2ALJA

Structure of the cis confomer of the major extracytoplasmic domain of the bacterial cell division protein divib from geobacillus stearothermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
GSEWRRIAYVYDRQTFFPLLENGRLLKQEGTKTAPSDAPVLVGWKDGDAIAEMTGQLAELPAAVLGAMSEIHYKPTREYEDRVIVYMNDGYEVSATIRQFADKLSHYPAIAAALDRNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords cell-division initiation protein
publication title Domain architecture and structure of the bacterial cell division protein DivIB
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2aljA00
1YR1A 2ALJA
chains in the Genus database with same CATH superfamily
2DSNA 1Z6QA 2OORA 4ZTUB 1G9SA 1A7KA 1ZH8A 5KO2A 3GT4A 4YCJA 1Z4LA 4NENB 4IR7A 4DG8A 1R88A 1YA6A 1Y8AA 3IR5A 4E03A 4ZYTA 3VDMA 5EZ5A 3AYZB 3EYWA 3PTAA 4LZJA 1P5HA 4GOOD 1ANKA 3KQOA 2DETA 2Q7XA 1QTIA 3SWWA 2AZXA 2C04A 1AKWA 1MQSA 4F11A 1R8QA 1Y89A 3DR3A 4TTTS 3ZGYA 5DNCA 1V4BA 1TVKB 2FSFA 3A7DA 4AJ9A 1B7GO 1JJFA 2EX0A 3ANYB 3BXHA 1RAEA 2X1HA 4LZZA 1UDRA 4YWHA 4DCCA 5ITVA 5L4LA 3GRCA 1RWBA 4O33A 4XPIA 3SLRA 4QUEA 2J0QA 5IVDA 3ROFA 3HUTA 4HRXA 4OXIA 1R10A 3M4XA 1E98A 3KOMA 4BQQA 4OQFA 3AFIA 1DX4A 1HV8A 2BUAA 2X7HA 5TMBA 3WBFA 3TGPA 2M9MA 5J47A 4F72A 5I7RA 2R00C 2PBZA 3PQEA 2IEIA 2W5UA 5AW3A 1RABA 3FAKA 1GHTA 3BWVA 2BFBB 4XGKA 1G6Q1 4YPFA 3DLPX 3SZMA 5DCWA 2PTHA 1BO6A 1M1NB 1T0HB 3MELA 5HNKA 4PZ0A 5IK2A 2GYYA 4GR4A 4KJXA 3X1YA 1Y8CA 2I2BA 4BFXA 5HFAA 3CLSD 1NU6A 5CUQA 1O5OA 1Y80A 3K1AA 3M4ZA 4CMAA 1FP4B 2IZ0A 5B3KA 1EK5A 1KQGA 4QYMA 5JJKA 1QTRA 1HEYA 2SKEA 2I22A 3NRBA 1RP7A 3HCAA 1XZQA 1YGPA 1UBRS 2WSBA 3KX2A 4IILA 5CNMA 4ZU3A 5G4KA 1JECA 1FLNA 3VOAA 3LVQE 2ZTVA 3ZXSA 3H8SA 5F51A 1C30A 5BP7A 4XYEA 1QQ5A 3EMVA 3KXLA 4HAYA 1XO1A 1XCGB 2G5CA 4ZOCA 1AHNA 1EUDA 2I7VA 3TD6A 4OM8A 3WRYC 4AF8A 2YKGA 4P53A 5ER9A 5JLJA 3CZAA 3M7IA 3USZA 1NONA 1F6BA 2XD9A 1FUEA 3CW2A 1XZCA 3ENZA 3Q3EA 2WPDD 1NE2A 1RZ3A 1YBHA 3B89A 3DFUA 2FN4A 3P9SA 4MRPA 3VYRB 2PFKA 3QY0A 5LBUA 4XJSA 1SJ9A 2Y66A 2J0EA 4P7JA 2K5UA 4L51A 2Q5CA 2O2CA 1V4NA 5BVHA 4ZVVA 1M2HA 3FGNA 3ZD9A 4BMDA 1JG7A 3QV1A 3HO6A 4ZK6A 5H9VA 2PX6A 4G5QA 4Q01A 1Z7EA 4EVRA 5FWYA 5ED4A 3OE7D 4D9IA 3T1TA 4HUTA 4FD3A 1UM8A 4RKYA 5LZ9A 3GRUA 2I87A 4XDYA 1LBHA 2OLEA 4AICA 3QA9A 3DW1X 4MO9A 4FWTA 5IBRA 1PJ2A 1U0NA 5H7XA 5AVWA 3SJUA 1ZNQO 3L0DA 2FF5A 3A4NA 2OWEA 5K01A 2XKJE 4FC7A 4Z0NA 4DVJA 1QYWA 3AUAA 4JLSA 4B3GA 4UUNA 1KYQA 2GFIA 5EP3A 1F8XA 3VYUB 2GRJA 4EEKA 5IFLA 4D42A 1OLSB 4V1CI 4PGFA 1TLLA 3Q41A 1ATZA 1ODFA 3T7DA 1W2GA 4PSKA 5HIMA 3CZQA 5DLEA 1G5HA 4YMVA 5DRYA 5LQRA 2XMBA 3O8NA 1CY2A 1VE5A 5BN4A 2GYUA 2TMYA 4U6NA 2PX3A 2R7LA 2XB6A 3H5OA 4RF4A 5I3CA 4MV8A 1QYVA 1I7SB 6PFKA 4K6OA 5LQJA 4PHTA 1RMQA 3QKRA 4QWMA 1JAYA 4CG1A 5HBGA 1ADJA 1HE4A 5E4FA 1ICEA 3Q7RA 5GONA 3BBPA 2KW5A 4EP1A 4E31A 1LDBA 2YVAA 4LZWA 4CMGA 1RPJA 1TMYA 4NBNA 3TFQA 1RQ2A 2I54A 3T0FA 3T94A 3CPEA 5KOYA 2JLWA 1NW3A 4Y6OA 4V0SA 4QFMA 5FUQA 1CULC 1KH3A 2C61A 5C1IA 4AQ7A 4YRJA 3A2NA 4DBLE 2KX7A 5HHTA 2Y93A 3ZBQA 2HBYA 4RCVA 1OXXK 4PZYA 2HI0A 2WJ6A 3O82A 3T54A 1W7AA 2RGNC 3VR6D 2VTBB 3G5LA 3C8ZA 3QJGA 4BX8A 4DBZA 4ZN6A 4TWBA 4MNTA 5DE3A 2V7GA 1JDBC 1I6WA 4JZYA 4P4SB 3NGLA 3U4GA 4F12A 1R8XA 1J8QA 4C4OA 1SVOA 1PR5A 1JDJA 5IAEA 2JJYA 3OG9A 2GK7A 3LXXA 3TZHA 1R1DA 4B6PA 2ENWA 2Z2KA 3R3XA 1T2CA 4CEHA 1ECFA 2YVLA 3O83A 4IDNA 4DIMA 4W8HA 3U3XA 2ZDHA 5DTRA 3C3BA 4YRKA 2CNLA 2FPSA 1U7TA 4QNRA 4ZQHA 5JO0A 3AEQB 3HHEA 3PC6A 2SNIE 4IINA 3JALA 3LX6A 1V3VA 1QKIA 2H65A 2C4WA 2N3ZA 3Q8KA 4ZYLA 5F5LA 3D1VA 3PHCA 4IDQA 5DHQA 5IAJA 4PO8A 5FH9A 2AD5A 2EZ4A 2VTVA 3MUEA 4YJ3F 4XWTA 1E2NA 4XUCA 1UM9B 4AC9A 2V7XA 4R6WA 4M54A 2H1OA 3U4HA 2CNDA 5KX5B 1D9ZA 1R0BA 4RHCA 4UKDA 5TEVA 1EFHA 3TQRA 3WQRA 2JGFA 3ZG6A 4JCCA 3ZV4A 4XWOA 3ZZ1A 4OQQA 3GLTA 3UW3A 3UK7A 2YIDA 1NRWA 1NVVQ 2XCUA 3FLEA 3ABSB 1NMEA 1JEDA 4KK3A 1VMIA 1HT0A 2JIRA 3TO5A 2NSHA 4BZZA 5EUMA 5LXTB 5F2EA 1N5OX 1I51A 3T3PB 2BOVA 2WW8A 5UKDA 4HADA 1LW7A 4AZ3A 4ZC8A 3NNDA 5I7UA 1K98A 2ZATA 3INNA 1DPFA 4MGKR 4JKOA 1MVOA 3D6MA 1NQ5A 1OTXA 2G5PA 2QZPA 2VXBA 2WG2A 4MULA 2HFJA 3KHKA 1Z0ZA 3WMWA 4YPOA 2PFGA 4KH1A 4C4TA 2VDKB 2I7XA 3PJGA 1U3FA 3NV9A 3Q7TA 2XUFA 1VJCA 5JJLA 3I5AA 4WKBA 1E3LA 5H4GA 1NATA 4ZO6A 5CW1A 2QY6A 3CXUA 1GZ7A 3UHOA 4AZ0B 1GO2A 1JKMA 1PCXA 3IP6A 3JW8A 4KFSA 4KO1S 2X40A 3IMFA 4PFQA 3ITKA 1EWQA 1MXHA 1CUSA 5CIQA 1TA9A 3C6ZA 3VJMA 1K88A 4CUKA 2H5IA 3P1JA 3QEKA 1MRZA 4F46A 1YHZA 4AYWA 2GZ1A 3QM1A 2FWPA 3PT5A 3C3YA 4TVBA 1OZFA 5L4SA 2GH1A 3GNTA 3SQWA 4OHYA 3W5UA 4KO4S 2ZUSA 3BXPA 5J58A 1SQFA 4D96A 1A27A 3K9NA 1CERA 4QVGA 3K4QA 1CR4A 3D0OA 4UPDA 1QC5B 2LRHA 2ZJZA 3LDHA 4J0GA 1Y1TA 2PM8A 3EOBI 1NN1A 4LYFA 5K20A 1GT91 3OZVA 2LUOA 4B3MB 3GNSA 1C1DA 3RBZA 3K35A 4BGDA 2IS2A 4K9SA 3LY9A 1O1YA 4E5VA 1RYMA 1KQNA 5IDQA 5G41A 1JDNA 2NXEA 4C20A 4J16A 3CJTA 1QP7A 2GKGA 1MDFA 2A5GA 3B3AA 1G5QA 3ABOB 4MGEA 3T99A 4HAOA 2QPAA 2B4RO 4DC0A 1W19A 4N7JA 1PO7A 2WHYA 2EYUA 2QU8A 1TKAA 1OX4A 4LNHA 2OEPA 4QYXA 4KR3A 4HXGA 3U3RA 2LZ0A 2YS7A 2ID8A 3E7PA 3HA2A 5FJIA 3DYBA 3OZAA 4G5HA 4CXMA 2VAMA 1P3Y1 3MERA 3G6WA 4EJFA 4DMGA 4HAUA 5DGXA 2NQ2C 3INYA 4M7PA 1MUUA 2ZEJA 1QHGA 3GGSA 1NBHA 3AVXA 2XR1A 3LA8A 5AK0A 3HTXA 4GFDA 3OPNA 4Q9LA 3ESRA 1Z0UA 3EZ2A 2YL2A 3MT0A 1GPBA 4KN5A 4J8PA 3MQFA 1PHRA 1OW3B 1JBKA 1N6NA 4G01B 1GTJ1 1P61B 4KPUB 4OK5A 4EA6A 4NOLA 4EG6A 1J2UA 1MB9A 3HCPA 1PJAA 1X7XB 1YR2A 4JNCA 5I8ZA 3U1VA 2HBQA 2AW3A 2VOJA 4C1BA 2NWQA 1ODTC 2QTWB 1K63A 3CB2A 3RLFA 2X3UA 3BH6A 3G23A 3NHUA 4F3NA 1XXHE 4EGFA 2RGUA 1IH8A 5DXFA 3TKAA 1ZUD1 1UPAA 4DSZA 3ONVA 4ZZ1A 3NPAA 4J2HA 2NSJA 4H1TA 5IP5A 2PY6A 2Z5FA 3JVIA 4R54A 3WK9A 1WNFA 1X9IA 2V7UA 2RH8A 2WF7A 2ZUCA 4QUAA 1B6GA 3U62A 3DC7A 1PNOA 3A70A 1OXUA 4WK4B 4DUZB 3FGPA 5TY0A 4RGBA 1FVHA 3KJNA 3Q9LA 5J63A 3WQQA 1T5IA 2W8BA 3IIKA 1HTBA 3LVFO 1QNFA 3AKEA 3E48A 4DWWA 4IWNA 3OUUA 1JKIA 3EHDA 5FEUA 4DUGD 2I8CA 2YXEA 5G0SA 1NJFA 5IBQA 3OO1A 2BI8A 4UZEA 5C5CA 2Y1WA 2XQKA 1K8YB 4U3JB 4TS1A 4D9JA 5FOQA 2YXNA 1CDEA 5DULA 2W22A 5F3DA 1BVUA 3HLTA 3Q0EA 1D2HA 5K8LA 1MP0A 2RGWA 3IKMB 2DFTA 4CVNA 4FW8A 2VSXA 1H6DA 2R62A 3KDSE 4XSHA 2KMLA 1MABB 1RMTA 3RHTA 1NQXA 1AT1A 1A04A 4PX2A 1V1MB 3KYBA 4NENA 3KJQA 4K6HA 5KSWB 4DV2B 4BBPA 1SXJB 3D4IA 3UT0A 4P0TA 1DJNA 3GFVA 4PPFA 3I23A 4A6DA 4BEJA 1JEAA 1LC3A 1UH5A 4L8LA 3JARB 3VHLB 1J20A 1T3GA 2ZRPA 3A1WA 3H9GA 4YFYA 2XUIA 5B5SA 1CS0B 1QH9A 4CM7A 4W82A 4H7JA 4I0WB 2XB8A 4M9QA 1Z6PA 4GXQA 1V5EA 2VK8A 1TVKA 4IMPA 4K0KB 2M6KA 4J90A 1O8CA 1I7NA 3FG9A 1F5SA 5G40A 1J90A 2QL9A 4Z54A 3FHLA 4L78A 1OWOA 2JEYA 2WM2A 4R2HA 2IZ5A 3F7MA 4MEJA 3TMYA 4L57A 3TYXA 1D0SA 2R11A 1OFIA 4HAZA 1UBJS 2D2IA 1TQ8A 1SU7A 1RC1A 1CY8A 1PSDA 2JVJA 2OENG 1G7TA 2XMRA 1I36A 1DOZA 3VNUA 4JBLA 3EBOA 3CLHA 3R3ZA 1YL6A 3PZRA 4G3XA 2HOQA 4OFWA 3SEZA 3UXMA 1C9MA 1RJDA 3ZEAA 3I01M 2ZP1A 3HQ4O 2ZAGA 4LXHA 5IUJC 4ZAVA 3BK7A 1M1NA 1FVXA 4ZMSA 4GX1A 1R7RA 2X76A 3DDSA 1KDTA 3RI3A 1ZJ5A 4Z49A 1V9CA 4PHFA 1KRHA 1FP4A 2HU2A 3IMGA 3PPWA 4HLNA 4ZI3A 2OG2A 2HZBA 2O54A 3IUBA 2YMLA 121PA 1KYXA 3H2SA 5DMHA 5IH3A 1HBJA 4HRYA 3L7MA 1D4ZA 5C0OE 2I7CA 4EKDA 2HMSA 1EP9A 4YV7A 1Y4AE 5DSXA 4NFHA 4RZQA 5CD1A 4FDVA 2F9FA 2R7AA 3AVQA 4O6VA 1QLJA 1VHLA 1VE6A 4YBRA 1TI7A 4JY7A 4LF7B 5EGNA 1GPJA 4OFZA 3KSRA 4R7GA 4DB2A 2HHCA 3L8FA 3N2LA 1J8FA 1BGXT 1H05A 3IAAA 3OIDA 4G07A 3E7FA 3VVBA 1ISFA 3FN4A 5SYAA 3WQBA 5M2QA 2WIDA 5TS3A 4NBKA 1XZNA 1T34A 1DIHA 1GIAA 1WCXA 4BHTA 2VJMA 2Q5EA 3E82A 4C0KA 2X2PA 4YJGB 4OI1A 2IUYA 3ICPA 1A9XB 3GU3A 1G3RA 1ZMOA 2JC3A 3PX2A 2H1RA 2J6IA 2VP2A 3MJCA 3ZHZA 1M6HA 3DM5A 1Q1EA 4RGYA 1JTVA 4I8IA 4Z7JA 2MHCA 5DGIA 1RXWA 1OA1A 3G0HA 1BWPA 4TN1A 3CB4A 2CXRA 1Q1BA 1MH1A 1KJYA 1PS9A 2HRRA 5B1YA 2Z08A 2PKRA 1WULS 3L8MA 4W1QA 5SY6A 3IO5A 1HZZA 4OIFA 1JQEA 4EMBA 1GCUA 1HZJA 2VPPA 3QBEA 4Q02A 4Z0HO 2OVFA 2Z8ZA 3C7TA 1OLSA 1WEHA 1P77A 1QIGA 1XWFA 2RK3A 3MWKA 3PFNA 2YFHA 1G0NA 4LVCA 4DDHA 4PXAA 1ZA2A 1WDLA 2IBMA 3VOBA 4EHDA 5LVAA 1HNXB 2HLDD 1FZTA 1XI2A 2QVZX 1EVJA 5FBQB 3TSWA 3NS7A 4QTYA 3G2NA 5LSAA 2WYIA 2ZQZA 5K0BA 3U7QB 2CJFA 1P6UA 5D01A 1JX6A 1UC4B 2XGOA 3JQAB 4RD4A 5DWDA 4QHTA 3LH5A 4B2PA 4ENPA 1E5VA 4X1OA 2VDOB 4R68A 4M9XA 1ZRSA 2X0JA 4LXQA 2GJ9A 5ELLA 3LHDA 2IH5A 2ANBA 3VH4A 2XF2A 1CRLA 1N6HA 2C7OA 2Q41A 2X9LA 1X77A 4DXHA 3VV3A 2JIBA 4PC1A 4Q5IA 1DC4A 2NZUG 2VT3A 3KJGA 5FOTA 3OFND 3KJHA 2ILVA 3H99A 4ZDWA 3SVZA 4HWPA 2YJ3A 3ICVA 3WSWA 1NIJA 2ZE5A 1D1PA 5JPCA 1MAHA 5MFPA 2HPZA 2I3DA 5EJAA 3LS2A 4MRRA 4ZOBA 1Q7CA 3HDYA 4PM4A 2PMFA 3NHMA 4KXLA 1L4EA 1LK7A 1M33A 1JUDA 1UL1X 2CHGA 3A0RB 4X41A 2V58A 4DLYA 1TUBB 2P9YA 3O92A 5TSDA 3LWDA 1R16A 1AA6A 2Q2OA 4C04A 4P4SA 1GLVA 4EF4A 1SPXA 4D8VA 4DRYA 1UOPA 2VKTA 4ROSA 3K71B 1Y1SA 1TYEB 2O1SA 2WV9A 2ZPUA 2V6IA 1MF7A 3ZXIA 4E5KA 5CIYA 5KJCA 1TVCA 2R79A 1DC3A 2X0NA 3L7AA 3DR5A 4KB5A 2QYHA 2MSDB 4HX9A 4NBRA 4URVR 1KU6A 2QQ0A 1Q84A 4G41A 3ZCRA 1IHDA 4YRIA 5CM9C 3UTCA 1GSOA 3O1IC 3VR6H 1U3UA 5EP1A 2Q1TA 2ZU0C 4QOHA 5JNWA 4BKOA 5D1HA 4M1SA 3AEQA 2I6TA 1W0KD 4BS9A 4HVTA 1KR2A 2E6UX 3G7UA 1TZBA 1U7UA 4UHFA 5C1DA 4C3UA 4B2LA 1T9DA 4REQB 1SELA 3ZDYB 1JBQA 2BI7A 3FYUB 4ETIA 5T8KA 5CYPA 2IEBA 3N8DA 1W8IA 4JJFA 4HFNA 1UM9A 3G89A 4TRNA 2JFFA 3G88A 5DTMA 2OP1A 2XB9A 4R2MA 5TJHA 5KX5A 1SUDA 4ASUD 3FOCA 1M5TA 3K31A 3TRHA 1XDGA 5DP1A 4BATA 3P0IA 2GILA 3ZXUB 4RORA 5FTMA 1US8B 4JKYA 2LCIA 4HNQA 1FTNA 1TPYA 3R9KA 4HDRB 2ST1A 1WSBA 2CY0A 4OA5A 3CKLA 1G2PA 2M98A 4JC0A 3EHEA 1WZNA 4AMGA 1N2ZA 3DFZA 5LXTA 3I0NA 1B3BA 4M9ZA 1W2HA 2NO4A 1Z5GA 4C6TB 9ABPA 1XQ1A 4M53A 1YFLA 2OESA 4U02A 1WZUA 2NADA 1RZRA 3DPUA 1WM1A 6NULA 5DTEA 3Q6IA 5HIIA 3W5SA 5HJ2A 4ETNA 5CITA 2CXSA 2I62A 1AB6A 2WAAA 4AKSA 4TYMA 2IT1A 2CHEA 2BE7A 3KV1A 3DLIA 4RQTA 4KLZA 3QKIA 3HN7A 4NOJA 1CJCA 4QNMA 1GZDA 2JFYA 1B4DA 5B36A 3W04A 3UANA 1ZNZA 1ZMBA 5HTKA 2IOQA 4J3FA 4RLFA 4TUYB 1IN5A 3WHPA 1ZN2A 3CTMA 3G17A 4UM9D 5ALZA 1TTTA 4AZ0A 4KCGA 1JALA 4LE2A 4W5WA 5DCYA 5KWIA 3QMWA 1E4YA 2HAEA 3U3OA 2WU4A 1Q17A 3BCHA 1XA0A 2LIVA 2ONYA 1MH9A 3CLRD 4B4OA 5KYKA 3SZGA 1Z2DA 1C7FA 4U2EA 3JX9A 3T4XA 4INPA 1WTCA 1E1YA 2YXLA 2OO7A 1G9XA 1P3JA 4ZEWA 2XXAB 2PUWA 5I4CA 1E79D 1JILA 4DXDA 4EPWA 1SA0B 3QE3A 1N9GB 1RHKA 4PYKA 1BS9A 3F5MA 3H8VA 4P4GA 1PFVA 2P3LA 1WB6A 2VIIA 3QTLA 2SKDA 3ND9A 5AM5A 1X1EA 2B2XA 2GNAA 3THWB 4WNCA 2QIPA 1G3MA 2VQ6A 4AQYB 3FSRA 1GN8A 3HZRA 3QVSA 2GEBA 1KDVA 3LDUA 1QC5A 3FTNA 4MW0A 1NW4A 3HVJA 2VEOA 4E7PA 4YQEA 4EWLA 4H4CA 3B53X 3P9RA 4R0NA 4BNIA 4DWJA 3D5QA 1RAGA 1NM5A 2AOWA 2PA3A 3D0KA 2AT1A 2ZRIA 4MHOA 3JYLA 2AN1A 3WYFA 5D1NA 4YX9A 3Q9NA 1Z6YA 2CJPA 2CL6X 1NMQA 1B1AA 4GW3A 1SC6A 4RXUA 4CKWB 3RV3A 3HDJA 3DEYX 1GG5A 4WKPA 2ZM6B 3DZJA 4HL6A 4P7GA 2O2DA 4PU0A 1OGJA 1Y5MA 3AWDA 1E89A 1RU3A 2DFDA 3LFHA 2HCFA 3WRVA 2ZCJA 2B3DA 4MUKA 1TYDE 2VTDA 2ZR7A 1KYWA 3D31A 3I58A 3LW8A 3MGCA 3UWMA 2R84A 3M33A 2QAJA 2IW3A 1AV6A 4IV5A 4DYVA 4YV1A 1L0BA 2B37A 1E4VA 1PUIA 1XTZA 1D6JA 5J5VA 2J4CA 3EA5A 3TMKA 3N53A 4BNHA 4R9RA 3NG1A 3LQ4A 3UXEA 1T29A 1XEAA 3Q8XB 1DU4A 5IDWA 1I3CA 1XRSB 2LCFA 3RKRA 2B78A 5JYEA 3AVWA 1JXOA 3D5TA 3NATA 4Q3CA 1IXSB 1LDMA 3RNOA 4NY1A 1URPA 2QIOA 5BW5A 2E3JA 2P9QA 1X7DA 4KPUA 1K97A 2OO3A 5H3HA 3BRWD 1A88A 4B87A 8MHTA 2PUAA 2QX6A 3RKUA 1MCZA 3ZDAA 1ADCA 1X7XA 3WMFA 1T4MA 1X1SA 4H59A 2OSBA 4B31A 1VDMA 4MOWA 4YI5A 3TR0A 2G3YA 4LJ8A 3MSXA 4PTYA 4EPTA 2HRZA 1GGEA 5A4IS 5ALVA 1WRBA 3L92A 1DAMA 4Q6WA 4LIPD 4ZQBA 721PA 4R8SA 3G8AA 4URYR 4NPHA 5EWJB 4RLQA 3KB8A 2P0EA 1QONA 1WMAA 1YZ3A 4TSKA 2PUVA 1A69A 3JPYA 2Q3CA 3KKZA 1S8NA 3ZWKA 4Y2HA 4OI0A 1UPXA 4GSKA 2O59A 4L4RA 1ZKMA 2CD7A 1KJZA 3UCEA 3R5SA 4AJKA 5INTA 5AVTA 3CG4A 2WIJA 4AXBA 2B20A 4MI1A 5EQJB 1SXPA 5GONF 1W581 4RZXA 1JU3A 4FEAA 1H5UA 5FV4A 1SZPA 4J0DA 3E15A 3UAGA 1ES9A 4O0MA 3NH6A 1WVIA 3NBKA 1GUZA 2QMYA 3UB2A 4PPQA 1C3EA 1DCKA 3V7NA 4X65B 3HUEA 2V0CA 1COZA 1FUIA 3AL2A 2DH5A 3EDMA 4U3JA 1BQ3A 4XI9A 5L3RA 3RTEA 1UR5A 4NQZA 2WT4A 3W2TA 3LT0A 1HA3A 2FMIA 3ZJUA 4RGQA 4FU0A 4FZ5A 5D00A 2Z98A 5E7QA 5H81A 1F2DA 1QKKA 3HACA 3VO2A 4YDQA 1PT9A 1MABA 2EKDA 2RBGA 3GIWA 1T4GA 2WQZA 3H8JA 4F45A 3WNCA 1JTFA 2DKFA 1V1MA 2O8NA 3OPYI 4OQEA 1FTGA 1ML4A 2HRQA 2OFXA 4YT2A 1SXJA 3B60A 1UJMA 4YACA 2GD1O 2D1FA 4XFKA 3JARA 5CFRA 4BNVA 1JZTA 1NBEA 2Q9CA 4YC7A 4EHAA 4UQLA 3PWKA 2V7VA 1PT7A 1HNWB 1CS0A 2GK3A 3PGMA 2FDCA 4GMGA 5ALGA 5IHXA 2I9PA 2PPVA 3P9PA 4AXXA 2I6UA 5J5CA 4D1YA 2Y1DA 1P62B 4N01A 4MGIR 4Y98A 2COUA 3AFOA 4Y2RA 1Q0UA 3JQQA 5J1TB 5TMDA 4NS1A 3H5WA 1EHYA 4JBYA 3I92A 4GT1A 2W90A 1VJ0A 4NPAA 3DV9A 1TTPB 3SG0A 3E2IA 3I72A 3BHNA 1QHEA 3IP8A 4GI7A 1I13A 2GTHA 1YR1A 3E27A 1T4CB 3L0IB 4TKLA 5CIWA 4Q9JA 5ITWA 2A3NA 2X8JB 3N2NA 4QU8A 4EUHA 1H23A 5T7BA 2XBUA 2Z6UA 4BRUA 1HE2A 1HL3A 1DV2A 2OCGA 3I8XA 4ABTA 5DBGA 1S2NA 3M5WA 2BELA 3S70A 3UBTA 1LWOA 1IN1A 2FEAA 4C05A 4F8JA 1V39A 5BW8A 4AO6A 3UCXA 3E58A 1HDGO 2R1TA 3GFSA 3CVWA 4XPZA 4Z99A 3WKCA 1D2RA 2R25B 1DDOA 3EJWA 5EHNA 4HWTA 1OFTA 1EWVA 1DEAA 1DQNA 1VHWA 1B8UA 2ECOA 1T6YA 2D0PB 2PSEA 4L4YA 4MMZB 2NO7A 5JECA 5CURA 2HL6A 2O1WA 1ZICA 1JEYB 1PE0A 2VTEA 3UUEA 2C2XA 4RO0A 4UMEA 1ZMXA 2Q8NA 2DUNA 3O31A 1AKTA 4M60A 3OFKA 5ELXA 4MIYA 2OT3B 2VXCA 2H1FA 4MB0A 4UMVA 4MVJE 1DNPA 1JT9A 4R8LA 3SKVA 4R98A 2W0MA 4WFIA 2XUKA 5AQ1A 4DR4B 2Q5FA 2P5YA 1XDDA 3NYIA 3JWHA 2PS0A 2NZJA 1CUZA 1K7EB 2FW6A 2D0DA 2GK6A 2IDJA 5F33A 1N33B 1M0TA 4MWSA 2IYYA 1PV1A 2W2XA 3G8YA 3RAEC 3GQBB 3JAMA 2Y68A 3E70C 3P9IA 3PP8A 4HWSA 4V0MA 1LBSA 4YJGA 4ZEMA 3B2QA 1A9XA 4BXOB 4O8ZA 4QUIA 1NYQA 4UHJA 4RVNA 1HNNA 1QIIA 4R8MA 2UVDA 1G59A 4P8RA 2ZS8A 3MTQA 4R2WA 5I3ZA 1NN3A 1WEKA 1MB4A 4FYYA 5BYBA 4BTVA 3JS5A 5H70A 3ELWA 4RHFA 4EO9A 3UWDA 2D1RA 4LGMA 4W1RA 2BY4A 1L1EA 2WYOA 3EF1A 5TDHA 1YFJA 3LC1O 3BH0A 3H18A 5D86A 3R7WB 5AIBA 4YRRA 4K1LA 3KSAC 3VHXB 2F55A 1TA0A 3GN2A 3H1FA 3NOOA 1ZJ6A 4R05A 4S04A 3TZLA 4UCWA 3V3TA 4P4UA 3PT9A 4B81A 4K5QA 2B69A 4IYJA 1KETA 3FCXA 2O2GA 4YA6A 3SDZA 4I1UA 1YMQA 2VT7A 5LZ2A 2IHYA 4I9HA 2K4MA 3VTZA 4TS4A 3LKBA 1NVXQ 2NVBA 3CX4A 1XOIA 1N3LA 1DQYA 2WMYA 1SRQA 2FFHA 1GU1A 1ZZGA 1BGVA 5CNJA 1U94A 3TF5A 4RKFA 1NBAA 2EVWX 1A5BB 1GSHA 1UZUA 5TXGA 4MQ5A 4LHXA 3U7QA 1OFUX 1GG8A 1P39A 1VPTA 3JQAA 2LTAA 4RD1A 3TJZA 1X74A 3ENWA 5EEGA 2VQ3A 2Z2YA 5BNFA 1G17A 4MQEB 5C31A 1KQOA 1AQJA 1QTQA 1U5BB 4EATA 1IOWA 1E1QD 4UTOA 1SD2A 4RUKA 3WL7A 2CEKA 2FWJA 2PO7A 3WGOA 1QNLA 3X1WA 4Q1AA 1PYDA 1G20E 2DBRA 5K0CA 3VZSA 4N0MA 4JH0A 5JNVA 2RARA 1L7NA 3VZBA 1WCYA 3I1FA 4YV0A 1B15A 5JZVA 4UFOA 3PIIA 2G5TA 5JBIA 4YCBA 2HDOA 3DQPA 1TPZA 3HABA 5BRNA 5KINB 1SXJC 4BQFA 5ERXA 4POAA 1R6XA 2D7JA 5F5XA 3HXOA 4PZDA 3JRXA 1TUBA 2AE1A 3G9QA 1Q2XA 3DC2A 2DC1A 3ICWA 1T2EA 4RJLA 3T0GA 2PGLA 4CUJA 5LOVA 3U09A 2I99A 2CSXA 1GOTA 3HDQA 1SKQA 1ABBA 3K0EA 3KR1A 2HPAA 1E9SA 5DYGA 1UADA 4URXR 4LDNA 2VJQA 1V5WA 4WJLA 4BLPA 5IYZB 3W1VA 2WAYA 2CFRA 1EFPB 3GD7A 1DDIA 4MKGA 3NTVA 2NG1A 3GMDA 3U4DA 3S7ZA 4UU0A 4RFSB 5EN4A 3T9EA 4AUKA 5LDHA 3A1EA 3EY4A 3BSYA 2NO1A 3KTDA 2ID9A 3FSJX 3RVDA 5JFGA 1T3TA 2IYWA 5E7MA 5L6LB 1DLJA 3VR3A 4REQA 3ZQ4A 5BWMA 2ZZMA 5KOHB 3FYUA 5D84A 4N3BA 1HG1A 2FKNA 1HYEA 3MRSA 3TXYA 4EW3A 2ACEA 2BFNA 5E9AA 1KZ4A 3UMYA 1NZDA 3OY2A 2H92A 2LR0A 3OO0A 3F9IA 3GEDA 5IBCA 1XWWA 1US8A 2CLSA 2IKQA 3N76A 3DXYA 4KO2S 4ND1A 3IXLA 2ZITA 4HDRA 1NWHA 1MQ9A 1KFJB 2R4QA 4NQRA 2TMKA 4OB6A 4BNFA 2OM6A 3OECA 4C6TA 3VKUA 4GR9A 2DMRA 1I1NA 3KBOA 3UMGA 4BP9A 4I1IA 5JBQA 4HMQA 4DEXA 1E2EA 1WUHS 3KYJB 2O9JA 5H1YA 3DPIA 2BFPA 4HNHA 2P6OA 2CE2X 2A4MA 2NGRA 3EN0A 4P5DA 5EA2A 5FUXA 4O4JB 4QXRA 2HJGA 2NX2A 3AG5A 4IRUB 5AJHA 5J40A 3ADBA 2Q29A 1JH9A 1X7YA 2AEFA 2ZSEA 4FHCA 4BNTA 4PYRA 1NJSA 4G2NA 4WA8A 3ML1A 2JEZA 1NWCA 4KZPA 2CLIB 4TUYA 4KP7A 3WFIA 2P9ZA 1TCBA 4XXHA 5KS2A 4ZICA 1ZH6A 3QIAA 3AIOA 4C0JA 3G2QA 2ZSJA 5AW6A 2HHLA 2HJHA 4JYZA 3T7SA 4D74A 1XVLA 4S1NA 1I1HA 2H31A 3ITDA 3K96A 4V0NA 4D02A 2QP3A 2P2GA 4OHZA 4G89A 4QBKA 4LVOA 3R2JA 3TTSA 4EO7A 1X8LA 2XXAA 2VEDA 1X3SA 3WYBA 5A1JA 4BVGA 4DUPA 4RTQA 1JG1A 1SA0A 1N9GA 1QV7A 3V4PB 3IAXA 2RHRA 3AJ8A 3GCDA 4GXRA 4Q39A 5CEEA 1J25A 1TFRA 3THWA 4DIKA 2QW1A 1TAQA 4JMLA 2AMFA 2DCUA 1SOUA 2QTRA 4YMSA 3VO8A 3WIBA 4B3BA 4DJDC 1CUXA 1NUTA 5IN4A 4EEXA 1FFBA 2ZREA 3ZJTA 3HMKA 1JDTA 2ZWMA 5IKEA 2ZBEA 3UEOA 5AVYA 1E1RA 2WNSA 3WIUA 2AMJA 4GBJA 1R6TA 2C5GA 4KYTA 4JP2A 5J4VA 2WNHA 3LKVA 2HDWA 3W1EA 4GO1A 1NVEA 2EHDA 4CKWA 3PQ6A 1NKVA 5CB4B 1Y6JA 4M8SA 1A71A 3Q2OA 4A8PA 1OMOA 1BYIA 4KGVA 2IY9A 4R8KA 4LGYA 4PLPA 2B5WA 3AHGA 2BEWB 3F7OA 5ALSA 1MBZA 1P19A 1R74A 1F14A 3X1DA 2WYWA 4A4DA 4H9GA 1PW7A 1R0SA 2ZS7A 1JU4A 3KPVA 1OC2A 2KLBA 3DG9A 3K5HA 4U7HA 4ARAA 5TGZA 5BV2P 5LUAA 2FSVC 1X8XA 3A4VA 1NULA 5HQJA 3IRUA 2O2XA 1L7EA 2RK4A 4YO7A 1M74A 1YHYA 2DG2A 3IE2A 3WB1A 4JLOA 4EJ0A 4BLVA 4MB6A 4BEBA 3MAAC 3ERCA 3BIOA 4FKBA 2R44A 1XN4A 2QXUA 2D13A 1EDEA 1L4HA 1YOBA 1YDWA 3PL5A 2BF4A 3L7LA 4UE2A 1FTSA 2N0SA 1NVFA 4QJBA 1PFYA 2BC9A 3DMRA 5DHPA 2R8PA 2EL7A 2EKQA 4RH3A 4M9RA 5ADHA 1UMCB 2XMZA 2ASVA 4LSWA 5KU7A 2H4YA 4LFBB 2XCLA 3G7NA 2HO4A 2ZSIA 3ASUA 3DHVA 3EASA 3NJRA 2XY4A 4O8CA 4Q82A 4UHCA 4ZAXA 2C98A 1FTYA 5BV7A 4QELA 1MA0A 4LA4A 5EWJA 1F0KA 3VGPA 3PI6A 4TL8A 5FL3A 1CR0A 3BE5A 3GWZA 3NETA 3DBOB 5EQTA 3RWMB 3W4IA 1UKAA 2J6CA 1OY1A 2PUJA 4X63A 5G0TA 2Q5LA 3LUGA 3LW7A 2EFEB 2OFPA 4BJHB 4PSAA 1Z4IA 2CXOA 2J3EA 5DLQC 3EXAA 1VMDA 1WP4A 3QF4B 5KNCD 1EB8A 1KQFA 5EXTA 1RM5A 3OT4A 1H2ZA 4XEHA 4A23A 4X20B 4Y2VA 2JPDA 4GDMA 5AJZA 3BIFA 1TKRA 1NDUA 3GELA 4PE5B 4PLCA 3VPXA 1GGHA 2XF8A 1V6CA 4IV0A 2HGSA 1QQ6A 1XZDA 2QRJA 3DB2A 1N1MA 3RS8A 3FHTA 3BRSA 4X92A 4ZU1X 3M6WA 1NW9B 4CIWA 3WGNA 3MS4A 2LNDA 3V55A 1G9TA 4MITA 3FPAA 4H7KA 1NPDA 3IYLW 2XA2A 4FFWA 1LK5A 1OVMA 3ROTA 2PD6A 4MI9A 3RIEA 2Z04A 4L02A 1PJ3A 3PDWA 2PT5A 4B44A 3QP9A 4FVTA 5JZMA 2M32A 2OV6A 5GJWC 1BRTA 2YHBA 4KV9A 2DWQA 1O9GA 5GV7A 3WNDA 2PCLA 4CPDA 1EFRA 3MEQA 4IVRA 3CX3A 3I30X 4OA8A 1QZXA 5FFMA 1Q0TA 3ORQA 3HGQA 5JDIC 5JTUA 3IV9A 3NR2A 4B4KA 2WK1A 4P3OA 4Y9RA 4QRDA 4DWVA 4KUEA 1LJLA 2YW2A 1N6PA 1J22A 1QLHA 1MIHA 1R9JA 3TNYA 4CLRB 4M87A 2JLZA 4KR7A 1BEEA 5TB5A 4JYMA 2P0YA 2X42A 2HLHA 2QU7A 3HCNA 3JQCA 3NHYA 4NI5A 3T7TA 3UOWA 3UJCA 2J8ZA 3ZCXA 2CJXA 3ZGOA 5BR7A 1L7AA 4HC4A 3H2GA 1GSIA 1LI4A 4ENUA 5B30A 4AZSA 1YQGA 4KZKA 3TS1A 3I3OA 4DYHA 3Q0IA 3U4IA 1EESA 3WLNA 2B4YA 5MN5A 1G5IA 2BGIA 2I6FA 4PYIA 3HWRA 1T4CA 5KX5F 4TGLA 2X8JA 3B7GA 4TM7A 5L3ZA 4W6QA 2CK3D 1QRDA 3BZUA 1L7OA 4OU5A 3KPWA 1QO0A 2V96A 1VIDA 5K0TA 3HG7A 2MU1A 3M1LA 3F1LA 2WKPA 1II0A 2A35A 2QMUA 5LXTF 1MU0A 1G38A 1FDUA 3I6MA 1S7GA 2JH3A 1TQDA 1ZGGA 1Y1RA 4HH0A 1HE3A 3WLSA 2MIIA 2HF2A 3WIVA 2P27A 4ESOA 5I7SA 5C1PA 1KTIA 1M1ZA 1JEYA 4PPGA 1DBRA 1GKUB 3RT9A 2Z83A 2HA5A 2XNDD 3S68A 4YHBA 4G86A 4C88A 1R8YA 4WY8A 1IY2A 2HA2A 2AR9A 1U7PA 3NAGA 2FLVA 4Q0MA 2CMHA 2ADMA 3TI9A 1GPH1 4NRDA 3WAGA 5FOSA 3LX4A 4D57A 1R12A 3FD8A 2PKWA 2J6BA 4QIHA 1DT3A 4A7PA 3LGSA 5LQAA 2ZBFA 3W5BA 1TLTA 2PJUA 1UOOA 3O3NB 3PNPA 1BKDR 2WU1A 3C74A 3DUFB 4JUDX 4TT8A 3QBVA 3HJRA 4NBVA 3D1JA 2CDAA 1NXQA 2WJIA 1P7CA 3WBJA 1SBQA 3VX3A 1FSSA 1IVYA 2R751 4MRNA 3HE3A 3HM9A 1V16B 3GQBA 4ZP1A 1X1AA 4H17A 4XD7A 3P8ZA 2W48A 1J0BA 3HNOA 3OM8A 2NUTB 1ZSVA 3H9UA 5IU6A 5I9SA 1LXCA 3WL8A 4H1HA 4LOLA 5MF6A 4BXOA 2VDQB 1Y7TA 2WIBA 3EAFA 1KXJA 4QHSA 1IQPA 3NANA 1XP8A 1Z39A 2OC9A 4G0QA 4IZOA 4BNDB 5DM70 4TZKA 3I2KA 3UT6A 3VYTB 3WWPA 1I5OA 1I32A 1NVUQ 1PFGA 2PJRA 2XGMA 2ZRJA 3R7WA 2WB4A 3VPAA 4B3SB 5F64A 1PJLA 1TQ4A 3VHXA 3S8YA 4PX5A 3U4AA 5I4IA 5B7GA 2VOEA 3O03A 1CEYA 2PVCA 1H0KA 3AUUA 3N2KB 3MHTA 5GQSA 3ZWMA 1J2JA 5LD2C 2JGIA 4FGLA 1JAZA 1CR2A 2NOAA 1KZYC 1HQYE 2YV2A 3H9BA 4H7EA 4WUTA 4GPAA 1Q1ZA 1T1SA 3QPCA 1X38A 3PE6A 4CL3A 1SFRA 4BO7A 1QHSA 3BF7A 2AVNA 1XA3A 4MUMA 1I4OA 3EPRA 3QLVA 4U2BA 4NCXA 4QLOA 4BRWA 3G5TA 1XHEA 3ECAA 3LLSA 4B8YA 3SJAA 3S2EA 2WEKA 2ZRAA 5CRIA 2RHDA 1N5JA 3SS9X 5EE1A 1U04A 4W5QA 4WEOA 5MN4A 3PDUA 3TPCA 2YWBA 3AB3A 4RNDB 2X5KO 1N3YA 3MYRA 1N36B 4MQEA 3IJEB 4M7OA 4NHOA 4YROA 1U5BA 2W2VA 3V4VB 1E8NA 1EUYA 4O0LA 3DTNA 3FMGA 1HT3A 1VL6A 2ON6A 3JWJA 1ZM4A 3K2QA 1H6BA 2F1HA 2IC5A 5CBKA 2ZYDA 4NCBA 2AN4A 5DNAA 4RTJA 3T61A 1OD6A 2VSQA 1X94A 4KXQA 3UM9A 4C21A 1W0JD 3EARA 4YMUA 1QRTA 3AQIA 2DFLA 4KNVA 5AJVB 3JYNA 4ZCPA 5I9TA 3OHSX 1UDWA 4KBYA 3TZCA 4AO8A 4AP9A 4V1CB 1UFOA 3PRHA 1MX5A 4DNPA 1VE3A 2I2XB 4N5NA 4Y6GB 1KFKB 1Q3KA 2B98A 2AQ8A 1M0WA 2GPBA 1JHVA 3E1KA 1SVUA 1U2EA 2JI6A 4G0PA 1FFGA 1Z3IX 1DAKA 3JD1A 1E6CA 2R1UA 1IZZA 1SUPA 5HKKA 1UOQA 2B4TO 2EFDB 3I34X 1T35A 4YCMA 3FTEA 3FKSA 4GEGA 2IYLD 2VXYA 3DE1X 2G63A 1UPBA 1FNNA 2JCGA 4EJ6A 2FK7A 3M6MD 5BXYA 3FF4A 1EFPA 2VHXA 4X93A 4FYMA 2DU8A 1FNMA 2RAPA 3NM6B 4MCAA 2GERA 4RFSA 1GFZA 1NXPA 2F3TA 3MUNA 1TK9A 2A58A 2NO5A 3O4IA 3Q7IA 3TR5A 4DIUA 3FOEC 2WAXA 3M6LA 3W8DA 3F5DA 4YT4A 4DCPA 4FYIA 4FS8A 4JI1B 5KOHA 1FNSA 1P2BA 3JPWA 3NORA 3SJBA 1CUWA 2O7SA 3NOQA 1U0BB 4TQGA 4Z8YA 3VAZA 4F4JA 1ABEA 2FSGA 2EIHA 2P5TB 2WLSA 2ZJ8A 5BOSB 2OB2A 3KB1A 3C14C 4L27A 4Q9AA 3D3WB 4UBKA 4PG7A 3NRCA 5HSGA 4IY1A 2VWQA 5KREA 2XGGA 1ORIA 5JTTA 4NECA 3ZNOA 5FPTA 4D3YA 3V4ZA 1YRQA 1YAJA 1NI3A 5JI2E 4P84A 1ZG3A 4ZK2A 1TE2A 2FP4B 2WT9A 4RK4A 4U4AA 1WAMA 4PWZA 3QLEA 3FSEA 4RSMA 5LWQA 3R5TA 3C8UA 4YRTA 1GDTA 1W2WB 4QDXA 2C92A 3W34A 1ZS9A 1Y1LA 1GTG1 2ATVA 2WJHA 4H6VA 5EVCA 4JI5B 3I83A 3RVLA 4BQSA 2R66A 2ZTMA 4KMOA 1T5OA 2R6HA 4L8WB 2IS4A 1IG3A 3PFIA 4KQEA 1PD1A 4O4JA 3L0SA 5AKYA 1I0LA 3IBFA 4ND7A 4MR9B 2YNMD 3RRMA 3FJ1A 3TM4A 1BAPA 1ZCZA 1O57A 1U9YA 2RGEA 3KNZA 3TWOA 4A9AA 1RI1A 3EW7A 1C0LA 1RRKA 3I42A 3QX9A 4IRMA 4JB2A 4MUEA 3T7CA 3VPGA 5JZ9A 3CWQA 3IUPA 5ALHA 3AIKA 1J2EA 4R1LA 3WGUA 3OMXA 2YTZA 4RJTA 4I5GA 4KL8S 4XH9B 4BFUA 2PRIA 3G0IA 1R6VA 1UBMS 4OBBA 4IJWA 3ZVLA 5BNIA 1J1UA 2BMDA 1H8HD 3ZXXA 3R7DA 3PC8A 1YQUA 1YRLA 1DKRA 2P6UA 1CS4C 1SOMA 4Q4LA 1WPXA 1KOLA 3T9FA 1U5CA 4LWZA 4Q93A 5T4HA 3VDXA 3X2FA 4D8XA 1BOFA 2QZZA 1RQGA 2Q1SA 3AOGA 1KE2A 4ZDIA 1XRRA 1UF9A 5CDYA 4BC1A 3MTJA 3Q85A 3RD5A 3NBZC 4J1QA 1I2ZA 4CTMA 1DBQA 1YK0A 4HQ0A 1JFSA 1G18A 4ACAA 1F9AA 2MMCA 4OKIA 1OXBB 3V8NA 4BJ1A 4KQFA 4QFBA 1TYCA 2INGX 2XUDA 1MVNA 2C88A 3KQWA 3AOEA 3B1XA 4IDBA 4F2WA 4PSVA 1NURA 1RXVA 4N7BA 2PWAA 3P9ZA 3SIXA 3JAWB 4PY2A 3U39A 3A28A 3Q1KA 1VRWA 4IHJB 1E2LA 2LBPA 5CB4A 1DCTA 3ZWWA 4U1RA 1T3HA 3L0YA 4E14A 5FLEX 1NMYA 3DSRA 3K15A 3F73A 4H35A 4KVGA 1FMTA 3SICE 4KXVA 3TMAA 2R4UA 2BEWA 3IAM6 5J59A 1KY5A 1XKTA 2PO5A 2WA2A 2Z2IA 1KEZA 4LDZA 3SBOA 3LU1A 4WFKA 1TIKA 2OKCA 2VCHA 3BWXA 3ZJVA 5TPWB 2LW7A 5JI3E 4N5DA 2X3FA 3QLUA 4I6EA 3VNQA 2JJ2D 5IHPA 4F60A 5G3YA 4QEZA 3I64A 3HFGA 5DGHA 3LUDA 5E4TA 2XTZA 1Y3AA 4IH1A 1ZIPA 2BCEA 2QTZA 3CLTC 2YMPA 5MFZA 5HA5A 1OGYA 5LKRA 4IG9A 5LKAA 1A2KC 3BXXA 1V37A 1XIVA 2FN3A 3LPCA 3OF3A 3IQFA 5LMCA 5HOQA 1SXQA 3TPZA 5E0KB 1UMCA 2R3SA 4EY5A 1AD2A 3H6KA 3D54D 1PEKE 1SZDA 3AUJB 4ZI7A 3ADPA 3PVCA 5GAJA 4WV3A 3KFLA 5DOVA 2BGRA 4D97A 4KFRA 1VC2A 4QU0A 1UKVY 1Q16A 5BWOA 1UBKS 4FP9A 2HRBA 1JR4A 4Y2TA 4B79A 6Q21A 3E4DA 3AKYA 4GD3Q 3V7YA 1IG0A 1DKNA 2WVGA 2X8LA 4HEHA 4N8EA 2V1UA 2F17A 1KKMA 1AQ6A 4QOJA 3C5CA 3QF4A 2C1ZA 5EHGA 2QSZA 4CDRA 1ISHA 3L1UA 3NH9A 2EWVA 4X20A 5HEKA 1R0RE 4EI9A 1E2QA 4JI8B 2Z5GA 3ASYA 1UKCA 5AVXA 3AEXA 3FPFA 4HQOA 3DE4X 1JDSA 2D2FA 5HDBB 1S8OA 1WXDA 2D54A 1PEDA 2ECFA 1MPXA 1O95A 2WSSA 1MVLA 2E49A 2Y8EA 2WPNA 3BWBA 1DCMA 5FO1A 3GA5A 1ISRA 3O1HB 1DRVA 1NAIA 4BVEA 3HCDA 2XEDA 2AUMA 2WF5A 4UHBA 5DM4A 3QVWA 2XUOA 3GRRA 1DAIA 2BMAA 4NBTA 3D7SA 3OOYA 5KNCH 1N6RA 4HRVA 2VPTA 3Q15C 2FE1A 3DVQX 3O5AA 5T67A 4DSUA 4E11A 2H2DA 2F1IA 1ILWA 3EAGA 3GJ8A 5HJ5A 2R97A 2FK8A 1WQ4A 3CGGA 5CK5A 5F7XA 1SRRA 4TKUB 4LYJA 1LNZA 4IIJB 2R8XA 4RE5A 4UOEA 2R1ZA 4FJ2A 3BJMA 2YVKA 1VXOA 3K3PA 3MFYA 4LDQA 4KIJA 2QAGB 3D2LA 2WDZA 4DMUB 2WZQA 3W6UA 4CLRA 4J3NA 5JSHA 4CEHB 3HN2A 4XKJA 2VNJA 3JD3A 5AK3A 3LPDA 4L85A 4P98A 3RS3A 4MYTA 2XITA 4LUCA 4ZYVA 4TS3A 1ESZA 4M86A 4Y9TA 2VHZA 3CVXA 1Z9BA 1CNMA 1H1DA 1EJBA 3FNHA 5FEMA 1I9CA 2ZWOA 2W6NA 1HY3A 4JVNA 4PG6A 3MB8A 1UEJA 4HDKB 2CD9A 3S4YA 5DOZA 1TZJA 1JQDA 5TGTA 3K1ZA 1GXSB 2QRQA 4WJKB 4Q66C 1JL3A 3B9BA 3N2ZB 5L6MB 1AHPA 4FYHA 3M3DA 3R7AA 2C2ZA 1W46A 3BVPA 3MB5A 5LQNA 4CETA 1UPTA 1ZFNA 2FRXA 2Y1XA 4F7WA 3UGKA 2D5IA 2HA0A 1BU8A 1TM2A 3WGMA 2GZAA 3OPMA 5DYTA 4B0PA 4EECA 1BA2A 1TK3A 1B43A 2JAPA 1M10A 2XYGA 3AOEC 2EATA 3ASZA 1A95A 1H93A 1DG9A 1U7DA 3QTBA 4WCDA 3SYNA 5HVNA 3E5MA 3H4TA 1W36B 1A9YA 2DQYA 5DSZA 1EQAA 1V3TA 4U9HS 2I2WA 1RLIA 2Q0QA 5FOVA 2I2DA 5BPHA 5AYVA 5ADWA 4J2TA 1BMTA 2F2TA 4KIUA 2FMFA 4N48A 2V7QA 1QUFA 2BZ1A 4OHXA 2X2FA 2GFHA 1ZI9A 5BSRA 3WBKA 4E5DA 4YRZA 1YR6A 2B61A 4EGQA 3RGGA 1ONBA 1BQ4A 4TUYF 1IUOA 1RHUA 2EJUA 2G1UA 5D7NA 2YOGA 4QOFA 1IOZA 2DFKB 4RS4A 1Q0HA 2WOJA 6GPBA 4JC8A 3DUFA 4A8TA 4KBGA 5DISB 3UBMA 1C2YA 1EFDN 4S05A 2XE8A 2V03A 1SG0A 1V16A 2QVXX 2WF9A 4GBED 2EWWA 3LY5A 4N7MA 5H59A 2ZKLA 4ND3A 2NUTA 4K6MA 3KYDB 1YOVB 1A9QA 1WW3A 4TLMB 4TWAA 3VO9A 2P2CA 5D7BA 1X2EA 1GRVA 4FYWA 4BNDA 2FR8C 3RRNA 3WXMA 1JR2A 3KUKA 4F8EA 3AY3A 4RF2A 3RWBA 3D8HA 4IP0A 3CLVA 1N0IA 5JATA 3DZIA 4EGCB 2VCEA 4YONB 4CE6A 3OA2A 1MZVA 3DHYA 2IOFK 2RCNA 1GTRA 2JZCA 4V38A 3LK6A 3A6PC 2MSKA 4V02A 1K6XA 3N2KA 3CINA 5SV2A 4M37A 1SVSA 3RQSA 4MO2A 3F9CA 2HXYA 4QBIA 4B32A 4FDUA 4BWFB 4TMWA 5K09A 1IRXA 2WTBA 3DXZA 3UHPA 1A9ZA 3COPA 3DPSA 3L04A 1T8PA 1HDZA 4HGRA 1YB1A 2XQGA 4B80A 4UTZA 5DGDA 2J9YB 4L4SA 2EKLA 4COOA 2WFZA 4L28A 4MWTA 1U2RA 4AURA 3LE8A 3LXUX 4GZ6A 1JU9A 2HUPA 2LP4Y 1Z5NA 2ZPAA 3Q87B 4MP8A 5CVEA 3TEMA 3U61B 3L02A 1RI3A 3AHFA 2HMTA 3QHPA 4L50A 3ZWCA 5TE9A 5CBPB 1GQQA 4G4GA 3DBRB 3T95A 1ENYA 1Y81A 2PV7A 3GCZA 4BCDA 1TT5B 3FH0A 4BO4A 1SOVA 3QF7A 2NTYC 1L4FA 3CLKA 4F1JA 4RM2A 4BWGA 2BHLA 4M55A 3ABZA 4LNAA 3QA3E 2WIAA 2AQKA 3LDAA 4KFCA 3EVCA 4CR6A 3ZH2A 1P45A 1W6UA 3HBMA 3BXOA 4V1CA 5D2CA 4CKXA 3RK1A 2YMQA 1IY8A 4MTCA 1YRWA 5D87A 4UPVA 4ARZB 4B3JA 2XE6A 5I7VA 5AHKA 3ONWA 4UMFA 2E5FA 4RF5A 1IYZA 4N3CA 3VI4B 1VB3A 2AN3A 4K8OA 5AVJA 4F6CA 2WWYA 3LQFA 4OHCA 1UBNA 1O6ZA 3MWYW 4RVCA 2JFUA 2ZRHA 4WBXC 2HN9A 1GTSA 1BDIA 3ZWBA 1PNRA 2HIMA 1SUFA 4EY8A 1ZD1A 3KG2A 4QJIA 3FNFA 2JLCA 1QH1B 2FTKE 2Y05A 1OFVA 2ZIUB 5KYXB 2QM8A 4QNNA 4DJEC 3JQ8B 3ENNA 1D6NA 2HWXA 2GWHA 1NJ5A 1X87A 1P0CA 3R20A 1Y3FE 3AM1A 7MHTA 2MR5A 3IULA 3JR7A 2EEZA 4OB8A 4RPIA 4KWIA 3LUAA 3K72B 2DKNA 3ZYZA 4C08A 4CLDA 4HOYA 3H97A 4JIMA 3KR0A 1NN0A 1WXEA 4NC9A 2ATIA 3FVTA 2EJWA 4O4HB 4C4XA 4AMUA 2D6FA 1ZA1A 4JI7B 2I4OA 3FWNA 4G67A 4Y67A 3ZD8A 5A06A 5BOSA 1XVUA 2AL7A 2YR0A 3HGTA 1LC0A 5DBEX 3D3WA 1WUTA 3K1TA 5ADVA 1SCNE 5FPSA 4WI1A 3WC4A 1QFYA 3T5CA 1NYTA 2QRMA 2AG5A 4PC6A 3HZZA 3OTGA 1IXYA 2KWIA 1O0SA 4KQKA 2X0KA 3PXDA 1E18A 3I28A 3K9WA 2IYOA 1N8SA 1PR0A 2FP4A 2O3RA 3M2PA 2GESA 2BKLA 5E4JA 3IQGX 5C52B 2AN5A 5IK2D 4LOKA 1IHYA 1WSDA 2OGWA 4J07A 5A62A 3ZJ5A 5CD9A 2OO5A 2NMVA 1T3ZA 4WVLA 3NYWA 2ZRDA 5BMVB 3I0MA 4YIKA 1POWA 5ALRA 4BV8A 3D8UA 1HDRA 3H87A 4MR9A 4R8VA 5FYQA 1PJCA 1AU9A 3ABIA 4G9EA 4YRGA 5LFAA 2X4IA 1G7CA 1N78A 2FN7A 1KKUA 2W98A 4KKVA 2H1CA 4LXUA 4RC9A 1QDUA 3BIXA 2IPXA 3H6HA 4ER3A 2Q6VA 3HSYA 1GZHB 4GC5A 1FTWA 3U3DA 4MCJA 5HR5A 4Z4IA 2O8BB 4B17A 4G56A 3UJBA 4D4MA 3RK4A 1H69A 5JHHB 2D3WA 2L17A 2OZLB 3GOQA 4D3SA 4BGEA 5CG2A 5EZ6B 2YJTD 2P2NA 4I8DA 4A2QA 2HCTA 4D7AA 2GAIA 2Y67A 2HYDA 1UP7A 4PYOA 2BMVA 1JIIA 2PZMA 3SMQA 3DT8A 4KU4A 5E95A 5KNDD 3GCXA 4EG7A 1G4UR 2WPDA 4PW0A 3U9TA 4BMYA 4V2IA 2R6AA 2R85A 4CG0A 1E1MA 2AIRA 4WKNA 1GGMA 3COVA 4UOZA 4ZYUA 5EE0A 4LDPA 4YK7A 5EJFA 2NZYA 4FFNA 4RKQA 4CODB 4E46A 4YCNA 2VQEB 4P81A 1HR0B 1T2VA 3OJ0A 3TCKA 2KBFA 1ZGJA 4U6QA 3ELYA 2UXBB 2QRNA 2WWXA 3PD7A 4K26A 4BUZA 2PWYA 3OE7A 4MWZA 1GTMA 5KSPA 3H75A 4JJ6A 3VH3A 4ZEXA 3RF7A 3BA1A 5KEIA 1ZINA 4YUZA 2B8JA 2AA3A 3OOWA 3JAWA 4RLHA 4ZOLB 5DM0A 4BVFA 1NI4B 3AC0A 4IHJA 4FNMA 3RADC 2WJGA 4FLEA 4E08A 1PLJA 1H5QA 2Y9MB 3KEOA 2CCJA 4L08A 2ZULA 3NHSA 3OIUA 1U0LA 1JEQB 1IJFA 1V25A 2X41A 2GXAA 1K92A 3PXBA 4H6XA 4YRPA 1JQ5A 3E9QA 5BV8A 2CF6A 2F00A 1RXSA 4HEJA 1E9BA 5JNUA 1DUVG 4MIKA 5TPWA 4F9TA 3FCYA 3DW3X 2H57A 4JELA 4EY7A 1W5FA 4OHUA 2ZBDA 3IEUA 5K51A 2LCQA 3TQCA 1E7MA 2C77A 4YAWA 4EHHA 3WLLA 4KITB 1U8CB 2FOIA 4G09A 5L51A 1PNQA 2WE7A 3HJHA 3A32A 3ZN2A 1DC5A 2PG3A 1N8KA 2QNBA 2FJPA 3F3MA 2HSJA 2DULA 3HU5A 1AXEA 1SOWA 2QE6A 1KAGA 3KCQA 4IDGA 5CDHA 1KEKA 4P31A 3ME5A 3QKTA 1CIJA 1H9CA 3CH4B 4AJ1A 3IVRA 5JAIA 3JYHA 3KKPA 4J4BA 2Q9UA 2QZ9A 4N3AA 3R40A 3PICA 5CJ2A 1EFAA 2AXQA 4P0QB 1P4HA 1VIVA 4NYJR 4KIWA 3FFBA 3KC2A 3FX2A 4CM4B 1RAAA 2A8YA 2ZPTX 1LI7A 2PHZA 4WXMA 4ZPJA 3VR6A 4MJ3A 2GDZA 4G0WA 3ZIUA 3CKMA 5ALNA 1KPHA 1BX0A 2P0AA 4QUBA 1U28A 1FFXB 5THQA 4HDOB 3BL5A 3VR2A 4EL5A 1G41A 1QBKC 1CEXA 1N75A 1LWNA 2RMKA 3GMIA 3KQYA 5IDVA 5K3BA 3HO1A 3B51X 3GJQA 3RBAA 3R3SA 3H0CA 4HFRA 1U0SY 2YH2A 3O9ZA 1DRJA 2ZJ5A 4RVDA 3IC5A 5KOJB 4HUJA 2RKBA 3S99A 3UOGA 2YJZA 3FCEA 4JODA 3ZV6A 2OXRA 3NBMA 2PGDA 1RLOA 5EJ2A 3SBXA 3T3DA 5B2FA 5SZHB 3ZE9A 2O06A 3U56A 1IB0A 2Z58A 4KE9A 1I4EB 2QR3A 3HBLA 1QYIA 2OO5C 2ZB3A 4R1NA 4LJSA 3V7FA 1QVVA 4CR8A 3LRPA 1N7IA 1YS2X 2RAUA 4JLBA 4CWAA 4B3RB 5KCMA 2R8BA 3OZDA 3VNVA 3SM3A 1AKMA 1RT9A 1V9LA 4CMJA 1YKSA 4L8YA 4LNUB 4TKUA 2ZI9A 3BUSA 3R8FA 4W5NA 4HYYA 4IIJA 1EWTA 1N0WA 2PV0A 4WXYB 3INGA 1J8YF 5H0IA 2P2YA 1TU4A 5J43A 2A30A 1F8FA 2VL7A 1M34B 2QAGA 1ZUHA 5IYZF 3OHPA 1AGRA 1ENZA 4IGEA 1KC3A 3BREA 4JITA 4PC7A 2OQVA 1I2DA 2DT8A 4YQZA 1X1BA 3WWDA 3WO0A 4R1UA 3VSEA 4OY3A 3EPJA 2VK1A 4WT7A 5AFSA 5DHTA 1N2SA 3SQNA 3IQWA 3O7WA 1Z2NX 3QVOA 2R6CA 4KE8A 4FFPA 1V8OA 4O5AA 1NNEA 5IF3A 2QA5A 2VUTA 3ECSA 3L9XA 2DPYA 3VNRA 2BFEB 5HIAA 3QPWA 1RBZA 2XXJA 2CL7X 4HDKA 2PH1A 4HRAA 4K9KA 1BN7A 2O6HA 1JWBB 1OIXA 4Q7EA 1A9OA 2WP8J 1HORA 1GXSA 4KK4A 3CWCA 3Q40A 2VATA 3D6AA 4UDXX 1UBUS 4U7JA 4UM9B 4FEGA 4YT5A 2PVPA 4BNMA 1BJRE 3X1JA 5JH7B 1SKYB 5CX4A 3WMEA 4KLAA 1IQUA 5DNDA 4C0XA 2O20A 3JSXA 4ENSA 1TLFA 4GX0A 4OLBA 4BLOA 3GJXC 1T8WA 1Z8NA 4EFDA 1GPNA 1RYHA 1F38A 1SUEA 4J76A 3RKSA 2V97A 4Z3KA 4U7WA 3AVPA 2PD3A 2FEXA 3F90A 4BZXA 1TXGA 4ZGGA 4JOBA 4RSHA 1D5WA 1GT6A 4DLLA 1E66A 1V5IA 4J91A 1Y34E 3O2SB 4KR0A 3RSQA 5I51A 2W9XA 4O4JF 3WLKX 4LY3A 3ANSA 1M0SA 3HR4A 5AO9A 3MJHA 4IXDA 1A8HA 3RUFA 4EYKA 4H4DA 3A1NA 1TOAA 3THOA 2FWRA 2W93A 3IURA 3OIWA 3V8MA 1ISPA 4UAUA 1R37A 3O2JA 2BL4A 1R0XA 3LVRE 4U8HA 4ARSA 5A4AA 3VA7A 2VHUA 3HRKA 4W5JA 1SHJA 4K2AA 3UJNA 3KSZO 2ZBVA 4OSPA 4YXWA 3BMOB 2QE7D 1IATA 2R68A 4MVJM 4ERXA 2F8TA 4TT3D 1ZGAA 1N8NA 4XYLA 3I8OA 4OYRA 3PD0A 1SIOA 2MSEB 1TYAE 3IAHA 3KYDA 1YOVA 2NTJA 5D5HA 5IBPA 2UZAA 3LUKA 4YYEA 3Q3CA 1Z4QA 2JFZA 3E8SA 3KETA 3OWHA 5I8WA 2QZ4A 1J7JA 1I6KA 3OIGA 4RHYA 2HIHA 4YGXB 3Q8MA 4KI7A 1BWQA 3D0QA 4W9NC 3TTYA 2GM5A 3CJQA 3WWOA 3GVIA 1GTZA 1D2AA 2W6ZA 3ABQB 2FFRA 3L1JA 4B84A 1QIFA 1BC5A 2FZWA 4ZAYA 3K2EA 1TVMA 4G25A 4YMWA 3ISTA 3CRZA 2QJOA 2Q4BA 5AKKA 5C4GB 5A3VA 4N65A 1JIXA 4ND4A 4EAQA 2Z3ZA 3G2OA 3ZDCA 3WL5A 1RYBA 2E4UA 1OV4A 3JZAA 2CL0X 2JHPA 1A2BA 1RAHA 1XU9A 1ZK1A 5CB4F 1PJTA 1MB2A 2FN9A 3PQ8A 4AJPA 4Y7DA 3SZOA 4CM6A 1GFIA 5IANA 4ARVA 4D9HA 2ZRGA 1FP1D 1QB8A 1TMKA 5AK5A 3UIEA 1CUJA 3MJTA 4DV3B 3SX2A 1G291 1V95A 2XAUA 1VYUA 2YDXA 3R09A 1A2OA 1G4AE 1QG2A 5GZ1A 4ZVTA 2QQGA 1LV8A 1NY5A 1ESNA 1VFNA 2VAWA 2PYZA 4IF6A 2P77A 1V8BA 4KN8A 1OV6A 5AXAA 4UM8B 3WOVA 1OZGA 2E21A 4EH1A 2A5DA 4UUPA 4LGVA 4AW9A 4DMHA 5A4JA 5CBPA 1MENA 1FXSA 3DBRA 5JXHA 3ANXA 4RKRA 3RBVA 1QM5A 1VLJA 1TT5A 1C9JA 1GP2A 1YQXA 2PUHA 4JMPA 4QOSA 5LA6B 3RVPA 3I9OA 3EODA 1U5AA 2OL4A 3I6BA 4D8WA 1Y8ZA 1MX9A 1GNRA 4L4UA 2H00A 1T9CA 1Z5WA 2VHWA 3K5PA 4K9RA 2NXNA 2J09A 4WMLA 5F52A 1YTUA 2YOFA 3KWMA 1M8GA 1MV5A 1DBSA 2VWHA 4LTMA 1NSYA 2YINC 3PS9A 1E7YA 4ARZA 3EFHA 5CTAA 3AHHA 1DOHA 1EHIA 1FYEA 3EWSA 3P94A 3SCZA 4DKXA 3GGPA 4BOYA 4MHTA 4EHNA 1CYEA 2VJLA 4NU5A 3L0CA 1NNSA 3U3JA 4BFSA 2BYTA 2Q27A 4ZI7F 2CVFA 3HXKA 3MIIA 2HUNA 2PZKA 3EIFA 1XEWY 3CNEA 4EGSA 5IG2A 5A3SA 2HD4A 1QHHB 2OBYA 4PSCA 2PN1A 1QH1A 5F7ZA 4XYBA 3OPVA 3W0LB 3GROA 4DAOA 5KYXA 2UXCB 3ZIAA 2V7EA 3JQ8A 1VB5A 1Y9JA 3C4VA 5D5PA 5I7WA 2VR1A 2DGDA 1HDYA 2OKGA 3RWOA 2Q5IA 1HDOA 2ZSBA 1E64A 4EG1A 2PVSA 1WXQA 1YUNA 4Q3BA 4E5MA 4X1KB 1F17A 1HMYA 4X24A 1T2UA 3WJ2A 4HBZA 4Z4EA 4O4HA 1FQJA 3TJRA 3M5DA 3IHLA 4I66A 4MPRA 3CH5A 2AVDA 3IVAA 4MS1B 4J29A 4OJMX 5I7FA 2H3EA 3MJRA 1P5FA 3R5KA 5G0WA 1MC4A 5MGNA 3OTOB 3L43A 3VTFA 3LHKA 5T3YA 4CHGA 4FTWA 4XARA 3RC1A 4DLVA 3AHCA 3VDRA 1WZEA 3DAPA 4B6RA 4U5QA 5F78A 1XZEA 4D92A 4DJTA 2G7ZA 3NHFA 5C8XA 3N2IA 2PQ6A 2FWIA 3UK6A 1DAOA 1LA2A 1ECLA 4C4AA 4OLFA 1HDIA 2C2WA 2XH8A 4JUFA 1JDPA 4N5MA 2FMKA 4IBOA 3CVVA 3WL6A 2BSQA 3AJ9A 1TM5E 2IH4A 1CE8B 3LECA 4LXXA 2H2AA 1L5NA 4IDEA 5LCXA 3ZYCA 3HHPA 2Z9BA 4XUEA 2CB9A 2HDNB 2P65A 3L7IA 5BMVA 2BM9A 4DT1B 4CM8B 4DADA 3FZGA 3OCCA 1KJQA 2IYPA 3KAQA 2FZCA 4IV8A 3ADDA 1MMFB 2W2KB 2VDWB 3BWDD 3R9XB 4WIAA 4HDAA 1SB8A 1W76A 1DEHA 3I04M 5BSWA 4TLAA 4HGZA 1OR8A 2FEOA 2I8LA 2WZCA 4JP1A 2O8BA 1KWGA 1U7WA 1YI0A 3DZDA 3QQ5A 5D3QA 1KFBB 3WZ2A 1N9ZA 2IX3A 2OZLA 4R4JA 1ZJWA 3O4JA 2QTNA 1VIMA 3QFCA 5HZHA 1V71A 5FAXA 4CI9A 5IDYA 5CB6A 1KJ9A 1KI8A 5EI5A 2PMKA 2CJYA 2FUG1 2B8WA 2WM8A 4WLUA 4LHWA 1K3TA 3G2JA 1IWOA 4GOXA 3O8QB 4J0EA 4RQUA 4C87A 2A9RA 2ZROA 4Q19A 1U1CA 1USIA 1QCZA 5TPZA 2EW1A 2GJ8A 4NZOA 4FHFA 5D3KA 1GYRA 3P0FA 5CXSA 1SVMA 4FS3A 5KYVA 3QW2A 3PEEA 5TRTA 1MQ8B 1VE9A 2P69A 2IOHA 1AE1A 3L05A 3SHFA 4DLNA 4KQCA 1AGNA 1SQ0A 5FIUA 1LY1A 5A3JA 4ZCSA 1LPAB 2XUPA 5SY9A 1KO1A 5LQKA 3TTTA 2JLBA 3IUMA 3L8HA 3EBPA 3HJGA 3UAYA 1DC6A 1UKZA 2ZK7A 3UKJA 1PR1A 4I1YA 5KNDH 2O57A 3DLTA 5KNBD 2G6TA 4LDJA 1OWLA 4BN0A 3HA7A 3AZQA 4RD2A 1XDSA 4UEOA 4YQFA 2ZI5A 1LNQA 2I6SA 4PF1A 1NI4A 4ZOLA 4B7ZA 1C1YA 1DJPA 4KGDA 4RZ2A 5EERA 4L3WA 2FJ0A 3VKVA 3MD0A 2C59A 2Z4RA 4GPBA 5GWXA 1EUQA 4M21A 3Q5EA 2C3PA 2FPUA 2R87A 3IPCA 3ZI0A 2KLHA 8LDHA 3G8DA 2IHKA 1YRYE 4EQZA 2AYYA 1JEQA 4WFQA 4F91B 3DVLA 4EENA 4MKZA 4RFVA 2FZ4A 3E1GA 1B93A 4BO0A 1E7WA 2EF0A 2FPLA 2XRFA 4LAFA 5ABPA 4OHOA 5IASA 5EMMA 4V0RA 4PGHA 3H2ZA 4AK9A 3T3NA 1C50A 3KSUA 1P18A 2HLDA 1UK7A 2VF7A 4J3JA 4D80A 3U5TA 3TD2A 2P4SA 1IE3A 2QXTA 1C7RA 1A2QA 1EXMA 5EXXA 2E1PA 2OCDA 2HQOA 3VR1A 3WWZA 1ONPA 1ZR4A 4QU5A 3DYVA 4OGLA 3AI2A 4MKFA 1CZKA 1ELOA 6ABPA 1BKYA 5E2AA 3CZMA 4DXAA 4F71A 2FVXA 2YXBA 4WD3A 5DT9A 1E6MA 1OLOA 2ZUDA 3K09A 4N18A 1DBWA 4N49A 3NOVA 4OP3A 5E8JA 2VUUA 2J9GA 4BMNA 4JBNA 3M70A 2YWDA 3TQSA 4BP3A 1V47A 3GGCA 1JI3A 5AR1A 2I6GA 5KWSA 4P83A 2ZM5A 4D25A 1WMDA 3OFNA 3U37A 4EDHA 1JE1A 3EXIB 4KYVA 4ZGWA 2GRAA 1QCDA 1Z4JA 1N6IA 1W29A 3H16A 4I1PA 4JCOA 1PDOA 3LBAA 1N5DA 3U13A 4CM4A 1EPUA 3UICA 1W4AA 1G2QA 1IHXA 1N6LA 4B46A 1BVYF 5AQEA 4B8ZA 4JLJA 2DPLA 2JAWA 3HZOA 3K2IA 1T8TA 1FFXA 3RUDA 1Q0PA 4OJNA 3L0OA 5TR9A 1W34A 3NTQA 2QN9A 5IVPA 3AETB 3EVTA 4G1MB 3PFHA 1CNEA 2XHZA 2VDLB 3AW8A 4FBGA 1RPTA 5JY6A 4KR2A 2XQFA 3I6IA 1HOXA 2B7LA 2R2GA 3GP5A 4QYWA 4EUEA 2OXEA 1NJ6A 2WMDA 1S2DA 1RCFA 1W48A 5KOJA 3GZJA 3HEMA 2M1XA 3X0DA 2VBCA 3O95A 3U44B 2I76A 3ETGA 2O05A 3B1VA 3Q3VA 4D6PA 1EBBA 4DQDA 4RHUA 1W0KA 1E2MA 2QD5A 3GAAA 4ZT3A 2DECA 2G7MC 3I37X 4A8JC 4DZZA 4JI2B 1IPFA 3ASVA 1AZLA 3ES9A 2FFQA 4LRTB 4WNYA 3B1FA 4JFAA 4RCYA 1WXXA 5FT9A 4AG6A 2JCBA 1QQAA 4C3OB 3KD2A 2VJDA 5I4BA 2H5JA 2UZ3A 1SCBA 3B82A 2YJ4A 4L5JA 4ASUA 1M0EA 2GMWA 4LNUA 3SI7A 5EJ4A 3EMDA 1IJBA 1FMLA 4J4HA 4FCVA 5A5EA 2BR3A 3RVKA 2D06A 5MN6A 3CQ9A 1T5TA 2ZUWA 4M3NA 2TMGA 4OQZA 5HS6A 3TZEA 1Q1GA 2R8RA 4KRYA 1UBEA 3H5RA 2QGFA 5A4FS 3VR5A 1M34A 4GMXA 2BM0A 1KPIA 1KOJA 3MLEA 1P72A 3S3TA 2V3CC 3FPJA 3O21A 3CY6A 5KWEA 2F7SA 4EDFA 2X14A 1E94E 4C22A 1QANA 2IHBA 3FMOB 5DYNA 1D09A 5IRCD 1S89A 3PEUA 1EFUA 1VGVA 3PIDA 1C5KA 3RIGA 4FB4A 2BFEA 2WHEA 3AUKA 3IHKA 3O9VA 1MB0A 4FSHA 4NCJA 5CK4A 2IUEA 5BQ3A 1JP7A 1QAQA 4PCAA 4YAUA 4OIMA 2R86A 4G84A 1X7ZB 4WN3A 1HEIA 3S8MA 3SXPA 3PJRA 3S27A 4FE3A 4OM7A 2B35A 4TYPA 5A6SB 1PZMA 1TCVA 4ALNA 3WB2A 2UZ0A 3GJ7A 1I80A 1YCHA 5JH7A 4MKHA 1WQ1R 2DR3A 2YOHA 3OD1A 4CF5A 1F0YA 2AG1A 2J32A 5TS2A 4KHPB 3A0UA 1WUIS 2B1RA 4QPZA 3V1UA 2E2WA 3H05A 2YV4A 3O91A 1XCLA 1KEVA 3HNRA 4GL4A 3WHIA 3JYPA 1XEFA 1E79A 3OUTA 4OI2A 4CKZA 2RJOA 3IOEA 5BUSA 3PX3A 4JLMA 4UFNA 2VP6A 1RPNA 2TECE 3MTEA 2PL5A 3PEVA 2DF8A 3NCHA 2GN6A 4L4XA 5IYZA 4Q00A 3MXOA 3LHSA 1RXUA 2GM4A 4BDTA 4PINA 3RTDA 1W4BA 2FMHA 2JKVA 3OU6A 3D3JA 3E9NA 5BSEA 1WSWA 2PGIA 5E6SB 1W5BA 3FPKA 1PSWA 2RIRA 5IARA 1N7JA 2JA1A 3GG9A 2YWEA 4C03A 5CA0B 2I91A 2IS6A 1W1UA 2CFTA 4O1MA 4DF3A 4YJ2F 4J4TA 4N1AA 4UM5A 4MVWA 3OZFA 2C2GA 5LUBA 3BMOA 1TC1A 2JAQA 3FETA 4MUHA 5GTDA 4KQ2A 3EIQA 3UQYS 4ITRC 4MQMA 2FEMA 3RABA 2H0AA 3LFUA 1USUA 3MRVA 1T5BA 2EFJA 3USCS 1SVKA 2O0KA 1KXZA 2H4HA 3IBTA 2GLTA 1CXZA 2GBLC 1N2XA 4CL2A 1W88B 1A5AB 2BGJA 3PFKA 5DBIA 1HNZB 1RKVA 3RJTA 2UUBB 2QJWA 3IP5A 3OPXA 4WFJA 1RRCA 4LCEA 4OQLA 3V8BA 4DS3A 4QT4A 6CHYA 4WKOA 1GFWA 1WSAA 1CF9A 2H7VA 2R5WA 4CRWB 1XB2A 2V4MA 3B3FA 2V3WA 5IAOA 1YU6A 2PUTA 1N2CB 3SFTA 5KTNA 2DB3A 3DZCA 2OHOA 1QB7A 2EKBA 3WRXC 3MJSA 3BM5A 4IHJF 1NHGA 4WZAB 3BRWA 4KXFB 1FFYA 3S28A 1B41A 2AQHA 1XPUA 2HB6A 1A77A 4FB5A 4JSRA 4ZPXA 4RTKA 2ID7A 3QYJA 4FE7A 2F1KA 3LBNA 1DB3A 1WW8A 2W4IA 2C99A 3BXGA 4BRSA 4TWIA 4YREA 1ZWKA 3P0RA 4CNQA 1JXAA 3EEOA 1YR9A 5JYBA 1XPRA 5BSUA 3WLPA 4FFBB 4B4WA 4NCNA 5BN3B 3HS3A 4GMDA 1E8DA 4Y18A 1OYWA 1CF2O 1UBHS 2XMPA 4LJ6A 3DZFA 4IS2A 2J3KA 3ZX5A 3S29A 4YCCA 2GCGA 3ZD6A 3MYYA 3U6BA 5LA6A 1DTSA 4E70A 2E0IA 1U0EA 2QX8A 4UNNA 2XWBF 4KQ1A 1PK7A 2WM3A 4II2A 1B74A 4UZSA 4QRHA 4FT2A 3C3CA 4XCQA 1DL5A 1DFGA 1G2IA 3TLEA 1FW6A 5KQPA 3M0EA 5ECYA 5FADA 4J1SA 4W8OA 4TLBA 1SULA 1C9EA 1RP1A 2WAMA 3CR8A 4HYQA 3O8RA 4ZALA 2BHSA 4D99A 4PS0A 1G60A 4J2OA 1L5MA 1VXRA 4TSFD 5M3BA 4BZQA 2EGGA 1RYNA 3FRJA 4GM4A 3PUKA 2DUJA 4LJLA 4YP0A 5JS1A 3WWYA 2IZ1A 2AZMA 2OECA 2PX5A 2JNWA 4IZIA 1QX3A 1SXJD 2YHAA 4L8GA 4OHMA 1QCCA 1QHHA 1TMGE 1H4QA 2QVCA 1YXMA 2D2VA 1JHDA 4TKZA 1Z5VA 4P7KA 4PC2A 4DCUA 4EJSB 2VWGA 2ZWVA 5E1MA 4QUKA 5CB0A 1VCMA 3NIFB 3QXJA 4EELA 3HVUA 2YUIA 4EJMA 4ZI7B 1AS0A 1F2VA 1VCOA 4MZXA 1QCYA 1QGUB 3AP2A 4EHJA 2GBFA 2XZPA 3DDWA 3KUCA 1NNLA 3P26A 2O5EA 1ZK0A 2OC4A 4X1KA 1U2DA 1ID8A 3K9HA 3KOUA 1F7UA 2QMHA 2NN3C 3KO8A 2B7CA 3IHTA 4MS1A 1WXIA 3VVLA 2GVDC 1H2AS 1VJGA 1X9HA 2GEUA 3P9QA 4HKTA 1PIWA 5DLDA 1ZC4A 3JD2A 1G8KA 1D2EA 4DREA 3DBHB 2CCGA 2NXWA 3FBWA 3R7SA 3ER8A 1QAOA 4FYVA 3ZNNA 1E32A 1ZD2P 2PKCA 4JU9A 5EOVA 5JAQA 3TRDA 3ER9A 1RVDA 1EUZA 4IIJF 2IYEA 4NNJA 3ROKA 2GK4A 1C9DB 4B3TB 3FYHA 1CE8A 2IW1A 3IXQA 1E9FA 2AI1A 3EVBA 1HT2E 4ZA2A 1RWVA 1WPQA 3P9XA 1GUDA 4OSOA 4WY5A 3X1MA 3RVNA 4DT1A 4O02B 1GZSA 4CM8A 1SBYA 4DARA 5CDTA 1IPHA 2IQ5A 3OTQA 4EB8A 1G16A 2GHIA 1FDRA 2UUPA 1CUVA 3A6DA 3L7CA 2W2KA 2VDWA 3FVRA 4OL0A 4RL4A 4N82A 3R9XA 3M6VA 5C5EA 1WNTA 3H0KA 4LVUA 3VDQA 1ABFA 2H7XA 3W7VA 2DPXA 1C80A 4ZZ2A 1B0AA 1CRWG 2NIPA 2Q3LA 3PVZA 4A0QA 1VBNA 4FNOA 4EK9A 5HJEA 2I33A 2JG3A 2FWNA 2CZQA 4HV4A 4B40A 1L9KA 2A3RA 2CVZA 1JHYA 3GT7A 4TTIA 5A2QA 4W5RA 4LOHA 1W4ZA 1XA4A 3O8QA 4RK7A 3VU9B 1C9KA 1TJ3A 1PR2A 2IPAB 1L5ZA 1MPTA 1PKXA 4NFLA 4KSBA 2WJVA 2IPOA 2ZWPA 3HN6A 2TMDA 1E1CB 1B0ZA 4A0GA 1DWOA 2AR7A 2XDYA 1MEJA 1KPGA 2AFHE 4MARA 3X2EA 4DV7B 5HG0A 2V7BA 1V26A 3NVAA 4JUBA 2IVZA 1M5RA 1EXWA 1WY7A 2YWJA 1FUUA 4ZMRA 2JFBA 3DGEC 3L6EA 2UYOA 2BGWA 3CVJA 2WFLB 2DPHA 2FH5B 1Y1KE 4ZRNA 4WCFC 5FPYA 3V32A 5DNWA 1PN3A 4IFIA 1Z33A 3TFWA 4AL4A 3X1KA 5HZKA 2R96A 3OSZA 4O1IA 2OPHA 1Y1QA 5IT9A 5EE5B 2W43A 2G1PA 2DTXA 3DL4A 4KLNA 1ZM9A 2WHPB 2WBLC 3TQIA 4Q7MB 4RVOA 3GLGE 3PNQA 2JBHA 3KHTA 3LOUA 4YP9A 1H3FA 1OSNA 1WHSB 1ZK2A 1CQWA 2DWUA 2SBTA 1M83A 4JL8A 4YVFA 4FX2A 5CXUA 2YY5A 1ZUIA 2NU7B 2I71A 5FULA 4YCSA 5KTRA 3CN9A 2AS0A 1QG0A 1MXFA 2NZWA 3JQAD 5KNBH 1D4AA 3HGMA 3DO5A 5DWQA 5HF9A 1WVMA 4JJ7A 1D0VA 4II3A 1R50A 3D8SA 5IXJA 2PGOA 4JQCA 1YI1A 4XJXA 3FTQA 4PO3X 4ZT5A 4JXXA 5JR3A 1JMKC 2ZYSA 4C01A 1LFDB 1YZUA 2BBSA 2HNBA 3PTLA 3EUEA 3IBYA 1BCRB 4ODIA 4PS1A 4XX0B 2O7NA 3QEBZ 3ICOA 3U7IA 2HHAA 4BNXA 4C7MA 1Z38A 5BVGB 4AI6A 4L16A 4PX3A 2CMFA 3IIIA 5F2KA 2FW1A 5AI9A 1OAAA 4M0UA 1AKUA 1JEOA 1G3IA 3EXIA 1FA9A 4YJ3B 1CQJB 4LHZA 5LZ7A 3YASA 1WS6A 2EZ8A 1FU4A 3T3IA 2QT0A 2Q5OA 3KQUA 3B7WA 4EMUA 3QMMA 2VDPB 3K32A 5TMEA 3NASA 2YDYA 1A8UA 3CV3A 2O14A 2Q99A 2C5HA 1XZJA 2XZDA 3GF4A 2FRVA 3ZX4A 2BGKA 3MLBA 5JU6A 3DNPA 4DNOA 5LMUB 4D56A 3AETA 3A2MA 1GRQA 1GGJA 1WG8A 2B2CA 2FEWB 1AN0A 3LCUA 4FK8A 1DQPA 4LCJA 5E1BA 4ETWA 5JEEA 3R5FA 3EWIA 2XA1A 5TVGA 1CVLA 3HCBA 3TRKA 4CNBA 1C4WA 2IXGA 1FS4A 1PV4A 1T26A 4U2GA 1B3RA 4P3YA 5JZBA 3U44A 2CWDA 3E3MA 2ANCA 1PFQA 1PR6A 2BMEA 2QV7A 1XRMA 3B70A 1JNYA 1NVVR 3LF1A 4DMRA 3DOCA 5JD5A 3UWSA 4OH7A 4X8OA 1TCCA 3QXGA 3CLUD 5HTOA 4YN3A 2CW5A 2II6A 1S3SA 3AONB 2AGVA 3KE9A 3UO8B 1BH2A 2V6MA 4PLGA 1GZ4A 4R9SA 2BFFB 4GX2A 3WK8A 4JV5B 4FHEA 4FN4A 1JG6A 3SJZA 1VGRA 1OIWA 4G26A 1X1RA 3SF8B 5DF1A 3RYHB 4E88A 3STUA 4MV0A 1CR6A 1B26A 1G8AA 2M6SA 3RRZA 3UTDA 4B83A 3AJDA 1QF6A 4V0QA 2FN8A 5JASA 2WUVA 3WGHA 2GCEA 2FUG6 3V2GA 1QJ4A 1WV1A 1WP9A 3VAYA 3FVVA 1XQVA 1I24A 1DJOA 3GIDA 3KJEA 3IV6A 3W2IA 4BZWA 1ZHHA 4E5UA 3VOTA 4HLUC 5ENZA 3ROXA 3KU4A 1KEPA 4JB8A 1T2FA 1TM1E 2RFLA 3EFEA 3P2MA 5EXSA 3P71T 2X0FA 4FEYA 3KLOA 3MPUA 2ZG6A 1M1YB 4AUEA 2XODA 1XLTC 3OBIA 1N5LA 2YFQA 3H5LA 4O4HF 1OROA 2VP0A 4DC1A 4RPJA 2QRKA 4ESVA 4DIBA 1X7ZA 4N3GA 4MGYR 3ND6A 5A6SA