5B2FA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (phosphate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Putative uncharacterized protein PH0499
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2fA00
1UANA 3DFFA 3DFMA 1Q7TA 4XLZA 5B2FA 2IXDA 3WL3A 3WL4A 5BMOA 4EWLA 5B2EA 3DFKA 2XADA 2X9LA 4XM1A 5CGZA 3DFIA 4XM0A 3WE7A 1Q74A 4XM2A
chains in the Genus database with same CATH superfamily
5LZ2A 4RV4A 1DZIA 2OO5C 2QSZA 5HIIA 2QQFA 1FRVA 3A9VA 3PUHA 3VH4A 1ZPDA 5LQSA 1TM1E 3RKUA 2RARA 5DTJA 4UDXX 3TZLA 1OGIA 2D2IA 2REQB 2JK1A 3A27A 3LT5A 1HT1E 2YFQA 3FVQA 1WZNA 1XEXA 4JYZA 2FSHA 1LRLA 3OPXA 3CISA 2V96A 4WUTA 2PBFA 3SIWA 2ODQA 1WU7A 4KBYA 4ND2A 3BB4A 4NQRA 1COZA 1KOLA 4GSYA 2GZ3A 1PN3A 1RCUA 1JE0A 1WABA 3A70A 5B64A 4B32A 4BTEA 1I36A 3JALB 1UKCA 2J4CA 3AL2A 3GLKA 5DSZA 4DYDA 1QHHB 2J9ZB 3T99A 3KYJB 3WB2A 1CUDA 4QBIA 4E31A 2CVZA 4U7GA 1EUQA 2EFJA 2Z57A 5ECDA 5E9AA 5HGXA 2C2WA 3GFBA 4JI3B 1RHMA 2QTHA 4M7RA 1ZUNB 5B37A 2AI3A 3AJ9A 1G8MA 2Q3DA 1F9EA 2ID8A 1DIRA 3CRW1 4V38A 2KLBA 2VCHA 3QVVA 5JAQA 4A1FA 1KWKA 3G0DA 4RXMA 3TCKA 3PJEA 4MB6A 1GFZA 4ZHSA 4YJGA 3ZGYA 4WJZA 2VIIA 3G7UA 4WERA 3O3NB 4D4MA 2QQGA 4CLRB 1A2OA 3N2KB 3HCFA 3PKZA 2AZXA 5LQUA 3LT2A 2G71A 5HJ2A 4YT2A 4Q1BA 4OLBA 2PGDA 1R0XA 2GCGA 3PGMA 3OHMA 1KI9A 1NRXA 1ZVKA 2ZI5A 1PG5A 2OXFA 2EV9A 3RUIA 4XVRA 1OWNA 3I01A 3J7TA 3RH0A 4RANA 1ORTA 3DV9A 4ZVSA 3ZHVA 4U3JA 3GPCA 1B73A 5CH8A 3GZTB 2OQVA 1R3DA 3MTJA 1VBKA 5G0TA 4OQYA 1K75A 2GK3A 3IEIA 4P3OA 3E5NA 2XHEA 1TKRA 3W5BA 3G02A 3KUXA 3ZZNA 2ZJ3A 2WE7A 1O77A 5B30A 3LGAA 4FFDA 2E4UA 4MHOA 5HA5A 2QU8A 5KYXA 5CEJA 4YCSA 1Q1BA 4KQ9A 3R0VA 2JFHA 2XF8A 3R6TA 5TGTA 2YNMA 4I14A 5ALJA 4H7KA 1VPWA 2QLNA 2AOTA 1UM9B 3ZJ4A 3C3JA 1Y4AE 4P4SB 1WDWB 4XVQA 1NG1A 2V8OA 3VMFA 1XZLA 2D8MA 2PWBA 2VJLA 5IFLA 5L53A 2UVPA 4X3PA 3T1OA 3BIOA 4RETA 4EJ0A 2ZRCA 4LKRA 1YZNA 3AOEC 4DN6A 4XPIA 3UPUA 3WK8A 3THSA 1CJKC 2QG4A 1H2HA 2WPNA 4I55A 2B8TA 1RMTA 4H6PA 4BVEA 2VS1A 3X1MA 1SXHA 5JT1A 5DSXA 4ZTUB 3W5AA 4PPGA 2YWEA 5B7PA 1E3IA 3QOWA 2C58A 3D7LA 4NIMA 1T36A 2E18A 3G59A 5LP6C 2A88A 2F17A 5ANRB 1C3LA 3GU3A 4CQNA 2XITA 2FWPA 2X4LA 3CB4A 5FUVA 3LA8A 4GBED 3TFWA 7YASA 1C29B 4ECAA 2QTGA 4PZ9A 5LFAA 2VKQA 4B9AA 5JRZA 3IB6A 1HSOA 2RGAA 5L7WA 1W88B 4HVCA 4CR7A 1P31A 1JG6A 3LZDA 4NBRA 1J39A 4RD2A 1Z7EA 1A9ZA 1EIZA 4XB1A 1BW9A 3C43A 3F5DA 1H2BA 3DMYA 4FCTA 1E3SA 4NZYA 5A7GA 2WT8A 3HCOA 5H02A 4KZPA 1POXA 4CLDA 4L5IA 3EQ7A 1P1HA 1IHOA 4ND1A 1LEHA 1MIHA 1NVEA 1MTZA 3ZLVA 2HNKA 3L4BC 3ZU5A 4D2IA 2O3JA 1ZM7A 3M5CA 4C43A 5LLTA 5COQA 3HB5X 4HEA6 2O05A 3IPXA 3FOBA 4MLZA 2OG1A 3E35A 4LWQA 4NDNE 3T4XA 4CMKA 4Z6KA 4FQ7A 4UAGA 1P17A 2FN7A 4A8JA 4D81A 3L0IB 3ZEIA 2FX2A 4QOSA 3HJTA 3IDZA 3RREA 1I2DA 1JDSA 4PX2A 2I2FA 5FO1A 2GJ9A 2ZR7A 3CVVA 4ERXA 3B3QA 3CUUA 4PYJA 1BFKA 5DCLA 3UB3A 4F84A 4K03A 4E1BA 1RWWA 1JSLA 5G0SA 1F0KA 1EXDA 2YC2C 3TZCA 1HYHA 3LHKA 1U0HC 2XQVA 5IHXA 1SPBS 4HWTA 3SR3A 3K0HA 1J1UA 4O2BA 3PC8C 1GTRA 3EVGA 3H86A 2IWHA 1C80A 2ATCA 1YHNA 4I81A 4NK5A 4BE4A 1U81A 3R5KA 4BNIA 2BT4A 3Q9LA 2R79A 3HM2A 4RLFA 4A2PA 5IWAB 5ELXA 3GV0A 4BECA 1MAAA 4M21A 1YZQA 3ILVA 1N8KA 4P9NA 3TH5A 2CFSA 3VR4A 1CQJA 4HPXB 2NZ8A 3A0RB 3QUQA 4Q0MA 1WXFA 1FMLA 1UC8A 1Z62A 2Z8ZA 3TDNA 1BWQA 2XMSA 4MQEB 1H65A 2V6IA 2ORIA 1X7YB 2ZE7A 4FK8A 1TJNA 3G1WA 2OBNA 3OPQA 4WBSA 2PL9A 3V8RA 4TVKA 1DIBA 1Y0BA 3JQFC 4A36A 1WNTA 1YQ9A 3MTBA 2WM8A 4I6EA 2BMFA 4IG9A 4QICA 3DDSA 4FW8A 4WVLA 1GGVA 1F12A 3GF4A 2PWZA 3EZYA 4HDMB 3GAAA 1NG9A 3C1TA 4OFXA 3EZGA 1DTWB 4EG4A 1TJPB 4RY9A 3AFIA 1IJBA 2QTVA 3Q8KA 4J1QA 1SVLA 2CMDA 1E6UA 3INNA 3PSHA 1PD1A 4HFRA 1ILWA 2NYVA 3K9HA 4OGGA 4ZODA 3DL4A 2BHLA 3A9TA 1U28C 2WV9A 1LV8A 4ZVRA 4DAEA 1DJNA 1OI3A 2JFNA 4OL9A 3T0FA 1NXTA 2FUCA 2B37A 4US1R 3SGLA 1XPOA 2DT5A 3CE9A 3INRA 4MQUA 2Q7OE 3NIGB 3DWEX 3AM5A 3UKJA 3A28A 3W4IA 4O4IA 1TU3A 1HG0A 5F7JA 1T3HA 2VPQA 3EG9A 3EIUA 1CEEA 3K15A 3ZX5A 1MQ8B 3CVWA 3UA4A 1RRPA 3CC8A 5HDBB 3SMVA 3ZHXA 4BMDA 4CODB 3LHDA 2JK0A 3B9BA 3OOHA 3ROQA 2NSYA 3SZLA 5DLPA 1I2MA 2QGNA 1WCYA 2I6QA 1L4KA 4N7RA 3KPVA 2X7JA 1QIFA 3QOXA 5ARCA 2CNWA 3UBTA 2B5WA 2A1IA 2P75A 3QELB 5EIAA 3UQYS 1D6SA 1ZX1A 4WZBE 1FP4A 4J9VA 3EC7A 2JLZA 1AQUA 1JWBB 2ZYHA 1Z15A 2OMKA 1JHOA 1GTVA 1KYVA 4KIWA 1RLOA 2ZATA 3V7NA 5ALEA 2JNWA 3SE0A 4IUCS 1FSPA 2BFOA 3OCUA 1R0CA 4A5OA 2HJ9A 1ZXLA 5JMPA 4GP9A 3R6DA 2D5CA 3KB2A 1WSWA 2AMJA 3B82A 4IH9A 3EXG1 1U5BA 3KYDB 1O8BA 3FZGA 2AR0A 3PYMA 2XQJA 5HPYB 5HRAA 1AV6A 5ER9A 1M5TA 1WHTB 2ZGVA 1RWBA 2DX7A 2CHEA 2HIGA 3MIIA 4ZOBA 3SXPA 4BNHA 4HCJA 3U44B 4NYMQ 1JAIA 2JANA 4J0IA 3UJCA 4FZ3A 1EKXA 3KTOA 3U3XA 1Y7TA 1CZLA 1RKUA 2C3MA 3DKPA 4FVTA 3QVUA 3K4QA 4GLOA 3WV4A 3BB1A 3K9WA 2GUGA 4OEHA 1EZ4A 2QLTA 1BCSA 3AUAA 1U2QA 2VYFA 4DJTA 3WL5A 1XRLA 3ETGA 3DMTC 4LJYA 4IBOA 4MROA 1WXIA 2DECA 2RK3A 3CYFA 3HR8A 3ZY5A 5KOIA 3QOYA 4L7QA 3DOEA 2WU3A 4I1SA 4QHTA 4RTKA 2GBCA 2BL4A 1ZC4A 3CVJA 5ICFA 5FTNA 1KQNA 5HRCA 4KR2A 4K1XA 2FWNA 1L5LA 1J56A 3QEBZ 1EVZA 2INGX 4YP6A 3IIIA 2VRWA 2HU7A 2H06A 2VAPA 2WHRA 4V39A 5FQNA 3SBOA 1ES9A 1ZL0A 4FFRA 3ZIAA 1HR0B 1PEDA 4BV9A 4DPKA 3DE0X 4RFVA 1RI4A 1OAOC 3TW0A 1FTNA 4RE6A 1PK7A 4OGLA 4R1UA 4KMSA 4X7BA 4H7FA 3QBDA 1GZ6A 3HB0A 3UOWA 1CB7A 1PW5A 2MINA 1YKSA 4BFSA 4BTVA 4LZAA 1P19A 3F8TA 4KN5A 4DY4A 4OSPA 2D4AA 1ZG3A 2Y92A 1RAAA 2ZPUA 2UUPA 1YR8A 3GLIE 1N1EA 3EIQA 4ESHA 1SU7A 3R3VA 4D0NA 4GQIA 2NGRA 4N6GA 4DCVA 4QG3A 3UBMA 5GZ1A 4HNAA 2HEIA 3X3HA 2PT7A 4UE6A 3X1DA 1X15A 3ROFA 2IYZA 2YZNA 3QW2A 1B7GO 4BB9A 3P2EA 2EYQA 4E11A 3JAKA 3F3KA 4IMJB 1XF1A 2MSNA 4G8CA 1B76A 4NECA 3WRVA 2WK1A 1UUFA 3QUTA 4KV7A 3LQQA 4NQZA 4PU0A 5EGNA 2P62A 5BSMA 1QTQA 3L1JA 3ASVA 3FFXA 5I7AA 4W7SA 2NXNA 1L4FA 1QFMA 4BNYA 3OIDA 4EA8A 1KPGA 1Z18A 3L04A 5CURA 3IUBA 3W78A 1FPMA 1AG9A 3NZEA 4L72A 3CNEA 4OMDA 1IDOA 4K9OA 1VBMA 1XCLA 4NFYA 2A6PA 3ODPA 4R2LA 4EFLA 1NZFA 1WR8A 3GMDA 4YRRA 4OFWA 2SICE 4QEDA 2CEAA 3UQZA 4R2KA 5HKBA 1KU0A 2W4MA 3SZGA 2WNHA 1PEAA 1II8B 1GJRA 4V1CB 5IYZA 5J2UA 5FLYA 3WIBA 1EX1A 4EHLA 4ZYXA 1KVQA 1AQ6A 2XADA 1HE4A 3MWJA 1MW9X 3GUVA 3LMKA 3IOBA 4OHOA 4MIKA 1P1KA 3RQSA 4BC0A 1H9BA 1I33A 5LDDC 4OJYA 4R6WA 4XVUA 2BF7A 3ORYA 1NZJA 3IEKA 2I7TA 4KLCA 1XMIA 1LC3A 4UFOA 5CVDA 1KIAA 3HJGA 4GZLA 3G89A 1EJ6A 3K1ZA 4B44A 2VQ3A 4QRIA 2P1RA 1AKMA 2QD1A 4EG7A 4G97A 2F6RA 2I80A 3BICA 5DLDA 4AZTA 1L3BA 1O6CA 3ODGA 1SBQA 1FB5A 1IMOA 4R51A 3JYOA 2WYVA 3BOSA 2CXQA 3RC2A 4ETWA 4YUYA 2LPMA 4BPRA 1HOXA 1L4UA 4L5AA 4OB6A 3UH1A 8LDHA 5E1DA 5TARA 3D6TB 2JFFA 1RW4A 3RLIA 4ZMBA 1JMVA 2QLJA 4CM8B 1XE3A 1YZYA 3RYFA 1G7TA 3QKIA 4U2DA 3KPYA 4MULA 5CDSA 2IUYA 3FCUB 1K6JA 2FSUA 3GRAA 3BF7A 1CF2O 4EECA 5BVGB 4ANFA 4KI0A 4GRDA 4ZCMA 1HETA 2R1ZA 4N6OA 4RPHA 4X60A 1EVIA 2YMLA 4XA8A 3BG5A 4ZMSA 3WISA 5JZMA 2V0CA 1P4GA 3GEMA 4NRDA 1HE8B 4XWAA 5AM0A 3D3WB 2XXJA 3NBKA 4RJLA 3K31A 4FXOA 2BI4A 1VL1A 3AB3A 5CAEB 4AM8A 4BP3A 2P2NA 3IQXA 3ZBUA 5E4JA 5IASA 2YHIB 2Q2OA 1JB9A 1E79D 3OIYA 3TEJA 3VJLA 5CA0F 4G1EB 5EEHA 4A1OA 2UZ4A 6ABPA 3E5RA 5CU7A 2KHZA 5E6UA 3K35A 4FU0A 4X92A 1ISGA 1PO7A 1JYEA 1MQSA 1JU9A 3KUKA 3LRTA 4KYTA 3WQSB 3LQ2A 1Y6QA 2FUNB 3VO2A 2O7QA 3Q4GA 2JH8A 2C9OA 2PX4A 4RJKA 3EUEA 4XIFA 4CI0B 5DNEA 4EUEA 1QRSA 2GD2A 2RHMA 3JCZA 3TLGA 3WBKA 4BO0A 5NLLA 2O3UA 2Z5VA 4NMXB 3U4QA 2FCRA 2GBFA 4E14A 1VJ1A 3LLVA 3FOEC 4RBNA 4GX5A 2WYOA 1F1BA 3NKLA 3PUZA 4GMKA 4BVKA 2QG6A 4EB6B 1SVKA 2IT1A 3VC7A 5FOUA 3AR5A 1E59A 4DCCA 1WULS 4UTOA 3CWZA 3O95A 1AGXA 3KKMA 4EF6A 2RHHA 4B09A 1NPYA 4LBZA 2PZKA 1XTIA 4CCAA 1CJUC 5ITZA 3R3YA 3PI6A 3QLUA 5E3JA 5CDFE 2ZIVB 1P7WA 2GPYA 3WAJA 4EJ6A 2I7DA 3LUPA 3WLRA 3ZV3A 3WY9A 5I7OA 1T8YA 1VJRA 2JIRA 4MR7B 3RUDA 5L51A 4B2PA 3VZDA 1X74A 5LB2A 3REOA 1C30B 3GOQA 5HZGA 5JDIC 2J31A 1P9LA 4H7DA 5LB4A 3S2IA 1OD6A 4DR7B 4TKZA 1JVNA 4OQFA 2J3IA 2OBXA 3ZS8A 1OFUX 2FSPA 2P7IA 2PFGA 2YXPX 2ZSIA 3O1HB 4QBHA 3OJFA 4AC9A 4IDCA 2AC4A 3OJWA 1XTVA 1T6BY 3I2KA 3NC0C 3TE7A 3AF5A 3WGOA 1ECFA 2BISA 5HFJA 5BRAA 3QM1A 1RQXA 1GFIA 1JTEA 3GVIA 3OFND 3Q6NA 1C3EA 1YCGA 3E0QA 3K9BA 3PK0A 3AUYA 5JC1A 2WI8A 3IUPA 4FFNA 2ETXA 3OJXA 1DT5A 2A9FA 5C9ZA 2GCOB 4BNGA 1FJGB 4D9GA 1TRKA 2G36A 3IVGA 1Z16A 4BJ1A 1VCHA 5KVCA 4HX9A 3HB4X 2QTWB 1NASA 2VHEA 1TMYA 3WLPA 1JKIA 4HNGA 3HBLA 1NAIA 3AQ4A 4H3VA 3CEHA 1ZESA 2GK7A 3L7MA 5KKAA 4ZVMA 5JI2E 1SO8A 4ZFNA 4MUYA 3TGLA 2JIBA 3LPLA 1XRJA 1HA3A 4M38A 5GV8A 2E49A 4ZTZB 4RF2A 2QLFA 4UU8A 4GM0A 3KU1A 3M83A 1R0YA 5C5IA 5L4NA 2I55A 3O8QA 4I36A 1K8XB 4M0EA 4BAGA 3KUDA 3QG5A 4HNTA 3E81A 1Z0DA 1FYVA 2AR9A 4I1RA 2M6LA 4G67A 2G3YA 3A4LA 4GC9A 2L69A 4GG1A 4GSLA 4E15A 5DZSA 1AQNA 2C5LA 3AETB 1W9HA 2H7XA 1UJ5A 2MTBA 3PPVA 3GIDA 1CYEA 1PG2A 4IHKA 3EVEA 1NJGA 4L4RA 1N77A 1U2GC 3GHHA 1Q1NA 1SXJC 1K4YA 4WXPA 2OLKA 3IOYA 3RIGA 5F2NA 3ERCA 4Q16A 3KAJA 4H27A 3VNBA 2B4YA 2BGTA 3GAMA 5BWCA 2PUFA 1JA0A 2WIJA 4KUGA 4MP8A 4CV1A 4DQKA 1FUYB 2W6MA 3B3FA 1XFAA 1IU9A 1ISFA 5FA6A 2IOYA 1KK1A 1CJTC 1CUYA 1QFXA 4LK3A 3UWSA 3K0EA 3IVAA 4MS4A 2BKUA 2JAWA 3KFXA 3PCRB 1Y5RA 3RUPA 3REGA 3U3OA 4JP2A 4BNWA 1VMDA 1Z83A 3IP1A 2JLXA 3DLAA 4D4HA 2EL7A 1JGTA 5EINA 3V42A 3IDOA 4M0PA 2IY8A 4XQ0A 4RD3A 3T8YA 2BRUC 3WQQA 5ALVA 1GG9A 3G2OA 4PCAA 2F8TA 2WM3A 5AICA 3DHWC 1PJ8A 1U3FA 1Y8AA 1SHLA 4F1WA 5CT5A 3KVNA 2VK8A 3HA7A 1SG9A 1YR6A 2NU6B 2OHGA 4TV9F 3ZWDA 3E9RA 1POWA 3OTWA 1I7PA 3MJHA 3WL3A 4KITB 4W5JA 3NW9A 2VWPA 5KZMB 1YS9A 2OILA 1Q3HA 3AUFA 3EWNA 4EVIA 1YDMA 4KXLA 4ZHQA 5AVWA 3GMIA 1EFDN 1PRYA 4N8DA 2CXTA 3U7RA 4JBXA 3E48A 1BU8A 3MWKA 1YK0A 4L15A 3AVWA 1M6VB 5M3BA 3FGPA 1EFVB 1E58A 5EZYF 3WKBA 3C6QA 4MV3A 2XBUA 4YPVA 4D26A 1QYXA 2O48X 1JHQA 2WTAA 5LZ9A 1C4WA 4GBGA 4U6SA 4MA5A 5IG2A 2IEIA 2ZVDA 3Q0TA 4KIFA 5IJWA 1T9GS 3V7UA 1XQVA 2XZLA 1OBCA 1FXWF 2I3GA 2ZWOA 4BBAA 5IH7A 1KTIA 4QOHA 1U7TA 1Q84A 3QVSA 1N2XA 3DW3X 4HYQA 2UV8A 4A23A 4EA6A 1C3OA 4M9ZA 4EJSA 2CYBA 4GKBA 4RQAA 1JI3A 1CNMA 3BWDD 2HRQA 5FOSA 2G0NA 4FFPA 2P79A 3HBMA 2PQ0A 4Q9JA 2FZEA 4FWIB 1ECLA 4O4HB 3RS2A 5B6JA 2ZSHA 1C0PA 3A9SA 5ILGA 1DQPA 3LO5A 4O2LA 1RFLA 2Y1CA 3WGUA 4BZXA 3KL2A 3L93A 5ADWA 1SUWA 3AZOA 1B8PA 1Z5WA 4RL4A 4G0YA 4AJ9A 2ZB4A 5F64A 1JEQB 4XVHA 2DEUA 2QUZA 4YJ3F 4W8GA 2ZT8A 1KY5A 4EK9A 3SS7X 4TV8F 4X65B 1FVHA 3ZDQA 4RC9A 2KLHA 2AFIA 3WLOA 3HI6A 1EQ2A 3G85A 5T3UA 4C2AA 1U7DA 1VPVA 3IDFA 5BSUA 4IKOA 4YAWA 1UCFA 4A6XA 3RC7A 3UMJA 2IP2A 2NUAA 2MDTA 2REOA 3IT1A 1NUQA 3MD0A 3Q1KA 1E98A 1ULBA 1J33A 2GPTA 4U7FA 5IEJA 2BIFA 3P9KA 2GFIA 1OWMA 3W2TA 3ZXSA 4EW6A 3C74A 2ONZA 3IKVA 3MCVA 1D2NA 4WE3A 2BGJA 1LPAB 4E51A 1OASA 3PR2B 4FXPA 4HNRA 4KFUA 1YI1A 3C3YA 5JE8A 9GPBA 3WGKA 621PA 2GYUA 1M0WA 1R3UA 3LJKA 3CG0A 3CX6A 2XCSB 1JLKA 2QI9F 2VCEA 5A5FA 2F1RA 3NDPA 3NX4A 4TTSA 3D0OA 3KUUA 1AHNA 2X6RA 4JC0A 5I7UA 1OREA 3H3XA 2JEZA 4GE0A 4Q4LA 2QUHA 5I9TA 5ALGA 4LMAA 4CT5A 3STUA 5G2OA 4YXWD 4IV8A 1WMDA 4HUQA 1A2BA 1ESMA 3BIFA 5SYMA 4J90A 4KI7A 5FLXA 1YACA 4MUKA 5HIMA 3ANMA 4NBNA 3HBNA 4DWWA 4QPJC 1N8SA 4ZEWA 3OQVA 4M9CA 1UQUA 3AI7A 4KE8A 2MSLA 2F3QA 2M98A 1L5FA 1TVKB 1HZZC 3RUHA 5BUQA 2X1VA 1DELA 1DFHA 4RELA 3VNAA 1LTQA 3QXCA 4FQ5A 4M76B 2HX1A 3UZUA 4UBMA 3L7JA 1M8GA 2H59A 6REQB 5BN5A 3HJCA 4KIUA 3W1VA 1FS4A 4LYHA 1BQ4A 2HCRA 2J87A 1YVUA 3A3KA 5K0GA 1CT9A 1MIOA 1TXGA 1IXSB 1ZJJA 2PAFA 2FWJA 3HO8A 1TZKA 1Y6ZA 2C83A 5ALHA 4ETMA 4KP7A 3G5MA 3HDHA 3RTCA 1ZCAA 2O4UX 1MRZA 1UODA 2FZGA 3C8MA 2PQMA 5AVRA 2PJUA 1EP3B 2BM9A 1DEAA 5JSUA 1SCBA 2DZDA 4CG0A 2C7OA 2GETA 4J4BA 2HMTA 3QFFA 4RVDA 3L3BA 3N8GA 1IBKB 2GD6A 1Q1ZA 3OIUA 5H8WA 1LF5A 3BBPA 3AVXA 4PXAA 5LQMA 5ALYA 4M99A 3DEJA 4RY8A 2PGNA 4NPCA 5JH7B 3AF3A 4D6YA 3VR6H 1CQPA 3H5OA 5IXJA 4B4WA 4DLLA 1T1RA 5B58T 2QLBA 3DP7A 3ETEA 5LBUA 1DDIA 1FLDA 4W1PA 2YWDA 4D46A 1I2BA 2PKQO 1ZOOA 9ABPA 2V1UA 1ZJWA 1LI5A 2O0KA 3K09A 2PUBA 1KP3A 3PGJA 3L1VA 5FT9A 4IDOA 5B4VA 5EXSA 1Q0SA 4RJTA 3G2QA 5DJ5A 3PXXA 1SKAA 3E0XA 3OUTA 4FSXA 1T29A 2G17A 2QMHA 4QTZA 5H68A 1R6AA 4PZUA 5H82A 5A9TA 2HNAA 1EP9A 4BP1A 4INJA 2WYIA 2HQSA 2QR3A 2OGTA 2YOHA 2NO6A 3L7KA 3M5PA 3NTVA 2J0UA 3NOQA 3R20A 4N7MA 3DE6X 2V4ZA 3CLRC 1AVTA 1L7AA 1M0TA 2WJPA 3ZTWA 3ZU6A 2NU8B 1Z2PX 1E2JA 2Q6KA 1TA9A 1SZCA 2O1EA 3M6WA 3U13A 3GLHE 4HRAA 4G65A 1M8KA 4O1HA 4Q7LA 2MYUA 4X97A 4HNUA 2UZ0A 2WW8A 4D9JA 1OH6A 1U11A 4JUBA 4YS6A 4BVLA 1EFAA 2C2OA 1FPQA 2DKOA 4CW7A 2DUMA 3R7AA 3RB8A 4IOKA 3GX1A 3JPWA 1PZNA 3W1EA 3KKLA 4DVGA 1XD8A 3SD7A 3RSHA 3W90A 4YJ2B 2AK3A 3JWIA 2Q1SA 5IVKA 1C7RA 2B1IA 2FFHA 4BNZA 1Q7CA 3WYNA 2AEFA 4G36A 3X2EA 2HDWA 4RTNA 1G20A 2PKRA 3JR3A 3MLAA 4TVOA 1ENZA 3KQKA 3O4HA 2D1RA 3G8YA 3OCYA 1LPNA 3QVGB 1A1VA 2ZUWA 3B13B 1RD4A 3O03A 4QKQA 2XUIA 3ZIDA 3K30A 2RJNA 1CKEA 3CH6A 3FCYA 4HZGA 4YCDA 3HEAA 1K1EA 1G8SA 3H2ZA 4JI0B 1XDZA 4ZI7F 1KC3A 2D74A 2ZJ1A 5AVZA 5HGJA 2XB6A 1CP2A 1OBVA 4XW2A 1S4MA 2EKLA 3JQRA 3ZLTA 4UEJA 1KY3A 2ADFA 2NADA 1SXJB 3N0XA 3QPBA 4J9UE 4R2IA 4YRSA 3DHYA 2C4WA 2Z2ZA 3RVPA 1CUIA 1XRPA 3DA8A 5HK8A 4KGXA 4LXIA 3W2EA 1HM5A 3P2IA 2GD0A 4ACBA 2VOJA 3PV0A 1CXZA 5DCYA 5DNVA 1WUTA 4B3XA 4E5UA 1PYDA 5DM0A 3QVWA 2BUAA 4IVQA 1XMPA 2OESA 4L73A 1TIKA 4PC2A 1RHQA 1FBTA 3ORSA 1RM0A 3DMGA 2PZLA 2O2GA 4AJKA 3FWPA 4B8YA 1PR6A 4QTYA 1L5QA 2P9FA 3KQYA 1XQXA 3OPVA 2JCVA 4M46A 4IEFB 1LS6A 4X20A 5T5QA 3RIHA 2CVHA 2WJ3A 4DNPA 1PGPA 2Q5FA 2AG8A 2AFRA 2V98A 1TUEA 5IABA 4XX0B 2WHPB 1DPFA 3K5HA 4HN2A 3ZCSA 2C1XA 1P0QA 2QW1A 4IHJF 2B78A 2ZCUA 3VH3A 2VHQA 2WIBA 3PQ3A 4RIIA 4JBGA 4D02A 3LHSA 2FEPA 3DMRA 1X1TA 3NDJA 3WOVA 3DTVB 5LQAA 3NM4A 4J8PA 1WDMA 4MYUA 1ODCA 3B1WA 4TUYB 3GJXC 3S29A 2QYSA 4C7JA 1QF6A 2B35A 2VP3A 1M33A 3MJFA 4X7RA 4YP0A 2EQBA 3VVCA 1GAWA 1QFJA 1V45E 5EJ2A 4NCAA 2YFYA 5FWXB 1RNLA 1FTSA 4HH3C 2UUAB 3OQPA 4P83A 1VHQA 2OHFA 1J0XO 3CZPA 3PJGA 2R86A 4DABA 1JPVA 4OBXA 5D1NA 2ACKA 1BRMA 1HV8A 1C8VB 1JWAB 1QNLA 2EW8A 2R60A 2PAAA 2Y0BA 4P8RA 3SOZA 2ZI3A 5KKCA 1YDGA 4PHTA 3N0RA 5IXYA 1KMMA 4H6XA 4RSRA 5FTLA 3K0SA 2ONCA 1HDOA 1JQ3A 4MCIA 1FYWA 4P7GA 2XB4A 1FFDA 4KOAA 1XZJA 4GNRA 4RCYA 1JVBA 5LXTB 2VTDA 1WSDA 3PFGA 3BMNA 4X6LA 3C6XA 5CA1F 2NXEA 5ITWA 3AESB 5IZCA 2FUEA 2R4UA 5IKOA 4BO5A 2C57A 2GEUA 3T34A 4XGRA 2C5SA 1NBIA 1CK4A 2VYQA 2QD5A 2WFZA 3PTZA 4HRVA 4Z0HO 3GRRA 2GJ4A 3OJCA 4FZRA 4LHWA 4ZVKA 1EDDA 3BYZA 5T8KA 4JJGA 2WA2A 1AN0A 4YBZA 3E05A 1NFFA 2BH9A 2OD9A 4R9NA 3TRDA 6GPBA 5AVVA 2HTFA 3DKKA 1ZGAA 3WZLA 4BMSA 1AHPA 1FDSA 2C2YA 3FNQA 4IGAA 1X8JA 4DR2B 4RVOA 1OLUA 3FKSA 3H42B 3OT1A 3VJKA 2VOEA 1V1MA 1BU5A 1H4VB 3I32A 3BH0A 5JQGA 3L4EA 2V9PA 2P5YA 4M89A 4B3FX 2OB2A 4CG1A 2H51A 2QX4A 2CFCA 2JDIA 4GHWA 2FW6A 3Q6IA 5AMXA 1M76A 2PZBA 1FSFA 1RRKA 1EFPA 2CK3A 2AYYA 2R6ZA 3IELA 1DV1A 3WC4A 3ZY6A 2YS7A 5BXQC 4FINA 4OQMA 4Z1MA 1N5RA 4UUBA 1QXSA 5FBKA 4N0DA 3DDUA 1K6XA 1E1DA 3OA0A 3VR2A 4IM7A 4MQFB 5E4TA 4HEA1 5LCXA 5B6IA 2BZ1A 1PNVA 1VBFA 2JVJA 1V16A 2O0HA 3OCJA 5FPYA 3U1VA 5J63A 5CFPA 1NF3A 3AY7A 2XGOA 3RSFA 3SEZA 1NXWA 1G3RA 1G4UR 1R9NA 2IDZA 4JJ7A 4LOKA 2FPIA 2XMDA 2AFHE 2Q8PA 4HDKB 4P80A 1V8PA 1G6Q1 3N53A 4GF5A 1PAUA 3PUIA 2DHEA 4ITRC 2ZT6A 1Y3FE 4K5QA 5E6SA 3ZH2A 4I50A 2V9ZA 3TM5A 1YCFA 1CRLA 1M2FA 2OQ2A 3CLUC 3V46A 3DQZA 4A3SA 3TCXB 2CN1A 1P0CA 4IV5A 5AVQA 3EMKA 3ZJ5A 5J4VA 4BO2A 2DRIA 4WSOA 4CBVA 5FPPA 1DWPA 2IBTA 2Z2KA 3WWDA 4UCFA 2AQKA 3WDSA 1HY3A 1W93A 2H4WA 1VJGA 3P4UA 4Q02A 2CYAA 3KSBC 2XA1A 2YJ3A 3HSKA 4JUFA 1T4BA 5F77A 2H2IA 1FMFA 3ED5A 1S8FA 3GCZA 4L3OA 3EVZA 5INTA 1ONSA 1FU4A 1TE2A 4UMEA 1EBFA 4AS2A 2UKDA 1RT9A 4AP5A 1TB4A 4P84A 5BV0A 1LK5A 3RE1A 1QKKA 1QH1A 4CF7A 1L8LA 1TA4A 3JPYA 5KB3A 5KPDA 5SY4A 5KO2A 3WYDA 4ZN6A 1LK0A 4UM9D 3S4YA 5JAHA 2N42A 2GN4A 3D8RA 3EVTA 1I3MA 2DF8A 2XKJE 3B20A 3FGNA 3LZ6A 4Q4DA 2F9LA 1WX1A 3RRNA 4ILKA 2JAUA 3BK7A 4RKQA 1X77A 4BGUA 4DL9A 4F9TA 3IQWA 3PLAE 2WF5A 2EBUA 3BXPA 2HLDA 2A57A 1G2QA 3ZXIA 4POAA 1YJXA 3KQWA 3Q12A 1MO3A 3EF0A 4K8OA 1JYSA 5ALLA 3WYCA 4A2QA 4DV4B 2E82A 2ZSAA 3O90A 4N4AA 1JR4A 5TF4A 3O94A 1M1NB 1YD7A 5E4YA 1MH9A 1Z82A 3RTEA 1DJMA 3AEQA 2VH5R 4ZU1X 1T35A 4AMBA 3MVEA 3HDYA 4A4DA 1XWIA 1Z0IA 1WD7A 2CDNA 3EOAI 5HRUA 4ONEA 1QMPA 1X14A 2J6BA 1M1UA 4NS1A 1B1CA 2PV0A 4PGGA 2NVBA 1DCMA 1C1XB 1GQRA 3AC0A 1LZKA 3EIOA 4DA6A 3BIJA 5A3JA 4GMHA 3BZBA 2QIPA 1JFFB 3BHMA 5MDHA 3UXEA 1SUBA 3UPDA 5AOAA 4ER3A 2FW9A 1U0NA 2IS1A 1GUBA 1NPTO 2C29D 3EMBA 1J2UA 4GXTA 5AKKA 2VFAA 2GO1A 5BURA 1CZKA 3T1HB 1SWWA 2AXNA 2D1YA 3M33A 3PJDA 3P2KA 3MUNA 5H3CA 3SYNA 5CDYA 1E4EB 3PFHA 3RJTA 1LGYA 2OQRA 3PNBA 1IEQA 2IK8A 4RNCA 4DARA 5BMVF 1R74A 5DWQA 4OFZA 3U4AA 3WMWA 5IAOA 5SZKB 4LPSA 1B3BA 2PS3A 3B9QA 1I5RA 5KMGB 1SA0A 2I3AA 3WV5A 2GYYA 2PSHA 2RE8A 2WJVA 1WVIA 2XCLA 3SWWA 3A26A 1CFZA 2RKBA 4GZMA 3PX2A 1NW7A 1WIWA 3A1CA 3HR4A 2R6R1 4YQFA 1NKTA 5HZKA 1NJ6A 1DADA 3PDHA 4FFBA 4LOHA 2JRLA 1IM8A 5I9SA 2GZ1A 1XQWA 3FDJA 3KT6A 3Q8XB 4H35A 4KCGA 1BKSB 2GSWA 5I8ZA 1TD9A 1BWRA 3CMCO 4FYVA 4KQCA 5KAMA 2PK3A 4MUBA 2E21A 4F4FA 2VHCA 1XV5A 1WQ3A 4UNPA 5T4EA 3SKXA 4WKPA 1VDZA 3SDSA 1WP9A 1EK2A 5FX2A 2XGJA 2ICAA 1BCRB 1M75A 3DZHA 2XMRA 3MJCA 5F76A 3BVPA 3IOMA 5AUQA 5GJWC 3UGKA 1AMOA 2BM1A 4OU4A 5IF9A 2G5PA 3E2IA 3GG2A 4JJKA 2OLJA 1R6BX 1AU9A 3ABSB 3UUFA 3ZBTA 1JNXX 2BDEA 3PLNA 3RIMA 1GM5A 4RVGA 1XLUA 3WJAA 2DPXA 1F5NA 4G86A 3PRJA 1GUAA 1KEUA 1U8ZA 5T6MA 3TBFA 4DGSA 4U7HA 2O8CA 3TE6A 1XA4A 4AMZA 2Y27A 3L49A 4NZNA 2JGNA 3NYIA 1ZS9A 1G19A 1MEOA 4FEEA 4FQ8A 3QTTA 5FBLB 4TRNA 1N5DA 2ZAMA 1D0VA 3NEJA 4G3XA 2UYQA 2VDPB 2VWQA 2ZWMA 1J5EB 4MDFA 1SUSA 4TKUA 3VAYA 3ZWOA 1GZ4A 3W0LB 2AWNA 2EKBA 4DYHA 1M34A 2WDZA 3I6IA 4TMYA 4K9LA 5HCIA 4EYQA 5K3EA 2VQSA 5DHAA 2OAGA 2Y9MB 5C8YA 5JOQA 4KW7A 4A0QA 4EKNB 4DM4A 5C7LO 4D9EA 3HNPA 3TL3A 1YQQA 4KC0A 2ZR9A 4EEZA 3MPUA 2YHAA 4F6RA 4GI3A 1XZKA 3FOAA 4MVXA 4P2BA 3S2GA 3QKSB 3HLKA 1HNXB 2QN2A 2IOQA 3AXTA 5FNVA 1GCAA 3TOXA 1Y5LA 4HGYA 3AEXA 3ZD9A 2CT8A 3DW1X 3D7RA 4X1IB 4UNSA 3HVUA 3UEOA 2M6RA 3EGOA 1F14A 4MDHA 4QFBA 1U90A 1XK7A 2JCYA 2R68A 1BGXT 1VSQA 3AF2A 4FNGA 4L6AA 4L2IB 3UB2A 3CJQA 1A9PA 1AN9A 1WUYA 5H16A 5MN5A 2P8SA 2DUJA 1Y9ZA 1RYEA 4LRSB 3UMBA 4BC1A 1XLWA 1FNSA 1Q0HA 1O57A 2XHZA 2EYUA 3FPEA 3OT4A 3PHIA 1FQWA 3BE6A 2NUTA 2FDRA 5A03A 4LTMA 4ER6A 1KHTA 5JISA 1JLMA 1NTRA 3ENVA 4TTRA 1DXHA 2ZJ8A 5ETJA 2SCUB 2LDXA 3S99A 5GIPE 4NZOA 3GWGA 1H1LB 3JARA 4L22A 1GADO 4E22A 1OVMA 5MFZA 1TIPA 5JROA 4F8YA 1GVHA 2J9FB 2ST1A 4JK3A 4MGIR 4O63O 3SIXA 3WLLA 4KQWA 2VK2A 4MQBA 4MWBA 2GS9A 3R7FA 3D3KA 3KYCB 2IITA 4HLUC 3JQBC 2YN2A 1SPXA 4EVSA 2AMVA 2RGDA 3A6DA 3Q9NA 4GRIA 1RHKA 4J76A 3H3FA 4X1YB 5DX1A 1TC1A 3CO5A 2PGLA 4A15A 4P4GA 2GZAA 3FZYA 4HSGA 1Y4ZA 3UNXA 3LXXA 1CZNA 3DZFA 1TK3A 4KL8S 4BVJA 1T9AA 5BWNA 5FUQA 1MJGM 3QVLA 3I1YA 3RNLA 2X4IA 3A4MA 1WAMA 4KQMA 3GZNA 2G8NA 1OSNA 1DC6A 1KYZA 2ACEA 2H3EA 4FDTA 4JYCA 4KVGA 2UDPA 1MG5A 4M1OA 3IE1A 4ENVA 1UBLS 2FEWB 5JHGB 3EDRA 4CQJA 2BZ0A 3KD2A 1NWCA 3CZCA 2EKQA 2KWIA 4FYHA 2O59A 1Q44A 2GUWA 3HTXA 1E1CB 2D1TA 5F78A 2W11A 5G1PA 2P6NA 3HI4A 1YE8A 4FKBA 3UG6A 5KBYA 2GCIA 1ZR4A 4ZZ3A 1RBMA 4H17A 2XXAA 2NG1A 2CHQA 2JHFA 3A05A 1LDEA 3TW8A 1QUEA 4WAUA 3FLEA 2CCJA 2OORA 2BV3A 1PR0A 3AILA 3TRIA 2WYWA 4TYMA 3WHKA 4GD3Q 2X1MA 5BSHA 4C0SA 3WVNA 3BS4A 2ZSBA 3KHTA 4TLBA 1Q11A 2BFEB 2VSNA 1ZN9A 1THTA 2CZQA 3JWJA 1RACA 3V5NA 4EW3A 3IHTA 3O92A 4FMPA 1LX7A 2NT4A 4FS3A 1PGQA 2ROQA 1UF9A 2JAOA 4IUBS 4NOMA 2WOOA 2VLBA 2WHEA 3GNQA 4BNTA 5IJ0A 4Q6BA 1TECE 1HYGA 2IIBA 4QSHA 5B3LA 5L3QA 1WMBA 3QRWA 2EBFX 4ZRNA 4KFTA 5DLQC 5FYQA 1NBHA 3F6EX 4ISCA 4C21A 1OV6A 1U7WA 4XEHA 1M2WA 1Q1QA 1JDJA 2OT3B 4B6PA 2AKYA 1GLGA 4GXNA 2YYZA 3GLGB 1DIGA 1OHHA 3BD6A 4ZEOA 1EWQA 4RABA 2BTQA 4ZOAA 4GMFA 3ZHRA 2IU0A 3WTCA 2O8DB 3FPLA 1GQOA 1GG8A 1T2VA 2PR2A 4QUGA 4RA9B 1Q21A 2FZKA 3SYRA 1KI1A 3KAPA 3BMXA 4S3MA 2GM9A 3LL7A 4ND3A 4E12A 3AVUA 2QVGA 1ORRA 3T52A 2D06A 2QV7A 2QKYA 5DFAA 4N6NA 5BNIA 3ILXA 1E5VA 3VAAA 1SKUA 2KM1A 1TQHA 3NIBA 4FGJA 4QQKA 3ZYZA 4DA9A 3N28A 3BZUA 2HIAA 2B36A 4DWVA 3M49A 4BKUA 2OHVA 1QGUB 5DWDA 5IS2A 3RS5A 5K0SA 5EQJB 4CM4A 1PVOA 3MTGA 2L42A 3NU1A 4BQSA 2FQXA 1XDGA 1Y3CE 3IESA 5D01A 4ZT6A 3WO0A 1S02A 1E77A 2VYND 3AJ8A 4BMZA 1V25A 1EVJA 4LVOA 3JASB 1JIUA 4FDMA 2CK3D 2CLOB 4FTWA 4LFBB 2NZ2A 4AMYA 1ZOIA 1LVHA 1YVPA 2JGFA 2B83A 4R3WA 1TT7A 5G53C 3EUFA 4BRSA 3HVIA 3S6JA 3KTAB 1UJ4A 2QE7A 3N2LA 4O4JB 4XPZA 4RFSA 1UXHA 3LT0A 4B7CA 3KFLA 2EZ4A 3VHLB 5DGCA 1DRJA 2GBLC 4JKYA 4RIHA 1S4QA 1VG8A 2DTXA 4JI4B 4K9RA 1C3JA 3A1WA 4MR8A 2EVWX 1BH6A 3JWEA 2P2SA 3RT9A 1MMFB 1RPNA 2I6UA 3AR3A 3IGFA 3ZDYB 4B6OA 2Q29A 3W9UA 4MPDA 2UZ1A 4TMFA 1Q2UA 1T0HB 4EDFA 2ZRIA 5H9WA 3HJUA 5GZ3A 2R6DA 3GRZA 3ES9A 3HKBB 1DBRA 1H23A 4AG6A 4DQLA 1OTYA 1TO2E 3Q2KA 4X8LA 3SG0A 3H2BA 4L5BA 4B82A 1LC0A 3BWVA 4M0DA 4EBBA 4MAAA 4PRKA 4OB7A 2AOWA 1VPLA 5EIWA 5K3DA 2D0DA 3OFVA 1JX6A 3VU0A 5JBIA 4O29A 4AZ3B 2FPGA 2DYKA 3RHTA 3LCCA 2W4QA 1E8NA 3F90A 3I23A 3ZG6A 3HR7A 3EPPA 1YL7A 4OHVA 1YZTA 2FXVA 1BE6A 2NNLD 2GPBA 2NTVA 3K71B 4X90A 4GPD1 5KQSA 2R4QA 4J43A 5K09A 3BL5A 1CUSA 3NQ41 4YHHB 4Z4FA 1CHDA 1LA2A 1GRRA 3I62A 1EA7A 2ID7A 4ILEA 3P96A 3BTSA 2PANA 3TJMA 3MMXA 3VUFA 4EUSA 5KUTA 2F4VB 4KE6A 2GHQA 4DBVO 1X80A 4ME6A 1KZHA 1MO2A 1BN7A 2CXPA 2CZCA 2IYQA 1Y1QA 2X8BA 3OZRA 4JVLA 3K72B 3HP7A 1PWEA 3WWEA 5IN4A 2MSEB 4NBTA 1ABBA 5HE8A 4NSNA 4S1WA 2XTNA 5C1PA 3QWFA 4IVPA 4IIBA 4P6VF 1PFYA 3VZRA 2I9KA 2J6HA 2CFOA 1LBEA 2IYAA 4MLCA 3WRXC 4FOOA 4M8LA 2SKCA 1X8LA 4RNDB 3RO7A 3UJ6A 3PFCA 4A7PA 2E3JA 2IEDA 3QVXA 4HXEB 3I6YA 4MQ4A 3RSLA 16PKA 3TTWA 3TUJC 3M81A 4MPJA 3MS4A 2B6HA 2FETA 1HNNA 1FSSA 1BO6A 1NLYA 2HNBA 1SHKA 3G0HA 1K5GA 2GZSA 2PX3A 1DWQA 4U2EA 4M1MA 3MJSA 4TKLA 5AJHA 3W9BA 2B3TA 2B99A 4M1TA 5EKXA 1WUHS 1YS2X 2MSDB 1IONA 3C15C 3PRHA 1VC2A 2PMFA 3NVDA 3AJEA 3DFIA 3FHLA 2X3FA 5KYWA 4IJKA 3FHJA 4TN1A 5J2TB 2G1JA 2OTCA 1T34A 2J8ZA 5AOBA 4WOPA 2HA7A 2R8RA 2IQ5A 4NAHA 3CKYA 2FWIA 1FYDA 3HPRA 4LSGA 1BE1A 1B4DA 3FGZA 1E2MA 1JG4A 3E22A 3ESXA 3FDXA 4NARA 4ZDJA 1V95A 1JSCA 3MJDA 5CM2Z 1XNGA 2E5FA 2HGZA 1CDZA 2ZRHA 4BO8A 4TYWA 2IU6A 4DMRA 1SIOA 2DWOA 2XYHA 1OZGA 4ASUD 2QRUA 3VZCA 4IDAA 3FX2A 4V1CI 4RK7A 3NHLA 1GA1A 4S0XA 2X0EA 3VR3A 2BHSA 1S2IA 1Y1SA 1C9YA 4XFDA 3RVQA 4RWEA 1DX4A 3PQ7A 4FEYA 1AQIA 2BVNA 4AL4A 1QIGA 4EZBA 2GPNA 5KX5F 3IQGX 3ZE1B 5CB4A 3MIZA 1EFRA 1MHPA 2Z9CA 1BJTA 2PTHA 4HH1A 4QYWA 3MLBA 2AGVA 4B40A 1X7WB 2VP0A 2XVMA 4NU6A 5L95A 3MQ2A 1N1MA 3CGWA 1VFNA 2A1TS 3ZQ4A 4E70A 5LMCA 2RGBA 3DT8A 3LBFA 5ICEA 4H9GA 4BKMA 3FLAA 1N9ZA 3N6XA 1E7QA 2A59A 4C0HA 1X7XA 5ALZA 1W49A 2HZBA 5AM3A 3BL6A 4E4TA 1R16A 1T3ZA 1QAOA 5CLQA 3O3MB 4XD2A 5BVHB 4IIYA 4P7KA 3Q11A 5EPEA 2FH5B 3WI7A 1KZ7B 3HVRA 4RMHA 3ET5A 2HQBA 3FB4A 1FFEA 2JCSA 2HU8A 2CL0X 4NCJA 3V97A 1LTHR 1Z4QA 2BFFB 1P39A 1ZJYA 2QYHA 1S5PA 1T8PA 4ZREA 1ECPA 4EA7A 4Z3OA 2FRDC 2X5JO 3CUVA 4HGRA 2ZU6A 4R9RA 5HQTA 4UE3S 5BV1A 3N0TA 3SNHA 2ZRGA 3CNQS 3TO5A 1ILEA 1UL1X 5J4HA 4KQIA 5SZIA 2PH7A 1IXRC 2ABWA 4CG2A 5JO9A 4NESA 1VMIA 3MCTA 3OAAA 1VYUA 3I4LA 1UMBB 4FBLA 4V24A 2WAXA 3AW9A 5LZ7A 3WP0A 3CVYA 1C7IA 4QWWA 1AUXA 3LUCA 4HDOB 4DS3A 1XXHB 1UQTA 3BCHA 3RJ9A 4F5WA 3ICWA 1AKNA 2HADA 3MSXA 2ZRPA 2XWQA 4PQEA 4PZYA 4C7KA 5UKDA 3EMVA 3EVBA 1EM8A 2XW6A 1KH1A 4WNIA 1VG0B 3QW4B 5I7FA 4GL2A 4XWYA 1HEUA 4BV8A 3V1LA 3M1AA 2BKAA 2HW8A 2YWBA 5AW4A 3FTCA 1GZHB 1GUZA 4KGZA 1R00A 2RAVA 4UHHA 1RXVA 4FI3C 2VUSA 3P0IA 4WLFA 1OI7A 2QBYB 1T3GA 4HAWA 1FEZA 4X0EA 1IY8A 1S7GA 2ZZMA 1Z07A 3BL8A 3JVUA 3NAGA 4PYKA 1ULHA 5FEUA 1WO8A 4G0QA 4JUCA 1UEIA 4MICA 4UXHA 2ATXA 1ZEMA 2FRXA 2ZRMA 4BKOA 5FWYA 1Q7RA 3N2GA 1EDBA 1ZUWA 1XA3A 3WTBA 4YAKA 3ELYA 5FULA 4PFQA 4ZI3A 3VC3A 2DQZA 3B3JA 4H7JA 3MAJA 2QZPA 3T4EA 1D07A 1U3WA 4QGFA 2HYIC 1H8EA 2O14A 1FLVA 4II7A 3JQ8A 2RBGA 2ZS9A 4E08A 3OPNA 1BE0A 3ESBA 9MHTA 1Q0TA 2I7XA 4Q39A 1RYBA 2WM2A 3KX2A 4QGSA 3SQLA 5KNBA 3TIXB 3LX5A 1D0IA 1UKBA 2A94A 5F1OA 1J6UA 4DVJA 4JMLA 3UJDA 3OTQA 3R5XA 5CNJA 5DYTA 2XKAA 1XTJA 1XC7A 2XUJA 2ZAIA 1WDTA 5FR2A 2WSLA 4NZPA 2H1VA 3WMFA 3CQ9A 3ON5A 5F1YA 1VHLA 2NSDA 3T9AA 2QMQA 5JD3A 1VYVA 4LWOA 3PP8A 3NM6B 2ZYRA 2DXIA 1GP2A 1GOTA 3OPYI 1YB7A 3PD0A 3S5UA 3U1TA 4DIBA 2XOKA 4QOIA 2XB2A 3B8HA 1YO6A 3CVOA 4YRDA 5IT4A 4QJ5A 4CZ2A 1P6QA 4NFSA 3ZXXA 4ZJPA 1F51E 4Q3EA 2V45A 3EFOB 4TKVB 2WWGA 1TJ3A 3B2EA 4AS1A 3TNLA 5L7YA 1FXUA 1Q3KA 4CT0A 5T67A 4YFYA 3QXSA 2IZ0A 2KSQA 2D3TA 1XU9A 2E1PA 3JXEA 3NALA 3PCTA 2NO0A 2ZCVA 5EXPA 5TV2A 4AMUA 4B71A 4UCXA 4B3MB 5FL7D 3PGLA 2VHWA 1JIJA 4PFJA 4KSBA 2H48A 1N92A 3WYGA 2CL5A 1DBQA 1O94C 1Y3DE 3RG8A 1WQ4A 4BKPA 2F1HA 1DQYA 3WFJA 5HIAA 3M3HA 5HYVA 1Z26A 2GBGA 3P27A 4CFYA 1XOIA 2FQWA 3EA4A 3RRFA 4CKZA 1ZK1A 3IT2A 1YGYA 1UH5A 2JEYA 4G07A 1W36C 2YVQA 2D0OB 4UAUA 4P33A 3ST7A 4DGQA 3QUSA 1RYMA 4EYKA 4RXTA 1NBOA 4LWZA 1U0EA 3T41A 3KL4A 1GN8A 4KB5A 1A88A 3H2IA 4HPWA 3T7DA 4XYLA 4XDGA 2AV6A 1YIOA 1JIKA 1NF8A 1MORA 3E1SA 1SCUB 2BFDA 1ZVJA 3ZNPA 4R16A 1Z8HA 3AERB 5B4UA 2BCGY 3PXUA 3EH2A 1RHRA 2WJAA 4WJKB 2KJQA 2OBMA 1E63A 2Y1KA 3L9XA 3LQ1A 5DBIA 2XMZA 4P3YA 1ZD5A 5FV4A 4DLSA 4DV1B 1GKKA 4INOA 1FDUA 2BELA 1P6UA 3JALA 4M2LA 5FTKA 2TMDA 1FNNA 3B9RA 2HMWA 2P6OA 4C7MA 1QHHA 5EN4A 3W3AH 3JYLA 3O2SB 3PUWA 3T5PA 4IHQA 3ONEA 2FW1A 1JQBA 5EWMA 4X7MA 5IARA 4AN1A 3WNBA 1ZUNA 3MGBA 2W9XA 1EFTA 2IA5A 2NNWB 3D02A 8AT1A 1Q1GA 2AQHA 1Z38A 1KJIA 2Q4RA 3I58A 2PL5A 3JD4A 2FJUA 3Q7RA 2O2XA 1CZOA 4CKYA 1UEJA 2Q9BA 4MYCA 4C76A 2ILVA 1K7SN 1X7DA 4JHXA 4K9SA 2H85A 4LZOA 4EUNA 3TN7A 3U9LA 1E5DA 4EAQA 4D44A 2YWCA 2C82A 3QNWA 4YRGA 4IIDA 2DWPA 1TYDE 2HF2A 3PICA 3D6VA 3W6ZA 4NCHA 3BK2A 5TXGA 2W6QA 1N33B 2G9ZA 2PZEA 4M1KA 4MPRA 3IUEA 1RXCA 4QGHA 2QSJA 4KQGA 1QH0A 2Q3EA 2E6KA 4RJJA 5CMLA 1EB9A 4RDHA 2HT1A 3ER8A 5ALIA 3ZQJA 1U3DA 3QNMA 3PS9A 4ARZA 3NT2A 5IK2D 3DL0A 5HUHA 1ZJ4A 2OCKA 2WT4A 1F6DA 1KSFX 2R84A 3TRHA 1DL5A 3VH1A 5GTDA 1NYQA 3AHDA 2CXNA 3U7QB 5IYZF 5J2UF 3EG5A 2J6IA 3L7NA 5BXYA 2QTFA 1C8KA 2UZIR 1JP7A 5HFNA 4EPXA 4AP6A 3TAHA 3U80A 4Y2SA 4BNJA 3LXMA 4BUCA 3PFNA 4MWTA 4V3BA 3A3OA 1OUMA 5FRDA 4EBFA 5LMUB 4BPBA 3NHFA 3EGWA 1RI1A 4MCJA 4Z8YA 1PIWA 2IC5A 4I9FA 3ZTYA 3IEMA 4UHDA 2AE1A 1O9BA 1ATIA 2G25A 4IQ8A 1WWKA 2NZUG 1WXGA 2WIKA 2VYVD 4NNJA 4C0QC 2B7BA 3I05A 1JHXA 2HM7A 4NAUA 2N75A 1ZH0A 1OX4A 1C81A 1D2AA 1XI2A 2BFBB 2D4HA 2DSNA 2H1HA 4OK6A 5DBFA 5K3AA 3WZ2A 5LQNA 3GYBA 1NVBA 2QN7A 3HXPA 2JIPA 2B4KA 3CRVA 3EEIA 1QGYA 3GJQA 4I4LA 4QRDA 2FGJA 4MTCA 2GHTA 4DT1A 2J5QA 4A6EA 1O6GA 1UFVA 4FMBB 5DW3A 3ZWAA 3A2MA 4COKA 2IXEA 1N6OA 2FG5A 4NJEB 5EJIA 2XDWA 1L7QA 4ZT3A 1ZSVA 1W88A 3ISVA 4PE5B 2X8JB 2XNCA 4YCMA 1U04A 6ADHA 2JFQA 2ZM6B 1QJCA 1TO1E 2JFBA 2R5NA 3LVBA 1V96A 1Z0JA 1IEWA 1XQYA 4ES6A 5E9JA 4B6QA 1S1MA 3FTDA 3L7AA 5EIBD 3V2UA 3AJAA 3L06A 4DCGA 5ADUS 4JBIA 5HXAA 1DKMA 1V0JA 2FW8A 1ADFA 1L5HB 3DP9A 3G2HA 3QMWA 4GFDA 4PLZA 2XRZA 3VR6A 4GOOD 1AKTA 1W2HA 1HK7A 1OFVA 2HBQA 2GN2A 2IRWA 3NNNA 3O4RA 4XD7D 1C0LA 4BJ6A 2Q3LA 1SG0A 1SVMA 2QM8A 3ETHA 4J29A 4OGKA 4C04A 1G21B 4DLAA 1PGJA 4NG5A 5DF1A 5LKRA 1L7BA 1KGDA 3EXIB 3DAGA 5AM2A 2BCEA 3FE2A 3H2GA 4RK4A 2BHTA 1IH8A 1ZM3A 2BMJA 3EBLA 4L4UA 3C7KA 4LDRA 4DSAA 1HMPA 2C20A 4RQUA 1TKAA 2PGOA 2QUKA 3WZMA 3ZQ6A 4XWOA 3JWPA 3LZCA 3FGOA 1EGVB 2G40A 1GZ5A 2V6GA 3DE2X 3EDYA 4M0KA 1GWNA 2EQAA 4NC9A 1OC2A 3CSSA 1C9EA 3H16A 3QLJA 5EKSA 2IYYA 2WFLB 1I1QB 3JW8A 4H7IA 3JATA 2FSVC 4R3UC 3SZUA 3UK2A 3VPBA 1TX4B 3W2IA 4YP9A 1E2PA 1NBAA 1Z75A 2O2ZA 3E18A 3W3ZB 3L0CA 1PT9A 3H99A 4Q47A 4GX0A 4QARA 1KI3A 4LC0A 1AC5A 1Y1TA 2AL7A 2NUPB 2WSIA 3L41A 4G4SO 5SYAA 1WW3A 1KJ8A 3OOJA 2JAHA 1ZQ9A 3PNKA 2XRYA 4DDKA 1RRGA 3ZGNA 1TQ8A 1KSJA 3NRCA 1WZEA 2W00A 3LECA 4ND5A 3VSAA 4ZD6A 4ATNA 5EJ5A 3DMFA 4QUIA 4CDRA 3W9YA 1Q20A 1WG8A 4MQEA 4AO8A 1SUCA 5KJ1A 3UAWA 4UPEA 2GXSA 1XTZA 1Z9BA 3KPJA 4HLQB 2JGIA 5JD5A 3W8EA 5CCXA 4ZGGA 4F7WA 1TJ5A 1Q0QA 2BI8A 4HDMA 4AJPA 1E2IA 1EFRD 3C87A 3OOWA 3SFZA 4OIMA 4Q3NA 2A5YB 1DTWA 2XMQA 1W5TA 3CIOA 3ND6A 5FV7A 4RFLA 5IAEA 5BWLA 2QZ9A 1KYIA 3ME5A 2C61A 3G17A 3SZRA 3O7WA 2BMEA 4JP3A 3JVVA 1MR3F 1AK2A 1Z45A 4M0FA 1CTQA 4OY3A 2AXQA 3F7NA 3AZPA 3KT0A 4BCDA 1JHDA 3PE4A 4D0GA 2EL9A 2ID4A 3OVMA 1LKZA 2QD2A 3QYPA 4PVCA 4XSGA 5TPZA 4O2RA 1YVRA 1EHCA 4DR5B 1JWLA 4Z0NA 4N76A 4BFXA 3V3TA 3RHZA 4L51A 5CVTA 1CEYA 3HXLA 3JZMA 5BSEA 3DYIA 1RZVA 2ZTHA 3A9CA 2GAOA 4O4LB 1SIWA 5HF6A 4J0GA 2PJRA 2H18A 2X76A 4MCHA 1LI7A 3IUNA 1T8TA 5LPNA 4IMRA 2JBAB 3W04A 2I2CA 3D8TA 1UDAA 3LS2A 1NVUQ 4KXMA 5LQKA 4MUJA 4ND7A 1A0OA 2VVTA 1SBTA 3FMOB 1LPMA 4K6KA 4AMVA 1P73A 4AYTA 2JRCA 2Q50A 1XKLA 3A7EA 2RMKA 3GFFA 5TT0A 1GU1A 4BNUA 2I6SA 2R0QC 1JILA 1RHJA 1A8HA 1SKQA 1T8UA 1UK6A 1W0JD 2EEZA 2IL1A 1L4GA 1Y3BE 4B87A 3JVIA 3QEAZ 2KBFA 1G3QA 3O8BA 1M2EA 5DV9A 4H1UA 4XOIA 3VGPA 3KSUA 3BHJA 4CVNA 3KYDA 4TWJA 4WY2A 5DI9A 2A30A 1V7QA 4GSKA 2XEDA 3CPHA 1Z2CA 4YLYA 5J5AA 4NMWA 1NLUA 3IIEA 4M98A 4OOEA 4IZ6A 1WHTA 3OIWA 1DO8A 1U5AA 4DMMA 2YZMA 4CTJA 1K7YA 2IXBA 2PX8A 4LPKA 4PAMA 3U44A 2ZQ5A 3Q3GE 1UBGA 2PQ2A 3FCCA 1BA3A 3H1AA 4WKGA 4QXMA 2YJTD 2OO5A 1CY4A 3VYVA 1WVMA 3H2YA 4MW1A 3IUJA 4WWHA 4CNQA 5KTNA 2P77A 3AKEA 1RI3A 1XYVA 3USES 4RLQA 1EESA 4LXXA 1OXVA 2FG6C 5HM8A 4B3CA 4CMHA 1ORHA 5GGYA 3SSNA 2XCUA 3T7SA 5EZ5A 4GRAA 4OUKX 3R44A 2WHXA 3CLSC 3MBIA 5DEIA 3G8AA 5HDQA 4LY9A 4F2DA 1PJQA 3O1LA 4NU8X 1EXNA 4FHCA 5BN4A 2PBZA 4K05A 4JC5A 4R1MA 4DCMA 2HGSA 2CNKA 4P81A 3FPJA 1P60A 5CB0A 3TR5A 2WTUA 3N3BC 4FCCA 4IIEA 3RS8A 1E6LA 2R97A 4WFKA 4FX5A 1A82A 1WB9A 3ITKA 2CJWA 3DCJA 4JP1A 1U3CA 1SY7A 2QX9A 4G0OA 4PLCA 4BGVA 1NVDA 4ZQIA 1GLNA 2PXXA 3LIIA 3K2BA 5IJXA 2CHGA 3OLCX 3HDTA 4OTZA 3F7OA 1GKYA 4YRZA 2D59A 2G72A 4EYGA 2GDJA 4GOMD 1NW9B 3TD9A 3WGVA 2C8VA 4CL2A 1DT3A 1JHVA 4ZAYA 2VRCA 2X0IA 1FSZA 2VDLB 1HDIA 1Z5OA 2G9RA 1XWFA 1XZBA 4QREA 2B1GA 4BDTA 1YZGA 2PT5A 1NIJA 5EJFA 3IUSA 5AKZA 5AI8A 4EYOA 2L82A 5DM4A 1W47A 2VHYA 4Z4GA 4RZHA 3TTVA 3ZHSA 4ADSG 3LPNA 5H0IA 2OD2A 1PUXA 4I8IA 3KC2A 2QVCA 1OYOA 2WJJA 2BMAA 3FMGA 1GNSA 1X9GA 1T9DA 3EJ6A 4QOGA 1RWQA 1NNEA 4HY3A 2OE2A 1NV9A 4BE7B 1O9GA 1P5ZB 1KWGA 3FZEA 2ZRJA 2GNPA 1P9NA 3BSYA 5D3MB 4DNXA 5HEKA 2XECA 3K2QA 1NTOA 1Z6QA 2JAXA 3ZX4A 1LV7A 1SQGA 4CCSA 3GFTA 1CR4A 1II8A 1O95C 1SIUA 1BX1A 4KPGA 1BX3A 5C8DA 2NYRA 1QDEA 2NN3C 3VM6A 3QJ5A 1T2EA 4DG8A 3I30X 2AI1A 2O7VA 2GQ0A 2JI9A 4KAJA 2YX1A 3SP1A 2FDCA 4KHZA 2WSSA 5KTMA 4UHEA 1ZZGA 3AOEA 2WLTA 2ZSFA 1H93A 1WDKA 2PMCA 3CR8A 5KWEA 1WOYA 2KX7A 2D0IA 3FOWA 3E3MA 4EUHA 1R9GA 4RGBA 3C1OA 4UTXA 4FFLA 2VPIA 4DLTA 1KSHA 3FAKA 3KETA 1GSOA 1Z35A 4GI1A 3LWNA 1IBLB 1IBSA 1L5ZA 3Q3EA 4G0WA 4TKMA 1RIIA 3N2EA 1X1BA 5C80A 1C1YA 5LP6A 2JIOA 2YINC 3EPJA 3UUGA 3R09A 2EZUA 4A0HA 3HXQA 4HF7A 4NF2A 1ML4A 4J2OA 4GH5A 4N9QA 2EHJA 1XLVA 2C9YA 3V8PA 3I3SR 2IEAA 4B4DA 4DLYA 4DRZA 1EI9A 1JHYA 1UBCA 3E4DA 3HYLA 1MX1A 3H8JA 4OHYA 3E03A 3IA2A 4CKXA 1G9XA 1TUBA 4UAVA 3KQNA 3AKCA 1T2AA 5F33A 5AW1A 2X13A 2J7PD 3FZNA 1O0CA 4BRZA 4I9GA 4JR0A 4MSUA 4BV3A 2YIVX 2YKGA 4GYKA 2ODNA 3OJEA 5K01A 4NE7A 3L4BA 2QRLA 2HTEA 3G0IA 4X63A 1Z34A 4LJ6A 3M4NA 3ZWNA 3U4GA 5LOVA 1Z73A 4ZAFA 2EP7A 4ZDWA 1E99A 2BM8A 2R1VB 3D3WA 2V7XA 4TSFD 2YJZA 3NIDB 1HE2A 1NW3A 4U9IS 1XMQB 3I9KA 1OLSA 3RV4A 1BHQ1 2YHIA 4CDMA 2J5RA 3VU9A 3NDIA 5AKXA 2Y4NA 2QNBA 4WLUA 3MSCA 4LF5B 2F64A 1ORDA 3A1TA 1RLJA 2Z6UA 4D3YA 1NQWA 2A9KA 3P8ZA 2FKAA 3ZKWB 4Y9TA 4A0GA 4F86A 3FR8A 1RKBA 4IS3A 4Q3AA 3ND8A 1G8HA 3NV7A 3GY0A 4MVJP 1M83A 5ARDA 1SFRA 1BEZA 3ZZTA 1EVQA 3II6X 1VMEA 4ZAWA 4G26A 3PC8A 1M1ZA 3HDVA 1E2NA 1L7XA 2KYRA 4LHEA 4D4GA 2XGSA 3K9LA 3L01A 3UGJA 3LTNC 3FFTA 4RA6B 4KR3A 3ZE7A 4BGEA 1H8HA 4YGYA 2ETVA 3WMEA 1A7UA 3V1YA 4KXNA 2CNLA 4Z49A 3D31A 4RIEA 4YUXA 4LVNA 2H1SA 4GYYA 4DXHA 4NOJA 1BRTA 2J07A 1UKVY 2RGWA 3LA6A 3WNZA 4EY6A 2ZB3A 1N8NA 3NORA 5ER6A 3TKYA 5K4HA 2IZZA 1RYNA 4JT8A 2A5LA 2GZHA 3WLIA 1XEFA 2NO9A 3JQFA 2G8LA 1T9GR 1N5LA 1P7PA 3CO0S 1FFXB 1C30A 4G23A 4DTIA 3EA0A 4KJZA 3T5BA 4ENPA 3QFSA 4F93B 2I62A 3P45A 1R6UA 4OATA 1Z4JA 2M2IA 3GUCA 2EFYA 1Y33E 4OF4A 1USIA 2EJWA 5KU1A 2PUAA 1EINA 4HWOA 2NQ8A 2CLFB 1EZZA 4OXKA 4RM3A 5DX8A 3BILA 3GEIA 2WNSA 3VVBA 4K0KB 4Z3KA 1U4SA 2YVAA 4YUAA 4LX8A 1S8NA 1T5HX 1U28A 3SI7A 3ER9A 1OE0A 3MW8A 3C3MA 4MVJI 3L7DA 2VUTA 5AHRA 4TS9A 5THKA 4M60A 1IG0A 3PX3A 1JFTA 4G6ZA 4FOTA 2WAAA 4MEBA 2JLSA 2GCOA 2AEEA 1D6MA 2SKEA 5DBGA 3LXUX 2CBGA 2IBMA 3OPYA 5B3AA 3N76A 1DIOB 3I8XA 2B8NA 3RFXA 3V4PB 3VR6D 3VXKA 2WPDA 4Q9HA 4EYSA 5EJ6A 3ENQA 4UTNA 4MZDA 1GD1O 2X0RA 4ZVUA 4Y2XA 5DOVA 4ERNA 5LA6A 2OKCA 3FHOA 4RYLA 3S1AA 5DGTA 2LNDA 5D2CA 1PDVA 5F7OA 3ZU4A 3WLKX 3RKSA 2PXCA 1PL0A 3NM5A 5DN6A 5B1YA 2O19A 4MWSA 4IF6A 4FFWA 4M1EA 4ZXFA 1TQ4A 3B51X 3IHWA 4UHJA 2ZSJA 1HO3A 4YR7A 3IP6A 2Q8QA 2R3SA 2FMKA 3JQAB 5JMWA 3BE8A 1USWA 3PVZA 3BDAA 4BZZA 4NNPA 3HLTA 3R8CA 1YQTA 3EY9A 4P7BA 1SBZA 1UMDB 2HLPA 1E3WB 2CXUA 3AETA 4QTTB 5D51S 4CGYA 1VKZA 3T5TA 5KYNA 1I9CA 2ODTX 4LOAA 5L9AA 1ZD8A 3FTQA 2PDAA 3BWBA 3ZDRA 1GDTA 1NF2A 5JXJA 3DNPA 3IO5A 3R7LA 3E9YA 1EA5A 4DF3A 1FP1D 1ACLA 5ALDA 2YASA 5H5JA 4ACAA 4E5DA 2O5EA 1FJ2A 1VJTA 1OU4A 1QIEA 2XEXA 3K5WA 3NTUA 4PRLA 4DKXA 1SKYE 3IP9A 3MUFA 1GPBA 1NQUA 2B34A 2JCGA 4JGGA 3AFMA 4BFLA 3ZW7A 1L9XA 1E9BA 2IZOA 3PEEA 3H8VA 3QBEA 2NPIA 3NOOA 4HNVA 2Q6VA 3DMTA 2JLAA 1L4HA 3MT7A 3TSYA 2EC5A 2HSEA 3DMHA 4IH4A 4D4IA 2GZRA 4KE9A 4S04A 3ZGLA 2OHXA 1M8FA 4DW8A 4UMDA 1OT3A 1Z4MA 2F1IA 2F3UA 6AT1A 1CY0A 1TZBA 5DYNA 2PYIA 2JFYA 2UVQA 1D3AA 5AK5A 1V39A 4KVZA 5CT6A 3K5PA 4G5FA 1WUKS 3LCUA 3UMRA 4J0JA 3UT5B 4LOIA 4C6HA 3SEFA 3ZKAA 1PI3A 2ZUSA 2A0YA 4D9MA 1D6NA 3VR0A 1WBBA 1OAOA 2NU6A 1QOZA 4JFRA 4YLGA 3MS7A 3QE9Y 3WAKA 1LDGA 1Y37A 1YK1A 2PRJA 3N39C 1OIVA 1NYRA 3CGGA 4HB4A 4JAVC 3ETNA 4O4HF 1GDHA 4RWZA 3NFYA 3DYVA 5DHSA 2W6JA 1LLCA 4HQFA 4LJRA 2NV2B 3H2JA 1BX0A 1TCCA 1QVZA 2X22A 4BP8A 4RVHA 1DBPA 5HFAA 1M6VA 5KPJA 1EFVA 1FFSA 2Y9PB 4MYTA 3TZHA 2FA9A 1VPEA 4UQOA 3L07A 5GJBA 1DRVA 4DV6B 4HG2A 4D25A 1E0AA 3QXXA 2EKZA 5G0VA 4OB8A 1T2DA 3OURA 3BH7A 2VZ0A 4KUEA 1QO0A 4HPJB 1Q6YA 3GN2A 3CJTA 4RZQA 2F3TA 3RABA 3VU1A 2NYUA 2O0LA 3KSRA 4EB0A 2IODA 4WESB 1HYBA 2CLMB 2ET6A 5L3SA 3ETLA 3QU2A 3PTLA 1RZUA 4KYUA 4YMGA 3L0BA 4IDFA 3SX2A 2A8YA 3QVMA 3QEJA 5KIAA 4RHUA 4I4TF 4L5CA 4Y6QA 2G1PA 5JO0A 4F3TA 4UOQA 2Q9AA 2XJ9A 3LK7A 3UYKA 2H1IA 1BOOA 2A14A 4XB2A 5CXUA 2BHRA 1JHAA 4HQ6A 1TF7A 1PL7A 1O6BA 4IEEA 5DISB 2Q9UA 4O2AF 2BEUA 4UE2A 2IPMA 4GR4A 4F3KA 1LSUA 4IXTA 5IULC 2EF0A 3OX2A 4NOKA 4AJOA 3LCVB 4HEJA 2OECA 4IH1A 5LZ4A 5EYPA 1SN7A 1Y81A 4YALA 3L6RA 5HJ7A 4EPYA 3RIEA 1IOLA 1OPXA 1U2SA 2HHLA 3R3WA 5TR9A 3FSGD 4JVSB 4Y1EA 2XT9A 4WRRA 3SS9X 4C78A 3BCSA 3I2IA 2O3TA 4RHFA 5CYFA 2IXDA 3OQJA 4HAZA 2Q07A 3RHFA 3T7JA 1BXGA 1CC1S 1E69A 2ZDGA 4ALKA 4OI1A 5A5DA 2OFOA 1QANA 4IAOA 5B3JC 4NY1A 2BAGA 4Z9FA 2JBWA 5TVGA 1P8AA 2VXYA 4HRXA 1FLAA 1CJVC 2NO7A 3DULA 1HH4A 2QI9C 1VLQA 3GG9A 4DE5A 5CXQA 4OGWA 1FRFS 1L3IA 4R68A 1G7SA 3IEPA 2BFPA 4P2GA 1A97A 2CFRA 4G25A 3WYAA 1QLHA 4O5AA 3UK7A 2ZIEA 4JI8B 2Y1OA 1ADYA 4QNMA 1GEGA 4R1QA 4RLHA 2OCDA 5HS6A 1O0BA 1GCIA 1ZZEA 2I4LA 1Z0SA 4AB1A 1YJBA 4DZRA 3HDJA 4P34A 2E4ZA 3IRVA 4F04A 5C8VA 1GAEO 1KO5A 1RC1A 2JI8A 5C81A 1SOVA 2VA9A 2WF8A 1PJ4A 1QAQA 2XSZA 2QX6A 4HQ0A 5FHRA 2RI0A 4DJFC 3SX4A 2AHRA 3VTAA 5DMHA 1AGNA 4OKNA 1J0AA 4ZZ2A 3RPEA 3I0MA 2OHIA 1TVKA 1SBCA 1JDUA 1VRVA 1MB9A 3RFVA 1FVXA 3EGDB 1LY1A 1V4BA 4ZOQI 1E1QD 1Q12A 1NI4A 2RH4A 4FSHA 2CXHA 5EFZA 3M9WA 4JYMA 2PIAA 1YHYA 2WM9B 2YXBA 2ZYWX 1M1YB 3AEYA 1J0BA 5AW0A 3LBAA 2C1ZA 3EOBI 5P21A 4C7OB 1KKMA 4F1JA 1SQ0A 1ULAA 4DRXB 4HZUA 4IDHA 1IN4A 4LYAA 4JC8A 5HZHA 4PXYA 3M6IA 1B0AA 1DIAA 2LXNA 2ZAYA 1FE8A 2APJA 3V1UA 2CW5A 3BCUA 1QMGA 3R3XA 1WW8A 4MV0A 2QENA 2EKDA 5IUNC 3T4PA 2X23A 1C8BA 1DJQA 3CWQA 4LGYA 4NG4A 2QAGC 1XPUA 1GR1A 1VBNA 2IGTA 2PS0A 4HVAA 4J1NA 4L4SA 1OB2A 3VZSA 1JLRA 1LDNA 1EXMA 1SBIA 4HS9A 2ZYTX 1FX1A 4FMCF 4WIAA 4WPGA 3RTDA 3SSAA 2FPUA 3H1BA 1NUTA 2IF0A 4J49A 3FN4A 2OL4A 4P0TA 3ZDBA 3NHSA 3OETA 5IVDA 5JDIA 2O20A 1UBUS 4BX3A 4TWBA 4MH0R 4DLWA 2O8BB 2ZT5A 4H7PA 2EP5A 3MTQA 2OCPA 3T7KA 5A6SA 2AXPA 2C0PA 4IR7A 3WGLA 3QXHA 1QX4A 4G5QA 2NQ2C 4IHAA 3RBXA 1THZA 1NQXA 2P8JA 1WS6A 2AK2A 1H2AS 1ND5A 2Q6LA 3LOQA 1GTJ1 2R48A 3LT1A 2A5FA 7ADHA 3KT3A 2Q21A 3EQ8A 4Q9LA 1I7SB 3PLRA 3ZW8A 3KB1A 1YUNA 3ECSA 4EVQA 3PEFA 5A3SA 3UJNA 1A72A 1B15A 2KBEA 1U4OA 1T15A 3WYFA 1XKTA 1NP6A 4F5DA 1SHTX 3H9EO 2AG5A 4NBSA 3CVXA 3IV7A 4NBKA 3SVZA 1F20A 5HKKA 4UUOA 4B45A 3U60B 3HY6A 4DDTA 2CXRA 3A9WA 3OUUA 4ZC1A 4GM4A 3Q41A 5CK4A 2V3WA 1ISHA 3A31A 3D3QA 3UMSA 4BVGA 4YJ2A 3T3OA 1GTL1 3LFTA 1UFRA 3G23A 5CYPA 1RYYA 4GKAA 5BWBA 3HCWA 1XTUA 3EGEA 1GG2A 4C2UA 2RHOA 2TS1A 3B7PA 2XT0A 4BB6A 4GMXA 3R3SA 4PX3A 2OUIA 2BEJA 3OPMA 3PHLA 3TLJA 3CW2A 1GZUA 2BGKA 4M86A 1ODSA 4RSGA 3TF5A 2ZUBA 4YN3A 1Z33A 2PLNA 2ZSEA 3VKVA 4IFEA 4EGAA 3KRTA 1IIBA 2NZJA 3CLHA 1VJDA 3JTEA 2E5WA 3CIFA 4UXJA 5DM60 2PSJA 2EF1A 4K9KA 4QQ8A 3ADDA 1VE7A 3JU3A 2HUNA 2Y2VA 3HRHA 1YZVA 2ZANA 1RXIA 4G5RA 1KDYA 2O07A 1NF9A 1IVSA 2CUTA 1UQRA 4P1ZA 3WRWA 1H8HD 4C3ZA 1XP8A 1DAEA 3LGXA 4GVPA 1U2GA 3O91A 3IVXA 3KOUA 1SXJA 2C5FA 2YBDA 1E3EA 3LFUA 4M0CA 1IUPA 2PG3A 4GPEA 1G3MA 1KJYA 2FEKA 1QHEA 3BWEA 1AD2A 2JGJA 2WWTA 2PBRA 1XVAA 2B6NA 2XQIA 1RLMA 2ZFUA 4BVBA 1LDMA 1LRKA 1QS0A 4I5IA 5H3LA 1TADA 1UAAA 3PZRA 3RVBA 3D4IA 3GJ5A 1Q5PA 5K0BA 3FOZA 3RANA 1GNQA 4N49A 2PFSA 1H66A 1UKAA 3NC1C 1NATA 1YRHA 1WXQA 1XAGA 2GLUA 2ZROA 1X7GA 1HFKA 3LM8A 3TGWA 3ZY3A 4CM7A 1QYCA 3UUWA 4TLDA 2GN8A 3OE5A 2HRCA 3NMUF 3HKEB 4MR9A 1J2TA 3OZUA 3WA6A 2HQRA 2WRZA 4N5NA 2BRUA 1ISMA 1X13A 3D0KA 1QZTA 2GBPA 1USVA 1R8JA 5EXXA 3DLTA 5LXTF 1XMVA 3LY7A 4IV0A 4MKFA 3KKKA 4R98A 1DFIA 1NQTA 3HXKA 4TV9B 4URZR 1XHFA 1NUPA 3ESZA 3DB2A 2CVPA 3UY4A 2GRJA 2HK7A 1FUIA 1JYFA 3DTVA 2QL7A 2QN3A 3F1KA 1DXYA 1E6KA 3HRIA 4TUYA 4IG4A 4R8MA 3TFOA 2B5OA 2Z83A 5E7MA 2PVSA 3AF1A 2YMQA 4LMPA 3JVEA 3PD1A 1E7MA 2XDQA 5AFSA 3GFVA 3BA1A 5AVJA 1BH2A 4HNHA 3IAAA 3H75A 3IAXA 4ZRDA 5FWXA 3QYFA 3SBDA 4X5OA 4R3NA 3TQCA 1UC9A 4LJ4A 3N59A 2QPTA 1ONOA 1EK0A 1XJQA 3H87A 2F59A 4JYPA 2TECE 3AI2A 3DWIA 3WK6A 1Z2AA 1M2VB 1QQ7A 2FSIA 1EFLA 2PZFA 3BSFA 4QOFA 1XHLA 2KQUA 4JITA 2CJXA 4PZDA 2JPDA 3REQB 2QLMA 4W5OA 5LD2C 5BR7A 4BWGA 5BPFA 3ANTA 1NL3A 4F0JA 4ZOEA 1S3SA 1N8TA 2V6FA 4QNRA 2N3ZA 2HU2A 4CIBA 5JPDA 3IXLA 2HCTA 2LD4A 3AESA 4UBJA 4YUWA 2GVZC 4AZWA 1FNCA 4JGIA 4FYWA 3SC2B 4YQZA 3QJGA 3WL8A 4JC4A 1Z8FA 2B1JA 5ECWA 1GTSA 4TVBA 2DKNA 2W98A 1DJPA 2AUMA 4RJ2A 1MH1A 4YJ3B 2OBBA 3KZOA 3V4VB 5K8TA 1D2CA 4ESEA 3PG5A 1LBQA 1PT5A 1GPKA 5B3KA 2NZXA 2FNAA 2Q28A 1KJJA 5K6TA 4WK0B 1QFYA 1YJCA 5FF9A 1C7ZA 1IY0A 2V7WA 2I6XA 5JADA 3IXMA 1F2DA 2HN9A 5EY5B 5GONA 1YTLA 1P0FA 4NFHA 4WL0A 2PQ6A 4TMZA 3ANXA 5ABPA 1EHYA 2ZBVA 2J46A 4F8JA 1T3TA 3I6QA 1K63A 3WLAA 3OH8A 1JEYA 1Q0RA 2B7LA 4O08A 4C29A 1HGXA 2QP3A 1N6KA 5FL3A 4MVWA 1NKVA 4FONA 2MU1A 2WR8A 3R24A 3FKJA 3ELBA 5LZ5A 2H4HA 1LPSA 4W5HA 1W1WA 3R5TA 4MQFA 4CF6A 5EJ9A 3IKMB 1QAMA 1QBGA 1XDDA 3E9ZA 5TEVA 1D8AA 2FMIA 1X3SA 1Z5VA 3QE4A 2BR4A 3LY8A 5AI4A 4I6JA 3WYEA 2BLNA 4NVRA 3U09A 3E4CA 3LP5A 3EX7C 3EUAA 4NK4A 2EJTA 4W5WA 3M6LA 3N70A 3JQGA 1IWOA 1SQFA 1AHIA 3JAWB 3TDMA 1F38A 3M5WA 1VLHA 4EG3A 3ZZUA 2C9DA 4FILA 1DQSA 4LG1A 2WY2D 2P5SA 1U1FA 4JWKA 1BDBA 1PSZA 2HV9A 3ACCA 3EZFA 5HCUA 2VQ6A 1JIVA 3CUTA 4NTZA 3I5MA 4B8WA 5D3QA 1P44A 4AICA 1ACJA 1OBHA 4YECA 1WV0A 1YNSA 1K06A 2I66A 2QN8A 1GV1A 1Y8CA 4URUR 3DPUA 4KR6A 3IP5A 3K05A 2FPLA 3H9UA 2W83A 3W77A 3QVTA 2XMGA 3BDIA 1HZZA 3EYAA 2I91A 4B76A 1SHZA 4G4JA 1VYTA 5A4JA 4TWAA 2QEQA 2GAFA 1CZRA 4HBZA 5SY6A 1N5IA 5I9LA 4QODA 2OGUA 1GSAA 2C3YA 4N1AA 5FKJA 1O5IA 2Z5LA 2DPGA 2ZRNA 1BJKA 2O1WA 4WGFA 4RTLA 3FYHA 2FK8A 3DVLA 3F5QA 5I7WA 2I2XB 4LOLA 3BE4A 2HO5A 4IGKA 3AX6A 3GHYA 1EDEA 4L3VA 2C7PA 3SPXA 1MO6A 3LQRA 4OUDA 4XSVA 2FTKE 4OYLA 3KKNA 3T5DA 2OCYC 1GNLA 5A7HA 2AZDA 5IM4A 3EZ2A 1FMCA 2VDMB 2G5CA 2ZDQA 2QT9A 3GDHA 3L7CA 1TPZA 4L0DA 4X7PA 4EFKA 2QAGB 3SQOA 4OP3A 4XRRA 5E8RA 3VNVA 5C7YA 1KEEB 1RWKA 2JZOA 4M22A 2UAGA 3WWCA 4R84A 4R1LA 1M3SA 2X6QA 1U8XX 3H5TA 1OC4A 2OOKA 1M1NA 1DMSA 4FW9A 5F9MA 1RCTE 1ZP6A 4Y6OA 5HMMA 4KPEC 3GR6A 5IAKA 3PQEA 4Y2VA 4DJJA 3W3AA 1NNLA 3U4IA 1DCTA 3VR4H 3QKTA 1C14A 4LRTB 3T3PB 4F2WA 3P5SA 1XTQA 1E3JA 1K8QA 1CP3A 3LAWA 3IA7A 1XFDA 4AKEA 4U5XA 4M8KA 1E1YA 1W85B 1Z6GA 3VOSA 1XA0A 5KYTA 3NDBB 1J06A 4ZRMA 3Q3CA 3UTDA 4D43A 2ECQA 4FB5A 3DBLB 5B2FA 2CNNA 1CWUA 1KAOA 3G5LA 3P9PA 4JLPA 1NXQA 3L82B 1NURA 1T6NA 5TMBA 2P4QA 2QTCA 5BUZA 1YR9A 3U56A 4DR1B 1E4EA 2OP0A 4GWGA 2EGUA 4QC2A 4TX1A 4UHCA 1NX6A 1RVDA 2FP3A 4S24A 5FUXA 1N9KA 3GJ0A 1M7HA 3ZIAD 1KVRA 2HHCA 2SHKA 5A3QA 3NTQA 1W4LA 2GB4A 4WNCA 1M6HA 3SHOA 4B8ZA 3WAGA 2LP4Y 1CUXA 4QQRA 3DFMA 2XX3A 3KJEA 3KQPA 3TINA 3TYXA 3U7FB 2Q4OA 4ZVQA 4NENB 3G9QA 5AD1A 1JI0A 3VI4B 2QN1A 5K05A 3TKAA 1DBIA 1EGHA 2ADOA 3LL4A 5M34A 3DE1X 3W8FA 4ASUA 2QSUA 1BCRA 1AQJA 2ZJFA 1N75A 3GNTA 1IQ0A 2ZM5A 3VPCA 2A86A 1ID1A 3O1JC 4K9DA 1YMQA 1IG3A 4I6GA