1C41A

Crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
195
structure length
165
Chain Sequence
GPTPQQHDGSALRIGIVHARWNETIIEPLLAGTKAKLLACGVKESNIVVQSVPGSWELPIAVQRLYSASQLQSTGPFDALIAIGVLIKGETMHFEYIADSVSHGLMRVQLDTGVPVIFGVLTVLTDDQAKARAGVIEGSHNHGEDWGLAAVEMGVRRRDWAAGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
pubmed rcsb
source organism Magnaporthe grisea
molecule tags Transferase
molecule keywords LUMAZINE SYNTHASE
total genus 58
structure length 165
sequence length 195
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1c41A00
2C94A 5IM4A 1HQKA 2A57A 1RVV1 1KYVA 2C97A 1W29A 5IM5A 2OBXA 1NQVA 1NQWA 1KZ6A 2C9BA 1NQXA 3MK31 1KYXA 2A58A 1KYYA 1NQUA 1KZ9A 1W19A 1XN1A 2B98A 2JFBA 4J07A 2I0FA 2C9DA 2O6HA 2A59A 2VI5A 1EJBA 1C2YA 1DI0A 2F59A 1T13A 3NQ41 1ZISA 2C92A 2B99A 4KQ6A 1KZ1A 1KZ4A 1C41A
chains in the Genus database with same CATH superfamily
2FSVA 4XDGA 1Z17A 3EGXB 5TE9A 3KTDA 2EP5A 3NGMA 2Q4TA 1EK1A 1LVHA 3MELA 3RTAA 4B85A 1U9CA 3DDOA 3HA5A 2H1LA 4W7HA 1Z8HA 4NP6A 4O2BB 4ZEOA 4DADA 1BS9A 1B42A 3ON5A 1DCKA 1KY4A 2ISSD 2IYQA 1AXRA 3CNQS 3EHDA 2HRQA 3OESA 1XAJA 4NENB 3RHSA 4D8TA 4BLPA 5C5IA 3W1VA 5LQRA 4ZCIA 1OI3A 2DQ4A 4PAMA 1Q16A 5IXYA 4YI3A 4J0FA 6REQB 4Q4JB 1VC2A 1V43A 5J4KA 3HFRA 2VHXA 5ETJA 3GV0A 5K8LA 4JUBA 4PHHA 1Z0DA 1VMEA 3WWPA 1X1SA 4EY8A 2XSZD 1ZZGA 4YRIA 3BWMA 1IK6A 3M6VA 4OLJA 4BO5A 2X3YA 5JXIA 3LBAA 3FVWA 1RWNA 1TZKA 1X3LA 3M82A 1UBRS 2AFRA 2D8AA 2HIAA 2OZPA 3O1HB 1U1GA 2BHSA 2KPOA 4FD3A 4GOND 3HDGA 4NWIA 3V4FA 5JCZA 5K8JB 4S04A 3BWYA 3KXDA 2E4YA 4K46A 1FXWA 1C8BA 2FQWA 4MV9A 4N47A 3ZCXA 1NYLA 2DCUA 4HDNA 2P3QA 3DMRA 1Y1RA 3TH5A 3PGMA 3UGQA 3VX3A 1W8DA 1XKXA 1W5BA 2W2XA 3UWDA 3VDXA 3I01A 3G2HA 1JF8A 2FPPA 2WJ6A 4R31A 2H08A 1U8XX 3HR8A 1LW7A 4LOLA 4MLCA 5AIAA 3Q72A 4N0PA 4BGDA 1CY0A 2C7QA 2D7DA 5KNCH 3N3BC 1W8IA 1KHTA 1MAWA 1T9AA 2N1BA 4Y2TA 4R2IA 4B45A 3HI4A 3A1CA 4N0MA 4RPKA 2J0SA 1H9BA 2P9BA 1ZICA 4JBXA 2QRVA 5CM8B 3KOYA 1H69A 4JASB 2GTHA 3OE1A 3ZHXA 5K0TA 1CR2A 3PEVA 3QPVA 1Y48E 1AZSC 5ICMA 4FFNA 4EY3A 3D6HA 4Q0MA 1NDHA 3KQMA 4TYQA 5FA5A 3S0JA 3WLIA 1CUWA 1R50A 4UKDA 4NESA 2FG7C 4RWZA 2P65A 4F3CA 1ZRNA 2CXHA 4BX9A 5I7EA 3KWLA 1IWPB 2O05A 5FFFA 1LSJA 1ZI6A 4RK5A 2FH5B 2REQA 3OX3A 2WP0A 4HWTA 3W5HA 4CIYA 1DL5A 1V47A 1WQ1R 1FS5A 3ACDA 3EXFA 4PZAA 1RW4A 2GUWA 4Z0TA 5TV2A 4W5QA 3CCFA 5IAGA 4EG4A 3MHTA 4WBNA 3E1GA 1WSDA 4FNOA 4HP8A 1V9CA 4BO1A 8LDHA 1TT5B 3H0KA 4BEBA 4R6WA 2A1UB 4L15A 3DLCA 1ORVA 1ZJ6A 1CZNA 2G1KA 3NI2A 5IAEA 1LI7A 1DOAA 2XUGA 3IBTA 4OPMA 1RQPA 4HZGA 1QK4A 2XUJA 4BO7A 2EW2A 2X8LA 3MUFA 5DBGA 4ALIA 1OLXA 3DQZA 3O2NA 4O59O 3BFKA 3GLHB 1T6NA 1UZNA 1KJ9A 1GAQA 3V4VB 2X0FA 4JSRA 4PO9A 3L1JA 3OOWA 2XBLA 3HBJA 4MV4A 1U4OA 4ZOLF 4LCJA 3AERB 1KERA 4DLZA 1E20A 3LBFA 2BW0A 4G5YA 1Y89A 3E2MA 3IR7A 5CIWA 1W9MA 4LRYA 4I4CA 3WTBA 2WWGA 4D4JA 1LRJA 4I1PA 4J0HA 3W90A 4LDPA 2UAGA 1KMNA 1JFFA 2DHQA 3U4DA 2YV2A 1W85A 3M83A 3Q7PA 4LYFA 5LQAA 3FCSB 4RESA 4EZIA 1JI3A 2HA4A 5ALNA 1RI1A 4WOJA 3GRFA 3U1VA 4PTZA 4F60A 1UJBA 4NDZA 5FYQA 5SZJA 3M81A 3VKFA 4L3WA 4XLTA 3EAGA 2J31A 4IW3B 3RCBA 3QA9A 2GJKA 2GFQA 4HKTA 1GG5A 2F1IA 4DUGA 4DV2B 1T5TA 1I1QB 3QPDA 2I8LA 5CW2A 1TLTA 3G8YA 1Y8ZA 1H8ED 1PQYA 2O2EA 3OCYA 4UBIA 4ZYUA 2F48A 3AW8A 1UBKS 3KPVA 5AW4A 5KU7A 3UEOA 4F45A 4YDSA 1LSOA 4ZJZA 1Q1BA 4P7FA 3OHMA 3TECE 1PV4A 5JO9A 1SCQA 1PJ4A 3PEEA 4TXJA 1B8NA 1V4NA 1E94E 1WO8A 1VPEA 4Q7KA 2P75A 2VZ0A 4IFBA 1YK0A 2PCLA 2AZ4A 2CMHA 3TMAA 2H1OA 2IV3A 4EJSC 1RAAA 3SKVA 3KQLA 3E4DA 2GCEA 3GJ3A 3IUEA 1GPKA 1P3JA 1VRVA 2J0UB 3LYLA 4UQLA 3FOEC 1DIAA 1L5HB 1E96A 5G1OA 1VCOA 3W4JA 3HSKA 1PT5A 1WOMA 1S7GA 3U26A 3VYVA 4N7JA 3WKAA 5JDCC 4W5RA 1PZFA 1E1QD 2HADA 3GWGA 4WK0B 3O7MA 4DVJA 2E89A 3UATA 1YBVA 3PDWA 1LPMA 3WMWA 1FIUA 3ICEA 2GTPA 3OZDA 4RGBA 4WECA 3NHUA 1CE8B 2YXEA 2CCKA 3LS2A 2CKMA 4HX9A 1N8KA 2C4HA 4GOKA 4KJZA 2FCRA 2JJYA 4R69A 4MYUA 4XRRA 1N6NA 3HACA 3KHTA 4J6EA 4J1SA 5EIFA 4MYRA 2O8BB 4IDOA 4BLWA 4ARSA 1N75A 2X6RA 2Z8XA 4MTCA 4PGMA 2FWRA 3DE3X 3ZQKA 5KYNA 1WUIS 3PHGA 4KFCA 1CSEE 4V38A 5TSDA 1UXKA 3FMVA 4UE3S 2R60A 4EI8A 1A98A 1TA4A 3L4BA 4KDRA 1SKMA 2FPLA 2C8KA 4FNGA 4RLQA 5EUMA 4YP9A 2GHRA 1U81A 2RDMA 3W2TA 1E7WA 1CEQA 2EZTA 1R8XA 1X80A 3L4SO 4RA6A 3T3DA 1O03A 1RM3A 1C3EA 2P1ZA 1AUOA 2FRVA 2M6RA 2XTAA 3DS8A 5A7GA 2XYRA 3OM8A 3L1HA 5K0BA 2V58A 2QAIA 1JMVA 2YIVX 5D1NA 5BSTA 3LA8A 1Y8CA 4YAUA 1I1OA 2QQEA 3ONEA 4Q6WA 5CT6A 4P9NA 5IHPA 1E0AA 3D64A 4Q3DA 1AKMA 2QMUA 1ONSA 3A0UA 3KNZA 4NBTA 3ZWQA 1J7JA 3ZZNA 3JSAA 1XPRA 4HV4A 2DKNA 4JMLA 3BK1A 1KDPA 4L28A 4ZEWA 2YNMD 1LNZA 5I7HA 3ZV4A 1UKAA 2OORA 3DOCA 5LA6A 2VTVA 1Y81A 2Q5CA 1UP6A 5D87A 4A0HA 3ZUPA 4B80A 3UJDA 1N3YA 1ORDA 1PTKA 3WLLA 4CMBA 1L8LA 2OD9A 2C61A 3G68A 2OGWA 5SYAA 2RGXA 2WV9A 2Q9UA 1WZ2A 2CZQA 3CHYA 3AILA 3ZHUA 3BMCA 3DMTA 4KL8S 2CD7A 4L0MA 4FBLA 4OLHA 3G1WA 2EBHX 1QNLA 3IODA 3R7DA 4EI9A 1QYDA 2PT5A 2Q46A 1J0EA 1C9JA 2JA2A 3S2IA 3EC7A 5A03A 3H1AA 4H7IA 1E32A 4RLHA 4KI0A 5JO0A 5LP1A 1KAMA 1O9GA 1NOKA 4FE7A 2B4KA 1JYSA 2C2WA 5AOAA 5FLXA 1AGXA 1TU4A 2A58A 1B2LA 4EATA 3FGOA 4ZVNA 9ATCA 2HIMA 2WABA 1T2DA 3NBQA 4CQJA 2GN9A 3KZXA 4BN0A 1FB5A 3I01M 3BGSA 3WK5A 2EX1A 5HP4A 1TVEA 1EM8B 5EJ5A 1NW4A 1CUBA 4US1R 1ACLA 2RAUA 4IBOA 3LCVB 3KUCA 3IEMA 1BC5A 5CHYA 4R5MA 1VG8A 1LRLA 2VK1A 1HR0B 4JGGA 1MJGA 3IDFA 5LOVA 1D8TA 1W30A 1E9FA 1VJGA 2GVNA 3ONNA 4QPNA 2ZIZA 5T57A 1W36B 2YZGA 4DA4A 2AF3C 3IQDB 4QNNA 4AMVA 2AVNA 1W5SA 1T9HA 3RW9A 1NUTA 3T7DA 4C29A 1G63A 3HTXA 1YSCA 3F78A 1CDZA 1NQVA 4YH1A 4O4HB 2W11A 1W96A 3E4CA 1L5LA 1MZPA 1ZP6A 1LQ2A 1RMTA 3P97A 2JZOA 1OX4B 1E6MA 1E7SA 1RRCA 2QLMA 1XVAA 3UY4A 3TXXA 2WQZA 1RLOA 2CVZA 2JJ8A 3JQFC 1MG0A 1REQB 4EO9A 1MIOA 3ZOKA 2WM8A 3HXOA 1Q6YA 4AWBA 4U9HS 2P0EA 4Y18A 3NIDB 3F46A 3C5CA 3IP3A 3W2FA 1E9DA 1WDMA 2OB1A 4WN3A 2V5VA 1GHTA 1JIXA 1RKVA 4R1QA 1QTIA 4BTVA 2F90A 2FFQA 3N2ZB 4FYVA 1Y1TA 4M8SA 2P6OA 3M8KA 3ILXA 5DBHX 3UFXA 4Z3DA 3P32A 2FMIA 2RHHA 1G5PA 1XTBA 2PMBA 2VF5X 3B1KA 4B76A 2QSJA 5IC5A 4HTAA 2Y1EA 3RKRA 1XZQA 2I2WA 1DNPA 2XVYA 5F3DA 5BT9A 4YRZA 1TYAE 1ZNYA 1AQ6A 3WYAA 3ZXSA 4CM4B 4PS0A 2F67A 1OI4A 3CRNA 4GX1A 3TVDA 4CMHA 4CWAA 1MW8X 3SHVA 3G0DA 3SZMA 3GO4A 1Z0AA 1EDEA 4M36A 3S2YA 4D0LB 5K3EA 2AKAB 4JP2A 4TWRA 4IOKA 1NVBA 2XTMA 5JRJA 2CBXA 1RXSA 2I2AA 2Q62A 5EKUA 5HCNA 5T4HA 2FEMA 2JFNA 3MWKA 4CLDA 4EM6A 4UPEA 3C7AA 9MHTA 2R87A 1NPDA 3ANTA 2G6BA 1DIBA 1P1JA 1M7HA 3EVNA 3DP7A 4KXVA 1YOBA 4XOUA 1ZLXA 1K7YA 1OCEA 3GRRA 3UJ8A 4BO2A 4DLRA 4AI6A 2XB2A 1D4FA 3L6DA 4EGSA 1SUAA 3CX6A 2X42A 3GJ4A 4EGJA 3L40A 1JHMA 4PVDA 4UCXA 3H1EA 1SO8A 4D82A 5BWCA 1RLTA 4ZXPA 2AYZA 4W6QA 2UYYA 2Y3IA 2FETA 1ENYA 4FZRA 3NHPA 3T3OA 4MITA 2KQUA 3NWOA 3OU2A 2YY5A 1F5SA 4RSHA 3TCKA 5DI3B 4KRFA 3GFQA 3LW8A 4QVKA 1T5BA 2GWRA 4FMDF 4JCOA 4KXYA 1II0A 3ZY6A 2QP4A 5DM2A 1I13A 1UR5A 5IM5A 4YREA 2MIIA 1OBHA 2AFIB 2V8BA 2YWHA 1GGNA 1E5TA 4TXLA 1P2SA 1ZS9A 1HEUA 2OG2A 4MPJA 3DOEA 4Q1EA 2WNSA 1G8GA 2P0AA 4KAJA 2EKBA 2HH9A 2AC4A 1YMVA 2A9KA 4KPUA 4G5XA 2XQFA 4FD2A 4G6ZA 4ZOLA 4JZKA 1VIAA 5EXEA 1E9AA 2V9ZA 5A9RA 2P40A 4ZVKA 5JSKA 3OIVA 3RVKA 4MRMB 2ZSDA 3PC8A 3OFVA 1NXQA 2YW9A 3LOQA 3VI3B 3HCNA 5ANRB 3ORFA 2GI4A 4NFLA 2XXAA 1W6UA 3PQEA 1UPXA 1XD9A 4RENA 2EF0A 5IJ0A 2FWMX 5LJIA 3BMOB 2JAPA 2HU8A 2ZWOA 2VTEA 2R4TA 1IJEA 2PWZA 3TCXB 4TZ0A 4ZYXA 2FK8A 4DTIA 2B99A 5F73A 4JT4A 5LMCA 1VA4A 2UZAA 1XZ8A 2G4LA 3LBNA 2QUBA 1CY7A 3DTYA 3CNNA 2ZR0A 3IB3A 3P5SA 4S1NA 4B3MB 3E3MA 2WFLB 1KF0A 4BPBA 1NZDA 2R4UA 1X38A 4EB0A 3S1AB 1TZJA 4G2TA 1K4KA 3GROA 3PDUA 1T4BA 2JJ1A 3A8TA 2QMOA 3KR0A 4IDGA 1FS4A 2D2FA 3S1SA 4JAVC 4MO2A 1V8BA 3JAMA 1V26A 1K5PA 2YNMC 3OLCX 4HMQA 4M1OA 3SF8A 4MV0A 5FA6A 3WK8A 4MHOA 4BNDB 4JITA 1EX9A 3NX4A 4IMRA 4JEIA 2AV6A 2NO7A 3C8HA 5E9QA 5EL0A 4DGQA 5GGYA 5AVTA 3W9SA 4IDQA 2VT6A 4G86A 1FYWA 4HGZA 5SY9A 2IDMA 1U2TA 5C52B 3A1NA 2DU8A 1MTZA 4TS3A 1P81A 3NAMA 2BY4A 1X6VA 3FVVA 2O48X 4C6SA 2JLSA 2IYNA 2HTEA 3LDHA 2BF4A 1E2UA 1EP2B 2DUMA 2IVZA 3ZE2B 2Q45A 3D1VA 2QTCA 3B3AA 4C2AA 5KX5A 2YS6A 2EZUA 1Z7BA 1JFLA 2RAPA 2CLHB 5AJZA 4CGZA 4JY7A 1ZD4A 2MSLA 4QJBA 1A76A 1OLUA 2EYQA 1G9SA 3BOSA 2VXBA 5IYZF 2IWRA 4NCAA 1T8WA 2D2VA 2I1WA 1FNSA 1GVNB 3ZXUB 2G3YA 3NYIA 4ZCQA 3WLEA 2B5WA 2DULA 3PHHA 4NKRA 2ON6A 4GQAA 4FC6A 4MGKR 2OR3A 1NM5C 2IYFA 4ZALA 3T41A 2XMRA 4KH1A 4UNSA 2P9QA 1HT0A 3RK1A 2HHAA 2PZJA 1YQQA 4W5TA 3AEUB 2QENA 2ZPTX 2ZBUA 4C7MA 2I71A 5HKAA 4XIFA 2IW1A 5KNBD 1RABA 1UXJA 2KW5A 3I28A 2PLNA 3EMBA 4TTPA 3R5SA 4G07A 5CDSA 3QE9Y 1J9ZA 3RUPA 3TFWA 2C83A 3ND5A 4UPVA 4G5GA 4LSZA 4GPIB 4KQ2A 3GRPA 1DKOA 3OFND 4RHEA 2X9GA 3BE8A 5BYJA 3TNLA 3AM1A 4Q82A 4MV5A 3ASZA 4MS3B 4ARAA 2AWOA 1VHDA 2YHBA 1UBJS 2WHEA 1EMDA 4JP8A 1YVPA 2VF4X 1UM8A 5E0OA 1KJJA 3IHWA 3NM6B 4BO0A 2ERYA 2HX1A 4L16A 4JQOA 2PU5A 3KSRA 4P93A 4ID3A 4YJ2B 5EPOA 3A25A 2XYHA 1P8JA 2PBZA 4RQUA 3SFVA 1N36B 2XTZA 3GNSA 3A6JA 1R0KA 1VI2A 5K99A 4W9NC 3C8DA 5A0VA 3V1UA 2OBMA 3EVZA 4L0QA 1TJYA 1Q91A 1PGJA 3LHDA 4HDKA 3T7IA 3HZOA 2BR3A 3HL4A 3G02A 1U2GA 2Q0HA 3T15A 1PDOA 2X0IA 1DB3A 3D1JA 2G9UA 4PBTA 3V46A 3K9QO 3OBBA 4W5WA 1QHHA 3H1BA 4ZJPA 4S2UA 2PXCA 4XM1A 3R0JA 2BFCB 1K27A 1VSBA 2GAOA 3F3KA 1ETHA 1D9XA 3OPYB 4IZOA 3SLGA 2FEXA 3SHWA 2B3TA 3TAHA 4XVCA 5ESRA 1XD2B 4F5WA 4NU6A 5K6AC 2WE7A 3IE2A 1V8OA 1ZRHA 4LZJA 1QC5A 4P2BA 5K3SA 2BI8A 3ZYZA 1W4LA 2DPLA 1FQWA 1PL6A 4M1YA 4M6WB 4UBNA 4AECA 5E6SA 3C16C 3QI7A 1IE3A 1WQ3A 4KI7A 1QYIA 2VNAA 4RDXA 1RZRD 1CQPA 1Q50A 1L8QA 3CWZA 3ANSA 1ZUIA 3C45A 4WZBE 3TSCA 1A5SB 3MOSA 3HMQA 2FFHA 2JD0A 4XDYA 2DWQA 3DT9A 4CEIA 1N2EA 1T36B 1VKJA 2AA3A 2I76A 2ODPA 2VZLA 4YMWA 3STUA 3T9DA 4CTNA 5BSEA 3B7PA 1TEZA 5EXSA 1WWKA 2LUOA 4HXEB 4Y7CA 4ND4A 3H17A 3ZH9B 2ZYUX 2NZXA 1C30A 1TVCA 4M9UA 3G9QA 1E3LA 1JTEA 1IMJA 2ZPUA 4O4JA 1JKIA 3DWEX 4I9NA 4RW0A 3A7EA 4HXGA 1T4CA 3LO5A 2IGTA 4NV1A 4XCQA 1MQ9A 4LVNA 3T06B 2JAQA 3QNMA 4EW3A 1UC4B 4YR9A 1A9XA 1E5DA 2LV8A 2AX3A 3SMQA 4ZMSA 1E8MA 2Q99A 2FJUA 1P4SA 3ZHTA 4DXHA 3ESZA 4AD8A 5JMTA 2AG5A 3INTA 2RARA 5E6RA 5BUSA 1RLMA 3C14C 4WK6A 1UAYA 3EZNA 3NATA 3RSQA 1C1HA 3RRNA 3T3HA 1SRRA 2QZ4A 2PZFA 4AZ0B 4EL0A 5ADUS 2VDWB 2CNWD 1FFWA 2YIJA 1AN0A 4LXGA 1D9ZA 2IIPA 2W2NA 4U00A 3DHWC 3PSAA 1D1QA 5CLIA 4GZMA 3FYHA 4AJJA 1J0AA 1L1RA 3P9RA 3WYNA 4C0XA 2BTEA 4HUQA 2O0HA 4BTEA 4ZCLA 2I6QA 3GFSA 3MIZA 4MZXA 5FWXB 3LQ1A 4Q4AA 1I2CA 2RHRA 2VDRB 1JR4A 1K6IA 1WMBA 2ADMA 3KXKA 4BVKA 4DSTA 3JQEA 1UFRA 1R9JA 1XO1A 4FOSA 2ZI4A 4HXYA 4TLEA 4FW9A 2HLDA 4C08A 1ECGA 3VQTA 4EG6A 1NUQA 4MI9A 3VPFA 3FUVA 3GFFA 4ZQBA 3R5TA 2AR9A 4L8VA 4PLVA 3ZHOA 4HUJA 4RM2A 1YOVB 4OMDA 1IY0A 3QSGA 4R2HA 4ZDWA 4QG3A 1SUFA 5HHTA 4FOOA 4L57A 4YT4A 2MT9A 2IZ7A 4MUHA 1SC3A 4ZOEA 2GN4A 2JGLA 4POOA 3D2BA 1HT2E 1H94A 3MLAA 2N47A 2QUHA 2IF0A 1JLHA 2NP7A 2W83A 1M66A 4WY5A 5AKLA 2Q5HA 3KD2A 1X3SA 1NQTA 1JDBB 5JS2A 2ZS7A 3D1LA 3WL8A 2JIDA 4XUDA 2WAYA 3BZWA 3UA4A 3WGZA 4ND8B 2NGRA 3PHJA 4K1XA 2WF5A 5AHKA 3QH4A 3QM1A 1PWHA 1B0AA 1WAMA 4PLTA 3ETCA 4O1MA 1R18A 1WUJS 4PHCA 4BX0A 1OXMA 4YFYA 1XN1A 1M74A 1KPIA 4MW1A 2JLVA 5KIAA 1YGPA 3RYFA 2H2DA 4L9RA 2SICE 1DQNA 3WS7A 2W98A 1BIFA 1GNQA 1VECA 2ZVPX 3ED5A 2PUTA 2Z4SA 5B53A 2GVZC 3V3TA 2L42A 1BHQ1 2HYDA 5HKKD 1BNCA 3O9MA 1MORA 1VE6A 2C8VA 3PD0A 2NT4A 2SCUB 4WASA 3BL6A 4IO1A 3VV2A 4I5IA 2IQ5A 1SQ5A 1GRQA 1OW3B 3I9NA 4Y2PA 2OQRA 4OJNA 3KP1A 3OECA 4BASA 4BVEA 5JEDA 5AJYA 4PX9A 3AF3A 1LY1A 1KZ6A 4MUJA 1W34A 1WULS 1XPJA 5EMLA 4KVGA 4DCMA 4GGPA 4BMPB 1G4UR 3EIWA 2GD1O 1PD1A 1YIDA 5DGIA 3VNQA 5FTJA 5E6RB 4PC6A 1NWCA 1ISSA 3WI7A 2BGTA 1B8OA 4UPDA 5KMGA 1C9YA 3IPLA 3T38A 4QXRA 2V6FA 4LWPA 3ZBPA 1KJWA 4IQ8A 3LL7A 3QELB 4L5IA 3PGXA 3RS5A 1ZSYA 3WBJA 1RFLA 2GXQA 4L5CA 5L3QA 4B31A 5DE3A 1C7FA 1SIBE 3U49A 2H2WA 3EPPA 4MA5A 4X92A 4BMOB 3HG7A 4PX5A 1GNTA 4ZJUA 3D7KA 1K0FA 3GZNB 4ILEA 3KU1A 3UJ6A 3VR4H 3A7DA 1O1YA 2ZRDA 4B4OA 4CN8A 3EAFA 3IPAA 4YMGA 5LMZA 3T3NA 1GVHA 3K30A 3OIUA 2CLFB 1R12A 3TZLA 2D4HA 3PHCA 1P45A 4HADA 1U1FA 1MEEA 3FCXA 2YVKA 1NPYA 2FEPA 2Q7OE 2QTVA 2PRJA 1TNDA 2UZ0A 3PVCA 1YCGA 1SBZA 3L6OO 1Q7CA 1T0IA 1SU8A 2P78A 2QDKA 5BUQA 4ND2A 2WWTA 3KPJA 4E5MA 3MFYA 3QLVC 3UENA 4BVGA 5IKXA 1KYIA 1U80A 3SYRA 1RWXA 2V4UA 4WADA 4B3FX 1NDQA 1N5JA 1A5BB 1J33A 2YCBA 4G4GA 3WXMA 2GEVA 4NBLA 1P62B 3ZKWB 5CVDA 5BN4A 3F47A 4IQ4A 5EIWA 5DBOA 1VLVA 5FXMA 4PX3A 4F5ZA 2VS1A 2V0CA 2PS9A 4DLBA 4RKQA 1XJWA 4WV3A 5CH8A 2JJQA 4ENQA 3RAPR 1PEDA 2QAGC 2YQ4A 3WGMA 3KB8A 4O4LF 1PR3A 1C7JA 3JQ6A 3OLVA 5G4LA 5JVDA 3CVXA 2CNDA 1I6MA 4HLUC 3M33A 4IDNA 4OIFA 5AOBA 5HRCA 3JZFA 2VP9A 2MDTA 3A9WA 5F1PA 1CX9B 1MB4A 4ALJA 4ZO4A 1B43A 1XYYA 1K4MA 4N18A 1L5MA 4Y2UA 2PL9A 1LDYA 1KS9A 3V55A 2O1EA 3HLTA 1JJIA 5EJ4A 4EEXA 3A1TA 3D02A 4F9GA 3AM5A 4PFJA 1QF9A 4IJMA 4LZWA 5LD2B 3QEAZ 4NCIA 2XT0A 2QIOA 1Y6GA 5FYDA 4GPZA 4NH0A 2NOAA 3UWKA 2JVKA 2D2XA 4ZT4A 5CDFE 1B15A 5G4KB 3UWMA 2HPZA 3FCYA 4BL5A 4CT5A 2VQ6A 4K5QA 2HHCA 5JT1A 1Q21A 1PF7E 2XUHA 2ZE5A 4CKEB 5F2EA 1YQTA 1HFWA 3S2UA 1USVA 1KE2A 4LBVA 4MQUA 5D3MB 3H3XA 4BJ1A 5CDGA 1WCV1 1UZUA 3ORSA 4YALA 2RHJA 1GKIA 3LBIA 1KYVA 1F48A 2W0MA 2JIZD 3AMVA 4TV9A 1QDEA 1XMSA 5I6DA 4JYZA 1NY6A 2EBWA 1J42A 2WUDA 4HLNA 4MDHA 5IDWA 2NO4A 4GLOA 3PCTA 1KFEB 1OXKB 1X15A 1QFXA 3QFRA 2V54A 4KMMA 4RE5A 3TL3A 3HGTA 2VF7A 3ROXA 4DLNA 3WZLA 2EP7A 2NYUA 4RTJA 4AZWA 1H1DA 3TGWA 4N1AA 5JYBA 3WKCA 1KZYC 4ER0A 3KXLA 1EEHA 2WUWE 3QXSA 4PONA 3K0SA 3RG2A 1ZQ1A 3FPKA 2HF7A 3JAWB 5I8ZA 4AF7A 4I8IA 2R7NA 4TTAA 4WBNF 2HWKA 3ZNQA 3SC2B 4RABA 3R75A 2NO6A 5IWAB 3DVAB 5KQMA 4CG1A 4MKZA 4QLAA 3QX9A 4AJPA 3PE3A 3WE7A 1DJQA 1XZBA 2E6KA 2GYYA 2HUNA 2VR1A 3KWMA 1O87A 1WKBA 1ZO8A 3KC2A 5HA5A 1UIRA 1QHXA 1TZCA 2QQ5A 2WJPA 4LNAA 4RPIA 2IP2A 3CRQA 2BMWA 2LP4Y 1HPLA 2WHQA 3DJYA 1RMYA 1DQZA 3IP9A 4FHCA 1KWKA 1NURA 4C2TA 3FOWA 2UZ3A 1UPBA 1IJKA 4RSGA 3WADA 6CHYA 1MB0A 2EQBA 2ES4A 3HXLA 4LYYA 5ITVA 1JFTA 1BXZA 3HU5A 3LYUA 4X91A 2ZRBA 4YDRA 4YONB 3GRYA 4R9VA 2XVXA 3EOAI 4EGFA 1RD4A 2HLNA 4LZZA 3B48A 4PBSA 2I29A 1AKWA 2Y2UA 4JD5A 3ZDCA 3HJAA 1Y3HA 2QXTA 3U3JA 2XMSA 4RADA 5DPMA 3WC4A 2C1EA 2NZ8A 4L3VA 1KEEB 2KE5A 5JAZA 1R88A 3UIEA 1K7XB 1X7WA 1A27A 1JEDA 3TTXA 3ZUGA 4E88A 1DINA 1CRZA 5IJZA 2W6MA 4A2CA 2H1FA 4RD3A 3CU5A 5HFJA 2E9SA 2ECKA 2HCJB 5CX1B 1JQJC 3LDAA 3NASA 3FPGA 3GLIE 4OI0A 5MN6A 2OQ2A 4KMSA 5JJ5A 3OUUA 1EKXA 3FD8A 3E82A 3LWBA 2RJNA 3L8CA 4D81A 1U2ZA 4F84A 4X6XA 4N01A 3GJ6A 4BFYA 3H0EA 5F1YA 4E1BA 2QL7A 3OE7A 4YAEA 2R1TA 1WCYA 4PNHA 4WFJA 1WZEA 5AKXA 3NGXA 3Q2OA 4HD8A 2WWXA 3PKIA 1E2JA 5CTAA 5D3MA 3STHA 5B7PA 5EJMA 2G67A 2OD7A 4CLRA 4JJEA 2ZZMA 2H2HA 3CN7A 3AK4A 4M9ZA 5T67A 1XLUA 2IYVA 4CFZA 3V7FA 1ZRSA 3AGQA 4OA5A 1PGPA 5FWYB 3T7EA 1EUCA 2ZCUA 3RADC 4DA0A 4B71A 1QQ6A 3AGPA 3MSCA 2M98A 3H65A 2P11A 2ZUWA 3TLXA 3QK7A 3A2LA 5K6AA 1ECCA 3BUSA 1LI4A 1Z6GA 4NHOA 4CHGA 5KHLB 1GQQA 3EF1A 4KQ6A 1YDFA 1EXDA 4JI4B 3G2JA 4M21A 5DB4A 4EY4A 1XRQA 2C5HA 5H5JA 3HBMA 1HG1A 2B69A 3S70A 3E3AA 3ELDA 2V0GA 4JYAB 4F5EA 3GEPA 1E8NA 1CT9A 1Z5ZA 4MWDA 4BBJA 1N2HA 5GJVC 1N7HA 1WY5A 2F1OA 4OM7A 5KC8A 3RYTC 1D0SA 2O8VA 4JP3A 3IR5A 4GPBA 2DLNA 3FCOA 1W19A 2JFVA 2VJLA 3P0EA 2CWDA 4TXMA 1FTYA 4PGFA 2NZWA 3SR4A 1UP7A 2EERA 1GR1A 1E5VA 5KYYA 4ZO9A 1HA3A 1OB5A 1N6PA 2VH5R 5B7GA 2HYIC 2C7PA 3R9WA 4J1NA 2R6HA 5IC4A 3TNJA 5JR3A 3F3MA 1ZR2A 1YR1A 3IDQA 3UMGA 3LPAA 4BUJA 3DFIA 1IXRC 3B1JA 1DX6A 4AKGA 1Y7PA 1IEVA 2VC2B 3GFOA 2OBLA 3THOA 4YDQA 2CDBA 2Q5FA 3VSCA 1JFFB 4R8MA 1VHWA 5KTRA 3F6SA 4LVUA 4IIDA 4OP3A 3F6BX 5JC8A 4DR2B 1ZH0A 4AQ7A 2RHCA 3EY9A 2Y0BA 1CEEA 1QAQA 1UODA 3AOGA 1NXSA 3RVJA 4IUBS 4XSVA 3PLRA 3FYUA 2C5EA 4X54A 5D86A 1QAOA 2Z30A 4NZZA 4G8CA 1J5EB 4RD0A 5FA8A 4IJ6A 1CHDA 5FBKA 1S2NA 3WNVA 2XVMA 4ZPJA 5EQJB 3AR5A 2HJVA 1PU2A 2QTRA 4HSGA 5T41A 4CL0A 2NZUG 3O82A 3QTBA 4UQOA 4D4MA 2SNIE 2Z8ZA 5DHFA 3RODA 1BEZA 1MGPA 3AFIA 3DZBA 3VR2D 1SOVA 1SXQA 1OXTA 1QR6A 3K3PA 3M1LA 3MJCA 3D43A 4NE9A 2UYHA 3K70B 4F12A 2SKDA 2PV7A 3CLRC 3FNRA 4RFSB 5G41A 4QREA 3X1YA 3I6YA 5HILA 5GOTA 3W77A 4DC1A 4F8JA 3VHLB 5DHQA 3VO1A 4Q37A 1DQRA 1QH8B 4MUNA 2H3EA 2PD6A 1Q11A 3G9UA 4C1BA 2PMFA 3H4IA 4YQEA 3SGLA 2VH2A 2A7XA 3NCHA 4IG9A 5FHRA 3I3OA 3SR0A 4EF5A 3ZC3A 3WQQA 2X40A 3CVUA 1U0BB 4HCJA 4Y6LA 4POAA 2X0EA 3UPTA 4LI0A 1CDEA 3EG9A 2BEJA 1N25A 1U0FA 4YP7A 2W9XA 4MVCA 1L7RA 3Q0EA 5LQMA 3IJ5A 1I32A 3UJCA 4ETNA 2HCTA 2PVPA 5ALJA 4RH0A 4EYEA 5HIIA 3D5EA 1IRIA 4HDNB 3W7VA 2PWPA 1SQFA 3DBOB 3C1OA 3N2EA 1BSVA 2OHVA 4RY8A 1L1FA 4FOTA 1RJ9B 5FOXA 2G88A 3FY4A 3G23A 3H7AA 4TROA 1WE2A 1MHTA 1GA4A 3IUPA 3OPVA 2VLIA 2C4WA 1M6VB 2X6QA 3NRCA 1LV7A 4YGXB 1UMBB 3P94A 2EC5A 1ZAKA 3PA8A 4EGAA 1EXVA 1U7UA 1ECLA 5ALQA 3AETA 3G59A 3V1YA 1E0KA 4KGVA 2ZRQA 4ARVA 2WAXA 1YU9A 4CV2A 2Z1NA 3AC0A 3NC0C 1DKRA 4KZPA 2H16A 3OOSA 4GZ5A 1SHLA 2QTWB 1IY1A 1X14A 3BS4A 5EJ6A 2X86A 1TRKA 1XEFA 3QF4A 3T4EA 3CVWA 5GJBA 2A33A 4BJ5A 4UVIA 4M46A 4QTTB 3SR3A 5JZBA 2I7TA 5KNBH 1Y82A 2YWGA 3D8TA 3IL2A 3GK3A 4Q4HB 1GTG1 1H23A 3WGQA 3ZGLA 3REGA 4BVJA 3MAAC 1XT6A 3W6UA 1T4DA 2W6CX 1IMOA 3A4LA 4LYDA 2PKEA 2EEPA 2VQSA 4LYEA 3S1AA 4U0KA 4D97A 3SE7A 2G04A 4LZLA 5A5FA 1LTHR 1I80A 2C2OA 2P69A 2ZBVA 3EZ6A 4M9CA 1J0XO 1CIVA 4UFOA 1YMUA 2VSYA 2XOXA 1JSCA 4V0KA 3U7IA 4HUQB 3CLUC 4NMXB 2JIBA 3DC2A 1ZW1A 4RELA 3DLHA 2P90A 3M89A 1G20A 3ITEA 1RQRA 3GA5A 2AUNA 4G56A 3AX6A 1ECJA 5I9LA 1QORA 3P71T 1VLQA 4WZZA 3TTUA 5ALIA 1WNTA 3SEZA 4EY5A 4F46A 3X43A 1EB8A 2BM8A 1U2GC 5GIOE 4P81A 4Q15A 4XPIB 2FU5C 4INZA 3LKDA 4H6WA 3K4QA 1NV9A 2JC3A 4PGGA 5AVKA 2PQ2A 3DMFA 1WY7A 4G1MB 3T35A 2A14A 1L3IA 4K6OA 3RQSA 3ZDEA 3PVZA 4B3SB 1SUEA 5F98A 4FR0A 1F38A 3QE4A 4GI2A 5I51A 4K7JA 5AK3A 1SA0A 4RANA 1IQ0A 3B5IA 2QX8A 4QASA 4YAWA 1F8FA 3IIJA 5REQB 1IXYA 3D4BA 3K72B 2B6HA 4V2IA 5EUQB 4KLAA 1NKSA 2Q3MA 2AXPA 5DI3A 4UAGA 3UMJA 3GRVA 5EHXA 2E87A 1D07A 4IEFB 1YRLA 2MYNA 2GYVA 1K8ZB 1KHHA 4OU5A 1II8A 2E7ZA 2PGNA 3FBWA 1E6EA 1IDN1 5EXDA 3V8PA 2ENUA 1H66A 4HDMB 3DVSX 4WHMA 5HTKA 1DG9A 4E2ZA 1EFTA 1GFZA 2H31A 3ETHA 2AOVA 1W5AA 2VPYA 3NUZA 1JGTA 1M7GA 4XGRA 1JYFA 1MX3A 3MPOA 2RGNC 4MYDA 3KWFA 1HTBA 3VSAA 2GD0A 1BJRE 3L8GA 1UBFA 3C6XA 1MEJA 4ZOBA 3WAJA 5AM5A 3QKSA 3LDGA 4JUAA 1IY2A 3E27A 3WBBA 5LYJF 1U9IC 5I4KA 3N76A 2GLUA 2ZUFA 1Q92A 1O58A 4QDKA 4RE6A 4NABA 5EP1A 3HXQA 3TUZC 3CVJA 5LP6A 4XGNA 2ZDQA 4WAUA 2O3RA 1VYVA 3AI2A 1OXVA 4L4ZA 4TTJA 4I1YA 5CLHA 4Y6QA 1W4ZA 5JWRA 4WK4B 1P5FA 3LQQA 2ONJA 2RKWA 1NQXA 3PUYA 1J1UA 3B6KA 2H4FA 3FFBA 3U9TA 1D2NA 5TARA 3V7UA 4YRNA 1J5PA 4HDKB 4DV0B 4XB2A 3CUUA 3EYAA 1VG0B 4E33A 3B89A 3QWHA 4L3OA 5EKSA 2Z2IA 1LNSA 4WGFA 3G8CA 3CLVA 4L4YA 1XXLA 1IJFA 1WIWA 4WCFB 2QJOA 2LIPA 3ZHCA 1U5AA 4G0VA 5D3QA 4YYZA 3AF5A 1Y9AA 4E4RA 3KZOA 1PQWA 3Q5GA 4FE4A 4QOIA 1TC2A 1ZNQO 4QU9A 4TWIA 1R4MA 2BBWA 1VMKA 1H8HD 5K1ZA 1XYVA 3ZNPA 1O5IA 2FN8A 2JZCA 4W8OA 4RTMA 4ZAVA 3BIFA 3HEBA 3R0VA 4BFUA 4FWBA 4MKIA 4C07A 2GBCA 3PFKA 4YRLA 1A9ZA 3RFCA 2YC2C 1XTUA 4XSHA 5FI0B 4B74A 1ONNA 1YCFA 3IT1A 3O8LA 3ZHYA 1GT91 1WCIB 5CFQA 2DMRA 1DCFA 2C59A 2VI5A 4JJGA 4QT4A 2BSXA 3QVOA 1IC6A 4EHFA 2P9TA 4LKOA 4F06A 3L3BA 1B6SA 4OHFA 3N2KA 2XWJI 2C84A 3RUAA 3JZAA 2YUTA 4CGYA 1KR5A 4RTKA 5KJ1A 3JR7A 2JGRA 3PC8C 1BCSA 4F3KA 2CB9A 3HB4X 5C34B 3I1IA 1I33A 4PEVA 3FR7A 3VHQA 4WZBB 2CSUA 4DMGA 4G0WA 4GRAA 2W2QA 1D03A 2EFEB 3G0BA 3KQTA 2Q2NA 1ZVMA 2CSXA 1VBFA 1HDXA 1Q5PA 2PT9A 2C5AA 2UKDA 1XJ0A 3GBPA 3T4XA 4IR7A 4EJ0A 1DIRA 1XJQA 3FUCA 4OATA 3I61A 3PLNA 4TYNA 3ZJVA 1N3LA 4NU0A 1PJ8A 4IIFA 4P4LA 2WC1A 3GF4A 3V2GA 4RMJA 1TJ5A 1QZXA 3DFFA 1II8B 2ARKA 5BSMA 2WSYB 1AMUA 2XKKA 2HLDD 2OZVA 3H5AA 4WNYA 2J7PA 3GAAA 1Y7HA 3N5KA 2C9ZA 1AHNA 4YA6A 2UZIR 1JBQA 2JI4A 2W2OA 2FW0A 2OCBA 3O4GA 3GDOA 3TQIA 4ACAA 4A15A 2WVGA 3DW3X 1UJNA 4ZANA 4ZHQF 3OQPA 1QBGA 1NV8A 2BTQA 3E23A 4HB2A 3MWLA 4Q02A 3CLTD 3K9BA 4LYAA 1ADBA 4G0PA 1Z2PX 3UHFA 1X70A 4AZ3A 3EVGA 2I4MA 4RVDA 3EPJA 1CVLA 1MRNA 4F93B 4GI3A 1DAFA 5CDHA 5HK8A 3JQQA 1USWA 1F8YA 1ZM3A 1CUHA 2CB0A 2Q8QA 3BORA 4FZVA 4MKRA 4S0ZA 5H3CA 3RG8A 2H2AA 3RRMA 2AN9A 4ZVOA 5CH5A 5K2MA 1UC9A 2Y1KA 3BXEA 5H70A 3ADKA 1UZLA 2CNKA 2J6IA 1IHUA 1IVYA 4RCZA 1YJAA 2ZBQA 5JW6A 5KC9A 1N1DA 4C7JA 3RTDA 2ZJ3A 3JRXA 4MPRA 4JLPA 1V5IA 1R4MB 2UVQA 3Q7RA 1NSYA 5C37A 2QRKA 5JBQA 3H8WA 3U3ZA 2X2OA 2B3DA 5LIPA 4QBFA 2GZDA 4QQRA 3UHJA 1ACJA 4LWOA 4G5OA 5ENZA 1LSUA 2J59A 4DLXA 4CL2A 1XZNA 4P83A 3OKCA 1J7KA 3DH0A 5TVKA 2Z1MA 3DNMA 4IPTA 2QK4A 2F2TA 3QF7A 5FAXA 2C5FA 1W75A 1G2IA 5BQ3A 1G4HA 5F1OA 3TXYA 1H2RS 5D51S 4DCTA 4GMGA 2EDCA 1PV2A 1WPXA 1RKQA 2IYXA 3SSNA 3ASVA 4IO0A 3V4ZA 3E7XA 3L49A 3SQDA 1P4GA 1NVVR 4MW7A 4M54A 1U7XA 4ACBA 1M6HA 1PD0A 1MH9A 4J94A 4B6RA 1PJQA 3ZLVA 3K0HA 2XRZA 4E5PA 2YXDA 3FE2A 2C00A 1UQRA 1JKJB 1NTRA 1WCIA 3EVAA 4JLKA 1PZEA 4REMA 2OT3B 4IRUB 1UAAA 2DBQA 4JEUA 5FBQB 3I04M 5CJPA 4F9FA 1W4RA 1YJBA 4JJIA 2ONYA 1GPWB 2Q7XA 3Q7TA 5LYYA 4FCVA 1EXMA 2VKTA 4EOGA 4R71A 5JQGF 4AT1A 4KXFB 2P5TB 4Q5IA 1G55A 2ZS8A 4CM6A 1SKQA 4IHJB 5JH7A 4B3GA 4FI3F 1K3TA 3E9ZA 3VMMA 3W04A 2OQIA 4X1YB 4YRAA 1AS2A 1W5EA 1Q3HA 3HKDA 4FHDA 1BGWA 5HRUA 4CHTA 4QSHA 1F4VA 3AU8A 3GCDA 1U0EA 2BBSA 5B5SA 1H9CA 3HR4A 2CNLA 1WMEA 5F5XA 1CUJA 2ZK7A 2VP6A 1XVLA 3II6X 5CFMA 3ERCA 1PJZA 2CJWA 2VJOA 4HEA6 2C88A 5BQOA 3UAVA 1D2HA 2PGAA 1TJ3A 2IDJA 4FILA 3WFZA 4MV8A 4U2BA 4AO8A 4W7IA 2G0NA 3BMQA 3TN7A 4LRSB 1SPXA 1Z68A 3H6KA 3KKMA 5EC8A 1JE1A 3F6YA 3NTQA 4B6QA 2YXBA 5SICE 4KQFA 2RG1A 1JXAA 3F5DA 5L51A 2BEVB 1HNZB 3BL5A 3NYQA 4TT3A 3T52A 5LZ9A 5HZGA 1RVDA 1AOXA 3ZJTA 3FNIA 1YUBA 1IOZA 2V3WA 4H3VA 4LEIA 1YL5A 4QQKA 5ALHA 4KR9A 1UFKA 3RC2A 4X90A 2ZVJA 3QTLA 1X1QA 4PLZA 4KK3A 1BWPA 1JEEA 1Y4SA 3C6QA 3OZAA 4HQ0A 2I7DA 4IYJA 2BI4A 1VDZA 2XQVA 4D0SA 1THGA 2K7ZA 2AG8A 3LT0A 3PIRA 3HRHA 5TGDA 4HWKA 3AUYA 4GO1A 3W2EA 3KELA 3L7AA 1KIAA 3WB9A 2TECE 1R5OA 3QJ5A 5E6SB 4F97A 1VXRA 2NUPB 3O4HA 4XUEA 1TM3E 3DYIA 4E13A 4KWIA 2H2FA 1NYTA 2R8EA 5T8KC 5EJ8A 1UMDB 3HLKA 4DOMA 2G80A 1OXSC 1VKOA 2Q3EA 3RO7A 2XCRB 3WLSA 1REQA 3C1TA 3DFZA 5B7QA 2C04A 4K9PA 1ZXLA 2Q1SA 5AHOA 5K8IA 4J6FA 4B6SA 1K7FB 2BMEA 1XFAA 3JWHA 3PUWA 1H6DA 1RPZA 4ENVA 1KRXA 1DCTA 4KIJA 3Q87B 1GPAA 5C4MA 1HYHA 3UK1A 3V1NA 4DQXA 3IPCA 2RIPA 1BMDA 2HBYA 3A26A 3LZCA 3BEOA 1IQPA 5B4TA 1M5UA 3SN6A 1EX6A 3C74A 3MCVA 4J91A 2LW7A 4LDJA 3VR6H 2RC6A 3JQBA 3NBKA 5GPBA 5BT8A 2RGRA 1WCWA 2GJSA 4M88A 4E3ZA 3ORQA 3O31A 2F1JA 5JMWA 3GUHA 1K5GA 1ZIYA 4OKSA 2II6A 2XE6A 3EZ7A 1VI6A 4H17A 1FU4A 1JYEA 3QW2A 4W9RA 2KI5A 3REFA 5F5LA 4HNUA 1SD1A 2YWXA 3AEKB 4OK5A 2ZYHA 1AH2A 2ZS9A 3F71A 3MPUA 3KB2A 3MOGA 1DFHA 1YMQA 5HKLA 1N57A 2QYOA 1FDOA 1Z7YA 1HETA 2NACA 2QM8A 3JARB 4X00A 2D1FA 4F86A 3COSA 1QRTA 3E3NA 4RLSA 1J8FA 1DAEA 1RE1A 4AF8A 3WDLA 2Z2KA 2O8FA 5E9AA 2AOTB 1G8HA 3ZZMA 1YFJA 1YS1X 4G0MA 5F4ZA 2E5LB 4EO7A 3T7JA 4IEIA 4P2GA 2W58A 2QU8A 1X1RA 4AJ2A 1R9NA 3OM1A 3WV4A 3GVCA 1L1EA 3I72A 3TL2A 3UKJA 2IYOA 2FWIA 5D8DA 3TDMA 4PQFA 2OEPA 1RNLA 3O83A 4LJYA 4YXWD 2H1VA 4IV0A 4S1TA 4EELA 4RVCA 4LF4B 2ODNA 3UYKA 2DYKA 4OXIA 4ZP1A 3UC9A 2JFFA 2DF8A 4WFQA 5MFZA 2FZLA 2I7VA 1JFRA 1BWRA 3N53A 1JZTA 1KORA 1JN0A 2HU5A 1F06A 4JSTA 2JF0A 4YRSA 1V25A 3RIEA 1FLDA 2BUBA 1FXWF 2WG1A 3H2HA 3QKRB 2VT3A 3LY7A 1HDRA 1T1IA 2ZTLA 6ABPA 2R3SA 3GLRA 1P7ZA 4TWBA 4CF6A 2GETA 2WZDA 1UBEA 4QOJA 3O90A 4WUTA 3PTAA 2YH2A 4IJWA 4BFWA 3MXOA 4FLFA 5EE3A 3AV0B 4IXDA 4U7HA 2VJKA 2FR8A 3OZSA 2FN4A 3WYCA 1CEXA 1QIIA 4RTRA 4DDWA 1YRYE 3CZ9A 4TSFA 4GQIA 2ZI7A 5FUQA 3ETDA 3MCAA 4HUTA 2C7VA 1LLQA 1WPRA 2AB0A 1FS6A 2AJDA 5JJKA 3MILA 2FYTA 3PE4A 2ZWMA 4FCWA 5LUBA 3D6MA 3ZNNA 3EISA 5KWEA 1Y9DA 4R40A 3EG5A 2A9RA 4ZICA 3LBHA 2H5JA 1NMYA 2I1QA 4O2LA 4PZLA 2FEOA 3LX4A 3EBLA 1VL2A 4HNRA 3HM9A 1JLLB 2XKJE 4QXOA 3WLHA 4F5DA 3G0HA 2XUAA 2RBGA 1R5JA 4N82A 4DDUA 4DW8A 3NR2A 4AJNA 4QHTA 4ND6A 4B4WA 1QR2A 3DVQX 3LPMA 4KYVA 4CMKA 4DLVA 2XNHA 3QYJA 3ANLA 4FX2A 1DWPA 4UU1A 1U11A 4KO2S 5DNEA 1OQAA 4RQTA 1WXIA 2HIGA 4HEJA 1HOXA 2VZEA 4BQFA 1MV5A 3X0DA 2D5LA 5KNCA 1E2EA 3GEBA 2ZUDA 2QB5A 2G4VA 3QJYA 4JLUA 4GKVA 2QBYB 1TAUA 4HB3A 3NVAA 3IUJA 4RZXA 4ZOCA 3PXEA 5KWIA 1YHYA 2PH1A 1X1EA 3MJHA 5BWOA 1T8YA 4QRIA 3DBLB 2ANCA 2FPGB 4XPZA 3ZJUA 3B1VA 4BNVA 1ATIA 2JZNA 3GAZA 4NICA 2HXYA 4K6KA 2A9FA 2G36A 4UVEA 2X0DA 2ZJBA 3TOZA 3O26A 1Z29A 2JNWA 1E2KA 2H54A 5C2JB 5IX8A 4TTQA 2TS1A 2QQ0A 4UFPA 2PK3A 2QW1A 3LSYA 4G37A 4MP3A 3OCUA 5I8WA 3K9FC 1P2DA 4L27A 4BO6A 2AEEA 1SCNE 1BCRB 2OAP1 3CH6A 3RJTA 1SVNA 1OH6A 2R6CA 3GJ8A 2OCDA 4WESA 4CLRB 4LHVA 2XRMA 4QFBA 1NF9A 3FPBA 3DLBA 3TOXA 3BTVA 1GTL1 4CKZA 1XU9A 5DNDA 4HX5A 1KAEA 4OK6A 4QEDA 3DEJA 3OZFA 1B1AA 1SIOA 1X42A 5ITWA 1V8PA 1M2OB 2PRIA 4E6EA 4FMBB 4OJKA 4YLYA 5GONF 1I4WA 2O06A 1EX7A 3H2YA 1MIOB 1GKUB 2OV6A 3G5MA 3ADOA 2XF8A 3O73A 2OYRA 2P7IA 3DDZX 3H84A 1RBMA 2AD1A 2YFQA 4RMNA 2XH8A 1QFYA 2YJNA 1O0CA 4D96A 5AO9A 1KFCB 3WNDA 4Q3KA 3N74A 4EEKA 5JNTA 2H7YA 5ALGA 4OBBA 3TZQA 5LQNA 5J1TB 1R6UA 3Q9LA 4F6RB 4RK4A 3SQXA 5L3QB 1PK8A 3D2CA 2F3PA 4OSEA 4RPHA 4WBSA 3W78A 4GOXA 2XCSB 1PGOA 4F7DA 2NAFA 2FP4A 3I8XA 2J5BA 2FXVA 4EB6A 3HP1A 2HHHB 4LW8A 2HMAA 3L4EA 5DCUA 1TTQB 4XX1A 2HA2A 1RIIA 4EP1A 2XE4A 2D0PB 3GZ4A 4WLFA 5JCXA 5G0UA 1G20E 1Y9ZA 3JQCA 4HDSA 2Y6UA 4O4LB 1H2FA 1P2GA 2WFAA 2GDZA 3LXMA 5FCDA 5J2UB 5KTOA 1IBRA 3CNEA 3W0LB 3K8OE 3ZWWA 2EJWA 3LTEA 1ORWA 3HP7A 1QE3A 3ZD7A 2WIAA 5BWNA 5DTQA 2I4NA 2ZEJA 1R37A 3GUYA 5DDIP 5LMNB 1KI4A 1DBSA 1PJLA 4L85A 2ORWA 3BXHA 3BTSA 1M2OA 4DBLC 1ZR4A 3CE6A 3SEAA 1KVUA 1YR7A 5ALDA 1SBIA 4C3OB 5LR6A 3SK0A 4PYLA 2H48A 1ZNWA 1UANA 3JQAA 3E70C 4MV1A 1QPBA 1C8KA 3DFUA 5IULC 2WMYA 2C7OA 2MSDB 2XADA 9LDTA 2NO9A 3K2IA 3UMVA 3VISA 1SVMA 3PQ7A 1R6TA 3JQ7A 4NAVA 2ZIWB 4UC0A 3EGOA 4GLFA 5AJTA 1IULA 2IODA 3RRBA 3WIBA 4B82A 1NONA 2B92A 3P9YA 5IAJA 1IHXA 1RAFA 1N0VC 2WDPA 3L7OA 2NZJA 1CQIA 2C20A 3SYMA 4UUQA 2VLBA 3F8TA 2QD2A 3KEMA 1C29B 5I5EA 4GM0A 4J07A 1RWQA 2DR2A 4Z3OA 2W37A 4HNHA 2JFGA 2ZRNA 5JJIA 4E5NA 5C8VA 3A58B 1DRUA 5IABA 1QVAA 1THTA 4LYJA 4AF6A 5K3DA 3ZK8A 3DA8A 1WZIA 5KKCA 2VJPA 3ZHQA 3AVUA 2H4HA 2PPLA 4KPGA 3WK4A 3AJ8A 1XVIA 2QRJA 3R77A 4Y6PA 2PWAA 5CEEA 5K8UA 2NT3A 2GMWA 3H5TA 3ICPA 3L1UA 3OQIB 2ECQA 5DBIA 4TLBA 3IKTA 3BRSA 3CTMA 5L40A 1N5KA 5HDQA 4G9BA 4S1PA 4X95A 4OFXA 3HN6A 3V00A 2WVHA 2ZBPA 4KU4A 5HIMA 4C89A 3VAYA 1W44A 1WZNA 2V1UA 1BDIA 3AJRA 3DPSA 1T9DA 3R8CA 1TCAA 3W4IA 4EL5A 5KTMA 1I3CA 1KDOA 1YHNA 4O2BA 5DVZA 3G9XA 1S2OA 1MAUA 1QB8A 2K2QB 1MU0A 4FKMA 4DJEC 2ODBA 1IBLB 2JGEA 4LXXA 1OC4A 3G7NA 1MOSA 3BVPA 2HWXA 2FPIA 5HUHA 2OGTA 5B3JA 2QVLA 3GGJA 5LC1A 4DN6A 3MJDA 4QU5A 3WHLA 3ESRA 3I3SR 1LDNA 4FDTA 1PK9A 1U7HA 3DMGA 4UUOA 1XAHA 2GZHA 1JHOA 1BVRA 2WHRA 4RXTA 5EYPA 1X7YA 3WLQA 3ZJYA 1G9XA 4BV8A 1SBTA 3ZGYA 1T8UA 4YAGA 1JHRA 2ZG6A 2GZAA 3ABQB 1PN3A 1Z22A 2IUYA 4HRVA 2C5SA 4LOAA 4GKJB 1MENA 1V1JA 5BV0A 2FGJA 1QVVA 1O8BA 1OAOA 2CDAA 1FFEA 5TY0A 3LC0A 4ZWNA 4AURA 4CCSA 1JXOA 3AUUA 4PSAA 1PYOA 2QRPA 4CTOA 2ZRKA 2QRGA 5DSXA 1RHJA 3WLAA 4WLOA 7REQA 1R16A 4OKNA 3QEBZ 2DY0A 4LDQA 5ALLA 3QVKA 3QUAA 4C88A 1ZH4A 1H2HA 4S1WA 5HZMA 4M0UA 1L7DA 3QA3E 2H85A 1RIFA 1GL7A 5KZMB 2BEKA 4CJXA 4W8HA 2J41A 4NPCA 3WNBA 3ESAA 2QNBA 2OG1A 5ICEA 3G2MA 4U7WA 3HFSA 4CMIB 3U19A 3U4AA 1VMIA 1KOFA 4BVBA 3A4IA 4D8WA 3H42B 1LLCA 1MVOA 2NZ2A 5FO1A 3TIVA 3PLAE 2GEFA 4I1SA 4DA6A 2G82A 3WKEA 5JHHB 4KLCA 2QMZA 1SELA 4BKQA 5LQDA 2WHPA 1IXZA 3OPQA 4UCFA 3KFLA 1GTRA 5KEIA 4G89A 2XUDA 4URUR 1L5NA 1X7ZB 3IAHA 1BXKA 4KX5A 4YB8A 4NSNA 1CY6A 1N5OX 2WT8A 1P7VA 4P8RA 4B6JA 3IT2A 2Y76A 4NECA 1Q17A 2PLAA 2ZIGA 3IUSA 2JFXA 4ZC8A 3WA7A 3C0KA 4LBWA 3OLXA 4Q05A 3VXKA 4DWVA 3U0BA 1DC3A 4FJ1A 4G36A 4JT8A 1BA3A 1PR0A 3N0RA 3RFFA 4ZYVA 1V95A 2XDWA 3ZKWA 4JBLA 4W63A 4OMCA 3MT8A 1KOJA 1IXSB 1LBSA 1Y63A 3N86A 4XQCA 3WOVA 3PCXA 1Y8RA 1DAMA 4PINA 3LM8A 4R1TA 1P1KA 3BRWA 4OXKA 5U9CA 1OA1A 4UM7A 2NU8B 5C8YA 2B8TA 2J9RA 4JIMA 1ZVJA 3B6EA 1M73E 1AIPA 2BGGA 4DCOA 4PNZA 2EKZA 1XA4A 4UAVA 2HJGA 1QOQB 2G09A 3A06A 4QDZA 4C3ZA 1QJCA 1JDPA 3ZCUA 2XYGA 1M8PA 3REQB 2FZ5A 3MW8A 4RPCA 5HOQA 1UJMA 4AYXA 3T1QA 1K97A 1K1EA 1Z9BA 4ZI3A 4GGMX 1XQ6A 2EU8A 2IJGX 2LVBA 3KLOA 3L7YA 2BSAA 5ED0A 4AIIA 5LQCA 1EUYA 5EJ9A 1P0IA 3SQOA 4Y2YA 4C9BA 2H52A 1KKUA 2EL9A 4LOHA 1A0OA 2XWPA 2GPBA 2Z58A 3EUWA 5EJIA 3TLYA 2B8NA 4JP5A 2HF8A 3HCRA 4M2LA 1BE1A 1E2FA 4WK2B 2HCRA 1XX6A 3VX4A 3ZGOA 2DGDA 2HQBA 3BH0A 4FJ0A 4BFZA 4DV6B 3UC5A 4X6LA 1X9HA 4MVJH 4NDNE 3WICA 4EA8A 5KMGB 3BXOA 2YN0A 4LXQA 3VR6A 5FWDA 3T0IA 2PZAA 3CR7A 4MQLA 1TO1E 3H99A 3HZHA 2QUJA 1APBA 4LF6B 3UWSA 1F7VA 6PFKA 1U6JA 3CZQA 4EAAA 5E2BA 1I2ZA 5E1OA 3KM0A 1U5BA 1E92A 3THWA 2PVCA 1DVRA 1RJDA 3ZWMA 3ONFA 4X71A 4CEJA 4D9BA 4WKNA 2BGJA 1K89A 2QG6A 3BAZA 4HNGA 4JEMA 2H0AA 2W93A 2YOHA 1MDBA 2VJCA 1D4AA 1EVLA 3GJXC 4YK7A 4ZAXA 1DJNA 1IZYA 1FSFA 2C0PA 3Q3CA 1AMOA 1G5RA 3R9IA 4V1CI 3B6JA 2L0XA 1E61A 1XWIA 3R5HA 3A4MA 1I5RA 2INGX 2ODEA 3FYTA 1F8GA 2YR0A 1RTKA 2P9HA 1FU8A 3FLEA 3I58A 3RNOA 1CFZA 2WF9A 1PGNA 2EL7A 3KQOA 3VDQA 3ZVLA 4DNQA 5HJEA 4Z8YA 2A9PA 2NADA 5IG2A 2GAFA 4M8NE 4YCDA 5LQKA 3OCCA 4YMSA 3ZDZB 2PV0A 2AF4C 2Q50A 4O3FA 1BFKA 3P0RA 4KGXA 1UBNA 4Q01A 1ABFA 1WXFA 5KO2A 1JXMA 4GDMA 4PGAA 3I9MA 4XTRA 3UMCA 4YHHB 1B26A 4U7DA 4RH1A 1XNHA 1KH1A 2ZJZA 3PZBA 2Q3LA 5JRDS 4ADSG 4DPMA 4U63A 2ZSAA 2W8BA 4BAGA 4ISCA 3ZG6A 4KQMA 4PPGA 2VPTA 3QUQA 4GEKA 1J39A 1NBMA 1V7ZA 3K1ZA 4J2OA 1SC6A 3MYYA 4LGCA 1C8VB 1GSOA 4XD2A 5TS2A 3GUVA 2PWYA 3IP7A 3QPBA 4HBGA 2B37A 4QDUA 2C31A 2JIPA 3CJTA 4P3PA 4CL8A 1VYUA 3EPRA 3ICCA 1FVXA 4E2FA 1GUZA 1XIVA 5IKOA 1VHTA 2HMWA 3Q6NA 3R6LA 1ORRA 1Z6TA 4UXIA 521PA 3MYRA 2YHIB 5CB4A 3A6PC 3EZ9A 2GASA 4O2AA 4AO7A 5ITSA 4X7RA 1T1GA 1X7XA 5CYGA 1Z38A 1SULA 3AZOA 3BB4A 4IQGA 5F4BA 4GOMD 2YWCA 3NFRA 4G0UA 4ROTA 1BWQA 4KE8A 1GD1O 1WR8A 2XT6A 3FJ1A 1E9VA 4K03A 2G9VA 3KKNA 4ZV7A 3TRHA 2OM2A 1AY0A 4M1SA 1VSUA 3OH8A 4RIHA 3A27A 3E9CA 1QLJA 4KHZA 3HE3A 4MV6A 3UT5B 2IRWA 3KYDB 3L0PA 4KJXA 4PYMA 2IOHA 4TL9A 5CXXA 5DLEA 4ZCPA 2X8WA 5KYVA 4D80A 4DA7A 5JSFA 3WRXC 4CODB 3WNZA 2GH1A 5IKEA 2DXIA 3VJMA 1YJXA 4GS5A 3EPLA 3DYVA 5JMOA 3I12A 1DEXA 4LQ4A 3TTYA 2A1IA 4MIEA 2XUKA 1BXGB 2EJBA 4ZVPA 3VTZA 3VNUA 1BZYA 2VYQA 1H2BA 2R8YA 3AHIA 4PLPA 1SQ0A 1YKSA 2XNJA 3H3JA 1N4AA 3U5TA 1QH0A 2ZJ4A 3KBOA 5J40A 3L0BA 2ONCA 1KP9A 2CNOA 4J03A 4OHOA 1QZTA 3ROEA 5TIIA 1J25A 1T1EA 1ZCBA 1DJMA 6NULA 2I65A 1Y5LA 2QL9A 4IGKA 1JPUA 3DO6A 4ZARA 1FL9A 1QH8A 2HRDA 1TK2A 4OJMX 3FYUC 3FNBA 1CUZA 4GI1A 5AI4A 4ZJYA 3TQCA 3PIIA 1QG6A 3T3MB 3QUCA 2TMDA 5K3FB 3AJ9A 4JR1A 4Z1OA 3LOUA 3TCNA 3P2JA 4D57A 1X1TA 2CL0X 1QKKA 1BE0A 1YTUA 4R2JA 4TSFD 5MHTA 3DEYX 4JB3A 4Q9KA 3LNTA 2FOXA 3FWHA 5LOVF 4MVJE 2FP3A 2YVLA 4NLLA 1NJ5A 4C4PA 2ST1A 3CURA 3GNLA 4JKYA 1X94A 2DBZA 4MVJM 1WZCA 2Q8PA 2R62A 2OHJA 2A1TS 1PE0A 4A8TA 4CR6A 1LC3A 1UFOA 1JKXA 3U09A 3F4LA 3ZKAA 4H4DA 1I30A 3CZCA 2QV0A 4BXOB 1E4VA 3HXTA 4NZ9A 1QMGA 4TLMB 1DZIA 2H18A 2H1RA 4R8LA 5FFNA 1J97A 1O3YA 2X2EA 1G3UA 2WK1A 3RABA 3H83A 4AYTA 5BSVA 5H8WA 3F6PA 1V1MA 3CG0A 4KN6A 3FI0A 6AT1A 1KSFX 2OVFA 5LXTF 3WWCA 4URYR 2AIRA 3NO4A 1KJZA 4LA4A 3CIFA 3TLAA 3LTNC 3SBXA 1WXQA 3VU8A 3FUUA 5IS2A 1S3IA 3GGDA 3F74A 5FQNA 2WSLA 1HE3A 2ZXUA 1N2JA 1VB3A 4PNEA 1ISIA 1DBRA 1SXJE 1NJ2A 2BN4A 2I4OA 2VF8A 4C4SA 1NL3A 2GO7A 7REQB 1Q12A 2BFAA 1NXTA 2J6HA 5I9TA 2WT9A 3ETNA 3BRWD 2PSSA 4GXTA 1TKAA 3JX9A 3IUYA 1GYRA 1LX7A 1DP4A 2PZEA 2YJTD 4BEWA 2V3VA 4W1RA 3IALA 2LPMA 5KREA 4IICA 4JLOA 1BQ4A 2HDNB 1JT9A 2O7RA 4S12A 1CZHA 2FSIA 4U39A 1U6KA 3GY0A 3BBLA 1R66A 4HJRA 4MS1A 1CDOA 3ENZA 5GVRA 3WGVA 3HNPA 4N5IX 2QE7D 4N0EA 4P38A 3S2GA 4DZRA 1Q6ZA 4MS3A 2O5EA 3ITKA 3ZCSA 2DX7A 1FDRA 2PX4A 3RAJA 4JI0B 3ESYA 3M2TA 3BIWA 3DHYA 3GMTA 3NRJA 4AY3A 1ZONA 5CM2Z 1C7QA 1XZAA 3CUTA 4CG3A 5DASA 1Z2EA 3TLMA 1U9YA 2OV8A 2Q4RA 2VNKA 1Z08A 3EULA 3OT4A 2HMSA 3MSXA 1M0WA 5P8WA 3S7ZA 4OH7A 2ZGVA 2ZJ0A 3I9KA 4MKXA 5EAIA 3HFJA 3KJNA 5AXCA 5CIYA 2WJJA 1KQGA 5FWYA 2VDQB 4WLEA 4QYMA 1NVFA 2AC7A 4OCZA 4YLGA 2DSTA 2QVZX 1DTEA 2FW1A 1XE3A 2OMEA 3PYXA 4Z7OB 1HKHA 1YTLA 3GW8A 4JODA 2QPAA 3HO8A 4RD4A 3RSHA 2WJYA 3LE8A 1Q0UA 4X1KA 1XCPA 5M7EA 4XR9A 5IJ9A 1MP0A 2IYEA 1ZM4A 1MC5A 3EIOA 3DO8A 4TTIA 3KSBC 1GILA 2FLVA 2RH9B 2RC5A 2UVPB 3D54D 1M3SA 1ZHOA 4XCVA 2B78A 5AKYA 4P84A 3RRZA 3OQ1A 4QEZA 2FHPA 1VL8A 3WP1B 3FBTA 1W1WA 4MUKA 4OHBA 1XRMA 2OHOA 4KAAA 3ZZUA 3E18A 4DCGA 2WOOA 3DZKA 2OC4A 4J4TA 2GNOA 1A77A 4HOYA 1JR3D 1W2HA 1O6ZA 3QU7A 4OOFA 2CNBA 2UUPA 1YS4A 4Q03A 2NU9A 4RH3A 2W70A 4FGSA 2H57A 1E1DA 1FUKA 3DFKA 3GD5A 2JVJA 2VPXA 4K8OA 3R5KA 4K9QA 5F35A 1IN5A 2Y1GA 1GZDA 4OQYA 4RHYA 1NW6A 3LOPA 4F38A 2A5JA 4LXHA 1G7TA 1ISGA 4X5OA 4XLZA 3IEXA 1E2MA 1S6YA 1YBAA 4UTPA 4Z7NB 4PO3X 3ELWA 3QLJA 5IZ4A 3D3JA 1GGKA 3CGGA 3EIFA 3K4HA 1RJEA 1ZHHA 2GSDA 2I3GA 3O1JC 4JVNA 2CHEA 1I1HA 1MO5A 2VHWA 2UDPA 1J8YF 5FLEX 4DYDA 1POWA 2BDUA 1U1EA 3CB2A 5DH9A 1TQ6A 5F2KA 5CUQA 5DIFA 2DWPA 1XALA 2HPVA 3SX4A 2YZ7A 1KAQA 4HPJB 2A84A 1KK3A 4L08A 1NMSA 5EIHA 4QRHA 5IPFA 3GCGA 1GN9A 2JFPA 3DCIA 1YDHA 1W5TA 1OFGA 3UPUA 3W8NA 2CE7A 5CX4A 1F9AA 1TUBB 2ZTMA 1B6GA 1KH3A 1YACA 3BE5A 1A8SA 2HO5A 3DZ8A 4QYIA 1B6RA 3PKJA 3OKFA 5TQ0A 1SMKA 4MULA 2XOKD 3MK31 4LDAA 4M1TA 1AD2A 1WXGA 2I4IA 1N5MA 1PVDA 4EAQA 3NDIA 2YYSA 5JXJA 5DEIA 1WB5A 2C3MA 3BCSA 4GICA 5CA1A 1W36D 1O89A 4IHAA 2VPWA 1Q7BA 3UWPA 1KA9H 3UFXB 1ANKA 2I6SA 2I6TA 2YWJA 1EUDA 3DGEC 2D74A 1G8YA 3I5UA 1I4OA 5SY6A 1ODTC 1M6EX 4M99A 2ZQZA 2HPAA 1ZA2A 1NW9B 2AZMA 1A9RA 5A02A 3DXXA 4KE9A 5J5CA 4DMUB 3RVNA 3SOZA 1EP9A 1PS9A 2ZIFA 5IP5A 3RUHA 4AB1A 3QPCA 1L4FA 1IY8A 1XVUA 1JH9A 2R6GA 2R1TB 3MJRA 5DV9A 1AC5A 1DQPA 3H5WA 5CFPA 2OM6A 4A8HA 5MF6A 1SHTX 2IY7A 1IZ9A 3EC1A 4QJ3A 3GEEA 2IT1A 2Q4OA 4FX5A 5DMXA 4NZYA 2IHJA 1YI8A 3N8NA 1Z47A 1J2RA 3Q8WA 4XYBA 1CD5A 5T3UA 1XQ1A 2Q4EA 1NATA 1OH7A 1R9GA 5AW5A 4Q7EA 3GLHA 4GW3A 4IOMA 1I6LA 1J9EA 3OIGA 1OX6A 3TXAA 3L7BA 2A4MA 4R7ZA 3WDKA 4BMSA 3DTVA 2OL4A 2PYIA 1RPTA 3F1KA 3G1TA 2DHDA 3L9WA 2HU2A 1U2DA 5L7TA 1GSHA 1LWOA 1ZN7A 1TT5A 3DOJA 3L8DA 4J75A 1H65A 4JX8A 3RQIA 1TQHA 1O96A 4P08A 1CQJA 1HLDA 2EV9A 1T15A 3B3FA 3VKHA 2QM7A 1JP7A 1KC3A 1NQOA 2B2XA 2PXHA 3CF6R 3HVKA 5FTNA 4DSAA 5HOEA 1FYXA 2G70A 2ZUBA 2PMDA 4I0WB 2Z5LA 5E3JA 4EECA 2IPAB 3FPSA 1RM4A 1AF7A 2CMFA 4YAOA 1FJ2A 2D54A 3IRUA 4I5DA 5A4MS 1JNYA 2H4WA 3ZW8A 5L6MB 3MMZA 3JVUA 3NJRA 4KQGA 2O8CA 3JQGA 2F55A 4GVLA 1TYCA 4UDXX 1GR0A 2WYUA 4OV6B 4BVLA 3LMKA 4FXPA 1PWYE 2ZBEA 1L5GB 2HV9A 5LKRA 1QP7A 1XB2A 3QVWA 4YRCA 5DLDA 2JH8A 2Y0EA 1EK0A 1YJ8A 2F1HA 4LBYA 1KY3A 4MUIA 4JI1B 5JPCA 2PAAA 3H1TA 4D45A 1VE9A 3EXG2 3HYLA 1ZRMA 3HGMA 1RCFA 2I4TA 1BAPA 1Z0FA 2QN8A 3R3WA 1H5QA 2IA5A 3BDIA 2OILA 1W88A 2CY0A 2H2GA 3HKBB 3FDXA 1OA0A 3OO1A 3JZIA 4RC9A 4TKZA 2P67A 3ZWDA 4QA9A 2YS7A 4QD3A 1U1IA 1M34A 4GXQA 3TZBA 3ACBA 1C7IA 2BHRA 5FJIA 3I2FA 1NKTA 4TV8A 5JPIA 5JUWA 3PQ6A 2MYUA 4I4TF 2IX9A 1KO8A 1CNMA 5A3JA 2WICA 2XUIA 3EIXA 4NJOA 5JSQA 1HBJA 1ZN8A 5TF0A 4ZT3A 3ZGXA 1WPQA 3HS3A 3BA6A 2HA3A 4JH0A 1ECFA 1YRWA 3D8HA 4WGGA 3AKCA 3PX3A 4H7JA 4P3YA 1AKUA 4HX2A 2PJUA 4JQSA 1OVMA 1JEYA 4Q93A 3KDAA 3PQ5A 2YWRA 2O2CA 1U7TA 3GDHA 5KWSA 2YYZA 4ALKA 3W06A 1I0LA 1NGSA 2TSYB 5CXQA 2OYSA 5KTSA 5HQJA 4GL4A 1NN0A 3IQIX 4Q4JA 1FUUA 5FB3A 2XJ4A 4FEEA 1R00A 4Y1GA 3VNAA 3OQNA 2VNSA 3EXEB 2BZ1A 4X1OA 5L7YA 2IVFA 3SDSA 1DPFA 4OVKA 1WVGA 1V39A 1ID1A 1CE8A 3SBEA 3HEAA 3LUPA 2BWJA 4P7KA 2ZRFA 4MW5A 2GPAA 1SOAA 1Y4DE 2REQB 4EG5A 1PDVA 1VJ0A 1WG8A 2VRCA 1LGYA 3TNFA 2BD0A 5FFMA 5K03A 3UXMA 1GG8A 2YMQA 4TYPA 1CRLA 3D4NA 4RPGA 3U7QA 4KRGA 5JADA 4RDCA 5EWJB 1IWBB 3KG2A 5DNAA 1P0QA 1BWSA 4Q4CA 1DKMA 1S0UA 2C07A 5DBEX 1E1NA 3H9EO 3BDVA 4EHKA 5J2UF 3VR6D 1I36A 1USGA 3SF0A 3I45A 3DBHA 2PZMA 1EE9A 4GI5A 4BMNA 2Q28A 4O02B 2J7KA 3FWNA 1QHEA 2Z57A 3GPCA 2O2XA 1RJGA 7YASA 3FI9A 3E15A 2XAUA 5FBVB 1NHWA 4F1KA 4RO0A 1P44A 1KI9A 1OE0A 2V98A 3VJLA 5HQ3B 2G28A 2XWSA 3QIAA 2HPHA 5HGXA 3ZX5A 2VZ8A 1X7DA 2BJVA 2J6CA 3ILSA 1MB2A 3QOXA 1NC1A 4ZT2A 3C3YA 2DHRA 3WGNA 3ZH2A 1JKFA 3WGJA 4BZZA 3RFVA 1LK5A 3MT9A 2YZMA 4MW9A 1QIMA 5C35A 1LQTA 1PW7A 4PR0A 4KXWA 4N8EA 4V3CA 4A7PA 5BNTA 4Z4IA 3TB6A 2R00C 3BWDD 4RY9A 4KOEC 1YDGA 4XQEA 2F1RA 2ZT5A 3FWPA 4LV5B 1GA1A 5B1YA 1J0CA 1TEHA 2JLRA 2C2ZA 2IYTA 3MGCA 3BE6A 4HMPA 2P3LA 5EHIA 2VTKA 1VCMA 4C6TB 4IMPA 4M7PA 1BKSB 4UMVA 5C1OA 5FAKA 5AW3A 3S8EA 2OFWA 1VKZA 3DMNA 2B8JA 3A6FA 5AK0A 5FUBA 1YZNA 4WPGA 5CNKA 1XDDA 2OOKA 4JHLA 5BW5A 3W5DA 1TB4A 1TIPA 1WSAA 5G53C 2ZJ1A 3AV3A 4F92B 2NW6A 4LC0A 4Z9AA 3EY4A 3GGCA 3AP2A 1VRWA 4P5DA 4TV8F 1I7NA 2R47A 4DV3B 1OXBB 2BUAA 4Y0NA 4IMJB 1GZUA 3BHNA 4UNIA 1G1AA 3O8OB 2BFBB 4K2HA 1PWEA 3ADBA 2FPKA 3IEKA 2PGIA 3EFEA 1SB8A 2AN1A 1C1XB 3K7EA 3NCTA 4UMFA 5CVVA 2QGZA 4NMHA 4ENUA 2OO7A 3TSAA 3PXCX 4WE3A 4BQPA 3IUMA 1GGHA 3CJQA 4KYIB 2E49A 4V0QA 4NFYA 4Y1RB 1HORA 3DZHA 1I3LA 3W5JA 2FTKE 3HUUA 5DTMA 5A3QA 2HT1A 4W5NA 3JTMA 4B75A 4G5HA 1XMJA 3EXFB 2QD5A 3AVVA 1FFCA 5JYCA 4W6ZA 4GOLD 4LRQA 2JB9A 3SDZA 2ZR7A 4L75A 5KTNA 3LX8A 3M6WA 1PFWA 3O2QB 5ALZA 4OX9B 1OFUA 4C01A 2ZYAA 2BH2A 4AO6A 1SB9A 3ZWVA 4CZ2A 3K0FB 1C0KA 1JALA 4CTJA 5BQFA 3A6KA 4NI5A 4EBFA 4DIDA 3ZIDA 5KS2A 5F64A 1E6WA 1U3TA 3DJFA 3LAWA 5JCOA 2HM7A 3KVRA 2WAMA 1T6BY 3DCNA 4HWRA 5FPSA 4QFMA 3U62A 1UF9A 1SPBS 1WB9A 4RZHA 2CCJA 3H11B 3M3PA 4N76A 4IDFA 4F4FA 1AB5A 1GKYA 3GELA 3RF6A 2WWYA 2IPMA 4EHBA 1E89A 2XGOA 3HHEA 4HAZA 2RHDA 1KNQA 2JKVA 3C3WA 5JV5A 1DAGA 5I4BA 5EZ5A 3SEFA 2NV6A 4JEHA 1ZIOA 1EU1A 4A26A 3R5JA 1K63A 4AN0A 1PZXA 4EA9A 3MRTA 5A06A 5MN5A 1L3BA 4F2GA 2ZANA 1UT5A 4CQMB 2BJWA 1UP4A 4IIHA 5JAPA 2KJQA 3GDGA 5DGCA 4QG7A 1GDHA 4NYMR 3ROMA 1C50A 2QR3A 3V8MA 4RGQA 5K3FA 5NULA 1DI0A 4PYJA 1M1YE 4M0DA 2H63A 4CCWA 4Y2QA 2G7MC 3K09A 4NNPA 1XHEA 2C92A 3IMFA 2ID4A 2P79A 1DOZA 4JLBA 3R3ZA 3NJ4A 4WJKB 5DISB 4N65A 5AR1A 3JVEA 2C3YA 3SVLA 3FPAA 2WG2A 1BD4A 5L4LA 4TV9F 4FHGA 3L7MA 4FI3C 3CEPB 1RHUA 5KPDA 4GBJA 2J9XB 4Z7QB 4L8FA 1WXDA 4EUEA 1BQEA 4JL5A 5FTMA 3CUVA 3W6PA 1T10A 1C7ZA 2RGCA 4NFHA 1J2TA 4IZ6A 4RACA 2CHGA 4D9HA 2ZFUA 2NQ8A 2RG7A 1EGQA 2NSDA 5F76A 3ZDXB 3EGXA 3FG9A 3BMNA 4RXUA 1LDGA 3NDBB 3KPUA 2ZETA 2ZLBA 3EUEA 1N0UA 2WM9B 2OXFA 3STXA 1NU8A 4PN7A 1U2PA 2A0UA 5GWXA 4LY0A 2N1MA 1GGEA 3FUTA 3CF4G 1U1CA 3R7WA 4DUZB 621PA 1TVKB 3N7UA 1AKQA 4MYHA 4UUMA 3PWTA 2FK7A 3VU3A 4F11A 2PM8A 1DBWA 1M7BA 3NWPA 3SS8A 4P7GA 1B6TA 1AGPA 4WY8A 5EP2A 3ZVMA 1P17A 3JQPA 2CXPA 1JTVA 1UPTA 3B8HA 5D6NA 5EEHA 2L19A 3IYLW 5DYIA 5DGHA 4D3FA 4BV2A 5ALFA 4QM6A 4DIEA 1NNLA 2O0MA 4F71A 1NFRA 2IKSA 4H1HA 5EVJA 4HNAA 1KYTA 4FR2A 3M5DA 5HIAA 3WAKA 2Y6VA 3K35A 2IEDA 3F9IA 3L0OA 4HAYA 4QQNA 4CYMA 4DS3A 2NPOA 4PPNA 3OEED 3UK2A 1F2TA 3GQBB 3P9ZA 3IXQA 4AXXA 1DIHA 1QLHA 2SKEA 3OX1A 2XGSA 4QYSA 4UUAA 3PTZA 3EXIA 3RVRA 3BIXA 4B1FA 4F3YA 3FOAA 2QVXX 4XWAA 4YAFA 4PF1A 1IM2A 2QOEA 5CPFA 3I9FA 3MG9A 4DQDA 5DMHA 1IB6A 1TJ4A 3BX1A 4QHSA 3QMMA 4DILA 1M83A 4IEEA 5B55A 5KPJA 5BV7A 2BIFA 4DC0A 3WRWA 2HDWA 3KL4A 1C1YA 2ODWA 1SVLA 2VIIA 4NZPA 4DLLA 1U0RA 1FXUA 2WUFA 4UEQA 1CFJA 1XQVA 1SVKA 1G66A 5DRYA 3WHIA 1Q57A 3V8BA 3R3YA 4UVDA 5B2ZA 3SU8A 3U7JA 5LPNA 3TIGA 1X1AA 2CXOA 2PMEA 3ELYA 5L3SB 5DX0A 4MB6A 5HIJA 2WWIA 3I9V6 3B12A 2ODQA 2C5GA 2YVQA 2WTEA 5KTYA 1LPBB 2C95A 5CM9C 5FNZA 4OJTA 1P2FA 1YFKA 1DDIA 2ANBA 3ISVA 4TN5A 3BJEA 4HTFA 1HLFA 4INAA 4B44A 5B12A 4HQRA 1CUSA 1ND6A 1ORHA 2AT1A 5ALMA 1LBHA 1I2DA 1E1QA 1JKMA 3EDMA 2VHQA 4Q21A 1HTWA 1JAYA 2Q2VA 5THKA 3T0FA 4QGSA 5FHQA 1E62A 5K0LA 4YPVA 2D5IA 2AI1A 1NW7A 1B3BA 4RVNA 1KK2A 3EC2A 5AJVB 1WBBA 1MOZA 3AEKA 1DEOA 4UZFA 3VGJA 3FTNA 1Z63A 1IJBA 3IQGX 1C80A 1JLMA 1UPAA 2RMKA 5FOWA 3Q6MA 2Y4OA 4Q9NA 4MRAA 3ZW9A 1HI9A 4ZEXA 4ZVLA 1RHMA 2FR0A 2PX5A 4JJ7A 3ADDA 3TRKA 1QXSA 4I66A 5K6RA 1DC5A 1UDWA 3NBFA 2E4ZA 3WGUA 2E0IA 3OZIA 1NYRA 2YBDA 1O0SA 4FGZA 3R7WB 3U56A 1RDFA 4ZZ1A 4KO8A 4QE3A 3GLKA 3N8DA 3W7BA 1EHCA 1K4YA 1G2QA 3H8VA 2Q6VA 4WOKA 2OD2A 4WSOA 5IK2D 1AQJA 1OLSA 1Z07A 4N4AA 2EHJA 5EIBD 4PIVA 2NNLD 1HLGA 3E81A 1O57A 5A9TA 3V8VA 1M10A 5JNRA 1ZU5A 4DLWA 4NOJA 3MAJA 4RS3A 5M2QA 3G5TA 1N33B 2WLSA 4MAFA 1RYEA 3MCTA 4DG9A 2VUSA 4CIVA 1N4DA 3DDNA 5T4BA 4E5KA 5AM2A 3W5AA 4C14A 1SUPA 1TF5A 2JGIA 3OICA 1A4UA 3KFXA 4QTZA 2HMUA 5AKIA 5FUWA 3PC2A 3KQUA 1G5TA 3C3MA 3T1NA 2OTCA 1L7XA 1Q95A 2QLBA 4HC4A 2CXRA 3AJDA 1DRWA 1SXGA 3VBCA 2X7XA 3X44A 3G82C 3P27A 4BQIA 3HR7A 1QAMA 2FSPA 5LU9A 4KVAA 1YNSA 1T4CB 1G21B 4ZXFA 3I64A 3ZDAA 1TUIA 3I92A 3KQPA 4D92A 4DWOA 1HYEA 1E79A 1RI3A 1QV6A 2VP4A 2DPXA 1KZGB 2J4DA 3AP1A 1R8YA 1RI2A 2E6UX 3OAAA 2JJ2A 1XYGA 4TKMA 3RUIA 3ZV6A 5K7SA 3T9FA 4Q9AA 5DSTA 4MKGA 2G5TA 3FPFA 4JQCA 4AICA 3NLLA 3VHXA 1OB2A 1AO3A 2A57A 4DQVA 2JFZA 4HGRA 5EJAA 3CKYA 2HDHA 1OJLA 3KJZA 4JVMA 1N9GB 1XI2A 4UZSA 3BA1A 5DU2A 2A0XA 2XQIA 5GZ1A 4MV3A 3LLCA 1W59A 3HC7A 1LW6E 1XTIA 3HB5X 4KO1S 1UPUA 5A1JA 5K0EA 1T9GS 3OTOB 2A92A 1SK9A 1KBZA 4F2PA 2OK8A 1HDOA 1Z3CA 2DPHA 2GZRA 3BD8A 3K9GA 4PO8A 4C04A 3PT9A 1FMCA 4TTRA 4EPVA 1RRPA 1XZIA 2VUHB 2LCQA 3ESBA 4ITVA 1OIXA 3Q2KA 1EBUA 3D7SA 4RL4A 4XWWA 1LJUA 3IOYA 4B6GA 3GNQA 3LXRA 3WKBA 4KQIA 1RYDA 4Z54A 3RYIB 4XB6B 4TWAA 3MB5A 1RWMA 2MMCA 2I3AA 4TVBA 2VA8A 2J3LA 2DPMA 1JG2A 3CE9A 5DIZA 5C81A 3VZRA 4BP8A 3SZOA 1T0JB 5AKKA 3VKWA 3LX6A