1C41A

Crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
195
structure length
165
Chain Sequence
GPTPQQHDGSALRIGIVHARWNETIIEPLLAGTKAKLLACGVKESNIVVQSVPGSWELPIAVQRLYSASQLQSTGPFDALIAIGVLIKGETMHFEYIADSVSHGLMRVQLDTGVPVIFGVLTVLTDDQAKARAGVIEGSHNHGEDWGLAAVEMGVRRRDWAAGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
pubmed rcsb
source organism Magnaporthe grisea
molecule tags Transferase
molecule keywords LUMAZINE SYNTHASE
total genus 58
structure length 165
sequence length 195
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1c41A00
1DI0A 2C94A 1C41A 1NQXA 2A59A 1KYXA 1HQKA 4J07A 2A58A 2OBXA 1T13A 2B98A 1KZ4A 2C97A 1NQVA 4KQ6A 2O6HA 2F59A 1C2YA 2A57A 2I0FA 1KYVA 1NQUA 1W29A 2C9DA 5IM4A 1RVV1 2B99A 1KZ9A 1ZISA 1NQWA 2JFBA 2C92A 1W19A 1XN1A 5IM5A 1KZ6A 1KZ1A 2VI5A 1EJBA 1KYYA 2C9BA 3NQ41 3MK31
chains in the Genus database with same CATH superfamily
3T5BA 4C3UA 4MP6A 5LOVA 1HC7A 1WHTA 3HV0A 1QK3A 4Y30A 4ZYLA 3N58A 1L7VC 3ZWDA 5I9LA 3QJYA 1JLLA 2JGRA 4OB8A 2NU7A 1ILWA 1ZCJA 5KQMA 1G8SA 4XIFA 3GPDG 1JTEA 4AF8A 4WZBB 4LYGA 1NBMD 1PNOA 3PUVA 3QPVA 4WUVA 5DTRA 3ZTWA 3KQKA 5E0OA 4LHYA 2H65A 1TL7C 3OFND 5DEOA 4ZQEA 3IEMA 4TSKA 3RSSA 3FXAA 5JXWA 5KTMA 1G21B 4M22A 1JBEA 3CLTC 2P78A 4J2TA 4YAGA 4GPZA 4FSXA 3FVTA 3RM3A 3IPAA 1XXHE 4EG1A 2K2QB 3D5QA 1M7HA 3ZD8A 8LDHA 1GPLA 3WSWA 2I76A 3OE7A 1NDHA 3ZJYA 3RLIA 1GNRA 5I47A 4PPGA 4BRWA 3GRPA 4X24A 3THRA 3CX8A 1RAGA 2HRBA 4QPZA 3QEBZ 3OWXA 4IIBA 3VTZA 3ANSA 4AY2A 1H0HA 1WDWB 5IKOA 4I4IA 1HUQA 3R7NA 1NDQA 1DX9A 1YB2A 4KXQA 4OMDA 4LRWA 1NHGA 3E9DA 2HDHA 2K4MA 3M6FA 3RF6A 5CDYA 3KQLA 3UB3A 1UMBB 4MB2A 3WFIA 4K2AA 2VF4X 5DLEA 4CMEC 2HHJA 2J7PD 2XF2A 3HYTA 4M3NA 4F6RA 1S01A 4JR2A 4O29A 1XZJA 4QEZA 1P7CA 2H7XA 3RC7A 3HY6A 5IJXA 4M1WA 3I37X 1D2AA 3KK0A 5ALVA 3BSYA 4KKXB 5K0TA 3EBOA 2CV2A 1ZGAA 4ROTA 5JCOC 1Z2EA 3G7SA 1AVTA 3GRVA 4ZVSA 3MUEA 2UUAB 3IVCA 4ARUA 1N1DA 4HP8A 4TS4A 3X1XA 1LWOA 3EQZA 5CFPA 5KSPA 3C98A 4KG7A 3QY9A 1I3MA 2JATA 2NTVA 2HBRA 1WAMA 1XTZA 4LKOA 3L8MA 3CF6R 3DQQA 2BZ0A 3AONB 2V59A 1AIPA 4HAWA 3OM1A 4KMMA 1ZH2A 2BMWA 2PGDA 4DLUA 3WKCA 5TQJA 2W71A 3EDQA 3RABA 1DXQA 1XRNA 1JSZA 2PQ6A 5TQ2B 3W4KA 4DMRA 3EDCA 4DJAA 2WF9A 1YRHA 5DISB 2ZUVA 2CJPA 2HMVA 4GPIB 4HNQA 5TMBA 2P9BA 3OH8A 3AERB 3B89A 4XQCA 5FOSA 1OUMA 1UBOS 3TKYA 1AKWA 2JL1A 2XMPA 3DF9A 5CIQA 4DY6A 5B64A 2YRFA 2FEKA 5D85A 4MO9A 1YDHA 5GY7A 4DIBA 3CR3C 5CA1B 4UXJA 2DE0X 2DY1A 3M2TA 1B16A 1O97D 4C76A 1ZFNA 2I8LA 3MWDB 3B12A 5YASA 2QAIA 1E1MA 1XVAA 3CMCO 4NP6A 4G01B 3ROPA 3WQQA 4YPVA 4ENQA 1QYCA 5JNSA 2F4NA 3AJRA 2HQRA 1V43A 1DI0A 1WMEA 2GEVA 1CEYA 1CSEE 1FDSA 2A94A 1U8XX 4E70A 1TVMA 4G0UA 1N7GA 1NM5A 4WFQA 3GF4A 3D8HA 2V4MA 1T3ZA 3DW1X 4EA8A 4L15A 3U61B 1U2EA 1XMXA 3LP6A 5ALPA 4G4SO 3QY0A 4EG4A 4GL2A 3UAOA 2PRYA 5I9SA 2I71A 3S0JA 1ZHHA 1ISSA 3U4AA 3ZWQA 2NU9B 2QP4A 5KNDD 1DTWA 3PUWA 4HK4A 4MS4A 2A1UA 1DB3A 3UW1A 1XZGA 2VTBB 1L7BA 3D8BA 3SY8A 2ZR0A 5FV4A 3O3NB 2WVGA 3E9RA 2JFPA 1JXQA 1ODLA 3BXPA 4MUEA 4NS1A 1Z8FA 4NU8X 2MTBA 3AR5A 1I80A 2JJ1A 4K86A 4KODA 3SYLA 3F7MA 4BBZA 3C6MA 1FZTA 4RS3A 2NGRA 5I8PA 3R8XA 1IY8A 1U7WA 2HUPA 5DBIA 5IT0A 4Z4HA 5L6MB 3H2JA 1SUSA 1TTQB 1VJGA 1UEJA 3IBGA 1CY8A 2IV3A 3OUUA 1SVUA 3UT5B 1YA4A 2UU9B 4L78A 3AV0B 3BJEA 3HA3A 2FZEA 2BEVB 4AZSA 1KKMA 1DOHA 5K45A 1SQFA 4AWXA 3QYAA 1C8BA 4X1YA 2RB4A 3LO8A 2CFIA 3E4CA 3L7LA 4LZWA 4OLAA 3EQ2A 3ZZTA 4MGIR 2X23A 3FFAA 4HGNA 4ZVRA 3N3AC 2AWOA 1BGXT 2A5LA 2H17A 3KB6A 4QUEA 2WAAA 3FD8A 4R51A 3UC5A 1JKXA 3M1YA 3HP7A 4G0PA 5AVSA 2JLCA 5KJEA 1U6JA 3P96A 2ZJ8A 9GPBA 1WMAA 3G17A 1U11A 2IK8A 3GGPA 3RSQA 3WGQA 4V2IA 4FCTA 3L1IA 3UMGA 1I2ZA 3HS3A 2IUYA 5IWAB 5JNVA 3DA8A 1Z7GA 2WU8A 3NYIA 1N34B 3L7YA 4C06A 3PGKA 1IK4A 3NBMA 1WOYA 1KVRA 1L5ZA 2V8OA 2XD4A 1Q0TA 1YZKA 4OFBA 5C8YF 5BW8A 1TEZA 2O8FB 3DVAA 3BTSA 5G4KA 4P86A 4EG3A 1ATIA 2I7XA 4MUBA 5E4FA 3F6SA 3I30X 5JRJA 2WD8A 3O84A 3T38A 3L8GA 1WULS 4B43A 1Z37A 4P4SB 4RTMA 5J1TB 3OM8A 1FP4A 2X3YA 3OY2A 2XCIA 1I2AA 3TFQA 3SFVA 4II7A 2HT6A 5C1PA 5HE8A 3VPAA 3DPUA 3MTIA 2X3UA 1FFEA 3STHA 5MFPA 4EPRA 4AD8A 2EFGA 1G0OA 3ZNNA 2CLMB 1WX1A 2OHGA 3DLIA 5JADA 3QQ5A 2JHPA 3W3AH 3M8KA 3ECSA 5SZJA 4D0RA 3E8MA 1QVZA 2WTBA 1ISGA 1EP2B 2ZVQX 1C4XA 1K7YA 4FWIB 1G7TA 2GWRA 4TMYA 3SHVA 1FS5A 3HCNA 1QVWA 4FLFA 3C4QA 5A2GA 3U39A 3H1AA 1NATA 1RYZA 4BNLA 1WBJB 1J1ZA 2VJNA 3GC6A 4MWCA 3A36A 1C7RA 1VA5A 3RKUA 1E3WB 4NEQA 4BFXA 3CVXA 4I1PA 1LRLA 3M6WA 4XJSA 2AOTB 3COPA 4N3GA 1YRQA 2ZIUB 3E2PA 3MSXA 2VZ0A 4KOAA 4EGFA 2QZ9A 2XA9A 3CVJA 4H15A 4B3SB 1V8FA 3KZMA 2INGX 3CRW1 2BVNA 4G5QA 2H9YA 5HGJA 5K3SA 2R5FA 2V4UA 2ODEA 3VU8A 3PNQA 1N2XA 4LXGA 5CXSA 3RYCB 2O8BB 3PWSA 5TEVA 1AN9A 4ZVQA 2AE1A 4A23A 1HR0B 2C54A 3QOYA 2Q3DA 4MQMA 4AO8A 4I46A 3UK2A 3MHTA 3N6XA 4C3VA 5AFSA 1AN0A 1IZ9A 1W5AA 2VJOA 4FE4A 4N3AA 4I3GA 2O3JA 2ZBUA 4Q37A 4DSTA 4OM8A 3ETDA 2OE2A 2E5FA 1SZDA 3D2BA 4JD5A 3N8DA 3TOSA 4B5LA 2AFHB 4GSKA 2UVQA 1SQ6A 3OZSA 2BM0A 1JU3A 4FJ2A 5A9RA 3P9SA 1JSCA 2JBAB 4Z9YA 1B4DA 2OZKA 5JV5A 3PD7A 2ORYA 3B9PA 4WESA 3LY5A 2G1KA 3SK0A 1OIWA 3OIDA 1IAQA 1JPNA 3LECA 3G9UA 3E61A 4A0HA 4IF4A 4F85A 2D2IA 4M2LA 4R2JA 2ZYSA 3T7RA 4HH1A 2QVGA 1SFRA 1SKYE 5I4IA 2UKDA 3QMWA 2IU3A 4QG3A 3AB7A 4LVUA 4RD2A 1PV1A 1VHDA 4AZ0B 1IY1A 3G9ZA 1VL0A 1USGA 4FZVA 1QQTA 4O2AB 2W5UA 4QA9A 3GLIA 4B8YA 3O9VA 4FSHA 3LBHA 1TW2A 3GJ7A 4X1IA 5FWDA 1ZJ4A 3HZZA 4A0RA 1Q19A 1U6IA 1YF3A 3RBXA 1W19A 4X20A 1T1RA 4HX2A 1QC5B 4QJ5A 1J39A 4E14A 4CEHB 5B1DA 3Q40A 4JVOA 4DUGD 1UT5A 1YCHA 2LIPA 3DC7A 3H6HA 4ZAGA 5EGSA 5FNVF 5HF5A 5JYDA 4JJZA 1JXAA 4B3CA 4W1SA 2R00A 1O6FA 1FP1D 3O95A 3SQDA 3RAJA 5DTQA 4Z8XA 3LUGA 3RWMB 4BAGA 3D0KA 5KOYA 2YOGA 1EM8B 1TF5A 3THWB 1TO1E 3AYZB 4G6ZA 5JW6A 3ESBA 4KQXA 4CT4B 5EKXA 4DSZA 1TK9A 1JBKA 1U28C 2QUBA 3LPAA 2HLNA 4Z3KA 3GWZA 1N78A 4GMHA 2QE7D 2Y27A 2OXIA 4OHPA 3O8QB 4KREA 3G2PA 1V7PC 3KYDB 4G84A 4RD1A 1A8QA 2WJZB 3FOCA 3LK7A 1YI8A 4XWOA 4UQOA 2Z9BA 3QFRA 2ZG6A 5C7LO 3DDWA 5F1KA 5K2MA 4E2FA 2ZSEA 4MUKA 1FSGA 4D9BA 1MAWA 1VHQA 2ZT8A 4ZVMA 5ITVA 3NNDA 4TT8A 5LWHA 2VJYA 1T4CA 2GF2A 4QTTB 3E8XA 3BQMB 4DA0A 3MYYA 1FYEA 2GBLC 1XDUA 2HEIA 4BGVA 2CL5A 1CU1A 2QUHA 2ZITA 4CI9A 3H5NA 1C1HA 1TF7A 1YWGO 3BWDD 1THZA 4YDSA 3VU1A 1V4NA 4F1KA 1A2QA 1G2QA 5F2NA 2AKEA 1FW8A 2ZTSA 4WACA 2VP4A 3GRUA 3LP5A 1DFGA 4ZCTA 4C6RA 2AA3A 2CMFA 1C9NA 2G40A 1RJGA 1SOMA 3EVNA 5FNZA 1I36A 4JLWA 3ZWCA 1M2JA 3TNJA 4FWTA 4Q4DA 2IYVA 2W2KA 5CNKA 1R88A 1S96A 4QOIA 2ZDGA 2CJWA 2WFAA 3KAKA 1XN4A 1F2DA 2WM2A 3THSA 3NO4A 4OH7A 2ZCUA 1IG0A 2NAFA 3A37A 4BQNA 4GQAA 1Z6PA 1EFDN 3K4QA 4CEJB 1OX4B 4RHCA 4CZ2A 1JB9A 1GZ3A 1NZJA 2AOUA 2L19A 2PL5A 4M1KA 1DAFA 4V0MA 4J1SA 2VK8A 3AUUA 4QFDA 2IKSA 1JS1X 3OZ7A 4DLLA 3JASB 1RVV1 2XF8A 2WZQA 3EULA 1CP3A 3ND6A 5KMGB 3T52A 4S05A 5CA1F 3G5AA 5KIAA 4NAHA 3DSRA 1T3GA 3TJRA 3AR9A 4MPDA 3WGHA 1I51A 3KQTA 4CIBA 1CY4A 1IHDA 1VCNA 3VR6A 1T9GR 3EIUA 3TSAA 2P40A 4WECA 4CUZA 2XA1A 4OQMA 2GXAA 4RGQA 1LKZA 2BR5A 3KSDO 3RUHA 4Z6KA 3GDOA 1YZGA 2BFCB 2JFFA 1TQ6A 3COJA 5I6DA 2JA1A 1J8QA 2HBQA 3CEAA 3GG2A 4TXJA 5EJ5A 5JZSA 3OMLA 3TZEA 4R84A 1DAPA 3BT7A 1BN6A 4FYKA 2WHPA 3LGSA 2FY8A 3K9BA 1CBUA 4MEAA 2X14A 3EAGA 4OQQA 1WPGA 2WD7A 2SHKA 1OFGA 5CGQB 2R6R1 1PFVA 4ECEA 5EI5A 3DWEX 2WP8J 4ITRC 2QZSA 3NHUA 4MVCA 4B4UA 1W1IA 1X94A 2DKNA 2Q0SA 3Q4GA 5G0SA 4FNAA 2Y1LA 1W581 1NUUA 2ECKA 5T8KA 3VC3A 4E03A 5CR9A 1R12A 4XX0A 1XAHA 1I24A 1B73A 2WD9A 4L9AA 2B8EA 3CLRD 3K94A 3WA7A 2GZDA 3CZRA 4G4SP 4OJNA 5K3FB 3W06A 3ZHSA 4HLUC 2DUUA 2EYUA 1BU5A 2NPOA 4NARA 3USCS 5DN6A 5BSEA 1H1TA 1UOEA 5ICSA 1SH7A 1OLXA 4HXEB 4M38A 1CY6A 1Q12A 3L7IA 3GHYA 5JEDA 2P9ZA 1L1FA 4J0QA 3HVIA 4DKJA 2HHAA 2XTNA 2XCUA 1G5QA 2O52A 2OCBA 5MN5A 2JCVA 1KRWA 3HY3A 3CUTA 2GN6A 3QYJA 1KAOA 5IXJA 4M1OA 5TMPA 2C9OA 1PWHA 3IKJA 3G2HA 2RHHA 3UJAA 2YVAA 3DT8A 3H7AA 2XXAB 1EYZA 1FRVA 1GZVA 1K27A 1N25A 3A1NA 2C8LA 3ESYA 1PJZA 4WUTA 4PFKA 2QE6A 1XD8A 2VDKB 3OECA 1D4AA 1AXRA 3OD5A 3NR2A 3EXIA 4CLRB 4CGZA 2BEUB 2I9PA 4OL0A 1GLGA 4XI9A 3RAGA 3OQIB 1XLTA 1FY2A 4Q6BA 5J4LA 1J42A 4NCIA 2CCKA 4ALNA 4AMVA 2GA8A 3THXB 4C1BA 4NDAA 3DM5A 3EVFA 3LFTA 2XMZA 1RLOA 3AQIA 4L3OA 2L17A 5UKDA 5CDFE 1NQUA 5LOVF 3E9YA 5EHGA 5GGYA 5JLAA 2OO3A 1JR3A 2O14A 4EECA 1TYCA 3HN7A 3LDGA 1E1DA 3AMVA 5HK9A 3T1HB 4OI0A 1R5BA 4HAXA 3HBLA 3VOSA 1VZ2A 2YJ5A 5KOHA 2PLNA 3I2IA 4O5AA 2XPCA 5GIPE 4B3GA 4XM0A 1U8CB 2GPNA 2WFLB 4BO3A 1UBUS 5AXAA 3WMGA 2GJKA 1K97A 1R10A 1IUKA 1UPFA 5E4YA 1XPRA 3MELA 1ZJ5A 1E3WA 3OLVA 1PJ8A 1RPJA 1TKAA 3AVXA 2R1UA 1BRMA 1GZ6A 1PSWA 3B8HA 3OT5A 4MPJA 2IZOA 2XDAA 2HCFA 1BKYA 1G8PA 3HUUA 4DQVA 5IAKA 5I8WA 3AB8A 5J40A 5ICFA 4Q5IA 4YP0A 1OX4A 1VJCA 2RKOA 5AVYA 1QQBA 3DDSA 3URMA 2ZRCA 1TZJA 3N75A 3CO0S 4CDGA 4IQGA 4IKEA 4MKFA 1KJQA 5JMOA 2JLQA 3R3JA 1DIRA 3D3WB 3WKDA 3CVVA 4ZYTA 3TM4A 3M1IA 1N77A 3KT3A 3N53A 1R8YA 2GD2A 4FW8A 5A9TA 2FV8A 2HCBA 4V0SA 3VHXB 3JY6A 4ENPA 5TIIA 2K6GA 2DEUA 3EDMA 3AKEA 3IDOA 1M33A 1E9FA 2P35A 3RJMA 2CV1A 3MJRA 2Z4RA 5DTMA 4ALKA 1E1LA 1ZR2A 2OBLA 4DFDA 3RAFC 2JASA 4ZCMA 3TIIA 1U9IC 1CJUC 2UZ0A 2HJRA 3GA0A 5JXHA 5KINB 3KJXA 5JJLA 2YWFA 1KO8A 4TLCA 4BBAA 4X7PA 2R11A 1P4AA 2NVUB 3BFPA 4B2IA 4GE3A 4JDPA 3S8EA 4E31A 1KZ6A 1GARA 2P30A 3G9XA 3OVMA 1PR5A 1QPBA 1XMSA 4MUXA 3KKQA 1B0ZA 5EWMA 3DS8A 1T4CB 2BL4A 1D07A 3JYNA 2JJ2D 2WV9A 2W6NA 3JQGA 3R3WA 4I55B 4MRPA 5C5EA 4LF8B 1N92A 3EWAA 2AI3A 3BZUA 3PC7A 4JKYA 4F2WA 3KLMX 2GYYA 1TXGA 4POOA 4OQPA 4LDPA 1HE5A 4MUGA 1O2DA 5DGXA 2VK1A 4OYHA 1U0TA 1Z35A 2XVMA 2DPHA 4FOSA 1THGA 5H81A 1ST3A 3F47A 3WP1B 4UQPA 3DOFA 3GA7A 5AO9A 3KV1A 3WRWA 4E2WA 1QFJA 4BJ5A 4EKDA 1V45E 3E7PA 1ETUA 1G60A 1DNPA 2GNOA 3QBVA 1U8YA 4FEAA 1C7ZA 4FFVA 2VZLA 3NFYA 3S28A 1O94C 3ZIUA 1HI9A 1K2WA 1HQCA 4IGEA 4E5DA 2E48A 1OKKD 2FPGB 3J7TA 4JWTA 2Q9AA 2WJ4A 3CR8A 4LJ4A 2CJYA 1FNBA 1TQHA 1CUCA 2FRDA 3BA6A 4IH4A 3TLAA 2J31A 3M9XA 5TS2A 4UUMA 2AMFA 1COWD 3DZHA 5EIBD 4PG4A 5GMOA 4J16C 5HQ3A 3CB4A 1CRWG 4QXMA 3GI1A 5BYAA 3WNBA 1W46A 1NFRA 1F48A 2ONZA 2ACEA 2YXLA 4DCJA 4Y6LA 1JF8A 3QELB 1TT5A 2RCYA 4CUJA 2F17A 1ICEA 5JD4A 2C88A 1KSGA 2WWGA 1GZSA 3MK31 3X1JA 2NMVA 2OGTA 3GRAA 3GARA 1K6IA 1V1RB 2H59A 3K1JA 3ICOA 3N7UA 1RHKA 1I9CA 4UAUA 1KDYA 3A6ZA 3EG9B 1AQIA 2HOQA 2PBRA 4KAJA 4OU5A 4Q3CA 3TW8B 4DV7B 2P11A 1K92A 3HACA 3F8WA 4O2LA 1Z0FA 3L0SA 4CJXA 5AIAA 3T6KA 1JHYA 1SBIA 2OAQ1 4ZPJA 1EJ0A 1FP7A 3GP3A 1RRCA 1N2OA 3B1JA 3R5JA 4L02A 3RKRA 4AP5A 1RZ3A 1JXMA 4BO8A 3NTOA 2XSZD 1BGVA 3PE3A 4QPCA 5ISMA 5A0TA 4IW3B 1MDBA 3H4VA 3RO7A 5HEKA 1ZVQA 5IM5A 5DDIP 2QPTA 2XKKA 2YDXA 3RRJA 4Q4JA 2YNMD 4YC7A 4IX9A 4F5WA 1E3EA 1A96A 4U6QA 4UM9B 1QP4A 4I9GA 2CYBA 4LWQA 3L0YA 4J1NA 4JT2A 2LUOA 1ODIA 4GS5A 1YNSA 5EZYB 4OQZA 1SB8A 4RV5A 4X94A 3U17A 4JMLA 4E5VA 3PPIA 4DEVA 2XT0A 3I8OA 4JLVA 4I1UA 1M7GA 1P7VA 2NNWB 2WSSA 1ZL0A 2JLSA 4BNWA 4DDVA 3R7DA 4D9HA 2FSVA 4NABA 5LZ8A 3QMMA 5DNAA 3D43A 5J58A 4O4HA 4JENA 1W30A 1JXOA 1T35A 4QUJA 4C4XA 4YMTA 5CIWA 4EA7A 2FMFA 5DT9A 1I6WA 1PJAA 3MBOA 2HX1A 3TR0A 4NBRA 1V0JA 2A0WA 1RLTA 4DABA 1CD5A 4WMLA 5TF0A 3LC7O 5H68A 2CLDX 2DQYA 2FN3A 3FTCA 3DO6A 4GLFA 1X7XB 4UVEA 5DJ5A 2D54A 1WXEA 2XCQA 4MW7A 1JDZA 5ED0A 1UIRA 1V5IA 3U49A 1ECLA 2VDQB 2D8AA 1P61B 4FINA 5LDGA 2ZIEA 2EKPA 3SJ7A 1FP4B 2BHSA 5C52B 4H6WA 2Z6UA 3P7MA 1C0KA 2NZYA 1DV2A 4P38A 3ZI0A 1IOWA 2FPLA 2WPDD 3NIBA 4G0NA 1CZLA 4ID9A 3VSBA 1T9HA 1LSOA 2WAOA 1ZY2A 4G8DA 3U3RA 1HK7A 2H18A 3SVZA 1IBMB 1D6MA 3JWIA 1ADYA 1TCBA 1CUWA 5C1BA 4HATA 4O0MA 4R7GA 2OCXA 1QPZA 2IZ1A 1CCWA 3JQ7A 2JLBA 3ZBUA 4ZN6A 4BHTA 5CTAA 4M0PA 2FPXA 4TSFD 4W6QA 1CB0A 1KP9A 5AKYA 3TX6A 4E88A 4F3YA 3OKAA 4D43A 2GM9A 4F84A 2RK3A 2Y92A 3AJEA 4CM4A 4JOSA 4ZV4A 4YCNA 4TMXA 3IJ5A 1WKCA 5IZ4A 4GRAA 2XAUA 1PW7A 3GJYA 3ZVLA 4B6RA 2FRDC 1P1HA 2EJCA 3KVRA 4JYBA 3SSOA 3FH0A 5IMSA 5IT9A 2NV2B 2FUCA 5LB4A 1OI7A 5KCMA 4YPOA 3H2HA 1K8ZB 1BE6A 3NB0A 1J22A 3QBDA 1R8JA 1NUQA 4G1MB 5IC5A 4AUMA 1PG0A 5IW8A 3DKIA 2XD9A 4YMLA 2C7OA 1DX4A 3G0IA 4NMHA 1ABFA 5DNWA 4QBGB 1AM4D 2C7GA 5A3RA 5IJZA 3IHWA 4D6YA 3I6QA 4W9MC 4MB6A 5C1OA 2BP7B 2GM5A 3LP8A 4OJYA 3RJ9A 1QH8B 1J7JA 2BKLA 5DMXA 3E9ZA 1YB4A 1RYHA 3KX2A 1JJVA 4CTOA 4EJFA 5AW0A 2QRMA 3GLKA 2VP6A 2XH8A 2PA0A 5BWBA 4EW6A 3A2MA 2Y2VA 1HE8B 2AEEA 4HDCA 1R6BX 4WD3A 4A6DA 1WIWA 3MT9A 2V98A 2KX7A 1RQXA 1XRRA 3LY7A 1QFXA 2GFHA 3DBLB 4FUTA 4G8CA 4QDXA 1SM4A 5A6VA 2P6RA 3L5OA 3MFYA 4X85A 3V1LA 1Q1AA 1RWBA 3QX8A 4MGYR 1Y1KE 1CQIA 3T5CA 4B71A 4F4DA 3E7DA 5FCDA 2IJGX 1PW5A 1KI6B 5FULA 3IDSA 1PL7A 1N5RA 3W5AA 2PZMA 3VR0A 2R6ZA 1Q92A 2R25B 2R1ZA 1AGRA 1EVKA 5AHKA 4E22A 2FX5A 5K0NA 3J7AC 3HNPA 4FX2A 4TKUA 1RAEA 2W83A 3KSMA 5CP8A 5EL0A 3WRXC 4OQNA 4GR4A 3UCEA 1QTQA 4P1ZA 1KI4A 4B6JA 1NQVA 1H2FA 2XB2A 4CHGA 4QGGA 4BB6A 3ZV4A 4OUDB 4I55A 1PT7A 2O0JA 7AT1A 4JVLA 3EIFA 3GLRA 5KYUB 2N47A 1T4DA 3CG4A 2BC9A 5HILA 2HTEA 5HKBA 1JBQA 2UYHA 5FO0A 4WN3A 4U7HA 3EYWA 3IIMA 4RMJA 4X7RA 5FRDA 4IIVA 1R0KA 3TSOA 1XCBA 4A8JA 2AG8A 3MTAA 3PFGA 3ZDXB 2YZMA 2BMAA 4HMQA 3JYLA 2GARA 3L49A 5ULLA 3QJ5A 3LGAA 5KEIA 1PNTA 4ZYWA 1C41A 1XKTA 3DONA 3JWPA 4KN8A 4ZRNA 3UMRA 1EFRA 4QXAA 3TLGA 4RWZA 4UJ5A 2C2BA 1REQA 2EGUA 2W6CX 4CXMA 1YR9A 2B20A 3BA1A 2D0DA 4ETNA 1P1BA 2NSLA 3NBUA 4BGDA 1QDEA 2C5FA 1R6UA 1YFJA 1Z2CA 3CV3A 2PZKA 1T6XA 3O94A 3IDZA 3AEKB 5BV8A 2VHYA 2G09A 3GX1A 4G0MA 2B83A 5AUQA 4D8VA 2PKEA 5IKPA 3VR3A 3OM9A 2C95A 3EWIA 4XARA 1L1EA 2W4IA 4YJ2A 5JCPA 3SD7A 3ACBA 4I6JA 3VI4B 2B2CA 4IDDA 4BFZA 1VMAA 2XV1A 1Q50A 2JDIA 3V97A 3WX0A 1HDRA 4JBGA 1GM5A 1V1JA 2E49A 4TTRA 1IDN1 4PYJA 3WLJA 5ALHA 3NBAA 4B45A 2UZ3A 2Z58A 4K26A 4R1NA 4M9SA 4OH1A 2QUZA 3HU1A 1Z7WA 4H7KA 2NTEA 2QJWA 5IN4A 4FYJA 1NQTA 1ZM4A 3NHPA 5BURA 3FHTA 3A1UA 3CNEA 2XQIA 2KBFA 2CMDA 1N3BA 2JDID 2XDYA 3VR3D 3SQWA 1V3UA 4WBNB 3TPCA 2ANBA 1DC8A 4RK6A 3R24A 4HGRA 4XTCS 2BFFB 2OHXA 2XB6A 1TA4A 4S12A 4YJ3A 4DLRA 1GU1A 1E62A 1A77A 2GRJA 3WK7A 5CA1A 2BGWA 2Q8NA 1X1DA 4PHHA 5GIOE 1GTRA 3K9CA 1E2LA 2V58A 3B70A 4BUZA 2GZRA 4JXZA 2ZRMA 5D7NA 4E6EA 1OWLA 1WNTA 2BHRA 3GN2A 3HA2A 4PAGA 5IAEA 3M3DA 5AJYA 3BGOS 1Y9JA 3DR5A 3EQ6A 3BMNB 4PIVA 1DKOA 2X1VA 5JVDA 3RUEA 2VHZA 2AR7A 1DMRA 2D4AA 5E7IA 2EG5A 3LPDA 5E3IA 2GLUA 2G25A 3E8SA 4LXXA 3QUQA 2ZU0C 4I36A 4OUDA 3WRYA 4IFBA 4UDXX 2M98A 2MDTA 5FUYA 4Z4CA 1NKSA 1Y1RA 1KY3A 4IS3A 1L5WA 2L69A 1IUPA 4RGBA 4WVFA 3UVEA 1HYQA 3CTPA 3O8NA 1N4AA 3W4JA 1FJGB 1K88A 1PD1A 5DHSA 1JIXA 3OJOA 5JUWA 1X70A 3I04M 2YV2A 3V8VA 5KX5B 5KOJA 1D1TA 1X1CA 2RGRA 3LW7A 4FDLA 3AFIA 1HT3A 3U48A 5JO0A 5IC6A 4M54A 4R9SA 3Q98A 3WK9A 4LMRA 2PX2A 3DFUA 1G64A 1I4TD 1QJ4A 1SA0B 3U7IA 1G41A 1I30A 1I14A 1P4GA 1TD9A 1FTGA 4RSHA 1OXKB 4M9ZA 4U2KA 2WMYA 3PSHA 1MIOA 1CRPA 3VH3A 3EH2A 3D0OA 3MMNA 5AI9A 5KTKA 1E61A 1U7TA 2PLWA 4BNHA 4QT4A 1DV1A 3TG8A 1C29B 4P4SA 1VE9A 1T5DX 1JKJB 3BKWA 4GYYA 3IAM1 5BSRA 1K7SN 1NI4A 1NLZA 2YN4A 5ALRA 2O48X 5EUCA 2EG9A 1MB9A 1WDLA 4I9UA 3LTEA 4EP1A 1UM9A 2FZGA 1ZGJA 5HKAA 3SU8A 1C80A 4HEJA 4TXMA 4MQUA 3BWVA 4JLKA 4EABA 4ZCLA 1EHCA 4UFNA 1OQAA 2H1VA 2WUGA 2ZPTX 2WABA 2EJWA 3P71T 2JKVA 3FI9A 4UDOA 1DSSG 2QRQA 2PJUA 5BN5B 1KOGA 4GUAA 2VJBA 4KITB 5HZHA 2OAEA 3K05A 2GK7A 3O4VA 3SHFA 3AKZA 5LUBA 1UAYA 1LZLA 3B2NA 3QWBA 3DHEA 3L2OB 2QI9C 3PRYA 3FLAA 2JGEA 1T3TA 2F6RA 2Q1TA 4OREX 4FKBA 3REFA 2Y76A 3ZWPA 1YI1A 1ZN8A 4BFLA 3NHMA 3TQHA 3PX3A 5HOEA 2Y1OA 5H83A 3CLKA 1HTBA 1MG0A 1UFVA 1YZUA 4NI5A 4WZ6A 2O8CA 4JP5A 3BTUA 4LNUA 3UWMA 3KAJA 5LQNA 3OPYA 1EFPA 4DCCA 3HJHA 1SU7A 2ZYTX 3FTQA 3RNLA 4EMTA 4I4TA 1WS6A 3Q7IA 1XTVA 2WICA 1EE2A 4KQCA 3WZLA 4BBPA 1EM8A 2P9EA 1FUKA 4PG7A 3OOJA 4MLPA 4TRNA 4ZEWA 4U2CA 1AKEA 3SF0A 4HUTA 4URFA 1NVGA 3CS3A 3FTPA 2C5EA 1IXYA 4R81A 1TFUA 4KLRA 3T1YB 4PNEA 4ZI2A 1Z7BA 2IOFK 4CV1A 5HUHA 5ENZA 3VZCA 4YFYA 1TM4E 2GXUA 3ONEA 2IYSA 5CB0A 4R9VA 2REOA 4PE5B 4BQSA 1A7KA 2ZI7A 5I3CA 1DFIA 3MCAA 2YICA 4JLPA 3VR5D 3OT4A 3P4UA 1WMDA 2JZCA 1ZVMA 2WF8A 2WINI 3NNNA 4G65A 4JJGA 4LE1A 2LE0A 4OHBA 4TX1A 5AUOB 3ZVKA 4PG8A 2LV8A 4YT8A 3SHQA 3C8UA 4ETMA 1M1XB 2GYVA 1E18A 1X9HA 2XUZA 4RPIA 3AEUB 4JN6B 1KPGA 5K0ZA 3JD2A 4MAFA 1X19A 4QFMA 3GAAA 1T15A 3ZNOA 1JVNA 4L4RA 4WCFA 3I45A 3UT0A 2XWBF 1XNHA 3PDUA 5FL7D 3EZXA 3DMDA 1AK9A 1TYAE 2AB0A 3P2YA 5EIAA 2AE2A 1Q77A 3PXGA 1Z0DA 2OZEA 4IQ8A 4LRQA 4R69A 4B7AA 3G89A 2PCLA 3KZ1E 3MLBA 1OC2A 3AY7A 3JX9A 3N86A 3IQDB 3QVTA 1QKIA 1U9IA 5F33A 1HDYA 5EXSA 2QS9A 4MQ4A 4X62B 1VL6A 1GR1A 2EGHA 5KOHB 2DG2A 2OQ2A 3N5KA 2W7TA 2A33A 2LRHA 4GPTA 1WB9A 1XXHA 2HMYB 3QG5A 2OORC 4GI1A 4AQDA 3QUBA 4JU8A 2NV6A 1VFPA 3PUJA 1XELA 3COZA 3M1LA 1GVHA 2DTEA 2KI5A 4W82A 2ES4A 5LQAA 3NDPA 1T9GS 4GMDA 3SE7A 1R00A 3KVOA 3N0WA 1GTG1 3MTBA 1MTZA 1NY5A 3R2JA 4IV5A 1DFHA 1G7RA 4UUQA 2W37A 3WG9A 1P0CA 3RC3A 5ABPA 2JIZA 3I5UA 1MO2A 1BIFA 4C6TB 1X2EA 4CCYB 4D7AA 3TGPA 2Z57A 1P60A 3WMFA 7ABPA 1GSHA 1S89A 2HDWA 4Y3UA 2EBFX 2G6TA 3UXHA 2GCIA 2O8NA 3I9FA 1O77A 1A1SA 1B8NA 2VDUE 3LCRA 3ENZA 2W8BB 4K9SA 4M1ZA 1KDOA 1GA4A 2B61A 1JEEA 3R0VA 2RBGA 1ECJA 2Z1NA 5FBHA 1W76A 5HCNA 3UMFA 3ZU5A 3FWKA 4UOZA 4MCAA 2XRZA 1MCZA 3SDSA 5LZ9A 2JKYA 1VBFA 3G7UA 3PICA 2YMQA 3L93A 5C35A 3WL6A 4OQXA 3SZOA 2J67A 1XAIA 1S02A 1YVPA 3IKLA 5JROA 1M5RA 1DBIA 1N5IA 1YOVB 3LS2A 2X40A 2GQ0A 3AM1A 3ADDA 5BOVA 4K2HA 1GO2A 4MW5A 5ARDA 4D8TA 3TRHA 1DRVA 1YQEA 5K7SA 1MX5A 3AP1A 2ET6A 2FNAA 3TSCA 4QYSA 4FZ5A 4DR4B 3MAAC 2AN5A 1MZPA 4ZTZB 1D1QA 1GPMA 3CNBA 5G41A 1RPZA 1JHPA 3IAEA 1EFTA 2E4AA 1MZVA 3PCRB 2BGTA 4Y8VA 1HXHA 5JHGB 1UJMA 2QTVA 4YRQA 1ECPA 2AJLI 2I87A 1HQKA 1I4WA 1WDTA 2QF7A 4PAQA 2X8WA 4EZIA 1GL6A 1UEXC 2BDEA 1U81A 4G07A 1GYQA 4AXBA 4B8ZA 2ZT6A 1OVGA 2C2KA 4EFDA 2JIDA 4YV0A 1J1IA 3HKBA 4LYJA 5FAXA 3E70C 3A1VA 3CKLA 4KX3A 3KR1A 3DE4X 3UUGA 1G21E 2FF7A 2J6BA 2JVKA 9LDTA 4LRYA 1KI8A 1LQ2A 2XOKD 3ASZA 1JG6A 4R8RA 2ERCA 3MGGA 4XGIA 3TZ6A 3X3HA 1E3QA 4F9TA 5B7PA 1U8ZA 4A36A 2JI8A 2WMNB 1ID8A 2VPWA 1J06A 3FFTA 3H5RA 3UXMA 4UD2A 4BYMA 3T9FA 2AC2A 1P44A 1SMKA 3IXMA 3VDMA 8ATCA 4C4TA 3FR8A 3OTWA 3L7BA 2ZQYA 2DQ4A 1GPKA 4INPA 4NU0A 2H11A 5B58T 4PPQA 4DCTA 1X7GA 1DC5A 3P9KA 2Z56A 3FFBA 3OBIA 1YZ3A 3PDHA 3DWIA 3IQXA 1U0JA 4B3HA 4LBWA 2PVSA 1LI5A 1H85A 1MAAA 2QQFA 1K98A 2QWXA 4OVKA 4JSTA 1AMOA 2Q07A 1JEYA 4D8YA 3UUEA 2FN4A 2YJ6A 3ISJA 5CFOA 1PLLA 4W9NC 2HLDA 1DO8A 2RBKA 3NT4A 3RSCA 3ROFA 4PYKA 4JB8A 4B7ZA 2O2ZA 2I9KA 2GESA 4IH1A 2FEAA 2HQOA 3WLIA 3TQIA 3HHEA 4EG7A 1KFBB 4KAAA 3TZQA 1E9RA 3JTEA 3Q6NA 4NZMA 1RVDA 2YC4C 2YHSA 2PYZA 1XK7A 1EK5A 4ZCRA 5LQRA 1FX0B 3MTQA 1SN7A 1GPUA 4DYDA 4XLLA 1MGOA 4L5BA 2D1FA 1JLHA 3BRSA 5BMOA 1FTYA 3EGDB 3GMTA 4Z9XA 5IABA 3WK8A 3GJ8A 4BQFA 2PXAA 5L3SA 1HOXA 3GRFA 1EGQA 2UXCB 5DM0A 1GN9A 4AAYA 3IOMA 2R2GA 4BLOA 2OENG 4MUFA 1JIKA 4D0NA 4BLSA 4XYMA 3QE0A 1O89A 2AOXA 1J4AA 4INAA 4IO0A 4TS9A 2A30A 4YRJA 4CMEA 5TGDA 5FBVB 1P1CA 4Y9SA 1CVLA 2BFAA 1GAWA 2AHRA 3LE8A 3R23A 3E0XA 1QZZA 1U6KA 3M4NA 3S7TA 3LOQA 2XTAA 1Y8ZA 5C5CA 3RADC 1LF0A 2HJVA 3W5JA 5JNWA 1IUNA 3CKMA 2EKBA 4MYRA 1KZ7B 1DBWA 4UEQA 4C0KA 2HRZA 2SCUA 1VYHA 2ZIXB 4FLMA 2B25A 4M7RA 1Y9DA 4MJ3A 2GERA 2DPLA 5EOVA 5L8VA 2V0GA 4YP7A 2HNAA 5EWMB 5ARCA 1M1UA 2PJDA 3LSTA 5BQ3A 4V0OA 4HR7A 1CK4A 1A72A 4UPEA 1KDTA 1CJBA 4HN4B 4DWVA 1Z4OA 2W6OA 2X8JB 3H1FA 3P97A 1NLFA 3DEJA 4G0ZA 2Q6KA 1M2NA 4WTOA 4E5UA 1HT0A 4KFCA 3DNFA 3DPSA 1E8MA 3DBLA 3L1UA 4OYYA 1UQTA 3M4XA 5C3UA 4ARBA 4EGQA 1DJQA 1F0PA 1CS0B 4L6CA 1FFWA 1QF9A 1WQ1R 1E4VA 3GDHA 4NDZA 2HF8A 3RU7A 3CE6A 5CT5A 3S2SA 3A10A 3LCUA 4F5DA 3OU7A 1FFYA 2I3ZA 2JPDA 1WLYA 2OCYC 4Q34A 1I01A 3WLSA 3IPRA 4CLHA 1Z36A 5J5CA 1ORDA 3NWOA 2XVXA 1ZD3A 4IDHA 1F2VA 4X8MA 1E6EA 1BSVA 1HURA 1WD7A 2R6HA 4IHQA 4YJFB 3T7TA 4YP9A 5GJCA 1QH0A 1TQ8A 4IFTA 2IY7A 4S1NA 3STUA 6REQB 1ECFA 1E66A 1HE4A 2QM3A 3JVDA 4K1LA 1KK3A 3QVXA 3EC1A 3COVA 4KXXA 3VNAA 3H11B 2FMUA 3ZDAA 2Z4SA 4NWIA 2C7RA 5E6UA 2C1ZA 3FHLA 5DX0A 2J08A 5MGBA 4NESA 1AKMA 2YJNA 1OBFO 1JSRA 3VYWA 1DXOA 3CZ4A 1JHQA 2EL9A 3QV2A 4HMPA 4DXAA 4PYRA 1SCIA 4NS4A 4IP0A 4HFMA 1N75A 1NQXA 4R7ZA 5TPZA 4MB0A 1XFDA 3IVXA 2J9FB 1K1EA 4MX8A 2D62A 1F9AA 3V00A 1U0BB 1VE6A 3NHLA 3T0FA 1V3VA 2FOXA 1TVEA 4MXDA 4BZWA 3IIEA 4ND3A 1XXLA 1D6SA 1A98A 3VKHA 3IAHA 1WVIA 1T25A 1W96A 1NVXQ 3D6VA 1PL0A 3M6VA 4NF2A 2JH9A 3I2GA 3N2LA 3O47A 1H4SA 4LQ4A 1JAHA 4M46A 2PR7A 3PTZA 5H59A 5IAJA 2CXPA 4U0KA 4M0KA 3ZU3A 1KAGA 4MV0A 1R0BA 2QTVB 3OQIA 4JLOA 2D5CA 3LUPA 3VC7A 4BFTA 4D2IA 1FFSA 4YQZA 4FK8A 5AM0A 2IWHA 3C8DA 4KPGA 4ZI5A 1QF6A 3LFUA 3NHWA 4H0NA 3HM9A 2X0NA 1FFCA 2CHQA 3GELA 1OGIA 3F7NA 5JS2A 2NZJA 2XUKA 1TDJA 1U04A 3CIFA 2OFPA 5CHYA 4NFYA 3EBPA 4NV3A 3EZFA 4ND4A 4DQLA 3U40A 1UZLA 2IS6A 3OZTA 4J0KA 4X8LA 4C07A 4PO1A 1JG2A 2VH1A 4IVNA 3I2FA 4KNVA 3QE2A 5J2UB 1LVUA 5JS8A 2IEDA 1VIAA 1A9YA 5EJ2A 4F3NA 4XGKA 1CG6A 2TSYB 1E1QA 4YJHA 1WTAA 4DLXA 1U3WA 3H0CA 2X8LA 2P5TB 2BDTA 3P9ZA 4LVNA 4UU0A 3UMCA 4D0LB 3LLCA 5BT9A 1OA0A 4TYWA 2XIJA 4FN5A 2COKA 2OFOA 4BX0A 3HJAA 4P80A 3V8BA 3S68A 3BFXA 4DZTA 2MSEB 1UCFA 5TGZA 2FGKA 1RYNA 5AM1A 2Q4BA 4XH9B 2DTXA 4M87A 2YXEA 3T3GA 1S2NA 3H0EA 3NWJA 4C7BA 1MJNA 4LGMA 2EBWA 3L0OA 5AK0A 5H9WA 1BVHA 3R9WA 3JATB 4CTKA 5KHOC 1RMTA 4QHYA 1W1WA 3DLTA 4ZZ0A 2IPOA 3SN6A 3D8NA 3JQFA 1XDGA 3BXGA 4ZVNA 3DLHA 2P4QA 4RL6A 1KMMA 4XCQA 4JC8A 3SYTA 2EX0A 2G80A 2P3LA 2XQKA 4LSGA 2GF9A 3JPWA 4YLGA 3L4KA 1TIPA 3E9MA 2QY9A 4M0UA 3GLGE 4YROA 1EE9A 4JEHA 4X95A 1CW2B 5DI3A 1LPAB 1ONBA 2Z8YM 4DV1B 1X77A 2Z4TA 3S55A 3WLRA 1L5LA 2C98A 4BFCA 3WXMA 1NMYA 2AQIA 1RAFA 1H6BA 1NQ5A 5DHPA 5L3RA 2NXCA 1X7WA 4HQ6A 5EGNA 1NVAA 2QNRA 1G0NA 1K7XB 2YV5A 4HAVA 1QV9A 3DDOA 4OYLA 4A4DA 4JI2B 3ZLVA 2DBVO 1PK9A 3IUQA 4PBSA 1KEKA 3B3GA 2ORED 2XCLA 4ROSA 1PGPA 1PTKA 3D1VA 1VKZA 4EGAA 2PZAA 2P0EA 4Q3OA 4X00A 3TBFA 2R62A 1PHPA 1KZ1A 1EZ4A 3MINB 3G2LA 1R6AA 4OHOA 1PO7A 1KKUA 5FL7A 3ZCSA 4D41A 4PBRA 3M4YA 1Y3IA 3VHXA 5IKEA 2NLOA 1A27A 5SZIA 2AJBA 4MR7B 1CUEA 1RZVA 1XL0A 3HC7A 4Q3DA 3I05A 1F8YA 2BFOA 3QLUA 3R3UA 4MQEB 5T5QA 5J4VA 2AJ8A 4N41A 4KE7A 5LD2C 4N1AA 3AESB 3I0MA 2WJGA 3KCNA 5I7RA 1PE0A 5J2UA 2BFDB 3H86A 4RJTA 1U63A 5KYTA 2JAHA 4EFLA 3C4VA 4FBMA 2AYYA 4J6FA 4Q7MB 4I14A 4EI8A 4HVTA 4MP8A 4NQRA 3W5HA 1FBTA 3CX7A 3ZBTA 1W8DA 2VA8A 3KZXA 3L77A 1DEHA 2HBYA 2V0CA 3B2QA 4D9KA 5KSZA 1PV4A 3WKEA 1EWQA 2FCAA 5IHXA 3KIPA 3NASA 3ZDEA 3DJYA 2O2CA 1ZONA 4JUIA 4ZYXA 1ZVJA 2BGNA 5DO9A 1JQLB 5SY9A 1ZR4A 2WUFA 1PL6A 2EF0A 2NSYA 4LC1A 5CEJA 1NNI1 3GZNB 4FBGA 4B48A 4Y2HA 5FPSA 1XBTA 5KX5F 2OP1A 3ND9A 3SS7X 1IHOA 4UNSA 3V8MA 1KQFA 5ALXA 4K87A 4TRRA 2OZLB 4QWWA 1ZN9A 1XQ1A 1RWNA 1NV9A 2WWTA 4EKIA 1MJGA 1GGHA 4HQFA 4YMWA 3EEOA 4F3CA 1KIAA 2YOHA 2QW0X 2QXUA 3NC0C 1BXGA 1P9OA 3RKSA 3DEIA 5JLJA 3KVYA 4XB1A 5C8YA 4ETWA 3RYTC 2CDCA 4QAJA 1X7YB 2ZULA 4YRAA 1S2LA 1KDVA 4C0JA 3HHPA 3O91A 1OFIA 4IVRA 5FUWA 2BM9A 4QAQA 2WWHA 4YAJA 2FHSA 2X5XA 2YWEA 4R05A 2FWRA 4ZQBA 3H11A 5K8IA 1P1FA 5JCXA 2MSNA 4BX2A 1QE5A 2HQBA 2WT9A 3HO8A 5E3JA 3FGZA 3PITA 2W6ZA 1Q7BA 2JI6A 4RDCA 5C80A 4OK5A 3GVHA 2HCJB 1DWOA 1DRKA 2E37A 3L04A 1D0SA 1TMOA 1TADA 3PR1A 4EDHA 3OCYA 5COQA 4C4RA 2JRLA 2IIBA 2YWRA 5HQTA 1PWYE 3UGKA 4D8XA 2BE9A 4C7OB 1RJ9A 4HLUA 3L6CA 1ONNA 4DIUA 5K51A 3T9CA 4H7PA 1TPZA 3OOHA 4OFZA 1Y4AE 2WWIA 3OTHA 1ZAKA 1ZOPA 3DKKA 5I9MA 2PU5A 2XYPA 2FQQA 3EPRA 3K6RA 4Q0MA 1WY5A 2NQ8A 3TKAA 4JFAA 3JD4A 5EZ5A 1O94D 2ZBQA 3S99A 2G70A 3QIVA 4YONB 4A8PA 2A88A 5F7JA 4HEA1 5B3LA 3ORQA 1SXJC 1UJ6A 4OXQA 1PBTA 1B3BA 3INRA 3PZBA 4JUCA 4UTVA 5JANA 2SKCA 1TCCA 5EMKA 1T2VA 1M10A 1JAYA 3CEMA 4KH0A 1CJTC 2IP4A 3GRKA 3IPXA 3KOYA 4ECAA 2HKIA 2OC4A 2UZIR 3DLCA 3WLFA 3UB4A 1C1DA 1UXOA 2O4UX 2PUJA 3GN1A 1P5FA 4AB1A 4KLNA 2LW7A 4LZNA 2P91A 4FCCA 4IJ5A 4JDUA 4QU5A 4F4CA 5E7QA 4J1TC 2ZT7A 1DBRA 3R74A 1DGQA 3I5AA 3N2NA 5F4BA 3C3JA 5IZCA 3AM4A 3RRNA 3ZXUB 4D96A 2A9FA 1V6CA 3BWEA 3VNRA 4QFBA 2G0TA 1SXJE 1EWVA 5FT9A 3AWIA 4HRXA 4QGBA 3UJDA 1OT3A 4FGUA 2WSIA 3LC0A 2FR0A 4QOSA 2Z8YA 3AESA 3OX2A 4KN5A 1PG2A 4FTWA 2FP4A 2ZB4A 2MINA 1IULA 4IMPA 4L73A 4C29A 1W2HA 3GUUA 3KYJB 3K0BA 5IRCD 2WVAA 1X39A 4Q93A 5CNJA 1V9LA 2BCJQ 2FPWA 1WSBA 2HSWA 5COAA 3I6ZA 4MV8A 1SC4A 4BO5A 1EMDA 4YRLA 4JELA 4JT9A 1A9SA 2ZVJA 1VL1A 3BMQA 3GD5A 4NBWA 4KRXA 2J33A 1K9VF 3AEKA 4PC1A 4NNJA 2B98A 5I4CA 4XX0B 1E5QA 4LC9A 3T3NA 3DZDA 1OFVA 3EEYA 2BP7A 2W2MA 1AUOA 1GGEA 3DMHA 4YGXB 4Z5XA 3EF1A 4DCPA 4BX9A 3QITA 4F2HA 5CLGA 1U28A 2H2AA 4TL9A 2X58A 1ND6A 1ZMOA 4WX2B 3B9RA 5FJJA 5TJHA 5CB4F 2VHQA 3AUFA 4IQ4A 1MX3A 4R0VA 5EP2A 4KACA 5JI2E 1Q14A 1ZKDA 4DARA 1U5BA 1FMCA 4BNDA 4QKQA 2DERA 3AV3A 4FDTA 2V5UA 5H0IA 4KQ2A 4IQFA 1GILA 3DV9A 4W5WA 4KGXA 5KNBA 2FN8A 3RU2A 1BD3A 3ETGA 4LE0A 4EQ6B 1LI4A 2YIVX 4W8GA 1U0GA 3CUKA 4Y9UA 1BD4A 2H5IA 2YYAA 1U3VA 2EP5A 4FVTA 2JLYA 2VYQA 1KR5A 3GQVA 2NU6A 4KWHA 4R8VA 2RK6A 3D3KA 3MSCA 1E0DA 4V0NA 3TL6A 4FDUA 3QEMA 5TE9A 5CCXA 2A57A 3VM6A 3IGFA 4EUHA 4GR5A 3JD1A 4KV7A 3T7IA 1L8LA 3JASA 5IJ0B 4PCUA 5CFLA 1ZQ1A 4ZOEA 3C6QA 2VBIA 1EUZA 1D8TA 1R6TA 3EWSA 3K0FA 1MABB 4GZMA 1IBRA 3KLBA 1EWYA 3EPPA 3S1SA 1II0A 5CUQA 1DCTA 2RJNA 2QDXA 2BKUA 5SZHB 2OOSA 1KYIA 3NTVA 2BONA 4BWYA 1JILA 5U1PA 3O8LA 1RE0A 5BSUA 3PTLA 4TTVA 3CN9A 4ARAA 4RAQA 3RFFA 4XIGS 1B0UA 2QLMA 4JI7B 2IYAA 1FFXA 1DUVG 1GUZA 4W7SA 5FUXA 1C8LA 4ISCA 4BPBA 4XYLA 1JVSA 5ECWA 3HG7A 5ILQA 3P20A 3ZUPA 2OCDA 4EA6A 3ENWA 4Q1BA 1HEUA 1JEYB 1EG2A 3D6UA 4BLRA 1YUBA 2GAAA 3U4IA 1UJCA 2W9XA 3PXCX 4BFUA 4DMGA 3AVQA 5A4IS 2ZUEA 2CNNA 4S2EA 3VTFA 2NP7A 3OAAA 3QEJA 1OIXA 3LUJA 3A0RB 2FZ5A 3DMPA 3FZYA 2DR0A 2CD9A 2I78A 1QLHA 2GBLA 2ZWAA 3EE6A 4JH0A 4TPKA 1YJ8A 4GKAA 3I4CA 4OM7A 4Q4AB 1HX7A 4G9GA 2O05A 2IPMA 1GPAA 4RH1A 3ZG6A 2HWKA 3NHAA 4B33A 1YE3A 4QQFA 4BNIA 2HWWA 4BE7B 4QM7A 1DARA 1H2BA 4F2GA 2J3EA 4WOBA 2O3QA 3BILA 3GRCA 3NHFA 4K40A 4HD8A 4WNYA 1RKQA 3X44A 2BY4A 1G7SA 3HP1A 4KIJA 5C4GB 2ZE5A 3K0AA 4FMDB 5T3UA 3CZAA 3RREA 4C0HA 5DNCA 3K9HA 7MHTA 3MQ2A 4CODB 2VXOA 3AERA 5REQA 3OE5A 1YS6A 3RVSA 1JFLA 2V4ZA 5ER9A 1LZKA 1RR6A 3THWA 2VDWB 2WUEA 3CF4G 3ZHTA 1MMFB 3B9QA 3G7NA 3GFVA 5C31A 4I5IA 4NMWA 3V9PA 1KEVA 4NYIR 2PBZA 2E4YA 4L27A 4JQSA 1MV5A 4L5AA 4O4IA 5C51B 1E2KA 2OQRA 3N6RA 4RSGA 1Z0UA 1BXRB 2A9QA 1MD9A 4TXHA 3LT5A 4MS1A 5FQOA 3U81A 5E6UB 2XKJE 4RU1A 2ZUTA 1U7OA 3ZE1B 1PR3A 1SRQA 1J99A 1M0SA 3RQIA 2ZYHA 1CHNA 1BMQA 3RC8A 3F7TA 1G20E 4KNYA 4F21A 1ABBA 1Z8HA 2JGAA 2QZPA 5IH3A 2GCNA 2YJTD 3AIMA 3HBNA 3E0QA 4FZRA 4X6LA 4E33A 2PG3A 4MLDA 2V7VA 4O4HB 1IATA 4KO3S 2PD6A 4XUEA 3L43A 3KB1A 1QG2A 2R0QC 1VE7A 2O7RA 1AHPA 4JASB 1E6MA 3Q3GE 1CUYA 4MKRA 1QYWA 5KTPA 2J30A 2D2EA 1E20A 2FW9A 4NPHA 4QYIA 5D7BA 3I6YA 4DG8A 5LR6A 1G17A 3CQ9A 3FRHA 4HDKA 5JC1A 3OQBA 5EJ8A 5DLPA 3EVCA 1PJ3A 5DXFA 5AKIA 1L7AA 4DUYB 3MFQA 2A8YA 5AXBA 5KVAA 5G0UA 2CMKA 4UZEA 1OPXA 2GYWA 3EZ6A 1Z7YA 4Q4JB 4V0RA 2ZK7A 4Y7DA 1JDSA 3UICA 4XVUA 3U3XA 2O8CB 2ONKA 4LRUA 4O8ZA 1J24A 1RRMA 1BZYA 4M9UA 5ESDA 1QX4A 2OFWA 1WE2A 4JJEA 5M29A 1KS9A 2GBCA 4AZVA 3GZNA 2P2YA 4TTIA 1VBMA 1OWPA 3GYGA 1CQPA 1YVDA 2OO7A 2BEKA 3PFHA 5KCZA 4QUGA 2VNHA 3KAPA 2XUOA 3KTOA 2B8JA 4JLSA 4KJXA 3S27A 2QMZA 1AS0A 4II3A 4HVLA 1QYVA 5KNCH 1TAGA 5F9FA 3GG9A 1GTL1 4EUKA 1PV2A 3Q3HA 2QRKA 1TFRA 4C43A 4WZBA 2PV7A 4XYBA 3V2UA 3RCBA 2PO7A 1N5JA 1U3CA 3RVKA 4RMGA 3H1EA 4PZ0A 1YK1A 3FR7A 3GLTA 4E3ZA 1DQYA 4KXWA 4OD0A 1MH9A 2FW1A 2WFZA 2DWOA 2AZDA 3GCDA 1J8FA 2GAJA 1DCMA 5DYIA 3WO0A 2A0YA 5EFOA 3I5XA 3GNQA 2CFRA 3H1BA 1NAHA 4Q9AA 5CG2A 1N0WA 4ERNA 1NC3A 2OY0A 3BK2A 2IUSA 1ZM3A 1UMCB 1O9BA 4MMYB 3TOCA 2G6BA 1OOEA 3DJFA 2FOLA 4BE9A 3JAMA 1A2BA 3MB8A 5GM1A 5JPDA 1QU3A 4IS2A 1J0EA 1D4ZA 3IR5A 4WN9A 3IB6A 2QPAA 2D4HA 2VT7A 1QFSA 4JEMA 3U4DA 3NTUA 1GPDG 1BWPA 5CX1B 5HFNA 4EHHA 4ESHA 3GNSA 3MJEA 4C2UA 3ZDYB 3PKZA 5GAJA 1M5TA 4IZHA 4XPIA 3K70C 4E13A 2Z8ZA 1UKZA 4HADA 2MCFA 2ISSD 1VMEA 1Z9BA 1L5VA 3AFOA 4JI3B 2DLDA 4UBKA 3ENNA 3TIFA 5IFLA 1HNWB 4GUDA 1NPTO 2Y1EA 3EFOB 4U8GA 3LT1A 2EATA 3DYVA 3BJRA 4K9QA 2H1LA 4ZT3A 1MC4A 3K1YA 4MZDA 4MI6A 3U7RA 1SPBS 4AMUA 4IJQA 4HJRA 2BCGY 4D45A 4Y0VA 2HV9A 2RB5A 5AKXA 2V3VA 3IH5A 2G9RA 2ZIGA 3OEHD 2H7YA 2RH4A 3W8NA 2FSSA 3O2QB 3ZE7A 3CKKA 4YXWD 1NF2A 4MV5A 2VG8A 4HMOA 1QR2A 4RPCA 4BLWA 4LGVA 3QVJA 1NJ8A 3FI0A 1TZKA 1NBHA 5AD1A 3JVIA 1OH7A 3B3JA 2XNSA 1V39A 3BIOA 3LUBA 4GLBA 3EEQA 4X60A 4Y2QA 4Y2PA 4AX4A 5AW5A 1MW9X 2CLOB 4JL5A 1UUFA 1MXFA 2GR9A 2HA6A 1VKJA 4N01A 3HJTA 3EGXA 1C8KA 4QSHA 1V7CA 1PVVA 3OCWA 4JS0A 4TV8B 1VSTA 2BIFA 1LW6E 2GDJA 4RZHA 4ZA2A 4H7JA 3WHPA 5B1EA 3QLEA 2DFKB 1YL7A 1A9PA 5LA6B 1J00A 1WCYA 2ODTX 4GOLD 2XE4A 4Q1VA 4RV4A 5TQ2A 2CMHA 3QI2A 4KO1S 2AZXA 2JKZA 2H1RA 1EFLA 1LY1A 3KR9A 1HG1A 3UW3A 5BV7A 5KREA 4PC3A 1R0RE 2PAAA 4ZO4A 5FF9A 3DMTA 4EJ2A 2Y9PB 4H1VA 5TARA 4HAIA 4TZKA 4X61A 4DCNA 3VGPA 4ZZIA 2XUQA 1NMQA 3I9V6 2EERA 1DQPA 1NR7A 2VUUA 3JZMA 5K4HA 3AIKA 3CVYA 4XEUA 2JS7A 1HL7A 2AN3A 2VJKA 1I94B 1L5MA 1GL9B 1M5UA 4M1MA 4IUYA 2YH2A 5BR7A 4R4JA 4B2YA 4AULA 1V8BA 3RT7A 4PCAA 5AVRA 3SVTA 2G36A 2FK7A 1DZ3A 2SICE 1OI3A 4N5MA 2XB8A 2BUCA 3A11A 1D3AA 1XZKA 5GONF 1EQAA 3TQRA 4EY5A 2B8WA 2O23A 1LBHA 3NEPX 4ZO6A 4KHZA 3OP1A 1DEKA 2PX4A 3OOYA 1FNSA 4GNKA 1EIWA 2BSXA 1K2VN 2VH2A 4FNMA 2QTFA 2Y0BA 2ZRDA 2IWRA 2KS6A 4DMHA 5CLQA 2HPVA 4WXRA 3C3YA 4IHAA 4BMXA 5JXIA 1Z3IX 4R7TA 8MHTA 2F1JA 3D4BA 3EXHA 1JNYA 4FMPA 5D3MB 3GUHA 3CNOA 1C2YA 3ESQA 3HCPA 4IJMA 3W1VA 1TCUA 1ZC3A 2I3GA 2Q5CA 3K0CC 4Q7JB 2JB9A 1U7ZA 5AI5A 5DH9A 4BP3A 3MZ0A 3GQBA 1Y3AA 1CLUA 3KQSA 4C20A 1KY4A 1II8B 1VLZA 1G7CA 3FUVA 3NJRA 4JOQA 4KR0A 5I4KA 5DOVA 1XJQA 3IP6A 1UH5A 1SIWA 2C5LA 1VA4A 3TSWA 5HCUA 1XQ9A 5CMLA 1T2UA 5TMDA 4RK7A 3V4RA 2GSDA 2AYXA 2QT9A 4Q7LA 3EPKA 3N7AA 4FPXA 2MR5A 3G82C 3QKIA 1LUAA 3I1YA 2YWDA 3IAXA 3QU5A 4WASA 3SI7A 2X1HA 1NY6A 2OK8A 1QMPA 3TCNA 1USIA 1K8XB 2IUTA 2FE1A 4Z1MD 3R0ZA 4OKSA 4QVGA 5TS3A 3NTQA 3UMSA 5D51S 2F9MA 3O3CA 1YAJA 4JJAA 1SUEA 4BMVA 1HZZC 3L46A 4UUBA 5F2EA 5LQSA 5SZKB 3T3HA 2AUMA 4JXKA 4CQMA 5FWNA 3EPLA 1EKXA 1Y33E 3AETB 3HJUA 4DB4A 2H4HA 2HMWA 5L45A 1NNEA 3WBFA 3F5QA 5CA0F 1WHTB 4YUVA 2FRVA 4QHTA 3ISVA 3JYPA 3KD2A 2FPIA 221PA 3GAMA 3TFWA 3V4FA 2WTAA 2FI1A 3WISA 5JQWA 3PTAA 4WPGA 5J4HA 2VDVE 1U2PA 1X7YA 3G59A 3T94A 1UBCA 2YWHA 2A1IA 4LUCA 3IO3A 4YRNA 3W5BA 5KC9A 3AC0A 4YLYA 4RJ2A 3JRNA 1GPYA 6AT1A 1SOUA 2AEFA 2IUFA 2Q0XA 3KPJA 4GYKA 2GEUA 4YP6A 4C6TA 1NOKA 3IT3A 4K6MA 1E9BA 1KQOA 4OYRA 1DAIA 3ZV7A 3ZE6A 1WZEA 2B21A 3ZCUA 1S3IA 3Q11A 3OZFA 3OURA 2X4DA 1QLWA 4KDRA 1L7RA 4P22A 5A4DA 3E3LA 2FZVA 1PDOA 1ZUHA 3H18A 4RQUA 4KHPB 2X5NA 1XG5A 3RVJA 2H57A 1QP7A 5DCLA 3W2HA 3WXBA 2XQVA 1XF9A 2H08A 3KKNA 1LBIA 2FW8A 2FYTA 3BXOA 2GD0A 4JLBA 3TE6A 1ZK1A 3NATA 1UC8A 2NM0A 4ND6A 1EXWA 4UZSA 1SHZA 3D2CA 3EJ6A 1ULHA 2AX3A 5KYUA 4F46A 3I64A 2B4TO 1HMPA 1TJPB 4PS0A 3SZGA 1DVRA 2J4FA 1B1CA 3E1GA 3A9RA 3JQBC 5AVXA 1W8IA 4IQ0A 1E2DA 1GV1A 2PZFA 3C6ZA 4QODA 1PFUA 4RTLA 3EUEA 5DCWA 4E7OA 1RJWA 1AQLA 2R84A 4TV9F 5HDBB 3UG7A 2ZTLA 4UNNA 3QHAA 2DLCX 5IG2A 2MHCA 3CA8A 5TQVA 4CF3A 4CEJA 1T29A 1YZVA 3F2IA 1QGUA 2GS9A 3L01A 1NR5A 3L8ZA 1VXRA 4N0EA 1Y6ZA 1QFZA 3MWJA 4F91B 1I6MA 4XPIB 3ROXA 2I0FA 3UH1A 3A27A 3WQRA 5FA8A 5JAOA 1H9BA 2UZ1A 3DE7X 5CX1A 3PT5A 4QELA 1TLFA 3VBEA 3MUOA 4LDNA 1B74A 3CJRA 2ZAOA 3EIEA 2XB9A 2CDBA 1NMSA 2B9EA 3SNKA 4RTOA 1X1SA 2HREA 2RGNA 1I3CA 3RW9A 3AKCA 3U0VA 1VCHA 3EZ9A 3GJRA 4RX1A 2OXTA 3KKMA 1JEQA 4J0IA 1E5XA 2GEBA 4UAGA 1X86B 4WNCA 2J1LA 1CDEA 2AZTA 2VL7A 5DPMA 4JXJA 2PKCA 1DPFA 1L4LA 1T2NA 3P19A 3F5DA 4GC9A 4WY2A 2RHWA 1NNLA 1N5LA 2A0XA 4LOHA 3WRXA 1BWRA 5MHTA 4HDSA 4UXIA 1JHZA 2MWMA 3M4ZA 5C0OE 4CL3A 4WOPA 3Q3CA 3UAZA 1P2FA 1XEAA 3BAZA 2GH1A 1UJ5A 3H6GA 3MMXA 3PDIB 5F52A 4DJDC 1ZW1A 1W5BA 4L5JA 2C3UA 5K09A 4R1OA 1OJ7A 4RHEA 2I7VA 4BGEA 1G1AA 4TLDA 1NYRA 1E6UA 1MAVA 1NTRA 1XDZA 1XZQA 2VAVA 4IDGA 2VDNB 3IJPA 4Q7KA 3CGGA 2IP1A 3IUJA 3NQ41 2XEDA 2YWGA 1KR2A 1P5ZB 4JUDX 1VMIA 1F7UA 3WGTA 1IQPA 2JEZA 3KQPA 4LJKA 3GGDA 1TEHA 4CL2A 4LAFA 5K0EA 3U4QB 4FIZA 4DRXB 3ABOB 2QM7A 4KGVA 1J6UA 1G5RA 4KIUA 3P0JA 1WXXA 3B1ZA 3R5XA 4WK0B 1X8JA 1T0PA 3IO5A 3PIIA 4E51A 5J5VA 1J33A 1YHYA 1IMJA 1ACMA 2JHGA 2QQ0A 4I6EA 5FYDA 4DHEA 5LCXA 5ICMA 1DC7A 1GZ4A 1OCEA 2POCA 3NXSA 3NJ4A 4JA0A 1S3SA 4INJA 4QLOA 1MOZA 5AVJA 4XD7D 3VZBA 3G88A 3ESXA 3MJTA 3ZGYA 4RIFA 1C0PA 3R41A 3N39C 2C04A 3MVEA 1FDUA 1ABEA 4NOMA 4TVKA 3DPIA 4Q15A 4BN5A 3CBQA 3GEIA 4WI1A 1A76A 1GEGA 4PWZA 3K0HA 1G8JA 1DRWA 3DHYA 1WU8A 3PKJA 3D2LA 3QPDA 2BHNA 5THXA 5BSGA 3OZWA 1H22A 4P5PA 2RE8A 2REXB 3CPSA 2CBXA 4QVIA 3Q2KA 2Y0CA 4B73A 1G8KA 3WV4A 1G55A 2VF5X 1IBSA 3TRDA 3EEFA 3ZXXA 3MQFA 3ZX4A 5L9AA 2ZZMA 4C5CA 3RS5A 1ZM2A 4F6RB 1X1RA 3BHIA 4BEBA 3IL2A 2HFKA 4M9XA 5AIBA 1U0LA 4TGLA 3DKPA 3CPEA 1ULAA 3IBSA 3ZH2A 5JJBA 3O82A 1ZU4A 4BIMA 4HUQA 1ZGGA 1HRDA 5EAIA 1S0UA 4U63A 4EYEA 3KR0A 4LOLA 4MCIA 3EISA 5DBFA 2PSHA 5FHRA 3ZZUA 4CFZA 1BHJA 1CR6A 4J9VA 1JG1A 1V8ZA 4GWGA 1WXHA 3F1LA 2H8KA 1Y6JA 3R3HA 4DCOA 3DZCA 3WL8A 4QDKA 3HWRA 1QHYA 1H5NA 4ZTUB 2GCOA 3IP3A 2GLXA 1ORVA 5ELLA 1WKVA 3OZUA 4B5KA 5JCJA 3IDQA 2FMTA 2R8RA 1SCUB 2O3UA 1UP7A 3L0PA 5DSTA 3RLFA 3UY4A 1BX1A 4DQDA 4WBSA 5CB8A 2OV6A 2EDAA 5FLYA 3NAGA 1R15A 1B1AA 1KEUA 4M89A 4RNDB 2GTPA 4Q82A 3AEZA 4P98A 2OCKA 4XE5A 3RK0A 2IP2A 3FUUA 1JPVA 3KXDA 1V1RA 3O8CA 3HKCB 1SBQA 4D4GA 1PCXA 1ZD8A 4LMPA 3G9QA 2Z0MA 3G8AA 1LPOA 4OHVA 4A3SA 4DWJA 3HCWA 1V6AA 3BZBA 4IINA 4OQEA 4F0JA 2BRUA 4KV9A 2YXDA 1N6NA 4MGKR 4B8WA 5AW4A 1SIOA 3MD9A 4EG8A 1X8XA 4Z4FA 3RYIA 3T7DA 1GPWB 2A5JA 5BYBA 2BBTA 3Q15C 3CU5A 4X3CA 5E9AA 3AZQA 4Y2YA 5AJUA 1MOSA 3KJNA 4WKOA 5IWCA 3GLFE 4G5GA 1VDZA 3KFVA 4OXYA 2QXYA 3L6OO 2PX6A 4IXTA 1GCOA 2Q41A 4H7DA 3CSSA 1TM5E 2PTGA 4MZXA 3WYDA 1D6JA 1ORIA 4XA8A 4IG9A 5H3CA 2IE8A 3LRXA 2B1QA 3ZPXA 4X5OA 4E4TA 3AVTA 1UZAA 4URXR 1Y4SA 3HO6A 3JQPA 1FBNA 2M2IA 3L1JA 2WFMA 1FCJA 4ON9A 5K3OA 2IVZA 2ZRJA 4F2DA 1XDSA 4K46A 1PKEA 5JSFA 3I83A 5FEMA 4UTPA 3KDAA 1T6ZA 5AKLA 5FFNA 4G1CA 2PDAA 3WK4A 1XI2A 2XBLA 2BOVA 2Q3HA 5ADWA 3TMKA 4PCVA 2QPOA 1Y6QA 4QX6A 4RVSA 5JSZA 2OD2A 1XPUA 1V6SA 4RACA 1U2ZA 3OLXA 4M86A 4R1LA 3W1EA 1M2VB 1IPHA 1NONA 4KSCA 1R6DA 5K3BA 1CC1S 3B6JA 2CVZA 1TC2A 5HW0A 1Y0BA 3OIFA 1JDUA 1HSZA 1WB5A 3UJHA 4X93A 2AK2A 3AOGA 3LUDA 5HYVA 2IHTA 3BM5A 3DMRA 1VG0B 4MVWA 3HGMA 1FLVA 4GD3Q 4PZAA 3ZHCA 5JQGA 1F6DA 1HSOA 3U2QA 3BQNB 2BEVA 3KVNA 3FE2A 1CQJA 1ODJA 1U9JA 4LJ9A 3HUDA 1U0SY 3KL4A 4PQRA 3QPAA 3O4HA 4H6VA 2YVUA 3MJDA 4MS3A 2ENUA 3TQOA 3G49A 1A2OA 4E12A 4WKCA 2GVZC 3WGMA 2G9UA 1ZGBA 2VJMA 2WU1A 3ICQB 2PRSA 1OWNA 1D04A 2OCPA 3C3KA 4O4JB 1JKJA 4P3YA 5L3QA 1ZPDA 5LM3A 4GKJB 4J49A 2VK4A 4NCKA 4O1IA 3ZS8A 5ALKA 1TM2A 3IV9A 3OO1A 2ESRA 2JLZA 1TU3A 3O2JA 5FORA 4GXRA 1MRSA 2A1UB 1X0VA 4WY5A 2BTOA 1UBTS 4DLKA 2XNKA 2XYHA 1Q7GA 4H17A 4B6GA 4Z7JA 4ZICA 1U1CA 2JBWA 3P2IA 1YOVA 1BO6A 1KQPA 1PJQA 2TMDA 2ZIWB 5K3CA 1FFDA 2BFEA 2OYSA 3GEHA 1HDIA 1ZCAA 3QKSA 1C50A 5H5JA 2AMJA 3S8MA 1CNEA 1M2OB 1NBME 2QP9X 4Q05A 5CDFA 3WC4A 1S8AA 5IBRA 4YJGA 1ZI8A 1LEHA 1AURA 2ZREA 1BG6A 3O03A 4Q3AA 5EZYF 1MEEA 1P2DA 2ZRQA 1QZTA 1VG8A 4R6XA 4BVJA 4Z1OA 5K2OA 4GPD1 4Q9HA 3GRYA 4JGBA 3PDWA 1T4GA 2IYOA 1RYMA 4NJEA 4YCJA 3SKYA 4DA8A 3NHSA 1XMQB 2KB0A 1WBDA 1RPTA 2Q3CA 1RU3A 2IXFA 3FGPA 2XQGA 1SCUA 4XDHA 1L5FA 2ST1A 2OFFA 4KR2A 5K3EA 1UBMS 2XNJA 4ZOCA 3WWDA 4NV1A 5NLLA 1SQSA 2Z08A 1X87A 5JVDB 4URWR 3ZKAA 1RZRD 1ZESA 1FQWA 2BJWA 2G5GX 3RT9A 4AKHA 1RRFA 2IPXA 3T7KA 3LKBA 4EL0A 4K6OA 3CISA 4Y2GA 2O0LA 2UXDB 1CP2A 3V2GA 1L4BA 4BASA 4B79A 4EJMA 1FDTA 4QYTA 4JGIA 1BKSB 1Z6GA 2XGGA 2OCGA 3KYIB 2WVHA 3NCTA 4MW1A 4CF6A 3LHIA 4UVDA 4QO7A 1LK0A 1P5JA 1PS0A 4ZODA 3URKA 1DBSA 4G5YA 3DB1A 4CM7A 4YCLA 3A6FA 1DAEA 3JD3A 4BNZA 2JHCA 3H1TA 4K88A 4ZHQA 1QU2A 2QJFA 3Q8KA 4JR0A 1SCBA 1T2EA 1UADA 3M82A 3WNDA 1CIPA 3N0VA 1UKVY 4BFWA 4YJGB 4EY3A 2BR4A 4C3OB 1M1YB 3LF2A 1ZK0A 5SV2A 3FN4A 2D3TA 3CCCA 5BSWA 3O0TA 1ZO8A 1F2TB 3QUCA 1FB5A 3T95A 3CT6A 3G8CA 3OIGA 1CNMA 3P0IA 1EVQA 2E55A 2LIVA 4FBLA 3OKFA 1K0UA 3NORA 3FNFA 3HH8A 1D03A 1YJAA 3HLYA 3UOWA 4N7RA 1YQ9A 4RF3A 1GLVA 1KI1A 2QMQA 3NM6B 2DFDA 3VNQA 2H4YA 3S2EA 1UC9A 4E5YA 4YMHA 3O90A 3OZRA 4Q1DA 3OWOA 4M9QA 1O95D 1BMDA 3KLPX 3R0XA 2IODA 4H16A 4LJAA 3D6FA 3GNTA 4BC1A 5BSKA 2GBIA 3I8SA 1RXUA 4IHKA 4KUEA 2B4RO 1RP7A 2ABWA 2A3NA 2VPZA 3L8EA 4KXFB 2BI7A 2VHVA 2X9NA 4W5HA 1KI9A 1OKKA 3GEGA 3PRKE 1RYYA 1XNJA 3KYCB 1EFVA 4WVLA 4ZZ2A 1G20B 4RH0A 1PQYA 1Z5PA 2Q8QA 3A4NA 3NBZC 4HGPA 4EMUA 4OAPA 4BC0A 3IVAA 2P65A 1G6OA 2DHRA 4JEIA 4OP2A 4AY6A 5CA0A 2G7ZA 3KU1A 2R79A 3RRXA 4RK0A 3MGBA 5L95A 3EVBA 3BSSA 1ZVKA 2ZRKA 3GJ5A 1W88A 2IDJA 4MEJA 4FYYA 3ND8A 4Q3NA 4R0MA 1P7ZA 1EVEA 2OV8A 3DUFB 4F2PA 1GG2A 1L4GA 4BOYA 2Q2NA 1ZD9A 4Y2XA 4AP9A 4M36A 3TD9A 4OQYA 4KW7A 4GO1A 4YT5A 1WXQA 3PP8A 2QN3A 1Y7HA 2C97A 2D1RA 5CVUA 1Z4PX 4MVXA 1SXGA 3SICE 5HJ5A 2ZYRA 2JF0A 4Q19A 3U9SA 2X2FA 1KA9H 4BKRA 2WIBA 1JQEA 1L5HB 4JK3A 1B42A 5EJIA 2D59A 4Q3BA 1CUFA 1N6OA 2VR1A 1JKMA 5AW2A 1JI3A 5J2TF 4WXHA 3N59A 2F1KA 3LXRA 2G1UA 4Y1RA 1P1IA 2YJGA 4X0EA 4BKPA 1CJKC 3PNYA 2GWHA 3C1TA 4FYXA 4RA6B 1Q0RA 4JJIA 4ZVKA 4ZI7B 4MROA 1H66A 3A9UA 1I10A 1WXFA 1NMEA 1WPQA 1T34A 4IDNA 3NGXA 4UDNA 2BI4A 2LWIA 5C37A 1KAMA 4LI0A 2ZSBA 3CNQS 2E82A 1NLYA 2V6JA 5JARA 5HS6A 1P0QA 3EMBA 4HG2A 4RWEA 4XW2A 1PS9A 5A3VA 3UAVA 2NU9A 2XE6A 3A6EA 3JQ8A 3LLSA 5FUQA 3KTAB 3R7AA 4HPXB 4C89A 3R6LA 2BFBB 1JDJA 2XWJI 1JR2A 3AW8A 3FLEA 5KYYB 1KKLA 4JBLA 4O0LA 1TRKA 4ZGWA 2F3SA 3MMSA 1M0TA 1Z0IA 2DP4E 1VYTA 3OICA 4U7WA 2HCTA 4R2IA 1S9HA 2IITA 4S1TA 1RM5A 1KI3A 4NG5A 3A6GA 4D25A 5BVHA 1FS6A 1KERA 2RC5A 4ZC1A 4G0OA 3WGOA 1E6CA 1B7GO 1O8BA 2AN4A 2E4WA 1KOFA 3F96A 3HKDB 1MIHA 1RRKA 2JCBA 2NO6A 3A1EA 4M6WA 2YZ7A 5LXTA 3R5KA 3X2SA 4KE8A 1HFWA 4MWSA 4EQ6A 5TT0A 5KNDH 1F38A 5H7XA 1YDMA 4ZVLA 2IZ6A 1XCOA 5A7GA 3WLNA 3DAPA 4W9NA 2FPRA 4G1EB 4URVR 2DUMA 4C87A 1RC0A 1VYUA 4M8NE 4OEHA 4MW9A 3WB2A 3MOSA 1BEEA 1BN7A 5C4IA 5LKAA 2ZJ2A 1XEXB 2NZXA 2R8OA 1DAKA 5LMZA 1NW5A 3OX4A 4W7IA 3TL3A 1RWWA 2ZJ5A 1EGAA 3S1AB 5BW4A 1DOZA 1J56A 5C8XA 1VCMA 1RJ9B 5DXAA 3V8NA 2ACVA 2FW0A 4CKBB 1VRCA 5GV8A 4AUEA 4U4AA 1C5KA 3S81A 1YJ5A 1G2OA 4Z9AA 2PH5A 3RTBA 4CR8A 1IJEA 2GNAA 2FWAA 5KU7A 3IEVA 4FP9A 2C3MA 1L4KA 2JCSA 5KQSA 2DH6A 3LVRE 1XYYA 3IV6A 1VL2A 5CTJA 4YS6A 4ODIA 3QTBA 1N5KA 2BFEB 3MRXA 3R5TA 2NTJA 3RIHA 3HJFA 2XYQA 1A4XA 4PRLA 2CMGA 1W0JA 2QVLA 3P9NA 3QEOA 3QXCA 4Q47A 5KOJB 1VI5A 3U3KA 3JALA 4MMZB 3A6KA 1KP2A 4H9GA 4M1SA 4EYGA 1DBVO 1H1LA 2O57A 4B1FA 5IC4A 4HS9A 4QUKA 1KEEB 3VDQA 4YUZA 1KZYC 3U13A 5CCDA 1AK1A 1AU9A 5EZ6B 4DBZA 1C7JA 5EVJA 4OLJA 4OMUA 2Q7OE 5IDQA 1ZD2P 3EFEA 2Q5OA 4O4JA 4QGFA 4R3WA 4KJZA 4LHEA 1QAMA 3DP7A 4LDRA 4PG5A 5AVKA 1W0KD 1NJ6A 1Z26A 3O75A 3CZQA 1FTSA 5EY5B 4ZHSA 1C1YA 1YTLA 4ZKDA 2OM6A 1EDOA 2QK4A 4G5XA 4N4AA 5HKLA 3DOHA 4RKQA 3TO5A 3FNRA 4YMVA 3VU3A 1XZMA 4YT2A 1T6BY 1Z5OA 2IZZA 3E27A 3VR4A 4Y2RA 2OG2A 1KHHA 1W0KA 3WIBA 3PL5A 3PZRA 5AW9A 3HA7A 3OHMA 4FGKA 3DCJA 3HBAA 1L7QA 1YQGA 2FQ1A 4NRDA 3BD8A 3TI7A 1II8A 2C61A 4AZ3B 4FFMA 2J9RA 1MAHA 5HJ2A 1KRXA 3UPTA 2YFHA 4GYJA 1C3OB 5DMHA 1RD4A 4QXRA 3MBIA 1S7CA 2EJBA 2G4CA 2WQ7A 4NJEB 4RD4A 3NV9A 1FYVA 1AX9A 4XX1A 3EXHB 5M3BA 1E2FA 1KARA 1Y3HA 1O03A 3F6EX 3DL4A 3HV2A 4A6XA 1ZIDA 2QD5A 2X9LA 3G1UA 1FNCA 1P3Y1 1Q6ZA 2QN2A 3R20A 1XVVA 2XUIA 4KK4A 3HWWA 2GRUA 4DS3A 4B83A 3ASUA 7ADHA 2ISCA 3L0ZA 2I6QA 3N3BC 2OHVA 4TZTA 1W2WB 4LK2A 1BW9B 4D9GA 5J43A 1K5DA 1V95A 5LOVB 1S1MA 2W98A 1E2QA 3AHEA 1ZLXA 3RIYA 4XTRA 1U2GA 1XRLA 3SR4A 4MEBA 3TLKA 3OEYA 5F1OA 3EZYA 1UK7A 3GA5A 1RDFA 2ECOA 4O5OA 1D2MA 3R44A 4R9UC 2QRGA 3QKWA 1NURA 1KAHA 1GTJ1 4I6GA 4YO8A 4IV8A 2YJ4A 5CG1A 1KIMA 4F4UA 2P9YA 1Y34E 4J2HA 5GJWC 2R8XA 3WLAA 1G4UR 1NBAA 1HLDA 3KLNA 4IAOA 5G4KB 1PYDA 3T9AA 1XJWA 1E9DA 4UFPA 1QIIA 1N9KA 1ARZA 1UANA 3K7EA 1IFXA 4C4ZA 2QRPA 2IS4A 1WHSB 3QG1A 1WV1A 1E6KA 1J0DA 4P33A 1L4EA 3K0FB 1KO5A 4HFRA 4J94A 3T4XA 4E21A 1R2QA 5B6PA 3KS9A 4OIFA 4YR9A 4OOEA 4XIIA 4NECA 4WERA 3QKRA 2PWPA 2QTLA 2GRAA 1QAOA 1T8TA 3W3AA 4NU6A 5G3YA 4ZOLF 3NWBA 5KSWB 5I5EA 1OXSC 3IMEA 1KH3A 5KNLA 2H4JA 3JQQA 4C2BA 2FCRA 2VO1A 1JQJC 2F1IA 2DU8A 2BBSA 1Z5UA 3MMPA 4TMWA 3I1IA 3C5HA 4ZJUA 2FU5C 4X66B 5AHWA 2C58A 4UHEA 2B7LA 2N46A 4PONA 2QLNA 1EFVB 2NU8B 1OLUA 2PZEA 3CRNA 1QO0D 3IBCA 2EQBA 3E1KA 4KYUA 4RDIA 5EKUA 4ZV7A 2A6PA 2H29A 2YVLA 3CCBA 5DGCA 5BOSB 1ECCA 4D5GA 2GAFA 1H6DA 1KORA 4YAUA 5EQDA 1RQLA 5EZSA 3SJUA 2WAMA 3QTTA 4BU0A 3Q9NA 1VXOA 4I1RA 1DUIA 5JY6A 5JBIA 4DEXA 1H2RS 4M49A 5GJBA 1C0EA 1UZNA 2VRNA 2XHEA 1Y7TA 2B1JA 2ECQA 2EFEB 2DUWA 3OPYI 1WSDA 2VBCA 4BDSA 1ZH0A 4WCDA 3ZGXA 4H6XA 2ASEA 1GG8A 4TVBA 3SX4A 1RXWA 2LVBA 3DNMA 3AFHA 4PTLA 2O07A 2P7HA 2PS3A 3FKSD 1ZUIA 3FWYA 4H77A 1AZSC 4D9MA 1WUIS 3HGTA 4NIMA 3M9WA 3RU3A 1RCFA 1VPWA 3F4LA 1ZMTA 3FYUA 4MDEA 1FLAA 2HEGA 4TKVB 3EZGA 4UVHA 2IYQA 1ND5A 3NFRA 3C3EA 4IDBA 1TI7A 3RUCA 5IJ9A 1QP8A 3GEMA 3NGLA 3K0KA 3U1TA 2BFWA 2JNWA 3OJXA 3VO1A 3RNOA 4RZ2A 3AKYA 3TMYA 4AX8A 5EJGA 1Q5PA 1V7QA 4HEQA 1EUCA 4LYYA 1XMJA 3VR2A 2FPMA 3JW8A 2Q3BA 3TVYA 2CCGA 3DTTA 1FPQA 3RR2A 3AVUA 5KQPA 4TRMA 3RGWS 1SVLA 4P4LA 5JZBA 4EZEA 3KFXA 3GOQA 4BNTA 1TIBA 5EXXA 2ZB2A 1AUXA 3IDAA 3V8QA 2VTKA 1XZHA 3CRVA 3R76A 5KJ1A 3JQ7B 5DYTA 5CFMA 3GLFA 1S2OA 3PWKA 2NVWA 1AHIA 1SQGA