5B2FA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (phosphate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Putative uncharacterized protein PH0499
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2fA00
3WE7A 1Q74A 3WL4A 3DFMA 1UANA 4XM1A 4XLZA 5BMOA 3WL3A 5B2EA 5B2FA 3DFFA 5CGZA 2IXDA 2XADA 4XM0A 2X9LA 4EWLA 3DFKA 4XM2A 1Q7TA 3DFIA
chains in the Genus database with same CATH superfamily
4J90A 5AVVA 4PHFA 2X2EA 4Y2XA 2R1TB 1MC8A 1YJBA 2X2FA 3AERB 4JA0A 5CDFE 4QBHA 3VR5A 2XMGA 5BRAA 3WLJA 2QE6A 1D9XA 3I1JA 4HSEA 1AZTA 5GJVC 2FRDC 2P90A 3P9YA 5AJYA 3JWJA 4C0BA 5G0TA 4BQFA 3G7NA 1OA0A 4BFTA 3EYAA 4QLOA 4BNYA 4LVNA 5KB3A 1C1HA 2QQFA 4EM6A 4ZIRA 5A4DA 1STOA 5KHLB 1BC5A 2AR7A 4TXLA 2ONKA 2D7CA 1A9PA 1WM1A 2OHOA 4BMOB 5HP4A 5LZ4A 2IIPA 4OKSA 1XXLA 1TVEA 3EYWA 1TW2A 3HCRA 3P9NA 3MMZA 3PGA1 4XARA 3E82A 1FMCA 4CT5A 1YA6A 1GPDG 5A9SA 3ZJVA 1COWA 4HR7A 2AUTA 2CHUA 4BNZA 4DQ0A 1S5PA 4ALKA 4W8GA 2WNHA 3MT9A 2C9MA 4QYSA 4BZXA 1NXPA 1VL2A 5AK3A 4COKA 4H27A 3ZQ4A 3AZQA 1Y42X 3RROA 1IDOA 1Z68A 1M6WA 4LZWA 2X8WA 2ZXEA 3PSHA 3DQQA 3NYIA 1SU6A 3EF1A 5SY4A 3EIUA 4PO9A 4OHYA 3GLHA 1J8DA 2C9OA 2V58A 2XNHA 3X2FA 3LBIA 2FLWA 4JJIA 1W30A 3PPIA 3O2QB 4HBZA 4MA0A 4I1IA 2PU7A 5AK0A 3IPXA 3PCXA 1RKQA 2XB6A 4Q4AB 1QPGA 1L7QA 4CRWB 2NPOA 1RQLA 2HU7A 4ZQHA 3RUAA 1TCBA 4WKBA 5A9TA 3FCCA 3DWEX 2A5DA 2C77A 1H4QA 2H5EA 3FBWA 4ZD6A 5E8JA 2Z09A 3ZY6A 1N5JA 1U2EA 3KVOA 1CP3A 1LQ2A 1N0UA 4Y30A 4MP6A 3PFCA 4N49A 1SY7A 5J5AA 3C3JA 3ZKWB 3N0VA 4D82A 4CI9A 1PGNA 3NDIA 4H7IA 3ZE0B 5IS2A 2C98A 1RM3A 5FHRA 1W73A 2NYAA 4ODIA 2ZS8A 3FGZA 3RV4A 4BNIA 1I24A 2JAWA 1KETA 1OXKB 4FJ2A 2VSQA 3OWOA 3CCFA 2A9OA 2B21A 2O0HA 4YMTA 1X1EA 3E9ZA 5KTMA 2IH2A 2EGGA 3LM8A 3LVBA 2FUKA 2JCYA 4LRQA 1KH3A 2JIPA 4UNQA 5EWMA 4DCUA 2UYHA 2NO6A 1DINA 3CLSD 3NTXA 5HOEA 1K0FA 1T0UA 1UF9A 1HG1A 2BI4A 2H8GA 4V0LA 1IU9A 2JVKA 2QRVA 5DNAA 4OQDA 2OK7A 5JI2E 2QL7A 2GKGA 3T15A 4BGDA 2I1LA 1DP4A 2RK3A 1D4ZA 1E1CA 4UJ5A 5CPBA 1C0KA 1OVGA 1V5WA 2I3ZA 2IHYA 4HEJA 1SUDA 2HQRA 4C1BA 1QHEA 1QHNA 1G291 1Q3TA 4JJKA 1NZJA 3NOVA 3RS8A 3ZHXA 2J41A 1DIAA 5FI1B 2OFFA 4EPXA 4FQ5A 4BV8A 4AQ7A 3FTEA 5IN4A 2QSYA 4G37A 3RAPR 4KPYA 1VB5A 3VYRB 5K05A 2B1GA 2OKGA 3AJ8A 3O4IA 5F9HA 2O7SA 2QU7A 1Y7PA 4UM7A 4Z51A 2R8PA 4A0FA 1XRJA 3WZ2A 4P80A 2G8LA 2WVGA 1M1UA 1J97A 3LLVA 2EYUA 3O3NB 5EWJB 1OX4B 2FR1A 4D8UA 3QITA 1HT1E 4WE3A 4MQLA 1US8A 1O6GA 2VP3A 1A72A 2BSQA 4IZ6A 1FB5A 3HC7A 2G1KA 2QJRA 2RARA 4OKNA 2XJ9A 3CF4A 4FEEA 1ABFA 4C4ZA 1RWBA 3UMCA 1IIBA 3WL8A 4DJDC 1AUXA 2PCJA 3AR5A 4RCYA 4U6SA 1TEZA 4PTZA 3OCJA 4G1MB 3WLIA 2AH5A 3BXFA 2YV4A 1XF1A 3R4CA 4IIEA 4EABA 1ZIDA 3EEBA 1U2PA 3EXHA 1C9JA 4AW9A 5LOVF 2VZ9A 1XZPA 2Y76A 5I48A 4IGKA 4IICA 1B42A 3BM5A 4TLLB 3UMSA 4EYQA 2WV7A 4LHZA 1Z4QA 3AEXA 4F12A 5H3CA 1TRKA 3L04A 2Q1WA 3IFSA 1RKUA 4TV8B 1KAMA 4JI2B 4TM7A 3REFA 1VE3A 1SCJA 2VK1A 4UDNA 4UDYX 1E2HA 2XD4A 4HJRA 4MPPA 5DRTA 1ZRHA 2DF8A 2QXYA 3PJGA 4GC9A 4HDRB 2ZSJA 4YGYA 5IU6A 4AKGA 1W6RA 4F3CA 4EVIA 3UGJA 4CKEA 2O2CA 5K0FA 5DYGA 1LDEA 5G2OA 5I4BA 1U0JA 3KP1A 4X3PA 4AKIA 1TQ4A 2WUVA 4RHUA 4TZ0A 4LY3A 5HTKA 3KZOA 4QDUA 1JAIA 3NTLA 4DQUA 3KWLA 4X94A 2Q49A 1OU0A 2V7XA 4G3XA 4IUYA 3LA6A 1R4NA 1W35A 4LQLA 5A4KA 4HDKA 4AULA 2VOJA 5P8WA 3VVCA 1N6KA 4B2YA 3TFOA 1IATA 2D5CA 2FJUA 3IUBA 2ECPA 3QW2A 3OQNA 1JUDA 1L7AA 3AESA 1ZW1A 3MB5A 1MIHA 1ZKMA 4I08A 4NZMA 1DTWA 5CXUA 5K1ZA 4Z3OA 2IH5A 1OBCA 1MUUA 3UMRA 2IS2A 2QUHA 2Y1CA 4RGQA 4RL6A 3TLYA 4OQZA 4NSNA 4A36A 3KOWA 2NV0A 1JFVA 3BCSA 3GJ8A 1KI6A 4WLUA 1BKYA 2ZJFA 3U39A 5CH3A 1UFKA 2W48A 4R8SA 4Q4CA 1R64A 1Z37A 4EG1A 3OMWA 4CTNA 1VGRA 1Y9DA 2GF0A 3T9DA 1CQPA 4Y2JA 3VTFA 2YZGA 2EEPA 2MINA 4DRXB 1DAHA 3S40A 1UDCA 1YIDA 3LL4A 4OI2A 4WWHA 1SMKA 1MQ8B 3C1UA 4FFOA 4NMMA 3R9KA 4BLTA 5E6RA 5BYKA 3R1IA 2NSHA 3WJ2A 5KS2A 2X23A 5LMZA 3QU5A 3C8UA 5EE1A 3QBTA 1LLFA 2NYUA 4GMXA 4M1ZA 5FOTA 4D3DA 1IUPA 1JSXA 4QO7A 2XWJI 1PYGA 3BRWD 4LWOA 4BLUA 1UC9A 1S02A 3PEWA 5J2TB 4KXMA 1UFVA 5HWSA 3GDHA 1IWBB 1LF5A 3H99A 2OCXA 3LYLA 4G8DA 4KEAA 3WLPA 1G0NA 2Q4TA 1BHSA 4XB6B 3UM9A 1XYYA 3B7WA 1X2EA 2BHSA 3F1LA 3IDFA 3QPVA 3CHYA 4KRFA 2ZE8A 1RR6A 5ALRA 5BWNA 1KIAA 4BRSA 3KXLA 5C7LO 2FSVA 5B7QA 7AT1A 3N7UA 3IKJA 1ZVMA 3OEHD 3HCNA 3QVWA 3F9IA 1DFIA 4IQ4A 4RZUA 4ZOLF 5CX1B 5TMPA 1TTPB 3A6FA 3GX1A 4QJ3A 2K7FA 221PA 1OGIA 4PLGA 3GYGA 1SHLA 4CM5A 5A2QA 5DYYA 1QWOA 1T9KA 2UDPA 3H7AA 3LGXA 5IULC 4NAUA 1L4LA 4C06A 3QV2A 1QF9A 4LF7B 1ORDA 3C1OA 5HDBB 2XOKD 3BF8A 1NDUA 2A7QA 4RV5A 1U3WA 1E6WA 2B8WA 5K51A 2IUUA 4URZR 2KM1A 4JBWA 3OJWA 5DH9A 4GMKA 1TM5E 1QRAA 1UK9A 1RP1A 4O0MA 2FPSA 2VHYA 5KBYA 4MR7A 2ACEA 3FYTA 3O4GA 1UIMA 2FW8A 3ZN2A 4BMSA 1IY1A 4MVJD 2RJOA 1GCAA 3GJ3A 2SKEA 4KE6A 2FH5B 2J3HA 3ZHOA 4B6QA 1W52X 2IYQA 2CN1A 1WBBA 1T2NA 2O2HA 2XUPA 3LWDA 3P9PA 1D8AA 1U8ZA 2G40A 5GZ1A 1TW3A 4WD3A 1JDZA 2PMCA 4K03A 3WGZA 3GFGA 2LVBA 3PQCA 3V33A 1SXHA 2X2OA 4DR3B 4NG5A 2JIRA 4IFTA 1JPUA 3GRZA 3O91A 3TM4A 3I0NA 3TZLA 5DXJA 4YUVA 1G16A 2BJHA 3B7GA 5JY6A 2J08A 1NGSA 1R16A 2FDXA 1KKLA 3OT5A 1A1SA 3A9SA 3QF4A 4AVYA 2GO1A 3LCUA 1NQVA 1WPXA 2ZDQA 3DNFA 1XCMA 2D1YA 3PSAA 3PQ3A 1OHHD 1JDTA 2IHKA 5FA5A 1NN1A 3UK0A 2ZKLA 1F8FA 3GGOA 1CHNA 2O3JA 5DMXA 3STYA 3HSSA 4ZCTA 3WAGA 3S1SA 4MKXA 2QAGB 3GI1A 1JNXX 4BQPA 2G9VA 3E81A 3K09C 5GGYA 4ZKDA 1O1YA 4RLSA 2WJVA 4UBLA 1XTQA 2XMSA 1WULS 1H05A 3HA3A 4UPVA 3VU8A 4ZXPA 4AL4A 3QVSA 3EIHA 3UMMA 2GWRA 2IV3A 4QHTA 1W6UA 2YJ3A 2I9PA 3CWQA 4RWZA 1L6RA 1SOVA 3KQVA 3L1IA 3W3AD 3VTZA 4CIWA 2HLPA 4GXTA 1P72A 2P5UA 1NI4A 1X1AA 3H1TA 1ZBQA 4NBLA 4TSKA 2FZEA 1ORHA 3JPYA 1V8ZA 3C5WP 3W6OA 1NW3A 1H4SA 1WEHA 2G07A 1EP3B 1OC2A 2BM9A 4HFJA 4DBLE 5A0TA 3H2KA 3BH7A 5FPSA 2Z2XA 2GN9A 4BBJA 5KHAA 1HRKA 4TQAA 1SHJA 1CY8A 2ATCA 4LYHA 4RY9A 2GD2A 4CIDA 1IK4A 3R7FA 1GNLA 1YMQA 5FOWA 4A27A 1Z83A 1GG2A 1G3MA 2X7HA 2J3KA 4URHA 1ZS9A 1D9ZA 5J58A 3PDWA 3AKYA 3OD1A 4YAUA 3NC0C 4DR4B 2YHIB 3QU7A 4FGKA 3WK5A 3GRFA 4UMFA 1KHHA 4M37A 1RHUA 4MV0A 4C04A 1FVOA 1V3TA 5KOYA 3ICEA 4S12A 3O90A 1TMKA 1U8CB 2M98A 3UC9A 3FETA 1A7KA 5IDYA 2CE2X 1XDSA 1AH2A 3QFCA 1I32A 10MHA 3VX4A 2J45A 1DC8A 1ABEA 4JVSB 1VKNA 1X9HA 4EFKA 4A8JB 1E89A 4F06A 3CEHA 4LBYA 2MYTA 4N12A 4NWIA 1CJSA 4S24A 4BNJA 2I22A 2JLXA 3VHLB 1GQOA 1HTBA 721PA 5HG0A 3D1VA 1TM3E 3N8HA 4CLDA 4ZEMA 2FUG6 3H5RA 3USES 3DQPA 3X1WA 3KZNA 3NAZA 2C4HA 4OQYA 1MDBA 3TS1A 2JGFA 2X9QA 3I3SR 4DLBA 4BQOA 4GZ6A 1N9ZA 4W5WA 3DV0A 3V8MA 4ESHA 5I3CA 2R8ZA 2VJCA 1NYTA 1OZGA 4JBHA 4MOWA 4MVJM 4RD3A 621PA 1LEHA 2VT3A 5JSHA 2ZR0A 1T10A 1R0RE 2Q1XA 3DBVO 2FSIA 2DFVA 1B43A 1MGPA 4JU9A 2J7PA 4NU8X 2IZ1A 1RYMA 1SQGA 3D4IA 3EG9B 5FPTA 2G04A 4RTOA 4HQLA 3HCFA 5GM1A 4G63A 3I1YA 2NTNA 1BMTA 3CPSA 2ZR8A 4IUDS 4NPCA 3EIQA 2JFZA 3UKJA 4ARSA 3CTMA 3RVNA 1LNZA 2WKWA 2CZGA 3A70A 1RE0A 3CRQA 2ZVPX 4N9QA 1Z0DA 3MZ0A 3FF1A 2JAPA 3HI6A 4PW0A 1I4DD 4YV2A 1NQ5A 3HVHA 2OVFA 5EY5B 1N1EA 2G77B 4XIIA 5B7PA 1JHMA 5LA6A 2GBLC 2PNFA 1C3VA 2WKQA 3PPXA 5CUQA 1IM2A 2WRZA 3SLRA 5EHXA 5KC8A 4L8WB 3UJ8A 3O1HB 5EIXA 2G83A 1E64A 4URFA 1GGMA 3HKEB 3KPYA 3KV3O 3LF2A 1CQXA 4CG2A 4EQ6A 3CSDA 2OGSA 3K0SA 4LE0A 1GQQA 5K6TA 4GOXA 2BGWA 4YRAA 5KOHB 5ALDA 3B52X 1KZ6A 4IAOA 1M34E 4RVGA 3RR2A 1OH6A 3DP7A 3WP0A 1N2CB 4RHEA 5A6VA 5CA1A 2ATEA 3LC7O 2GWHA 1UJMA 2NG1A 2WYIA 1MRSA 3L6DA 3NJRA 5DI3B 3P19A 3W6UA 3VSAA 1RZRA 1Y3DE 4TYYA 2WOOA 3MGGA 5J3JA 2JHGA 2RE8A 1VMKA 4ZDKA 1U5CA 1JFLA 4KWHA 4F6RB 4NCBA 4HDNB 1GNTA 1UJ6A 4B3SB 1ZM9A 3X1JA 3IEVA 4CV0A 4HDMA 5ALPA 3W6ZA 3E15A 3OMXA 5IUJC 2OO5C 1QFJA 3ZHSA 3M83A 2QSJA 1UJBA 2GVNA 2G5PA 2W6IA 1II9A 4ZJPA 3ADCA 3R2JA 1B8VA 2QN2A 2JFHA 2VYQA 1BG6A 1T2EA 1KSGA 1KOGA 1ADJA 2VWHA 4RV9A 3X1YA 5EFZA 2CHFA 2WJZB 3AVTA 2C88A 4YJ2F 4QPDA 1T3HA 5KDOA 1GGNA 1XXHA 2CKDA 1G19A 3FWPA 5TXGA 3O4HA 4ND8A 3WK8A 2JJ2D 2POQX 1RJDA 5A1JA 2PXHA 3CX7A 3W2IA 3ROXA 2EJTA 3ZZTA 4ZVKA 1EK2A 3QYPA 1PGJA 3ROTA 1GDHA 3HFJA 4HCJA 4OG2A 4QGFA 2R6AA 3MWEB 3ESXA 3OQOA 4HXEB 4II3A 5J4KA 4BNNA 4B8WA 1SC3A 4JSTA 1RXCA 1L7VC 1PU2A 2CHEA 2P75A 1QG6A 3CKLA 1HDRA 4QOJA 3U3XA 4R9NA 2ZSKA 3RIHA 3VPCA 1CS0B 1NNUA 1NW7A 1XA3A 4MIYA 1POXA 2QRJA 4KFTA 1X2BA 4NH4A 2ISSD 4E0BA 4ZTZB 4EHIA 1HX7A 1XTJA 1XCJA 1F0YA 4WDRA 3O1IC 4NCXA 3CKMA 2I3GA 1ZC4A 4F93B 4NBUA 1XDBA 1RRKA 2YQZA 4KUEA 3SLGA 1NC3A 1UM9A 1K97A 3VKUA 2RHMA 3HJCA 1FRZA 1L4NA 4YRZA 2N47A 3NOXA 3V6LA 1FFDA 2KLBA 3H0KA 4B48A 1J1ZA 4WI1A 1YE8A 2VZEA 3MBIA 3RTAA 1UPXA 1BVRA 1XXHB 2OC4A 2GLTA 2P91A 4CM1A 5BNWA 1AGYA 3AEUB 1YOBA 3MBKA 2NZYA 3GPCA 5KJFA 3ZGZA 1PNOA 4HWPA 5AVRA 3RADC 2G3YA 1SNYA 2HA5A 4FXOA 4J76A 1T8RA 3KB8A 1M8JA 2AJDA 3ZUGA 3B9RA 4KDCA 2VCHA 4PAWA 4Y9UA 2H4HA 3ML1A 3OCCA 2CXQA 4HDCA 2FKNA 2BFCA 4D46A 4IUCS 3I1IA 4CT4B 1BYIA 3PFKA 1NU6A 4R5HA 2VDKB 1WW2A 4ZEVA 1XNGA 4XWAA 5SY6A 3DGFC 5TGDA 3ROGA 5IM4A 3IXQA 1NDHA 1E0DA 4N01A 4Z7QB 5ENDA 5HIAA 1W36C 1KOFA 2VHWA 3OPMA 4MYCA 2VHVA 3GLSA 3JQGA 3EFOB 4LDRA 4WK0B 2P6UA 2R6ZA 5LOVA 2O2ZA 3Q3JB 1YIAA 3TR6A 4HP8A 3GLFA 5I7OA 2IELA 3G1WA 2YZMA 2W2MA 4ZOCA 3WO0A 3O0DA 4DPMA 6AT1A 1XAGA 2QRHA 2CV1A 2LP4Y 4REQA 1KFEB 4UZEA 3TIGA 5JNRA 2XMRA 2AZXA 2XEXA 4GLFA 1KJQA 3JV7A 3ZCXA 3L6OO 4IDHA 3V6MA 5K8CA 3L0IB 1FVXA 3PHHA 1OI7A 3NIBA 4OM7A 5H7XA 3JRWA 3TBHA 4D6PA 3LYAA 4RENA 4J94A 3EEQA 1X77A 5KI6A 3COZA 4K28A 1KVTA 3OFJA 5LU9A 3MRSA 1YZQA 5C1IA 1DC4A 3BJIC 3OU7A 1EGMB 1L8AA 3G2KA 2YV3A 4LE1A 4DM4A 4QM7A 3EW7A 1T4BA 3IHWA 2WU3A 4MVCA 3TQFA 1VKZA 5LQKA 2PUGA 1XU9A 3KJEA 2LIVA 3CNHA 2GPNA 3ROKA 1M7BA 1XL0A 4TLCA 2E5WA 4KVFA 1XHLA 1XPJA 2K4MA 3FRHA 4RLHA 2G76A 3GLVA 4UCWA 3WXMA 3PEYA 1USKA 1PS8A 3UO8B 1M6VA 4OP2A 1QX4A 1OLOA 1PGOA 2AN5A 3K8OE 4GM4A 1LI4A 4JVNA 4L8GA 5J2UA 5FBRB 4JY7A 3ZWQA 4PSUA 1UP6A 4BLRA 1J0BA 1YZHA 1COZA 1PR3A 1GM5A 2ID9A 3ZXXA 1GGJA 3OQIB 2ZAYA 4OAQA 5LCXA 2VCYA 2BZSA 3MTEA 1P61B 2COEA 4HDNA 4QKQA 3KZ1E 1XU7A 2GPJA 4BLQA 5I01A 2QRZA 1IM5A 2PKWA 1FMTA 3CJTA 4PYJA 1D6MA 2X5JO 3AJDA 4C6HA 5BOVA 1E79A 4G41A 8MHTA 2X8LA 3HSKA 3G5AA 5GVRA 3PXEA 1JXQA 2OAGA 1F6DA 3G2IA 3SC4A 4BNDA 4IJVA 5KUTA 4B31A 3EXFA 4P4SB 5CH8A 1I1HA 2WIBA 5IAOA 3KRTA 3RSQA 3WBJA 2JH3A 2F8LA 3LT1A 3ZEAA 4OJMX 1RTKA 4U7DA 3EMDA 2H4XA 1GG5A 4P7JA 3UK7A 1W36B 4URXR 4LTNA 3LBYA 4QEDA 1RYHA 3HNRA 2FJPA 3N86A 3FD8A 3TQTA 1RQRA 2WKSA 3ZNOA 4D0LB 1W2GA 2IPOA 1W5AA 1Z3CA 2R79A 5TGTA 4MW0A 4B7XA 2CLHB 2MJLA 1KC3A 1SEPA 4OPMA 4WNIA 3G9TA 4D8YA 2DHCA 3DAFA 5BORA 3F6RA 3WHPA 3L49A 1DC7A 3GFSA 1I7NA 4BNVA 5BN4A 3RUHA 4PU0A 2QMEA 4PN7A 3WK4A 3AMVA 1N77A 2XE4A 1W9HA 3EW9A 1C9KA 1VI2A 3Q7TA 3FOWA 5HBGA 3CLSC 4F46A 2ZBFA 3FCOA 2OR3A 3ZDEA 3HDJA 4IH9A 4HVCA 3DXYA 5AM0A 3GRUA 5EJIA 4GYWA 4YJHB 4EW3A 3DEAA 5KYKA 2PQ2A 4WESB 3OPXA 3PE6A 4JL6A 4X6LA 5H81A 3NHWA 5CEJA 4EI7A 5K0ZA 4MHTA 2IUYA 3HV0A 4R4JA 2HRCA 3DB1A 3IEPA 2RK4A 1TQ8A 3QHQA 4B82A 1J1UA 4RADA 1JE0A 1NRXA 1T4CA 2PUVA 3K3PA 4KQ2A 5DYWA 3CLUD 4WBNB 2C54A 4OL9A 1UK8A 3V1LA 4WXHA 1ZR2A 3FAZA 1RWWA 2QRLA 1D6SA 4DDVA 4EGSA 1U7PA 2FOXA 1FJGB 3P0HA 3VKGA 1JB9A 1T8SA 5AI0A 2D06A 3OZEA 1P7ZA 2VHEA 5CDFA 2C4VA 4NYMR 3VNRA 4YLYA 1KMCA 2PAFA 1I6KA 2I7VA 3MK31 4PNHA 2G9QA 3R5KA 3ZCPA 2HIHA 5LNK1 2GAAA 2P3OA 1CF2O 3CZPA 1WY5A 1Z6TA 2DT5A 3AUJB 5EERA 3U3KA 4TKUA 3UPDA 3ND7A 3JW8A 3LGSA 5F9FA 2BM1A 3QUBA 3A9VA 1JHOA 1FMLA 2LCFA 3GGJA 2GJAA 4WZBA 5ADHA 1H1DA 3BD9A 3KUDA 4ZT2A 4EAAA 4YRSA 3V7YA 4MQUA 4CIAA 3TR5A 1GLGA 3VO9A 4D2IA 3L0BA 1U90A 4R40A 1I33A 3BG5A 1W85B 1L1QA 2QW0X 3K94A 1JR4A 5FT9A 1Z2EA 4PGGA 4JYCA 5JAPA 4XDZA 4OQNA 5JYCA 2O5CA 4Q4JA 3I01M 3ABZA 2B8NA 2BEKA 1V41E 4MUBA 2GK7A 3I1FA 4GEKA 4HPWA 5DP2A 4FB4A 4LXHA 2QBYB 3C7DB 3D7KA 2NWQA 5TLSA 2HUPA 2CE7A 5BWLA 3AR8A 4H0CA 4NTZA 4RIGA 2YS7A 2CJFA 4XLLA 4RJKA 1IOLA 3ABQB 3EDQA 3S2SA 1LDMA 4S1WA 2I6FA 2Q2VA 3PFBA 4FKZA 4U3JB 2NPIA 4DREA 1ADGA 2C57A 2BT4A 3GEPA 1WCIB 4H6WA 5E1BA 3F1KA 5PNTA 2O8EB 4UAUA 5AHRA 5B64A 3KEOA 5AHOA 4O4LF 1A27A 1NLMA 1OVMA 1AKYA 3GBPA 3VHRA 4BTVA 4E2FA 1PJ8A 5C7YA 1H2WA 4CDMA 1TF7A 1HI9A 3RSSA 5BSGA 3PHLA 3BKXA 1ISHA 3AO0B 3E84A 3I45A 4U3JA 1T1JA 1FTQA 4ZVVA 3N6XA 5H16A 1RS0A 5IDVA 3TVDA 4FSDA 2XA1A 1K5PA 1RZVA 1AG9A 4D74A 1QSGA 4FMBB 2PV0A 2OGWA 3QBJA 2E85A 3R44A 4JMLA 2EKDA 2GHQA 2PG3A 2Q07A 4LSMA 2ZRQA 4N3GA 4Q9DA 4L95C 4P3YA 4DBVO 2FLVA 3KZMA 3PP8A 4JUFA 1BDMA 3DLTA 1ORTA 1D8TA 2R6HA 1B2RA 4ND4A 4Q4JB 2IEDA 1OAAA 2V5VA 2HJ9A 3NGLA 5BQXA 1RRVA 4R1OA 4FDMA 4U2BA 1NBMA 1LDYA 1RZUA 3RJ5A 4UCQA 2IV2X 1XEFA 2CKMA 4MV7A 5C80A 1XD2A 2QNRA 5DWQA 1RHJA 3X44A 2QMHA 1FMFA 4MVWA 2VG8A 1FUUA 2W00A 3MTBA 3GA5A 5BQ5A 4WZBB 4BP8A 2ODNA 2XQFA 1J99A 3CF6R 4C2AA 1DTWB 2ILVA 3H5AA 4LI0A 1DXQA 1KFJB 2XUFA 3HVJA 5CXQA 3E7FA 1XMSA 3E7PA 1A9RA 3PD7A 4XM0A 1ZN7A 3SZOA 3VKFA 4OLHA 5ICGA 1ILWA 1X1CA 3EULA 3Q6IA 5EWLB 1YA8A 3Q12A 5I7RA 3ID6C 1OZFA 2OV1A 4QOHA 3G0CA 2Y1WA 3UATA 3WLTA 2DPLA 4NYMQ 1GUZA 1R4MB 2LCIA 3PZRA 1SU7A 5J5CA 4NFHA 4B3JA 4BYGA 5IT4A 1TAGA 1SJ9A 3KE9A 2F7SA 1RRGA 2IOHA 4QT0A 4V0RA 4ALNA 5IEBA 1HORA 2J0EA 4LXUA 4CFYA 1F48A 1G1MA 1HEIA 1A4RA 1Q1QA 4FYVA 4EI2A 3OE7A 3DM5A 5K0SA 5KYUB 4TM8A 2PVCA 3EVNA 3OIDA 2A6PA 1AUQA 4W5HA 8ATCA 1E8DA 3U44A 1AMUA 3U4QA 2AFIA 4QATA 5T8KA 3FOEC 2I99A 3N5CA 1YDMA 3P0EA 3SCZA 3SKVA 3GB9A 2PQMA 4PPQA 4TS4A 5KWSA 4H3KB 4GL4A 3IHTA 1TLLA 3KYCA 5MN6A 2EGHA 1XSEA 4M0FA 1ORIA 2IY8A 3P9XA 2E37A 4XA8A 2CNDA 5SZJA 2H9AA 5CCXA 4YP5A 2GN6A 1V2GA 3RUFA 2OM2A 3OETA 1Y3IA 2XOEA 3AH8A 2CDNA 3ANLA 4FJ0A 3E3MA 4ARVA 4F3NA 2O7QA 3G2NA 3OQMA 4AWXA 2Y4NA 2VAXA 3EGEA 4QJBA 5TMEA 1EP2B 3AL2A 3HQ4O 3ZIAA 4EFMA 3U7FB 3TGLA 1U9JA 1BWQA 1J5XA 2ZRIA 1JWAB 2BTQB 4S1TA 4BQSA 1NI3A 1ODJA 1VKOA 2P2CA 4C0JA 5HIIA 2YZ2A 2XZLA 4J2HA 1LNQA 1ZK1A 1CDOA 1LVHA 1U9CA 1CJBA 2A0UA 2O3QA 2G63A 4I6EA 1M72A 1LQTA 2IHJA 3B7PA 4RD4A 4OB8A 1A5SB 2ZE7A 3IPCA 4QDJA 3WYAA 1GFSA 1Z7YA 3H8VA 2R6GA 4KPUA 4BEBA 3TLMA 3K9CA 1DHTA 3I3OA 1UAAA 2NUTB 4CKBA 1QVZA 2IKSA 1TKCA 5D51S 3T1YB 4TTIA 1OWMA 1J0XO 5TRTA 3RBZA 2WAYA 1XJ5A 3E1KA 5JMOA 5KQSA 3L5OA 4J43A 4JLVA 1NR5A 5AOVA 4Q4HA 3TG2A 4GQAA 1IHXA 1R18A 1A9TA 3FZQA 4UU7A 1NUPA 5C8YF 1F4LA 1KHTA 4XDYA 1N9GB 2H7XA 5CW2A 4DCOA 4RD2A 1TPYA 3V8VA 1CFJA 1MJFA 1NVUQ 1ZH6A 3Q8MA 4M8SA 1I2MA 1TQ6A 1QNFA 4B45A 4G1FA 4QT4A 4N0EA 3RRYA 2P3QA 1DG3A 2QAGC 1E66A 2NV2B 3ILSA 3FFAA 1QRRA 3WNBA 4KQHA 4HVTA 4CTOA 1U0OC 3FDXA 4CMEA 3LW7A 4OMUA 4QOEA 1WQ1R 3TECE 1THGA 5JXIA 1VYHA 3R6WA 1KSFX 4WUTA 4MS4B 5L3SB 1HDCA 5J47A 2C8JA 2VPWA 3RS0A 3SQMA 5IUKC 3BJEA 1Z0ZA 3C6YA 5BW5A 2R96A 4ND3A 2O8BB 3COVA 4X41A 4XRGA 3WNVA 4LQDA 1SBCA 1K5DA 2I3DA 4GUDA 5CGZA 5EIWA 4AJHA 4C3UA 2AEJA 3N74A 4WN9B 4TWJA 1T9AA 4MYRA 2G1AA 2R2GA 1LC0A 3LX4A 3U4MA 3LK7A 5L40A 3C7CB 4P6VF 1M7GA 4AO6A 1XD8A 3PQ5A 4L8FA 4URYR 2YJ6A 3MAGA 5IBPA 3SHWA 3OFVA 2QP4A 2ZT5A 3KKZA 4UREA 5ARCA 2WFLA 4JUIA 1YJ5A 2IHBA 4EF5A 2PUCA 5IJ9A 1FFSA 1FDOA 1Q1AA 4F11A 2Q3FA 3BEDA 1UXGA 3HYSA 3CISA 5D3ZA 4ADSG 1RACA 3WNDA 2W22A 1U7ZA 3L4EA 4QVIA 2HXYA 5A0VA 4C03A 2X3FA 1G1AA 5DGDA 3F98A 4I5IA 4RVHA 5IM4F 3H83A 3K5WA 3UICA 4AK9A 4F72A 2BEVB 2C3MA 5AM1A 2C7GA 4QARA 4V0OA 3ORQA 5A5FA 4MDFA 3USCS 2L18A 3FYDA 3DZCA 5K0BA 3Q8XB 4FR2A 5GJBA 2QTGA 3KJXA 1PNQA 2H1HA 1SFRA 5J5VA 4AJJA 4B3XA 4PR3A 5HS6A 1Q0HA 3LOUA 2I6TA 5A5DA 2X9LA 3K8QA 3NWPA 4QO8A 1IL0A 1GO2A 4AN1A 1O95A 2OZVA 2QAIA 4D8VA 1XJQA 2LKDA 3JZIA 4BZQA 2EGUA 2HWYA 2VTKA 3N2GA 4KIGA 4LPSA 3DAOA 2BJVA 2OAQ1 3ISTA 4INOA 1J07A 1DZ3A 1IOWA 2JH9A 3CZRA 4IO0A 2C3UA 1AN0A 3TTXA 4GVPA 4HGOA 1K6MA 1VKRA 1Y7TA 1Z12A 3UAYA 3AEUA 3DEFA 2VJMB 2EFGA 2RHHA 4CHTA 4MRSA 3COWA 3VC2A 1BS1A 4LDPA 3FFXA 2EBWA 2DQYA 4M87A 1LZKA 1GGEA 1XG5A 4Q5IA 3LSYA 1XD9A 3GT3A 5IF9A 2CDCA 3R3WA 1GIAA 1YK0A 1T9BA 4IWXA 3WTBA 1N33B 3UBTA 2I2WA 1M1YB 5SYNA 1T3GA 2Y0PA 4KGDA 5F3RA 1JXMA 4CMAA 1Y1RA 4D8TA 2CV0A 4KR2A 3KKMA 1MC4A 1NAIA 3PJFA 1TUGA 4NP6A 2VZ0A 4QC2A 1P1IA 5KSZA 3DTNA 4QOFA 1JT2A 2VHCA 4Y6PA 1RBYA 2XEDA 5BSUA 3HFGA 4JV5B 4PHHA 1RLMA 4DM3A 1Q16A 1T2AA 1V6AA 3OX3A 5TQVA 4DIUA 1ZU5A 1DCKA 2QW1A 3A14A 3C7KA 2V7VA 4X9XA 4OAPA 1Q12A 1MXHA 3NUGA 3R3VA 2QA5A 4G56A 4LECA 4DCSA 3THWA 2ZI7A 4V2UA 2P9CA 2WHRA 4YMHA 5EFOA 2XBLA 3U4QB 3D1LA 5K8UA 1WW8A 1EJ2A 1XTUA 4I3GA 3R77A 3D3WA 4K6MA 4XQ9A 2E4XA 1KAGA 1TC2A 2Z04A 5K2MA 5KQRA 4XJVA 3JZMA 2Q29A 1V4BA 1X8XA 3B1ZA 4MR7B 3VO2A 1YZNA 3AKCA 2WHPA 1R37A 3H19A 2XRZA 4YRMA 5M5BA 1EB8A 4RZIA 1G17A 4GX2A 3FUVA 2R9VA 2XNKA 1ZY2A 3V1YA 4TMVA 3TRFA 3AM3A 5JSZB 3VU9B 4KH0A 2ENUA 1M2VA 5DKFA 1GL9B 4U39A 3VPSA 1XCPA 2QVYX 2A67A 3RASA 2MWMA 4RHTA 4G5YA 3ZEIA 2NU6B 3IMCA 1NNLA 2DLNA 3ZS9A 3CN9A 1ID8A 1TUBB 1EBUA 1DBIA 1QZ3A 2ZQYA 5LP6F 1UT5A 1M1ZA 3KOXA 4FOSA 3A6ZA 1KOLA 3OQBA 1YU9A 4IKPA 4ZV9A 4U5QA 2ZETA 1JTVA 1JVSA 1S9HA 4PG4A 4Z8YA 1HDYA 2HBYA 2ZUUA 1UDBA 1WTAA 3ONWA 4P7KA 5EJAA 3RUDA 1KS9A 3E5HA 4RLQA 1JHAA 4CQLB 3MS2A 3KQLA 2Q6TA 2ZANA 1PJBA 1C7FA 4DC1A 5CURA 3S2FA 3TVTA 3MJSA 2VDWB 4PYKA 4HATA 1BYUA 4TSFD 3LDGA 1UDRA 2BUAA 4KLAA 1C3EA 4HLNA 5IBQA 1J90A 4WOBA 1U7XA 1Y5LA 3FJOA 3QKIA 1BAPA 1T5LA 5FFNA 4R31A 4LV6A 4NZ9A 4DRXA 1IN6A 3CZ4A 3EVCA 4ZICA 3I6ZA 2RGDA 2QIPA 4M98A 2BBOA 4AG5A 1N8NA 1G3RA 2V4ZA 1JBKA 3QMMA 5AVOA 1B0ZA 1L0BA 3G2JA 2JFUA 5IZCC 4JASB 1YRHA 1O5TA 2CLEB 3ETNA 4MGKR 5D6OA 1ENPA 4E4TA 4B34A 1UCFA 1OWPA 5TQ2A 4D9HA 3PNQA 5K0JA 1A9SA 1JJIA 2PPLA 2MMGA 3C6KA 3O2NA 4FDLA 1TIBA 4R7ZA 5H5JA 1Z18A 3QKUA 5HQJA 5KDLA 4EDFA 1MAHA 3CG0A 1U3GA 3OUTA 1LSOA 4EF4A 4NV0A 1SXJD 2VRCD 2BBTA 3A7DA 4OI0A 3MOSA 3WYNA 1HQKA 2HF7A 4F4UA 2JFFA 5HKBA 1NV8A 3LCCA 2YIDA 3Q6NA 5F4BA 1KZGB 1RCFA 3ONEA 4PO8A 5KKAA 1NE7A 2G7ZA 3SEQA 4A1FA 4BV3A 4YMGA 2QYSA 4IO1A 4HDMB 3FOBA 5HF5A 1QH9A 2PKXA 3JVVA 2CVZA 1BE6A 1DAGA 2WPNA 2CMHA 3CE6A 1VFPA 3M3PA 3L40A 2JI4A 3L6CA 5AVSA 4LRSB 3MTJA 2NGRA 3KXPA 3FRIA 1VB3A 4RTSA 1SBQA 2JGRA 1N2SA 2VI5A 4BO1A 2GGSA 1EAYA 1Y5RA 2GS9A 3EQZA 2PJDA 3EGXB 3LX6A 3PCTA 4C30A 4C14A 5K01A 3MOIA 2YNMC 3DFZA 3R5TA 1XMJA 2IQ5A 2ZRCA 2DX7A 3IKLA 4BHTA 1L5HA 4E70A 4AZWA 3TZQA 3C70A 4EB6B 2I71A 3HYCA 3FNIA 3K6JA 1SCAA 2G06A 2VHJA 5HOQA 3O8OA 1U94A 1WDMA 1T8PA 1W2HA 2OHJA 3NO4A 3EZGA 1DJPA 2RGBA 4RK6A 1YRLA 4R6XA 3R7WB 4ASUD 1GSAA 4DC0A 3DMGA 3DXZA 1KOJA 1XRNA 1J2RA 1WZNA 3MCVA 3OCXA 1IOZA 1MBZA 1US8B 3V32A 4ARZA 2B35A 1DX9A 1Z0JA 2H4JA 3INTA 4DDMA 1ZIYA 1WXGA 3FX2A 3F7NA 1VLQA 2Q0HA 2BBSA 4JP8A 3O21A 3OTIA 1N6NA 3KLPX 4AD8A 3OPQA 5C7IO 4C07A 4Z4IA 1GJRA 2GYWA 3JWHA 3I9LA 2ATIA 3C3AA 4EG6A 4CEIA 2C4UA 4GOLD 1H9BA 3IP5A 3TTTA 3X1ZA 1Z4PX 3CR8A 5DWDA 4LC0A 1VLMA 1ZN8A 1JXOA 1ZVJA 4A0HA 1TU3A 4F3YA 3U61B 5TJHA 1IBCA 2X5KO 2WB4A 2HK7A 3AJAA 3DBRB 3H5TA 5HKOA 4BLOA 4IV0A 4MV1A 3PD0A 1T2UA 1HY3A 2Z3VA 1GGHA 4IH4A 4LA4A 4MICA 3OX1A 2G5CA 5BUZA 5PGMA 1CYDA 1YJXA 1VG9B 3KHKA 1QOPB 2IBMA 2Y66A 2F17A 3OQJA 2PUFA 2HMSA 4K6HA 3OWHA 3BOSA 1ISRA 121PA 2B8EA 2VP4A 4E4YA 4LYJA 4ZGWA 5LMNB 1BDIA 2F1RA 2MSEB 3OZIA 4JQYA 3GFPA 4KN8A 3QF4B 4WGGA 1DV1A 1RBQA 2WU4A 3EF0A 1QH1B 3G2LA 2QD4A 3KDPA 4JUCA 4MI1A 2QJTA 3D6TB 3PNVA 1EXVA 2HDHA 3S7TA 5JIBA 1LXCA 2IX9A 1LRKA 3ZKWA 2L17A 2ANCA 3O38A 4JEUA 3SXUB 2QXTA 3IQWA 1SC1A 4NCNA 5AIBA 5B57C 3DHYA 1A8UA 2GO7A 5E1DA 3ZJTA 1P1HA 2QLBA 4M9UA 1XLTA 5A03A 2EP8A 3WKCA 2EQAA 1HDZA 1K5GA 4RKRA 1GL7A 2OKCA 3PFNA 3Q1KA 2H9YA 2YV5A 5DNWA 2R5NA 4F4FA 4GRAA 4N1AA 2IWRA 3FDIA 3H3XA 2ZUBA 4EVQA 4YAEA 2G1PA 2C5BA 3FYUC 3GGPA 4AB1A 4FNOA 4ATNA 3FNBA 1LK0A 4N7BA 3HJUA 3N7AA 1I3KA 1L4YA 5AK6A 4KMSA 4EKYA 1R0BA 2XNDD 4KXFB 4FFPA 1NUHA 2FWRA 5EZYA 1U7DA 2P6PA 4YTEA 1ZG3A 4QBFA 2PT7A 1MTOA 3ZNPA 4PLZA 1KJ8A 1PZMA 2HO5A 2EW8A 3EX7C 1O8BA 1KI7A 4UZSA 1CR0A 4WX2B 1OB5A 1EHIA 3KPVA 2EJVA 5B4UA 3DVAA 4E7PA 3B1KA 1ZK3A 4CEJA 2E48A 2LD4A 4U9IS 4QHYA 5IC5A 1Z74A 3GG2A 3GZNA 3VU1A 2H7CA 3HB5X 3PA8A 3SVLA 2GNAA 4GGOA 5LJLA 5FX2A 2NVWA 3OLYA 3AONB 4N0QA 2QV7A 2B94A 4UBNA 1PI3A 1KPGA 4GPAA 2VR1A 1RM4A 4QLAA 4DF3A 3S28A 2OXEA 3JVIA 1YB2A 2A4MA 1L5NA 4F3RA 4R2LA 4DW8A 2HCBA 1DHRA 1CUDA 5KKNB 1C1DA 3K5PA 1C7JA 3L18A 1JEQA 1PW7A 2IZ0A 2R1VA 3MW8A 5JWRA 4DV5B 3C4VA 4QWMA 2GBPA 1BH2A 5CYFA 4GYKA 1KKMA 1QVAA 1SOWA 3EODA 4QSMA 1NT4A 1MOSA 1KYTA 1RI5A 3D31A 2W4MA 1R1DA 4FYKA 4P98A 1PP4A 3UANA 4MWSA 1RRCA 1DO0A 5HMLA 3PC7A 3WA6A 1YI8A 5T64A 3I09A 1ECCA 4G9GA 4ZO4A 5F73A 3WLEA 2XQVA 1QRDA 3HKCA 4K8OA 4XCXA 3GPIA 4EEXA 3OZCA 5CDGA 1M1XB 4MR9B 2QOEA 2V6FA 4YT5A 4LF8B 3EFOA 1EUQA 3VJKA 1K3FA 3KZKA 4RC9A 3ZHYA 1H6BA 1V1MB 4G0PA 1SO8A 3GZNB 5EG5A 1MO5A 4QDTA 4U7GA 5HF6A 5K6RA 1NRWA 4KMMA 1ZVVA 3DVAB 1SD5A 3PWTA 2FWAA 2TRSB 3C3XA 1H9CA 1B1CA 3LZCA 3OF3A 3VXKA 2J5XA 1GNQA 4JMPA 4FCTA 2FSSA 5AJVB 3PGVA 4D9CA 3W5AA 5I5GA 3L84A 3LNCA 4GOOD 4JYMA 4KFRA 1RXVA 4MIEA 5BSTA 2NZ2A 4UATA 5D3MA 2AN3A 1YR2A 4NDZA 2OFOA 1KEVA 1HXHA 2DYKA 2MSCB 1BE8A 4O3FA 4A23A 4E15A 1R3DA 1ZN9A 5IBRA 1PNRA 3I05A 2P41A 3SIWA 3BMQA 1J1IA 3B2EA 3B89A 1F9AA 4PYMA 4TMTA 4B09A 1ESZA 5AW8A 4H7EA 2AF3C 1YUNA 1QIJA 5CHYA 4BRZA 5C4GB 1P5FA 1E20A 5EIOA 1A7JA 1UWLA 1VIDA 2FMHA 2HQSA 3V2GA 1T6BY 4BX2A 2XTAA 4AM8A 5IVKA 3CEMA 5IHPA 5DYNA 4UHBA 4ZVLA 4R54A 3S4YA 2R65A 3JQBC 4E11A 2NQ8A 3FVRA 4JBXA 1TGVA 3R3YA 4C7JA 1WZCA 3PRYA 4K0RA 1PVOA 3JSXA 3WTCA 1Y89A 3NBYC 1KBQA 1NBOA 2P9JA 4YJ2B 4S04A 1OX4A 3IKTA 1U0LA 3INGA 3OZSA 4HC4A 1AK2A 4I50A 3RFTA 4US2R 2H3HA 3OM0A 5B1SA 2CXTA 3AK4A 1MQAA 1PFUA 2FAXA 2ZYRA 3KAQA 5F12A 3GLIB 2OBNA 2GEUA 2F2TA 3QBVA 1LLDA 4E32A 4LYYA 1SBIA 1JJVA 1QKIA 2J59A 3EDYA 1B8PA 4ZJUA 3TQRA 3IMGA 4UHEA 3KAKA 2R86A 1CUFA 2W6PA 1JX6A 2B82A 3LWNA 4IUBS 2NLOA 4JSYA 4DC9A 4C7XA 2FQXA 1PNTA 3BSSA 3P2KA 1NWHA 3VTAA 1JLLB 1WVIA 3AVWA 3DBRA 1E8MA 2AZTA 1FXWF 1UBNA 3M1AA 3FCAA 4WK4B 5ALJA 1E1CB 3WLAA 2FFHA 2UUOA 1V71A 3HHEA 1G64A 3QFFA 3L1JA 4O63O 4QXAA 2JEOA 3OUZA 2X77A 4QDKA 4BTEA 4M7OA 4A2QA 2O2YA 4RU1A 5CB4A 5JATA 4ICIA 4DJFC 3N6RA 4ZCLA 2DHRA 4CG3A 3AUSA 3UAOA 1FXSA 2Q3DA 3D4OA 4BFZA 1IMOA 1O94A 1QLWA 2OENG 3NBMA 1PF7E 4AF8A 3BCRA 3UNXA 3KUCA 4X66B 2IZ7A 4L85A 3NU1A 1KERA 4HAOA 4V39A 4ZHQF 1PL7A 5CT6A 4GWGA 5GPBA 3NNDA 4AMGA 2ZBVA 4BKRA 3NHZA 4RYLA 1YZYA 1N3YA 1YGPA 5K45A 4FHGA 4HGZA 1B73A 1XJ0A 1XI2A 3URMA 4E31A 3F47A 3KKPA 1OV4A 4C0WA 5SZKB 4QAQA 4ZEWA 1MB2A 4OXXA 1F2UB 4BE7B 3TGWA 1YQXA 4XVRA 1PX2A 2YWXA 1ZA2A 5GONA 2VYVD 3I0MA 1B74A 2J0UB 1PZGA 1TZMA 2HNKA 3COSA 4QXQA 4ZHQA 3RRJA 1ENYA 4XEHA 3ZE1B 3KQHA 1Z2NX 2WABA 3JAKB 3QG1A 2XXAA 2CEKA 3NTQA 2FNAA 1CKEA 3CU5A 4FWBA 4TMWA 1RWNA 3O0TA 4ND5A 1ZI8A 3D7LA 3I9OA 1P62B 2O3UA 3C4JA 3ZNQA 2GYVA 1BU5A 1X7WB 1N2IA 4M7RA 1ZR4A 3ZVRA 1C41A 2ZSBA 3HNPA 3HJTA 3JR7A 4K87A 2N1BA 3H2BA 1AHIA 4OYHA 4ZZ2A 5E7JA 1QS0A 1TJPB 2OBLA 4GR4A 2PXAA 3WZLA 3RQSA 1TFRA 5FJIA 7YASA 1P2UA 2IX3A 2OV4A 3IE1A 1OTXA 2HJGA 1OQAA 3F74A 4GR5A 4ITUA 3K6SA 4IHKA 1T25A 1DIGA 4ABTA 5H83A 2G1JA 2JGMA 5BUQA 2Y0CA 4XIJA 2DH6A 5LL6P 4IGAA 3UUEA 2J3DA 3TOZA 2WJYA 3H75A 6ABPA 5AI8A 1PWXA 1QB7A 1WNTA 2WD8A 5DXAA 2HHLA 2WAAA 4ZCQA 4RIIA 2EFYA 2YUTA 1NMSA 1FP6A 1VHJA 1W1IA 4CIXA 4GW3A 4RKEA 3C5EA 2PZKA 3LQ4A 4AX8A 2WZBA 2BSAA 2NXNA 4B73A 3HO1A 1YXMA 2ZXFA 3PUIA 2GCPA 2IYYA 4XLTA 3QM1A 4QREA 1SHKA 2I7XA 4ZO7A 2ZZNA 3UYLA 5JI3E 1YZFA 2HIGA 3BHNA 4YCNA 2O4UX 2ZBGA 5JTTA 4I6GA 1JALA 2BGUA 3QY0A 3F5DA 3PC8A 2GJKA 4HRXA 2QGNA 3DL7A 3R0IA 3W5BA 4LXYA 1OYWA 2ADMA 5T7BA 3F3YA 5ESRA 2GNOA 2V4UA 4KYVA 1CY1A 5FYQA 3TCNA 4A8PA 1VL0A 3PNLA 4FEAA 4MITA 4QUGA 4OHUA 1QHIA 3HZOA 1H5UA 1RYNA 4UOZA 4H4CA 4ZJZA 2X8AA 4HNTA 3ETDA 4DDHA 2IUFA 2AS0A 2ODEA 2YWGA 4GPBA 3PVSA 5DNEA 1CVLA 2WYUA 1NXVA 1B76A 2BP7B 2PSJA 2G88A 5FI0B 1LWOA 5D5PA 5B2ZA 4EHKA 4EHDA 1ZH2A 3AV3A 1OI4A 4KO1S 1PLLA 2FA9A 3SQDA 3GUYA 2BEJA 3ITDA 2WYOA 4BO4A 1AU9A 4P4SA 2GFHA 5LKAA 2ET6A 2IGBA 3ODGA 3UG6A 3PNSA 5BR1A 1CLEA 1T5DX 2C84A 5C8YB 1FS5A 1UAGA 2WTXA 3AOGA 3OTHA 4GDMA 5CA0B 1XKQA 3EFEA 4QOSA 5TPZA 3WRYA 2O57A 2QRPA 5B6PA 1T4DA 3FTNA 4XWGA 2JNWA 4DR7B 1O6CA 1LJLA 2YOHA 2XAAA 3SQXA 4YRTA 4IEIA 3ZZ1A 3FSRA 3M3DA 1W94A 5C8XA 5EVJA 1Z2DA 3OQIA 3RSGA 2EW2A 1FFWA 3JALA 4JBLA 2QVZX 3L4BC 1TUIA 4JZYA 2F1JA 2Y9MB 4AUMA 1XZFA 2P0EA 4NL4H 3JQFA 1VXOA 2YRFA 2M6LA 1PJ4A 3QUCA 5KOIA 3K0CA 5FA8A 2CNBA 3U4DA 2D5IA 3C1TA 2R00A 1WETA 4MK4A 3CT4A 3JX9A 1E9FA 1TUEA 2EFEB 2YN2A 4M6WA 1E3IA 2AFHB 1Q50A 2PUTA 1Z75A 3HZRA 1NTOA 4Y2GA 1IEWA 3W79A 4C7BA 2II6A 3FDZB 4Y6OA 2DMRA 3AQ4A 1SVOA 1QU2A 1RBMA 5BSMA 2PH3A 1JLRA 2CVFA 3IQGX 5C0OE 1IVSA 5INTA 1GKKA 3HKBB 2QV0A 3AU8A 2FK8A 2PBRA 4RD0A 3TMYA 3W4JA 2QD2A 2R8RA 4K05A 3OLXA 3O75A 2EKZA 4MUGA 4WCFA 4CEHA 3PQ8A 3UV7A 2PLRA 1QIFA 2GBGA 4RKFA 4IRMA 4DABA 4RPCA 3NTRA 1I5EA 1KI8A 4Q39A 4ZGGA 4I7EA 3BXPA 5C81A 3SIXA 3VQTA 5EMMA 3ZBTA 4Q03A 3IXMA 2D59A 5BN4B 1XLUA 2RGRA 4RMHA 2ZUWA 5D84A 3HHPA 3QYJA 3ZHRA 1NMQA 2FQQA 1FP2A 4Q9AA 3H2YA 2RD2A 1S01A 3A27A 4GS5A 2F9MA 2QRKA 4JI3B 3WLNA 2WE7A 4U2KA 1A76A 1X7ZB 4I5EA 3T9AA 4KU4A 2I29A 4F9GA 5ALIA 5IUNC 1M0TA 3E9YA 3L8DA 4XB2A 2BMEA 1TE2A 2JCSA 2NIPA 1XOIA 4PYIA 4ISBA 1SK9A 4DQXA 2FQYA 4IR7A 4WGFA 3ICPA 2H1SA 2RJ3A 5CDSA 2FRXA 2DHDA 2ZWAA 2OPBA 3AHHA 3O7MA 4J0CA 4FYYA 4G0OA 4ID3A 4Y6QA 1E6UA 1NF8A 1OAOC 3SVZA 5LR6A 5I9LA 1MO6A 1CUJA 1VCNA 4F45A 3A1DA 1LZLA 4D42A 3L1VA 2NVBA 4RWEA 5T5QA 3SF0A 3VZRA 1P9NA 4TXMA 3KOUA 1YSCA 1Z56C 4LMRA 5LIPA 3SS9X 4Y2RA 2HSJA 3NQ41 4ZOEA 1QP8A 1RP7A 3SOZA 3ZBPA 4Q37A 2VJQA 1IN7A 3ZDXB 4DR6B 1D2MA 3ENQA 3R23A 1QE0A 1NF9A 3DCYA 1NLZA 2NO4A 3QF7A 4HDSA 4DAEA 2WFMA 1N4DA 4V0QA 5B12A 2UZIR 1FE8A 4BVEA 4TMXA 3ZJ4A 3QVGB 2QEQA 4WN9A 3D8NA 1N7IA 3RKUA 5E6UA 1AS2A 1ETHA 1NIPA 2Q4OA 3PHCA 3MAAC 3RHZA 2B4TO 1YJCA 2B92A 1Z7WA 3MLBA 1IC6A 2ZYSA 3CNNA 1KO1A 1MD9A 1QKJA 4R81A 4FXPA 3SIRA 5KTRA 4EFNA 4HQOA 1PJTA 1F8GA 1PL6A 1T3SA 2XB8A 3L02A 3SBEA 4Z7JA 3RVPA 2I91A 4QE3A 3VOSA 2RAFA 5B1YA 4TVOA 1QFMA 1UK7A 3K16A 5LYJA 5BN5B 1F1BA 2IS6A 4YLGA 5ECYA 1CIJA 2WHYA 4OB7A 3RABA 3RRZA 3J81A 1HDGO 1O9HA 3ESAA 3AY3A 1EX7A 2J9FA 2KSQA 1R4NB 3MTQA 2WAMA 2WWHA 5COAA 5K99A 1H0SA 2FG7C 4CKZA 2Q3EA 1APBA 4MGZR 1U9IC 1VLHA 3ZJYA 4F60A 5DEIA 3LLCA 4QICA 3HCBA 4HEA1 2IWHA 4JD5A 5DPMA 4YMLA 2DY0A 3M7IA 4C21A 1BCSA 1PQPA 2J5RA 5DGCA 3MT0A 4IXNA 1XKLA 4BKMA 1E2EA 1NQTA 4PC6A 2FPKA 2WU8A 2H3EA 1HDXA 2PX5A 1JV2B 1VTKA 4KWTA 5TDHA 3DMPA 4CF5A 2X40A 2XYPA 4TZKA 1NXTA 5JOQA 1AA9A 3IBGA 1OASA 3LWBA 1TOAA 2H9IA 4ZCSA 3ZCRA 3GRCA 5HZMA 1AY0A 2E4VA 1NKVA 4QIHA 1D09A 4IRXA 4QX6A 2H1WA 4MUYA 3T1OA 1E1NA 4B79A 5M34A 5FEUA 1EX9A 1EFPB 1PYDA 3PGLA 4FE4A 2PL3A 3I04A 1CQJA 2HTFA 1U9YA 4YP1A 3RYFB 3QKTA 5BPHA 1M76A 3G8YA 4LYFA 2Q2QA 1Q5PA 2AD1A 2XNJA 5E95A 3SJAA 1MFZA 3B1XA 1BE0A 4PNZA 2YY5A 4ZT7A 4A6EA 8ADHA 3I61A 1FS4A 4UEOA 4PYLA 4D80A 4FS3A 5DASA 1GTSA 1ZAYA 1TKBA 3AM5A 2PGAA 3GJQA 2PFSA 4JI7B 1BQ4A 4E94A 3I53A 1EEHA 2F48A 2NTYC 1OYOA 4YMWA 3W8EA 1OI3A 3G2QA 2DY1A 3LCMA 4ARIA 2YJ5A 1YE3A 3N59A 4XD2A 3ZE8A 5FL7A 2HBQA 4N18A 1BRTA 5KTNA 5KZMB 2OV3A 1KE1A 4HLCA 5H82A 5CBKA 3DL0A 1ZC3A 2DEUA 1W88B 3AUTA 5CW1A 3GLHE 1ZK4A 3BWBA 4HYQA 2CMDA 5BXYA 5JYEA 3SZ3A 5FTNA 2INGX 2O1WA 1GTG1 3ISJA 1Q7EA 3M9LA 3HWX1 4C3OB 3IBSA 2O20A 1XCOA 3CFYA 3AEYA 1OYVA 2DPMA 2B0CA 2V7QD 1QTIA 2C4WA 3EGDB 4M54A 5F2OA 3TEJA 4D98A 3PUXA 3UJNA 2JK0A 4PLPA 5DBOA 4LSWA 4OQ4A 4NZYA 2UUPA 1P0QA 1XA4A 3RWMB 4FNGA 5DGXA 5EKXA 4A10A 4W9NC 1EQ2A 1V35A 2BGIA 1D5CA 1ABBA 1RFGE 3JTMA 3MCUA 4FOLA 1XEWX 3T3EA 1GAXA 5AYVA 1GYQA 3QLUC 4DNQA 5A06A 2EWMA 3M5CA 2YUIA 4EKGA 1JHDA 2QIOA 3P4YA 4F92B 2O7VA 1GQRA 5EJEA 2VK2A 1LBSA 3FLMA 1ST3A 1UBSB 4RPGA 3VAYA 2C3YA 5CLQA 3JR3A 4Y18A 2YFQA 4I46A 4B4OA 4QQRA 2C7RA 1ECFA 2D7DA 1DARA 2IYPA 2VDQB 2Z5VA 4N5MA 5ESWA 3SSAA 2F4VB 3IIEA 1ZMOA 1FQOA 4E5PA 3N3AC 1JFFB 4RELA 4RFLA 4S1PA 1N7GA 2AK3A 3AZOA 3RGGA 5KNLA 5AKXA 2BR4A 3ODPA 4YDHB 3H2SA 1YMVA 1ZITA 2J07A 1F60A 2I4LA 1J21A 4IPTA 1QQ7A 1PJLA 4M1MA 1GPAA 3PL1A 4EGJA 1CZKA 4D4JA 3RARA 1X1SA 3QEBZ 4AY3A 4RF2A 2REBA 4X84A 3RUIA 4INPA 5JEEA 1PV4A 1LA2A 3TL6A 4DWOA 3RVOA 5JXGA 4WZ6A 2CSXA 3K1TA 1RQ7A 3UOWA 3QU2A 5TEWA 1XMIA 4JUBA 4LC9A 1DQSA 3BWDD 1CQJB 4D9BA 4D9FA 1OI2A 2BFDB 1LGYA 2HC9A 1E7RA 1WQ3A 2XKJE 2RCYA 1QNLA 3HDVA 3ME5A 1VI6A 4H1TA 4QPPA 16PKA 3WQSB 3ZDZB 1FDIA 1P91A 1U2ZA 2WFLB 4GM0A 5AOBA 1LLUA 5DLPA 1XJCA 5JWHA 3ZVLA 5CNIA 4DMLA 4H9GA 3OQVA 3FUTA 4UNNA 2PKCA 4KQ1A 2X0EA 821PA 3DTYA 3T4UA 1B0UA 1S2IA 3GU3A 3RSOA 3UA4A 1BJTA 4KXLA 4XSVA 3V34A 3DYVA 5JCPA 5JVDF 1SUAA 3UK1A 4F38A 2B99A 3RKRA 2HZ7A 3BXXA 1U2GC 1FFXA 3ORRA 5LB4A 4JJGA 3OU6A 3ROEA 3PTLA 3PWKA 3TFQA 4Q1EA 4YC7A 4ZTUB 1E0KA 2FR8A 5ICEA 2QNIA 4FYXA 3K5HA 4E13A 3RF7A 4W9RA 4UU0A 2PMEA 2RG1A 3RBXA 3G6WA 3UVEA 1WUHS 5LP6C 1N6RA 4Y98A 5BN5A 3RYIB 2NZUG 4UE2A 5L3QA 4BATA 5JH7F 3ADKA 4XWWA 1C14A 5JG7A 3W77A 1N9GA 1ESDA 1KJNA 1V3VA 2OD7A 3G2HA 5J2TA 2O1SA 1ZPDA 2H2IA 1WLYA 5EJ8A 1Q0ZA 2Y1GA 3P0FA 4WIAA 2PH1A 4I36A 5F2EA 2HWXA 1GT6A 4HH1A 3Q3VA 2A5YB 4FGLA 3T99A 1E4YA 3SSOA 3UAXA 1EFTA 2V7BA 4N8DA 4WADA 3RAEC 3HRIA 4JUDX 4H08A 1DE0A 4XCQA 4YXWA 1QV9A 4BJ1A 1R9NA 5EKSA 5JH7A 3STVA 3G8BA 1P8JA 2RGGA 4RTRA 3OZGA 3OHMA 1G21E 2ZUSA 4TQUS 3QRWA 3OCYA 2ODWA 1Q57A 3E9MA 3ROPA 1ISFA 3DOFA 2X0NA 3CGWA 3O6VA 1G20E 2RCNA 5DHFA 1KSJA 3R0VA 1UQUA 3SHFA 2GAIA 3A28A 3NR2A 4JXJA 2P8JA 5JNLA 1BW9B 1GT91 4ZCPA 4B35A 5ALGA 1MAUA 3HA5A 4TLDA 1LDNA 1T5SA 3IVXA 5EXDA 2PT6A 2HCRA 5LQMA 1X7GA 2ZWOA 3RFXA 1N2EA 2VJNA 2ZT8A 3F7MA 1LSSA 1C4KA 3UT0A 1WPQA 3V8PA 2ZJOA 1NVVQ 1GA6A 2HEGA 4BV2A 3BE8A 3TUZC 2WHXA 2DU8A 5JS7A 2BZ0A 2GXAA 1PL0A 1DAKA 1NBME 3OT1A 3WHKA 3OO0A 1H6CA 1PFVA 5A7FA 1IVNA 1C3OB 2IXDA 4TKVB 4S1NA 4YV0A 2FN9A 3MB8A 4G97A 3VBCA 5HFJA 1EK1A 4X1YA 1VHQA 2A5FA 2VIIA 2PSHA 4IIBA 1A9XB 3BGWA 4HN9A 4KVAA 5CLGA 1T34A 2EHJA 3RNOA 4ZN6A 5IKMA 1DI0A 3DKPA 2XUIA 2Q5EA 1UBKS 5IJXA 1FW6A 1A7AA 3JRXA 4FPXA 5JAMA 1XZIA 4MWZA 5ER6A 2FY8A 2AC4A 4EA9A 3RIMA 1IWPB 4HGNA 3PGJA 1XVVA 3OLVA 1G4UR 1XC7A 5EJ5A 1GTL1 4LZOA 1FMJA 3MUEA 3QEAZ 1BCSB 3SQOA 4EFLA 3GWZA 2CYCA 2F1OA 1Q0PA 3EH2A 3TD6A 1SHTX 2QTHA 4ER3A 2I03A 3AEQB 5DGIA 3R7SA 1FNBA 2PO7A 2V0CA 4UJ3A 1G9XA 4OREX 4PX5A 3UWOA 3HFSA 1XR3A 2EWWA 3OH8A 3IH5A 4FNMA 1HSOA 1ZJYA 1A97A 1KVQA 2B25A 2XTNA 2XYRA 5AQ1A 1U2RA 5TNXA 1ZRMA 2O0KA 4PF1A 8LDHA 1RWKA 4XR9A 4Y2UA 4WLFA 4B6FA 3ZDBA 2AJTA 4DUPA 3COYA 1FU4A 1JJAA 1E61A 3H86A 2FHSA 4XKJA 3UCFA 3NI2A 2WKPA 1ECBA 2J0SA 3QFTA 2FPMA 4MLDA 3G79A 1NY5A 1Y9ZA 2SHKA 4P4LA 4EMUA 1ENOA 4OQXA 2BHLA 4IVQA 4MEBA 2CNNA 4Q3AA 1VJDA 3AESB 2ZBEA 2ZP1A 3F6BX 3KAPA 2JLYA 3W6PA 3LUPA 4JKIA 5HTOA 1DDIA 2WC1A 3ESQA 3TWOA 4OHVA 2C7BA 1RC1A 2XMBA 3RQIA 1OFGA 2Z43A 1QVVA 1X1RA 2V74B 3BE4A 3DO5A 4HLDA 4O1IA 2WUGA 4XTRA 3TI9A 1NSFA 2JJYA 2OT3B 2GPAA 3OZBA 3GUHA 4PYOA 1CTQA 1RXEA 1BSVA 2GSWA 3NHFA 1JHXA 1BFUA 1EGQA 4G5HA 3AI7A 4F97A 3CY6A 4DCCA 4PIPA 4NHEA 3U0VA 4LNHA 4DAOA 1N6LA 3RO7A 1EVJA 4CCSA 2AJ8A 3VHQA 1OIWA 3VVBA 3NVAA 3ETJA 1SOUA 1C2YA 2X1HA 1ORWA 5AR1A 1LI5A 1YAHA 2J3EA 2ZWVA 5JCXA 3PF8A 2Q27A 2XCLA 5ALYA 4MKGA 3S6JA 1TIPA 1XAIA 4YRKA 3CO5A 3ERCA 1KFCB 3FOFC 5FWDA 1V3UA 1XPOA 2DBRA 3TIXB 3DC2A 4ZOLA 2W2TA 1ZOIA 3LZ6A 2HX1A 2P2NA 1UWKA 1I1OA 2MIIA 1GY8A 2V9CA 4CM4A 2QRNA 1XNRB 2XR1A 2JIBA 2XH8A 2R7LA 3C97A 4LJLA 1JPVA 1PUJA 4N7JA 4QNNA 3W2EA 3DMYA 3HKEA 4NE7A 4BFVA 5ECDA 1OH8A 1OLSB 2R6FA 3DE2X 4IDFA 3A1VA 4JROA 2FMXA 2OBMA 3L8FA 1NRIA 1OJ7A 4C2BA 3T8YA 1JHYA 3OE5A 3P9ZA 4KE8A 1HLPA 3KPJA 1NIJA 1CWUA 1T5HX 5C46F 2CBZA 5DSTA 4U9UA 3NIWA 4YREA 5EIHA 1HZZC 3TRDA 1R6TA 3LUGA 3ROZA 1J8FA 1X8KA 3JARA 3BX1A 3WGIA 2V8OA 4DV7B 4GKKB 2QW8A 5H1YA 5LBIA 2QUAA 2AQ8A 1XDDA 2H1LA 5FPHA 4Y67A 3IOBA 1E9CA 1UKAA 1VIMA 1U1EA 1E1RA 5FFFA 2BM8A 3WMXA 2O05A 2PIDA 1OIXA 2GZAA 3F2VA 2VK8A 4LC1A 4QYTA 1KAEA 4NYIR 2H18A 1UXKA 3DULA 4E88A 1Y48E 3VO8A 2RK6A 3QXXA 4CTJA 1FVFA 2IYTA 3KQTA 5CLJA 1ZUNB 1G8KA 1NBIA 1U0NA 2NU6A 3EZXA 1JZQA 3S1AA 4CN9A 3IUNA 3BWVA 5G0WA 1FNNA 2NNWB 1R0WA 1WDLA 3QWIA 2ZBQA 4F5WA 3AF0A 4NZNA 1SC6A 2XE6A 1NFRA 4Y0NA 2QQ0A 5ENZA 2GARA 3WWDA 5J2TF 2J0QA 1ADYA 1CJVC 3O1JC 4AXBA 2FWIA 4MS1A 4Q02A 2JKZA 3T0IA 1F4VA 3EIEA 4B83A 3I6YA 2YASA 2YVQA 4J1QA 1LTQA 1VFNA 4GICA 2BGNA 4NV3A 1WB4A 4QHSA 5FTWA 2Q8QA 3ZWNA 3PIRA 3DMTC 4MQ5A 4GKBA 5ETJA 3WGLA 3RHTA 2G9NA 4KVZA 1P0PA 4WESA 1ZKDA 4YRCA 3KSUA 4LXQA 4LZAA 4M0DA 1F20A 4D3ZA 3B6JA 3WY9A 3N75A 4O2AA 4W8HA 4J0KA 3AX6A 2R6CA 2BBWA 2WT8A 3WO1A 2X8JA 3IURA 4KN9S 3IT2A 1SH7A 4POOA 3C16C 3H9UA 2C2WA 3I62A 4YK7A 4EYEA 5AUNB 1DO2A 3BCHA 2ERCA 1SWWA 1QFYA 4JLWA 1TD9A 1XA0A 2E87A 3LPAA 5E9JA 2SKCA 1AGNA 2CFCA 5A1TA 3THYA 1OTHA 1G5TA 4KXYA 3TL2A 4RE6A 3DA8A 2REXB 3LUAA 5FWXA 3MCTA 3VHXA 4ARUA 1HG0A 1KBZA 4GZMA 1EBFA 4HWGA 1JQ5A 1PBTA 1ZINA 1JKIA 2F1IA 4YJ3B 3HUTA 3K9HA 1B6SA 5K3OA 1MIOA 4AYWA 3RYCA 1UIRA 3BT7A 2VEDA 1A9YA 3O3CA 1H1LA 4L8VA 2XGOA 1ZHOA 1N2BA 4JI4B 2LTAA 1M73E 3K2IA 5AKGA 2RH5A 2B9VA 4KYIB 4L7QA 4N7MA 5ADVA 2W2OA 2OO3A 5IWCA 3NGXA 4IIYA 2QLMA 1UFQA 3OOWA 5IHXA 2ID7A 3G0OA 2A9FA 3L1HA 1WCWA 2Q45A 1DQPA 4S1OA 1T15A 2WU1A 2I8AA 1FZQA 2GMWA 2WDPA 4HX5A 2G0TA 1W34A 1A88A 4Y6SA 1KDVA 3EOZA 5LD2C 4B5LA 3C2QA 1ZUD1 3GOQA 4FHZA 4W7SA 2BRUC 2BCJQ 4YUZA 1YB4A 3MGBA 3EFBA 2AYXA 1XXHE 2WJ4A 2X6RA 3MJDA 4G0MA 1VMAA 2BM0A 5EINA 3IE2A 5K3BA 2YWRA 1AGPA 5GAJA 1NPDA 3RIGA 4REMA 2BKXA 1G8SA 1Z0SA 2IYFA 1E9DA 1EE9A 4RE5A 4QUHA 3BTSA 1J0AA 1XL1A 3CXRA 1OJLA 3JAWA 1I2BA 3U1TA 3LY7A 1Z62A 2IVZA 1DQZA 3H5WA 3WYBA 3QUTA 1ZSNA 3QOYA 4YJ3A 4PBSA 4YJHA 4C6RA 4DDWA 3HXQA 2P79A 1E3QA 1P6UA 3NV7A 5DLEA 4AROA 2OGZA 1NAHA 1DKLA 4ZI7F 1RXSA 3K1JA 2LNDA 2QTMA 1HE5A 1W47A 2VWQA 4ZQBA 4N8EA 1JR3A 1N3LA 5EKTA 3WKEA 2WE8A 1BHJA 2OZKA 5LBTA 5JSFA 2Q1YA 4XIFA 4JGIA 3HR8A 1YD7A 1UDXA 2BMWA 1KRHA 3DOEA 3RU2A 3T5PA 1U11A 2X7XA 4D26A 3GP8A 3VNVA 2IZOA 1TEHA 1OB2A 1U2DC 2CK3A 3BXZA 3Q7RA 1QFSA 2AL7A 4AG6A 5L3SA 5ADUS 3DOIA 2E21A 2PLNA 1GZ3A 1D04A 4O59O 5K3SA 1EA5A 3KJFA 5BRNA 1UWCA 3LKZA 4FCCA 2Y0EA 2OV6A 3W5UA 1JKJA 2UVDA 1EE1A 4TTPA 4HRAA 4BUZA 4PQRA 1XT6A 1H2AS 2ZSDA 4GVLA 2ZSEA 1QZZA 4I1SA 4ONEA 5TMDA 1Z2OX 3SYTA 3UF0A 1KU6A 4D5GA 3JVUA 1DLJA 2VBGA 2NO0A 1Q6YA 3R3ZA 4PHTA 1Y3AA 2OFWA 3ILHA 4NAVA 5KNCD 2B1IA 1XDWA 2QX8A 3HI4A 3U7IA 1OAKA 4Q66C 1OFHA 3TX2A 4PHGA 3JD0A 1KK0A 3DP9A 3NEYA 1SXGA 3CWZA 5F7JA 3RBVA 4AS3A 3C0KA 5F64A 1QONA 1K7EB 1O6ZA 2C3OA 4RTLA 1H93A 4E6PA 4MW9A 1QIHA 5HKKD 2CF5A 4FE7A 1PT9A 3BAZA 5SICE 1FJXA 3URKA 1J20A 3C3DA 5EZ5A 4AKTA 2NU9A 1W0KA 3G8CA 3DB2A 2BZ1A 3A36A 3UJDA 2FX3A 2Z5LA 1DIRA 4ID9A 3DHWC 3ZVMA 1DWOA 1S0UA 1UQRA 2PQ6A 2P9FA 2DPYA 4Q34A 5EZQA 1G3QA 2V54A 3LPNA 4O4JF 4B44A 1IPEA 1DEKA 3HJBA 1EUCA 2JI9A 3FFWA 3AF6A 2HB6A 3NVKI 5GTDA 2ZUTA 1B1AA 5A4MS 3SPXA 4YRBA 5TV2A 1MABA 3WI7A 1FFYA 3JQAD 4NMHA 3MOGA 4TRNA 1B2LA 3F6CA 3LC0A 1FDVA 3BD8A 2VTVA 5IMSA 2C5FA 5K6AC 3WHIA 2C3PA 4BMZA 3FHCB 3BXEA 3UMYA 5B5SA 1B6RA 1U31A 1NF2A 1R50A 1U8XX 1TT5B 2VHQA 2YWBA 4H4DA 4BKUA 3QVKA 1UKYA 2CUNA 2QG6A 4IMPA 2VDJA 2HI0A 3KVRA 1C30B 3T4EA 5THXA 3I4FA 1U4SA 3DNPA 2CDRA 3HKDB 4CM4B 3KQPA 3WA7A 1KWGA 3G89A 5ADWA 1SKYE 2HSDA 3FTQA 2ZJZA 3TMAA 3IDQA 2AFVA 1A96A 2WTMA 3D8TA 1O0SA 3MYRA 3TZEA 3VH3A 4BO2A 5AW1A 1G8GA 3PXAA 5B3LA 3OD5A 3L4KA 2QLFA 1DC6A 5G1NA 3ONFA 4KI0A 5EEHA 1R4MA 2YJGA 4ROSA 4QUJA 1BA2A 1KI1A 5KYTA 1TIKA 1W9MA 3BFPA 4QEKA 3FNEA 2P77A 2HBRA 1AKTA 1JA1A 2JFWA 2WVHA 4IHQA 4ZVRA 3MILA 2EJCA 2IPNA 2PY6A 4TROA 3A3PA 3AB8A 3THYB 2H51A 3ELBA 4KB5A 3OFND 1G3UA 1G21A 4AZSA 1NLUA 2AXPA 4WZZA 4A91A 1SBNE 4I5GA 4X20A 3TLGA 1QDEA 4W7HA 5TSDA 4WH0A 2WHPB 1YZTA 2X3UA 4DILA 4RGBA 3LQYA 1J23A 1B3BA 1D1SA 1ZQ9A 1J8QA 1AKWA 1NOJA 2A3NA 1R3UA 1ZMXA 3EVFA 4WN3A 1KYXA 3SYNA 1NW9B 2ZU0C 1ODKA 5JD3A 4MDEA 4P4TA 1RQXA 4YAJA 3CZQA 3MLEA 5EUCA 2PL5A 1WXDA 3HDQA 1NMYA 3LPDA 5EMLA 5T6MA 1YBHA 3W8NA 2VH5R 4X7PA 3P0RA 4II2A 5GJWC 2Y4OA 1YU6A 3OU2A 4P0TA 4D9KA 2OAEA 2IUEA 3I9JA 3KR0A 5BRJA 1FXWA 4EA7A 4YP6A 3GV0A 4GOKA 2AF4C 1ZYUA 4H7PA 1AKQA 3SR0A 3ZE9A 1TZ2A 3I64A 2W70A 4H16A 3OLQA 3AP3A 1LX7A 1G7SA 1NLFA 1OBFO 4D0GA 3PPYA 4HH4A 4R1QA 4REOA 2ADOA 4MQFA 1QOQB 1KJJA 1QYVA 1KZ9A 3GXBA 5E2BA 2HV8A 2QZPA 1AB5A 2V7TA 1GPWB 2QVLA 3B38A 4JNKA 4BB0A 5HYVA 4H6VA 3THOA 2FP3A 5LPNA 2PL1A 3E22B 1NNI1 3HGTA 4KHZA 5DBEX 2O8DA 2ZYHA 2TMGA 2NUTA 4YYEA 4PNPA 2ZZMA 3R8XA 5DW3A 1W4LA 1DFGA 5B1EA 3MSXA 1J9GA 1U4OA 4BMXA 2ISQA 2C5HA 3L7KA 4AMBA 2OWEA 3SJUA 1ZI6A 2GEVA 4ZYTA 1M33A 1ZXLA 2GAOA 4EGAA 5AQEA 4QXMA 1A4XA 4KI7A 1XP5A 3UJAA 1QC5B 2XDWA 2GHIA 2NU7A 5L51A 2MU1A 4MP8A 4DLNA 2ZAOA 3PKIA 4L4SA 5GONF 2H4YA 5GMOA 3IAXA 3VKVA 1RT9A 4LF5B 3AHDA 1V5EA 1F5SA 2HOQA 2PA3A 2QD3A 4K9KA 1KK2A 1ZX1A 2PHZA 4I1RA 4MVYA 5DHRA 1ZOLA 1H2RS 1MOPA 1QAQA 4YJ2A 1VL5A 1XZHA 2C61A 3OEYA 2HZBA 1YTLA 5DSZA 3NWEA 2AC7A 5DZSA 1B6GA 4WK2B 1PT6A 1O7JA 1WIWA 3B3GA 3TXAA 4XR4A 1NPTO 2VYCA 4GBMA 1XHFA 5TIIA 1HE2A 5HM8A 4ZU1X 1N2CE 4KYUA 5B36A 3HA7A 3QTLA 1FNMA 2YVLA 5TT0A 3Q2IA 3RIYA 1HRDA 1K8QA 1KTVA 2YJTD 3FKSD 1ZLYA 3HWSA 3PL5A 4TT3D 4V0SA 3T9BA 4DM7A 5JJLA 3AVUA 2CLDX 1HYEA 3M6XA 4LAFA 3RLIA 4I9NA 4HFRA 4O5OA 4OK5A 3G02A 2WSSD 4P3NA 1EXMA 1A98A 4ME6A 1XTRA 1H0HA 3OZUA 2BONA 2BFFA 4LMBA 4AIIA 4DIMA 4UEWA 3MAJA 2Q9CA 2IBSA 3C7TA 1LC3A 2NM0A 4EK9A 3MGKA 4M9QA 2FGJA 2IUTA 4ZYZA 1ULUA 4FS8A 3PYMA 4CV2A 2ZJ1A 1AN9A 1MA3A 1U0EA 1ZGHA 3RJZA 1RFLA 4NNJA 1AC5A 4H60A 2CWWA 1NJ2A 2FTKE 4IJQA 1T5TA 1BH6A 5SV2A 4DE5A 1M2FA 4EGCB 3FGPA 2OC9A 1VMEA 3IS3A 4Y2TA 2WG2A 2XXJA 2EAUA 2UZ3A 2JK1A 4P7GA 4XQCA 3ZV6A 5B30A 5CITA 4PRYA 3NHMA 2H4WA 3D3EA 3FR7A 3IBFA 1MC5A 1TK2A 2WIJA 3ETLA 4CM3A 2O06A 4NF2A 3R3UA 5ED4A 4FSXA 3VPGA 5KYNA 4D56A 4XGQA 3ZBUA 1L3CA 1OXUA 4N8SA 3S81A 3RK0A 4XASA 3DXXA 3HKBA 2OECA 2FPUA 5KSOA 3DZGA 4F4DA 4KLCA 4W82A 3MWJA 3I9NA 1AKMA 4QUAA 3LOPA 3E2PA 3DHEA 4LTDA 1GSHA 3TQOA 5DTQA 4HPJB 1GVNB 3AFMA 4TYQA 2JIDA 3FIUA 1OSNA 2Z95A 1BVYF 4PQEA 3EE6A 3T7DA 4JEIA 4XFKA 1JKMA 3PTZA 5K8IA 2Q1TA 1MB3A 5EP3A 2G9ZA 1DADA 3EA5A 3LCJA 4IG4A 2JLSA 2KBEA 1X3SA 2W6JA 4JJ6A 1PG0A 3RH0A 4ABYA 4UXHA 3GVHA 3H8WA 5HCUA 3GA7A 4BNHA 3BA1A 4N5IX 1Y5IA 1Q77A 2C92A 2FKAA 2W43A 3BWXA 4A03A 3QKRA 1ZICA 2I1QA 2PGXA 1AV6A 1NW8A 4R3NA 2XNSA 3AT1A 3RS9A 3MF4A 3NBKA 4GNRA 1W76A 2C1ZA 1WABA 5CFZA 1PV1A 4JI1B 4UQPA 3FUXA 4ECAA 4MA5A 1AHPA 1FK8A 1O95D 2DFNA 1QHSA 2FX5A 1V5FA 3BZUA 1D2NA 1H0KA 3E23A 4P5DA 5JNSA 1JZTA 4CDGA 3TTYA 1NATA 1X7DA 3DE6X 3HR4A 5FV4A 2FOIA 3QMWA 3F97A 3T7EA 1N0WA 1VSQA 2CUTA 1UXHA 2AI2A 4H7KA 4BKOA 5FDFA 4V1CA 4B3DA 1L7OA 4JSRA 4Q24A 3WICA 2C4KA 4ND6A 2QQGA 1P9OA 3GLKA 4QUEA 1QTQA 3VZDA 1DAEA 3HO6A 4B3FX 5BMVB 4ILKA 3I9KA 4J7UA 4QTTB 2N75A 3TNLA 5KQLA 3HXLA 3GUUA 5ENVA 5E38A 1BGWA 4QBTA 2I62A 3FCUB 4TWRA 2V59A 5TR9A 3EHDA 4Z8XA 3CRMA 4N0MA 1MMFB 1DEXA 4GAEA 4FZJA 3AEKA 4GXRA 5TQJA 1L4FA 3H5NA 3OKCA 3PPVA 5A9SB 1BFDA 1V0JA 1WLSA 5HQ3B 2O59A 4DLWA 1NUTA 1Q17A 1P4HA 3IX7A 4Q18A 2NTJA 4CW7A 3FHLA 3G5UA 2Y1FA 3OM8A 1CS0A 1V25A 2RBKA 1M3SA 5IAJA 3VZSA 4A6XA 3AHEA 3HFRA 5ELMA 4IVNA 2NU9B 4YDQA 3L46A 4FR0A 5F5LA 4FQ8A 4AJIA 5BN1A 5F3WB 3WMGA 3QWFA 3VO1A 3VZQA 5JS8A 1U0TA 2ODQA 5HSGA 3Q3IA 5KJEA 1EIWA 4P33A 1EGHA 5JTUA 4E5DA 2GCIA 1W88A 2ESRA 1XZDA 1H66A 1F7VA 2ZTUA 4AO8A 4C08A 1QH8A 3D6FA 5ALVA 3ZLTA 1P2FA 3CE9A 3ZY2A 1SBHA 4WFQA 4P8RA 5U4QA 1ACLA 3N2ZB 3OFSA 2YVKA 3GWGA 2J4FA 3A1EA 3CRW1 3PQFA 1JG1A 3JYPA 1JHRA 3F4KA 5DHTA 3AUKA 1VQ1A 1Z5WA 5IH7A 1NNEA 4IQ0A 1FX0B 3P9RA 5E9AA 3RVLA 3CKKA 3EHEA 3BB3A 2B5VA 1TMGE 4HQ6A 5TX7A 3U7JA 1KYQA 2MSKA 2V45A 1H2EA 2Y2UA 4A0GA 1QE3A 4DSOA 1E9SA 4K7JA 3H65A 1BD3A 1MFPA 3FPEA 3GVCA 3V7WA 3B9PA 2F8TA 4JI8B 2VATA 2H31A 2R5WA 1LY1A 2VPZA 1V8OA 2ZRBA 3NTOA 3OJLA 1X39A 2IDMA 2BFFB 2XUQA 2A33A 5IASA 2VS1A 1ETUA 3QZUA 5CNMA 5I9BA 2W8BA 1J24A 1T5OA 2PRKA 3L7MA 2JHPA 3NM4A 1L5LA 3EZ9A 4P2BA 2IYZA 2G67A 4IDNA 4HMQA 1JR3E 4KW7A 5H68A 1SUEA 5REQA 4D4IA 2XKAA 1RPTA 4S2UA 2ZRPA 2IEAA 1F3OA 3I58A 4FNAA 4KREA 1R6UA 2FPGB 3D7NA 5LQAA 4HXYA 2A9RA 1A71A 1R8SA 1MN6A 3ANMA 4N9WA 1P6XA 2FEXA 1GTJ1 1PQWA 5GADl 3AVPA 3ZE2B 4E09A 4PXSA 3HXKA 3OOYA 1P60A 2WPDD 2C7PA 2ADFA 1L4UA 1NVGA 5CLIA 3JATA 4MUHA 5CEEA 3BJZA 5EJ9A 4AKEA 2RG7A 1E6LA 1D7OA 3D6NB 5K3EA 3VOAA 3QJGA 3NM5A 5T3UA 1ISPA 2RHWA 3RSLA 3IOCA 3L1KA 3IP1A 2YJZA 3OZVA 3AB7A 4X90A 4YCAA 3S1AB 1QO0D 5EA2A 4ZYWA 1WBJB 1SPBS 4KG7A 1BXRB 1CY4A 4XX1A 3ZI4A 1CUXA 1ORVA 1QE5A 5FJJA 2ZRAA 4LGYA 2AG5A 2CB9A 1SIUA 2C5EA 2Q6OA 3BMOB 4LOIA 3PENA 2AJLI 3HCCA 3KT3A 5FNVA 5L4SA 1SG6A 3H42B 1QHYA 1PK7A 4XQ0A 3A4YA 3ZY5A 4DNFA 2QORA 3HCEA 4LVOA 2D4HA 3E48A 2GTPA 1TK3A 1ZWKA 1FY2A 2RKBA 2I4MA 4C29A 3TQCA 4MJXA 1M54A 1GZDA 1VLLA 3DFIA 4NHOA 3FTPA 4MUKA 4H15A 3PFWO 1KY4A 5IT0A 3QA9A 4QASA 1D6JA 4RVUA 3I8OA 4U5XA 2ORED 2ZATA 1E7WA 4B3BA 1H2HA 3BH0A 4XFDA 1A2QA 3NJ8A 3W5IA 4EJ0A 4JXZA 1OU4A 4DUGA 4FR5A 2GXQA 1VGVA 3EOAI 3KALA 3M70A 5JROA 2PUAA 4LJRA 1QIDA 1L5HB 1ZIPA 4LJ6A 3PQ2A 4IOLA 2CXNA 1UFRA 3K20A 4M38A 1VLVA 1SIWA 2OOKA 3C41J 2PSEA 3S5UA 4BXOB 3QXHA 1DX4A 5FUMA 4DMMA 4G0VA