1E58A

E.coli cofactor-dependent phosphoglycerate mutase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
247
structure length
246
Chain Sequence
AVTKLVLVRGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHOGLYCERATE MUTASE
publication title High Resolution Structure of the Phosphohistidine-Activated Form of Escherichia Coli Cofactor-Dependent Phosphoglycerate Mutase.
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 246
sequence length 247
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1e58A00
1C7ZA 1E58A 1YJXA 1RPAA 3MXOA 2HIAA 2WNIA 1DKLA 4IJ6A 3D8HA 3DB1A 4E3WA 2GFIA 3QPUA 2QNIA 1RPTA 2YN2A 1ND5A 3E9DA 1CVIA 3FJYA 4D4LA 1RIIA 1QHFA 1C81A 4ARUA 1BQ3A 2H4XA 2WU0A 3R7AA 5AK0A 1UJCA 4PGMA 5PGMA 1DKOA 5CDHA 2EOAA 2P78A 3IT1A 3IT0A 3MBKA 3PGMA 1FZTA 1UJBA 2P79A 1SKAA 1FBTA 2P77A 4PZ9A 4PZAA 2ENWA 2P2YA 1V7QA 2PA0A 5AJVB 1V37A 2P9YA 1YFKA 4GPZA 4D4MA 3K4QA 2P6OA 2BIFA 3D6AA 1NT4A 1SK9A 2P6MA 5AJWA 4JOBA 5AJXA 4MA4A 1QWOA 1K6MA 4HBZA 3DCYA 2ENUA 1IHPA 3FDZA 3BIFA 2P2ZA 1TIPA 4AROA 3D4IA 5CU7A 2P30A 2P75A 3LNTA 3GP3A 1DKQA 2AXNA 4ODIA 2OWDA 3EOZA 3HJGA 1H2FA 4EO9A 3NTLA 2EKBA 1DKPA 5AJYA 2P9FA 1EBBA 3FDZB 3NFYA 5AJZA 3E9CA 1BQ4A 2WNHA 1DKMA 1ND6A 4QIHA 4EMBA 4ARVA 1QFXA 2IKQA 3E9EA 1BIFA 3GW8A 3KKKA 3K4PA 3LL4A 2DWOA 2P9ZA 1C80A 3F3KA 2A6PA 3QPWA 1XQ9A 4D4JA 3IT3A 2RFLA 2H0QA 2OWEA 3OI7A 2F90A 2HHJA 4IJ5A 1E59A 2I1VB 1DKNA 3QPVA 3F2IA 1SK8A 3EZNA 2EKZA 1H2EA 2H4ZA 3C7TA 4FDTA 4JOCA 5CX4A 1SKBA 3ZHCA 5HR5A 3GP5A 2DWPA 2YN0A 4FDUA 3LG2A 3IT2A 4ARSA 4JODA 1T8PA 2HPAA 5HTKA 4D4KA 3O0TA 4TSRA 4GPIB 2H52A 2A9JA
chains in the Genus database with same CATH superfamily
3REFA 4J75A 2PRJA 4TXNA 2AOWA 5CLLA 5BOVA 3SIPA 4EZIA 3EW9A 2IFTA 3L0YA 4XSVA 1U8XX 4B2PA 9MHTA 4KL8S 3MCTA 4RZ2A 3M6WA 3LT4A 3PHHA 4G41A 3WIDA 3ZGVA 4O2BA 2VA9A 3USCS 3PUJA 1LPSA 2ECFA 3H11B 4C29A 1HFKA 1AO0A 1L7BA 1GCOA 1JTVA 4PFQA 4WESB 3VSAA 3VYVA 4C05A 4EAAA 4UBKA 4OG2A 5EINA 1SQGA 1IZ7A 3RB8A 3T9FA 1TTTA 1U1FA 3M6IA 4TYNA 2DXIA 4NLLA 4BDSA 1GN9A 1M54A 2OD7A 1EHCA 4DZRA 4NIMA 2BM0A 3DZHA 3TZBA 4BO6A 3U56A 1H5UA 3PWSA 4L9SA 2PS3A 3CUUA 3JRWA 2HMAA 1D4AA 5JNRA 1TU3A 1VKHA 1G55A 2QNRA 4PNHA 4R05A 3RTEA 4DIFA 5CDHA 1SXHA 2ON6A 2BGGA 3ND6A 3M8KA 5HJ5A 2ZYHA 3DMDA 1GUBA 2AOXA 1L5YA 3DAGA 4EY4A 5JANA 1PT8A 3RVJA 2BKLA 2C8JA 3QW4B 3OEEA 2V03A 4W5WA 3KJZA 4H1VA 4K9SA 3BXGA 4OSOA 4YRCA 3SGLA 4DWOA 2YWEA 4QD3A 2OP0A 4GXTA 2D1YA 3DDUA 1FYWA 2PBZA 3IJRA 5GAJA 5IDQA 1E98A 1WF3A 4NONA 1YQDA 5I7RA 1WE2A 1ESNA 2OXIA 1SBHA 3K0AA 3K20A 4XUGB 4XYEA 3OCJA 2VP9A 2JHGA 4Y9RA 1NXVA 2M6KA 2JG3A 3DHWC 1OAKA 4R2JA 2WOOA 2ZBUA 4ME6A 6ABPA 3BB1A 4ROTA 1N92A 3BRCA 3VYSB 5LP6F 4L74A 1GPUA 3OSZA 1GFZA 4QE3A 2VBIA 3BSFA 1X38A 4X7BA 3GX1A 3VZBA 3MTEA 2K7FA 3FFXA 3I5YA 4JLOA 4X3CA 1PU2A 2W6QA 4TMFA 3LNTA 1U0FA 1GDHA 4DMKA 1L7QA 2NVUA 3VC2A 3SQOA 4TRJA 1ODFA 1Y6QA 2A1UB 221PA 2N1BA 4AQ7A 2DHEA 3LIPA 3AX6A 5DOVA 3FMIA 3WKCA 2UZ4A 1JBKA 1N9GA 2HW8A 5CNIA 2QTVB 4U2FA 2YIMA 1H2FA 1XTZA 2O3SA 2HTFA 3IQGX 4YB8A 1CQJA 2B3DA 2J31A 4EO7A 2Q3BA 2QWXA 2B5WA 3U3ZA 1D4FA 2HJHA 1GVNB 3FPKA 4Q1VA 2GJSA 2B82A 1N7IA 1YBVA 1COWA 3P2YA 3P71T 2DWCA 4DMRA 4YQYA 3KWFA 4L3WA 5ELMA 4OHXA 1E3IA 4XYBA 1GGNA 1EVKA 1PFKA 1V3TA 4KIJA 4FJ1A 1V95A 3TE6A 1BKDR 4GI1A 5MHTA 2B21A 1JFLA 1R9MA 1MO5A 1KO1A 4F5WA 1NVFA 3IAS1 3QPVA 3ECSA 2RGNA 4FBLA 5E6RB 2D06A 5CA0A 3WL7A 4XPIB 5JYCA 1Y1KE 3PUWA 3ZJVA 4URXR 5DMXA 4AQYB 1FYVA 3P20A 4L5IA 3OJWA 2P4SA 1I33A 2QT9A 4FFSA 1X7YA 4AWBA 1WSBA 4M1TA 3P0JA 4UM8B 1FYFA 4DEXA 4BWFB 4F1WA 1JG6A 3U09A 3AUXA 4AT1A 1S8NA 5K09A 2PUTA 1TZCA 4M0UA 5K8IA 5K8JB 4FDMA 2JFYA 4L6IA 1HL7A 1G1AA 5DW3A 1XCJA 3K9NA 1M0TA 1TL7C 3MUFA 1Y89A 5CGQB 2Q5IA 2V97A 3H6GA 1TZMA 2G63A 1NNSA 4GYJA 5LBIA 5D85A 1PJ8A 2G1KA 2IYNA 1Y3HA 3CC8A 5JPCA 1ABBA 1XTKA 3ANYB 3EG9B 3F8WA 3N0TA 5D51S 3ZXIA 4BFTA 1YVEI 4DLSA 3QXSA 4Z1OA 16PKA 4CMCA 2OG2A 3DE1X 5F1YA 1JB1A 1V41E 3AT1A 4KI0A 3BCSA 4LQCA 4M9QA 4UARA 1GNRA 1LW7A 1T36A 2VZEA 2C0CA 2NZVG 4TOIA 3SJ7A 2XQJA 1H05A 2XOEA 3M81A 2W6MA 1XMSA 4PBSA 1YDWA 3DD5A 2HUNA 3C98A 2ZZNA 4MCJA 4MITA 1X0XA 4ID3A 4LAFA 5GADl 5TQJA 1XL1A 2OFFA 2QL7A 1XMQB 4IDFA 4LV8B 4D8XA 3CIFA 5KNCA 1WUHS 3T3DA 4OU5A 1LDNA 1FP2A 3U44B 1G16A 3GLKA 3HBLA 4HVCA 3FSJX 1J2JA 2ZRJA 5HX7A 3OZGA 1L7NA 4R1MA 2F9MA 2FUNB 1KIFA 4WWHA 2ODWA 4WV3A 4C6SA 1HE2A 1PG5A 4YJHA 4DEYA 1DB3A 3EMVA 3F6SA 4WZBA 3ZE0B 4KAJA 3NTOA 1NM5C 5EGNA 1V8DA 1O8BA 4FN5A 2LZ0A 3P19A 1B2LA 1F3LA 4XWGA 5DNDA 3NP9A 1HKUA 5TGTA 5KX5F 5TMDA 1XJQA 4E5DA 1T9DA 2W00A 3EC2A 1KZ6A 3EY9A 4WGGA 3IBGA 2Q3FA 2ZWOA 4J0IA 5JBNA 4DNPA 3WIEA 1GOTA 1EFCA 2OBFA 4DG5A 4EGSA 1G66A 3T0IA 4O4LF 3IDSA 3N87A 3QITA 4O08A 3V8PA 2PMWB 5JZOA 3UANA 1XMJA 2BKEA 3COSA 4N48A 3KZNA 3O5AA 3NHRA 3MJTA 1NVTA 1KZ9A 1ZCZA 2I34A 3KB2A 3NEJA 1NQVA 3ROMA 1DRVA 2HLDD 5JS7A 1R8XA 1WBDA 4HNQA 4LPSA 4DV4B 2IHKA 3D6UA 4ZOLF 5IBCA 1U3FA 3PKJA 4E4TA 4FFMA 4YLEA 1QUFA 2GJ4A 2WJ4A 3LOQA 4AF8A 2ZM6B 4G0PA 3URMA 1MDBA 3Q40A 5C81A 1NJ5A 8MHTA 2OUKA 3LHKA 3MGKA 1FDWA 5KC8A 3EZFA 4O3FA 3IH5A 1SOAA 4GXNA 2FHPA 4ZJPA 3R7DA 3A9UA 1WS6A 2HK7A 2ISCA 3L8DA 4D92A 3KSBC 4ANFA 4XVHA 1PL6A 2P3LA 5AHXA 3UCEA 3FNFA 3O91A 1AHIA 1NM5A 2QOEA 1GCIA 5EUCA 4PVCA 1MRSA 3U61B 3AJ9A 4ZTZB 1QIKA 1U2RA 3KR0A 4H77A 2PKQO 5FI5A 5I4CA 3HUFA 5JMWA 4HQKA 2XXJA 1EXDA 1R9GA 1QLHA 4FNMA 1N8SA 4DNOA 2QUIA 1BRMA 4QTXA 4NCKA 1KZYC 2BLNA 3PX3A 3Q9LA 5AVJA 3GN2A 5G0WA 3C3BA 5DI9A 1E1YA 4IDCA 1IYZA 4JXJA 1IBMB 1KYIA 4RM3A 3DTVD 1I3NA 3ZHXA 3CKYA 1X77A 1OZ0A 3DR5A 1Y4ZA 4DUZB 2NZ8A 3QXGA 4C43A 2UKDA 1AIPA 4U7HA 4XX1A 5FA5A 2GWHA 3LT0A 4YRFA 3F71A 3G0IA 4RHUA 1PUXA 1E0JA 3X1YA 4F2DA 1AKYA 4R84A 1KKUA 1SG0A 1NVVQ 3L1UA 3FNRA 4IJQA 1DJQA 1M72A 2FCAA 5LA6F 3GYGA 3B2QA 2QSUA 1XXHE 2HRBA 3CONA 1WHSB 1JLLA 4IHKA 3ZJTA 1CLEA 1Q1QA 5AXCA 1XYVA 1OWMA 3CF4G 2BWJA 3DE4X 4RXTA 5A04A 3SQDA 4FYIA 4PWYA 4LF8B 2Z1MA 2PKQP 3EPRA 3MBKA 4QQ8A 4XVQA 3LUJA 3DULA 1CR0A 1T5SA 5BVHB 2NN3C 4JH0A 2B6HA 1Q17A 3SOPA 3PZBA 1U8AA 1XD2B 2EW8A 3WBFA 2C1XA 2O5CA 2YXPX 4M7RA 3W78A 1NI4A 4AXXA 4LDPA 4KQWA 4UXJA 2QZ4A 4R41A 3FYTA 5JEDA 3GRFA 5F5NA 2P6UA 2YFYA 3CEJA 4R8SA 3AK4A 3SEFA 1CZKA 2W0SA 3D1LA 1YA4A 1UZLA 1JAXA 1RJ9A 2IF0A 3KZCA 3MSXA 2EYUA 4K9NA 4LI3X 4ZQHA 5TS2A 4KMRA 3SWWA 1F2TA 1SQ6A 2QE7A 1IJKA 3AUUA 4FR5A 4QJIA 5DGTA 5IN5A 3ZDAA 3RVPA 3ZXXA 2HA0A 2KSQA 1QIFA 2Z09A 2V45A 4BP8A 3L4JA 1C1XA 3BFKA 4HBZA 3RS2A 3UC9A 1UOQA 3GRCA 5B5SA 4ZK6A 1DUIA 4MV7A 1UFOA 3LRPA 4U2BA 2ZCUA 5L3ZA 1W4RA 4RPIA 1TEXA 1VJ1A 2V4UA 3T7SA 1JKFA 2VUHB 3B3QA 2I7XA 1V8PA 4FBGA 3ROFA 2D0PB 2WFLA 4E03A 2PWBA 2YQ5A 2IBTA 1ISRA 3H1TA 1Y1PA 1J90A 3RJMA 1V5IA 1MT0A 4L76A 1LSJA 1A9TA 1TKRA 4ZEVA 4DBZA 2QTAA 3CH7A 3W04A 4XQEA 1CHDA 4AP5A 1AQLA 5AMXA 1U2EA 1LY1A 1ZH8A 4MKFA 1EWRA 4NZZA 4E6PA 5K0TA 3EULA 1R5JA 3D0OA 1V48A 2FSGA 1UMBB 2AH5A 3DUFA 3KXIA 4FNGA 3HU1A 4WDRA 2PX3A 2FTKE 1CUHA 2I4MA 3AY6A 4RLSA 4KXYA 1UCFA 1Z07A 1H4QA 1COZA 5IAOA 4P3XA 1EUCB 3AIIA 1RYMA 4YJHB 3H5AA 1RAFA 4DSZA 1XCMA 3PI7A 3AM5A 1GKIA 2CXQA 3HCRA 1RKXA 4MB2A 4IICA 1BN7A 3H3XA 5CDYA 1CNFA 1DQYA 2QMEA 3GEDA 4DQKA 2GZ1A 5A3JA 5BPFA 1GXSA 1K0UA 4MSUA 4EG5A 3C7CB 4FINA 2ATIA 4E15A 1QCYA 1FRVA 1JDBC 2I1LA 4AYWA 4NP6A 5IHPA 1HRDA 5EQFA 1FW8A 2I4RA 3IBCA 4X1IB 3WJAA 4GRIA 1KH2A 3G88A 3AHCA 1WDMA 2IDMA 3K0EA 1U2QA 1I9GA 1XR3A 4BXOA 4Y7CA 4BFLA 4ZEWA 1OB2A 1CY2A 1F8YA 1TW2A 4QJ3A 3G7NA 3EXAA 2AZTA 2HV9A 2X8BA 2J1LA 3ENQA 5J5VA 3UPDA 3DBHB 1J2YA 3C39A 3DZDA 2ZJ3A 4OP2A 3NMUF 1OSNA 2OCAA 1AZWA 4D9HA 1ZVVA 5KYNA 3KXLA 3BBPA 2K2WA 2WA1A 3VDXA 4BFYA 2DCUA 3EUEA 4K9QA 1C1DB 4J2TA 1D8AA 2BZSA 3J7TA 3OTIA 4UMDA 4BC0A 4XJTA 4M7PA 4ZYZA 5C52B 5F3WB 5SYNA 1L6IA 13PKA 3C74A 1F7VA 2CYAA 4ZWNA 5EE9A 2XDQA 3ROXA 1G3MA 4QPNA 3TIFA 1YGPA 4M0CA 2NMVA 3K1JA 1P60A 3OQNA 2X22A 2ZFUA 3EXFA 1XSEA 3WK4A 3HK2A 4H6WA 5H81A 1L5LA 1A98A 2AZ4A 4D80A 4UAUA 2FQYA 2PPLA 5F7JA 3DMPA 4Z3DA 2BHTA 1IB0A 5DNYB 2RKBA 4E2ZA 1T2DA 3WRVA 4YGXB 4EJSB 3FIJA 2VXOA 5B4UA 3GNQA 3PGA1 1IXKA 1F0KA 3K4QA 5A6SA 1PBTA 1POXA 4J29A 2WMYA 3B5IA 4W8GA 3G6WA 4OMDA 4HNUA 2YJ3A 2P5UA 1E4OA 4QT4A 5LDDC 2FW7A 4QUEA 5C31A 4L4XA 3MTQA 4D99A 1VSQA 3AERB 4RU1A 2NU6B 4CMHA 1Z35A 2VUTA 3ABSB 5A5GA 4Y6RA 1B6SA 1N5OX 4WVFA 5KVVA 2AXQA 3W6NA 3IOBA 1AH2A 3WRWA 3I9JA 4LEIA 2WUFA 2GBFA 3MHTA 4RJLA 1JEYB 5TR9A 1LNZA 1RCFA 2JEOA 3F49S 1EWTA 1PGOA 2P75A 2FWJA 4UHBA 1W5AA 3GZJA 1J5XA 1ZUIA 4PAWA 4ZHQA 5KOIA 5M7EA 2X15A 4Y2UA 3IULA 1R50A 4FYWA 1C3XA 4D44A 4KPYA 1NWHA 1E2FA 1JEJA 1WOMA 2F17A 3CA8A 3GFRA 3IA7A 4MKIA 1GSIA 4HNRA 3FOWA 3IUJA 4OFWA 2VP3A 4UUOA 3V4SA 2D7DA 5DHQA 2PANA 3A9VA 1ILEA 1HNXB 5LNK1 1B14A 3NKFA 4KFSA 1S8OA 2NO4A 4GOJA 3VNSA 5HOQA 1N33B 4KITB 3CE9A 4XE5A 2ZTSA 5HCIA 4UC0A 2MSWA 5LCXA 3DAPA 4AVYA 5BQPA 1J1ZA 1IMJA 1G20E 1NI4B 4K6KA 4Y6GB 2VSOA 4HH0A 3GJQA 3GMDA 3QMMA 4MV8A 3HKDA 1RBMA 4EHHA 3GJ0A 4ZGGA 1NYLA 3IT3A 4KNVA 3KVVA 5C7YA 2XRMA 3AB8A 3I76A 1QUEA 2C83A 3OT1A 3KJHA 4IQ4A 2IUSA 2CBXA 3KYCB 3F2IA 4ZGWA 3RRBA 3ND8A 2RAFA 3EGOA 4NPAA 1PTJC 2OSBA 5K8VA 4HPWA 3QMWA 1C1XB 1J5PA 2BEUB 1EFTA 2H5LA 2QZZA 3OIVA 1N3BA 2F3UA 4A3SA 1QYCA 1QFZA 1HTWA 1XTQA 3DC2A 2O54A 4M1QA 4YYZA 3Q15C 3OLZA 4G4IA 2ZKIA 5ARDA 2H06A 5EHIA 3WGHA 4ZAYA 5SZKB 5HRUA 4DRXA 5I7HA 3TBHA 3SZRA 4X62B 5D86A 2NYAA 5I7SA 1JJVA 2NTYC 1PLKA 1U1GA 2FK8A 3NHZA 5GQSA 2AR7A 1UDAA 2QLLA 1OI7A 2PGDA 2WHQA 3EQ8A 2FEWB 3DJYA 2P2NA 2P8JA 1VCHA 3R6GA 2CB9A 4UMFA 5AVQA 3QEJA 3EDCA 4RO0A 1G21B 4G1FA 3GLIA 2BKUA 4UOEA 1GDDA 2EIXA 2VJCA 3GNSA 3LMKA 5DM70 5A71A 5HF8A 4BLOA 2Z1DA 3IFSA 1E1NA 3CKKA 1BH2A 3COZA 2FSVC 2FMIA 4G0NA 4DMMA 3AL0C 2VRCA 4I9FA 5KTKA 3SE7A 2XZLA 2C9MA 1HGXA 3GLQA 1X7WA 1C4OA 4JUBA 3FGNA 3U4QA 3RV4A 4B3HA 2OFWA 4URYR 3VR4D 1P2SA 4R54A 3ABZA 2CVQA 4N0MA 5CW2A 1E5TA 4W5NA 5K6AC 1OXUA 3IAM1 1K3FA 4HQLA 4JITA 3LECA 3P9YA 3O82A 5EMKA 3WDMA 1PTJA 2GK7A 4ABYA 3CN7A 2NYVA 5K0ZA 3H16A 1L4GA 2XBUA 1YL5A 4A0QA 3A4LA 1I32A 1OZHA 1GYRA 2A86A 3SN6A 2JFWA 2ZR8A 5BV8A 4GOXA 1Y8QB 1NLZA 4URHA 1Z7YA 2ODPA 1G8KA 1OXVA 2GT1A 2JFBA 2N75A 1MIOB 4Q3DA 2VHQA 1QS0B 3BK2A 1PJAA 4K9LA 4KKXB 4QATA 3LVRE 2DETA 4IFIA 3V1LA 1G8JA 1WWKA 3MWYW 3STTA 4TLMB 3ULKA 2AMJA 3TOZA 1VJ0A 2W93A 3C1OA 2SICE 4Y7DA 3N8DA 5EE0A 5T3UA 3TSAA 4BQOA 4E3ZA 3HY3A 2LD4A 3EIHA 3GLRA 2SCUA 3QV1A 1SXJC 3G2PA 4IHJA 1DADA 2ZQZA 4L4RA 1P7PA 3FRJA 4YS6A 1YRBA 1FFHA 1GNTA 2OSVA 3WLSA 4CCYA 4EYQA 4CMEA 3AEYA 1LNQA 2VCHA 4OU4A 3ZZ1A 2UUAB 1T2VA 4ACAA 1W5BA 1UBGA 3SSAA 2UYQA 3HV2A 4KZKA 2FSVA 3WTCA 4O4IF 1CIPA 2DPHA 3TRJA 2CNBA 1A9PA 3G8YA 3HA2A 3PL5A 5E4JA 3A9WA 4K7JA 1KRWA 4BBAA 2ZSUA 5KAPA 2ACWA 2O20A 1DZ3A 1W30A 3OCUA 2OB2A 5E4YA 3WTBA 4QICA 1IC6A 2I8LA 4D02A 4AF7A 4PSKA 2XCLA 2ONKA 3GRRA 4ARVA 2PO7A 1EK2A 5ALHA 2YHBA 4OBWA 2VDVE 4Q3NA 1KPGA 2ISSD 3OBIA 4R7TA 1SCNE 5FCDA 4U7DA 2WQZA 4QPJC 5JAHA 2FEOA 2VYNA 3D4NA 1JDBB 1WXWA 4YN3A 3N6XA 5HGJA 4H18A 2Y93A 1KDOA 1MORA 3IMGA 1X94A 4JYZA 4UUAA 1HY3A 3KALA 2QX8A 3R3HA 1OPXA 4YFVA 1YXMA 3BJZA 3DW3X 3RRXA 1ZU5A 2FPIA 4DA9A 3QV2A 3L0CA 4L75A 3P9ZA 1GT6A 4BX8A 2Q2WA 1Z0AA 1C2TA 3A10A 3DD1A 2W6CX 4HXEB 4YP1A 5EMJA 5JVDA 3H2ZA 1W35A 1LLUA 2P3QA 1GPDG 3GDOA 3O7WA 3FOCA 4MWCA 4B3JA 3QK7A 4G63A 5DBHX 3DONA 4O2AB 4QXRA 3ZDFA 4ENTA 3K0HA 3CRZA 4K0KB 3SC2B 5D6OA 2GMWA 2PWZA 3OH8A 4PLTA 4Q24A 5I9MA 3IMKA 3SS9X 5JQGF 2Q45A 2BHNA 3RFFA 4QFBA 1ZPDA 2Y3IA 2FWPA 2L2QA 1QH8B 3IDFA 3ILSA 4KWHA 4ND8A 5HFAA 1E9CA 1R66A 1BN6A 2Y1FA 5J2UF 2CHQA 2P40A 1F3OA 4Z9FA 2MWMA 5JDCC 4D46A 2ECOA 5IAJA 1EKXA 5JLJA 5BNFA 4BZWA 2JAQA 3KOWA 2NUPB 1A9ZA 2SHKA 1JB9A 1E2JA 1FDIA 2I2CA 2YDXA 2BDUA 3GAAA 1BDMA 3KPVA 4JWKA 4V0SA 4CI9A 4HJXA 4YRIA 1J2UA 1Z62A 3ASUA 5F9HA 5GZ3A 4JYAB 1U2TA 1P9NA 2AEEA 1W8DA 3BHJA 3FKJA 1YVUA 1SG9A 2IK8A 4FMCB 3RIGA 1ZHFA 4OREX 3R8XA 3T12A 4U63A 5CURA 1IDN1 2YNMC 3BXZA 1FFGA 3HFSA 2SKDA 1G1MA 2JI7A 3RG2A 3UATA 5KTSA 2ID7A 4BN5A 1AKTA 1A7KA 4Q9HA 1A8HA 4ZI2A 3SKYA 4KP7A 2GHRA 4C6RA 1D6MA 3I34X 4PYIA 3WIOA 1MPXA 3RM3A 1U0BB 4V0QA 1EP3B 5AKJA 3SZMA 5A4IS 2OLKA 2Y8EA 5KINB 3PUZA 1QKJA 5B3JC 3H5TA 3AXSA 3K1AB 2ILTA 5EHNA 4I36A 2EL7A 4KPGA 3HS3A 3JXEA 5FTMA 5JI3E 1RVV1 3B52X 4J03A 4QEZA 3OKAA 3BX1A 4M21A 2QN2A 1O4VA 2HHHB 1F9EA 4JU8A 2JBAA 4NBTA 2Q9CA 1RKQA 3D02A 2ENUA 4Y6OA 4ENRA 4R0MA 4OHWA 3GUHA 3AFNA 3CF0A 4U3JA 2PL1A 3E5NA 1DBRA 5I7UA 1PT6A 2OXEA 3CJRA 5EPEA 3FKQA 3HXLA 4CTKA 2FZ5A 2P11A 3N8NA 5IABA 3ZGLA 4HXYA 4P2BA 3X1XA 1TO1E 3MG9A 2VWHA 3VC3A 1UK9A 3O8RA 1I4DD 4UVEA 4YXFA 4AMVA 4JEUA 2WTXA 4N76A 4OIMA 4MLDA 2AR9A 1OH6A 5A0FA 1Y9JA 4QNMA 2F48A 3RYFB 2QB5A 4MW4A 1K6JA 1ZRNA 5F23A 1T34A 2A3NA 4ESVA 1Q20A 1FMCA 1EI9A 1FNCA 2YNMA 3CLKA 3CSSA 3MC1A 2QZ9A 1XAIA 4TTQA 2EZUA 4M0DA 1BX3A 2Q0XA 1SCAA 3PTLA 3BYZA 1IFXA 2Q3HA 3N7UA 3BEOA 3VV2A 2JL1A 4FT2A 2IKQA 3CLUC 2R3SA 3F1LA 4RY9A 1M8KA 3T7AA 4B7AA 1PUIA 2BFEA 2ZB7A 3A4TA 3VPCA 4DT1A 4N9QA 1RXYA 4NXNB 2XSZD 5G0UA 1PZGA 1YR9A 3SNHA 2CLHB 2O07A 1HDZA 1Z8NA 2Y4OA 3L7MA 2GYVA 4K9MA 2XWSA 5DGIA 4ALIA 2HHJA 1TMYA 2ANCA 3CCBA 2GBLC 4JQOA 3UWDA 4W9RA 5JBIA 3KFXA 2BKVA 4P7KA 4DVGA 2Q28A 3TLXA 2R6R1 1NDUA 4ZEOA 4DLPA 1NP6A 2QTRA 3LA6A 2PO5A 4F92B 1UK7A 2HXYA 2YC4C 3ZVKA 2JLXA 1XA4A 5IJ9B 2C2XA 4LCJA 5DLPA 3U1BA 4IVPA 4AD8A 2XCUA 3OF5A 2GN1A 1OFGA 3PE3A 3C4QA 1IJEA 2P3OA 3OZBA 4MWTA 1J9ZA 4CL3A 4P0PB 4YCBA 5FYDA 3OF2A 1QTRA 2QMQA 3CT4A 4ESEA 3E7FA 5FRDA 5JNSA 5MFZA 1SB9A 3FSRA 5HFNA 1X7DA 1VMIA 2JK0A 2ILVA 1XRNA 2PGJA 2ZS9A 5K3FA 1E3DA 3U48A 1KJZA 4RORA 1JJBA 4Z3OA 2G71A 2ZUCA 3ISTA 1N34B 2DR0A 4V0KA 4Z9YA 5JCJA 1ZZGA 3AVQA 5DWVA 1TQ4A 1P5RA 1LWOA 4QU8A 1JEOA 1ORDA 1T3ZA 2RB4A 2ZPTX 1WR8A 1KDVA 1IVNA 1JE0A 1M7HA 1T6BY 3HM2A 4L5BA 4Y2YA 3TVDA 5C3MA 5L53A 1H2WA 1N75A 1N2GA 2IELA 4JLVA 2AMFA 2Q2OA 3DBLB 5A6VA 5DLQC 2IXDA 3H9GA 4MVJA 4BQPA 4BNIA 4GRAA 5ECYA 4URUR 3M82A 2JFPA 1K5GA 3CRMA 4OK3A 3ZCPA 5K99A 4JYBA 2O59A 1T9HA 4CYMA 1HMYA 3FUUA 2HO5A 4A23A 2Y71A 4K46A 2DFLA 1L8XA 2GCGA 3CO5A 3HTXA 5EMNA 3ZTYA 5HK9A 1I7PA 1FMJA 2CD9A 2QSJA 3LX6A 1LRLA 1V1RA 4EI7A 4ARZB 1SXJB 2NOAA 3WLEA 1B6GA 2XKBA 2OHFA 4F5EA 1XZEA 3WIVA 4FOLA 2I55A 4JLBA 4L8LA 3EGXA 2QLMA 3RYCB 3T3HA 3QOWA 3T1QA 2J0UA 1JYSA 1E3WB 2XWPA 2BTQB 4UQLA 2JJ1D 4COOA 1UEIA 1E1CB 1T4DA 5FPPA 2W71A 3I5AA 2GRAA 3STWA 2DJIA 3KU1A 4WL0A 3G9QA 2PL3A 3FDZA 2G76A 4J9VA 1PGPA 4L5YA 4MYCA 2C94A 4QHSA 1PGQA 2Z58A 2A78A 2B9VA 3CZPA 4XA8A 5DH9A 5AVOA 1HO3A 4F2PA 3X44A 1DG1G 1P1IA 1QWSA 4K0RA 5AI6A 3UWSA 1FQJA 1T43A 3KVYA 1TCAA 4AU1A 4NDZA 4XWTA 2BE7A 4UM9D 3BUSA 1OLSA 4P7BA 1DKPA 2PUCA 4K88A 5GV7A 4RGQA 2C9OA 1UP4A 2I6TA 3TAUA 3TH5A 2Z5VA 5E2IA 2R8RA 1XQWA 1ORWA 2BDEA 2CXNA 3KB1A 1G3UA 1R0BA 1SIWA 2EATA 1ZICA 4DADA 3H86A 1F0YA 1GT91 1NE7A 2FZLA 3E27A 1USIA 1OBOA 2WSMA 3Q10A 4JR2A 4QHTA 4XEHA 4YDQA 1WETA 3HA7A 2R6DA 1QGAA 1QX4A 4NC9A 1G18A 5HUQA 3E3OA 1WW3A 3HJFA 3AR3A 3KKPA 1CETA 4I8DA 2GZ3A 2IHUA 3AIOA 4P3KA 2R86A 1A69A 3F46A 2WIJA 1P6UA 1EPUA 4NU0A 1BKSB 4YROA 3FFBA 4Z4FA 2P2SA 4BE9A 4RTQA 5KNBH 4LF5B 2NP7A 1CIVA 3PFCA 5FYQA 1JPJA 4QTUB 1L7XA 2VSYA 3S7TA 4CV0A 5HNKA 5KUTA 4AI6A 3WB0A 5BNTA 3A26A 4M53A 3LP6A 1P6QA 4I7EA 5BV0A 5AK4A 4Q1FA 1O0SA 4DDKA 1AMOA 1X3LA 1QRRA 4KN9S 5BT8A 4DCJA 4LVUA 1UT6A 2JGKA 5B12A 1KZ7B 1XEAA 1TT5A 2O7NA 3MAGA 1DTEA 1DHTA 4LE1A 3KOXA 4WNIA 4DM4A 2AZXA 1DEKA 3R7WA 1JSXA 3F0TA 3FMFA 2O7SA 2YIVX 2XZDA 5IBRA 3T5GA 5C46F 3IPLA 1QMGA 1PT7A 2YN2A 1RABA 2Q1TA 2PBFA 3EARA 4IZHA 2HIHA 1Z6ZA 2C2YA 4S12A 1IPEA 2X9LA 3H5VA 1DUVG 3PUVA 3KSRA 3BAFA 4IWXA 5CCEA 2B6NA 4DIBA 1S2NA 2Q5FA 3O47A 4IZIA 3IPXA 4OBXA 3K70D 2GEDA 4F72A 3AVVA 2ORED 1SVUA 1ST3A 3K5HA 2I4OA 3U9SA 1U7ZA 4FQ5A 4PIMA 5JDIA 3NC1C 1Z9BA 2C4VA 3A36A 4OUDA 4C3OB 4CCSA 4MR8B 3WIUA 4F8JA 4JB0A 4WLFA 2BY4A 2VDLB 1E5QA 5ALUA 3K8QA 5FUQA 3ESZA 3KUKA 3GK3A 3IJEB 5AKYA 1O6FA 4XCVA 3CW9A 1RHMA 2JIMA 3FNIA 1XVLA 3O7MA 1SKAA 3WAGA 4CU5A 4E5SA 3CZMA 3GFTA 2IYWA 2YMMA 3WNBA 4PQFA 3EPLA 4HS9A 1SVOA 3KVRA 4CM9D 4CGZA 4GKVA 5TQ0A 3CNLA 4ALLA 4BVJA 1ZU4A 3AI3A 3C2QA 3EFBA 4S1PA 2Q9UA 3NVKI 1X8JA 1WW8A 3RVSA 1TQDA 3CHYA 3E1SA 2ZM5A 1DX9A 4P2GA 3RR2A 2VNJA 4BMYA 1I2AA 3QE2A 4OKSA 4N03A 4ZANA 2LV8A 1PJ4A 3CZCA 3KOUA 3PV0A 3N2GB 1LVGA 1Y4DE 2XYVA 3R3ZA 1XTSA 3JQFC 3JTEA 4W9NC 1YRWA 2ODTX 4P36A 4RNDB 5IJXA 2WR8A 3BL6A 1NUQA 1N4DA 2QTNA 4KTVE 2HTEA 2WLSA 4YJGA 1IZ9A 5ADWA 4AN1A 3MJHA 2V6BA 3FMOB 1ULUA 3GT7A 2YXBA 3O0DA 1U3GA 4B9EA 4PO9A 4MI1A 4YA6A 2EBUA 2M98A 2J9ZB 2VBCA 4J07A 3C5VA 5IK2A 4TZ6A 1JHYA 5JZSA 3KB6A 3KEOA 1TUIA 2LPMA 3NOXA 4CKBB 1MNAA 1EGQA 1SB8A 1PFUA 3IVCA 2XA1A 4G8CA 3FGOA 3Q4GA 1Z47A 4Q4AA 3HM9A 2JGLA 1C50A 1QQ6A 3GHYA 4E88A 3BTOA 2J7PD 3CRRA 2DFNA 4NECA 5KYYA 3GVXA 5E4TA 2GK3A 3S8MA 5J2TA 5IAAA 3PPYA 1QHHB 3LUDA 4IDBA 5C80A 1KL7A 1DQRA 4CQJA 5CDUA 1KZ1A 3Q7PA 4F4DA 1JHZA 3BDVA 3JQ7A 3GRUA 2K5UA 1V3QE 3FBTA 3IUEA 1H2BA 1TMGE 3G89A 1SOWA 4BAUA 1SKQA 4P31A 3SY8A 1BEUB 4DY4A 2IZ1A 5EVJA 4GKBA 1DWUA 1KQPA 1N6PA 1UBUS 3D43A 3I58A 1PAUA 5EEHA 4RMGA 4TVSA 5FWXB 4KRFA 3OWXA 4G9GA 4PFJA 2AV6A 2YN4A 2EFJA 1B6RA 2YUTA 3I28A 3IE1A 4BN0A 2EW1A 3LFUA 1E2EA 1MX5A 1V11B 4ZQIA 3RV3A 3JQFA 3ZS9A 1WZCA 3KK0A 4GYYA 4DW8A 1SCQA 1HUQA 4HUJA 1W25A 4PSVA 1ICIA 3TW6A 5LYJF 1CEEA 3QUQA 1NQUA 3LT5A 5KYUB 3NRBA 1M8GA 2H52A 3B2EA 1PS0A 2G06A 3QGMA 1K08A 4MUYA 3B36A 3TLAA 3F8TA 2UZ1B 1AN9A 1Z8FA 4L3OA 4M83A 4X94A 1C1YA 1LBHA 4JIMA 3TYXA 2FEMA 2CDNA 1T2FA 2Z57A 2O8FA 3LCUA 1O89A 4H9GA 3J80A 4V38A 3FTPA 3MTJA 4HLQB 3AP1A 3KTAB 4MWSA 2WWVD 1NASA 1YASA 2UVQA 3QU9A 3ZE6A 1XDGA 3M6AA 5JIBA 2EIHA 4Q4JB 2J9XB 1CY8A 3JQAD 4XDHA 4EUHA 2C9ZA 3L6UA 3UOAB 2VZ0A 3RSCA 3ZCQA 3EZXA 1E79D 4W8OA 4QDXA 2H4XA 1CZHA 1CU1A 4JZYA 1T8TA 3GGGA 4ND1A 1Y0BA 4YRKA 2RONA 4AKEA 1GQOA 1A9QA 1ZWLA 1L5QA 3IPYA 2DE0X 3PQ3A 1NP7A 4QYTA 4TV9B 4BNFA 4U9IS 1CDOA 2O50A 3D2AA 3EB9A 3I32A 1T1JA 3GWZA 5KWEA 3F6EX 5C8YA 3GIDA 4NAHA 4LNUB 4JS0A 5J4VA 4FIDA 5DBGA 2P77A 3KJIA 4LMPA 4PTZA 3D6MA 4BKPA 4ZT5A 1MG5A 5E8JA 2DM6A 4LBYA 1LGYA 4CR7A 2HT1A 2XCSB 1I4LD 4YK7A 2RGDA 1B42A 5FQOA 2FUKA 3FW1A 1R12A 5DNEA 5KOYA 2XT0A 4X20B 2ZT5A 1VG0B 3L01A 4LWZA 3G2IA 2DTDA 3OPNA 1OPRA 3HN6A 4KO4S 2XTAA 1J2EA 1PX0A 4UHEA 2NG1A 1RFGE 1ZM7A 4YJ3A 2VDQB 3I9V6 3KD3A 2D1QA 2C78A 1IXYA 3O84A 3H8VA 4ZRNA 3E7WA 4F4CA 3PEEA 5EHXA 1A8UA 2GUGA 1H8ED 2ZZMA 4GC9A 2AN4A 1MJFA 4Q1AA 4TMYA 4MWOA 1O97D 5CU7A 4O4HA 2PMEA 3O9VA 1GTRA 2LCFA 1XGKA 1W73A 1VMDA 1A88A 1Q14A 2I4NA 2X40A 5H9VA 1ELOA 5CLIA 1KY3A 5LOVF 2PGAA 1J25A 4LGVA 1Z6YA 1ZA1A 2AS0A 1RRCA 2FU5C 1CS0A 1EFRA 1T5HX 1U0TA 2OUIA 4N0PA 3E9CA 1W7AA 2YXLA 1RAGA 4FYJA 3W4JA 5ULLA 1RHUA 5L51A 1SHLA 1D6JA 1HA3A 1O9HA 2EG5A 4TWJA 3VZQA 3MJFA 5G0TA 1EXMA 2WJ6A 4NHEA 4Z99A 1IK4A 1Z5NA 4YJKA 3LL4A 1D0IA 4K3VA 5EERA 3ANMA 5FPHA 5HKKD 4NJEA 2B20A 3ASVA 3QE0A 1EZ1A 1XQ9A 1NOKA 3AR4A 3O8NA 4IYJA 4ZVQA 2DQYA 5T8KA 4BVBA 4YVFA 1V6CA 4AYXA 2AG5A 4PQRA 5TMEA 3RF7A 1O1YA 1AQYA 4RS4A 2GN6A 3O4HA 3KCNA 4Y2GA 4K26A 1CR6A 2WPNA 2E55A 3VISA 1TD1A 3O03A 4MROA 4PYRA 2FX2A 5AI4A 3GGCA 3JD2A 2VTVA 4JI0B 2FXVA 1ADGA 3EGEA 3UH1A 1RBYA 3PE4A 2MR6A 1E6EA 2KWIA 4Q4HA 5C0OE 3PLAE 4TKVB 1ZFNA 2BKXA 4DAEA 2YOFA 3I3OA 1KVQA 4XRGA 1KOGA 1FDVA 3VKUA 1GTVA 1BJTA 3LDFA 2HR1A 4FSHA 3IIJA 1L5GB 1FX0B 5JMPA 3P2JA 3KZKA 4B3CA 4E5UA 1T4BA 4DOMA 2XRYA 5JCOC 3HE3A 1CHNA 1VA4A 3P2EA 1BWQA 2X23A 3AEUB 1GU7A 1JR4A 3DEJA 3QFHA 4N5NA 4C2UA 4DM7A 1ZBQA 3QKSA 1QLJA 4JCOA 3PPWA 4IGFA 3B7PA 4NG4A 4M7OA 1QHGA 2AKAB 1ADYA 5ENVA 3SYKA 1KQGA 5J2TB 1FJGB 2OO5A 3H2KA 1MNQA 2RH4A 4HDNB 4CHTA 1WMEA 4WBNA 3T06B 3WXMA 4BNUA 2OCLA 4EEXA 5AW0A 1KMNA 3ZE9A 3LFTA 4IV0A 1T26A 3F4BA 3OZCA 3PNYA 1NLYA 3RBXA 7GPBA 2HDOA 5GM1A 3FXAA 4EW2A 4BWYA 4LMRA 4M1ZA 1DBQA 2BEWA 1D4OA 3JWHA 1Y63A 4MR7B 2I2DA 4X6XA 4M1KA 2O2XA 1ZN7A 4IIVA 4M9XA 4UCFA 2PA0A 1DOAA 2FFRA 3NGMA 3T4EA 1OX4B 2EKLA 4PBTA 2ERXA 2ICAA 1AF4A 3BH7A 1FSFA 3MYRA 4FE4A 3QIAA 4JEHA 4OA8A 2YFHA 3QLTA 3MCWA 1T9ZA 5FL7D 1QGZA 1WNFA 3H6KA 5DSTA 1FL9A 3STHA 2ST1A 1TECE 1XWFA 3M6MD 1ABFA 4PO3X 4F85A 1ZAYA 1YH3A 3MZ0A 4YUZA 3LJKA 1YKSA 4WPGA 3CF2A 4QDKA 4P83A 1MW8X 4B40A 2M2IA 5FTWA 5JCOA 4BDTA 1BHJA 4CKXA 3IIIA 4OTZA 1AV7A 2BGKA 2B2XA 1QV6A 1ZN8A 2PD4A 3D3EA 4RJ2A 1JR2A 3TWOA 1U7OA 2Q5CA 1UP6A 3LX4A 2E5WA 4N0QA 3G8DA 1GRRA 4P6VF 4CIWA 3NBQA 2QXUA 4Q3EA 4UFOA 4DUGA 3I73A 2JAOA 4D56A 3ANXA 3TW0A 1NF2A 2EZTA 2V1XA 2E9SA 3KLOA 1NLUA 4K9KA 3LHSA 3QELB 2HHLA 4REMA 4N7JA 1U94A 3HNPA 5JNUA 5F4BA 1UKAA 3SJUA 4ESOA 4YRMA 4RPKA 5A03A 2VNKA 4OHRA 3QPAA 4C5CA 2J59A 2VNHA 3H8JA 4TLAA 4BX2A 3BFVA 4QTYA 1ESZA 4I4NA 2ZBRA 4PCAA 4UHFA 5TEVA 2XE4A 3SD7A 1Z4NA 4MIYA 2VL7A 4BRZA 1DIOB 1ZUWA 3ITKA 1BX1A 1O95A 4X1YA 4CG2A 3GCDA 2B98A 4I5FA 3OI7A 4RTNA 3OESA 1E92A 3PQ2A 2A4KA 1AJEA 1U3CA 3FI0A 1LSSA 3OD5A 4JJ4A 4RKWA 2PLWA 3DOCA 4X66B 3OKPA 2O57A 1EEHA 4WKBA 2JIOA 2OENG 2VCYA 1EVEA 3K9GA 1N78A 1FP6A 2HMSA 1EM8B 5JSHA 2XNCA 1D2EA 4PCLA 4G4GA 4PS1A 1DC8A 2MU1A 2ZYWX 1Y1TA 3B3FA 1X0VA 1JG3A 1FFBA 2H2FA 3FVQA 4FGWA 3N2EA 2YV2A 3ESXA 2R6HA 4WXPA 2VPQA 5LZ8A 3WX0A 5LD2C 1YAHA 1PNRA 4PPNA 4GEGA 2H8GA 4FCWA 1KAOA 2FQQA 3G2LA 5AVXA 4G56A 5IVHA 4FFOA 2YZ2A 4HP8A 3S28A 3UT0A 2Q1XA 1U8TA 2H2DA 3F6BX 3ZNQA 2MYPA 2QGZA 3AB3A 3MYYA 3U17A 1HDRA 2YWXA 1CX9B 4WZZA 1DQPA 3WP1B 1OLUB 2BMJA 2IVZA 4J3JA 3ZLBA 3CNBA 1ACJA 3KHTA 4A6PA 4UPEA 4HDQB 1ZIPA 5JRZA 5KMGB 1HYEA 3F6PA 3ZZ0A 2HK8A 1YOVA 1P7VA 3RSQA 2QY6A 2A5GA 3GFQA 3PQFA 2OCPA 3IGFA 1BMTA 1C0IA 1GZ5A 1LQTA 2RHBA 4E1BA 1UBHS 2Q6OA 2R96A 5DLDA 3NBYC 5HQ3B 3ZCSA 2GAAA 4AUNA 2ZAIA 3QOYA 4GC5A 3BJEA 4WUVA 2OL4A 2EJUA 4JLJA 2GN2A 3QEAZ 4RZUA 3K5IA 4DA8A 1O94D 1P1JA 2AN3A 2PTHA 3QRWA 3FRHA 2J9YB 3ZE2B 3ZKWB 1YFLA 2NNWB 3VKFA 4B2YA 2PGXA 2DG2A 3UFXB 2XZOA 3FN4A 2XOKD 2EYQA 5EWJB 1AURA 4UTRA 3M4XA 4L9AA 4WN9B 5EOVA 5JHHB 1M2VB 2F1OA 5ETJA 5FJJA 5CIYA 3AVUA 1XCOA 3I64A 5FKJA 2CB0A 2RG7A 1T1SA 4Z4CA 4UOQA 5A9SB 1LFDB 5JC1A 2BZ1A 2OOSA 1W0JA 1BCRB 2P65A 1FUIA 1J42A 3ITNA 4L57A 3ZQKA 4WXMA 4E46A 1YBMA 2QR5A 4ZCSA 1ZOIA 1YR7A 5CT8A 3JQQA 5HF6A 2H1OA 4Y1FA 3U39A 1BTOA 5EJGA 1FLVA 1QGUA 4PO1A 1T24A 3N2YA 5K51A 1MP0A 2O5RA 1E3QA 1QV9A 4HS4A 1JS1X 4B71A 2QGFA 1F8GA 3A04A 3LWNA 4DV2B 1ECFA 5LUBA 3P9XA 1OQAA 1XJCA 1UC4B 1JT2A 1M0WA 2IQ5A 2W2QA 3FHJA 1R6DA 3NHSA 5BWBA 5B1YA 4FFBA 4S2UA 1X2BA 5EIXA 3W5UA 1XI2A 1ZD3A 1NN1A 4JP3A 1F5SA 4MWGA 5I9SA 3FPBA 4NENA 4UDNA 2EJVA 3ER6A 1EJ6A 3O83A 4EO9A 4BC1A 4HMPA 2GZ2A 3IALA 2AFHA 2BZGA 2VT7A 5SY6A 5C1PA 4Q00A 2BEWB 5F76A 3P4UA 1WXGA 2Q3EA 3CTMA 3ORHA 1CY1A 3C3MA 3ZEAA 2VJNA 2R5FA 1JHPA 1MH1A 4TWRA 2YY5A 1MJ5A 1DWOA 5AIAA 2C99A 2GZAA 2G25A 2JCBA 3NJRA 4EP1A 5FPKA 3V42A 5BXYA 3ZJ4A 1JVBA 3FZEA 3R3XA 1N0WA 1NXSA 1J7JA 1YDGA 1YCGA 1ZL0A 3N6VA 4RCZA 2Q5HA 3RTDA 4Z8XA 5JJBA 3MRSA 1JQ3A 3DAYA 3DMRA 4BIMA 1UPTA 4Q3OA 2JCVA 1S3SA 4B44A 4CODB 1YC5A 1QV7A 3OHSX 3PDCA 3Q1KA 3UA4A 1GQYA 2F9LA 2QN6A 2QVCA 4I1RA 3R3VA 2IC5A 3CB2A 2VJDA 4I55A 2O2DA 3LV8A 3V46A 1GQQA 1XEWY 1UDWA 3NVMB 4RLQA 3T4XA 5GJBA 2WINI 3LHIA 3LBAA 1RJWA 3ZIUA 3E6AA 4BV2A 1YTUA 5E6SB 2D1FA 2D7JA 3LI2A 5AVWA 2WA2A 3BSSA 5AHWA 4OQNA 2NNLD 3EWAA 3LK7A 3N76A 2QP9X 2VOEA 2FPLA 4L2IB 5P21A 3W2EA 3H19A 5HF9A 3VTFA 5TVKA 5HFJA 1KXJA 4ZVUA 1OYWA 1UF9A 1Z5GA 4XVCA 3OOWA 1E4VA 5IDXA 3S1SA 2PN1A 1YCFA 2CBGA 3EN0A 2DSNA 4ZQEA 5E6UA 2Z83A 3VUEA 3GGOA 5B53A 3AFHA 4F5YA 3GBSA 4RHCA 3MOSA 1V2GA 4HUQA 4RIFA 3R5JA 4F9EA 1WB6A 4D4LA 4WIAA 2ZDQA 1X39A 1I4OA 3OCYA 5CVDA 4ARUA 4A36A 1XTRA 5HTOA 3U7EB 1UPUA 2W6IA 3DMTC 4H59A 4MR9A 3EXHA 4PPYA 5T3YA 3N2IA 4HWPA 1DDOA 2C2MA 4P5PA 5FPTA 4BNMA 5JD6A 2BM9A 1JEQB 1NW5A 1PP4A 1VDZA 1W5SA 1BA2A 4OJQA 1PWEA 1Y8CA 3IT0A 4KSBA 1L4UA 4OXNA 4LFCB 3TB4A 3HWSA 4AP9A 3LUPA 1N0UA 3MS4A 3KQVA 1ODJA 5FT9A 1S2LA 1D5WA 1XB2A 4D4HA 4HDMA 2O8NA 5TQ2B 4B7ZA 3KFVA 4RJTA 3TFOA 1J33A 4EQZA 5JRJA 3EGCA 2XB4A 3QSYA 4GZ6A 2JI8A 2J3JA 4C0KA 2PH3A 1L8LA 3WGGA 1G7RA 2EBFX 2M32A 3AKEA 3DZJA 4P08A 5IAKA 1E9SA 2ZAGA 4GOOD 2Y2VA 3KQNA 1UDCA 4IVNA 4IJVA 2A9OA 4PPQA 3CBQA 1N1GA 3K73O 4CLOB 4CXMA 2ZYAA 2Q46A 3TD2A 4CTNA 1JHQA 1Q1EA 2W2OA 5DTJA 2QGNA 1IJFA 5J63A 2YTZA 4KO1S 4PYQA 2Y6UA 4ECAA 5A02A 1XQYA 1ZMXA 1WABA 1H2AS 4RAOA 4CMKA 3T5AA 2NUTA 1Y8AA 2W2LA 4EHJA 5IAEA 4C4OA 5JYEA 4UM7A 3HBJA 1KDZA 1FVFA 1R2QA 4L6AA 4F9FA 1NN3A 1C29B 2VDWB 3JQ8B 1UPXA 1G7CA 3SIXA 4B3XA 2CKDA 4TL7A 5L3VA 3A25A 5B7QA 3UJNA 4EJ6A 2HU7A 2JDID 1SFRA 2WM9B 3H87A 3SU8A 3OX3A 4K6HA 2PSFA 4FM9A 5BW6B 4W5JA 3RU2A 1IVSA 2GD6A 5CMLA 4DIOA 3PICA 1PGNA 3JASB 4NV0A 4PAGA 4D9FA 2WWTA 3D54D 3OX2A 1JJIA 3TXYA 1WXDA 1Z5OA 1VHTA 3OCZA 2VRBA 5CB0A 2SBTA 2FQWA 3LQYA 2ZB8A 5AQEA 3V1UA 2D8MA 1U5BB 3M3DA 2I71A 2GDJA 3HN2A 2WQ6A 3BXHA 1GZUA 3HXPA 3IMFA 4YCDA 2C2HA 4UJ5A 4DV5B 2PUWA 2WWWA 2X3FA 1GJRA 2Z9CA 1N0IA 2PEYA 2AX4A 3ZCUA 1BU8A 5LD2B 2FRDA 2IT1A 2PYZA 1RWKA 2J4CA 3ICWA 1RZ3A 1OYOA 3NWEA 2YBEA 4GPD1 4HB3A 3JYOA 1DXQA 3CZ4A 1K75A 3PHIA 3UY4A 1K5PA 1LLDA 1U0RA 2YMPA 4DB2A 3MD9A 3ITDA 2NPFA 4HRAA 3TUIC 5J4KA 1AQ6A 1SCBA 3UMRA 1K6EA 1LDMA 4MUFA 3VSEA 2HDNB 2JC3A 2HPAA 1NPTO 3RTBA 4EDFA 4INOA 4MQFB 1ATIA 4RTMA 4AB1A 4Q9KA 3CUEF 4EJFA 1A5ZA 4J9UE 4AJNA 4V2IA 3M6LA 1Z5VA 4I50B 3GRKA 3LW7A 3W7VA 1E9BA 4TUYB 1M2JA 1BWRA 2HNAA 3KKOA 2V0CA 4CM6A 4QUKA 3R76A 2Q6VA 3VI4B 2QVYX 3WLOA 1CUCA 4JBYA 5EMLA 5B7PA 4IXTA 1MQAA 1P77A 4RWEA 4RGYA 4X1KA 1LBSA 1BSVA 1AKVA 3TJRA 4ZA2A 2YJZA 2CCKA 4UULA 5I7AA 3GFPA 3R7AA 1REQA 1N4AA 4CV1A 4DQDA 1FSSA 2CLMB 1XZCA 2NZXA 2YVKA 3WGTA 4B5LA 1YB2A 4C6TB 1YV9A 2ZT8A 1CUFA 4NWIA 3ZUGA 1VTKA 1K7CA 1QZXA 1U99A 1IIRA 1FFXA 2F9FA 4HFMA 2P79A 4QPDA 4FE3A 5J58A 2Z3VA 3B6EA 5DM0A 3UHFA 1TIKA 1KR2A 4HAVA 2HQ1A 3QTLA 3JQBA 2C03A 1XALA 3ZI7A 3ZUPA 3JAWB 4UEJA 4GLLA 3FYCA 3OETA 4IX1A 3OJOA 3I1JA 3RD5A 3BERA 4EFKA 1L3BA 2I2WA 1QPZA 3ZGZA 1FRZA 3MELA 4X9XA 4FW9A 2JHFA 5CPFA 2Y92A 2FUEA 4U9HS 2UYHA 4G97A 5AVZA 2O23A 3OKFA 1NQAO 3A70A 3K1TA 5I9NA 3GVHA 4NJOA 3GDHA 3K30A 4ISCA 2Y1LA 3W5CA 2R85A 1N5LA 3SHWA 3PF9A 5IZ4A 3AONB 5AKEA 3AY7A 3G85A 821PA 1RYYA 3C5WP 2M1ZA 1E0DA 4HUQB 1A8IA 5CTJA 1X1DA 3S2FA 4W5RA 3K31A 4K1LA 2GESA 1NPYA 3DE6X 4GBGA 4IDEA 2HJSA 4IDOA 4IP0A 1E69A 1T3HA 2NZWA 3RS5A 4WJLA 3U60B 4JBXA 2ZROA 4Q3AA 1PDVA 3U9LA 4DCPA 1ZINA 1KK0A 2QI9C 3BE5A 5ALQA 1T8WA 2VPWA 4IZ6A 2IXGA 1XZNA 3A4NA 4PRLA 3T95A 2J30A 1PX2A 3B53X 5JS2A 2H4YA 5CA1B 3BMNA 2D4AA 4I3FA 2C9YA 4Y2JA 2Y66A 1MZPA 4HDCA 4EMBA 5A0VA 2OCIA 4OP3A 4CL0A 1II8A 1ZOSA 3E9ZA 3PEFA 4P4NA 1U0HC 2R60A 4JFAA 1JHRA 1PIWA 2IPLA 4YRPA 3MTIA 3SHOA 2VF7A 1VI6A 3ZV5A 3W5IA 4G5OA 3REQA 3BGSA 4REOA 1RI3A 3BULA 1W8IA 1YI1A 2VQFB 4G4SO 2RJ3A 3E1GA 4EY8A 5KNLA 1LJUA 2GO7A 2JLRA 3EGIA 4N5LA 1VLMA 4QVIA 3ZDBA 2R4TA 4V0ME 3ICOA 2ZRDA 4L15A 5BWNA 1SKBA 3GCZA 2CZCA 3L6OO 3U62A 4YR7A 1HTBA 2Z3WA 2IYQA 4I1PA 4ASUA 1K9SA 1CZUA 1R4NA 3GP5A 5ICFA 3A3YA 4BE4A 4F06A 3X43A 5L3SB 1L5SA 1T5TA 2JGJA 1V7ZA 4M1YA 1N9ZA 4A0SA 3Q7IA 4KFCA 2XYQA 2X4GA 3K32A 4MUKA 1RAHA 3QXHA 4D4KA 1LDGA 2JD0A 2ZBFA 4E5YA 4E13A 1E58A 1ZXLA 1AQNA 5KCMA 3GLFB 3V3KA 3FOZA 2D5BA 3TI7A 5BSFA 1R0KA 4XQGA 1Z2OX 3PC8C 1GPBA 1M7BA 1NE2A 4CKCA 4MULA 1DBIA 2JGEA 2ZT6A 3GCGA 4ZVNA 5IVDA 3TDMA 1GPWB 1R0ZA 5H5JA 3VR4H 2IV2X 4DKJA 3OMXA 1JR6A 2Q07A 1RT9A 2AWNA 2WF6A 3PA6A 4EEZA 2EWVA 5K3EA 2HYIC 3HYCA 1W6UA 2O2YA 4G01B 5B36A 2G9RA 1Y6ZA 1YZVA 3E03A 3EE6A 1PS9A 3WICA 1L5MA 2P2DA 1WDLA 2QYSA 4G4SP 1IBRA 4Q7MB 1E2GA 2HPHA 1ONOA 4RA6B 3QJ5A 1RAAA 1G5TA 4ENSA 3GLSA 2HK9A 1C9DB 4JEIA 4G1MB 1CP3A 3LOUA 1OKKA 1NJ8A 2J3EA 3A6KA 3MB5A 3LPLA 1YDHA 5AM0A 4JB3A 4O2LA 4PGGA 4GX2A 1J8VA 1JDZA 1UM9A 1QHNA 2FEKA 2XUJA 3GFVA 5FLKA 1WAMA 3CVUA 2YWCA 1OHHA 2LP4Y 2R1UA 5D5PA 1RW4A 3NBZC 1P9RA 4OH1A 4OXIA 4RHXA 3EVAA 4NEHB 3AESB 1DUSA 4K9RA 4NBKA 3TJMA 3TVTA 4BUZA 1M6VA 5MN5A 2CJYA 1NUSA 3HO8A 4CEJB 1Y9EA 1PQUA 3I62A 4M9UA 5KNBA 5IMSA 4AECA 1P0PA 4CQMA 1U2DC 1GQFA 1SVWA 2FR0A 1OV4A 2J3HA 3R9IA 3BE6A 3PC8A 2DHRA 3E3MA 1Q7RA 1QH1B 2BMDA 2WWIA 2X77A 2YS7A 3GPBA 3IVXA 4JJ7A 4KQMA 4FYXA 4QASA 4QBGB 3TNDA 5DHTA 1SKYE 3AFGA 5EXEA 3IP6A 4MVJP 4OXXA 4RPHA 2CJFA 4YJ2B 4XQCA 3HWRA 3SJBA 3ZVMA 2A0XA 1UJ5A 1W49A 4RFSA 3UT6A 1RKBA 1XXHA 3G9ZA 5DCLA 1VIMA 1SVNA 3HADA 4JBHA 4LF4B 1QHIA 3P52A 1J7KA 2W4IA 4C0BA 1P4HA 4EZBA 2NU9A 4XB1A 2LVBA 3K7EA 4C07A 3ZEIA 1RE1A 3UT5B 1SPBS 4IMJB 1J0XO 4DXAA 1GU1A 5DBOA 2J3QA 2R8OA 4PAQA 4OFZA 2B0JA 1CLUA 4TWZA 3EX7C 2FCRA 3BMQB 4DPKA 1HZJA 3PXBA 1T4GA 4L6CA 3GHHA 1GPJA 3S5JA 3LVFO 2W2MA 1VOTA 5J5AA 5JAZA 4CM4A 1VG9B 3UXMA 4EM6A 1AM4D 3T99A 3G1WA 1YF3A 5IZCC 2H9IA 3FNEA 3K05A 1S3IA 4PZPA 1UBEA 2NO1A 2ZWMA 1L7MA 3QWHA 4KMOA 4Q9IA 4YMUA 3UJ9A 4ZTBA 1ACLA 2HFJA 2OWEA 4FWIB 4EGCB 2FJPA 3DS8A 4NR0A 4QJ4A 3H5LA 3GEMA 1UEJA 1MF7A 2AFVA 2C2OA 1P2VA 2REQA 2PZEA 4B7UA 3L0DA 3QKTA 3KR2A 4HZUA 1BE0A 4KIUA 3PU6A 3PXEA 3OWHA 2UZIR 1MGPA 1U2DA 1RM5A 2R7NA 3IAS6 3M0EA 3L7BA 2QJFA 3QNUA 4M9SA 2YZKA 4RM2A 5FFMA 4C78A 3GLTA 5TGZA 5HCNA 2WTAA 5ALYA 1YJ5A 4IDHA 4US1R 4EABA 2LTAA 5JD3A 2C7QA 3P9NA 4JUDX 1UJNA 4HX2A 1W2GA 3KPWA 2J4DA 2AVDA 1EGHA 3LYHA 5DN6D 3BMOB 5ES3A 4X00A 4KSYA 1NIPA 2VP5A 3NU1A 1RZVA 3SX2A 3TX6A 2E4ZA 3DPIA 1HK7A 2XYHA 4O1HA 4BEJA 3G2KA 4L50A 3N39C 1A8PA 5CB4A 2YVAA 3N28A 1YRQA 3SIRA 4DV1B 1YACA 1G4AE 3RC8A 2AVNA 1P4AA 2PRZA 1M1YE 3IQFA 4JDUA 1JZQA 1DG3A 1G41A 3G68A 5JS8A 4ZHSA 3UAVA 2VI5A 3VU0A 2NSJA 1Q74A 1GV1A 1QONA 4QBKA 4Q7EA 1Z08A 2CZQA 1QP8A 3F5DA 1QTQA 2ODBA 5IZCA 2WILA 1JYFA 1PL8A 2ODEA 1SVKA 3VSBA 4ZYTA 2W6NA 1IM5A 4LTNA 1PNQA 3K0SA 2KX7A 2B1IA 4TTJA 2K87A 3V8BA 3EMDA 4E5PA 1QK5A 5KOJA 2QZSA 4AN4A 1E5XA 3QKWA 1QHXA 4B6OA 2B1GA 5BSTA 3UC5A 3VU8A 5C5EA 3RAFC 2RBKA 2VBFA 3FSGA 3WLTA 4E2XA 4BBJA 3FKSA 1SBYA 2GCPA 3B7WA 4LVCA 4OQPA 1RWXA 3PENA 3WFZA 1T2NA 4PXYA 4LZLA 4K9PA 3GJXC 3A6JA 2A58A 3WGUA 3EAFA 4UD2A 2C31A 1QVZA 1LC0A 4HGNA 4KB5A 5JWOA 3AO0B 2YZNA 5B2FA 5KCZA 1EB9A 2LE0A 1OAOA 1Q6YA 5C5DA 2PJUA 1X9IA 2FSIA 1YIDA 3Q7RA 3TSYA 3AC0A 3DEFA 3HRHA 5CFQA 1WP9A 3ACBA 3VPXA 1XZQA 2ZB3A 3I0NA 2RARA 2CXPA 3KELA 4S1OA 5AUNB 1JTEA 1XVUA 4I66A 1GUAA 3FLAA 3FHLA 2ZRHA 2QNBA 1IBCA 4L8WB 4EY3A 3AHDA 3JR7A 5ED4A 4QAQA 4TYWA 3QVGA 3TQFA 1PJZA 5BMVB 3DMHA 4MUAA 1BYIA 1CJMA 4U2GA 5CW1A 3PKZA 3G0OA 1ZIOA 2H7YA 4P33A 1UM8A 2FN8A 1T5LA 3FCEA 2O9JA 4NMXB 4RQTA 2FY8A 4B6FA 1NF3A 1NC3A 5F2OA 1W0KA 2VUIB 3UQZA 5KQRA 1G8GA 3KVNA 4R1QA 5JTTA 4S2EA 4B87A 4CF3A 3SZOA 4RZSA 3EQ2A 3ZWVA 2HWWA 4WCFB 1FLAA 1R7RA 3IXMA 2WM3A 2IU0A 3ZV6A 1LF5A 2IYXA 1PWHA 1ZGJA 3VXKA 5KTNA 4D2IA 3I83A 1L3IA 1U3DA 1IHYA 3CMMA 1GARA 1W47A 1ZWKA 2H54A 1XD8A 3RUHA 3IPCA 3PQ7A 3K15A 4YLYA 2QW0X 4C7JA 3SI7A 1PD0A 4IJ5A 3JX9A 2R4QA 2ZIGA 4X6LA 3MCVA 3I30X 1XTVA 5DI3B 1N5IA 3N53A 2J8ZA 4J0QA 5DHPA 1GA1A 2D5IA 2AQIA 3OQPA 3CF4A 4QGBA 2O8DB 2G1JA 2X5KO 4PGHA 1DP4A 2G40A 2VJMB 3FCYA 5HTKA 4FBMA 4D8YA 5A4JA 1Z82A 2OCYC 4HGPA 3ESCA 3MINA 1W1UA 1ANKA 2BT4A 2R751 4LRQA 1X80A 5TV2A 1L1FA 5FLYA 3QG1A 2ZI3A 2IQIA 2HO4A 3DOHA 4BZQA 2V9CA 3GBPA 1F8FA 3NHFA 3V3TA 3CLRD 1QGYA 2X58A 5A05A 1ZOPA 2FSSA 2I7DA 3TMAA 4CM8B 4KYVA 5JMTA 2C9BA 1N2CA 2Q21A 4PQGA 3DAFA 2WOJA 1P8AA 3AEQA 4HQOA 4ZQFA 2A88A 4HDKB 2QX7A 3DPUA 3W77A 3S7ZA 2FPGA 2DBZA 2P4UA 3SJCA 5KX5A 1D1QA 4CCWA 1GADO 3WGQA 4LW8A 2IP4A 3BK1A 4MVCA 1YS6A 4BP9A 3TPZA 1YZTA 4CM4B 1II9A 4I4TA 3DDZX 3QY0A 1KKMA 2W2TA 4IUCS 2V7WA 4RV5A 5EEGA 4Z0TA 1TC2A 2PXXA 2Q3MA 4B83A 2PKRA 2J9FB 3NNNA 1EP1B 3PHCA 4UZFA 2G9VA 2FSPA 2I7CA 1GAWA 3G9UA 3HGQA 4DTIA 4F04A 3GELA 1PEYA 1O5OA 1L4BA 3C41J 4V0LA 4HNGA 2OBNA 1QBKC 4BLPA 1UMCA 4Q7KA 3SJZA 4Z3KA 2WJAA 3PSAA 1BVUA 2GEJA 3HSKA 2HQSA 5FWNA 1GGFA 1P4SA 2GI4A 3QXJA 4Z51A 1GWNA 2HX1A 5TT0A 4JUIA 2HAEA 3C48A 3L18A 4M9ZA 4RD6A 3LS2A 1DXOA 3PR1A 1QOZA 4MP8A 1X19A 1ZMTA 2JFNA 4BE7B 1CQWA 1FFSA 1L9XA 1WIWA 1U7TA 1DJOA 3A2NA 4CF5A 3QEMB 3A11A 3GJ7A 2V54A 3G49A 2ZRLA 4XI9A 4IFTA 1ZIXA 3C0KA 1N2ZA 1IY8A 3KOYA 4RVUA 1UKCA 1I3KA 3CZ5A 1FTQA 4C0AC 5CB4B 2II6A 1S2MA 2DBQA 4R98A 2D74A 3NRJA 2F4VB 3OOSA 4RY2A 4K81B 2OXCA 1SQ5A 1W5EA 2ZYUX 2V6MA 1QORA 2XJ4A 3HKCB 3M6XA 1CQPA 1OLOA 1E4EA 1JA9A 1T4MA 3I2GA 3IA2A 3KZVA 4KO8A 5DYTA 5IDYA 2A2ZA 2UUPA 2JB9A 3ZE1B 1MKYA 2GASA 2LUOA 4FHFA 5EIWA 3WO1A 5LOVB 2QEQA 6REQA 5IH3A 3MXTA 1MZVA 3HSYA 3GZNB 3QYJA 3SYRA 3GLVA 1IUOA 2OESA 3TTSA 5TPWB 1D1TA 4U2EA 1R4ZA 3LCJA 4F4JA 4UUNA 1H2ZA 1NQTA 2I6XA 1Z2PX 3HCOA 2WIGA 3B6JA 4O2AF 4MV1A 4AMZA 2XGJA 4IVQA 1EXNA 5DHFA 1SBCA 2DWOA 3DDHA 4I6JA 5EN4A 3O1IC 1D2MA 3QPWA 4H17A 4PZEA 5IMBA 3COYA 2VHWA 2GNAA 3BFXA 4GT1A 2RFLA 1TCUA 4MW0A 1MC5A 1P91A 4LQDA 3WYEA 3W9YA 3MWDB 4M87A 4B84A 5K05A 1NVMB 3JQGB 4I3HA 5I45A 1ZYUA 3FA2A 1RYHA 4A8JC 3UGQA 3KHKA 3QU7A 4Q4LA 4UVDA 3ESYA 1I94B 3PJFA 2IS4A 5DHSA 3TLYA 1IH8A 2ZIVB 4BIIA 5EJ5A 2A5LA 2YWJA 1LQUA 4EW6A 3UMGA 4V3CA 1PT9A 3UUFA 3AVYA 4ZTUB 4FMCF 1P3JA 1VBKA 2ZJFA 5LBUA 2GHTA 3HKBA 2GJKA 3U4GA 3V8NA 1S7CA 3JD3A 2X41A 2JI6A 5BURA 2XX3A 3E8MA 3PHJA 4X8LA 1XK7A 2BEVA 4RMHA 2R8ZA 4C20A 3H65A 3MQFA 5AM1A 3KZOA 1Z4JA 2HSWA 1O96A 1LBQA 3LUBA 3D8BA 3PK0A 1W9HA 1YDEA 2QAGC 4JMLA 2RGGA 1XD9A 1WPRA 1M6YA 2WPDD 3DV9A 4HWSA 5G0SA 3VH3A 3ZXYA 3GLGA 4H60A 2JGDB 3R41A 4HNHA 1Y3DE 4BL5A 1BROA 2VYND 5JH7A 2X0IA 2HF9A 5HXAA 3IV9A 3OM8A 1K6XA 3PDIB 1RQNA 3D64A 3BB3A 2V3WA 3JARA 3OIGA 3ADDA 4RVNA 1W76A 4OM8A 3UWKA 4AJ9A 3EDYA 4FN4A 3ZJYA 1XF1A 4QHYA 5L7TA 2OV8A 3O93A 2JZCA 5JS6A 3DB2A 1UXGA 2QR3A 1IEXA 4A27A 4CG3A 1V26A 2C7PA 5EIBD 1N6HA 3FR7A 4EGQA 2L19A 3BOSA 3KP1A 1HDEA 4DLKA 5JZVA 3WV4A 4P9NA 3FTDA 3S99A 4A8JA 4JI8B 3CNNA 2R7LA 1Z13A 3GH3A 1GVHA 4PZYA 3UFBA 4H27A 2ZTHA 1RQPA 4YAGA 2FA9A 1UKZA 3X3HA 4P98A 5KSOA 3A3NA 5EMHA 4XW2A 4D8VA 3MIIA 5ERYA 4C01A 1FFDA 3CX6A 1LI5A 5BWLA 4CQLA 1GZ6A 2ZJ6A 4GXRA 4ZPJA 2VJPA 4KJXA 1NN5A 3I72A 4MEAA 3NIGB 3W9UA 5C35A 1WXIA 5HZKA 1LV7A 1L4YA 2ODNA 3ZWWA 1VM6A 2J4FA 3H5NA 5TJHA 4GMHA 4MPRA 5G4LA 3TLMA 4DC9A 3ZLJA 4IM7A 3WGNA 1SN7A 1UJ2A 3TTXA 1TX4B 1V4VA 1XRRA 1RZRD 2FPGB 2R4UA 3RI3A 3ONNA 4R0NA 4D3YA 1G20B 3SCZA 4PN3A 1TPYA 2H2WA 2IXAA 3NIBA 3PA8A 4ZXPA 1KMHB 1LS6A 4IXDA 4R2MA 1IONA 1O7JA 2W37A 2XAUA 1W6RA 2TECE 1B4DA 1UBJS 2HB6A 2IHTA 3H3FA 4LBZA 2BEKA 2VHJA 4ZCTA 4GH5A 3HLTA 5CBPA 3H7IA 3V5NA 2EX4A 1C9JA 4Y2HA 3IR6A 3Q3EA 2KM1A 2O48X 4LXQA 2V59A 4ZI5A 5CVTA 2PWAA 1NYTA 4IHJF 4MMYB 3A9RA 1DMSA 4KHPB 1JQBA 5LNK6 3E82A 2C29D 1AUVA 4RJJA 1QSGA 4M76B 3A6PC 3U7JA 2I4LA 4ETNA 4URFA 3C1AA 5T6MA 1JSRA 3K6KA 4H7JA 3JQ6A 4PNZA 5DXFA 5HZHA 3NDJA 1QKIA 2RK3A 3NHYA 4MYRA 3BQMB 2R44A 2F90A 3UF0A 5LMCA 2PFKA 1HKHA 3U49A 3MCUA 3PFNA 4DLRA 4BATA 3U0BA 5GZ6A 2Z2JA 2H5JA 3P94A 3PBKA 2NLOA 5ALGA 1E9FA 1PCXA 2IHVA 3CEPB 3KKZA 4KGDA 5D84A 3WYNA 3ZHCA 5JR3A 1XLTA 1XZAA 2TMDA 1QOPB 4BRWA 4L9RA 1G98A 2XIQA 2FB9A 4AKSA 2B8JA 3GJTA 3MT7A 1C0PA 3QPDA 4EARA 2PVPA 1L8AA 1MJGA 1R00A 2CLKB 3VO9A 1ZGBA 3FR8A 1TEVA 2H4WA 2PRKA 4LHWA 2DF8A 4EO4A 3LTEA 2AR0A 2PRSA 4ENWA 1JI0A 1NTRA 1R10A 1U2PA 2I3ZA 3ESAA 3TKAA 3VR2A 4TKMA 2JBWA 4QJ5A 1Y6RA 4W4TA 2P1DA 3R09A 2HLDA 3ZLUA 1UR5A 3WGVA 3MN1A 3NOVA 2CVHA 3GY0A 4CCAA 2AOTB 2OXTA 5B3AA 1FP4A 1M8JA 2FHSA 1L8QA 4RKFA 3RODA 1JAYA 4A2QA 1IN7A 3NPMA 3DUWA 4LYFA 3PNMA 3OUUA 5JVDF 1FMFA 1KI4A 3DCIA 1DKRA 1E7YA 1ESDA 2GPAA 3NWJA 4H4DA 3VHXA 5EJAA 1HV8A 4KH1A 1BCSB 1A7UA 2SNIE 3OURA 4U6QA 5CX1B 2HYDA 5KJCA 5KNDA 1O0CA 4K6FA 4Q3KA 1XZIA 3PR3A 4HQRA 2A0WA 3OJFA 4G86A 4ABTA 3Q5EA 3WB2A 1I0ZA 4GPAA 1VFNA 2TMYA 2XWBF 1G7SA 3GG2A 3H9UA 4YAJA 1CY4A 2NYRA 2PZLA 3GD5A 5AKIA 1GL7A 3D6HA 5I3ZA 2RHLA 3LDUA 2QDKA 2VJAA 2ACVA 3K9BA 4FEYA 4GMXA 1LWNA 4X3PA 4YMVA 2CFTA 3SIWA 4JMPA 3PC3A 3HLYA 3IAM6 5UKDA 5FA6A 4U7PB 1L7VC 1KYTA 2HF8A 3I12A 3PNVA 3SYMA 4DCCA 1RC1A 1YFKA 5K0NA 4BGVA 1F51E 4FWBA 3SFZA 4DV0B 3DFFA 2CVPA 1DEAA 1LBIA 1JFFB 1T5BA 1DRUA 1Y8RB 3LVBA 4GDMA 3DTVA 3EZ2A 3GT0A 1BHO1 2P9BA 4MUXA 2PUFA 1XNQB 1LVUA 3QOXA 5C4IA 4NJMB 1OYYA 3OIWA 2QUHA 2BEVB 2H31A 4XEUA 5DGHA 3RK0A 3T9AA 4XJSA 2CEAA 1JECA 1K8XB 1B74A 2H3HA 2J07A 3HJRA 3GJ8A 3PKIA 1DARA 4BNJA 4G9EA 1RQXA 2JASA 3MTDA 2Q62A 1FRFS 3CJTA 2AC4A 5KOHA 4ZDKA 2PUGA 4O4LB 5JH7B 3T34A 3QTBA 1P4JA 2IKSA 4JC4A 3X1WA 3E81A 3WJ1A 1J97A 4F3TA 1E3MA 1ADJA 5DMHA 5LPNA 4ZZ3A 4PG8A 3ICEA 3UMMA 3S2IA 3JARB 2QTFA 3SQNA 3N0XA 1K63A 2CDAA 1WY5A 4Z0NA 3EZLA 5DEOA 3CX7A 2BFFB 4B3DA 2MYTA 3U7QA 4ZOLB 3HXOA 3BXPA 1FDUA 5ILQA 5EL0A 5C8VA 4J6EA 3NJ8A 3EQZA 4PNPA 3L0BA 3M5PA 1T3TA 3NFYA 5AJZA 3TLGA 4ALJA 4CKWA 2WKPA 4KFRA 3KT3A 3SZ3A 2DRIA 4GO1A 4Q1CA 3RVMA 3UM9A 3P9SA 1YU6A 4YO8A 1YL7A 2DERA 3RLFA 3RHTA 2X4IA 1I3LA 1QFJA 2PMBA 1J70A 4CTJA 1E2IA 3VX3A 4D41A 3ZY2A 5DP1A 1FJHA 5C32A 2QT0A 3DDWA 3UCXA 1FTWA 2E2WA 1XMVA 4MLPA 4IINA 4E7PA 1KAGA 3PT9A 5F78A 3R9XB 3S5UA 3AIKA 3QMPA 2H08A 4E94A 3IP5A 2WSLA 2AHRA 3AETA 2C5SA 3VR6H 2NAFA 3F3MA 1SIBE 1U8FO 5G1PA 4H7DA 3OA0A 7ABPA 2H1HA 2QAGB 4MPDA 4ZU3A 2IYSA 3TKLA 4JVNA 1R4MB 4K03A 1EFPA 3TZLA 4CTOA 2XRZA 3INYA 1XZFA 5DV9A 2WB2A 2QJWA 4G8BA 1LLQA 2Y0CA 1TFUA 2EFYA 1G3IA 5CHEA 3KUUA 2ZU6A 1T8SA 4U5XA 5LB4A 4CDNA 1YJXA 1M8PA 3LX5A 2GEKA 4UW9A 2XLCA 4Y2PA 3OU2A 2GLXA 4ZJYA 5EQTA 3DVQX 3OSUA 1H6CA 1VRWA 4P84A 5SZIA 2Z9DA 4NU6A 1Z38A 3JYNA 4YT2A 3D1JA 3ICPA 2P8SA 4BJ3A 1UC9A 3T9CA 2R47A 4PLCA 1E9DA 1DFIA 3KT8A 3NYWA 3VZSA 3BMCA 3A6HA 3UENA 4JSYA 1BA3A 1YB7A 1AGPA 1DAFA 2J3IA 4A0HA 5IT4A 2FEPA 1J1UA 4H0FA 3I2KA 5DX1A 4C30A 3BWYA 3FG9A 3HDYA 4PGMA 3DEIA 4QBIA 2VTBA 1M1NA 3ZDCA 4G0OA 5IULC 3RIXA 3PSHA 1FXUA 1T5OA 2RSLA 4AJ1A 4TQAA 3DCNA 3G2NA 4MQMA 4DYDA 2DR2A 1C9MA 2RHRA 4UNNA 4BS9A 3LC2O 3TFQA 4LF7B 3NM4A 1GLGA 1QZUA 1C3VA 1NMQA 2JGIA 4GGPA 5CEEA 2P91A 4OM7A 3RRNA 2VWQA 2DPMA 4AM8A 1V8ZA 4GZ3A 2RHDA 1PKEA 3THWB 4M0LA 3Q2IA 2P6OA 3IAXA 5EJ6A 3NS7A 4URZR 5CRIA 3OG9A 2FFAA 2OHJA 1ZUNB 3RT9A 1US8B 1WCIA 5CB6A 4MVJF 2PXCA 1NBAA 1NYRA 1W581 4LSZA 5DHRA 3GJ5A 3MUNA 1LDBA 5JTUA 2X1MA 2BLLA 2CF6A 4INPA 2XDAA 3QNWA 1ZR2A 3W8DA 4YPVA 1CZLA 3IUMA 4XVRA 5FDFA 2KB0A 4J0EA 1E60A 1VJDA 5G1NA 2HRDA 5CG2A 1IHXA 3AKYA 1DRJA 4UBIA 3X1KA 1NQOA 1OBVA 1YZGA 3IR5A 3HU2A 4EGAA 3KC2A 3DBIA 2DULA 3WNZA 4EI8A 2D00A 3MGAA 4I14A 2FVYA 4ED9A 4BCCA 3C1TA 1VJCA 1SGWA 1ZSVA 4TTRA 4F3RA 2GS9A 1NFRA 3TZEA 1YS1X 3BSWA 4GI7A 4WECA 5ALZA 2X19A 1UC8A 2C4WA 3JATB 4TTVA 4HTAA 5AJYA 1B8UA 4JELA 4H7FA 1NVAA 5F2NA 2YL2A 3P0EA 5SZHB 2MINA 4J90A 2QLJA 3HZOA 5JSYA 2BI4A 3PQCA 5AESA 4BMNA 2ZTMA 2NIPA 5BW8A 3QI7A 2UYGA 4BBZA 3GQBB 1IHDA 4BFCA 1BS1A 2ZYIA 2EP7A 5F7XA 3HB4X 2JIQA 1A5AB 4FC6A 3W2FA 1L9KA 2WUEA 2P1RA 1RTKA 2XZPA 5KPJA 4OGWA 1ISGA 3VPAA 4QXOA 2H59A 1T3GA 2QRHA 3RU3A 1NBMA 5IJ0B 1G8YA 3LT2A 4KRYA 4IRMA 3CTPA 3KQWA 3SBDA 3NTUA 3DBRA 2Q1YA 1Z36A 4OXYA 5ADUS 1X8XA 1NY5A 2C82A 2FRVA 4LVNA 1NUTA 5JJKA 4PBRA 1P6XA 1MOSA 3T7KA 4M8SA 1W85A 4OHPA 3GT3A 1FK8A 3LPCA 2QV7A 1SBIA 1P18A 4TV9F 1Y1SA 1AS0A 3I09A 2VXCA 2YRXA 5E3JA 3ZV7A 3HR7A 1ZNXA 2BRUC 3OFSA 3PQ5A 4OFBA 2ROQA 1ISMA 4H7EA 2PH5A 4PY2A 2NUAB 3IIEA 2EKDA 2XECA 4AS3A 4PQEA 3DMFA 1N3IA 5K5EA 5BNWA 1HEYA 1WMSA 4AQDA 4PGAA 3DO6A 4IG4A 5AOCA 1VCOA 3VNQA 3WL3A 3AUKA 3WNVA 3ILHA 1WD5A 1V16A 2TRSB 1RIFA 2EJCA 5MF6A 1S6YA 2JGAA 4S35A 1TYAE 9ABPA 2D6FA 4K3UA 1E96A 3BDIA 3LC0A 4FYVA 5ENZA 1ODSA 3IKMB 3VH1A 4A0RA 4BQFA 4Y2VA 1ZA2A 1OD6A 2WU0A 1K0FA 3PR2B 4MI3A 3VI3B 2XRFA 5SYAA 3L02A 4M1OA 3DKRA 3RBVA 5LZ9A 1RYBA 3ETDA 1IXZA 1CUUA 4RZQA 4UBNA 2E1PA 3SFTA 1J0CA 3KDAA 1CUDA 1U5CA 2MOKA 4HSEA 4LDRA 4L8GA 1QH0A 1XQXA 4W1SA 5M34A 3H8SA 2GD0A 2F2TA 1NZFA 2RAPA 2FPRA 3ZQ4A 1WA5A 4UUQA 4KXXA 3RQIA 3FY4A 4EF4A 1KP3A 1PDOA 3OOHA 4HPJB 4GPZA 1NVBA 5F2KA 3WZ2A 4C03A 4PRYA 3HJAA 3RVBA 3HCFA 1ZM3A 1OV6A 1WVMA 2IXTA 1WSAA 1PNOA 3GNLA 1C9YA 3OQ1A 1VPVA 6LDHA 4F1JA 5CFZA 1XA0A 3KYIB 3OP1A 4EGJA 4P8RA 1Z3IX 3TG8A 4Q37A 2XHEA 3HUDA 1FBNA 1SCIA 3BXXA 1ADBA 3MIZA 2YICA 4QLOA 4X24A 1WZEA 3TUJC 3OHPA 4ZVOA 1NQWA 1FW6A 2PUAA 3EXEB 1VE3A 2DPLA 3GNTA 1TEZA 5AW4A 4ZEMA 1SHZA 4EG8A 5A4DA 4NVRA 1C3OB 1K8QA 2QUBA 3DP9A 1I5EA 2R7MA 3IVRA 3QXXA 3TAHA 1G59A 2BELA 2J6CA 1EE1A 3KTFA 4FCVA 4KTTE 1MAVA 3L46A 1MA0A 1GZ4A 1H2RS 5CB8A 6CHYA 4D0GA 2QMHA 4QQRA 2BE9A 3P5SA 4WINA 5FWAA 4KR3A 5FO0A 3CLSD 4FYHA 3HGMA 1U3VA 3HL0A 3BIXA 1Q7GA 1SUCA 5DSXA 1HDXA 1T29A 1OU0A 5CH3A 5FV7A 3ND5A 3VR4A 2DSTA 4GFDA 1NOJA 1HLGA 1U11A 1VPTA 4GP7A 2WIBA 4LWOA 4Z7OB 1SR8A 1HETA 5KJEA 4ZAZA 1ND6A 1T1EA 3R3YA 3SBEA 3ZTTA 1SM4A 3JYHA 4KR9A 1QFSA 1UT5A 3I6BA 4KXWA 2PSEA 4Z6KA 1YL6A 3I42A 4ZIRA 2ZSJA 4K6GA 1A9YA 1PFVA 1YQTA 2QM8A 4JXKA 2CCJA 1KFEB 2J9GA 1WDKA 2FUG6 5CFPA 2JZOA 3H2HA 1LPNA 3KT0A 1K8RA 1DOHA 3SSNA 2O8BA 4US0R 2W9XA 4PZ0A 4EW1A 1RYNA 4PFSA 2RAVA 5T7BA 4WJZA 3H0EA 4NQZA 5J2TF 3BD7A 1P2DA 3FHTA 4HH3C 4MS1B 1J56A 2ZANA 1CEXA 4Y1RA 2X4LA 5DO9A 2J3DA 4AUEA 3L6CA 1ZK3A 4A2CA 1DRKA 4KNWA 4OHUA 2HWUA 3M6FA 4LWPA 1R0CA 2Q8QA 1IEWA 3MRVA 3AUFA 5CJ2A 3UYKA 3VBCA 1NMEA 4BTEA 4YMIA 2QRMA 1F2UB 3T1TA 2F1IA 3ZE8A 2CV2A 4GOND 3CSUA 3L7YA 4HLNA 5KTPA 2ZUUA 3QLEA 1ZC4A 4XR4A 1EH5A 5GP1A 3LYAA 3JZAA 1K98A 4NZOA 4O02B 3KAPA 4MRAA 3PXGA 4ZO9A 4OLAA 2PHZA 3AHGA 2D3TA 1TO2E 3N07A 4QNRA 2AA3A 5DFAA 4JKYA 3RIYA 4RA9B 3RUPA 2ZKLA 1RLIA 2ORVA 3VU3A 3WHLA 4O8ZA 5EFZA 2Y1KA 3H42B 4GM0A