VA 4Q19A 1XN1A 2BL4A 1EA7A 1M72A 2O3TA 2QD3A 3CH4B 2BEUA 1RIIA 3HYCA 4NFYA 5EFZA 4TGLA 4FDVA 3D3KA 1QHYA 1CDEA 1ZGAA 3F1KA 1FY2A 3HYLA 3BFKA 3H1FA 3T3DA 4C4RA 4ZHQB 2XYQA 1OZFA 2OCIA 4WJKB 1B8VA 2UYYA 4PLHA 4XASA 3W90A 4XJVA 2RGWA 2W22A 3BRWD 1N2IA 1UXKA 2WE8A 2YWJA 3GA5A 1JDTA 1B73A 1LPPA 4UAGA 3ML1A 4GLBA 4WI1A 5EAIA 2QTLA 2M6KA 5HM8A 2R85A 4FEEA 2M2IA 4N47A 3ZGZA 3MIZA 1V5EA 1V0JA 1RLUA 1ZS9A 3PF9A 4FW8A 4PBTA 4QEKA 2AXQA 3C3MA 4R7TA 3UH1A 3ZIAD 4LQCA 1M2GA 1T36B 4NRDA 5IWAB 2GEFA 4TM7A 1CFZA 2FP4A 5FHQA 3IEMA 2DFKB 3T9AA 1K2VN 2HO4A 4FFPA 1M2JA 3GVIA 4JGIA 4NPAA 4WASA 5EJ6A 4B3MB 3H4MA 3THYB 4B6EA 2YFKA 1U8XX 1IY2A 2E7ZA 5LQJA 5SYAA 4BMXA 1FYFA 5A3SA 4ZYVA 2RGBA 1DWOA 1QH8B 1M8GA 5K3SA 1EXVA 4MJXA 2IW1A 1QVRA 5IC4A 1SWWA 2WTXA 2FQXA 4WKCA 1Y4DE 1U5BA 1I0LA 1FS6A 2G9UA 2PUCA 1QOQB 1YWGO 2V9ZA 3JY6A 1QR6A 3O7WA 3PJDA 1XQWA 5HE8A 1A50B 4W99A 5LU8A 5AT1A 1NV8A 4UM5A 1JHYA 1Y6RA 2XZDA 4DCVA 5CH8A 2WAXA 1HFEL 2HL6A 5D3QA 3GEHA 3ER8A 1U2PA 4ROSA 2RGAA 5E9WA 1YJAA 1DDIA 2C5AA 4LE0A 1KSFX 1Z3IX 3W9BA 3L7BA 4I5DA 4M76B 3RFVA 4GXTA 2BISA 5FBRB 1DRUA 1V7ZA 1ZNQO 3A1VA 3O21A 4HMQA 2EC5A 2W2NA 3MBKA 4N0DA 4TV9F 3RO7A 2AG0A 4MGKR 1T0HB 1KDVA 5DP1A 2O3QA 2ZIVB 3AI7A 3OMXA 4QODA 4S1NA 1RYDA 4V0LA 4KR9A 1E5QA 4AIRA 4BFVA 4JH0A 4CV1A 1R4NA 2JIMA 4GXNA 4A8HA 4RGYA 1N6PA 5E6SA 5IZCC 2B8EA 4L5IA 4UXJA 5K51A 1KTVA 3JZIA 3DDCA 2FZVA 1ST2A 2QG9A 2HHAA 2ZJ4A 1V6AA 2Y77A 3MAJA 3MTDA 3O2JA 1ZR2A 5FBLB 4ND8A 3QLVA 4FFLA 5KTKA 5JV5A 4RQAA 3HP4A 2DC1A 4D0LB 2OHIA 1WUIS 2I8AA 1HZZC 3LHFA 2C7GA 2H08A 5HIMA 3RAPR 1NXWA 3NKLA 4UEOA 5F7JA 4QU9A 3ND9A 2ZIGA 4ZZ0A 2ZZMA 3PLNA 1VE9A 3ZU4A 4QDKA 1ULBA 1EFCA 1ZM7A 4KN6A 3UMJA 1SPBS 2X0EA 4JYAB 2IOFA 3KP1A 3ROXA 4DCUA 4D6YA 3ME5A 4ZJPA 3PFKA 1KARA 2OVBA 4O4IB 2ZUEA 2DR0A 1TK9A 1NU8A 2PZFA 1KI1A 3X1DA 1X7ZA 3A25A 3O83A 2VJQA 2O3RA 1M6VB 3GLRA 1VG1A 1T5BA 4DSOA 4RIEA 1PL0A 1JIKA 2WJVA 2HRQA 3AVWA 1RZVA 3L4BC 2V9CA 3A3PA 3IMGA 2W71A 3QE3A 2DP4E 2J5BA 3TL3A 1YFLA 2V7UA 1KFCB 1JIQA 5IKEA 4Q02A 1HNXB 1GR1A 3FYUC 1GNQA 3RABA 4Y7CA 4HDAA 3T15A 1B74A 1LTHR 4I50F 3IOEA 2YWBA 4ENPA 1HQCA 3ABOB 3FMGA 4LKOA 5G0TA 4XVCA 2I3GA 5KOHB 3K70D 3IPYA 3HLTA 5EI5A 2EHJA 1QFMA 2EZ4A 1I94B 4B32A 2E21A 3HEAA 2Y1EA 3WHPA 3DL7A 5C1DA 1L7AA 3NWPA 3KAQA 1K27A 4RELA 3I09A 2D74A 3AB8A 3RANA 2XQIA 4MV1A 4PE5B 3SLGA 4QJ3A 2D13A 4H08A 1YR8A 2EKLA 4BV9A 4TWJA 3N3BC 2XVYA 1V8ZA 3KPVA 2WWVD 4BUZA 3PIIA 2PWPA 1XJ0A 3CA8A 3I6BA 3PNQA 2HA7A 2K4MA 1XI2A 2QYSA 3FX2A 3K31A 1C8VB 3FVTA 4K0RA 4M1QA 2HJVA 2VBCA 5GVRA 3LPDA 2NNWB 4HYQA 2D2EA 5I4KA 4JIMA 4B1FA 4BX9A 2QI9C 4GPBA 3V4PB 2LCQA 4K9KA 5L53A 4MV0A 5EE1A 3GGGA 3EXHA 2YFHA 2HM7A 5EQJB 1QHEA 3FTPA 2H5JA 1Q1AA 5JPCA 2PZBA 4YUAA 1Z82A 3DQQA 1Z4QA 4P83A 1YR9A 2CK3D 3FUWA 2C4KA 4K5QA 1RZRD 4Q9AA 2DH5A 3CWQA 4JLAA 3DMRA 1PI3A 5KAPA 2A3NA 1PEKE 3BQNB 4WY2A 4GP6A 2FR1A 4M22A 1XD2A 3AG6A 3EUAA 4IR7A 3RUHA 5BN3A 2HHHB 5BSRA 3GLSA 4GYWA 4XYEA 3BFVA 1JI3A 4YGYA 4CN8A 2J0EA 3PC6A 4UD6A 2EX1A 3TLBA 5HTOA 3A36A 4GU5A 2ONJA 4KXMA 3PUZA 1JAZA 1E4EB 1LA2A 3REFA 1G3RA 4FFNA 5J9FA 2H1OA 2WU0A 1GZVA 1PNTA 2GM9A 2LE0A 3Q87B 2VT6A 4KSBA 4AY2A 3KIPA 2GEKA 2IHUA 4LSMA 2B83A 1PV1A 3BS4A 4PSCA 1CC1S 1U3TA 2C2XA 5TLSA 2A0KA 2EG5A 5EMHA 2JFNA 1UBCA 3SR3A 1PZXA 4Y0NA 3U7HB 2H1FA 1JB1A 3PFBA 4YACA 2WWTA 1BH6A 4Y1EA 4QULA 1DZ3A 2A9FA 2PRKA 3DHVA 3ABQB 4V2IA 1G18A 1RQNA 2B92A 1R0XA 3DE5X 3BXOA 4OQZA 4ZI7A 2IXEA 3AEZA 2OTCA 2DKFA 2QTCA 5C3UA 5E2AA 4EO7A 3IT2A 2VZLA 1OXKB 1TMKA 3MW8A 4RYLA 4CKXA 1QGDA 2NUAA 3I53A 4IFTA 2RC6A 5IVKA 4TVOA 1OV4A 3PFIA 1VG9B 2NVWA 4EP1A 2QP4A 2IHJA 3HNOA 3TI9A 1NUAA 5DNEA 4ENUA 2OYCA 1QQ7A 2PPVA 3IERA 2VZ9A 1NLYA 1C14A 4F56A 4ZOAA 3LY7A 4RVSA 4G65A 2Z5LA 2XYHA 4WNAB 5AOBA 1KY2A 4Z4CA 3OLCX 4MVCA 4BVLA 3AR6A 3AJDA 1TUGA 4YJ2A 1BWRA 1W1UA 1WDMA 1R50A 2X76A 2BGWA 4FOSA 3FNGA 3VMMA 2EIHA 2BH2A 4BNYA 3QXXA 4W1SA 1ZW1A 4I6GA 4IQ0A 4YIKA 1EFLA 3BE6A 1CY8A 1H4TA 1QZTA 3KYDB 4GS5A 5D3KA 4YMLA 1OI3A 1WKCA 4GPTA 5D7NA 5ALMA 5FBHA 2C7RA 1MO2A 4NCJA 2XA1A 3OQJA 4CM9D 3OECA 3C3AA 3L0PA 3LWBA 2P9BA 1U9YA 2FCRA 4L16A 3OFNA 4PLZA 1HPLA 1JU4A 3GLIA 4W7SA 1T4GA 1L0BA 1X2EA 3EZLA 3LPCA 1M2FA 2JBAA 3LRTA 2ONZA 2PX3A 3CB4A 3JR3A 3PBKA 4PG6A 2I0FA 4XSGA 1EX6A 4K86A 1KRHA 3C24A 4JLUA 3TB4A 5FPYA 5CCBA 2G1UA 3DLTA 3HFJA 5KWSA 4TS3A 5L4NA 2PKRA 3PDHA 3TFOA 2FWIA 1YQQA 2CLKB 1T2UA 1SKYB 2G07A 1V5IA 4JJ6A 3JWIA 2G9ZA 4QUBA 2GBLA 3SD7A 5JBQA 4DBVO 1L8OA 2IYFA 1IC6A 2WWGA 2X41A 1LZKA 4FHCA 1OILA 3WRYA 3MIIA 3KHTA 221PA 2VP5A 1D7OA 2Z6VA 1H3NA 3HJHA 4NPHA 1MAHA 4LF6B 2Q7DA 4E2XA 1DNPA 4HYTA 2HSEA 3ENQA 3PDUA 1F4VA 4NV3A 3HFGA 1Z0UA 3EA0A 5FWYA 1PRYA 2AQIA 2GESA 5I7UA 3TM4A 3U61B 4BVGA 2JVKA 2IEBA 1KPHA 4H3KB 4F4DA 4DA8A 1F8UA 3U60B 1NI5A 1R9MA 2D0OB 4WMLA 3TD9A 4Q3LA 1RRFA 2W2XA 3MSCA 1ID1A 2PEZA 2G9RA 4J1TC 4EBBA 4QWMA 3QF4A 2ANCA 5A4DA 3ZVNA 1Y6FA 1E2EA 4EHIA 2FEMA 5K0CA 3A7EA 2OXEA 2HBYA 4V0ME 3UIEA 2DGDA 3QFCA 1JLHA 4AZ0A 3RQIA 1QPBA 3ANLA 4C3VA 1PIWA 1A7JA 1QIMA 2NVBA 2WD9A 2Y1FA 4CR6A 4E7OA 4G3XA 1UXGA 5LVAA 3M9LA 2IHKA 3KLMX 2H3EA 1XN4A 5AJVB 2YMPA 3WGGA 1CJCA 1NVKA 3T1HB 2Q45A 4QDOA 2XUIA 3ANNA 2II6A 4LRXA 4KXLA 1Z6XA 2A9QA 3DJFA 2PSHA 2ODPA 3K6KA 4G8DA 3GMDA 4K87A 2IBTA 1HRDA 4GDFA 5JWHA 2WE7A 4BO9A 4L8LA 4C4SA 2NT3A 2H57A 2CSXA 2F3SA 1GU1A 3RS4A 3N2ZB 2DPHA 4FIZA 4HUQA 4M1MA 5AHRA 5JY1A 4N03A 4K3VA 2AYXA 4KVAA 1FQWA 3OKFA 1P1JA 5KOYA 3LXRA 3H7IA 3P27A 4AG5A 4Q1DA 2GVZC 4E7PA 5EP1A 1ZAYA 4CZ2A 1J97A 1JG7A 4Z4QA 3DV9A 2BHNA 4GMFA 1SVSA 4KE7A 4Q9IA 3T5GA 3TK1A 3UPDA 1DJMA 4V0SA 2IYEA 5CNKA 3VU3A 2CCKA 4XGNA 2DH6A 1RS0A 5FTJA 2J4FA 3DE4X 4MO2A 3VNSA 3BMCA 2ZJ5A 4CLOB 1XVTA 2B8JA 2RK3A 2OGSA 4ZQBA 1CUAA 1DKNA 3FPBA 2R66A 1XLTC 3TNFA 3E9EA 3GDFA 4Q37A 4ZU3A 4ZVKA 2IZ1A 2GXAA 3WIEA 4Q12A 3T94A 2Q5IA 1UPTA 1VJGA 2EZUA 2XMBA 5AM4A 1A9YA 1GNPA 4N6GA 4TTVA 4U1RA 1KMQA 3TMAA 4DIMA 4Y0AA 4M7WA 3P20A 5TX7A 3F4KA 4FNOA 4FBLA 2PX6A 3L43A 2Z5FA 3MMSA 3L79A 2EZ9A 4D6PA 3PG5A 4WINA 1F51E 2GZAA 4RAQA 2P9ZA 1F17A 5CG1A 1R0RE 5H3LA 3D43A 3ZW7A 2NVUA 1FZTA 4RZ2A 2R47A 2DBZA 3GRUA 1HDZA 1T1SA 2O1SA 4JX9A 1KVUA 1PYGA 1RZUA 4EA6A 1O94A 4D97A 4WK6A 2FQ1A 3P2YA 3PB3A 3ZGVA 16PKA 3BGIA 3NJRA 3FMFA 3GLUA 2GARA 2AOTB 3BH6A 3E9QA 4MA4A 4LXGA 2WZDA 1X7WB 1DOAA 3R7WB 3PKZA 4ZCTA 2B1GA 2OGTA 3AXSA 4WA7A 3O4HA 3VTZA 1EU1A 5AM5A 1GNLA 3ZHUA 3RYFB 4IG9A 4HAYA 4L7QA 3T9EA 1UFVA 2VJLA 3HM2A 5BY2A 1Z6PA 4QPJC 3LM8A 5JXJA 4R05A 3WJ2A 4JJFA 3CLUC 1O2DA 3OU6A 4LK2A 3B2QA 1REQA 1YR7A 4URUR 1T3LA 2CLEB 4HWRA 5EVCA 4BBAA 2XR1A 3P7MA 3G9QA 1FDTA 3DFKA 3OPQA 3E4CA 4R4JA 1A4UA 1Z35A 3MT7A 2C07A 1U3DA 4K9DA 4KQWA 2AL7A 4W5JA 2YRWA 3MINB 2VYVA 2PH3A 4MP3A 3CZ9A 4UHFA 4DJEC 1K6IA 4CQLB 2G06A 1YBMA 5LB4A 4MYRA 1BX0A 1PU2A 2QZ9A 1D4FA 3D8UA 3FGOA 4IUDS 2DERA 3ZS9A 1BVHA 5CH5A 3N2GA 4PPNA 5J23A 4GOKA 5EC8A 5GAJA 3SNKA 1PD0A 3DLCA 4B2YA 4ZYUA 1R0YA 5KYWB 4I1IA 5EESA 3ZH2A 1VM6A 2JLZA 3BA1A 2BJWA 2JW5A 2BSXA 3AXTA 3NFRA 3OD1A 2R6FA 4WZAB 3U9LA 3NAMA 4CR8A 1JBQA 3C3CA 2AA3A 2G28A 5AK4A 3UFXA 5JS7A 3UPTA 2GO1A 2KX7A 5JIBA 2QM3A 1CUFA 3U3MA 3DAOA 1EVYA 1LPOA 5EL0A 1LI5A 1U5CA 2J1LA 3K6JA 4LHYA 2QUJA 1A2BA 5GOTA 4REMA 4D8XA 2P6UA 3C5HA 4LDJA 1YVPA 3NEPX 1ML4A 1RPZA 1NRXA 4AJ1A 4YCDA 3ZU6A 1QP4A 5F5LA 1EP1B 1SC4A 3WMRA 4A8JA 3SEZA 4DSUA 2Z3ZA 1BEZA 1FTQA 2Q5QA 3QUQA 3DNMA 4Z5XA 4AS1A 2OOKA 1U7HA 3MFQA 4ON9A 1KMNA 4LSWA 2VI5A 1E1CB 2PXXA 1Z0ZA 4OIMA 5FUVA 2UUPA 4U00A 3AR9A 1Q1NA 1SHLA 4ZYLA 4RFSB 3K32A 3U56A 1FFGA 1HLFA 3UW3A 2DKNA 3DMHA 1Q20A 2YXEA 4OKIA 4EMTA 2VDQB 3TCNA 2ESRA 3HWX1 1M2OA 4YCMA 2AFHB 5MN6A 4KLCA 2P6MA 2R2AA 1RCUA 3LDFA 3QVLA 4R40A 4BO2A 4YMIA 1OH8A 9MHTA 4ENQA 1JAXA 4EZIA 5E1MA 2GN8A 2TMGA 5F33A 1HNWB 2O3JA 1CJBA 4I4LA 1CV2A 1H0KA 1J90A 5B12A 3A1CA 3RS5A 2FSPA 3FROA 4C0XA 1ZKDA 2MIIA 3S1SA 2ZBUA 4O1HA 5DLDA 1ZUD1 5LA6B 3AEQA 2VP0A 2H07A 1I8TA 2F3QA 2QN6A 4O2LA 4AO7A 1O96B 5FUWA 4TMKA 3U62A 1V1JA 1SBYA 3LUBA 5IDWA 5LYJF 4RJ2A 1QRUA 1KMHA 2GT1A 4FXPA 3UEOA 4CHTA 4OHRA 2FFAA 1ADFA 1KQFA 3ABSB 2VDWB 3DL4A 3A1TA 1H42A 1I6MA 2ODNA 5AVRA 2DULA 4DR4B 3PNBA 4MUHA 5L45A 4JJ4A 1FC0A 2VDNB 2CF5A 3D6FA 4PN7A 2NQ2C 2W90A 5FOQA 4G25A 1MVOA 1WUHS 1EJ0A 1M6WA 3F3KA 1LLDA 3UWSA 1MGOA 3MTEA 1VL5A 4HLDA 2C1XA 3NT5A 1WW2A 1YU6A 2QQ5A 3IX7A 5FUXA 2ZJ8A 1G5RA 3TIIA 2RDMA 4B5LA 3OQ6A 5F98A 1JIIA 1KF0A 3HS3A 3QU7A 5C0OE 3DE6X 1VLJA 4W8HA 3A2KA 1N3LA 2HXSA 4B74A 3L84A 4A8PA 3IH5A 1IQRA 4F5EA 3MZ0A 2TYSB 4PRLA 4XWKA 3PWTA 2ZAMA 4EGFA 3OBIA 4XW2A 4DIKA 1WU7A 2NU7A 1WDTA 1TVKA 4YP9A 1R0BA 2JFYA 4O08A 4UE2A 4AG6A 2BM9A 1Z6TA 4QATA 3S40A 3G9ZA 4FEYA 3NMUF 1VMEA 4TL8A 2G70A 2XYRA 4K9SA 1XSEA 3L07A 2RBKA 3A1WA 2Q6LA 4C4ZA 1EWQA 3FUVA 4HDOB 1RQ2A 1PHPA 2CBGA 1NQOA 1PR9A 2QW8A 5AIBA 1C9YA 2HQRA 5DYWA 1V16A 1SCBA 1C3LA 1W2WB 3DW3X 5IDQA 1N2GA 1OX4B 3NOXA 3CF0A 2X0JA 3OM0A 3SFTA 4E51A 3DC2A 5EMKA 1W8IA 1AKVA 1UXHA 3A1UA 1C3OB 1QVZA 2P35A 3HKCA 2W2PA 1B8UA 5EN4A 3DSRA 1J49A 5DEIA 1RI2A 5CPBA 1RQLA 4JGBA 5EKXA 2GEVA 4IEEA 2FW1A 2J7PA 1AA6A 1MXHA 2QM0A 2C9MA 3OJOA 1QANA 4H3SA 1BDJA 1NY6A 2CUKA 1XRPA 1D1TA 5AH0A 2UUAB 4MA0A 2IP1A 4FR5A 2GGSA 2OV4A 1ND5A 2IU3A 1J9GA 3PSHA 4KJZA 1J0DA 2OCDA 4UZSA 4B2LA 1A69A 1T3ZA 4EGQA 1LDMA 2LP4Y 2O8DB 3DT6A 1X19A 4YDQA 5KSYA 1M5TA 4LNAA 2BGNA 2C7QA 3TLCA 1V8DA 1G2IA 1M76A 3IT0A 1MPTA 1ZBQA 3RASA 1XDUA 2HDNB 5JISA 2WKQA 4L4RA 3ZXYA 3CH5A 4Q9HA 1TKBA 2SNIE 4QTZA 4LXXA 3V7FA 3U7QA 1USIA 1KVSA 1CERA 4ATNA 4H2DA 3T1QA 5ILOA 1ZICA 1Z12A 1XD8A 3TVDA 4EFMA 1WX1A 2VPYA 5B1YA 4P4UA 1ZOPA 4L74A 1VRVA 1R8YA 1RQGA 4ID3A 2ZI7A 1NVDA 4R0VA 1SA0B 2N1MA 3EVCA 4HDNB 3HCRA 4J9UE 1U6JA 1N33B 1JQBA 4J2OA 1K3FA 3PSAA 4UHJA 3JZFA 2HWUA 4FCCA 1MIHA 2AHOA 2QK4A 4QOEA 4FWIB 2WMNB 5IU6A 3K1AA 3TD6A 2ECFA 2HDWA 1K5GA 2ECKA 2XX3A 3H0KA 3MS2A 3T4EA 1ORHA 3U1TA 4BFTA 3K9FC 3DLBA 2IW3A 1CJSA 2AJDA 4B3DA 3AU9A 5D6NA 1KDTA 4KSCA 1MIOA 1NVUQ 1M5UA 2GJKA 5DYTA 4ENRA 1E9VA 1NRIA 4IRXA 4ZYXA 1KFJB 1EM6A 3JV7A 1W4AA 3KXLA 3WY9A 1GG5A 1A3CA 3CF6R 2DBYA 4ACAA 1YACA 1BMQA 4A92A 1QFXA 1DCFA 4BE4A 3F7MA 3UT0A 1K9VF 3D6UA 4EHLA 3MB8A 3GDOA 4MA5A 4HX2A 4OH7A 1M2VB 4WNYA 4JDUA 2QEQA 3UG7A 1QG0A 2JPDA 4OUKX 3DVAA 4MW1A 4PF1A 2ZTUA 3NTUA 2XWSA 5CAEA 1THZA 1BCRA 1Z5OA 3JQAA 3KNZA 4WLOA 3S70A 2AC2A 1YZQA 2Q3BA 1X1AA 1HG0A 3DHEA 4P0TA 5FR2A 5CDFE 2WT4A 4ALNA 3C6ZA 2IZ5A 3FCEA 1HL7A 2BY4A 3E27A 3GCGA 2FFRA 4R3NA 2P4EA 2PGAA 4H59A 3LOQA 2C78A 3BZUA 2CCGA 5I9IA 3L06A 3AVXA 2JGIA 2P5UA 4MW5A 3S2UA 2ZTSA 3H5TA 4DLXA 4F6LA 3Q2KA 3OLWA 4UAVA 4NHOA 3NRCA 3AY0A 2XB6A 2M6RA 3QPAA 3SJUA 3UMFA 5B7NA 4WY8A 5KTTA 1BHO1 1MG0A 5KC9A 5DHSA 4GKJB 2ZYSA 1YZKA 3K73O 4OAQA 3RVKA 1VPLA 1F2DA 1HDEA 4RHXA 2PS1A 4DDMA 3DE3X 5A4MS 5IHXA 2LTAA 4R1UA 2WBLC 1UP4A 4WADA 4WZBA 2D0PB 4DV3B 3KO8A 4MWCA 5DT2A 3RYIB 4OATA 3DKKA 3IL2A 2PYZA 4JXXA 4B44A 1MGPA 3DZBA 2XECA 4GLJA 1G5HA 4LG1A 3RODA 2EJTA 3H42B 1XP5A 2P2NA 5EA2A 1VKJA 1FW8A 1T2DA 2RHBA 1C2YA 4FYYA 5HVNA 4CKWA 3UH0A 8AT1A 4M0MA 3TBFA 2PDAA 2PIDA 4ICIA 1RM5A 4RY8A 1W9MA 3AJEA 3TPFA 3QKIA 2HA2A 5HKBA 3G0BA 1Y9DA 3BWMA 1PJAA 4AKGA 1OLSB 3AV0B 4PX5A 3JYHA 2YZMA 2VXYA 4I5FA 4MZDA 4F3CA 1C9DB 4G07A 3SZMA 3AFNA 1ZNZA 2JH3A 3PD0A 3P71T 1YIOA 1K3TA 2V1XA 2YJ3A 3O31A 1PCXA 1FTGA 1JQLB 3O8QB 3R3UA 4LC9A 3TE6A 3QWBA 3W2FA 3BUSA 3E9NA 3CT4A 4H16A 4FB4A 5LWQA 1Q7TA 3QXJA 1L3CA 1Z2OX 4G01B 2EEZA 1NW9B 1O9GA 1VIMA 2C04A 4HCJA 2VNKA 1YRBA 2PUTA 3DL2A 3EJ6A 1NGSA 4YJHB 4RL4A 1DAFA 4LBVA 1U3VA 1P61B 5ICMA 1P73A 1JQ5A 5HIJA 2QENA 1KH2A 4OI0A 3UUEA 2ZSEA 4ZKDA 3AW8A 5JXWA 4LBYA 4LY3A 1E9RA 3N0RA 4E5SA 3FSGA 1DX6A 1JU3A 3HXLA 3QPVA 3HTXA 2FGKA 1H5QA 1WDLA 3H9JA 3K4HA 5JCOA 1A9RA 3FIUA 1YB7A 3EZ6A 2MR6A 4D8WA 1NW8A 3Q3GE 4UZFA 2FPSA 1T9KA 5BOSA 2BGRA 5LLDA 4EB3A 1MJFA 3ROQA 2IY9A 4I9NA 5HBRA 1JJBA 2ONCA 2QMQA 3SPXA 4TWZA 2LD4A 4ETWA 1CG6A 2IWRA 2YOGA 1EINA 4S1OA 1ZZEA 1IHUA 2G17A 4HDRA 1I7PA 5TJ9A 5LYJB 4EW3A 4J4TA 4IDBA 3VJKA 5J2TF 3I9KA 1Y9JA 5BN5B 3LGXA 3B3QA 3DEHA 3WC4A 1A98A 1U2QA 1V2GA 2LRHA 2R97A 3H11A 4OH1A 3U44A 2WWYA 1ZK3A 3OE7A 3FGZA 4TUYF 4XWAA 5E9QA 3QVGB 4R31A 1NYQA 3COSA 1SJ9A 3VI3B 2OGWA 1GEEA 4JELA 3QYJA 2ZUWA 2B4KA 1QYVA 1ESZA 2XCIA 3GNLA 3KR9A 3KM0A 3PYMA 3QX9A 3RKSA 3UT6A 3WX0A 1V5GA 4CKEA 2YOHA 5ICGA 2D0DA 3THRA 4CU2A 1V35A 3L7NA 1NAHA 4ER6A 5BV0A 1KWGA 3ENNA 3EXIA 3NLLA 3N8IA 1UQTA 1ULZA 4WESA 3OPVA 4BRWA 2IHYA 1DKUA 4BPRA 4JT8A 1LS1A 5CEJA 3ISJA 1SGWA 2QUAA 1VP3A 3NDJA 1ADGA 3ON5A 4HSEA 5JALA 1WVMA 4DC0A 3HUFA 3VYRB 4EB8A 1R0ZA 5JOQA 3RFXA 2PS0A 3AEKA 1OFTA 3CV3A 3QV2A 1NQXA 3A9WA 3QKSA 4P81A 2VIIA 1E2DA 3WMEA 4EATA 3T0GA 3B38A 3N2LA 1TCVA 3G7NA 1OU4A 1FNCA 4ZVRA 3FPFA 2XDYA 4ZK6A 3H5IA 1AKYA 4MDEA 5E95A 5KSOA 3VR3A 4WOKA 2GPAA 1ZJWA 3DT8A 1K4YA 2FJPA 4R8VA 3OEHA 2DJIA 3A4MA 2CJWA 3CX3A 4ZT2A 3NVAA 3BILA 3RBXA 1YOVA 1PBTA 2EVWX 2NXNA 3CISA 2NOAA 1AZLA 4PC1A 1ZL2A 1Y6ZA 2IEZA 1FCJA 3T5CA 1KOGA 4GSKA 4LMRA 5E1DA 1X80B 3UQYS 2IYRA 5FF9A 4ETMA 4TZ6A 4H1VA 5BUCA 3P9KA 1W0KA 3RJ5A 2AB0A 2O2DA 1L7NA 2VG8A 2QSZA 2PJRA 1RI3A 2YTZA 2VYVD 4EITA 3T3OA 2Z30A 4UPDA 3AR8A 3R7SA 1GP2A 1S96A 4F86A 3HVIA 2OCKA 2J3JA 4G9GA 5IK2A 5EMLA 2NQ8A 1A9SA 3EIQA 2W6PA 2DWPA 2G83A 2ONKA 2FPKA 3O3NB 4PYOA 4QO8A 3R3ZA 3X1KA 3ZQKA 4EGCB 3ECCA 2UZ0A 4XGIA 2WDZA 1FU4A 1GUAA 1B15A 3CKKA 3IXMA 4YROA 4ZZ2A 1BNCA 4QGSA 3FMVA 1JLRA 4YC7A 3LUJA 2E6UX 4TVKA 1XQXA 1W5BA 2V6BA 4ARIA 2D5LA 4H4CA 4ZARA 2BUCA 3FPSA 1V3VA 3GLGE 1XYYA 2BGJA 1LVHA 4W1QA 3ZV7A 5DSXA 2JFGA 3OX3A 4OQNA 4P9NA 1UMBA 1VDZA 3EZNA 4RHTA 1Q7GA 3A14A 3HSKA 4GE3A 2W43A 1Y1TA 4F4JA 1EVQA 2VHQA 1NLZA 3N2KA 4MMZB 3RHSA 1XALA 4P3XA 4ARZB 1V3UA 2OHFA 2XLCA 1RAEA 3KKLA 4HB0A 2Q7OE 3SY8A 3UV3A 3HLKA 5JW6A 4KO1S 1GAQA 3Q3CA 4U6NA 1QGUA 1RRMA 2GJ9A 3OJ0A 4LQLA 4YJFA 2Z4RA 1A8SA 3PKJA 2JI8A 1S01A 2WYOA 4PQGA 1CKEA 3EGOA 5D5QA 1XNRB 3JAKB 3ZCSA 1G9XA 4BUJA 2J3QA 3PJFA 4LECA 3OM8A 5AJZA 5BSWA 4GBED 2IIQA 3TR0A 1ITZA 4LN1A 2RB4A 1U9IA 4PHTA 4YI5A 1BX3A 1BVRA 1TQ4A 1GG9A 3QX8A 4Z8XA 4AVYA 4Q3CA 3D1LA 2BGKA 4MVXA 3BGDA 2CLFB 1R9JA 4EO4A 1MOPA 1MA3A 2H48A 2QN2A 5BQOA 2W6JA 5TJHA 1ZH2A 3L5KA 3VHLB 7MHTA 3N8NA 1CUDA 4PWZA 3ASVA 5FNVF 5I48A 2HK6A 2ZRNA 1TKCA 1R8XA 2N3ZA 1Z9BA 1F4PA 3E1KA 1PJBA 3LPNA 2VUHB 4QVGA 5EUMA 5IMBA 3SBEA 1SVWA 3IVCA 2BFBA 3H2SA 1PFWA 5BSMA 4WFKA 1QRAA 1AKNA 2DPMA 3LUDA 3WYEA 2VCYA 2I6XA 4Q9DA 5JCJD 1JSRA 1P18A 3IKVA 3EYWA 3K9LA 4JLJA 9LDBA 2QBYA 3JPYA 3MUEA 5E0OA 2VHJA 1TQ2A 4FJ1A 4WA8A 1KYTA 3L04A 1D9ZA 1U7DA 4MS3A 3EZYA 4ARUA 1IU9A 2WVHA 5AKGA 4KO4S 4IMJB 4RF4A 1N4AA 3QHPA 4PIMA 2DY1A 3CH6A 4I4NA 2P0EA 4HWKA 1Z4LA 2DCMA 4KIWA 5EQFA 1J09A 3IURA 5CP8A 2VXCA 3FDXA 1V6SA 5BR7A 1MB3A 2NLOA 4D98A 1PJQA 1PJ3A 1U8AA 3EA5A 1MO4A 1R5BA 2Q8QA 2V45A 4MHOA 5JAHA 1W30A 2QAGB 5GJWC 5P8WA 5JLAA 3KQUA 1VL1A 2ORED 3VHQA 4BQPA 3B1YA 2H59A 1P72A 2HRBA 5THQA 5LL6P 1QPZA 2Q7XA 2GS9A 4GUDA 1G3QA 1ZCZA 2BFNA 4IJUA 2NU8A 4EJSA 1WD7A 1RRGA 5LLTA 3IR7A 3RWOA 2F3PA 1D2RA 1U2RA 4C7OA 2FEKA 2XV1A 2YHAA 1KYYA 1YA4A 5KYGA 1F06A 3PUKA 1TI7A 3DFMA 1AXRA 1LFDB 3TNDA 5B6IA 2OC9A 1BDMA 5KTSA 4TS9A 2FSSA 4IIXA 5CNIA 4JI5B 1XTPA 1ZC4A 3W9UA 4OAPA 4DA6A 3KJNA 2A57A 1N25A 2HSWA 2OZEA 2PKQP 3P97A 5B1EA 1DIGA 2FRDC 3IJEB 3V8RA 4BNFA 5KUTA 1P5RA 4QAJA 5ANRB 5TQ2B 4S35A 4AZ3A 1G9SA 4CXMA 2Y4OA 2IYQA 2ZVPX 5LP6A 4UVEA 1Y48E 3L0ZA 5JMWA 4XB6B 1ZD8A 3GEPA 3DCYA 3HJRA 3TJRA 5DYGA 5JVDA 1YXMA 2X8BA 5E3JA 2XH8A 2RJOA 1T6NA 2ZIEA 1WD5A 2GTIA 2OILA 1UBTS 3R23A 4KI7A 4O2AB 3P0FA 3X44A 4YV0A 4TWRA 1EWYA 1VSTA 3VSAA 3D1JA 4NVRA 5HGXA 2OFFA 3C8MA 4CDNA 4R69A 1CVIA 2AFIB 3STWA 4D1YA 1O97D 5EXTA 2WMOB 1TA4A 1ZD2P 4ZT7A 5HE9A 3EODA 4BC1A 5F9HA 5H1YA 4HXFB 3ZE2B 1MMFB 3QOYA 1G291 2X0RA 2JGFA 1M73E 3BK1A 3ZXXA 4TWAA 3IIKA 5LXTF 1KAHA 3VR4A 7REQB 2ZYTX 5I9LA 4GKVA 3QELA 5LMUB 1QIFA 5D85A 2NUBA 4I08A 5CXQA 3AFMA 4TTAA 3JSAA 1D4ZA 4NE9A 4WLVA 3TWOA 3V46A 4QG3A 3IHTA 1EE9A 3ETLA 5FADA 3RSZA 4DMLA 4CIVA 4CRWB 4PM4A 1L5RA 2F8SA 4YRSA 4WKNA 1PV2A 3FR7A 3HXPA 1G42A 3AP1A 4LBZA 1O54A 2IVZA 3IAHA 4EW6A 4XB1A 2ID8A 1XELA 3WMWA 3LS2A 3FPCA 5G2OA 2EP7A 4MXDA 4I5IA 2JA2A 3WK4A 1B1CA 2BRUC 3DTNA 4YCSA 1ZXLA 5BQ5A 4QHTA 1PBNA 4R6WA 5IBCA 3C2QA 4OBXA 1E8NA 3ONNA 4D3SA 1CS4C 4OQMA 2WR8A 1QMGA 2VYNA 3VI4B 1D6NA 1LSSA 3C4QA 3JQGB 4TUYB 2PUGA 3O0DA 5CLHA 4CEJB 3ICQB 5IRCD 2I4TA 2CL0X 5CFPA 5MDHA 1IHOA 2XQKA 2XDQA 1EM8B 1Z5UA 4LJAA 4FVTA 2A5LA 2DHRA 1OXXK 5F1OA 2WSIA 1F7UA 1NQVA 3M6UA 2ZBPA 3W1EA 4ZGBA 1L3BA 2MSNA 3IJPA 5L95A 2HNKA 4C06A 1SBIA 2XT0A 3R4VA 5JJ5A 4I8IA 4NCNA 5MF6A 1Y8ZA 3Q12A 3VH3A 4P33A 1XCGB 3QM1A 1INLA 1NJ1A 2FPIB 4LZZA 3S2YA 1NWHA 2FSIA 1W73A 3MM4A 2FGJA 5BN4B 5C1OA 4TOIA 4LQDA 3JQ8A 2JCVA 1FEZA 2CD9A 4XPIA 4XX1A 3DNFA 1WXXA 3UB2A 1H69A 1ZUIA 1RJEA 1PT9A 3OPMA 1I3KA 1D03A 1V9CA 2Z95A 3UKDA 1N75A 5K0NA 4FC7A 3JQAD 3ZK7A 2B1IA 3LYLA 3QZUA 1L1RA 2HLPA 2CDNA 2VLIA 3AR4A 3HGTA 4U3JA 4COOA 1KAEA 1ONOA 1TZBA 4P93A 5KTMA 3LC2O 5SYMA 2V7VA 3QUCA 1G8MA 1VMIA 1U0BB 3HCFA 4XPZA 3LCCA 1YZGA 1P81A 4IIGA 4J2TA 1RMQA 3A3OA 2EAUA 1VRCA 4YN3A 4ZJUA 2G1KA 5JSQA 3WGHA 3AESB 5L4SA 1T6XA 2R62A 3QLEA 4FOPA 3ZV5A 1N78A 2PZMA 5FPPA 4Z49A 5EG5A 5K3OA 3CVOA 1PL8A 4KGVA 2ZE7A 5CXUA 1JQEA 2RHLA 2FDRA 2EQAA 2AMJA 4V0NA 3QI7A 4DWWA 3BB3A 3IHWA 3FTCA 1T8PA 2GCGA 2GCEA 3GP5A 3MGBA 4WXRA 4ER3A 4REQA 1C9EA 4V02A 4WERA 1UJ5A 2BZ0A 4PQRA 3FWYA 3KSDO 1N7JA 4DQDA 2WPNA 4KBFA 3UMBA 4LYDA 1AURA 5DSTA 3GH1A 3KZCA 4EHAA 2JGLA 2YC4C 4IXMA 2O52A 5FLKA 5C7LO 4XXHA 5IAEA 1P6UA 4EJ0A 1XQVA 3EYAA 2HXGA 1RBZA 4XFJA 1GTSA 1MLDA 4KPGA 4A73A 4CCWA 2WD7B 3KR1A 3MD0