5B2FA

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (phosphate-containing condition)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
publication title Substrate recognition of N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 5b2fA00
1Q7TA 4XM1A 4XM2A 5CGZA 3WL4A 3DFMA 5B2FA 1Q74A 3DFKA 3WE7A 2X9LA 3DFIA 4EWLA 2XADA 3WL3A 5B2EA 4XM0A 5BMOA 1UANA 4XLZA 3DFFA 2IXDA
chains in the Genus database with same CATH superfamily
1PDWA 3VZDA 3PQEA 3QMPA 2AG0A 4MMZB 2D2EA 1ZD3A 1Y5LA 1YS1X 2OHHA 3EPJA 1GZ6A 1TLFA 3E5RA 4BNJA 4LMRA 1ODIA 3MHTA 1JDSA 1ADJA 3IHTA 3PE4A 1JIIA 1YJQA 1TAHA 5TNXA 3AUUA 2VNJA 3DGEC 5IBPA 4WKCA 1LU9A 1G5QA 4NEHB 5H02A 1VLVA 3GJYA 2IGBA 2Q7XA 5IAAA 5TJ9A 5K8CA 3PF9A 1XYVA 2ZBQA 4KO1S 4J0JA 4Q3EA 5GV7A 2OLJA 1OFUA 3CSSA 3JWEA 1YS6A 4X20A 4E4RA 3N8HA 3HVRA 4A6PA 1U4SA 2YVQA 1X15A 3P2KA 2AS0A 3BCUA 1FDUA 5T64A 4NXNB 2IYEA 4BKPA 3EMKA 4RK0A 3HXKA 4WKPA 5BSUA 3D5QA 3AIMA 1OLUB 2CVPA 2O7RA 3ZHRA 2WTBA 4BDTA 3GQBA 3HKCB 4KV9A 3WNZA 2HGSA 2C3OA 4KXLA 3QF7A 4LJ8A 3U4HA 4XWWA 3P32A 1U0RA 4LZWA 5EGSA 4QGGA 4QYTA 1JWBB 4DIUA 5BVHA 3JQPA 1FDWA 3M4YA 5JZBA 4YJ2A 4YCDA 2QE7A 3A4IA 3MYRA 2B2XA 1US8B 3WWYA 4Q4JA 2V4MA 1HT3A 1CUAA 2FXIA 4JVMA 2RFLA 4YEDA 5E8RA 2JLVA 3U13A 1WSAA 5ERXA 3DEYX 4KHZA 4MDHA 1I5RA 4Z0HO 5ITZB 1XJ5A 5I4KA 4HLCA 2BWJA 5EP1A 3HC7A 1H65A 3M3HA 4HWGA 1BDIA 3CUTA 4KP7A 3WMRA 3G0GA 3ZLVA 3G49A 4B7CA 2K7FA 3N70A 3VO9A 1E79A 1L4KA 4AY5A 2OXTA 4DIMA 3BEDA 5BSMA 1TCBA 5SY9A 2QLNA 4LXQA 4RK7A 1JALA 1UBGA 4WESB 4F92B 1YQ9A 2Y2UA 2M1ZA 2QN1A 4ITVA 2XKJE 4D57A 5GONA 1CY1A 3M83A 4LVNA 3V8MA 3HUTA 2XB2A 1L9XA 1P5HA 2QUAA 2JD2A 3MWGA 5AKXA 3L4JA 2JHGA 1K98A 3CG4A 1SVOA 1T24A 4DR1B 1NPDA 2QD3A 1D09A 2FWAA 1FYVA 1XU4A 2KHZA 3KQSA 3P1JA 4IGAA 1V5WA 1KP2A 2WZBA 4XLTA 3ZI4A 1XIVA 2SKDA 2YJTD 3RTEA 2N46A 1BJTA 5ALFA 4KPEC 3N2EA 1A04A 1IM8A 4IOMA 3RM3A 3WWOA 4QG3A 1M75A 5E8JA 3OTGA 4YO7A 3ZOZA 2F8TA 5EHIA 5B3JA 4K0KB 2GOYA 3U80A 3T6KA 1MB2A 3RHZA 2HF2A 2DBZA 5M3BA 3UW3A 3AUYA 5JG7A 1J2TA 4A0HA 3GRRA 3CEMA 2QYHA 3AXTA 3EFOA 3RLIA 3MWLA 2VDLB 3WZLA 1C9KA 2HJ9A 1PFQA 4BVJA 3SS7X 3TOSA 1TVCA 5A1TA 1M6VA 1GL6A 1X3LA 1OZGA 1P2SA 2D1YA 3FJYA 4M9QA 1UPAA 4GYKA 3GCXA 4UEOA 3I1YA 4HAUA 4WZ6A 3DOHA 3ZN2A 4HVLA 4MV0A 1IHXA 1NW6A 1VHWA 3CZ4A 4R1LA 4A8JC 1YRBA 3EVZA 3G59A 5BSTA 4B79A 3TQOA 1V4BA 3O8QB 1V2HE 1BHQ1 4WLVA 4XX0B 5H68A 4A0RA 4RTOA 3RTGA 1M7BA 5KI6A 1E6MA 1MAWA 1SU8A 2PH3A 3E1GA 1H2BA 4QUAA 5F9FA 3MC1A 2HMYB 1B6RA 4HN4B 3JX9A 4YI3A 5TE9A 4YRKA 1R8YA 2VDNB 4PSVA 3S8YA 5CYGA 2CYCA 4S04A 5GOTA 4P0PB 3MLBA 1LKZA 3NJ4A 3NX4A 4MS4A 5GZ3A 5F98A 4RULA 2FUNB 5EAIA 1PJZA 2G7MC 1N7JA 4PFKA 5KPJA 2FAXA 4DG9A 3QVVA 2O0JA 3KHKA 3PENA 4L4YA 5FPYA 4QDTA 2AOUB 3IP1A 1ZEJA 5HTOA 4IZHA 1IPHA 3OIDA 2WF7A 1RJEA 1VSTA 2F4NA 3AUTA 4K8OA 3T9AA 3PU6A 3VR3D 1CS0B 1VA4A 4GX2A 3GLSA 2ET6A 2J9RA 1M2NA 2M98A 1GO2A 2I1QA 3HCPA 3SE7A 4W5RA 4AS1A 3TR0A 2R97A 3SC2A 3FYUB 1DP4A 1N6HA 2H5IA 2GCOB 4KYUA 3T0FA 4C30A 2G6BA 3FAZA 1V3VA 1VIVA 4M21A 4TV8B 1C1YA 2X42A 4H1VA 2DLDA 1C4WA 3ZCTA 5BSHA 1ZH4A 2V59A 1P0FA 1OFGA 4OAQA 4TRJA 4OMUA 4CKBB 3TX6A 4XWKA 2WWHA 5F64A 3CH5A 3WLEA 1XXHB 3ZWWA 5EIFA 2A1TR 1LWOA 4YRJA 2D0OB 5KWEA 2A59A 3FR8A 2O8CA 3OTIA 1Q5PA 1XZCA 2W5UA 5K6AA 3TSAA 3WFZA 1C14A 1JDZA 1ZRNA 3N76A 3PPYA 3KWLA 1RLUA 4D5EA 4GZMA 3C97A 2X13A 3AU8A 5FTKA 1M6NA 4R81A 2V9CA 3NETA 1OAOC 4MKRA 5ECWA 1RYEA 1JTVA 4NATA 1G0NA 4LNHA 1AZSC 4BBJA 4CLDA 5H83A 1UBSB 1LBHA 4GE3A 3FTQA 1XZNA 3L1IA 1KPHA 1T3HA 2EKDA 2B8WA 2Z8YM 5JJIA 4B87A 3PFGA 2IYWA 2MYNA 4WCVA 4F3KA 3FJ1A 4HO1X 2BHLA 2NXNA 4ON9A 1V4VA 2NG1A 2CEKA 1T9AA 4I36A 4JI4B 1AKRA 5ALWA 1JPNA 1PO7A 1OQAA 3K94A 3W4IA 4D74A 3WAJA 1XNHA 4QBFA 5A9TA 7REQA 1O6FA 2FSIA 2QZPA 2YFKA 4TUYA 5DWVA 2YWCA 4IKPA 3KFXA 2BMEA 4YP5A 4BLTA 3IUJA 4F2HA 2OCBA 2AN9A 4CQLB 1U2PA 3IOYA 3M81A 1QF7A 1G2QA 4IMJB 2Q3EA 1I94B 2A0WA 3LUKA 1BO6A 2Q4RA 2QVGA 2Z43A 4RSMA 1DAKA 1QHFA 4JHXA 2RGNC 3BQNB 2J45A 3CIFA 2RI0A 4FFPA 3U7QA 4Y67A 3UHAA 5C32A 2FN4A 3DL2A 3HWX1 5JNTA 1XEXA 4R2KA 1A8QA 3SX2A 3PF8A 5HBRA 2A2ZA 4NJEB 5IYZA 1EE2A 5GADl 4TKMA 1P0QA 2AC7A 3BB1A 5CJJA 3OPQA 3BA6A 4LF7B 5BQ5A 1J0EA 3ISJA 4CLRB 2VCYA 5IKMA 2ETXA 2HKIA 4CPDA 1Y3BE 4FWBA 4UQOA 4BBPA 1CEEA 1KMHA 3ANYB 3STXA 5LLDA 3C3AA 1G5FA 2B8JA 1N2ZA 2OWEA 4LTMA 4QO7A 2M6KA 2CBGA 2P3OA 2YHBA 2G9ZA 4MV6A 1YQGA 3Q5GA 2HXGA 2VP2A 3DTNA 2E85A 3OLWA 1UAGA 1FJHA 2EFYA 4N12A 1GQRA 3E5MA 4Y2TA 1XVLA 3RS3A 1YR9A 3R44A 5JNLA 1XL0A 2Z5FA 1QRSA 2BH2A 2AR9A 2O2XA 2VJAA 4ZZ0A 5T57A 4LSWA 1CZLA 3AESA 4R2XA 2WU1A 1KJNA 3ZHSA 3SMQA 1GHTA 4MGHA 1Z17A 4XIYA 2J4DA 3H9JA 1F3LA 3AHIA 4B7ZA 2Y1FA 3SBXA 3BWEA 1PLKA 4BVEA 1KPGA 2C84A 3W5SA 1ID8A 3ADKA 1MVNA 3GAFA 3LX4A 1Q1ZA 3NPAA 2P9FA 4KIWA 4BVAA 3P0EA 4E94A 2J87A 1D2AA 1SCBA 2AEEA 4RE5A 5DGXA 2L42A 2B7LA 2AUNA 1T29A 1OFTA 2IXEA 4WX2B 3SZUA 4LF6B 5D5PA 3AERA 1QGED 3D1LA 1EE9A 4JLAA 3M3PA 4TL9A 4JX9A 5EJAA 4CV3A 4EGJA 1YCFA 3DFMA 1IXYA 4Q3OA 3RSFA 4TMWA 5KEIA 1V6AA 2DECA 2FW8A 1MC8A 3G9TA 4OUDA 1SPXA 1W75A 2JFPA 4G5SA 4MR8B 4V0NA 3FVRA 5IHPA 3V42A 2IH4A 4FI3F 3Q3EA 2X1VA 3I2HA 2WAMA 5U4XA 4U1RA 2YIJA 4I08A 5ADVA 3IALA 3D3WA 5AUOB 3DSRA 2FEOA 4D9EA 3O8RA 1EFRD 2NVUA 2HSGA 2QN2A 2G3YA 1LC3A 2ZANA 3I04A 3K4HA 1ZP6A 4F5DA 3HKBA 1OHHD 5DNVA 4ENVA 1I1NA 2HHAA 1IDOA 4UTRA 3VC3A 4YP6A 2AZMA 1XZQA 4P38A 4QRDA 4BAZA 4LDQA 1RYDA 5KYGA 2QYOA 3QU2A 4R1NA 5ELXA 5K0GA 2W2LA 3KT0A 3IKMB 1ODFA 1U0EA 3BJEA 4OATA 1NNI1 2QPAA 4DDUA 1F6BA 1JL3A 4YJFA 4UHDA 4GZ3A 4AKGA 3WBKA 1SA0A 2CN1A 5K0ZA 1L8AA 2H17A 4M9SA 4EH1A 4R8SA 1II8A 1D5WA 2JLZA 2XITA 4ILKA 1GVNB 2E55A 4O4HB 5K2OA 3FM9A 3BJIC 3VKWA 1YTUA 2X9VA 2NO0A 1EYZA 2YBEA 4RPJA 5IUNC 5L4NA 1QNFA 3CZPA 3H2IA 2QMQA 4M6WB 3KPUA 1DJMA 1C3LA 4K9MA 2MTBA 1IN1A 2A35A 3MB5A 4I81A 5TXGA 1TTHA 4RNDB 3A2KA 2D54A 1SN7A 2ODNA 3WDLA 2PX2A 3HE3A 5I45A 1DKPA 1VJGA 3HUUA 1D7OA 2HU8A 1E4VA 2YV1A 1V1MB 3OOHA 5BOSA 3NB0A 4UDYX 2PRZA 5KOHB 5MN6A 2RAVA 1PEKE 2GVNA 3AOEA 3H6GA 3D4OA 4G0XA 4RKYA 3S7ZA 3H65A 4EECA 5I9IA 3EE6A 2ZULA 2KYRA 4MVJP 4YRSA 3H87A 5AJHA 4QQ8A 2QQGA 3A9RA 3UPDA 2AH5A 2AR7A 3HKDA 3ZDYB 4DWVA 4M86A 1NF8A 2AG8A 3LXRA 2Q4BA 4QBTA 5CB4F 3T1QA 3UJ8A 1PJCA 1JX6A 2R68A 3B9BA 3PVSA 4Q02A 4RYLA 4Y0VA 3ZK7A 1Z2DA 4UE3S 1C3VA 1TKAA 4NU5A 1DCTA 4M2LA 5FPKA 4Q21A 3WL7A 2A9RA 1U99A 3KPJA 2EHJA 1ENYA 3P2MA 4ZXFA 3WHPA 5COQA 1HY3A 1ND6A 1Q2XA 3NWEA 4X66B 4F5YA 4KN8A 1WCIA 2FZEA 4PC2A 1PR9A 4TOIA 4B9AA 1G5IA 2X8JB 2ORED 3NKLA 4C08A 1H4VB 4YCLA 2ID4A 3K70C 1HDZA 1J49A 3QEMB 2IDZA 2IYFA 3ACCA 2QX4A 1XTUA 4ZIRB 1JMKC 3ROXA 4G89A 1H4QA 4WKBA 2AE1A 4DBVO 4DSZA 2C5FA 1SC6A 2PJUA 3HCFA 4LBZA 4UFPA 4IF4A 4JP5A 3HDTA 2ZP1A 1CBUA 2WV7A 1Q7TA 3HNOA 1IN5A 2RHRA 1B6SA 4G24A 3W2GA 1TU0A 2IUFA 4GFDA 1UXOA 4NOMA 2X0FA 4X8LA 2QSZA 4AKSA 4QX6A 2WSMA 4AYTA 1SGWA 4DT1B 3ZW8A 1NUSA 4ID3A 3PHCA 3UOGA 4V1CI 4MW4A 4U7JA 3EY9A 2OQ2A 1FUUA 1JA9A 5CNJA 5AM3A 1RPNA 2ZVPX 2O5EA 4EHKA 2O3SA 2GPAA 1N3BA 3OVMA 2VPQA 3CRW1 3NM6B 5B1HA 1EJBA 1ZY2A 1P4AA 2P2ZA 5JQWA 2VEDA 2ZI5A 2ZI3A 4IQ8A 3EPRA 1QIJA 5CHEA 1SUEA 3GJRA 2XKAA 5A7HA 1E94E 1S1CA 2EJWA 4N82A 2GN2A 4GKJB 4B74A 2XD9A 4EEKA 1NXPA 4UMEA 4PVDA 1NLUA 1XWFA 2CNWD 2EC5A 1W9HA 3GD5A 1P4JA 2AJLI 2ZROA 2B36A 5E1BA 5U1PA 5DNCA 2FSFA 2OD9A 3OU7A 5JNVA 1PJ3A 3CF4G 1ULSA 3I73A 4WT7A 5THQA 4JYPA 3RJMA 1D1TA 1P7ZA 2O8DB 5DO9A 5KQRA 2YRWA 2HRDA 3BTVA 3CUVA 4HQ0A 4AG5A 1H4TA 3FBWA 2A57A 4KE6A 3UV3A 1TFRA 1FU7A 2WT8A 5B2EA 2ZCVA 1CRQA 1CUHA 4PC6A 4L4ZA 3WLPA 2O5CA 2FJUA 1LPOA 2Q21A 1T8PA 2JS7A 3G7SA 1C1XB 3NWPA 3Q7RA 4Q3AA 4R0VA 4YAOA 4JGIA 4PYNA 3FTDA 3ORSA 4MITA 3DNPA 4W5TA 5B30A 3FIUA 4PZYA 5I7VA 1FDVA 1FSFA 2OGSA 4IXTA 4N3NA 4OI4A 1RWQA 1T0IA 5JC1A 5FBKA 1LVUA 1PNOA 1ZYUA 3EXEB 5I9TA 1N0IA 5JMTA 4RTJA 4UEKA 2VTEA 3FLEA 3I4FA 3UMBA 1KHTA 3UK1A 3W5AA 2G5CA 2VNHA 5CXSA 1KPIA 1WD5A 3ED1A 4NE7A 1EIZA 2PSDA 2ZYVX 3H9CA 3WQSB 4AJ4A 4XGNA 4KR3A 3HDYA 1NVDA 2PWAA 2PSFA 4L5BA 3FMGA 4C22A 4EHHA 1J5PA 3AVPA 3C16C 1IWBB 3O1JC 1WABA 5BYJA 2BYTA 3BERA 2FHSA 3RFVA 2VWQA 5LCXA 2DCMA 5H7XA 2IUEA 4JBWA 4C7MA 3R7FA 2PKXA 2QTLA 1VM6A 3K8YA 4UVIA 3FZYA 3LKBA 3AY3A 2WDPA 4QT4A 1OLXA 1UT8A 4RQUA 1C0EA 1ZRMA 2PMFA 3F5MA 4L5JA 3OD5A 3TXYA 1T6BY 4AKTA 3VYVA 4DL9A 3KUXA 3MA0A 1L6RA 2H63A 1E32A 4M0EA 2BBSA 5AM5A 3LQ1A 4LOJA 1HV8A 4U6QA 3HB5X 1IOZA 4KWTA 3UJAA 3C43A 4J7UA 1T9DA 4BO4A 1VECA 3EASA 2BM9A 7MHTA 1RMYA 3MAGA 3P9ZA 4HQ6A 4TLCA 4UTOA 1GKUB 3JTMA 4U0JA 4TQUS 1R6DA 5C37A 4Q3CA 5I51A 1KTIA 1SHTX 3IXQA 1CJMA 4OQPA 4BFZA 1I4TD 2YYYA 3SC3A 3I6MA 4RXTA 3KYDA 2BR4A 4MR7B 2X4DA 3I2FA 2JJ2A 4YMWA 1MJ5A 4E5MA 1TPYA 4Q1DA 1IJFA 3N8IA 2HOQA 2R8ZA 1ECBA 4HFJA 3UAYA 2GAJA 5EMNA 3FWZA 2F59A 2PVSA 3A6GA 1AUXA 1T5BA 2MU1A 3BHNA 4YJHB 3WHLA 4E3ZA 3NGMA 3WADA 2ZRFA 3LBHA 4BQQA 1AIPA 1PJ4A 5JTUA 1YZVA 2FLVA 3BMQA 3PGMA 2G9QA 5HPYB 1CY6A 1KF0A 1B8UA 3IUYA 4WXPA 2HLDA 2RAUA 4DRXA 2VP3A 4ZKEA 2IXGA 4AAYA 4DA7A 2FSSA 2H57A 3HN2A 4BQSA 1K4KA 3R7NA 2FP4B 1VXOA 4HDCA 4BB6A 1T4MA 3F4BA 2HPZA 3AFNA 1OYVA 3NWOA 3KKLA 4R0MA 3FWPA 2EKBA 2F9FA 2CMFA 4OHOA 3W90A 2VYVD 5I7EA 4G0YA 1O94C 5J58A 1OKKD 4NZZA 4MUJA 4W1RA 4H4DA 3T3HA 5AKHA 1P3JA 4FOPA 1TUIA 3AUSA 5E1MA 4R1UA 5K3BA 1JGTA 1WIWA 4XE5A 3CM0A 4FYYA 1TECE 1Y7IA 3L7YA 3SR0A 4U7WA 2VAMA 4KXYA 1KRXA 1FUIA 1DEKA 1W94A 3C48A 4BZQA 4CG1A 2W22A 4JROA 5ALMA 3TE7A 4H6VA 3U3KA 5H4HA 4REOA 3OEEA 3C5WP 2WV9A 2C5AA 3QIVA 4HDAA 2AZ4A 2B1GA 1W88B 1R4MB 3RD5A 4Z53A 2YNMA 2PS1A 4XVCA 4YRNA 2QTMA 2W0MA 3H2GA 2WTUA 1P6XA 3F6PA 4HYTA 2FG5A 2GF2A 5A4FS 3T7KA 3QFHA 3U4QA 3DZFA 1DRVA 3V4OA 4NPHA 3NYRA 4QBKA 1HDOA 3DF7A 3GZJA 3K9GA 1XQYA 2G71A 4E09A 3T5CA 4MS1B 1O3YA 3I01M 4CM4B 1LUAA 2IYSA 3CUYA 1YZLA 1C41A 2J32A 3SKVA 3EHEA 4QGHA 3M3DA 5BNWA 4BNXA 4RF3A 4C4ZA 4W5WA 3L01A 3KB8A 4HZGA 4IW3B 5JD5A 3RSSA 1AK9A 4MUYA 3R20A 3EC2A 1NVGA 3B6JA 1H5NA 3MFYA 2A4MA 4X6XA 1SXJD 2WJAA 1SIBE 3LC0A 4G0MA 4Z86A 4ZC8A 3QUAA 2CDRA 3FTCA 4DG8A 4XGQA 3IBTA 2ZZMA 1E61A 3P19A 2XGGA 3DEJA 3PPWA 4DVGA 3KG2A 4H6XA 1Z15A 1RAFA 2J9XB 4MCHA 3AETA 3KZXA 4KQIA 4DE5A 3L0CA 3V5NA 3GZNB 1PJBA 3BWVA 4DF3A 1XAGA 1JSXA 2YWEA 3R0XA 3KV3O 2JEYA 4P0TA 4AWAA 2RGWA 2B83A 1VC2A 4WQMA 3UC9A 4F84A 2AMLA 4ZRDA 5WRFA 1PT5A 1R8JA 1XRQA 2C2KA 2GPYA 1D04A 4FR5A 4E5KA 3KRTA 1QVZA 3TTWA 1WUTA 2B21A 3B5EA 1X42A 3NBXX 4AC9A 2FN7A 1F9AA 5CM9C 2XGMA 4LQ4A 1NZFA 4UUQA 3N8KA 2CVHA 2ZTLA 3EZ6A 5LNK1 1T26A 4OX9B 1N8KA 1P0PA 3TFQA 4YIKA 4WI1A 4JCOA 3OM0A 3D4IA 1JU9A 4IJKA 4EMSA 1V48A 4V03A 2ODEA 3CWCA 4YROA 1QKJA 3OAAA 2HW8A 5E2AA 4YWJA 3X2SA 2PT6A 5J4LA 4TV8F 2KS6A 3STHA 2ENUA 5KBYA 3AJ9A 1EGVB 1L7RA 1WKCA 2O8VA 1H2FA 2KJQA 2WVGA 3WOHA 4AWXA 5GINE 3H5OA 5DIFA 1FMTA 4HWOA 4RL4A 2JFZA 2AC2A 4UU8A 2PMWB 4DMLA 5CBPB 1HDCA 2HXSA 2VA8A 4Q34A 1CERA 2BFCA 3SOPA 3CTMA 5JBIA 4MZDA 1HE4A 3KSZO 5FUXA 4F4JA 3GT4A 4Q0MA 1S2OA 3QVTA 2W6NA 5E3HA 2OBBA 3C74A 4YAFA 1YA8A 3MHPA 4CG2A 4U2DA 5KDDA 5E6SB 5FOSA 4KK4A 3O95A 4J0HA 4AZ3A 2ZK7A 4C6RA 1QFMA 4MWOA 2WT4A 1URPA 4IGEA 1BVYF 1HA3A 1HYGA 1UEXC 3ELBA 1QVVA 4TTVA 4DOMA 4DW8A 5HRUA 1NXVA 1XRJA 3IEKA 3MRVA 3PPXA 4XWAA 3HO1A 1EFVA 1NR5A 2GLUA 1IC6A 2C4HA 3ZTTA 5BUZA 1DDGA 1EFUA 2C4WA 1PKXA 4YV7A 2NUBA 4RU1A 4K26A 5KJ6A 4X84A 2XJ9A 5IH7A 5JEDA 5JXIA 3K9NA 4KXWA 1EXNA 1R6TA 2CYBA 4K9OA 3WB0A 3GJ7A 1JFTA 4Z4EA 1NDHA 2CHQA 3LLVA 4IIUA 4AICA 4WPGA 1GPBA 2LZ0A 2R86A 2W9XA 2IS2A 2C2YA 3GRYA 3ILSA 2WK1A 4HAZA 1SY7A 3WIVA 2ATXA 2AYYA 3I2YX 4L4UA 4ZQGA 4MK4A 2I55A 3OBIA 4L8LA 4PTLA 4LOLA 4ZQHA 1JEJA 5KAMA 3W6ZA 4WCDA 5A4MS 3DYIA 2EHDA 3WWZA 5L3ZA 3NJRA 4IYRA 3V7WA 1N2JA 3TIGA 4BP3A 1PHRA 3EVAA 3NOVA 1SIOA 4RWZA 3QPWA 4CDMA 2JAXA 1G3QA 3M6MD 4TYQA 5EPUA 4EY3A 2D6FA 1QGAA 2EWWA 4G5OA 1RW4A 3DBLA 2DMRA 3GY0A 4ARIA 2QMUA 3COYA 5D2CA 1QB8A 1RPTA 2Y4OA 3IVXA 3N8GA 1GDHA 4P4LA 5REQB 4PBTA 4PXAA 4BLVA 2WHEA 4V38A 5CG1A 5H3HA 3L0IB 1EFLA 3BDIA 2G80A 3PKZA 4QELA 4X3OA 3ZXSA 1NLYA 2C78A 4CU2A 5GZ6A 3UWOA 4I4LA 1AE1A 1UBLS 2AN5A 3K2EA 3KQWA 4MQFA 2YYAA 1WXWA 2LUOA 2JLCA 3UFBA 1V8OA 1RRCA 1QCZA 4CM9A 2BTEA 3OESA 1CRLA 2QTRA 4XW2A 5BV2P 2O2GA 4URUR 2YIVX 3SF8A 3DW3X 1AKMA 1RZ3A 4PLTA 2VN8A 3ZDAA 3QKWA 5IYZF 3I92A 4J1TC 2EX0A 1XZMA 3WV5A 4D4KA 3UWPA 2I22A 3QVJA 4L9WA 4MUBA 4OFZA 1ZXLA 4H35A 3DLBA 1Z2PX 1MXHA 2VNKA 4HY3A 4IIHA 2QX8A 1DCFA 4KQKA 3CVOA 2BCEA 4DB4A 4KUGA 4EB6B 3AG5A 3R41A 1I13A 16PKA 2V7UA 5CCXA 4HQKA 2XDWA 1YR6A 3EIHA 3ZJ5A 1L4HA 4LC9A 3DOOA 5CRIA 4LYYA 3SLRA 3EPLA 1T35A 5FWYA 3ETGA 4DIFA 4KR7A 5HKLA 3FPAA 5JNSA 2P9HA 5HGJA 1JLHA 3K8OE 4HB3A 4HBGA 3Q8LA 4WJLA 3J81A 1RRVA 2V6GA 3G13A 3IO3A 4J0FA 2L82A 5KYVA 1VKRA 4H27A 2X58A 1XN4A 2PLWA 3OM9A 2JIDA 2Z8YA 5EUBA 2ZPAA 1O97C 4XWGA 2B3TA 4RORA 1LRLA 1GLVA 3QBJA 1QKKA 2AEMA 4KQ9A 3FXAA 3H7AA 1ODCA 2FZGA 4F2WA 1AA6A 1WLSA 4CMCA 3CGGA 1V7QA 3FAKA 3LMKA 4F3RA 3G2KA 3OT5A 1W0KD 1FXUA 3FFWA 5DX0A 1QDUA 2H5EA 5J2UB 3U0VA 1ZBQA 3FYDA 4F4CA 5L3QA 1UBMS 1QFYA 5SZHB 4MMYB 3H8WA 2H4XA 1GNLA 5FL7D 4US2R 4S3MA 4L9RA 2AFHB 4RA6B 4J8PA 3ET4A 4D96A 3TF5A 4Z4FA 5LBUA 2H11A 1W35A 2BTOA 3ZX4A 2H31A 3KZOA 2EP7A 3C45A 4NTZA 1IG0A 3RVNA 2ZJ6A 3A6EA 1XOIA 2BEUA 3NKFA 1MRSA 4HAXA 4AJNA 4CCYA 1RNLA 1F2UB 4HS9A 3PIIA 1JYEA 3QVKA 4NJOA 1NM5C 1R0CA 3U81A 3UAWA 1LLFA 3C8ZA 4JT8A 4JCCA 2FPLA 3WMGA 4BRUA 4GMGA 1EWYA 3LY7A 3GWZA 2QUKA 2WE8A 3CSUA 4IPTA 3JZIA 4EYKA 4UNQA 5FPPA 2PZMA 4PPGA 2FJPA 4W5JA 1DQPA 1L5MA 4X8MA 3OQMA 4E0BA 3LTNC 3RBVA 1L5ZA 4RIFA 4O4HF 4YP0A 1BN7A 2EZUA 4GYYA 1MNQA 2C9BA 3E22A 4PIMA 3A0RB 1NJ5A 3KJGA 1F0YA 2B7CA 3GMTA 3LNCA 1L2TA 4RAOA 2QDKA 2G6TA 1O1YA 3MILA 1IWOA 4DG5A 1V1RB 2P7HA 2BEKA 4MQEA 4CG0A 3PNKA 4R69A 2JW5A 1PS8A 2R6JA 3JD3A 1J99A 10MHA 3WS7A 1XEWX 1T9ZA 2CLSA 2QX9A 3QYAA 3EARA 3R40A 2JH3A 3V1TC 5AW1A 2P4SA 3JS5A 4X94A 1TFUA 2Q5HA 3F8WA 5LDGA 5AKEA 4IJ5A 3ZQKA 4MARA 3WA7A 1SKYE 1L7PA 1KH1A 1PR2A 5GJBA 2YOGA 4OTZA 3ICWA 3WSVA 4DLUA 4YMUA 4ZT2A 4YAJA 1GNSA 1OA0A 2Y1XA 1BHSA 2Y67A 1PEDA 3MTJA 5SZKB 4DYVA 5C8VA 1W36C 1DAPA 5DNYB 2F3PA 3UNXA 4RY9A 2XJ4A 1GSHA 4NRDA 4OHVA 4QYWA 5EJ6A 3TFOA 2NO1A 1IYZA 3I1FA 3PK0A 1OAKA 3D5EA 1XRRA 2IX9A 3AB7A 4PO1A 4RMHA 4ZYUA 4RDCA 4GWGA 1H85A 4FCWA 2IU0A 5FUQA 1D1QA 1GTG1 2P6UA 2QRQA 3CRZA 4QPJC 4M37A 3KXPA 4JYZA 4WK2B 2KMLA 2OHOA 4K28A 3LFUA 1ISFA 5E7IA 4MIOA 4HDRB 2A30A 3DQPA 2QJTA 2YHAA 1LI4A 1N57A 3OP4A 1ZQ1A 4I9NA 4JK3A 2Z2YA 4BL5A 1WZ2A 4OB8A 3TEJA 4WECA 4EKGA 2AI3A 3AGQA 3FZGA 4CETA 5JDIA 4EW2A 1G8YA 2GQ0A 2DFKB 3QVSA 4GP7A 5AXCA 3U62A 2H16A 1N5OX 5C5CA 2Q6KA 1ZG3A 3NU1A 4JEHA 4KE7A 4LJ7A 2TMGA 3L0BA 3MOIA 3KZCA 4H7IA 4NAHA 1B4DA 5TQVA 1QK3A 1SFRA 4Y18A 2P41A 5C4IA 1KAQA 1YZFA 2WR8A 2V6IA 3OX2A 4FKBA 5CNMA 1E8NA 3FPLA 5IT9A 1R6AA 2HUNA 1E96A 1L7VC 3FI9A 1PLLA 2G4CA 2X0JA 2DQKA 2YUIA 1NY5A 3BDAA 4TZTA 3ZU4A 4A26A 5A9SB 2C3MA 1X87A 2HMWA 3ROKA 2X9NA 3BM5A 3ESQA 3QKSB 1RP1A 2GILA 5DBEX 2JEOA 1SG0A 3GEEA 4MVXA 2V5AA 1UBKS 4IY1A 5C18A 1KYQA 2GD0A 2X8LA 5KSYA 3COWA 4A0SA 2FZ4A 1TYBE 1FRNA 2R85A 1KI6A 2G5TA 1BE1A 3NUGA 1G4AE 1KY4A 1Q77A 3M1AA 3E3NA 5AKGA 4BVLA 1PEAA 1D1SA 2WSLA 3EDYA 4BFYA 1OB2A 2GZ1A 1RT9A 2C2OA 3GWGA 4Z8XA 1DBWA 3LPLA 2IYXA 2SCUA 2NZUG 1ULBA 3RHFA 4TQ9A 1ZOOA 2B4QA 1REQB 1W76A 4R2WA 4II3A 1FDSA 3L7IA 4GQAA 4NVRA 2NN3C 3RKUA 4C6HA 3CQ9A 3THRA 3TIVA 5CBKA 3OWXA 4W63A 3K31A 4MQUA 1Z47A 4L5IA 3GD7A 4LJ5A 3IUSA 3NR2A 3WE7A 3ER9A 4HQLA 1MBZA 2PZ8A 1VYVA 3FDZA 3JWHA 2X8BA 2XQJA 1IU9A 1CE8B 3AR6A 4KKXB 5DSZA 5EIHA 3BE4A 1BOOA 1LTHR 2WM9B 1A4UA 4DSUA 3FZNA 2F7SA 1NMZA 2JHAA 4WLNA 3E3OA 3D0RA 4NDZA 3FSGA 2EEPA 1JECA 1M8JA 3KBBA 3PJGA 4G37A 4M3NA 2Q6VA 2ZUBA 4WXEA 4YQYA 5KU1A 1HE3A 4LDJA 1YCDA 5LM3A 4XSHA 1VE5A 3VJKA 2HO5A 4BX8A 1PZNA 3U26A 3AEQB 1WF3A 4M49A 1OBFO 2VQ6A 3B6EA 1KEPA 1THGA 3O4FA 4O29A 4EF6A 1VIMA 2JF0A 3UUFA 5K01A 3HK2A 3FCSB 2TMYA 1IZ7A 4PG6A 2JHFA 1PIWA 4AURA 4B7XA 2JD1A 2NTEA 1Q0ZA 4H7PA 4WDQA 1NP3A 4AULA 2P8SA 3GN2A 4TS1A 2UZ4A 2IS1A 3ILXA 3NI2A 2I3ZA 3HSSA 3EZGA 3WO0A 1MPXA 4A2CA 1KTVA 2KB0A 3GBSA 1JBKA 4K0RA 4B33A 2G0NA 4LPSA 3JD2A 2A4KA 2ANCA 2KE5A 2RBEA 4EUEA 1Z6QA 2CY0A 1GN9A 5KHLB 4R4JA 2AN1A 4L15A 1ZIPA 4HI0E 3SD7A 2VK4A 2YZKA 3IEXA 2Q4DA 4KL8S 4RGBA 4OGLA 4XJXA 1GEGA 3V00A 2B1QA 3AB3A 4KMSA 3WRYC 4AMUA 1UJMA 1PR3A 3KXKA 4TXJA 5CAEB 3GFPA 2GDJA 4IEIA 4OQMA 3U17A 2IPOA 3JQ7B 3V8RA 3DM9B 1KEUA 1WPRA 2LKCA 3D4LA 3WGJA 4QVIA 1SCQA 1UDCA 1K6IA 4TROA 2C4UA 3WTBA 2JH8A 3ISVA 4KKVA 3I8OA 4YA6A 5E7MA 3SK0A 4CF5A 1OXKB 4PCLA 3L6CA 3Q87B 3BH0A 3IMFA 3JD0A 1L3BA 3S1AB 1X1BA 3JTEA 5ARCA 4R9UC 5KNCD 1CDEA 1VL2A 3N3AC 2GS9A 2BGMA 1MEOA 2RSLA 4ETWA 1WU8A 1LX7A 1Z6XA 4TMXA 4RETA 1M8PA 5D3ZA 4PNPA 3Q3HA 3B3FA 1KHHA 5P21A 1ZJWA 3IR5A 3QK7A 1J9EA 2H1OA 1F8XA 2ZUWA 221PA 3L05A 4H7JA 2A0KA 1TMGE 1JVSA 2PUVA 1SBQA 2CJPA 3OIYA 3S40A 1Z5UA 3DO8A 3LUGA 1KU0A 2Q3CA 3M5CA 4I1IA 4TYNA 3ZXUB 4NI5A 2GFHA 5K8VA 3BMOB 1X92A 3D3KA 2NU7B 2P79A 2EIHA 4GZ6A 1ICIA 1CDDA 1W4LA 2C95A 3K0FA 4GGPA 4R31A 3RUPA 3BOSA 3TG2A 1L8LA 2NZVG 2HR1A 1P0CA 4EFKA 3WMFA 3DUFA 1GCOA 1JXAA 1F6DA 1Z0AA 4TVKA 3PCTA 4MUHA 3LVBA 3P9KA 1UKBA 3USZA 1Z88A 4B7UA 2PUAA 3W5IA 1B26A 1T3SA 3IUPA 4DXHA 3T3OA 4QXRA 2XSZD 3DFIA 5DFAA 1F48A 3V7FA 5KYXA 1GWNA 3HBJA 1C8LA 4CL0A 3OOSA 3EAQA 2IYOA 1NX6A 2GYYA 3NHZA 1E4OA 2JGAA 4XI9A 1E9DA 3MNFA 3R0ZA 1RRFA 4GSKA 4O2AF 4RPIA 5FH9A 1M10A 3AL0C 1GPJA 4A10A 2XUDA 2R4QA 2DWPA 2VJMB 2C8KA 5IKPA 1U8YA 3T35A 2NV2B 5BSRA 2QRHA 2V6MA 2ZKIA 5H82A 4IXDA 1U7ZA 4DKXA 1FSZA 1GP2A 1LI5A 3CUKA 4EG3A 3K16A 1XRPA 3ZS9A 8AT1A 1JXOA 1KJ9A 3A9CA 3PC2A 4NJMA 1GAQA 1J07A 1BCRB 3EVTA 4XRRA 3B9PA 4DC1A 2HK6A 2DT5A 3MJRA 5BWLA 4QAJA 1J90A 5CIQA 3DDHA 1GZVA 3DV0A 3OKFA 2PUFA 5E3JA 3AO0B 5KX5B 2Y9PB 1JIKA 3TCXB 2RB4A 3JQ8A 4K81B 4JIMA 4NEQA 5SZIA 3GPDG 3WBBA 1N5IA 4PS1A 3I37X 3IIJA 4U6NA 1THZA 1UJ6A 2XOKD 2YMPA 2BDTA 2W37A 4P93A 3IUQA 4X60A 1MDBA 1Q95A 1WY5A 3EZFA 3F6CA 3M4NA 4FUTA 1JQ5A 1HG1A 1NPYA 4RS4A 3BF7A 3K0CA 3KTFA 4U7PB 4NCJA 5AOAA 1E1QD 2BZ1A 3CBGA 5HX7A 3QKRA 1ZUHA 4DLVA 2PFGA 2P6MA 2QHXA 3FR7A 3H13A 3BBLA 3DDSA 1X0VA 1UBCA 4JLDA 4KWHA 4Z2YA 4KOEC 2VPZA 4I9HA 1FA9A 3V6LA 3VISA 1W7AA 4D56A 2P6RA 2P75A 4C0JA 4UNSA 1BKDR 2ZTUA 5KSOA 3H5IA 4Y3UA 5F2KA 1C7EA 2XUJA 4K9KA 1RMTA 2QBYA 1KMCA 1IY2A 4FR0A 5FTJA 4E1BA 1GCGA 1TW3A 1P4GA 5JH7A 5CMLA 5DM0A 5B4VA 2DY1A 1TT5A 5C52B 2C98A 2I3BA 3WFIA 1ZOSA 2BLNA 2QG6A 3ZWYA 1FFHA 2EX1A 1LF0A 1YONA 2O2HA 5BMVB 1VJTA 3K2QA 4D97A 1P1HA 1B23P 5KTPA 2OK7A 1KJWA 4X1KA 4G5YA 5D1HA 2HPAA 3BAZA 3DFZA 1Z74A 4MUGA 5C31A 1TVEA 1MORA 3ESZA 3K9QO 3ET5A 4M1SA 4W5NA 2YINC 3WNVA 3HJTA 3S70A 4AYWA 3T0IA 1CVLA 3H5LA 5AUNB 2AQHA 4IDGA 4ZVVA 1Q91A 3IH5A 5CK4A 3CCFA 2C2BA 2ZIUB 4YRLA 4BMXA 3IP7A 3OQVA 1N6IA 1NF2A 3ZXXA 1K5GA 3EWIA 3L0DA 1IY0A 4FSDA 2CJYA 1THMA 3SZ3A 3M9XA 2ZCJA 3VUEA 5AJZA 5LR6A 1U6IA 1JEYB 1POWA 1HUQA 1U9CA 5LZ9A 4N18A 4BNUA 2FI1A 2G77B 5G02A 4EQ6A 3LYAA 4BJ1A 4C43A 3W5UA 1TQDA 1QH1A 1WV0A 2BTQA 3GRPA 3INNA 3PQ8A 2FPXA 4W9NA 2WFMA 3B2NA 1NZDA 2M9MA 3ZWNA 4CMAA 2A1IA 1FLVA 1SWWA 5ALJA 2GM3A 1Y6FA 3ZWQA 4BZZA 3HR7A 1SIUA 1J00A 3D6AA 4EP1A 1W30A 4RXMA 1VBFA 3B1WA 1AQLA 1NVMB 2JIZD 2E18A 2Q5IA 3F74A 5IUJC 3I01A 3OM8A 4IIJF 1L4FA 4JT2A 1RXEA 2QGZA 3V2IA 3CLUD 4Y98A 2V8OA 4BGVA 1SC1A 4H15A 5L3SB 1A1VA 4DV5B 3WHKA 3GROA 4ZP1A 4N39A 4Q37A 1VBNA 2JDID 3TAHA 1USGA 1AGPA 2CVZA 4JYAB 5DP1A 2CZGA 4NBLA 1AH2A 2DHEA 3VXKA 1MW8X 2BONA 4MB0A 3C3BA 3NONA 4KLRA 5TQ0B 1IBCA 1NG1A 5IC4A 3DJYA 1JW9B 4IM7A 2PD4A 3A6ZA 2FY8A 4LI3X 1FSPA 1V8BA 2W2PA 4QJ4A 1KQFA 5DULA 5ARDA 1US8A 1SUDA 4WN9B 3GVHA 3OSZA 1STOA 2O3JA 1C2TA 3IC5A 4GKAA 4UHJA 5EHGA 3WZMA 4C9BA 1FFXB 1JSLA 2FMUA 3IEPA 5BT9A 2F1OA 2HF8A 5EWMA 2CVQA 3CF2A 3FOCA 4BO8A 2V3CC 1UEIA 2P6OA 3OMXA 3OX1A 4Z4HA 3QUBA 4O3MA 3ETNA 4XIJA 4C4AA 4WBNF 4L1KA 5DTEA 2OT3B 1PT9A 2IJGX 1BJKA 4CM6A 1HGXA 2GO7A 2WINI 2ID9A 1A95A 2AK2A 2FOLA 3LUFA 5ALKA 1XZKA 3B6KA 2E5WA 2K7ZA 3GRUA 2QP9X 4Z9XA 5H5JA 4PPQA 4WESA 2BD0A 3WLJA 1SVLA 2OB2A 4FN4A 5L8VA 4INAA 4DR7B 3CIOA 1FFWA 4EGCB 4IDAA 4Z2AA 3URKA 1FX0A 4IV5A 5B3KA 3DAGA 3IV7A 3SHWA 5JWOA 1MCZA 3VTFA 4AJ1A 1O0BA 5MHTA 3TNDA 1MC5A 1TGVA 2ZWOA 2X40A 4LHSA 1NJFA 3UMJA 1KK0A 4DDVA 4O5AA 2XMZA 3ZS8A 3O74A 5KOJB 2J3LA 1K8XB 1PGQA 5ALDA 4DNFA 1V8ZA 5JSKA 3FPSA 4EEXA 1MO4A 1ZPDA 3MQ2A 1JKMA 4BNLA 4O1IA 1N2GA 2GB4A 2YRXA 3ZWMA 2Q27A 2C00A 4C29A 3VDRA 3QHQA 5FP0A 3U5TA 2O1XA 4PYIA 1P4RA 4MPDA 2YXPX 4YDSA 5C1BA 2R00C 5E9QA 5B4TA 4PLYA 4MUIA 1EK5A 4PZZA 1OB5A 3G5UA 2A7XA 4KJZA 2GN0A 3C70A 5DP2A 5FPTA 3T4EA 1ZGGA 2RH8A 3KYJB 4CR8A 3GVPA 3ZLJA 3T1VA 3KSUA 5HWSA 2WIAA 3F49S 2QT1A 4Q66C 3B1XA 2PRYA 3A4VA 3V1UA 1PZXA 1CR2A 2PZFA 2ZIEA 4RPCA 2VR1A 2DRIA 3VNAA 2Q29A 3QKIA 2QDXA 3Q3VA 3W4KA 4PLFA 3IP5A 3IQDB 3K9BA 1KFJB 3MJVA 1P45A 3T9CA 2PWBA 1NXQA 3CJRA 4Y6PA 1N7GA 3P4UA 4TXHA 5BW5A 2O57A 1H69A 4I50A 4F3NA 2XB6A 2ESRA 9ABPA 2J85A 2VJNA 3H7IA 5C8ZA 4YRQA 4L50A 5HNKA 1PNRA 3GLHB 4CGZA 3LBYA 4D9JA 1A9ZA 1AO3A 2XMPA 3IOCA 1C1DA 2F00A 3PRHA 1UADA 1AQYA 4A7PA 2O2YA 4JA0A 1ZK0A 4QRHA 1VPWA 1SKAA 3HYRA 3OZEA 3ZVNA 1HG0A 4L85A 3RYCB 1EM8B 3JALA 1IUOA 5F2OA 5CLGA 5IAOA 1HLDA 4FYHA 4F8JA 4LFAB 2G5GX 4P33A 2CKMA 4TV8A 5FWDA 2BM8A 5DK4A 4PO3X 1OWMA 4GPZA 4MW6A 2Y1KA 4ZK6A 4HGNA 4D6YA 5LMZA 2C2WA 2WYIA 5AUPB 5CFPA 1U3CA 2L2QA 3ABSB 2QGNA 3F9CA 4DY4A 2GTHA 1P1IA 2ZYUX 4ER3A 5AIAA 5EJIA 3L2OB 1P77A 3L0OA 4HYYA 1PTJA 1NDQA 2D1TA 2GPWA 2C07A 3P9QA 1P5ZB 1ARZA 1L5FA 1SQGA 1V71A 4YRAA 2DH5A 4GR5A 3EGOA 4CDRA 5ICCA 3O83A 3B7PA 2RBGA 4TX1A 1FJ2A 1K9SA 3QLUA 4HB0A 2XLCA 4BE4A 2B6HA 2E21A 5ABPA 5JBNA 2UUBB 1CC1S 4RHYA 1UC8A 1IHYA 2A3RA 1E2DA 1FP2A 2QIOA 1W34A 1GUYA 3NHMA 4U02A 2VXYA 1RCTE 5D51S 3WL5A 1AV7A 1GJRA 4OHZA 3VHQA 4JVLA 1N6RA 3P2YA 1J8QA 1H8HA 1TUGA 2WKSA 4IQ0A 4MTLA 4D5GA 1B0ZA 1GQOA 1NVAA 4I9GA 4EHDA 1E9VA 3DLPX 3RNLA 2AJBA 3K70D 4QLAA 1U0HC 3PVCA 4FBMA 4KTVE 1JWLA 3MWEA 4JSRA 3D2LA 1U3WA 2CXUA 1OZAA 2DTXA 5KTOA 2HNBA 2RONA 2C58A 2NTJA 2ZRBA 3D3EA 3DQQA 1FFSA 2FKAA 4CQLA 4ZHQB 3TLKA 3T7DA 5GP1A 1UK8A 4HGQA 1RM0A 3HWRA 2WTXA 4CU5A 3N6RA 4KXXA 2VDWA 1T9GS 1DTWA 2IITA 4ND8A 2AKAB 5HQ3B 4U7DA 2V74B 3KEOA 4MINA 1FNBA 2FJ0A 2VCHA 4YPFA 3DA8A 2WJJA 5DYWA 1KETA 3VYWA 1P1BA 3AK4A 4UBKA 4EF4A 2DFLA 2RKWA 4HEHA 4HGZA 4A0GA 1BXGB 1L4EA 5DT9A 3QQPA 3GHHA 1W4CA 4D26A 3KQVA 3ZGYA 1IATA 1KZ4A 2G82A 1HSOA 2VI5A 4FYVA 4NICA 4CLRA 2N1MA 5B3JC 1QX3A 3PQFA 2O1EA 3L1VA 3NT4A 4AF7A 1G38A 1X1EA 1ZD1A 5KU7A 2I7VA 4JKIA 1W36D 3MW8A 3ZHBA 1KR2A 3EY4A 3TQSA 2YZGA 3L7BA 2HMSA 4RQBA 1DSSG 3NO4A 4YRPA 1QS0B 4Z54A 2NSYA 5JS7A 1M1XB 5JUWA 3IDZA 3GUVA 5GIOE 1K68A 3GDOA 4M0KA 1E2FA 1OPXA 4CMJA 1RWVA 5CEEA 1OWLA 1YZGA 2VQDA 4DQUA 2OAQ1 1O96B 2P2GA 1GRCA 2W2VA 4NV3A 1LBIA 4V24A 4EGSA 4OP2A 4TSFD 4EYOA 3IQFA 4G25A 1QR2A 4A16A 2PT9A 3FRHA 5FEMA 4FQ7A 4BFXA 3AI2A 3I9KA 3OE5A 2OGWA 2WJGA 3TM5A 4BLRA 2WAOA 3ECCA 3ELUA 4BNMA 4BVFA 3S27A 3EW9A 4DLPA 4YRIA 5B1IA 3WDMA 4EHBA 3ETEA 1DAFA 2ZAGA 3CJQA 3BMCA 4ZVKA 1V7PC 3TD6A 1B00A 4E1VA 4LEIA 3FUVA 4PZ0A 5CVEA 3SIRA 1RQXA 3ICQB 1XR3A 1YD7A 2I1WA 1ZC4A 2NMVA 2GBLA 1L4YA 1T5LA 2PUEA 4XD7A 4B4OA 2BM1A 2V3VA 3SQNA 4I8DA 3MT9A 3ZV3A 3DZCA 4CHTA 2QMHA 3DVRX 3KV1A 1NVFA 3T7AA 2C5HA 2E6UX 5CT8A 4F2DA 5A3JA 4NFYA 1EFKA 1UBUS 3FF1A 4TSKA 2JK0A 5EC8A 2HDHA 4HFMA 2XUGA 3F1LA 2REBA 3SC4A 4CCAA 1PUJA 3F7MA 3Q10A 3UJ3X 4OVKA 2VZ8A 4HZUA 2XVAA 4EPYA 2R7KA 1XJCA 1BU8A 3OZAA 3C85A 4XYMA 2NU9B 3RV3A 4CF4A 4HNUA 2QWXA 2VHQA 1NBMA 4HNGA 2X6QA 2WIKA 4Q9DA 3TMKA 4C0QC 4EG7A 1P3DA 2CW5A 3GMSA 4DZZA 3OOJA 4F4UA 5LDDC 3WVNA 4FOSA 1LI7A 5LVAA 2DETA 3RKSA 1JYFA 5IBCA 1D0VA 1LLUA 1QOPB 4WMLA 3N53A 5CIYA 4R05A 2J9ZB 3OT1B 2OCPA 4ML3A 4O4HA 5EXXA 2FOXA 2X6TA 3WNCA 4UTNA 1M2OA 4LXXA 3I8XA 4I8IA 3AL3A 5LJLA 3ZV7A 3O9VA 4YAKA 5ALEA 5BV8A 4HDSB 1IXZA 1A7KA 4UUNA 4CL2A 1KO7A 2J0UB 1XD2A 1ZUD1 3LSYA 3OQHA 1YQEA 3SVZA 1LY1A 4IGIA 2DPXA 2XGOA 3FTEA 1C50A 2ODWA 4R3UC 1AN0A 1UDBA 3GFBA 4PZPA 5DMXA 2KW5A 2W8ZA 4GMKA 4G0UA 4OHBA 3EZYA 1Z83A 2Q99A 1DIAA 1P2VA 4NMWA 4RQAA 1SD2A 1RZRA 4AMVA 3FETA 3VC1A 4B46A 2ZQ5A 4TYMA 2HQSA 4P4TA 4WVLA 5AVYA 3KD3A 2Z4SA 3NS7A 2JAWA 1HC7A 2LV8A 2YHIA 4W1QA 3RVRA 1C3XA 2VYNA 3T7RA 4DADA 2XEXA 4RY8A 1PQ4A 3I3SR 4C4SA 3V4LA 4G0VA 2HK8A 3DBOB 3L02A 3GLFA 2R7MA 1UFQA 2I6GA 3BXZA 4ATNA 5HUHA 2OP0A 4HLNA 1R7RA 1WDTA 1SZDA 4IXMA 1DZIA 1FS6A 4NNOA 2ZRPA 1VRVA 1WXQA 3KXDA 1O94D 3ZE1B 1D2NA 1VL6A 4N40A 3BVPA 5FNZA 5K7SA 2Q3JA 3RVJA 4BO1A 6YASA 5TMBA 4RJ2A 3RSHA 2X8JA 3EEFA 4WEQA 1OILA 1F14A 3JQCA 4LUCA 3QUQA 1NOKA 1OAAA 1GA1A 2YYZA 3NIGB 4YQZA 2X2OA 1CQIB 1Z5VA 3SKYA 2GBFA 1EGQA 3N74A 4QDKA 3B48A 4ZIRA 5KPDA 3TQHA 2WUGA 2BFWA 1WJGA 4B2PA 3BWXA 4OYHA 4Y2JA 1XZIA 3D02A 3HKEB 1Z0JA 1X80B 3D2BA 4MVWA 3GEMA 4HZIA 4CV0A 4KWIA 4EVSA 2XMGA 4EUNA 4DSAA 3KSDO 3HJBA 5I8PA 3OPXA 4P1ZA 5EKSA 5FHQA 3QX8A 1MOPA 5J3JA 4PTZA 1KVSA 1TUBB 5AK6A 4JLOA 5DIZA 1BS1A 5CX1B 1RSZA 5F1YA 1BCSA 3M9LA 1X6VA 3SSMA 4FDMA 2GKGA 4MJLA 1G7SA 2I4MA 3QU9A 4GI5A 2ECPA 3ZBQA 3SHFA 1Q1NA 1A5ZA 3ZK9A 1CVRA 3BMXA 3TGPA 1ZEMA 5KIAA 3HXTA 1I2ZA 4D82A 5DHTA 1P7VA 3HFRA 2QJWA 4L73A 4MIKA 1YHZA 2CMHA 4LXGA 2CXOA 2GERA 3H11B 3EAGA 2GLTA 1TPZA 5JD4A 1YS7A 1KMQA 5CFMA 1VOTA 3HUDA 4IDQA 4UPVA 3PE6A 3TRHA 3UYKA 4ZOQI 4RZHA 4ZMRA 2X4LA 1XZLA 2J1LA 4ESOA 3DKPA 3AR3A 4PAMA 1D2HA 1DFGA 3GNSA 1NY6A 3GX1A 2O20A 2CNNA 4LJYA 5D85A 3GFGA 1T1EA 4DUGA 4I8XA 4IQGA 4AT1A 5D7BA 5HJ7A 5JZ9A 2O7NA 3V4VB 3PXCX 4TYPA 1H3FA 1G60A 2EARA 2WABA 3GP5A 2HQ1A 5K3SA 4IBOA 2UYHA 5KX5F 3R77A 2BPOA 3LPAA 4MVJD 2VSQA 1LX6A 3IIEA 2I6FA 3FDFA 2WKRA 5DLYA 1SHKA 5LQDA 3DBVO 3S5JA 3SQLA 1U1CA 5EE5B 5BXYA 3AILA 5GVSA 1ECGA 2IOFK 1L4BA 2NYRA 2Z9DA 3QYJA 5FOXA 4EF5A 3ZWCA 1IM2A 1C7FA 3EXFB 1F51E 1NAHA 2MSKA 1W87A 3G2PA 3KSMA 4KPUA 4LJ6A 4HGRA 4IRXA 3RSQA 2O19A 4MJ7A 3HJFA 3HLYA 4XD2A 4YP7A 5A6SB 2RHJA 3VM6A 4QECA 2C29D 1XJWA 2YHSA 4HN9A 1CD5A 3I9NA 2ODAA 1BMQA 1QZUA 3GCWA 1FFCA 2V6FA 3AJRA 2YXBA 1F1BA 1AA9A 1LTKA 1UAYA 3W9SA 3PHGA 4URFA 5C53B 4LMBA 1X1QA 5HYVA 3EQ6A 1U4NA 4DR2B 4CZ2A 4MB6A 2YWBA 1NI4A 5BMVF 3AM4A 2AMVA 4I55B 1UP7A 2PUWA 1M6HA 3PLNA 2DFPA 3GLKA 4EX7A 5KWIA 3DP7A 1A0OA 3NHYA 5FBRB 4V1CA 4FZJA 3ZDFA 1ZDMA 4HATA 1L6IA 2CWDA 4RV4A 5GTDA 2N0SA 5CTJA 4QOHA 3AOEC 5BV0A 2C9ZA 1WRBA 2IP1A 3MGBA 4Y1FA 4DA8A 3DE3X 5CH8A 1QYRA 3K30A 3OY2A 3Q7SA 4MW7A 2W90A 3UJ7A 1Y4UA 1CJBA 1A4RA 1PJSA 1SK8A 4QUBA 1UWCA 3W5JA 2QZJA 2OC9A 5EXTA 4NCAA 2Y76A 3EXIA 1T1GA 3NCTA 3P9SA 5FULA 5I7HA 2WMOB 4GVXA 3CNOA 4LJRA 1FU8A 5AKJA 1ZVKA 3CCCA 2WY2D 3GJ4A 2BFNA 2QVBA 2GZAA 4HTFA 5GVRA 3IKTA 3U4GA 1ACLA 1DKQA 4LRSB 1L4MA 4L6IA 2DERA 2DJIA 1I9GA 1R5JA 1AJEA 3TYXA 2YWXA 2YWHA 4INPA 5DYYA 4AO8A 4WIAA 1G7RA 4UHHA 2D5IA 4ZOLA 2LCQA 5J2TB 2V65A 3MPUA 3LUBA 2RCYA 4C7OA 1U04A 2IYZA 3NWBA 4LF8B 3DVAB 4HAYA 1Q74A 2EATA 2JLQA 1PX2A 1WMEA 2MYPA 2WWWA 4NKRA 4NPAA 5KNDH 3ER6A 4JI2B 2QNRA 1DU4A 5BSWA 5JRDS 4D9KA 1CZUA 2Y0CA 2EFCB 3K2BA 4QLOA 2WPDD 2FEXA 2R6FA 4IOJA 4M88A 4W6ZA 3ZKWB 3QMMA 2Q7DA 4DARA 2ZYHA 4K9RA 4UXJA 5IDWA 4COOA 3V7UA 2B4RO 4PY2A 1I30A 4D45A 1H9BA 3G9QA 2F64A 4CMIA 1Q3HA 2Y6UA 5I3ZA 1DCKA 4LXHA 3VPHA 3K73O 3P2OA 3VZRA 5KYXB 3CZ9A 1AQUA 4DHEA 5FBWB 2IOFA 2J6HA 5AQ1A 1GRVA 1PX0A 1QCDA 1O5OA 4BQFA 1W19A 2RGDA 2FQ1A 3C3KA 3K9LA 4KN5A 1X9GA 4XTRA 1IXSB 3REQB 4NR0A 2GAFA 1X7YA 5BPHA 4M9XA 1JKJB 2VUSA 4EQZA 2FFRA 6CHYA 5BWOA 1XC7A 1WBBA 2Q41A 1T3ZA 1LK0A 5KSPA 2GVDC 4O2AA 1V11B 1VE3A 1NFFA 3MZ0A 1EEHA 1BC5A 2NUPB 1T2AA 1P1JA 4KRXA 4ODIA 4TS4A 3E1SA 4O25A 5FAXA 2JI8A 4EG5A 1NNUA 5ALVA 2W6PA 3H9UA 3E81A 4FFVA 5CJPA 4ZOAA 5K3FB 1M8KA 5IXSA 1B74A 3U37A 3U7GA 4ARVA 5MF6A 1QUEA 2WA1A 3WK4A 5ILGA 2QM0A 3DEZA 3H5TA 4FFNA 5MN4A 1XU9A 1S01A 3X1ZA 2IHNA 3WL8A 3KUCA 4G1EB 3O0TA 4EJSB 1RS0A 4CGYA 3QEAZ 3ZWPA 1JHVA 1NQAO 1ZJ5A 3D6FA 4M99A 2QLTA 2I2WA 1N34B 1LNZA 3OJCA 2ZSKA 3BJRA 5IULC 2B61A 4N0QA 4HNTA 2C54A 1A7UA 3LBFA 4D4HA 2HCJB 1O97D 4JUCA 2BELA 3BN3A 3HGMA 4MI6A 3BXPA 4EHNA 2ZVQX 3HCAA 3OE4A 3Q7QA 2ATEA 4BNNA 1L5NA 5JY6A 2ZITA 3HZRA 2V98A 4FIDA 4JXZA 1MX1A 1OIXA 2AQIA 1W6RA 3VR0A 4DMUB 1RI5A 4K87A 1V9SA 1DC8A 1OGIA 2V7QA 4IHKA 4B3MB 2F1JA 3TSZA 1TTPB 3FNHA 2W98A 3VPSA 1TQ2A 2HJHA 3O9MA 2VDRB 3LSTA 1T2DA 2CL0X 1H0KA 2SBTA 4XKJA 2FR8A 3UJ6A 3T34A 1FJGB 2JFGA 3SWWA 1WMBA 2VH5R 3ENQA 5BO5A 4PGHA 4YR7A 4OQYA 2VRBA 3FGNA 2OHGA 2WD7A 4BQRA 4IUDS 1ZUWA 4KAXA 3OETA 2ILTA 3MMSA 3A04A 4QOSA 4YMSA 4YFVA 2G25A 2FW7A 4L9SA 1JHOA 2OGTA 1ZIDA 3BIXA 3OLCX 4C7KA 2ZPTX 4DN6A 1OIWA 2R66A 1WDKA 2XF8A 4RPHA 3NC4A 3QY0A 1U1DA 3GFVA 5C3UA 2WJHA 3OF5A 1PYDA 2DQYA 3N39C 3QYPA 5LMNB 2DWCA 4MRMA 3N2KB 3AZPA 5CLIA 1NJ1A 1ML4A 3ENWA 4B71A 1BU5A 2CE2X 1Z37A 1AF4A 1OT3A 2DJ5A 2NACA 3F71A 4FPXA 4MWGA 3WL6A 4CQNA 4K6HA 5DWDA 3HDHA 4JLUA 2OBXA 1T1IA 2UZAA 2DFVA 2EBUA 5DSXA 5JROA 1NBME 3EUEA 2JLAA 2YR0A 1VGVA 2BE9A 1CUEA 2BH9A 2HRCA 1YL7A 2VXBA 3V48A 4ZO6A 1MLDA 3AEKB 1SUSA 4M36A 3QA3E 1T4CB 3ES9A 3TTYA 4D8VA 5CUQA 4C0XA 2V3WA 4ES6A 2CV1A 4JZYA 3JZFA 4BLSA 3NHFA 4UM5A 4UTVA 2FH5B 4AB1A 4MI1A 4JZKA 5IJAA 1MZPA 1JG6A 1BMTA 3O2JA 2AG1A 5CBPA 3WGHA 1PT8A 3C3YA 3E7DA 2VIIA 3A9SA 2JJ8A 4FXPA 4IIJA 4RFSB 1EP9A 3LECA 2GZSA 2AXQA 2A94A 1TRHA 3BH7A 3KDPA 3M4ZA 5FTWA 2BBTA 1LPNA 4CMGA 4C0KA 4ZRNA 4CQMB 1SBCA 3R8FA 3W2HA 4D0SA 1X19A 1K88A 4MP3A 4BGEA 1OV6A 2MMGA 3B6ZA 1M1YB 4TVBA 2WC1A 1OIVA 3UJBA 5HS4A 1SG9A 4BX2A 1T8UA 3FVVA 1ZKMA 3ZVLA 4NOJA 3L93A 3OICA 2HQOA 2O05A 3F6EX 4O4LA 4JYBA 1M0SA 3QYFA 5FWXA 3KELA 3MBKA 1L1FA 121PA 3C87A 3PR2B 4L22A 4QYMA 4WKGA 1LEHA 1KQOA 1CY8A 1M0TA 4GIBA 4Y8VA 1T8TA 4QTZA 1EDOA 4XPZA 4EHJA 3F5QA 1T2VA 2CXSA 3RSGA 2X0RA 3WGUA 3HRKA 1Y7PA 4AKEA 4YP1A 3CYFA 3GLFE 1G98A 3OJ0A 2FP3A 4ZHQF 4DLTA 2AFRA 4FFOA 4HGYA 2BFMA 4PAQA 4WBNA 1I0IA 1KJIA 3LQYA 5ALQA 1ECCA 1RAHA 4H31A 3VNBA 1B1CA 2PEYA 2OFXA 1GGJA 4A5SA 3N1UA 1K4YA 3KB2A 1B3RA 4OLBA 4C3VA 5DLQC 1E9AA 4YASA 4I66A 1PK8A 3GA5A 3DKKA 4RIHA 4NOKA 4ZAGA 1YI0A 4QVKA 3UFXB 1XMOB 3BXHA 3WJAA 1JFFB 2B9VA 4MRRA 1NJSA 1RWBA 5EIWA 5SV2A 5FCDA 3D3NA 2JC3A 3R3SA 3UQZA 1VCOA 1NUHA 4S0XA 4OAPA 1TYEB 5REQA 1DBPA 3IAS6 4X65B 4WZZA 2J8ZA 4KCGA 1YRHA 1E7SA 1U1EA 1FLNA 3I4CA 4EY6A 1PP4A 3E7WA 1JHPA 4P22A 4ZJYA 4LXUA 1WV1A 1NUTA 2UYYA 5T41A 2TRSB 4LS3A 4YAUA 1IBKB 3KOMA 1CIJA 3B1KA 3LLUA 3NORA 2MINB 1ZR2A 5H70A 1W96A 1NOJA 2GYUA 2I1VB 3EOBI 1CQJA 3LUHA 4OYRA 1I7SB 5H3LA 3JD1A 4MI3A 2QL7A 4EENA 3AZQA 4MQBA 4Q3NA 4WJZA 1GGHA 1T4BA 2C9YA 1M6YA 2H6EA 4P5EA 3HBNA 1UXHA 2X5OA 2RIPA 3ZZNA 1THTA 4D79A 3CBQA 3FTPA 4R8KA 4M46A 1PCXA 3WIEA 1Q7BA 1L5OA 3HCWA 2FWIA 5AVTA 1QWSA 1RYZA 4WXRA 3OWHA 2YL2A 2BSAA 3LBAA 5BUSA 4P5PA 1MF7A 4Q1VA 2HQBA 5DRYA 1GA6A 1Q16A 4ICIA 3VR2A 4C5CA 4N8SA 4D1YA 2VBIA 2CYAA 4QL3A 2KBEA 4CFSA 2IHBA 1U8UA 5I48A 2Q50A 1IXKA 2WU8A 2BFEB 3IPCA 1GKYA 3IQIX 3BHJA 1U94A 3K53A 2QVLA 1EP2B 2G28A 2I8CA 4Y6RA 2QJRA 1ZJJA 4RPKA 4ZV7A 5HK8A 5LA6F 1F2VA 4FU0A 3P9YA 2BBWA 1MG5A 1R8SA 3ZCUA 4F1KA 1Q12A 5AKLA 1LZLA 3OCCA 3OFND 1BXRA 3JYQA 3PQ2A 3WYAA 1WDLA 3FDIA 1YSCA 2ZRAA 3UXEA 4MVJG 4E03A 3KQUA 1IL0A 1EJ0A 3VR6A 2QUZA 6REQB 4LJKA 3LQRA 4PRYA 3M49A 3TIIA 3OG9A 4IVRA 1WMAA 3ZPXA 4BLQA 4UTXA 2YX1A 1E2LA 3RIGA 1R27A 5AI8A 1F4PA 3C5CA 3HCBA 3IT1A 4RA6A 2E2WA 3FZEA 5A4DA 5JNRA 4JDPA 3G0CA 2J7PA 1JFRA 3TRDA 3IVRA 1YI8A 4TV9B 3VAZA 3JRNA 3CF0A 4RA9B 2FPWA 2PX8A 5E6UA 3WAKA 4Y1RB 1N2EA 1ZHFA 4H2DA 4Z7NB 1WXHA 1QANA 5TIIA 2BHNA 1B14A 2O2SA 3QV1A 1ZNYA 3JW8A 1RXCA 1SOVA 3ITDA 2JH9A 1XEAA 1SU4A 1XDZA 2XTZA 3HJHA 4Y2SA 4KFUA 1IY9A 1F8GA 5DGCA 5TPWB 4NSNA 2OXRA 1UCFA 1GUBA 1Y9EA 3QWBA 4X45A 1WKBA 2VDOB 4X1IB 4YJ3A 3HXQA 2QN8A 1GKIA 1Z3IX 1IM5A 2VP9A 2NUAB 1H2WA 3KKOA 4OFBA 3QGMA 2ZRJA 1N8SA 1UPTA 1T3LA 2I6SA 1JJIA 4II2A 4QJBA 4UATA 1DMSA 3QRWA 1RKQA 1R3UA 2GD2A 2PQ0A 4XR4A 4OHPA 5L7YA 5KJCA 5KNBA 3NBYC 2R8OA 2JVKA 3LC2O 4GSLA 3EIEA 4LZLA 1JDTA 3SJBA 4KB5A 1CHNA 3TBFA 3SKXA 2IZ1A 2R1VB 1GPAA 3DG9A 2OPBA 3FOEC 2V1UA 3DMHA 2WKWA 2KPOA 2JI6A 4O8ZA 4MPJA 3QI7A 4Q4HB 3G2MA 3PJFA 4I6EA 4J1NA 1E2IA 1EFPB 4YPVA 4PLZA 4KLZA 4ZHSA 4B40A 4E5NA 1LV8A 5F7OA 3ZV5A 2W6ID 4CMBA 4B3TB 3FFTA 4RIGA 4UHKA 1WVIA 4FCCA 3V6MA 1HT2E 5FYDA 3X2FA 3VA7A 2VRNA 3GUHA 1YV9A 4ZZ1A 3L6RA 4BNKA 4BU0A 4INOA 5DBOA 4C3ZA 2CNOA 4A36A 3OPYI 2BAGA 4EFLA 1SBTA 5TPZA 2IV2X 1ESMA 1JQKA 2XRFA 3PDCA 3SXUB 5BN3B 4LGVA 4JQCA 5JPDA 4KIGA 4QQFA 3IEIA 1RM3A 3IQXA 4PGMA 4B8ZA 3G2HA 4FD2A 2XV1A 3ORHA 4MDEA 3KVYA 4B8WA 2HFKA 1LFDB 1OMOA 3GQVA 3JQRA 3HJNA 3KVNA 1U02A 2F17A 4G86A 4OOFA 5CTAA 1CIVA 3COSA 3G79A 5FR2A 5KWSA 1DARA 1SOMA 2RGAA 2FWJA 3BTSA 1TB4A 3L1UA 5DX1A 2GM4A 1ACJA 1ONBA 3QOXA 1EE1A 2SECE 3FNRA 3FSJX 5DPMA 3AJEA 3SZOA 2IZ0A 4QOGA 1X9IA 3C1TA 5L45A 4RTMA 4MWBA 1GYPA 3IE0A 3KL4A 3I9V6 1XTQA 3AB8A 4X20B 1XTVA 1E7RA 3I64A 4ZYVA 1P81A 1L8XA 1MO2A 2J3KA 2JGLA 4IDNA 1N2CA 3QXJA 4ZAWA 1JH9A 3EQZA 3OEHD 1MJNA 1TU3A 4U7GA 1U0BB 1M67A 1N6LA 3RLFA 5CCBA 5KS2A 2Z5VA 2PH1A 2FEPA 5JJCA 4G0NA 1JU3A 3R75A 1Y6QA 2H00A 4HXGA 5EJMA 1N6PA 2JI9A 3PRYA 2AC4A 4YTEA 5BVHB 3D8RA 1SRQA 1W5BA 2QD1A 2WUWE 3CR3C 4YJ2B 2EBHX 1UFOA 3EUWA 2OHIA 1BVUA 2VQFB 1M1NA 3PC7A 4OBWA 1V3UA 3J7TA 1E2KA 1Z06A 2QRJA 4JWTA 1OZ0A 3KT6A 1LTQA 4G5GA 1NKTA 2WF8A 3E9ZA 4K9QA 5HMLA 4P4SB 5IT0A 1X8KA 1Z0KA 3S2GA 2OXFA 2GCGA 3G1UA 1XCOA 3DBHA 3S99A 1YE8A 3HRIA 4HLUA 4OMDA 2GEVA 2QPOA 2GWHA 2WJ6A 4E7PA 2YZMA 4HCJA 2VO1A 3U19A 3WDSA 4IJMA 3RS4A 3L3BA 3NG1A 4FGJA 2QZSA 1SK9A 3A6PC 2JVIA 4PIVA 1CDZA 2AXPA 1J70A 4ZICA 5LQRA 3VNQA 1SELA 3C0KA 5GONB 1DBRA 2ILVA 2JANA 1JPJA 2AXNA 1P9LA 4KQXA 1RYMA 4D81A 1CZHA 1W1WA 3D6JA 3KVOA 4J2HA 3AI7A 3OD1A 3FCCA 3TLAA 1N2SA 1NT4A 4HT3B 3ESYA 3GJ3A 1WVMA 3I62A 5LBIA 3GGSA 3OBBA 3L9XA 3WJ1A 4ZV4A 2PM8A 2EKZA 2LE0A 4X61A 1X9HA 1XTZA 1ZNXA 1E92A 2P5SA 3N6XA 3HB4X 2C1ZA 6NULA 3II6X 1KL7A 1AHHA 3LLMA 4BFUA 2EKPA 1P4SA 5IBRA 3T9DA 3FNGA 3PFKA 3AEQA 1Z8HA 3DHNA 1E3DA 2WAAA 1QHSA 3B78A 3MYYA 1T9HA 4OQZA 3EFOB 4FW8A 2I33A 3VX3A 5AESA 4HPJB 1BX0A 2PVCA 2TS1A 3D6UA 4JSTA 4COKA 3LUAA 1G66A 4BE7B 3PC8A 1D4FA 1LGYA 1M6VB 3NEPX 4W8OA 2JLRA 4B6RA 3CA8A 4NNPA 2AJDA 3E9QA 3ELYA 1UZLA 3TZLA 2G72A 1OXBB 4F4FA 3SAJA 4NZ9A 4MOWA 5DKFA 4IIBA 3N0XA 2ZM6B 3K0AA 4JC4A 3A1TA 3V8QA 4BEWA 5LWHA 4Y2RA 2WJZB 4JLWA 4KPYA 2BGLA 3K3PA 1R74A 1SBHA 2V1XA 1EX9A 1XF9A 1C8KA 3HCRA 3N3BC 5BOVA 1RWNA 4B1FA 2ZRLA 3E1KA 1QRDA 2Q6TA 4A1FA 4DXDA 1IPEA 2QQFA 4LX8A 1Y37A 4LQLA 5B7PA 1VJ5A 2GUGA 4EABA 3NP7A 1YB2A 4LV8B 3OTWA 5ALRA 3F5FA 1P61B 4MS4B 3IAFA 3TOZA 2BMAA 1VIYA 2RIRA 4F60A 3LLSA 4WAUA 1GRQA 1Q3TA 3LH5A 3MTQA 1J8MF 2ZB3A 3C6KA 4B81A 1Z18A 4DZRA 4EB3A 3A4TA 4GNRA 3U7JA 5ES4B 1EZ1A 3JQ7A 2D5AA 1RU3A 3UB3A 4M0CA 3BRWD 3VYSB 3ZJTA 1GNTA 1A8UA 4PU0A 2A78A 2EP8A 2ISSD 4PLHA 4NZYA 2OHVA 2WDZA 3GIWA 3KQTA 4PCVA 4TTPA 1W2WB 5FOUA 2FWPA 2ZJ3A 2POCA 4O4IB 3SC2B 3G2LA 5K1ZA 1QP8A 2R1TA 3PICA 4BS9A 2AHRA 2AVNA 3RAEC 2MR6A 1SKBA 3DYVA 5AWFC 3SYTA 2X5JO 1DLJA 2L17A 5HOQA 5JCZA 5LQKA 4CR7A 5J2TF 2BFDA 1HBJA 3UVEA 1F2DA 1WAMA 3NTLA 4NBVA 1TJYA 5JALA 1ZIYA 3LE8A 3COZA 3LKZA 1QTQA 4EVRA 3UMYA 1KA9H 1U0GA 2EVWX 3QOFA 2O8CB 2YFHA 5KTYA 2P5TB 4UDXX 4UNRA 1HORA 2B3DA 2I80A 4ILEA 3RKRA 3VPBA 1FXWF 2CMDA 5BR7A 5TVGA 2CFOA 3RHSA 4ZARA 1DINA 4RO0A 2ATIA 2IOHA 3VU8A 3IB3A 4CMEA 2UXBB 3UEOA 3T7JA 2Q4TA 1E7MA 1EWKA 1XDBA 4IEFB 1HDRA 2I0FA 3BJMA 2DT8A 3OSUA 4V0MA 4ARBA 1QH9A 1SUIA 4NH0A 5GM1A 4DUPA 3A25A 1XV5A 2XMQA 2J30A 4MRVA 3EIQA 3WNBA 1ZITA 3PWKA 1D8TA 1VIAA 1GQQA 3MF4A 2O14A 2NZ2A 3QKUA 4H4CA 3UWKA 7REQB 4TUYB 1UPXA 4PYRA 5AJXA 5A02A 5H80A 2WWFA 2MOKA 1NKSA 3KQYA 1U2ZA 1LB1B 1YXMA 2PGIA 4ECAA 3HZZA 2PQ6A 3C15C 3GRKA 1I32A 1XALA 4UNIA 5IBQA 3RSLA 5C2JB 1BQ3A 2WJIA 3Q41A 3EGVA 4P83A 4QJ3A 1RC8A 3GGJA 3FA2A 1ZGZA 1GQSA 3IBYA 2IU6A 3PA6A 2PZEA 5BRAA 3UT5A 2B78A 4PYLA 3IV9A 3SU8A 3VSEA 4AKHA 3SR4A 1SVKA 1E3JA 3U7QB 3CF4A 2PX4A 3ZE6A 4FI3C 2ORYA 2LCIA 2J4CA 4TTJA 3ROZA 4DIDA 5EHZA 1O4WA 1VPLA 3I6ZA 2P9EA 2CD9A 4E51A 3ZK8A 3V1MA 1T4DA 3IR6A 5IYZB 1E0JA 3GLUA 2ZBDA 4YVFA 4EFNA 2I9PA 4BO0A 3I34X 5JSQA 1FPQA 2WYWA 1GTL1 5FT9A 3KEMA 3IAS1 2IXAA 3G2OA 2FDXA 1KOFA 1WEKA 1DC4A 4O1HA 4YJHA 3A05A 3PJDA 1KMHB 4FMDB 1V37A 4G1MB 4IXNA 1GTZA 2ALJA 3QFTA 3WV4A 2QW1A 2DFNA 4TWJA 3RABA 1UH5A 3EJWA 4PANA 3AC0A 4R98A 4IX1A 4YGYA 5AVZA 4IG9A 3QEOA 4Z8YA 5B3LA 1HLFA 1VGQA 3V33A 1EHCA 1VJRA 2G83A 4C20A 2EERA 4Q82A 2R5WA 5K09A 3S1LA 1QBKC 4EO7A 3DVQX 3FIJA 3LDAA 2R25B 3GPIA 2Y77A 1LLDA 3QFRA 2EP5A 3AESB 3QPDA 2VJBA 1QO0A 2LRHA 1YR7A 1NSFA 2LP4Y 5C3MA 1N3IA 3WIBA 4B6SA 3O31A 4G2NA 2V58A 3U4IA 4ND2A 1AC5A 2VAPA 3AQ4A 4AN0A 4PQYA 4C07A 3UWDA 2ZXEA 1NW4A 2BMDA 1Y63A 4KQ2A 2X3FA 2VS1A 3R3ZA 4FLFA 4CMKA 4BUZA 1KMNA 1UXKA 1FMCA 2WILA 3RVKA 3SFTA 1SD5A 4BCDA 4IUCS 5TDHA 2MHCA 4MQLA 4EIWA 4ER6A 3NZEA 3LAWA 3PD0A 1ABBA 2XCOA 3ZDEA 2AMYA 3BD6A 2Z2IA 3O73A 3B9RA 2DFDA 2BFFA 4BMSA 3AERB 2FZLA 4KOAA 4XWOA 1ELOA 2ZAIA 1Z34A 4AX4A 5HIJA 5DEIA 3BB4A 3H1TA 1IMOA 5D3QA 2WJ4A 4AO7A 3MJDA 5F78A 3U1BA 3CVUA 4OUDB 3VBCA 3VBEA 4G4IA 3I0NA 2HV8A 1QKIA 4PZ9A 1QTRA 3R6LA 1AOXA 3VU0A 4GBED 4JOSA 3S2YA 4UOEA 3RH0A 1Q11A 1VKNA 5C81A 1U31A 3OQIA 4TLBA 3ANTA 3UWMA 3L7NA 3VOSA 5JISA 1EESA 3FHJA 1TJ4A 4GAEA 4WBSA 2QE7D 1C9DB 2FB9A 3C3MA 5AW2A 2NVUB 1M34A 3HY4A 2OESA 4LVUA 1KGDA 1Y98A 2GARA 3F8TA 5LYJA 4UNNA 1ZK3A 5IT4A 2EW8A 4UW9A 2PH5A 1I2DA 3R9XA 3FROA 3TK1A 1P2TA 4AU1A 4DNPA 2GN1A 4EW1A 2JVJA 3KU1A 1DC5A 3QX9A 4H18A 3Q6NA 3I2GA 1PWHA 3TRJA 2FU5C 3QOWA 3WHIA 5A1JA 3CEJA 1A5BB 721PA 4DM4A 1T34A 5C7LO 3TJRA 2FPRA 3NM5A 4E5DA 1PKEA 3AEZA 4F7DA 1FFAA 5L3SA 5L6LB 1JSCA 4AJPA 3EZ9A 1II8B 3V2GA 4RW0A 4DBZA 4DRYA 4Z5XA 1IZ8A 2G07A 1PQUA 1T2NA 2XYGA 3IIMA 5EQJB 5JSFA 5E1OA 4NCBA 3DZIA 4LCEA 1H2HA 2JGKA 3FMOB 5TQ0A 3FN4A 3H6HA 3I53A 5ED4A 4ZEOA 2R9VA 3KUDA 2K6GA 2QRPA 1Z8FA 4EDHA 1P0MA 2GNPA 5EJGA 4PGGA 1EVZA 3K9HA 2H9AA 3O47A 3SJUA 1M1UA 5KYWA 2DX7A 1W0JA 3WLLA 3ZDDA 4EG4A 4HDQB 4DANA 3F73A 2OSBA 3T5GA 1ZESA 4JUBA 4M1WA 4UBJA 2PJDA 3EUFA 3IUEA 4JJ6A 4UM9B 4A82A 1G16A 1HL3A 1QHEA 1QIIA 5EZYA 5BOSB 1N9KA 3ZUPA 4AUEA 4MW9A 1XMPA 4OCZA 3TOXA 5B64A 1IQ0A 5K0CA 1PBTA 1RYNA 2HADA 3NATA 4HDNA 1TUEA 2FE4A 2VJYA 1ODSA 4IG4A 1QQ6A 1J21A 1JG1A 4HRYA 4PPFA 3TQFA 1FTWA 2FSVA 2HIHA 1ORVA 3HKDB 2OA0A 1PR0A 3AEYA 2HJGA 3TAXA 4EQ6B 3AR9A 5DBHX 3F90A 1A88A 4WADA 3FLMA 4N01A 1DG1G 1NP6A 2H29A 2UZ0A 3HFJA 4K3VA 5JQGF 3ANSA 1DO2A 2ZUTA 4IDDA 3LC7O 5K4AA 2IS4A 3E9RA 1WA5A 1GXSB 1JT2A 3RRFA 4RTLA 1S89A 3K0BA 3O3MB 4JB2A 3SPXA 5CA1B 4UUAA 2QENA 1FYDA 3P26A 1SUPA 4ZV9A 4H7DA 1D8AA 1NVXQ 4TRMA 3ADPA 1WCIB 1U7XA 1LRKA 4MX8A 4R2LA 1N2CE 3RC1A 1IUPA 4P5DA 3IESA 3S2UA 1CF2O 2PKWA 4GBGA 1PWEA 4NLLA 4CLOA 4GRAA 3KQQA 2O23A 4JVSB 3KKMA 2B2NA 1WCWA 1T9KA 1WHTA 2I54A 3K0CC 3ZD8A 4N4AA 2I3DA 2I2XB 2WVAA 5D6OA 5ESXA 4EY4A 4I2VA 4MWZA 4LYGA 1IUNA 2AOXA 3FYSA 4J16A 5LU8A 3HYLA 2YDXA 3R3HA 1DBSA 4I4TF 4K88A 1RQ2A 3SYKA 4B6QA 3E03A 4BPRA 3MXOA 4ZRMA 2Q8QA 4KGVA 2DWOA 2H4YA 3S44A 3WBJA 3K6JA 1DX6A 4NHOA 3QJ5A 2QRUA 1KI1A 1NN5A 3AJAA 3IE2A 1UF9A 5A7GA 1WY7A 4FX2A 2YS7A 2BF4A 5TC4A 3OOWA 4E3WA 1K7XB 1NLFA 1TM2A 4HVAA 5IC6A 1MDFA 1E1CA 1YVEI 4KVAA 4EBBA 1YGYA 4QUDA 1XTIA 4NMLA 3HHPA 4CEIA 5HM6A 1BS2A 2C9OA 1TM4E 2ZI4A 1UBEA 3UCEA 4N9QA 4RHCA 5LIRA 3L5KA 1EXMA 4QAQA 4KODA 1B42A 5A4IS 1EVJA 5HF6A 3BCSA 1Y3AA 3FMVA 2PA0A 1VL5A 3G2NA 4D43A 3GT0A 1CYEA 3ABZA 2VRCA 5EWJA 4GDFA 3IB6A 3AU9A 1Z7GA 2FKNA 1R5NA 4G9EA 3SZMA 2NPIA 2A9JA 3GLHA 3QW4B 3JYOA 2GPJA 3K5WA 5EFOA 5JLJA 1WXFA 1FC0A 1WNFA 3AQIA 5AJVB 3QE3A 3LL7A 4OQQA 3HDGA 4B3IA 4RVNA 3GRAA 3ELWA 1I7DA 1T2FA 3OIWA 4ZVPA 4DJTA 4D41A 3FCYA 3QITA 2E4AA 3TUZC 2Z6AA 1YRLA 3CT6A 2PX0A 4AJLA 2VOEA 2WQ6A 4FK8A 1TYAE 4QTUB 5KJEA 4UUMA 2HPHA 2DUWA 1CETA 1E5LA 1VE1A 2AJTA 3CKKA 3CSDA 2OO3A 3PEEA 2JARA 2OV2A 3R3VA 4OKSA 5D01A 2QD5A 4IRUB 1V7CA 5CJ2A 3HMQA 5FPSA 4B0OA 1UXIA 1ACMA 2YY7A 1JJFA 3PSHA 4W7SA 1F2TA 4IYJA 2HRRA 1Y8AA 3AONB 2YWDA 3ZH9B 1E2NA 3WL4A 2P2SA 1L7QA 3L7OA 3NJ8A 2RHGB 2UYCA 2ZR0A 3DE6X 2J07A 2OY0A 3G7UA 4QFMA 3Q8KA 2L19A 1T8RA 1C8BA 4IP0A 1K6XA 3LNTA 5CDYA 3ZWBA 3LQ2A 3I12A 2R7NA 3AKDA 3KLNA 4J4HA 4DMFA 4R9SA 4LZOA 3MJCA 4L51A 4P3OA 5A5GA 4JL8A 2QN7A 4ZQFA 4LJ4A 3U4MA 2PT5A 1RBZA 1V7ZA 3VAAA 3VVCA 5C5DA 1FP4A 1L4GA 1YS4A 2W4MA 2G76A 1KERA 1DX4A 3KYCA 1OC4A 3O3NB 3QM1A 1H8ED 4REQA 3UBMA 4LZZA 4QOFA 5DDIP 1CWUA 3FF4A 4BQEA 2WWIA 4BHTA 4DY6A 2ZJ5A 3KPVA 3MERA 4JH0A 3HNPA 5HIIA 3RC3A 4YDHB 4BO2A 4HLQB 2QM8A 2VP5A 3FE2A 2Y1EA 4YT8A 4ZYXA 4F9EA 4C2UA 1J8VA 2E4VA 1TZCA 4M8LA 2FX2A 3EIXA 5HIAA 2OLEA 1OF1A 2N42A 4LNUB 2RHOA 2ZIGA 5COAA 1V0JA 1YS9A 1PSZA 3KKEA 2VXOA 3PIDA 5CXXA 3AR8A 3CRVA 4QGAA 4CLHA 1NI5A 4NU0A 1B16A 3UGJA 5HIMA 1GPWB 1RM4A 4YT2A 1RKVA 2ZBPA 2IY7A 3A0UA 3BRQA 5JYDA 1PS0A 3VHXA 4PCUA 1DDOA 4MGKR 2H92A 2J3MA 3PR3A 3JXEA 5KQGA 1SKYB 4DLRA 3T9FA 3U60B 3SEQA 3D2CA 3ENZA