2ALJA

Structure of the cis confomer of the major extracytoplasmic domain of the bacterial cell division protein divib from geobacillus stearothermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
GSEWRRIAYVYDRQTFFPLLENGRLLKQEGTKTAPSDAPVLVGWKDGDAIAEMTGQLAELPAAVLGAMSEIHYKPTREYEDRVIVYMNDGYEVSATIRQFADKLSHYPAIAAALDRNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cell-division initiation protein
publication title Domain architecture and structure of the bacterial cell division protein DivIB
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Cell cycle
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2aljA00
1YR1A 2ALJA
chains in the Genus database with same CATH superfamily
3ZE7A 4BE9A 5ALGA 2WIDA 4ZQIA 3RYIB 3WGJA 3C4JA 1Q5PA 4EB6A 1A9PA 2OWDA 2CVOA 4UHKA 4U2CA 4FFDA 1YFZA 4GC5A 4JYZA 1S1CA 1ESDA 4GM0A 1VL6A 2NSDA 5JYCA 3QSGA 4H1HA 3RC2A 2YJ5A 2C4NA 4QQKA 3BJMA 1DGQA 2EG5A 5GM1A 3WMRA 3COVA 3O1JC 2H3EA 2PPVA 2JIDA 2ZRBA 2JLUA 4NU0A 1TVMA 3J7TA 4KFUA 1NMZA 4X1OA 1QCCA 3K94A 5DCWA 1VCIA 3HRIA 5CJJA 3RAGA 1VHQA 3Q8WA 1NQ5A 1G42A 3WAKA 2W6QA 5M34A 4EMBA 1U4SA 5F12A 1ZC4A 1AM4D 1KR5A 3OPXA 3SBDA 2D54A 5M2QA 3DA8A 4B6SA 2XNSA 1QZ3A 3JVUA 3O9ZA 1C4WA 1R15A 1QFMA 4M7OA 1X15A 1E99A 4N5MA 4TS1A 3UXYA 4BJ6A 1M2GA 1P7WA 2ZU6A 1ECGA 1PFQA 2CVZA 3LQ1A 3ZDCA 1R9NA 2H4FA 1IN1A 5F9MA 4ZCRA 3O8QB 1LX7A 4EEZA 1Z88A 4Z4HA 1AO3A 1S7CA 1N5IA 3GFSA 3KBOA 1R4MA 1KAGA 3GXOA 1LX6A 2X0NA 3KT0A 4IX9A 2B7BA 4O5OA 4WN9A 3NC1C 1LK0A 1C8VB 3DPUA 1I5RA 2IOYA 1NWCA 3ACBA 3C41J 2ZM6B 3U7HB 3WB0A 3IIJA 4MUHA 4CUKA 1KI4A 4LNUA 1HGXA 3I6IA 1J97A 3K1JA 4YJHB 2IH5A 3MRSA 3OETA 2AZMA 3Q9NA 1VMAA 3H0KA 4MRNA 3AR5A 3MM4A 5ERGB 2ZXFA 4ZCPA 3SICE 3ETCA 4OOEA 1L7DA 4EQZA 1OX4A 1S2NA 2FSGA 3C3YA 2IKQA 2VZ0A 1WF3A 5DK6A 1C30B 1GRCA 2JFNA 1P74A 2XMQA 4ND8B 1RWPA 3RFVA 4DCMA 3DE6X 1X3SA 4JUBA 3TSOA 2Q50A 4KLZA 5JFGA 2QUJA 2EJWA 3FZYA 1K0FA 1QG4A 3AW8A 2XUDA 4GX2A 3D3QA 4ANFA 5A2GA 1XO1A 3ONNA 1N57A 4CNBA 1N5JA 3AG6A 2B82A 5C18A 3KWFA 3VU9A 4QFBA 4PGGA 4WZAE 2ZVPX 1W4ZA 2WDZA 4KRGA 1NUAA 1BU8A 3AQIA 1SB9A 2NQ8A 1DBQA 2JFHA 2BEJA 4C4OA 2VP4A 1G8FA 4CV1A 2VJBA 4P7FA 5HCNA 2NYAA 2H0QA 4ZOEA 3BZBA 3ZXXA 2QVXX 4BNIA 4IM7A 3Q6IA 3SM9A 1HNNA 4YGXB 1L9XA 4AJHA 2WM8A 3LI2A 4DLKA 2DUMA 2JASA 3GJ4A 4G0VA 2ZR7A 1T43A 3CZPA 5A71A 1MOZA 3UAVA 3PUHA 5E7MA 4UFOA 3EXG2 3TLKA 3CBQA 4BMCA 1GNPA 3G6KA 3JASA 2PH7A 4GPTA 3CINA 4DB4A 4R98A 3TDKA 5J4YA 4GSLA 3TSAA 4K81B 2WT8A 3DSRA 5KYWA 3PPIA 2HPZA 3UK1A 1A9XB 1B74A 1BGXT 1VMIA 3HUDA 2BRUC 3K5HA 2HHLA 2QUBA 3NXSA 4DABA 1C3LA 2R66A 5ILGA 2LVBA 3TW8A 2BFMA 4EG1A 1XRJA 2Q0XA 3CRVA 3NCHA 3R9IA 4RA6B 1QM5A 4F85A 5KTKA 2XX3A 3PSHA 3DWEX 3GOQA 2RE8A 1PK9A 1R4AA 1PJZA 1ZKDA 2G5GX 2PE5A 1P5RA 5FJIA 3A1DA 5E4JA 1Y6RA 2HFJA 5JHHB 4GM1A 1CUZA 2WHXA 1M1ZA 1MAWA 4I50B 3G0OA 4KMRA 4BGVA 4AKHA 3KZMA 2BCGY 4OU5A 1F0PA 5EXPA 1ISIA 1NQOA 1OV4A 3KEQA 2WP0A 3WLPA 1VIMA 3VR4H 1OVMA 4GPZA 4KBGA 3A0RB 1U8UA 1WEHA 2WICA 3N74A 1G9XA 1Q2XA 3HFGA 4Q9NA 3RU7A 4ZEOA 1IDOA 3NT5A 3PJEA 3GC6A 4NFLA 4RK1A 5FF9A 3MGGA 2OSVA 4CHGA 5A7FA 2HLDA 2J9RA 4R6XA 1ULTA 2AYYA 2W4IA 4L4RA 2A9QA 3G5LA 4L0QA 3VHLB 4AS3A 4A92A 1DO2A 4YB8A 1GAJA 1FYWA 1NVVQ 3KL2A 3KLMX 4IH9A 1YZGA 4XXHA 5K8JB 4ZODA 3QPWA 2DPXA 4L8YA 4H6WA 4CLEA 2Y67A 1IJFA 4O3MA 4UC0A 5HJEA 4YT4A 2QWXA 3WB9A 4RKWA 4YT2A 3U80A 1WHTA 3VHQA 4KK4A 5EZSA 2R4UA 4NZNA 3FTQA 5EGSA 3U5TA 3N8KA 4FCVA 3SZUA 3H11A 4IPTA 1MABA 3AUJB 3DBRA 3L18A 4DJAA 2W43A 2O9JA 4MLCA 3BD7A 2PV0A 1ZA2A 4O4HA 3TLBA 3ZLVA 4G5XA 3W78A 4E11A 5CA1F 2JLWA 4MJXA 1UXJA 3KZCA 3LXUX 1VLVA 2I62A 3G82C 4TWAA 1BMQA 3BHIA 1FTSA 1Y48E 1C3JA 3OQVA 1ISGA 2R2GA 4GYYA 4MI9A 3S81A 1E62A 1PN3A 3C14C 4KQ2A 3LT5A 1T35A 2HSDA 4GKAA 4N0EA 3TBFA 1IXKA 5HVNA 4Z53A 5DLEA 3PQDA 1W35A 3B52X 3ZVRA 5JATA 2EF1A 4UCFA 3N70A 4G56A 4JKIA 1JKMA 4YRCA 5E1DA 3SIRA 1IM5A 4DC9A 3JQBC 1Q91A 3D3WB 3L7JA 5C7IO 4ISCA 1ZL0A 3UMMA 2C2OA 1Y4SA 2FR0A 2A1UB 2GPSA 1EVEA 2XMSA 4H27A 4OVKA 3TMKA 3TLCA 3AM1A 2FZWA 3K0AA 3FH0A 3FDXA 3MWFA 1BC5A 5AVQA 1DJLA 1JWLA 3ICQB 2JIQA 3AILA 1EE2A 4HRVA 3MWLA 3A1UA 4W5RA 3VHXB 3DZIA 4EVRA 3G1WA 3ONWA 3HJTA 3PQ3A 4NU5A 4AJ1A 4EPWA 2YZ2A 4C2AA 2ZR8A 1YB7A 3O94A 4JYBA 4LEIA 5T6MA 4D4MA 1NXQA 1DS6A 1T1EA 3HI6A 1ZD8A 1AD2A 1UT8A 1FFBA 1T4DA 2GBFA 2VZLA 3KUCA 1CKEA 3HVRA 4EZEA 1HE4A 3C1UA 4I5EA 2H9YA 3HO6A 5FAKA 1GG2A 3ELBA 3I6QA 1ZRMA 3TR6A 4MB6A 4UTVA 3U1VA 4N5IX 1GT91 1H22A 1O6GA 2HHCA 3PGJA 3S1LA 3KOZA 1L4LA 1B8OA 5LP6B 4E4RA 1CS0A 4EKEA 3C5VA 1GITA 3V8EA 2JHPA 2Y99A 3OD5A 2X6RA 3ET4A 5G0UA 3WSTA 5DM4A 5JJIA 1JL3A 1KI8A 1KORA 2A0WA 2PX0A 3TIXB 4EKDA 1JHMA 5FI0B 2C9DA 4YUZA 3WBFA 4GSKA 3T3OA 3QE4A 4LBWA 4FBLA 2V3WA 2D8AA 4HOYA 4Y9RA 5EVCA 5B64A 2WF7A 4I5FA 2NUBA 3EXAA 1IOZA 2B1IA 4FI3C 4MRPA 4Q00A 2QN8A 3BPSA 3EGEA 4AMVA 7REQA 4ZGGA 3SG0A 1M33A 1SQ0A 3O0DA 3HRKA 4DUGA 4CR7A 3JR3A 1R0XA 2X4GA 4NOLA 2F90A 3NRBA 1C80A 3MINB 1G1AA 1NUQA 2AMJA 2SECE 1ZISA 1NW6A 1G8PA 1S7GA 3IKVA 2QKYA 2JH9A 4D3XA 1QNFA 3H1EA 1UP7A 4RD6A 2OXIA 2O2HA 3PR2B 5D5HA 4ZVMA 3F5SA 1PR6A 1FFHA 2GVDC 4EW2A 4D6PA 4TQAA 5ALWA 5EXTA 4IKPA 4YV7A 3PQ8A 4JWTA 1DSSG 4RZ2A 3ZJ4A 2CZGA 4U2GA 5F3WB 5CITA 1IPEA 1AZSC 1D07A 1EFVB 2VF7A 3IPLA 3ECAA 3OO0A 3BB3A 5CA0A 1NSYA 4DIKA 4RIFA 4OMCA 1MORA 3GEHA 4QUGA 3UAGA 3O91A 5MN5A 3H5VA 2CD7A 1OE0A 2HIHA 2BT4A 4YP5A 3HJFA 1DHRA 1I1NA 5ADHA 3J81A 1J7JA 2XZOA 1N8SA 5KREA 1UFKA 2OFWA 3ZOZA 1Q50A 3VPXA 4C6HA 1B6GA 1U0TA 2IS6A 2AF4C 3GLHE 1JEEA 3I04M 4DV1B 1W5FA 1GNLA 1Q14A 1VJCA 4C05A 5TX7A 1Y7IA 5CH8A 2ZJ6A 1SY7A 4MW5A 2P9CA 4EYKA 4MP6A 5AK0A 5AW6A 5LOVB 3DE2X 5JDCC 2RH5A 2QTVB 1YFKA 2ZE6A 4QATA 1X39A 2D2IA 2G71A 1QJ4A 4KI0A 3WB2A 3ZNPA 2O7QA 1RM5A 4AX4A 4DQUA 1W94A 2FWPA 3KOOA 1EUDB 2RBGA 3G1TA 3WLOA 5LPNA 2OCYC 3EG9A 3KVOA 5TPWB 1QG0A 4ZDKA 2FQXA 1B2LA 2FN3A 2PZGA 4KXWA 5IJ0B 3HC7A 1LBEA 2P6PA 1SKAA 2OZLA 2WU4A 4YY3B 2FQ1A 3CX4A 4KWHA 3FMGA 4CMEA 3AIOA 5ITZA 2C2XA 4HN9A 3W6UA 3ESBA 4V1CB 4FB4A 4Q9HA 5I4CA 2W58A 1QX4A 2O8CB 3QU5A 5C3UA 3VDRA 2E1RA 4WBXC 1QHSA 1W0JD 2XUOA 2ZJ7A 3BWDD 3WYEA 4B0OA 2VQ6A 1U3UA 2D7CA 1ZU4A 5TB5A 3LU1A 4LSWA 3STWA 4DJJA 1L6IA 4V03A 2PJRA 2YHUA 3ZWYA 2O50A 2XOEA 3OLQA 1M7HA 3W8RA 1PYDA 4QIHA 2RHCA 2GHTA 1IXZA 2P2YA 3INGA 2FXIA 3I9KA 3T7AA 4BFTA 2NTNA 3PWZA 3AY6A 4I19A 3AESB 5CPBA 2Q27A 3I8XA 1OC2A 1JFFA 1QORA 3JQ8A 4FKBA 4MEAA 3RJ9A 1JYEA 1NYLA 1UEJA 3LECA 1L0BA 1XGKA 2XRMA 2PRKA 1IXSB 1WP4A 2BGJA 2P69A 1E7YA 4ZHQB 5IT9A 3K1YA 2HRBA 1NN0A 2ETXA 2ORED 3S2IA 1GAXA 3Q7RA 3B12A 3UH1A 5KSOA 3KUXA 1K0UA 1PNTA 4GI1A 2J3HA 4X64B 4BQQA 2JFUA 2OBLA 5CP8A 4JODA 5CPFA 2ZVQX 4O2BA 4ACBA 3ORHA 4F0JA 1IG0A 4A7PA 2H06A 4BKUA 1J8FA 3B85A 5T4HA 3ZZNA 2GWHA 1G5TA 2JGAA 3R09A 2NZ2A 3SR3A 2WWYA 1CK4A 4L1KA 1GQFA 4L7VA 3TIFA 3ORRA 1AN9A 3K70C 3MSXA 5LQCA 1ZD4A 1OYOA 1QGYA 1ZH6A 2PBLA 2PS0A 3P5SA 3F78A 4FE3A 2O20A 4XD7D 5B3JA 3PJRA 3TGPA 3LP6A 3ODGA 3EXIB 2P75A 5CYGA 1NC1A 3LQ2A 4KRXA 2IBSA 5HA5A 1Q77A 2VBIA 3AETA 5K1ZA 3V1YA 3HU1A 5JAPA 4HDSA 1FMCA 4M6WB 3BULA 1AKMA 4LXGA 1VC2A 3EYWA 2O2XA 3SC4A 4TMWA 5E0KB 3AEXA 4A0GA 1SK8A 5HMMA 5KNCD 5D3ZA 3RJMA 5KHOC 1T3ZA 3JPYA 1QRDA 5KWVA 1BGVA 2HQ1A 1EK6A 2FSHA 3K5PA 3BFVA 3WWCA 3LQRA 1KF0A 3U4CA 2RAUA 1JF8A 3GUHA 5KI6A 2C2ZA 4MP8A 1JKJB 1RJ9B 1FA9A 3ZDDA 1U9ZA 3A27A 1L6RA 2FW6A 4Q1DA 4X1KA 1IB0A 2I99A 1M34B 3KKEA 2IHJA 3Q40A 4EDFA 1UOPA 4EUEA 1Z16A 5L3QB 5IULC 1KSGA 2NPOA 4MYDA 2AC4A 2AMLA 2H08A 4M0CA 4B4KA 2X2EA 4HB3A 4DCSA 2YVLA 1GT6A 1NV8A 4DLUA 4B48A 1XDDA 4C4XA 2VDNB 3THSA 4LJRA 1S4MA 1DLJA 3MIIA 2TSYB 3H2GA 3OC0A 4HVLA 1M83A 4ZICA 1QTRA 4BASA 4H3VA 4O5AA 1E3SA 3ZZ1A 2EKZA 2IIPA 4OBXA 4EY3A 2QMOA 3L8GA 4GZ5A 1B15A 2VHJA 2IX9A 1XZFA 4FWIB 1WXFA 4JOSA 5FBHA 4KNYA 4EPXA 5FPPA 4YCNA 1FFSA 1GGHA 4LA4A 4NEGA 5A4JA 2YXNA 1NIPA 2D4HA 3GJ0A 2XMBA 4IGFA 1OH6A 2QDXA 2QTBA 3C8UA 3GUUA 4QJBA 4BFYA 4KYIB 2RGYA 4QHYA 4E3WA 2HUPA 3BWMA 3DP7A 1TF7A 5I8PA 1L7BA 2FUG1 1FVFA 2OUIA 3RRYA 5KCMA 2PQ2A 2XCRB 2WD7B 5E1MA 2JLBA 2WSSD 1EFKA 3NS7A 3QF7A 4JAVC 3DLCA 4QM7A 1F3OA 2GAJA 4B7ZA 1DCMA 2ZIUB 1R6VA 2OZEA 3OFSA 5KZMB 2OCBA 3C5CA 3SF8A 3MYRA 5ALMA 1JS1X 1M2KA 2P9HA 3MFQA 5B58C 3D7LA 2G25A 3LX8A 3A6EA 3IVAA 4I66A 5K09A 3UJNA 4ZI5A 2NO9A 521PA 1KNQA 1K8XB 1Z4OA 2D0OB 4A2WA 1IBLB 3KHUA 2B6NA 4B47A 1WKVA 3ZV5A 1W0JA 3WJ7A 2D1RA 1EG7A 2K5UA 2XCIA 4JOCA 3JQAB 4OJTA 1XCOA 2AB0A 4PO1A 1X7YB 1E6MA 1Y6JA 3OX1A 3NYQA 1SRRA 2VH2A 3A2KA 3VKHA 3H0CA 3VR5A 1NM5A 2ISSD 2O6LA 5IYZF 2XEDA 1O5OA 3NNNA 1RWKA 2YQ4A 3KHKA 4LDQA 3OD1A 2FEPA 1NQVA 3MJFA 4C7OB 3NP9A 1LNQA 5AXCA 1N4AA 1TA4A 5FQOA 4RL4A 1IWOA 3QVWA 3UN1A 3B5JA 2CNKA 5IC6A 1IHDA 1HL3A 3OEED 5CDFE 3NBFA 1MAHA 4R16A 1II8B 2HSJA 1BW9B 1Z0FA 2FQYA 4G9BA 3AFHA 5A9SA 5KWIA 2QLFA 4ZOCA 2O2IA 3KOXA 4L15A 3WLIA 4DMRA 1FS5A 4WY2A 3D2BA 4M2LA 4EA9A 1ZN7A 2G72A 1R0CA 2V8OA 5PNTA 5JZBA 3EPLA 3QHAA 4INPA 4JLPA 4OM7A 3W3AD 4DKJA 3GEBA 1PR1A 1UBKS 4JA0A 2IUUA 4AWXA 5BVHA 1XTTA 1U7PA 5EJAA 4OYLA 2GHRA 2XI4A 3G9ZA 4QFDA 4O33A 5K20A 1QDEA 3E7DA 3EAFA 2IXFA 2QXUA 2HDOA 2VC2B 3IESA 3R5TA 5JCJA 2ES4A 4EYGA 4NOJA 4WUTA 5IBRA 2AX4A 1ZXLA 3RVSA 3CUKA 4S0XA 1PGNA 4NICA 2E85A 5EXEA 2D4AA 1ATIA 1JJIA 4E2YA 3TNDA 1DKUA 1TECE 1BE6A 1EK0A 1H4VB 1PFUA 3ORFA 4PHFA 4J76A 4LY6A 3OUZA 5ICFA 2ADOA 2AWNA 2KSQA 4MWZA 3OP1A 1BE8A 4H7DA 4JC8A 5C31A 3UG6A 4YUXA 5JROA 4WLVA 4Q9LA 1V25A 4XD7A 4HLQB 3MYYA 1VL5A 2LP4Y 3GJ6A 4NBKA 4NQZA 3BF7A 2QL5A 1U0EA 3AVXA 4RTOA 4JI1B 3IO3A 2BJVA 3PEYA 3O4RA 5FWNA 4WVFA 1SBZA 4KFRA 1YHYA 4BV2A 5A06A 4JYAB 1PI3A 1EXDA 1L4YA 2Y0EA 4LWOA 1BCSB 1DUSA 3EOZA 2PLAA 3NONA 4K6HA 3W4IA 3SX2A 3IDQA 3T7DA 2JAXA 1A2OA 4CMEC 3H84A 2J3IA 1L4BA 3WZ2A 4GW3A 2VUUA 1R2QA 4XCVA 1F9EA 5TJ9A 3S2YA 2WUDA 4WLEA 4WLOA 4IP0A 1XNQB 4M36A 5JS1A 4NYJR 2J0QA 2GO1A 1IUPA 3IILA 3E3NA 2OD9A 3I6ZA 4FHGA 1JG1A 4QU0A 4X71A 4MJ7A 2AG8A 4ETWA 2K6GA 3WL7A 5JVDF 4Q1FA 4NU6A 1R4NA 1MQSA 3TW6A 4QJ3A 4GQAA 3E2PA 1MF7A 1Z2AA 5DGXA 4KIUA 2VDJA 1NFQA 2XDQA 4HGNA 5LNK6 2BFCA 4TX1A 4AUMA 1BQEA 2WT9A 3Q9SA 4DRXA 3PPYA 4QT0A 5BMVF 3Q7SA 1N2GA 4REMA 1FVXA 3HWWA 2XTJA 3KQWA 4DT1B 1PG5A 3M49A 2IEAA 2LE0A 1N1MA 2QTFA 4XVQA 3SJAA 2ZJAA 2CMDA 3SVTA 4GWGA 2XUKA 3DBIA 1ZYUA 1Z5GA 2P6OA 3ABSB 3LZDA 2WJAA 5BURA 4MH0R 3QUAA 1QHFA 1Z0UA 5CT6A 3IULA 5CNIA 2I4NA 5KKAA 4FFPA 4URUR 1E5DA 5E95A 1E5QA 3N07A 4KPFC 1P2UA 2F1JA 4Q4CA 1FEZA 2QMUA 2CFSA 2YH2A 2IQIA 3OTIA 2EHDA 3FBTA 5JZVA 1O9BA 1RCUA 3LG2A 2O7NA 3OQJA 5HF6A 1C3EA 4BBPA 3KX2A 1DCFA 2R5WA 4QODA 2ZQYA 2IS1A 3KAKA 3B8HA 4MO2A 4UOZA 2R3SA 4MV1A 3EXFA 1UMKA 2Q3BA 5K0NA 5EIWA 3SJ7A 4IDBA 5B3JC 1I8TA 1NRIA 2BH9A 2EW2A 4X1IB 1KI1A 3SQOA 4YMWA 1CQJA 1DG3A 1L7RA 1QJCA 2JZNA 4Q03A 1QK3A 2VQEB 2O1EA 2ZRGA 5FEUA 4IDDA 3AVVA 5JPDA 3ZWMA 1ZWLA 3T95A 5JSFA 1NBMA 4N3BA 1PWZA 3Q9UA 5DN6D 2C1XA 4L07A 2RJOA 4URFA 1H69A 1L7OA 2WIBA 2YJ3A 3LCRA 2RGNC 2P9JA 4K8RB 3WSVA 1EP3B 2Z83A 3ZHZA 4D43A 4DCVA 3JTEA 3R1IA 1H3EA 3UB3A 2COUA 4JSRA 4S12A 4M0EA 1C1YA 1GKUB 4KHZA 1QYWA 4YH1A 3ZQUA 5JYEA 2J9XB 3LKDA 5ES3A 3LY9A 4G8JA 2XE8A 2GD6A 3L46A 1L5WA 3WKEA 4ZTUB 4RUKA 1F7UA 2P8JA 3KR0A 1E2GA 5EPUA 2WJYA 5EHQA 4CLDA 2IHNA 4HUJA 3U7IA 2HEIA 2IVZA 1BKDR 3D6JA 2JIZA 3OEEA 3IVXA 1DTWA 2Q4DA 3R2JA 3A7DA 3HXLA 4LZWA 3RGGA 2I1WA 4WV3A 3AGPA 4BP3A 2Y9MB 3RKRA 2IZOA 4X8MA 4C0WA 4LFAB 3HXKA 2JGKA 4EZIA 3WDLA 4I9UA 1A8PA 4MVCA 2OWEA 4CT0A 1WOMA 3K6SA 3R6DA 2OVFA 4GMFA 4YV0A 1G59A 4JJGA 5BUSA 4KZKA 4LJYA 2QG6A 4R7GA 3A0UA 2AUTA 2J31A 4I1IA 1J25A 1W581 3HYCA 4LWPA 3INTA 5GY7A 3ZCPA 1V2HE 2UZ3A 4RNCA 2WFLA 2EFYA 3GEIA 1VI2A 3CNHA 4LRTB 3ZZMA 2ZZNA 4AZ0B 4F8YA 1V8PA 4MV9A 4N7BA 4RPGA 4WIAA 4OQNA 5LBIA 5CGQB 4OHBA 2Z1DA 3R7WA 5ECGC 3RV3A 1I2BA 3MQ4A 2W2KA 3OUUA 4RZ3A 3UUWA 3SBOA 3K71B 5CLLA 3WMFA 4EB8A 1JEQA 2ZUTA 2FMKA 3WDSA 1WUTA 1N9KA 1K2WA 1UK8A 3H3XA 3KT8A 3SGLA 3FIJA 3P2JA 4F1JA 4XJVA 4LHXA 2UYQA 3FN4A 3I8OA 5IJWA 5HXAA 4LF4B 2BE7A 3PQ5A 2ACVA 1KYIA 1TVKB 5EERA 3CB4A 4FW8A 3SJZA 2BM8A 1E4EB 1KFJB 3B3AA 3V8BA 3NDPA 2NXJA 4KLRA 5CIQA 3AIIA 2Y1WA 1A72A 3KSZO 1RPNA 3EDCA 3L07A 1J5XA 4LCEA 3ZXYA 2A5GA 3CBGA 4G1BA 2JGEA 2XUIA 4JJKA 1SU7A 4AO8A 2MMGA 1ZVJA 1XRSB 3MTAA 2IXGA 3IUQA 2VCHA 1C9DB 2C97A 3ENVA 3OA0A 4O1IA 3BFPA 3KVVA 4P7GA 2QVLA 4PZAA 2GF2A 4IIJB 4YYEA 3GNSA 2AG6A 1E8MA 2BFDB 1CY6A 1CE8B 1TCCA 4M98A 5FI1B 1NM5C 4E14A 5A0TA 3HJBA 5I5GA 3MSCA 1THZA 1V7ZA 3MB8A 4W8OA 5JLAA 1E7QA 3ROQA 3CFYA 4KQWA 4BVLA 1TJYA 1UT5A 3C43A 1FPMA 3DVSX 5AMXA 4P92A 4S2UA 1QS0A 2YUTA 3GJTA 3DBOB 2OGZA 4JSTA 3OCXA 3JZIA 2J41A 2VZEA 1VPTA 4HXEB 4QNNA 1ZIOA 4AM8A 2V55B 5FLYA 1P6UA 4AJIA 4HX9A 4G01B 4ZAZA 3EZLA 3V4OA 3ZW8A 4EY8A 2BLNA 5EEHA 1HQDA 4GF5A 1A0OA 2NU9A 2C0PA 4O2AB 4BNLA 1QQBA 3GG2A 4DPLA 4DA4A 1MFZA 4DG8A 2EWVA 1KRHA 1DXHA 3L49A 4S1OA 1T4CB 3CZ4A 4CM4A 1K3FA 3E82A 3G8BA 3M1LA 2HA6A 3QUQA 4AMUA 4F04A 3P0HA 2HU7A 4EW6A 1BA3A 2YRFA 1TUIA 4F4FA 1SVNA 1FDIA 2DB3A 4IUDS 2YS6A 5EVJA 1GUBA 1T1SA 1IK4A 2ZTLA 4IXDA 2MOKA 2XVYA 3R5FA 1XEAA 4DJFC 1T8SA 5ALHA 3E9RA 3KKNA 3L2OB 2VYVD 1PL7A 3I2YX 5H82A 5CX1B 5IP5A 3WDKA 3VVBA 4MV7A 1N2CE 4PANA 4OHWA 4K40A 1PKEA 3W5HA 2IDZA 1FNCA 5JANA 2YN4A 3AR7A 1NT2A 3MXOA 1V48A 1GZ4A 1I6MA 1KGSA 1DI0A 1VBFA 2GBLA 2ZE8A 3QTBA 4TZKA 1LC3A 2FETA 4RESA 4RACA 2G8LA 3EA5A 1NP3A 1QH1B 2IZ6A 1QRAA 2VA8A 4OJYA 4Y1GA 3HPRA 5FNVF 3PEUA 4NATA 4OLBA 3MUNA 4PC3A 2ZGVA 3QX8A 1OFTA 4LMPA 4YNBA 3GDOA 5JBQA 2P91A 2ODTX 2VYND 4IHAA 4Z1OA 5LLSA 1DJQA 3AFMA 4NG4A 5C81A 1NBOA 1KPGA 2JEZA 5D5QA 3TO5A 4DQ0A 1L7AA 4FILA 4G5OA 1BGWA 2AHRA 5GIOE 4F1WA 2YZNA 1SVWA 4LVCA 1I94B 4AG5A 4KBYA 3W5SA 2FDCA 1MX9A 3N3AC 4QU5A 1UH5A 3NAMA 2RGBA 1LDNA 4E4YA 2R87A 5DBEX 1T2EA 5JNVA 1QLJA 4QJ5A 4X85A 5H7XA 1JDJA 1GDHA 3INYA 5CA1A 3ER9A 2EWWA 3CNOA 2C3PA 4LCBA 4DV6B 5G02A 2BI7A 6PFKA 4KQXA 3IUYA 4FMPA 2FA9A 3FHCB 3AL3A 2WKWA 3O4JA 4DNPA 5I5EA 1JQ5A 4TWRA 4DTIA 1PV4A 1UXKA 4BE4A 3KXLA 3L40A 2QE6A 1T2AA 3GT3A 4IIVA 2IV7A 5F5LA 3RRXA 3DYBA 3IEPA 5FBKA 3UAXA 4F9EA 2X7HA 1G2OA 4MS3B 3ZU4A 2VDRB 4I4LA 4UULA 3HNOA 4XVRA 2EZ8A 1AQNA 5DHFA 1K6EA 3JZFA 2VVTA 3I5AA 4OYHA 5EKTA 4Q37A 3RUEA 4FNGA 1ZW6A 3LUDA 2XRZA 3DGFC 3NPMA 3ZZ0A 3RBZA 1C4OA 5JAHA 2VP5A 2PGNA 1U3FA 2FEAA 1YQUA 4UXIA 1SK9A 2XKKA 1NLYA 2LCFA 3QKIA 1YDGA 4C30A 4G25A 2CMHA 4YXWA 5BWOA 1OFHA 2XJ4A 1WW2A 4LV5B 1ESCA 1VECA 1G41A 1KYXA 4U5QA 2XYRA 1ZUHA 1TCUA 2BFBA 4PINA 4TMFA 3RYCB 3I53A 1P1FA 4NRDA 2MWMA 3PC8C 3EG5A 3ADPA 5A1JA 4MR7A 2SNIE 1TQDA 3GQBA 1ZK0A 3UH0A 3N05A 3IPYA 4C6SA 3RSQA 3ZBTA 4S04A 4H0CA 1ZUNA 1IEVA 1YZLA 3HR7A 3RKSA 1JEYB 5FR1A 2M2IA 4MR8B 3IOYA 1ENYA 1CIPA 2R751 2B8EA 2DZDA 2VNHA 3NXKA 4UMVA 4BXOA 2Y71A 4BO5A 3C7DB 3A6JA 3H6KA 1J0CA 3D2CA 1U04A 3M7IA 3PE4A 4GKBA 5BQOA 1UXOA 2YIMA 3IDAA 2QN6A 1OAKA 4FHCA 2PX5A 4HAIA 1NMQA 3DEZA 5I3CA 7MHTA 2AZTA 1YCHA 1HT3A 4X54A 5IEJA 2ZUSA 3TPZA 1MO3A 4QD3A 4YMVA 1SCIA 2AI2A 1YV9A 4Q34A 3DFFA 3DLBA 1APBA 1BWRA 2VHUA 4TKLA 1BA2A 3QELA 4D81A 1GV0A 2ZAIA 1U2RA 2PQMA 2VPYA 4HMOA 3SLGA 4F4JA 1Y9DA 2H1SA 3DQQA 4IILA 4Q24A 1GA6A 2VNKA 2YOHA 2VRCD 3EW7A 3GFRA 3HCEA 3PNKA 4ZQCB 2PMWB 3GT7A 3SVZA 4XTCS 4MKXA 4HDNA 3DE4X 3EEFA 1EFPB 3R3HA 1IEWA 3M70A 4FEYA 4K3VA 4M0KA 4NOMA 4UUBA 1YB4A 1D04A 2GEJA 2GM9A 2AMFA 3K0FA 4YEDA 1X92A 4NBRA 5CT5A 3WNQA 3TECE 3K30A 3FR8A 2IODA 3PFCA 5JXJA 4ZMRA 5FO0A 4XKJA 3R5KA 1IBSA 2PZ8A 1TMKA 2FG5A 2WWRA 1Q84A 2GZDA 2R86A 3GVXA 4O1HA 4IOMA 1R8QA 2JC3A 3KLBA 1JH8A 1K75A 5FYQA 3GEMA 1D0VA 5A0VA 3QWAA 5CIWA 5BRJA 4N8EA 2VSXA 3HUFA 4URVR 4ROTA 2DPMA 1P7CA 2XODA 4F8JA 4GGOA 2VYVA 1NP6A 4A6PA 4L2IB 2VAWA 2GLUA 4AY5A 2JKZA 3EHDA 5L6MB 4WBNB 4U6QA 5ITSA 3IP6A 4FHDA 2ZBUA 5DM0A 1M5UA 5IEBA 2P4QA 2YC2C 4WXRA 5JS8A 4RXUA 2GCOA 5AJUA 4DBLC 3DCJA 3TIIA 3KETA 4L27A 2ZT5A 1TYZA 3VVMA 3KJIA 1GKKA 3JSAA 3SR4A 3X1MA 4DLAA 3TKLA 1XD2B 1O5TA 3KXDA 9MHTA 1YNSA 2FZVA 2V7EA 5KYNA 2H65A 3TQFA 3ZKWB 4BP9A 3AU8A 3AUAA 1OROA 2BEVB 3KQYA 4WTOA 2VUIB 4RGVA 2ISQA 1ZUWA 2Q2WA 3WNZA 5CCXA 3DE3X 2O3TA 5JJBA 5JUWA 2RH8A 2ODPA 2V96A 2Z4RA 4KWTA 1JDZA 1N5OX 4BLVA 2O8EB 1N5LA 2J8ZA 3VAZA 1DX4A 1F2TB 2FZ5A 1EBBA 2O2ZA 2X5NA 3DO8A 1Z34A 4Q7MB 3FSGA 2A92A 4LE0A 2IXEA 2PUWA 2D5CA 1X38A 2PZJA 3L0PA 3LDUA 1E77A 2WHYA 3FCXA 1ESNA 2WP8J 3RHFA 3UW1A 1K9SA 1VL8A 5EMMA 3MJDA 3AR8A 2VNSA 1YT5A 4HLDA 4RF5A 5SYAA 3D4OA 2XAAA 3I9V1 3OJFA 4JGIA 3OPNA 2YCLA 4JUIA 1Y6GA 1L5HB 1DINA 2VH5R 3RS0A 2JHAA 3P9XA 4DCOA 3HQ4O 3NVKI 2H31A 1FDRA 1ZCZA 2VPZA 1JDPA 3NNSA 3BRSA 3CH7A 3GLSA 1IN6A 2B7LA 3F6CA 3RABA 4HX5A 4A2QA 5BUZA 5EJEA 2YKGA 4L0CA 4U00A 2IL1A 1T1JA 1SCBA 1HSZA 3EGWA 1PT7A 2M6RA 4TXJA 1WZEA 4NAHA 4RPIA 3AB8A 4I1PA 5I9MA 5HFNA 3WL5A 3Q3GE 2CDAA 3QLJA 3PUXA 2BFEB 1CRWG 1XVLA 1MVLA 3CSSA 3P20A 2RKWA 3N2NA 4NARA 4J0DA 3CRW1 3MEQA 2WZBA 4CKCB 4D9GA 4PAOA 4UBOA 3JWHA 1XELA 4N12A 3Q6NA 4W5OA 2X42A 4RJLA 3DL2A 1GAQA 4AWAA 4MGZR 1E1NA 1JDSA 1P0CA 2GBLC 4B2LA 1FP7A 3AHFA 2I1VB 1SHLA 2J09A 4IS3A 5FO1A 3DYVA 3GLKA 3PEWA 2JI6A 4HDCA 1CDDA 3HUTA 4OJMX 5ESXA 3SPXA 3TRIA 3VPHA 1P61B 4MKGA 2XVZA 4F7DA 1XZCA 1RNLA 1WQ3A 2EFDB 4HZGA 2OZPA 2EJCA 1JDBC 2VPPA 2J5BA 2B36A 1E3IA 3A4LA 3CRMA 4MNTA 5FCDA 3S0JA 4U7WA 1E96A 1PT8A 4HHEA 3OY2A 2DM6A 1YK0A 1A9ZA 2VHWA 3AIMA 1H9BA 1DCKA 2I91A 5BSFA 2C2GA 5L3SA 2BWJA 2G0TA 4LOLA 2P9FA 1V4BA 1KYWA 3TFQA 4AIIA 2OB1A 4C0LA 4F3TA 4EJ2A 1YGPA 2GEVA 3RSHA 1LFAA 3C6YA 3RBXA 4ZDIA 3E03A 3LW8A 2J33A 4J1QA 1EVIA 4J8PA 4KACA 5AVSA 4C89A 3ESYA 4C6RA 1NJSA 1FLDA 3KYCA 2QT0A 3LZCA 1UPCA 1M8GA 2HT6A 1A8SA 4H7HA 4QQNA 4I4CA 4QJIA 4TMKA 1NT4A 4W1QA 4KH0A 3SS8A 4E31A 3KSAC 3URKA 2DY1A 2VRCA 3W5JA 1ZCAA 4JI6B 2LCIA 3MWDA 1HTBA 4AROA 3VGPA 5JV5A 1AKEA 4E5MA 5ICMA 2BHTA 1MC8A 3DAOA 3TTTA 3CGWA 2XR1A 5DBOA 5KOIA 5CB4F 5GAJA 1NN5A 5ERXA 3A58B 3PX2A 2JFQA 1YZHA 5TIIA 4ZI7F 1HURA 4CKBA 1X9GA 4A0HA 3MGAA 1DOAA 5CM9C 5KNDD 4CFZA 4HDOB 4O6VA 2WUVA 4F72A 5MN6A 4ZCSA 3N0RA 4DMUB 3ZWCA 3PL5A 1O96A 3HKDB 4G0XA 4OXIA 1M6HA 3DE1X 1XU4A 4YPVA 1FDVA 1XR3A 1WB6A 3C8ZA 3M4JA 3PI7A 4XUEA 1KAMA 3JRNA 5TS2A 2ZRKA 3TW0A 3Q1LA 4XD2A 3K0SA 1MIOB 2XNDA 4KXQA 3GPDG 1MV8A 2PL5A 1YRQA 3AV0B 3DZ8A 4L78A 1WXWA 2XVXA 4GLOA 4EMTA 4UUNA 2F8SA 3MMSA 4IHJB 2FTKE 3HWSA 3TQTA 3O31A 2P11A 3DDUA 2HL6A 3FZGA 4RF2A 5EXXA 4OHRA 1NVWQ 3EZGA 4Z0HO 2OFOA 1JMKC 2OOKA 2Z8YM 3OCYA 1H0HA 4LSZA 4WXHA 4EWLA 5LC1A 4B1FA 3IHWA 1WCIA 2RGUA 3B78A 1K2VN 2ZT8A 1W48A 1X7GA 5EUCA 1RAEA 4FQ8A 2CVQA 4HN4B 4P53A 4H0NA 3ZGXA 3BMXA 5TF4A 1XXHB 3OEWA 4RPLA 1A9OA 2PANA 3LXRA 1H8HA 3NNDA 3ZGYA 4JX8A 2II6A 1GAWA 4KOAA 2HCJB 5JY1A 1A50B 2B4QA 2GS9A 4RIHA 1E1MA 1Y6FA 3AH8A 6REQB 3W1WA 4IFTA 5P21A 3U17A 1P44A 3EZ2A 2G82A 4EKIA 1UDXA 2QRHA 2OHXA 2G63A 2NZYA 4MEJA 5G1PA 1IULA 2Z4TA 2PZMA 1U5CA 2A7XA 2M1ZA 3II6X 4TXLA 4BZPA 1YE8A 1PS8A 3L4JA 4DNOA 4FINA 3C6BA 3NEPX 3IHLA 5IYZA 5C1PA 2XTZA 1CJSA 2XTNA 3UICA 3WGKA 2APJA 3WHLA 5BYKA 3R6LA 1O6FA 3R3JA 2RK4A 1LU9A 4AMBA 4IQ4A 2WHQA 2A33A 1N6NA 1I2ZA 3GMSA 3I64A 4EM6A 4EB3A 4Z3OA 1TJ4A 2CWWA 4ZK6A 3OKCA 1D1PA 3PITA 4HZUB 4M76B 4UHBA 3OTWA 4ZVRA 3QPBA 5G3YA 1A4UA 3BGDA 1ARZA 1WZUA 1DV1A 1Q0ZA 3VR2D 3R77A 4EELA 3FGPA 1DAFA 2VEDA 3HVKA 3PCTA 3PC7A 4PYIA 4A91A 1IWPB 1G8GA 1UPTA 3QKWA 4X9XA 4CVNA 4J90A 1NAHA 3B3JA 4WESA 2Z2XA 2EKLA 4RENA 3QI7A 1CY7A 1Z0IA 4YR7A 5JC8A 3D3NA 1CUCA 5AJTA 4RDXA 3JZDA 2H2DA 1M2VA 3DONA 4Z8YA 3T7TA 3DV2A 4AYWA 2OPBA 2B0CA 1Y63A 5CLHA 3LT1A 2CY0A 3KS9A 2XWJI 5J2TF 3GCGA 4R51A 1L5LA 1OLSA 2IOFA 1R5JA 3GZTB 4H1VA 4JL8A 1QH8A 1LC0A 2ZB4A 4X7MA 1J1ZA 1JJ7A 1KP2A 4MJ3A 4OI4A 4YP7A 1YB1A 1P9NA 4DLWA 2MDTA 1DAPA 1GQOA 1MG0A 3V3KA 3QE3A 1K4KA 3N3BC 4GBED 4WADA 3T7KA 2P41A 1AGYA 3LHSA 3EZFA 4CLOB 2R8PA 4LYYA 3R23A 5DGHA 2GPJA 1RZRD 1Q1AA 1GO2A 4LJ4A 4TKZA 4F5DA 1B43A 1K63A 1AV7A 1LJUA 2JBAA 3TL6A 3VFDA 5H0IA 4LZJA 1KH3A 4NYIQ 3BBPA 5CUQA 4UBIA 4N39A 4E15A 2V45A 4HGYA 3R7FA 5H4HA 1FZTA 1BN6A 1FTQA 5KC9A 3NV9A 1I6WA 2WJHA 2ZQ5A 3FPEA 4G0WA 5CNJA 2DFKB 5F1YA 3VC3A 5THXA 4BEVA 5FV7A 1LBHA 3W2TA 4J2TA 1ZD9A 2VQDA 5EJ5A 2UXCB 1TMYA 5LU9A 1YFJA 2FFHA 3MXTA 4O0MA 4S35A 3SJUA 1Z17A 2G7MC 2ZANA 1T8PA 1DB3A 1E4OA 2QRQA 2ZYIA 3OIUA 2ADMA 3PPVA 1VYUA 5JVDA 4GDFA 3IIMA 2PBZA 3RF6A 3WWDA 2OG2A 3LX5A 3IBTA 3STTA 4XDZA 5EP4A 4B79A 2R1UA 4JJ4A 1PJRA 2FUCA 1L1FA 3ZGNA 1KDZA 1TA9A 4YTEA 3F8SA 5BMVA 1BX3A 1X8JA 1W30A 2HO4A 1J8MF 1PSWA 2O7VA 3H86A 4PTZA 1DRVA 4BTVA 3O3MB 2AOTA 2NPFA 4JKOA 3E9YA 4MV4A 1U98A 3QWBA 2XUPA 4OQYA 4UE3S 4UQOA 2FPGB 3U4QA 1QHHB 3L8HA 2IH2A 3EXEB 3MS4A 4Y2JA 3U3MA 1BWSA 4WNCA 1QHYA 4NZMA 1PQPA 3FPGA 3L4EA 2C8LA 3M4YA 3NANA 1Z7GA 5HHTA 3WSWA 3IQWA 2R47A 3IODA 4R0NA 3P2EA 1U3TA 2V5UA 3Q0IA 4WOBA 3ZY2A 5LJIA 2IKSA 2QAGB 1J6UA 4OQZA 1WB9A 4MLPA 2I2WA 3RUPA 1NV9A 3TE6A 3QSYA 2ZUBA 1QGED 3ED1A 3N58A 4EHAA 5JSYA 3Q5EA 1Z29A 1PZXA 4DNXA 4IUYA 3DHNA 4RFSA 4TOIA 1SUIA 2JJ8A 4D8TA 3KOMA 5DHAA 2Q4EA 5I7WA 3QE9Y 1E2PA 4M0MA 4Z4FA 2IYXA 4LQDA 4BMPB 2ZWMA 1G64A 4G8CA 4E3ZA 1VG0B 2BEUA 1XMVA 3E15A 4M9CA 2AKEA 5DEOA 2DWCA 3JQRA 3Q3CA 3EDOA 1RTKA 3NKVA 4KN9S 3ZI7A 3WOVA 2BMVA 3U60B 1I32A 2GXQA 2AJCA 4ZT7A 3STXA 1TFUA 1AGXA 2FW8A 2FWNA 2YQ5A 4FR5A 3P4XA 1YIOA 3U3OA 4F2GA 3OQBA 2CBGA 4L7QA 3QW2A 1HT1E 2D8MA 1FQKA 1V1MB 2WNHA 3LKBA 4HDRA 4K6CA 4PYNA 5I9SA 3TR5A 1OPRA 1CU1A 2ZIXB 3PWTA 1UINA 3PUIA 1QOZA 1MG5A 3TAHA 1N2BA 1EVLA 2WTMA 1KK0A 2NWQA 2R1ZA 2IEIA 1Q11A 2QRPA 2LDXA 1N3IA 2QJWA 2XTAA 3KE8A 3GWZA 4FYYA 2KM1A 4ZV7A 2UYCA 4L0MA 4ODIA 4M7RA 4L5CA 4LDJA 4R7TA 5IM4F 1UMCA 4AKGA 1XAGA 3KD3A 1Z6XA 4XX0B 2YL2A 4O8ZA 3ZTYA 4FYPA 1AZWA 3P0IA 4ZO4A 1S8NA 5C5IA 4N54A 3SZMA 2E4WA 1BS9A 1E2NA 4IMRA 2CUKA 4ZC8A 4BNXA 3SOPA 3W5VA 1UBSB 3AR3A 2GSDA 2OD7A 3I2HA 5DFAA 2DE0X 3P8ZA 3QJYA 2WC1A 1H65A 2AKAB 3FPKA 3K72B 3P0JA 3TBHA 5LZ2A 2XD9A 1LEHA 1EWVA 3AF2A 2HWYA 2AH5A 4PAGA 5T67A 1RQGA 5LIRA 1K6JA 4XIJA 5AR1A 4Q3NA 2X41A 3HKCA 1NQWA 3WOHA 4O4IB 2O8BB 1WM1A 4CTMA 5FOTA 3WO1A 1O58A 1M8KA 3X1ZA 3MPOA 1E1YA 3AR6A 2I78A 1W44A 3DMDA 3NHAA 3PKIA 1REQB 2PUJA 1CY8A 2AOUA 2ST1A 1H85A 5E9QA 4LJ6A 1G98A 2ZI3A 1AXGA 3FYDA 3QKRA 2FOXA 3EVBA 1ZQ1A 4CT4B 4DSNA 5J3JA 3IX7A 4EJ0A 3NOQA 2ZUUA 3BWVA 1WIWA 4FYIA 1T9GR 1GOTA 2QT9A 4HVAA 4UU1A 2A9VA 1Z35A 2VK4A 1POWA 2AHOA 3ZE0B 4IO0A 1Q0SA 1P7VA 4CMKA 4L50A 2ECPA 3U44B 3P2MA 5BWCA 1NDQA 4DOMA 4YYZA 1QF6A 2OA0A 5KJEA 1RFGE 2Z3WA 2D74A 5AHWA 1H9CA 1SQGA 4PBRA 1X8KA 2R8OA 3QITA 2FYTA 1RZRA 4CTOA 4DARA 1W36B 1SIBE 1XU7A 4L95C 4R9VA 4DA0A 1FFDA 3BWEA 3KPWA 4QGGA 5E7QA 2Z3VA 1RPJA 3CEHA 3E58A 3TZQA 621PA 2Z1NA 3BD6A 3I61A 3TLZA 1CP3A 2HIAA 3Q7QA 3HEMA 3N75A 3RS4A 4Q4HA 3N87A 1UZMA 2IH4A 2RMKA 4Q01A 4IFBA 3GGGA 3NVDA 4PLWA 4YAIA 4ENVA 3ZD6A 2VDVE 3L7OA 1U8FO 4E5KA 2OQ2A 1QU2A 4PIMA 1RJEA 3BMNA 4LDZA 3LPNA 2W8BA 2HJHA 5K8LA 2AN1A 1RXYA 2R0QC 1CERA 2J3JA 1QOQB 4D3YA 3IJPA 2RHTA 3B20A 1E1CB 1C5KA 3PENA 1YJ5A 2NUPA 2XUZA 4QA9A 2DYKA 3QFHA 3U5ZB 2WNIA 4IXTA 3D2LA 1GZHB 3ABQB 1E2UA 4JU8A 4MQ5A 4QDKA 1NNSA 2RONA 1ADFA 1BG6A 1BS1A 1CTQA 1WR8A 2H2AA 3BCUA 3ZE9A 1Z3IX 2WJVA 3T35A 1OR8A 2AXNA 2D5BA 3CB2A 3CZ5A 4MHOA 2IYOA 3OU6A 2XWPA 3RGWS 2FN7A 3LM8A 3GI1A 3MQFA 5C51B 3D6HA 4I4TB 1KS9A 2PZLA 5L7YA 2O2YA 4PGHA 4WOJA 3F8WA 4BJ5A 4WINA 5EEGA 1GDTA 4C21A 2OFPA 3N2KA 4JC4A 1N8TA 2WILA 3ZCSA 4MB2A 2GZRA 4J4TA 1L5ZA 3C4QA 1GQRA 3E3OA 4HRAA 4RCVA 3BHMA 3PT5A 4GPBA 1ZNYA 1CR6A 1P72A 4PX5A 1X2EA 1LJLA 3RTCA 4FEGA 4HNVA 3S2GA 5JJCA 2GPWA 3NIDB 4YP1A 5I7OA 2VHZA 3KQMA 1IC6A 2PS3A 3WLNA 1Z33A 4FNAA 1BIFA 1X86B 5T5QA 1CUIA 3DUFA 4GOMD 3L6OO 5H1YA 1RCFA 3KRTA 3D2AA 3MJEA 3RNOA 5IKPA 5B3AA 4YR9A 3WXBA 3U3ZA 1OLUA 2I4OA 5CURA 4NFYA 3IAFA 5DHSA 4ESHA 3ONDA 3A2LA 4IDAA 4R2WA 2CVHA 1K6IA 1GTG1 2ZAGA 4NP6A 3BSSA 5TEVA 3IUPA 1NG1A 1NJGA 1YS7A 3QVGA 3F46A 5DNEA 2C61A 5FNVA 3FJ1A 4GOND 4Q16A 1HFEL 4CL2A 3NKLA 3PD1A 4IVPA 1E1RA 1XP8A 4U2EA 2PEYA 2IS2A 4GG1A 5AESA 3H6GA 2ZK7A 4KFSA 4IWNA 2GNOA 4C3ZA 3VA7A 4YAFA 3NOXA 2X5OA 5DLYA 1M10A 1XXLA 5JIBA 4X1YA 4G67A 1XF9A 1VGVA 4Y9SA 4WASA 5CG2A 5K0GA 3T61A 1XVAA 3HA3A 5ETJA 2VF4X 1V39A 3AXTA 1G5FA 3RHSA 1W4CA 4PQRA 1J2EA 5AICA 3EVNA 4LC9A 3AZPA 2VSNA 2ZIWB 4G4IA 5IJ9A 2IFTA 5JZMA 2ZIAA 4NK4A 3PGA1 3K9GA 2O7RA 4CI9A 2CNNA 4C4ZA 2XKBA 5KCZA 3NAGA 4R2HA 2BIFA 3AUXA 4P8RA 3E8MA 3VC2A 5HF5A 4HXYA 4QGHA 2HEGA 4XWAA 1HE3A 4RORA 1XN1A 2P67A 2O7SA 4FMBB 3LS2A 2IU4A 3N9IA 1JR2A 1LJ8A 1NVTA 1UDCA 5JOQA 3ENWA 3C2QA 1ZVVA 4ESOA 2O8DA 1W59A 1EUYA 2XNCA 1TZJA 3MMXA 3WFJA 1DEXA 2FZCA 2IJGX 2AMYA 1RKVA 1SA0B 2DSTA 3GQVA 1JLLA 3A1TA 5AM1A 4RGBA 1B4DA 4AO7A 2VHEA 2H17A 3BZUA 5B1YA 1GZDA 1FYVA 4XUCA 1F48A 1KO4A 2D3WA 3V3TA 5IF3A 1FMLA 1J2UA 1OUMA 1WUHS 3QNUA 3WQSB 4C7BA 3A3KA 2VJLA 1NSFA 1IZ0A 1P7ZA 4RU1A 1PBNA 4BBZA 4M8SA 5HM6A 5HCIA 3ZHQA 3GL9A 3FLMA 3R6TA 3VAAA 3LLMA 4TQUS 2PCLA 1IY0A 5L3ZA 3CKKA 3VTAA 1T15A 1XJWA 5EESA 3L9XA 2HPHA 2BMAA 3BDIA 5BXQC 4BOYA 3NW9A 1D2MA 1MBZA 1TO2E 2ID9A 3A1VA 3HM2A 3L6EA 3PNVA 2XGJA 1E6KA 3SQLA 6GPBA 3A28A 1EX1A 3MILA 5LP6F 5A4IS 1MJ5A 1KFEB 2J0SA 1YA8A 2XZLA 2I1QA 5EUBA 4NAVA 3NBUA 4WK6A 2V6JA 2OL4A 5SZIA 3S3TA 1P33A 2BY4A 4X97A 1MLDA 5EI5A 2NV6A 3QYJA 4RFLA 4LJ7A 3UMFA 1Y1TA 4JBLA 2WAMA 3BSFA 3EUFA 5JD3A 1A76A 3TVTA 3WFZA 4NH4A 2C7VA 4UTOA 3BA6A 2C77A 3WXMA 3ZDEA 2WMNB 3ZCTA 1JHDA 2FN8A 1F8GA 2J0VA 3A4IA 4XIIA 1WUKS 2YOGA 3F5FA 2NO7A 1T0HB 3PIIA 1RPAA 1XQ1A 1XF1A 2R7KA 2YVUA 3IIIA 3Q5GA 4QYWA 3EPHA 3RFTA 1H0SA 2KBEA 3GDFA 3RSZA 2ANCA 4ZO9A 3KPUA 3DC2A 4QNMA 2D1TA 1WU7A 2MR6A 4JI8B 1NFFA 3LUJA 5HIKA 3THYB 3BGOS 4Y0VA 3VR5H 4DCNA 4MZDA 3H5WA 2BGTA 3B6MA 4YV1A 1ZM9A 4MLDA 3LT4A 3JYOA 2ZUFA 2NAPA 5JU6A 2EGGA 1OFGA 3JWEA 3MTDA 4KUHA 1PF7E 5ADVA 4DR3B 2ZZMA 3G0HA 1I5OA 2ACKA 4Y3UA 3WQBA 4YAWA 4B4VA 3VH2A 3E2IA 1M7BA 4RVDA 2HPVA 4ZVPA 4EH1A 1CQIB 2L0XA 5J1SB 2OHJA 1ZGCA 3LQKA 4J0QA 4Y2QA 4YWJA 3BH0A 3LHDA 4W7SA 5M04A 2VT7A 3KTAB 4JXKA 3U39A 3A26A 2ZSKA 4NV0A 1KI7A 2PKQP 1NW5A 2ZKLA 3ZV6A 4B35A 4MUNA 5EP3A 2AI3A 3Q2OA 1AKUA 3AI7A 3WAGA 3RRZA 3VZRA 1M1NB 5IH7A 4TKUB 4E94A 4DF3A 4XLLA 1UANA 3ANLA 1NVVR 3I3OA 1USUA 3G9TA 3RVLA 2E37A 2JI9A 2I4RA 2LW7A 5LOVF 4CM3A 2YWCA 2JATA 2WKPA 1G60A 1W5EA 4I46A 1N2ZA 3VI3B 4CKXA 3DCIA 1E6LA 2VDOB 1YZVA 4TSRA 5AHKA 2ZIEA 3BGVA 4AMYA 3Q98A 2C2WA 4GMGA 4JYPA 3SX0A 4MV3A 1E9AA 4AN4A 3PDJA 2B21A 3G5AA 1LDGA 5JPIA 5H83A 3UWKA 1EWRA 2ESRA 4AP9A 2CBZA 2R8ZA 1N1DA 2WWHA 5BQ3A 3NORA 1EQUA 1GXSB 5CT4A 1U8YA 1JSRA 3LSYA 3I58A 1YCGA 3O73A 4N7MA 5AKGA 1B0ZA 3GFVA 4UATA 3SHWA 3R9XA 1HFKA 3RVRA 5TQ0A 3ZE6A 1KEUA 1XE3A 3ME5A 1BJRE 1YMUA 1O1YA 2O2EA 5DYNA 1S2LA 4YCCA 2F1HA 1Y7TA 3UF0A 1JZSA 2O48X 3L92A 3D1VA 4ZOLB 2VDLB 5GJVC 4NJEB 5IT4A 4UBNA 3I34X 1R0SA 1MXHA 3UMRA 1GTL1 3EW9A 4A16A 2DWUA 2YWJA 3VDNB 5G53C 4CIAA 5A4MS 2M6LA 3SXPA 3OJOA 3QWIA 1F2UA 5T64A 2Q1WA 3RFFA 1ADCA 4JIMA 3W2HA 4K9SA 4OHCA 3SKXA 4C7MA 4F06A 4MUBA 3O8DA 1CUFA 1Y9ZA 4EGFA 4JFRA 2JCGA 4HO1X 3K9QO 5DWDA 2EARA 3I05A 1PLKA 2HYDA 4ZFNA 3OX3A 3W7AA 1YS6A 3F3MA 1N75A 5IDQA 2AFIA 3EOBI 3I73A 4J0GA 5B7QA 3CUTA 3I9OA 4ZHQF 1T29A 2O4UX 3HR4A 4G5QA 1W4RA 3QG1A 3QKSA 4EENA 1IH8A 2OTCA 1PKXA 3L5KA 4HD8A 3NVMB 2C95A 2NN3C 2GJAA 3RADC 5F35A 4LMBA 1NY5A 4XWTA 5FFFA 5BRAA 4FB5A 2FUNB 2R4TA 1MD9A 5DCLA 3AT1A 4WJZA 1KZHA 1HMYA 2YWFA 3I2IA 4AJNA 5ALLA 2QS9A 3U19A 5C7OO 1I7DA 4BHTA 1NXWA 3SHQA 2A1TR 1LV8A 1OF1A 1UWCA 1ZRNA 3FY4A 4YK7A 1EWQA 1C3XA 1W73A 1CZNA 3FE2A 3NUZA 4G6ZA 3EVEA 4MULA 5AQEA 4DEVA 1T9GS 4TRRA 1OYYA 5FEMA 4FTWA 3FYUA 1ULHA 4MKZA 3JD2A 1ACMA 3AF4A 4CEIB 1IXRC 2O5VA 3M5WA 1RM3A 3RRFA 3QTTA 3VC1A 5AW8A 4F3RA 5C1BA 2R6DA 3EIHA 1W47A 4DAEA 2TMGA 3HN7A 4I3GA 2BKLA 3ZWDA 2GN2A 2QLNA 4HFRA 1DMSA 1VYTA 3CKYA 1VG1A 4UHHA 4CBVA 1F17A 2NLOA 2JGNA 2A0KA 1MU0A 1QIJA 3GRCA 3EAQA 1VMKA 4GSYA 2JD1A 5EIXA 1A8IA 1WBBA 1O6CA 4L3OA 4P3PA 1T0UA 1THMA 4K7JA 1TYBE 4LHVA 4XOIA 3WIDA 1ZUD1 3MAJA 3NU1A 2A8YA 5A5VA 3VPSA 1U80A 2IYNA 3UHAA 2A5DA 2FMIA 3PFWO 5EZ5A 1KE2A 4BUCA 1UBLS 1D09A 2CXRA 4QDZA 3ZVNA 1IEQA 2OCKA 3FB4A 1B41A 2AN9A 2H5IA 2ZBDA 4HDQB 3C8HA 3M2PA 1EB8A 4PV7A 5FBWB 3T3EA 3V7WA 2RGAA 1NU8A 2QRVA 4J1NA 2HK6A 1JQKA 5B7GA 4CGZA 3RRJA 5JAIA 1WO8A 3Q9LA 4A6EA 4CF4A 4QYIB 4X3PA 3V55A 3FOFC 5CB4A 1I0LA 3ZI0A 1RHRA 1WXDA 2Z4SA 4NENA 4KG7A 13PKA 4ZI7A 2VL7A 3CS3A 1ZL2A 3D5TA 4C0SA 5CEFA 1NWHA 3QUSA 4ZRDA 1T9BA 4NULA 3HL4A 5D1NA 4MICA 2R00C 1R6BX 1TIPA 2YYZA 1AHIA 3EQ6A 4G5HA 5LXTB 2K7ZA 2JKVA 3KVYA 3E5NA 3OJLA 1RI4A 3PQ6A 3VQTA 2X76A 1ODLA 3SQMA 1WHSA 3G9QA 4ZPJA 5HFAA 2C42A 4D57A 4B73A 2WTAA 2OV8A 3IKLA 4FYKA 2YQZA 4M22A 5EP2A 2WQZA 1W85A 3VZDA 1LUAA 1Y0BA 3ZQKA 4PGFA 4MTCA 4M4SA 3B53X 3UMJA 1ECFA 3FTNA 3KJGA 1TKAA 1DFIA 1NE7A 2HCBA 3ODPA 2UUCB 1MMFB 1IY8A 1ZI8A 2Q5HA 3ZD8A 3TJMA 1AHHA 5KVVA 1UDAA 5B1DA 1FFGA 2IOFK 4WGGA 2PKQO 1OCEA 2J7PA 3B82A 3KSMA 2PLRA 1M2OA 2A9OA 2KYRA 3GLHB 4D9NA 1J8DA 3KCQA 3QFTA 4AJKA 4EVQA 4CLRA 1Q2UA 5JMTA 1QR6A 3F5MA 5MF6A 3D7SA 3P0RA 2WMOB 2UZIR 4HDKB 4WEOA 1JHOA 2V9CA 2Z5LA 3DT6A 3HDQA 5F1OA 4KQ9A 3OPQA 1ABBA 1K6XA 1RAIA 1V6SA 4GEKA 1H4TA 3PD7A 1IY2A 3DOFA 4Y2HA 1TC1A 4IBOA 3NHKA 1NNUA 5EXSA 1PWHA 1JAZA 1US8B 1V16B 1VZ2A 2BDUA 2Y9PB 4P35A 4HTFB 4Q21A 1F2DA 2Y76A 4IDPA 4IEIA 3ZD9A 4D99A 2KPOA 5J2UB 4ZGWA 1HQCA 3ONVA 4CMIB 1A8UA 2Z2YA 4D4JA 2BSQA 2J85A 2CCGA 4I81A 5E3HA 2HR1A 3PQ2A 3H8WA 1P1HA 3QF4B 3MWJA 5IH3A 2VSQA 3QBDA 3HG7A 5SYNA 5CXQA 2VH1A 3ZPXA 3W5BA 4ER7A 4OL0A 1CZKA 2UVPB 4ZOBA 4DQXA 1ESEA 3D9QX 4HQFA 2NVUB 2H16A 4D0NA 4KVFA 2FSFA 3BTUA 3WLMA 1ZRHA 4CG1A 1FNSA 4BKPA 2QT1A 4ZIRB 1XCPA 4FONA 1KMHB 4HB4A 5NLLA 2FPIA 3WLQA 3MTEA 4UU0A 5HKBA 3ZU3A 2FMFA 1Z9BA 5HQ3A 1EJ6A 1LH0A 1QDLB 3FWNA 4AJJA 5ADUS 1E0JA 2GO7A 5EA2A 4YREA 2JJ1D 3CUVA 3OU2A 4I9GA 1ZPDA 2H1IA 3ZHTA 3UGKA 4B6FA 2YVQA 3GJYA 4Q9KA 4MV5A 3TRJA 4NBNA 1Y8QB 1AQUA 1UJ2A 2A0XA 2GCGA 3DCYA 2H11A 1VP3A 3O8OB 1ZJ5A 2POQX 3AKYA 3D8TA 3QM1A 1OPXA 4OJQA 4X84A 5AP9A 2Q3MA 2JFYA 1TM3E 3RRMA 4AULA 2FFRA 5JCPA 3NM5A 3KKQA 4WAUA 2WTBA 2ZT7A 2XZDA 4OQXA 5FHRA 3CZ9A 4LOJA 4P83A 3VR1A 5BNZA 4YRGA 5A6SB 4G5SA 1BAPA 3IELA 1YZ3A 3WG9A 5BORA 2VP2A 2WJ4A 4Z0PA 3SJBA 1E94E 2IZ0A 5J2TA 1ZFNA 4KE6A 4ARVA 5AJZA 3MLAA 3EXHA 3OIVA 4BATA 5SZJA 3AO0B 5DHTA 4OV6B 3I2FA 4DHEA 1WB4A 5HNKA 4JBGA 5IKEA 4FZ5A 1Z0SA 1NJ6A 3ZIDA 1VHLA 4GRDA 3PQFA 4R01A 4BIMA 1SG0A 3KXIA 4P4SB 1K8YB 4CMAA 5BP7A 5BWBA 2LKDA 3STYA 2DR2A 1EBFA 3R7NA 4C7JA 3C6QA 4ZI2A 1GV1A 3PFGA 3K6JA 3QBTA 2DULA 3CH6A 1P4AA 3USZA 1CRPA 2EHJA 3F7OA 4LN1A 2VRWA 2QGNA 4ND6A 4L5YA 5EJFA 3WK8A 5KTYA 1QIDA 1TUEA 2ODAA 3ELWA 3LOPA 1UPAA 1T5TA 3D59A 4XIGS 2JAQA 3OLWA 3RS9A 2X5JO 1QKKA 5K45A 4L3WA 3IEXA 1RS0A 3S29A 2VJMB 2FX2A 1IONA 4B17A 4QOJA 3C39A 1T5HX 4F12A 2P3SA 4MIKA 2XWBF 3VH1A 4Q47A 2CD9A 3H99A 4EARA 4W1SA 1SIUA 3HA2A 1EGHA 1VIYA 3ANMA 3BXOA 4AZ3B 3ETEA 2FZLA 2OLJA 4M87A 1E3JA 3GOHA 1P4JA 1UXHA 3LA6A 1JHRA 2EGUA 4YCAA 1IZ9A 3NTXA 2CVPA 2RHBA 2EVWX 2FPKA 1IOWA 3LV8A 4FUTA 4L76A 5GGYA 4AKIA 1H1TA 2BUCA 1HE2A 3PXGA 1WMAA 2W00A 4DQDA 3AJ8A 4E2XA 1XVIA 1C9JA 3SQXA 4R6WA 2PKCA 1CY0A 2YVKA 4MVJP 1DWPA 3N39C 3GLGA 5K3CA 3V6LA 5IZCA 2CXUA 5JZSA 4MDFA 1TD9A 3FZEA 3CE6A 3OZEA 1NJ2A 5JNTA 1T5DX 1N5RA 1JIIA 1PG2A 2IYWA 3QEJA 4RPHA 1FSZA 4J9UE 1ECJA 3T1YB 2ZRPA 1KC1A 3SMQA 2JGMA 3FXAA 3SBXA 3V8PA 3CNLA 4GWLA 4O4LB 4RVOA 5J4HA 4PY2A 5CFPA 1VLMA 1G7CA 2IUSA 2DP4E 1DKNA 3KUUA 1G18A 3VPBA 1N7HA 4DLZA 1JFRA 3G5TA 1L8AA 4RGYA 2WKSA 1IBMB 2LD4A 4F92B 3FWHA 2ZUEA 4HNHA 1TNDA 3C3DA 5F78A 2FK8A 1QWOA 1OZAA 1P2FA 3FYUC 4GS5A 4PQEA 4Z86A 3KPYA 4EJSB 2FP4A 1TADA 2HBRA 2JZCA 1ZIDA 2VTBA 1D2CA 1AUVA 3QY9A 3EAGA 3OQHA 5DM2A 4X91A 1N4DA 2WWTA 2L42A 4GMXA 1XEXA 3L1KA 3BQMB 5JSKA 1DIGA 1BXRB 2JA2A 1HETA 2C5AA 3U09A 2V0GA 3RSOA 3HDJA 1Z5PA 4HYEA 3BOSA 2PRSA 2NT3A 4P36A 2ZUDA 1YKFA 2GAAA 2Q2QA 1OFUA 4PG4A 4JL5A 1ZITA 3GDHA 4RA9B 5CVUA 5AM4A 4EY5A 5KINB 5JJLA 3EEBA 1BDIA 4I5DA 1XNRB 5BR7A 1T36B 1ADYA 1IRXA 1G21B 2G67A 3QOXA 4YRTA 4BDSA 5HX7A 5IM4A 4BX2A 3E9QA 1BFKA 4NOKA 3REFA 3C1TA 3PRHA 5LSAA 1OXUA 3RS8A 3HTXA 1XMIA 1JLMA 4EA6A 5KYVA 2C83A 2Z58A 5FPYA 3FDFA 1EFRD 2PFGA 3HXQA 1XEFA 1AXRA 3TM4A 4M54A 4WFKA 3R0ZA 3RASA 2Q6LA 3UV7A 4WJLA 1WXHA 3FRJA 4QQFA 3VI4B 3MTIA 1ZP6A 4TS9A 4MQEA 2I8CA 2J3QA 5FRDA 1E0KA 3E61A 4JP5A 2VDMB 3R7SA 1C7EA 3DFKA 4S3MA 1LPNA 3SHVA 5HK9A 3C6MA 1U0OC 2FDXA 2G07A 3AVPA 5A2QA 3L6CA 5JH7B 1ISHA 3GFBA 5AVZA 3EUAA 3UK2A 4QPCA 1NNLA 2H3HA 4H2DA 1MEJA 3HA7A 4OK3A 1NI5A 2X8JB 4KIWA 3FPFA 4AO6A 1ZONA 2H1RA 2WA2A 1DEAA 2FGKA 2HDNB 2O1WA 3PV0A 4FR2A 4OL9A 4D9CA 4QVGA 1G20B 3O8QA 2Z1MA 2HOQA 3EQ2A 4GDMA 4C2TA 2QZSA 4NH0A 1I3KA 1LSJA 3HH8A 1TO1E 3QLUA 2VFAA 4V0SA 1NF3A 5JCXA 1V4VA 2WYUA 3P1JA 2FWRA 3VZPA 2WIFA 4OXXA 5DT2A 3V2IA 1F8XA 1OTYA 2VXBA 4FE7A 1H2YA 4FX2A 5HEKA 4YP6A 2W2TA 3H1BA 3PCXA 2E6KA 1V5FA 3PYLA 2HF2A 1VCNA 4J4BA 3PKJA 1AKYA 3TVYA 2B2CA 3UV3A 5C8YB 3S2UA 4BVAA 3OPYB 3O75A 3Q3JB 2FUG6 1E6UA 3DFIA 5L45A 2QLJA 4Q12A 3BG5A 3L1VA 4IDOA 2NU8B 4RQUA 2JLAA 2DETA 1Q7BA 2DCUA 1KH2A 1C30A 1WJGA 2VNAA 4K9PA 4L51A 5DBGA 4Z9FA 4EEKA 4Y6LA 1YDFA 5AVTA 2JI4A 2A1TS 4E1AA 3V2GA 2IUFA 1W93A 3DHWC 3PD0A 3DW3X 3EC2A 2W4QA 4HYTA 5A5EA 5DWVA 1RQPA 2BEKA 3RBVA 3IO5A 4B3RB 3EA0A 1X80B 2E55A 3O3NB 2BHSA 4IIJF 1JLSA 1U8ZA 1WMFA 3QGMA 2Z6VA 5A4DA 2W7TA 1VKZA 4KMMA 1C7ZA 1ZK3A 4D3FA 3D8NA 3G0BA 4JJ7A 4JKYA 3BCRA 1DFHA 5EJMA 1KY2A 2N0SA 4G5YA 4FJ1A 2HTEA 3DE7X 4YRIA 2VZ9A 1GDDA 3GV0A 3BC1A 1Y9EA 2FPXA 3IV7A 4MR9B 4YAJA 4B3JA 3KWJA 3VKUA 4ERNA 2ATIA 1J1UA 4BO3A 4RCYA 3NFYA 2NPIA 3N8DA 1MC5A 4R2JA 5EL0A 4PZ0A 2WKQA 2ZSHA 2Y0PA 3P9KA 2M98A 4KZPA 1M34E 1C1DB 5FWAA 3D64A 3MMZA 1WTAA 1PJ4A 1GYQA 2ZI4A 2OHFA 4C3VA 1GKYA 3LLSA 4BNMA 4YRAA 4EG5A 5B12A 2VCYA 1TX4B 2FW9A 3R3UA 1VCHA 3K8YA 1F4VA 3MWEB 1U2QA 2IGBA 4BJHB 1SCUB 4EFKA 1GIAA 3G7NA 3MCAA 4J2HA 3O6VA 4KXFB 1GZVA 3UTDA 2JGLA 1D2AA 2VJQA 1ADJA 2IE0A 3IV9A 2FE4A 4FSXA 4RA6A 2CYBA 1CR1A 2FPLA 3LLUA 2CEKA 4J0IA 4BNJA 4DVJA 2CMKA 5K8VA 1JG2A 1Z4NA 3D81A 2PFSA 3HZRA 1DOZA 3SNHA 1JHAA 4JLDA 3QOWA 1XRNA 1CNMA 4JJEA 3ZK7A 1SC4A 4ZN6A 2V6GA 4X63A 3SS7X 4LVOA 3EXHC 3M6MD 4IYRA 1P17A 5IJZA 1U81A 4K6KA 4DBVO 1TVCA 4OQLA 4K9QA 1DEKA 4IRUB 3LGAA 3V1UA 3CU5A 1XJQA 3FSEA 4DG5A 4DW8A 2ZTSA 3FNRA 4MWOA 5JXIA 1QZTA 4PZUA 4V0ME 4OJKA 3IMCA 1FJHA 1QAQA 1XN4A 2H07A 3VKWA 2OXTA 3VZSA 1VSUA 4JLWA 5BV8A 2ECQA 1P2VA 3J80A 3I6MA 1DAEA 3K2EA 1CBUA 2WM2A 3LRXA 1TLLA 3ZWQA 4F97A 5IFLA 3UA4A 2IITA 5BWLA 4F71A 2VP6A 1DKPA 2QUAA 2HSEA 1ZJZA 1MFPA 5BN1A 5F2OA 4EUSA 3W04A 1HQYE 5DVZA 4G5RA 4ZKEA 2ZU0C 2XT0A 2B83A 4O59O 2I0FA 4B44A 2ZXUA 1S2OA 4Q4AB 4L85A 3HU2A 4G8BA 4MVJG 1G3RA 2A94A 3BIOA 3QBVA 2F9LA 4WDRA 4EPTA 1V9SA 4LBYA 1DT5A 1R0ZA 4CIWA 2EJVA 3ES9A 4IRXA 2HX1A 1RHUA 5FBZA 1O03A 4F8EA 3UCXA 2WUWE 5HZHA 2DQ4A 1L5GB 3Q8KA 2Y93A 3EEIA 1Z6ZA 4GI3A 1TK2A 3L0DA 4LISA 1BJKA 3CWZA 4XQ0A 3MOSA 1HNWB 3AVQA 4ACAA 1SG9A 2ZIFA 4JYMA 3U4IA 1W75A 4BNNA 4Z9AA 1SXIA 6NULA 4B5KA 4YDQA 2NXCA 4BO2A 3L0BA 5IZCC 4B5LA 2BN4A 3AKCA 3D3WA 1LF0A 4WY8A 2G9UA 2D7DA 1AS3A 2A1UA 4DAOA 3WFIA 5FL3A 1S2DA 1UMBB 3B36A 2I5PO 1PS9A 3ZY3A 3S44A 3V4ZA 1R50A 1L4EA 3U56A 5JY6A 3AOGA 2R1TB 2WJ3A 1RKXA 3HYSA 1XKQA 3VHXA 2GTIA 3WLRA 5BW4A 1Z62A 2E89A 3JYHA 2VJAA 3P32A 4OA8A 1PHRA 2H1VA 1R5BA 3IOMA 4PS1A 3E22A 2I34A 3FTFA 2GTPA 2V6FA 2WVHA 2GJ4A 2FEOA 2VJYA 3E0XA 1Q6ZA 2XBLA 3WRVA 1J9ZA 4I8XA 1ZY2A 3TLGB 2AG5A 2YMQA 3O1IC 5AJXA 1ZR4A 2DWQA 2DAPA 2HQRA 3H4VA 3LUFA 1T3GA 1T0PA 2IT1A 3AERB 1XJ0A 3H4MA 3RUDA 5EE5B 2QU8A 3UHJA 1TB4A 2PCJA 3TNFA 3M6FA 3HMKA 5LP6A 5FA8A 3CC8A 4JL6A 4MMZB 4GFDA 2GD1O 1N5KA 1XQ9A 4MUYA 5GONF 1BFDA 2RHHA 4BN5A 2E6UX 3M6AA 3KWLA 3BH7A 1C9EA 2NUTA 5I7HA 4CODB 2V74B 3U3RA 3MF4A 3WGLA 3A1NA 2TMDA 3EBLA 2WJGA 5IBPA 2EFEB 2FN4A 4F1KA 1FFWA 4RVHA 5IS2A 3HABA 3KHTA 3UGJA 1Z4MA 4KP7A 1NW9B 2JF0A 2RGGA 4PN3A 5KPDA 2LGJA 3Q15C 3UJCA 1EDOA 3T38A 1QGZA 4OUDA 4CM1A 5C3MA 4JCCA 5H3HA 2UYYA 1B1AA 4HL6A 1T8TA 1UKYA 4GD3Q 1CW2B 4KLCA 1MEOA 3CVJA 4YPFA 5TMDA 4TTTS 2B8TA 1HLPA 1KOGA 1WSWA 2C5FA 3OKAA 4C4PA 1SHKA 1TIBA 1EAYA 2HH9A 2YX1A 3PX3A 3PT9A 3BDAA 4J2OA 4C29A 4F6RB 3SWWA 5AI9A 1XNGA 3F7TA 4XRGA 1CPYA 3DOIA 3D4PA 1IQPA 4ZAWA 1ZH4A 2GCEA 4XPZA 2IZZA 4K6FA 4F11A 1G4UR 4RIIA 4Y9UA 5H8WA 5GVSA 2AQIA 4INAA 3PNOA 4AS2A 4DCCA 4JHLA 3LJKA 4CU2A 5EIHA 3TFOA 3MUOA 3K2QA 3OZAA 4M49A 1EFVA 3QVSA 4OA5A 2C1EA 2Y3IA 3FPCA 4IOJA 4CM9D 3HMQA 1TDJA 4MYTA 4LRXA 2PMFA 3EBPA 1L7XA 4C7XA 4N4AA 1SHTX 3LKZA 1SBHA 3QXSA 4ZKDA 5JSZB 3U9TA 1O94D 4TLBA 3A37A 1FNBA 2BZSA 2REXB 1ZEJA 5HDBB 4C2BA 1B8NA 3DPSA 4JQOA 4WWHA 4Y2RA 3WYGA 5C37A 5BVGB 4PZ9A 2UYHA 1RLIA 2WWIA 5H59A 4WBNF 1QKIA 1WF6A 4Y7CA 4IV8A 3BXHA 4I9NA 1XMOB 5EQFA 5LOVA 2B99A 2R6CA 3MCWA 2NYUA 3FLAA 2QTZA 2QTVA 3F4BA 1BN7A 4D80A 3K8ZA 2CMGA 4K28A 1MA3A 4B8WA 2F1OA 4CF3A 4JBHA 1A88A 1EUDA 3VUEA 3IP1A 4TPKA 2FJ0A 1J0BA 5TPWA 1V2GA 1WVIA 1Y1KE 2C59A 3O8BA 1N2CB 3H2JA 1YQGA 4LGCA 4Y67A 2IYPA 4ZYWA 3ZV4A 3UB4A 2RKBA 4AB1A 3ZNNA 1QUFA 4KC0A 1IBKB 5IJ0A 1A7UA 2YWGA 5IUJC 1W25A 3SF0A 1N0UA 5EPOA 4JJZA 1FQWA 3VJLA 3TGWA 3P52A 5ICSA 1TJ5A 4YI5A 1P1BA 1GTZA 4V1CA 2PSDA 1ZM2A 2GM3A 3R41A 3GLIE 1JYFA 4ZCTA 2O8CA 1NUSA 1U7ZA 1M0TA 3QRWA 5ES4B 2CCKA 3WYNA 1PLLA 3JQAD 4LK2A 3T1HB 1E9EA 3I01M 5CB6A 3JZMA 1S3FA 3AF3A 4UMEA 1RVDA 1W1UA 3OHSX 4EG0A 2VXOA 3AP1A 3NH6A 1KVSA 3S70A 4RYLA 1P18A 4LHSA 1KAEA 1UC5B 4IX1A 3D02A 3E4DA 5EWMA 5EPEA 2BI4A 1A1SA 3NASA 2VG8A 2IPOA 2IPAB 1ORWA 1TUGA 2X1LA 2G40A 3G8YA 4GHWA 5AHRA 2N75A 5BWMA 4RKQA 5C8ZA 2EBWA 2P3OA 4F2HA 4BKMA 3B3GA 4GP9A 4KX5A 3D5EA 4N9QA 2ILTA 5BYBA 2WWVD 1S89A 1Q7CA 2HRCA 5AJHA 3PGMA 1YZTA 5FPSA 2ZSUA 1VG9B 2B20A 3GBVA 1IIRA 1HQKA 2AXQA 4PXAA 4EHBA 1RAGA 121PA 1TT5A 4ZHQA 3FWZA 3EWNA 4XSVA 1S3GA 1WDWB 4KN6A 4N65A 1GPDG 2ID8A 4YIHA 4QOEA 2J3EA 4H7IA 2VA9A 4TS4A 1ZJYA 3AJAA 1P2GA 5JD4A 1P0FA 1I36A 4UPDA 1U4OA 2BSAA 3EARA 3C5WP 3EMDA 3NUQA 4GGMX 2FSPA 4YT5A 1N2SA 3R6GA 3IERA 3S2SA 1PX0A 4G1UC 4QYSA 2QP4A 4Q9IA 1A5SB 2IEDA 1T0JB 3PPWA 4R4JA 3ROFA 3NG1A 3SZGA 4XLZA 1KRWA 3HS3A 2YFQA 1J07A 2F3RA 1DXYA 4Q93A 4B3FX 5JI2E 1CZHA 2IHYA 2OV3A 2YW9A 4K1XA 5FUVA 4KGVA 2REBA 1QHIA 3UK6A 4ZQBA 1FNMA 2GZAA 4RIEA 4PWYA 5K8UA 5JSUA 1L5FA 1WV1A 3ZWOA 3DBLB 5CB0A 2R97A 1P77A 2W6JD 1XHEA 1Y42X 2X2OA 2MSLA 2YXBA 3EDYA 4ON9A 3I62A 3R9KA 1DBSA 1DZ3A 3OQOA 2XY4A 4KXYA 4M6WA 5CFOA 2D6FA 4E5PA 2FPMA 4WZBE 4ZT2A 1BQ4A 1PZNA 1ZSVA 1RWMA 1Z0AA 4HAWA 2F1IA 1DC8A 4R8MA 3SFVA 3SXJA 3ERCA 2BL4A 1HPLA 2BGWA 1KXJA 1ECBA 2AN4A 3NATA 2ZBVA 4RO0A 4OKIA 5BQ5A 1AQIA 3E48A 1KDTA 3NT2A 4R3WA 3GHYA 4YC7A 5HZGA 1L4NA 3KBBA 4KO8A 3VZBA 1E6WA 2X4LA 1EDDA 1U0GA 3QYFA 2V6BA 1RJ9A 3E70C 2XW6A 5DHRA 5EIBD 4DGSA 4Y2GA 3OOYA 1ZAYA 5DOZA 4KBFA 4TTPA 2GN8A 1MV5A 1SPXA 1AV6A 1ZJ6A 1BROA 4XX1A 3HCPA 2DPLA 5L3QA 4CG2A 1TLTA 3B1JA 1PJCA 3V9AA 2XSZA 4CQMD 4XPIA 4DMCA 3N2EA 1FMTA 4NV3A 1PZMA 3CW2A 1R6DA 1T2UA 2OP0A 3L8CA 3PWSA 4MOWA 2PXHA 2P1ZA 1SBNE 2YCBA 4NMWA 4R1QA 3A14A 4GYJA 4E5YA 4FIDA 3OZXA 3GAFA 4MCAA 3EQ8A 1NZDA 1XYVA 2PZAA 2Q46A 1BNCA 1YUMA 2F2TA 2WZCA 3ZCRA 4MUJA 1DAHA 4Q4DA 3K1AB 3ZVKA 4RDCA 4R1LA 2R4QA 4LOIA 4GICA 1J24A 4CM9A 1RBZA 2P90A 2G5TA 2ZAOA 3NDIA 1ZGJA 4PZPA 1O94A 1PNOA 1Z22A 3S2ZA 1J1IA 2AZDA 4RLFA 1NONA 1DBRA 3FDJA 3RW9A 5IC5A 4OSOA 1CYDA 1RWVA 3GVPA 3IE0A 4WMLA 4IH4A 5A3JA 3QUBA 1YU6A 5ABPA 3NDJA 4O2LA 1IJBA 1MPXA 1XLTA 2C8KA 2ZCVA 3M5PA 3CXRA 4CLXA 1IFXA 1WMDA 4IHJF 4V0MA 1FUYB 4IJMA 2NVBA 2WU3A 1R66A 1XVVA 1PDOA 1T3HA 3GJQA 1SUCA 2H54A 2Q5LA 1QK5A 1CFJA 4UNSA 5HRCA 1N7JA 3ENNA 4YAGA 3SEFA 5BSUA 4D0GA 3TF5A 3K2IA 1HDCA 1N2XA 5EHGA 5LP6C 1Q16A 3ZI4A 2A4KA 3EQ7A 5FX2A 4IIDA 1E3MA 4NZOA 1KC3A 3KJXA 1DPGA 1FB5A 3O3OB 3AJEA 3ILXA 2X8WA 2JHCA 3OZRA 1KPHA 3TS1A 3OPVA 5CHEA 1XTUA 4WKPA 2Q7OE 4D98A 1PBTA 2SCUA 4B6OA 5KJCA 1BE1A 3RWMB 2ZSFA 1R4MB 1I3NA 3ZEAA 5DI3B 4WN9B 3R4CA 2GESA 4YAUA 3AF6A 1B3RA 3KKMA 3M3PA 3LX6A 4GXNA 4XR9A 4A8TA 1X7YA 3JATA 3A6ZA 3O26A 4ILEA 3OMLA 3ZDXB 4BMOB 1N2IA 4TV9B 5JNUA 3C1OA 4CEJB 1H4QA 1EX7A 1GEGA 2F4VB 3BRWA 4F4CA 4J1TA 1EBUA 4S05A 5IW8A 4MA5A 1EINA 1QP8A 3VVCA 2ONZA 2YHSA 2BGUA 1OX4B 4B7UA 2QRUA 5KQLA 3TD2A 1RWNA 3ZWPA 2P4EA 3WRXA 4BNFA 4W5TA 2CXQA 1BHSA 3D6MA 2H4WA 3MGCA 1B16A 4I1RA 2OO7A 1S5PA 1CR0A 2WG2A 3LUPA 1ZNQO 2P9YA 4PCLA 3HP7A 4PPQA 5CNMA 2DPGA 3UXHA 4IINA 2H9AA 3H1TA 3CUUA 1XQXA 3L9WA 3G2HA 1KFKB 2XTMA 4IZHA 1T24A 5C8XA 3LBNA 1YVRA 1QYDA 2YINC 3EIQA 2Z08A 4RV9A 4ZAGA 3RHZA 3V6MA 4ENUA 2PSFA 5E4TA 2CLMB 2FNAA 2O3RA 7ABPA 2CLLB 1JTVA 1XZMA 2DC1A 4BC0A 4MARA 2JD0A 2O0JA 3U1TA 5FNZA 1U9JA 4DMKA 4EL5A 2ZKIA 2WF8A 3FNFA 3GGOA 4X60A 1P0MA 4YJ2B 1RTTA 1WXIA 3GN1A 4AFNA 5ESDA 5DV9A 3LVQE 4P4GA 4D4GA 5KYXB 2HFKA 5CDYA 4TN1A 5DTJA 3WTBA 1D03A 6YASA 4DVGA 1VKJA 3MWGA 4DZTA 4UVHA 1I9CA 1ND5A 1E7MA 1KETA 4JP8A 1KAOA 3JASB 1NMEA 3T0GA 1TKRA 1K5GA 2FGJA 1ISJA 2RDMA 1RCTE 1KSJA 2KHZA 4NMMA 1L3CA 1JQDA 3HB5X 3VM6A 5KC8A 4CCAA 1LI7A 1T5BA 1JIJA 2J5KA 3GHHA 4DBZA 3N53A 1W7AA 1FDUA 3F47A 2W6JA 1NI3A 5KKNB 2G3YA 1XWWA 3D3EA 4RS4A 2YBEA 4AJEA 1UP4A 5AIAA 3BAFA 2BHRA 1BCSA 1H6DA 1YDMA 3RO7A 2OK7A 4BVEA 4CTJA 4QQRA 3A1SA 5GZ1A 2W2LD 4Q9AA 3WKDA 2JLYA 4TMTA 5CLQA 3TQHA 4HWSA 3FLBA 1GFIA 4YS6A 2HJ9A 1CUGA 1DQYA 1D4OA 5KB3A 4U63A 1L5KA 1HORA 3TOCA 1FU8A 4DWOA 2XB2A 5J63A 1QB7A 4EHHA 4GL4A 3W05A 1R6TA 3WHPA 1MT0A 4B6EA 1QMPA 2QAIA 5DHQA 4MWBA 4S1VA 4BFXA 1NRJB 1WMBA 2JFOA 3I39X 4MUMA 4CQMA 3ET5A 2CLKB 2OXFA 3KVNA 1GU1A 1CFZA 2C3UA 4EPVA 2NACA