2M6KA

Solution structure of the escherichia coli apo ferric enterobactin binding protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
292
structure length
292
Chain Sequence
b'ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrienterobactin-binding periplasmic protein
publication title The solution structure, binding properties, and dynamics of the bacterial siderophore-binding protein FepB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 50
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2m6kA02
4G07A 4M7OA 4WNAB 4WESB 2R7AA 3AERA 4H59A 3AEQB 4XPIA 4TKUA 5CX1A 3ZK9A 3MINA 5CX1B 4FKMA 5M29A 3BE6A 2O1EA 2PS0A 4INOA 2XDQB 3UJPA 5M3BA 3TEFA 4WN9A 2YNMD 5B58T 3U7QB 5JOQA 1KAEA 2AFHA 5HDQA 1M1NA 3MWFA 3R5SA 1M1NB 4OXQA 1QH1A 3ZKAA 2RG7A 1QH1B 1KAHA 4UDOA 3HH8A 5M34A 5KHLB 5CR9A 3BE5A 5M2QA 2R79A 4B8YA 5JJ5A 1PQ4A 5JPDA 1FP4B 3AETB 4MX8A 4BBPA 1M1YA 1N2CA 2AFIA 4INPA 4WZAA 4UTPA 3LHSA 1N2CB 2AFIB 2XV1A 2OV1A 3PSHA 4MLZA 3ZK7A 3AERB 4XPIB 1EFDN 4TKUB 2PHZA 3MINB 1K75A 4CL2A 2OGWA 2M6KA 2XQVA 3EIWA 2XY4A 3TLKA 4HMPA 2M6LA 5KOJA 2WHYA 2MINA 1K2VN 4WN9B 4HN9A 2MINB 3PDIA 3GI1A 4UTOA 2AFHB 1N4AA 5BVGA 5BVHA 1L5HA 4N01A 5BVHB 3LI2A 3TNYA 4PM4A 2WI8A 2Q8PA 3AEKA 4HMOA 4NNPA 1PSZA 4TKVA 1N4DA 1M1YB 1N2ZA 4WZAB 2YNMC 3R5TA 2OV3A 4K3VA 2PRSA 2OSVA 3NU1A 2PS3A 4PAGA 4DBLE 4GICA 4ND8A 5KOJB 2Q8QA 2X4LA 3MFQA 4ND8B 4MO9A 3PDIB 1G21A 5BVGB 5KOHA 1K7SN 1G20A 1H1LA 1MIOA 1G21B 2QI9F 1ESZA 1L5HB 1G20B 1H1LB 3PSAA 4H0FA 5GGXA 2XUZA 4WNAA 4MDYA 4UDNA 3G9QA 3HJTA 4G09A 4OVKA 3AESA 4OXRA 4WESA 1KARA 3AEKB 3AEQA 3AESB 2XH8A 1K0FA 3CX3A 1QGUA 4TKVB 3ZTTA 5JG7A 1QGUB 3EIXA 1QH8A 4WZBA 5HX7A 1QH8B 4WZBB 4FILA 2XDQA 5GGYA 1M34A 2ETVA 3U7QA 1M34B 4HMQA 3AEUA 4LJSA 3HXPA 3AEUB 5I4KA 4NNOA 3MWGA 4FI3F 1TOAA 4FNAA 1XVLA 4LS3A 2PS9A 3K1AA 4IRMA 3ZK8A 1FP4A 3K1AB 5AFSA 3AETA 5KOHB 1MIOB 5FLYA 3MD9A
chains in the Genus database with same CATH superfamily
1BSVA 2G5PA 4QPNA 1YACA 5H9VA 4O4LA 3LYHA 5DBOA 3H2KA 4OJTA 1D2RA 3TLZA 3PS9A 4JT9A 3ISJA 1TT7A 1GKIA 1Q22A 1G19A 4H60A 1BNCA 3VR2D 2HA0A 2AWOA 5E2BA 5JO0A 4QQ8A 3ZPXA 2XEDA 4S3MA 2IV2X 1E2HA 4QUJA 5HE8A 3LHDA 5K6AA 4RK6A 3C87A 4ZAFA 1Z0KA 4JLKA 1V11B 2B1IA 3E8MA 4UXJA 5J1TB 1G3RA 3PGVA 4RIFA 3UY4A 5JYBA 2LP4Y 4A8TA 3Q7TA 3WYNA 1Z7GA 1FP4B 1FU8A 1FFBA 1CR1A 2NOAA 3K0EA 3OPMA 1NAIA 3RBXA 3S2EA 1UJNA 4OQMA 3UGTA 1ADGA 1FMCA 1QUEA 2CBGA 4FX2A 2QZJA 4QGGA 2I4IA 1YZQA 3KBOA 5LMUB 5I7UA 5CVJA 4RTMA 3FLAA 9MHTA 5L8VA 2AYXA 3L46A 3MSCA 3OE7A 4MH0R 3KQMA 4Q01A 3TAHA 1GTRA 3KJFA 4I5EA 1X7DA 1ZGZA 1MZPA 4QRDA 2EP8A 1D1SA 1N57A 1OI3A 2JFVA 2CLLB 1U7OA 2WMYA 4A5SA 2UYCA 3BDIA 3TQTA 4PZUA 2FE4A 4CT4B 2HL6A 2PBLA 5BNWA 4DLPA 1BGVA 3HI6A 4L4RA 4BNNA 4EABA 3THYA 3U48A 1TYBE 3IQIX 4KO4S 4AX8A 1X1CA 1JFRA 1STOA 1ZD2P 2WM3A 3E9QA 3A1WA 5FL7A 3CZRA 1M6NA 2CHQA 3LY5A 3RG2A 4P4SB 3W5VA 4KR3A 4O0LA 1HM5A 1LJUA 1E18A 1Z5VA 2WV9A 3KV1A 1XCPA 3NU1A 2PUFA 1G8FA 3MOIA 4CN9A 4DDUA 3MJFA 4PCAA 1WTAA 3UFXB 4X24A 1SCIA 2OAEA 3EQZA 4L51A 4PRYA 1NY5A 4R3NA 3IUEA 2C92A 1HF3A 3REQB 2HMWA 4JI1B 1T5TA 3HXMA 5ITSA 2YZMA 2HT1A 5IN5A 3B6EA 2B6NA 2P9ZA 2XYPA 1V2GA 3AUYA 1W5FA 3C3JA 3L04A 3RLIA 4DB2A 1TPYA 3BHNA 4OVKA 5DIFA 3EJ6A 3AHGA 1SFRA 3OUUA 1UBRS 3H5OA 3DC2A 1JT9A 1NVDA 4KLZA 4LOAA 1JQ3A 3EEBA 4RZUA 1P2BA 3HA5A 4JMLA 4LE0A 1QHFA 3D9QX 1RWBA 2CMDA 2PX6A 3LX6A 1BMDA 4ZC8A 2KHZA 4LZJA 1CE8B 1H2EA 5AI5A 3AUJB 1E63A 4RD4A 4WFJA 3FYDA 2GBLA 3EVAA 1JWLA 1OMOA 2B8EA 3H6KA 3IAUA 4HQOA 1YHZA 3QEJA 1DCTA 4I4TA 3SF0A 4JLMA 5LKAA 1XVLA 4DADA 4LSWA 1IDN1 3W2EA 2E4VA 4F1JA 1FLNA 3Q72A 3QIVA 2E21A 2FZEA 1QR2A 3GDWA 2BEUB 3PQFA 1T4BA 2FSVA 1V3VA 4GI1A 3LDFA 4YLEA 1DTWB 5KI6A 2AXEA 4TXNA 2A9FA 4FX5A 4H7KA 3TXYA 1XCJA 2PV0A 4YREA 4EKIA 3PT5A 3CMCO 4U9IS 4AWXA 5LQJA 1NTOA 2OM6A 2Q0QA 1NONA 3FDZB 1MDBA 1NV9A 3KCNA 4L8FA 3FPLA 1T6ZA 3R7DA 4G2TA 4NRDA 2YN4A 2FZKA 4K87A 4Q6BA 3EH2A 4TXJA 3TTTA 5JSKA 4RZ2A 1ODIA 4WXRA 1R6VA 4YTEA 3CPEA 5CYGA 4N9WA 2HT6A 4J7UA 2Q27A 3E1GA 4H7PA 3LGAA 3B9BA 4TTQA 4O3FA 2HMSA 3HE3A 2CXQA 3PNYA 5FHQA 4Y2RA 3GRUA 3RRFA 1JQKA 1YBMA 2O6LA 2V7VA 2Z5LA 3PIDA 2BISA 5K0GA 4RIEA 3PYLA 2QTGA 1RR6A 1WSWA 4QXRA 3TVYA 1H8ED 5CNJA 1TUBA 2I2CA 1LZKA 1Y1PA 1JEOA 2ZR9A 4Q21A 1QFMA 5AVKA 3PFNA 1SD5A 3P9PA 1I2BA 2XODA 3X3HA 5A1JA 1HLDA 3MWYW 2XQVA 1CX9B 3EIQA 3A9VA 2C3OA 1IBKB 1SQ0A 3D8BA 4A6PA 1Z7WA 2ON6A 2BEVB 4CF7A 1U6IA 4X3OA 2XGJA 3SF8A 2YJ3A 3EUFA 4YFVA 5ARDA 1W0JA 2JHGA 2Q8PA 4RKWA 1LX6A 3ZU6A 4AJHA 2OVFA 1OQAA 2CMGA 1NX6A 4N65A 5C8YF 1F3LA 3QW4B 2H07A 3L4JA 3MT7A 4L4SA 2P67A 1Z6TA 2WE8A 3MNFA 1XE3A 1TQHA 2YW2A 1SBNE 3LWDA 4WZAB 3K1ZA 4BB0A 1A98A 3CWCA 5BXYA 2YUTA 3EMKA 2O0MA 4TLEA 1ODJA 2O3TA 3OOSA 4LECA 5C32A 3F9CA 1YMUA 2HA3A 3VJKA 3LD9A 3QYFA 1K92A 1K6EA 3FMFA 2PXHA 3KHSA 1AY0A 4IUCS 1G6KA 3CM0A 2D2VA 4LOHA 3QYAA 5FPTA 5B30A 2F1OA 5AI8A 3IEMA 4GKKB 5ECDA 5CG2A 1JTFA 1YNSA 3MTEA 1J1UA 1BVHA 3KETA 1C1XB 4RDXA 4BTEA 3VNVA 4BQPA 4OP2A 4PZDA 1YZGA 3DLCA 3A8TA 3EISA 4KZPA 2PL1A 4X6XA 3RS2A 4BO8A 6CHYA 3VNUA 2RGCA 3KEQA 4UULA 1NBMA 1WDLA 4XRGA 3DFUA 2NNLD 3PQDA 4LBVA 4M55A 5CYFA 2GJ8A 1G2QA 2GZ3A 5CEEA 3NM6B 2BOVA 1G2OA 4FDAA 1K63A 4KYUA 1M1UA 3VHXA 1CUIA 3ZDQA 3AVTA 1HDZA 3I76A 3KKMA 1V37A 1D6MA 1VTKA 4QUBA 1EGVB 1ZJ5A 4X7RA 7REQA 1DQRA 1HLPA 3O8OA 4N3CA 1KI7A 4PANA 4LNUA 4DA4A 1ZNQO 3R8XA 3I83A 1LH0A 4B80A 3HUTA 3W7AA 4RD2A 1WXXA 2X0NA 2OG1A 2ONYA 3FDXA 2WOOA 3GX1A 1T8TA 1NLUA 3KALA 3ZE8A 3BB1A 1I7QB 4Q3CA 1VP3A 1QOPB 3E84A 3EIEA 1AKYA 2OZKA 3CY6A 1W94A 3BH0A 3G1TA 3LUBA 4UHFA 1KDRA 1NC3A 1C29B 4W63A 2DCMA 3H9BA 1E58A 4ITRC 1A88A 2YQ5A 4HEHA 3ZDEA 5I3CA 4BUCA 1ETUA 3F90A 1KR2A 3CN7A 1YZHA 4M0DA 5FO1A 2J3HA 3E22B 3HVUA 1WCXA 1OE0A 1WLYA 3Q8MA 4RVCA 4AJJA 1POWA 3KQVA 4X63A 2B4RO 5DYTA 4LF7B 2ZUBA 2Q5EA 4TMWA 2DGDA 3FRHA 3QX3A 1D1TA 3PGLA 3ABIA 4OQYA 2VATA 2IC5A 4MR9A 3QKSB 4D97A 1SIOA 5FB3A 2IWHA 3A06A 2DB3A 1WNFA 2QN8A 4DCJA 3LKZA 4QE3A 5I9MA 1WG8A 3OU2A 1OZAA 3DYIA 1QHYA 2F8TA 1QNFA 1GSHA 5P8WA 1ENPA 1H94A 4GPIB 821PA 2IS1A 4GRIA 3LPMA 4P7KA 5DU2A 2IXAA 1DRJA 1SKAA 1XKQA 1NKVA 1IXRC 2VHTA 4EHJA 1OYVA 2GM9A 4DR5B 2V8BA 4AYXA 1O5TA 3IUBA 2E5WA 3WA6A 3GFPA 5JI3E 3FGNA 1SR8A 1PEYA 1BEUB 1MC8A 4FFNA 5IPFA 1Z73A 1Z3IX 2B2XA 1DO8A 3KC2A 1OOEA 4GQIA 2YWEA 4X5OA 2DSNA 1ST3A 2ZYTX 2VZ8A 4IQ8A 3ZX4A 4Z0HO 2H3HA 1R0CA 2FKAA 4I6EA 1Y1SA 3TLJA 4ES6A 4CIWA 5LYJF 3RLFA 2DCUA 2RGEA 1ZDMA 5KCMA 3BCRA 2WIJA 1U3GA 2OPBA 1C8LA 1E2FA 1UZAA 1G5QA 4N7RA 3OTHA 1GZVA 1E77A 3GEMA 4QQKA 2ZE8A 5DO9A 5GQSA 3ZR4B 3TF5A 2XHEA 3VH4A 4ZI7F 2QTLA 3JQ7A 1OXXK 4P35A 1P9NA 2BFDA 2GEUA 5EMMA 1ND5A 4DCMA 4KRXA 1E7WA 1MOSA 3RUIA 3LIPA 2V54A 4KN9S 1XNHA 2IEGA 1ZL2A 4H0FA 2G1PA 1IHYA 3OA2A 1C7FA 1NURA 4CFZA 4DCSA 5AVSA 3H6GA 5ARBA 3EQ7A 4XKJA 1E9SA 4GS5A 4HH1A 1FNMA 1P2SA 5ELMA 1DRUA 4CEHB 5DP2A 2PZGA 3DOOA 4NDAA 3U3JA 4RSHA 3HC7A 2VDWA 1X9HA 1C14A 1BC5A 2QTBA 2OQIA 3IVMA 3JQDA 3PWZA 4KGVA 1XQ1A 2EAUA 4ARUA 4HATA 1L5WA 2GHQA 2W4MA 3W7BA 3HJNA 2QLBA 1WMSA 3PTLA 3UJ9A 2ZJ3A 4PIVA 5DWQA 4C4PA 4C5AA 4R2JA 4JLUA 3WSTA 1V0JA 4URFA 1TVKA 1X1EA 2VSFA 4OJNA 2GPSA 1XIVA 1R6AA 2QYSA 3QM1A 4LY6A 5BRAA 4EJMA 3LSYA 5KYXB 1Q7BA 1WEKA 2ZE6A 3C41J 5TT0A 2P35A 3M6MD 4PPQA 3EG9A 5AHRA 5TX7A 3ZE7A 3S6JA 2HBRA 1C0PA 3HKBA 4P82A 4X66B 5KKAA 1BS2A 3JD3A 3PDJA 2DJIA 5HIIA 5A0FA 3S1LA 4J49A 4A16A 2PH7A 4G89A 1PF7E 4Z86A 5E3IA 3O2QB 4LXHA 5E2AA 4AKTA 3FPKA 5EJ9A 1O9HA 2NVWA 4CIXA 3HFJA 5KCZA 2YXNA 3FNEA 1BN6A 4J1NA 1JIXA 4NZMA 3RJ9A 4F9GA 4GMDA 4ZYVA 1QC5B 4KNWA 4XD7D 2E87A 2LKCA 2ZYDA 1Y9EA 5CIYA 1XO1A 2F1KA 2FWPA 4R8LA 3RSLA 2QXYA 5BNZA 2FSHA 1VCIA 1U0GA 4EM6A 2CXUA 2QF7A 4PPGA 2UYQA 3NALA 2REQA 4RQBA 3F6PA 3PDCA 3R7AA 4NCJA 4R6WA 2WJJA 4Y2SA 3OA0A 5CIQA 4YJKA 3WWYA 4GYKA 2WQ6A 2GMWA 4MQ6A 4H1TA 1FRVA 3JYOA 4Q18A 4KDRA 1CJUC 1UJ4A 3QWBA 2GXSA 4PGAA 4D80A 1CHNA 1UZUA 3T9BA 4HVTA 2LV8A 3AUKA 4FYPA 5FUQA 3SHOA 4PLFA 3UAOA 3HO8A 2BI8A 621PA 3ICVA 4UM9B 4MYHA 4FE4A 1RPZA 3BXXA 2X23A 2X4GA 5K03A 3IQWA 1P1HA 5CEJA 5JNWA 1KF0A 3P2JA 2PUEA 3GCGA 3WIVA 2A1TR 2C04A 3HL4A 4HAUA 3AB7A 3DCJA 3BWDD 3QY0A 1UOEA 5D3ZA 3EVNA 3WIEA 4DDVA 4RDHA 3KB1A 4CG2A 4REQA 5KTTA 3VSAA 5JJBA 5CFRA 1JKJB 1PQPA 5EIWA 5A02A 5B3JC 2P2GA 3E5NA 5KNCH 5G0UA 2NO9A 1IULA 1M10A 1QZXA 1RBZA 4WLVA 2OSBA 2P6UA 4E5DA 4MHOA 3EOAI 1MNAA 1O95D 2IYVA 1U0HC 3M6WA 4JOQA 3T1QA 5BNTA 3I23A 5F2NA 1QHNA 3P96A 4WPGA 1VKJA 5EP2A 1PK9A 5B1HA 5JH7F 5JAIA 1DCMA 2B2NA 4V3CA 3SIPA 4Q4HB 3ZWMA 4PYJA 1FUKA 1M6WA 4QOEA 3UJNA 5FT9A 4L8GA 4ZVLA 1N5JA 2WWHA 2ZTSA 4ZRNA 3ZCSA 4EPVA 2GZ1A 3CEAA 2O06A 1V41E 4OXXA 2JC3A 5TXGA 1FK8A 3TPZA 5K7SA 2ZETA 1TCVA 4K03A 4IYRA 2QIPA 1P9LA 2VIIA 2ZUVA 3NTQA 1KO4A 2JCSA 2BP7A 4MLCA 5GGYA 2FMKA 3VR4H 1EUDB 4QXAA 4GKBA 1TVMA 2P41A 2H2GA 3BAFA 2GEDA 3GJ8A 1A8QA 2G4LA 4F5DA 1X8KA 1ZRMA 2Z4TA 4NH0A 4FGUA 5HE9A 3OKAA 2V74B 2WZBA 4NMXB 1QPZA 1CULC 3SFVA 2HJSA 1QAMA 2IHYA 2VDQB 2WABA 4H0NA 5L6MB 2AE1A 1YTUA 5FLYA 3AU9A 2N9UA 4HVAA 1IRXA 3WJ7A 1FVOA 1Z2CA 3N74A 5LC1A 4TRNA 3Q3HA 2GYYA 3ZWNA 4WESB 2BYTA 4KXMA 4HAWA 3D8TA 1RQNA 4CMEA 2WLSA 4DMFA 3IEKA 5BOVA 2XADA 3SJZA 2HHCA 3TTYA 4G9EA 1TQ2A 5EP3A 5JXGA 1K6MA 3QKRA 1XZMA 5F7JA 5AOVA 3K53A 1ZJYA 4UHEA 4QNNA 1S7CA 4W5QA 1AQYA 2BMEA 1IY8A 4LCJA 1WD5A 3THOA 4UVEA 2ID8A 2ZYSA 2PUVA 1ISMA 4FEAA 4RH0A 1A95A 1T3LA 2BBTA 3SPXA 1QX4A 2RG7A 4BB6A 1JT2A 3MSXA 3TG8A 5G3ZA 4ZTUB 4FYMA 2ZYHA 2Q3EA 3IILA 1GFZA 4ZJUA 1X1BA 1A50B 3TECE 1KYWA 1KDPA 3NDPA 2XB2A 1FSPA 2WINI 1DBIA 4G1FA 3FF4A 3N9IA 2QSYA 3WLMA 1WZUA 2YVQA 1IE3A 3ZK7A 1Z6AA 3AKCA 3SFTA 1VGRA 3QKIA 4U2DA 3B12A 3L6CA 4E7OA 2QUHA 2OVBA 2Q9AA 4F1KA 2IYWA 4EFKA 3EPPA 3PD0A 3E58A 4ODIA 2XTAA 4KV9A 1S02A 3AT1A 3DFKA 3MJSA 3A6LA 5EUCA 3RRBA 3ONVA 1DIAA 1HE4A 2G5CA 2HRBA 4IHAA 2UUOA 4IIFA 5COQA 3IP3A 1L5HA 1DC5A 5T3YA 1RYDA 5DYYA 3E6AA 4DY4A 1DAIA 4KK4A 3SWWA 1S7GA 2J7KA 1SGWA 3NG1A 1ML4A 1PFUA 3IUPA 3MYYA 2Q6OA 3R6LA 3UGJA 3LP5A 1C41A 1ORVA 2FG5A 5EZYB 1PVOA 1PJ2A 4MB2A 3B13B 2IXFA 5D2CA 3KQKA 1P75A 2VSQA 4G1VA 3ABQB 3ZVMA 1FX0A 4RENA 5AWFC 4ROSA 1Z26A 4BNYA 5FWNA 4OLAA 2H16A 1QGZA 4UHCA 1F8UA 1DBSA 1U7TA 3W4JA 3QNMA 5CCEA 3HYLA 3GZNA 2CLSA 1N5IA 2NSJA 3PKJA 2ZR8A 5J40A 1IOLA 2NYRA 2WSSD 1II8B 2A5JA 4NE7A 2G06A 3DDZX 3HB0A 2INGX 1Y5IA 1MXHA 5HNKA 3I9LA 3ED5A 3ZE6A 5HILA 3JALB 1Z38A 3HU5A 1NUPA 3LCRA 5B4UA 2HLNA 1LBEA 3E9YA 3GJTA 2LCFA 3AONB 1PYGA 2R8XA 1P1IA 4R1SA 5U4QA 4KFRA 2Z4RA 4MR8B 3C8ZA 3EHEA 3PFBA 4I55B 5EHXA 1RRFA 4IOLA 4DRXA 1U2GC 3OO1A 3MOGA 1GQFA 5DTIA 3I9JA 1Z0DA 3PJRA 5J2UA 2JHCA 3NJ8A 2FR8A 2AKAB 4H6PA 3MS7A 4TROA 4AF6A 3BJZA 4ZVTA 2WFLB 1L5YA 3JQBC 2ES4A 3RIYA 2AJDA 4RKQA 3GRKA 1Q1EA 5T3UA 5A0VA 2I33A 2VPQA 3RUPA 4DA9A 5I8PA 3AZQA 1OPXA 5IT9A 1E5TA 1X86B 3TXAA 1A4RA 3N2IA 4UMFA 3V4PB 4G4IA 1NYTA 4E5KA 4TKZA 1JTVA 1DT5A 1OW3B 3FBWA 4G07A 4FT4A 4ARVA 1GJRA 3KXDA 4B6JA 4YRQA 1M6EX 1T1RA 4RFSA 3W34A 1DJOA 4I4IA 5DZSA 2QT9A 1TM1E 4ND6A 3FZGA 3LUHA 4OBEA 5TB5A 2FPPA 3GJ6A 4CMHA 3B20A 3CF6R 2JHAA 4LI0A 4HUQB 4HVCA 4O2AF 4MQEB 1JG6A 4Q37A 5I7RA 2Q4DA 2ZSKA 4JGGA 4KAXA 4YAOA 1R0WA 2AT1A 3EPLA 2VDPB 4S04A 1CIPA 1T4CA 4MYTA 5DGXA 1AQUA 3QLUC 3BC1A 4OHFA 3WKBA 1Q0QA 2RGGA 3JSXA 1KOFA 5D5HA 2JVKA 1TYAE 4CDMA 3R6GA 4B40A 1H65A 3SX2A 2X13A 4I8XA 2IYSA 3MTIA 5FQOA 2G36A 1H2WA 1JHAA 1LLCA 2VF8A 2BV3A 3ND8A 2IU3A 3RUAA 1LLDA 3BEOA 5BW5A 1JI3A 3K15A 2CVFA 3PXXA 3GLGB 3VSCA 1WL8A 3MWDB 3QBEA 4F92B 4L3OA 1CQJA 4JXKA 2ODBA 1R8YA 1YUMA 1SG9A 4L7QA 3ANMA 1ODFA 4OJKA 4EB8A 2XCUA 1YT5A 3IDQA 3SC6A 5FOTA 4D8VA 4V1CA 4E88A 2ATIA 1OU0A 2KB0A 2P7HA 3PNVA 2HADA 4FN5A 1BFDA 2BGKA 1BHSA 1LDGA 2X2PA 3HVRA 1VZ2A 4GI2A 1HFKA 5THQA 5TT1A 3BB3A 1FFGA 1YB2A 2DJ5A 3MLEA 3WAKA 1MC4A 4GT1A 4CF4A 1E0JA 3INGA 3LQ2A 4A6EA 4EAQA 2FRDA 1XWFA 2QVCA 3A3KA 2IQIA 4ZCMA 8OHMA 2BMWA 5I9IA 4GKJB 5JHGB 1I30A 4L8WB 3ETEA 4NMMA 2ZJFA 4KIUA 2H9IA 1N4DA 4K6CA 4KN6A 1AK1A 3DQPA 4O29A 4ZICA 2P79A 2PV7A 3CN9A 3M89A 2SKEA 4I1SA 1G1MA 1XDUA 3JAWB 1ADFA 2OC9A 1YQ9A 3SEQA 1QZ3A 2GA8A 1OB2A 4CKYA 2KLBA 5KNDH 4OHCA 1ESEA 2OLKA 2Y1WA 4DZZA 3RK4A 3B53X 3OT5A 1ZNXA 1UIRA 3ZDYB 1DRWA 1PUJA 2DH6A 5AK0A 3B3FA 3EDCA 2XGSA 5TS2A 3KELA 2B1RA 2GVNA 4YONB 3O9VA 1RM5A 1GZUA 3ESBA 2BFAA 3I05A 3IJEB 3KOZA 3PC8C 1DBWA 1R9MA 3PHLA 4HRVA 3UT5A 4A27A 1JHUA 1R0ZA 4ZO6A 3PQ3A 2K2QB 1JFFA 2IW3A 2WKWA 1A8IA 4OI0A 2PD4A 3ZJYA 4NCBA 4X44A 2O2JA 4OMCA 1XEWY 4MZDA 1TUEA 1AN9A 1KDOA 1KE1A 3ESCA 2JK1A 2RJOA 4FP9A 5GTDA 5K01A 2WSLA 4YP0A 3G0HA 1SUBA 5B36A 1N0HA 1JQEA 2CXHA 4RDIA 3N3AC 3WGOA 2VPPA 4O2RA 1KA9H 1PN3A 4QJBA 4B4WA 1R00A 5TDHA 3KPJA 4BLWA 3GLUA 1OU4A 1Q0SA 3E2PA 8AT1A 5B57C 1UKEA 3ETDA 3UC5A 5C5IA 2RJNA 3DMYA 3QU4A 1G9XA 4K9KA 3SC2B 4QVIA 2W2VA 3V7YA 4NP6A 1F6WA 4FMCF 5ENVA 1PT6A 3LKVA 5I4IA 1VHWA 5JZBA 2C88A 4F8JA 4HNGA 1GGMA 5AM2A 2AKYA 2VDOB 4B4KA 3BMCB 3RYFB 1M9NA 3OTQA 4ZK6A 1UXJA 1T2EA 2XVZA 1O96B 4KFCA 3VPXA 1L1QA 1NJFA 3NXSA 5DNUA 1EK0A 1MCZA 1YVRA 1YJAA 4L0DA 4Z54A 4R8SA 3RJMA 3W78A 4LF9B 1U9IA 2W6CX 2HUPA 1U94A 4D5GA 3NASA 2P7IA 1O0BA 3KPUA 3KZXA 5SICE 3SDZA 3FHCB 4FBLA 5E8JA 4B33A 2YNMA 3IUYA 3QE3A 4JI2B 1LW7A 3RV3A 2YC4C 1BQ3A 2O3RA 4I2NA 4B9AA 1VXOA 1VB3A 2YYZA 3CRRA 3LLMA 2Y6UA 3LAWA 4E33A 3TOZA 5IM4F 4B3RB 3A7EA 2ZM5A 1REQA 2C5BA 1Q7TA 3H8VA 5DYWA 5E6UB 1CUYA 3GLQA 2DFTA 1U7ZA 2FB9A 1T6NA 1XL1A 3PFFA 3ROZA 5AW5A 3MXTA 4E5PA 4KO3S 4IRUB 3PKIA 2ZUSA 4MPTA 4W5TA 2JIRA 3TJRA 2AX4A 2HI0A 2Q6VA 4RVHA 2IA5A 3JYQA 2OLJA 3UOGA 5D6OA 1WDMA 1A97A 2CHEA 2Q3LA 3QV1A 4MIEA 4HVLA 1MHPA 4HDKB 1V45E 3KAPA 1N9GA 3BAZA 4CT0A 2GD0A 3W9UA 2GNPA 4RW0A 2YOHA 2VNKA 3DMGA 4R05A 5AXCA 2ATEA 2IXBA 1ZN8A 1UKYA 3UG7A 4FU0A 3EXIB 1RRVA 3LUJA 5KDLA 3WYCA 2R7NA 5K0FA 4U8HA 5IUJC 1J2TA 4D0NA 3RTAA 3K7EA 4R2XA 3RH0A 1UBMS 4NQRA 4COKA 1V1JA 4GM0A 4QGFA 1ZGHA 4OP1A 4AJLA 3CWQA 2J4DA 2YYSA 1C9NA 4BATA 3KVNA 1XAGA 2C7PA 4PLYA 3HCRA 3A9CA 4BLQA 1GPH1 3IQEA 2Q1SA 2PX0A 1S8OA 2JIZD 4FYJA 3LTEA 3TI7A 3AGPA 3LQ1A 1VG1A 4OHXA 4JQSA 4A82A 5IJ0A 4HDMB 5LOVF 1W1IA 2PZ8A 2NADA 4IDNA 5FNZA 4HDNA 1S2LA 2EYUA 1N33B 2B20A 4OCZA 2G9NA 3FROA 3QK7A 1E7RA 4N49A 3U4DA 2XUAA 2ZWPA 3N2GA 4K1LA 5H59A 3DTTA 5I7WA 4R0NA 3KZOA 3B6JA 3MJVA 1H2FA 2EL7A 2ONCA 1X7WB 5FOXA 5HX7A 3O26A 3EIOA 3PGA1 4WCFC 1AXRA 1CC1S 4WFQA 4KUHA 4GO1A 2HJVA 2UVDA 1SCKA 4ITVA 1PQYA 3AVPA 1DC8A 1BDIA 4U00A 1GCAA 1FP1D 3DF9A 3BHMA 3TR6A 4RUKA 4MVWA 1IOWA 4GR4A 3ONNA 1GNTA 5CAEA 4HTFB 2X7JA 1X19A 4DS3A 4BB9A 1EG2A 3W5DA 2FF5A 2C03A 4F3RA 4BXOA 1N2SA 3RVOA 1CR4A 3MD9A 2G63A 2IIVA 2VJQA 2WG2A 2H7CA 2QT1A 3DCYA 2QVYX 4LW8A 3MMXA 1BKYA 4P93A 1TO6A 2HK7A 3RANA 4OAQA 1GV1A 4GE3A 2ZYWX 2LCIA 3WXMA 1X7XB 2NTJA 1Q95A 5L3QB 2A1UA 2VR1A 3PPYA 3PT9A 2R47A 5JZ9A 1QO9A 1NDUA 4Y0VA 1GCUA 4TWBA 4L74A 3H19A 1JS1X 3BWEA 1US8B 4PLHA 3SLRA 1U65A 3V4FA 3X1DA 2WJZB 4BZPA 1KQ3A 1R64A 2C98A 4Q9NA 5E2IA 3KSAC 4QEDA 3MMSA 3AYZB 1YIDA 3ZS8A 2JFXA 1NC1A 1W0KD 1CZOA 4D9NA 4Y0NA 1ZJWA 4H35A 1UQUA 3N7TA 2FG7C 4LV5B 3FUWA 4L5JA 3WMFA 4KDCA 3RAFC 4NOJA 1DG9A 4YUWA 5AVRA 1PG0A 1HQDA 1H5NA 4F86A 1GCGA 1WKCA 4V0QA 3GN1A 3DONA 1K68A 4S24A 1KI1A 1LVHA 2DETA 3N8HA 1JBEA 3EWSA 4PINA 1P7YA 3S8EA 4K6KA 4V03A 4HYQA 4AJPA 1TKAA 2OGWA 1SBTA 2I80A 3GLKA 3OZWA 4D3DA 3S4YA 4BWGA 3O2JA 4TV8F 2RHBA 2G80A 4I9FA 1P91A 1G4AE 2HA7A 4UEJA 1RRCA 2J0SA 2NU8B 4EMSA 3TLGA 2C0QA 3HMKA 5GMOA 3K0CA 1OTXA 4LF8B 4UEKA 3LU1A 2O2ZA 3KKEA 2JGFA 3N70A 3VZDA 2VHXA 5J43A 4PZ9A 4EYSA 3D0KA 3UUEA 2AKEA 4BP9A 2CMKA 3DZCA 1ZM3A 1E2JA 2PWPA 2RH5A 3IHKA 2DY0A 1JR2A 1LV8A 4LRSB 4AF7A 4C76A 2N46A 1S9HA 5BSTA 3DBLA 3RS5A 4FOSA 4LNHA 2YJ5A 1Z6GA 5DHPA 3PUXA 2H08A 3IP8A 3NETA 4F56A 4BX0A 2P4HX 2X6TA 2FCRA 3D3JA 5CW1A 3OEEA 4W1RA 4FBMA 1JEDA 2ORVA 3DE0X 2QVLA 4DY6A 3TW6A 2XYHA 3AY7A 4F0JA 2WTEA 2HF2A 4RNCA 1AF4A 4YRKA 1G20A 3EJWA 3I9FA 1KK2A 5IJAA 4WY8A 4N3AA 5DNVA 1YA8A 4YMIA 1KWKA 3TRIA 3NTOA 1USWA 1P18A 1DJLA 1UWLA 2FEMA 4G5YA 4V2IA 3EA4A 2C2XA 4ISCA 1LFDB 1FC0A 3NGMA 1QCCA 2BFOA 1BHJA 1JWBB 2I34A 2NUPB 3DMPA 2OV8A 3P9YA 4JU8A 1ULBA 5ALYA 4ZD6A 3TL6A 4CL0A 2C7QA 2AFVA 3MMZA 4DWWA 1ZH8A 1TT5A 2FW1A 1XVIA 3ANTA 5DCWA 5JCZA 4Z9XA 1NQAO 4I1VA 1EGAA 3CZCA 2YJNA 2BM0A 1KY3A 5CFOA 1GQYA 5BWCA 5FP0A 3ZWKA 4ID3A 4QBGB 3HXPA 3VR5H 2EX0A 3E9CA 5ALNA 3PWTA 4EJSB 2H3EA 4ED9A 1XVVA 4ENRA 4G0WA 1KEUA 1MB9A 5BN1A 4XLTA 3IELA 4MA0A 1R5NA 4ANFA 3N07A 3NV9A 1DC3A 2DHCA 1F5NA 1V25A 4OYYA 1VJDA 1I2MA 2DUUA 4KE9A 1PSDA 1FW8A 3HP1A 4P53A 5ICSA 1PHRA 2P5YA 4QOFA 2QRLA 5IAAA 3OOHA 2HFKA 1KAQA 3CEHA 4L0CA 2LGJA 3FBGA 4KXQA 5CH3A 1PV2A 4Y67A 3B1JA 2Q6TA 4QAQA 5E95A 3NORA 3DBVO 4B6FA 3K1TA 1UBLS 2DG2A 3SQOA 3UAVA 2JASA 2X0RA 3KAKA 3F96A 3GFFA 2D5CA 3LG2A 4X0EA 3O0DA 4WY2A 5BUCA 1LJLA 4DV3B 4Y1FA 2I3GA 3WJ2A 1H3FA 4S0ZA 3TZHA 1NAHA 2C20A 1KQPA 1B3RA 1ODCA 2DH5A 3B85A 1LC3A 1VZ3A 4FDLA 1X70A 2EKDA 4KQWA 4IGEA 1XQ6A 3FN4A 4IVPA 1NVMB 2J5BA 1E5DA 3L4BA 3AX6A 4KQ2A 4UNIA 2NQ8A 2AC7A 4MHSA 1YDEA 4B8YA 2FZCA 2GESA 2H51A 1K7FB 4AYWA 4UCQA 3C3AA 1L9XA 3L43A 3GEHA 4IF4A 2X6RA 1R8SA 3HBMA 4CFSA 3IBYA 1A3CA 4MKGA 2XA9A 1U0NA 5JARA 5JSUA 1GUDA 1VRVA 1XRNA 4M1KA 5L51A 3PR1A 4KUGA 5DBGA 4JEMA 4QU5A 3W6NA 1NF8A 1VDZA 3FYSA 4FZ5A 1IOZA 1F6DA 2JS7A 5IFLA 2LTAA 3K32A 4EY5A 1C0KA 4GZLA 4BJ1A 4HMPA 3L1KA 1YRWA 4P4UA 1G64A 2B7BA 4Q9LA 4DXHA 3K05A 4AS2A 3DNFA 1GIAA 1PAUA 1ZD3A 2EJTA 1QFJA 2GPJA 2V3CC 3Q3IA 3HWSA 1Z4KA 5CCDA 3C3BA 2YIVX 1F60A 4P98A 1AHIA 1X3SA 5J58A 4PVCA 4FLEA 3IAXA 4KZKA 4EO7A 2AIRA 1Q0ZA 3U4IA 2QS9A 4DF3A 1LDNA 1Y3AA 3KJNA 3PFWO 5HGXA 2F1JA 2QE7A 4KIFA 3NHAA 4NESA 1I6KA 3TAXA 3QE9Y 3EW7A 2XPCA 2B94A 4U6SA 3AP3A 1XSEA 1U7XA 2IH2A 1G3MA 1JU9A 3OTWA 1W1UA 4FDVA 1D4ZA 5FPPA 3I5YA 4MSUA 1OI7A 1PZMA 2ZI4A 3IQZA 1TEVA 4OGLA 4QSMA 4HGQA 3KTOA 4GLLA 1GPAA 3K4PA 5EOVA 2ZIXB 4OH1A 3RK0A 1J21A 3TQRA 2PUHA 3KTAA 5T41A 3UQZA 5KTKA 1Y4UA 3WYGA 2Y1KA 4IIVA 1Q20A 1W35A 5DHAA 3EMVA 1K7SN 2FEXA 1KAMA 3R44A 5HIMA 2VYVD 5IH7A 2VK4A 1GPNA 4ACBA 4W5RA 4V38A 3OIWA 3QUAA 2GXAA 4GLBA 1JLSA 2VBIA 1ZOLA 4CMJA 5KWEA 3G68A 1ZMRA 3U3RA 5DHFA 4MINA 4DW8A 3IA2A 1GGNA 1CF9A 1M2EA 1SOMA 4AZ3A 1DAPA 2C3MA 3UA4A 2DWQA 4QOSA 3HK2A 3T99A 5K0CA 2EZTA 3QKTA 4OLFA 1YVDA 3DEIA 1YZVA 2XX3A 1RPAA 2G70A 3AIIA 3GUUA 3FUCA 3H9JA 1VMDA 3L8YA 4QELA 3TPCA 4BTVA 4BNUA 1FPQA 1U0JA 5BMVB 2WUEA 4OPMA 3KYCA 2GKSA 2Y0EA 3H2HA 3U26A 1RXEA 4Y1RA 4XR4A 3A1UA 3TTVA 2QQFA 1QIMA 1XTIA 5ALTA 3VU9B 1G66A 1XZCA 4KCGA 5CVVA 5D1HA 1JPJA 3D6JA 2QMZA 4TT3A 1Z4IA 2NU9B 3PUKA 3QVJA 2A5GA 1Z37A 4MV6A 5TGZA 3TIFA 4P4GA 1NBME 3C74A 4XPIA 4RKYA 3ZIUA 3VZRA 1Q7RA 2CV2A 4CUZA 1KWGA 1SBIA 2ZJ8A 1DJMA 4BJ6A 4KPUB 4BQFA 1LVGA 5LQCA 3QMMA 2ZROA 1NMZA 1Z74A 4MV5A 2CDBA 4PU0A 2YRWA 2F00A 4MTCA 4Z9AA 1TQ8A 4DQUA 5M3BA 2XSZD 1T1IA 1UP4A 5DB4A 4J7XA 1D1PA 2X1LA 1G0OA 2VH1A 3U7QB 2FSFA 1TA9A 4AUKA 4C3ZA 3DXFA 1Z07A 4HNAA 5AVTA 3UK0A 2Z6QA 2QUBA 1ORDA 4XDYA 2VZ9A 3GLTA 5AKLA 3ZKAA 3EOBI 1MQSA 4EGQA 3RVPA 4LDRA 3RT1A 3P2OA 1PL7A 3V3KA 4AC9A 2RHDA 1D2EA 4UCFA 4CF3A 4IEEA 3AWDA 3FSEA 2MYUA 2VNJA 4UHJA 5LZ7A 1TJYA 2JIOA 4BLOA 4IDGA 5JYCA 1SCDA 4BGVA 5K0ZA 2PXAA 1C3EA 3LW8A 3S2YA 4DLYA 3U3KA 3DVSX 1E9DA 1BVUA 1WW8A 4RV5A 2D2FA 4MK4A 2WVJA 3FTDA 3O8CA 4YACA 4BAGA 5DTJA 2H9YA 2A88A 2B69A 3E3OA 4E2YA 1NL3A 1ZU5A 2FDXA 1D4AA 5AHXA 1CYDA 4AG5A 5BWOA 1DDGA 1RJDA 5M04A 3NHMA 1NX9A 1F4LA 1RLOA 2PKQO 5DGHA 1F17A 1T1EA 3BULA 1IWOA 2AJCA 4LXIA 1Q91A 4LXUA 4MRAA 3VBCA 1XZLA 1WETA 1C9YA 1ZVKA 3A2MA 4KB5A 3W8EA 1L0BA 4B3JA 1O1YA 3IXMA 2V7QA 1RU3A 1KZ4A 2R7KA 4JVSB 5FLKA 1VSTA 2YWCA 2NZYA 4UTXA 1E89A 3OU7A 2IK8A 2TYSB 4KIGA 2JJMA 4D3SA 3TWOA 1HWYA 4TTIA 3DR3A 4B6QA 5IT5A 2D8MA 4TV9F 1MOZA 4WKPA 4EY7A 1DHRA 2RSLA 3FIJA 3I52A 4JFAA 4FR5A 3ED1A 1ISRA 4G67A 4GYYA 2Q29A 3NR2A 1RM4A 2E0IA 1TK3A 2JGAA 4QYXA 1WXHA 4I3FA 3UYKA 2AUNA 3LA8A 2BEWA 4A73A 4MUKA 4LC0A 4PBTA 2PANA 3REGA 3B7PA 4MLDA 2O5RA 2I22A 3HU1A 1D3AA 2QPOA 4IXMA 5CT5A 2QJTA 3Q2OA 4JT8A 2H06A 3I92A 1JAHA 1MV5A 4FQ7A 4QPJC 4Y6SA 2I6XA 3JQ6A 1M2OB 3K0HA 1I5OA 2G40A 2EZUA 1PW5A 3J7TA 3L5OA 4J8PA 4URZR 1S8AA 1KEWA 1NDHA 2O4UX 3PZRA 5P21A 4P92A 2QG4A 3I9MA 3F3YA 1QG0A 2CNWD 2IZ7A 2PK3A 3Q3JB 4JGBA 4ZT5A 2IPXA 2AW5A 2FFBA 2JFQA 4HAIA 1KFCB 3QFHA 4KVZA 1Q17A 4DIOA 1Y8CA 3HDTA 2C8VA 3K31A 2WOJA 3ODPA 1L5KA 3ROEA 2GVZC 1GZ3A 2BI7A 3KT8A 3LRTA 4GC9A 2ZZMA 2I6SA 2QAIA 3K1AA 4B3CA 1SBZA 5G1PA 1TGVA 3MWEB 4HNUA 4E7PA 4QT0A 5C8YB 5F5XA 3K09A 4D6YA 3Q8WA 3PE3A 4CM8B 2RK6A 2QD2A 2GAAA 2B7CA 3SEZA 4L85A 3B48A 4EX6A 3IQFA 2ISCA 4M4SA 5LVAA 2CMFA 3ENVA 4CM6A 1QGOA 4Q82A 2XMDA 1RZ3A 3V4RA 2XCQA 2ZB8A 1TVEA 2HLHA 1TRHA 2RARA 2WD9A 3PCXA 3CSSA 4MUGA 1UWKA 4WN9A 1U9ZA 1Z62A 4G97A 5B7GA 1X7GA 3SE7A 2FYTA 4XYEA 3OX1A 3PLNA 4JR0A 3K1YA 1DOAA 3HU3A 1N3YA 5DEIA 4YXFA 5E8RA 1QHGA 2HMAA 2VRWA 4PQEA 5HDBB 3S1AA 3EEOA 4CM9D 1BXGA 4HWTA 5K3AA 2PX2A 3RWOA 1E4YA 2W9XA 2XRFA 2EX1A 1DQNA 1S01A 2J33A 1NKTA 5JNRA 2CVHA 4HDCA 1V35A 4FBGA 1NXPA 1IZ0A 2BFNA 2P27A 4YRSA 1EFDN 3ZWBA 1E3QA 5E6RB 4DMKA 2F7SA 4ZI7A 2WHEA 5TPZD 3I3SR 5CDSA 1W4LA 5FBRB 4DCUA 2I7TA 3TLKA 5EJEA 2WIGA 1VLLA 1K2VN 1FDUA 3B1KA 4FYVA 3I5XA 4LWZA 4DQDA 4KQIA 4LJKA 2QZ9A 4U7PB 3H5IA 4M1WA 5BUSA 1QAQA 3RU2A 4WZZA 2LVBA 4U6QA 4IIXA 3K73O 3I9V1 4DLVA 4C3OB 3O3CA 1UDAA 4YJHA 1Z0UA 5AVZA 2FP3A 1AKVA 2FOIA 3ID6C 2CJYA 1ZRSA 1AV7A 4R1TA 3CXUA 4OGGA 4TS3A 4DMMA 2H1LA 3S27A 3ACCA 4KWIA 4M1TA 2CHUA 3E81A 3L6EA 4I7EA 4GGOA 3WISA 1F20A 3M5DA 4FC6A 2CD9A 4FMPA 5H80A 3L6RA 4R01A 1RWWA 2KBEA 3Q4GA 1YZNA 4UNPA 1IXKA 4JDUA 4JODA 4C07A 5EPOA 5T64A 2OXTA 4F60A 3K16A 3VYRB 3CLUC 2FX3A 4Q4JA 1M75A 2JBAB 2R2AA 4MNTA 3RIXA 1HDRA 5TV2A 5AW2A 2GFHA 4Y2UA 2G08A 5EFZA 4LJRA 3N59A 3HP7A 3QPAA 3GFSA 5DTQA 4MV1A 3TVDA 1XLTA 4JEHA 4CLHA 2P2CA 5AKGA 5CURA 1JUDA 1TQDA 4LHZA 2IOHA 4IIUA 3WOVA 4BRZA 2NUAB 5EHQA 4ZEVA 5C37A 2KWIA 2WVGA 3HJRA 1GTSA 1DAGA 5ALPA 2WDPA 1G5TA 4N7MA 2UZ3A 1M83A 4Z0PA 1LPPA 2WPDA 5C1DA 4J4HA 1JSRA 1QK3A 1UP7A 1CWUA 3GR6A 4S12A 5ALLA 5AM1A 3GFBA 5CU7A 1Z33A 2IEDA 3U80A 1OAOC 1XT6A 2O8DB 1ZGBA 5IVPA 3RI3A 1J0EA 2OB2A 5C51B 5J2TA 2J48A 5LZ5A 1E2EA 2PGJA 2I29A 1Z83A 3GEEA 4WBNA 5LYJB 1R0RE 4RH3A 2CXNA 5C1OA 5TMBA 3MAJA 2ZE5A 5JECA 2HXYA 4N6GA 5JW6A 3QX9A 3NX4A 4R2KA 4BMVA 3N0RA 3QLVA 4FKBA 2YN0A 4A5OA 3NMUF 4C4YA 5FUWA 2JNWA 5MGNA 1AQNA 5JAMA 2W98A 1UBEA 1ID8A 2R6GA 3CRW1 3CTPA 4D9KA 4EYOA 1SK8A 3G5LA 3T54A 3COJA 3OCZA 2CBXA 2PZEA 5E4JA 1ECPA 2CHGA 4F4IA 5EUQB 4CTOA 5IKOA 1NKSA 1QCYA 3T3GA 2VPTA 1JDZA 3I09A 4AS1A 1HTWA 4W1QA 2HDOA 4JCCA 1QRRA 3TMAA 2J3MA 1CSEE 3HKEA 2J32A 2QRUA 1PR1A 5IM5A 2PKEA 3ZWPA 5AXBA 6Q21A 4LMBA 4J1QA 1FP7A 1UFVA 2GS9A 2J9ZB 5CLHA 3TIVA 1Y34E 3HCCA 4GPTA 2D0IA 3U4HA 2ZUDA 3BD7A 1GGEA 1RYZA 5H4HA 3HTXA 4BEVA 4G6ZA 2YCBA 4O63O 2XB8A 3IURA 1R0XA 2JGEA 4LHYA 2BHNA 4AG3A 2GFQA 2VXOA 3TNLA 2I2WA 5CFLA 1YUBA 2OCYC 5CGQB 5CJPA 3JQAB 2M6LA 4C4TA 3I1FA 4HC4A 4HPXB 2X77A 4LJ4A 5BSFA 3RASA 5BSEA 8MHTA 2QYOA 3O84A 1BH6A 1T0UA 2EBFX 3RRJA 1EB9A 2X7XA 1QX3A 2XMRA 4GWGA 4MV3A 4YCAA 3RC1A 4P0QB 2DBRA 3R5XA 3UUGA 4EA9A 1DWPA 2ATXA 2IXEA 5AW9A 1CY7A 3DVRX 3QVXA 1JW9B 1N6PA 5L3SA 4LRTB 1VLMA 3FPEA 3T12A 4RZSA 1Q0LA 3DXXA 1N6LA 1IHUA 5BSMA 3CG0A 4Q05A 2FK8A 2C31A 2W4QA 4KQFA 3RC3A 3NHJA 4YV0A 1YOVB 3FPAA 3AWIA 3O2SB 2ID7A 4MRSA 3RSHA 1MFPA 1QIHA 1QB7A 3NYRA 5AIBA 2RI0A 2J30A 3HB7A 4FIZA 4DT1B 1CS0B 2P6MA 3WDSA 4F38A 3DTVD 1XG5A 5DX0A 1PJLA 2C82A 3A3PA 1RKXA 4HCJA 4GZ3A 4IJKA 3CLTC 4NENB 4NQZA 1POXA 4UVGA 1ZGCA 4YPOA 3UH0A 2SKCA 5A3RA 5KYKA 1XMPA 1G21B 3I2FA 3OLYA 3PSAA 2OR3A 2QP4A 2J6CA 3VO9A 2VL7A 4B3MB 4WOCA 1Q15A 4EVIA 2XXJA 3THYB 3HVJA 4BO0A 5L40A 1T6YA 2H0RA 3FIUA 3OEWA 5CDGA 1OREA 2NO1A 2ZBDA 3TBHA 4CDNA 2QLJA 1QFSA 3VNAA 3GV0A 2V6JA 4CLRA 4LBWA 1TQ4A 5ALSA 4AO6A 1YXMA 1E98A 3EH1A 1Q0HA 3CR7A 5LDGA 1Z39A 5C8VA 1N8KA 1E92A 4LJYA 3NRBA 4NNOA 4ESHA 2R25B 5JJCA 1V4NA 2EQBA 5KTRA 3U3OA 5TGDA 4PPFA 1JNXX 2REBA 1C2TA 2WM8A 2BI4A 1CUFA 1CHDA 1ZSNA 1V4BA 2CLHB 2OO7A 3JQ8A 3DVAA 4I8DA 5F5LA 1R7RA 2NXJA 2R4UA 1I51A 4N9QA 1ZAYA 3G23A 5JCOC 3EE6A 3FX2A 2MWMA 4V0KA 5HFJA 3WNCA 2Q5QA 3S68A 5HZMA 4RVOA 3KZ1E 2DPXA 2G77B 2YY5A 3EB9A 3G7NA 3MCTA 3R3YA 1WMEA 4L9WA 1N92A 3CIOA 4MWCA 2ECQA 1O6ZA 1YASA 2QN1A 4IZIA 4ND5A 5ECYA 3VR2A 5IS2A 1ZXXA 1IHOA 2Z1NA 4QG3A 3BXPA 2Q28A 3DOCA 3R4VA 3KL4A 1VCHA 1E66A 4IG9A 4NCNA 1LI7A 2HSWA 2R1ZA 3ITNA 4XSHA 5IC5A 3ZDDA 1CU1A 1P2UA 2E4YA 4LQ4A 4R9VA 4YB8A 3Q3CA 4I4TB 3DFZA 5EHIA 2OENG 2I4NA 1FDTA 3GELA 4R8VA 5EWLB 1ZH6A 3GYBA 3KKNA 3MLBA 4UEQA 5ESXA 1X6VA 1A7UA 3A26A 1V4VA 3DLPX 2PUAA 4KDEA 4KG7A 3RTBA 5CB4F 4INPA 3BHJA 3WTBA 4DJDC 5FBKA 1N2CB 2R6CA 5KVAA 4HEA6 3AU8A 1Z0AA 1OROA 2PSJA 3MCWA 4ZGWA 3HJAA 3U5TA 4HO1X 3DLHA 2B82A 3IJPA 4ZCTA 2LDXA 3IV6A 2OILA 4WJLA 2J5KA 5AIAA 4I4LA 3BA1A 3JD1A 3VPFA 4C5CA 1EINA 1MV8A 2Q9UA 2YW9A 3GHYA 4KPYA 4ECAA 3ETLA 4A4DA 9ABPA 3FM9A 4MEBA 4KOEC 1APBA 3C8HA 4KBGA 3DMHA 1ECCA 4EGSA 1XALA 3KXPA 2ZRQA 1YRYE 3N53A 3OMLA 3NYWA 3I45A 2I2XB 1HYEA 4BVAA 1PT7A 5T57A 1DEXA 4FS3A 1QP8A 3A9WA 3DDHA 2IELA 4WAUA 1FDIA 1RCFA 2Q7XA 2VK2A 5ILQA 3G59A 3PNLA 3K5PA 2G7MC 3IE1A 1ITZA 4JS0A 1DTEA 5FA5A 3H16A 1JE0A 4BNTA 3UC9A 2OCDA 2OSVA 5IJWA 2OV4A 4Y6PA 2ZSBA 2QMOA 2CFIA 4GVLA 3JYNA 1W8DA 4MPJA 4AO8A 4BGDA 2AK2A 2ZBVA 3UOWA 2KBFA 3DDOA 2J8ZA 4HG2A 5BO5A 4Z51A 2WICA 3WQHA 2AYYA 3Q3VA 1UMKA 2V7UA 3N0VA 3JD4A 1YJ5A 4FMDB 1RAHA 1VLJA 3WLKX 3KBBA 1GM5A 4YWJA 1EVQA 3SF8B 4BQSA 3O1IC 3RNOA 4XTCS 4ZGGA 2X2FA 3IX7A 3NDIA 1AQ6A 2NO6A 3Q0EA 2H00A 4O2AA 1RRKA 3USCS 3I61A 4KR6A 1H0RA 4JSTA 4ZCSA 4MI9A 3WGTA 1SXJE 3C97A 4BB5A 2O8BB 1KC3A 4OFXA 2ZKLA 4FXOA 4HYEA 1CTQA 1USGA 2BCEA 2ZCVA 4FNGA 4ZCLA 2HIHA 1R66A 1M34B 2AFRA 3IE0A 4WOBA 4B2LA 1ZINA 1XDGA 2H4YA 5LXTA 1OYWA 1K5PA 1SA0B 1X1SA 1SB9A 3JZMA 3LQFA 1ULAA 4EPWA 2F64A 4Q39A 5LB2A 5F4ZA 1X39A 2VHQA 4NF2A 3LQQA 2EV9A 3CEMA 5HQTA 3GBSA 3PPWA 4IOMA 4ONEA 1EX6A 2PZBA 4DEVA 3VVMA 1SEVA 1TM3E 3ABRB 1Z63A 3AGQA 1DFIA 2V4MA 4P4TA 1QZTA 2WM2A 4Z3DA 1P3JA 1C9EA 2Z2KA 1E61A 1YZKA 3NXKA 4WLOA 2Z8YA 4HZIA 4AN4A 2B98A 1IFXA 3O47A 5EIEA 2CNOA 2Y9MB 2HTFA 4UCWA 4YDQA 5AUPB 1UC8A 5LDHA 1ZWLA 3KU1A 1K4YA 1YFZA 4KQJA 1NXOA 1N7HA 2XAAA 3CB2A 4KXLA 1O94C 4ZQCB 2EWWA 3EQ8A 7REQB 5CK5A 3T41A 4RHEA 4KGXA 4BVHA 3FUUA 4LNUB 2YFHA 1MO2A 4JB2A 1U3VA 4Q3OA 4C04A 4AN1A 1E4OA 2JFZA 1TMYA 3AM3A 4LTDA 1P1BA 3AO0B 5FPHA 4U0JA 1RLIA 4W5WA 4UPDA 2IYNA 3BSFA 3HKCB 3VZQA 1LF5A 1ATZA 2XV1A 4KBFA 4IIEA 1J0DA 3ZTYA 2NNWB 4QBIA 4KLAA 5LU9A 4A36A 3R7NA 3LYLA 1H8EA 2X3FA 6LDHA 1RYFA 4LXQA 4CL2A 1KYYA 4OB6A 2BJVA 2B30A 3ZG6A 4BX2A 1P44A 1XJCA 3EXFA 4JLOA 1DARA 4XIFA 2QVGA 1JLRA 1M66A 1TKRA 1VE1A 3MBKA 2OQVA 3Q87B 3EVEA 1J9GA 5AKJA 3S7TA 1ENYA 3VHLB 5BVGA 2E48A 3K2BA 4M88A 4NFLA 4MI6A 4W5NA 1EU1A 1QZZA 3UPUA 1U90A 4IGIA 5KTPA 2G1KA 2XMCA 1WRBA 3RAPR 1YFLA 3VNSA 3TB4A 2UXCB 1MABA 4FZRA 1UFQA 4IIHA 4TYPA 1YVUA 1RQPA 2XJ9A 1KDTA 1GDHA 4S1PA 1YE8A 4MR9B 3W8NA 3UJDA 4M8LA 1Z36A 1H4TA 2HWWA 2IY9A 1NI5A 5ILOA 1PJSA 1JHMA 4IO0A 3EXHA 2HQOA 2PVCA 4MUAA 1ZW6A 4LZOA 3L7NA 2B8WA 2PL3A 4M0KA 5EWMA 3SZMA 1D6SA 2L69A 4YRZA 4FXPA 4CMIB 2FUEA 3C0KA 4URWR 3B6KA 5BV2P 1UFRA 5CK4A 5JDIC 3EVGA 2IOFK 2DMRA 2M2IA 5EJAA 2AL7A 4C4SA 4UMDA 2V1UA 2Z3WA 3QYPA 3E5MA 5EJMA 1LX7A 2V7BA 1UAYA 3ACDA 3GMIA 2Q6LA 1QYXA 1XZIA 3FSRA 2P3QA 1KJYA 4QUIA 4B3FX 1IRIA 5LP6C 3TDMA 4YROA 4LSZA 4NK5A 4DR1B 1BWRA 2QUAA 3UAXA 4KPGA 3CTMA 3HCWA 3UMYA 3U7FB 4NK4A 4ZQIA 1MO3A 4JJGA 3TKAA 2F90A 2V55B 3QENA 2ONZA 1PDOA 4M0MA 5KYUB 3C5EA 3OLWA 2XCIA 1S3SA 2A78A 5IF9A 4WZBB 4PWYA 1K88A 3EXG1 3SZLA 4W9MC 1BWPA 1YZLA 4M8IA 5FX2A 5IKMA 1KYTA 3CLSC 4QDKA 2WNHA 1CJMA 3KWLA 4CNQA 5ALEA 5JNLA 3K9FC 1TF7A 2IP1A 3DGEC 3NTVA 3WDKA 3C7KA 1T4GA 3ZU3A 1VPDA 2PFGA 1ISJA 2H2IA 3JQ7B 4OATA 4FWBA 1FXWA 1C2YA 2IKSA 3KJEA 3LCVB 3PCRB 3CO5A 1J7KA 3KSDO 4UU0A 2AMFA 3HY4A 4MCJA 1Y3CE 1ZYUA 2IY8A 4NABA 1DKOA 2OFOA 2VH2A 4BO1A 1D9XA 1F2TA 1SBYA 1IVNA 4RA6B 4RFLA 2VDNB 3S70A 4CG3A 4UE6A 1W5AA 1OBHA 1R6XA 2PD3A 1PGNA 3RREA 4XB1A 2ILTA 3BWVA 2V4UA 4AUEA 3U62A 1L8LA 3WLAA 3KD3A 4P7BA 2AZMA 3D64A 3EZ7A 4C2TA 2HEGA 2X0EA 4B6GA 2VDWB 4P9NA 3QEMB 4RM3A 4DOMA 1LQUA 1SULA 2D5LA 1Z18A 3NVMB 4UFOA 2TMKA 2H52A 1P1RA 2AOTB 3R0ZA 4GZMA 4N7JA 1IJFA 4UJ3A 4HDSA 3A2LA 4K6HA 4ZVMA 4EGJA 3MBOA 4ZAYA 2X6QA 5FEUA 3W5CA 1H4SA 1F8GA 1XZGA 4Q66C 1Z2OX 2FW8A 5HR5A 4AB1A 4ZZ0A 5IZCA 2D1RA 5B6JA 1QLJA 5LNK6 1TVKB 1ZUD1 5DM60 2PWAA 2A1IA 4E22A 4QG7A 1ZM4A 1IQUA 2PN1A 2FVXA 4D96A 4LYYA 2Q2WA 4V0ME 1RACA 3FYUC 3K9WA 5LZ8A 5JQGF 1CPYA 3FTNA 3I2KA 3CKYA 3EG9B 3FFWA 1FFWA 3B8EA 2VDRB 4HDOB 2Q6KA 2PHZA 5FF9A 1MPTA 1IEWA 3HY3A 3PF8A 4KL8S 1AQLA 1GWNA 1ZQ9A 2VPIA 4II2A 4US0R 4YVFA 2GJSA 5F2KA 4D3XA 2K7FA 4ZPJA 1K5HA 1O97C 2MINB 3CUUA 1IIBA 3OPVA 4CKEA 5I6DA 1P77A 2X8AA 4HZGA 1AO3A 5B64A 4NFHA 3LRPA 2NYVA 2PXXA 4ZCPA 5IYZA 2M6SA 3HR8A 1ZD1A 1FNBA 1X92A 1QHIA 2GUGA 1JIIA 2P75A 1VFNA 1N5RA 4RM2A 1TYEB 1YAJA 4WTOA 3CH6A 3C7DB 4LJ9A 4AN0A 2CXXA 2ZTVA 4TKMA 3LH5A 2REQB 1CEYA 5FNVA 5K6AC 2X4IA 5CVCA 1YQQA 3R75A 4L5BA 1NRIA 1USVA 5KYWA 1I1HA 1RI5A 3A4VA 3AJRA 1T8WA 3HN7A 3PEEA 3U1BA 4C06A 2PUCA 1ZM9A 4EW3A 1U1DA 4LHSA 1QHEA 4QXOA 4F6RA 4L75A 5GADl 2FN7A 1XEXA 2RIRA 3FTQA 1KEVA 2QTWB 5SZJA 1FIUA 1UPTA 3HYSA 4NDZA 1MKYA 3BUSA 2I7DA 3PPVA 2O0HA 5K4GA 2GAJA 2HMYB 3AKEA 1H1LA 1M2NA 2FNAA 1YKGA 1RE0A 1RYHA 1V8OA 2F3SA 3BIFA 3ZGNA 4FN4A 1IAQA 4HXGA 4K2HA 3N05A 2Q4BA 2VDMB 4JP3A 3SIRA 2REXB 3DBHA 3AXSA 3VSDA 1DLJA 3LM8A 3UT6A 2IEBA 3ADOA 4KH0A 4RK4A 4YV2A 4TYWA 1C4OA 5G40A 3ISTA 3TJMA 5CA1A 4BIMA 4REQB 1I4OA 1T9CA 1WXDA 2B3TA 1PEKE 3C39A 2WWFA 4GBJA 4YN3A 4W5OA 3QEBZ 2QI9C 3D4LA 3L7YA 2NXWA 2QLNA 1VCMA 2P3SA 4FYWA 4QARA 1YU9A 2FWBA 3NKLA 2RHHA 1L5SA 1E79A 2WM9B 3CNEA 4G4JA 1JMVA 3GUYA 3Q7QA 4OB8A 5GPBA 5CJJA 3UV7A 4EKEA 3ER8A 3L8ZA 1XDBA 2NTVA 3CG4A 1PVDA 2J09A 4X71A 1ZRNA 4DFDA 4YAFA 5JSZA 1AB6A 1YQUA 4WVFA 1B2LA 1G20E 1XWIA 4EBBA 1QFZA 3MUNA 3OLQA 1AC5A 2W70A 3WLIA 3EPKA 1SKBA 1QIDA 2HOQA 3LYUA 1S2GA 4C14A 3JYHA 5GOTA 2YQ4A 5CNKA 4QFBA 4DB4A 1F9AA 4CF5A 5BORA 2ECFA 3E53A 4H59A 4MDEA 5JV5A 3BT7A 4D9GA 5AQ1A 4KR0A 3D6AA 5LPNA 1U31A 4WKOA 3IVRA 2B8NA 1QQ7A 2GX6A 1IZZA 4H7IA 4TV8A 1UOOA 3AVWA 2BP7B 3DOJA 3W8FA 1DO2A 2IX3A 3D3WA 3TYXA 2O8VA 3C7TA 3FGZA 3DPUA 4DEYA 2OYSA 1AGNA 3PZBA 1QYCA 3DEZA 3FUXA 2ZUCA 3I12A 1E1DA 1NYQA 2PT7A 3QITA 5DLYA 5KHOC 4OX9Y 3PR2B 4X1YB 4IICA 4Y7DA 2BUAA 4UBIA 1ZMOA 2DPGA 2L19A 1N1MA 2PXCA 4XD7A 1UBGA 3IODA 1T6XA 1VBMA 5JS2A 3T7EA 1VHQA 1P39A 5FFMA 2I66A 1B3BA 4J94A 4GOND 2C9YA 4L6AA 1Z88A 3RFVA 1PU2A 1VMIA 1W9HA 2ZJ1A 4Q9HA 3AP2A 4JP1A 3F49S 3N0WA 4KLRA 2GF2A 3GIWA 2F1RA 2NMVA 1RLTA 4IX1A 1VSVA 3L82B 2H4WA 2LR0A 3E7XA 4NMLA 3U7RA 4KYIB 1TF5A 4OBBA 2R8YA 2BGRA 2BMVA 2O7RA 1VE7A 4H2DA 1Y0BA 2A94A 1EP3B 1JJ7A 3B78A 3GLRA 1Z9BA 3ZWQA 2V96A 4N3BA 2ZZNA 3G2JA 3FVTA 1JN0A 1XB2A 2GYVA 4BMSA 2FSVC 4F93B 2GJ9A 2OD9A 2O8EB 2JLBA 3BXFA 4O8ZA 2DQSA 3FCXA 4KEAA 5GP1A 1M2FA 2Q5HA 5JBIA 4AKSA 1QQBA 3FA2A 1Z28A 1BH2A 3N2KA 2QDKA 4B73A 3FVQA 3I72A 2PGDA 2VKTA 2AXQA 1WAMA 4GU5A 4G86A 2R66A 1T3ZA 2Z57A 4JBHA 2PYZA 3QKUA 4CG0A 4D7AA 1OGJA 1EDZA 4HRYA 4OL9A 2VF7A 3R77A 2FQYA 3OWXA 3H11A 1COWD 4YRPA 4MICA 2OHXA 2MSDB 3G0CA 5C2JB 4WK2B 1O95A 4JLSA 2QHXA 5LQAA 4O1MA 1BN7A 4U5QA 1BHO1 3V6LA 4RAOA 1CJVC 1JPNA 4IM7A 3I6BA 4F3CA 1XEAA 1CT9A 5CP8A 4YJGB 3VYSB 4ND3A 5AJUA 3T4UA 3UK1A 2NAFA 3W5AA 1L5HB 3IJRA 5J5VA 3LXRA 4H4EA 1DEAA 1DIRA 4JOBA 2PT5A 1P81A 3SQDA 5C5CA 1B23P 4EW2A 1DUVG 2KM1A 1YDMA 4U6NA 4CTJA 4UBMA 1PEAA 1F8YA 1WHSB 1Q16A 1SHLA 1UBCA 3ITKA 4Y2YA 3GLIA 3G0GA 4TL7A 1U8UA 4ZVKA 2GDZA 3HDYA 4OKSA 4M8NE 2R9VA 3ETJA 2BH2A 3A1DA 5B3JA 3EZLA 3AEUA 1SQSA 3HFRA 5IJ9A 3QVLA 3WL3A 2XKKA 1NVXQ 4CEJB 4NYJQ 4DGQA 1GFSA 2AE2A 1WD7A 4LS3A 4FYYA 5FWDA 2C5LA 3TG2A 1Q3TA 2PMKA 3QSGA 5KWIA 5GJCA 2NLOA 3PB3A 2HB6A 3QELA 4L4UA 3VSBA 1YU6A 3PRJA 4RHXA 3UJ7A 2A4MA 1V7CA 2IUEA 1TTTA 1T9GS 1OV6A 3HA2A 4H77A 3UW1A 1EQ2A 4P5EA 2Q3HA 3J80A 2Q3BA 4UMVA 2E7ZA 2QRJA 3MK31 4WBXC 5E7MA 1V5EA 4D1YA 4EHKA 1JJFA 3NANA 1J8FA 2ZB7A 3AMVA 4EVQA 4O08A 3M6VA 1SHUX 3T35A 1X15A 2X5NA 3D7NA 5JVDB 1X13A 5IDQA 2ISQA 3F8TA 1L3CA 1GTL1 4FGWA 1P0FA 5HGJA 2W6JD 2ZYGA 5LBUA 3WRYA 3S2GA 3GFOA 2NTEA 1M54A 1KXZA 3QU5A 1ZD9A 5DDIP 4D4LA 4C0LA 1WPXA 1T13A 1BRTA 1KY2A 4Y1EA 3EGDA 5K0TA 2JA2A 1HY3A 2VQ6A 2XQIA 4FGKA 5BN5A 4ZVPA 1G8YA 4RFSB 1GT6A 1RWVA 5ALUA 4Z3OA 2AOVA 4Y6QA 1VBKA 2F3TA 5KBYA 2FPPB 4L95C 5AD1A 5CXSA 1W76A 1EHCA 4LX0A 3WGNA 2IXDA 5L4NA 2WHQA 1DX6A 3C1UA 3TR0A 3FCOA 1WNTA 2BFEA 2I1VB 2WSMA 2YHBA 3T3EA 3QTTA 4WA7A 4B31A 3RUFA 1T4CB 2V0NA 3G7SA 3FAZA 1GKYA 3MJCA 2CJWB 4FOPA 5BVHB 3L7OA 1S1MA 5KNCD 4UATA 3L8FA 3ZH2A 4OI1A 4D9HA 2OCKA 2JRLA 3DF7A 4B5LA 1K66A 2P90A 3ZJ4A 4DCNA 5JY1A 4P8RA 1UF9A 2FEWB 4MV0A 3MILA 4QJ5A 2ZB2A 3WFZA 3UA3A 3F7TA 4OHMA 5I7VA 4NYIR 1TE2A 4RGVA 3U4MA 2B35A 2OFXA 3W0LB 4KQCA 3D1JA 2Q5JA 5HZKA 1UINA 3I6YA 4RPHA 1XRJA 5IM4A 4F06A 2CWDA 1C3VA 4GIBA 1NJGA 2TS1A 1F51E 4IFTA 2I6GA 2ANCA 2UZ1A 2V9PA 4FHFA 4NBSA 3BM5A 4V1CB 5ALRA 5K3OA 4LF4B 3RS4A 2PMFA 1WTCA 3TLXA 2QQ0A 3GJYA 2RGYA 4ND8B 1QB8A 3A1CA 3E9ZA 3CVVA 3RYCA 4AKHA 3F6RA 3VR4D 5EJFA 1E20A 1RAAA 3CGWA 2IDJA 3V7FA 2B0JA 1M1YE 2XKBA 4F4JA 3O21A 3SHWA 4O4HF 4BMDA 3DP7A 2X58A 3IUQA 2X9LA 3PC7A 3VX3A 2F3QA 1FRNA 5F35A 4AY3A 2RGXA 3DBOB 3WL6A 5JRDS 5DM4A 5G02A 4DCCA 3W5IA 1KP3A 3IRUA 1T5BA 4ERXA 3RHFA 1W85A 2XNJA 3NHWA 4FE7A 1UOQA 3GDFA 3X44A 1JALA 4CQMD 4DDWA 3KKLA 4ZHSA 3RF6A 1W52X 2LWIA 2QW1A 3AUUA 2G5GX 3PXCX 1P6UA 3LK6A 1WUYA 4YMGA 2AA3A 1H6CA 3DAHA 5CXXA 4YPFA 2MTBA 1KHTA 3AJAA 3CCBA 4Y6GB 4UHKA 4F96A 3A1TA 4E4YA 3FOFC 4LJLA 4M7OA 3SXUB 4HQRA 5T4FA 5GM1A 3UT5B 1MXFA 1P5HA 4FINA 4DM7A 3NEYA 4EFMA 5LLTA 1JFFB 2VKQA 2XDYA 4L9RA 4XGQA 4A26A 1TNDA 2MIIA 1I3KA 2XZDA 1NQVA 3L79A 3ZOKA 2IH5A 3GAAA 3CZAA 3KOWA 1S1CA 2XCLA 4LRUA 3DAGA 4OHYA 2K4MA 2WUWE 3UZUA 4B2IA 2P62A 1C0EA 2N3ZA 4ABTA 4MHTA 1HO3A 1L7QA 2C5AA 2QTVB 2NTNA 2I87A 3C98A 2FEOA 4UXHA 4QZVA 1IC6A 1MORA 2I3AA 2X14A 3LWNA 3I8SA 3RV4A 1ONBA 4C22A 4HXFB 2ID4A 4LBZA 2C7RA 4F2HA 3A1VA 4EFDA 3GIDA 2ADOA 1HTTA 3DOEA 3DT8A 1U4OA 3L8MA 3UKOA 3FFTA 1D07A 2NO0A 2RH9B 3C8DA 5D3MA 3I0NA 1RDFA 5LYYA 4K9DA 4RK7A 5KREA 1VG8A 3MYRA 5EXPA 4HLCA 3K6RA 5C4GB 2A67A 3KNZA 5HBGA 1T0BA 1HLFA 2R6ZA 1MMFB 2FMTA 1CEEA 4I1OA 4NOMA 4PZLA 1P9RA 3IHTA 5IVIA 3SC3A 4D02A 3ZZMA 1NN0A 4KW7A 2DFPA 4JOSA 4UM9D 1ILEA 2F17A 3H5AA 3Q2IA 2PGIA 4G37A 5KJFA 1T8SA 1A96A 3L2OB 3PPIA 1B93A 5H02A 1A4IA 2P4UA 4BLUA 4CLOB 4JD5A 2IYPA 1J99A 1KPHA 1LDBA 2Q7DA 4RTOA 3T3NA 2P8JA 4F3YA 2GPYA 3T0GA 1VL2A 1RYYA 1WU8A 4Z7JA 2FFQA 1FDWA 3JWPA 1UBHS 4PM4A 3OIDA 4XB2A 4A3SA 5C81A 4IOJA 1EUCA 2IHUA 1KI9A 2PWBA 3RYTC 1G6Q1 5FL3A 2C4MA 3IAS1 5E7QA 1UPCA 5CTJA 1Z7YA 2C2YA 5CD9A 1PYOA 5F2EA 2GRAA 4LXXA 3VKVA 1E94E 3X1XA 1SNYA 4UBLA 4AMYA 4ZYWA 3SJUA 1JXOA 2C5HA 2GEFA 1M2VB 3A6ZA 4RCZA 1ILWA 3PHBE 1I4DD 1GL6A 4GH5A 4DLNA 3IR6A 1Y42X 5ARCA 1E1NA 5DF1A 2WWVD 2AFHE 1M0EA 5A4DA 1JSZA 4JR1A 2ZI3A 1XDWA 3UT0A 2ERYA 2R6DA 4IGFA 4ZZ1A 1M73E 4Y2GA 2BMJA 4NEGA 1QF6A 4C0XA 3INTA 4YFYA 3BREA 3OX3A 4ENQA 3WYFA 2KS6A 5AVXA 5IUKC 1V2HE 3DVLA 1RM0A 4HAZA 1N9GB 3AM5A 3WWZA 2G9RA 1A77A 1XKLA 3RARA 3TQHA 3B5EA 3S2UA 2AMLA 2R1VB 2EBUA 5DLDA 1KKLA 4KHPB 1NVGA 3WLQA 1YB1A 4EQ6A 3NBZC 2X9GA 3OHMA 1PJTA 5U4XA 1AS0A 3NT4A 1E69A 1XHFA 4HT3B 4EG0A 4ZO8A 1JDBB 2VSOA 3S2ZA 2Y67A 3DJYA 1XDZA 4IQ4A 4UUQA 3E3LA 4Q1EA 1K2WA 2VRCD 3KVVA 4WRRA 3ZIAD 4EF4A 3RJZA 5AW3A 3OQOA 2NZ8A 4ARAA 1WIWA 1E32A 4OLBA 3ADKA 4D57A 1PGPA 3KZMA 4JP8A 4FPXA 5DTMA 5IJ0B 1UFKA 2WJ4A 5E0OA 3LC7O 3AETA 1VC2A 1BDJA 4RZHA 1TDJA 4B7CA 3PE6A 3SKYA 1XPRA 4HDNB 1B16A 1XWWA 3I3OA 5AUOB 1BQ4A 3GB9A 1MRZA 2R4QA 3CZQA 2WAMA 1SUPA 2XJ4A 3OPXA 5J63A 2A92A 2PU7A 2SNIE 2E1PA 4RTRA 2OWEA 1DTSA 4ROTA 2EGGA 2I62A 4ZO9A 4OQZA 2ZZKA 3C6XA 1JQBA 3FWPA 3QMWA 3X2FA 3O74A 2EWMA 4Z4QA 3IP6A 4AMVA 2C2OA 1XAIA 4XCVA 4H15A 3WQQA 4KFUA 1UM9B 3KWJA 3R2JA 4G5GA 2DTEA 3AF0A 5CDHA 2N0SA 3AFOA 1OFIA 4MRPA 4GNKA 1A4XA 2E4AA 5DHUA 5KHLB 4L4ZA 4D81A 1EAYA 2XHZA 3P9ZA 3DD1A 5CAEB 1O3YA 3NOXA 4BXOB 4A6DA 1XJ0A 3CINA 4UBNA 3O4FA 3PRYA 3DHVA 2VA8A 1FDOA 4BBJA 3L6BA 1KMHA 4CKCB 2XB9A 4EUHA 3ELUA 4J0JA 2RC5A 4LY0A 4ZZ3A 2A1UB 2AQHA 2ACWA 3DMTC 3IO3A 4XYBA 3CGGA 1ULSA 2BKEA 4BCCA 4FLMA 3RSSA 4DR4B 1XCMA 3FPBA 3LQYA 4IDDA 4JA2A 3E3MA 4N41A 3P5BA 1BCRA 1VL5A 3PDIA 4B7AA 3RVLA 3TZEA 1KC1A 1FYEA 1ZVQA 3KSMA 3VPHA 3LTNC 4CMEC 1Y1KE 1RKBA 1QH0A 3LT5A 1S2OA 1FL9A 5SYNA 1CQIA 3AHEA 1W2GA 2VXCA 1JR3D 3BH7A 5KNDD 2QTCA 3C5WP 4E4RA 3CC8A 1SQGA 1N78A 2ACEA 5KYTA 2BTEA 4DWOA 5L3RA 5DBHX 5CITA 2HO5A 3ILYA 1YS6A 3GDGA 1TPZA 1V9SA 4WWHA 3H83A 1GYRA 1O4VA 2IZ1A 1M7GA 3WP1B 5JRZA 2K2WA 5D01A 3LE8A 1NPYA 5AT1A 5DXFA 1EFTA 4MO2A 3SKXA 4MQMA 4TTPA 2GN6A 4TUYB 2QAJA 5BRJA 1BW9A 5H8WA 2VK1A 1HR0B 4D46A 5LUBA 2QRGA 2RE8A 1UJMA 4ISBA 4A23A 3IESA 3CRNA 1I80A 2JIZA 3G0OA 1L7AA 3WFIA 1SUDA 1Z16A 1OIVA 4TL6A 4GD3Q 7ADHA 3AI2A 1SJ9A 3Q12A 4QUEA 3TLGB 4AU1A 1FQOA 3QLTA 2Q6IA 4MEAA 1V47A 4PG8A 1PWXA 4UOEA 2NO4A 4MDYA 1UBTS 1ZI6A 2IU4A 1U8ZA 3ECSA 4M98A 2IDZA 1CRLA 1TJPB 3EFHA 3LUPA 1WA5A 2E49A 3RADC 4TVSA 3ONEA 2WAOA 3BQ9A 1A8SA 4H18A 1SXIA 1PJCA 2IP4A 4NKRA 4QYIB 3NKFA 4GW3A 4R8RA 2G76A 1ATIA 4MJ3A 1MAHA 1MQ8B 1CRWG 1P6XA 1Y6GA 3SX0A 1XNRB 4D45A 2C5FA 4DG8A 4QKQA 1Y5RA 1NBEA 2XGGA 2CXRA 3EF3A 3QVGB 1C3LA 4OH7A 4XVRA 1L4UA 3HWRA 3ML1A 5HKAA 5FD8A 3BORA 1DQPA 2BT4A 2R97A 3EODA 3F4KA 2Z6VA 3LBIA 3PHJA 3AF6A 1BVRA 1GGFA 2COEA 2R7MA 3B8HA 1BEEA 5B58C 2QENA 3H3FA 2DR3A 3ROGA 4AZTA 4LWQA 1ADCA 4TMXA 5DV9A 3MHPA 3LIIA 3PVSA 3MLAA 2Y93A 4MROA 2O48X 3V42A 4DV4B 2PUGA 1Q0UA 2FOLA 1AA6A 2IXGA 2W48A 2X0IA 2WF7A 3MRTA 3RD5A 4HGZA 3H2GA 4KYTA 4B4UA 1P4RA 3QTBA 3QWFA 3K9BA 3L1UA 3OCCA 1YVEI 1OASA 4D8TA 3LVBA 2AXNA 3PQ5A 4K1XA 4XQCA 1MDFA 4UDOA 3PJEA 1P2DA 4CM4A 2ZRIA 4BV9A 5SYMA 1KYXA 2BSQA 1E1RD 3I5UA 1W0KA 3LUAA 4LK2A 1OZFA 2ORED 3QUCA 1W93A 5GWXA 3ZV5A 3QGMA 4P3OA 2CFOA 5CBKA 2DKFA 2FR8C 2R84A 1L7PA 4P31A 2EHJA 1BKDR 1ZU4A 3NONA 2BGNA 2O2GA 2XNDD 4GOKA 4IFBA 1JIVA 4IQ0A 2W11A 3SX4A 1M0TA 4Y9SA 1NVUQ 1WE2A 1L8QA 1PWEA 2ZSDA 3L05A 4NAHA 4RVUA 2NVUB 3U7IA 1ZVVA 4BKQA 4UZSA 1ZGJA 1N7GA 2ZYAA 3VFDA 4P08A 1X2EA 2BGGA 1TVCA 1TYDE 1FRZA 4UUOA 4W1SA 4YRFA 1L5GB 4EY6A 5CDYA 4QATA 1PRYA 2AZTA 3Q0IA 5A3VA 2WT8A 4UDYX 5HF6A 5HF5A 1KZ7B 4AD8A 2AMVA 2Z2XA 1JFLA 2IEZA 2Q5LA 3G8BA 1Y82A 4QYTA 5FJIA 2EG5A 4D56A 1XU4A 2NZUG 1CJBA 5ALQA 3SHQA 1ONNA 3B9PA 2ATCA 1R0LA 2EX4A 4GSKA 4QWMA 1U28A 4DMRA 1QGAA 3HDGA 4F9FA 4OGWA 1T0IA 4CL8A 1ZK4A 5DM70 3N6RA 1Y3HA 4L15A 2W2QA 1GPKA 2WK1A 3OZAA 3JTEA 4BZZA 1SUWA 9LDBA 4JLJA 5EJ4A 2ZLBA 3H42B 4YO8A 3VMFA 4A0QA 4PGHA 1OUMA 2I2AA 2NUBA 3NDJA 3H2JA 4CXMA 1OTHA 2MYNA 4HJXA 3JQFA 4WW0A 3V32A 4HAYA 1GAQA 4OQFA 1KYQA 2OM2A 1XCOA 2WWRA 1JQJC 1DUIA 2WKPA 1J90A 3GGDA 3LBFA 1I4LD 3NUQA 4OO3A 4OGFA 4NICA 4QQNA 5FJJA 3TOCA 4HEJA 3VOTA 5B1IA 3WFJA 3HJFA 5LQNA 3ME5A 1G63A 4AIIA 1K8RA 2QUZA 3GDOA 5SZKB 3K2QA 4PTLA 1ONOA 3HXTA 4B76A 3UGQA 3GGGA 2G6BA 2F3UA 2YZ7A 3C5VA 3GVIA 4MJ7A 1FJXA 3ISVA 4A0HA 1EX9A 3E15A 3WO1A 2FRDC 3O3NB 1CD5A 3D6TB 2ERXA 3FI0A 3STWA 2WQ7A 3MWGA 3EUAA 1P1FA 2ZAOA 2UYOA 4Z4FA 4G0QA 4LYEA 3CX4A 4G01B 4LVOA 3HSYA 3KTAB 4M0LA 2CNDA 4ZDWA 3RF7A 1RVV1 1PZFA 4MIOA 3WKAA 1X7ZA 2AF4C 2VJPA 3KO8A 3E4CA 2P65A 2DWUA 5CB4A 2YZKA 3DE4X 1UZNA 1VQ1A 2ZSUA 3KEOA 3KXIA 4X20B 4TLLB 3UAZA 1AK2A 3O9MA 2QD4A 4HOYA 1O8CA 5JJLA 1U02A 2A9OA 2X3YA 4BDSA 2WYVA 3DE2X 3R9KA 5CA0F 5ITWA 4L8VA 1U2ZA 3CLRD 1OH5A 2MSCB 5ABPA 1QIIA 2PSSA 4AZ3B 3DPIA 4C88A 2UUBB 1L4LA 2XYGA 1PFVA 4BPRA 4FEEA 4NJMA 3FOWA 5EZQA 5JUWA 2D1FA 1W0CA 1FSZA 1HORA 3KFLA 4UUBA 3RM3A 4YO7A 1E8DA 4RHUA 2QRMA 4YGYA 5ALFA 4DBVO 2JLZA 1LBQA 4ZYLA 1K5GA 1A27A 2KQUA 4J3JA 5K1ZA 3AHCA 4X6LA 1YDWA 1A8HA 2FG6C 4Y3UA 2PT6A 4DMLA 1EJBA 2WRZA 4Y1RB 5HA5A 2QN2A 4FR2A 1B74A 1LRKA 3A6JA 3FKQA 2V6MA 1GU7A 1KFKB 2EEZA 5LQSA 3FCEA 3TPFA 2GCOA 1CYEA 2Y1XA 2L82A 1T36A 4JWKA 4CR7A 3U4QA 4O6VA 2H1FA 1H85A 4LPSA 1Z6ZA 1QRAA 4I99A 1FJ2A 1LCIA 4MVJH 4GNRA 1GUYA 3JX9A 3L6UA 5A1TA 4MARA 1G7RA 2K5UA 1SXJD 2B3DA 3FNBA 3OP4A 1KZ6A 1N5KA 4JNCA 2O9JA 4XPIB 3SOZA 1NY6A 3IDAA 4YQYA 4JROA 3OCXA 1N1DA 1MN6A 5AKZA 1KZHA 2IBTA 1ML3A 4Y9DA 2Q3DA 4YH1A 2UAGA 3UANA 1KQNA 5HWSA 3ICOA 2CV0A 4Q1AA 5KOJA 1QH9A 2JEOA 2Y1DA 3H1EA 4A2WA 4B43A 2QM0A 3DMNA 2ZRLA 4PONA 2NX2A 1C4WA 2HWUA 4DYVA 2JGRA 4B0OA 1EWVA 2QOEA 2BKXA 4L07A 2DE0X 3P0EA 3TQQA 3K8OE 4IHJF 3IIEA 2ZAIA 4KXXA 4BNHA 2WI8A 4NS1A 4R5MA 4WL0A 1YRAA 4HMOA 4PXYA 2ODTX 1H2BA 2KMLA 4G0OA 1U9IC 3ZGZA 3NKVA 2OORA 4CM3A 4S0XA 1BE6A 4EKGA 1MR3F 1RFLA 3AK4A 1NN3A 2JGIA 5EE3A 1CNFA 2YNMC 1XGKA 2A33A 2ZK7A 2HUNA 2VS1A 3L7JA 5EG5A 4M89A 4B3DA 2HMVA 3AYXB 1V71A 5AKXA 1AKUA 3WNQA 3EEQA 1U2RA 4PEVA 5IF3A 4OQPA 4TL9A 1KXJA 2W2XA 4WK4B 1K7CA 2YHAA 1CLUA 3OIGA 4JXZA 1NMQA 3F4BA 2QK4A 3JAKB 5BYAA 3CCCA 2HDHA 2W6NA 1Z13A 3NAQA 4AYTA 2Y27A 5DM2A 4QFDA 4AULA 3KVOA 3B1VA 3NTLA 3WP0A 3HO1A 3TZKA 2VYVA 3WIUA 1KSHA 1OHHD 2BGMA 3LWBA 4N54A 3AESB 3VR5D 3VTAA <