2M6KA

Solution structure of the escherichia coli apo ferric enterobactin binding protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
292
structure length
292
Chain Sequence
ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure, binding properties, and dynamics of the bacterial siderophore-binding protein FepB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrienterobactin-binding periplasmic protein
total genus 50
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA02
5CX1B 3AEKB 1M34B 1K75A 2YNMD 3MD9A 1M1YB 4WNAB 1ESZA 4XPIB 1N2CA 5M2QA 3G9QA 3MINB 3AESA 5BVHB 4HN9A 2AFHA 3BE6A 1QH1A 2XUZA 5HX7A 3BE5A 2YNMC 5M29A 5FLYA 2WI8A 1EFDN 3CX3A 1PQ4A 2PS3A 1M1NA 2PRSA 5BVGA 5KOJA 3K1AA 2O1EA 3PSAA 4FNAA 1G20A 5HDQA 4CL2A 3TEFA 2PS0A 2XY4A 2R7AA 5B58T 4ND8A 4PAGA 4WZAA 5BVHA 4ND8B 2MINA 5JOQA 4WNAA 4XPIA 3UJPA 2MINB 1N4DA 5CR9A 4HMQA 2AFHB 5M3BA 1H1LB 5GGXA 4INPA 1QH8A 4TKUA 3AETB 1M1NB 5KOJB 2PHZA 2QI9F 2XV1A 3MWFA 5KHLB 2RG7A 2XQVA 5I4KA 1K0FA 4B8YA 5BVGB 4H59A 1L5HB 2AFIA 4FKMA 4G07A 3LI2A 4HMOA 3HXPA 1MIOB 3U7QB 1M1YA 4K3VA 3AEKA 1KAEA 1N2CB 3U7QA 3AEUA 1XVLA 4G09A 2M6LA 3PSHA 5CX1A 4LJSA 3R5SA 2OGWA 4TKVB 4WZBA 3AERA 2M6KA 4WESB 3EIXA 5KOHA 2R79A 4M7OA 1KARA 1TOAA 1H1LA 4MLZA 4OXQA 2Q8PA 3MWGA 3ZTTA 2AFIB 4MO9A 4OXRA 4MX8A 4FI3F 4UDNA 5JG7A 4UTOA 1KAHA 3PDIB 3ZK8A 3ZK9A 4GICA 4DBLE 1QGUB 1K7SN 4IRMA 1MIOA 4FILA 4WN9A 4NNPA 4HMPA 1QH8B 2OSVA 3AETA 3EIWA 2PS9A 3GI1A 3ZK7A 5AFSA 3MFQA 5JJ5A 5JPDA 2XDQA 1G21B 4TKUB 2OV1A 3K1AB 1G20B 1G21A 2XDQB 3HH8A 4WZAB 4H0FA 4BBPA 1M34A 4NNOA 4WN9B 3TNYA 4MDYA 5GGYA 1FP4A 3R5TA 4UTPA 2ETVA 4INOA 4UDOA 4TKVA 1QGUA 3MINA 4LS3A 4WZBB 3TLKA 3AEUB 2X4LA 3AESB 3NU1A 4WESA 4PM4A 1N2ZA 2Q8QA 1QH1B 5KOHB 4N01A 3AERB 1PSZA 3LHSA 1K2VN 2XH8A 3HJTA 1N4AA 2WHYA 3AEQA 3PDIA 1L5HA 5M34A 3ZKAA 1FP4B 3AEQB 4OVKA 2OV3A
chains in the Genus database with same CATH superfamily
1BKSB 4WOBA 3UOWA 4NSNA 2ZIUB 2PX3A 4IY1A 5D8DA 5TPZA 1JQEA 2B1QA 5LMCA 2EKZA 3IQDB 3G9QA 1I2ZA 4I4IA 5BVHB 1PJLA 1ESCA 1CT9A 2PWZA 4LHEA 3SIXA 1PJ3A 2CXPA 4UTVA 5A4JA 2HIAA 3FMOB 3QMMA 4MGZR 3UVEA 1Z8HA 3RUIA 4I1PA 5DX0A 5CFQA 1OPRA 1S2OA 3BRSA 2YVUA 4X1YA 4YJ2F 4ZT7A 3JQ9A 3K2BA 4UVDA 5FR2A 3HS3A 4X84A 2J0EA 4MLDA 2OHFA 4PEVA 3FOBA 2FDCA 1JZSA 2C54A 5K99A 4PFKA 1JMYA 2AIRA 2C96A 3TBHA 2YBEA 1SXJA 2RB5A 3IALA 3STXA 2ID9A 2GEBA 2VQSA 4PX2A 2C5HA 1T35A 2XLCA 4TV9A 4EJFA 1GGMA 3U3DA 4G5OA 2X0JA 3TFOA 1D4OA 1T2AA 2JZNA 1RWVA 4WACA 2CJFA 2KBFA 1N8TA 4RDIA 1QH8A 5KYYA 3AYXB 3OH8A 2ADMA 3ENVA 1NRXA 2NVBA 4ZYYA 5B36A 1ZM3A 4UAUA 4G26A 2YH2A 3W5SA 2FA9A 1W9MA 3DOEA 1AQUA 1L7OA 3KVRA 5WRFA 3RO7A 5JR3A 3PPWA 3LI2A 1DTWA 4CF4A 1MZVA 4DSTA 1G59A 1EXDA 2XA9A 5A0TA 3AFNA 3O8OB 5IFKA 2W4QA 4O4HF 5KQRA 1TK9A 3WV5A 1C1DB 4P58A 2UYHA 3U4QB 4DV0B 2D7DA 2Z3ZA 2A4KA 3B20A 4G5RA 3U7JA 4YYZA 1OZ0A 3FTQA 4LPKA 1AQNA 3F4KA 3U7GA 3D8BA 2OZKA 4PX3A 1DKPA 1QYWA 1K5GA 4IJVA 2ZFUA 2XXJA 1JLSA 3GX1A 4XW2A 4YRPA 2ZUSA 3SC4A 3U3OA 2Z2XA 1XBTA 2BBSA 1QAQA 1Y6GA 3NB0A 2XYPA 1VLLA 3MRSA 1BHSA 1EG7A 1L4KA 3HYLA 4ZODA 5DN9A 3A37A 2EP5A 3LDAA 1V8FA 4EJSC 2GPJA 2UYCA 5JJKA 1TGYA 1H2AS 4B7XA 4EYQA 4Q4HB 4DIEA 4R9SA 2ATXA 3F6RA 1RYDA 4DGQA 1G3RA 4RKFA 3VH2A 3Q4GA 5CEEA 5HF5A 3PF8A 4S35A 1CEQA 4LF5B 4YONB 4X97A 3I6YA 4TSFA 5KQMA 1K6XA 4NCIA 4GLJA 1VP3A 1XXHE 3H9CA 1E4VA 3UUEA 3QOXA 2MR6A 2ZW9A 1GJRA 2I55A 1AJEA 4B8WA 5JDCA 2BDTA 4CG2A 3HVKA 5C8DA 1KZ7B 2BT4A 4NNOA 5HPYB 1GUZA 1GNLA 1YCDA 2AN1A 1KA9H 3K9CA 1AQYA 1X7ZA 3KWMA 3NUQA 4ZT3A 5F33A 1CZRA 4K0KB 1CVLA 4RGBA 3RC3A 1OGYA 5BOVA 4DDHA 2P90A 4EDFA 2XUAA 2FG5A 2WICA 2G7MC 3D7SA 4KQ1A 5D6NA 3BZUA 4ESVA 4F4CA 3PDWA 1NXXA 1Z3IX 1VJTA 3B89A 3BTUA 3ND8A 3VPXA 1AS3A 1J00A 2HRZA 3JY6A 3OU6A 2DUUA 4B40A 4MARA 4CF7A 2CFIA 2HSJA 1Y1SA 3HJTA 2GJSA 4G24A 3PA8A 3RJMA 2DJIA 3N2LA 4OHZA 4IFIA 4L15A 1DG1G 4MCHA 1M6EX 1G9TA 3A1TA 4IMIB 2AJBA 4NBUA 1UEJA 1G3IA 4EKEA 1K3FA 2JJQA 3QXSA 1E5QA 3W5CA 1NBME 3I6QA 3S7ZA 2AKYA 5ER9A 2YRXA 3DLCA 1EB8A 2QGZA 4MR7A 4MQFB 2P4QA 2DP4E 3M0EA 1N6NA 2VP0A 3DKIA 3JYQA 4A6PA 2Q99A 2V6FA 3CJTA 4TQUS 4FXOA 4CLHA 2IZOA 3TKLA 2UZ3A 3NEPX 4Q47A 2VWHA 5LPNA 3RUPA 1JAYA 3DDWA 3G17A 1ZEJA 1JR2A 2QPOA 1NNUA 4H27A 5B58T 2Q0XA 3HLTA 3HL0A 1WE2A 4JFAA 4MS1A 3V33A 4EAAA 5JD5A 2P9CA 2QQ0A 4R2JA 2R5NA 2WE8A 4AYTA 4LGVA 4BX3A 4MYRA 1G2PA 4KKVA 4O2AA 4XLLA 1QP8A 1XTTA 5IH3A 1HRDA 2G63A 1ZVKA 5BY2A 2YBDA 4NPAA 4OAOA 1I32A 3SJAA 3RPEA 2AJDA 4OFXA 3SQLA 3S2UA 1YMVA 5EQFA 5JQWA 3OX3A 4Z4QA 1HWYA 2AOUA 1EVQA 3CHYA 5BN3B 1I4WA 2IPMA 4NBKA 4OXXA 5J5AA 2X8LA 1U90A 4JQZA 3ZHOA 2AYYA 3CT4A 4DMMA 2I3AA 3QU7A 5FP0A 2YS7A 2FZEA 4EEXA 4KDFA 3G2NA 1N1DA 5IN4A 1LVGA 4AUNA 4EH1A 4QQ8A 1RAAA 3K8OE 1V5FA 4B9AA 2ZCJA 3QW2A 5B1EA 3RNOA 2I9KA 3WLPA 2FJUA 4CTJA 2GCGA 1AUQA 1O0SA 2L19A 2VDWA 3ZXUB 1PLJA 3SZMA 2GM4A 4JASB 3O1JC 4LHSA 1U7TA 3FNRA 1KEVA 2DJ5A 2OZVA 4BQIA 2B2NA 1U9IA 5J5CA 1FS6A 2RI0A 4KLZA 2G1JA 2OCKA 3BOSA 4Q7MB 1BWRA 1Z26A 4BRWA 1GU7A 4XYLA 4D6PA 3KQWA 5YASA 4DDKA 2R60A 4Y2PA 2BGNA 2JVKA 4OCZA 4DRYA 1R4MA 4D98A 4E32A 1FFDA 4ZCRA 3EFEA 4R2XA 4XYGA 4A0QA 1G66A 1IAVA 1OGJA 4XCXA 4BVGA 3WKDA 3A27A 4ETMA 3RREA 2RKWA 3DGEC 3QK7A 3A7DA 3D4IA 3QVSA 2AOVA 2GNAA 4HXYA 4MW2A 1G8GA 4ZAFA 3Q87B 1C7EA 3K4QA 3LG2A 2VNHA 3KC2A 1Q11A 4HBZA 1JXOA 4C89A 2ZDQA 5E0KB 4XJVA 4PAOA 4QXAA 3RC9A 3GEPA 2X0KA 2YWDA 1GUBA 1ONNA 3GUHA 4TYQA 5CMLA 5FV7A 4I50A 3KSAC 3BKXA 1RP7A 4LWQA 4W5NA 4GE0A 4KN6A 3WP0A 4BDSA 4FOLA 4K2HA 5GONB 3I2GA 5HILA 4B87A 1ZN7A 5F9FA 3GJ4A 4J2OA 3LYUA 3EXEB 4BNMA 3MGKA 4GWGA 1Q3TA 1Z45A 1JECA 1Q7GA 1DKLA 3P0RA 5BUCA 1PSZA 3RRNA 2XH8A 3ZWAA 1YFJA 3MT8A 3ICCA 3DBHA 2QLLA 1KI8A 2RMKA 3OZ7A 3OA2A 4Y6LA 3AIIA 3N0WA 5JD3A 1IPEA 5M34A 3ZWCA 2WJ3A 2UZ4A 4HSGA 4YAFA 3COZA 4BKRA 1N6OA 5LC1A 1Y8QA 4FW8A 3H1TA 2L18A 4Q9HA 2HA5A 2ZWAA 4FGZA 3BZBA 3PWKA 5F12A 4D6XA 3AHEA 2E5FA 1E9BA 2B8JA 3NKLA 1NG9A 2GFQA 1KP2A 3EWNA 1ECGA 3A9SA 1MTOA 4I1RA 3KUUA 2RGNC 3PUHA 3KKOA 3HCOA 4DC9A 3W77A 3HBMA 3NC1C 2WJWA 4OSEA 2H2FA 4XSGA 5THKA 1SXJE 4B71A 4YUZA 3UMBA 2JD2A 3BWYA 4GOLD 4Q21A 3K9BA 3OLZA 3WL6A 1FFHA 1DRKA 1NXQA 1ADBA 4KC0A 4E6PA 3PNSA 1ML4A 3Q12A 4P7BA 2WABA 4HYTA 1DPGA 1JHMA 1G4AE 4V24A 3V55A 3U44A 2P9FA 1PYOA 3OTHA 4NZMA 4WOKA 5K05A 1RAFA 3VDMA 4NCBA 1QCYA 4CWAA 4L2IA 1HV8A 1J0EA 2FQ1A 4D26A 1H2RS 2RG7A 2GEKA 1GL6A 3GJXC 3Q3JB 1KBZA 1BCRB 2EP7A 3ENQA 3GVCA 4KO3S 4LZZA 5CW2A 2J30A 4NE2A 4AJIA 4XOIA 4HQKA 5TDHA 3A3OA 3IAS6 1J7JA 4OH1A 4OPMA 3KSMA 1VSVA 4CT5A 5LN1A 1FVOA 1OH5A 2L42A 4LJ6A 2INGX 4TTVA 4RKEA 3PGXA 1LSUA 2FOIA 2YJ4A 1PFKA 4RMNA 4EA9A 1I94B 4DSOA 1GP2A 3DC7A 3PEYA 4FGWA 1X7YB 1ULTA 3TEMA 5JSZB 5DXAA 5FOWA 4U7JA 3IEXA 4PNPA 5E4FA 5JASA 1CV2A 1BQ4A 5CT5A 1Y3DE 3EN0A 1QG6A 3CCBA 3NIWA 2QRVB 1G8YA 4EGSA 1UDXA 4RHUA 5CVJA 4DT1A 3FMGA 2NO4A 3ZI0A 2H52A 3N2GA 3ZDRA 1JYSA 1AKNA 4FC7A 4YUVA 3ZVRA 4DHWA 5I01A 1Q6ZA 2D2FA 3KJGA 5CNMA 4G36A 3RAJA 3ZJVA 4RJIA 1UJMA 2F3SA 3RS8A 7AT1A 4MUIA 1YDGA 2PSEA 1EK6A 3DTNA 4B3MB 4AYXA 1KDZA 2MDTA 4F5ZA 2X8WA 3ZJUA 1PZXA 2XWQA 2C77A 3CRMA 1PGJA 1ULHA 1JQ3A 2HKIA 1Z2EA 4CETA 3FCSB 4DR2B 1RQGA 5FBZA 3PUVA 2RKBA 2V7WA 2VC2B 2OXEA 3GAAA 3UICA 3RAFC 3ET5A 1VL0A 2DFKB 4ND2A 3TW0A 3G59A 4R3NA 2A7XA 1P45A 1C9DB 1V16B 3VR5A 4UU8A 3BSWA 4IV8A 3AFIA 1WF6A 1LX7A 3ZE9A 3RSFA 2J3QA 3GGGA 2JLQA 5LQKA 1XJQA 3I9LA 4FXPA 2H07A 4QXMA 3CX7A 4E1AA 2ZTSA 1O95C 1P8AA 4QPDA 2Z08A 2PYIA 4NEHB 3HV2A 4G37A 4QKQA 1UKCA 1JQ5A 1NIJA 1FFSA 2WU0A 3JV7A 1PT9A 4K46A 2JLYA 4Z1MD 5A2GA 1GGVA 1WY7A 3PLNA 3PGKA 3FLMA 2QDXA 3M6WA 5ALNA 2B1JA 2SICE 3P9KA 5B1SA 1UEIA 3SZGA 1T3ZA 3E1GA 1S9HA 3TTWA 3CEAA 1KOGA 3ANLA 4H7KA 2HMTA 2XVMA 3I1YA 1KRXA 3HBFA 2B98A 1P1KA 2HHAA 2YFYA 1NONA 1GQFA 1Z5ZA 4IIJB 2JFHA 3L1KA 3ICWA 1N5KA 1EFDN 4RC9A 2W11A 1U3FA 3NWBA 3PPYA 4XB6B 5FQOA 3VO1A 1AO0A 4RH1A 4KI0A 2O6LA 2H18A 2AEEA 4WFIA 5KZMB 1QOPB 3V8MA 1LLUA 4A5OA 1BJTA 1EFUA 1EP9A 1C4XA 2WILA 4B3RB 1VA5A 5LP1A 1REQA 3CCFA 3LCRA 2NOAA 2Z5VA 5EXXA 4HNTA 4NQZA 4X3PA 3MTQA 1KWKA 5ICCA 4DY4A 3QTTA 3AM1A 2OR3A 4TOIA 4CL0A 1GY8A 3E22B 4Y1EA 4QD3A 3HWWA 4ZVTA 1CIPA 3CB4A 1NSYA 2H4HA 1F12A 4BQQA 2G1AA 1RMTA 5IAAA 2RHDA 1M2OB 4YQYA 4ZJZA 2BEUB 4KWTA 3IKMB 1F6WA 4RA6B 1W36D 3T5CA 5FNVB 1GZ6A 2VOJA 3SM3A 1SBHA 3FM9A 2H3EA 2H59A 2R7NA 3IP1A 4EP1A 1E18A 1FRNA 4AJLA 3GU3A 3VDQA 2CNLA 2J9YB 4JLBA 5JMWA 2FGJA 1MEOA 2QUHA 1LLCA 4DPMA 2W43A 1MRNA 4E08A 2REXB 2IITA 2VH1A 1VLZA 4M9CA 3CNNA 5EMNA 3W8FA 4L07A 1J99A 2RHLA 4B4OA 4DXHA 1PNRA 3VTAA 4MO9A 3UENA 3D3NA 1FRQA 3G8AA 5CH8A 1FXWF 1E4EB 3SGLA 3AY3A 5DOVA 3GROA 1ZM9A 5KOYA 4P33A 2QQFA 4W8GA 3VV3A 1VECA 1JBEA 1JHRA 4XEUA 1FTGA 5ALVA 4JI8B 4U4AA 2CNKA 4HEQA 1F6BA 4PC6A 1MAVA 1VSUA 5AXDA 1ENZA 5AVSA 1NAHA 1QFMA 2ECFA 3CONA 4UD2A 1Q1GA 3ET4A 4UUOA 2XX3A 3FDFA 4GPAA 1J2YA 4M88A 1BZYA 5IN5A 3K72B 2YINC 5BR8B 4CN9A 4MKIA 3EY9A 3EMDA 2UYQA 1XPOA 3KVOA 4GYWA 3GL9A 3Q0TA 1SB8A 5I9TA 4BO7A 4M0LA 1I4EB 1QONA 3CW8X 4QM6A 4WE3A 4FWBA 4DXAA 1P7CA 1SBQA 3M5PA 5JS6A 5AI0A 2AXPA 1JB9A 4MEJA 4L3OA 4CMIA 2H06A 2P91A 5FRDA 5GM1A 2GF9A 4TXNA 4U5QA 1OD6A 1RM4A 2HAEA 4PHTA 5CD1A 3M6UA 2YMLA 4NEGA 2D54A 2JRLA 5ALJA 4DTCA 1P1BA 3IQHX 3UH0A 1VYTA 3PB3A 3CRQA 2P9YA 1NVTA 4LRWA 1UBHS 2IIQA 4S1WA 4WEQA 1P5FA 4YRGA 1Q0HA 1MORA 5ESRA 5AM4A 4C3UA 4ZHQB 1GTVA 3HGTA 1YHNA 2H54A 3BXPA 4HX2A 5IXYA 1EWQA 2QENA 3TR5A 3GRUA 2QR3A 4FFOA 2H0AA 3KIPA 2FZ4A 2BDUA 1GG8A 2F1KA 3TD9A 1ONBA 3ZQJA 1LPAB 4DN6A 2I4TA 3PQ5A 4KR7A 3HDGA 2PCJA 3CLUD 3OT1B 4FBLA 4TMFA 4MVJE 3PKIA 4YO8A 5SZKB 2IYZA 3UW1A 1RKUA 3MERA 3MTJA 3NHAA 3THWA 3ZE7A 1IN8A 3T5PA 3NONA 1R0BA 3T1HB 1TM7E 3WK8A 2XVZA 1K5HA 1OX5A 1P4JA 1XQVA 2B35A 3F96A 3TK1A 1SXJC 3VAYA 4AD8A 1O8BA 1XZQA 3GGSA 1K7FB 3E05A 3OSZA 3TD2A 1DINA 3G2OA 5HFNA 1OBOA 3VAAA 1O77A 3OQ6A 4WJKB 4Y9UA 3C5WP 1OC2A 5AJTA 5EJ6A 4QSMA 4Z2AA 2E1RA 3HA2A 1GARA 3FYUA 4QUDA 1YNSA 5TEVA 3V34A 4DXDA 3OURA 2ODEA 2CNWD 4FYXA 4NBWA 3M82A 1KEPA 2OHVA 3PCXA 3AV3A 3BZWA 1I7QB 2ABWA 4IGKA 4F7WA 3HKDA 4HFRA 5LXTB 4G4SP 1I2CA 4RTMA 3K0SA 3ZDAA 1JF8A 1IY2A 4DYDA 1XMQB 3CX8A 1Z7GA 2DHCA 2VHWA 5K6AA 4EEZA 1DJQA 4JI6B 2I65A 3FF4A 3C3JA 3ZCQA 3V2UA 1HYBA 5DISB 3H4IA 1C29B 1LWOA 4LYGA 1AQJA 1KK3A 4IG9A 4LJRA 4JXJA 4YP1A 3VPHA 4JL6A 1LY1A 1M2NA 5CAEA 1RC1A 1Z74A 5KTOA 3ZDBA 2C7GA 3F98A 3KYIB 1BDJA 1UDRA 1SXGA 5K1ZA 4CGYA 1W73A 1II0A 1KAHA 2H1CA 1ZCFA 2FUG1 3DWIA 3GCXA 2J09A 1NR7A 3GT7A 3E7PA 3QLUC 3FGOA 4IDOA 1WHSB 2HLDD 4LX0A 5E9JA 3ROZA 3DE4X 3W7VA 3VVCA 4L22A 4OB6A 1V2GA 1IJEA 1L4LA 4CTMA 4ZQGA 5FHQA 8LDHA 1T8WA 1P3DA 3LA8A 4OBEA 4UM8B 1KH2A 4AWBA 1UOQA 2JGRA 5LM3A 4J1TA 1S2MA 1P9LA 2Q1XA 1U63A 1RPNA 3AHHA 4MWTA 5A4DA 3K4PA 4C7OA 4FFSA 5TQJA 2DHRA 2FJPA 5HGXA 5IABA 3NASA 1Y5MA 2JASA 1XDDA 5JPIA 2DTDA 1N2SA 2P9QA 3D9QX 4RVDA 4D45A 1O03A 5EQJB 4B4VA 1SIWA 3A9VA 3C3WA 1B0PA 1GNVA 3OPYB 4WUVA 5UKDA 3A1DA 3JD1A 4GECA 2GZDA 3TL3A 2JH3A 1EI9A 4L6AA 4C0AC 1DJMA 2VJPA 4S1OA 2HMSA 5H81A 1YS2X 5IZCA 1C7QA 1YOVA 1N33B 3PUYA 4R2WA 3WKAA 3AKEA 1QP0A 2ZIWB 3SBOA 4KXUA 1NJFA 4DOMA 4D0SA 4Q48A 1U9IC 1ISFA 4DR1B 1B16A 4M0DA 4MS4B 1UZUA 2VJLA 2H7XA 2V7GA 2VNAA 4OOEA 1AHPA 3IULA 4L4YA 3WNDA 3VSAA 1VC2A 4L0MA 3TZEA 1MP0A 5IEJA 4DSUA 4EFNA 3D3QA 4HG2A 4ARVA 1P77A 1MOQA 2HUPA 3AHIA 3R9IA 1SC6A 2WU3A 3KHSA 3QWBA 3KXPA 4JVOA 5COAA 4B3XA 4JI0B 3JATB 3HWRA 1T24A 1Y89A 2SKCA 3P1JA 3PHHA 4I6GA 5G40A 5JCJA 3HTXA 1WXHA 1PFWA 1W0KA 2X5KO 4NY1A 5HGJA 3G88A 3PL5A 2VAPA 1XQXA 2Y6VA 5CA1F 1EWYA 2Z5LA 2GVDC 4HZIA 2VAVA 3HDJA 1IEWA 1TVKB 3AW8A 2G77B 4U0JA 1B23P 1QHHA 3BGIA 4FYHA 3FVQA 3VSDA 1HTTA 3C6KA 4PYLA 4FJ2A 4MHOA 1SZJG 2MSLA 1RS0A 1KY4A 3Q72A 4FE3A 1A88A 4JEHA 1FLVA 2GM9A 1V16A 2Q41A 1ZJ4A 2CFTA 1LBIA 1LC0A 1WSDA 3UGJA 4MVJF 3HSKA 4RSHA 2I6FA 4HK4A 3TMAA 5CR9A 2ZYIA 3ILXA 1SC3A 5M3BA 1AMUA 1VQ1A 5ELLA 1YU6A 1YR6A 2ZGVA 4QNRA 4IFTA 4QAQA 3LS2A 5AJYA 5DWDA 5KTKA 4ZI7B 3U62A 3FCXA 2QTVB 4XTCS 3CRZA 3UUFA 2FSSA 4WADA 3LUDA 3A6ZA 3S27A 3EF1A 4QWMA 1Q15A 2OTCA 7REQA 3SS9X 4MQ5A 4AKSA 4YJ2B 1TGVA 4NS1A 1MG5A 2JEZA 1H2XA 2VK2A 5EJGA 3VR1A 1RM3A 1JFTA 5I9MA 1OLUA 1LWNA 3COWA 2HADA 1RI4A 2BOVA 2H11A 2XZDA 2GHRA 2XSZA 4IR7A 1A71A 1QWSA 2PIDA 2VBIA 4O4JB 3IP9A 4QRIA 5LA6A 3RYIA 5AM1A 3HCRA 3S2IA 3VAZA 3COJA 4HDRB 3BJEA 3PWSA 3EHDA 3ORHA 2VCHA 2AK3A 3F47A 1R6DA 4LOIA 4XARA 1ZR4A 3IT3A 2HPHA 1B0AA 1LPMA 3FOWA 1EPUA 3LBHA 4HATA 5I7VA 3AVUA 2XOEA 4GMGA 1SUSA 1ISMA 3G0BA 5LP6A 2G80A 1Z68A 3OEHA 4X64B 3BMOA 3ITEA 1WUKS 4I3FA 1FJGB 2PN1A 4ZO6A 4L02A 3FF1A 1YB5A 1D1QA 2FUCA 4NNPA 3HLYA 2JAUA 4EY7A 1TC2A 4AN0A 2C78A 1OXUA 2GBLA 3DEZA 3DL2A 3GNTA 1E8DA 3N8DA 4QXOA 1I5OA 1OV6A 3PYLA 4CIWA 4NC9A 4ENWA 2E4WA 3IO5A 2Y76A 4RHFA 3C3XA 5JS1A 4RM2A 1RXVA 1JU3A 3AGPA 1UJCA 3OMLA 3FFBA 4JNKA 3ZY3A 2O8BB 4TGLA 1JEAA 1OWPA 4UTZA 3IQFA 4YRRA 5CW1A 2NADA 4ALNA 4Z4CA 4QASA 5A03A 1VKHA 4H7PA 4QHSA 1E1NA 3CSSA 1T8RA 4A1OA 1GAWA 4LXHA 2AW5A 1T9ZA 2XBUA 3VU0A 1NP7A 4DCTA 3VJRA 1EFPB 4K6KA 5DLPA 4FSXA 3WLQA 1OILA 2J3JA 4HPJB 1E0JA 1AZSC 3U26A 1CUSA 1D07A 2ZIZA 4KZPA 1YRBA 4C0QC 2BSAA 1Y4SA 4CM3A 1DX4A 2ZB7A 3MELA 3L0SA 1T4MA 4LMBA 5D1HA 3ZIDA 1ZHOA 3QKTA 5IAKA 2ZBVA 2QG9A 5KTTA 3I5YA 3W6NA 1N0VC 2X4DA 5FUMA 5IG2A 1NW4A 4TL7A 1W52X 2BKXA 4X63A 2LGJA 1G55A 1H4VB 2VVTA 4MICA 1U0OC 2Y9MB 4RNDB 1P9NA 4ZVOA 1DOHA 1CLEA 1P7VA 1QS0B 1ZN2A 3EDQA 1JAXA 4URZR 4TLLB 5DM2A 4G5HA 4YAGA 2UZAA 2C5SA 2O2ZA 4K8RB 4BNTA 1C0PA 3R4CA 2ZRPA 4HV4A 1VE7A 4L5JA 3PC2A 3L8CA 3RVBA 1Q0RA 3ULKA 1W8IA 2K2QB 4YWJA 3Q98A 1ODFA 2BFDB 3DXZA 1J5PA 1ZUNA 1IUKA 2FEMA 3PRYA 1XV5A 4HPXB 2PQ6A 3F0TA 5AVQA 1M1NA 1PD0A 2JBHA 3X0DA 2HH9A 2NU7B 1MKYA 4QBTA 4BQEA 1XXHB 1CZHA 1F5SA 1JG6A 2GPAA 5JH7F 3MTDA 1DQZA 4RUKA 3RIMA 1UJNA 1Q2UA 2BJWA 2VG8A 2PGDA 2DBVO 5LVAA 4BZXA 1GNTA 1XKLA 2VSQA 2QAGB 5AM2A 3ANNA 3V4RA 3BGWA 4UE3S 3T3NA 4Y6PA 3SYRA 4Q82A 3VZQA 1Z0DA 1O58A 3IVRA 1LJUA 2FZVA 3U39A 3W6ZA 2BI8A 3MCAA 4X54A 5JS8A 4BXOB 2O7NA 4JR2A 2D1SA 4PIVA 1RKBA 3N7TA 3DOJA 2JATA 3P9RA 1G41A 2DUWA 3GT4A 2PZFA 4XFJA 1L5RA 5H1YA 4AMBA 4JQYA 4DG8A 3EVCA 4QLOA 4Z8YA 4BVKA 1HLDA 1RC0A 4Q15A 4DANA 1MLDA 5BNFA 1M0EA 1WMSA 1DUSA 1V8BA 3VFDA 4A2QA 3IOEA 2V7QA 3RYFA 1IIRA 3PC8A 3OZVA 4FZRA 1F3LA 4MVCA 1PD1A 1TRKA 4NDZA 2HSEA 5FQNA 5GP1A 4JUCA 3THYA 3DL4A 1EVYA 4DCJA 3EIFA 3HB5X 4PLHA 1XYGA 2BBWA 3HJNA 3Q9NA 4ADSG 1GZ3A 3TECE 1J23A 2CV0A 1LH0A 3JXEA 4OFWA 9ATCA 1DC4A 4QG7A 5G3ZA 1F4LA 3DZHA 2GSDA 3TTSA 2VNSA 3FPFA 4R54A 3SXPA 2P1RA 2NVWA 2VDNB 3VHLB 1GL7A 3NCTA 3FOFC 1KORA 2I4OA 2NZWA 4MV8A 1QLWA 2B9VA 3UY4A 4A8TA 2ZKIA 1HT0A 3C16C 1YI0A 1HF3A 1P6UA 3UG7A 2GZ3A 1THZA 1EGQA 5IKMA 2FR0A 3NEYA 1PLKA 4PE5B 4E4TA 1O96A 2FPWA 4Y0NA 5CGZA 1JTFA 1VBMA 3W5DA 4OQEA 1AQ6A 1PLLA 3M5CA 3TYXA 4BNDA 1X9HA 1XDSA 2I54A 3AVOA 2GRAA 3LTNC 1UCFA 2PZKA 3COPA 3RADC 3H8SA 5IJWA 1PFQA 2HSDA 2J9ZB 2VZLA 3DLTA 3KXIA 3U3RA 2R0QC 4LVOA 3QVGB 1Z7EA 3VKUA 5DM70 4BB6A 2AL7A 2OWDA 5K09A 2FAXA 2V74B 4EF6A 3TLKA 3IR6A 3ZWBA 1J56A 3RJ9A 3K1ZA 4HNVA 1XD2A 2J07A 3TRJA 1UM9A 2X40A 3D3KA 4DKJA 4E7OA 3HVIA 1JFLA 1BS2A 3SOZA 5F1PA 4C7JA 2LR0A 3I3OA 4C2AA 4G89A 5CDHA 4BN5A 2WHYA 3VNSA 5EAIA 4U6NA 4HAUA 5K7SA 4TWBA 5CT4A 2ODNA 3TLGA 4MIOA 1EFAA 2OCLA 2D5BA 4RMJA 4DCUA 1YZTA 2R8ZA 2V7PA 4MW5A 1IHOA 4WD3A 2X6RA 4RL4A 2FETA 1DSSG 3LKDA 3MB5A 1H05A 3WYBA 2FMIA 1PL7A 2H1LA 3OTOB 4NJMB 2ZM5A 5IP5A 4EW6A 2JAHA 5B6IA 4I1SA 8ATCA 2ENWA 5ARDA 2Z6UA 1P29A 2Y27A 1BMFA 4P2BA 2J5BA 2F3PA 1CR2A 3LHIA 3U31A 2A9JA 2ZG6A 4J07A 4BUZA 4ZJPA 2KLBA 2GLXA 2DYKA 1Q1BA 3N8NA 2A9FA 1Z29A 1V45E 1VBFA 1XWIA 4HNSA 4J75A 3QU9A 5I7RA 4KSBA 2X5OA 3CYFA 4MS3B 3TOXA 1GLGA 2FYTA 4H1UA 4N7BA 4YCLA 5C37A 5I8WA 2W6JA 4CM4B 1N4DA 4MYSA 2E6UX 1Y37A 3B1FA 3ADKA 3HL4A 3H1PA 5CX4A 4PTZA 1NN3A 4I9NA 5IC6A 1CYDA 4RTKA 3SP1A 4V38A 2VBGA 3ESRA 4IKPA 3P71T 4QO7A 3D2AA 2YY7A 2AWOA 5F52A 1K06A 1U2DA 3THOA 2QSUA 3TW8A 3DJYA 1M83A 4KFRA 1ULUA 1OFHA 1VKOA 4UFPA 2R8OA 3HACA 3OD1A 4UUQA 4N5DA 5IHPA 3U56A 1VRCA 1NBOA 3ILHA 3RFVA 1KOLA 5EFZA 1XLUA 1EBUA 3IYLW 5CDSA 1ZJ6A 3U5ZB 1J20A 2YN0A 4GU5A 4IWYA 1JJIA 1KMIY 1T0HB 4J1QA 1FDWA 1HL7A 3I1JA 2XE8A 1K6EA 4NZYA 3PJRA 4QM7A 4MVJI 1U04A 3DMYA 1E9DA 1CJKC 4RD6A 1NPDA 3SWWA 2GBLC 4EMBA 3ONVA 1TRHA 1VKNA 1Y8CA 4KIGA 4HN4B 5DHTA 3SQOA 3Q0IA 4CLDA 2VJMB 4NYMR 2Q5FA 1LW7A 1C7FA 2CFOA 3D7LA 2ZRCA 1CRLA 2PVCA 1NZJA 2HHJA 3CURA 3NG1A 1N36B 1M2WA 1P74A 1T8YA 1ULZA 3AHJA 2OSVA 3BTVA 5CJPA 1R4MB 3Q1KA 1G5PA 2V0GA 4RSRA 4XWAA 2GBGA 4QU8A 5F64A 1BWSA 3G0GA 2CHVA 5FTKA 5FTNA 3TG2A 4DLRA 1E1RA 3QY0A 3CO5A 5FO1A 2CJXA 2CXHA 3L4BA 4LFCB 3W7AA 3GJQA 4DC1A 2H17A 3U7IA 5KQLA 3V4LA 2VDPB 2V7VA 5DNWA 4E21A 4HAOA 2PL5A 4LV6A 3AUAA 2Y0DA 1U6KA 4DLSA 1H5NA 3IPAA 2J5KA 4M86A 3VHXB 4F04A 4UREA 1ZZGA 3AJEA 2G71A 4PPYA 3P2KA 2QD3A 1PVVA 4B79A 1H65A 2Z1DA 3TZ6A 4YJDA 4B2LA 4JX8A 1WV0A 4NOLA 1SY7A 2QQ5A 3UPDA 3EPJA 5CA1B 5CLGA 1MCZA 3H7AA 1W93A 2AEJA 2IHJA 3L1UA 4MVWA 2FFHA 4CLOA 2NYUA 5D3QA 2WF8A 4OMCA 4P83A 3S29A 2WVGA 1XKXA 1ENYA 4RD2A 5BRJA 4EYOA 3EGXB 3HYRA 2PYZA 1W76A 1KYZA 2BZGA 2EQAA 1H4QA 2M1XA 3ECSA 4YBZA 5E2AA 5G0WA 4YUYA 4YAUA 2PUFA 2Q27A 4TS4A 1BXGB 1ZD8A 4DNOA 2PXCA 3E5HA 5I6DA 1A2KC 2W2LA 2BHRA 3QKRA 3SZRA 2DFNA 1BW9B 4LSMA 1SXIA 4FOPA 5HBRA 3RG2A 3UFBA 4D3YA 2IHKA 2JPDA 4A91A 4X5OA 4CQLB 4YCSA 1RFLA 2G9ZA 3R7FA 1X2BA 2OBNA 4RZUA 4GBGA 4HEA6 4DB4A 3DR5A 1KWGA 1RAGA 2JKZA 1CUHA 4JIMA 3IBSA 3OE7D 3WYNA 1JVNA 1SK9A 4JLPA 3OLVA 4N48A 2ZSAA 2WR8A 2P2CA 4M8LA 4D9BA 1A8UA 5GIOE 1J07A 2ISCA 3AM5A 4LDJA 5LNK6 1MT0A 1YIAA 3ADCA 2EKBA 4CXMA 3L6BA 1PJAA 1B2LA 2A0FA 1RYYA 2GBPA 3DE0X 5IX8A 1MDFA 3JVVA 3K8YA 4HEJA 5DWQA 5K3CA 1AT1A 3VPCA 3L4JA 2Z2YA 2IWRA 3ZV7A 4JQCA 3BCUA 3GMSA 3I4CA 1GUAA 3TIGA 1YSCA 2VTEA 3PHLA 1VG1A 3EMVA 4TXMA 3WGOA 1PT6A 1XDUA 3SQDA 4KODA 1J2TA 1O5OA 3AIKA 4FDUA 1PHPA 2J9GA 3I9KA 4IIDA 5DEIA 1E7QA 4MPRA 4AN4A 3DEFA 3K9NA 4DGSA 4HWGA 2OCYC 4ZVKA 4R7TA 1I4OA 1VHDA 3AZPA 4I3HA 4I1OA 1E2PA 1I3MA 1BMTA 2BFCB 1DKQA 4ZCSA 3TRKA 1XQWA 2ATIA 2EL9A 3L0ZA 3QHQA 2JG3A 1ZM2A 4FMCF 3EUAA 4UEJA 3TTYA 2QP9X 1KARA 1SUIA 3VTKA 1CB0A 1YFKA 1HQKA 2WTBA 3DM5A 1ZP6A 2GLUA 2OA0A 2AG0A 1IVNA 2FE4A 1ZOOA 3DDSA 1U2PA 2PS1A 3BEOA 3H9EO 1GTZA 3I34X 3PR1A 4JK3A 4QYMA 4BB0A 2PUDA 2QN2A 2OGZA 3QV1A 1ZX1A 2REBA 4BVHA 2O4UX 2V6JA 2XADA 2WY2D 3U1TA 2QN6A 4Q9DA 4C0SA 1SK8A 2I8LA 5EP4A 1IXKA 3GARA 5KNBD 3ZXSA 4JOQA 3AOGA 3KTOA 5H16A 2F9FA 2VP9A 3OWHA 4IHAA 2C8JA 2IT1A 2EC5A 1QVVA 5E0OA 4ZU6X 3SR4A 5EJ9A 3KJNA 3QKIA 2C2WA 2RH4A 3LXUX 5DHAA 1SQFA 2CXRA 2AG8A 5A62A 5ALQA 3ESBA 4A92A 1PW5A 3SVLA 2P30A 4QHTA 3PLAE 3W8NA 1QHHB 3KZKA 5GJWC 2FQWA 1L1EA 3WB9A 4HTAA 1Z4PX 4FEGA 1TM2A 1BXRB 4TV8F 3REQA 4CKXA 3P0JA 4UBMA 2GILA 1T4DA 2Q6VA 3HKBA 5LBIA 3R4VA 1PJ4A 2FPLA 4H1TA 1FTYA 1S3SA 1T6YA 1WEKA 3JATA 1Y6JA 5ARCA 2WIDA 2VH5R 2OLJA 4HS9A 4D9IA 2HC9A 3IOMA 3GJRA 1CK4A 4LK3A 3X43A 4RY2A 1GNQA 1NW6A 1E5XA 2I3GA 2IHVA 3HDYA 1YQQA 3TRDA 4DPKA 5A1TA 3LVFO 3HR8A 4GX5A 1J0CA 1CQIB 1T2DA 5IK2A 4RA6A 4N0DA 3AEQA 3OQPA 5CPFA 4F46A 1LDBA 1NXVA 1U8TA 3UXMA 1DRWA 2ZWVA 3L05A 4JHLA 1ZA1A 5B3JA 3GB9A 1YJ8A 3IHKA 3M6FA 4ITUA 5ALSA 3TW6A 3BWVA 3UFXB 1SBZA 2IK8A 2MR5A 2GH1A 1RPAA 1J4AA 1SM4A 3WIVA 5EJIA 4I36A 1EFVA 4RW0A 2XNDD 3K9HA 2EXXA 3E84A 1CIVA 2WIJA 5L6MB 3IH5A 1QQ7A 3BJIC 1UDCA 2PRSA 3PUKA 4FYJA 4L1KA 2OAGA 1QBGA 4QGGA 4MVJG 5IM4F 3JALB 2CL0X 5DF1A 4CPDA 1B6SA 1A27A 1MV8A 1XC7A 2QROA 3DCYA 3VR2A 1NSFA 1ID1A 1GQQA 4HVCA 4DILA 4EB6A 4B44A 1LPSA 2PUEA 2WUFA 2XMGA 5BVHA 3B7WA 4RIIA 2Y2VA 1J8MF 3H0CA 3EYWA 2O57A 2P3QA 3G0DA 3O75A 1NM5C 3QEOA 1H1TA 4PX9A 4ENPA 1SHTX 3SPXA 2HPAA 3HO8A 3HNPA 3RHSA 4BJHB 4LJYA 2BCGY 3LY5A 2CNDA 4UNQA 1BVYF 4ZD6A 3QOWA 1UODA 2V7UA 2UZ1A 5AKZA 3J81k 3THXA 3BL6A 1NF8A 2JI9A 3JWPA 3QLVA 1RJ9A 1EM8B 3ZV4A 3RTDA 1NW7A 3JWHA 1H9BA 2P4SA 5F78A 1PDVA 1THGA 3FMPB 3VOAA 1QVZA 2GR9A 2HCFA 5A0VA 1CY8A 2FDXA 1JEOA 5EE9A 3BXOA 5KOIA 1PDWA 3BEDA 4GOND 4FNGA 4PPGA 1W0JA 4XFDA 1P0QA 4F4UA 4F6CA 1FLDA 3BMNA 1C30A 2J59A 3GN2A 2NG1A 4ED9A 1J21A 2J6BA 4KDEA 4WGGA 3PC4A 5CFOA 3DULA 2A1UB 4DLXA 2Q6TA 2V98A 3B7GA 1YZFA 3QVWA 4IDGA 4ZFNA 1CIJA 4U6QA 1N7HA 2CKMA 1A96A 3ASZA 4U7GA 4EVIA 5CVVA 3L7CA 4XR4A 1F06A 3JASB 4QOJA 2ZQZA 1KJ9A 4NYIR 4UATA 1QGUB 1QOZA 4N3AA 1XTKA 4J3JA 4BQFA 3FNFA 4GR4A 1VMIA 3CZMA 1N9GA 1Z36A 3GLUA 5I51A 2B4RO 4HGPA 4DCVA 1N5LA 4UAVA 4Z86A 1L6IA 4DLZA 1U8CB 3D64A 3LDGA 2W8ZA 5FUWA 3A70A 4BTEA 5GPBA 4LECA 3ML1A 4H35A 3BRWD 1NN5A 5DH9A 2QBYA 2RHMA 4YRTA 5GJBA 1FUIA 3FN4A 4AIIA 1QKKA 5BSTA 4XR9A 4BNKA 2P9JA 3WLEA 2QRVA 3GZTB 3CVVA 4RH3A 2KE5A 3KQHA 3IE1A 4FEAA 3KHKA 3IMFA 4Q3EA 2CVZA 3NHMA 5TPWB 4KRFA 2TMKA 4R6WA 1SCKA 4NTZA 1ZPDA 4C05A 4ARCA 1KY2A 1UJ6A 4D0NA 4ZA2A 4RA9B 3ZOZA 1AGNA 1UBTS 4MINA 1EX6A 4X45A 3DTTA 2OVFA 2QOEA 4KYUA 2CK3A 5DI9A 5D01A 1QANA 3PVZA 5FPYA 1SKMA 3D6MA 5CB0A 2KBEA 1JE0A 4UUNA 4HN2A 3PFKA 4YMIA 5I3ZA 2BKEA 3L82B 2FFJA 4LOJA 4E11A 2IF2A 3WAJA 2V9ZA 2PXHA 4HT3B 5J1TB 3KOXA 3QXXA 4MWEA 2VAWA 1NVMB 5DU2A 3TAUA 4J16A 3ETGA 1NULA 3EUEA 3GYBA 1CR1A 4OF4A 4OYYA 4BMVA 4CMAA 3FTCA 3JQ8A 3I12A 1R66A 2C9MA 4M4SA 3FPHA 5B5SA 2H2GA 2W6OA 2L82A 3FLAA 2FZWA 5FNZA 1XD2B 2XSZD 1UXIA 2AFHA 1WZEA 2P2NA 1VRVA 2RJOA 1Y4UA 1Y6ZA 3PE3A 4IVPA 5ICMA 1IB6A 4YRKA 3DT6A 3QU5A 3DMNA 2C7PA 1CP3A 2PD6A 2C5BA 3KL4A 3K5PA 4IP0A 1SULA 3N07A 4BAZA 4R40A 4DABA 5DGIA 5A3QA 2HCJB 1NJ6A 2EWVA 4B35A 4O2RA 3V9PA 2EV9A 4G5XA 1JYFA 3RU3A 4EW3A 1YQUA 1X7DA 3LXRA 1RHKA 2JCBA 4YV0A 5JQGB 3FHLA 5C80A 2CFCA 3W3ZB 1LV8A 1RM5A 2MINA 5JD6A 3NV7A 3UMVA 5F51A 2CZCA 2NM0A 1NNSA 3KK0A 3CEPB 4WFQA 4B09A 3FX2A 1HT1E 3RU2A 2XE4A 4YMHA 2HGZA 1XTJA 5FLEX 3RSSA 1QHFA 4OHOA 3EXIB 4REOA 5LYJB 1JZTA 1PJSA 1T1GA 4DBVO 5HRUA 1R5BA 4C0XA 1E4EA 2O9JA 2XCIA 5H3CA 4EHIA 4F0JA 3V4VB 1XF1A 4YVFA 3TNFA 3B38A 2PJZA 1UPCA 2C82A 2RIPA 2LXNA 3COVA 3NWOA 3PS9A 4ZEXA 4NH0A 3UO8B 1SUEA 1SOUA 4TTRA 1QC5A 1Z8NA 3U16A 1S2GA 3TLAA 1IY1A 3DAGA 3GFVA 4PQEA 4EHKA 2V0NA 3G2HA 2EKQA 3OJ0A 4GYKA 5E3IA 3DPSA 2D0OB 3GEGA 5F35A 4DMRA 4H1WA 3IRUA 4BNIA 1T0IA 1U5CA 5CDUA 1LI7A 2V6IA 3EMKA 1GFIA 1K89A 3SBDA 1YULA 2WA2A 2BTOA 3UCXA 4Y2GA 1KRHA 5JCZA 3O82A 3SS8A 3K1JA 1NLMA 1RI2A 5AW5A 2A1TR 2RC6A 1G0NA 3H2HA 4M36A 3Q2IA 4JU9A 4HVAA 5EZQA 3ZV5A 5B6PA 4ARAA 5JBQA 4XWOA 1SOVA 1N5JA 3EXFA 1SD5A 4YRFA 1C9MA 3LZ6A 1G8FA 1GKIA 4RK5A 1NVEA 4WINA 5K3DA 4IWXA 4MZDA 1JFSA 1IN7A 3GLKA 3K5HA 4BZPA 2RAFA 2BKAA 4JLUA 3TNDA 4IYJA 1AKVA 4LNUB 1XR3A 2XCSB 2GKSA 2OK8A 3EIWA 3MC1A 3SHTA 3HCFA 5L3QB 1DC5A 1WXWA 3KLPX 5CIQA 4F91B 3H19A 1HDEA 1Q22A 1TYDE 2B4AA 3H87A 4MQ6A 4BU0A 3OZBA 3NGLA 4OM8A 4Y2HA 8OHMA 3II6X 1XCPA 1PCXA 3O38A 5FO0A 1P1JA 2FRDA 3DMTC 3SBEA 1GAXA 4YIHA 3DZGA 4X7RA 2VDQB 2OQIA 5G1OA 2PEZA 4OYLA 5KAMA 1Q3HA 1DUIA 1CF4A 1EFCA 3FYCA 2PIAA 3GUCA 3KAJA 5DGTA 1PV2A 4MWGA 1A8SA 1CFJA 5F1KA 7MDHA 1ORHA 3OF5A 5GV7A 4BGEA 5AVYA 1AMNA 2IH4A 1MO6A 1MOPA 4D74A 1RRCA 3MUEA 3N05A 3G89A 1YR8A 4GSLA 5FKJA 2POQX 2V7QD 2IWHA 4JXKA 3CJRA 1EJ2A 1XE3A 2PZEA 3T99A 1XXLA 1M0SA 5J4YA 1XAIA 3G9XA 3BWCA 4YC7A 4YROA 4YDRA 1JPJA 1Y1TA 4YGXB 4ZQFA 4DDWA 4CJXA 4ZZ3A 2DH6A 4BC1A 3EEYA 5DBGA 1AUOA 3LWDA 1JDNA 2BFCA 4DCPA 4S12A 1IMOA 5H7XA 3F97A 3FB4A 4EFDA 5AM5A 5HOQA 2VJKA 4KGZA 4BKOA 2AX4A 2OKCA 2QTBA 4NP6A 4C9BA 2C2OA 2R4UA 2JL1A 3F3YA 2Y1CA 1UFQA 1IZ7A 2E4VA 2CDBA 1G21E 2PAFA 5F4ZA 4MA4A 1ONPA 2F1OA 3E1SA 3DMRA 2VYFA 5G4LA 4D8VA 1X38A 1LLDA 2PGXA 1MNAA 1RRVA 2FSVC 5G02A 2GB4A 3VU3A 3ZCTA 5C5IA 4RS4A 4IX9A 1UFVA 2BGJA 4FGUA 5E38A 1JRLA 2QMYA 3C87A 2XB4A 4XQGA 1A8IA 1RKXA 3A36A 3CLVA 3ZBPA 1A4RA 1DOAA 5AK4A 4H4DA 3ZS9A 1WETA 4LJ5A 4C30A 1P0IA 3FGNA 5K8VA 4ETWA 1JMKC 1JQLB 2NUAA 3OJLA 4MWCA 2ZRJA 1B8NA 1TQ2A 2ZT5A 1TYAE 3FPCA 4FVTA 3U48A 4EG3A 5K3SA 2BGRA 1H1LB 4R2KA 4Z8XA 2FFRA 3WV4A 4KR0A 2ZAMA 1KMHB 1W8DA 3NIFB 4UM9D 5CCBA 5LD2C 2PHZA 4H7FA 4XKJA 4G23A 4NBNA 4YJHB 3ZDQA 4BJ6A 4DT1B 2VO1A 1RABA 4L6IA 1BRTA 2W2OA 4DG9A 2R6AA 2R1VB 3CW2A 1D2EA 1TTHA 2D5AA 1Z0AA 2H31A 1N6PA 3JQEA 1V5IA 4WLEA 3RSHA 3GLIB 2XQGA 2PGOA 1NBHA 5EC8A 3NYRA 4N6GA 4U9UA 1XB2A 1BVHA 3BGDA 2DHQA 1WNTA 4RJLA 4BFTA 1ORIA 5FLKA 4ZV9A 4JUIA 3GGCA 2C5EA 2HJWA 2YUIA 2A9KA 3OU7A 1QU3A 3CQ9A 4DM7A 5KTYA 4OOFA 5J2TF 4QTXA 5KX5F 3P2IA 4M0PA 1BCRA 1TEHA 2JFFA 2JJMA 4N12A 1P2BA 2NACA 5J59A 3T12A 1LBEA 2G5TA 2JHCA 2VTVA 3UJHA 4KVFA 5AHOA 4AJNA 5JFGA 2HV8A 2Y6UA 4PHHA 3TOZA 3FPAA 3WJ2A 4BV2A 3ZLUA 5JJCA 1HZJA 1PS0A 2P8JA 2FZCA 2HJGA 2Q4EA 1XU9A 3FKSA 3I8XA 3H9UA 3OQJA 2AOWA 5LQNA 3V8QA 2AOXA 2EYQA 3JARA 5ICEA 3CXRA 2O2EA 2DKNA 3NNNA 4IBOA 5LBTA 3MJVA 4Q9LA 5ALOA 4OJMX 3B2NA 4ENSA 3F73A 4EG6A 3PTZA 1UF9A 4X3CA 5JPDA 1SU7A 1U2QA 2HMYB 3VVLA 2HTFA 2JIMA 1Z0SA 2NO7A 2WIGA 4P7JA 3BMXA 3AVTA 2AZMA 5L53A 3DONA 4HWOA 4M0CA 2ZBGA 4RY9A 4UTPA 4LKOA 1C7JA 2DPLA 2GDJA 2JLCA 5C4MA 2PU5A 2A30A 1QUEA 1S2DA 1V4BA 3MCZA 3PNMA 3B12A 4PR0A 4Q9KA 2B5VA 5L3QA 1KS2A 1X7WA 2WPDA 3SVTA 1C3JA 3EIEA 5IJ0A 1FQWA 1EM8A 1NY6A 4KMOA 5FTJA 4BMOB 3EG9A 3ODPA 2TMDA 1H0SA 1M6HA 1JPVA 1TMYA 2Q5JA 3AR7A 4GKBA 3KALA 1DRJA 4NENA 5C51B 1EZ4A 3OZCA 1U0TA 4E5KA 1HSZA 2V54A 2AC7A 2QV0A 2W2PA 2DQKA 2O8EA 1EQUA 1Q1EA 1WCIB 1BMDA 4TWRA 5AHKA 3S68A 4F1WA 1PO7A 4MRMB 2WM3A 4M87A 1N75A 1FS4A 2EIXA 3V4ZA 3FCOA 5AESA 1TMGE 2UYOA 3KQLA 1A8HA 5JJIA 1T9CA 3CVJA 5DT2A 4D80A 2ZJ8A 4G5QA 1BGWA 2GAOA 4NXMB 3H4TA 1AZTA 4BAGA 1DX9A 1XRSB 2YOFA 5K0LA 5IM4A 3KLOA 1YI8A 2AXNA 3HVUA 5KOJA 1RQLA 2OO5C 1JHXA 2MTBA 4IRXA 3H9GA 4YAWA 1V3VA 1K4MA 1G20A 4GXTA 3OIWA 4WV3A 2DECA 4NK4A 1IM8A 1UC9A 4P0QB 3VPAA 1Y9JA 2W0MA 1L4EA 3UNXA 1TIPA 3T1YB 5TMEA 3GFFA 4RVFA 4IO0A 4Z9BA 2FI1A 3O3NB 2R2GA 5T6MA 3TLMA 1QGAA 5C1IA 3HCEA 3KJZA 4FUQA 4IDQA 4YJGB 5TVKA 5KNCA 5H82A 1HXHA 3C3PA 1M6VA 4MRVA 5HF6A 4DSAA 2QX6A 2O3TA 3N3BC 3ZE2B 5CYFA 4G5SA 1Z6TA 4F3CA 5JSZA 1EIZA 1L5QA 2A33A 3R5HA 1X87A 2XF8A 2YZKA 4GZ3A 4MJ7A 4BCCA 4RQBA 5DHQA 2Q21A 1FMJA 3IXQA 1SURA 2K87A 4CQMB 4CUZA 3KEMA 2CZQA 9LDTA 3G8BA 4LHWA 2UXBB 1ZBQA 2DBRA 4BZZA 3FBTA 1S6YA 4TMKA 3D81A 4ZU3A 4LYEA 3UWSA 5CFZA 3FSGD 3NTUA 4WZBA 2NZYA 4YWHA 4BXOA 4OHCA 3HXTA 2WAMA 1QM5A 4G9BA 2DXIA 2GTHA 2FSIA 1RLUA 3UAOA 2GK4A 3V32A 3PWTA 5EJMA 4HAWA 5FEMA 2Q8PA 4GSYA 1TIBA 1S01A 2UZ1B 2HIHA 3UJDA 3JAKA 4BWVA 4PZLA 3WLLA 3O2QB 5JG7A 3TZBA 3UPTA 1QE0A 2AN4A 3LWNA 3HJCA 4GICA 2BGTA 3D2BA 1VE5A 3O8OA 2X42A 4GI3A 3K0AB 4YMTA 1F0PA 1RE0A 1E1MA 3CO0S 4HGYA 3V1KA 1TQ6A 2V3WA 5JW6A 1XDGA 4TTJA 1GILA 1L8QA 2P9EA 2WAAA 3AETA 4CF3A 4GP6A 1G20E 1HURA 1Q77A 2R751 4H3HB 4MRAA 4OI1A 3H04A 3N0VA 2XNHA 4DCCA 4FZ3A 2V3VA 4PZZA 4XFKA 2ZJZA 4GT1A 3X1YA 4CQNA 2A1IA 5JC1A 2WYOA 3T5DA 3UM9A 5IRCD 1JG3A 3ZS8A 1G9XA 2OV1A 1DHTA 1TTQB 4BATA 3PNVA 3WL4A 4OTZA 1DEKA 2FW8A 3KT8A 4JLNA 4UDXX 2ZE7A 1WVGA 3FPKA 3U7RA 1J97A 1ZU5A 1AC5A 2CB0A 1XZLA 3E7DA 2J33A 2QX8A 3L77A 2PT9A 3IVGA 1CQXA 1GCAA 2HW8A 1WX1A 5CA0A 2PQMA 3N6VA 4TWJA 2GETA 5JE8A 3RUCA 5KNBA 3GEIA 4FLMA 4MGHA 4XGIA 2FH5B 4DC0A 5CEFA 1H4SA 5HUJA 2WV9A 2P67A 1L5ZA 2FN4A 4PSKA 5SY4A 1M2KA 4NCXA 5TY0A 3TOVA 2JH9A 2O7SA 3FIUA 2FKAA 5BNZA 1YUBA 3WBBA 2VFAA 4CM1A 4EHAA 1A7UA 5CX1B 1KS9A 3OEWA 4KE9A 2FN7A 4TVOA 1RBMA 1TTPB 4G2TA 4EBFA 2VF7A 4UU1A 3UAZA 5LOVF 5JWRA 3KUDA 5LUAA 1DT5A 4BMXA 3HMQA 3C5CA 3MCTA 1NTOA 3HKBB 1AKYA 2HWUA 3K9GA 3R3JA 5AI4A 3F9CA 3AQ4A 3OC6A 1C30B 3V4OA 1QH1A 4CM6A 1ZWLA 1EESA 4PLCA 2AR0A 3WRXC 1L7AA 2W8BA 1JR3D 3UJAA 1OQAA 1QUFA 2ZYUX 4QJ4A 5JEDA 3OKAA 3BH7A 2ZQYA 2W5UA 4QRDA 1KE1A 1TIKA 4G84A 5GY7A 1YB2A 3ZBUA 2PDAA 1R15A 1K4KA 3Q7QA 4AWXA 2CXXA 5HZHA 1YZYA 4WZAA 1JG2A 1JFFB 2ID8A 3W6PA 4BASA 3GJSA 4S1VA 3VDXA 3FSEA 2P0YA 2BFEB 3JRNA 3M4ZA 1DAGA 4X94A 4JEUA 3ZQKA 3VYSB 4IJUA 1SBTA 4FDAA 1T15A 1UBUS 5K8IA 4GI7A 2MJLA 4L0QA 1ODCA 1TZ2A 4MP6A 2MU1A 2XMPA 2WOJA 2WM2A 3IIKA 2XQVA 4BNDB 3GLFB 1XL1A 3L40A 4LZAA 1H6DA 3RGWS 1MX5A 4M38A 4DM4A 1M74A 5I9NA 3QOYA 1T5OA 3BWBA 3C98A 3WWZA 1I5RA 3TFQA 3IEMA 4TL9A 4M1EA 4IJMA 1H3NA 1SEVA 4UPDA 4B17A 3DAOA 5F23A 1FTWA 3ROQA 5SICE 4OATA 5E2IA 4ISBA 3C6YA 3QITA 4NDNE 5EIFA 2Y66A 3BM5A 3ZZNA 1B42A 1ZQ9A 5EXEA 5LFAA 2HBZA 3DD5A 3RROA 1MF7A 4FMBB 2FUG6 4M0KA 4ROTA 4YFVA 2X0FA 3T5BA 3TQQA 3ZEIA 4EENA 5ERXA 5ADVA 3SHVA 1N3BA 1T4CA 4K9MA 3RODA 2EFGA 2Q07A 1IEVA 4PQFA 2GAFA 2IUUA 3U49A 3TQSA 4WASA 1WB6A 4MUYA 1Z13A 5FF9A 4BV3A 2F8TA 3ND9A 1D6NA 1VHWA 4YMSA 1XU7A 1AKWA 1X1RA 3VOBA 4CM5A 4QPPA 1DADA 1JIXA 2A6PA 4ROSA 5B4UA 1GEEA 3GJ7A 4MIYA 2Q7DA 3SHQA 4C88A 3QVTA 3W9BA 3ONDA 1U4OA 1UBFA 2IP4A 3OZAA 4NPHA 3ZH2A 4J0FA 1N6HA 1CNMA 1GNRA 3IIIA 4OB8A 3VDNB 2X7HA 2X7JA 5SY6A 4N6NA 2VZEA 5D86A 4ZEMA 2YWEA 1RAIA 1MJGM 2QRJA 1EAMA 3HKCB 4HLQB 1IUNA 1E9FA 3M83A 1JLKA 2XEXA 2VDMB 1KSHA 2B8NA 4JY7A 1TA9A 1V1RA 3VU9A 3M49A 1OXBB 3PGA1 3VNVA 3LX6A 1V35A 4O4IA 4QJ5A 3HJRA 4FONA 3D8NA 4QDKA 3VR6H 3PR2B 1ISPA 1HORA 3C2QA 3CVOA 4R1OA 2Y68A 2H3HA 2WAYA 4JSTA 4E94A 2Q46A 3LT2A 1VL8A 2OQ2A 2F64A 1H9AA 1QXSA 2R86A 1QTNA 5EESA 3RVKA 2H1OA 2EDCA 4I5EA 1GTSA 5JFOA 3WIUA 1E2GA 4YRZA 4LOHA 1WHTB 4AP9A 2EARA 1SAYA 1DUVG 1AKRA 4MS3A 4OHPA 5EIAA 1QVRA 4ACAA 3HVRA 3AKZA 4E70A 1NP3A 3FUUA 2QTVA 4ZAWA 4W5QA 2A9RA 4UHEA 3HXMA 3K92A 4JJ6A 1CY6A 1YS9A 5FIUA 1EUCA 1MC1A 1PSWA 1R16A 3OWOA 3QYJA 4X8HA 5EPUA 1EBBA 2V9CA 1S7CA 3FTPA 3NUGA 3CLRD 2NPFA 3MVEA 2B8TA 2YICA 1S3FA 2BM1A 3E5MA 4QNMA 4BOYA 4DY6A 3NWEA 1JKIA 2YYYA 4F56A 4ND8A 2OBXA 5DNVA 3T4PA 1B1CA 1CZKA 3AOEA 4MUNA 1LTKA 4KOAA 3JARB 4OIFA 2I34A 5BWBA 5AJHA 5JCPA 3IV7A 4HXEB 5C1OA 1FL9A 1PDOA 3NPMA 1J90A 3PE6A 4K9QA 4R2MA 4YO7A 3EIOA 2F2TA 2W2XA 3OQBA 5AP9A 1YC5A 4FW9A 3FJ1A 1W1WA 4DV4B 2O8BA 1NPTO 4C4XA 2GUWA 1XP5A 4V0SA 1ZK4A 3KEOA 3GNQA 4FR0A 4F93B 1VHTA 1GPYA 2ISQA 1DDOA 1RHMA 1ZRHA 3DQZA 4JITA 3RANA 3VR6A 2KMLA 2R8YA 1UK9A 4PANA 3Q41A 4G9EA 4U6SA 5DTRA 3UATA 3VNRA 3L8EA 4FHEA 3LOPA 2EW8A 3LSYA 3ABZA 2HEIA 2KPOA 1G8HA 1YA8A 1NURA 2XIQA 3CEMA 1L8LA 4PFQA 4AU1A 2WBLC 1BH6A 1WV1A 4M1MA 1L3BA 3L6CA 2P1DA 4Q0MA 4U2DA 3VJLA 1EVZA 1FTNA 4XWYA 1T9HA 3EQ8A 4MV3A 2ZYSA 3P0EA 1O9GA 1S9DA 4G1VA 4XWGA 4OK3A 5HFAA 3WWOA 4EJMA 3VSBA 5KJ6A 5J2TA 2DFPA 2PLNA 4L9WA 4QUJA 4CI9A 4B3JA 3S40A 4G56A 5FCDA 4AIRA 3CC8A 4HAYA 2QUZA 4NICA 2BEKA 1BTOA 4BFYA 4C3OB 4DWWA 1P0FA 1YC2A 2EWWA 3OUUA 5CJJA 2WHXA 3BULA 2VJNA 2BEWB 3THRA 3ND7A 4YMLA 2H5IA 1WUIS 1VGRA 2ZPUA 1S2NA 3ZU4A 3HMKA 5C7OO 4ESHA 3O95A 2VP2A 3VQTA 3WYFA 1Z8DA 1FNDA 1HQDA 4ATNA 5U4XA 1QIKA 3HEBA 1I7LA 1KF0A 3UMMA 4CEJB 1BDHA 1U7WA 4W7HA 1QK5A 3TTXA 4P7KA 4MVJD 1JU4A 2XA2A 3LCCA 4BE4A 4LMPA 3UMGA 4IMPA 4X41A 3I53A 4A9AA 1JI0A 4DV6B 3ZGZA 3CV3A 4WXYB 5T8KC 3BK7A 3RSOA 3TVDA 1WHSA 2ZB8A 5F7JA 4CV1A 1E2NA 2XMCA 1YFZA 1ZI6A 5IAJA 1DEOA 1LLQA 1ADGA 1ISIA 2B92A 1NMYA 1A9TA 1NFFA 2QR5A 3HM2A 4GE3A 1P1IA 3VMFA 1S1MA 4YMUA 1N2ZA 1HTWA 1JPNA 1Q1NA 1ZIXA 4II3A 3EHEA 3DTYA 4OLFA 4XRRA 4RHEA 3FE2A 4HWSA 4BMDA 4QGAA 1O1YA 3K20A 5H8WA 3ZWWA 4FQ7A 3DBHB 5CK5A 1QQ5A 3PFFA 2NZVG 1F8YA 2ZSEA 1DWUA 3OQIB 4BMPB 4B4DA 4GLFA 4L57A 2BE9A 5CT9A 2B37A 4M8NE 3B6KA 3WL8A 1O95D 3SJCA 2LDBA 3SEAA 3A32A 2VDLB 3TDKA 1HE5A 4J0KA 4YT8A 4FK8A 1Q1AA 3GC6A 1O94A 6CHYA 5L7WA 10MHA 1TXGA 5HIIA 3A3PA 5EKDA 5FULA 3QPAA 2FPKA 1BCSB 4LEIA 2IZ1A 4C0BA 3ROFA 4FFWA 1I3NA 4IX1A 3PGMA 3A3YA 3W2HA 3RS9A 1IUPA 3ZKWA 2H48A 2Q3EA 3K31A 1OX4B 4Y2JA 4GC5A 3VZDA 4AROA 3MEQA 1OWNA 4GMHA 2JGAA 4GR5A 1VCIA 2H4XA 4B3FX 4K9PA 1V1MA 4RTRA 5D3MA 1WBBA 4X20A 1PS9A 1WBJB 4L4UA 1WSAA 1JG7A 1IRIA 4TLCA 5EMHA 4UNPA 2WWYA 1QDUA 2QYOA 4IJKA 4M6WB 3MS2A 3RDPA 1JV2B 3V5NA 2Y8EA 3TLEA 3C48A 3QEAZ 5IT9A 1SU6A 4J3FA 4WX2B 3WNZA 3MD0A 5MGNA 4Y6SA 1B8UA 2O2JA 3H99A 2NIPA 2HDNB 4P98A 5TQ2B 1AV7A 2CV2A 3RYHB 2F4VB 1OFUA 1BHJA 4LXUA 5JDIC 1X74A 4DR7B 3KDSE 1KERA 5GIPE 1CDZA 1EXWA 1QIGA 1QZZA 2ZRBA 3C8ZA 3Q9UA 4WESB 2W93A 5E6RA 3VSCA 1E58A 3KVYA 4AS3A 3KZ1E 3L46A 2BSQA 1OBFO 1JMVA 1A7KA 2QE6A 5TRTA 1X2EA 3KYDB 4F5YA 2LUOA 4FR2A 4XDYA 4EJ6A 3SC2B 4JIGA 4Q66C 3AWDA 2ZREA 3ZHZA 1KR2A 4DJ5X 3WNVA 1Z4NA 3WMEA 3OX1A 5JZBA 3H6GA 1BG6A 4P3KA 2HNAA 1NJ1A 3E4CA 2QAGA 1Q7BA 5AMXA 2VF2A 2YV1A 1U8YA 2Q4RA 3EGEA 4IVQA 2X0DA 5IKPA 4RMHA 2I6SA 4ZV7A 2OYSA 3MS4A 2H16A 3GFPA 4RK0A 4DL9A 4YDQA 3KB6A 4TMTA 3D8TA 3VC3A 4DLNA 5JQGA 1FYWA 1N34B 4D46A 3QJGA 3QBTA 5H9WA 2RHJA 3HA7A 1GSHA 1L4NA 3M3HA 2DPGA 4J0CA 4L4SA 4DA9A 1NBMA 2HCRA 2ZIGA 2YTZA 1HFKA 4LXQA 4ZOCA 1UKBA 4UBOA 4E2YA 2PMFA 1UFKA 1WDLA 3INGA 3LZCA 4LPSA 2C0QA 4AZWA 4EZEA 3UJ8A 4AL4A 2A5YB 1K3TA 3SE7A 1K0UA 3QE4A 1U8UA 3ZUGA 5HJ2A 1XNRB 3L9WA 4N5NA 5JWOA 2VDUE 5TT0A 3KWJA 3EMBA 5JZMA 4FT2A 2GD1O 3NKFA 1JIJA 4LOKA 3SZUA 4HB3A 4AJ1A 5AICA 3FDZB 4BFZA 2BGLA 2EEZA 2WKWA 1EB9A 2DQZA 4NHEA 2J6CA 3TQIA 3UAVA 2WJVA 3OIGA 1CHDA 1P18A 1KQOA 3H83A 4II2A 2WFAA 2WFZA 4URYR 2OC9A 5CTJA 1QO0A 4ENRA 2F90A 2UZ0A 4FD3A 2I4MA 4BC0A 2C9BA 1NUUA 3NTVA 1HQYE 1KPGA 1HLFA 4JBYA 4EJ0A 4ZGBA 1RACA 3PX7A 4DMHA 1KSGA 3TPFA 1I7PA 4JI1B 5T4HA 2AOTA 3SIWA 4QJ3A 3ABIA 1PHRA 4C1BA 1WKVA 1PW7A 1M0TA 3Q85A 4REQB 4Y2TA 1ODIA 2D1FA 2FCAA 3ANYB 1FP6A 3GJ0A 4IKEA 3Q5EA 1P60A 1G9SA 3N2GB 3OFND 4FGLA 1QPGA 4GPBA 1XLWA 2Z3WA 5IAEA 1YKFA 5F5LA 1L7EA 3AX6A 1ZUIA 3O03A 1TJ5A 1D09A 4WDRA 4WNAA 2Z6VA 5TE9A 2AVDA 2MINB 2FDRA 4FC6A 4FJ1A 3T7RA 1Y1RA 1DAEA 3AUKA 1N9GB 4N49A 3VR3A 1Z4QA 2D2XA 4RADA 4EO9A 2ZWPA 4JBGA 2V65A 4MW6A 4NJMA 4FFMA 1E7YA 2QIPA 3KOZA 4MP8A 5COBA 1K7XB 3WKEA 4UTRA 4Q3OA 5A5VA 2OYRA 1RLJA 2PMBA 3DQQA 1Z82A 1PTJA 3FVRA 4CKYA 1RVV1 2D2IA 3QLJA 3NIBA 1Y8ZA 4F3RA 4AI6A 4A4DA 3R7NA 1CE8B 1SG0A 1TMKA 1U94A 4NMLA 4Q39A 5EE0A 4M8SA 4RIHA 4N65A 1JIIA 3L07A 2PX4A 1U7PA 1BDIA 3U19A 4QDOA 4Q3NA 3EDRA 3V7WA 4OLAA 1OIVA 3EIXA 2XTAA 3BSSA 2PXAA 5IKXA 2DPHA 2VIIA 2QPAA 3L8HA 1NUTA 1LFAA 1ORVA 4IS3A 3MT0A 4J03A 2BMAA 3JD0A 4XRGA 4KQ2A 1UBSB 2M32A 3CFYA 3I61A 3VTZA 1ZNYA 4FI3F 4EB8A 4IDPA 4ZVNA 4KB5A 3ZCPA 1WD7A 1NBAA 2X0NA 2JRCA 2YXNA 3WWPA 5KHAA 4RVNA 3ZY4A 3BIWA 1CBUA 2I2XB 5K0GA 2ZK7A 3A28A 4DNFA 2XWJI 2FZ5A 3GT0A 4Q12A 5L4LA 1P5HA 2P0AA 2J32A 2B0JA 3R41A 5J63A 4HZGA 4A82A 2BHLA 2MYPA 5TPWA 1GPWB 1VM6A 1MOZA 5DCWA 1V7QA 2FFBA 2P7IA 3E5RA 4POAA 4QUKA 3WJ1A 5K4GA 5D5QA 4KVZA 1V4NA 3OBBA 3VV2A 1XVIA 1RT9A 5B64A 4WWHA 4KO4S 3N5CA 4W5OA 3RFCA 4UQPA 3B3QA 5J9FA 4ER6A 1ORRA 2BM0A 2R66A 1QIDA 2LV8A 3VZRA 4GPTA 4YP6A 1OROA 2MOKA 2ZWIA 4Q02A 4ZK6A 1SKQA 2G82A 1PRYA 3IPRA 3LA6A 4RACA 3ZLJA 4J0HA 1DBPA 3NIGB 2ZXFA 4AC9A 2CYAA 3X1DA 1P0CA 4KNVA 3M6VA 4D92A 2J0UA 1SC4A 3AJRA 3Q7SA 2NT3A 3AJ9A 2FGKA 2J4DA 4Y9SA 2ERXA 2J3LA 1T5DX 3IBFA 4ZDWA 1PYDA 4GOJA 2Z8XA 4NFSA 1OLSB 3WLIA 3L9XA 3ZCUA 4MAAA 1IXZA 1RBYA 4N54A 4K26A 5T7BA 4C2UA 1PSDA 4GNKA 3MAGA 2R8EA 5KU7A 3BMCB 2VUUA 1OKKA 5AI8A 4P35A 3IOYA 2D8AA 4BYMA 3RF6A 5FBRB 4PAQA 4AF8A 4IINA 1S2LA 2BFOA 1HYHA 2PO7A 3IVAA 2PMWB 5G0SA 4E4RA 2EW1A 4PO1A 1M33A 4HDMA 1ZK2A 3KV3O 1SB9A 5D87A 4MRNA 4DG5A 3C5HA 1DXHA 1C5KA 3OTIA 4HRVA 3TWOA 4AP6A 1EXVA 2VQ3A 4LF9B 1DEXA 4JJGA 4JU8A 3VR6D 4AJHA 2ZUDA 4R0VA 4D96A 2DLNA 1ZVJA 4OBXA 4FYMA 4YJ2A 1HG0A 2FPOA 3AF5A 4B76A 3T06B 2EGUA 1BA3A 5JHHB 1JAZA 1Z2NX 1RVDA 3MUNA 3OE7A 1XA4A 3LOUA 1A5ZA 1Y3AA 3WOHA 4C7KA 3QLUA 5CVUA 3O8LA 3E35A 2C9YA 1PJQA 4K9DA 3ETJA 3MOGA 4ND8B 3RVMA 2QZJA 2R00C 2ZUCA 4BFXA 5REQB 2ZU6A 5CFLA 1PP4A 3RYCB 3S28A 3OJWA 1ZIPA 2KX7A 1W9HA 3PQFA 4OHVA 1QP7A 1EFRA 4L0DA 2COEA 1EUCB 4A8JC 3IHWA 1W88A 2XGSA 4WK2B 1E89A 2CLSA 2WJYA 4WZZA 4GI1A 3HZRA 4PGMA 2WVJA 2AEFA 5AQ1A 2WQ6A 3M3PA 2YWGA 1U0FA 5JTTA 3EPKA 1GIAA 4JODA 4XSHA 3DUWA 2JFNA 3NWPA 4JOSA 2EFYA 5HP4A 2HZBA 4KK3A 3W0LB 1W46A 1JKXA 5G53C 3S8MA 2R00A 4BDTA 5LL6P 4P3PA 1NVVR 1HETA 3E5NA 3FMIA 5J2TB 1ZMXA 2D59A 4Q1VA 1KDTA 2QE7D 3B5EA 4XM0A 2Q0HA 3KR2A 2Z2KA 5D7NA 5K8CA 1XCJA 3UT6A 1YK0A 4QUAA 1JHVA 2GVNA 1KTIA 4U0KA 4YPVA 4NBVA 3ZR4B 1Q21A 3ZWPA 5LQMA 4BKMA 4COOA 3ZD6A 3FI9A 1UK8A 1WW3A 1IN1A 2AA3A 2ZSIA 1VE6A 3CUYA 3NUZA 3P9CA 1IWOA 3HFSA 1MG0A 2A88A 4NNJA 3K9FC 1Y0BA 3VX3A 2QMQA 3B78A 5JNSA 2D6FA 2G04A 4K5QA 4JVSB 4X1KA 3R7WA 3WGVA 4X6LA 1B14A 3BTSA 4WBNA 1LDGA 2AJTA 5BMVB 1U8XX 1ZW6A 1Z5GA 5BMVF 1UPTA 2JLAA 1XCLA 3TH5A 1G20B 2R6ZA 2QP3A 2D5LA 3B6JA 3CF0A 5K51A 4EVRA 2XJ9A 4ZO4A 2VXCA 1ZA2A 3ND5A 1ACMA 1O4WA 4F2PA 3B3FA 4UJ5A 4PPQA 4B80A 4BQRA 3A6DA 5H83A 4F45A 1PV4A 3PG5A 5CJ2A 4ASUA 4R6XA 4HLUA 1CQJA 3U7HB 4G5FA 3UA3A 5IAGA 4B32A 4DYHA 1YS7A 4C78A 1CF2O 2Q5OA 3LO8A 3VJMA 1UMBA 3E23A 1IXYA 2ZUEA 1NC1A 3E53A 1DO8A 1IBSA 3O8DA 3VVBA 4D5GA 2OB1A 4Z1OA 2AWNA 1XZDA 4MOWA 2X76A 5IS2A 2GCIA 1P2DA 3OOEA 4BN4A 4ZWNA 1Y5LA 1XTBA 2P75A 2YNMD 3B1ZA 4PLZA 4F9EA 3DP7A 2C9OA 2YQZA 2M9MA 2WNHA 4GD3Q 3WLNA 4EYGA 3KDAA 1ZUD1 3TQCA 1L7RA 4N8EA 2RGGA 4EJSB 1HKHA 2OORC 1ZUHA 3DR3A 2XTJA 4K6OA 4N9QA 3RV4A 4QOIA 2ETXA 3OCCA 5T64A 1V37A 3CZAA 1RBZA 2WPDD 2RSLA 2ZETA 1UR5A 1OAAA 3P26A 2J1LA 2XGJA 3H1AA 2UVPB 4BY9E 2VHUA 5FOUA 2F43B 3B70A 4BP1A 4ZI5A 1MB4A 5MFPA 4L85A 3KLBA 1AXRA 2X5JO 1E69A 3D1LA 2CLMB 2D0PB 4CL8A 5BN4A 1MJHA 4TYMA 3CJQA 4K1XA 4YP7A 2JJ1D 4IDDA 5MHTA 5FTLA 2EG9A 1OB5A 1KI7A 2JARA 3KOYA 4PFJA 1NMSA 1I7DA 3BC1A 3B9RA 4IQGA 5B4VA 3GLHB 4DSZA 2OOSA 5L7TA 1KJNA 2CE2X 3GNLA 4CKBB 4DNQA 1I4LD 2CL5A 3GG2A 4LXGA 4JI5B 1D2MA 4HGQA 4KIFA 5CGQB 2R96A 2BFAA 3EBOA 3KPJA 5DCYA 3W2IA 5FWYB 3STWA 5HRAA 3B36A 2WWXA 5DIZA 1B8PA 1WOYA 2ZVJA 4MV4A 3H8VA 3LYAA 2NAPA 2AFIA 4HMOA 3RKRA 4JP5A 1G5HA 4JYBA 4EVQA 4QTYA 4LY3A 3AY0A 2IODA 2W6PA 2ZBEA 3R75A 4WLOA 1ULSA 4YRQA 2GFHA 1A9XA 1XVLA 1YHYA 3W1WA 4XZ3A 3ZHTA 4YCDA 1L7VC 3A4TA 1FJ2A 5IVDA 1ST3A 3LHKA 4EGJA 5J4HA 2W6ZA 2JJYA 3V3KA 4YJGA 2VN8A 2RHTA 2QAGC 4FE7A 1G3QA 1W59A 3BB4A 5GZ3A 4YT5A 4F9TA 1U1EA 4M6WA 3V97A 4CFYA 1W7AA 3RI3A 1DEAA 3FYUC 3EGIA 4UUBA 4RETA 3ZV3A 4EGAA 1X9GA 1CEXA 3OQOA 4GEGA 1UP6A 1PR3A 5B55A 1IVYA 2P11A 1BU8A 3JTEA 4I2VA 1I0IA 3U4DA 4YCCA 3DBLB 5LR6A 2WHPA 2DM6A 4TTSA 2PNJA 1ZNQO 2WZBA 5EVJA 5KS2A 1EDEA 4Z0TA 3G5AA 2ZVQX 3DB1A 3HYNA 3ICPA 2AUMA 4EPVA 4RXTA 2XQKA 4NHOA 2V97A 4HWKA 1DAHA 4Y7DA 1ECPA 3E7WA 3MFQA 4JL5A 4FOTA 1YJBA 1NQ5A 1DKUA 4BO4A 4R0NA 4YCMA 1OFIA 1EK5A 1VL6A 3C1UA 3U2QA 4D3FA 1HOXA 3PGLA 4G1BA 4MPDA 1A50B 2Z83A 1R6TA 2VT7A 4NU6A 4B6QA 2EZTA 2HJVA 3F6EX 2VCEA 2ZS7A 3LLMA 2IP1A 3BK2A 3EFHA 1KC3A 1JGTA 3E2IA 2DF8A 4UDOA 1A76A 4W7IA 3ZYZA 1GDDA 3AHCA 5KYTA 1NYLA 3OZXA 1WIWA 1R6XA 3CT6A 3GFTA 1Q2XA 4GZLA 5FEUA 3S2YA 2GGSA 3UT0A 1K63A 4D3ZA 1UKZA 1YDWA 1MN6A 3I76A 3JYOA 3MCVA 5L8VA 2BUCA 2H2IA 2RHRA 3EARA 3EGVA 3JQCA 1O7JA 1W2WB 2IELA 5AKEA 1JEDA 5F4BA 4TS1A 1YWGO 4YAJA 5K3FA 5JNTA 3C0KA 2B36A 3QX8A 3GEMA 3CG4A 3GJYA 4Q4JB 2DUNA 3N1UA 3KYDA 3L8GA 3VR5D 3O94A 4ZQBA 5DOZA 3VYUB 4BAUA 1KMNA 3GD5A 3OP4A 1LQUA 1N3YA 2I1WA 3PC8C 3G23A 2Q9AA 2XUPA 2ZI5A 4MVYA 3Q11A 2QLNA 4GPZA 2XXAB 1U8FO 2GF0A 2YYAA 2ZJOA 2JJ8A 3GUUA 4JH0A 2XYRA 3I5UA 3CX3A 4TXLA 3DZCA 5KI6A 1M6VB 1GCIA 1K5PA 4EKDA 1GG9A 2O5RA 4D1YA 4IEIA 4FFBA 4JV5B 1UDWA 3W9SA 3NT2A 2RE8A 2B3DA 3AEXA 2WWFA 4PG6A 1DFHA 2XMRA 3SSAA 3WSTA 1N6IA 5A4IS 5CA0B 2LCQA 3HM9A 3BQ9A 4UHFA 5AXBA 3U80A 5C8XA 1C9YA 1WULS 4CR8A 4O02B 3UJPA 1N8NA 1TYBE 3ESXA 3QWHA 2CVQA 4JWKA 3L79A 2OY0A 2GAJA 2AR9A 4G0QA 4NATA 4MXDA 3BFPA 3EUWA 2CDCA 4X1YB 3QPVA 1ZI9A 3KCQA 4PLPA 1AN9A 3QUSA 3UXHA 4HDNB 2R68A 3D59A 3S8YA 3ZVMA 4LF7B 5D1NA 4WA8A 3A26A 2A35A 4IIGA 3RLFA 1E3SA 2D7JA 3MXTA 3NNSA 4K9LA 5DIFA 3HR4A 3ITKA 4O6VA 4KXQA 4K9NA 3B6ZA 4KFUA 4RKRA 2CWWA 2H5EA 1N5OX 2BIFA 3A14A 2YNMA 4AY2A 4LNAA 1J9ZA 1I1QB 5DULA 1T2EA 4A6DA 1Q50A 5K3FB 1HGXA 2IBMA 3OJCA 4F9GA 2V5AA 2OFXA 4LQCA 1IPHA 4H7IA 1MH9A 3T4XA 2FWNA 3O2NA 3T9AA 1ZJZA 4KR6A 4KQHA 5KJCA 5KDDA 4FIZA 4UNIA 1WVIA 2E4ZA 4Y6OA 1OI7A 1T26A 4CQMA 3B3JA 4EPYA 1OIXA 1D0IA 1V11B 2IEAA 5C8YF 5L40A 1GOTA 1TT5A 3NOQA 2FHSA 2TRSB 4HJXA 1OH8A 4MUBA 4B47A 4QDJA 1A5TA 1BH2A 1VBNA 3CTMA 2G88A 5FJJA 2ONKA 1EMDA 2QD2A 3GAFA 4MMYB 4ZALA 4PZYA 1S89A 3WZ2A 3PFWO 5KYYB 4DNPA 3UB2A 2RKOA 4BBPA 4UQLA 1FLNA 1KVSA 1L8OA 2FP4B 4ZARA 1Y5IA 5DLYA 3EPRA 4BLPA 1V8OA 3EPLA 3I01A 4I55F 2CE7A 3IELA 4U9IS 3USCS 3UK7A 4J0QA 5JPCA 1FU7A 1FX0B 1WDKA 1KMCA 1BD3A 3I3SR 2VHZA 5BSRA 1IQ0A 3GP5A 3AEUB 4UEOA 2G67A 7MHTA 4G63A 2GLTA 3M5DA 1U11A 3BJRA 3NP7A 3VR5H 4E2FA 3LDHA 3QWFA 1TF2A 4ND3A 2XAUA 1GPKA 5AJVB 3W5VA 1S1CA 4GZ6A 4MVXA 5BW5A 4ZT4A 4FM9A 5FR1A 1YMQA 3KXKA 5G4KA 4WXMA 1I3OA 2H00A 5EP2A 2UKDA 3G85A 4ZHQF 1OTXA 1PR6A 1TU0A 2QDKA 4XD2A 1WWKA 2B61A 1DMRA 3IERA 2R1TB 4K6CA 4ND5A 5C32A 2WWRA 2JLSA 3NYQA 3L4EA 1ECFA 3CZ4A 3AF2A 4QOGA 2GOYA 3LKZA 2WAXA 1TEVA 4WNYA 1CQWA 3FCEA 3FPBA 1W47A 1K68A 2G40A 3BICA 2UV8A 2AXQA 3O5AA 3OWXA 3W9YA 1T5SA 3HYTA 4XE5A 1OJ7A 2QW0X 4RTQA 3CR7A 3TNLA 1XDBA 5ED4A 1E5TA 1DKMA 4P81A 1NT2A 2O3JA 3L1HA 1PZNA 4MKZA 5JAPA 1Z6XA 3QPCA 5F2NA 1WP9A 2GYYA 4CCSA 1O96B 2PZ8A 3UAGA 4GUDA 1SPBS 1I51A 4KR9A 2NU6A 1J5XA 4RABA 1YB6A 2BZ1A 3PXCX 1QNFA 3IAXA 3EK2A 5HCIA 4JEIA 3ZDFA 2ORIA 4D9KA 3MMZA 4TV9F 4Z51A 4KV9A 3K32A 3RBXA 4YT4A 1HPLA 1NKSA 3O92A 4LJ7A 4WEOA 1FJXA 1OU4A 4HS4A 5DXJA 4Q4AA 1QFSA 1AUXA 4V0RA 3BSYA 4TN1A 3PDUA 1U98A 1E9AA 4II7A 5DWVA 3BG5A 2WD9A 4LJKA 2PRZA 2SECE 4KCGA 4NZNA 1U8ZA 3BD6A 4LJ4A 3SDBA 4BFSA 5FWNA 1WXEA 2O8CA