1C41A

Crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
195
structure length
165
Chain Sequence
GPTPQQHDGSALRIGIVHARWNETIIEPLLAGTKAKLLACGVKESNIVVQSVPGSWELPIAVQRLYSASQLQSTGPFDALIAIGVLIKGETMHFEYIADSVSHGLMRVQLDTGVPVIFGVLTVLTDDQAKARAGVIEGSHNHGEDWGLAAVEMGVRRRDWAAGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUMAZINE SYNTHASE
publication title Crystal structure analysis of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
pubmed rcsb
source organism Magnaporthe grisea
molecule tags Transferase
total genus 58
structure length 165
sequence length 195
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1c41A00
1C2YA 1NQUA 1C41A 1KZ1A 1W29A 1DI0A 2O6HA 1ZISA 1NQVA 1T13A 1EJBA 1HQKA 4KQ6A 2C97A 2I0FA 2OBXA 1RVV1 1KYYA 3MK31 5IM4A 4J07A 2C94A 1KZ6A 2C9BA 3NQ41 1KYXA 1KZ9A 2B99A 2A57A 1KYVA 1W19A 1NQWA 2F59A 2A58A 1XN1A 2VI5A 1KZ4A 2C92A 1NQXA 5IM5A 2C9DA 2A59A 2JFBA 2B98A
chains in the Genus database with same CATH superfamily
5BWCA 4QQ8A 1KZ1A 4W7HA 2Y1GA 1KEEA 4RPHA 5T6BA 4PZYA 1RPAA 3SYNA 2BCEA 1NW3A 3LW8A 2I7XA 2WM3A 3VH1A 3BCHA 1H5UA 4D92A 4DA6A 1LTHR 1CY8A 1NJ1A 1TAGA 4BFLA 5EZYA 2NPFA 1FY2A 4KR6A 1DEHA 2NX2A 2VNJA 1SMKA 1E7MA 1ONOA 1UXIA 3JARA 1SC3A 3VUFA 5DRYA 1J9GA 1UJBA 2JCBA 3AI1A 4Q4HB 3T06B 5K3SA 4UTNA 4IDDA 5IH7A 1KAOA 4EI2A 1U2PA 2BFOA 3A6DA 1HEIA 4NS1A 1SHKA 5E4YA 4WN3A 1EDBA 2P2GA 4G85A 1G7CA 5JNSA 3ANMA 3WLLA 3GLIA 2F9MA 3H4IA 3GFOA 5E6UB 5K4GA 4Z9YA 5CEFA 4BUJA 4ZRDA 1AKUA 2CJFA 1GIAA 3ZLTA 1W5SA 4YMTA 4CQJA 4YQEA 2HQOA 1KJQA 1DO0A 3QVMA 3HA3A 1DBVO 4EF4A 1ITZA 1U31A 4ZC1A 4C30A 1H42A 2CUNA 1SOUA 4N8DA 2DWQA 1BE0A 1AUVA 3VM6A 4E5KA 2G6BA 2XVXA 3I12A 4G81A 4JIMA 3IJPA 1FTNA 3K2QA 4B80A 4DQXA 5B7PA 4XWOA 1XQ6A 4O1IA 1SRQA 1WULS 4RKEA 3ID6C 3NDPA 3CIOA 3NXSA 1JI3A 1W87A 4PYJA 1CCWA 4DHWA 2C5AA 2UUBB 4QM6A 1NJGA 1W94A 2DR3A 3QW2A 2J3DA 1KORA 3AUTA 3R5KA 1BOOA 3KP1A 5KOJB 4I9FA 3VZCA 3CWZA 2JFNA 5CVUA 5HZKA 1RVV1 3I8XA 3T1QA 1ISRA 1TMOA 3EH1A 1Y89A 4G1CA 2H1SA 3B7PA 1E3WA 4IIVA 3OTOB 3T54A 4K7JA 5KMGA 3TTWA 3BL6A 3DDUA 3QG5A 1YXMA 2HU7A 2DTXA 2IDKA 1EAYA 5JPCA 4KXMA 2VPIA 4F96A 5DOZA 4RADA 4BO8A 3LWZA 1TDJA 2RHCA 3NC0C 5IRCD 4CG2A 2D62A 2W6OA 4PG6A 5D87A 5KVAA 1SKQA 4AJ4A 1EQ2A 4FZJA 4DBLC 1YONA 2PAAA 5DHRA 1V0JA 3KB1A 4JI6B 1L7OA 2F6RA 4I6EA 4W7SA 2RONA 1WUJS 5CP8A 2WG0A 3B89A 1KOGA 4UC0A 1UPAA 3LX4A 2KW5A 5DJ5A 3AL3A 4IVRA 4DRXA 3VNBA 1RJ9A 4EM6A 1E3SA 3K9GA 3T5DA 2XDWA 1ISPA 1ZY2A 4IZIA 5A5DA 3G7UA 4BZPA 3I04M 3PKIA 2WTNA 3K96A 4GKAA 3RG8A 4DC0A 1VYTA 1JHPA 3G8BA 3MB5A 2I29A 4KFRA 5F98A 2PT7A 4D8WA 5ESWA 4BVLA 2HMAA 3CNBA 4WWHA 4BLOA 5FBRB 5J2TB 2EBWA 3GEEA 4HJXA 1U1EA 2OQ2A 1J7KA 2CXSA 1XTQA 3EOBI 1A7KA 2IOQA 3MOSA 1XDSA 1FBNA 1ZNYA 2VP5A 2PMKA 2QP4A 2YUTA 5I9MA 2C42A 2XTNA 3V7FA 4B87A 5MF6A 2GZDA 3R8XA 1YFKA 4G8DA 3RJTA 3SEZA 4U7WA 4G63A 4XQ9A 3SEFA 4B7CA 3LA6A 2ZU0C 5A71A 3VNAA 1GKYA 4NZNA 2IP4A 2R1VB 4REQB 3ZNQA 2PO5A 3NNDA 1G18A 1ZM2A 1MVNA 3IPLA 5C9ZA 4QJBA 4TT8A 4URXR 5FPKA 3EQ8A 1PFGA 5TNXA 1K6MA 2AR9A 3AKDA 3JASB 2FPSA 4I4NA 3U80A 1YVDA 3WQQA 3ZWKA 1FMLA 3OHSX 4ENUA 2Q6OA 4MJ3A 3A6JA 3B13B 1QDUA 5LP6C 4BP8A 1GA6A 1GNLA 1GPDG 1UJCA 2Q0HA 3GJ3A 3O2JA 3BULA 1QV9A 1ZH0A 3AR2A 3EOAI 4OREX 5BVHB 1JPVA 4CM9A 4LNUB 3CBQA 1QNLA 1NXVA 4H59A 5IM5A 3D8UA 1OXSC 3W2GA 1GZ6A 1SBIA 4FZVA 4A0FA 1FE8A 4QDOA 3KAQA 2Q4EA 4E4RA 1DO8A 3JAKB 4WLFA 4F8EA 5I8WA 2NXWA 3QUAA 3R75A 2BKEA 3ABSB 2JEOA 1O97C 1QK4A 2ZRLA 3OQHA 3DFFA 7YASA 1PJAA 4Y6PA 4ZT2A 5A6SB 4F85A 4OHYA 5H02A 1THTA 2FW7A 1T1JA 4H3HB 2QJRA 5FUXA 1TF7A 2QM8A 4JU9A 3W9SA 5IFLA 2R751 1T3ZA 3BGSA 1VA4A 3ENZA 4GE3A 4XCVA 4RMIA 2PGIA 3KR0A 3EDRA 2H4JA 4J0CA 4AT1A 1GRVA 3P9ZA 5C8YB 2JKVA 3NEYA 3F73A 3PDHA 5LDDC 3KOMA 4NNOA 4GMGA 3JS5A 1NP3A 4JK3A 3R8FA 4Y2JA 4YREA 4W7IA 3WDLA 2PJRA 1H2ZA 1ELOA 2XWSA 3AFGA 2C1XA 1QO0A 2FZWA 1J8DA 1IIBA 4MYCA 3P9RA 2G9VA 3GDHA 1OLUB 2ETXA 1QKKA 2ZBVA 1P1KA 3AU9A 1Y8QB 1WU8A 2V45A 3F8TA 1TKCA 2QTCA 1DXOA 1RZVA 3HJAA 1R10A 1V41E 4R2KA 3IAHA 4F2DA 5JD5A 3A4MA 2FP4A 1HZZA 5LD2B 2PPVA 1GFSA 3ZLUA 1AK9A 1N25A 3I04A 4DB4A 2V4ZA 2Q5HA 2HU2A 3Q0EA 1HYEA 5FWAA 1X94A 2W2OA 4MUHA 3B8EA 3D3WB 2X3YA 5CFZA 2P79A 3K0FA 4Z0TA 1E7WA 2CFSA 1AQYA 4NI5A 2W70A 3RT9A 3U3RA 3INNA 3OZFA 4N47A 3U1TA 4BN0A 3P32A 4HGZA 4K9OA 2VUUA 1XCLA 3N7AA 1Y80A 3UAZA 1O03A 3WB9A 4ZAFA 3AW9A 4L72A 1ZGZA 3NUQA 1Y7PA 4CDMA 1ENZA 1M8FA 1IAQA 2FUG6 2VDNB 3PX2A 3P1JA 2YMMA 1G7SA 5BUZA 3KPUA 5IMBA 4W5OA 4GLJA 3FLMA 3HFSA 1R4NB 3UH0A 4FEGA 5A3JA 4JBYA 1DUSA 4AYXA 1F8GA 4FCTA 4FCCA 1HMYA 2JCSA 3GUVA 1CUUA 1H6CA 3LP6A 3W6NA 3P0EA 1RIFA 2Q49A 3CMCO 5GMOA 2PV0A 4OBEA 1G5RA 4F5WA 1RJWA 5LIPA 5ALFA 1JDJA 1NBMD 1A8UA 4Z0HO 3EN0A 2FZKA 3O4FA 3OTQA 4HLCA 2Q6VA 4EUEA 1H4QA 4CQLA 2VHCA 3UWKA 5BUSA 1VJTA 2NG1A 3BF8A 1RXSA 5A1TA 3I52A 1JA9A 3L0DA 4C9BA 1KBZA 2LPMA 2O3RA 3FPHA 4JC4A 4DHEA 1YNOA 2BF7A 3K6JA 2QZPA 1VPWA 4ZVUA 3GLQA 4OY3A 8AT1A 4DB2A 1YHNA 1CUDA 2N0SA 4OQQA 3KC2A 3OIGA 9LDTA 2HHJA 1E4OA 1Y33E 4HNRA 1VHJA 2H1FA 2B7BA 4V38A 5LFAA 3ACDA 2F3UA 1U0HC 5G0WA 4DEVA 1VC2A 2H4YA 4WZBA 1Z0IA 1JE0A 4S0XA 1ZKMA 3TKAA 2G8NA 1P31A 4E2ZA 1YVPA 3E2MA 5AJTA 2Z2IA 4W1PA 5LM3A 4KW7A 3A9VA 4BJ3A 1T0PA 4LPKA 2OVBA 5LOVB 3ZDBA 2YOHA 4UXIA 2VQ3A 2WW8A 1HOTA 4KPGA 1RQ7A 4JLMA 5JJCA 2C2XA 2CXPA 1GL3A 5A1JA 1VLJA 3BJRA 1MW8X 1XRMA 3KYJB 5HEKA 2GJ9A 2D1TA 2X13A 4MCJA 4KQCA 4LJKA 3BJZA 3FPAA 2Y76A 3FSGA 3LUFA 5A5GA 2FE1A 1F2UA 1PTKA 3L7LA 4LPSA 3T0FA 2UYQA 3VJRA 1J49A 4HCJA 2ROQA 4F6RB 3KQYA 4EP1A 5H4HA 4D0SA 1AS0A 5D3ZA 4G0OA 1JUDA 1XVTA 2ODTX 2PN1A 4QSHA 3FFAA 4MJLA 4NE7A 1N5DA 3MILA 3RRFA 2TMKA 3JWPA 3FVQA 4FFOA 2JGAA 2NVOA 3C85A 2GA8A 4RMGA 1V5IA 1WPRA 3AY6A 5AWFC 3T5CA 1N2HA 1XI2A 3NHLA 3CXUA 4TUYB 1C7RA 4L0CA 1J8QA 3C97A 4RJJA 1Y6RA 2JIRA 3KKNA 5EHQA 4D46A 1UPTA 4BFTA 1FJHA 5C34B 3ZEIA 2ZYWX 3AF4A 3GMDA 2ZQ5A 4PX3A 3WXMA 4DY4A 3V9PA 1IHDA 4G0NA 4W5HA 4EITA 5HUHA 1WHTA 3G1WA 3LDUA 5E6SB 5JCZA 1O3YA 3GFPA 2BMEA 4Q3KA 4JFAA 4BL5A 5DXAA 4UE3S 3TLBA 4P86A 3UK6A 4HFMA 3P9XA 1P74A 2WAOA 3LW7A 3Q2KA 4UNSA 4UPVA 4ZYZA 3F9CA 2QMZA 4R1OA 5HQTA 1IONA 1JDSA 3L0ZA 1Z5WA 2HLDA 4K03A 3RU7A 2QTFA 4BV2A 4C7OB 4Q15A 2J3HA 3LYLA 3T3DA 1JKJB 4Y1GA 2D2IA 2QM0A 1PGJA 3VKWA 3EMBA 5EFOA 5H5JA 3WB0A 3OTHA 4S35A 2XA2A 2H7YA 2ZRMA 1R0ZA 4IJKA 4KQ2A 1DCFA 4IDNA 1G98A 3W9UA 3MOGA 3H6GA 3C5CA 5IPFA 1IEWA 3DOUA 5FYDA 4MMZB 2MSNA 1MQSA 4W8HA 3PGXA 4A6EA 2W00A 4YRJA 2NXEA 1SUDA 2GO1A 5HF5A 3GRAA 1BKDR 3GZNA 2OO7A 2RSLA 3GGGA 3SF8A 4U8HA 5J2UA 1CLEA 4HDQB 3DE0X 1A1SA 4PZ0A 2XLCA 5DGTA 5DYTA 2HGZA 1M8PA 2JFOA 5BNIA 5LKRA 1K2WA 4COOA 3ZHQA 4Q24A 2AMJA 4RSRA 3JZMA 1AMUA 4CKCA 2N1BA 2C7RA 4Q4AA 4EGQA 2UKDA 4QECA 1RI2A 3NZEA 5E3HA 1ENOA 3ZI4A 5E9JA 5KTRA 2C95A 3LUPA 1Y1QA 3RVLA 1X7WB 1V5FA 3F1LA 4TROA 5E8JA 4JUCA 4DCVA 1ADBA 1GYQA 3UANA 3WICA 1FNNA 5BV2P 2H51A 1XZQA 4HAOA 2HB6A 3ZWVA 4MCAA 1XD2A 4ENSA 1FX1A 1H6AA 2E4XA 1K08A 5G02A 4ZK6A 2VQEB 5I7OA 3GX1A 3P9NA 3H4MA 3U7JA 4PAGA 2H1VA 2HWKA 2AN4A 1WDMA 1S2OA 1KI2A 3C41J 1V7PC 2XUQA 5FTNA 5H16A 3BZBA 4WVLA 2ON6A 5H8WA 3HB5X 3OQIB 2QR3A 2QBYB 1E2PA 3FH0A 3LOPA 4LOHA 3MTAA 3VDNB 2EAUA 4JA2A 1POWA 1A5SB 4WLOA 4TLAA 5D3MA 2X5NA 4H4EA 4Y67A 1EWTA 2IZ1A 2PU5A 5JD3A 2Q1TA 3O91A 2Y99A 1G17A 2ZJZA 5FPTA 4AWXA 3QU5A 2WUVA 1RLUA 3D02A 3QV1A 4P5PA 2BGIA 2H5JA 3DO8A 4UE2A 1Q0TA 1Q0ZA 3EGVA 3PHGA 3ZHVA 2IPXA 4O4HA 3B6KA 1MOQA 2J3EA 2XQGA 3EY4A 4WJZA 1II8B 5EUCA 1CUAA 1SA0B 4WCVA 1U7OA 4B7UA 2WF6A 3PFIA 3QPBA 4LTNA 4TSFA 1P8JA 1BW9B 1W0CA 4J7XA 1UJ6A 1XVLA 3C98A 4BLQA 1U3FA 1E58A 1E6UA 1LFAA 3K0AB 4UCWA 1VDZA 3L6EA 3M6AA 3BGVA 3OLCX 4LXXA 1PWZA 4I3GA 1J9EA 4LDRA 4NEHB 3FTPA 3AM1A 3FDIA 4D0GA 5KWEA 4HB2A 1HKHA 2EJCA 1AU9A 4XIFA 2F1IA 4L76A 1C7QA 1E20A 1N0UA 1O77A 4OFXA 5DYIA 3TEMA 1NE7A 3VYRB 3F3MA 1OBHA 2W6ZA 1WDLA 2VTVA 3FF4A 3NBXX 4UNNA 4C06A 3WQBA 1JR3D 3I28A 4ZHQF 2F4NA 3BA1A 3FPGA 3FRHA 4FFNA 2AH5A 3Q87B 2XECA 1M9NA 4AW9A 1BGVA 3RSCA 3EVTA 3EQ9A 3T7DA 2B5WA 5ALXA 2AZDA 2Q99A 3H9BA 2Q3JA 1MOZA 1PZHA 1WA5A 5COBA 3T1TA 5EIEA 4EX7A 1K75A 1AQLA 1DMSA 3BHJA 3GWZA 1EVQA 6LDHA 4E1AA 5B1DA 4ZYYA 2PD4A 1G41A 5GIOE 3OA0A 2PCJA 1Z6YA 4UD6A 2Z3VA 1KY4A 3BIFA 3VHQA 3P2MA 4OQYA 5T8KC 2GBIA 3TQCA 1T3HA 1T1EA 2LE0A 1NLUA 2NU7B 2P6UA 5FWNA 2WE7A 3K9FC 2HSGA 4NENA 4RFLA 2ZVPX 3TUIC 3NTOA 3QGMA 1X2BA 1T8RA 4AY2A 2OZKA 4TTSA 1NGSA 3B78A 4B76A 5C32A 3I8OA 4KRXA 4L3VA 1CZHA 3LVBA 2FPMA 3HCAA 3G9TA 1DKPA 3F2VA 1JN0A 3PNPA 3HZZA 4F38A 4UOEA 1L7VC 3FDFA 3DC7A 2GM9A 3ILVA 4QBHA 1QSGA 1T8WA 4MWCA 4PQEA 5FBVB 4K9RA 2FW6A 2PX2A 2O2ZA 3LX5A 2X3FA 1LPOA 3DVAA 4LYAA 1SUCA 2IXGA 2O4CA 2BDEA 1TK3A 2UYGA 3CA8A 5BYBA 3W79A 4B2IA 4YPOA 1RRKA 1IHXA 2X2PA 4EDFA 3P2IA 1RYMA 3O7MA 2NVBA 1OZHA 4P2BA 4RZXA 2WDPA 4UCXA 2CXNA 3BZWA 5DHAA 5C3MA 5FP0A 5E38A 2ODWA 3W8NA 3Q9NA 3DP7A 3RUPA 1DXHA 3VU8A 5I7RA 2A35A 4M9XA 1YMVA 3FKQA 3ZJ4A 3T7IA 4ZYXA 1QYVA 1EDOA 2YICA 4I99A 3N1UA 4ZEXA 3RNOA 4CM4A 5I9LA 5JDIA 5CAEA 4W5JA 2NNLD 5EIAA 3QKRA 4LISA 3EIXA 1XDZA 1HI9A 3PHBE 4PLZA 4I4TB 3IEMA 2RH4A 3VR2A 2I9KA 5EMHA 2R25B 4MW4A 3MT0A 1IWOA 4ER0A 5K0JA 2XODA 1ZYUA 4HH0A 3V8QA 3VYWA 1UR5A 3CYFA 5C5IA 4A8PA 4II7A 1NUUA 2WU8A 1PR5A 5H70A 4B8WA 1A4XA 2W8BB 5M2QA 2ZJ4A 1YKGA 3HV0A 4F5ZA 2JLWA 4R8SA 4Y0NA 4F92B 3PF8A 2VHJA 1MAUA 3TIFA 4D4HA 3NANA 3WMEA 2Z56A 1HDZA 1XAJA 4EPWA 4YI5A 1TPZA 3LZ6A 3MBIA 3EX7C 3BSYA 2A1TS 5I7HA 2VT2A 1YT5A 1VIYA 1LY1A 1C1HA 3DSRA 3FVWA 3GIWA 1GTJ1 2GHQA 2P9CA 3KD3A 2NZ8A 2PMDA 3OZBA 4KN5A 2P6RA 2Y1CA 3UJPA 5EHZA 1ZBQA 3FRIA 4YALA 1ISFA 3U5TA 1CEEA 5DM4A 3E23A 2GA9A 3GCWA 2WD9A 2FWIA 2YWRA 1Z7YA 4TL7A 3MBOA 2OZPA 2YZGA 1ZD1A 5A3SA 3WIDA 4A9AA 3UMBA 1SCJA 3X2SA 5CU7A 3QVLA 2VSXA 5EXXA 1Q16A 3OLYA 1BJKA 1DQRA 4QOEA 4QEKA 3HEAA 1G64A 3I05A 3D8TA 2F9LA 1CQJA 2Q7DA 3RU2A 4YCDA 5ENZA 3CVUA 4L6IA 5E7QA 1WXDA 1GVNB 1ZS9A 4MWGA 1P75A 2YJNA 1XGKA 4TYNA 4YN3A 2PRKA 4G0ZA 2RH9B 1U8YA 1SVNA 2EWWA 2ONZA 2W22A 3I9MA 1NTOA 3DFKA 3H0CA 4DEYA 4M9QA 5DNCA 3TZHA 1FNCA 3S70A 1DJOA 3GI1A 4L8GA 2BFCA 2VFAA 4EGAA 3LY5A 4OAPA 3D9QX 3F3YA 2C8KA 1WCV1 1GPAA 4ZCSA 2H92A 3DVRX 5K0FA 3IL2A 5DKFA 1NRXA 1H2XA 4EEZA 5ITVA 1NUPA 4PFKA 1T5SA 3JYOA 1B2LA 3A4VA 1Z4PX 2PKYX 3WV4A 1WCIA 1LVGA 5FBHA 1D3AA 5IBCA 1PTJA 2Q21A 1GILA 2FZCA 2F1OA 1KEEB 2BGTA 2WF5A 1QE0A 4IIJF 5CDHA 4M0PA 3BCSA 1S2DA 2D0PB 1J0BA 4YDHB 3ILHA 1JSLA 3EE6A 3AY3A 3VBCA 4PYQA 4JBGA 1UP4A 4BPRA 3OF3A 2WHPA 1K4YA 3FWNA 3R09A 5MGBA 5EZYB 4P7KA 3CN7A 2YINC 1ZIOA 5BV0A 1E2KA 3GRZA 2QMUA 1MG0A 3HJTA 2X8WA 4M98A 2OZEA 1ETHA 3GBSA 3H5LA 2O07A 2PLAA 3IS3A 4YP1A 1NMZA 1KYVA 3RIEA 3IHTA 2ZWPA 2X0DA 4OM7A 5JD6A 4PLGA 1QRRA 1EESA 3WZ2A 5K3CA 3I9V1 3IVXA 2L42A 3FOAA 4KFCA 4M8NE 5ES4B 4TN1A 1T2CA 3RVQA 2XA9A 3PQFA 4X54A 1QHXA 1JR4A 3PJRA 3DBHA 1VPTA 3MAGA 4YBZA 1W34A 4HWOA 4KREA 4MB0A 3T3NA 2D13A 4B3DA 2ZRIA 4MUJA 4I8DA 1MGPA 2JHPA 2A78A 4MHOA 3ZWWA 2FG6C 4IFIA 5CYPA 3WGVA 2B92A 1O97D 1GL6A 2B4TO 3KQWA 3DL4A 1Y3BE 2YV5A 4RA6A 5TMBA 5A62A 3GVPA 2IUTA 4ZOLF 1H8HA 1PJ2A 3OQOA 2B36A 4I6GA 2X23A 4OFBA 1E9AA 4JJEA 2QMQA 1C8BA 4DZRA 4L85A 2D0OB 4RZQA 4NHEA 4Z9FA 2ZJ1A 2E4UA 3PXCX 1LS6A 1EK0A 3GXBA 5KKNB 1XVVA 1VYVA 2WI8A 2Y1OA 4Q3BA 4FFVA 4I3FA 4DIOA 2X8LA 1E1NA 1C30A 1MB0A 3DYIA 3EXIB 3QBVA 5I3ZA 1Z7EA 1IXKA 4CLHA 2PH3A 4LYYA 2QN6A 4OMUA 5AO9A 4ALKA 2R47A 4D0LB 2YOGA 1XK6A 1RZUA 3L0BA 3PC2A 1GPKA 1W96A 1QRUA 1FDSA 1E3WB 2AOWA 3B82A 3DBIA 3OD5A 1Z36A 1H9CA 4LRUA 4MMXB 5KSYA 2IZOA 3MZ0A 3R44A 1UT5A 3CTMA 3QSYA 3GBPA 2JDIA 1V48A 1EUCA 4KR7A 1NQAO 3U1BA 3IP1A 1KZGB 3QENA 1L4GA 1R0BA 4C0LA 2I4OA 5TIIA 1U8ZA 2AEFA 1D4AA 1RD4A 2NSLA 4JROA 3IPXA 3ZEAA 5MN4A 1FYVA 4NBNA 4RU1A 2DFTA 1AURA 2QLLA 3GLHE 1NN5A 2XJ9A 1SUSA 4R69A 5KNLA 2VTDA 3OE7D 4HRXA 3UMVA 4M1QA 4RQAA 2HPAA 4DRXB 2GM4A 2VJYA 1RJ9B 4B31A 3QFRA 2BR5A 4DA9A 2NZJA 2CVHA 3GLHB 4X1IA 4LC0A 3W6UA 3WGGA 3RGWS 2O05A 3FBTA 2VBIA 1UBNA 3OCCA 4IHQA 4F4HA 3I9JA 1KQGA 1Z2PX 2BRUC 3HY4A 4MR9A 3C6XA 5E95A 1SXJA 2ID4A 2ICAA 2PX8A 1P2VA 2XZDA 4WNYA 5CVEA 4EH1A 2AMVA 2XGJA 4EJ2A 1VL5A 3TXYA 4RPJA 3DNMA 4I4TF 4F93B 5LQMA 4UTXA 3LE8A 1C81A 4P36A 2O0KA 3CXRA 1WXGA 1LCIA 4RXTA 1QDEA 4DLBA 2NV0A 3AR6A 3QMWA 3FOCA 3CE9A 3I6QA 4K81B 3H2YA 5AOVA 3A27A 2DXIA 4QLOA 2C4NA 1ZM3A 3SQMA 4BNFA 3R7FA 4DFDA 3E7XA 1XAHA 2Q50A 2FVYA 1ACMA 4FNMA 3E9EA 4G84A 4XDGA 3IOYA 3TI9A 1C8VB 1UK6A 3BL5A 3SHWA 2IIBA 1V25A 3TDKA 1G5PA 1GPUA 1Z2CA 3B48A 1NURA 1WPQA 5EHXA 1EHCA 4N03A 3TRHA 4ZYWA 3CU5A 4A0SA 4LE1A 1WQ4A 1RDFA 4C5AA 2N47A 1ESDA 5EHIA 5AVWA 5IM4F 3UCXA 2IPNA 2ONCA 3PDJA 3P19A 1A8QA 2VH2A 4IJQA 1EZ4A 1HETA 3T1VA 4KXNA 4ND5A 4QXOA 3VPSA 1UFKA 4QU5A 1N32B 4WXRA 3U1VA 1JHMA 5K3OA 2BM1A 5FT9A 3ZE7A 3ZU5A 5AQEA 5FORA 3A9SA 1M54A 3UK7A 3RK4A 3UOWA 3TIGA 1EK1A 1YJQA 4P32A 4U5QA 5DWVA 3REOA 5ICMA 2JLZA 3I6BA 3HK2A 4B3HA 1GG2A 1LV7A 1W1IA 3KT3A 3ODGA 1IHPA 5ALDA 1FYXA 4TL8A 1HF3A 4FW8A 1OVGA 3R5HA 3DDZX 4XI9A 2M1ZA 5AXCA 1CUZA 3NBMA 1DELA 4RGQA 3CZMA 1ZEJA 4HYYA 4IUCS 3S68A 4BNDA 5IJ0B 3IIJA 2GUGA 4RD4A 1QYWA 2XYGA 4XSGA 1K4MA 3GAZA 2X0IA 3CZ5A 1LEHA 3A70A 3H2GA 3LHSA 3S8MA 1Z17A 4GR5A 1E6KA 4ZGBA 2RBKA 4KN9S 3X44A 4HNHA 4B4DA 1N2CA 1P9OA 1E9RA 3J81A 2FP4B 1WUYA 2OUKA 5KTMA 3C4VA 4YMWA 4BFUA 5G0TA 4ZAWA 1QHIA 4KDEA 1KKUA 3RO7A 3HB9A 2DBQA 1T0BA 3K0FB 5JHHB 1JG3A 4UMDA 3FN4A 2V4UA 4NCBA 5TS3A 2XE8A 4C2AA 5IANA 4B6JA 2W37A 1O89A 1PR2A 1G9SA 2YV4A 4C87A 1G9TA 2OEPA 2ZIFA 1J7JA 3UJHA 1NJ2A 3GUCA 4KLCA 2AF4C 2IYLD 2WYIA 2XVAA 3WAKA 4U0JA 4RJIA 4MV1A 3UPTA 1R37A 2HRBA 1WCWA 4QUAA 2ACVA 3EXHC 4H18A 5K3BA 1EXDA 2WFLA 5TLSA 4OI0A 2XZLA 4XPIB 1GGNA 2PGOA 1Z4MA 2I76A 1ZDMA 3OFKA 4KJXA 4UE6A 5DNDA 4A2WA 4EHNA 1G42A 4HNVA 2BOVA 4WAUA 3JTMA 4MR7B 5C2JB 1G8AA 3EXEA 4ZVNA 1GLVA 1YBVA 2E9SA 2C58A 2ECPA 1LSUA 2PX0A 3STUA 5B55A 3VJKA 4ALJA 2HSEA 1X7ZA 4M36A 2HT1A 5D7BA 1FSPA 1JSCA 1K6JA 4JXJA 5ADWA 4IDHA 3GLGA 1TIKA 2CHVA 2ECOA 1AGXA 5C46F 1I2AA 4P0PB 5K3DA 2EW1A 1QFMA 3RUDA 1MX9A 1XRRA 4MP8A 4CLEA 3NP9A 4NAUA 1DAHA 1TUIA 3O8OB 1GR1A 1EVEA 1U3TA 3BD6A 3PPWA 4M9RA 1OZ0A 3H6HA 4PLYA 5CTAA 3CLTC 1R64A 2Y1WA 3ZWQA 2UUPA 3B6MA 3MCZA 4J8PA 1KI1A 1PGNA 1YJCA 2EQ5A 5IVPA 1O9HA 5KINB 1SHZA 3SVLA 4GW3A 3NRJA 2CHUA 2X1VA 1QIIA 3UNXA 3WKDA 4YROA 3JVEA 1QONA 4ZAVA 3V4PB 1TTHA 3W6PA 3WQRA 5CB8A 2XNKA 1TZ2A 1B0UA 2MJLA 4WZBB 2ZKIA 4D98A 3AUSA 4KYVA 3SQLA 1NU8A 3E9QA 3QLUC 4EYGA 4ALIA 1VMEA 1D4OA 1ZJYA 3ODPA 2YYAA 1N2GA 4KIGA 2YCLA 4O3FA 4D9KA 1ZXXA 2C96A 4G9GA 2HHAA 3V6MA 1IFXA 1ORWA 3R7WB 4AJPA 4HX9A 1SIOA 1K98A 3CX7A 2WKPA 4MUBA 5JMPA 3R9IA 1UUFA 4GVXA 1GZVA 1RAFA 4N01A 2WNSA 4R01A 5JQGA 4LF6B 3KU4A 3NDIA 2BHNA 4LRQA 5G1NA 5JLJA 4FYJA 3IAAA 4Z0NA 1PJLA 4R1QA 1DB3A 3R0ZA 3PEYA 5C18A 1RXUA 4Z9XA 3KJNA 5UKDA 2FSIA 1RJFA 3Q4GA 4MS1A 4HVCA 4JI2B 4I5FA 4YCAA 4MI9A 1Y81A 3V4ZA 4YPFA 3TD2A 3H1BA 3PXBA 2FRXA 4LF4B 2BIFA 2FPUA 4EFMA 2WJAA 4FGUA 2C1EA 3TMYA 1KJIA 2O5CA 4CUKA 2APJA 3HNOA 1R8XA 4C3UA 1E9EA 2GWRA 3PDUA 3AR9A 3HU5A 3K8QA 1AVTA 2J1LA 5BN4A 1K27A 3O4RA 3SGLA 1LC0A 1XMQB 3KO8A 4AMBA 4JX8A 2EW2A 2PS1A 3PIIA 3SBDA 3DE7X 4LC1A 1JYFA 2QUKA 4I55F 1ZJZA 4J76A 1Z4IA 4PY2A 4EWLA 3DAOA 2PY6A 1JPJA 1QX4A 3HYTA 4KYUA 4L4SA 4ARCA 1FYDA 2XCOA 1V2GA 1WHSA 3LVRE 5MFZA 5GM2A 5HKOA 2WUEA 3AHEA 3CUVA 2OGTA 2FEPA 1R8QA 2H1HA 2O5VA 2ZYUX 3OU6A 3Q3VA 1B76A 2FUKA 3OCXA 4IEEA 1U11A 1RVDA 4IIDA 4IFTA 3I2IA 2ZTLA 4LDQA 3SDZA 3AVWA 1CQZA 1KKLA 3ROMA 2GXAA 1M67A 2OECA 2IYQA 5DX8A 3EBLA 1RLMA 1ZN8A 5GY7A 2AFHB 4E2WA 1WXIA 1ZIDA 3QRWA 1RQLA 2ZBRA 1EX7A 3GLSA 1FP1D 2QROA 2EJUA 4XQCA 2HCJB 4P58A 1CY4A 1B1AA 4YB8A 2GXQA 1NI3A 2HJ9A 3B20A 3CBGA 4Q1DA 4UBKA 2B4KA 1U8FO 3N28A 4BO4A 3F8WA 2WKRA 3P9SA 3KS9A 3WK9A 1IJBA 4H0NA 3ZX4A 2A1UA 1WMSA 3KLNA 3WL3A 3D81A 3D7MA 1TIPA 5TR9A 4OHXA 3RIXA 2B83A 3T7CA 2LTAA 5C80A 4W9MC 5HK9A 3VJMA 3B5EA 3GZNB 3EC2A 1AZTA 5FO1A 2ZSUA 3PC7A 2V7XA 3SF8B 4BU1A 5BWNA 1NP6A 1KDPA 5B7NA 3AVVA 5EYPA 3BRCA 1AO0A 3S8EA 4S04A 2C5HA 2EGGA 4UAVA 2VF8A 4P34A 1E7SA 4UVGA 4PWZA 3RVPA 4CKCB 3WWEA 2CF6A 5KNCH 4KQHA 1DAKA 4Q4AB 4C7KA 1E8DA 4BPBA 2GVDC 1XDUA 4LXTA 2BP7A 4PN7A 4TWAA 1W0KA 3DOOA 3IO3A 4LJSA 1Q14A 4FDTA 1P1RA 2CEAA 3W9YA 4LAFA 3E7FA 5DHQA 1C9JA 4QL3A 3HP1A 1X3SA 2YN0A 1U0OC 5F2EA 2AXEA 3ZW8A 3QWAA 4OSOA 5AKEA 3AF3A 1PQPA 2ZDQA 5TVGA 2JD2A 3OMLA 4IKEA 3JW8A 3ZHBA 3FJYA 2SHKA 5DX1A 4DNFA 4K9KA 1PFYA 2YY6A 4UOQA 1REQA 2GDZA 4P0QB 4KVAA 1ZJ4A 3R1IA 4LKOA 3SZOA 2CXRA 3JQRA 4E5YA 2QZSA 5ERGB 1JLKA 2W2XA 3E9YA 3P2EA 4PNZA 1E2FA 2QSZA 5D3MB 1OLOA 1RMQA 2AFRA 4KOEC 2B9VA 2GBLA 3PQEA 2V55B 4IY1A 1FDIA 3KPYA 1ECJA 4OJYA 1Z5NA 1JQ3A 2Z09A 3FZEA 4MJ7A 4CMAA 4EY8A 5LXTA 1PWHA 3WL6A 4G25A 3W34A 5L7WA 4O4HB 3BH0A 4OHMA 4B4WA 5KTSA 2X0KA 1V8DA 2XV1A 4CMIA 4FHEA 3RIYA 3S1LA 1RYHA 2C2HA 3D59A 2ORIA 1EP9A 2EKPA 1POXA 1D2MA 3A1UA 3AF5A 3FCOA 4HVAA 1C7EA 3IO5A 3WLIA 2GZHA 3Q0TA 4MQ5A 1NY5A 4TSRA 4U9UA 4UUPA 3O8LA 3RAEC 4LJ7A 1XNGA 2IYTA 3HI6A 5FFMA 2X0EA 1VE7A 1K4KA 1D0SA 2YV2A 3BRSA 4OI1A 3UV7A 4CTJA 3PYLA 3VA7A 1Y6GA 4ZQHA 4M1SA 5SZHB 1NNLA 2QRHA 4AZ3A 1ZINA 1ZU5A 2PA3A 2FAXA 3DLTA 2LDBA 1KPIA 2Q3HA 1N1GA 4KNWA 2NN3C 1Y9AA 4DQLA 3PUJA 1IH8A 2XNHA 4YJFB 4EVSA 1E2DA 2M32A 1NJFA 2NP7A 3UT6A 2WWYA 3VKHA 3LRPA 5EFZA 1ONPA 5JS1A 3QX3A 5JI3E 1SR8A 1U7DA 2CWDA 5HILA 4ZOQI 3PNKA 2OCKA 4NBKA 1O58A 2R1TA 3EQ6A 4H7HA 3JQDA 1ZUD1 2AD5A 1QAQA 1U7PA 3LPDA 3WGYA 4Y2RA 3NVKI 1P9NA 3R3JA 1V9CA 2V7PA 4B71A 4A7PA 4CDGA 3DTVD 1P4RA 3FY4A 1E8NA 3I2KA 1TVKA 3SOPA 3BSWA 4ZAXA 4AMZA 1L5SA 5IU6A 4DSAA 2WMYA 2Y68A 3H19A 4HXYA 1RPTA 3QXJA 2WIGA 4AN1A 3DOFA 3UWMA 4EUHA 4OLAA 1CB7A 3C3MA 4FR2A 2J45A 1GU7A 3IEPA 3DMGA 3OKCA 3P4XA 1C0IA 2F3TA 4DIFA 5AW6A 1RPZA 1D7OA 2JL1A 2PPLA 3HQ4O 2H1CA 3PR2B 4NENB 3OFND 3THOA 1MH9A 4AP6A 4YJ2A 3BMOA 3DVSX 4QPNA 1QTIA 2DMRA 1G59A 1VCHA 2IU3A 1RZRD 1TLFA 3IODA 3MWYW 1FMTA 3C6BA 3MSCA 4XLTA 4FILA 5JI2E 1Z34A 2G08A 1DC6A 2H3HA 3R4CA 4BFYA 2VG8A 1ABEA 3QPAA 5C8ZA 4X7BA 5FOXA 5CPFA 4YYZA 3KOZA 2BM0A 3DVAB 1BRTA 1Y8AA 2CVPA 2FY8A 3DGFC 3IAUA 3JX9A 3R20A 1QHSA 4JP5A 1KEVA 1ST3A 5TQVA 4JWKA 4U2FA 2ZROA 3S29A 1IOLA 3AUJB 5JMWA 2QSJA 3AR8A 4KGDA 3A6PC 2FFHA 1Q95A 3A06A 5DYNA 3IPCA 5KHLB 4XXHA 4OHZA 2XBLA 5EEHA 3KQPA 1PBNA 3MYYA 3UMRA 5I7EA 1GWNA 1B6RA 2ZIZA 2BUAA 2WVGA 2YWBA 1BXRA 5IAGA 1XQXA 2I87A 3VC7A 3UT5B 3WC4A 5CA1A 4CM4B 1L4LA 3GRPA 1UKCA 2JIDA 1A9YA 5EJ2A 5YASA 3X2FA 1PKEA 1RHKA 3QKRB 5HG0A 2UXBB 4TLDA 1K0FA 1ISIA 1E7QA 4RSGA 2VF4X 5D5HA 3KBOA 1WBBA 3CKKA 1GTL1 3S5JA 2JFFA 2ORWA 2XX3A 3GJZA 2IDZA 1F5NA 4OJQA 4TS3A 4E11A 2OQRA 2RJOA 2Q7XA 3N2GA 3QPDA 2MSEB 2EKQA 1XNHA 5H3HA 1Y9ZA 5ELMA 1HT0A 3C3AA 4A2CA 2Q6TA 1JBEA 1E0JA 4EAQA 1FC0A 4FKBA 5IBQA 3VJLA 5AVQA 3AF2A 1K5PA 3TEFA 2FN4A 1MB9A 4H3VA 2X9VA 4YAKA 3VO1A 5GWXA 5IC4A 3FOWA 4QASA 3AU8A 3DEIA 4UDNA 5AK0A 5BSGA 4XUDA 1EFUA 2KBFA 1IBLB 4Q9JA 3KSMA 4HK4A 2IP2A 1MIOB 4ZD6A 5HX7A 3ABQB 4RVOA 5J2UF 3FHTA 2BWJA 1BMTA 2OB2A 1OFHA 2UYYA 1TZKA 3DZJA 4A3SA 3PB3A 5C31A 1NVEA 3AZOA 1E0SA 4LGVA 1CQJB 3K8ZA 1SCDA 1EHIA 2Q5CA 1KJZA 5JCOA 1BMDA 4OJMX 1ZICA 1S8FA 2L82A 3CUSA 4UASA 1G0NA 1IHUA 3GO4A 5H1YA 2X2FA 1BS1A 3F6PA 4D9NA 3KEOA 1RQRA 1AKVA 4EYQA 1DWUA 1SBHA 2OD9A 2WQZA 4YQYA 4PYKA 2I4MA 2HA3A 5IHPA 2DR2A 1IEQA 3W9BA 4X41A 1NW7A 4GGMX 1I1HA 1FSZA 1DBIA 2V74B 2FXIA 4FYWA 4GM4A 4LX8A 4U6SA 3W3ZB 1AV6A 3HNRA 4KWEA 5DV9A 2AG0A 3I5YA 2LXNA 2ALJA 2RGAA 2X7HA 4BGDA 4NPHA 1UZUA 1IB0A 3RASA 3UBMA 4XLLA 2VDQB 2JEYA 4JITA 4OXRA 3G2MA 2H1WA 3K5IA 1DAPA 3VVBA 4UCFA 1JZQA 4XX0A 1RNLA 4W5TA 1A5TA 5GQSA 1RPJA 3GJ8A 3FLAA 2KMLA 2WHPB 4Q1AA 2IV2X 1P39A 4AS3A 4RY8A 4O4HF 2V1XA 1XCPA 3E8MA 3D7RA 4L4UA 4MTLA 1GG9A 1SUWA 3LO8A 2IQIA 5EQTA 5B2EA 2JCVA 3NHZA 3S2GA 2ZRHA 4J16A 2HTEA 1FW8A 3IJRA 4R0VA 4I66A 2JASA 3CCFA 1OX4A 4YUAA 1A7JA 3QIVA 3AYZB 3FHOA 3DWFA 1O7JA 4B6PA 4YEDA 4ZCRA 3DBHB 4M1WA 5ITZA 3KKKA 1JB9A 1U2GC 3EZ9A 3L46A 1FLNA 3IE1A 4J7CA 1L3CA 2VBGA 4ER5A 2CXQA 3NTUA 1R1DA 2QGNA 4PCVA 1A9QA 3SDSA 1LWNA 4CEIA 3IQGX 4PG7A 3A1DA 1ML4A 4KKXB 4TS1A 1UBFA 1U0SY 2GPNA 3PI7A 4RA6B 4YRDA 5BWMA 2C8JA 1JNYA 1W36B 1VSVA 1II0A 4RTNA 3TSWA 4UXHA 5EE0A 4DJFC 4KL8S 4JP8A 1FXUA 3PE6A 2HO4A 4BKUA 3LUHA 1PO7A 2J3IA 4XWGA 3IOEA 2GEJA 3F6EX 3HVJA 4GEKA 4OJKA 3G2HA 4P80A 1VE3A 4S24A 5E4TA 2GHIA 1ICEA 2FPGA 2F48A 4QXQA 5JMTA 4NQZA 4QJ5A 3PEUA 4XQGA 4F4FA 4N4AA 3EVCA 5JZVA 1KBQA 1L7PA 2JI4A 2ZRAA 1V96A 1C30B 2AI2A 3I5UA 4QUBA 4DAEA 2GAJA 1KJJA 1XLTC 3R3SA 1I80A 1NX9A 3EG9A 1GQQA 4G8CA 2HIHA 3ELWA 3IT2A 3OEWA 4K6KA 3AO0B 4HWPA 3I4LA 5I8PA 4POOA 2QJWA 3ZD8A 3RADC 2DPYA 5IZCC 3U56A 1FZQA 1GDHA 2GASA 2IHTA 5IAKA 1Z2DA 3CFYA 3R5JA 4HNGA 4CV2A 1A5ZA 2GCGA 4V1CA 5HP4A 4FXOA 4D0NA 2P8JA 2I4NA 2XYRA 1EUCB 4PO3X 5JS8A 1SHJA 5JBNA 1USVA 5J1TB 2H2IA 5U9CA 1N0WA 1QVVA 1BWSA 1ORIA 3T52A 4B3FX 4DR6B 1SY7A 2MT9A 2XBUA 2J0VA 2Z2XA 1J9ZA 3UWSA 2LP4Y 2Z1DA 3OVMA 4UEKA 3UK1A 2J5XA 2O0HA 4CMEC 1HBJA 1PQUA 1GQFA 3ETCA 2GM5A 4W5NA 3NT4A 1YCDA 3P97A 4C05A 5I4BA 2V5AA 1GAWA 3G0OA 2CKDA 1NN1A 5JWRA 1J07A 4F9FA 5E0KB 1J2YA 1VI2A 3G6WA 5BQXA 1UPUA 3LUBA 5IKOA 5KU7A 5CYFA 1D2AA 1JVBA 1QDLB 1U28A 3E1GA 4HGPA 3HWSA 1JYEA 5DFAA 4L51A 1N9ZA 3NPAA 1T2UA 4MR9B 1FJ2A 1V4BA 4WOJA 5JALA 3H5NA 2D06A 3I72A 3VHXB 5CXXA 4DCCA 3FA2A 4WCFA 4K9DA 2I91A 1L1QA 5CHEA 4RZ3A 4YFVA 1E1QD 4ND2A 4ZODA 1LI7A 3F49S 5EZ5A 1EFPB 4IWYA 1MVOA 4DV4B 4S1OA 1B8NA 2PX5A 1DL5A 4X7PA 4X95A 2FWNA 2L0XA 2I8CA 2UDPA 3KYCB 1R9GA 3OE5A 3DT9A 1E9BA 1WDWB 2PJDA 4L57A 2EOAA 1JHQA 5BOSA 4RFSA 1MKYA 3OIVA 5K0CA 2OK8A 4PRLA 3GEPA 1Z37A 1OHHA 2PGNA 3BXEA 1N57A 1F6BA 2ZIWB 1GLGA 1G8FA 3AZQA 3BIWA 4JD5A 2C2BA 4L02A 1RP7A 4PFSA 2JFQA 2XBMA 4AKIA 5CDYA 4HDCA 3ZHOA 2QLBA 4FHGA 4RVCA 5T41A 1UINA 1SXPA 2E3JA 1MN6A 1NMYA 2EXXA 4IGEA 4FFBA 2OAP1 2NO6A 2Z58A 1NDUA 3G68A 4JQZA 4RPCA 5LLSA 3WLMA 1A9PA 4R5MA 2H5IA 4LA4A 1Z73A 3ZV6A 4CT5A 1LPSA 5JOQA 3IBCA 2ONYA 1W25A 1KR5A 4ESOA 2HK6A 1G5IA 1V26A 4JMPA 4JUBA 4WZAE 1N77A 2PUAA 3WYFA 3NALA 2RKWA 1P3JA 2AVNA 5K8CA 1A9OA 3G5UA 4L5BA 4LOIA 5CHYA 4QBFA 1XZIA 5F7JA 1NKTA 2WSLA 2JZOA 4BNKA 3QW4B 1JWBB 2L69A 5KYKA 1P62B 2XMZA 1FXWA 4EHLA 3CRNA 1M66A 5G1OA 3E1SA 3P0IA 5EJ4A 1N3YA 1ZMRA 3BA6A 2E4AA 2QP9X 1AUOA 1U1CA 3EXFA 3KRTA 3U4CA 1I0LA 4A73A 4HF7A 1VXOA 1I6KA 3KYIB 1OV4A 4MGEA 1AXEA 4OSPA 3B5JA 1MORA 3KQSA 3CEHA 5BQOA 3K1AA 1L6IA 1KQNA 4KQKA 1L4KA 2HCBA 4P3KA 2HJSA 3W3AD 3ZJUA 2OHJA 1SG6A 2B1GA 2QAGC 2CHQA 2VATA 5E1MA 3ZWMA 4A92A 2XHEA 2WIDA 2AB0A 4G1BA 2GD6A 3EC1A 3HRKA 3EB9A 1XKXA 3A4NA 4GRIA 2BJHA 3AF0A 3I23A 1DT3A 4EDHA 1JMVA 1TGVA 2KLBA 2VHQA 2LRHA 4MK4A 1L5KA 4EHHA 2XCTB 4JXXA 2GPAA 4F6CA 5FHRA 2AI3A 3T3OA 1X7XA 1WW2A 2ADMA 2PBLA 1QFZA 4UDOA 1F4LA 4DE5A 2JFBA 1CERA 1ZN7A 4R98A 1YU9A 5HRCA 4FPXA 4GF5A 3IURA 4RX1A 3DPUA 3ER6A 1RC8A 4FP9A 4YC7A 2ATVA 1HRDA 3BMXA 5DT9A 3S2SA 3BK1A 4ECAA 2WFLB 2BD0A 4JOSA 5CEEA 1IRIA 3KPJA 3PSAA 2OXIA 2JGLA 1HLGA 2ZS8A 4Y2TA 1Q20A 2DHEA 1PT5A 2WYOA 4Q7QA 4F97A 1OKKD 1WWKA 3EXEB 1PE0A 1P0FA 3N8DA 3JQAD 1LRJA 4KXUA 4WOKA 2ZR7A 2P2LA 4OKNA 1NT4A 2CVFA 5JNTA 2I4LA 4IQ0A 5E2AA 5NLLA 5B7QA 3GLGB 1YOBA 1AKEA 5DEOA 1BDHA 4GKBA 1ZD4A 5SV2A 4U3JA 2ZT7A 3KVRA 4BMZA 3H9QA 4K9QA 1F60A 1IQ0A 5B3AA 1XZCA 2FMHA 3ENWA 1M73E 1Y4ZA 1N3LA 4C07A 1DADA 4X66B 4Y18A 3LBIA 4QT4A 5L8VA 2NTJA 5ETJA 2GZ3A 521PA 1Z62A 3P9YA 4P31A 2G4VA 2F43B 3RFXA 3TNDA 4HXFB 3TSAA 3RRYA 3VHRA 3TG8A 4X71A 3EFEA 1ZNZA 1OF1A 2J3JA 3BBLA 2GMWA 2XF2A 2CMHA 3KUUA 1N9GA 3ZXSA 421PA 1PF7E 3HBMA 3KD2A 5AKGA 3R7AA 4Z3OA 1DGQA 1BYIA 5AW2A 3O94A 5KKAA 4LDAA 2J87A 5IS2A 3EVGA 3SYMA 1VCMA 3C1AA 1IN1A 2ZSKA 5A4AA 3GF4A 4EYEA 5L51A 2WTBA 2J09A 3U4AA 4NBRA 1KWKA 1DBPA 4O4LF 5EA2A 4J03A 4YRAA 1AZWA 3HADA 4CIDA 2XE7A 2WJ3A 4MIKA 4JJZA 3LBHA 4HDRA 3SBXA 1XR3A 4YAIA 2Y9MB 2IBMA 5GVSA 1I4TD 5JQGB 1UXOA 4NEGA 1NBMA 5FAXA 3FUXA 4WK2B 1XYYA 1QQ6A 1U3WA 4YAUA 3QTLA 3SEAA 3U0BA 5PGMA 4Q7JB 3E3MA 4NICA 4UTRA 1LDBA 3UG7A 3MSXA 4UD2A 1JQBA 4YUXA 4MS1B 4ESHA 1DWOA 1FSGA 1FP2A 3PENA 4JBIA 1QPGA 1XTZA 5IH3A 2QTMA 3KOOA 2Q9AA 2O50A 1FFYA 1WKCA 1OIVA 4HLQB 2RE8A 1G3QA 2RKOA 4HX2A 3SFTA 2ZRJA 1LQTA 4WLVA 2BYTA 4AICA 1DT5A 4DIUA 4HUTA 4C1NA 5BUQA 5BN4B 1RAGA 3VZRA 1MDFA 1R4MA 3ZK9A 3QELA 2PMBA 1FDRA 5TGDA 3ZDXB 3QPUA 2Y93A 2EIHA 2CLEB 3U3DA 4F60A 4GNKA 1Z25A 3L0IB 3DZBA 1MXHA 1WXWA 3GUYA 2IZZA 4X44A 2RI0A 4EK9A 1OWOA 1CQWA 3H17A 3ONWA 3IELA 4J94A 4FR0A 5LQSA 3ENNA 1OTXA 3RJMA 5JQWA 2ZT6A 3QPCA 2OCPA 3AC0A 2DPMA 3IUJA 1LBSA 1IC6A 1T5TA 3FTNA 3MWEA 4FDMA 4LXUA 1CNFA 3MW8A 4NBTA 1ULZA 4IINA 1Z12A 1YJ5A 1SCIA 2WZDA 1TJ5A 3QA9A 1PT7A 2GHRA 4PM4A 4YCBA 5LQUA 3M9WA 1JDBB 1ULTA 2IF2A 2WAAA 2HXSA 3JQ6A 3QUSA 5L4NA 2D00A 3UAXA 4TTPA 2NXCA 2ZM6B 2FWJA 1WDKA 3LYHA 3QKWA 1N8SA 3QVOA 4MRAA 1FNDA 4B3MB 5F3WB 1AQJA 2O4UX 3SWWA 3RSSA 2QG9A 3R5XA 1TB4A 2QRZA 2ES4A 2OD2A 3OSUA 3W6OA 1Y3IA 3W4JA 2UYCA 1BO6A 4A0HA 1OMOA 2A1UB 2X77A 3CLRC 3RSGA 3WWCA 3DOCA 3U6KA 1CZRA 4AUNA 2HIMA 1RABA 2RAUA 1K97A 4ZCIA 2PXAA 4TTVA 1W0JA 4LZNA 4XCQA 5EJGA 4AIIA 3OPXA 4TS9A 2TMDA 3V4OA 1GQYA 1VJCA 5JAMA 5EYPB 3CWQA 5EERA 3V2IA 2ZJBA 2C9DA 1JIKA 1X80A 1BMFD 1P4AA 1Z06A 1JJAA 2OT3B 3KJFA 1OVMA 4HUJA 4RVNA 5LZ2A 4L1KA 4PNPA 1W581 1AUPA 1ESCA 2I8AA 1M2FA 2BP7B 2I6TA 4U2DA 5JE8A 1ISMA 1JQEA 4IMIB 3RHFA 5DN6A 4D9HA 2C2ZA 3R9XA 4FONA 5JXHA 3TLMA 1X42A 4YAOA 2H9IA 2I62A 4OGLA 5IJ9A 3O9MA 2EV9A 3R23A 5CUQA 1H0SA 3EUAA 3ZXYA 4DLYA 4NJMA 3DQZA 5K8VA 3E3LA 5EP2A 1OQAA 3U3KA 2HMWA 5CW2A 1A0OA 4PXSA 1ENYA 1M5UA 2X40A 3FSJX 3KQOA 1R2QA 3K15A 1Z4LA 4WN9A 5J5AA 5BSUA 3TNJA 2WJYA 3G5TA 4QJIA 2Q8NA 4Z4FA 5JCXA 3SF0A 1IN4A 1VPEA 2BLLA 3LL7A 5ALVA 2BSQA 3JPWA 1J00A 1V11A 1U5BB 2ZU6A 2DX7A 1XDGA 3EAGA 4GM1A 4OK3A 4EGFA 3OE1A 5HJEA 5JBQA 4F3CA 1HNNA 1YR6A 1LJLA 2NSHA 2NVWA 1WVMA 4LNAA 3A28A 3G8CA 3L6CA 1KTIA 3LA8A 3MAJA 5CIQA 5IUJC 1IUNA 3WQSB 1I94B 1R5JA 2R8RA 5FV7A 4FMPA 1KVSA 3LDAA 3MLAA 4M1MA 3PGLA 2VHUA 4IPTA 3UUGA 2D5IA 4LRWA 3WMFA 3BFXA 1RQNA 3PIDA 4D4JA 4CMIB 1NW8A 2C3PA 2DQ4A 4A8JC 5LZ9A 3B3QA 4C2BA 2HM7A 1TIBA 1G1MA 4IGIA 1MTZA 3GEIA 4D8TA 3QF4A 2IS6A 3WBFA 4P38A 3GA7A 4MVJF 1DDGA 3B3GA 3TL3A 2XT0A 4ROTA 2A9FA 4BE4A 1W5TA 4J9VA 4CM3A 2IOYA 2E5WA 1XX6A 3BMNA 3VQTA 4QKQA 2W4MA 4O6VA 3E2PA 2GN4A 2W11A 3W2TA 1F7VA 4MVJP 1AJEA 4M0EA 4HDNA 3BXFA 4BATA 4P4LA 1KO1A 1M2VA 2C0PA 3F5QA 3SXJA 4AZ3B 4FYXA 1QRDA 3GN1A 2LCIA 2D6FA 4D4IA 3OZIA 3W7VA 3VYVA 1TC1A 1QZUA 2QXUA 3HSSA 3OEEA 5JRDS 1DCMA 4W5WA 2I7TA 2YOFA 4PC3A 4FIZA 1VFNA 4B0PA 3T38A 1NJ6A 5CG2A 1KZ9A 2VXBA 3ZH2A 3SHTA 3H0KA 3M6UA 5CLIA 1K5DA 2WUWE 3SZMA 4IJUA 4C0AC 3UJAA 3VFDA 2HUPA 3N86A 2OYCA 2QL5A 1UCFA 4QG3A 4HPWA 4BN4A 1OLXA 3P20A 1VPLA 4I9NA 2VNSA 5EWJB 2R6ZA 1IVYA 3PCRB 1K86A 2QTNA 3TFQA 6CHYA 1SD1A 2EIXA 1QNFA 2GCOB 2H2WA 3ISTA 4GU5A 5HOQA 4ETWA 1XTRA 1GDTA 1CP2A 3CM0A 2DHCA 3NWOA 3Q7TA 3U3OA 3UJDA 1WU7A 2VTKA 1T3SA 5JQGF 2H7CA 1CTQA 3BMOB 3RVBA 1SN7A 3FDXA 4CKBA 2HYIC 1EUZA 2HRCA 2VYCA 4P33A 4RHXA 1NPDA 4GUAA 1CXZA 4MV7A 1FFAA 4LV5B 5DT2A 4I50B 3WKBA 2H00A 1NVAA 3VTAA 1JR3A 3ZUPA 2ZEJA 3C7DB 5IABA 2AFIE 1GPJA 5LQKA 1Y4SA 5GVRA 4FHCA 3G59A 4KO3S 1DSSG 1K6IA 1Q0LA 5I4KA 3QVGB 2WHYA 3U7IA 1LJ8A 3M9LA 3TR6A 2VIIA 5HVNA 4A10A 1CQIA 1ZA1A 4A2PA 3PK0A 3GHYA 1D9XA 3KFLA 2MR6A 1HNXB 5BYJA 5D5QA 3B2NA 4JJAA 3VYUB 1HT3A 1UDBA 1N2XA 4GPIB 1BE8A 1BXRB 4GP6A 1OAOA 4I4IA 4M0UA 1QUEA 4DRZA 2NT3A 1U2DA 4F5DA 4YRRA 4RACA 4BHTA 1YRBA 3LAWA 2NUAB 4BCDA 2ZLBA 1OFIA 4LVNA 3AMVA 4KQMA 3WYEA 3REQA 3X2EA 2P6PA 1Q5PA 3DAGA 3TR5A 3PS9A 4RNDB 1QCDA 1U9YA 3B9QA 3GPDG 1E1LA 3N9IA 5EKXA 3LDHA 4RDIA 5HBRA 4KSCA 3ZW9A 1V8FA 3IP7A 4ZZIA 5IYZB 1QG2A 3N2GB 1RRFA 3CNEA 2QTLA 1HEUA 1BXKA 1DRJA 2ZE7A 3OX4A 2IPMA 2VHXA 1Y1RA 3FMOB 4K6FA 2CF5A 3WE7A 5CXQA 4D26A 1ZH6A 1ACJA 1FUYB 3OPVA 4FQ7A 4QU9A 5EC8A 1LLFA 1CBUA 3OBIA 1QYCA 1J39A 3SLKA 2FR0A 3ZE6A 5HJ7A 1I1QB 3N6VA 2OORA 3LYAA 5HK8A 1X1TA 1CRWG 4OXIA 1Z18A 2V9ZA 5FI1B 4RTJA 1KJWA 2Z4RA 4PE5B 3SD7A 3GJYA 1XMPA 4N18A 1CDEA 2FQQA 2PLNA 3IQEA 3QYFA 2A9OA 3JU3A 4M7RA 1EGMB 3IBGA 5ANRB 4DG9A 5FAKA 4IVPA 1HL3A 2C59A 2ECKA 2QUJA 1PT6A 3BGIA 3E9NA 4E13A 4GPAA 1QFSA 2AA3A 2ORYA 1E1CA 3R4VA 3HJHA 5B3JA 1CB0A 5AFSA 5BN5A 5BVGA 3BB3A 1PP4A 4UMEA 5KSPA 1R6UA 2IYPA 5JDCA 4X62B 1OXMA 3IB6A 3G9QA 1LUAA 3Q7PA 3FIUA 1ZN9A 1EEHA 1QO9A 4CQMD 1HC7A 1EEXB 2BBTA 2QRVA 1NR1A 3KLOA 4HL6A 3KTOA 5K6TA 3CY6A 1BROA 4NG4A 1ECBA 2HPZA 2WHRA 3KKLA 3W2HA 4CNQA 4J2TA 4O63O 1O94C 3CG4A 3ICQB 1IQPA 5FOSA 4QOGA 2DJIA 2PUJA 1PSZA 3HR4A 3OPMA 4P3XA 4O0LA 2JIBA 3U2QA 5C8XA 4X60A 4HWTA 1XKQA 1Y5IA 4LOKA 5EP4A 4YAWA 2HU8A 3MGKA 4KQWA 2P9BA 5HFAA 5TB5A 3FTCA 5AIBA 3WL8A 1Y5RA 4B6QA 3A1CA 5CFPA 2R96A 3RIGA 2O8EB 1C5KA 2ZP1A 1HURA 3ESAA 4ARVA 3NUZA 1T2DA 4ZREA 5K4HA 4FDAA 2PZFA 3DZCA 4BKOA 2V8OA 2ZE6A 5KYWB 3GZJA 4BMSA 2XWQA 4UBIA 3STVA 1A5BB 1JLLB 3W8FA 3H9JA 5TEVA 5KSOA 5LL6P 4DV2B 4ARSA 2VUTA 2IYFA 3D6FA 3NVDA 3BM5A 5LXTF 2YNMD 3S81A 2E21A 3OKPA 4KXFB 3ZV7A 3CHYA 1SFRA 3CLKA 2QN7A 1N6LA 1PJRA 3HKDB 1OYOA 4YJKA 1KH1A 3NOXA 3ZLBA 2RHRA 3OKAA 4B2LA 1Y7LA 4ND8A 3CF4A 3M70A 4EHJA 1XMOB 3S1AB 2FDXA 1CETA 5EZ6B 3AFHA 4WE3A 3RQSA 3CR7A 4DCNA 3ZNPA 3EEYA 1PCXA 4U9HS 3ZYZA 2PBFA 4Z4QA 1I7SB 2FSSA 3K9BA 4O33A 5ITZB 1D5CA 2Q41A 3SXPA 3BWYA 3HO6A 5FOVA 3K9LA 1NSTA 1XMJA 4CEIB 1X7YA 3S5UA 4JN6B 1FB5A 1PIWA 4QG7A 4OO3A 5GAJA 1XEXB 3MAAC 5TQ2A 2Q7OE 4K8OA 3KDAA 3BWMA 4PZUA 1CUSA 1E8MA 2EJWA 4QNRA 4TWIA 2VRBA 1NQTA 4CFZA 2OZLA 4U7JA 4YMLA 4QELA 3FD8A 3K4QA 4CV1A 5FBLB 4DLKA 1C2YA 4RO0A 1GRQA 3MINA 2H0RA 2C2YA 5HIKA 2HJHA 2GCIA 3FYDA 1GCUA 2XADA 1T2NA 2FCAA 2FPGB 2XUOA 4H4DA 3BYZA 3E48A 1KP3A 3ZGZA 1UANA 4BGVA 2P9TA 3AR5A 3GY0A 4NF2A 3O4IA 1CUCA 4WV3A 2VRCD 3PC6A 1TCAA 1PN3A 3EG9B 4PHCA 5F76A 2KE5A 1U5CA 1EGHA 2POQX 3DE1X 3QBEA 1XO1A 4OBBA 3RS5A 1EWRA 1K88A 2GN2A 4XTRA 3WRVA 5DM70 1MOSA 1J8MF 1RZ3A 2RB5A 4V1CI 2QV0A 5DSTA 1X39A 4JZKA 1YFLA 1VG1A 2R00C 4MI1A 1SZDA 3OEYA 4X84A 1E4EA 4XFJA 2A0XA 4YJ2F 2B3DA 4EW3A 4DV7B 4W6QA 3PGKA 2CC2A 1BDIA 4REOA 1PK9A 2BMAA 4O5OA 1A97A 4XW2A 1PK8A 3VR4H 1JKMA 1W47A 4FS8A 4NCNA 5HYVA 4R1TA 1CYEA 1OFUA 3I0MA 1E3TA 1FSFA 2L19A 4JX9A 5DTJA 1DC3A 4GQIA 5E9WA 4B7AA 5LU9A 4NU8X 4ZI5A 1JTEA 1R9JA 1HV8A 2NAPA 1HDEA 5GZ1A 3OZEA 4O5AA 5H81A 4RABA 2CKMA 4FCWA 2WIBA 3MGCA 4JBWA 3KTFA 3N2KB 5LMNB 2W6JA 1KVUA 1DX4A 3GDFA 4KIWA 3KAPA 4KYTA 5TMDA 1TT5A 4CM7A 5HMMA 1CRLA 1D03A 3TGWA 3V8PA 2B1JA 2XMQA 3D5EA 4WUVA 3L8CA 3NTRA 3PQ5A 4E5VA 1G2PA 4PHHA 4EHKA 1Y4AE 4DMHA 3IILA 5CA1F 1SUEA 3NAZA 1GZ5A 3TQRA 4PZCA 4GMDA 4US2R 1T2EA 2IK8A 2YC4C 5BQPA 4KAJA 3GPIA 3N74A 2B9EA 2JFYA 5FLKA 1LPNA 4ID9A 1VZ3A 3SE0A 2I6QA 4WLEA 2VDRB 1CP3A 4JEUA 4PLPA 4Y7CA 2JGJA 3EGOA 3MWDA 4MS4B 1F0PA 3QKIA 3SSNA 3MERA 1PV4A 2RHOA 2Q5QA 4F2GA 1JKIA 1OXXK 3C74A 1AG9A 4RQUA 3WJ7A 4RFSB 2EDAA 4EKNB 1UZAA 4R7TA 4GLOA 1ZEMA 2IYAA 5FTLA 1JMKC 2PR7A 4N3NA 1FLAA 1HH4A 5T4BA 3GARA 4KLNA 1WD5A 2PWYA 4GRAA 4E21A 4BJ5A 2UZIR 3DFUA 3T5AA 1TCCA 4HRVA 4LYHA 1YRHA 4LN1A 4ND1A 1DV2A 1P1JA 1DFHA 4FB5A 3E3AA 4FFBB 2AR7A 4FB4A 1JX6A 1W93A 2Q6LA 1D07A 2RFLA 1NW6A 2PANA 3KZCA 5SY9A 3REGA 3VZBA 6NULA 1O57A 2C0QA 4NH0A 1GSIA 5JU6A 1C9EA 4MGYR 1V5EA 1ESMA 2VNAA 2ZTMA 3H11A 1XZHA 4ZVVA 1CWUA 1OZFA 2CV0A 2C4HA 3CR8A 4PSVA 2PT5A 4RPIA 2XCQA 4I4CA 3DHNA 3OE4A 3GLFA 4HEQA 2R1UA 5TS2A 5C81A 3DF9A 4NBSA 2IWHA 2P7HA 5FPHA 4HEHA 1JBQA 4UQPA 3OT5A 2NGRA 4BXOB 1V16A 1YBAA 2MOKA 2NU9A 4RS4A 4LF5B 5H9WA 4HTFA 3GFBA 3HVIA 4F4CA 3COJA 4BNYA 4MULA 5FL7D 1XSEA 3ANYB 4LQDA 3KUCA 2ZUDA 5K3FA 1QQBA 2SECE 2OFXA 1ABFA 3UA3A 3UMYA 2ENWA 2I66A 3HCBA 4CM5A 2NIPA 2XMGA 5IJAA 4FEAA 4GLFA 4KQJA 1ORHA 3K1AB 2ZIUB 2FDRA 4O02B 1Z0AA 3GL9A 1VTKA 4UZEA 5K99A 4NXNB 1YBFA 2EL7A 3QEOA 1KNQA 1T5BA 4XVRA 1W4CA 5IAJA 3SI7A 1UXHA 5BMVA 2QRQA 1K8RA 3CVYA 1I9GA 2OHFA 2V7BA 4II2A 3UXHA 2FK7A 5I01A 5KU1A 1WSAA 1A9ZA 1TJPB 1U3UA 1KQ3A 3LF2A 2OXTA 4QM7A 1NSFA 1XTPA 2PRSA 4XWAA 4CW7A 5A4FS 5HA5A 4NCHA 3B6JA 4JYCA 3BGOS 4YMHA 2FP3A 4N6OA 4YACA 1RBMA 3U9TA 4TMVA 3WIVA 4LV6A 5K51A 2WM8A 2XITA 2HUNA 1VMAA 2NWQA 6YASA 1BE1A 1I24A 4OB6A 2O8CB 3OQMA 4AY5A 1JECA 2OGUA 1PVVA 4HGRA 3L0SA 1DFGA 2QTHA 2YHBA 2QAIA 5BOVA 4BMOB 1YOVA 1DKOA 2Z9CA 3CLRD 1C9YA 3INTA 4MB2A 3PKJA 4BVJA 2I2FA 4LOLA 1W36D 3CVJA 5D84A 3IEVA 4HQNA 1PDVA 5KDDA 3HKEA 1J25A 3AEUA 3Q3EA 4QOFA 2AE1A 2H16A 2V9CA 4V0RA 3JYNA 2OA0A 3SDBA 3I9NA 2J5RA 4HBZA 4Q3AA 4V0KA 1YQQA 2AZMA 3K09A 3Q41A 4HYEA 1XF9A 4M86A 4U3JB 3RK1A 3RHSA 5KIAA 3B5IA 3LXXA 1H1TA 4ERXA 3PDIA 1P4HA 4GYJA 2J67A 2HQSA 2R6FA 2XQIA 3OF2A 3CUUA 2AOVA 3FPJA 2C54A 1G4HA 4FYYA 2C5LA 4YAEA 2AUTA 3FOEC 1DCKA 4EGSA 1WR8A 2DT5A 3O31A 4G23A 3LUDA 4IYJA 4D56A 2JKYA 2C3UA 1CC1S 4DBVO 3TTVA 2PU7A 5IF9A 4WNIA 2FEXA 4P7FA 4NE2A 2AE2A 2Z5VA 3HCFA 3R3YA 4N7JA 5DGIA 4MHTA 4OSEA 1JJ7A 2VHTA 1MR3F 2JJYA 1OD6A 1E63A 2VI5A 3JV7A 3EVAA 3I6MA 3NS7A 4DF3A 3C5VA 4QT0A 4GX5A 1W52X 2QIPA 4WDQA 1UC8A 4ZOCA 2Z98A 3OJCA 4KBGA 3FCUB 1PU2A 1HOXA 2PD3A 3KOWA 4NFHA 5AM1A 5DI9A 1JI0A 1XELA 3EA0A 4EGJA 4HNUA 2J85A 1MDBA 1R50A 1XRNA 3KOUA 1PT8A 1QYIA 4HDRB 4QHYA 1O6GA 3MD9A 4RZUA 4YJ3A 3WBKA 5LYJF 1MW9X 3M3DA 1F20A 3MK31 1HQYE 4GM0A 5F2KA 3O4GA 3D1VA 2HLNA 3H8SA 1YKSA 3LFUA 1I7LA 2JZNA 2O0MA 4V39A 1EJ0A 1DBRA 1VJRA 3GMTA 3MN1A 5BXQC 2XCRB 1UBJS 2A9PA 3O5AA 2XYPA 1FPMA 4JJKA 4R8VA 1XTIA 4QEZA 1YS6A 1LQ2A 2BH9A 2BEJA 5K4AA 4QYXA 2GKSA 4P7JA 1AXRA 4BQFA 2BUBA 1SKBA 3U6BA 2XRYA 5JPIA 1R4MB 3RVDA 1E79A 3O8DA 3L7OA 3RYTC 3GJQA 3QNMA 1ZVVA 1K7XB 4MJXA 1NQOA 4R3WA 2R97A 3H75A 1WKVA 2QXYA 4KFSA 1QZZA 3EEIA 3IIIA 4LX0A 5HWSA 4FSDA 4OBXA 1LLDA 3AONB 2IYNA 3OO0A 4H0FA 1TO2E 2CK3D 4NNPA 3GRKA 4FYHA 5ECDA 3HSYA 1Z8FA 1KYXA 1T3GA 1M10A 5MFPA 4NESA 4PCUA 4X9XA 3O8RA 1U8UA 2WV7A 5AW8A 3U4MA 1MNQA 2CE7A 3NRCA 1XN1A 4JHLA 1YJ8A 4AY4A 3CNHA 4HFNA 2Q1XA 5EJAA 3LDGA 3WLNA 4C89A 3JYLA 3GP8A 2I6UA 3PVCA 1KO4A 1I1OA 3RF6A 3HBFA 2HEGA 4NU5A 4UARA 4UJ3A 5F3RA 1NDHA 3ESCA 5EIWA 1R6AA 4YMUA 5GV8A 2UZAA 3TLEA 3GLVA 2O2CA 3A1VA 2PMWB 4B0OA 3VR3D 1SU7A 1Y98A 2VNKA 1W4BA 2FR8A 5HS6A 4URFA 5IWAB 1OGIA 3THYA 3E82A 5ALOA 3C6YA 1T0UA 1T29A 2QQGA 3MMZA 3ZCSA 3QXSA 1QP4A 1DEXA 3X1WA 3E03A 2FX3A 1D6MA 2JATA 1EYZA 1CHNA 4WKPA 2WJ4A 4G9BA 2X4IA 5LB2A 1ZC4A 1HYBA 3ACBA 5JJKA 4KVZA 1RLIA 1RM4A 3BXOA 3UB3A 3HKBA 4UUNA 2VXCA 3UFXB 4UNPA 2IZ5A 1X80B 1EIZA 1P1BA 1GZ7A 3L1IA 4XVUA 1ZSYA 4XJVA 2NO4A 3CO0S 5TVKA 2PT6A 2ASVA 4PQFA 1VCIA 2IIPA 4ZALA 4CEJA 1HQCA 2X6TA 3WIOA 2YHSA 3O93A 1DKMA 2I80A 2JGDA 3BMCA 3QFFA 4FEEA 4QQNA 1CJKC 2A88A 2JC3A 2HJGA 1G6KA 2R6JA 3NBYC 3R9XB 2JHCA 3VBEA 3OOJA 2I3BA 2G80A 1I7QB 4GC9A 4NZZA 1PJTA 1NRIA 4UFOA 4P4GA 5I7FA 1QH1B 5AW9A 2DLNA 4D9IA 3WK8A 3C8UA 3VNRA 5KWSA 2GNPA 1ZW6A 5IDQA 1C3OB 1GCOA 2LKDA 1E3LA 3QG1A 1XZNA 3L8MA 4UKDA 4FT2A 2H18A 2HN9A 4OHWA 3HCNA 1KEPA 3MMPA 1P2FA 1UBTS 3RVJA 2QX9A 5HW0A 2IVZA 1LDYA 3OLWA 1V11B 2UZ0A 4UHDA 5FBZA 2XCSB 4MS3A 2R87A 1ONBA 1AKQA 2IYEA 1DG1G 3JQCA 2V96A 1OIWA 2QDXA 2QE6A 2RGRA 1KTVA 3G89A 2OESA 2J0QA 4WXYB 3MGGA 1F2VA 3HYNA 4XRRA 4PYNA 1AQNA 3W8RA 1XNQB 3TE7A 3D4LA 2ENUA 2VF5X 4YCCA 3DLBA 2E0IA 4OV6B 1G38A 3AQ4A 3RBAA 3FWHA 4W9RA 2YQ5A 3DP9A 1YZKA 4HDSA 4RJKA 3WL4A 2VAVA 1AQIA 4F9GA 4CKEB 1L5YA 3L7CA 1VHQA 2UZ1B 4IRXA 1T0IA 5AW5A 4OQLA 1IOVA 1P9LA 5J3JA 3QF4B 5B1EA 1JLRA 1LPAB 4ZJYA 1P6QA 3HJFA 5DWDA 1BX0A 2ZJ7A 1TCVA 3OZVA 3QXHA 4BFZA 1J2TA 4GL2A 3NHBA 2VOEA 4RTRA 4H7EA 4UHHA 5FLYA 4RQBA 5L4SA 2D2FA 1M2VB 3ADPA 1R8SA 5CJJA 5ABPA 2WZQA 1UC9A 3FWPA 1C9KA 3PV0A 3C87A 4FX2A 4ZVOA 3BEDA 1EFAA 3K0CA 4EKYA 1NI4B 1MXFA 3GEHA 3UAWA 5JLAA 1YAJA 3PQ7A 5IVHA 1ZK0A 4WK6A 2G9NA 4LV8B 3O9ZA 1S2GA 4Q7EA 5FQOA 3NKVA 4QJ3A 1YZLA 4KVFA 5DXJA 2YWCA 5JSYA 1UM9A 4ES6A 1L3IA 2PBRA 4KQEA 1O94D 4LCBA 1U2TA 5F1KA 4D3SA 1P0MA 5JSQA 3UV6A 4A5OA 1RAEA 2HMUA 2OAQ1 4FE3A 3T61A 4KRFA 3KB6A 3THWB 3AF1A 4R71A 2A9JA 2QTVB 3GW8A 5A6VA 1NVVQ 2RI6A 4Y2QA 5G0UA 2BZ1A 2ZIGA 4MITA 1C7JA 2BE9A 1AXGA 2HDWA 5MN5A 3ED1A 3HYSA 821PA 1VP3A 1QVRA 3UAGA 4LC9A 2WWVD 3P2JA 3E58A 5KNBD 4BUZA 1GFWA 4MPTA 5IG2A 3O4JA 1YA4A 1KNXA 2PS0A 3QPWA 2OMEA 3LUAA 3N53A 4DTIA 1LDEA 2RCYA 2O3TA 3OQVA 4CKBB 4NFYA 5BN1A 2DVMA 3R76A 3ZOKA 2G63A 5JBIA 3RKUA 1ND5A 1TO6A 4ACAA 3L49A 4G37A 5FFFA 1JHOA 4YECA 2O8NA 1F48A 3CSDA 3EQZA 3PP8A 4JVOA 5DDIP 5KNCD 1FPQA 3AERA 3SN6A 4EUSA 3PFHA 4TQ9A 1B3RA 2OO3A 3LCVB 2WF9A 3TTYA 5EJ9A 2DCMA 1TZCA 2OBNA 2GHTA 1DHRA 1P5HA 1V9LA 3C4JA 1T34A 1QTNA 2BDTA 1WMBA 4L5IA 5ESRA 1DLJA 3NORA 1XZBA 4BLSA 4J1TA 3G0CA 2CE2X 1CQIB 4WZ6A 4YT4A 3C3BA 3GFRA 4Q34A 1I3MA 1UOQA 3H2JA 3H3XA 4MUEA 4UUAA 4B74A 4DN6A 2C7OA 2OLEA 1VE6A 1OA1A 1ZJWA 5EP3A 2YW2A 1L5NA 3DMTA 1YDFA 2VKQA 4RGBA 3BUSA 3OZUA 3PUIA 3ZE2B 5BQ3A 2YH2A 4YY3B 2YV1A 3CRZA 1QGDA 4UFNA 3RFVA 3WKCA 3DDWA 4L9AA 3U7EB 1TVMA 1HTBA 1MABA 2FWAA 2DQSA 2NLOA 1HFJA 1Q3KA 4NCKA 5KQPA 4KDFA 4BFWA 1QP7A 2PXCA 5EMNA 1LK5A 3REQB 4CWAA 3OFNA 3KWFA 4B9AA 4BLVA 1ZISA 1UDXA 1FMCA 1TUBA 4B8YA 4X94A 5BNTA 2OV4A 1FDOA 4MP3A 5D3QA 5HDBB 1RZRA 4GSYA 1RC1A 3DOEA 1N2BA 2UVPA 3U17A 2BZSA 3ZY3A 3WHIA 3WLRA 5HKKD 3Q6NA 3CEAA 4TYQA 1UT8A 2QZ9A 1HLDA 1Y3AA 3P9KA 3L8YA 4MWZA 5F9FA 1PSDA 1YGPA 1HPLA 2HL6A 3WGKA 3SZRA 1L5FA 2V7QA 1T8YA 2BAGA 1M0SA 2B82A 3OHPA 4KIFA 1IPFA 3AHHA 4XGIA 4F11A 5HM6A 4DJ5X 1YIOA 4DZZA 4P92A 2DBZA 3PPYA 4KV9A 2AEMA 2UZ4A 1T9DA 2F00A 4FCVA 4DV0B 1W88A 4C4PA 1RXIA 1XZEA 3NCTA 1ANKA 1T0HB 1NPTO 2NPIA 3N59A 2O2JA 4OHFA 3ETLA 5CA0A 4XFKA 3HXKA 2XI4A 3KXIA 3O0DA 4ZQEA 2G6TA 3V1MA 1DXQA 3I6IA 2P30A 3J81k 1R3UA 1RI3A 1ZP6A 2IUSA 2Q2OA 3QFHA 3NMUF 4INJA 1G8SA 2OSVA 3H1EA 4P4TA 3UQZA 3KG2A 4ZAZA 5JAZA 1PX0A 1UMCA 4URHA 1U4SA 3UN1A 1QH0A 4BJ1A 1Q0HA 4Q05A 1WW3A 4DIDA 2CNBA 1NLMA 1P1HA 1R00A 3OBBA 1KAEA 1Z35A 2BKXA 1XZGA 3A4YA 3UC5A 3FTEA 5EINA 4F3NA 1L4UA 3H18A 1LBHA 3R0QA 1QMPA 2UXDB 1QUFA 1NYTA 4ZTUB 3AH8A 4IDPA 5ECYA 2OWEA 1EK2A 2VOJA 1JU3A 3KELA 2VPPA 2QAJA 4L4YA 4C0XA 5LMCA 2FPPA 5KYYA 4CN8A 3NX4A 3LO5A 3M83A 1USUA 4C14A 1RHUA 4XASA 2MSCB 2SKCA 2HV9A 3COSA 1JNXX 1MFZA 2PKRA 4DBLE 4XKJA 1IU9A 1P6UA 5AI5A 1UBKS 1GSAA 2XYVA 3OA2A 4RCVA 2HNAA 2RHDA 5DTRA 5A05A 1TMGE 3JRNA 3NEPX 3DDOA 2C9YA 2G3YA 4G41A 4R40A 2QENA 3QE2A 1I2CA 1Z0SA 2GESA 1ZK2A 3IVGA 4QYMA 3K5WA 3GR6A 4ID3A 1XVIA 1M1YE 4DS3A 3PFNA 1FJXA 3GZ4A 4CN9A 1JDZA 4HQ6A 4JLVA 1OUMA 4L9WA 1VKJA 4ND8B 4D6PA 4BO7A 3F96A 3KJIA 1M34A 3CH7A 1YC2A 2OHXA 1XNJA 5DNVA 1TQ4A 1Z07A 3A3YA 3W2IA 1X2EA 2ZI7A 4FMCB 3SZGA 5ECWA 3F78A 3W5JA 1CU1A 3T9BA 1VPDA 1OX6A 1MPTA 3OC6A 3UO8B 1HEYA 2IZ0A 4IUBS 3DZDA 1JG4A 3UKDA 2DLDA 4RF2A 1QK3A 4ZEWA 4U0KA 3L05A 3C3XA 4B75A 4NBUA 3O21A 2BHTA 1Z5PA 3GJXC 3KCQA 4ENVA 1PUIA 5TQ2B 1H3NA 2ZS7A 5TF4A 4TMTA 1NM5C 2W2KA 4G1EB 3WMRA 2OZLB 5K0BA 5K6AA 4W99A 1S3IA 1P4SA 1HM5A 1PT9A 1I3OA 3SC2B 1J97A 2GARA 4QLBA 2DFVA 2Q9CA 1LPMA 2R6R1 3O8QA 1D2HA 2HAEA 2NO7A 4DYDA 4XDHA 2FSGA 3WA7A 3CR3C 3NVMB 3SY8A 4L6AA 2ZRKA 3FAZA 4IVQA 3ROZA 4L4XA 5LQDA 1XJQA 3EGCA 3TAUA 3KUXA 4TZ0A 5ENDA 3GNSA 4AJKA 3DO6A 1NJSA 1UMDB 1G63A 4W6ZA 2FUCA 3LFTA 1HMPA 1T9AA 2BEKA 2YVUA 2XY4A 5J63A 3RC3A 4Z3KA 1J56A 1I7PA 1E4EB 3LT5A 1YUMA 3GOQA 3TZ6A 4Z7NB 2WIAA 2ZS9A 3EHDA 4ZXPA 4JVSB 4QPCA 3C3DA 4IZOA 3ZD7A 1M6NA 1UBHS 3MCVA 3HACA 4H4CA 4UPDA 3RSQA 2QPLA 3M5WA 3QNUA 4Y6QA 4BO2A 4KZKA 2XOKA 4E6PA 5AXBA 1SUAA 2VSFA 3RIHA 4C03A 2VJCA 5BWOA 1TTQB 2GFHA 2GBGA 4D45A 2HK7A 1UAAA 2LDXA 4QFMA 3LQFA 5KQRA 1U7HA 1YL6A 2DGDA 1E1MA 1NF2A 2PS3A 3NOVA 4Z54A 3FZGA 4YXWD 1E9CA 1GZDA 1NYRA 4IMRA 2A1TR 4MI6A 3TB6A 2V6GA 3UOAB 2W90A 1QP8A 1XXHE 2WSYB 3K0BA 4UQOA 2IEYA 3KXPA 2WP0A 2LZ0A 4OGFA 3DEAA 5LZ7A 3HRHA 2AGVA 4JJFA 1K7CA 2HX1A 3BD7A 4N5HX 3W5SA 2GD0A 5CNKA 4DMMA 4RJTA 1NUSA 1EMDA 3MG9A 2G0NA 1HNWB 2WMDA 1E6LA 4RHEA 1XCGB 3KQVA 4WK0B 5SZIA 4F4IA 4ZDJA 4OYYA 4XVCA 1A8PA 1Z08A 3L79A 4BOYA 4UMFA 1S01A 3E81A 3OIFA 2P6NA 3OX1A 3P4UA 3DNPA 2DKOA 2GB4A 4JKOA 1PZEA 5GJWC 4FUQA 1X8XA 3PNMA 1E5VA 1O4VA 2IE8A 1Y5LA 2JBWA 1W5FA 4L0DA 4FOOA 4MRSA 2JAWA 4AS1A 4DUZB 2YQ4A 3U40A 5AJUA 4LI0A 3H2HA 1TI7A 2CMFA 2EQBA 2Z04A 2IFTA 2HTFA 4MA0A 2PVSA 1PFKA 4E7PA 3TRFA 3OQPA 1TQDA 4BCBA 3TOXA 1N2ZA 4YIHA 1ZESA 2VSQA 1QQAA 3M2TA 2V1UA 4MQLA 3HBLA 1Y6ZA 4K9MA 1WCXA 4JDPA 1O9GA 4EABA 2HH9A 2O8BA 2PLWA 2YFHA 2P40A 4XDYA 4XH9B 3H11B 3PNLA 2DM6A 2HZBA 1MT0A 3QA3E 5KOHA 3NLLA 3PQ3A 1O95A 1QHNA 1HE1C 2G76A 4HH1A 5K0SA 2AQHA 5DTMA 2ZJFA 2P62A 4E5DA 3GLFB 3CV3A 2IA5A 3OZDA 3ZCPA 4RKWA 2JLXA 1IY1A 4YA6A 3CNLA 3RC9A 2RBGA 5MHTA 2FG5A 1V16B 1TYAE 2YHIB 3GJ7A 2XNSA 3NAMA 5FWDA 3O6VA 4HTFB 2FDCA 1HORA 2HY7A 1B41A 1B15A 3J7TA 3RI3A 4M37A 1ZN2A 4WKOA 3GPLA 3L4JA 1VGQA 2ZUEA 4KQFA 1EB8A 2IITA 2H11A 4U8GA 2VF7A 2VCEA 1B3BA 1O96A 3DUFA 1EK5A 4ZEVA 3ZDDA 1SQ5A 3GRFA 4U7HA 3VR5H 2KX7A 5F33A 3OF5A 2HK9A 2D1FA 2WJ6A 1NZJA 2PRZA 1JH9A 3NYRA 1TA9A 3K8OE 4KK3A 1M2NA 3ETGA 4LMAA 4GZMA 5ALGA 1LNZA 5BMVB 2FQXA 1NNI1 3HRIA 5FPPA 1EUDA 1E69A 1WZEA 4K6GA 1II9A 3E1KA 4OHVA 3VC3A 4BDSA 2PT9A 1J2EA 3R3UA 5ALYA 5EZSA 4CU5A 4D8UA 1QGED 2JIMA 2B5OA 1G5QA 2QZ4A 4D82A 1KMHB 2AS0A 3F5MA 3H84A 4OIFA 4AMUA 4FN5A 4RSHA 3ROFA 2FMKA 2ZB4A 1AHNA 1HR0B 2O3UA 2ODAA 4B3IA 4A16A 4BYMA 4KXQA 3MTQA 3COVA 4YS6A 1VL0A 1YIAA 3CH4B 2EFCB 2VJBA 1QH8B 3CNNA 3IHKA 3RYCB 1IBMB 4IV8A 2O23A 4MGIR 1MJHA 1F38A 1DRVA 1QHH