2HRDA

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with thymine and phosphate ion at 1.70a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with thymine and phosphate ion at 1.70A resolution
rcsb
source organism Salmonella typhimurium
total genus 88
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hrdA00
4GLFA 3MMSA 4WKOA 4YMLA 1YRYE 1A9SA 4M3NA 3LBAA 3UAXA 4P54A 1PR2A 1WTAA 3SCZA 4M1EA 4EARA 3OOHA 5F73A 1ODJA 1A9OA 1PR0A 1V2HE 2I4TA 3KUKA 2AI3A 4PR3A 1V48A 2QTGA 1JYSA 3BGSA 1OV6A 4TTIA 4L5YA 4LZWA 2B94A 3FOWA 1TCUA 1OVGA 4LNAA 4TTJA 1RFGE 3MB8A 1VHWA 1Z33A 4BMXA 2PGAA 3DJFA 2HN9A 2HSWA 3K8QA 3UT6A 2AC7A 2A0XA 1LX7A 3QPBA 5CCEA 1K27A 1RXUA 2P4SA 3PHBE 3FNQA 1PKEA 1JPVA 4UC0A 1T8RA 3NM5A 4D8XA 3DF9A 4LKRA 4WKNA 1RXCA 2AI2A 1OUMA 1PW7A 1YQUA 3DDOA 1U1DA 1ZOSA 3T94A 1Z36A 4F2WA 1Y1TA 3OCCA 1A9QA 5KB3A 1ODIA 1Z37A 5F7ZA 3O4VA 3EEIA 4NS1A 1SJ9A 1RYZA 2HRDA 5F7OA 4OJTA 1U1GA 5JPCA 1PF7E 3FUCA 1K3FA 1M73E 4GKAA 4QASA 3OZCA 1PR5A 2A0WA 4JWTA 2BSXA 3NM6B 4TYMA 1A9RA 1RT9A 1G2OA 2QPLA 1PK9A 1OU4A 5FAKA 2ISCA 2XRFA 3PHCA 2OXFA 3LA8A 1PBNA 3EMVA 4QAQA 1U1FA 4KN5A 2H8GA 4R31A 5C80A 1FXUA 1VHJA 4G41A 4DARA 1B8OA 3P0EA 4OY3A 4TS9A 5B7PA 1PR4A 3GGSA 4I2VA 1JDUA 4NY1A 1SD1A 3IOMA 3ONVA 4DA6A 4JOSA 2QDKA 5CXQA 2RJ3A 1Z35A 4U2KA 3BL6A 1A69A 4L6IA 4TXNA 5F76A 1CB0A 2IQ5A 1Y1SA 4R2XA 4MCIA 1XE3A 4WKCA 3E9RA 3E9ZA 3PNSA 4GMHA 1Z38A 4LDNA 1U1EA 1Z34A 1JE1A 3BSFA 4MCHA 3ENZA 4DA0A 2QTTA 3E0QA 1PWYE 1YQQA 1SQ6A 3TL6A 1T8YA 1N3IA 1RSZA 4F3CA 3K8OE 3DPSA 3OPVA 1V3QE 3GB9A 4WKBA 3P0FA 3UAVA 4OGLA 1JDZA 1OTXA 4QFBA 1V41E 1LV8A 4DABA 4ECEA 3EUEA 1ODLA 5F7JA 3EUFA 1Z39A 5EPUA 3UAZA 4K6OA 3UAYA 5B7NA 4JP5A 1JDSA 4F3KA 4BN0A 4QEZA 4WKPA 5CYGA 5IFKA 4D8VA 3FWPA 5CXSA 1RXSA 4IP0A 1TCVA 4D9HA 2OC9A 5F78A 2OC4A 1PR1A 4OF4A 3KHSA 1T8WA 5I3CA 4DANA 4OEHA 4YJKA 4M7WA 1RXYA 2AI1A 1QE5A 2QSUA 1NC1A 4G89A 4YO8A 4EB8A 3KVYA 4H1TA 1NC3A 1I80A 1T8SA 4E1VA 2GUWA 1C3XA 2I8AA 4LNHA 4DA8A 1Y1QA 1NW4A 4X24A 1TGYA 3DP9A 3KVVA 3NM4A 1JDVA 5F77A 4TS3A 3LGSA 4YNBA 4L5CA 4TXJA 1JP7A 1CG6A 3IEXA 1Z5NA 4MARA 2OECA 4PNPA 1K9SA 3BJEA 4L5AA 4D8YA 1ULAA 1V4NA 1Y6RA 4OGKA 4BMZA 3F8WA 1RR6A 4F2PA 1A9TA 4FFSA 1ECPA 1JDTA 1VFNA 4BMYA 2Q7OE 5CCDA 1B8NA 3OOEA 1A9PA 3INYA 3OZDA 1RCTE 3KU4A 1SD2A 1OTYA 3PNPA 4DAEA 5IU6A 1PR6A 1U1CA 2ON6A 3O6VA 3U40A 4TXHA 4TXMA 5ETJA 5B7QA 1Y6QA 1JE0A 2A0YA 5B7GA 1YR3A 3NBQA 4DAOA 5CYFA 4RJ2A 5F7XA 2HWUA 1Q1GA 1VMKA 5K1ZA 1T0UA 4TXLA 1Y1RA 5EFOA 3D1VA 4NSNA 3C74A 5DK6A 4L0MA 1ODKA 1V45E 3OZEA 3OZBA 2A8YA 3OF3A 3FB1A 4D98A 1TGVA 4R2WA 1Z5PA 1YBFA 4GLJA 3KVRA 1PK7A 5EUBA 4DA7A 1TD1A 1ULBA 1LVUA 4QARA 3FAZA 3UAWA 4TTAA 4F1WA 1Z5OA 3ODGA 4QATA 1ZL2A 4G8JA
chains in the Genus database with same CATH superfamily
3GDWA 2D7CA 2YHUA 4S1TA 3NGXA 5FOSA 3MMSA 1A8HA 2HM7A 2WYHA 1AC5A 1QNLA 2AOXA 2B82A 2OXEA 2PSHA 3E7XA 3QF7A 2ATCA 4OSOA 3ZE7A 3EF1A 4UTRA 3ZCTA 1FP4B 1Z4PX 2CGEA 4JDUA 2RBEA 1ABEA 4RIHA 3H9UA 3BMCB 5JH7A 3UAXA 4W5QA 5LQUA 5BXYA 1PR2A 1VZ3A 3THSA 3TTWA 2Z95A 2X2OA 4KE9A 4N5DA 4H77A 5D3MB 2XRYA 4H7HA 3TLCA 2ZWPA 3WK8A 1R9JA 2YJZA 2OO5C 1CQPA 5FX2A 4P34A 4H60A 1MZPA 1QANA 3VR4A 3ICPA 3A32A 1PV2A 1UBOS 5IC6A 1NY6A 2CXRA 1OHHD 5KHAA 4MQEB 3ZCPA 4FKZA 3OD1A 3V2GA 2HYDA 4FKMA 3RV3A 3IE2A 5AJTA 3GLFE 2OZPA 1G38A 4D43A 2ZM6B 3C3XA 3MJFA 4L28A 3P2KA 5ADWA 4JLDA 1ZLXA 1ZNZA 3H75A 1SOUA 4AP9A 1EBBA 1BJTA 1SH7A 3LT1A 1M8FA 4BP8A 4CIVA 3HO1A 4RVDA 3IFSA 2BGMA 3RG2A 3MB5A 3HO8A 4B32A 1PNRA 2BMDA 3SBDA 2HI0A 2Q6KA 4Q3CA 4LCJA 2J5RA 5DTQA 4ZCPA 3GAMA 4L9WA 1FFYA 4MA0A 3SQOA 1QRTA 1MMFB 5D6NA 3L04A 3KPJA 3BYZA 2Q5JA 1NNI1 2IU4A 4FS3A 2HCTA 4U2DA 1U11A 3WIEA 4R2KA 1MB3A 2Q1YA 4RH1A 3T9AA 3D4IA 3IYLW 4D6PA 3AJAA 5FYQA 4HVAA 2JIZD 4BMXA 1P7WA 2XF8A 1C9YA 3MD0A 3UT6A 2VDMB 2DBVO 1EE9A 2R8PA 1JKFA 4ZU3A 3OLVA 2HSEA 4BAGA 2N9UA 2YN0A 4Z4GA 3SJUA 4FD2A 3H5IA 3RU2A 3V4RA 2J3IA 2XHEA 3EE6A 4MUMA 2FQWA 2G09A 3HDYA 3T1QA 3S2IA 3TSOA 2I1LA 3DTYA 3U3KA 4TKVB 4TV9F 1T2EA 4M0UA 4Y1FA 3GX1A 1U5BA 1CYDA 3GPBA 2JHFA 2QAGA 4DBLC 3NM5A 5TPZD 2XB9A 2GM5A 2E4WA 3G9UA 3LQ2A 2VWGA 3QPVA 2PJRA 1KMQA 1W4RA 2P0AA 2ZPTX 2P90A 4P32A 1HDZA 1LDYA 2EATA 1UDRA 3H97A 1FMLA 3I8SA 5ADUS 1IPHA 5FBRB 1IY2A 2Q2OA 4MQ4A 3ZV6A 4XWTA 2PJZA 3ZXXA 3MFQA 4BJ3A 1GAXA 1AOXA 2QYSA 1EEHA 3E5NA 3KYDB 4PBSA 3NHUA 1RWWA 4MEJA 4OTZA 4QUIA 5IAAA 3MCTA 3RYIA 1DC6A 3RTDA 3T9BA 4KXUA 1D09A 5E1BA 3D4NA 3HO6A 4BFXA 4F2WA 2C8VA 1DOAA 1Y1TA 1DXQA 2GPNA 4P35A 4EI7A 2ZSBA 2VLBA 4RHXA 2OOSA 4BLUA 4OB8A 1RIIA 2BRUA 4NHEA 1H1DA 9GPBA 1G8KA 2NYAA 3QWAA 2IU0A 5FV4A 2GXUA 5CA1F 3GLUA 1V8ZA 4TKMA 1SR8A 3VR5A 5JCJD 3CCCA 4DTIA 4YMGA 4RTSA 3ZI0A 1UZUA 2E4XA 3W2HA 2X1VA 2X4GA 3VV3A 1YZHA 3BKWA 3JQFA 1LZLA 5F7OA 4PBTA 1FL9A 1P75A 4KPEC 1AHIA 2PTHA 3EASA 4TLEA 2YJ4A 1CPYA 1PT7A 2RK4A 1R0WA 1P81A 5EZYB 4FBMA 1NN3A 2NADA 1NU6A 4HDOB 2YOFA 5D85A 3R3VA 4C0QC 5HPYB 4WBXC 1MPXA 4YAJA 2QTHA 2J4DA 1V3TA 2EKZA 4D9EA 4IHJB 2CK3D 1FU7A 3OAAD 1NJSA 4OYLA 5JQGF 1MV5A 2VJQA 3VDMA 1Z7WA 3T1HB 4DLPA 3QV2A 1X1RA 3IIJA 1ESEA 1CJUC 1TCAA 4QJ4A 4AJNA 1HRDA 5ICFA 4KQ6A 2C94A 1EUZA 1V7CA 3GJYA 3H3XA 4N8SA 3NTVA 3TD2A 4RVOA 3VDRA 4HDNB 5CDYA 2FDRA 3AUXA 2YS6A 3TMAA 3WXMA 4A0SA 3NLLA 2CYCA 4RQBA 1XQ9A 3D8SA 3ICCA 3JXEA 1JH9A 3HP7A 3FCAA 3M4NA 5F3DA 4DJ5X 4BBAA 3QENA 3UUWA 1A9XA 4KEAA 2X0NA 4UHHA 2C58A 4DIEA 2X15A 3TLGB 4MDHA 1UK8A 3RSOA 1P3DA 3EVFA 2EF1A 3ZTWA 1AKNA 1SG6A 4PC2A 3KTDA 3T9DA 3QKRA 3BG5A 5EJ9A 2QW1A 2OP0A 4OQMA 1XXHE 1T9ZA 1ZK3A 4TTVA 3V8EA 1B8OA 1DL5A 3IIKA 3STXA 4WZAB 3VHRA 4IDNA 2A7XA 2H1RA 5KNBA 3GLFB 5KWEA 1WPGA 2ERCA 2PGDA 3JYPA 2H1FA 3GQBA 1KJYA 3OU2A 3TQOA 4UTOA 4DV4B 1VL0A 4GOOD 1HYQA 3G13A 3LLUA 5JYCA 2PD3A 3PE4A 3Q9UA 4OXXA 4BVGA 5F3RA 4CW7A 3ANNA 2ZYGA 1TC1A 5CXQA 3NVMB 5CX1B 3SM9A 1VYTA 5LPNA 1Z35A 3OX4A 4ID9A 3ZLVA 3A3PA 3OURA 2XOKD 3FBWA 2FKNA 2JVKA 1JPUA 4L5IA 1C7FA 4L6IA 3SYNA 2IQ5A 3TLKA 2AMJA 4DCCA 1XVLA 1Y1SA 1AUXA 1DIGA 4WUTA 3VNUA 1M34E 2OV1A 3TMYA 3SF0A 2GEKA 2NX2A 3CF6R 2NZWA 5K7SA 1K68A 3UBMA 1MTOA 2QJTA 1XRLA 3QEKA 3CPHA 3MOSA 2QX9A 2PNFA 3KK0A 1O87A 3JRNA 1FNCA 1EJ6A 4XR9A 3DW1X 4MVJH 3VZRA 1XZGA 2FMTA 4BZXA 1FVHA 2YFKA 3OPXA 4J0EA 1WDKA 2FV8A 3TL6A 1E18A 1WB6A 3Q3HA 2EG9A 3M0EA 4V0KA 5BNIA 1Y7TA 2X2PA 4C7MA 2H1HA 1F06A 3LOQA 1NN1A 4R0NA 4ND8B 3MMNA 3VNAA 5TB5A 2IZ6A 3MM4A 4K6HA 4CM5A 3F71A 5FOTA 3FZGA 5G0WA 1KJ9A 3G2QA 4HX2A 2J6IA 3IEVA 4PEVA 1KJJA 2RG7A 3MS4A 4NCXA 2I4IA 1Z12A 1N77A 1N8SA 1NVAA 1MIOA 1T8PA 2AZTA 3OJFA 4K03A 5AVVA 3NMUF 1HZJA 3KKOA 2B7LA 1F2VA 2O6HA 3L9WA 1ACMA 2X8WA 2C2WA 4HH1A 5IAEA 3PGMA 4D9IA 4F9TA 1D8TA 2GZ1A 1ZJJA 2Q7DA 4UVEA 4IZOA 1W4LA 5CEJA 4ZVUA 1KMMA 2R66A 1DX9A 1NOIA 1GRCA 1XZBA 1V5IA 2TS1A 2Q0SA 5F3WB 1NXPA 3LGAA 4MB0A 1MG5A 2IPMA 1HMYA 4OBBA 3A06A 1CWUA 1NVWQ 1ODLA 1U2SA 3PITA 4X3CA 4BAZA 3UT5B 3CZMA 1JAIA 4NDZA 2BE7A 1SM4A 2DE0X 4RTOA 3DDUA 2PUVA 2V98A 2PMKA 4N9QA 5FORA 3V6MA 2CD7A 4Z7QB 4XOUA 1JJAA 4JCOA 4PX2A 1GFWA 3MJDA 4R7TA 1GGMA 4UBKA 2B35A 4NLLA 4QNMA 4XFJA 1Z8HA 2IXDA 2X1HA 1TKBA 2C59A 3M6WA 4OGWA 3ZY6A 4F86A 5KO2A 1T4CB 1KDPA 2OO5A 2FMHA 3GJ6A 4FI3F 5ANRB 3BMXA 5EE1A 1IEWA 4B48A 4EELA 5CH8A 3OZTA 3UXMA 4FEGA 4KWEA 2V7QD 4DOMA 4P84A 4P1ZA 1NW8A 4V1CI 3UMYA 2VAPA 2GM3A 1VJCA 3ZZTA 1HNZB 1W9MA 4NBLA 2ZYSA 2IHUA 2Z09A 1K97A 3JVEA 4EDHA 3C6ZA 4GICA 4REQB 4CMJA 3ETNA 3GAZA 3O8LA 1Y48E 2A92A 5LYJB 4NFYA 1ZCAA 3PF9A 4OF4A 2B1IA 2R79A 4MPDA 4OYYA 5NULA 2Q62A 4GFDA 3TZKA 4AY5A 3TX6A 5HUHA 4F4DA 3L7JA 2GYVA 2XIJA 1N5RA 2JFOA 5LQKA 3GLGE 1RNLA 3L7DA 1S2NA 4EB6A 2QVZX 3N2YA 1FQJA 5JARA 3FSRA 4NCJA 1VHDA 1R0XA 1XPJA 3FIJA 4N01A 1Q1ZA 4ZI5A 4HXFB 3BREA 1XXHB 5LL6P 1B16A 1IONA 3JQRA 1XTTA 1NC1A 4X93A 2HWWA 4CM1A 5HILA 3E9EA 3GW8A 2V97A 3L07A 4U63A 4PAQA 3VPHA 1CX9B 4XDZA 3WGZA 2QLTA 2ECPA 3KVYA 3EA0A 3QKTA 4JNCA 3EXFB 3LQQA 4LHZA 1VJ5A 3ZH2A 4JKYA 3TSCA 1N6RA 4EQ6A 3HUDA 4DVGA 2GJ4A 2LGJA 4NICA 1X1BA 2I5PO 4RA9B 4Z6KA 1IZ9A 3G68A 3K96A 5LUBA 4BFUA 4QDKA 1VRCA 4IIVA 3T3PB 2B7CA 1HX7A 2VQEB 1GG2A 3BHIA 2ZRMA 5AJHA 1RQLA 5JI3E 2FPIB 2G88A 1CY1A 2W00A 5LP6F 4AS1A 4FJ2A 2BHRA 3F6BX 3PI6A 5TDHA 4ASUA 4B2PA 1M34B 2AN4A 1EVYA 2IZ1A 3R5XA 4N82A 4R7GA 3RSHA 2VCEA 2HJSA 1NFQA 4IIXA 3KQHA 2N75A 2QS9A 4ALLA 2MU1A 1YS9A 3CUVA 2WSSD 4G5OA 4HQNA 2RAFA 3ZWNA 3VTKA 3P0JA 4MP3A 3ZWDA 2O8DA 4I9UA 1ZA2A 2YQZA 3LI2A 2YINC 3L5OA 1S2GA 2ECFA 4PZ9A 1DU4A 3GJSA 1E3WA 3FI9A 3UQYS 2D5AA 3EG5A 1CUGA 2XOXA 2WU0A 3OHMA 3K0BA 2PYDA 3Q11A 1QQTA 4DLRA 1JWAB 3WMFA 1KZ1A 5EC8A 3DOFA 3HKBB 4BX9A 4C6TB 2HC9A 2JCYA 3LL7A 4FCVA 1SG0A 2W0MA 4UBNA 5LMUB 1Z3CA 3A11A 4FFSA 1FRZA 2ZEJA 1RQGA 1Y8CA 3KC2A 1ZJWA 1X8JA 3L8YA 3VHXB 1GAWA 4BMYA 1HYBA 5EQFA 4EJSB 3OM9A 4K9SA 3UK1A 1O96B 1UZLA 1Z13A 3NATA 2Q7OE 2PQ6A 5CH5A 2FSVC 5K0LA 2FUKA 4BFZA 2Y71A 3HL4A 4IQ8A 5DGTA 3MPOA 5JCXA 1KSJA 4Q9DA 4NBWA 1RPNA 1Y4SA 4FZ5A 1YF3A 4G4SP 3SM3A 3DV0A 1CDEA 1L4EA 2OORA 3CUWA 3DR3A 4GX5A 4QHTA 2IUYA 2RIRA 3MAJA 3R09A 3ZDZB 2EERA 1P45A 2YHIA 3DOCA 4PW0A 3IERA 4RJKA 5EMKA 4F46A 2BKUA 1E3TA 1SD2A 5BYAA 3IMCA 4XPIB 4CMIB 5HQ3A 3GCDA 1U90A 1EM8B 1C4WA 3FPGA 1XMOB 4LCBA 3VH3A 1C9JA 3COZA 1QUFA 4ZAYA 4PPGA 4J0HA 2IXFA 5I9MA 2WA1A 3FYHA 4DV6B 4Q39A 1ZVQA 3D0QA 3UTDA 3HYNA 3EPHA 2V7PA 2WU8A 2DPGA 1IYZA 2IPXA 4WESA 4ER6A 2C8KA 4DV0B 3DQPA 2QRVB 3KR0A 3W8RA 4OX9Y 1PFGA 2GPSA 2JEYA 1GILA 2WFLA 2F7SA 4RJLA 4UZSA 4KXYA 3E5HA 3MWGA 3GLHE 4MJLA 3HA2A 2NXJA 2AWNA 3SKVA 3WL4A 3FFWA 4I4TA 4DIMA 1KTIA 2ACWA 1S2MA 3BCRA 5F4BA 3NYIA 2FQXA 5K8TA 1A95A 4Z8XA 3WMXA 2IPAB 2ZT8A 3H5WA 1CUCA 2NXCA 3ZR4B 4CM9A 3FA2A 3QE2A 5B3AA 3TTTA 1YDHA 2J30A 2WHEA 3HS3A 1Y9ZA 1YU6A 3ADPA 3JS5A 2QN9A 2XNSA 4JLVA 3NXSA 1XQWA 2BMAA 5BOVA 4HPXB 4EPVA 5H5JA 2VDWA 4LXHA 2PUWA 1E6UA 1B26A 2RIPA 1EZZA 1ESNA 4QPDA 1PT9A 5EIWA 5H16A 4ZTUB 1Z3IX 3LD9A 2YL2A 4QGHA 1HO3A 1V5GA 3HRIA 3PIDA 4GQAA 3FB1A 5FPSA 3UQZA 2ZBEA 1IZ0A 2NUBA 2OBLA 2Q9CA 2RK6A 2O3RA 1BA3A 3OZSA 4JQZA 5P8WA 2JGDA 3T8YA 1ORDA 3R6WA 16PKA 2IC5A 4PYLA 4C5AA 4OBXA 3I9LA 2Q8QA 3OZRA 4E5KA 5C34B 1MLDA 5FDFA 4KZPA 1J5PA 4Y0NA 1SQ5A 3EULA 4MYCA 3ZXYA 3ER8A 3JQ8B 4YONB 3IVXA 3WA6A 1TRHA 1XVAA 1RKVA 1ULBA 1P2DA 3Q2OA 1T36B 1GUZA 2YVQA 4Q1DA 4QARA 4YCBA 4HG2A 5GOZA 4DM4A 4EYKA 2CLEB 4CT0A 1E7MA 4BL5A 1P0CA 2A5YB 2G4VA 1VOTA 3IR6A 5KYTA 2P5YA 5AOCA 4C89A 1P1RA 3LQYA 2CBZA 3O8OA 2JJMA 3AM5A 5B3KA 2B99A 3ODGA 1NBIA 1U9YA 2CFTA 1USGA 2H1CA 2J33A 2ZLBA 1XN1A 3IPAA 3PZRA 5D5HA 3NEJA 3ORQA 4KRFA 2YRFA 5KNLA 5JNSA 1TT7A 3EN0A 5BW5A 3G9QA 1DG3A 2QT9A 3MA0A 4OP1A 1I3OA 2OCBA 1I1HA 3KQYA 3O0DA 1D4FA 1Z16A 1ST2A 1U2RA 4GP6A 5F1YA 2CLIB 3HN6A 3RIXA 1VE3A 1Q0RA 2ARKA 5I9NA 2W71A 2HD4A 1IBCA 3DWGA 5HTOA 3X1DA 1SKUA 5BXQC 2H7VA 1XTUA 4N0MA 3OPYA 1NVXQ 4J1SA 1X7ZA 4DSUA 4F2DA 4C29A 1A8IA 3NR2A 4WINA 4QL3A 1R27A 1ZGGA 1D4AA 1QZUA 1QYWA 3E82A 3RKRA 2W2OA 5JSKA 1IVSA 2AI3A 4D9MA 3WV5A 1BNCA 5DYTA 4BMOB 2I76A 3VI4B 4RHUA 1L4MA 1SUBA 1IJEA 3EOZA 4EMUA 1I6KA 2H1LA 3CW8X 5F98A 1JDBC 2GAOA 2H08A 3NU1A 4R71A 3EVEA 3VNVA 1TCCA 4TTSA 2BR5A 4QE3A 1AHNA 3WYCA 1AQNA 4DNXA 1XNRB 2C2XA 4NE7A 5IBPA 5ICSA 1I6MA 4RK1A 4S1VA 4ZEOA 4BO9A 3DWEX 4GOXA 5IZCC 3DS8A 1UPTA 1L1EA 2YV5A 3WVNA 1TUBB 2B34A 3F5DA 1FFAA 2HF7A 1KVQA 3C1OA 3HUUA 4XTRA 1LRJA 4MKIA 2Q3HA 4QODA 3LT5A 4YIKA 5BNTA 2YWFA 3HWSA 4PANA 2PKCA 1O95C 3A27A 1TO1E 4M8SA 2PRJA 3ITDA 3RGGA 4P4SA 5HJ2A 4CFSA 3PDJA 2ZJFA 1M67A 2NPIA 4A03A 4KQKA 5A0TA 2QZJA 2NXEA 3MPUA 2BLLA 3P96A 4BYMA 4WECA 2R8ZA 3EBLA 2GVDC 3CW2A 4OX9B 1WNTA 2A0XA 2NU6B 5K8LA 4E12A 3PGA1 2R7AA 2VSFA 3EH1A 3QMPA 1OXVA 4KNYA 1PG2A 1WW2A 3NHBA 2SCUB 1WMSA 2XUPA 4XEHA 5KPDA 5J2TF 1Z8DA 4UXIA 1E9EA 2C83A 3G9ZA 5LBTA 4G65A 4Y2XA 5DFAA 4O2AF 3RS4A 4NMMA 3VR2D 3E58A 4EVSA 5BSVA 2B69A 4PPFA 3HKDB 3RH0A 3OQIB 2AB0A 1V9CA 2FZEA 2FRDA 2EP7A 2PX0A 3PEEA 3V80A 1MABA 1S8AA 4YXWD 2O2IA 3GLHB 5BQFA 2JKZA 5BSHA 2H2FA 2PKYX 1FUEA 1RXCA 1PVOA 3FPHA 4DA9A 4G0MA 3QYFA 2ET6A 2OPHA 2WWRA 2I6TA 4DSTA 1VLZA 4YQZA 4FB5A 4W6ZA 2HZBA 2R8EA 2DUNA 3L43A 4ZP1A 3ANXA 4PO8A 1U1DA 2AWOA 2C4HA 4YA6A 3UW3A 1AV6A 3ME5A 1KQGA 3RC8A 1H2XA 1KO7A 2RGEA 3DE2X 2K87A 4FX5A 3SIXA 4BVKA 3LPDA 1ZN7A 4QT4A 2NVBA 2V9CA 1EKXA 4HEJA 3X44A 1H2YA 2NYVA 4RVHA 3AFGA 1FB5A 2AX4A 1FRQA 1Q91A 4H27A 4KWHA 2JLSA 3KYJB 3R4CA 3G89A 4MS3B 2WJGA 1G7TA 4KTVE 3EARA 4R2IA 4O3MA 2DLCX 4DR2B 1W52X 1ZXLA 1LDMA 1IXRC 2IODA 2NWQA 2WBLC 5HGXA 1Z07A 3TJMA 5KKCA 1I2CA 4BFCA 4ENSA 3QUQA 2FUG6 1CUUA 2OGWA 5FNVF 2F9FA 4C0BA 5K3FA 2KLBA 1I2DA 4PG8A 1ZW1A 4JR2A 5KYKA 5HIJA 4LOJA 1U9ZA 3EWSA 4P08A 3VJLA 3WMWA 3W3AA 4BFVA 4F21A 2IYQA 4WI1A 1J8VA 1ORVA 3ZU5A 3AB8A 1I7PA 1GGKA 2ZGVA 1CYEA 1GYPA 2YQ5A 4U7HA 1ULZA 1DAFA 3HJHA 2IYRA 3EB9A 3IEIA 4TROA 4YJ3F 4B4WA 4C76A 4C03A 4OB7A 2JGLA 1L5GB 5BT8A 3IKJA 1P9OA 4BDTA 4TM7A 5FPPA 4B9EA 1OLXA 4QPCA 3VZSA 5DX0A 2JVIA 1X94A 3G79A 4H1UA 3PC2A 5KQRA 1QU3A 3H1AA 1Y80A 1FVXA 4KDEA 5KNCA 3FLMA 1O6CA 2AFHA 1PNQA 3CXUA 2VK2A 5THQA 3W8DA 5HYVA 3ZY5A 3CONA 1ZUNB 5IH3A 5C4IA 1KMHA 1FDSA 3RAGA 4YJFA 5EKXA 1H3EA 2N3ZA 5DXFA 3RS8A 1UPCA 5LUAA 4YJ2B 3H0EA 3FPBA 4XLTA 1Y3HA 3H19A 1FSPA 2BGRA 2RH5A 1PJTA 3KG2A 3LCUA 4RESA 4U2GA 3UXEA 4B74A 1GU0A 1Y1LA 3IPYA 5AVOA 3TVTA 5B4VA 1SELA 2FEPA 4OHPA 4CU2A 3NCHA 3P4XA 1PNTA 4QXAA 1A1VA 4N4AA 2QM8A 1CW2B 2PXCA 1X77A 5DLQC 3IKTA 1JALA 3CNOA 2ZT6A 2R1ZA 2VHTA 3ZY2A 3H4IA 5TJ9A 3MT8A 2ODAA 4LWQA 1JG3A 4FB4A 2O8CA 3MTIA 4JYCA 5HS4A 3VOAA 3VYVA 1XPUA 4B2LA 2ZYUX 3N2IA 4G63A 3U26A 4JUAA 4TTTS 2YJTD 3LX8A 4J75A 5CLFA 2ATVA 5ALOA 5ICCA 1TYCA 2Y76A 2Q6VA 3HB5X 1Q0QA 2RJ3A 5B1YA 1TEXA 3L41A 5FPKA 1Q95A 1II8B 5D1HA 1KE1A 1NUTA 2WOJA 4QUEA 3ROGA 3HRKA 4HGPA 2EKBA 3AY0A 4QDZA 4TXNA 4YJGB 1RWQA 1CB0A 1WMFA 3HVJA 1CC1S 3WRXC 1Y5MA 3Q7QA 4MRMB 1SIWA 3T7DA 1XE3A 1MC8A 4AD8A 3ZE6A 2GF9A 2PX2A 3KSRA 3ZWMA 1Z38A 1S9HA 4Q3DA 3G1UA 1NP3A 5FBLB 2X4IA 4QXPA 5KX5A 2QI9F 3K9BA 3HVUA 3AVOA 3BSFA 4MCHA 5CA0F 7ADHA 4DA0A 4AJJA 3BWEA 3WRYC 3ANLA 2C96A 2XITA 4L3WA 4E4TA 4EO7A 2M1ZA 4R1UA 2SECE 4ZJZA 2GSWA 2DT8A 3O74A 1BO6A 4RACA 2V6JA 4OHBA 3AUFA 521PA 2OFOA 2REQA 1I4EB 1T8YA 4CKWB 3AHCA 5K0EA 4F38A 3EZNA 4ZQHA 1FRVA 4YDHB 3W1EA 2PSFA 2E7ZA 5JSUA 4MUYA 1WUHS 4LGMA 3W7AA 3ZIDA 1K7XB 3DSRA 4AO6A 4YMSA 2GAIA 1F8UA 1PJ8A 3OM1A 3R23A 3SJBA 2HY7A 1L8QA 2VH1A 1NNUA 1GP2A 2HNAA 3H4TA 3THYB 4O2LA 5G4LA 3SP1A 4DKXA 3SC2A 3QY0A 2R6DA 3IUSA 4WT7A 4YAOA 2HK9A 4B47A 4C3VA 5EIEA 1E79D 3JR3A 2VSOA 2W48A 3ZGVA 4BIMA 1JJBA 1XEWY 4E7OA 4QTXA 5HQTA 3ENKA 1GVNB 1L4UA 2HMTA 4GRAA 4JLBA 5FLYA 4ZI7F 3NC1C 2FDCA 1OAOC 1RWVA 3ZYZA 3U2QA 5TVGA 2H1SA 4Q1EA 4NFHA 1GL9B 4CKZA 4QKQA 4QGFA 3OTWA 1DOZA 1Z0JA 1K66A 3EUEA 4RDIA 2CUKA 2QE7D 5LMCA 3N2NA 3SXUA 3RANA 2BM8A 1EUCB 3S5UA 2VXBA 1TADA 1WXIA 2QLJA 4PS1A 5KYUA 4I55A 4JB2A 4WN9B 2ZKIA 3HDQA 3IJ5A 4L6CA 5REQB 3W5UA 4ALIA 2QVGA 2ZRIA 1Y8QB 1RXEA 4H08A 2W70A 1NYRA 2DOKA 3CRMA 3DBHB 3L82B 5EMLA 4BU1A 5CB4F 4HH4A 1KO4A 4LOLA 3KKEA 1DV2A 1KETA 2FX2A 2O5RA 3LE8A 4GI2A 1D6JA 3T38A 2P4EA 3B6IA 2FUG1 4KI7A 4TMZA 1KVTA 2GBGA 4ZVTA 4L50A 2PPLA 4M2LA 3T7KA 4DWJA 2JK1A 3HXLA 3ZI4A 3PX2A 2KJQA 4ZIRB 5AUPB 1FYXA 5C5DA 4CCSA 5JBNA 1WCYA 4Q3AA 4KRGA 4RANA 1YA4A 2VJMA 4U0KA 4WOBA 5ELLA 4B31A 4DMGA 4Z4QA 2JG3A 1O94A 3KPUA 4NYMQ 4DFDA 2V0GA 4M0FA 3K8YA 2J3HA 4TX1A 3SY8A 1PJZA 1NSTA 1UJMA 3L92A 4G5SA 3NGLA 2FW7A 1KHTA 1JA9A 5H68A 4YUZA 4XWKA 5F78A 1MO2A 4UARA 1PR1A 5IKOA 3LCMA 6PFKA 3AESB 2QF7A 3GC6A 1T13A 3V42A 3W06A 3RVMA 4RLSA 1OVMA 3BWVA 3P52A 3F2IA 3Q8WA 1LZKA 4YFYA 5HBRA 3CSSA 4JC4A 2JIDA 1P1JA 3KQMA 3ZQ4A 4NVRA 1OOEA 3L0YA 5FULA 4MI9A 4U0JA 3IAXA 2JGMA 3VH2A 1H8HD 1O95A 3PUJA 2B8NA 2J7PD 3ZTYA 3IAAA 3U17A 1MCZA 4AZ3B 3N76A 4HPJB 4IIJB 4H59A 2DUJA 3DE3X 1HQCA 3BRWD 4PVCA 4CUZA 1YTUA 3MMZA 1IDN1 3IP1A 5DP1A 1ZNXA 3EVGA 5I8ZA 3HWX1 3HBFA 4LC1A 2ZRAA 4G89A 3DDHA 4MR9B 2YR0A 1Q7GA 1PZFA 1VB5A 2DC1A 3RJ9A 2J48A 2HF2A 1TIPA 3E8SA 1HDGO 3UMBA 1X9HA 2BD0A 1TW3A 5EHXA 2BTEA 1MPTA 3IMFA 1XD2B 4QVIA 5EE5B 1N6KA 2OAP1 3DL2A 1BG6A 3QUBA 3ESZA 3UTCA 4E1VA 5BV2P 2ZG6A 2AYZA 5KVSA 1HC7A 3CEHA 1GTZA 2I8AA 2AOUA 1FCJA 3ZE2B 3SVZA 1DFIA 2J0EA 1KZ7B 4M60A 1C3VA 5L7WA 2PZJA 1SVNA 3N0TA 3P2MA 2W9XA 4XWYA 2M6KA 4BNUA 4Q16A 4US2R 3N0XA 4KMOA 4G8CA 1QO0A 1UPAA 4TRNA 4MUEA 1XVUA 3ADKA 1K5DA 1XCMA 2YXBA 2FW9A 3QJYA 4TXJA 5AJWA 4DGQA 3DYIA 4Z1OA 2VRCA 5AXBA 1JEOA 1ABBA 4MW6A 1JP7A 2GESA 1L7VC 1M1NB 3MS2A 4INZA 5U9CA 4JSRA 2Q2QA 3PNVA 4LRWA 4WFKA 1IG3A 4D97A 3GMIA 3FJYA 4ENVA 2ZI6A 4E6PA 1OBFO 4EI9A 2PUJA 5E6SA 3HGQA 1MX5A 4X1IB 1KSGA 4LJ6A 3MTAA 3H2HA 2YICA 3LPAA 4ND3A 5G2OA 5H3HA 1NWCA 4C5BA 3DMHA 4MO2A 4YRKA 1ZS9A 2Q6LA 1HDCA 3QQPA 2GCOB 2O06A 4L4ZA 1WCIA 2R8OA 1U1IA 2R4UA 3D3WB 3D5QA 2X8BA 3L5KA 4TWBA 3RFVA 3OE7A 1BA2A 1ZUWA 2RHDA 3QKSB 3IHLA 5BMVF 5LQNA 4AQYB 1CDZA 2CB0A 2ZSDA 1XP5A 1X80B 1RD4A 2DPXA 2XT6A 4PFQA 2V7GA 3VGPA 3ZXUB 5KQLA 2ZS7A 2IEZA 2XYGA 4HEA6 4R05A 3FCCA 3A9UA 1SC3A 4MYUA 4ZTZB 4E70A 3GNLA 5FFFA 3ZCRA 4EZEA 4AN4A 4LX0A 1JG6A 1ULHA 1SU4A 4P5PA 5BYJA 4EUNA 4ZI3A 5BQXA 7ABPA 1VPTA 5JAUA 2REOA 1P0IA 5HP4A 3AHJA 1QO9A 3KU4A 2MSWA 3WJ2A 4BO5A 3CVXA 1SVWA 1OGYA 3CEMA 5HCNA 3VNBA 4IICA 1ONOA 2Z98A 3U1TA 4B75A 2GEBA 2W6QA 3W04A 2HXGA 3K70C 2VNIA 1JIXA 3SX4A 1JTFA 5JV5A 2BPOA 1BS1A 2XBLA 1XQ6A 4WNYA 5EUMA 1WZCA 3CLUD 1JE0A 4XGQA 5JVDF 1NNEA 5B7GA 4WBNF 2O23A 4YBRA 1V37A 4M88A 4N18A 4JLOA 4B3XA 2QRJA 3NJRA 3AZPA 4G9EA 2IV7A 3PHGA 2QY9A 5F7XA 3MIIA 2AXQA 1FU4A 2MMGA 3EY9A 3W4JA 1I01A 4HDMB 4I0WB 3N2GB 2EC5A 2GGSA 1DWQA 4DQ0A 1FMJA 1HKUA 1S3IA 2BYTA 1F1JA 1NBME 4HYQA 3WY9A 4RX1A 2J3EA 1XGKA 4QTYA 3ZNOA 3H65A 4KIUA 1ZICA 3GOQA 3FVTA 4PV7A 2QUIA 5DSTA 4RCYA 4XUGB 4DPLA 2NZ8A 1DC3A 1T3GA 3GJXC 4JYMA 2OK8A 2EJBA 4YPOA 2HYIC 5JAZA 5BN4B 1TVKA 4IR7A 2VOJA 2X3UA 2BZSA 4P6VF 2H5IA 5H7XA 4I2NA 3NAGA 1E5VA 3VGJA 1AA6A 4EK9A 2KBFA 1OLUB 4O4JB 1TIKA 3M2PA 3BJRA 3CC8A 4HWRA 4OAPA 5JFOA 4LMPA 1FY2A 5TXGA 4JL8A 3HK2A 3WRXA 3A37A 2KHZA 5AO9A 1Q6YA 4EGAA 3ZV3A 5LN1A 4RK4A 4YRGA 2OZLB 2XZLA 1NXXA 4IDDA 1VKJA 2PUBA 2IEIA 3GGOA 1O0SA 5JH7F 4TYWA 1L5MA 1Q2UA 3FCEA 5B5SA 4FYWA 4ZJUA 2E6UX 2M32A 4ARVA 3U6BA 1GPAA 4K8OA 3VHLB 2NP6A 1LBTA 4CLEA 4RXUA 1XQXA 1E8NA 3S6JA 1TEZA 3JQGA 4LHXA 2FEAA 3S2YA 3CS3A 4BGIA 5CM8B 5J23A 4V0OA 1SBZA 3UOGA 2B8JA 1H2FA 2VHQA 3FM9A 1T2CA 3IOYA 3CVWA 4R8KA 2QN6A 4EUFA 1P73A 1H3NA 2QTWB 2QN3A 2X4LA 4FE7A 5AI5A 4BC0A 5AJUA 5A06A 1ZKDA 2Z5LA 1Y81A 1DZIA 1B1AA 4FILA 5ED4A 1G3UA 4KK4A 1IIBA 2CFRA 3ZIAA 3HPQA 1VA4A 3T5MA 3FOZA 2Q1WA 1L4GA 1MFPA 2WZQA 4WK6A 5C0OE 3VSDA 3UJNA 3AEXA 4BNYA 4D25A 1K3TA 4NMWA 1DAPA 4Q9HA 3JTMA 2GD1O 5I7SA 2ODEA 2WUVA 4G5HA 4I5EA 5DM0A 1W47A 2OWDA 3NHFA 1E9SA 3I4CA 1TQDA 3IALA 3NOVA 4C43A 5A6VA 3OIYA 1H22A 2AJ8A 1VMEA 3DB2A 3R3UA 3GLIE 4Q1BA 2A2ZA 5F73A 1A9OA 1WKCA 1WOYA 3OTQA 4PYMA 4F3TA 1PVDA 3AVPA 3NT5A 2G67A 2BHLA 4FDMA 1Q6ZA 2R85A 1YVPA 2BH9A 4MVJF 5JISA 5FJIA 3IIEA 4O4IA 5T5QA 4QU8A 5ULLA 3LVQE 3LMKA 4U9UA 4C21A 2G6TA 1QHGA 2RGXA 4E3ZA 1AGRA 4XJSA 5LC1A 1SVOA 2CDRA 2B8WA 3A6DA 4RE6A 2GM9A 2OXIA 3WLPA 1PHRA 3FTNA 4BHTA 2ZI3A 3JPWA 2EGHA 5DU2A 3THOA 3IBSA 3VKUA 2PRZA 1KRXA 1V3UA 5EE9A 2QIOA 3OOJA 5J5CA 1V1JA 1L7PA 3EZFA 1RYHA 4LNAA 1GITA 1RC1A 1NF2A 2P6PA 4IX1A 2WU3A 3PXEA 1JYFA 2VPTA 2ZATA 3O2QB 3ZBUA 4A0GA 2XDWA 4JYAB 2AA3A 3AEUA 1UPUA 3DFKA 3TB4A 4HWTA 1P2TA 3ZN2A 3MB8A 3B6KA 3E81A 4RSRA 4MP6A 4XWGA 1U3VA 3DO5A 2Y93A 1JSZA 1WIWA 2JD2A 1FUYB 4HEA1 5EY5B 4A36A 1BU8A 1IZ8A 2HN9A 3TLBA 2HSWA 1GSIA 2P9HA 4UTVA 1DAGA 3K7EA 2BF7A 1YHYA 2BEUB 3B8EA 3RVDA 1B7GO 1WUKS 1GCGA 3OJWA 5HUJA 4HNAA 5CVVA 1P60A 3NTQA 5DIFA 3HCRA 3O95A 3WZLA 1H4TA 2DXIA 4CV2A 5T3UA 1QTNA 1ISRA 1CLEA 4PNZA 3LL4A 5CLGA 2WTMA 4ALNA 4FC6A 1RPJA 1T8RA 2HMAA 2YYSA 4BNMA 3F6SA 4NYIR 2X7JA 3SI7A 4KPFC 5A05A 2VZEA 1KQPA 1M74A 1QHEA 2WQZA 5MGBA 3ZD7A 1IWPB 1EG2A 4Z8YA 1QB8A 3D3JA 3RYFA 5KVVA 1DAHA 4OL0A 5KNDD 1BYIA 2X8JB 1PW7A 3B36A 3R3WA 4RD3A 3U3DA 3SFZA 4QFCA 2OHGA 3IEUA 4J1TC 4R8LA 3T5CA 2FZWA 3OC0A 4P0TA 4ZZ0A 1LDGA 4KV9A 3NTXA 4CG1A 5B6IA 2VH5R 4MA4A 3W2TA 4A16A 1LKZA 2AL7A 2AN9A 2EVWX 3OEYA 1EWRA 1C9KA 3ZNPA 1E4EA 5I7OA 4KV7A 4OQNA 5KB3A 4NARA 1RQXA 2W6NA 3B1XA 5F7ZA 1AQLA 4WMLA 3OQ1A 4R1OA 2ZUEA 4KREA 1K8YB 2C42A 1B6TA 1L6IA 4XFKA 4IHKA 4XR4A 3D2LA 1Z6XA 3C48A 5A4IS 4URYR 2ODQA 3GIWA 4YCAA 1EFVB 4ZQEA 4EL0A 4B45A 2ZUVA 2ORIA 3MJTA 2CCGA 1OWPA 3E6AA 3EXEA 4RHCA 1XDDA 4B6QA 4F9FA 4ADSG 3GN1A 3DTVA 3ESDA 1COWA 1YSCA 1KL7A 2RJOA 1K3FA 4MKGA 3ISVA 4DUZB 2BUCA 4XCVA 4EY3A 2GYUA 1E0JA 4I1RA 4LJ4A 4OXRA 1DWUA 5FBWB 3VKGA 1H6CA 4UUPA 2VTEA 4P38A 5A5DA 4M37A 3NRCA 4OIMA 1QJ4A 2CZQA 2EV9A 2QG6A 1NQOA 1F0KA 1T8TA 1G2OA 2AZMA 4U3JB 5C3UA 4DJEC 4NNPA 4BE7B 4G26A 4E5SA 3RVJA 4QPPA 1BX0A 4RZ2A 3QQ5A 4B71A 5ISMA 4HXYA 4D9JA 3RSSA 1RTKA 4MPJA 4J76A 3G2PA 4DDVA 3DBRA 3AR9A 2C7QA 2VLIA 1KVSA 3BGDA 2L17A 2N42A 2JIBA 4CYMA 2DWUA 1N9ZA 3C98A 4GXRA 1JHYA 3U4GA 4BJ6A 2ZI4A 2FSIA 2YJ6A 4J7CA 3C7DB 1S7CA 2CEKA 3NUZA 5FUXA 4H1HA 5CJJA 1ZD2P 2AK3A 4MVXA 2WPDA 5K0TA 1CUJA 4OB6A 2ADFA 3BORA 1J8DA 3QVKA 3QEOA 3GLIB 1HKHA 1XLWA 4RMIA 5G1NA 3CUYA 2QSYA 1WOMA 1EXDA 4NENA 1C2TA 3TRJA 3VPDA 1PR9A 1HYGA 2JAUA 4A0HA 3B7WA 5DJ5A 1R0LA 2FMKA 3RSGA 4NMXB 5C7LO 3UMSA 2NUTB 1PFYA 3R44A 2Z2XA 2BBTA 4O59O 5HGJA 4E7PA 2H4FA 2W2QA 4FYVA 4J1NA 4NY1A 5JDIC 1IY0A 3IP5A 3ZGZA 3FPSA 4X3PA 2GN6A 5AH0A 4ESHA 1M2KA 1Y8RA 1N2BA 1U8UA 3L0CA 3CYFA 4X45A 5LZ7A 2ZWVA 3WJAA 6ABPA 2F17A 2WYOA 4NXNB 4F5DA 1M5TA 1NYTA 3D1JA 4J07A 1U6IA 2JZCA 3N0RA 4JXJA 4DF3A 4DZTA 2PVSA 4C7VA 3R5SA 3K1AA 4F04A 3O3MB 4DCSA 3FGZA 1R0SA 1N2EA 1W19A 1Q11A 2CL0X 5F76A 3PFGA 4ZVOA 4BO2A 4GL2A 3C2QA 1SVIA 4U6QA 3HNOA 4GC9A 4AIIA 3CM0A 2ZI9A 4FZRA 1OX4A 2W0SA 4TQUS 4FOTA 1EA5A 3PLNA 1KEKA 3FYCA 3THWB 1C1DA 3PNSA 4FT2A 1HOTA 1XOIA 1OZGA 2CJXA 2VT3A 3AC0A 3AMVA 2J3JA 4G9GA 4M8IA 5IM4F 1GFSA 4Z86A 5C8YB 4LDPA 2GEDA 2BKXA 1JXOA 1WXDA 3C5HA 2QP3A 4OHUA 4YWJA 1AO0A 3ZY4A 2CMHA 3ZU6A 3QYPA 1CEQA 1ATIA 2AK2A 1EMDA 3BF7A 1XTQA 4GI1A 1KZ6A 2YHAA 3B20A 3D4LA 3LYHA 4CKCA 1I14A 5FTKA 2WUWE 2JCBA 3VPXA 3UENA 5CRIA 4WOJA 2C57A 3OLQA 4JLAA 1CQJB 4UHDA 1SBCA 5HFJA 4BGDA 3VR5H 2R47A 3IEKA 3FTPA 3N8IA 3A2KA 5D01A 3G8BA 4IWYA 2YVLA 3AKYA 1EZ1A 1NATA 1QHNA 2C98A 3I5UA 3OJOA 1ZI8A 1Q0UA 1R3UA 2EL7A 1V5EA 5AHRA 3AF3A 1FS5A 2VYCA 4I5FA 5GTDA 1L5LA 3GB9A 1PQ4A 4HS4A 3TZCA 4M1SA 2CT8A 3A6PC 3UAVA 3EFHA 5BMOA 3QELA 2E1RA 5D5QA 3SIPA 1V71A 3GZNA 1R9MA 4G0OA 4TSRA 3GD7A 2J9GA 1U2EA 1TZBA 3PXAA 4TRRA 4JJ4A 1NUSA 3SEFA 4YT8A 3RAEC 2BISA 1PJLA 3FMPB 1R4AA 2DPYA 2WF7A 1M5UA 3A4VA 4NBRA 4ERNA 4JI2B 3EIXA 5I7EA 1HNNA 1I4DD 2WINI 5DWQA 4DDKA 5EWLA 1FDRA 3PFBA 2R8XA 1UANA 3D0KA 3CMMA 4FBGA 1W85A 2LTAA 1XRQA 4NJMA 4DR5B 3PE3A 3QMVA 4NQRA 1G5TA 3I9FA 4BB6A 3OQ6A 1L7XA 2NN3C 3FYUC 4U8HA 1M8JA 4NYMR 2H65A 3GLVA 4DC0A 3REOA 1K4YA 3AHDA 4LXGA 1E1DA 1Z39A 1JU3A 1B14A 5A5EA 3TTXA 3HDGA 3LZDA 5J9FA 1BU5A 3A3KA 1KBZA 3RR2A 1DQYA 1JILA 3HSSA 4HSEA 2QMUA 5DBGA 1N4DA 4WKPA 3RFCA 4TQ9A 4OQYA 3KDSE 3SS8A 4BFTA 2B20A 2PV0A 2A30A 4FCWA 1KMIY 2C2HA 2G9UA 5FOWA 2EDCA 2Q4RA 3HV2A 4F71A 1QDEA 3NH9A 1NONA 5FUMA 3BE6A 1R4NB 1NVTA 2J9ZB 5HF9A 4E2XA 3FMFA 3WGMA 1QVZA 3IKVA 3AP2A 4IYJA 1B76A 1SCQA 1T4BA 3DKVA 1CU1A 4HNUA 4ABTA 1SCNE 1AS3A 2JGRA 1AQYA 5ILOA 2C4UA 3K31A 1VBMA 2V96A 3GRCA 3B89A 1NW6A 1QB7A 1W1IA 3IDSA 3PQFA 5DGIA 3UGKA 4RLFA 4ZHQA 5BUQA 3ZE0B 1EGVB 1XTIA 4WK0B 5KQGA 4YP5A 1IPEA 1NURA 4AZWA 4EY4A 4I4IA 5AESA 1M1ZA 4CQLA 4A23A 4DANA 3SZRA 5FBZA 3AOEC 3V4ZA 4BNDB 5CAEA 4KFRA 4KH0A 2D1TA 4PHFA 3ZVKA 3EYAA 4BX2A 5A04A 3LPMA 2PBRA 3JCZA 3KFXA 3HJNA 4BNHA 2HWYA 4XD7D 2L0XA 5ALXA 5EHQA 1KAQA 3VPCA 4EHHA 2NGRA 1GT6A 1BCSB 4C20A 2Y1GA 2DVMA 2ZVQX 1MHTA 3MLEA 4XSHA 3D3EA 4Z3DA 2WW8A 1UJ4A 2J0UB 3O9VA 5DE3A 1TTPB 2GN0A 4CIDA 3EDMA 1Z22A 2N0SA 4NZYA 3O8DA 1P2VA 3ZVMA 1MC5A 2AZ4A 3D5TA 3QWIA 2E4UA 4OUDA 4V03A 1NW9B 3EGXB 4CQMD 1ICEA 4N65A 3OSZA 5TF4A 1FDIA 4PPNA 4V02A 1HTTA 4YMHA 1CRZA 4HFMA 4J9VA 4RAOA 1EX1A 1D6MA 2PBLA 5JXHA 1ICIA 1TMKA 1O5IA 1KI4A 3AXSA 1SK9A 3C6MA 3IPLA 3TZQA 3E03A 3UV3A 4A8TA 4HHEA 4FFLA 4OMUA 1MW8X 1FW8A 1A8PA 4M38A 5J4YA 4J1TA 3GV0A 1ZCJA 4KZKA 2X0DA 4IJ5A 1WZEA 3V2UA 1SC9A 5AM3A 3B9QA 4CIXA 2E89A 3HE3A 5EJ7A 4FUQA 1RWMA 4GBED 4JLWA 1UDCA 3LC0A 3H87A 5CURA 1QRRA 4LS3A 3AEKA 5BPFA 1U3GA 4KQ1A 1NAIA 1KFKB 2GBFA 3E53A 5F5XA 4DBLE 1J9GA 3K9HA 2WWGA 1O7JA 5EESA 4MDYA 3KR1A 1WQ3A 4U7DA 3NNSA 2E18A 1XAHA 3AJ9A 4PLGA 4FSHA 3E35A 3AQIA 3LCCA 3W78A 1VFNA 2AEFA 1QS0A 1YZQA 2JFWA 2I4MA 3C6BA 3LVRE 5F2OA 3NWBA 4MLZA 4B8ZA 3MAAC 1IY8A 3QVGB 1RHMA 1U5CA 2VPYA 1S2DA 2L42A 3I45A 3O1HB 1G4AE 3C6YA 3GH3A 5IAKA 3PUXA 4JI5B 2A4MA 5DCYA 3SN6A 4EKEA 4CETA 1DQRA 2F8LA 2JIPA 2YY5A 2XT9A 1DCMA 2NQ8A 3HFGA 1GD1O 3V8QA 2YIVX 1A9PA 2B4AA 1XHFA 1YDEA 4FOLA 3DLIA 1MJHA 4CTNA 1G98A 1OLSA 2WHPA 3IIIA 1T4MA 4FQ7A 3UN1A 3L7CA 4IJQA 5F2NA 3PNPA 2A1TS 3I23A 4XIFA 3SJCA 2NO0A 1SKMA 2ZYRA 3L0ZA 4MZXA 2B2NA 4OXYA 5ALLA 4F84A 4KR0A 1G41A 5HW0A 4MIOA 5JEEA 2OO3A 4KHZA 1NBMD 4P4NA 1IN6A 4Q9KA 1JTEA 3WLQA 4HUTA 1XQVA 2ZRQA 3ETCA 4RJTA 3DE7X 3NP9A 2CVQA 2IX9A 4ZPJA 1ZD5A 3F7TA 1MUUA 3IB6A 3JYLA 1L5SA 4G24A 1J09A 4RYLA 5E2BA 5GONF 2HWUA 1KH2A 3LF1A 4F4HA 5C9ZA 2VQFB 3ENWA 4MZDA 4RVCA 4TVSA 1QG6A 5AVUA 1N6PA 4WDRA 3TIIA 1J33A 3WQQA 2G5PA 4CI9A 5LQCA 1I0IA 2GPAA 2V9PA 3NZEA 4QLAA 3VAZA 2IS6A 3LA6A 1XTZA 3GRZA 4WV3A 3SDSA 3P9KA 4U2BA 4R9SA 2O2CA 5E4TA 5HK9A 1YKFA 1EUYA 3WLJA 1NI4B 1WXWA 5JDIA 3BXPA 3EPPA 3VTAA 3U4IA 4MGEA 2PEZA 2O8BB 1SKBA 4PHGA 1FUKA 3G2NA 4IFEA 5KHLB 4GGMX 2CV0A 1TT5B 2DUMA 3RKUA 5BSKA 2UYHA 3Q1KA 5PNTA 4KKXB 4A5OA 1JNXX 4B8YA 1AS0A 1WWKA 4I50B 4QTZA 5JRZA 1YQXA 1DHRA 1V95A 1ISPA 3LXUX 3QX8A 3WNVA 4AN1A 3QUSA 3G9XA 5LR6A 4TSFD 4GPZA 1LPNA 3AY7A 2P9GA 2DCMA 3UCXA 2OVFA 1N0VC 2O3JA 2C3PA 3I53A 5ERYA 3ZU3A 4CCWA 4KU4A 2OQIA 2Q3DA 3QU7A 4L5BA 3OQOA 2CL7X 1EGAA 1S4QA 2Y3IA 3QXCA 3LP5A 4JVSB 5HFNA 3SEZA 4BE4A 2PZGA 3AL2A 3O84A 5F2EA 1KJZA 4RKRA 2XYHA 2JGIA 2AJTA 3TNLA 2R1VA 2PSDA 3EXHC 3KEGA 4FS8A 4TTAA 1ZNYA 4EHIA 2PQMA 4ESEA 4FUTA 3WRWA 1E1LA 2OCDA 5GPBA 1JRLA 4TPKA 3NIFB 4CIWA 1U8FO 3HLKA 3PQ5A 5BOSA 2WR8A 5I5EA 4OKSA 1TF2A 3CB4A 3C85A 3VR3D 1X7XA 3F47A 1PV4A 3N2KA 4KLCA 5CHYA 1QCZA 5DMHA 5BURA 2PUCA 2CL6X 4QOIA 2V7BA 3K16A 4UBIA 3CH6A 3M81A 4JKOA 4NJEB 3JSXA 2DHCA 4JZKA 3RODA 3AYXB 1N6IA 1JQLB 3FDZB 1KEPA 1OXUA 3P26A 3DDNA 3AJRA 1G3QA 4UU0A 2DB3A 2JVJA 4B40A 4AT1A 2H9AA 4CLOA 3PBKA 3BD7A 2P79A 4MWEA 3BCUA 3MF4A 2JLAA 4M1KA 1ZD4A 1RWKA 4WACA 5DLYA 4CDNA 5JAIA 2HW8A 1GPJA 1QQ7A 3KUKA 3CXRA 3EXG2 3EQ7A 3QWBA 1XRRA 2OFXA 2LD4A 2WTAA 2NSLA 1JFFA 5JS2A 1ZU4A 3CX8A 4Q9LA 1UZMA 4PAOA 3B5IA 5DOVA 4HAXA 3F78A 5GJVC 4Z7NB 2FWRA 4TTIA 3WWZA 1ZMOA 1D6NA 3DOEA 2D1FA 3VH4A 3S8MA 3S99A 4GMKA 2IF2A 3W5SA 1W29A 1BVUA 4FN5A 4L0QA 1DARA 5AK3A 1QOZA 2BDTA 4N5HX 3LRTA 3DHWC 4RV4A 4AM8A 1LPOA 2IUFA 3PYMA 2WSLA 3KXPA 5G40A 1DCFA 4QOJA 1ENYA 1V39A 4J0GA 4D81A 3BKXA 5K0CA 4GQIA 3ZKWA 2DSNA 2DFVA 1GTSA 1L5WA 3FRIA 2X2FA 3TLEA 3OX1A 1UJNA 5FL7A 3EMBA 2XNJA 2HQSA 1EPUA 3SX2A 2AJCA 1OWMA 3KYBA 3NANA 2C2KA 1T29A 3UC9A 1IEQA 1TLTA 1LA2A 3GUZA 4NDNE 3S70A 4JP2A 1GN8A 3SXPA 4EMTA 6REQA 1ZMTA 3C6QA 3H1PA 3NDJA 1HSZA 3RT9A 3SZMA 1N7JA 3KKQA 3ROZA 3PPVA 2O7QA 5JROA 1FMFA 3MJVA 3PNMA 2I7TA 4YUYA 4KYIB 1V1RA 3FDXA 4IJKA 3AJDA 2H2DA 1O6GA 2VDJA 3A4YA 1Z6AA 4FE3A 2CFIA 1KY5A 1FFEA 4YWHA 2P8SA 3N9IA 4HGNA 5E2AA 1L7DA 2V7TA 1FNBA 2XCUA 5ICGA 1WB9A 1PFVA 2WJ4A 1W87A 3P94A 2XT0A 4MPPA 5AKKA 3VR6A 3CT6A 3BFVA 1N78A 3K72B 3LLSA 2XDYA 3G5TA 4LRXA 5F51A 4Z1MA 4JYBA 1ZD3A 2VNAA 3FTQA 3RK4A 4CMEC 2A9QA 1YJXA 2PK3A 2VWPA 2AF4C 4WKNA 3AOEA 4F9GA 2HSGA 3REQA 3RU3A 1G5IA 1MOQA 1KAOA 2RHTA 3H6KA 2WJ3A 3E2IA 3FPFA 4OKNA 5LZ2A 3C5WP 3LP8A 4TM8A 3HEBA 1Z18A 2OAGA 4GBMA 3TOXA 4B83A 4JJAA 4MR8A 4EGSA 2RKOA 5A9SB 3ZDAA 2BFOA 2H9IA 5B58C 1E2IA 4BPRA 1T5BA 2H85A 3CX3A 1CVLA 3Q7PA 2AD5A 2IYSA 1POXA 4GC5A 3S7TA 3NNNA 1EYZA 4XI9A 4UEJA 4YUXA 2WJJA 4EWLA 1V26A 1ID8A 4JI7B 1E1RA 1RYFA 2D8MA 3E7FA 1A8SA 1ITZA 2JC3A 1RKQA 4AMYA 3T3NA 4UEKA 1HRKA 3IVMA 2IV3A 1N0UA 1HDYA 1M1YA 2OXCA 5ELMA 4ENTA 3ITKA 2OZKA 2VSYA 2PMBA 4E5VA 3QNUA 5CT6A 2HRDA 5LNK6 1ZGHA 1JYEA 4M46A 2WLTA 2Q6TA 1DE0A 5B64A 2O5CA 3QU2A 4QRDA 2QV0A 1NV9A 4MWOA 5AK0A 3UF0A 1T2VA 1NE7A 2W93A 4H3HB 1KYXA 4L76A 4PS0A 3AOGA 4YJHA 4XVCA 1HE2A 2BI7A 1KJIA 2PU7A 3MUOA 1QGZA 5FUYA 1ST3A 4FGLA 4MVWA 4UDYX 2H2AA 5MGNA 4CDRA 3BULA 2AOWA 3MLAA 4TVOA 1H5NA 1VI5A 3DAFA 2I6FA 2OSVA 4DUYB 3LUJA 1KAHA 1XL1A 3L7YA 1SXJB 1TM1E 3NASA 4LE1A 4QUGA 3WAJA 3IULA 4QDOA 1M6NA 5BV7A 1APBA 4WCDA 1BVYF 3ELUA 1TEHA 3PX3A 4QT0A 4QOSA 1WX1A 1A8QA 1V5FA 3ZG6A 2H5JA 2IHTA 4QSMA 1JR3A 3PWTA 1CF2O 1R50A 4JMPA 3GROA 3AR2A 1QVVA 1V7PC 1EFHA 3V1LA 4BAUA 1LTQA 4ZGWA 1MD9A 1XZHA 1CZLA 1JJ7A 3K0HA 5EN4A 5CD1A 4L08A 4TLAA 1E8DA 5KSZA 1DLIA 2CJWA 4JA0A 4HUQB 3RJZA 2WUFA 4LF7B 3ISJA 1DNPA 2P5UA 3ZBQA 5IX8A 3EFEA 4QYMA 1R74A 1RKXA 2FEOA 3CZPA 4GPIB 4QPZA 4CRWB 2Y1KA 1PSDA 5L53A 1AD2A 3AW8A 1WCXA 2K2QB 3D3NA 2D13A 2ZCUA 4R7ZA 1SC1A 1FXUA 1ZINA 5SY6A 5MDHA 4LOHA 2AKAB 2C4MA 3OI7A 4UEWA 2OV6A 4U02A 4YBZA 3AR3A 3BS4A 1MKYA 1FPQA 4IHQA 4ZQBA 1C1XB 5A5GA 2E9SA 4D8UA 1H2BA 3FPAA 4EHKA 2AFHE 1H85A 4M9CA 3ZK9A 1BSVA 2OPBA 1DG1G 1KJQA 2C99A 4GR9A 4YC7A 2NUPB 1PUJA 3EC1A 1XTSA 5L4SA 1IQ0A 2H7CA 2O6LA 2XWQA 1X7ZB 4OXKA 1WS6A 3WL5A 1B15A 3ZXIA 3U19A 1LEHA 1IU9A 1BVRA 2FH5B 2NTEA 4NEQA 4WK2B 4C6SA 1P5JA 5E2IA 3PPXA 2FSUA 4FMCB 2AH5A 2XUGA 2C2BA 3IT0A 2FU5C 3LBFA 3UHAA 2G5TA 2HA3A 3BTUA 3H3JA 3A1CA 4KE8A 4PAMA 4ZRMA 5FQNA 4BMCA 2DFPA 2IEGA 2O2SA 5F1PA 4EPWA 1YIOA 4O1MA 2GO1A 5ARDA 4LDNA 2F3RA 3JQ7B 5DGCA 2OCKA 1YB1A 2HXSA 4IVQA 3SS9X 3GRAA 1JXQA 4IDQA 2Z1DA 4LBWA 1A27A 4PYNA 4WZZA 4Y0AA 3TNYA 3WLEA 1CR4A 1N2CA 3CLSD 3R0ZA 1PWYE 1YQQA 1SQ6A 2XYVA 3O8BA 3NALA 4WLFA 3O75A 2J9XB 5JI2E 5EIXA 3FOFC 1NW5A 1DUVG 5HR5A 4LF8B 2UZ1B 5DLDA 5B1EA 1CY8A 3GFFA 4K2HA 4RH3A 2J5KA 3BH6A 1DC8A 3DMTC 2OQ2A 2SKCA 1Q7EA 2QZPA 5CW1A 4QDXA 2XDQB 4XDHA 1W88A 4F93B 1UKYA 1ODCA 3HJCA 4YHBA 2J0QA 1NVBA 5GVRA 1LF5A 2BT4A 3P0HA 4C9BA 2G9NA 4RMJA 1T6BY 4J8PA 4IH1A 4AWXA 3PNYA 5BSGA 2BFDB 2CVPA 3C3PA 4Y7CA 2ORED 4DM7A 1J90A 3I92A 2IKQA 1V11A 3PNLA 5CVUA 3MUNA 2OY0A 2IQIA 3EXHA 3HBAA 3IP9A 4BYGA 4P3NA 1YBVA 3BDVA 4RD2A 3LNCA 2CHEA 3LSYA 2PRSA 3BCHA 2H17A 4QFBA 2P75A 5KVCA 2QD3A 4GVPA 3T7IA 5AVYA 4NE9A 1PWEA 3H05A 2C5BA 5EP2A 1ZR2A 1ZWLA 1D07A 1ZQ1A 2RB4A 2PXHA 4AG6A 1KJ8A 5MFZA 2FPGA 2WKWA 3K20A 4X66B 1SMKA 4YECA 2P62A 3L4BA 1S2LA 4LK2A 5BYBA 1MFZA 2QVYX 1CIJA 1Q1AA 1F38A 5A4DA 2ZCJA 1WABA 4MAMA 5BSEA 1AKUA 3V3KA 4IEFB 1QIEA 4JEMA 4MI6A 5AKZA 2RI1A 2D1SA 5J59A 4OP2A 3NDIA 5U1PA 3IQHX 2A9VA 3X2EA 2R6FA 1F8YA 4G8BA 1W35A 1MX1A 4R9UC 4M7PA 2Z2JA 4AW9A 3EDRA 5I7FA 2P2NA 1C3OB 4QGAA 2HPVA 3X1ZA 1XZAA 5KSYA 2Q4OA 1LNZA 3U4AA 4E15A 2CF5A 8ADHA 5AVTA 1Z2CA 2JJ2D 5LNK1 3EFBA 2IXBA 1TM7E 1UM9B 1M1XB 3SZUA 3OO1A 4XUCA 2QRZA 4F2GA 1ZNWA 3OG9A 3MK31 3PQCA 1ZKMA 5DP2A 4N8EA 1GXSB 1YE8A 2FMIA 2I78A 3E8MA 3GPIA 4O4LA 2EJUA 4I81A 4A2CA 1QV6A 3R0JA 4QUHA 4BBJA 4ZMSA 1FDOA 2V0NA 1O9HA 2H4YA 4OG2A 4LOKA 1A4IA 2IH2A 3G0BA 2GZ3A 5J2UB 2OC4A 3USCS 4KXWA 1TAGA 5BR8B 1N75A 1GPKA 5K3FB 4HNGA 3WLMA 1QAQA 1WXEA 2O57A 1OYVA 3F7MA 4FLFA 4LJAA 1RAHA 5SYAA 3UKDA 1GPBA 4BZQA 4QJBA 2PT6A 5ALZA 5AM4A 1YRQA 2BMEA 2QTCA 3A0RB 4K40A 3RRBA 3TM4A 3VHQA 4RHTA 5KSOA 5JZOA 3WB0A 4WNAA 4Y6PA 4YJKA 2JCXA 2UYGA 3W2IA 4QWWA 2F2TA 1LSSA 1VA5A 2FSGA 4P98A 2IH5A 4HWGA 4P4LA 5IT4A 2ZYDA 4Z9AA 5C46F 4LQ4A 1PT8A 1YZKA 2XVZA 4EY8A 1J9ZA 2Y99A 2BELA 1OZHA 2AFHB 1ZEMA 1DPGA 4B3CA 1VZ2A 4LG1A 4ZOLA 4C14A 3L93A 1A50B 5G0SA 4HXEB 4H1TA 3FHOA 3DT6A 4CL0A 2GS9A 1RJEA 2NZVG 1NC3A 2L18A 4G9BA 1P5ZB 1Q1NA 1TKCA 1J6UA 4WUVA 3F74A 2P6OA 1Z82A 2CVOA 3KXIA 2QMQA 2VBIA 3WB1A 3NVKI 2XY4A 2HMVA 3ZD9A 1YACA 3U39A 4BB9A 4ER0A 2QNBA 2G1UA 1AU9A 4X1OA 4CMEA 1WD7A 2X6RA 3AKEA 3HN7A 2WE7A 4DCUA 1I13A 1N8KA 4NV3A 4A10A 2A57A 4W1RA 1Z5GA 1KZGB 1OHHA 1SHKA 4F60A 1ELOA 1NUAA 2B1GA 2WMOB 2VHUA 5CTAA 4I5IA 4B0PA 1NL3A 1RMQA 3JD1A 5KBYA 2VJCA 2UXBB 3A9RA 5FP0A 2IXGA 2OECA 4K88A 2QTBA 3UJHA 1NE2A 1YHZA 3RVLA 1K7EB 3F9RA 2WWFA 2DG2A 1DWOA 2XWJI 4EG0A 4OL9A 3VPBA 3TUJC 2EIHA 5A1TA 2FLKA 1E1KA 1FBTA 2UXCB 2LW7A 3CIFA 1G5HA 3E4CA 3GHYA 2IWHA 4B2IA 5B1DA 4LVNA 4A0RA 3MD9A 1L7QA 4AJ9A 5K3BA 4XARA 2XXBA 2HIAA 4P81A 5H4GA 5L3QA 4IEEA 4RA6B 4JHXA 3K2BA 3EVTA 2WU1A 6LDHA 4YRAA 2JIZA 1EUDB 2VBCA 5MN4A 2FWAA 3F7OA 2V8OA 4C4AA 5FPQA 3CFYA 3MUFA 5ALHA 1EEXB 3R7WA 4JN6B 2R1TA 1U0JA 2CXOA 5YASA 4AJEA 1VJRA 4WERA 5IVKA 1UFOA 4MVJI 1CY4A 3GFQA 4EMBA 5DCUA 3SQMA 1QH8A 1CK4A 5FFMA 3RTBA 3BTVA 4BO0A 5I7HA 4U9HS 3R9KA 5DH9A 3SF8B 1AF4A 1ZN2A 5GV7A 2BUBA 4AROA 2AZXA 2RC5A 2DQ4A 4BU0A 2H2HA 3ZGXA 2PWBA 2BV3A 2G9VA 5TPZA 2FX3A 3TW0A 4D45A 4UNSA 1NQXA 4EUEA 1FF9A 1CQZA 2WUGA 3IUNA 3RU9A 4E88A 1DRUA 1CR6A 1PAUA 3ASYA 3E3OA 4OQLA 4UUAA 3MJCA 4FTWA 1L5HB 3A58B 3MGAA 4KR7A 5HF6A 2FJUA 1NUPA 1YB2A 3AEQA 3EIFA 1YR3A 3C1TA 3LGXA 3TG2A 2I6QA 3IODA 3WA7A 1YNSA 2BEVA 2H29A 2J9FA 4MVJD 3QP9A 4NNOA 1DKLA 2ACKA 2RGWA 3C8UA 3IDFA 3Q3GE 1AGYA 3Q7TA 2ERXA 5JALA 1F60A 1KEEB 1KFCB 3W4IA 3BJMA 4FGKA 1CD5A 5DB4A 1T0UA 1R0YA 2B78A 3NUQA 3PS9A 3ZZ0A 2BFFA 4BLQA 1NU8A 3BBPA 1GQQA 3NV7A 4MWBA 3D1VA 3D4OA 3WL7A 4CMKA 1L8AA 4UAJA 4XSGA 5JCJA 4MAAA 3CZ5A 4RD4A 4MTCA 4XGRA 3ETEA 1SBTA 1QP0A 3LK7A 1TTQB 1HWYA 2FB9A 1TQ6A 4D44A 4E5DA 2DPLA 5FI5A 3OZBA 4CKBB 5IXSA 2R65A 4QBFA 2I9PA 4B79A 4JHLA 4YLYA 1YTLA 3ZJVA 3PUWA 5HZKA 2RCYA 4N7MA 3TH5A 4HYEA 1DDGA 1ECLA 1NT2A 5K0ZA 1NFRA 4K26A 4ODIA 2QRNA 5FI0B 3ZC3A 4FR5A 4MVJG 5ECGC 4A82A 1IG0A 1SXJD 3F3MA 3UB3A 4W82A 2GPBA 1X1QA 4ENUA 3MGKA 4GLJA 2VJMB 3T5TA 3PFFA 4REMA 2GN9A 2CK3A 3OAAA 4JWKA 3EGWA 1SZJG 3P2OA 2HQOA 4U2FA 4EAAA 4UHFA 4ED9A 5FTJA 4DBVO 3TZBA 2HWXA 3DZJA 3IIMA 4OA8A 2GN1A 1CY6A 2JBWA 3PJFA 3OVMA 1VL8A 4HYTA 4R69A 5FTLA 2XCTB 3L7OA 3UAWA 2DWPA 1CR0A 4CIYA 1XDWA 3DCYA 3W90A 2ETXA 4XX1A 3ZDXB 4OQ4A 1FLVA 4F6LA 4KQWA 5EUCA 1YFZA 5IBRA 1RHUA 3P9IA 2AOTA 5GM1A 1ZIYA 1Z0FA 4M1QA 1BEUB 2ODWA 1KHHA 1QYCA 4PQRA 3I52A 4BNJA 4Z7OB 2W6PA 1GYQA 3B52X 4GLFA 3KSZO 5EVCA 1SUWA 1TK2A 3LUDA 4H7JA 1M54A 1B0PA 3SC4A 3UM9A 4H35A 1G66A 4KPUB 3WGYA 2R2AA 1R6AA 1SHTX 2C03A 4IJWA 4BRSA 4KBFA 3H9BA 1JBEA 4MYRA 5LBIA 3RQSA 2FPKA 4PG5A 1ULUA 1W0KD 1WXFA 2DH5A 4XZ3A 2IK8A 2OBXA 1IMJA 3FTFA 1NNLA 4LDJA 3SCZA 4AJHA 1MENA 1FLDA 1GY8A 2XVXA 4X3OA 4K6MA 3S29A 5C7IO 2FZLA 2VZ8A 4HDSA 4Z51A 4C07A 2BWJA 2AKEA 3ANTA 2UVQA 3WOVA 1J2TA 3FUWA 5BWOA 1I5EA 3T1YB 1IZZA 3LXXA 2PM8A 4UZEA 1HORA 1X92A 4KRXA 2PHZA 2OCIA 3CH5A 3EG9B 1JLLA 1G0OA 2XOKA 3N59A 1XAGA 1JB1A 2FPXA 5H1YA 5TGZA 3VISA 1EJ2A 2JFNA 5EJGA 3KBBA 3U31A 3U0VA 3D02A 1QRAA 3LM8A 4RIIA 3H1GA 1L5YA 4Q9IA 4EYQA 1A97A 1JMYA 2YY6A 3JW8A 4A6PA 2G25A 2WNHA 2ZJZA 5AUNB 1RQ7A 2C5HA 2O7NA 2HOQA 3KWMA 2SBTA 3ZHBA 1QM5A 4K0KB 1P9WA 4L3VA 1NVVQ 1BKYA 2AXEA 3CVYA 1T34A 1BE1A 3WHPA 5DRTA 2JATA 1R6UA 3ZWVA 4PRLA 4G0YA 4MQFA 4B3IA 5K0JA 1EWYA 4N6NA 4QA9A 2VTBA 4JR0A 4MULA 1KDRA 3U44A 3PFNA 5IYZA 1IBLB 3FOAA 1NOJA 3GT3A 2QRHA 3CWCA 3CN9A 5DW3A 8ATCA 1KWGA 3A4MA 3A4TA 2VJBA 2C5LA 5TGTA 1HEYA 3DUFA 3PGVA 1PQUA 2E3JA 4IGAA 2PKEA 1IJFA 4IINA 2VDRB 4TUYA 4X41A 4F6RB 2D7DA 1X7YB 2ORVA 4K1LA 1GRRA 3ZE8A 4QZVA 1SWVA 2B3DA 2AFIA 1BDJA 4EW1A 1I4LD 2YX1A 2QNRA 2XNHA 3T35A 1QPZA 4C1BA 1TYZA 1WDTA 1WY5A 3OX3A 3G23A 2NVUB 3HVRA 5IT0A 2OCXA 3LCJA 5IWCA 1RIFA 1D6SA 2FZ4A 5KWJA 2ZJBA 1GCIA 2PZEA 2DEUA 2H5LA 5CLJA 2IL1A 4HMQA 1WSAA 2X23A 3WDMA 1M0SA 2UUAB 1FYDA 4WTOA 4GR5A 5HIAA 1QP7A 4NAUA 1SHUX 1ZHOA 3B1KA 2I34A 4MGYR 5TE9A 4PYJA 2LDBA 1HURA 3DOUA 3INTA 4ENQA 3WAGA 1CHDA 4Q66C 3RUEA 2EU8A 4OYRA 2HPHA 2E6KA 2WF8A 5ALYA 2IDJA 3Q8LA 2VTKA 4FFMA 5BSWA 1X7WA 4JUIA 4DCVA 4IDCA 3B2QA 3DEKA 1T26A 1KVUA 3IKMB 3UFBA 1SOAA 2EW1A 4U7FA 3AIIA 3DT8A 1Z6GA 1DC5A 1ECJA 4GHWA 2C8JA 2WYWA 3WO1A 3O03A 1S1CA 1Y37A 3DUWA 4HY3A 1OLOA 3ZHZA 4BP3A 1P17A 3AF4A 4M0EA 2KLHA 3KP1A 3B1FA 3ELBA 5IZ4A 1M7HA 3DO6A 2WFAA 2V7QA 1UBCA 5I4CA 2OV2A 3DVAA 5DI3B 1IUKA 3W5AA 3W1VA 4QQRA 2ZUDA 1SUEA 2ZIZA 5C2JB 2ANCA 1G5PA 2FOXA 4CVNA 3GFPA 3H99A 2F00A 1D4ZA 1SC4A 4FYJA 2QUAA 4U7JA 3G3EA 2NTYC 1BMFD 4JU9A 2I3GA 5DT9A 2BHSA 4RFSA 1G3IA 3O1JC 4PHCA 4M0CA 5IAOA 2C5FA 4LYAA 4QYXA 3CU5A 3DCJA 2J3DA 4H2DA 3ASZA 3NRBA 2HO4A 3M34A 4YR7A 5FAKA 3O90A 2FLWA 4CXMA 3MMXA 4M6WA 4V1CA 4KK3A 3I2JA 1QH1B 1N6OA 3NHWA 3T4EA 1KNQA 1ZX1A 3GRFA 3QTTA 3VBCA 5AKXA 3QUAA 1Q22A 1XLVA 4G2TA 3RS5A 1Z7EA 1PHPA 1QYXA 3PCRB 2JI8A 3PL5A 2M9MA 3QI7A 1DV1A 2JI4A 2JI7A 2H8GA 4WEQA 4MYTA 1FP4A 4DMCA 1DGQA 4ZAXA 4MEBA 2IOFA 5JAHA 2GHIA 4ZYLA 4QRHA 1UJ5A 3BMCA 2ZIAA 2PMDA 2ZU0C 3FPJA 5AD1A 1TFUA 1UXOA 3QLTA 1ONSA 5BRNA 3M6XA 5FTWA 5AKEA 4AJIA 5JASA 3OT1B 5D3MA 4XA8A 3T3GA 4AMBA 1P7PA 5GAJA 1ILEA 1G17A 1KXZA 4ALKA 2OUKA 4KSBA 5IBCA 2JLXA 3H5TA 1TYAE 4BQNA 3S8YA 3OCJA 4D3DA 4Q4CA 5LLSA 4ZCTA 2QTLA 3EOAI 3RFXA 4MQEA 3UWMA 3ROTA 4KQ2A 3FSGD 3K30A 4N3CA 2FMXA 3OHSX 2Y77A 5H0IA 5JWOA 1JEAA 3AERB 3GDHA 2WSSA 1CUEA 3GP3A 4LZJA 3NIWA 1IATA 1I3NA 1BWPA 2VT7A 3PXUA 4ZFNA 1BHO1 2P8JA 1UBTS 4B3JA 3JWEA 5L9AA 4Y2UA 5BW8A 3PIIA 2VUHB 4IV5A 4N7JA 3UNXA 4FMPA 4II7A 3RBVA 4UPEA 4PZAA 4PG4A 5DYIA 5TC4A 2QQ5A 3TNJA 1JEYA 3UA4A 1SXIA 4BLTA 1E9FA 5LQMA 2IEYA 4JYZA 3M4YA 1FP7A 3T5BA 5JS8A 2QGFA 4G84A 4ZWNA 1TCBA 1XELA 2H2WA 3GMDA 4OQPA 1YONA 2NPFA 3IXLA 4Q3EA 4AKGA 3I37X 3PUHA 1D1QA 3C3AA 4ZJYA 4OMCA 3KJNA 2ODBA 2D0OB 3D7MA 1NDUA 1SXHA 3B53X 3ZJ5A 3ABQB 2ZE5A 1E2DA 4MNTA 4MJXA 5EKDA 1V35A 1N1MA 3U7QB 3W5CA 2ZE6A 3FWYA 2RFLA 1GNTA 2HO5A 1QPGA 2PGOA 1RRFA 2W6OA 4TKVA 2O8EB 1M6HA 1KI8A 5L7YA 1KS9A 2CBGA 2VXOA 3VUEA 4QHSA 1QYRA 2PYIA 3SYMA 5INTA 1R10A 4OUKX 1M72A 1KDTA 3OCWA 1SVKA 2EP5A 1GTJ1 2POQX 4OA5A 2R84A 5AUOB 4IIFA 1AZTA 3D59A 2OQRA 5TSDA 4HLQB 1JMKC 1OTXA 1XVTA 3DE4X 1P4HA 1TNDA 4OOFA 1ENZA 4IOJA 4Z54A 1G5RA 2R6AA 3KYDA 1HDEA 1PFWA 5ALDA 4DHEA 5I4BA 5ALIA 4B87A 5CFZA 3OPMA 3W8FA 4D7AA 1J25A 2A86A 4KG7A 2C5GA 1G6OA 4C0XA 2Q3FA 1L0BA 1V9SA 3LSTA 1HF3A 1EWVA 1RM0A 3IURA 3RYFB 1ZUD1 3F8SA 3IJEB 1ZM9A 3HGTA 3MSCA 2D2IA 5IF9A 1FBNA 2YZ7A 3AH8A 4XFDA 1TECE 3GFGA 2X86A 4OFXA 5FO1A 4F4IA 1CULC 2Q6IA 1VL6A 2W2TA 2OL4A 3BD9A 4OHRA 2HV8A 3T1NA 2VHZA 5G0UA 3B3GA 1Z47A 3N3BC 2MR6A 2VBGA 2VSXA 2Y1CA 1JGTA 3URMA 3TBFA 2WWXA 3DHEA 1QSGA 3NWJA 2WMNB 4W5JA 1H8ED 2IXAA 3FMVA 5EZYA 3ZYCA 5JRJA 4MHTA 2H18A 5IUNC 3PC4A 1IHDA 2PD4A 3JWGA 3IBFA 5CXSA 3TUIC 5FBVB 4MK4A 4UMDA 2W8BB 2EWWA 2C5AA 1E3SA 1Z2AA 2J67A 3T41A 4YUAA 1ZQ9A 3DGFC 3JU3A 2B83A 4IHJA 3E1SA 621PA 1DIRA 4TL6A 1Q12A 5ITWA 1JVNA 1QTIA 4LJSA 3ZS8A 5A3VA 2ORYA 2W37A 3HI6A 4CG2A 1Z8FA 4D9FA 3KEFA 1J24A 2PR2A 4JQOA 4I36A 2ZXFA 4PSKA 3GPDG 1XAJA 3KHSA 3QEMA 4HDNA 3BPSA 4MWZA 1DAKA 3OQHA 4LQLA 3SFTA 3UJBA 1RPAA 3HXOA 2JLZA 2PIAA 2R0QC 5BQ5A 1X1TA 4M1ZA 1C1HA 1X8KA 4CFYA 4C2TA 3LJKA 4JLJA 3GHHA 1XKTA 5CBPB 4O2BB 3TLGA 4ZZ1A 1WETA 4JI8B 3UK6A 1XMPA 2Z5VA 4WY8A 2QTFA 3S2UA 1VHTA 4DLKA 3AP1A 3TINA 1HM5A 1QCCA 4S3MA 2Y92A 3FGNA 3ZDEA 3PKJA 2YJGA 4IF4A 2H57A 4Q7EA 3TIVA 2CW5A 3PQ4A 4TMXA 1Y9DA 4U39A 1YDFA 1JEDA 1IJKA 1GDHA 1P8JA 1K86A 2DWCA 3PRKE 4WZAA 1PQYA 1UP7A 2IGBA 3C97A 5A7FA 4BEBA 2DAPA 2PBZA 1H6BA 4N03A 3FCSB 4QNRA 1CRPA 1FJ2A 1DINA 4Q02A 1WTCA 1ZGCA 3U37A 3CQ9A 3WSWA 5DNYB 2LCIA 2GN4A 3PICA 4D2IA 3ANYB 2CLHB 2GJKA 1NUHA 2JW5A 2VPQA 3JZDA 4L57A 4QBTA 1R5NA 3N8DA 4U2CA 3CISA 3W2EA 4K81B 3K5IA 4UBLA 1ZN9A 1GEGA 4I1SA 2ABWA 2D2XA 3NM4A 2H3EA 2XCLA 4KAJA 4TL8A 5CX1A 3TZHA 1VKHA 2JFGA 1EAMA 3G6WA 4NH4A 3UANA 5DBOA 3MJRA 2Q3BA 4I4TF 1EVKA 2YMPA 3JD2A 2QG9A 1P0FA 4B6SA 4ZHSA 1S8OA 2WG2A 5IK2D 5JZSA 1KYWA 3KOZA 3GJ7A 3INGA 4BUZA 3MWYW 3TLMA 2FZCA 2GD6A 1KH1A 1VIYA 2JHAA 3CSDA 2DQSA 2O3SA 3NBUA 1WKVA 3FHCB 3BIOA 3CIOA 3MEQA 1DAEA 5EWJB 3VYUB 1U0LA 1PLLA 3V4OA 3E9NA 3ID6C 3WSVA 4EG6A 1R1DA 2BZ1A 1A7KA 4BMZA 5AW2A 1RR6A 3GFRA 1EHCA 3PDUA 2A59A 5EMHA 3CMCO 2HXYA 2K7FA 3H9GA 3IPRA 3I5MA 1YDGA 1WB5A 3ESBA 3VI3B 3N1UA 1IE3A 1JQKA 2CLCX 4M1WA 4PWZA 5B2FA 2Q2NA 3WGOA 4YP1A 1FDUA 1Y8AA 3NEPX 4A7PA 5JMTA 5CDHA 4GX2A 3JQ6A 4M53A 1OPRA 4ND8A 4U7TB 1L5RA 2O52A 4PN7A 2WQ7A 3NIBA 3SYTA 4KAAA 4BCBA 4XD2A 3KDAA 3N86A 1RQPA 1EFPB 1QAMA 3IHWA 4LBYA 4B7AA 1WUJS 5CB0A 3BK2A 3QLEA 4KR9A 3N3AC 2CSUA 2NO6A 3VU8A 1JA0A 4QC2A 4ZKEA 5JC8A 3VR2A 1I3KA 1WZUA 5JQWA 1A1SA 1SBQA 3JALB 1RYMA 1W94A 4J0DA 4ZMRA 1JLKA 1NZDA 2I3DA 4Y67A 2G36A 5TQVA 4AF8A 3U40A 4BX0A 1RHQA 4YXWA 5ETJA 4JJGA 4ZT5A 2JB9A 3WSTA 3C39A 3H84A 1J2UA 1IWBB 1VB3A 4P7BA 5HKBA 4GX1A 5K2MA 1JVBA 1MB2A 2DHDA 5IG2A 4B8WA 2I6UA 1OQAA 2AJBA 1UXIA 4Z2AA 3UT5A 1QRUA 3C45A 5E8RA 2GH1A 3FGPA 4FJ0A 3M1YA 5K20A 3ZV4A 4J9UE 3AEYA 4BEVA 4ZVRA 1ZBQA 1RWPA 2EG5A 2R7NA 4TXLA 2QY6A 3RNOA 4INPA 1J2JA 1SAYA 3JASB 2ZRFA 5IASA 1K63A 2BKLA 1T4CA 3RSCA 1KI6B 4UQOA 1CR2A 5JT1A 4DV2B 5C32A 1Y63A 2FWIA 5KOIA 3SHWA 3CJRA 3T7EA 3KHTA 3AY3A 2B0CA 1CZHA 4R54A 2GYWA 5JCOA 2NO5A 3CX4A