5B2FA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (phosphate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Putative uncharacterized protein PH0499
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2fA00
1Q74A 3DFMA 3DFIA 1UANA 3WE7A 2XADA 4XM0A 5BMOA 5CGZA 4XLZA 3DFKA 3DFFA 5B2FA 2IXDA 4EWLA 3WL4A 3WL3A 5B2EA 2X9LA 4XM1A 1Q7TA 4XM2A
chains in the Genus database with same CATH superfamily
2QDKA 5G02A 4C3ZA 5GVSA 4PSAA 5LP6F 3A3YA 4B43A 5K3CA 2H8KA 2VSNA 3D6FA 3L8HA 2E3JA 4X6UA 5E9WA 3ZYCA 4Z4CA 1IJFA 1W8IA 4OQMA 1WVGA 1NWHA 3PWZA 2PMEA 4JI3B 4AP5A 1ZAYA 4C14A 5TT1A 1P0MA 3MUFA 2HB6A 3K9FC 2HEGA 1P91A 4GX2A 2WC1A 4DMGA 4RL6A 4G5OA 2NTNA 1QIGA 1ECCA 1X8KA 2HBYA 2KWIA 2OXCA 1L4FA 2VPIA 1U9ZA 1W75A 4HAOA 4HLUC 4Q1VA 1U28A 3CG0A 3MJVA 4QXPA 4ZAGA 1YQDA 4YP9A 1U1IA 4FHCA 2VYFA 5LQCA 5CM9C 3T7DA 3T7RA 1Q0SA 4RORA 2C9YA 5JROA 3DH0A 4YRQA 1G98A 3UHFA 3I5AA 2WOOA 3T5PA 2WNIA 4XFDA 1U2GC 3EC1A 4B6GA 1KAMA 2VPPA 1LTQA 3BMOB 4I1UA 5H68A 3FAKA 3PUZA 1L9KA 2QP9X 3KVYA 4ZXFA 4LYYA 5B1SA 4F2WA 2AVNA 1U1CA 4IV0A 3GLIB 2E4UA 2Z58A 1FFBA 2H1HA 1KMNA 2CDBA 3UH0A 1UBMS 5I7RA 3U09A 1R0ZA 1F06A 4H1VA 2CNNA 2J8ZA 1W9HA 3EZ6A 4FD2A 3ZIUA 1CUBA 4LJ4A 4DZZA 1HOXA 1G3QA 2YV2A 3EA5A 2QW0X 3LL7A 3OECA 1U65A 3OZEA 5GV8A 3M34A 3WJAA 3ZD6A 5B12A 2KBEA 1ILWA 3COJA 4QXOA 1SA0B 3T3NA 4WK2B 3C7DB 4CRWB 2JFOA 2QD2A 2YASA 3LPNA 4P82A 4WN9B 4PVDA 5ARDA 3N53A 2O19A 3KT0A 2XCIA 3SD7A 1THGA 1DO0A 1TLFA 4PPNA 4BP9A 4FEAA 3R2JA 1JIKA 3JQRA 2GZHA 3EW7A 1ETUA 1NXOA 4ILKA 1FUIA 3RFCA 4FE7A 4C0AC 1QYXA 2PZFA 3D3JA 4HWGA 3UCEA 4AN0A 3MMSA 3DL7A 1XYVA 4C06A 2G8LA 1HKHA 4MZDA 2IW3A 4PS0A 4S1VA 2CL0X 2BUBA 2R4TA 1FSZA 2WWXA 2RHMA 3K05A 4KFSA 1BN6A 4FI3F 2AE1A 1O0SA 4R83A 5DGTA 3THWB 1A2KC 1GTG1 5FBKA 4RA9B 1JBQA 4L9WA 4WEOA 3T41A 3IBGA 4KN6A 1FNDA 4HRAA 4HXEB 3LCCA 1FMJA 1T8RA 1AS3A 2P6UA 4MB6A 4P4SB 1BYIA 1G18A 4R0NA 4YQZA 3HK2A 2D8MA 3HSYA 1K8QA 1RC0A 1PYOA 2ETVA 4WZBE 3BA6A 4W5NA 4ZV9A 1FTYA 1D2AA 3OPVA 5GAJA 3VGPA 5DWQA 1ZRSA 5CH8A 2GAIA 1KEPA 5IW8A 2YWXA 2YW9A 1LDBA 4MULA 3WG9A 2VCEA 4NMXB 2A8YA 2P5UA 3CZMA 3PFHA 1K3UB 1D2GA 4Z49A 3U3XA 3ED1A 4YLGA 4ARUA 2H1VA 2XF8A 1PFQA 1UOOA 2ODNA 3IQFA 2Q5LA 1PT6A 1NF3A 1NJSA 1TI7A 1TFUA 2JGRA 2QJRA 1P8AA 2QN7A 4RLFA 5IWAB 4KZPA 3MHTA 3SKYA 2B8EA 2CZQA 3IJRA 3OEHD 3TRFA 4M0EA 5HZKA 2BD0A 1U2EA 1C7ZA 1H05A 1TKBA 2D59A 5KSPA 4DABA 3G9TA 3ZDDA 1ZKMA 1AU9A 3WL7A 4UVGA 4F9FA 4D0NA 4EECA 1KJWA 1JFTA 1TEVA 1W6RA 1ZW6A 2PX8A 3F2IA 2VWPA 4UNQA 3U4CA 3EIFA 3V4VB 4TPKA 1DQYA 1XDUA 5ITSA 4RHXA 4JLAA 5DT9A 4C01A 1ZQ1A 3HR8A 3AWDA 1FBNA 5ADWA 2WSBA 4MUMA 3AVTA 1P2DA 4JI1B 1VHQA 1CQIA 3ADOA 2WJJA 5JSKA 2NSHA 4J75A 1OC4A 4L4YA 5DTQA 1O5OA 1VLHA 2XMCA 5D6NA 2MR5A 1VJCA 1DXHA 1T8YA 2JB9A 1RI3A 2NXCA 3QMWA 4OA8A 2J0UB 2WQ7A 1WB9A 3ZCSA 4QLBA 1PWZA 3I39X 1W85A 3UQYS 1Z2OX 4YK7A 5THQA 4FT2A 4KTTE 1RR6A 3RSOA 4KBFA 3E3NA 3FVQA 2X2EA 4LJAA 4JKIA 1MB3A 2XV1A 1WU7A 1P1IA 1Y1TA 3DE4X 3KWLA 3PS9A 5EPOA 1M34B 1N32B 1CF2O 3K2QA 3O4IA 1ENZA 3ENKA 3L7LA 3PXDA 4LW8A 3D8UA 3U62A 8LDHA 2Q5JA 1WHTA 3DEYX 4II2A 1SC3A 4RF2A 1QR6A 2CDNA 4WZAE 2JLZA 4G97A 2WB2A 1BXGA 3FPCA 2QYTA 1Y7TA 1WEHA 4JT9A 3UGJA 4KXNA 4CI9A 3UMRA 4GOXA 1CQJA 3DO6A 2PMWB 4WKNA 5EZQA 4YIKA 1DBVO 3BZUA 4UM5A 1PVDA 1SC4A 3FPJA 4JVNA 1K8ZB 1E3DA 1N2CA 3D2LA 3NFRA 2AD5A 3DCNA 4KL8S 4KXLA 3SK0A 1C2TA 3UGTA 5EIFA 1E8NA 5IF3A 4C4SA 5IT4A 1ZOIA 5BSFA 4DLPA 1CETA 3D31A 1EFUA 3K4QA 1OHHA 3PF8A 4K2HA 2H92A 2PUHA 1I3KA 5DGHA 5LYJA 3K4PA 4ZI2A 1GKLA 1PUIA 3L4SO 1IEQA 2AG5A 4YRTA 3TSOA 4KK3A 1N5DA 3GP8A 3G2QA 2H54A 2KW5A 3JQCA 1IZ0A 4TVSA 4FZJA 4TS9A 4Y1GA 1GZ7A 4YRNA 1Z0FA 3IKVA 2P8JA 4AY4A 5FOSA 1MOPA 4X1KB 2FR1A 2WNHA 5DO9A 2DPXA 5DEIA 1R8JA 4JJ8A 3B3AA 3E5HA 3HG7A 2O0LA 4QWMA 3RSLA 4BQIA 1H1LA 3JQBA 3RS3A 4H6PA 1AH2A 2XOXA 3G02A 1R0SA 4IDOA 1W47A 1JNXX 2DM6A 3RHZA 1IOVA 2ZRFA 3CH5A 3HVJA 1RQPA 2Y05A 1UP4A 1DS6A 3F9CA 1JDBC 1IAVA 3CUTA 1H6BA 1J0BA 3DUFB 1Z47A 3KNZA 4XFKA 5CT9A 1EGVB 1YKSA 2HWKA 4WLFA 3PVCA 4AS2A 2R2AA 4PRYA 2Q3CA 3SVLA 1MIHA 3LLCA 3ZCVA 3G6KA 2IS6A 1NZFA 1UKBA 2CFRA 1V2GA 2X77A 3LO8A 4KRGA 3U3RA 1DIGA 5DNAA 1NY5A 1S2DA 3OT4A 4EB3A 1T25A 5TJHA 2XX3A 1KOLA 3WRVA 5SYMA 1JU9A 4YBRA 2FFRA 1Y7HA 4BZPA 4ND5A 1HBJA 1OY1A 1XB2A 4QYTA 5IWCA 4OH1A 2GPWA 2EW1A 5C35A 2WUEA 4XCQA 3OPXA 4KUGA 4DSUA 1KAQA 1SQ6A 4YCNA 1HI9A 2FN3A 3ETCA 2ONKA 1MORA 1WW2A 2EQBA 5U4XA 3UK7A 1J2UA 1A69A 4I5EA 1VPTA 4TVKA 2NZ8A 4GM0A 5F7XA 1YRBA 3ZVLA 2C84A 4P34A 3L8EA 2FUEA 1U8YA 4BX9A 1O77A 1WLYA 1XT6A 4JHXA 1KY4A 1P7PA 3ZU5A 4NPCA 4YDSA 3DHNA 2FX2A 1OBHA 2I66A 2X9NA 4GICA 2H59A 2UUOA 5K7SA 1W4RA 3DOIA 1QJCA 2C2WA 2R6JA 2BGLA 3DAGA 3O9VA 3T7KA 4GSLA 3H75A 5BV0A 1JF8A 2PV0A 2YWHA 4ETIA 3NOQA 1GXSB 3C5EA 1W46A 3IP6A 1SC1A 5KOYA 3F7MA 2HDHA 2QQFA 1V35A 2CHEA 1QU3A 1FDSA 1HF3A 4NKRA 1HPLA 2ZE7A 2J5KA 5B6IA 1FVFA 1QKIA 4JLJA 4O4HB 4JP8A 4E09A 4R8LA 5FUQA 1W1UA 1CJKC 1HDCA 3BQNB 4FI3C 4LRTB 4ETNA 2J3IA 4JT2A 1D7AA 1GILA 5EERA 2AZDA 2V0CA 3ZCTA 1C8VB 3TTUA 4B4DA 4B6SA 4PANA 3V9PA 3ZD9A 4C22A 3L5OA 3MVEA 3BD9A 5E1MA 4EF5A 3SZRA 2OM2A 3TSZA 4Z1MD 1JI3A 4LRSB 2PFGA 5JLJA 1E2HA 3VR4A 1DO8A 2UZ3A 4OAQA 3KYIB 4HLUA 3DS8A 5BSVA 2Q1WA 1KSHA 1E64A 3EARA 3NRBA 2J9FA 2FA9A 2AC4A 2XWJI 3EIWA 3QXXA 3C7TA 5DYNA 2LIPA 3H6HA 2GM3A 4X6LA 1Z6PA 5IAAA 5KYUB 2PM8A 4FLEA 4A4DA 1NE2A 1LNQA 1YJCA 4I55A 2SKEA 4YA6A 4TMKA 4ZPXA 4BVLA 5CT5A 4YCCA 4KN5A 5JYEA 3F5SA 4XFJA 1XVVA 3VZPA 2ZJ8A 4BB5A 1G4HA 3RARA 2AE2A 5LXTB 1ID8A 1AKRA 4FKMA 5B6JA 1LPSA 4Y2TA 5H80A 3S81A 4E5PA 1M6YA 2W6PA 4WX2B 3DHYA 3OSUA 5BQPA 5JTTA 4M0KA 1I5RA 1ODSA 3T61A 2QR5A 2B9VA 1UK7A 4Q12A 4QNRA 2O1SA 4N5MA 4HDSB 3SYLA 4WGFA 4JI5B 4AF7A 1WULS 5K0ZA 3R7FA 2YQ5A 5K3EA 2JFWA 5E1OA 4BQQA 4GWGA 4OTZA 2M6LA 1KJQA 3U7QA 3WHKA 4YRPA 4XPZA 1JQ5A 3BAZA 5KB3A 5TSDA 2ZITA 4ZA2A 3H1TA 3L5KA 2QZJA 4LBYA 3W9SA 1V7QA 2Y99A 5LQSA 3ZZTA 2J32A 3LT2A 4CMGA 4PCLA 2ZT8A 5JOQA 4WTOA 5JCJA 3ZXSA 4QG3A 4NFHA 1EXNA 4XQ9A 2P69A 2H5IA 4URZR 5K3BA 4Z0HO 2J48A 3VHRA 1G4UR 4S2EA 1REQB 4YYZA 3FLAA 1IONA 3RVQA 1LDYA 1HY3A 2OCXA 2CXPA 1BTOA 1JSXA 3CPJB 3EDOA 3KV1A 5DIFA 3W9UA 4ARSA 1GSHA 3DTVB 2JKVA 4B3SB 3BK7A 4IJKA 4R1MA 3AR8A 1ZJ6A 4P93A 3HJBA 4LXXA 4BNNA 2OORC 4IMRA 3OD5A 4P31A 5SZKB 4CV1A 1HDYA 4UVHA 1H22A 3K6KA 3KSDO 4CKWB 3ZIAA 4HS9A 5HW0A 1QG0A 3AETA 4ZO8A 1EJBA 3Q87B 2HA7A 5JMOA 2B8JA 5AI9A 3JQQA 1Z5PA 4NTZA 4OJYA 2HJRA 1E2PA 4ZYUA 1GSIA 4X1KA 2DBZA 4IDPA 1J8YF 1QAMA 3L8YA 4H6VA 4O1IA 3V2HA 2FP3A 3V3KA 3VTFA 3WE7A 4NZOA 3NVMB 3OAAA 4AF8A 1QR2A 2EG9A 4OHXA 1NF2A 2AKYA 3CXUA 4E2XA 5FP0A 1ONSA 4MKXA 3FCCA 3D2AA 1HWYA 1L5LA 3HVUA 2XITA 3C8ZA 3ZJYA 3FVTA 5KX5B 1UBCA 2R48A 1KOJA 1ZLYA 1NI4B 3D0OA 1OBCA 4XOIA 1DQSA 4DWOA 1AVTA 4PLYA 5D86A 2VQDA 4PN7A 5E3HA 3PSAA 1VHDA 3GHHA 2YDXA 3L8GA 4YPFA 3ZD7A 4XPIB 2QZ4A 2N3ZA 3C3DA 3WLOA 3CKLA 2WPNA 4PSUA 5SZJA 1G63A 3KKQA 4GAEA 3H9UA 3R5FA 4HB2A 3PUHA 5ELLA 4OHBA 4M53A 5D5PA 2G76A 1UXHA 4Q4AA 3KDAA 3BXHA 4KQ9A 3MN1A 1OD6A 3I5MA 5DX1A 4QBIA 5LD2C 2PUVA 1CUEA 1K7CA 3UUFA 4AU1A 3T1YB 3PNOA 1IG3A 4DLNA 4JSTA 1K4MA 2ZJ1A 4J0IA 5A3QA 1M34A 1AGYA 5BWNA 1QGAA 3P9ZA 4XYEA 3IQGX 4OOEA 2EJVA 2BHNA 1HMPA 3BQ9A 2GZ1A 3C3MA 1MEOA 2VSXA 4C0XA 5FWNA 5FIUA 4YO7A 3E3OA 5T64A 3JWIA 3VQTA 3R6GA 4RTKA 4I99A 2H8GA 3YASA 1V6SA 4DVGA 1QZTA 1UKVY 2H4HA 1JNYA 2I8AA 2XCOA 2NYRA 2N9UA 4YAEA 3HZHA 5FD8A 3ICVA 4QTUB 2I29A 2QPLA 1BW9B 1YUNA 2SHKA 1TMGE 3FXAA 3KXKA 5HF5A 1DUSA 1E0JA 2ZJZA 2O50A 4WA7A 1TJ4A 4KNVA 2W22A 5TGTA 4CV2A 5L6MB 4OGKA 2Z6UA 4WK6A 1QQ6A 2WU0A 4WECA 4L3WA 4V0RA 3RTGA 2R47A 5K3SA 1DAIA 1M0SA 3LP5A 2XYVA 2VHQA 2FE4A 5CLQA 2YN2A 3FSJX 4XQGA 2EBWA 5F64A 2FEXA 2UVPB 1KDYA 4NCHA 4DCSA 4RU1A 1Z8HA 2AGVA 1DIHA 3FYTA 3ND7A 1ZGZA 1JJIA 3NX4A 4L16A 1Y5NA 4GPBA 1EZ4A 3HWSA 1UBNA 2B34A 5A5EA 3NV9A 3D8TA 4FMCB 1L7RA 1I7DA 1QM5A 2E6KA 2AX3A 2QLTA 4GPEA 4E31A 1W44A 3PLRA 1N2IA 1PG5A 5J63A 5LBTA 1WEKA 3HP1A 4BO0A 2WTUA 4MQLA 5TY0A 2IU0A 1DE0A 3CA8A 4IH1A 1ZUNA 3KZXA 1U2PA 3A27A 4DA9A 1QE3A 2C4HA 3AUJB 1J42A 1V8FA 1FE8A 5IM4A 1V25A 4DR4B 3GRRA 5DKFA 1KZ1A 1N7JA 4A0FA 2VHCA 3KZVA 3HLYA 4HLNA 2CK3D 4RKYA 3U40A 5EFZA 5J47A 3IT1A 4MO2A 4NULA 1XALA 2RK3A 2WM8A 4HN2A 2OHXA 3KU1A 4QBTA 1KF0A 2L2QA 3ETLA 1M2EA 3ILSA 4NFSA 2V3VA 1X7GA 2H85A 2PX6A 4X1IB 5AJWA 4A8TA 4DCJA 5K3FB 3GZTB 5B30A 4PSVA 4ZQFA 4XGRA 2LRHA 1FZQA 3ANNA 3FROA 4O3FA 2GK3A 2WJ3A 3TZQA 1UZNA 2ENUA 5FUVA 4Z9AA 1XJ0A 1R10A 3AI2A 4JLVA 2R9VA 2H65A 3IQEA 3K72B 3EVGA 4CL0A 5I7UA 1Q11A 5F1OA 3SC3A 3HVHA 1AS2A 1AMNA 3IA2A 1RQ7A 4S0ZA 1CEYA 1DCKA 1UM8A 4PC3A 3AB8A 2JCYA 2FJ0A 1Q83A 5EWLA 3I9FA 1GGFA 1L5VA 4I4LA 4WWHA 3OG9A 4G65A 1KVRA 1GUDA 5HVNA 1DWOA 5M04A 4DUZB 4IDGA 4NICA 4I9FA 3QG1A 4OA5A 2GCIA 5AKLA 3N2LA 4CKCB 4JYPA 4AI6A 1Q77A 1T2CA 4Y2XA 3QTLA 1W8DA 1GVNB 2HBRA 4PIPA 4WCVA 1GEGA 2WU4A 3OETA 4IDEA 4DR5B 3HDJA 4PSDA 3GCZA 1U3GA 3HGQA 3FNFA 4YJKA 2UZ0A 4HEJA 4MRMA 3C1AA 2P2NA 4PZZA 4QU0A 5AW7A 4YCAA 3EXEA 3WAGA 2QVCA 2YC4C 3H9BA 4Y6OA 1X13A 2WIFA 4JI7B 2C7GA 1V6AA 4ZVSA 3L0SA 1G1MA 1RVDA 1ZN7A 4OLFA 2E9SA 3OQNA 2FYTA 3IXMA 4HAYA 5EPEA 3ZX5A 2DU8A 2QBYA 4R2KA 3SKXA 3BT7A 2ADFA 1YRQA 3ET4A 1EWKA 3S5UA 2CV2A 2FCRA 4W8OA 1EB9A 2PKYX 4FDMA 1SPXA 3QU2A 1L7PA 1UDAA 5SICE 1SM4A 1P7ZA 1WCV1 4MYDA 5JISA 1HNXB 2CJXA 1GNSA 1I1OA 4V03A 3GN1A 2AJLI 2H4YA 1KWGA 2ZBEA 3U7EB 3BK1A 1YL6A 2ZREA 5JR3A 5JS6A 3DAHA 2R7KA 4JL5A 5CHEA 3DL0A 2R00C 1Q1ZA 2FNAA 2JGJA 3RVKA 1G3UA 3O2NA 2VUIB 3F71A 3D6VA 3HB4X 3T9AA 4EI9A 2WOJA 4U2CA 3DWGA 5LM3A 1YMQA 4Q7KA 4DQXA 3KETA 1VHJA 2AEEA 1KDRA 4YACA 5CGQB 2NMVA 1M73E 2ZIXA 1QB8A 1QG2A 5LXTF 2JFNA 1YB2A 4HAZA 3U1BA 3EZGA 2OGZA 3QJYA 4Y8VA 4EAQA 2QVXX 2GBPA 1PFUA 4OQQA 4F12A 5JZMA 3WQBA 3DBOB 1RZRA 1E3MA 2QM0A 3ANSA 4GLLA 3VHLB 4LWQA 1IXZA 1E20A 3PC7A 4LSMA 1Y8QB 4W7SA 3G5TA 2AIRA 2ECOA 3A1FA 3MIIA 3I9NA 4Y9RA 3ZY3A 5JO0A 1R4NA 1NQUA 1SXHA 2QV0A 2QJWA 4LE1A 3KUUA 1X7YA 2VOJA 5C5EA 5KVSA 1OLUB 3CLUD 1V47A 2HV8A 3C1UA 1QYWA 3PQ2A 3OO0A 4DV2B 2WJGA 1XXHE 1E62A 2VQSA 3I04A 1UDWA 4F71A 1T5IA 3GH1A 1JHOA 1XZMA 3SXUB 4M1YA 3AHFA 2GFIA 3UF0A 2R86A 1F1JA 4EKYA 1UWLA 2F59A 3FW1A 4OK3A 3QX8A 4R1SA 4DLAA 1QPBA 3I53A 1RYZA 5DB4A 4A2QA 4ZHQF 3WMWA 1PF7E 4NP6A 2ZM6B 4H59A 1LQTA 4HGNA 4KQHA 3ZBPA 4N48A 1PNVA 2Y1WA 4C7OB 3RDPA 4AO7A 1YZFA 4RFLA 1LB1B 2P4HX 3BJRA 4G6ZA 1S8AA 4X97A 4WCFC 4G1UC 4HT3B 1DLJA 2AB0A 3KOOA 5FPQA 4YX9A 1XUOA 1WUYA 1YTLA 1LPMA 3IHLA 3VTKA 5LDHA 3E81A 1SK8A 1SG0A 4HX2A 4MEBA 1BOFA 3DMTA 3RREA 3SXPA 1ZWLA 5EVJA 5KOIA 3KM0A 4TSKA 3IEMA 4NNOA 1N7HA 3C87A 2ZTVA 4KODA 4MWTA 1B1CA 1S2NA 1V5GA 2ZE8A 5ER9A 1O6GA 2HR1A 3A14A 3ELDA 4BYGA 3IHWA 3NASA 4C5AA 3R5SA 2OORA 1EK2A 2AMFA 4OBXA 1UJCA 1MAHA 3RVOA 1K66A 4MMYB 4GL2A 5GINE 1EDOA 4O4JB 4IDNA 5FF9A 3VKVA 4LHSA 1O1YA 2Q4TA 2QNIA 5IFKA 1GPYA 1N8SA 1MO6A 2TECE 3DEFA 2ZRGA 5MN4A 2ZB8A 4G0QA 4KWIA 1USVA 4D96A 3E70C 1SCJA 3I83A 5JCZA 4LMPA 1T5TA 3A0UA 4FK8A 3GF4A 4Y18A 4ESVA 1E5XA 3UJ8A 1P62B 4O4LB 3GJXC 4L28A 2HA4A 4YREA 2N1BA 4DMKA 4KXYA 5HF8A 1GGHA 1DJOA 3K30A 4MVJI 5FWDA 4TLCA 3TO5A 1M6NA 1Y5LA 4EG0A 4F5YA 1Y1QA 2ID4A 3G2PA 4PE5B 5F9MA 1GU7A 3ENQA 3QKTA 3N8KA 5DYYA 1IN8A 3E7WA 3GDWA 4J3JA 3FWNA 3SYRA 5JZOA 2VTBB 3LT1A 3FTDA 3DOOA 4GR9A 4LKOA 3H8SA 4RQUA 4QJ3A 1D1TA 4KHZA 2NO1A 3AVUA 1H8HD 3OZIA 2CKDA 4QGAA 3V8VA 4GPIB 1JXMA 1X7DA 3C8HA 1B8PA 1E2NA 2RGAA 4TLEA 2BBOA 5KVQA 3W8RA 1BXZA 2Y6UA 2HMTA 4TM8A 5HA5A 5L45A 1P1CA 2YR0A 1G55A 5FOXA 3INTA 2JGEA 3Q5EA 4QREA 5A6SA 2M1ZA 1FNSA 2OBLA 5KTYA 3DV0B 3FTPA 1MDBA 1W5TA 3LU1A 1R9JA 1J21A 4HDRA 4OJNA 5K1ZA 2UVQA 3CJTA 1ZK0A 4WFKA 3CTMA 3W8FA 4BE9A 4YNBA 2YZ2A 2A9RA 4UHJA 3RSCA 1RJWA 1ORHA 5ELMA 2G1KA 2ZRLA 1EH5A 4NBVA 4C4AA 3UJ6A 3W2TA 3QX3A 1B00A 5AW6A 4RMJA 3NIWA 2BELA 2XXAB 3R3JA 5EQJB 3KU4A 1GZDA 2HRQA 4LV5B 1MPTA 1SN7A 3N70A 2EJBA 3PPYA 2I8LA 2ZUCA 1IJKA 4DQLA 4IKOA 3W90A 3L92A 1ZXBA 3KT6A 4C1NA 2FWIA 5JQGA 3NG1A 3L0BA 3R8XA 3EPLA 1JMVA 3ACCA 2WM2A 3EXHC 3KSRA 1FRFS 3H11B 1QDUA 3HCBA 4IZHA 4QDTA 3WGQA 2BL4A 1I4OA 5AVRA 1EBUA 4KQIA 3EIEA 5L4NA 2YQ4A 3JARB 3LSYA 4R9NA 5G53C 5B55A 3LC1O 5B64A 4GYKA 1Y3IA 2WFAA 3DNFA 3LW8A 5JAUA 3FTCA 4IHKA 4ND1A 4EYKA 2CL7X 3GGJA 2Q9BA 4MJ7A 3LBAA 4C2UA 1Z37A 2BM1A 2HUNA 2Z98A 3H9GA 3TVTA 3B38A 3DM5A 4HJRA 4P5DA 4GP6A 4AZ3A 1P19A 1NP6A 3LY8A 2HHAA 3GRPA 3BHJA 3VPFA 4E14A 2DHDA 3DA8A 5IZCC 1Z35A 2IRWA 1DEOA 1YS1X 3K0BA 3PC8A 4JP3A 1S2MA 2A5JA 4GZ3A 1XTRA 2DR0A 4U2FA 1FU7A 5FA5A 2ZSUA 3PGLA 5GIOE 3ZJ4A 2JJ8A 1QIJA 4DA0A 1FFWA 3VR5D 2ID8A 4CLRA 3A4LA 2ZRBA 4LBVA 4MR7A 2AI1A 4PAMA 4UZFA 4ZCSA 3RLFA 2JANA 4I4TB 2GK4A 1NYRA 2CEAA 4DQKA 3LDHA 5JD4A 3IVMA 3P2OA 4TLMB 1T9DA 1YR8A 4R9VA 4YQEA 1I2CA 3EAFA 4FMDF 1R0YA 1KO8A 3ZWKA 2V7WA 1I7SB 4RW0A 3QF4B 2ZBFA 4PGAA 5A5VA 2Q4EA 4ITRC 1EEHA 1EX1A 1PL6A 3BIOA 4OG2A 4TTTS 4UCWA 2ZYUX 4WD3A 5EMLA 2A5DA 4RNCA 2A3NA 3A70A 1OAOC 4RD4A 5H9VA 1LI7A 1MJGM 1M2OA 1QPZA 3NHJA 3AR9A 4CIXA 3Q0TA 4JCCA 1BD3A 2H1SA 1HT1E 2Z9CA 3KO8A 4PQYA 2JGDB 2D1SA 2GTPA 2VPTA 4F84A 5CLLA 3MSCA 1ADYA 4CYMA 5A4KA 5JSQA 2JVKA 1OA1A 2H9YA 2P9FA 5JPIA 2O0KA 3ZV3A 3GEPA 2L18A 3UHAA 1ZDMA 3EEYA 3D4NA 4NV0A 3NM4A 4PVCA 3TXXA 2H18A 3QMMA 5K0SA 2QYHA 2Q5OA 1SB9A 2GJ9A 5MDHA 4LZLA 4U2DA 4Y1EA 2HZBA 1G2OA 1ESEA 3BULA 4I3HA 3CZCA 4YFYA 1PV1A 5JARA 3FJYA 3A3NA 3IUMA 3AJDA 1IDN1 4FCTA 2PH1A 2H1LA 1F17A 1P39A 2VDUE 2VFAA 2XEXA 1U2TA 3B1VA 3IXQA 4J0JA 2FAXA 4W8HA 5FFNA 2JKYA 5ALTA 4JY7A 3K8ZA 5EJAA 2YJTD 1W4AA 1V8DA 5AKGA 3A2KA 1X14A 2IHKA 2J09A 1YXMA 2XF2A 2Q8NA 1YL5A 1AUPA 3G2NA 3QBDA 2YJ6A 3FUUA 3GUUA 4FHEA 3DNPA 3A1NA 4OMUA 2QUJA 3VR6A 3CLSD 4C4PA 4ZK2A 2P6MA 4F0JA 3MF4A 1CDZA 1GP2A 1NYLA 3UAYA 1K7YA 5F1YA 3SS7X 2GJ8A 3L1UA 3IBFA 3CRW1 3N8DA 4L5IA 4ND2A 5FOTA 3KZNA 4KAAA 3AU9A 3H16A 1ABBA 5KYGA 1ISPA 2YYAA 4YAIA 5IF9A 2QRLA 1E79A 3H5VA 2J5BA 2OHHA 3EMKA 1XEWX 2AG1A 3M4YA 1Y7LA 3PNBA 4JOSA 4MKZA 1FDUA 2AEFA 4BAZA 4HQRA 1FZTA 4QU8A 1MXHA 3H9CA 4IHJF 2X1MA 2YMQA 4X45A 5FBQB 5K5EA 5GOZA 1G5QA 1LDGA 1Q57A 2QY6A 1J1ZA 4XGIA 1IZYA 3KL2A 5E4FA 1UKCA 3H7IA 4ILEA 1Z5OA 3VZCA 1V4VA 2JAOA 2VHYA 1GA1A 1H2RS 1QHXA 1XVAA 4KXQA 1AUOA 3RSSA 1F2TB 3H5OA 3QU9A 3ORHA 3O8OA 5EQFA 4FMBB 3PYLA 4KSBA 2O8CA 4BC1A 1H8HA 3AR4A 2E2WA 2P78A 3GRZA 2B5WA 2C9DA 5CIQA 3PFFA 3P4UA 4U9IS 3BH7A 3OC6A 1GUZA 2FG7C 1XRMA 1KSJA 1VBMA 1W2WB 3DP9A 4KE8A 1EX6A 4KAFA 3MGBA 3OIGA 2R1UA 1FF9A 4V2IA 1VA4A 1XLWA 2PQ0A 2VJPA 3I34X 5KTNA 4X91A 1QP4A 2G25A 4I1VA 2XDWA 4UEKA 1T2VA 5GONB 1N9KA 3I05A 4TMXA 1TUIA 1MA3A 3PEUA 4W5RA 1OXVA 2FOLA 4M1MA 2VPXA 3Q8MA 4QXQA 4OQXA 3PGXA 1AKEA 2WKPA 5TDHA 5EJ6A 4OPMA 5FFMA 2BBWA 4JB2A 2HJSA 4RJ2A 1W85B 4YTEA 1U94A 4RGQA 3IEKA 3OQ6A 5DTJA 1GPJA 5F77A 5KUTA 4WFQA 3X3HA 3CM0A 6YASA 1E1YA 1BDBA 1R50A 3U4GA 3T5AA 3VYVA 4GMHA 3FA2A 2H1IA 4IBOA 4Y6GB 4COOA 1R18A 4UOEA 5J4LA 2WD7B 2XZOA 5L51A 5HZGA 3LF2A 2HU5A 4MRVA 4N41A 4KCGA 3CGGA 1HE8B 2Q5FA 4L5CA 5IDVA 3BCSA 3GJ0A 4WY2A 2DLDA 4XGNA 2EP8A 3LXMA 4JDPA 4E5MA 1ONPA 1A95A 5BQOA 1PQYA 3O3MB 4B9EA 2WYVA 2XUZA 4Z9FA 3W4JA 1CERA 3BQMB 2IV2X 4BBPA 3A3KA 4IO1A 3AETB 4JUAA 5BQFA 4MKGA 1XA3A 5C8DA 2P91A 4HNHA 1RI4A 4LAFA 2EZ4A 4R54A 3EE6A 3D3KA 4HP8A 2HFJA 4NONA 1F60A 4W5TA 3OU6A 2ZOSA 1RFLA 3X1WA 2QTWB 2X7XA 3DKKA 4QQFA 1XL1A 5I9BA 5REQA 3TRJA 3SP1A 3CLKA 2FWPA 3MTAA 4WNCA 4YAJA 4B3CA 1JECA 2G6BA 3HCDA 3S55A 3QQ5A 1DCTA 2VNKA 5JDCC 4GGOA 1X7ZB 1NVFA 1NUUA 3DQZA 1VRCA 2P9GA 2ZWVA 4NCIA 3B36A 3R9WA 4GLBA 2LVBA 1GPKA 5IUKC 5F1PA 1AHHA 3O73A 3WK6A 2I22A 5TLSA 3B2EA 4UHKA 2ZVDA 4D3SA 4JLPA 3L05A 1IQ0A 3ANXA 1E7MA 5F9FA 1Q7RA 2EARA 1G6KA 5P8WA 2BJHA 4G8DA 4EENA 2ZIVB 4LJYA 3G8YA 4P4SA 1XD2A 3PTAA 3HZZA 1ULUA 2XVMA 5LUAA 1Z08A 3WMFA 4CEJA 4NZMA 2Q8PA 1QYVA 2EBUA 2F8TA 3D8HA 1O4WA 4MV8A 2QP4A 2PUGA 3JY6A 4OH7A 4ZOAA 5D01A 3TFOA 4ZAWA 2QMZA 4HGOA 3I5XA 1Z9BA 1IXKA 3W06A 3RODA 3LVBA 4F7WA 1PNRA 4ZC1A 4L8YA 1V3UA 4O4IA 2NXEA 4KQ2A 1T5SA 1HYGA 3NBQA 5B7GA 1QCCA 1LS1A 3O0TA 4OQYA 3ZI0A 1QAOA 1S2LA 3EQ8A 4DLUA 4GP9A 4MITA 1UOPA 2BFDA 3PUIA 5FTJA 3RWOA 3W4IA 1WA5A 3V7NA 4N3CA 1A96A 4CMEC 2Q6OA 2XWQA 4K9DA 2EX0A 1D6MA 1ZONA 4RABA 4EB0A 1P1HA 1PJRA 2DH6A 4X92A 3ETJA 2IHTA 2V59A 1RYBA 4EKNB 4XYMA 3A1DA 2BGNA 4DIEA 2J7PD 2XH8A 1L7QA 3E6AA 3KTDA 4GSKA 2IYOA 2O2DA 3OFSA 4OHZA 4LJLA 2UZ1A 1MX3A 2HDOA 3D43A 1T2FA 3QBTA 2V1XA 2HRZA 5AW3A 1M10A 3BF7A 4Y2SA 4OLBA 4PWZA 3DBHB 1T2NA 2VNHA 3NR2A 1KEKA 5K8LA 3ABRB 1DAMA 3MJFA 3NKLA 4ARVA 5I6DA 2I55A 3KB2A 1K88A 1DTWB 3HNPA 2Q50A 3IRUA 1CFJA 2GKGA 3L4BA 1WNFA 2WSIA 1DAGA 1YI8A 1ZEJA 3QW4B 1A8SA 1Q1QA 1WXXA 2XWBF 4IWXA 3QE4A 5CB0A 3GL9A 3T5BA 1T4DA 2H16A 1J06A 1CF9A 4BFYA 3VH4A 1NNUA 4GT1A 4GUDA 3BHNA 3FLBA 1CR0A 3BVPA 4JJZA 4ESHA 3P1JA 3WZ2A 4KREA 3AP2A 2O3TA 3ZWCA 5LLSA 4CKBA 2IKSA 1SVSA 3R3UA 2OESA 5GJBA 3BTUA 1AXRA 1RT9A 4C6TA 3V4ZA 4MB2A 1NN3A 2Q1YA 4F1WA 1Z4IA 2BKEA 4TTRA 4RESA 3AESB 3LLVA 1L1QA 1YTUA 1CLEA 2JA2A 3HCFA 1MIOA 5AI0A 1XZGA 2CLEB 1T2DA 5SY9A 4G07A 4YT8A 1GARA 1IDOA 1VECA 3OOWA 2NUBA 4CL2A 4GH5A 3BFJA 2W4MA 3IQXA 1ODJA 4RGBA 3TUZC 2JJYA 2HL6A 3QA9A 1Z63A 2OUKA 4BFWA 5DHFA 3E9EA 5DK6A 5C8YF 3VZDA 1C3JA 1KYVA 4TL8A 3WK5A 3VNUA 1QHNA 3AI7A 3P32A 4XD2A 3HWWA 5LQRA 4YP5A 4DCCA 3IDQA 3PQCA 4RV5A 5L3RA 3H04A 4FZVA 3QFFA 4QQRA 3EBLA 1JJFA 4FONA 4Z3KA 2YL2A 5KYVA 1YZGA 2NIPA 5B1HA 4TVBA 4KSCA 1WO8A 2ABWA 3CW8X 2NU9B 5LMNB 5DYGA 4OFWA 3CY6A 4MA4A 2JBWA 1WQ4A 4RPCA 4LJSA 4V0ME 1FLAA 4R81A 5H1YA 1B41A 5A9SB 1QBGA 2DJIA 3LWBA 4QUKA 5G4KA 4YRKA 5C3MA 1FX0A 2BKLA 4BTEA 5DWDA 2YHIB 2M98A 2QMQA 2O52A 421PA 1U80A 2XGGA 4F6RB 4MOWA 1UMCB 4J3NA 1F3OA 2RGEA 4UJ3A 4DA4A 2CJWB 5DM70 1A9ZA 2KBFA 2HSGA 3TL3A 4G5XA 4DJEC 4JLMA 2FQYA 1CQPA 1HEIA 3NETA 3PD7A 4UVEA 5K03A 2C4WA 3C15C 4PBRA 1THZA 1HYBA 3JWPA 3NVAA 3MRTA 4BZWA 3BMNB 4U6QA 3OZRA 3Q2OA 2P77A 1CUHA 4Q47A 4XGKA 3VI4B 1Y9AA 4M1SA 1NXPA 3VDNB 4E30A 2FJUA 2OMEA 1XNRB 1T6BY 1TVMA 2VK8A 3K0EA 1JAHA 4GIBA 2ZUTA 4IGEA 1RBMA 4KWHA 4NFLA 3RVBA 3TZLA 2C5AA 1M72A 1NATA 4MNTA 5EWMB 5IZ4A 5E6RB 1D8TA 2DZDA 3WO0A 3A25A 1E77A 4Q18A 3W04A 4GEGA 3DOEA 5A1TA 2QJOA 2IY8A 2VJMA 3GFFA 3O4VA 1V5FA 4Q93A 3A6JA 1A7UA 3LUCA 1FS4A 1BXGB 4LQ4A 5KHAA 4C4OA 1ZD1A 4FYMA 4CF6A 1B14A 2QOEA 4REMA 2XQIA 4BCDA 4X62B 4J03A 4JP2A 1XD2B 1EE9A 3QOFA 2HDWA 4JQSA 4PXYA 2Y1FA 3MMZA 1VMKA 5DISB 4D8XA 4KVGA 1E32A 1SCKA 1DEHA 1C7JA 2VDWB 1E1RA 1QORA 2VT2A 2RAPA 1CDOA 2VEOA 2XUPA 3FAZA 2DRIA 2Q6KA 3QXSA 4J0CA 2XYPA 3KOZA 4BGDA 4FGWA 1Z6AA 1L5HB 3KR1A 5COBA 3B6MA 2IYRA 4PAQA 1OXMA 1UINA 4Q00A 3HJAA 4J1QA 3RABA 3ZCXA 4F4UA 3L41A 3GA5A 5IVKA 2XAAA 3NZEA 2H6EA 2PO7A 4Q3NA 3KWFA 5A2GA 3OUTA 3HVKA 4XJTA 4G36A 4B45A 1DKPA 121PA 2RJOA 1HURA 1SNYA 1OWMA 2I4TA 4MS4B 1EP1B 4LZJA 5D3MA 4NR0A 1ODFA 3PB3A 5M34A 2WAMA 2EFJA 4ZVQA 3SC6A 1UBSB 3JAMA 3RAGA 2B4RO 3QE2A 5L6LB 1A9SA 3WDLA 2PJRA 1WP9A 2CC2A 3IV7A 2HQOA 3DE6X 4GXNA 4G0YA 3FWYA 4Y2YA 3L4JA 2DY1A 3MJDA 2X9VA 3MWFA 3ECCA 5A02A 4Q3BA 5IC6A 4Y1FA 1DSSG 3B13B 1JTEA 4YP1A 1PT7A 3WBBA 3MCWA 3HZRA 4L51A 3VAAA 4S24A 4V2UA 3ITNA 4NE7A 3LZ6A 4O02B 4CUKA 4DV0B 1UZLA 4DT1A 1HA3A 5F33A 3JQ8B 4OXNA 3IMGA 3RCBA 2HMUA 5EMNA 1Q3TA 1J33A 5FWYA 2BSAA 4JI8B 4A0RA 1JI0A 5EZ5A 3W7VA 1Y82A 1U5BB 3UFXA 2LCIA 2ZZNA 1PHPA 2J7PA 2CCJA 1T6NA 3MYRA 3Q7TA 3MWEA 4NDAA 4M4SA 4UDYX 5FKJA 3V32A 4KRXA 4MV1A 3S2GA 4BEJA 1XAIA 3PEVA 3AH8A 1ENYA 4AMVA 4CM8B 2ZPTX 4JJEA 3RTDA 2IHVA 2OK7A 4AKTA 3ESDA 2CXHA 5IEBA 3NBFA 4NENB 4E21A 5T8KA 3OIDA 2GXAA 2JHFA 4J4TA 2G0TA 3QXJA 3L82B 2VJLA 4DQ0A 4JR1A 4JZKA 2PRIA 2XBLA 4CF4A 1DC3A 2PCJA 4MWSA 4PS1A 1MPXA 1WXEA 2YXDA 1C29B 3MINA 1CYEA 1Z4LA 5BRNA 2PT5A 1E99A 5KREA 3AF6A 3FMFA 3RYTC 1E1LA 1P1FA 2J41A 4L27A 5ALWA 4S2UA 5AT1A 4QUGA 4R1NA 3INYA 3T5CA 2E4AA 2ZCUA 4HUJA 4IIYA 2XCLA 1DKMA 5FOVA 5NLLA 4QGBA 5CDGA 1NUSA 1ZM7A 4QKQA 4UU7A 1KKMA 3AY7A 2ZUFA 4X8LA 1TXGA 5MF6A 3UBTA 1USUA 2FFHA 5HQJA 4BVEA 3SYKA 3VR0A 2NYVA 2PAAA 2V7GA 4KZKA 3X1KA 3IEIA 5D6OA 4A3SA 3MB5A 3O03A 2YWEA 2OBYA 1FQWA 1WDWB 3TIIA 1DV1A 2B4TO 2OO5A 4LNUA 3DMFA 1C0LA 2A9JA 4IILA 2CUKA 2G7ZA 2CFOA 2J9FB 1XRLA 5E6SA 3CLRC 3Q72A 5LB4A 1J4AA 4AP9A 1RP7A 3IS3A 1O95C 4AXBA 3QPVA 5AICA 3RBZA 4G63A 1PZXA 3VPBA 1ZSNA 2JL1A 3IAHA 1QB7A 1NUPA 2NYUA 4F1JA 4QYMA 2R1ZA 5JNTA 3R3XA 3BMOA 5A03A 1WPRA 4NESA 2CLIB 3U17A 2FWMX 3GVHA 4PGFA 5E6UB 3Q9NA 4AWAA 2EJTA 3HV2A 4ZVLA 3F4LA 1U31A 4I1PA 2P0AA 4G1FA 5SYAA 1XVTA 2ZB2A 4CM7A 2WUFA 3JD1A 1ZN8A 5ENVA 5KSZA 4HFJA 3W2IA 3RS9A 3RYIA 5C8ZA 3HJUA 1XTBA 1OA0A 5CFRA 1LPNA 5FLYA 3PQDA 3O3OB 4Q3DA 4WZBB 1PJ2A 3UWSA 4F4CA 3GW8A 4D3XA 5G1NA 3GLUA 4U5XA 4DNFA 1YDFA 5JCJD 3SJUA 4Z54A 3ICCA 4LTDA 1EUQA 3FFXA 5FV4A 1GT6A 3OM8A 1TTTA 3HY6A 3S1AB 2PRZA 3VVLA 4GX1A 4CZ2A 3EF1A 1PG0A 4C76A 1XWFA 3PKIA 1KR5A 1Z74A 4M54A 1W0CA 4PO1A 4UXHA 3USZA 3ZEAA 1JU3A 5JJCA 1TZ2A 2JF0A 3OT5A 3U19A 5IM4F 3TLBA 3TL2A 3WFJA 3UY4A 4LCBA 3H87A 3VMFA 3NONA 1F4PA 3GGPA 4XUCA 1U8XX 1WE2A 2JRCA 2M2IA 4UU0A 1E4OA 2C3MA 3O8DA 4B7AA 5HKOA 5EJ9A 3I4CA 4ZWNA 2GA9A 4H7KA 1T0UA 3LBFA 4M8KA 5FPYA 1FUEA 3L0OA 2QS9A 3F47A 2A9PA 5B7PA 2FUKA 4CKXA 1T3ZA 4RCVA 1T9GS 2RKBA 1RKUA 1YR6A 2Y1KA 3FN4A 3JU3A 4WLEA 2FQ1A 1CHNA 3QK7A 3V5NA 3DL2A 4MV4A 6PFKA 1BN7A 1SVOA 4OBEA 4AJLA 3G0GA 4I3FA 2X15A 2AC7A 3COWA 4PZ0A 3VJLA 4FNMA 4B0PA 2B25A 3GT3A 4H4EA 5CA0F 5JPCA 8ATCA 4DY6A 5E7QA 4W9RA 1H9BA 4Y6RA 1XAHA 5B3LA 2ZTLA 3LC7O 3MAGA 1ZUIA 1XZHA 5IJ9B 3OZ7A 2OCBA 4ZU1X 3E7XA 1U0FA 1AF7A 2O8EA 1ZOLA 2AI3A 3EVDA 3DTVD 2GB4A 5G4LA 1U3WA 4C30A 3KUXA 1J0CA 2HKIA 2I34A 2QN9A 3VZSA 1KIFA 3GEMA 3IPXA 4J16A 1KJYA 5C18A 1GIAA 1TU4A 4B44A 5L3VA 4GZMA 5K0BA 4ARCA 1QE0A 2XOKA 3PRKE 4S1PA 4ZFNA 2TRSB 2PS0A 2PRJA 3HYTA 5DI9A 1P9WA 4ALIA 1FX1A 1WB4A 1R4MB 2C3PA 3DONA 4CQMB 3OVMA 4JU8A 4L76A 2VCYA 2P9YA 4G0XA 2X8LA 1BWPA 2BGJA 3MLAA 4PZLA 1PO7A 3SKVA 1K6JA 5CPBA 2GD2A 3ICOA 1EJ6A 1JW9B 3GAFA 1U3FA 4OKSA 1KH1A 5DASA 2CEKA 4U7TB 3ZW8A 3G3EA 4E46A 5JO9A 4X41A 5AM1A 1J8QA 1GNLA 3K9QO 4R7GA 2VATA 5IG2A 1RTKA 2OFXA 5K0EA 2XA9A 4N3AA 4XSGA 4GL4A 4DC0A 3T1QA 1OB2A 3JZDA 3IYLW 4MW6A 5IDQA 2WD7A 2XXAA 3F9IA 1JG3A 4XSHA 1NJ2A 1GZ3A 4TV8F 5KAMA 1P7YA 3DTTA 4P3YA 2PRSA 3FYDA 4RL4A 5CT6A 2OZLB 3I61A 4DJDC 3WNZA 1BVUA 1VHTA 3F96A 4L72A 3S68A 3EAGA 2QTVB 2CHGA 4RSGA 1B15A 5E8JA 3ROEA 5AD1A 1ZSYA 4I2VA 1TU0A 4QNMA 5CGZA 1VC2A 4EFDA 3VVBA 1XX6A 3TL6A 1H6DA 3BGVA 3JQ7A 1PLKA 3B1YA 2F2TA 4NJEB 2ID9A 2UKDA 4U39A 5IP5A 3WRXC 5CLJA 4KQWA 5AJYA 3OQOA 3FZGA 1DT3A 2R85A 4P53A 3E1GA 3I9KA 1FUKA 1YRLA 1KTVA 1LPOA 4YRSA 5EKTA 2QTRA 5AKXA 1YNOA 1KI7A 4EAAA 3OTIA 1ODCA 1UXGA 3LUBA 1XRRA 2FPWA 2R00A 4ZREA 2E1PA 5IDYA 1A8QA 2Y1GA 2RHDA 3U5TA 3CH6A 3Q98A 4RLHA 1IMOA 3N2KB 4UMFA 3FOFC 1KDOA 1U7UA 2P65A 2XMRA 3KCNA 4UPDA 3M5WA 2BTEA 1XRQA 2C2XA 2FPGB 3NUGA 4PX9A 5FLKA 3T06B 1X9HA 2Q3MA 2OE2A 3IPAA 1ZCAA 1PZHA 2X3FA 3BGIA 1JLSA 2PZLA 1XTZA 2ZJOA 3KD2A 3S0JA 4B6JA 2GJSA 4G41A 3QJGA 1A3CA 2QN2A 4Z51A 4G1BA 1ADCA 2YHBA 3AFMA 3ETNA 3HRIA 4KJZA 3TPFA 4F21A 3CZ4A 2QVYX 1HZJA 3VPXA 1S1MA 2OFOA 1E60A 3C3WA 2Q45A 5KYXA 1E3EA 4LI3X 5KNLA 5LQJA 2FZVA 4K87A 1PR3A 1WBDA 1SZPA 3CVVA 1ZIYA 5KTMA 2I1VB 2PGLA 2I2XB 5EJ8A 3NMUF 2JHCA 5CM2Z 4A91A 1ZIXA 1GZSA 4G0NA 4G4GA 2K2WA 5IT5A 3I64A 5C8VA 3EWNA 4RTOA 3NBYC 4RTSA 4CDNA 4QAJA 2Z8XA 1ZBQA 4IMIB 4XI9A 5CX1A 3V48A 1E1CB 2ZYGA 3HFGA 3LS2A 3T7SA 2K87A 4F5DA 1NW9B 3X1ZA 1TTHA 4MCHA 3HWRA 2WZBA 5KOHB 3M3DA 1RKBA 4LDJA 1LI4A 1APBA 2HLNA 4H1TA 1G21B 3Q6IA 1DVRA 5F7JA 5SYNA 3ZS8A 2JVJA 5J5CA 3SQWA 2VLBA 4AIRA 3N7UA 5JSYA 4EB6B 4RDXA 2WKSA 3BBLA 3PXEA 3N7TA 4ZMRA 1FP1D 3HRHA 2YFQA 2ROQA 3OZVA 1RHJA 4EQ6B 2CSUA 1Q50A 3U3MA 1KJNA 2X0IA 4X66B 2F9FA 3IAS1 1MABB 3COYA 3BMCB 4Y2UA 1ILEA 4Z0NA 1JT2A 3W5VA 1J8DA 3B70A 4ER0A 2F7SA 3EXEB 3CRRA 3GI1A 2I2WA 1CX9B 3FOZA 2P41A 1IULA 3EF3A 1RRCA 1YS4A 4D57A 1BS9A 1RJDA 1KO1A 4YQFA 1V1MA 2PSFA 4IR7A 4NCKA 2JLRA 3BGOS 3CVOA 4QPNA 3EXFA 1SQGA 3LLMA 5FNVB 3VFDA 4OQDA 3ABIA 1BKDR 1S96A 3HJNA 4TS1A 4UZEA 5D51S 1GFZA 2JFYA 3QKWA 3V1LA 2CFTA 2RGBA 4JEMA 3FB1A 3ODPA 2XUGA 2AN9A 2QMYA 4MWBA 1XU4A 2IOFK 2PWZA 1J0DA 1XA4A 2QMUA 3F97A 3UENA 3UATA 5JAOA 3ADDA 4DCOA 1RSZA 1Y89A 2ZTMA 5IJZA 2ZB3A 1TM5E 1E6EA 2R6R1 3BMQA 3TLZA 4ER7A 1DT5A 1E3IA 3G2LA 2ONZA 3AWIA 3P9IA 3LX4A 2Q7DA 4EMSA 4G1VA 4RSRA 4J0QA 4EKIA 4L15A 1I0IA 3W7BA 1JA9A 1V9SA 4E1AA 2F00A 2JLQA 1JJBA 2OO5C 3M5CA 3IR5A 2NU8A 4D7AA 1HK7A 1L5SA 1YUBA 3A4TA 4EYSA 1SHJA 1TPYA 3IIMA 4MVJD 3VPGA 4MUGA 3T9FA 3C0KA 5CG1A 4MP8A 4P3NA 1OW3B 4TQAA 3R0VA 1H65A 4OI1A 3IIJA 3PR1A 5DVZA 1Z7YA 3D1JA 1FP7A 1N2GA 3E0XA 1M5UA 1PDWA 4NL4H 2IXFA 1DZ3A 1I3OA 3MBOA 2EERA 4M6WB 2IBTA 2V7UA 1Z8NA 5KOJA 3T1OA 5ICCA 2V9CA 4UUNA 5DHAA 3ICPA 1B42A 4QJIA 1BEEA 1YA4A 2ZAYA 3MJ4A 4KAXA 3A3OA 1B2LA 1Y1SA 2MSLA 5HM6A 4FEEA 4D3DA 1QH8A 2BGMA 5C81A 2PUDA 2WKQA 1X6VA 2ZATA 5I7AA 4UMDA 1VB5A 4LN1A 4QNNA 5CXXA 2X8JB 4DPLA 4EELA 3H8WA 2ZQYA 2V9PA 1KMCA 3X0DA 1G42A 5TQ0B 5ICSA 3PC6A 2W6NA 4HGPA 3LUKA 4RK6A 4NCAA 1Z75A 4MI3A 3DKIA 3N8IA 5CLIA 3GQBB 2D1FA 4K81B 3ZTYA 5I01A 2NU7B 2I3DA 3TMAA 1JSCA 2PKXA 1AE1A 4NCJA 2A0XA 4HH4A 4XWOA 4AY6A 1ULSA 1G2QA 2A1IA 2G9QA 3ACDA 3HO6A 1WCIA 3AONB 4MUXA 4MI9A 4DLWA 2NV2B 3AEUB 2VYVA 5FHRA 2C3OA 1YCHA 3M6IA 4AIIA 1NAIA 2JFVA 2X2PA 1OBVA 5AM5A 3I5UA 4UFNA 4HSGA 3BX1A 4ISCA 3N0VA 3ODGA 2TMGA 1T24A 2VUHB 4MV6A 3UANA 4XX1A 3IODA 2OLJA 3CO5A 4DLZA 2Q9AA 1OFGA 4DREA 2I2DA 2IS4A 1CFZA 1LEHA 1NURA 3RHFA 3TBHA 4EFMA 1Z5WA 2XB4A 3CVUA 1EWQA 2WTMA 4F1KA 621PA 3MHPA 1J1UA 3N76A 4WASA 2AJ8A 1FMLA 1SKYE 1VBKA 3JATA 1ZI9A 2PIAA 1SRQA 4IYJA 4B6QA 2G63A 13PKA 2AZTA 2Q6TA 3DT8A 3H18A 1C9KA 2JEZA 4LHYA 3F6BX 4QXMA 2Z2XA 4CLDA 4AZTA 1K75A 1R88A 5IXYA 2D5LA 2OYCA 1K98A 2GCGA 3TCNA 2VP2A 4BO9A 4IQ0A 1ZUNB 1K97A 3IPLA 3KJGA 3VRHA 4AZWA 4B7XA 1XXHA 4NCNA 2ZXEA 1N6RA 1SKQA 1T1JA 5ED4A 4PZEA 4NABA 4MYRA 2IP4A 4EPWA 1HNWB 2AT1A 1JWLA 3GCGA 3GZJA 5A3VA 4EI8A 4QDXA 4MHOA 1CE8A 2YC2C 3OZXA 4Q66C 3NS7A 5K8JB 4KLZA 1HRKA 2YXNA 4ALLA 5BQ3A 1RAIA 4YR9A 1YC5A 3GGGA 1KMQA 1PWYE 4L4SA 4DT1B 1QHIA 2WHXA 2II6A 1L1FA 3ORSA 2JLBA 4ZAYA 2POCA 3A2NA 3TVYA 1BE1A 2ZE6A 1GVHA 1WR8A 5BSWA 2CWWA 2HJHA 1A9TA 1TK2A 2PT6A 3L77A 4C6HA 1R3UA 5DX0A 4R0VA 1E6KA 3DOJA 3D8SA 1AF4A 4G56A 4K46A 3C7CB 4RUKA 4UM9B 5KTSA 1J6UA 5K3AA 1UPFA 2I6FA 1ZH2A 3TLMA 1SBTA 3GJSA 4FX5A 4C2AA 5BN3A 1ZM9A 3OJOA 2XDQB 2AV6A 3G17A 2WBLC 3ESQA 1ZD3A 4KI0A 2O8BA 1BXRA 1KY5A 4QUEA 3PXUA 3BM5A 4Q9DA 3ASYA 1HC7A 4DBLE 4WKBA 1JL3A 5DV9A 1P60A 3PJDA 4G25A 1DXYA 1E7RA 4A8HA 3T0FA 2Q3HA 2BIFA 4C04A 2DG2A 2LDBA 3NBXX 3N2GA 3PFIA 4W5HA 1RQRA 3K1TA 5B3JA 2EVWX 2Q9CA 3EJ6A 4C3UA 2FP4B 3RSFA 2SICE 1X7YB 2BHRA 4KFCA 3G9UA 5F5NA 2HW8A 2CHFA 3E9YA 4ND8A 4WL0A 3L2OB 4RGYA 1TK3A 4OHOA 4B8ZA 3BN3A 1CZOA 1DCMA 3PG5A 5AM2A 3ON5A 2D1RA 5HGJA 3UJAA 1J5EB 1ZUHA 4UCQA 2EHJA 4AG3A 4OATA 4PEVA 4DCGA 4Z3OA 4XASA 4NC9A 3ETGA 2V4ZA 1BHJA 2OFPA 3DO5A 2GZAA 4UARA 3NT5A 4KYUA 4BNMA 4B3MB 3IMFA 1J56A 1SZJG 2FK7A 5DHUA 5LKAA 3LNCA 5DGCA 2V7XA 1QTRA 3QNUA 4R3UC 1FYEA 5I9TA 1NSTA 4BLSA 4D4GA 2ONYA 3D5TA 4ICIA 1R6TA 2QRGA 3OQHA 4D9EA 1G6Q1 3WSWA 4HQ0A 4HXFB 1NRXA 4EHBA 5L3QA 1DWUA 1IM5A 1M0EA 3D3WA 2FX3A 3ANYB 2E55A 4BE4A 3JSAA 4TYNA 1GU1A 2WJIA 1E4EA 2PGDA 3L79A 3R3VA 3N6RA 5C4IA 2BEWA 1MAVA 2NVUA 2ZSDA 3TQRA 4GKAA 4DQVA 2NG1A 4PFKA 1M2NA 3KE8A 4B2YA 4CQLA 2B1JA 2BEWB 3WDKA 5L7WA 1NBMD 1UBLS 2BKAA 2I7CA 1G9TA 2GZRA 5IBQA 4O4IB 5F78A 5FB3A 4TRNA 4ZCTA 4HX9A 3UJNA 2B6HA 1G7TA 2GEBA 2Q41A 3NP7A 1KO5A 4FJ0A 1N9GB 3BPSA 3O4HA 3ZGNA 3ZHRA 3WJ7A 1PFVA 1L5WA 4BMCA 1PQUA 1UJMA 1W59A 3A37A 3VAZA 1VPWA 1LGYA 1Y48E 1MTOA 2C94A 1IH8A 2X4LA 3EXG1 3M4XA 5JC1A 3TNFA 4S05A 2XRMA 2Z5GA 4P0QB 2SCUA 4NX2A 4YJ2B 5AW0A 1KFEB 2PZEA 1I8TA 2KMLA 3F98A 1SBQA 2NADA 3K0AB 3SX0A 2C8LA 3BIWA 3R0ZA 5BOVA 3U7QB 1MB4A 5B4TA 3EYAA 2MYPA 3K15A 1WZEA 3UKDA 1HMYA 1IY8A 4JBXA 2C29D 1WVMA 4JSRA 2CW5A 3PRHA 4EYOA 3MC1A 3U7RA 5JZVA 4JXJA 1FNMA 2WSLA 3ZQ6A 2DKOA 4DNPA 2TSYB 3E05A 3KT3A 4HAVA 4YT4A 2H48A 3VR6D 1AQIA 3LOPA 4XYBA 1F8FA 2VYVD 2ZWIA 2FOIA 4RK1A 2BH9A 3RUPA 4ZEVA 5HZHA 1YB1A 4MI1A 1N6PA 4ZEXA 2I2FA 2VF4X 4IINA 2HQ1A 5DSTA 4RTNA 5EPUA 4NYJQ 5IDXA 1W5AA 2DY0A 2F3SA 1KZHA 2K6GA 1DJPA 2LBPA 4IGAA 1S8OA 1XNQB 4LRYA 2IHUA 4ZVKA 2COEA 1J9GA 4BP1A 1FQJA 2OCLA 1KRXA 2H4ZA 4JVLA 3SFVA 5C5IA 3CUUA 1A88A 4MKIA 1ULAA 3Q6MA 3ZCUA 5BW5A 3NRJA 1OWLA 4QGGA 1GNTA 1UJ2A 3GN2A 3VAYA 3ZHBA 4EUKA 1ZD4A 4IFTA 5LLDA 2DBVO 3DAOA 5C2JB 3BXFA 1MOSA 3MQ4A 3QLUA 4ZGWA 1LK0A 1OH7A 1E2LA 4OGLA 4HDKA 5A05A 2O20A 2VDPB 5KWEA 2GFHA 2ZBQA 1YR3A 3JASA 1LU9A 4WK4B 5EVCA 1FS6A 3Q2KA 4MSUA 4H9GA 4RD3A 3KKMA 1CKEA 3DUFA 5EHQA 2PEYA 3T4XA 1MJNA 2Q4RA 4Z9XA 5JJLA 1EVZA 4W7IA 4N0MA 1DAFA 2UXDB 1Q15A 4ALMA 4KUEA 3GG9A 1ZGGA 1QIMA 2IP2A 3GDGA 5ALJA 4Y2RA 4C0SA 5C1OA 2QW1A 3DCYA 3RSQA 2O2ZA 2RD2A 1YQQA 2HM7A 3P9SA 2F4NA 4Q9NA 2NSYA 5E6SB 3ZHSA 4BFTA 1JH8A 1VG1A 1RACA 3R09A 5D8DA 4ROTA 5BV8A 2P1RA 4FLFA 1MHPA 2Z5VA 3FVWA 4UHHA 3GWZA 1RYEA 4M55A 5JALA 1TM3E 2TMYA 3WGNA 3V8BA 2ODWA 1JE1A 1ZRMA 2PGIA 3HBNA 3KKOA 1S3FA 3CF0A 2QTHA 2GVDC 3P9NA 2QRMA 4HOYA 2VDKB 2W2MA 5LZ8A 3KSMA 1GQYA 3II6X 5EKSA 4WDRA 2ZAOA 3CEMA 3OLCX 4HB0A 4UDNA 4XRGA 4O8ZA 4CIWA 3VA7A 3WLEA 1DDGA 5DGIA 1KZ7B 2WU1A 2QI9C 3I1FA 3G8CA 3K6RA 1LSUA 1UFVA 3C7KA 4A1OA 2C82A 2IQIA 4L5AA 3N86A 3CR7A 3B3FA 3T8YA 4DRZA 1XZKA 2V8BA 3MWGA 4PQRA 4RADA 4LEIA 1HZZC 4BO7A 3WZMA 4O5AA 5LOVA 1C4KA 1YHNA 4JB0A 2C9OA 1VJ1A 5LQNA 3N5CA 2A5YB 2H1WA 4NMLA 4U0KA 2A14A 3G0CA 5KDDA 2P3QA 3KP1A 4NAUA 1TECE 3ZLVA 3GEBA 5K8IA 4J1SA 2IV7A 2JFBA 4NENA 2PBLA 3RSHA 5DGXA 5LZ9A 4J8PA 3HB5X 2WWGA 2QV7A 1PT8A 2MSEB 3GJZA 4EW6A 2FZWA 4XWTA 4B4VA 1TX4B 2E85A 5EYPA 5I7FA 3MEQA 1WAMA 4YI5A 1QZUA 3JQBC 3UB2A 2WE8A 1NQTA 3NWBA 3PBKA 1Q12A 1BA2A 2Q46A 3CN7A 4XRRA 4ALNA 4RCYA 1PJ8A 2RHHA 4HTFA 3ONWA 3SS8A 3B6IA 4ER3A 2YFHA 2Q3JA 3B82A 2ZETA 1XZAA 4M1KA 3UOWA 1SKYB 3AF1A 2WI8A 1TJ3A 1XCLA 4O2BB 4RNDB 3H2ZA 4ZJYA 2CLFB 3K0FA 1RXCA 2WT9A 4IL5A 2WJVA 3L4KA 2WJZB 3AGQA 1WBBA 4EOGA 1JGTA 5F98A 5CYPA 3INRA 3ZWOA 3IT2A 4ZQGA 4RHUA 3CEPB 1ZI6A 5ALNA 1JHYA 5EEHA 5CDUA 2OSVA 5K8TA 2PQMA 4KXMA 4QT4A 2H29A 1BCSB 1W49A 3IAEA 2HT1A 1L8QA 5MGNA 2W2KB 2OD7A 3UHOA 4DYVA 4U7DA 3GRFA 1Y8ZA 1N2CB 1DXQA 2VDLB 3MT9A 4PHGA 1R8SA 2FX5A 3RVPA 1DFGA 3CX8A 1NMQA 4L7QA 3TG8A 1I5OA 4BMVA 5GJVC 1E7WA 1P4JA 2ZJYA 3FWKA 4HTFB 2B4KA 2XD9A 1XHFA 2W48A 1UQTA 3AHGA 4NE9A 2ZIZA 5LYJF 3VTZA 4ENRA 3V2UA 1YBFA 3TR6A 3VJKA 4D0LB 1SUWA 2W2QA 3VV2A 3I62A 3QVGA 2HQSA 3EF0A 3WGKA 1RPZA 2IYVA 3WHIA 5EQTA 4Q4CA 5EJGA 2ZG6A 5KI6A 5K4AA 2FWRA 2NSLA 1Y3HA 2WZDA 4LHZA 1Q95A 2I1QA 5ALOA 3RC3A 3RVLA 4ARZB 5EJEA 3KQHA 2I4MA 1OILA 2PA0A 4MDFA 3HCOA 1REQA 4BQOA 1RXVA 3RYFB 3C3CA 1R5NA 2XD4A 2FHSA 3LQ4A 2IIPA 3A6GA 4FCVA 7REQA 1GNQA 4HYYA 2ZS8A 3AHIA 3HA2A 3W78A 4F7DA 2MSCB 1C9EA 5H70A 4C3OB 2NT4A 5THXA 1T91A 2CE2X 4HWPA 4MV3A 1P5HA 1V8OA 4JEIA 1U0OC 2WP0A 3UHJA 4TL6A 1DC6A 2RGGA 1L9XA 4M1TA 4CM6A 4OLJA 1G6OA 1TE2A 2D54A 3KLNA 1F2TA 1LPAB 1N1GA 2QRUA 4QO8A 2YW2A 3C5HA 1YFJA 1XJWA 2ZSFA 3BYZA 4CEIB 1ZCZA 3BBPA 4TQUS 3WKAA 4NDNE 3G8AA 1UBFA 4LYGA 3T0GA 2IDZA 3K8QA 5CVVA 4DWVA 3QELA 4CIYA 3DEAA 3B78A 1OZ0A 3USCS 4BVJA 2OWEA 5B3JC 5CXQA 3HCCA 1BJKA 2XTJA 5EKXA 2W2NA 3QLJA 5IBRA 2BMWA 1P4HA 2QSZA 2X13A 3C1TA 5FL3A 3B1FA 3E1KA 1GPUA 1E5DA 2JGAA 2J0QA 3T34A 4JIGA 1RC1A 3STYA 2W43A 1ZK2A 5D5HA 2CSXA 2XW6A 1TFRA 3FHOA 3JPWA 4N5DA 4OK6A 4YAWA 3L7AA 3I9V1 3RVMA 4B84A 4CM1A 5E1BA 4XIIA 4X60A 5CX1B 2V7PA 2ORYA 4GYYA 4AY3A 1J07A 1P1KA 1SBYA 4EY3A 4MUKA 4IIDA 5DH9A 4QICA 3W1WA 4GQAA 4LZWA 4YH1A 5HTKA 1NBAA 3VX4A 1YA6A 1NXXA 4G84A 4H7JA 4XJSA 1OYWA 4MWDA 3ICQB 4YP0A 5BSUA 3TQOA 1N1DA 2EKPA 1XYGA 1CSEE 4OP1A 2JIMA 1KBOA 1W5BA 4KNYA 4A8JA 3TGWA 3HU1A 1E1DA 3CWCA 4UPVA 3BD7A 4IIFA 4AKSA 1QIIA 2AR0A 4LG1A 3UG6A 3WX0A 4O3MA 5IU6A 4ZHQA 1KK3A 1UBRS 2AXQA 1NW5A 1KS2A 2DUWA 2XMGA 4QYWA 3RYCB 2H2HA 3N6VA 4K26A 4XIGS 5KJEA 5JJ5A 1Z45A 2ZJFA 1JFSA 4AS1A 2VF5X 1Z15A 3UWKA 3DDSA 1DC4A 5ARCA 1LBSA 5BR8B 5EXEA 1PSWA 4MGIR 3UWPA 5KSOA 3LKZA 2QZSA 1ND5A 4K3VA 4U7PB 4X1YB 1YFLA 3P45A 1T36A 3QHAA 1XOIA 1IHPA 1GRNA 2COUA 2UZAA 2XT6A 1ZYUA 3QOXA 2VOEA 3GIWA 2HPHA 3E9CA 4H1WA 4R2LA 4R8SA 1KYYA 3HM9A 4PXAA 5B58T 3SDZA 3B1XA 2O2IA 1NXWA 3UNXA 2J9XB 2P30A 4K7JA 3CUYA 2GWHA 1QX4A 2CLLB 1NR5A 4PU0A 1D8AA 1AMUA 4MUIA 4TMWA 2MR6A 3GLFB 2BGWA 1Z7GA 2JGFA 4B74A 3FPHA 1R74A 3EULA 3C70A 4NZPA 1XD8A 4NSNA 3IVAA 2QDXA 2Z8YA 3LIPA 3PLAE 5H0IA 2I4RA 4BDSA 5IJXA 1AKVA 1OFUX 4C0WA 2AKAB 1TF7A 1XZ8A 4OP3A 3KFXA 3IP1A 1O9HA 2JI6A 3VU0A 4PNEA 3I9MA 4BUCA 3L0ZA 1E9EA 1MU0A 1XE3A 2JASA 3O94A 5BVGA 1ZVVA 3PITA 4IOKA 1ES9A 8AT1A 2DFLA 2IUEA 1WXDA 3FFTA 1IAQA 1THTA 1ZH4A 3GK3A 3WK7A 3K09C 4HUTA 1NZJA 4RMNA 1DKUA 3CNLA 1N5JA 3HYRA 3PC3A 5DM0A 3HYCA 1T1RA 2WMDA 4AZ3B 4B79A 3ZVNA 1L5RA 1LKZA 2A0FA 5FQNA 3TLGB 3WL6A 1O5IA 1U2QA 1SOVA 4BN4A 1P5FA 2Q21A 5IKEA 5LQKA 3EEBA 3QVSA 2ZP1A 3HSSA 1XNHA 3MWDB 1YCDA 4C3VA 3RFFA 4D0RA 3NDPA 5FBHA 5IVDA 1PJSA 2OV6A 4YI3A 3CR8A 2WF6A 5L3QB 1CUXA 3SE0A 1MJ5A 4GQIA 5BN4A 2A0YA 1ORRA 3NOXA 3LC2O 4KDCA 3G9XA 4KWTA 2LCFA 4W7HA 5B1DA 1UEJA 1C4WA 1QMPA 1XDBA 2D1QA 1Q0QA 3DFFA 5TPZD 5PNTA 5LZ2A 1P4SA 3D9QX 4QBGB 4B6EA 1VI5A 1MF7A 4WZ6A 2XCQA 1K92A 3S8MA 3GLQA 2WHPA 4ZIRA 1PCXA 3ZC3A 4NJMB 1UT5A 1ODIA 2XMBA 4IRXA 5EHZA 1Q17A 1S6YA 5J3JA 3UJHA 1TUBA 1OLUA 1Y8AA 2QVBA 4R5MA 2PMDA 1W0JA 4RD2A 1UK8A 2Z43A 1FYFA 3V46A 1ZBDA 1G59A 3KJIA 3S2UA 1YQUA 4PGGA 1T0BA 1U81A 3EZ9A 2XADA 3SR0A 3PFGA 3MRXA 4XXHA 2GM4A 1K8YB 3EEOA 3E0QA 5TQ0A 3Q7RA 3DV0A 3FFAA 1PDOA 4NQRA 1GTRA 3HYSA 4ABTA 1BE6A 5ILQA 4I5DA 5CK4A 2DCUA 1YV9A 2PK3A 3OTOB 3GC6A 4W4TA 2IYEA 3ST7A 2O8BB 3EVEA 5AOCA 2DR2A 3IUJA 1JFFA 2EV9A 3GA7A 3REGA 4YMTA 5T8KC 5JS7A 3BJIC 4BO6A 3CS3A 4RQAA 1VI6A 4HH1A 3H8VA 4IUCS 4OB6A 4OJMX 4WBXC 2IIQA 4NYIR 2NZWA 1VE9A 1A2QA 3LY9A 2IYZA 1AQLA 5AJTA 3TJRA 1OWNA 5KOJB 2VLIA 3DMDA 4RZIA 5EC8A 3GRYA 4O5OA 1JDJA 2WNSA 1QO0D 1YDEA 3QY9A 1CVIA 3Q3CA 3P0EA 5KU1A 1A9YA 3HCNA 1H2XA 1NVDA 1SHZA 4QOJA 2Z95A 3V8PA 3U4MA 3E9QA 4HAWA 4INJA 4EUEA 2RB5A 3JQ6A 1DKNA 4KR0A 3JVDA 1PV2A 3A9TA 2PANA 4Q4LA 4CM4B 2J7KA 3BRCA 1XCBA 4M7PA 4KYIB 5AI5A 1CE8B 2W6OA 2YWFA 4YY3B 5IBCA 1KU0A 1V7CA 2JA1A 1AM4D 3D5QA 1WABA 1E2JA 2HXGA 3QOWA 2NZ2A 4I9NA 3C8MA 4JFAA 3FKSA 4M2LA 4ENWA 5LMCA 2H3EA 3K7EA 2E4XA 3RS8A 6REQA 4UEWA 2JGNA 1FFSA 1P5JA 3N2IA 4LHEA 4EG3A 4RELA 3LQRA 3UWDA 3R23A 2ZUVA 4U6NA 4EW1A 2D4AA 1WTAA 3S99A 3JZAA 2ACKA 3RU9A 1GWNA 5DRTA 3GPBA 2GN1A 4I36A 1O95A 1TRKA 1UIRA 3GLVA 2G5TA 1IY1A 1C0IA 2VBIA 1BMDA 3HA5A 3OEHA 4EUFA 1WETA 1GLVA 2C59A 2XZTA 5TEWA 4FFSA 4Y0NA 3TH5A 3WDMA 2GYVA 1FP4A 3NXSA 1A9XB 4M87A 3TQCA 3U1VA 1P4RA 4L7VA 3VGJA 1TA0A 1H3FA 2X9LA 5G1PA 5C37A 1EFAA 3UJDA 2JLWA 2CUZA 4BVFA 2A0KA 4Q9IA 2QMOA 5BPHA 1GDDA 2Z04A 3QLVA 4L3OA 4TROA 4F93B 1IHYA 2QTLA 2XT9A 1VYHA 3HQ4O 3IB3A 5CVDA 4GKVA 4IF6A 1GPDG 3UBMA 4EPXA 2P40A 1D2HA 4YJHB 4UNRA 3RTAA 1MFZA 4S0XA 4CL3A 3WICA 2VAWA 5TT0A 4I5FA 3NH9A 3VR2D 4EVRA 1HDIA 1LNZA 3VH2A 3IDAA 4I66A 4P7KA 3RTCA 1V1RA 3D5EA 1Z5GA 3EVNA 2OL4A 3OCXA 1Y6QA 2E5FA 4R1LA 4JUDX 4JCOA 4NCXA 4G26A 5FNZA 3RWBA 2ONCA 3EDRA 5B4UA 3NKFA 1MRZA 1YOVB 4DM4A 3FRHA 3S8EA 3KFLA 2FJPA 2GVNA 5DLPA 1JB1A 3NKVA 3ZZMA 4JQCA 2H52A 3WMEA 2PZJA 3L0PA 3GWGA 2X0DA 1LSOA 4RGVA 4KDRA 2QA5A 3MINB 4Q4HA 5EMJA 3KHSA 2ZIXB 2J9RA 3B2NA 1BOOA 3LC0A 3LE8A 3ZXYA 4ZCMA 4OLAA 4ZOLA 2X0EA 3SWWA 5ESWA 2ZUEA 1SEPA 1IVYA 1GCGA 2QNRA 4J1TA 1OYYA 2Q28A 4JR2A 3RS0A 5I3ZA 4NCBA 4DRYA 4LF9B 2JK0A 1D6NA 3MTEA 3WFIA 1R4ZA 3L7BA 3ZTWA 4B87A 3HFRA 3K70C 2PVPA 1RWBA 3PT9A 1GKUB 3NDIA 3H2KA 1SVKA 6REQB 3BE6A 3SQDA 4AUKA 4EGAA 3NVDA 1AA6A 2G8NA 4UPEA 2WRZA 4ZU6X 1YGPA 1PK9A 1E6LA 1SWWA 1NX9A 1Z3CA 2YXLA 2V6IA 3ID6C 4H60A 4OY3A 3ZY4A 3FSEA 4ZI7F 4WJZA 5CD1A 1P9NA 1SCIA 4YLYA 3HKEB 1QO9A 1QO0A 5BW8A 4IIGA 2RHWA 4FMPA 2D74A 4MIOA 2C58A 1ONOA 5KYNA 1VHLA 3M6UA 1ZRNA 3OCJA 3RI3A 1WKBA 2QAGC 3W05A 2RFLA 1D6JA 2Z9DA 2L0XA 5L9AA 3OI7A 1BDIA 3CB4A 3D64A 3PRJA 3HADA 4BNGA 5BXQC 4L85A 1JAXA 1BHQ1 4C4ZA 4KXWA 4NBRA 4GXRA 5D7BA 4ZO6A 4QOEA 1XQXA 2ZIGA 5EXSA 5CUQA 1H4VB 1KFJB 5F2OA 1F48A 3UB3A 2B1QA 3BEOA 3GT7A 3HEAA 1G1AA 1L4UA 3HKDA 1I80A 2Q2NA 4GS5A 3DXZA 3MQ2A 4A03A 2PFKA 1XTSA 3CHYA 1SMKA 3C1OA 3WK8A 5LP6A 3Q7QA 4QRDA 1JQBA 1M7HA 1ML3A 2QU8A 2ZYRA 3QVXA 4IIEA 4C05A 1CUYA 3DDHA 2XNDD 3U60B 1Z6XA 2XI4A 4M49A 3RK0A 1O95D 3GY0A 4Q9JA 5F5LA 3TE7A 4LHWA 3MG9A 3CWZA 1MCZA 3VPAA 2AW3A 3EQ6A 3EUFA 2BLLA 2PPLA 4E22A 1E0SA 2D2FA 4PAOA 1CUZA 1WMSA 2D5BA 4WXYB 4IM7A 2ZWMA 2XTNA 2EQ5A 2HMYB 4O29A 5H16A 3SQMA 1BRMA 1SBZA 3RUHA 3WFZA 4L4RA 4TKUB 3WWEA 2FPKA 1HDRA 1XR3A 4II7A 4DB2A 3PQFA 4D0GA 1GADO 2HK6A 2DQZA 3UCXA 5CFNA 3FMIA 5FI5A 3H4VA 1XEXB 3G49A 5ALGA 3BDIA 2AD1A 2DX7A 1OZFA 3BH6A 3JYHA 4GO1A 1O0CA 2RKOA 1YK1A 2O0JA 4H6XA 3FYCA 4KWCA 4MROA 1MUUA 1M54A 3AEQA 1D2MA 2EOAA 3O9MA 5ANRB 2ZYHA 3UAGA 3VOTA 1BMFD 1OFIA 1Y5MA 2N0SA 2GF2A 3GRKA 4FKBA 2LCQA 1RKQA 2ZQZA 3CF6R 3TCXB 2XYHA 1FRQA 1XJQA 3BZBA 3SLRA 3IT3A 3OLWA 3WAKA 3KSAC 1C1HA 2XXJA 1KK1A 3F3YA 5AK4A 3ZJ5A 2RKWA 2WKRA 1UF9A 2OMKA 3ONNA 5H3LA 3I9JA 3HCPA 1AKYA 2CMGA 2IDJA 3H1FA 3A3PA 3K1AA 4ID9A 4J1TC 4LY6A 1JVSA 1A7AA 3M6FA 2ZS9A 5JNSA 1G8JA 5IRCD 4N03A 4M8LA 2ZAGA 3PE3A 2DQ4A 4RKEA 3ED5A 4MWEA 4OHFA 4P3XA 5DM1A 3OE7A 3IVCA 3ZJTA 1SVMA 2P2CA 1PJAA 1Z28A 1NU6A 2EEZA 3FKSD 4MYSA 5A6VA 4PLPA 3HHPA 2IVFA 5ENZA 1DWQA 4OU5A 4G5FA 2PUCA 3RRFA 3TJZA 3KLOA 5J5VA 3DAYA 2JH9A 3G82C 1JUDA 1ZH0A 1ANKA 5FRDA 4HFRA 1B73A 5G0TA 3U7GA 1R9NA 2AFHE 3ADCA 4BWYA 1JQDA 4J94A 1UKYA 2J08A 4CCWA 3F6YA 2HADA 1K6IA 1JMKC 1Z39A 1QYIA 2QMHA 3AUUA 2X19A 3NHUA 2DC1A 3FHJA 4G4JA 1TZCA 2Z2JA 4JXXA 4OCZA 4XQCA 3AB7A 1X8LA 1ISIA 2P0YA 1CZUA 2BDUA 3L7DA 5AXDA 1JJVA 2UU9B 3RG2A 2B35A 3H1GA 2B7CA 2WPDD 3C5WP 3UH1A 2R7NA 3MXTA 1ZG3A 4JVSB 1PK8A 1WUIS 3HSKA 2OP0A 4PFQA 3E5RA 3ZGOA 4BEVA 4CI0B 4LS3A 4U3JA 4EY5A 1AMOA 2XZLA 4B4WA 4RTQA 3C3BA 2XIJA 3K20A 2ODBA 3ENZA 5JBIA 2NP7A 1KYTA 1DX6A 3DZHA 5EJFA 5ITZA 3F74A 5H7XA 5JQWA 1QIEA 1M6EX 1EYZA 2DETA 2AUNA 3GYBA 1E9BA 2DLCX 1R15A 3I04M 4Z1OA 4WVLA 1OGYA 1M75A 1NQXA 2J5XA 2XNSA 3AUXA 1UUFA 1EFDN 1QV9A 1VE1A 3L46A 3M9XA 5DCWA 1JR6A 3MXOA 1U8TA 1XCMA 1T4GA 4HWOA 4K9OA 1XMSA 3F3KA 1IY9A 1PYDA 2NW6A 2OV8A 4QJBA 3DBIA 4D5GA 4F6CA 1EDDA 2HIHA 1RQGA 1TM7E 2F55A 2A3RA 2ZSEA 3EEFA 3TXAA 3COZA 3SBXA 1Y3FE 4DWJA 2QM3A 4BJ6A 3W3ZB 5FR2A 3ROFA 3ZHZA 3FNRA 4MWZA 2YVLA 3EGEA 4BQSA 3PDIB 5ICGA 3LI2A 4LDPA 2YOGA 1Y7PA 2D1TA 4FFVA 5LU9A 3OX3A 4ZVMA 3LXXA 5B2EA 1TYAE 2W4IA 4HDMA 3AVYA 2UZ1B 1E3SA 3GGCA 3LPCA 4MMXB 5CB4F 1M67A 4MQEB 2PBZA 2DQYA 4L78A 1N5OX 3NDBB 2OHGA 5HIIA 3C41J 3VSAA 3KTOA 2OM6A 2O7SA 1F6BA 4ERXA 5IJ0B 1AO0A 2DEUA 1DTEA 2F3QA 3NPAA 1FQKA 4CF7A 2OV2A 4F5WA 5ELXA 5BYKA 1JFVA 1JH9A 3FTNA 3DNMA 3JXEA 2D2VA 1B8VA 4GE3A 3SJCA 3ZTTA 3ADKA 3C3AA 3QFCA 1C1XB 4HMPA 3AEZA 1WMBA 1WWKA 1BEZA 3ZYZA 1B0ZA 2JZOA 5K0TA 1EHYA 4CE6A 4M7OA 2R68A 2OXFA 1RHKA 3OE7D 2NUTA 1H8EA 2HHCA 3T1NA 5CEJA 2IU4A 3QNMA 4M89A 2GCOA 4I08A 5T3YA 3L40A 2QAJA 4E2ZA 2HBZA 2AL7A 4QU5A 1O87A 3KR9A 5CK5A 2XXBA 2IIBA 4MLPA 3GFVA 3NJ8A 1UKAA 1TC2A 4LV8B 2GXQA 4YMIA 4KXXA 4BO8A 3BE5A 5BXYA 4LF8B 3C16C 5CFLA 2ZBRA 1OFUA 3A58B 3RYHA 2V98A 1XMIA 3L0DA 1Z0DA 1O96B 1B6SA 1NNI1 1SG9A 2PMKA 3DZIA 1ZH6A 2IPLA 3HCEA 3HJRA 4EHIA 2Y1OA 4UXJA 4UUBA 4YUWA 5CLFA 1GZ4A 3OIUA 2HQBA 1HORA 1WSWA 1OH5A 4AO6A 1VCHA 1VYUA 2CNKA 3KUCA 4G8JA 4UBMA 3TD6A 2EHDA 1VJGA 1QS0A 2D4HA 4UAGA 3ZE8A 3AF5A 4B32A 4BFXA 1FPQA 2AZMA 2P2ZA 1EHCA 3JWJA 2OBNA 3OZDA 4UHBA 4ZOLF 4BNYA 4BNXA 5A4DA 2FMKA 2C9CA 4HEA6 1UXJA 3RGWS 2JD0A 5ESXA 4OX9Y 1IATA 1G66A 2OYSA 4QPJC 721PA 3GO4A 4BLRA 1K7FB 3JCZA 1UDXA 4CG0A 2YX1A 1OTHA 1M34E 3MOSA 1IZ8A 4MQEA 1X9GA 1XLUA 1Z8DA 1DKQA 2OCGA 2GGSA 1J2JA 4KLRA 3FH0A 5MN5A 2VXYA 2NP6A 4GI2A 4ZYXA 1M6VB 3CJQA 2HEIA 2W58A 5F3RA 4JQYA 2BI4A 2PKWA 4Q9AA 4M9CA 3AVXA 4N0PA 1X8XA 2NTJA 1TT5A 3GFPA 1E9FA 4FOLA 3LP6A 4RVSA 1TTPB 2WM9B 3P2JA 4RAQA 5C34B 3L02A 1IWBB 1SBHA 2JJ1D 1DOHA 1ESCA 2B1IA 4EEXA 3AOGA 5EIBC 1HH4A 4YXFA 4EA8A 1YHZA 3T94A 3J81k 5FI0B 2YWDA 2AQ8A 3O3CA 3OMWA 4JUCA 1WHSA 3DZJA 1WHTB 2ZSAA 5BWLA 3HYNA 2ZKLA 4NK4A 4HQKA 3UJ9A 2GBGA 3QVJA 4H0NA 1OYVA 1ABEA 1E8MA 1XWWA 3HDYA 4IX1A 2VPQA 3LNTA 1H0KA 2WJWA 2QAGA 2A9FA 1UADA 4HRYA 5AHKA 5EUBA 1JEYA 1Z62A 2XDQA 1FB5A 2PR7A 4BZZA 3VC2A 5IUJC 1J8VA 3ILVA 2VQEB 5B3AA 4KBYA 3ZGXA 3WWCA 2MINB 3DEIA 4KXVA 2HO4A 5DM60 4LPSA 1K7SN 3E5MA 1BAPA 2WHEA 3JWGA 1AGNA 4O4HF 3A06A 4R98A 3FLMA 3I2HA 3X44A 1BC5A 1KDVA 1N7GA 1TYEB 1CNMA 1PGJA 3ZNOA 4QSMA 3IUNA 1TCAA 3MCVA 2C57A 2YOFA 1KQOA 5KSYA 1TB4A 1XLTA 4WBNF 3AUYA 2OSBA 4FYWA 4OMCA 1RRMA 1H8ED 3DFKA 7GPBA 1ZD2P 3PUXA 2PSEA 3IULA 5KNDA 2LKCA 2RHCA 2JHAA 4D92A