2HRDA

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with thymine and phosphate ion at 1.70a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
b'KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
molecule tags Transferase
source organism Salmonella typhimurium
publication title Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with thymine and phosphate ion at 1.70A resolution
rcsb
total genus 88
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hrdA00
5EPUA 1Z33A 1YBFA 3KUKA 1LX7A 4QEZA 4M3NA 4F3KA 1Y1TA 2AI1A 4TTAA 1PWYE 4P54A 4IP0A 4QAQA 3NM6B 2OC4A 1Z37A 1Z5OA 3O4VA 1V3QE 5IU6A 3OF3A 1JPVA 1ULAA 3UT6A 4TTIA 1XE3A 1ODLA 1T0UA 4D8XA 1Z5PA 2QTGA 4G8JA 1PBNA 1JP7A 5F7XA 4LKRA 1RXYA 3BGSA 4GLFA 4WKPA 3P0EA 3K8OE 4L5CA 3NBQA 1OUMA 1NC3A 4TXHA 4EB8A 5I3CA 3ENZA 3FOWA 1RCTE 3NM5A 1RXCA 4F3CA 4L6IA 4DA7A 5EUBA 1I80A 1PW7A 4F2PA 4D8YA 3OZCA 4D8VA 4OGLA 4G41A 4BMZA 3OOEA 4TS9A 3SCZA 3EMVA 1A9OA 2AI3A 1JDSA 4WKCA 2ISCA 1JE0A 4PR3A 1V41E 1NC1A 4DA8A 4JP5A 1C3XA 1OV6A 5F7ZA 4EARA 1PKEA 1A9RA 1T8YA 3KVYA 3IEXA 1Z39A 3UAZA 3DPSA 4U2KA 4WKBA 4OGKA 1Z38A 2RJ3A 3T94A 1TGYA 4MCIA 4OJTA 2QPLA 5IFKA 4QATA 3UAYA 4BMYA 1YQUA 1Z35A 4TXMA 5K1ZA 1VMKA 3MB8A 1V4NA 3PNPA 1WTAA 5B7GA 5CCDA 4ECEA 1A9SA 4WKNA 1U1GA 3LBAA 1T8RA 1TGVA 5CYGA 3PHBE 2B94A 5DK6A 5B7PA 1LVUA 1Y6RA 1JDUA 1K9SA 3C74A 4WKOA 5CCEA 4L5YA 4YO8A 3ODGA 1TD1A 5B7QA 1PR0A 2BSXA 1RR6A 4GKAA 1V45E 2HWUA 3LA8A 2OECA 1Q1GA 4QASA 1OVGA 1CG6A 2OXFA 1T8WA 4TTJA 1PR6A 3NM4A 5EFOA 2A0WA 4DARA 4K6OA 1B8NA 4X24A 2OC9A 4TXNA 2A0XA 5F77A 1Z36A 4MCHA 4FFSA 1PR1A 3FUCA 2QDKA 4TXLA 1PR5A 4TXJA 3MMSA 3QPBA 5C80A 3E9ZA 4OY3A 4DA6A 4F2WA 1PF7E 4LZWA 1YRYE 4M7WA 3GB9A 4KN5A 1M73E 3BJEA 1ECPA 4PNPA 3BSFA 2P4SA 3FWPA 1K3FA 5CYFA 1OTXA 3PNSA 2QSUA 4LDNA 2ON6A 1ZOSA 3K8QA 1JE1A 1PK9A 2QTTA 5CXSA 4M1EA 3DP9A 4DANA 4DABA 3P0FA 4OEHA 3O6VA 4L5AA 4YJKA 1ODIA 1Z5NA 1ULBA 4LNHA 1Z34A 3FNQA 4DAEA 2HN9A 3DJFA 1U1CA 3F8WA 1YR3A 3INYA 1Y1SA 5F7OA 3UAXA 1OTYA 4I2VA 2Q7OE 3UAWA 2HSWA 3BL6A 1CB0A 5FAKA 1FXUA 1A69A 4NSNA 1T8SA 1SD2A 4BMXA 1RXSA 2AI2A 1Y6QA 2H8GA 4R31A 4F1WA 1TCUA 5JPCA 3OZEA 3EEIA 1VFNA 4TYMA 2PGAA 4NY1A 1RSZA 1JDTA 1ZL2A 4R2XA 1RYZA 1NW4A 2HRDA 5ETJA 1TCVA 2A8YA 1A9QA 1YQQA 4YNBA 3KU4A 4DAOA 1ODKA 4MARA 1PK7A 1RFGE 3DF9A 1A9PA 1V2HE 2GUWA 3OCCA 3EUFA 1JYSA 1PR2A 3KVRA 3OOHA 4RJ2A 1RT9A 4E1VA 1U1FA 4JWTA 1B8OA 4JOSA 3U40A 1SJ9A 4G89A 1SQ6A 1JDZA 1Y1QA 1OU4A 1PR4A 4OF4A 4BN0A 4D9HA 1G2OA 4TS3A 1LV8A 4QFBA 5F78A 3GGSA 3PHCA 5B7NA 2IQ5A 3FB1A 3OZBA 3LGSA 3E9RA 3EUEA 4L0MA 1K27A 1SD1A 1VHJA 1ODJA 3E0QA 2I8AA 3DDOA 1RXUA 1N3IA 3OZDA 4D98A 1QE5A 2XRFA 3ONVA 1Y1RA 3TL6A 3D1VA 5KB3A 4NS1A 1A9TA 2AC7A 1VHWA 2A0YA 1U1DA 3OPVA 1U1EA 4UC0A 4R2WA 1V48A 3IOMA 4GLJA 1JDVA 4QARA 4H1TA 3KHSA 4GMHA 2I4TA 5F73A 3UAVA 4DA0A 4YMLA 3KVVA 5F7JA 4LNAA 5F76A 5CXQA 3FAZA
chains in the Genus database with same CATH superfamily
1TLFA 2IW1A 2Z2XA 3MT8A 4UM9B 3AR9A 2VBIA 3LFHA 2FR8A 2WHPA 3PGMA 4M3NA 4UAVA 3SQDA 4B3IA 5ALZA 4F3KA 4F9FA 1KEWA 2YUTA 4IZHA 1RBMA 2NZVG 2XCLA 3AKCA 3M2TA 1PKXA 4P54A 1JJ7A 3RFFA 5IPFA 5IM4F 1YI0A 3N2GB 1A9ZA 1LQUA 4C01A 1YF3A 1MR3F 3FTDA 3P4UA 1TAHA 4CL8A 4BVEA 5IH7A 3AY0A 3JQAB 3PCXA 2OK7A 1UQTA 1KDPA 2UZ1B 1EVJA 1YMVA 1JNYA 3AC0A 1A7UA 2SBTA 3UWMA 4CEHB 1ECFA 4NHOA 5JJ5A 1KHHA 1G21E 2BC9A 3NHBA 3B7WA 1VQ1A 4QGGA 3QU9A 3RBAA 1ZUWA 3L0PA 1XE3A 4K9KA 1R0YA 3NASA 3ABIA 4BO5A 3C6MA 1J23A 1XDZA 1ZOIA 2ZJOA 3GJSA 3ZGLA 1B1AA 4B73A 5BMVA 5A6VA 3EBLA 2HMAA 2PM8A 1QHFA 1N1DA 1FRVA 1P2SA 4LC9A 5TB5A 4BNZA 1JF8A 2PGIA 4OQEA 5GM1A 5IJAA 4WAUA 3T8YA 3S8YA 3CUUA 4J0EA 4JBNA 4I6GA 3VA7A 4X8MA 1GGMA 1GPKA 1QOQB 2X9NA 3OJLA 4HXYA 1F6WA 3RUIA 1FEZA 1Q77A 4Q4CA 1CFZA 5AXAA 2WJAA 3A10A 3E7FA 4YXFA 1CBUA 1H0HA 3TQCA 2GRAA 4GICA 4QFDA 4MI6A 4TWRA 2WWWA 3FUVA 1OHHD 3R7LA 5AVXA 4OA8A 5C52B 4Y0NA 5A71A 5LP6A 1F8XA 4HAVA 3TIXB 3RWMB 4IINA 4AICA 5KSYA 2VDUE 1GPDG 3GJ6A 4MNTA 2QUBA 1L4LA 2ODPA 2RONA 2ZI4A 3RFXA 1BS2A 4EI2A 4Q7QA 2DVMA 5L40A 2GN8A 4MDYA 1ZD8A 4TYPA 1ZHFA 1ISRA 4IXNA 2B78A 3ZXIA 3HHPA 3MGGA 1N25A 1KI9A 4J7UA 3ETCA 4MKFA 5HDQA 5IZ4A 3QKWA 1ZJ4A 1XNQB 2GPAA 1TMKA 1VCMA 2GYVA 2WUWE 3OSZA 5JDCC 1XQXA 4KFUA 1GNSA 4OXKA 4WXPA 4DGQA 1F0PA 4EFDA 4G41A 1MCZA 5KQRA 2RB4A 1IMOA 3ADPA 3P2IA 2VS1A 4NJMB 3TPZA 5IVPA 1Q1EA 1RNLA 2F3QA 3C1TA 1QK5A 4A2WA 4B3SB 1G7RA 1AS2A 3BTUA 3P97A 3TRIA 3KQUA 4G5YA 3WWDA 4ETWA 1V8OA 1X7YB 2CEAA 4MWBA 1CF9A 5CBKA 1Y34E 5B3LA 3U09A 4RY8A 2N42A 3GUUA 4DT1B 2RIRA 2R8RA 2C7GA 4FZRA 1YJCA 1EHYA 4MO9A 4XSVA 3REGA 4ZI3A 1W93A 1XBTA 5CLIA 4ZVQA 4FHCA 1SQGA 4BCDA 5NULA 1IY9A 3IHTA 3EXEA 5KU7A 2Q5FA 2PKRA 4DM3A 4DZTA 3ZWKA 1Q6ZA 5IZCA 4ROTA 2QRQA 4QBKA 5JTTA 1OV6A 2N1BA 3AKYA 3BQ9A 2DKNA 4YRRA 2OQVA 4MEJA 2HK9A 4EW1A 1C29B 1IZ8A 2EKQA 2YL2A 4UBLA 4CEHA 4QDXA 4PU0A 4YS6A 4UEKA 4FB4A 1BS9A 3P20A 1NVMB 1E7QA 2VYQA 1C8KA 3PWKA 4HWSA 4QICA 3F7NA 4U2KA 3SIRA 3AF6A 1YZHA 1Z38A 2E49A 3GLRA 4ID9A 4MI9A 1N33B 4DSOA 2R6HA 5GVRA 2QL7A 2ZRFA 3L4EA 1AK2A 2E4UA 2ADFA 4AW9A 3UGQA 3AUUA 2QPLA 5I7RA 1LI7A 2BKLA 3NTLA 5IFKA 1OBOA 2Q8NA 1P0IA 3U9LA 5GMOA 2NSYA 4KLCA 4WGFA 2FMHA 1EUCB 5DTMA 3D8HA 4RHUA 1JKJB 4O4HB 1NP7A 1O5OA 3BQMB 3WZ2A 4YAEA 4F06A 5DW0A 2VUHB 3U7EB 2V3WA 3LP5A 1TD9A 4ND8B 1ZBQA 1DQNA 2JLAA 4MR9A 4F3RA 2H9AA 2RE8A 1SKMA 2OZLB 1KFCB 1MTZA 3OQBA 4JT4A 1NLZA 4YRIA 4QUEA 3GRFA 2C31A 2V0CA 1EX9A 4PRYA 5LYJB 5LZ7A 3WKDA 2HWKA 3KHTA 3ADBA 5HF8A 1OKKD 3CSDA 3Q2IA 4V24A 2PWPA 5B57C 3B1KA 3BIFA 2BEWB 3LVQE 1R0WA 3TINA 1TKBA 2QP4A 4B3CA 2YVLA 5I9MA 3KAJA 3WYAA 5KKCA 4MQEB 4FWBA 4KQWA 1VMEA 4Q03A 3VDNB 3O3NB 4CMCA 1U2PA 4XLTA 4Y9RA 5CDFA 1G17A 3OM8A 4MJ3A 1MABA 4PS1A 1NYQA 2WZDA 4RCVA 1LK5A 1W88A 3BRQA 1F8YA 5EXPA 3BHJA 1US8A 5DMHA 1TUBB 4FGJA 5H0IA 2ASEA 2RKWA 2UYQA 2ZI7A 4NHEA 4NYMQ 4Y98A 5E6UA 1Y4ZA 1R0XA 2M6LA 3FNBA 5G4KA 3U7IA 4BVBA 2A78A 4C20A 2AOXA 3K73O 3UF0A 4ZMSA 3B1FA 3OIUA 4QASA 4WDQA 2YXEA 1C7EA 4URZR 1P4SA 5DO9A 5HK8A 4DCVA 3G9XA 1NMXA 4RY0A 3DWIA 5LLTA 4ZGGA 1B6GA 4DB2A 1PHPA 4FTWA 3CUTA 5ISMA 2BSQA 4KQCA 5EKUA 1GSOA 3NVDA 1N6PA 1OC4A 1YJAA 1BKDR 2EFGA 4XD7A 3SAJA 1T2CA 3PRJA 2OPBA 4IKPA 4C7VA 2VDRB 5LQRA 4TKUA 1WVIA 2TS1A 3ANSA 4Q1VA 2HF8A 1I7NA 2D2VA 3LECA 3MWEA 3G7UA 4QRIA 4TXNA 1JEQA 1A8QA 2I34A 5EESA 3RADC 2ZUEA 4PC3A 1KHTA 5LKRA 2Q2NA 4CMEC 4UHHA 1QE3A 2AN4A 1TZ2A 2IUSA 4QXPA 4RK0A 3K1TA 5BQ3A 3TLCA 3AEZA 4XUCA 4YJ3F 4GX1A 5A3SA 3UKJA 2GZHA 1XRQA 2XUOA 1XFAA 3PUXA 1JT9A 3RYFA 2JLWA 3LC2O 1M34B 4K6HA 2J0EA 3GNLA 3M6AA 4DE5A 2WD8A 4BGVA 2GVDC 5C81A 3C3WA 4UULA 3A58B 1IBLB 2R7NA 5IBQA 1EZ4A 2XUQA 1DIBA 1KMNA 5THXA 3ZH9B 5HKAA 1YVRA 1YR2A 4H0FA 4NNOA 3RRNA 4DMCA 4R0MA 2O8DA 4NF2A 4ENVA 1B7GO 3JQQA 3N2LA 3NZEA 3WL5A 5I7HA 4GI5A 3RWOA 4M7WA 1L7MA 1P1RA 2WWHA 3WLTA 2Z5VA 4J03A 5BPFA 3HBAA 4J6EA 4LV8B 5KTRA 1VB3A 3E9CA 2IHYA 1SQSA 3H5NA 3IR5A 4US2R 3F2IA 1LBHA 2YHIA 1LZLA 4XTRA 1MT0A 5BN4B 3SNKA 1JSLA 1K3FA 2J3QA 1W34A 2H5IA 2FG6C 3G1WA 1KJNA 4MINA 4LDNA 2ZJ4A 1U7PA 4EM6A 3F46A 2AN9A 4ZU6X 3WWCA 2HUNA 4FU0A 4JHLA 1XRJA 2HNBA 4O0LA 1TO2E 4NCAA 2O2SA 4NVRA 1TB4A 2L42A 4A03A 2AIRA 2I62A 2Q2QA 3GPBA 3U7JA 2DJ5A 2ZI6A 2R8YA 4BEWA 3EXFA 4X6YA 4MDHA 2R2AA 3WJ2A 5JXJA 1QV6A 1W4CA 1I9CA 3C8HA 4GXNA 2C58A 4L5AA 3V2UA 1JU3A 2BEVB 1G9SA 3DL0A 4XQCA 2H4YA 4ZYLA 2VO1A 3V1NA 3GBPA 4FFWA 4AJ9A 3LPDA 4P80A 1LDMA 3ER9A 2GGSA 4X90A 4LV5B 1NXSA 3CX3A 3PPYA 4MUEA 4RMNA 4TVOA 2W5UA 3DQPA 4OHPA 3VPSA 4W6ZA 1CZNA 2H2HA 3NOOA 4FFMA 1BX3A 5H4HA 3VR6A 1G59A 1JBQA 3TD2A 5F5NA 3CT6A 1NN1A 4JT9A 1R12A 2JBWA 2Q7OE 4F4IA 2GWHA 2HBRA 5LZ8A 5IT5A 3GLGA 3FYCA 3AFGA 3LYAA 4TZTA 3JQ7B 4UTZA 3P9RA 9ATCA 2VDLB 1HPLA 1VG0B 3OTQA 3RU3A 2FRDC 3DW3X 5A5GA 1W35A 3KC2A 1IN5A 3GFOA 2FEXA 3DUFB 3VVCA 3GDGA 3DR5A 2QTWB 4TLBA 3PNMA 4L2IA 4TVSA 5I9NA 4XW2A 1SD2A 4ZDWA 3TLYA 2BM1A 1PNTA 4MV4A 1Y5RA 1ODFA 1IXKA 1NE2A 5K05A 2G9ZA 2JHPA 2ZJ8A 3PFWO 3R4VA 4MCAA 4X92A 4JT8A 1KYIA 3MUNA 5AKYA 1N2HA 4LBYA 4DXHA 3DOOA 3EFEA 3KXPA 1PW5A 2MINA 2ZS9A 5CLHA 4BWFB 1CVIA 4NOJA 4URWR 5C18A 3KOWA 5K8UA 3GPCA 4KVZA 3VC2A 4ER5A 1IN8A 5KTPA 4JQZA 5IVHA 4URYR 2CHQA 4CHTA 2ZW9A 1BGXT 5IYZB 4EJSB 4M4SA 1KZYC 5DI3A 3BAFA 5GONB 3FPHA 2GR9A 3ZWNA 1TM3E 1KWGA 3AF5A 3UAOA 1ESEA 2AC4A 3ACBA 1KDZA 4E88A 2DKFA 4EY3A 3IR7A 2FFAA 2BKAA 3PQ5A 3VYVA 1C3EA 1G4HA 4CKWA 1ZAYA 3CWZA 3EMBA 1XV5A 4MVJP 2LBPA 2WNHA 4MYRA 4F3YA 5FPHA 1AKEA 5B58T 3KTFA 4HAXA 1AMNA 1Y37A 1EWYA 1HOXA 1WKBA 2J9FA 3K1YA 1SHJA 3O95A 4YNBA 5C1IA 2NTNA 1YFLA 2VHWA 3KU4A 2OHFA 2F1KA 3UMYA 4EFMA 2I8CA 1PK7A 4H18A 3CM0A 1VPTA 3SU8A 3D8TA 4JKIA 3SICE 2IV7A 1ZKDA 2ZE8A 2H4WA 1XT6A 2C83A 2F4VB 1USGA 3ECCA 4W9RA 2NUTA 4G1MB 2YH2A 4E14A 2HMTA 3M4NA 3WY9A 4EG3A 2H9YA 2D54A 5JZSA 1HYBA 4RJ2A 2X0NA 1L3BA 1JQ3A 5JO9A 3IMGA 1J21A 4RH1A 1C30A 2NADA 2O05A 1T6XA 3ENKA 1JU4A 3O8BA 4KCGA 4BUZA 4JUBA 4JWTA 3D6MA 3PPXA 4YVFA 5BN3A 3AJAA 1NGSA 4ZRNA 1R0SA 5JR3A 4BMSA 2GXUA 2RHTA 4CKXA 3IE1A 2W37A 4OHRA 3AV3A 1PDVA 2FUEA 3DBLB 4JYCA 3NUQA 4C78A 3V9AA 5DYNA 1PUJA 5SYNA 5JJLA 3SM3A 1CFJA 5IJXA 1CJCA 2UZ0A 5JADA 3WRYA 1QH8A 4C9BA 1V71A 3DDHA 3ROXA 4QUIA 3QX8A 4RTJA 1J09A 2ETXA 1RKBA 4MB0A 2C7OA 2QE7A 5F52A 4IUDS 3W9SA 4D46A 2Y1WA 4G0XA 1ORHA 1RHQA 4P7FA 3N2GA 2BH9A 3AJ9A 4I4TB 4JLPA 4U6QA 5F78A 2N47A 1KK1A 1G5FA 2XVMA 4NBKA 4N7JA 5KWIA 4LXQA 2NGRA 4OJNA 3ZW8A 3HN7A 2MR5A 3F2VA 5FP0A 3RABA 2JFGA 1AN0A 13PKA 4OM7A 3RSLA 2IEZA 3ZHBA 2ORVA 2VSOA 4W8HA 2TMKA 3EGIA 2V98A 4BP9A 2JA2A 4AXBA 5DGXA 4EATA 4BEBA 3N74A 1WV0A 2ACWA 4MRMB 1SC3A 3WMWA 2FZ4A 1G21A 1E2UA 5DNWA 4KLNA 5TS3A 4JGGA 4H59A 2WOJA 4OHOA 3W5SA 4MUYA 2BSAA 1KOJA 2W2LA 2QRMA 3O7WA 3UNXA 3KVOA 4DLKA 3AVTA 2VXBA 4ZVSA 2OCLA 3JVVA 3MGBA 4BV8A 4NTZA 1JEYB 4UUBA 2AWNA 2Q99A 1DBWA 4BBPA 1Z7GA 4Y0AA 3TL6A 4N3CA 1GPAA 1YZYA 2VDKB 3ICPA 4R8SA 3TE6A 4F1KA 5ICCA 1JS1X 1VA5A 3GLUA 5KB3A 1C7ZA 1T1SA 3HKEA 3MRTA 2BELA 3QWAA 4XM1A 2JI9A 3G88A 4A10A 4ZI7B 5CFMA 4FMPA 3TG8A 4IFIA 2Z6QA 1WLSA 3ED1A 2Y68A 2NNLD 1XQ9A 2BFDB 3I12A 5FJIA 2HPHA 4M37A 1W0CA 3W1EA 2HNAA 1L5QA 2JHCA 1M1ZA 4GE0A 4BFYA 10MHA 2PUEA 1M2OB 1AO0A 4LI3X 4QARA 1R6VA 4LSGA 3EPLA 1KAMA 5IZCC 3CUYA 3CLSC 2R25B 4GMHA 3TW8A 4DLBA 3FM9A 3HDQA 3L8HA 2HHCA 1IDOA 3NHPA 1H4SA 2IUFA 2EP5A 2X7JA 3HBJA 4KQMA 1SC4A 3ZZMA 3HWWA 2QLTA 1EX1A 4S2EA 1GAXA 5LLDA 1Z0SA 1W9MA 3A06A 5KOIA 4EF4A 4OYRA 3TZLA 3IP8A 4L28A 1SOWA 5C1OA 3AUFA 3ZBPA 3IP9A 5MGBA 5JHGB 3KQYA 4LF5B 4IDBA 3NR2A 1KJ9A 1G0OA 2HD4A 3O1LA 1ICIA 2DC1A 4GHWA 4Y2YA 2UZIR 2ZSUA 3JCZA 1O9HA 1KFBB 1M8FA 4CF6A 3IAS6 4TRMA 1GTG1 1NLFA 1FFXA 2V7GA 3Q3CA 3UT0A 1LX7A 3LM8A 1QPZA 1PS0A 5DN6D 1XZLA 2XZLA 2O2XA 4RD3A 3AFHA 3JRXA 4N76A 2X5JO 2A2ZA 2XT6A 4BEJA 4JBIA 1EA5A 5IABA 3LWZA 2IYAA 4G1UC 1SOUA 5IAJA 1XD2B 1O58A 3VDRA 4P4SA 3BHIA 1NJ6A 3THXB 3QVGA 4XRRA 4YWHA 1T15A 1H1LA 1RS0A 2ONKA 1PEYA 2BGRA 1RHKA 3V1LA 1FFHA 4G4SO 3KJQA 3CZAA 4I1IA 2G5CA 4HYQA 4PQFA 3NV9A 2XZPA 1KEUA 1NDUA 1UXJA 4JR2A 1HORA 3BJRA 3EUWA 3I0NA 3LPLA 3AHDA 2FK7A 4RNDB 4PXYA 4ZO6A 5C0OE 5A03A 1EX7A 1C7JA 3KNZA 5FOUA 3R6TA 4D42A 4Y9DA 3CPEA 5JD6A 2AB0A 1L7DA 4BGIA 4P83A 3QPCA 4AFNA 2O57A 1PBNA 3TWOA 1JXOA 4ZGBA 3ZLJA 3K09C 2C4VA 1H2HA 1JILA 1VYUA 2G63A 3EG9B 1ZJJA 3KEGA 4AG6A 1E5XA 4DCUA 5DWDA 5HIMA 1JFFA 4MPTA 4X65B 3FY4A 5AVZA 2BGGA 3NMUF 1USVA 2IZZA 5CB6A 3G23A 3NHMA 3CVJA 3L6OO 4L08A 4M1TA 2GBLA 4KBGA 1Y7LA 3B53X 1JQ5A 3LT1A 2JF0A 3AEKB 3D7NA 3DXFA 1P33A 4TXHA 5IKPA 1TYZA 1NQWA 4YP0A 5LZ5A 3BTSA 4YMWA 1MXFA 3U2QA 4OHWA 3VU1A 1X8JA 1YS2X 3AV0B 1PIWA 3Q6MA 2GKOA 3GD5A 3MBKA 2ZIEA 2XA2A 3JQ9A 1EXNA 2OHJA 2C95A 1P31A 3PDWA 3EW9A 3A3OA 3THOA 2J45A 1BXRB 3GAMA 4ZD6A 1KS9A 3TQFA 1KI1A 1USUA 3F97A 4G5QA 1YB6A 3DPUA 2OG2A 1OLOA 3ZWCA 1FXWA 3L7BA 3OE1A 5EQJB 3TM5A 3I04M 3OZCA 5AM5A 1I2AA 1WXDA 4MKXA 3VI3B 1F12A 3VX3A 1R3DA 2RHGB 3DTYA 2A0UA 3MD9A 1GNTA 1I3KA 1SR8A 4B45A 1YBAA 1A98A 5TRTA 3JQBC 2VTDA 4EY7A 1YQEA 4W8OA 5HIIA 3PUKA 3G2PA 4JJ4A 3SYTA 3VUFA 1DKNA 2NV2B 1QQ7A 4K03A 3CNOA 5DP2A 3EMVA 3GLIA 3IURA 5EZYA 4PFSA 1NF9A 5GPBA 3V00A 5MHTA 4Q19A 4A8PA 3IUQA 3A2NA 3A1CA 3IDQA 3KOYA 1MP0A 2CK3A 5FHRA 4WZAA 3P9PA 4D5GA 2CXSA 2EFCB 3WB9A 1A9XA 2YR0A 4KXLA 5BSHA 1K0FA 1LEHA 1RLUA 4QGBA 5KX5A 3Q87B 1NI4B 3VC3A 2BMAA 2ZBDA 3BTOA 4CCSA 3QE3A 5KJFA 3G0IA 1VSUA 5HZGA 5CITA 5SZJA 2PWZA 5BUZA 4AQ7A 1F1JA 2CZCA 3G9UA 2J33A 3C3EA 2AA3A 2E1RA 2VYND 3PIDA 2EKLA 4S3MA 1QANA 2OBFA 2AJDA 4RF2A 1Y8ZA 4NENA 1P1KA 2PS0A 1V5WA 4MW9A 7REQB 3EEQA 3G9ZA 1D2RA 2IXGA 1BJRE 1RPJA 1ZZGA 4X20A 2DT5A 4C7MA 1P1JA 5CPFA 4EY4A 3MLEA 4AKTA 3FVWA 3G0CA 1K2VN 3FF1A 2WWFA 4E7PA 5CDYA 1B23P 3VR3D 2F90A 1AGYA 2IL1A 4NCXA 1F0NA 1QX3A 5B3JA 1PE0A 3CH7A 3OE7A 2J9GA 3L1KA 1KJ8A 1KO4A 4BP8A 3ZVKA 2ERYA 1RM3A 3PRHA 3E82A 4QXMA 4YJ2F 1EAYA 2QNRA 5B5SA 3FW1A 4DNXA 1QLJA 2X5XA 2VZ8A 4FD2A 4C7OA 3IQDB 4ESEA 4URXR 4AJLA 5B7GA 3OSUA 2P9CA 3IHLA 4PFJA 1A9SA 4EHDA 2IOFK 2JGDB 4OOFA 2WE8A 2WSIA 4Z5XA 5CYGA 5FTNA 4S05A 2D3WA 5C34B 3CRZA 2HA7A 1GPNA 2R6FA 1M6NA 1ZJ5A 3TJZA 1TQ6A 1DJMA 3B48A 3WO0A 2ZSFA 4Z7OB 1GAQA 4BQSA 1AQJA 5EJ8A 3WIBA 3AEUB 3C74A 3GCWA 4B6JA 3R0QA 4JL6A 4ND4A 5J58A 1NMSA 4RIHA 4YHBA 1WBDA 1JALA 3FPLA 2G83A 2CD7A 1Q14A 2OZPA 4YO8A 3ND6A 4JC4A 3SQNA 5DX0A 4FLFA 3WZMA 1DAHA 1OFHA 2JFFA 2FY8A 5DYGA 1J5PA 4KMMA 4RAQA 3KKMA 1LF0A 3B6ZA 4R8VA 3D8RA 5BQXA 1Z0AA 1G0NA 1K06A 1P17A 4NZOA 3UPUA 1U63A 2G4LA 1N32B 1F8FA 1ODSA 3IBYA 4HFJA 1GA1A 1ZI6A 2A9PA 5F5LA 3RKRA 5AW5A 2EGUA 7ABPA 4JY7A 2IVZA 2WSSA 3HB1A 2GWRA 4R1MA 4C0LA 1KTIA 3CLRC 3ZI4A 1R00A 1Q57A 1H2ZA 2FOLA 2YYZA 4PHTA 3GVPA 3QVXA 4BO8A 4DLUA 3H5VA 2QQFA 1PJLA 4RXUA 2PH7A 1JHYA 1QS0B 3G8DA 4TTJA 5DN9A 5TT1A 3ZDEA 4KRYA 2OV6A 3I04A 3TSCA 4BNTA 2OCGA 1XDSA 5EP1A 5JVDB 5C46F 5JFGA 4L8YA 3MLAA 1GTVA 4K6OA 4UUMA 1J70A 5J5CA 4X24A 5BVHB 4MUKA 1YJXA 2NVBA 4D9GA 3PJDA 1JHPA 2P1DA 2B4KA 3IMFA 1PR1A 4JIGA 3GLHA 4G1CA 1C1DA 1XEXB 4ODIA 2AXEA 3DHYA 4E31A 1E66A 4GAEA 5E7QA 2J9YB 1P4AA 4BZZA 2GAOA 1WBBA 1RTTA 1MHPA 2YY6A 2V7EA 1FK8A 5CYOA 1J2RA 1MVNA 4JBGA 1T6BY 5FUBA 3LWDA 5BPHA 4PC2A 4H2DA 3NYRA 1QV9A 4LYEA 1VL1A 3DOHA 3FG9A 4GLLA 4HVTA 2AFVA 4IH9A 1JWAB 3VPDA 3Q7PA 2QD1A 2P9ZA 2D74A 3BOSA 1MQAA 2QZSA 3GB9A 2FKAA 3C6KA 3QFCA 4BVKA 5JBQA 1P3Y1 5TJ9A 2CVQA 3F9RA 4BS9A 3AJRA 1XMSA 3UA4A 2BFEA 2F1JA 4ZOQI 2VWHA 3C6XA 4QDKA 2FCAA 1O95C 2P0YA 5JCOC 3BJEA 2AWOA 2Z57A 2JIQA 4HAIA 1KDOA 4FHFA 4XR4A 4PLGA 5ALPA 3A9UA 5FPKA 3ZZUA 2V1UA 3PYLA 5FV7A 2AMLA 2I29A 1S4QA 1YUNA 2G82A 2DUJA 4F9GA 4PSVA 5LKAA 2I7TA 4JKYA 4AWXA 1Q16A 2QRJA 4B87A 3DC7A 4JGBA 2ADOA 2G07A 1JE1A 2XGJA 3S40A 1XVAA 2Q4RA 1DRVA 2YWRA 2IFTA 3BWEA 1X2BA 3K0HA 4EGCB 1QIDA 1H1DA 1HT2E 3FTQA 2KW5A 4AMUA 2ZWVA 1ORVA 3C41J 3NTUA 3KUUA 3QF7A 3QY0A 2FSGA 3W78A 4DIFA 4EPXA 3SBOA 3SLKA 2LD4A 2HJ9A 3MMNA 4J43A 5AK5A 1Z6PA 2NYVA 3AFNA 3DE6X 4ANFA 1OTHA 1I3CA 2C8VA 2VXCA 3DYIA 3E05A 2JW5A 4YJKA 6NULA 1N1MA 3TO5A 4B7ZA 4N12A 4NNPA 3UH0A 4KLAA 3LQFA 2VK4A 1HTWA 3GQBA 2Y8EA 3FR8A 4JUCA 4JODA 3F8WA 1V25A 1ZD2P 1NI5A 1IQRA 3CZMA 1U0JA 3SKVA 3QJYA 1ISMA 3DKKA 3AVWA 1SEPA 3HVHA 4FONA 4TTRA 4MUAA 5K51A 1EU1A 3TK1A 3KLPX 4RVGA 2UUCB 3OQNA 2ZRKA 1V6CA 3SQOA 4F45A 1SXJA 1FXUA 3A9SA 4UU1A 1T8SA 4D9MA 4ZZ3A 3QF4B 4NICA 1GL7A 1MJHA 3Q72A 5A0VA 2BEUA 2HU7A 3HB7A 2Z5FA 4RNCA 3LIIA 1WW3A 4KQ2A 2PFGA 2PUVA 2K2WA 3TQIA 2XQVA 1PZNA 2G76A 5FFMA 4POOA 3N3BC 1Y48E 4P6VF 4N0QA 1VGVA 1QP7A 1RBYA 4R7TA 3BN3A 2VQFB 1ISFA 3HRIA 5U9CA 4KWEA 3B82A 4BMCA 4EI8A 4ZQEA 3BKWA 1N4AA 1J9EA 3PLNA 3CMMA 4LY6A 2XXBA 2JB9A 3RIHA 2SKDA 3PGA1 5KAMA 1I2CA 3ZE2B 1AT1A 5HUHA 4R2XA 1T2FA 3GR6A 4F38A 1R9MA 1CUAA 4Y9UA 4H6PA 3FAKA 3L82B 4Z1MD 4LYYA 2OE2A 1M75A 2OFWA 2HRDA 1DE0A 1Y4SA 2GZSA 5ETJA 5ELXA 4N48A 1A9QA 1QPGA 3Q8MA 1G98A 3COJA 2VUSA 5G02A 1DG3A 4L8LA 5IYZF 4I5DA 4Q7MB 1I3LA 4N5DA 4V2UA 1BWPA 4QO7A 2EZ9A 1W87A 4L5IA 1RFGE 4BWYA 3K9HA 1LRKA 3TFOA 1M6EX 4UNIA 1W8IA 1SU7A 2QTZA 3PEFA 5EQFA 2VHXA 4WJKB 4K8OA 1U0EA 3GLSA 3IB6A 3FFXA 3ESQA 5I7AA 1CUCA 2OCYC 2H2IA 3RYTC 4AZWA 4B3MB 3UUGA 1Y6GA 4Q82A 3DMPA 5KDOA 2NPOA 1ILEA 5GINE 2NOAA 4TKLA 2Y0DA 3M7IA 1Q22A 3RASA 2I3AA 2JCGA 5A6SA 2JLYA 2PBRA 1U1FA 1D3AA 3K70D 2RK4A 2IYYA 2D00A 3MG9A 2W0MA 3VUEA 2FCRA 4JQCA 1AHHA 4GPZA 2WE7A 2F17A 2Q0XA 5G41A 1XJ5A 3AHIA 4LC1A 4QC2A 3ZG6A 4XVCA 1NN5A 1SBCA 5J2TB 5I4CA 2BJVA 5HCUA 1UDBA 4DV1B 2VDWB 4KQGA 4C7JA 2IEDA 4EW2A 2VBGA 1UAAA 1DO0A 3JSAA 3AZOA 4IXMA 1SQ6A 1NZDA 1HLFA 5BWBA 1D09A 2IUTA 3FHOA 4JC0A 5J4KA 2PRZA 2O20A 4PR0A 1RHJA 4QO8A 5JNUA 1KO5A 1H9CA 3IH5A 1RYDA 4I4NA 4BCBA 4X0EA 5C31A 1W7AA 3JZDA 2FMKA 4KVAA 4BO6A 2N9UA 4M0MA 3D3KA 4DV4B 1ISPA 5JVDA 1PGQA 2DWUA 5L3QA 3K6KA 2GMWA 2O8EA 3A6KA 3EDRA 1K8XB 3QUAA 4C21A 2CE2X 2ZYHA 2CL6X 3A37A 3BFXA 5BT9A 3EWIA 1MNAA 4ZXFA 5JDIC 1ZOLA 1GFZA 5HIKA 1D2NA 1QHEA 3OZXA 2RHBA 2AVNA 4BJ5A 3S2FA 4QYSA 1Q0QA 4YCAA 5EMKA 4JI3B 1W2GA 3S1LA 4KL8S 1I5EA 4I4TF 3ML1A 3E0QA 4KFRA 2J6HA 5L7WA 4L0CA 3OIWA 1ZCFA 3COZA 2ZT6A 1E96A 1TJ4A 4JWKA 4P3KA 4TWIA 5BWMA 2QIOA 2I1LA 3MT9A 2JIPA 3UEOA 3K0AA 3HJRA 5AI6A 3WKCA 3OVMA 1QGUA 1XLTC 1G2QA 1JHRA 3I2JA 3LFTA 1JR2A 2QVZX 3QM1A 4WRRA 3FDIA 5CK4A 3T3IA 1MB0A 3ZHCA 4DMMA 4EA7A 5EWLB 4O1HA 2B21A 4Z6KA 1WPRA 5JJKA 4XR9A 1X70A 2HSGA 1ZW6A 1UKEA 3WIVA 2R47A 5AVRA 1N0IA 1XMJA 1UKCA 3L46A 4RE5A 4AZSA 4I46A 4CTKA 1JWLA 1C3LA 3DBRB 3H9GA 4MVJH 4EAQA 3M82A 2QT9A 3H8SA 4OP3A 3ADCA 4QU9A 2Q1XA 3F5MA 3NNDA 4N82A 3DMNA 4AKIA 1YR7A 1PYGA 1KY4A 4CCYB 4XTCS 4CNQA 3B8HA 1QF7A 3G1UA 4W5QA 4G5RA 3OZSA 1EQAA 3ZD9A 1O97D 1KQ3A 5CA0F 1DT5A 1JI3A 1FBNA 3KVVA 3Q8WA 3T1NA 2H3HA 3ORSA 1I4TD 2C2XA 4Z4FA 3QE2A 3W7VA 4DMRA 5HJ5A 4YAUA 4MUBA 3P9KA 1M7GA 3AHJA 3P96A 2QP3A 4GR5A 1D6SA 2C8LA 2GFHA 5DHUA 3A9VA 4MS4B 2B37A 1P44A 1CQJA 2BRUC 4LBWA 4AJEA 4NENB 2G0TA 4P7GA 3ZNPA 2RARA 2QAGA 3C8MA 3ASYA 2VWGA 5DTEA 2VRBA 3F5DA 3UFXA 2PX6A 1YBFA 1VIMA 2WAYA 3T7KA 3FBTA 4CLOB 2CVPA 3K31A 4X6XA 1OT3A 1RYHA 3RT9A 3X1YA 4D8UA 4BNUA 4EEXA 3K70C 3UT5B 2C54A 3GRVA 1IZYA 4DLLA 3L7CA 3NV7A 2GT1A 4GPTA 3TEMA 2FX2A 4GDFA 4Z0HO 5GZ6A 1QGOA 2QSJA 4AJ4A 4IP0A 1MEOA 3B1XA 3LP8A 2C5FA 4ILKA 3KRTA 3NBMA 1ACMA 5DHRA 2YOFA 1IPEA 3FYDA 3PF8A 1VL0A 1WA5A 4L75A 2HA2A 1JL3A 1RPNA 2VL7A 3D6VA 3G0GA 4KOAA 3QUTA 5IAGA 4B32A 4BO2A 2UZAA 3PUWA 1JPVA 1ULAA 3H2GA 4YDHB 3WL8A 4LSZA 5FWYB 3DEJA 2ZYDA 3EGDB 3KU1A 1PG5A 4L5BA 5KSOA 3LFUA 3QWIA 4CV0A 1B14A 1RP7A 3LC1O 4IGAA 5K0JA 2DWCA 2EJWA 4E15A 3LLVA 1NWCA 3EEBA 3OFND 4HNQA 2OP0A 3DEIA 1W47A 1YCHA 1CUIA 4INPA 5SICE 4AYXA 4UMVA 1GHTA 3TH5A 2UXBB 2IH4A 1KWKA 1MPXA 2CNKA 3OZIA 2YCBA 1G38A 3G2KA 3BAZA 1H8HD 3D5QA 4HDKA 4PW0A 2CLDX 1NT2A 3L6DA 4GVLA 1XN4A 2AE1A 3O4RA 4XDZA 5ELLA 1QG2A 1HDZA 1WCWA 1V4VA 3PC3A 1NRIA 2PLNA 4QPDA 4X1YB 1QRUA 1FMFA 1XUOA 2X5KO 3DMYA 2J0SA 1GQOA 1M8PA 2GCEA 2HXSA 3I92A 3LUDA 4AG5A 1WCIB 4JJ8A 1GV1A 3ZVLA 4C4AA 4CWAA 2UUAB 1OUMA 1D0IA 4ZDJA 1KI6A 2B25A 3PHJA 3QELA 3NXKA 1JLLB 3NG1A 5CK5A 4P92A 1DTWA 1VE3A 1DX9A 2JD2A 3U37A 3VR3A 5K0SA 3IEPA 2A57A 4B1FA 3WYNA 5ECYA 3CWCA 3NUZA 5JSYA 2AXPA 3BBLA 2XVZA 3NEYA 4A91A 3C3JA 3P1JA 4O08A 3IJRA 4F96A 3KZCA 3EX7C 3B5JA 3SLGA 1YGYA 2NX2A 2Z04A 5DK4A 2LWIA 3JQDA 3SR4A 2V7PA 4BNFA 1ESMA 1N6RA 3PNLA 3I2GA 2O3UA 3LO8A 3A1FA 5HJ7A 4TMZA 1E2PA 5LIRA 1EJBA 4UUAA 2FFJA 1MIOB 1SVMA 4LJSA 3NVAA 3O21A 4JEIA 5E6SB 4BFZA 5JRDS 2XMRA 3AGQA 2AFHA 1XNGA 4L27A 1P8AA 3RIEA 3E5MA 2D59A 4G0UA 4O2RA 5KINB 2HHLA 3LA6A 1NVGA 5HBGA 4TN1A 4AWBA 2XUKA 2FWRA 3LKZA 1EXVA 2CK3D 4TMKA 1Z6XA 3EGVA 4XJVA 1VBKA 4HQKA 4MQLA 3B13B 4G0QA 4DV7B 5JS7A 3SY8A 1UDXA 2Y1LA 5FI1B 4ZCLA 2X4DA 4US0R 2G8LA 3G2OA 3LBFA 1HT0A 2V4UA 1BKSB 4OI4A 4ZVNA 3VPGA 3HYCA 1ECCA 2AHRA 3G2LA 1KVTA 2IOYA 2Q6TA 5IT4A 1ZUNB 2Y76A 1GJRA 3F3MA 4HNAA 4HWOA 5HQJA 5T4HA 3TQOA 3IE0A 4DLSA 3ZV6A 3U16A 1SC9A 1IB6A 1RKUA 3MWKA 1R6AA 3OM9A 4KPGA 1K92A 4O2BB 4WKBA 5EHGA 4S0XA 2YV2A 1ZC4A 2PLRA 2XCUA 3JVEA 1N8TA 2Q4EA 4KDCA 3BK7A 1SFRA 3IHKA 3LV8A 2OG1A 1P77A 2R3SA 3UKOA 2H8KA 2FSHA 4NMLA 4OKNA 1FSZA 1IHUA 3S68A 2PZLA 4HD8A 5TF4A 3GCGA 2PX2A 3IV9A 2KM1A 1SPBS 2OESA 3OX2A 3K32A 5IAAA 3U1BA 3BJZA 2PD3A 4Q7JB 5B12A 2XNDA 3HL4A 4LJ8A 2QX9A 1G8KA 4A0RA 4BFWA 2P4QA 2ID7A 2Q3FA 2X4IA 2IWHA 1W75A 2YZGA 2ACVA 2JFWA 3EIHA 5CEJA 2BKXA 2JAPA 2VNSA 1P1IA 3DZGA 2CLLB 1XZQA 2OO5A 5LUBA 3OJ0A 6REQB 1NOIA 1T36A 2YNMA 3DT6A 3K4QA 1XTTA 4H7EA 4NFYA 3SEFA 4MQFA 5ENZA 4AY6A 4K26A 2IH2A 3GDHA 3W5BA 4JHXA 3JAMA 3GO4A 2BBTA 4GM1A 4D6YA 3AU8A 1G66A 1ZNXA 4O8ZA 4YI5A 2Y0CA 1GLGA 3HUTA 4ICIA 3T7TA 3VU9B 3UV6A 1H23A 1DINA 1PT6A 4MVJF 1TD1A 1JG3A 1FMTA 2WTNA 3RV3A 2LW7A 2DHRA 2HF2A 2REBA 2VP0A 5E7MA 1R6DA 2GNAA 2OXEA 3FN4A 2AG5A 3V9PA 1DRJA 4EW3A 2HWUA 1E2NA 5B4VA 5HA5A 3L4KA 2C2BA 3BREA 3UXHA 1KE1A 1R8QA 1WPXA 3MM4A 1L7RA 2BHLA 1E79A 2CMHA 3BJIC 1E1DA 3D4PA 4Z0NA 3L7DA 5I5GA 2CT8A 1X1CA 2CLOB 3LP6A 4ETIA 1JPUA 1BAPA 1N6KA 3KD3A 1FSPA 3A4NA 3RIMA 1V8ZA 3W5AA 3W77A 3SQWA 4OLAA 4NV1A 5CW2A 4QG3A 2KBFA 5TGDA 1H2EA 1E8NA 2FHSA 1B00A 2Y6UA 4JITA 3NDPA 2CXUA 3HHEA 2JGRA 3N0RA 2BWJA 1OXVA 3NBZC 4YI3A 5CB4B 1YFKA 1T8WA 1C1XA 1Q3HA 2X14A 3KEQA 4HTAA 5B53A 2R97A 1GRCA 4Y6PA 1X80A 1OXKB 2WJ3A 3NM4A 1GGVA 4P84A 1X9IA 4XXHA 4ZEXA 5I7UA 1T3GA 4X1KA 3WL6A 4B81A 2CVOA 1GPLA 1ZMOA 2V9CA 2J30A 3CH5A 1ZK2A 1ST3A 3EASA 3IQZA 2ACEA 2CE7A 4JJ6A 5DLQC 1EM8B 3EZFA 3GRCA 4PPFA 3UWSA 4LNUB 4NJEA 5JLJA 4CEIA 3AUTA 2V1XA 1PK8A 2Q3EA 4BO0A 1XEFA 4BFTA 3ZDCA 1E4EB 3GVIA 4W4TA 3L84A 1KI4A 4WW0A 4MW5A 3V4VB 4TXJA 3QSYA 3KXIA 5D86A 2D06A 3I2FA 4GM0A 1WNTA 4NONA 3MMSA 1AMUA 2VT2A 1NBOA 4CN8A 4QIHA 2XDQA 2DG2A 3CX8A 1PDWA 2G4VA 4YXWD 3ZS9A 3B9RA 2P27A 3PWSA 1RP1A 3E9ZA 4UAUA 3RAFC 1Q92A 4R40A 1I6LA 3T9DA 3UH1A 3CCBA 1Y81A 3OPYA 4PYOA 5FA5A 3JZIA 2AJ8A 2O8BB 3HKDA 1CUWA 3UGTA 4UQOA 2IV3A 4JSRA 1OWPA 1U2DA 2A9FA 3LUHA 4B9AA 4KN5A 4UASA 1GYPA 2WJ4A 2BFWA 3QU4A 4ZVKA 1MEEA 2D13A 2BIFA 3IS3A 4O2BA 5JAZA 1Z2OX 1G20E 3PDUA 4PZZA 5ERGB 2D7JA 3IUSA 4EVIA 2ZQZA 2Q0QA 4WJZA 2YWFA 1B8PA 3EFOB 3TNJA 3LX4A 3L7LA 3MWFA 5JAOA 3R5HA 4ZPXA 2XYHA 2QG6A 3EDMA 3QY9A 2QTTA 3DAHA 1JPJA 3EGXB 1L5HB 3PNOA 1VHTA 2QM3A 3IQHX 5D3MA 1GAEO 5DYTA 3RI3A 5AD1A 3T5PA 3H6HA 3ER8A 2CGEA 2HTEA 3ULKA 3EB9A 3PGJA 1HETA 1LVHA 2ZVPX 3VKHA 1O6BA 2VDNB 4R3UC 4DWWA 7GPBA 2ZSKA 4FOSA 4OAPA 3JAWB 2HJGA 3DW1X 3GARA 4MIYA 1ODTC 5BYKA 3ZGZA 1EQ2A 1Y63A 1TUGA 3LQYA 3NRCA 2JJYA 2G5TA 2ZT5A 1PZXA 1MIOA 2RK6A 1F4LA 4FX2A 1FNBA 3IBSA 1PVVA 4LUCA 2JHAA 2GJ9A 2IS1A 4QVIA 3Q2KA 5F7OA 4ZU1X 3KQSA 3KKPA 4LZJA 1LD3A 4FNOA 2JJ1D 4KWCA 2QY9A 3KSDO 2IYLD 2B2CA 3MWGA 1IVSA 1BGWA 1OTYA 3F6SA 2G06A 4U3JB 5HX7A 4HB3A 4IL5A 5U1PA 1BROA 1I2DA 3ANXA 5JRZA 2PMBA 5EC8A 1C80A 2A9KA 3FPCA 1EVKA 4ZV7A 5B1IA 4ACBA 3UOWA 2VHJA 4X6UA 3RFVA 2X0RA 3A04A 4BLTA 1WTCA 3E1KA 1OX4A 4KG7A 5I8PA 4Z7NB 1KI6B 2IUUA 1TI7A 2P78A 1E6CA 3VKWA 3ZHYA 2Q3JA 4F4DA 1N2ZA 2HU8A 2QR2A 3H7AA 2ZB4A 1PJ3A 2ZB8A 4PQGA 4WL0A 3ASVA 1FZTA 2VNKA 3F6EX 1F38A 3R0XA 4UHEA 5K6AC 1EGHA 4ONEA 3R8FA 1J20A 4KO4S 1YU6A 4EX7A 5KTYA 1G6Q1 3DV2A 3VYUB 1HE8B 2ANBA 2G1UA 3HY6A 1XTSA 4UD6A 2C0PA 2C98A 2AXNA 2WLTA 1VFNA 1GZ3A 2VPIA 1X7DA 5EJ2A 3LHFA 5HS4A 2O59A 3RTCA 1E1QD 3H2HA 2J9XB 5A2GA 1TU4A 1FLDA 3QMPA 1RLMA 1Z22A 4Q3BA 5JWOA 4XD2A 4O5OA 4OTZA 3T7AA 4P0PB 3TR5A 2V58A 2PS3A 1L2TA 4MROA 2EFHB 4R1QA 1ZJ6A 3LCJA 4M7PA 3EGDA 4UE2A 2AF4C 2H29A 2ZUVA 2DLDA 1P6QA 4PZ0A 4ZCSA 4EKGA 1PGNA 1WDWB 2N1MA 2Z98A 3PGKA 4NOKA 1OY1A 3TIFA 1GFIA 1L8XA 3H87A 4UBMA 2QN8A 2EBFX 3IAHA 5DSZA 1QTQA 3UHJA 1VM6A 2A8YA 1JEAA 1WEKA 2AKAB 4WEQA 1NIJA 3PITA 1ZM3A 3QEJA 2OM6A 3UGJA 2LIPA 3TTSA 1GSAA 2DTDA 3IT1A 2OAGA 1M2VA 3TOXA 1TIKA 4G5GA 4UFNA 2G28A 2HEGA 4A0FA 2OK8A 1AF7A 4MARA 3MWDA 2ZSAA 3NAGA 2XSZA 3LCRA 4WXHA 2PYZA 3PE6A 4R9RA 4EPRA 2JGAA 1SUBA 1DAMA 1L1QA 4WN9B 1DQSA 4YCDA 1V1JA 5DHQA 1GKKA 3VYRB 4DCNA 4KGXA 4BX9A 3UFXB 3N5CA 1HEYA 4YUAA 4DV6B 3VU0A 3O94A 2BFCB 5IMSA 2WEKA 4U5QA 1MB3A 3KJZA 4MAAA 4NKRA 3LCMA 3H1BA 1C1YA 1G41A 2GYUA 3F4KA 2NO6A 4MUNA 4OIFA 4WX2B 4YDRA 2XH8A 4JJEA 3ND5A 4GQAA 3TTUA 3AP1A 2EDAA 4RL6A 3VOTA 3G1TA 4BRWA 2FE1A 1U0BB 2XEXA 1YIOA 3D5TA 1NOKA 5LB4A 4JOSA 3KSBC 2ONJA 3IULA 3DF7A 1V16B 1KETA 3JQBA 3MWJA 1QGZA 3QENA 1T4DA 1UK8A 4L4YA 2JIMA 2RH9B 1QUFA 3ECSA 3M1YA 2HMYB 2MT9A 4NV0A 3KYCA 3VRHA 4GEKA 3ROQA 3T3DA 4YPOA 3DOIA 1PWHA 2C99A 1QO0D 2H00A 4HHEA 2V7TA 4V1CA 3K70B 1UDWA 3C3BA 3A1TA 3NFRA 2BT4A 1E18A 4UHBA 1E3EA 1GV0A 2BGKA 2V0NA 3GT3A 4IEFB 3RC1A 4HVAA 1HL7A 3W79A 3AIKA 4C4PA 4YCCA 2W2KA 2B0CA 4JP1A 2QQ0A 1GTZA 1RYNA 3HJTA 5H4GA 1TYBE 4FMDB 1ZM9A 4YASA 1HT3A 2WAAA 2FWAA 1P75A 3E7XA 2YIDA 3R3WA 2B1GA 2WTEA 3L6BA 5EA2A 3KQHA 1A71A 2FQWA 4G86A 3MNFA 4DN6A 4HR7A 3PC6A 2QZZA 5GOZA 4EMTA 1RJEA 2HSDA 4G67A 2BGUA 4JYPA 1N9GB 1H6DA 1SIOA 2JKVA 4FHZA 1II8B 4YJGA 3FB1A 4F8EA 1BX1A 1DUVG 4NE9A 1NW3A 4XUEA 3E9RA 5U4QA 2Y1FA 4JLAA 2H0RA 4NARA 4UBIA 3RIXA 4FR2A 5FYDA 1ZG3A 1QU2A 3C7AA 4G5FA 4GVPA 2QTFA 1NU6A 4EUEA 4REQB 1Q1QA 1U5CA 1R6XA 5KJ1A 1O0CA 1SU6A 2WNSA 2ZRMA 3H0KA 4Y7CA 4NOLA 1BRMA 4P08A 2H18A 2I8AA 4BFXA 1SBHA 3RROA 1L7VC 3W2HA 1S3SA 5LWQA 4MVJE 1Z6GA 4LJ4A 3HSKA 4TGLA 1RWWA 3W1VA 2ID8A 3GT0A 1B0PA 4JK3A 3WNBA 3OZDA 4D0LB 3I5UA 4H3SA 1TF5A 1DUSA 3PHHA 4ZQCB 1MABB 1Y7HA 3G8YA 3A4LA 4YWJA 3UYLA 1LDEA 2ZKIA 3Q1KA 4LDQA 1FDUA 1ZMRA 5ALMA 2Z8ZA 1FYEA 2PGLA 3AW9A 1TEVA 4H7JA 3WFZA 4A5OA 2O0LA 1LK0A 4FN5A 4Y8VA 2QYSA 2BZSA 1O8BA 2J5RA 2WV9A 3HCPA 1QFJA 3C7KA 4R2LA 4R2WA 1T34A 1M2WA 2HWWA 4WBXC 3A11A 4ZI7F 3NDRA 3NPAA 4RIGA 2R84A 3UXEA 4FE7A 2QXUA 1BS1A 1H85A 3FLAA 3D5EA 4IOJA 4WZZA 5E7IA 2O2ZA 3K9CA 2HW8A 4EYGA 3R3YA 4MVJM 3V8VA 5C7YA 1JFLA 3PWTA 3ZU4A 1XAHA 2G80A 1E1MA 1YOBA 4X9XA 5L3SA 1Z2CA 3TCXB 3OQ1A 1NULA 3TUJC 1G20B 1E3SA 2ZRDA 3FMFA 3OT5A 4G0PA 4OJQA 4YTEA 3RV4A 1CXZA 5E0KB 1H1TA 2QRNA 4RADA 2DPXA 1FFWA 1QF9A 3CEJA 3FHJA 5AIAA 1KSHA 2YJTD 3PFKA 4FOTA 3SFTA 2B4QA 1E1KA 2ZBGA 2GERA 3B89A 4FC6A 1BHO1 4RPIA 16PKA 2B3TA 3VR2A 2Q2VA 3LQ1A 3EVZA 4A2PA 5COQA 3AEQA 3ZVNA 3OCVA 3CNHA 3ZY6A 2R8ZA 3NGMA 1MDBA 3CW2A 1FA9A 2C4MA 2ZRGA 1S7CA 2VC2B 5EPUA 4WY5A 2PU5A 2F64A 1TA9A 1I0LA 4Z4CA 5JPDA 5HP4A 1YASA 2VNHA 1H2FA 1LPNA 2GPYA 4B33A 1Q15A 5JRJA 4X66B 1UC4B 1VRWA 3B3FA 4KXVA 3OKFA 1IB0A 2FH5B 3COPA 4MS3A 4XOUA 3QIAA 5LA6A 2ZYIA 1EFPB 2GCNA 2Q3DA 3CRQA 1DHTA 2P6OA 1KAOA 3LQ4A 1MO4A 1Z82A 3DC2A 2OO7A 2V7XA 5DISB 1T5TA 1HA3A 2GEFA 3N8GA 1YZTA 4H3VA 3K6SA 4A36A 4LOLA 4ZI2A 2ZAOA 1LI5A 8AT1A 1NVVQ 3IILA 1KEZA 2SCUB 3SE0A 1ETHA 4ENSA 3FETA 1R0RE 5C8YB 2L82A 4QDTA 1CY8A 3K1ZA 1G64A 1SUCA 2V96A 4IRUB 4I1YA 4JMPA 4X1IB 5DE3A 3NWPA 5CDGA 4O25A 4HMPA 3UT6A 1E0AA 4P22A 4EO7A 3DBHA 1M1NB 1Z4QA 2UVDA 1OYVA 2CB0A 1O94C 1TIPA 4BKUA 4TWAA 4D99A 3ZK8A 3B6JA 1ZN8A 2O6HA 2ATCA 4NZNA 4AZ0A 4YUWA 1LPOA 2QRKA 1J0AA 2QZ4A 1C41A 5J2TF 5J40A 5CA1F 2GEJA 2HJHA 3Q8LA 1JMVA 3BGDA 3BTVA 4BPRA 1SUAA 3IQIX 3PXUA 3RC7A 3HK2A 1GEEA 5AW2A 4G09A 3MMXA 1UWKA 1WQ3A 2PL5A 3CUEF 4Q7EA 4RL4A 3IAFA 3Q1LA 4LPKA 1A95A 5CNJA 3R8CA 4CIXA 1NLUA 4M98A 1M1YE 3MGAA 2PQ0A 4GOMD 4L5CA 5BWLA 3ICQB 2XE7A 4ZV9A 3GGDA 2VNJA 2DY1A 5T4FA 5K6RA 1PV2A 2P40A 1AUPA 1HYQA 2Q1TA 3G8CA 1W5BA 2H1WA 3NATA 1KH1A 3N2IA 4R01A 2M1XA 5HK9A 1FXSA 3JR3A 3DSRA 3NM5A 3JR7A 4G9GA 1DBSA 4HRYA 4I0WB 5AI8A 2FUG6 5ICFA 3ADKA 4CUKA 2QORA 3BHNA 1F2DA 1MLDA 1ATZA 3ZGVA 3I62A 5CFLA 4N3GA 4RMGA 4JAVC 3RHSA 1C1XB 1CC1S 5M2QA 3A14A 1KVQA 4I9NA 2VJBA 2OZKA 1V2GA 3MAGA 4KK3A 4HLNA 2PSEA 2IU4A 4RH0A 1S0UA 2PGNA 3ORHA 4GYJA 5CH3A 1ISGA 1J8FA 4MOWA 1AKWA 1YMUA 3KOUA 1U7ZA 1VPEA 1NJ5A 1P2TA 2A33A 1NFRA 3AG6A 5CVJA 3D2CA 1E58A 2P67A 1NXPA 1Z0ZA 4H7KA 3W6PA 1VZ3A 4IXTA 4H4EA 1R27A 4RWEA 3AVYA 2FDCA 2FWBA 4IILA 5HUQA 1JDSA 1XTKA 1MV8A 2JLCA 3AVOA 4G37A 4NBSA 5EIHA 3WJ7A 3FDZB 2Q8PA 2KJQA 3HU2A 5TSDA 5EOVA 4AZ0B 4IIHA 1DFHA 4UTVA 3NKFA 1CT9A 1QDUA 4ZPJA 1UODA 4DA8A 5LMCA 1CY0A 1GAJA 1VB5A 2C3PA 3LKBA 4WOBA 1MIHA 2X3FA 5DP1A 1N3YA 2I7DA 1NBHA 1R4MA 2F48A 2H1CA 2LUOA 4C3UA 4OLBA 1QCYA 1LDNA 1ZUD1 1P5RA 5IKXA 3Q7QA 4HWGA 3QE9Y 3QFHA 1RQ2A 2YMMA 4HGRA 2X4LA 2WZQA 2ZRLA 3BM5A 3ZXSA 2D0PB 3AJDA 2CNLA 1KJYA 1WDKA 2DTXA 5AK3A 4J94A 1GGKA 1YTLA 1P0MA 2ZROA 4GIBA 1P4HA 1SCJA 4Q4HB 1XRSB 2XCOA 2Z5GA 3UJAA 2AR0A 3DS8A 3GP8A 1GPMA 2ZIXA 4HB4A 4ISCA 5ALHA 3UAYA 4DQDA 1QR6A 4ZYTA 1T4CA 1U2GC 5DNCA 2OV2A 5LBUA 1KDTA 4JYZA 3KZ1E 4PGAA 5KX5F 1V4NA 3OZUA 5C8YF 3A9RA 1KIAA 1JTFA 3DV0A 3ZJYA 1KFJB 2XB8A 1MRZA 3OJEA 4LMAA 2P6UA 2A7XA 3QHPA 4K87A 1RIFA 4GFDA 4IX9A 4MV9A 4QXAA 1BU8A 2R1TA 5AK6A 5ALNA 4GP6A 1RWNA 3GLHB 3PD0A 3A1NA 1C3OB 3CX7A 2F6RA 3HVJA 1AK1A 1OI7A 3SVZA 2TECE 1ZA2A 1GA6A 1C8LA 4GMFA 1VPDA 2NSDA 1G20A 3BICA 4RPJA 5ECDA 3MERA 4R41A 3TLAA 1CYEA 2YV3A 2YJNA 1GUAA 4LWQA 4LHSA 5B3KA 1JVSA 2ET6A 3HGTA 4E4TA 2E85A 2O5VA 3PI7A 2AG0A 3K9FC 2AK2A 4JOQA 2J3IA 4LF9B 2C2HA 4QREA 1K97A 3NXSA 3D02A 3P2OA 4WZBB 1LDBA 4JSTA 1X86B 3IOBA 5DM0A 4J91A 3H75A 1OB2A 3WA6A 2EQAA 2DJIA 1Y5LA 4RJIA 4C6TA 3AKEA 1KJIA 3T41A 1J5XA 3KYDA 1MNQA 1L5WA 4Z0TA 2FF5A 1O6GA 3BH6A 3CVUA 1Y3IA 4ZCRA 1SXJC 2IX9A 1KRXA 3GC6A 4YJ3A 3DLHA 1Q2UA 6CHYA 3ZI0A 1RBZA 4BQFA 5F2KA 1R6TA 1ZN7A 2AG8A 2F4NA 2J4CA 2WHQA 4TRJA 3F4LA 3CBQA 4YJFA 4AJPA 1SXQA 2DLCX 2XDAA 2Y0PA 5F9MA 4NU0A 5EJ7A 1FVHA 3AY3A 3OX4A 4ZVVA 5LXTB 4R0NA 4YB8A 5CHYA 1E1RA 2FRXA 3NONA 4BBZA 3MXTA 3ZDAA 4FFOA 4G24A 1E8MA 1RTKA 3P9XA 2QE7D 2HB6A 3AEUA 2PGDA 4D41A 2IS6A 4X6LA 3X44A 2W4IA 3FUCA 1NYTA 2AXQA 3N07A 2WA2A 2Y1CA 4TXLA 4Y3UA 4DMGA 3LGAA 1E20A 3WHIA 5C1BA 3I2KA 3FCSB 2F62A 1KS2A 3GLVA 1X2EA 2XBLA 3DXXA 3OD1A 4P3XA 4Q6WA 3LD9A 1OH7A 4D45A 4RVHA 1GEGA 3EOAI 3VOBA 2HRZA 4A5SA 2W2KB 1FLNA 5JSUA 2ZR9A 1OB5A 4KREA 1E3WB 4C0HA 1EIWA 2I66A 3E8MA 3M70A 2JK0A 3C8ZA 3E7DA 3KOMA 1UMDB 4U7FA 1K7FB 2AD1A 1DX6A 1PSZA 2XUPA 4M1YA 1XHEA 1SMKA 1L6IA 2VJMB 4JXZA 3D8UA 2JJ2A 4HTFA 4W5WA 4FD3A 5FWYA 2L19A 3LH5A 4JNKA 5IDVA 2C2KA 4IFTA 2VAMA 4PNPA 4EYEA 3BSFA 2Z58A 3V48A 3FWPA 4NG4A 3D4OA 2ZETA 4LMPA 5CDTA 2V6FA 4FFNA 3WXMA 4G5SA 1UJNA 4ZTZB 5ITVA 3H5LA 3ZDFA 3GI1A 3ZLVA 3MJVA 3WLQA 3KCNA 4A8JB 1ZQ1A 2HJVA 3VR1A 1U9CA 2FQYA 2ONCA 4WXRA 3JQFC 2LGJA 3FKJA 3UN1A 2J87A 4A9AA 3KLOA 2JI4A 2PRIA 1QIJA 3KB8A 5AKIA 4C6RA 4CV2A 1YB2A 2W9XA 5A4AA 1VA4A 3FIJA 1UOPA 3S44A 4E6PA 4B6OA 1JV2B 1LBEA 3NALA 2X5NA 2WKWA 2P9QA 1BVUA 1UFVA 3THYA 2AN3A 1EP3B 1YZ3A 3OO0A 5AKZA 3RVJA 4QSMA 3QPUA 4BO1A 2JKYA 2PDAA 3CW9A 3JALA 3JARA 3KAQA 3QE0A 3EZXA 1YKSA 1W5EA 1YJBA 1FW6A 1BCRA 1RM5A 1YHNA 4CI0B 2BE9A 3N87A 3L5OA 4QBHA 1UMDA 3UBMA 1P6UA 1AF4A 4GBMA 1Z5VA 4EL0A 3AFIA 4V0LA 1ZXBA 3UIEA 1ONBA 4BO7A 1B3RA 8LDHA 4NX2A 1IBCA 4YDSA 5GWXA 3RYIA 3G59A 3UJ8A 2UYHA 4B83A 4M55A 2DXIA 4S24A 3KZXA 1U9IA 5CDFE 1T5LA 3UY4A 4OSPA 3FBWA 2PLWA 4MIEA 2XMBA 4EJ6A 1OV4A 4P5DA 2VBCA 1TQ4A 3II6X 1E64A 5T8KC 3UC9A 2WU8A 1UANA 3P9IA 2H5LA 1RWXA 1ULZA 3QPWA 4IGEA 4RLSA 4EFKA 4ZICA 4NCIA 3EQ2A 5JC8A 3QKIA 3EBOA 4MEBA 3A4IA 4DMUB 5JSHA 1ZYUA 3IQWA 3TZKA 2AI2A 4DLRA 3K5HA 1VI2A 3NPMA 4JLOA 4MRRA 1J6UA 3P2MA 3R74A 1UBHS 4YAIA 2JARA 3ETNA 1D0VA 3LOUA 1AA6A 1SBTA 3M33A 4IIFA 3EA5A 5FTMA 3ADDA 4PICA 2HSZA 5ICGA 4CLRA 2QYTA 3AT1A 3L0OA 1W5SA 4GMGA 4HEHA 4XE5A 4RXMA 3T61A 4HSGA 1JSXA 4EABA 4TYMA 5A3QA 2GJ4A 3GCZA 4EDFA 1KKMA 2QU8A 1JSZA 1G55A 2ZWMA 3C8DA 1UQUA 2HJWA 4BHTA 2BR3A 3AL2A 3ELDA 2MU1A 3P2KA 2BAGA 2EP8A 4DG8A 5IJ0A 5LM3A 2QF7A 5TNXA 2DYKA 2IKSA 2BGWA 1RYZA 2CLIB 2GHIA 2YS6A 2PKYX 3TM4A 4ZRMA 5KQGA 4R1TA 2AN5A 4R9UC 1FFGA 2PS9A 4HLUC 1Y7TA 3STXA 2X8JA 5CDHA 1YB4A 2FF7A 3E3LA 1AN9A 4WFJA 4ZT7A 3UVEA 5HGXA 1F9EA 5AKEA 3T1HB 2V5AA 3PT9A 4Y30A 4C0AC 4RGQA 2EG5A 1XTRA 1T6ZA 2IF0A 3T4UA 1Y3DE 4DAOA 2V6BA 1Y5MA 4K9DA 1AKMA 2D1RA 1P2DA 2OKCA 4RKRA 1EWRA 1R0CA 2EX1A 4KQXA 4PQRA 1CNMA 3DDUA 1E79D 1KARA 2EFJA 4RXTA 2D4HA 4HZGA 2FK8A 3LC0A 1X1TA 1ZI8A 1A3CA 4JI5B 4M0KA 4B6QA 3FCOA 2R4TA 3JVIA 2Z30A 1T0IA 5ELMA 3ZBTA 4JMLA 1KMMA 1W9HA 4HADA 4MR7B 3H8WA 1YKGA 3ZDDA 1U2EA 2D5BA 2FLVA 2EL9A 4M9UA 5BSVA 4F72A 3ZN2A 1NF3A 1U02A 4PLPA 4KSCA 3GFQA 3QLVC 4CM7A 1GTSA 2ZXEA 1GXSB 4C1NA 1HG0A 1JQBA 3LUCA 1WAMA 3C6BA 4U0KA 5LBTA 3PJGA 4MYCA 3U3DA 1JXMA 4BVJA 1QF6A 2P4HX 5K0TA 3PV0A 3IX7A 2QTHA 3KCQA 3N3AC 3ZWWA 4L9AA 1NPTO 1VIAA 2RKBA 1ADYA 3BCRA 1BFDA 2XTZA 3GUHA 1D4FA 1TC2A 4ZN6A 1TEXA 1JQJC 6PFKA 1TT5B 1GP2A 1X1SA 5IN5A 2XBUA 4RTKA 2PE5A 3ND9A 1T8PA 2XLCA 3EYWA 1T26A 2W6OA 4Q4LA 1Z06A 4JCCA 1W5AA 2BMVA 3ECAA 3TXYA 4BQQA 3EPKA 3QVKA 1MC4A 1VJGA 2C4UA 4DL9A 1DQYA 4R83A 4ZI7A 4QGHA 4HGPA 4AJOA 1ZD3A 3IFSA 4OI0A 2TYSB 5E0OA 5T4BA 4FOLA 5LJIA 4ALKA 3GFRA 2QE6A 2O8CB 4L16A 2Q46A 3VTKA 1H0SA 2O1SA 3E8XA 1BVYF 3U56A 2QVBA 1O87A 2H17A 3WKAA 4EHBA 2QWXA 3DZDA 3T1YB 3L01A 4QOIA 1JG6A 1SEVA 2GEUA 2V45A 2I7CA 3V4PB 5EN4A 3DYBA 3EW7A 1QJ4A 5A5VA 3F9IA 2A59A 1GZ7A 1IIRA 2PSSA 2QJWA 3QXCA 4YAJA 3NU1A 3IIMA 5TV2A 5KSZA 2X6QA 1HLGA 1I01A 4PO8A 4RZXA 1X80B 3E27A 1M7BA 4ZVPA 3T5CA 5FNZA 1YQTA 1XO1A 1L4NA 2QRGA 2CCKA 3LTEA 1D4AA 2Q2WA 1N3IA 4KVFA 4D4KA 1TMGE 4UHFA 3VHLB 2E5WA 3DCNA 4AECA 4EF5A 3ONVA 2HWXA 2BJHA 4RK5A 1T0JB 1JDPA 1UP6A 2VRWA 1YR9A 4OB6A 2CNBA 1NMQA 4MYTA 1HNZB 1AQ6A 1HWYA 1PWZA 1VYHA 2ZRAA 2PA3A 4FFBA 4YRDA 2HCJB 3BRCA 5KNLA 3S2IA 4GOKA 3CZPA 4QXQA 3VNRA 4A92A 1XP8A 1JMKC 1JPNA 1PG0A 3TE7A 1XMPA 3T06B 5A9RA 2B69A 2IKQA 1SBQA 2QJRA 2ZVJA 4MK4A 1QFYA 3VZPA 1BXGA 2A1UB 2PUWA 5K4AA 2FZKA 3OPYI 1WL8A 4LQCA 2GM4A 1H2XA 3OTOB 1KZ7B 2O8CA 3GUCA 2QUKA 4QU8A 3WNDA 2I4TA 2C1ZA 3QHAA 3Q2OA 3KL2A 1QU3A 1C2YA 1HDYA 2FB9A 5CCBA 2QGNA 5FJJA 3U3RA 1GCOA 4HDSA 1DKLA 1X94A 2GARA 3TW0A 5BN3B 1VYVA 4LJ7A 3H4TA 3WGYA 4I66A 4O4HF 5JCXA 3TW4A 3Q0TA 2VDJA 3P45A 2ZBFA 3QJGA 4WZBE 4WNAB 3M6FA 5KVQA 3I45A 4LPSA 5KS2A 2FEKA 2OZVA 3D4IA 1TVCA 4J7CA 4LNAA 4DPMA 3JQEA 1XVLA 4UNPA 2B2NA 3HP7A 1NPYA 5EWJA 2YUIA 3IYLW 2NUTB 3OUUA 4FFLA 4FGLA 1MH9A 4M0LA 3L06A 1ES9A 4NQRA 5FI3A 1DEHA 1YZGA 1E2QA 3QBTA 4DY6A 4YHHB 1AIPA 2FWJA 1U6JA 2EJUA 3BX1A 1WX1A 4AUEA 4ZREA 5AT1A 3SSOA 4G3XA 5LA6B 1UADA 2POCA 1HSZA 3FPBA 2XECA 4ZOCA 4MWSA 4CM9D 2GDJA 5LZ9A 3SEZA 1RPTA 1RQPA 5C9ZA 1L9XA 1LCIA 2FETA 1SVLA 1SXIA 3FPKA 3FSGD 4DIUA 2XB2A 1AKYA 1NDQA 1WHTA 1Z4OA 2FWMX 2F9MA 2NZXA 3CH4B 3G5UA 1XVTA 1JA9A 4U2GA 3AJ8A 3L1VA 4JBXA 5DI9A 4KHPB 2DHCA 3U5ZB 2JZOA 1Q95A 1UIRA 5KI6A 3U4DA 2P69A 3H9JA 2EAUA 1VECA 1DS6A 3HVUA 4LOKA 2CNWA 2O8VA 4Q3CA 4ENTA 1KJWA 3E1SA 5AI9A 5AHXA 1ZAKA 3FDXA 4FT4A 3RTBA 3TQTA 1V26A 1U94A 1YZUA 4TMYA 3MN1A 2HJSA 4NU8X 2PY6A 5F7XA 1R88A 4WZ6A 3AESA 4LDAA 1GDTA 3PPVA 1AURA 2V5VA 1N7GA 4KX5A 1OIVA 4MV3A 5AJYA 3H5OA 2MCFA 1FUIA 2WWYA 3PZBA 4EHJA 4OV6B 1PLKA 2X3UA 4L2IB 4GO1A 3WYFA 4J4TA 3GJRA 5EVJA 3CZ4A 2XE4A 3CRNA 3FOWA 4U7PB 4BZXA 1G8MA 3PE3A 4ACAA 3A8TA 2FN4A 3EXHC 3HS3A 4B4DA 4EZBA 1A4XA 2GYYA 1JFSA 3OWOA 2PJDA 3GJ3A 3KKQA 2RHJA 2WUVA 4R7ZA 4L6IA 1SUSA 3HA7A 1GPYA 4RVSA 1BHJA 1NQVA 1NXWA 2WSYB 1PLLA 1I80A 3C3YA 3S3TA 3EWNA 1Y6JA 2ILVA 3LCUA 4EGAA 1ZNZA 4Y2HA 2OTCA 1BE1A 3T9EA 1KOGA 3RARA 1DEAA 3T9CA 5FBHA 2BMDA 2P4EA 3SOZA 1Y1PA 4S1OA 1QCCA 1G6KA 2WZCA 4YJ2B 3B9PA 2AOUA 4Q93A 4OX9Y 1GNQA 2G40A 2HF9A 5DJ5A 1HYEA 1T9KA 5K0BA 3OAAA 4GNKA 4OBBA 5EE5B 1E7RA 3B6IA 1RZVA 2Z2IA 1BE6A 3MT0A 5DGIA 2B98A 4D9CA 3FCYA 4ENRA 4HDKB 4FDTA 4L1KA 5I45A 1JECA 1KH2A 1SB9A 2VHYA 2BCGY 4QFCA 3U4GA 5BR4A 3K4HA 4GUAA 3CPJB 5DGCA 5CG2A 3UTDA 5JEDA 3B1ZA 2XSZD 2I3ZA 1B4DA 1WNFA 1KAEA 4NH4A 2GILA 3ET4A 1NC1A 2VTEA 3TTVA 3URMA 2BH2A 3KHKA 1I36A 5TMBA 2J48A 1VIYA 1DRKA 3NVMB 3RHZA 2BDTA 1XCJA 4LGCA 1KMHA 1RI5A 1T8YA 2NUAB 3CJQA 3JZAA 1Z39A 1UJMA 2R8BA 2Z4SA 4MVJD 3VZRA 4GR4A 4F6RA 1CUHA 3NWOA 2ECOA 3R3XA 4BFLA 521PA 1Y5IA 4KO8A 4L51A 4NABA 4LFCB 2RJ3A 1EJ6A 2HK6A 1RWVA 2RIPA 2JGDA 2W42A 4PHFA 3AONB 3MINB 2FWNA 2EV9A 2Q0HA 4UATA 3OZWA 4DFDA 4UAJA 4BLQA 1K4KA 4JI0B 1W1UA 1FTQA 4CEJB 3VR6H 3UV7A 1D2EA 3CC8A 2ZSJA 4PLVA 1RYFA 1V95A 4EMSA 3SQMA 2XNCA 4BP3A 1LH0A 3AHHA 2I2AA 4HX5A 3AVQA 5DNDA 4CR7A 2QR5A 1CUBA 5MF6A 1WTAA 2NT3A 3E3AA 4BLPA 4ECEA 5AQ1A 1NVWQ 3P4YA 5B55A 3LBAA 1AKUA 2H7XA 1RRGA 4Y1GA 1N2OA 2VPXA 3PHBE 2BFCA 3GL9A 2WPDD 2XAAA 3BYZA 3VAZA 3L6EA 1IWPB 3LUPA 1ZPDA 4AKSA 1QTNA 1WXHA 3CV3A 3LX8A 1EFLA 2QLMA 2K87A 1JEQB 1M76A 2QN6A 4QRHA 4V0RA 4WKOA 5CCEA 4Z1MA 2IBSA 5FUXA 3RC3A 4E1AA 1NI4A 3HJBA 1ZLXA 3JYNA 4C0XA 1N3BA 5KX5B 1C9MA 1MMFB 3NX4A 4BGUA 2A5FA 1YU9A 3H18A 3A1SA 2VLBA 4DRZA 1H66A 3TLZA 4KPEC 2Q6KA 4BVGA 2ESRA 2O5RA 1JYEA 1Z8FA 1DKRA 3EXIB 3N8IA 4KO2S 4AIIA 5IXJA 2DECA 2VEDA 1Q7CA 3ZX5A 5A62A 3PA6A 5SYMA 2EGGA 2ZPUA 3AB7A 4K9MA 3WA7A 3A4MA 4URHA 2DSNA 4JP3A 5CVVA 3HFGA 5IP5A 1Q1GA 1UR5A 4MLCA 4IQ4A 4KAXA 1A5AB 1KI2A 1OC2A 4NDAA 4IW3B 1VL2A 3M83A 3S4YA 2F8SA 3EPHA 4UUQA 3R3HA 3PQCA 1UBTS 1ZH2A 5ENVA 2B8WA 4H0CA 4OMUA 4TQUS 2E4WA 2J3EA 4A6XA 1US8B 1WU7A 4YJ3B 4KQ9A 3G79A 4HUTA 1JHOA 3HCBA 4KU4A 3G02A 4KXNA 5F3RA 1WMAA 1F5SA 2F1RA 1PJAA 1R6UA 1ULSA 2MYTA 1KJJA 1S3GA 2WFMA 5EFOA 5D1NA 3W8FA 2C20A 3DTVA 5JNVA 1IU9A 2JGIA 2F67A 4HL6A 3TI9A 2O1XA 3FTPA 2RI6A 3H2KA 3PTAA 2NSJA 3DE5X 4LWOA 4P33A 5KZMB 3L8MA 1JSCA 5FEMA 4P5PA 1BRTA 1E5DA 1XK7A 2O07A 3CISA 3DM9B 5LZ2A 2DPLA 3L4JA 3ESRA 3L8EA 2PQMA 4I1VA 4DQLA 5KTKA 3BFPA 1JHAA 4EG7A 1M0EA 1XNRB 4HRVA 2ATVA 1SHZA 2GXSA 1SRRA 4Y2GA 4C4OA 3S8EA 3HEBA 3I23A 3I09A 4C88A 3D8NA 4NDZA 4TKMA 1Y4UA 1X1RA 2MYNA 3I9V6 4AURA 3SF0A 2QP9X 4OY3A 3TTWA 5G0WA 1JRLA 4N1AA 4MV8A 1T9GR 1FE8A 5COBA 3FUUA 5K09A 3GWZA 4G5XA 4O5AA 4J29A 5D3ZA 3GNSA 3T3PB 1VKRA 1R18A 1U0LA 2P2NA 1P9LA 2ORED 3DNPA 5FCDA 1XTVA 3L9WA 3E3NA 2IC5A 4E5MA 4EY8A 2JEOA 3CHYA 4ZAXA 4RHCA 5EIEA 5JBNA 1ECPA 4GGOA 1PFGA 5E3HA 1A76A 1LBSA 1AS3A 4N40A 3RUHA 4AX8A 3EIQA 3A9CA 4FEYA 1E2IA 4IGKA 5JS6A 4TWJA 4B3DA 2OCDA 2W6PA 3AO0B 3THXA 3AKDA 4HS9A 1FMCA 1T3SA 4PZCA 2OCKA 3ZYZA 4FYMA 1JHQA 2RJOA 3NRBA 3H13A 2PL9A 1ABEA 1MXHA 2J3HA 2NU9A 3E5RA 2C84A 4MTCA 5EERA 3RNLA 2G5PA 4OO3A 2CNDA 3T9FA 4Q9NA 4DC1A 4DZZA 2O52A 2WJWA 5KYYA 1N36B 4Z0PA 2K4MA 1FFDA 2YRWA 3OU2A 2I71A 3KP1A 1P19A 3NETA 4B4VA 5HYVA 1C81A 3ROEA 1ZMBA 5BWCA 1MO5A 1CE8A 4I08A 3V4FA 1IZ7A 1U99A 3ESDA 2WSBA 3I5MA 4PAMA 3HE3A 1NW5A 3L0CA 3LNTA 1WUJS 3TRKA 4BWVA 1Z34A 1J0CA 3QFRA 5I9TA 2J0UB 2REOA 3LDAA 1YNSA 4NV3A 1ZJZA 3H99A 3G2NA 2IOQA 2QL6A 2JFQA 4ML3A 4EHAA 3ICOA 4LJKA 1BDIA 4WQMA 4PS0A 1WXEA 2D7CA 2V6JA 2H1VA 4OKIA 4QOGA 3WRXC 3VPXA 1PJCA 2RH4A 4GD3Q 2Q9BA 1FRZA 1O4WA 3QKTA 4I8DA 2V55B 2R1UA 3HV2A 4IHJA 3ZBUA 2BP7B 2WU3A 5EP2A 5BSRA 3HI6A 2I80A 2Y66A 2FP3A 3O8CA 3AVVA 2DQKA 1I10A 4UHCA 3E81A 5IVIA 5LOVA 1TKCA 1JIIA 2GTPA 4IO0A 4UU0A 3WJ1A 5LMZA 4DLZA 1CCWA 4IM7A 1YUBA 4GU5A 4RMIA 3GEMA 1DEOA 2ZR7A 3E7PA 4IXWA 1W8DA 4E07A 1XAGA 2WHEA 2FXVA 1HV8A 4QDJA 1ZUIA 3D1LA 2WYOA 4YN3A 4W7SA 1MPTA 2Z2ZA 2B4AA 4ZHQA 3OLCX 1GKLA 3PDCA 4OYHA 5AJZA 4L57A 2V4ZA 1U8UA 5ALOA 4UCXA 2VJYA 3A6PC 2FJUA 5EMMA 3Q6IA 3G6KA 1IN4A 4ZMRA 2Z6UA 3HY3A 3C3XA 4OHMA 2FNAA 2CF6A 2NPIA 2W6JD 2C2WA 1E60A 2XGMA 1MX3A 2EC5A 2QD5A 5SYAA 1XJQA 3WDLA 2MSLA 2ZWAA 4M87A 1MAHA 4RLQA 1T2DA 2OPHA 3RVPA 3CLUD 5GJCA 4BZWA 5HR5A 2HA4A 1NVFA 3GWGA 3KSMA 5BUSA 3M5DA 5MFZA 1XA0A 2IBTA 3FZNA 4A6PA 3WGVA 1K8QA 3LSTA 4RVNA 4C1BA 4ZYUA 1IEQA 2J1LA 2R6JA 3T1VA 2PMWB 3PQ3A 4LXIA 3U6BA 2FG5A 4U8GA 3R7WB 2AEJA 4GZ3A 1I33A 4BE4A 2QAIA 1SHUX 1F20A 3MILA 4CKEA 3GDOA 2JLUA 3GY0A 4PCVA 5CW1A 2X0DA 3FWYA 4ZWNA 3HV0A 3MTIA 3ZEAA 5KSWB 3VR5D 3VFDA 4TSFD 3C1AA 2V7BA 2WHPB 3DE3X 1UC9A 1ID8A 5A0FA 4CG0A 1D0SA 4N5IX 2IYOA 3F6RA 4MQFB 4NZPA 5EIOA 3LBHA 1NIPA 4DMKA 1Z7YA 1PJQA 4BB0A 1IL0A 2F9LA 5FR2A 3KV1A 1P74A 2YRFA 4WTOA 4NECA 1XG5A 5JV5A 3UWKA 5FWXB 1FTSA 5EXDA 4U7DA 3EJ6A 3B6EA 3H2YA 3ILXA 4QODA 1BTOA 4YRTA 1ELOA 3H2JA 2H1HA 1X9GA 4WESA 3PGLA 2GSWA 2DFVA 1GQQA 2OV3A 2C77A 3M6LA 2ROQA 3SHFA 3WAGA 1YS1X 3L5KA 3NAQA 1VTKA 5JYBA 3W4JA 1J2TA 1EAMA 1CPYA 1Q6YA 2KBEA 4B9EA 1J06A 2JLSA 1ZW1A 1RJDA 1DC7A 4L4ZA 1J22A 1VYTA 1AS0A 2YJ6A 1JMYA 2C2YA 4FB5A 2AX4A 1PR4A 3ILHA 3JYPA 3R7AA 3WBKA 4CTJA 3INRA 3D4BA 1JH8A 3O2JA 1AUVA 7AT1A 1XZ8A 1FC0A 1LDGA 2DT8A 4NMWA 4D02A 1G3MA 3NDIA 2XR1A 9LDBA 3P8ZA 1E5QA 5DNEA 3FB4A 3LLMA 3AR2A 4J2OA 2R6DA 2RGCA 3QKSA 4X3OA 3TSYA 4PG6A 4D3XA 5F98A 1BQEA 1X7WA 3G7SA 1MA3A 2I0FA 4IBOA 5J63A 4DCGA 3OZGA 1E77A 3BVPA 2OHGA 1XZDA 3CB2A 1BEEA 4JL8A 2WF6A 5IC5A 3KJEA 5JD3A 1GG9A 3U1TA 2P8SA 4TL7A 4YMIA 4RTQA 3K20A 1VL6A 5FULA 1KYYA 1YDGA 2JLVA 3GUZA 5DTJA 4L07A 5DI3B 5FBLB 1UBMS 2GYWA 4F97A 3NGXA 2GZ2A 1YFJA 4WA7A 5TMEA 4RTRA 4ARIA 2X8JB 3A2KA 2BL4A 2WU0A 3HG7A 1HMYA 2DPMA 3BXOA 1Z28A 2I2WA 2VHEA 3EZLA 4A3SA 4IF6A 3DE7X 4PHHA 1RBQA 2CL5A 3TTXA 5C8VA 5DM2A 1Y1RA 1Z5GA 4B79A 2Q6IA 2OYSA 1E4VA 5ULLA 3RWBA 4C5CA 1THMA 1EBUA 3KK0A 1Y3AA 2OQ2A 1KI7A 4BC1A 2PV7A 1P9RA 3TIIA 3WISA 4EG0A 3HMQA 1BA2A 4I7EA 2NAPA 3WADA 1Z18A 2IIPA 1G60A 1Y80A 1JLLA 2ORWA 3FRIA 3OJOA 1H5NA 2BBWA 1D5WA 4DV3B 1HFJA 2OUKA 1DCFA 3JU3A 3WG9A 5K99A 4EECA 3HA5A 2B8TA 5JUWA 3ORRA 1J0XO 3B20A 2XRZA 3AF4A 4K3UA 3S55A 2VAVA 1YS9A 1F48A 2OD7A 3ZCSA 2ZPAA 3H7IA 4DXAA 2J4FA 1U4NA 2MYUA 2JGFA 4LE0A 4U8HA 3HSSA 3DBIA 5IT9A 1UKAA 2VF2A 1OWLA 4GF5A 1RAEA 3CW8X 4JOCA 5J1SB 1PV4A 5J2UF 3UICA 4Q37A 2GD6A 4M22A 4DEXA 3N75A 4DA0A 4RO0A 4BLRA 1OIXA 2WWIA 1J99A 1RC8A 1SGWA 4EA9A 1ZK4A