2HRDA

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with thymine and phosphate ion at 1.70a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with thymine and phosphate ion at 1.70A resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 88
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hrdA00
4WKCA 2ON6A 1YR3A 3LA8A 1JDTA 5JPCA 4MCIA 5DK6A 1PR1A 4DA0A 1A9RA 1RXSA 4LKRA 2HSWA 4JP5A 1PR0A 5F77A 5ETJA 5F78A 4BMZA 1Y6QA 2P4SA 3EMVA 4L6IA 4NY1A 4L0MA 4TTIA 1JDSA 1K9SA 3K8QA 4TS9A 1YQQA 4DA7A 4NSNA 1JE1A 4F1WA 5B7NA 1SQ6A 1U1DA 1NC1A 3FOWA 1JPVA 2QTTA 2A8YA 1XE3A 1A9QA 4LZWA 3P0EA 3OZCA 5F7ZA 4X24A 1PR6A 1Y1SA 1V2HE 4OGLA 4WKPA 1PW7A 2I4TA 2QDKA 3KVYA 4LNAA 4TYMA 3GGSA 2A0XA 3DF9A 1B8NA 2PGAA 1G2OA 1Z39A 1YRYE 1ODJA 1V4NA 4DABA 1Q1GA 3UAWA 1PK7A 3OF3A 4TXMA 3UAZA 3E9RA 1JYSA 2AI3A 1RSZA 4TXJA 5F7XA 4TTJA 1Z34A 5EPUA 2QSUA 4I2VA 3BSFA 3BJEA 3FWPA 5IFKA 3C74A 1PBNA 5CYGA 2OXFA 1T8YA 1QE5A 1Y6RA 1RYZA 4QATA 1RXCA 4TXHA 4M3NA 4WKBA 4F2PA 4RJ2A 1VHJA 3FNQA 1K27A 1U1CA 4IP0A 1SJ9A 4G41A 3OPVA 4PNPA 3EUFA 4OGKA 4L5CA 4OEHA 4YO8A 5F73A 4OF4A 3DJFA 1Z35A 1RXYA 1Y1RA 4LDNA 4WKOA 1PKEA 3DP9A 3U40A 1NC3A 3OOHA 1Z5NA 4D8VA 1Y1QA 3MB8A 1ULAA 4P54A 3EUEA 4DANA 3INYA 3ODGA 5KB3A 4YJKA 3D1VA 1Z5PA 1T8WA 4GLJA 3UAXA 1U1FA 4G8JA 4DA8A 3T94A 3E0QA 4U2KA 1VFNA 1WTAA 1PWYE 1A9TA 4OY3A 4TS3A 1U1EA 4JWTA 4M1EA 3ENZA 1ODIA 1PK9A 3OCCA 1PF7E 5EFOA 1A69A 1JDVA 1U1GA 3LBAA 4DAOA 2B94A 4E1VA 5B7GA 4QASA 1JDZA 1YBFA 2I8AA 1JP7A 1LVUA 2GUWA 3OZBA 4D8YA 3PHCA 3ONVA 1LX7A 4D98A 4R31A 4YNBA 5FAKA 1C3XA 3E9ZA 4TXLA 4L5AA 2OC4A 1PR5A 1PR2A 3P0FA 3PNPA 1OU4A 2AI1A 2HN9A 5F7OA 5F76A 2XRFA 4OJTA 1B8OA 1V41E 1VHWA 2Q7OE 1ODLA 3KHSA 1A9SA 4F3CA 3IOMA 4KN5A 3UAVA 4TXNA 4DA6A 1N3IA 3TL6A 2A0WA 4BMYA 3GB9A 4EARA 1RXUA 4QAQA 1ZOSA 3OZDA 3IEXA 4BN0A 4JOSA 1A9PA 1PR4A 1JDUA 1T0UA 3KVVA 1V48A 4R2WA 1OTYA 3PNSA 3QPBA 4FFSA 4MCHA 5CYFA 3NM5A 1Z33A 5B7PA 1T8SA 1NW4A 5I3CA 3BL6A 2HWUA 1ECPA 2H8GA 1Z36A 1RFGE 1TGVA 5K1ZA 5IU6A 1VMKA 1V45E 4PR3A 4DAEA 3KUKA 2RJ3A 4M7WA 1I80A 5C80A 1K3FA 3KVRA 1M73E 1OTXA 4NS1A 4H1TA 1ZL2A 3OOEA 4G89A 1LV8A 1RT9A 2HRDA 4UC0A 2OC9A 4D9HA 4DARA 1V3QE 4QFBA 1SD1A 3F8WA 4BMXA 5F7JA 4QEZA 4WKNA 1Z37A 3NM6B 1ULBA 3UAYA 1TCUA 1OV6A 1TCVA 5CXSA 2OECA 1SD2A 1OVGA 1TD1A 5EUBA 3EEIA 3DDOA 3O4VA 2ISCA 1CB0A 3LGSA 2AC7A 4YMLA 2AI2A 1FXUA 3FAZA 3NM4A 4EB8A 4QARA 1RCTE 4L5YA 5B7QA 3KU4A 3FB1A 2QTGA 1Z38A 3O6VA 4ECEA 1ODKA 2BSXA 4GLFA 3MMSA 1TGYA 1YQUA 3BGSA 2IQ5A 3FUCA 3NBQA 4LNHA 1Z5OA 4R2XA 3UT6A 3OZEA 4D8XA 4K6OA 1A9OA 1Y1TA 1RR6A 4GKAA 1JE0A 4TTAA 2A0YA 4MARA 1T8RA 5CXQA 3K8OE 1CG6A 3DPSA 5CCDA 4F2WA 3SCZA 1OUMA 4GMHA 2QPLA 4F3KA 3PHBE 5CCEA
chains in the Genus database with same CATH superfamily
1XHLA 4WKCA 4P4SB 4ZOLF 3JWEA 3RK1A 1XZGA 2ZXEA 1SOMA 1SU4A 4R9UC 2ZQZA 2GN0A 3IALA 3GVIA 3LA8A 3TAUA 5BR7A 2FMIA 4NP6A 3B1XA 1UPXA 3LT0A 2I66A 5IAKA 2H1FA 1XWFA 2H6EA 2WIKA 3IMKA 1EVJA 4MQ5A 3GAMA 5H80A 3I61A 2IPOA 5ILGA 4NRDA 4PPQA 2G5TA 5LP6C 1TA9A 1X14A 1SUAA 4G37A 2N9UA 4Y1RA 1MJ5A 3L7YA 3T3MB 2N3ZA 2O4UX 5FWDA 5ULLA 3R7LA 4EP1A 2VTKA 4W5JA 3LGAA 1Q14A 1PZMA 1X1AA 5K8LA 1BU5A 2E3JA 2VHQA 5DW3A 3KELA 2J59A 4A1FA 4Q3CA 3NTUA 3ORQA 4PQEA 3STXA 1ISPA 4BPRA 2MSEB 1NURA 3V6LA 1IZYA 2X77A 3A1NA 3E5MA 3A1DA 1EB8A 1J00A 1TT7A 4J3JA 4MI9A 2X6QA 5JYEA 2H16A 1HYGA 4XAQA 3DLPX 1CVLA 3U7FB 3MWYW 4MRSA 3U62A 4E0BA 4Q3NA 2XX3A 2ZJ0A 1ONOA 1XTSA 5EMLA 1C29B 3WMRA 3VYWA 5A5DA 5C1OA 3ICEA 3GLVA 3TR0A 1XXHE 3W4JA 2X0JA 4ENSA 2PAAA 4N7JA 1U5CA 4ZA2A 2ZSDA 4ISBA 1IJFA 4DXDA 2W2VA 3ZQUA 5ECYA 5KI6A 1EWQA 3ZD6A 1SUPA 2Q45A 3HY6A 5DHPA 2Q3HA 5AXAA 4P81A 5A3SA 4FS8A 1L5HB 4MUNA 3SR0A 4WESB 1OPXA 2QTTA 2VRCD 4P3YA 4E3ZA 5FLYA 4EG4A 2HT6A 4UXJA 1GLNA 2H59A 4RA6A 1ZCFA 3GGJA 4KTVE 4DV7B 3IPAA 2WIGA 2B8EA 2MMCA 4BO7A 1NUAA 5E1MA 1X7GA 2HCFA 4L27A 2XZLA 1V11A 1ZW1A 3FDFA 1W2HA 2BFAA 2OKGA 2VJAA 3I6IA 2WWRA 3TSZA 2ZSEA 4OAQA 2V8BA 4DJTA 1E1CB 3C4JA 2QBYA 4BFWA 5B30A 5ELLA 2B6NA 2F3RA 4IXNA 3EZ7A 2F1KA 2YVKA 4TQ9A 3X1ZA 1CUSA 3P9QA 1FDOA 2C2ZA 1ODJA 1SUCA 3EJ6A 1ZIYA 2C8VA 4KQJA 1DZIA 4NIMA 3WFJA 1QRUA 1BOOA 2W2OA 2ZRJA 2JJ2D 2PZMA 3LSYA 1D03A 3TTYA 1M74A 1C9MA 2ZSJA 3AU9A 3T5MA 1G5TA 3RFUA 1Z26A 1KP9A 2VJBA 1RHJA 2Q1SA 3CN9A 1T5SA 1YWGO 4MWZA 1F1JA 4DEVA 3HXQA 3AF2A 3BWXA 3K2IA 2PVPA 1KFCB 4ZZ2A 1SUFA 2H1SA 5I7SA 1AQUA 3SJZA 2R6R1 5IM4F 2W6OA 3TFWA 3DMTC 4O8ZA 4LOKA 3LX8A 5EPUA 4AY5A 1GNVA 2QSUA 3K09C 4OX9B 4UXHA 3DQQA 3OQJA 5FAXA 1EE2A 1SXGA 3BJEA 1GYQA 4PX5A 1TUEA 4F56A 1SKYE 1ZGJA 2WJVA 3QSGA 5C3UA 3P97A 4O5OA 5FDFA 1E98A 2RJNA 1BRMA 3C74A 4XJTA 1BWQA 1GL9B 4YRNA 2ACWA 5E9WA 1RI2A 3TUJC 1R27A 2C4UA 4RMNA 5LQJA 3JASB 1F8FA 4YRPA 3UGQA 5CFRA 3OLWA 4ROTA 1V25A 3BD9A 3SI7A 1CF4A 1XCJA 2IODA 4XIIA 2UU9B 1DT5A 1F4PA 3CG0A 5CCBA 1LRLA 4NJMB 3K0KA 4U9UA 2FZ5A 1ZU4A 4R7TA 5JS7A 3KQVA 4BVFA 4UFPA 2FVXA 1DMRA 2WOOA 4UBLA 5EVCA 1E0DA 1IRXA 5JHGB 4W8GA 1QHSA 2YNMA 3H17A 4Q19A 3USZA 2ZIVB 1ZJWA 5AI5A 4Z4QA 1J2UA 2ZI9A 5D6OA 2FFQA 4JLOA 1G4AE 3KPWA 4LJ9A 1T1JA 1TJNA 3AUFA 2FSUA 4RY0A 2XUZA 4HNAB 4R83A 4V0RA 3WWZA 1UM8A 4FE3A 3GAZA 2PGDA 3IE2A 4G24A 3L2OB 1JHQA 1E2QA 3D02A 1QRRA 3PEFA 4JQCA 3WIVA 4IGEA 1SZPA 3HXKA 2JAPA 4OGKA 1CRPA 4NOMA 3A1SA 4YXWA 4E5MA 4CQMB 4F3NA 5CFLA 3ILSA 2C54A 1WAMA 5IJ9A 3ICQB 5A04A 5DCUA 4Q3EA 3HJRA 4AP9A 2PKEA 1H0SA 1LZKA 2PQ0A 2ZIGA 7AT1A 5GADl 1NN1A 1UBOS 3G59A 3FCXA 4FKZA 1WHTB 1OGIA 1PKEA 1USGA 2PGNA 2FLVA 3K20A 3H4TA 1Y3AA 3CH7A 3VNQA 1WZCA 2W98A 2BHSA 3S40A 3MXOA 3JYQA 1O1YA 4MP6A 5BQOA 3GMDA 1NVEA 5DT2A 3C48A 2TMYA 4NENA 4PICA 3WYNA 3V4VB 4DS3A 3BWEA 3KHTA 2F8SA 1NW9B 2QG6A 4KEAA 5AI6A 4PIMA 5C1PA 4G36A 3QVUA 4CM9D 4H0NA 3Q72A 1GPUA 1G3UA 4RC9A 1ZONA 3SEZA 5KMGB 1V7QA 2VPIA 3EW9A 3ZVRA 3H5WA 3KFVA 3PITA 4DUYB 4WI1A 3ZWYA 5A6VA 4CCWA 2VN8A 1YJBA 3L0DA 1P7PA 3K35A 5J1TB 3VKVA 3AIIA 3ER9A 1ZSYA 3ESDA 3F3YA 1IC6A 2ENUA 2KJQA 4PLPA 3MTGA 1C3OB 5EJIA 5DV9A 5JMPA 5LA6A 4YLGA 3U7QB 2CE7A 4IXMA 4UOQA 1NNUA 3UATA 2IEDA 5CW2A 1UEIA 4TZTA 2NP7A 2O2HA 1VLLA 2XTMA 2XXBA 3DBVO 4MLDA 3NDPA 2NUAB 4DWVA 3TLZA 5IAEA 3I62A 4HDQB 4HDMA 4OSOA 3AM3A 4B9EA 1ODIA 3SHQA 2B69A 4K9QA 4LTDA 1Y8RA 4H4CA 2XOKA 4QDOA 5E8JA 4B2LA 5IBCA 4AZ0A 2BMEA 1EWRA 3I6QA 4Y2PA 3DB1A 4BU0A 3UY4A 3RK0A 4B3JA 4CMCA 5C81A 1PVOA 2HNKA 1I2AA 1HE8B 1A27A 2HCJB 4ZYVA 1BJRE 3SM9A 3UHAA 3ZY2A 5CFOA 4KO8A 4DHWA 3C3XA 4QWWA 4KZKA 1QK4A 2CMKA 3V97A 1GKKA 2DBQA 4MHOA 3RC9A 3K72B 2OUKA 4RYLA 1W19A 3QPCA 2VJQA 4BMPB 3PD0A 1D4ZA 1YRQA 3EEFA 5JY6A 5J3JA 1RYMA 1BGXT 1U2GA 2E4UA 1SH7A 3ANLA 3WB1A 1P18A 2SHKA 2MR6A 3H9JA 3ONVA 2HMUA 3T5PA 1XJQA 3QMMA 3THOA 2HHJA 4HZUB 3U3RA 5B3JC 2C9MA 3AUUA 3SE7A 5E2AA 1U7UA 2XTAA 3AFIA 2J30A 4Y9DA 2DPLA 2IZ1A 2MYTA 1NMSA 3CRZA 3RVMA 2GBGA 1AU9A 2B3DA 2D8AA 2OAEA 4I9HA 4XVRA 3VAZA 1I7NA 2HY7A 4FI3C 4KN8A 1H0KA 3GQBB 1FYFA 2WBLC 3FKSD 2O8CB 4HQLA 3ZIUA 4J29A 1EVEA 4KV9A 3DULA 3VDRA 2W2PA 5HKBA 1FF9A 1ICEA 2IXFA 3RTAA 4H6WA 2DFDA 5AW8A 4NFYA 5DASA 3UJAA 2EJBA 4M7OA 1G8KA 1J2YA 3MAGA 5DBEX 4BFVA 4ZYXA 3TQIA 2Z3VA 1Z0SA 2R8RA 4DB2A 1A1SA 1G20A 1T0IA 4XTCS 4F38A 3JR3A 3M83A 1SCDA 3FDIA 3NT2A 5KTYA 1XYGA 2XUQA 3INNA 1JZTA 3ORFA 3RBZA 1HX7A 1LFDB 1Q7EA 1QYRA 1VPDA 3CH5A 5FTWA 1V6SA 3CEPB 1ZCZA 3FSEA 2PBRA 3DMPA 3V46A 2CXRA 1U8EA 4LQ4A 2XBMA 2J9FB 1IOZA 4JOQA 5TDHA 1LNSA 2OHIA 2RG7A 2XUJA 2O3RA 3N70A 3K0CC 4NK4A 3UW1A 3VZBA 1VBFA 2PUTA 3QKSB 1BN7A 2FA9A 3I5MA 3ZIAD 1X7XB 4Q01A 2WKQA 3PWSA 2A14A 1KI9A 4ZXFA 3FPAA 4ZEXA 1ODLA 2WV9A 3OVMA 3L7NA 3C3PA 4GGMX 1Y8CA 4DKJA 2IH5A 1I3MA 3NNDA 3RC2A 1OXKB 1TU4A 1V8PA 2X76A 4OLBA 2QI9C 3GPDG 3K30A 1A9SA 1ZK1A 4BQFA 2BOVA 3QW2A 2PFSA 2EV9A 4HGZA 2F8MA 4XWOA 4W8HA 5T3UA 1M1YA 3LVRE 2YYZA 4HLCA 1LXCA 4ANFA 3LE8A 2H48A 4HPJB 1VBMA 1FBTA 1XTRA 4HLNA 4K28A 4CR7A 4EF5A 4UFOA 1UDCA 2VAPA 1BHJA 5C18A 3P71T 1GKIA 1PFWA 2B34A 3EIQA 1E1NA 3F74A 4G0QA 1RYDA 4X61A 4CMGA 5AM3A 3TIGA 5FWYB 5DN9A 3H8VA 1E9DA 2IU6A 1KQOA 1KVSA 3L6BA 3A3KA 2R2GA 2OZEA 4UM7A 2CHQA 4RAOA 2EZUA 5IVDA 4QXOA 3RW9A 3RVJA 4YDSA 3WHKA 1DPGA 3WGJA 4AI6A 3KQOA 5LUBA 4YAWA 1PEYA 1H65A 1FMJA 4WD3A 3E27A 1BD3A 3E7FA 4WNAB 1I8TA 2NU7B 4TV9A 3TRFA 1AKNA 4J7XA 4V24A 1B8VA 4DB4A 2Y3IA 4CDMA 5IKEA 1H0RA 5KNDD 4EHLA 1QQ6A 1RYYA 2Q3JA 2C2WA 3LUCA 2XJ4A 4FHEA 3GEBA 4OXRA 4RXMA 2I7CA 2XCLA 4IS3A 5SV2A 3NM5A 1TRKA 3DLBA 2TYSB 1Z33A 2BEUB 1GRQA 2OLEA 3AY6A 5K6TA 3B1FA 1T24A 1M0SA 1NLYA 4Z99A 3VSDA 2HWUA 1U02A 3ZU2A 2H8GA 2DKOA 3BIOA 1VJ1A 2YBEA 2F9LA 5CJJA 3V4RA 4IIBA 4NV1A 3MTBA 2CV0A 1RFGE 4JI7B 2JB9A 2J3HA 4LX8A 4BCDA 1DRWA 1X1SA 1LQUA 3F7OA 1JH9A 2FPGA 2GRJA 4BJ3A 1G60A 1MT0A 1VLJA 1YACA 3ZKWB 3HUTA 5EPOA 5HMMA 2I34A 1BS9A 1BU8A 1SUWA 3IDFA 4LJAA 3NRCA 4PC7A 4QUIA 3UBTA 5EP1A 5C80A 2XVMA 2BSQA 1RLUA 3CIOA 4RKRA 1MOZA 1OREA 2YRXA 1EVLA 2ZCUA 3UEOA 2P11A 3FHCB 2PUAA 3VKGA 1Y3CE 4B4KA 2IYYA 2CUKA 1HLFA 1FFBA 5FTLA 2B4AA 1EBFA 3CLSD 2O5VA 3KXKA 1IUKA 1GPJA 3SNHA 3W0LB 1EK1A 4LC9A 3HWWA 5KSWB 2L18A 3JVDA 1YZLA 3CISA 2PEZA 4OI2A 1SFRA 2IPAB 1QHIA 1J5XA 3I12A 1RYBA 4HLUC 8ADHA 4HDNA 1K98A 1RZRA 3SBOA 3WGMA 4M86A 1C1DB 1KO5A 2FB9A 4UVEA 4CU5A 1XAJA 5BUSA 3OKFA 4HH1A 3T35A 1BMFA 2YY7A 3CHYA 2HXGA 4HMQA 3N05A 4G07A 4X20A 3H7IA 4QUBA 1U0SY 4DR3B 4EEZA 1NVTA 4IDHA 1NVBA 3KLNA 1ZKDA 4WA8A 4HNTA 3TNDA 4LY3A 3H87A 2JGDA 2LWIA 3CKMA 4FMBB 3T7IA 3U9LA 3AL3A 4R71A 5HKOA 2R8OA 3L77A 4EF4A 4EA8A 1FTWA 4MUKA 3GJ6A 5FWXB 3Q6IA 3JARA 1CC1S 1Y3FE 4EI8A 4EKDA 2P8JA 3SXUA 1LDYA 3VR6H 4M6WA 1NXTA 3ZXIA 1NJ8A 1TO2E 2R6AA 3R77A 1O6FA 3NONA 4MJ7A 3RBXA 1WZUA 2VNKA 4IIJB 4MV9A 1M6VA 1K75A 3EGWA 4CLRB 4CIWA 4CKZA 1E99A 1B1CA 4YR9A 3I2IA 1W88B 1Y1LA 1VTKA 1N2HA 4HNHA 1HTBA 3FDZB 4M4SA 2I4NA 2Y1FA 3G1UA 4NDAA 1SZCA 4YH1A 5SY9A 5JE8A 4E09A 1UP4A 2KWIA 4FSHA 2VHXA 3WSTA 1RCTE 4DCCA 1GG2A 1XR3A 1QH1B 8ABPA 3ZCSA 2CUTA 3I45A 1XEAA 4OREX 1EK6A 3F6BX 1K6EA 4UHEA 3O8OA 1XVAA 2H5IA 2JGEA 4TT8A 3OPXA 4PRZA 4O33A 4V0LA 3V1NA 5LM3A 1TGYA 2FN4A 4KK4A 2JVJA 3FBWA 4F45A 3C5WP 4CLDA 2P4QA 3A1WA 3PXUA 1NF9A 2WJ6A 1TJ5A 4B0PA 3KSMA 3CPSA 2WQ7A 1RC8A 1EUQA 1YFZA 4HSEA 1RAHA 1T10A 3AESA 3WS7A 2E18A 3JYOA 1DUSA 2AXQA 2XHEA 4ZZ0A 3DPIA 3EA5A 3PGXA 2A58A 2NU9B 1EVKA 1P5FA 1DX6A 2O2CA 1JAIA 4IXDA 3W8NA 4ARBA 2ZWVA 4DLTA 1EQ2A 2Q2NA 3GFTA 3AJ8A 2C78A 3NBMA 3AHDA 4OIFA 5CR9A 3TXAA 4RFSB 4KR3A 3EZXA 4X41A 1LSSA 1Z82A 4PLWA 2QSYA 4YV2A 3AHGA 4QAJA 1EHCA 2WY2D 2ETVA 1W4LA 2H8KA 1Q0QA 4KGZA 4ND5A 1VDMA 3N3BC 2ZRHA 3CH4B 3V5NA 1ML3A 5DLQC 4BVHA 3JQ8B 4RCZA 4GBMA 3QEJA 4O2LA 3ADPA 4NL4H 1EK5A 5BN3A 2BCEA 1JTFA 3SKXA 4ZMRA 4MVJD 1XRMA 2XYRA 1B76A 1TEHA 2I0FA 2DPGA 4N5DA 4EZIA 2CGEA 3EBLA 5F2OA 3FGOA 3F7TA 1S4QA 1KU6A 2C04A 3G2IA 5AK5A 3AJ9A 2IDJA 1M6EX 4JGIA 4RPIA 2PL9A 4A0QA 3LI2A 4ZRMA 2V7QD 1E69A 1KJWA 1JECA 2QGZA 4RIIA 5BYBA 4CQNA 4IIJF 2P8SA 2ZCJA 4W9RA 4FDAA 4AB1A 3ZGZA 1D2HA 5JPCA 3IQDB 5A9SA 1PVVA 1YZHA 2J3DA 2GN9A 2GNOA 2GEVA 2OM2A 3E35A 3R5XA 1L5SA 2BZ1A 1ISGA 2OY0A 4B3IA 3H0KA 1L4UA 4MSUA 3AY3A 1WXIA 3PU6A 9ABPA 3SQDA 2ZS8A 3MWDA 1OFIA 4HY3A 3VZSA 2C5HA 2V5UA 3O83A 3NEYA 3ROFA 4NX2A 5AVRA 4TLBA 3Q7SA 2VTBA 4QEDA 1DCFA 4NV0A 1KSGA 3AR3A 1G20E 4KH0A 4E1BA 3QUQA 4HH0A 5F77A 3EXHC 3P9ZA 5CLJA 2QAGC 1H9AA 1BHSA 1U3VA 4LRUA 2JG3A 4N82A 1UPFA 4QJ4A 3T9DA 1KI3A 3EPHA 4F4IA 3E8MA 4NAHA 1L1RA 1XMJA 4JV5B 4IJMA 4F4JA 4JSRA 3I64A 4E5PA 2YWJA 1KIMA 2AXEA 2V9PA 3D8RA 1WP4A 1U94A 2IYAA 1XZAA 4L15A 2VSOA 1L7OA 4EY5A 1H05A 5JROA 3HCRA 2JBAB 5KYNA 4IFTA 1H1LA 1JE1A 2XB2A 1SQ6A 1Z3CA 3C8HA 1FFXB 4D97A 3LZCA 2YQZA 1P62B 2A1UB 5H7XA 5T6MA 1P31A 2C20A 3QVJA 3ZY5A 2N75A 1JT2A 3KK0A 1FK8A 3GG9A 2VHZA 2X5JO 3DDCA 1KYXA 3SHFA 4YDRA 3TAHA 3CRMA 3VYRB 1YVRA 1IDN1 2NVWA 1Y1SA 2BMDA 3DE7X 4HEQA 4W1SA 1E4YA 4JC0A 1M1YE 4RK5A 4A2CA 1SIOA 4WKPA 2I4TA 1CJMA 4JLBA 4AW9A 6GPBA 4PZLA 3G5TA 2EKPA 2XADA 1Z2PX 4UNQA 1GU0A 4K7JA 3VPFA 2YFHA 1LLQA 2IOHA 5DHQA 5C8YB 3AJAA 4PO3X 5J63A 2JLYA 1ESEA 3Q85A 3TIVA 1QH9A 2FFHA 2VYVD 4ER7A 2WWHA 5BSWA 1AMNA 1DZ3A 3KYBA 4RJKA 2WRZA 2QX4A 4DY6A 5T4BA 5H3CA 4CNBA 2NTJA 4LQDA 4F9FA 3HRHA 4IIVA 2B4TO 1SC6A 2QIOA 3TR6A 4UAVA 4UHHA 3ZDRA 2J0QA 2WWFA 4MYHA 1T9GR 1ZCBA 2XVZA 4JL5A 4KO4S 5AVUA 4LFAB 2NVUA 2CYCA 4LTNA 3FWYA 2WSBA 2XQVA 3P9NA 4L9WA 1Q44A 1TT5B 5CEFA 3Q8MA 1JG6A 1N5LA 1DXOA 5HM6A 5HZKA 1ZO8A 2P77A 2CNBA 3T1HB 3F78A 1WXGA 1UBKS 2ZB4A 3T0IA 3T0GA 621PA 4MH0R 4R2LA 3CX4A 1LQTA 4YCAA 3ZWNA 4EVSA 4F12A 3DDSA 1V9SA 4UATA 4OP1A 4D3DA 5CA1B 3EPLA 2C7QA 4GEGA 4JIGA 2ZT5A 2BGRA 1YIAA 3PEVA 4YJGA 2J0UB 5CB4B 1G8JA 5A7HA 2W2KB 1YTLA 2NO0A 1HZZA 3GRVA 4P3NA 2Z8XA 3RS3A 1T25A 4CKCB 4ZD6A 2P62A 2OB2A 2ZKIA 3FA2A 2FOLA 3K4HA 5CW1A 3UWMA 4I4LA 4BXOB 2YHUA 2WUWE 4IMRA 2PGIA 5BOVA 3RFFA 4F2PA 5E6SB 3E6AA 1QG2A 2QUHA 1M2JA 3J81A 2WD9A 4X66B 1QIKA 1YDGA 2WIBA 3H13A 3H1BA 2ZYWX 3VU9A 4RORA 3QKTA 4JJZA 1P7ZA 3H2ZA 4D9GA 1P7CA 2HBZA 2JGFA 2QUIA 2ZJAA 4MKXA 4QBGB 2FHPA 5EYPA 4DSZA 1OFTA 2R5WA 4G56A 4L1KA 4XYMA 3FD8A 1MHPA 4BV9A 4D0NA 4EFLA 3BRWD 3QHAA 3W8EA 3RV4A 3OZGA 2JAOA 1ZP6A 4QYSA 4EYKA 4JYBA 5KNBD 5LVAA 1R8XA 2B9EA 3A25A 3PKZA 3T9FA 4BMNA 4DGSA 1R4MA 3MS4A 4NCXA 3RTBA 4LDNA 1RHQA 2DFKB 3OZ7A 1KXJA 3KQTA 4LI3X 4O3MA 3K9HA 2BEKA 2Z2IA 4C76A 1B1AA 2YIMA 2HLPA 1N36B 2OK7A 1VLVA 3LH5A 3T99A 2WD7B 3QI7A 4W1QA 4C7OA 5I4KA 2VRBA 4KDRA 2I80A 2QE7D 1Z8DA 4YJFB 4HDRA 1YI8A 3RJTA 1VP3A 4PSUA 3NBYC 5FUWA 3ZW8A 1O0BA 5IKPA 1NYRA 1KZ7B 2XSZD 3MJHA 3ET4A 4FCWA 3OZWA 1GFWA 3U49A 3DHNA 3KSBC 2A7QA 2GZ3A 3FVWA 2X1HA 3L0YA 1WA5A 3WBJA 1DKPA 1JQBA 1YCDA 2NTNA 2E1RA 2BMVA 1H5NA 4L72A 5BR8B 2P4EA 3FFBA 3AB3A 5CB4F 4WXMA 2FETA 2X22A 5FBQB 3CUTA 1V3VA 2H1RA 3B3JA 4DF3A 2P6OA 3K0AA 3L93A 1V1MB 5JMOA 2XGJA 1WULS 4YRLA 1SUDA 2QZJA 4IDCA 4JWTA 3B6IA 2M6LA 1KP3A 4EHIA 1JIIA 3KXLA 3ENZA 3LFUA 1UQUA 4CL2A 3WGOA 1NLUA 5T4EA 4WW0A 3ZE8A 4B3MB 4I3GA 2QUZA 1GDHA 4K9NA 4AZSA 1N5OX 1TJPB 1GV1A 1RMQA 2I4RA 3HCWA 1HRKA 2EKZA 1UK7A 2VH5R 1U3WA 4WY8A 4KFCA 1DC6A 2WE8A 5B1SA 1GKUB 1XZBA 2DTXA 1WPGA 3L4SO 3LUKA 4JB3A 2XRYA 1GZUA 3DE3X 4NLLA 4F21A 1J70A 3CGWA 3HHPA 1QGYA 3N74A 4BBAA 4YUAA 3R0QA 5CVEA 6LDHA 1LFAA 3VH3A 4KB5A 2DJIA 3VGJA 4PSCA 3JV7A 5CLLA 2DYKA 3D6FA 5TE9A 4AIRA 1MPXA 4M7RA 2FMKA 5FUBA 3RUDA 1TIBA 1NOIA 1VL0A 2PKQO 3A6ZA 4L74A 1UKVY 2BFMA 2GTPA 3I30X 4HFJA 4NICA 2CLOB 1QZ3A 2AZTA 4A0GA 1QB8A 4NEHB 2VZ8A 1EG2A 3HZRA 3Q5EA 2IU0A 3N86A 4PLGA 4GP6A 3R20A 3S27A 2HJ9A 4WN9B 4K9LA 1XPUA 3OY7A 1KO4A 1FDWA 4JN6B 5LNK6 4LZJA 3RG8A 4R2IA 1DEOA 4NOLA 4PXSA 3TDKA 5BV0A 3QVGA 5K3EA 3GX1A 3OEHD 2JJYA 3MPOA 5IG2A 1ZN9A 2XMGA 3ZHRA 1C7QA 2PH7A 2ZDQA 3DS8A 4BC0A 1BXGA 4MNTA 5E3JA 1PR2A 1RWNA 2UZ0A 3D8UA 3KAQA 4UM8B 3VMFA 5JXWA 1P77A 3LBHA 3UV7A 5ALDA 3ZD8A 2NW6A 2X1LA 3IQHX 4G26A 2FQXA 2QS9A 3B1KA 4GMGA 4MQFB 5FI5A 2TRSB 5HE8A 2GBFA 2PXAA 3ABZA 4UOEA 4Q4CA 2N1MA 2RGXA 2WMYA 1QX3A 5C5EA 1BW9A 3OCZA 1JX6A 5LZ2A 3D6JA 3BEOA 4MITA 3PFWO 2QVYX 2J8ZA 1UQTA 3WSWA 3PE3A 4RHTA 3KCQA 4O4LB 2NV0A 4MUGA 3LQKA 2HNBA 3IESA 3SK0A 3GYGA 1V71A 1GP2A 2GOYA 3FF1A 3MA0A 2IXGA 3OO1A 4M38A 1K4MA 1K8RA 2DHEA 2PYZA 4CMHA 2YJ6A 3ANXA 4E51A 1G3IA 4N5NA 2CDAA 2RAUA 1NXXA 4E13A 1F06A 1T5TA 3BXZA 3HB0A 4QPNA 1AN0A 3OC0A 5FUYA 2QYOA 3ZDEA 4Z7OB 1LJ8A 3ROTA 4ZMSA 1A72A 3SC3A 3G8BA 5I3ZA 3FN4A 3FPBA 1KAEA 1TAGA 2O7SA 3HLTA 1ZIDA 2AQIA 3AEKB 4XLLA 5FADA 4XQCA 3E3MA 2QLMA 3ESCA 5K6AA 2FR1A 2QM3A 5CP8A 3I2KA 1FU8A 2B4KA 5KTPA 1LK5A 5AJTA 1O5OA 3WJ2A 5ALXA 2P79A 2UYYA 2DFNA 2PZGA 4QELA 2YFQA 3MMZA 1IBLB 3FOFC 1U63A 3JZIA 4B7XA 5AUNB 2DTEA 3LDAA 4Y0NA 3TTUA 1GKYA 1P3DA 5EWLB 3DHVA 4LY0A 1RI3A 4R05A 4CDNA 5CX1A 4EM6A 4N48A 2IWHA 2EKQA 2YBDA 4OHMA 2PBFA 3FTNA 1D9ZA 3GZJA 1G8MA 1DAGA 2PLFA 4FZJA 1HDXA 2Q3BA 4EJSA 1E0AA 1ZJYA 3HCOA 4OH1A 4C7KA 4CMAA 3D6NB 3LP5A 3TBHA 1Z06A 5F2NA 3P2YA 2Q4DA 1Y7LA 1EM8B 2Z1NA 3RVKA 1TCAA 2RIPA 2GNPA 4R69A 5B1IA 3TTXA 1NW4A 3OO0A 4QOSA 3LXMA 1QUFA 3F5MA 5G0WA 1PNVA 3H2JA 2WM8A 4O4LF 2BFOA 3FFWA 4WOKA 1E1MA 4Q4AB 5F9MA 3ZS9A 1C4KA 4LF8B 4NBTA 4A2QA 4YUVA 4OQXA 4Z5XA 4JLSA 1PW5A 3TTSA 1RPTA 4DL9A 4F6LA 2HCRA 2VG8A 4ZU6X 1OJLA 2E4ZA 5IXJA 1EB9A 3PYXA 3HL0A 3QBEA 4KIFA 1GT6A 2Y1WA 1E61A 4XH9B 3G85A 5I4CA 2G83A 4PV7A 4U3JA 4H1TA 1T9AA 5C7LO 4B71A 1K86A 4PN3A 1M8JA 1ST2A 3CJRA 4G67A 3UOAB 3H99A 3GD5A 1CF9A 4FGKA 3UT5A 1QK5A 4PAGA 5HE9A 1ZUNB 4DIUA 1DDOA 5HIKA 1IEVA 3MSXA 3H2YA 4XGKA 4BEBA 3LKVA 3WYEA 1E3DA 4DARA 1VE7A 2OSVA 2PGJA 2ZJ2A 4QT0A 4WADA 5JSFA 1OGJA 2IS6A 3FZQA 3DLTA 1YGYA 2WNIA 5EJGA 2H29A 3HU5A 3Q8XB 2VPXA 1EAMA 3U0VA 4X84A 4CE6A 3KJIA 5EEGA 1LNQA 3OPQA 1HNNA 3P5SA 4JVNA 1SKMA 4QOIA 5FH9A 2YZMA 4FZVA 5F3WB 4AM8A 4YEDA 3SBDA 4Z4HA 3N0TA 1RP7A 5E6RA 4QBFA 5K3OA 3A6DA 5FPHA 4O0MA 3RSHA 2VDPB 1LPNA 3QXJA 3ABSB 2RGNA 5AVWA 1YJAA 4RVOA 2B5VA 1OD6A 3KUUA 3ENVA 5E38A 3R7WA 3A9SA 4GKVA 5K0JA 3EEOA 2DPYA 2ZYHA 5KTRA 2XBLA 4P53A 3OLXA 3GO4A 1XZNA 2YJNA 2R86A 3BQ9A 3ND9A 3UV3A 1P0CA 2IBTA 1RPNA 5KYYB 3W2GA 1OE0A 1H93A 5LDGA 3OU7A 4PLVA 2ZJ4A 1SCIA 2ILTA 2R96A 4V2UA 5DCLA 3DDOA 5G0TA 5EJ8A 4DSNA 3KJFA 4H16A 2QU8A 4O4HF 2AC7A 2ZE5A 3EQ9A 1B8PA 1XNHA 4XR9A 4HVLA 5HK9A 2CLIB 1JHMA 1FTGA 2DU8A 3B53X 3Q5DA 5DM4A 1H4SA 3J7AC 2ZT6A 4MEBA 4PNZA 4G25A 4KQXA 3HUDA 4MRNA 4N12A 2P4UA 2C3PA 3EXG1 3WFIA 4G4IA 4ZHSA 3S2SA 4Z4EA 3EIWA 3BBLA 1KY5A 3TLMA 1A2BA 4LDPA 1KIAA 4Q18A 2M6SA 1AZSC 5K9ZA 4ZVMA 3JU3A 1EGHA 4EELA 5DO9A 5BMVA 3UQZA 3WIBA 3W3AH 1GNTA 4A1OA 1UFQA 2DPHA 4HQRA 2YX1A 4FB4A 1GQQA 3E5HA 3L01A 4ZOCA 1N8NA 4Z9BA 3V3TA 4WCFC 4DQUA 3BGDA 1XWWA 2P5UA 5CD9A 3PDCA 5A4AA 5L4LA 3PP8A 2VDJA 4XQGA 4CM9A 3NT5A 2NWQA 3PFKA 2H4XA 2A0YA 4TLCA 4GUDA 3O0TA 9MHTA 1NMQA 4XB2A 3WB2A 2O2YA 4WH0A 1VJDA 2D3TA 1G6KA 4FT4A 4PNEA 2DJ5A 4O4JB 4R6WA 1BVRA 3CF0A 4FSDA 4WL0A 2WJZB 1XVTA 3AHFA 4DMHA 1PVDA 5TT0A 1U7OA 3QELA 3TVTA 5FA6A 4DLSA 2P65A 1FP7A 2JIDA 3PHBE 4UARA 3N6VA 3STYA 2NACA 4MKGA 5ES3A 5BN5B 1M83A 1SG9A 1T3LA 2ZYTX 2PKYX 2ZRAA 2QU7A 4IO1A 5BUCA 1BE6A 2B1QA 3V4OA 1JSLA 4XB1A 1KFJB 3L6OO 4I50B 5I7UA 3GUYA 2BJVA 4PC1A 2D7JA 4QU0A 4N54A 4ZP1A 4DLRA 4ENUA 5KQRA 3DH0A 2XMRA 1VHTA 3B1VA 5BW6B 5G0VA 2AZMA 1C3LA 1Y8ZA 4D82A 4PBRA 1JLSA 4JFAA 1VP9A 3PSAA 4K0RA 3LUBA 1JA0A 3HSSA 1O9BA 4KFSA 3VA7A 1OYVA 3G88A 4TL9A 1OXMA 3OFKA 3SYRA 4LOIA 1SXJD 1PR0A 1ZZEA 2P9BA 1IFXA 3FSGD 4OX9Y 2WF6A 2VPTA 2W0MA 4MDEA 4QGHA 2GKOA 4YROA 2BBOA 1W34A 4PG4A 2DUUA 4INPA 4I6GA 1UJMA 2VNIA 4MRVA 4ND8A 3ZLVA 1CBUA 3DQPA 4BMZA 3I8SA 2E5FA 1WB6A 2BUCA 2QNIA 3FKSA 3CVXA 3M3DA 1HKUA 4NG5A 4CTMA 3VR4H 2XUGA 1YZVA 2Y76A 3UMGA 2QD2A 1PSZA 1AXGA 2OV8A 2X5NA 1X74A 4J8PA 3RH0A 5CFMA 3TCKA 4MO9A 1S8NA 2HCBA 5J2TB 1ZOPA 2FP4B 3A6HA 1C9EA 1G8FA 2VPZA 1ZNYA 4O4JF 3NHAA 3IMFA 4GXTA 3LX4A 4ARZA 4F1WA 1AUPA 1C0LA 3GZNA 3NTLA 3ABRB 2H2HA 4GI1A 5JNUA 2VUIB 4XPIA 1CJCA 2EG5A 3A9WA 3EFEA 3DBHB 4ZQGA 4JYCA 5A0FA 3X2FA 5AIBA 4FT2A 4CM8A 2QF7A 5T41A 1NMEA 1AIPA 3KEQA 4ASUD 4WZAA 1C2YA 2V3WA 1WF6A 2LNDA 1WS6A 1SQFA 3QBTA 2CLMB 3B9RA 2AXPA 3NKFA 2FPOA 1CQJB 3W9BA 5BR1A 3ZIAA 4I50F 1DAOA 1T4BA 3I58A 3ZJTA 1YZYA 1X80A 2VWGA 3F90A 3O2SB 4LRXA 4QDXA 4ZOLA 1NUQA 5U4XA 3S29A 1X7HA 3DVAA 3VPCA 4X0EA 3F1KA 1RKVA 1GYRA 1TO1E 2R6CA 1OXXK 1PDOA 1VSUA 3F6PA 4KWIA 3SEAA 4D6PA 5HW0A 1Z0JA 4EENA 4BYGA 4UDYX 1XEWY 2ETXA 1VMIA 1JEOA 1U2RA 5LZ4A 1QIGA 3RAGA 2QJRA 1VIVA 2YNMC 1ISSA 4ND3A 2RH8A 3CO0S 5D3MA 4QXMA 3O4IA 3BFJA 3KZXA 3IR7A 3WMGA 3GVXA 4EKGA 4TTJA 1OWOA 1FP4A 1S8AA 5TQVA 5BQPA 2R97A 2J3QA 2J9GA 3P9CA 3T41A 2NZVG 4RJJA 4UM9B 1GA1A 4FYXA 5LWQA 4U2CA 1JKJA 3EPJA 5TR9A 3IFSA 3SX4A 1YQDA 4PYQA 3Q1LA 3UCFA 1KZ6A 2BZSA 3IKJA 4M0PA 1KAQA 1PBNA 4XCXA 5CYGA 4J4TA 3GXOA 4TKLA 1KGSA 3O4JA 2IV2X 5CBPB 3IVAA 1SMKA 4TZKA 3E48A 2CDBA 5J2TF 5A62A 1YZNA 1XD2A 2PLNA 2X19A 2X4GA 5F2EA 2J4FA 1NV9A 2E48A 3KQMA 3DTYA 1K7YA 2ZJ1A 4ZARA 2FKAA 2QTWB 4GVXA 1GR0A 4L4SA 1TLLA 4YS6A 1N77A 5ARCA 3PT9A 1RYZA 4TTRA 3DMRA 2CJWA 3FI9A 3EGVA 5A9TA 1MUUA 1T8UA 1ZLYA 2FSSA 3OQHA 5JNTA 1EVQA 3AVWA 1ZRNA 2ECPA 1MRZA 1Z56C 3VX4A 3T3IA 2Y8EA 4MV1A 4ZVVA 2AZXA 4EGFA 1QV9A 3UK2A 4DIKA 4IGIA 3BKWA 1XD8A 5TX7A 4NJOA 2W2QA 2X6RA 3JD1A 4N18A 4ZCRA 3AYZB 3MGCA 3SG0A 3VO9A 1HZJA 4QGFA 4P4SA 1P0MA 4E08A 2XYVA 3CE6A 1XVLA 2H7YA 2ZYUX 4L75A 3H75A 4BVAA 4GR9A 2ORWA 3D3WA 4KW7A 3T7EA 4PU0A 4U8GA 3TD6A 1JW9B 2VC2B 1WDLA 2Q8NA 3CRNA 4EJFA 3LBYA 3A7EA 1LB1B 2DHQA 4XGNA 3SXJA 2OCIA 4JLUA 3S2UA 3LCUA 5AUQA 3FGNA 1CJSA 5THQA 3CRVA 2I3ZA 5EKTA 5F5LA 3U40A 3BE5A 2F4VB 1XQ9A 4EUKA 1NC3A 5ALGA 4QVIA 2IYEA 2Z83A 1Q7TA 4OV6B 3C3YA 2OPHA 4U2DA 1MO5A 4L3OA 3RIYA 1X0VA 1L6RA 2FWIA 2R5NA 3MIZA 1PRYA 3MB8A 2AJ8A 5BY2A 5ALIA 4FINA 4KWCA 4ZOBA 2XRMA 5EZYB 2GCGA 4E6EA 4XUGB 1P7VA 4MRPA 4JOBA 2AMYA 2QR5A 5IM4A 2H2IA 1TKCA 4RS4A 2Z57A 1SBZA 3AILA 3MT8A 2A84A 3D1VA 3F3SA 1F6BA 1SUBA 1M0WA 1YULA 2ZB8A 4HBGA 4P08A 3H19A 3RFVA 2WJWA 4GPIB 1NRIA 2AN5A 3O9ZA 4Q3KA 1EDDA 1OXSC 1ECBA 2WTAA 5DBIA 5DPMA 4U2KA 3IPCA 4QDUA 3KOMA 5C1IA 3KPYA 3U4GA 1KYWA 3SHVA 1RLMA 3KT0A 2FN8A 4O4IB 4EI9A 2CSXA 1TVEA 2IDMA 3JY6A 1T91A 2J0VA 3LHKA 1I1OA 3UJ7A 2I2XB 1T5BA 3E4DA 2DHRA 3KOWA 4LWZA 4TWJA 2ZTMA 2GKSA 3R8CA 4OK5A 1OILA 3DFZA 1L5HA 3SFVA 4BB5A 1GIAA 4WESA 5KJCA 3U6KA 4DUGA 2WI8A 2F00A 3QX7A 3ELDA 4QASA 1JDZA 3FJYA 4L7VA 2VCEA 4BJ1A 2OOSA 1JHVA 5EXEA 4ZQCB 3EDQA 2BGUA 3HYCA 3X1WA 5BYJA 5CHYA 2JFXA 3EISA 1VRCA 2NO7A 1S01A 2WWWA 4KMRA 4URZR 4DMLA 2DZDA 1QWSA 4JI0B 2VKTA 3PDHA 3DOCA 1UK8A 3IIEA 5TY0A 2Y1DA 1E1CA 4KPFC 3KL2A 4JBNA 2COKA 5JCPA 5ARDA 1ABFA 2OQ2A 2C8LA 2CB9A 2FPUA 3ME5A 5LP6B 3TJMA 4ML3A 5C8VA 5DGIA 2XNJA 1N6IA 2C94A 1E7YA 1ATIA 1PJLA 2PUVA 1RM0A 1I5RA 3PT5A 3VR2D 4WLOA 2C8JA 4RSHA 4JDPA 3VO1A 4ZV4A 4ZZ1A 2P3LA 1DBQA 2BD0A 2H4ZA 2BI8A 1EP2B 5EZYF 4D4HA 1OVMA 1Q1AA 1Q3HA 2GCIA 2VCHA 4RACA 1DIBA 2IXDA 1M72A 4TXLA 2IYWA 3EIEA 4MRMB 1I94B 4RSMA 1NVKA 2VAWA 2EJTA 1NW8A 1E5TA 3MQ4A 1KJZA 2GXQA 2XDQB 3CTPA 3GWGA 3P5BA 1YAJA 2CHEA 3KOYA 4RV5A 4CM1A 4JUDX 3CX3A 1K68A 3B6JA 2ZBPA 4N6OA 5SYAA 4O4IF 3JR7A 1FFGA 4QPZA 3T5DA 3ZUGA 5JHHB 3JASA 4II2A 2L42A 3DMGA 3RVBA 3LX5A 3W4IA 1RHRA 1ZOLA 2GCNA 5F7OA 4X91A 3F73A 1AHIA 1JJ7A 3MJEA 2BV3A 4EQ6B 1XDUA 4NJMA 3AINA 3ZZ1A 3Q7PA 4PBSA 1P2SA 3OT4A 2BKXA 2Q0HA 5FTMA 4CYMA 2BL4A 2JLQA 3AF6A 3LRTA 4AWBA 5KJEA 5CXUA 1KEUA 4HO1X 1CR2A 1MVOA 5B55A 2XGSA 3U7IA 4XOIA 1PGNA 5EZ6B 4HNAA 3AH8A 4YPFA 3WYAA 5A4FS 3OZRA 3HWX1 2BMWA 3BWDD 2WTUA 1Y1PA 2D7CA 3TD9A 3BWCA 1ZY2A 4OQPA 2NU6B 5LBUA 1YZGA 1Y3HA 4Z0TA 3RBAA 1B0ZA 4TRMA 1SC9A 4OGWA 3VAYA 5L9AA 5LP6F 1R8QA 2ZSBA 1BDMA 3QYFA 4CQMA 3HP4A 1HL7A 4XFKA 3UJHA 4ZTUB 2WLSA 1GILA 3LLMA 3DXFA 5K3CA 5J4HA 1X77A 3RIXA 1N5IA 3WYCA 4B0OA 2O2SA 7YASA 1WHTA 1F2UB 1NE2A 1KRXA 5FJIA 1TTHA 5ALWA 1HR0B 1NW6A 1P8JA 4PE5B 1RXUA 3QFTA 1XX6A 4D3ZA 3JAMA 2OHHA 1I3KA 2PBLA 3LLUA 1DTWB 2R6HA 4WZAE 3D3NA 3TUIC 2WAYA 4F5ZA 3P9XA 1RVDA 1ZBQA 2V6JA 4UNPA 1S89A 1ZFNA 2AOUB 2C59A 2LZ0A 1ZOSA 3QIAA 1IY1A 3I3OA 4D4KA 3L1KA 4E1AA 1Z4LA 4GOND 4DQVA 1E77A 4NYMR 1M2OB 5KMGA 1PR4A 2MMGA 3DFUA 3I0ZA 4H77A 1JJVA 1VCNA 1XDDA 1WD5A 3DZ8A 2GN8A 1STOA 4HNVA 5JBIA 1D2EA 3AEXA 4LDQA 4AZWA 4PANA 2AMFA 2BHLA 4Q1BA 3V3KA 1E6LA 1JFVA 1L5GB 5HX7A 5A4KA 2VH2A 4HWTA 4KAXA 2ZJFA 4MI3A 1RLTA 3KS9A 1T8SA 3U7QA 1C3OA 5AW7A 2C2HA 5I3CA 1NG9A 1F48A 4H1VA 2C5SA 3BH6A 3RQIA 5BXYA 5JSZB 2NAFA 3X1YA 1OLUB 4Q47A 3P94A 2IUEA 4YRDA 2NUAA 5IABA 2COUA 4N0EA 4UEWA 1ELOA 4KODA 5JR3A 1SHJA 1W4ZA 1IK6A 3AMVA 1SXIA 2GF9A 3NH9A 4HAWA 4DJAA 3O84A 3MGAA 1H2XA 4O02B 3T15A 4H1WA 2EJVA 1VMKA 2X7JA 2DY1A 3FZNA 4FEGA 1DNPA 4P32A 5JZSA 4NWIA 3G9TA 2OCXA 2VHTA 1DOAA 3CO5A 2B92A 4HQFA 3EIFA 1M73E 2PLWA 4UBKA 2XMCA 4BKQA 4CKWB 2FR8A 3H5NA 3ZGLA 5DGHA 5IZCC 3ZE2B 5CVVA 5AJXA 4RBNA 2F3PA 3WV5A 1KMCA 1AB6A 2EATA 1O0CA 3GDGA 4QGBA 2QEQA 1C3VA 2VQDA 1N3YA 4MUXA 5LLTA 4G0NA 3WNDA 3WGGA 2QR2A 4GECA 1VG9B 2M9MA 1YL6A 1DCMA 1Y9DA 3I3SR 4L8WB 2NZJA 1EFRD 1NU8A 1OX5A 2E4YA 4HZUA 2M6RA 4KC0A 4XASA 4Y7DA 3RRYA 2PQ6A 5CDYA 2EHDA 4Z2AA 5LMCA 4JYAB 1P72A 2PE5A 2VO1A 1KYQA 2C5LA 4C0LA 2ZSUA 2MWMA 4CR6A 1Z16A 2EL7A 1OI7A 2EVWX 1ODCA 1R6DA 3N58A 4Y2HA 4D0GA 3EVAA 1Z37A 2QNRA 2QTVB 3GQBA 4Q7MB 2O8CA 4KO1S 5MF6A 3REFA 4A92A 1ULHA 1LJLA 3OPMA 2AEJA 2ZFUA 3I2YX 1Z2NX 4Z49A 2UXDB 4W8OA 5DM1A 3MG9A 5KX5B 2E5LB 2CEAA 2VK8A 4B3XA 2HM7A 1O54A 4QBKA 1SVWA 4GPEA 3M6FA 3VTFA 3N8GA 5CMLA 4R1QA 2RAFA 1TQ4A 2RHHA 4H7FA 1T0PA 4LISA 1USVA 2CSUA 1ZITA 2OD7A 4NMHA 2FUEA 5LQSA 2AUTA 4G0OA 4U39A 1YO6A 3WDSA 1D3AA 4E2XA 3Q15C 1G19A 3OX1A 4PAMA 5IAGA 4A9AA 3PHLA 2I4LA 1JA9A 1LI7A 3AR9A 1I2CA 2Q3FA 2IS1A 2REXB 4OHXA 2J9FA 1ST3A 1FXSA 5LXTB 5BQFA 3U5TA 3G2KA 2WSSD 4DJFC 4KFUA 1GTL1 2IELA 3QKSA 4INZA 1H8HD 3CX7A 3RVPA 1F9EA 3ON5A 3H0CA 2C1ZA 4HH4A 1X7XA 1R0CA 1X70A 4C4OA 4OGFA 5ALTA 4KBGA 2J0SA 1VLQA 4UTRA 1N32B 1JTVA 1Q0RA 3AL2A 3L8GA 4IGAA 3NOOA 2GZ1A 5GPBA 1Z68A 5DSXA 1D6NA 3KUXA 1NT4A 1QHEA 4QOHA 4XLTA 3M6IA 1FP1D 2FN9A 1J07A 2CF5A 3W7AA 4DTCA 1LW6E 2ZBFA 3MBKA 2XXAB 1J0XO 5LZ5A 2XMQA 3F5SA 3OESA 5YASA 4CF6A 4ZEWA 2ODWA 1ENZA 2ZEJA 1RR6A 3IT3A 3PNKA 1JE0A 5AXDA 4FHFA 3OIDA 2Y4OA 3F8TA 1BKSB 1N6HA 3I9LA 2XSZA 2DT8A 4UAJA 1P5RA 5EXSA 5BVHB 5CLQA 4QXAA 1ZRMA 1E3SA 5I7VA 4L4XA 1CU1A 1PHRA 1V16B 3K9WA 4NZPA 4UM9D 1P80A 3HR4A 4BB0A 4FGUA 4OFWA 4I5EA 1I4TD 3VU0A 1C5KA 1U65A 4LK3A 2GLXA 3K4PA 3SZMA 5JD4A 5L6MB 5FWYA 5JMTA 3ENNA 3MC1A 4E70A 4MAAA 1I4LD 2PU7A 2XWJI 5KX5F 5E7IA 1ZH6A 3GA7A 3IEPA 4R0NA 1CXZA 1NMXA 2YOGA 5BW8A 1OUMA 1LU9A 1HO3A 2J9XB 2WE7A 3OAAD 5LCXA 3OM8A 3BT7A 4PZUA 2UUPA 5AKIA 3SVTA 3PQ7A 4WNAA 2NU7A 4NKRA 4DR6B 2C9BA 2R85A 1BA2A 1CLUA 2C3UA 3QVVA 3JAWB 4JLVA 4K86A 2Y66A 4LRTB 2DE0X 1D1PA 2WZCA 4DLYA 1ZRSA 1NIJA 4WV3A 1KYIA 5TF4A 4G1CA 1WB4A 5JWOA 5FOVA 1QVRA 4L76A 3K92A 1QO0D 2BEUA 5HDQA 1X2BA 2O0JA 5LXTF 4KRGA 2JRLA 4TTSA 2XYQA 3EGCA 3C39A 4Z9XA 2VJLA 3S1SA 5CVCA 2QENA 4QG3A 1WUJS 2OP0A 2OQIA 4CFSA 2PD6A 2XD4A 1N0WA 4OFZA 3OFVA 3DOOA 4FYIA 4RMHA 1M6YA 1ANKA 2FN3A 1T6ZA 4AJ1A 3GEHA 1QRSA 3ZKWA 1MOPA 2NO9A 3A37A 5TS3A 1CZOA 2FCRA 1GPH1 1IL0A 4PC6A 3HJHA 3N8DA 3R3XA 4W7SA 3PF9A 2JA1A 4ZALA 5FOXA 2N47A 3H1EA 2QRNA 3Q2OA 3R2JA 1N6NA 3FI0A 2O8NA 4LYHA 4UZEA 4X44A 5ETJA 3VNSA 9ATCA 1PT8A 4PCUA 5F78A 5IT4A 3M6WA 2JI4A 1WPRA 1GV0A 1XALA 2M6KA 4C04A 2B9VA 1XZQA 1D1TA 3H2IA 2PD3A 4MVJE 4F86A 2RARA 1L5QA 2VF4X 4L0MA 5TS2A 3A8TA 4LECA 4Q6BA 3G0DA 5HF5A 3W5CA 1C1YA 3C1TA 4R0VA 4AMBA 4YP0A 4FI3F 1I3NA 4C3ZA 3IPXA 5DLPA 5EWMA 5FF9A 4C88A 3T3NA 1IB0A 3AYXB 2OFPA 2QX7A 2UZ4A 1RU3A 1NI3A 1FTSA 4IR7A 1T3ZA 2X4DA 4QTUB 1C1DA 1AKMA 4GVPA 2HZ7A 1VE6A 1KF0A 3EK2A 4IOLA 3WZMA 5K99A 4V0QA 2Q50A 4HGOA 4B17A 4CIXA 2WYOA 2WU3A 3QPUA 4A0FA 2VP4A 1A9QA 2C7RA 1ZA1A 5A02A 2V7PA 3IVRA 1EMDA 1TZBA 4H4DA 4C4RA 2CLKB 1GY8A 2WTMA 4C43A 2IYRA 2QRUA 3PL1A 3NVMB 4L51A 1DDGA 3HSKA 2PSDA 3QOFA 5I7AA 3BSYA 1AF4A 2F8LA 1VJRA 2ZBGA 4JHLA 4NFLA 4TYMA 4OXQA 4F7WA 5AVZA 4BY9E 1TM7E 5FWXA 2QL5A 2FSGA 3CT6A 3PUHA 4H15A 4LC1A 2ICAA 2JFPA 4ZAZA 1X19A 4N4AA 1NBMA 2J9RA 4JP1A 1CZKA 1KDOA 4ZGGA 4LXGA 1EDZA 3U19A 1NXWA 4EOGA 3NANA 4ZVPA 3I9NA 3PBKA 4R81A 4IIJA 2JIPA 3G5LA 4RDIA 3TLEA 2A9QA 1O87A 4CLRA 1HZZC 4K1LA 1EAYA 4JLAA 4F8EA 4Z3KA 3FDZA 2I22A 1NZFA 1Y9JA 2Z56A 2Y1OA 1P4GA 3M9XA 3OF3A 3PLRA 3GLGB 1PNRA 2PWYA 2QI9F 4J3FA 5FUVA 1QH1A 4GKJB 3M6LA 2NVBA 5JRJA 1RQRA 2KM1A 3GEIA 4G2TA 1CUVA 3ZJYA 2J5XA 4LNUB 1K0FA 1YB1A 1ILWA 2O3SA 1VYHA 2OPBA 3KSUA 4MV6A 4KQCA 4XQ9A 3PGVA 1KTIA 1WVMA 3I01A 1W46A 5ESRA 4L57A 4LA4A 3HA3A 3KZKA 3BULA 1FP6A 1WU8A 1MB9A 1Z4JA 2V7UA 1Q6ZA 2W2XA 3D8TA 3NP7A 3PKIA 4FE7A 1VOTA 4K5QA 3TLGA 5KZMB 3IAM6 5JNWA 4QU8A 1ZHOA 1FJ2A 2GEBA 3BGWA 2NU9A 4AF8A 4EYOA 2FZVA 5BSUA 5AD1A 2F1IA 1PJQA 4N0PA 3MCWA 1N5DA 3KPUA 2JI8A 2X0DA 3DTVB 4JK3A 1OFHA 1QHFA 4B45A 1NYTA 3ADCA 3QIVA 3WIOA 4BAZA 4L85A 3SIRA 1YDFA 1DAPA 1SURA 2RONA 1JFRA 5G3YA 1JQEA 4PN7A 3PXXA 4UVIA 2J31A 3B6EA 3CLKA 2VTEA 5JI3E 4N3GA 3U37A 4ZHQB 3JQ8A 2FX2A 3ZCTA 2BFDB 2QLLA 2IOFA 2Q99A 1WUTA 2R6JA 4LMAA 1DBRA 4DT1B 4CETA 3N07A 4CG2A 1W5BA 4DYDA 3HB9A 3FMVA 4QTYA 3WK7A 2AWOA 1SQ5A 2D2XA 4ZT7A 1ORRA 2A5FA 1S2DA 4G5FA 2NM0A 3RHSA 4BP8A 5KYWB 1GNPA 3U4QB 2D2FA 1M8FA 4PNPA 5A7GA 1NKVA 4BFCA 5D6NA 2ID4A 2RMKA 2ZE7A 3C3JA 3O31A 5DMXA 4EGJA 1SWVA 3JTEA 2YJ3A 3NIBA 5GTDA 4LKOA 1TZJA 3I9FA 2UZ3A 1OT3A 4P0TA 5JSUA 4PQGA 3DP9A 5CIWA 4MWEA 5E6UB 3VV2A 5BNFA 3GEGA 1N7GA 2ODPA 4A8JC 3DKKA 4RTRA 4JJ4A 3CQ9A 1I4DD 3OLZA 2NXCA 4QYXA 2E6KA 2Q3CA 4X95A 1DHTA 4AJ4A 3FCUB 5BNWA 4PO1A 1XTZA 4P0PB 4D56A 5COAA 2O2JA 4R2JA 1OC4A 2G9NA 2IEAA 1ORHA 2PRJA 3K6KA 1WY7A 1KNXA 3RRMA 4E03A 5HRUA 1XMQB 1ADGA 1FZQA 1H5UA 3PFFA 4RETA 1L7RA 3KDSE 1MJGA 4LSZA 2BN4A 4P54A 4TLLB 3PVSA 5K8JB 1L7EA 1U8CB 4QKQA 1DV1A 2YZNA 3DZDA 3EQZA 4N1AA 3ASUA 2XNCA 3OIGA 5AKLA 4JELA 1HE5A 1D2CA 2OZLB 4JLWA 3P4UA 1MBZA 3CMMA 1EWKA 1M9NA 2I4IA 3FOAA 4J1TA 4B80A 1Q92A 3MJFA 2EP7A 3ZK7A 4IHAA 4XJVA 3WNVA 4D9EA 1OBOA 3O82A 4IIUA 3UHPA 5IF3A 2COEA 4Q3OA 4QG7A 3V2UA 1CB7A 5F3DA 2A5YB 1I3OA 2G63A 2JBAA 4D4IA 1NM5A 3TECE 4GSLA 4FCVA 1L7PA 4M1EA 1WLSA 1QIHA 3HWSA 1FFXA 3L1VA 5CM2Z 4EJMA 4ZHQF 5C2JB 1TQDA 3LXRA 5AWFC 1GGFA 2A1UA 4BV8A 3JQFA 3DJYA 3NHZA 4JBWA 2I2AA 1JHUA 5AVVA 2YR0A 4NG4A 3AETB 3EPRA 4K6HA 1Q2XA 2G4VA 1M8PA 5ER6A 3ZDXB 3OSUA 3HCNA 1NQXA 4WECA 3CLHA 3TW0A 3QENA 4QYIB 3GJYA 2AX3A 5JDIC 3NVKI 4OXNA 4BYMA 1NQWA 2Y2VA 2B25A 2ZE8A 1L4MA 3C45A 3M82A 3TS1A 3ZY6A 2VWQA 4CHTA 1CUCA 1JBKA 3K8YA 4B2IA 1JR3A 2HXSA 3D54D 4EVQA 4COOA 2GESA 4AICA 3E7WA 4M7PA 4HKTA 4HQOA 4XQEA 5H81A 2VP2A 4ID3A 3UGTA 1N57A 1RIFA 1ZGHA 4J91A 5BT8A 1K6JA 1Z6YA 4JP3A 1TK3A 2OBBA 3P9KA 4D45A 5CURA 4OOEA 1EVIA 1ONSA 3RSFA 4DDUA 1GSOA 5JS8A 3M8KA 3WB0A 2C2OA 5DXFA 2ZLBA 1SXPA 4WXEA 4BVEA 1I3CA 4DLPA 2QAGB 2VHWA 2XWBF 2CXSA 1O97D 1OBHA 1QYXA 2DTDA 2F2TA 2OQRA 3A6GA 4MQBA 3E9MA 3KZ1E 1TT5A 3ETLA 3E03A 4LVOA 2YXEA 4QQNA 4ZGWA 3M1IA 4OL9A 3COWA 1KMIY 2OGUA 1QG0A 2GAOA 2XDYA 1T0HB 1W87A 2AG1A 2YXLA 3KJXA 1ZJJA 3DOIA 3GJ8A 4RESA 3HWRA 4Q1EA 3MYRA 1S6YA 3T7SA 4DSAA 4YHHB 4R84A 2HHHB 3FWHA 1XTKA 3QTLA 4X7RA 3RDPA 4G1BA 4EW6A 2HFJA 4ZU3A 5F5XA 1YB2A 1J2EA 2EF0A 1FRZA 3O8BA 2C9YA 3ED5A 4M9UA 3QVTA 2GZRA 1Z7WA 3FH0A 4FLMA 1SQSA 2VF8A 2YWRA 4QUHA 2EZ9A 4J9VA 4XFDA 4UUBA 3UMFA 3ZOZA 2J0UA 3V48A 5CA1F 5CB4A 2W2KA 1GUBA 1YC5A 2B0CA 2H18A 4IZ6A 1ZK4A 4OJTA 5AHWA 3TFQA 5GWXA 1SAYA 4CKCA 3VHLB 1U9CA 2ZOSA 4I8IA 4XQ0A 4B1FA 1IJEA 1BOFA 4N5HX 4BXOA 3J81k 1OKKD 4QFCA 2GJKA 4BLWA 3HJNA 5DI3B 1XG5A 4F6RB 1RPJA 4B6EA 3W5AA 3HJBA 1XJWA 2HMVA 3Q3CA 5FL3A 2VA9A 2OCPA 2UVDA 3F6YA 3HBAA 2Q6KA 2Q8QA 3Q2IA 4PXYA 2F3SA 4BQSA 1B41A 5BMOA 3X1MA 4FC7A 2GZHA 1VRVA 2AQ8A 2IIVA 2QW0X 4QNMA 1U9IA 3AO0B 5DISB 4A5SA 2N0SA 3VJKA 3WE7A 1E5QA 5BT9A 1C3JA 2JIQA 3FSGA 3QXCA 4JI5B 2HIAA 1RJDA 1E32A 3ZU6A 1HBJA 2JGJA 4EY6A 3VPHA 2HHLA 3I9V1 4BN5A 2V7XA 4EMBA 3MWLA 2IHJA 3LQRA 4CMIB 3WIDA 2I67A 3O47A 1WSWA 3C3CA 1WCIB 2R4TA 1EVYA 5INTA 1FXWF 1UT5A 4OBEA 1KR2A 6Q21A 4ETWA 2O7VA 4PZCA 2W6MA 1PT5A 2WD7A 2WVJA 2Z5LA 1BGVA 2IUYA 3KQPA 4KXNA 2DBRA 4X9XA 4BLVA 4DR5B 3NVAA 3CKYA 4YJFA 4WUTA 3TEMA 1TRHA 1Y48E 2VDOB 2I54A 3QVLA 4F3CA 1M2WA 2HJWA 2WF7A 4FQ5A 1UINA 1NBME 5B4TA 4PCLA 1AQ6A 1YNSA 2KLBA 3KZVA 4Q1FA 2ZVQX 4EG1A 5KYKA 3IIKA 3T5TA 2P9FA 1U7ZA 1E96A 3ESAA 2PJUA 2Y27A 4Z0HO 1I2MA 4JB8A 3RD5A 3ZU4A 4CW7A 3T9AA 2EX4A 1OZAA 1PEDA 2O5RA 4HWOA 1BX0A 3UJ6A 5K7SA 3HNRA 2NZYA 2VYQA 4FONA 1Z36A 3G2HA 5KAPA 2H7XA 5ALQA 4MPJA 1V1MA 3NYRA 1HRDA 3CKKA 5G40A 3V8PA 4I5IA 3FMFA 3GUUA 2XNSA 1T0BA 2VXBA 3JZDA 1G8GA 1LS6A 2B20A 3OTIA 4LVCA 1F2TB 3ZJ4A 5AM2A 4KREA 4JYMA 1T1SA 5JCOC 1J97A 4KQ1A 1T6XA 3H83A 3M4NA 4DAEA 1JPJA 5J4VA 3VR3A 1A2KC 1C8LA 1HE1C 2GNAA 3HB5X 4WDQA 1KJYA 1LK0A 3QG5A 3A6EA 1LEHA 5GY7A 4WY5A 5IAJA 1WCV1 1XDGA 2IYLD 2HR1A 4MW4A 3HB1A 3LLCA 3CEJA 1MC4A 5ICCA 3MLEA 4D9MA 2HI0A 3DYVA 3BD7A 3R7BA 1SB8A 4IJVA 4PAWA 4JT2A 3TQQA 3EVBA 1A8IA 3WJ1A 2YV4A 4K26A 1RT9A 4NDNE 1MAWA 1RABA 2YWXA 3LIIA 4UDXX 5AK0A 1O8BA 3AZPA 1CJKC 2NO6A 3K2EA 7GPBA 5FUMA 3IDAA 3W78A 3L05A 1Z7EA 4QHYA 3ZHSA 5ILQA 4J94A 3AF3A 2JGIA 3EG9B 4XYEA 5M5BA 4H35A 4QFBA 1MGOA 3TMKA 3V80A 1B23P 2IW1A 3MUEA 1KOGA 4JCCA 4QJIA 4O2BB 5HGXA 5EP2A 5IT9A 5I7FA 3RI3A 1M3SA 3V4LA 3NCTA 1EBUA 1KEEB 4TSRA 1U8FO 3FLAA 1EE9A 1KSJA 2ERCA 3GBPA 2E89A 2I87A 4DYVA 3NALA 4Q16A 2W42A 4WKNA 4WN9A 4EBFA 4ETMA 1EX6A 1NQUA 2XUFA 4DC0A 1G8AA 1LBHA 4MYRA 2WWGA 5KNCD 2H9IA 3WOVA 1EU1A 2G28A 2JFHA 3F9IA 4HXYA 2V0GA 4C1NA 4H7IA 1W7AA 1F7VA 2A1TR 3I2FA 4YI3A 5DWDA 3ZHOA 4NZYA 4RH0A 4EPYA 4JNCA 2WIDA 3WHPA 3VUEA 2G82A 3L79A 1SUSA 1IZ0A 3EVZA 5AUOB 1TE2A 3BWYA 2HQ1A 1S1MA 4K05A 3HMQA 4LZLA 5TF0A 1YF3A 3A9CA 4R5MA 2Q4EA 1PWEA 1LRKA 1FA9A 1UFVA 3HL4A 3LK6A 1WUHS 2A78A 4FYMA 4GRIA 4MQFA 3QE0A 1J20A 1JU3A 3NC1C 4L95C 2XB9A 5TB5A 2YS7A 3ZLUA 3GN2A 1RTTA 2HQRA 1E2EA 3VOBA 4MGYR 2EX0A 3KE9A 3KE8A 3TNLA 4KVAA 4O4LA 1GZ7A 2R84A 4WACA 3OG9A 2II6A 2YRFA 1HQYE 3SE0A 2QRKA 3I01M 4M8SA 2GN4A 4URFA 3DXZA 3DNFA 5C4IA 3WWYA 4AMUA 5AW4A 5EQTA 4GI3A 1YQUA 3GUVA 3PUIA 4DUPA 121PA 4LE1A 3GFFA 2H1LA 5A06A 2WWYA 1IPFA 1G59A 4H4EA 3C7DB 3FZYA 1FZTA 1D2MA 3IT2A 3FPCA 3ED1A 3NAGA 1CKEA 1NGSA 1N7JA 1PD0A 1W2GA 2E4VA 2L17A 4ZAYA 1LPAB 1SCUB 1UJ4A 4BNMA 4RCYA 3SQOA 4CQJA 4POOA 4HVTA 2V0NA 2ZE6A 4XKJA 2H7VA 1T6NA 5GVSA 1P45A 4HGRA 4GWKA 4ZI7B 3PDWA 1N34B 4O2BF 4EUEA 4RL4A 3HRKA 3IX7A 2WSIA 1O77A 3AEKA 4Q1DA 3IDSA 5PNTA 1SVUA 5K0ZA 4A2WA 2HBQA 1NYLA 2G3YA 1E1DA 5LQMA 3ZX5A 1UZAA 1XMPA 2O8EB 3C43A 5EHXA 4W7IA 2ZQYA 5KTNA 2IHZA 2C07A 3PQ6A 4J75A 1J33A 1O96B 1A4UA 1TC2A 1ZD9A 3ZI0A 4BO6A 4CM3A 5BYAA 3UV6A 1QOPB 2XVAA 4U0KA 4RIHA 5L53A 5IULC 1LF5A 3HDGA 3IUMA 3WIEA 5LKAA 1AMOA 1GNLA 3G7SA 3TW4A 2JPDA 2VA8A 4LIPD 4C7XA 5IWAB 4BN4A 2W2LD 3I2GA 4N7MA 1EM8A 3JTMA 2DGDA 4C0BA 4B6GA 5JT1A 2BONA 8MHTA 1A2OA 5HVNA 1C0KA 3LF1A 5DK6A 2C1EA 3RVLA 1K8XB 1UOQA 1T9GS 1U9ZA 4O4HA 4Q4AA 1P9RA 1RXSA 4KNVA 2GPJA 2QP4A 4U1RA 5AO9A 2HLDD 5GP1A 3ZNQA 5AOVA 4B33A 1ZC4A 3D0KA 4X3OA 4BNTA 1DO8A 4DKXA 3AVUA 4ZN6A 1R2QA 3DVSX 3QQ5A 2XNDD 2GB4A 4EY4A 3BG5A 3IBSA 2X2OA 4Y2TA 3L84A 1WBDA 3QWHA 2ZR0A 3Q9LA 1P2TA 3R3WA 4JASB 4FFMA 5DSZA 2V8OA 5LQRA 5MFPA 2PN1A 2WF9A 2ZIEA 3OTQA 5TJHA 3HR8A 3VR2A 8GPBA 1WB9A 1SM4A 3PEUA 4N3CA 1QQTA 2YXPX 4ZI7F 5JFGA 3KLPX 4GM1A 5DNUA 1YR6A 1ZICA 1LJUA 3FVVA 4QPJC 5P8WA 3LUPA 1B8UA 4C6TB 4RVGA 4H0FA 2H4WA 4DA7A 5EL0A 4KAAA 4EMSA 4RV9A 2Y9MB 1XELA 2ZXFA 5AR1A 3R5KA 3BAFA 4QDKA 2O5EA 2CMHA 1YJCA 3ESYA 3PI6A 5J5VA 2GHIA 3WV4A 6PFKA 1GL7A 3KLBA 2QZZA 3VM6A 1L7DA 3KPJA 4H3KB 3AJEA 1AA9A 4U7FA 5SZHB 3RPEA 4E31A 5EQJB 4G5YA 5LL6P 2FMUA 1B93A 1WBJB 2FLWA 2XKBA 4HB2A 4LBVA 2PD4A 4NMWA 4PEVA 4QJBA 4BP9A 5FBHA 1HE2A 2FSPA 2RHGB 1KJIA 4HYTA 4EUFA 5CX4A 5F2KA 1GGKA 1NVAA 4IDGA 3D4LA 1V5IA 2EJWA 4GU5A 1XL1A 2O3TA 2F64A 3BA1A 1PW7A 2QDKA 3ML1A 1ADYA 2QUJA 4QXPA 2FDRA 3FDXA 5A0TA 1F4VA 1Q74A 1Z4IA 1AV7A 2OG2A 3GGOA 1ZN8A 1CNMA 3DF9A 1XZHA 5KYYA 2O7RA 3EH1A 2AVDA 4CMJA 4TVKA 1XA3A 3EQ8A 1CJTC 1Z39A 4FD2A 4GX0A 5A2GA 3IE0A 5ES4B 2AN4A 5FEMA 1EXMA 4KFTA 5AJWA 3PWZA 4DABA 1Q1GA 2GM9A 1KOJA 2QX8A 3DC2A 2HJGA 1M1ZA 2W00A 3ANMA 4BMOB 4RF5A 1SCNE 5CB6A 1JIKA 1NV8A 2YHAA 1AKUA 1PK7A 3EVCA 3NOXA 1G7RA 4YAOA 5DTMA 5LQAA 3TVYA 2X8WA 2Q5CA 4NI5A 1U7DA 1GTVA 2GDJA 2A7XA 2KB0A 4G65A 2WTXA 1NJSA 5DF1A 1DAFA 4MWSA 4XLZA 1RM5A 1XP5A 2VRNA 5H82A 3RF7A 1KH1A 3ZZNA 4ZZ3A 2KYRA 3EDRA 5EGSA 1KI1A 1VDZA 4C03A 3MYYA 3NHMA 1L8AA 3ANYB 1NUUA 1J0CA 1NVGA 2ACVA 1OX6A 2X0RA 3UPTA 3W5HA 3QU5A 1E60A 3MS2A 2O1WA 5BW4A 3FWPA 3CJTA 2JEOA 2X15A 4KIWA 4TT3A 5GINE 2HRQA 1WVIA 2VSYA 1FNBA 3FTCA 4N39A 1RQNA 4TRRA 3OY2A 1Z6PA 3EB9A 1PZFA 5JQGB 2BRUA 2XQGA 3V1YA 5ADHA 2NSLA 4G1FA 1R18A 4JC5A 3G2PA 3BXEA 1WL8A 5D5HA 5EE1A 4B4VA 4QATA 1C7ZA 4QREA 3ILVA 2BE7A 4FNGA 1JIQA 3NBUA 5L3ZA 1CEYA 3CLSC 4IS2A 3EOAI 3QU9A 2DHDA 1ABEA 4R9NA 4K6FA 3C5EA 2UKDA 2OCAA 2WT8A 2XMSA 4O4JA 1M54A 3WK8A 1CUFA 2G04A 2XMBA 3D0RA 4HAUA 4QGSA 4R8SA 3FY4A 3GH3A 3MW8A 1D1SA 1BO6A 1RJ9B 2XDWA 2VZLA 3H2BA 4TN5A 1U28C 3EXEB 3LP6A 2G80A 3U1VA 1WOMA 1JBQA 2NPOA 4G41A 4LJ7A 5F1KA 3JQ9A 1IXRC 1LF0A 4LJ6A 1T2VA 3M1YA 4RWZA 4P3PA 1DTSA 3TG2A 1RQ2A 5BN5A 3M4JA 4US1R 2MINB 4XVQA 5JC8A 3TBFA 4TM8A 5B6JA 4ABTA 4ZVTA 1DRJA 3KSZO 2PSFA 2RHOA 2ZI7A 3WLPA 5J23A 2F55A 1GTJ1 4BGVA 1TPZA 2EZTA 3DWIA 3CY6A 4I50A 4JR1A 1YJQA 1VG0B 1NUSA 1LI4A 2BFPA 2HB6A 3F67A 1BE8A 3PJFA 4PHCA 5K3FB 4ZYUA 5KINB 4WKOA 1ZOIA 2PRSA 1QU2A 4XUDA 2P2ZA 3H5IA 1MENA 3B5EA 4GM0A 4FR5A 2LCIA 2NO4A 4HLDA 1YFKA 3KP1A 2CWDA 3OOHA 4RD6A 3MWKA 1TL7C 4W5NA 5LZ7A 5EZQA 1I6KA 2O3UA 4LJLA 4HAYA 3OOJA 4NYMQ 1C4OA 2YASA 4D46A 1Q6YA 1UKEA 1VA5A 4JENA 4LGMA 3KC2A 4WOJA 2Y0EA 1EP3B 1WEKA 2DFLA 3G0BA 3ZK8A 4AY4A 5JADA 1XNQB 1PQYA 1OAAA 1PFVA 1UBHS 1JXAA 3EUEA 2DP4E 4OJKA 5CNIA 4DIEA 4CIDA 1X8KA 3QPDA 4MTCA 4UUAA 1ZVQA 1APBA 5JQGF 2A88A 3GJZA 2JAWA 5L6LB 1G4HA 4P5DA 4JL8A 2H17A 3K05A 3NDRA 1Z0AA 3PR2B 4JU8A 4FUQA 4P86A 3IERA 4OYRA 4QRDA 4ACAA 3GJTA 3L7OA 5J2TA 2FP4A 5M34A 4RLSA 5J4KA 3JD0A 4TS3A 4OGGA 1MU0A 4D92A 2G9VA 4KBFA 4OLJA 1L4BA 2ZJ6A 4C4YA 3P27A 1BXZA 1EZ1A 2OD9A 3GJQA 1YFLA 3L02A 4BECA 3HRIA 3DBHA 4ZAVA 2XR1A 3BB1A 4CTNA 2IEIA 4J4BA 1MAVA 3K7EA 3CUVA 5ER9A 3T7TA 3TQOA 2C9DA 4L8FA 4IDFA 2ZYGA 821PA 1U3UA 1KDVA 4D41A 3HVKA 3QE9Y 3C1UA 2WW8A 3MTDA 3GMTA 2WYHA 1YCFA 3DHWC 2VYND 1SU7A 3O4HA 3SLRA 2X3YA 1Y34E 3D6HA 5I45A 1B0PA 4N76A 1YVUA 2FY8A 2PA3A 5H68A 1I5EA 1NR5A 3PHCA 4AY2A 2EBWA 4QICA 3NGMA 4ZQIA 4TV8B 3R9XB 2PFGA 1J0DA 1VZ3A 2QQFA 4Q34A 4TKUB 5F1OA 1DQSA 1W49A 4DLWA 3AG5A 2RH9B 3BEDA 3WAJA 2VHVA 3OWXA 3OE7A 4FPXA 5ICGA 4L8YA 3TUZC 2WM2A 3UKDA 1JGTA 2Q3LA 5A6SB 4CKEB 4B44A 1XQ6A 3RRBA 2VTDA 4LUCA 1GEEA 2C31A 4RPKA 5K8VA 5THKA 3THYB 1F17A 1N1MA 3D4NA 4XVUA 4A6PA 4DG9A 4J0KA 1SNYA 3F4LA 4KQMA 4RVSA 1ZBDA 2W8BA 3ND7A 4G01B 4B73A 3H04A 5D84A 1T9BA 5FLXA 3IJRA 1HF3A 4GQIA 1MO6A 3B5IA 1I3LA 1H42A 4EDHA 5CBPA 2IX3A 3DW3X 4TKVB 2VVTA 3AV0B 3G9UA 3O2JA 3U4IA 3IQIX 3QE2A 4J7CA 5TPWB 3PX7A 4KSYA 4K6KA 3UXHA 3S3TA 4JY7A 3OH8A 5FL7A 3SYTA 3TR5A 4KV7A 3TRDA 2Q5EA 2Y0BA 1HEUA 1Q0TA 3LHDA 3ETCA 3MTEA 4G09A 1QX4A 3L49A 7ADHA 1V41E 5ALHA 3W2FA 3MS7A 2WZBA 4EPXA 2I65A 2AMJA 1FFDA 4RD2A 2HGSA 1EJ0A 3HU3A 5MDHA 4M1KA 1QVAA 4NZNA 1Y37A 4Q1VA 5AI9A 3U3XA 5TJ9A 3IURA 1A5TA 3VSCA 2HDOA 1W48A 3IEKA 5I9BA 3T1TA 3DMDA 3ZJUA 5IH7A 1ZEMA 3CW9A 3DTNA 4RHEA 3UAVA 4BJ5A 1E8MA 4TV8F 3KYJB 3ZE0B 4DV1B 1JHAA 4GOXA 2OFWA 4TLDA 2KX7A 1F0YA 3QOYA 1QK3A 3BCSA 5FYDA 4UUOA 5H5JA 2C4KA 1N3IA 1TA0A 3WHIA 1FRFS 3V8QA 4FOOA 3EOZA 3B6KA 3NIFB 3HEMA 1UBTS 3OIYA 5FQNA 3L06A 3L6CA 4DLAA 3LO5A 3RWMB 1H8EA 3B1YA 4EARA 3A2NA 4KR2A 1TQHA 1WZ2A 2MSKA 4GOOD 4EGCB 2EIHA 3W5JA 4Q39A 5EIHA 3EYAA 4HN2A 3NORA 2VL7A 4MIKA 1QNLA 4DPKA 2H4FA 2F9FA 3IEXA 3EULA 2A9PA 2WD8A 5EZYA 2R1ZA 2CFOA 5DLYA 1QH8B 2R87A 2FR8C 3ULKA 3EEBA 3B2QA 1TIKA 3OBIA 4QGGA 1I10A 3AF0A 2JIRA 5A5GA 3PVZA 1SG0A 1XBTA 4FHCA 3D6UA 5E2BA 3TLXA 3L6EA 3T3DA 3CZRA 5D3QA 1G9SA 2C4WA 1R9GA 3M34A 1ZSVA 4MINA 1UBUS 4WN3A 5BRNA 1Y6ZA 2PMKA 3IB3A 4Q9DA 3PXDA 4HRVA 3OA0A 1F3LA 1VE1A 4JR0A 1ENOA 1W2WB 4OAOA 1GD1O 3KJGA 2GN6A 3AZOA 1EG7A 5LFAA 2VI5A 3U61B 2YVLA 3JYPA 1A8QA 3EZFA 4FJ0A 1XA4A 3OQOA 3VDNB 3BJMA 1Q84A 2ERXA 1CZHA 4QL3A 2IUTA 4GOMD 4O4IA 4D8WA 4DM7A 3AZQA 1RZUA 4M1QA 2WU8A 4CF3A 3I1FA 2QYSA 3UMBA 1SHTX 1RRVA 5HUHA 1U1IA 4HMOA 1ARZA 1TKBA 4RIFA 4AY3A 5JZ9A 1QFZA 2AFVA 2BKLA 3NWPA 2H4YA 3QF4B 4MS1B 5EUQB 1NWHA 3BXHA 2ZQ5A 4JT9A 3QYJA 3SLGA 3VZCA 3N0RA 1LPMA 2ZANA 3DE6X 3K1ZA 1FS6A 5AHOA 4J16C 5IAAA 1SOWA 1UOOA 1V0JA 4MKFA 4IJ5A 4U5QA 4LWQA 3O8QB 1KAOA 2OHOA 4ZGBA 2ORVA 5AI0A 3U4AA 4B43A 1ZGCA 2DHCA 4AQDA 2VNJA 4Q02A 1LBQA 1XDSA 5JXIA 5F52A 2AEMA 4A0HA 1CIJA 5ICFA 2BI4A 2BIFA 4X6UA 3BZUA 3KR9A 3OM0A 1DFGA 3KDAA 2DWUA 5KKAA 5CDSA 4KAJA 2PO5A 2PUJA 1M2KA 3A3PA 3DCNA 3OX3A 4HDAA 4YR7A 2CZQA 1Z73A 5LP6A 1ZD5A 1GN9A 4CG1A 2NSYA 3CEMA 4FM9A 4Q93A 2GARA 4UUQA 2IYUA 2HEGA 3DDHA 4S35A 4F4UA 3NTVA 5F7JA 2P3QA 1UT6A 4QFDA 1X1DA 4IBOA 3H4MA 1P5ZB 2WKRA 2AWNA 2JGNA 2NP6A 5CGQB 1HQCA 3LQ2A 4LEIA 3SF8B 2ABWA 1CDEA 2CLFB 4PRYA 1KPGA 2XKAA 4MRMA 4GNRA 3JAKB 3VR6A 3O4FA 1OV6A 1YRAA 4H3VA 1ZVKA 1WG8A 1TYAE 1MV5A 5C8YF 3D3JA 3NDBB 2X0EA 3VVMA 3IIIA 3K0BA 3P32A 1HG0A 1R66A 4M9SA 5ADVA 2XDQA 2EWVA 2WVGA 3LWDA 1V47A 4ZQBA 5I9NA 3PNBA 2G7MC 2RHBA 3EXFB 5JU6A 1O95D 2I2CA 4ES6A 1LUAA 2CLSA 3H9UA 4OSEA 3REQB 2IV3A 2UZAA 1ONPA 3GT0A 4IRMA 3QFCA 2VJNA 4R1SA 1TC1A 2PKXA 2V98A 4DCSA 3HO6A 3HZOA 1FXUA 3FAZA 1O0SA 5M04A 1HWYA 2FEXA 1C8KA 5KO2A 1Z6XA 3KKPA 4S2EA 2CKDA 4EQ6A 3EGXB 1ENPA 1MB4A 1GPDG 1R5NA 4FMCB 3WGIA 1R0LA 3RBVA 3SR3A 2V1XA 5CB8A 1DX4A 3V7WA 4XWWA 1SZDA 1H2FA 4YQFA 2ZJ5A 5EKUA 1LD3A 4RU1A 1Z6TA 1ORIA 1QXSA 5EKDA 5IT0A 1MW9X 1RHMA 2F4NA 3QLEA 3SMQA 2APJA 3NBQA 5DHRA 4DJJA 2O59A 2YMQA 1ZHFA 2IPNA 3GDFA 1HI9A 1NOKA 3A1CA 5I7WA 1BC5A 5FKJA 2VZ9A 1PR9A 2NU6A 2JZNA 3E7PA 4RVHA 4HX5A 1X6VA 2ZZKA 1RM4A 1IPHA 2GI4A 4GKAA 4UULA 5TQ2B 5A03A 1M1UA 2VAXA 3IP3A 4IQ0A 5JISA 2ZJBA