1E58A

E.coli cofactor-dependent phosphoglycerate mutase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
247
structure length
246
Chain Sequence
AVTKLVLVRGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOGLYCERATE MUTASE
publication title High Resolution Structure of the Phosphohistidine-Activated Form of Escherichia Coli Cofactor-Dependent Phosphoglycerate Mutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 94
structure length 246
sequence length 247
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1e58A00
2HIAA 3EOZA 1V37A 4MA4A 4HBZA 2P9YA 2WNIA 2YN0A 1ND6A 3C7TA 4D4KA 2P6MA 3FDZA 1V7QA 1BIFA 4IJ5A 4E3WA 3KKKA 3DB1A 5HTKA 4GPIB 1UJBA 2EKZA 1DKMA 2A6PA 2IKQA 4IJ6A 4D4JA 1YFKA 1UJCA 1E59A 2H4ZA 3BIFA 2P75A 2HHJA 2P79A 4PZAA 1SK9A 2H52A 3FDZB 5AJZA 3E9DA 2AXNA 1FBTA 5CX4A 3OI7A 5CU7A 1RPTA 5AK0A 2OWEA 3ZHCA 4PZ9A 5CDHA 3O0TA 5AJVB 2WU0A 3MBKA 4PGMA 1K6MA 4EO9A 4QIHA 1C81A 4JOCA 3NTLA 4TSRA 3HJGA 3QPVA 3IT3A 4GPZA 3NFYA 4JOBA 4ODIA 1C7ZA 2EKBA 1QHFA 1SK8A 3QPWA 2P6OA 1SKAA 4ARUA 1SKBA 1E58A 2P30A 2BIFA 1YJXA 2P78A 1DKNA 4FDUA 2P2YA 3K4PA 3LL4A 1BQ3A 3E9EA 3PGMA 3EZNA 1ND5A 2PA0A 4JODA 3D8HA 1RPAA 3K4QA 2P9ZA 2OWDA 2ENWA 4ARSA 2YN2A 3F2IA 3F3KA 2WNHA 2ENUA 2DWOA 3E9CA 3IT0A 1CVIA 4EMBA 2I1VB 1NT4A 3QPUA 4D4LA 1RIIA 1DKLA 3FJYA 5AJXA 1TIPA 2H4XA 5AJWA 1EBBA 4AROA 2F90A 5AJYA 2HPAA 2P2ZA 1QWOA 2DWPA 1FZTA 2EOAA 3MXOA 3DCYA 1XQ9A 2QNIA 2GFIA 5HR5A 2P9FA 4ARVA 1H2FA 2H0QA 3GP3A 3GW8A 3IT1A 1IHPA 1H2EA 3LG2A 1DKQA 4D4MA 3D4IA 3LNTA 3R7AA 1BQ4A 1DKOA 4FDTA 5PGMA 1T8PA 1DKPA 2A9JA 2P77A 1C80A 3IT2A 3D6AA 2RFLA 1QFXA 3GP5A
chains in the Genus database with same CATH superfamily
1ACLA 2VATA 1RJEA 4RLQA 3KV1A 4JWKA 2D06A 4PGAA 1CE8A 1FQJA 1U0OC 1IQUA 1IEXA 2G88A 3G0DA 5IUJC 3SQNA 4M53A 2B34A 1MW9X 2VSNA 1U0BB 2V7QA 1VCHA 3DM5A 3NEYA 3B70A 3C70A 1KH1A 2CDRA 3G2OA 2XQVA 1CZKA 4NFHA 4RY8A 1V4BA 2Y2UA 2I71A 3KLMX 4PZZA 3UAZA 2FEAA 1EIWA 4F38A 1DQRA 5KINB 4ZQIA 3BMCB 1U9YA 3TN7A 3WNVA 3GDHA 2YMQA 5CVUA 4PS0A 3EDCA 3QVGB 1DVRA 1Z4MA 3CFYA 1YL7A 4ZTZB 4EHLA 2FNAA 2PLWA 1U8UA 3QHPA 1SXJE 3B5JA 1D8TA 4G4SO 4MWDA 3UXHA 5JSUA 2Q5CA 1KK1A 5HBGA 1WTCA 1U1IA 2GPAA 4YIKA 3GNSA 4Q1AA 2CB0A 4NXMB 4G65A 4I4TB 1E69A 1W8DA 5CFMA 2XMGA 3PHHA 1QYIA 1GLNA 1VECA 3BGOS 3DE5X 3JWGA 4MX8A 4PX9A 1RPTA 3VZSA 3UG7A 3CH5A 1SBHA 2GVDC 4RFLA 2PCLA 1ZPDA 5IF9A 3NPMA 3UK0A 3O9VA 1YDWA 4FOPA 4OMUA 2QVXX 1ZUD1 5EJIA 3UUWA 5AVYA 4NMXB 3KZVA 1YQ9A 2B94A 1T25A 1RAIA 3PXAA 3L7LA 1SUAA 1NNLA 1XTSA 4P8RA 3WR5A 1ISRA 2AF4C 3ZWWA 5JRZA 1A97A 4F1KA 5L53A 5F1KA 1EX9A 1ZNZA 1NY6A 3P4XA 1TKBA 4QBIA 3PUVA 1W46A 4UEQA 1JYSA 5JZBA 1B0UA 5JY1A 2P6PA 3UENA 4MUHA 1Y1PA 3O7WA 5BVGA 5J5AA 5C80A 1X77A 3N59A 1XAHA 1D5CA 1LS1A 2GM9A 3MOIA 1XL0A 1QO9A 4G1BA 5EJGA 1KEPA 4JGGA 4XYBA 4PHCA 4R1NA 1VYHA 2WJ3A 3OLZA 4GEGA 1M33A 4M1OA 3VYTB 3WMXA 1YC5A 3WB2A 4BNGA 2N3ZA 4HEHA 4AN4A 3ZZ1A 3F78A 1VL2A 2XWBF 3A4NA 2O0LA 1ZGGA 4P08A 2WWXA 3O8NA 4TLLB 1OU4A 5DYWA 5E4JA 3W4KA 1X70A 4AK9A 4YAEA 1CLEA 1XZPA 4L7VA 5CITA 3W5CA 2YV5A 1C7FA 1JWBB 2KPOA 4GR9A 1K6JA 4Z1MA 4QICA 2MSLA 3IFSA 1BOFA 4W6QA 4K6HA 2BVNA 5AW7A 2R11A 3WWEA 2BHTA 1H2ZA 3MXOA 5LP6B 4IXNA 2X9QA 3SJCA 3IDSA 3ZE7A 4B34A 4KJXA 3K9LA 4UBMA 1X1BA 1XNHA 5AK4A 4ZGBA 4OHBA 2J1LA 2GAFA 2VWHA 2DFLA 2WD9A 1TVKA 2GK4A 4LGVA 1TK2A 4LVNA 4OFBA 2C94A 4ZIRB 4L2IB 1K5DA 4EJFA 3DULA 1FP4B 3FFTA 1JFFB 1UR5A 3AF5A 3BX1A 3D6TB 3QOFA 1JVSA 3UHOA 2CDCA 4Q9JA 3NNNA 1BKDR 3C15C 3KLPX 3SZMA 2UYOA 2QLNA 4D9CA 2G1AA 1H8EA 4E5DA 1CJKC 1MDBA 2JFGA 3ZHRA 1CV2A 2HMVA 4LJRA 1K9VF 3V32A 4LHSA 3R5TA 1IY2A 1G0NA 2HA0A 1CR4A 3BMQB 5SYMA 3TG2A 2HPVA 1W76A 2HK7A 4RVGA 3EIUA 4OKNA 2P9YA 3OOWA 4XZ3A 4B3DA 5M7EA 4DFDA 4UFNA 1A9TA 1XVLA 2AZTA 2WU3A 3D0KA 4MWBA 3HEAA 2RGEA 4C05A 1I5RA 1JDSA 2V4ZA 3VNBA 3G88A 2ISQA 3QWFA 1AX9A 4LMRA 4ERNA 2XZTA 1J8QA 1SURA 3NO4A 4O4LB 1EU1A 1MO2A 1YB2A 1Z5ZA 2BTQA 3I45A 1TMGE 1QS0B 3LLCA 3AERB 4H35A 3RU3A 4FSDA 1NLYA 3KXDA 1YS2X 4OHMA 1IXKA 2DJ5A 5JSYA 4HX2A 3G13A 4LZOA 3AGQA 2ODAA 4KDFA 4IUDS 5EWJB 4F5EA 5FDFA 2HRQA 2H85A 3FLBA 1X92A 4HB3A 4HPWA 2YIMA 2WDPA 1L9KA 3CGWA 4LQ4A 1DOAA 3A28A 4CMKA 5JJ5A 3OIUA 3N05A 3PT5A 5JAUA 1TZCA 4B43A 3TIGA 1X38A 4CEJB 3CN9A 1OZHA 4CIBA 3UUFA 1EQAA 3B1WA 4CFZA 1J39A 3HYRA 4MEJA 2VAPA 3KKPA 4EELA 2ZJFA 3C14C 4N54A 1IN5A 1B23P 3RVMA 4E32A 3AY3A 1GLGA 4KIFA 2HQ1A 1F12A 5TQ2B 4ZQFA 2Y8EA 3OKFA 2HA3A 5EZSA 1EUCA 1NF9A 4Q4JB 1AN0A 3H17A 4ZQEA 5LMCA 1EQUA 3GD7A 4C7OA 2FPWA 4I36A 1X14A 3H0CA 3T35A 4XSVA 2DFDA 1Y3FE 1RPNA 1XRPA 2ONCA 4B0PA 4ASUA 2Q5QA 2IIVA 5KNBD 5HDBB 3RT7A 1KPHA 4R1SA 1NYTA 4B4OA 3DFKA 4JMLA 2WP0A 2MINB 4YJGB 4RZIA 2GXQA 3FNBA 1XL1A 4M38A 3RFUA 5LD2B 1CUUA 1O6GA 4JC8A 3DAFA 4XWTA 1ZCJA 3ET4A 5JFOA 1PQUA 1DXYA 1Y4ZA 4LYDA 4X84A 2N0SA 3OIGA 1Y98A 4V2IA 3USZA 1F4LA 1D3AA 4B6OA 2AKYA 4MCJA 4PZUA 4CT0A 4KFUA 5BV8A 2C3OA 3H9UA 1NVAA 5EUQB 4CETA 3WZ2A 3DV9A 5AKJA 4Z9XA 4EJSB 5B7GA 5K0FA 5H68A 4KLNA 3N0XA 2JKYA 3DE7X 3BD6A 1R4AA 2Q21A 4KYIB 4PAMA 4TYNA 4H4DA 4ER6A 3UWDA 1YGPA 5CK4A 2QRQA 3E22B 4DR2B 4PPNA 1G6OA 4GI1A 3T4XA 5LP1A 2OAGA 2J31A 2YINC 2GEBA 3FNEA 4PWYA 1NVBA 2FETA 3CUTA 4CMIB 1GQRA 1DEXA 3CPHA 1NN5A 5DJ5A 3UK2A 3GU3A 4RGBA 4JEIA 4URUR 4BE4A 1H2WA 3VH2A 1HT3A 3IALA 1U9IA 3T12A 2OYRA 5KB3A 1J24A 3EBLA 4K40A 5F23A 3FRHA 3G2JA 3L7MA 1JA1A 1V2HE 4H6PA 1DKOA 4REMA 5DULA 5HIIA 3K53A 2OFPA 4ZOLF 5F76A 4GM4A 4NHOA 1HL7A 3FCXA 3F8TA 3VVMA 1E9FA 3A1EA 3GUYA 1L7XA 4AECA 1AN9A 2EL7A 5KHAA 5LM3A 1QHEA 4KKXB 4B3SB 2HF8A 2O8VA 2WI8A 2B4RO 2ZWMA 4IDAA 3N0TA 1VRWA 3DXYA 2NVWA 1E5XA 3A6JA 7ADHA 2B5WA 2G8NA 2G5PA 2WM3A 3QFCA 4JQOA 2P67A 2OQ2A 3KQMA 5ELXA 2X0IA 3JQEA 1XQVA 1G5HA 1VPEA 2G82A 1O6FA 3QXCA 3ETNA 4FJ1A 3YASA 2J9FA 3OZEA 3EZGA 4HTFB 4S1NA 1AGYA 2CNNA 1GZ6A 1KJYA 2BHNA 3EDQA 3QLVA 4WBNB 1LK0A 2AUMA 3EVCA 5F5XA 3ZVLA 3ZWBA 4BFUA 5ALVA 4MRSA 3G9ZA 2GHRA 5CIWA 1IJBA 2FPGB 2XTJA 3CMCO 4GPIB 1D6NA 5JG7A 4KEAA 3NHMA 4JT9A 1WZ2A 5CAEB 3URMA 4NZMA 4DSAA 2EFYA 3V00A 1DKRA 3JWPA 1U3TA 5FX2A 4RLSA 3RU2A 1PWYE 3DQPA 4JUFA 4R7ZA 4CFYA 1UAYA 2CVFA 1NBME 1UBCA 3C3DA 4LECA 4WX2B 5H3CA 3ZY4A 5TQJA 2PUTA 2AXNA 3IQEA 1ZXXA 4A0GA 2BTEA 3MWDB 2BR5A 2FI1A 2E85A 3ETDA 3IGFA 4JYCA 3CWQA 3RUEA 2AG6A 3I5XA 1BCSB 2JH8A 5K3OA 2GD6A 1K98A 2VQFB 2IHZA 4MP6A 5GGYA 5I4BA 4WASA 2R47A 2GD1O 1C3OA 3MN1A 1J8FA 4WJKB 5BNTA 4MQ5A 4KVAA 1L5YA 4TL7A 3A1TA 1P5FA 2YZKA 3LUAA 4QUGA 2QQFA 3AKEA 3H5AA 1X15A 2F43B 1FPMA 2RGUA 1ONBA 3H11A 4RZSA 5L4SA 3NFRA 4QJIA 1I36A 3F90A 1W2WB 5ECDA 1I4OA 5K0JA 4YCJA 4R3UC 5BW5A 3OE4A 2WU1A 2K6GA 4HT3B 2MSWA 1Q74A 1SUWA 1TJ4A 2QVCA 1STOA 3TSAA 2XNJA 3DC7A 1N34B 1I6LA 2GTIA 2VP0A 5A3VA 3VNQA 1VE6A 3K2BA 1JNYA 2XNKA 4ZT5A 2OO7A 5BSTA 3RGGA 5C0OE 2JIQA 3LRTA 2LPMA 2GHIA 3EA0A 4DANA 4Z0NA 3RFFA 5JOQA 1HZJA 4GE3A 4PO9A 3SKYA 3TEMA 3U6BA 3VKGA 1X1CA 5LR6A 3OECA 1MQ8B 4ZEXA 2HFJA 1QMPA 4NY1A 1DV2A 4WDQA 5HUJA 1PZHA 2VHTA 3W2TA 3KQLA 3UMYA 4J91A 1JE0A 4TS1A 3D8SA 3VHLB 4QQ8A 5C5EA 3ZOKA 3OJOA 4TN5A 1UH5A 2CC2A 1EDBA 5JLAA 3F67A 2AVNA 2JDIA 3KKQA 3PQCA 3OPMA 4RGVA 5BRJA 4H08A 2AD5A 3U09A 1USKA 3PL1A 3UIEA 3N2EA 3DZFA 4IMRA 3KJNA 2Y27A 1BQEA 3PGKA 3UH1A 2IWRA 2BP7A 4AMBA 2AEEA 3E2IA 5T67A 4LFCB 3TLCA 3VYSB 5IBCA 4FLFA 1Y8RB 1HDOA 2CXRA 2V5VA 3E9MA 3FTNA 4PSKA 1BDIA 3S2EA 1XCLA 1DFIA 2XQJA 5ALSA 2I2DA 3VSDA 2HI0A 1W4LA 2C5EA 3GT0A 3AEKA 1CZNA 2ZJ1A 2V6IA 3SYKA 5F2KA 4S12A 4HTAA 3LOPA 1EBUA 3OCZA 1DEAA 3KB1A 1SKQA 1V95A 1V47A 2Q5HA 3C98A 1KSFX 4GOOD 2C4WA 3W5VA 2X5NA 5G1NA 4JI5B 1VI5A 4XFDA 2OVFA 2CFCA 1Z0IA 4UD6A 3MB8A 2IYLD 4HBZA 4L8GA 5DU2A 3GHHA 4B6SA 2PK3A 3ZD7A 1JZTA 4AJLA 1VG0B 3GLRA 1I0ZA 3TBKA 5ESDA 4UUQA 3AL0C 4I4NA 3A4VA 2OV6A 2Q8PA 4Y7CA 5HWSA 3JWEA 3DE2X 5EKXA 3SS8A 2ZBEA 1KMIY 3WMEA 4OEHA 1JIXA 3GBVA 1KO5A 1P4JA 1NKVA 1WDLA 1F5SA 3PX2A 1U7TA 2C96A 4H7KA 5ENVA 3IBYA 4CTOA 3EXEA 3LWDA 2ZRJA 2IKSA 3O3OB 1L4KA 2Q7XA 4QD3A 1P4RA 1JYEA 4LA4A 5GZ3A 1RWBA 5J63A 3VSEA 3KCQA 4QSHA 5I45A 2AYYA 5JNUA 1ZWKA 1JH8A 3KEQA 1OPXA 4CE6A 3KK0A 4W82A 2YS7A 1GUFA 4RK7A 3HLKA 1WU8A 5IJ9B 4UNRA 1G98A 5DHSA 1FFDA 1YR9A 2Q6TA 4Q7EA 2VF7A 3U7RA 3WLPA 4JYAB 3TB6A 3L41A 4X1IA 3MCAA 4RMIA 3PFWO 1RJWA 2ODPA 3P9QA 4Y1GA 5C53B 1SXQA 4MUAA 3D3KA 5LZ4A 4X8LA 4BPRA 4AS1A 1G21B 2JGEA 4OBWA 4UTRA 4MUMA 4EO9A 1CIVA 2BEWA 2ONYA 3JQGA 3ZWKA 2CEKA 3PGXA 4ZREA 2PL1A 4A8JA 1DKUA 2BI7A 3HLYA 2D5IA 4EYKA 1CUFA 1X7ZA 1QDLB 3C1UA 3ASYA 4JUIA 3RC1A 3SEFA 5THKA 4UZSA 4XM2A 1HDCA 4JD5A 4QFBA 5G02A 1P5RA 3AJEA 3CC8A 3NORA 3PRYA 3SQLA 5ITVA 3H2SA 2NO1A 4RH1A 2BEUB 4RMGA 4BVLA 1O08A 3ROPA 4B5KA 2O7RA 4DNPA 5JSZA 2YJ4A 1CQIA 3IODA 2NUPB 5H82A 3DAYA 4HDCA 4J75A 3E4DA 4A2QA 3PGMA 5J5VA 5HMLA 5G2OA 1YZYA 4IH1A 3LU1A 5JUWA 2EQ5A 2DHDA 2H16A 3QNUA 1SY7A 2W6CX 4Q7JB 4POAA 4O2LA 2C4KA 3F3MA 3NWBA 1IQPA 1CRZA 2BEKA 4GLBA 2NU6A 4BB6A 3D2BA 3PQ8A 3RVPA 4E88A 3K96A 4ND5A 1F7VA 1V3VA 2ZZMA 2VHUA 3TDKA 4QBTA 1V9CA 1IATA 4Y9DA 3TINA 3AZQA 4JJIA 4RSHA 4C2BA 1ST2A 4FSHA 4LZAA 3TLGB 1ZN8A 3Q8MA 5LPNA 1Z4LA 2Q27A 3OQIB 5K3FB 3UATA 3EQ9A 2NAFA 1NHWA 1W5BA 4C88A 3T7AA 3OBIA 4TMVA 1GFIA 2WICA 1P1HA 2Q1TA 3SGLA 4C04A 4EA7A 5LQDA 2OD9A 3I6BA 2C5HA 4F4DA 3AIKA 2GRJA 3H9CA 2JANA 3LUBA 1EHCA 2Z4TA 3OO0A 4TZKA 4UU8A 3ZNPA 2O19A 2HTFA 3Q98A 3LG2A 3TRDA 4JXKA 1GUZA 4KPYA 1T4DA 4XGIA 3PEWA 5BO5A 4TUYB 7GPBA 3ADBA 1HYQA 4UUNA 1KMNA 3UHJA 3BICA 3F98A 3FPFA 4FCVA 3TMAA 3IVXA 2R8OA 2FR1A 4P98A 1IUPA 1ZN2A 2GF9A 2ZROA 4CGZA 3AR4A 4UMEA 1KQ3A 2JHPA 2O0KA 3K20A 4RLHA 3E8MA 3SS9X 3UW1A 4F3CA 5B4VA 1MABA 2H2GA 3OT5A 5JIBA 3EZ2A 2NSLA 2F59A 2Q0HA 5DHRA 4P4TA 4EY3A 2N75A 1SCUB 1TYDE 2JGRA 4FR2A 4NG4A 1R50A 1OAOC 1NG1A 1E6WA 4BUCA 3KR2A 2JAOA 2PN1A 3BB1A 3I53A 5BR7A 5LMNB 2HLPA 1O1YA 1LDGA 1P0CA 3KOOA 1N2CE 3C8MA 3E7FA 4LIPD 3B1FA 3MAAC 3NWOA 5LCXA 4TWRA 3NEPX 2O8CB 4Q9LA 3QEBZ 1EG2A 1R0WA 3NC4A 3OTOB 1UC8A 3Q7TA 3UKDA 4RJIA 2UUOA 5EIOA 1RD4A 4KR6A 2G5GX 3HCDA 3IJ5A 3IL2A 1A9ZA 1ECLA 2QMUA 2QBYA 2DUMA 3EF0A 3EFOA 3QYAA 2C0PA 4N1AA 4TKUB 3K0FA 4WUTA 4PHHA 4C6HA 4D82A 1Y6RA 2JZCA 2FWRA 4CQLA 3J7AC 1AUXA 4ZICA 3U7QB 3CNQS 4EH1A 5KAMA 5BW6B 1OZ0A 4P0QB 2OMEA 2Z4RA 2WVHA 3GFRA 1WXFA 2R751 4HGZA 5E7MA 3WFJA 5C5CA 1FS6A 3ZGXA 3ADPA 1JEOA 1DAPA 1M67A 2FN7A 1KERA 4ENTA 1J7JA 3I9JA 4WADA 3R75A 2PEYA 3NG1A 3RHFA 4UFPA 2JHCA 3WHPA 1D2HA 3HXLA 2R0QC 2JGDB 2XR1A 5HX7A 5JSHA 3V6LA 4MYTA 3PNYA 3C3AA 4MO2A 3HUTA 3T3MB 3NC1C 4I8IA 5K3EA 1WBDA 1E6UA 2O59A 1NKSA 3VYRB 4UCFA 1Q7TA 5F98A 1ZUIA 1QWSA 1NC3A 2ZB3A 3P0EA 5D1HA 3VR6A 4KSBA 3H2YA 1H8HD 1M8KA 2XBLA 2IC5A 3CR8A 4LDJA 4QQNA 3OURA 1IWPB 1UWVA 3DBHB 4HLQB 1SHZA 1UT6A 4LE2A 3RC2A 3B6JA 7REQA 2Q29A 4KGZA 2W6JA 1K6IA 4R81A 4ZK2A 5EPEA 3HKCB 5KYWB 1XR3A 1PL8A 1BHSA 4M46A 3D7LA 1ZEMA 1EE9A 3QY0A 4K03A 5B3LA 1NU8A 2RH5A 2PLRA 2WWFA 5GJVC 3RWOA 2DC1A 5IMBA 5J47A 2E6KA 4JC0A 4DWVA 4C6TB 2IHYA 3CLUD 5LQAA 3RO7A 1NUPA 2YYYA 3U44A 2VTKA 1RYFA 2LBPA 5AI9A 2VLIA 2EW1A 3R7BA 1XFAA 1NMYA 1TZMA 1NMZA 3MS4A 1GARA 2IEZA 3IPRA 3RJMA 4CQMD 2NT3A 4BNKA 4GPBA 1AKEA 1HM5A 4MA0A 5ESXA 4UKDA 4M0DA 3UMSA 3M8KA 3TTWA 2DHCA 3GP3A 1EDZA 1NOKA 3A6GA 3D6FA 3DLTA 4O59O 2W7TA 4MKRA 1J8DA 3PUXA 4TLDA 1CS0B 3PENA 3VOSA 1V3TA 4HMPA 1Y34E 3V8MA 3QTBA 2WJGA 5FL7A 5JASA 2F3RA 1V1RB 3TPCA 3G8CA 1DIRA 2FFHA 1I2ZA 1GYQA 1GVHA 2PQMA 3DL0A 1EFUA 4DXDA 1NDQA 5K6RA 1E6MA 2YL2A 3DLIA 5BMVB 4M2LA 1ST3A 3BMCA 4BAGA 1VE9A 4JC5A 5FUYA 2EFJA 4QWWA 4BX3A 3WIBA 3IQDB 3NM6B 3QVGA 5ALTA 1EFPB 1P39A 1ZMRA 3BSWA 4Z4FA 2FHSA 3DEAA 2DKNA 3D6HA 1KQPA 4Q1CA 1ZONA 3DP9A 4YRJA 2A14A 3OIFA 2D0IA 2FP4B 5EI5A 4BEBA 4EECA 5JBQA 4N5NA 2Z5VA 4JLJA 1V7QA 4I4TA 1BMFD 3QXGA 1LNZA 1O0SA 3D54D 4XGKA 4AJ1A 2JJ1D 1XJ5A 3JVEA 3VX4A 5DWVA 4LOHA 5G0UA 3S5UA 2G63A 5KYUA 4IXMA 3LBIA 1NTRA 3PFGA 1UK8A 5G53C 1U2RA 1YR1A 3K6RA 4C7BA 4E30A 1A9RA 1YXMA 2XRMA 1SXJC 2P4UA 4OXNA 4KVZA 5CTJA 2E4UA 3ELDA 1Z4IA 2GYYA 4FZRA 5HOEA 1VSTA 1JJ7A 5BXYA 2OORC 3IEPA 1LF0A 1T9GR 3Q8XB 3L4EA 2CVQA 3DOJA 1JT2A 2Y66A 2DCMA 2BM9A 1M3SA 4O02B 4H4EA 1VB3A 4MW5A 3LXRA 1W94A 3HR8A 1LX6A 1WETA 1UBKS 3GRYA 4X94A 3FVWA 4M22A 1Q0RA 3L8HA 3C5EA 2LXNA 4YRCA 2B8NA 3VNRA 1J7KA 5C46F 3NTLA 3L7KA 5SY4A 1CZRA 3TTXA 1CZHA 4KLAA 2ZE7A 3CF4G 3HUEA 3ELWA 3DZIA 3K6JA 3T0IA 4ZDJA 2VHJA 5KC9A 4X24A 5BSFA 1QIFA 2RI1A 4QX6A 1ZGCA 5K8LA 3FOCA 1RBMA 4XIIA 2I3BA 4MUYA 5EJAA 1CF9A 2HHAA 2YNMA 1B74A 1JQ5A 4HNSA 2PKXA 2G40A 3G2QA 3KKEA 5HMMA 3O73A 3SAJA 1YQEA 4XJVA 5LP6A 5IDXA 3IP5A 2ZJAA 4ZARA 3K9GA 3ZQJA 4OOFA 1NAIA 2G9UA 1ZDMA 1G5TA 3GDOA 3W9BA 4GHWA 4LJ7A 3AUSA 5IH3A 4ZIRA 2OCGA 1SUFA 5K0EA 1L7RA 4L2IA 1PDVA 1TMKA 2A9PA 3P4UA 1TVEA 3ULKA 1FP4A 1JFFA 2AVDA 2OB2A 2P4EA 2QDXA 3KAQA 4LJYA 2EBHX 4N82A 2I4RA 4H3KB 3MRTA 1GPNA 3G2KA 5CH3A 4A7PA 1DEKA 1RAGA 1S6YA 3OESA 4FT2A 4NESA 4AS3A 1M2EA 1RQ7A 1E2MA 2QE7D 3HWWA 4GUAA 1MP0A 1VBKA 2YHUA 1E3TA 4ZALA 5FWDA 4AP6A 3BMQA 2IHKA 4GYKA 1JIUA 1YMUA 3TZCA 2A7QA 2JGLA 3P9PA 2CHGA 1SWWA 1X1QA 2QQ5A 3FCEA 3V5NA 4H9GA 6YASA 5K1ZA 4UNSA 3KEOA 3AFMA 3I09A 3RUIA 1IAQA 4CDGA 2BKXA 1RWMA 2AMLA 4ZVUA 3UZUA 4HPXB 1S01A 5HUHA 1P0QA 1NBMD 2UZ1A 1S9DA 3W7VA 1GCAA 4O4LA 2VH1A 3U7FB 3IEUA 4IW3B 1EUZA 4QULA 1QS0A 5KCMA 3AERA 4QDKA 5LZ2A 1N92A 1TI7A 2XWJI 3LI2A 1NRJB 3CRQA 1LW6E 1R5OA 1TK9A 1YL6A 4FP9A 4DYDA 3UWSA 5EWJA 4G0PA 3GZJA 5KUTA 3TB4A 4F6LA 1QYDA 2HCRA 1ZLXA 3MERA 4HLUC 3WYGA 4UBIA 2QX7A 2ZYVX 2G1KA 1R8XA 1SUPA 4YUVA 4URVR 4PRZA 5HTKA 3A10A 4E2ZA 1DMSA 5J43A 1BE6A 2LD4A 5CW1A 3SFTA 4CEJA 2QWXA 1MTZA 4LYEA 2VT6A 4HDKB 3R7DA 5B12A 4FCCA 2YX1A 1GAEO 1YMQA 5G3ZA 1D2NA 4YRGA 3RV3A 2JK1A 3UHFA 4P7BA 4XPZA 1IEVA 1V6SA 3JQ9A 4QUKA 5F5NA 5FTKA 5TQ2A 1LBTA 2BI8A 4FCWA 4AXBA 3JRWA 4Q4JA 2BC9A 1SCNE 1LWNA 3JAMA 3HA3A 4UCWA 1XNRB 2O9JA 1Q95A 4MRMB 5KVCA 4CJXA 3D9QX 4I2NA 3D6NB 1LGYA 1FVFA 1MAVA 2CYAA 1BMDA 2XMDA 3R3VA 4FINA 5FOWA 4WGGA 4AP9A 4EI8A 5FULA 1NDHA 4EQZA 4I19A 3H99A 3QE9Y 2Z9CA 2O05A 1Y8QB 4U7FA 5J1SB 3I9MA 2MINA 4YJGA 4BWGA 3DG9A 3EJ6A 4U00A 4X63A 2A5JA 1E1LA 3S68A 2NO4A 4J1NA 1PJQA 1GG5A 4EHBA 1X7XB 3A6KA 3WNQA 2V7EA 5HP4A 1AS2A 2Q4EA 2LCIA 4IGAA 3FPBA 3HMKA 4JOBA 1OBFO 2A8YA 1PIWA 3KVRA 3I83A 4X62B 1QH1B 2P6OA 2HJRA 1EXWA 4CM1A 3OP4A 4Q02A 4EJSA 3IESA 3IV6A 4OKSA 4TYPA 1WB4A 3BKWA 4XB2A 3QZUA 1FSZA 4XOIA 2RH4A 4IDCA 4L07A 3E22A 4MCAA 3S2GA 1GTL1 4CMIA 3D7MA 1SVUA 1D09A 1L7NA 1SULA 3NHFA 3SYRA 3KT0A 4GS5A 3OZAA 2DYKA 3HNPA 5HKKA 4LK3A 3L06A 4E4YA 3QF4B 3BCUA 1NYRA 5C5IA 3HI6A 5G0VA 2AFVA 2M32A 1BN7A 4DR5B 5K99A 3JQPA 1O4WA 2F90A 1PF7E 4S1PA 2GYUA 2C0QA 3U40A 4GVLA 4A91A 3IQGX 3QOWA 1HDIA 3A1NA 1CUJA 2BMFA 4C30A 1DAIA 2QXTA 3VI4B 2NVUB 1UPXA 2IYWA 1NLFA 3C5VA 2P1ZA 5CCEA 2XMBA 3R9IA 2ZRFA 3QVSA 3C24A 3KETA 1X39A 1P9NA 1GVNB 3UJ3X 5B53A 1YJCA 1FDSA 1K68A 4DJTA 3ZWQA 3TTUA 2RHTA 3R41A 1D9ZA 4EY5A 5IAKA 2GASA 2HF2A 4K9NA 4E22A 1EWTA 3IERA 4HTFA 3AJAA 4I9UA 2RCYA 3NAGA 5H9WA 4WBNA 1KEUA 1JKJB 6GPBA 3WGJA 1ZJ5A 2GEUA 3PIDA 1CZUA 1HORA 2PVCA 5ALWA 1J70A 3DLAA 4M49A 5DO9A 4XWKA 5ESRA 4HAWA 2FPGA 3H5OA 2OCYC 3WLSA 4UZFA 1HFEL 4XDGA 4UUOA 4K8OA 3LKDA 1V1JA 2BE9A 2JFNA 3DMTC 5FORA 3FZQA 3H1FA 4L5BA 1VP9A 3NATA 5CAEA 3OE7A 1R6VA 1NATA 3UJDA 1EB8A 3M5DA 3GJ5A 3OTQA 4BQNA 1PV2A 5AVZA 3O4IA 3PC4A 4HN9A 1CETA 3M6WA 1L5WA 2IODA 2X0JA 4ZQHA 1BVRA 5EE3A 4YT8A 4V1CB 1ZM4A 1A8IA 2Y68A 1Q0LA 5FOUA 2BFCB 2WAYA 1V39A 3GGDA 3TE7A 3MUEA 3MWDA 1XAJA 4OJYA 4I55F 2Z1DA 4EFLA 3A06A 1NVMB 3HE3A 3RS7A 4DOMA 1BCSA 2YFHA 4RQAA 4BBZA 5IYZB 1NVXQ 4EATA 4NULA 2EYUA 5M34A 1WXWA 3OEHD 4F92B 4ESOA 1DBQA 1PUJA 1CY6A 5B7QA 4KNYA 3BT7A 1N5OX 2WJJA 4P9NA 3OZTA 2HREA 3O84A 3LUHA 1J0CA 2RK6A 2CW5A 3EK2A 3I6IA 1W59A 4BO0A 3SZLA 1PHRA 4E7PA 1ECPA 2QRJA 2F43A 4QARA 1NOJA 2C5BA 1DEHA 3EVNA 5BV2P 1VB5A 1ORRA 2DRIA 3LQ1A 4X45A 4HRXA 5D6OA 1KMHB 1MTOA 5KVQA 2JI6A 2R65A 3DUWA 5AJVB 2ZI3A 5DTEA 3ETJA 4F2GA 3FTCA 3HR4A 4IAOA 4RM2A 2V7GA 1U8FO 4PSUA 1ZXBA 3PHIA 1QMGA 2WU8A 3PGLA 4H3SA 4OQYA 5DX8A 4YRMA 3DEIA 1D0SA 2E7ZA 4WPGA 5JXGA 2I7CA 3ML1A 1MJFA 2MYTA 1P7YA 1C50A 1EHIA 3GWZA 1BKYA 4RZQA 3TQOA 2G7ZA 4LK2A 1JG3A 4CTKA 1CB0A 4DLTA 2BCJQ 2PMBA 3RTEA 4QGGA 5EIAA 2J0QA 4PQYA 4TX1A 3BSYA 1FFAA 4RKRA 4XYGA 5KTYA 4Z3KA 1Q0ZA 1M6HA 1JLMA 4HO1X 2ZUSA 2PUVA 3ZY6A 3SD7A 3ZLUA 1Q14A 2XMSA 4BMZA 3OJFA 4IG4A 4ANFA 3GPIA 4NU6A 4RU1A 5HE8A 3QHAA 1WNTA 1WXQA 2YVUA 4NK5A 3SHTA 1DC6A 1QUEA 3L6CA 2IYPA 3FPKA 1YAHA 1M6YA 1JHAA 1JYFA 4GWGA 1CY2A 4JBIA 2XMPA 3DMGA 3Q3IA 2NU9B 3ZH9B 1ODFA 4ABYA 4C1NA 3CV3A 1SC9A 2A5FA 3AM5A 2H59A 3CRVA 4IFBA 4GZMA 2C1EA 1Y8RA 4JNKA 4RUKA 3VJLA 2GVNA 1E1NA 4KNVA 1NV9A 5EA2A 4A2CA 1JSZA 3FJYA 3L40A 3I73A 3LZ6A 4BATA 4NYIR 1LKZA 4JP3A 2ANCA 1SIBE 1ISHA 4LEIA 5BSEA 2V6GA 4M1MA 1ODLA 1DRUA 1GPYA 3FNIA 4JCOA 3OQBA 1KEKA 3DR3A 3CJTA 3K2EA 3WGKA 5KTSA 2O1EA 4BPBA 5C81A 4KWIA 2VDKB 5WRFA 3NETA 4FBMA 5DP1A 1VJ5A 2HDNB 5CB4F 2DEUA 2XI4A 4MULA 5ERYA 1IWOA 2ZRLA 2CZCA 5TXGA 5H4GA 2LIPA 4XPIB 1YVUA 1ECBA 3QVXA 2D1SA 3J80A 2AUNA 4JYZA 1EUQA 3PRJA 1X7YB 2GJ8A 3AGPA 2Z3ZA 5TEWA 5DK4A 3EIHA 3P20A 3IOCA 5I7RA 2IZ1A 2JBAB 5LOVB 1IEQA 2FN8A 4NBWA 1S8FA 3R5JA 3LBYA 4HNQA 1YS4A 2DFVA 2OCLA 1WCIB 4HZGA 3GAZA 5E9QA 4BO9A 3EAFA 2GBIA 3PNPA 3IJPA 3KKMA 4FMPA 1C4WA 4QXOA 3L4KA 3FFXA 3TOVA 1IN7A 2CXUA 2XUQA 1GUDA 4RPHA 2D5LA 3AG6A 4V03A 5KYKA 1T6ZA 3PQ3A 4U0JA 1LV8A 1XIVA 3H05A 2WJIA 1HTTA 4H6XA 5LZ7A 2XE4A 3WWYA 1D4ZA 1F0PA 4EF5A 1X7HA 3LT0A 3MTDA 5A71A 4BP1A 2R68A 4UBKA 1A72A 3CCFA 2ZR9A 4BO2A 5IJ9A 4PTLA 1EVZA 4KX5A 3Q7QA 4BLSA 3GNTA 3U7JA 4WOPA 4ZYZA 2ZYTX 1YQXA 4N7JA 1JXMA 3LIPA 4KRFA 5IP5A 2EKZA 4OUKX 1QGAA 5SY6A 2I9PA 2IVFA 3LCRA 3BPSA 1ZEJA 4PRLA 5ADHA 1NN1A 3NP7A 4Z4CA 2LGJA 1G21A 2XEXA 4OAPA 3FWYA 5DLPA 4ADSG 1EXDA 3R6LA 1TYCA 2FZLA 1VE3A 1B0ZA 2W4IA 3FDZB 4PSVA 2HJSA 1N5DA 3FYUC 2JAHA 1GGFA 3T1TA 2CSXA 3JD3A 5T8KC 3EPPA 3LVFO 3OJEA 1NU6A 3E23A 3OU2A 4G0MA 3EGEA 5FH9A 5M5BA 3JQ6A 2RGAA 1B8UA 3W5DA 4K6CA 2Y1KA 3DMPA 2I7VA 3AVPA 2BEUA 3AOGA 2KM1A 1OW3B 4L8VA 1JPUA 4R40A 4ZQCB 4IUYA 1CJSA 1O54A 5J9FA 2NUPA 1ZN9A 3Q3GE 4KIUA 3C8DA 2JLBA 2FPKA 4Q3OA 4JJZA 5LA6F 5K8IA 1E89A 4EUHA 5CA1F 3W6UA 2QUHA 4DUZB 1EA5A 4YT2A 2I2WA 3LPCA 5A4DA 2C4VA 3EOAI 2EC5A 1P9WA 1SXIA 1I7QB 4RPGA 2PUDA 1G5IA 5JI3E 5J2UB 3D4NA 3V1LA 1RKXA 1RCUA 2QRKA 3DBVO 1OH7A 3HVIA 3K8OE 3OG9A 4OQQA 1Z4OA 1BE1A 1C3LA 3PQ6A 2DR2A 2P68A 4DHEA 2ADOA 1GL6A 1HV8A 4R98A 2P9JA 2YKGA 1XQ6A 5JSKA 2DOKA 3LDUA 2RAFA 3NX4A 2W6ZA 3TLGA 1L5ZA 4FS3A 5K3FA 2K87A 3OQIA 2SECE 3WMRA 4TN1A 2OVBA 3NASA 3NANA 4JIGA 1CJTC 1YRBA 2W83A 4LDAA 4PCLA 4XVRA 3UUGA 5CVCA 3H5IA 1YCGA 5FF9A 1IQRA 4N3GA 5KOJB 4R8SA 4YH1A 4DIBA 4QXRA 2BWJA 4Z3OA 2R5WA 1UBMS 5ALFA 3FDFA 1AZSC 3DCJA 2P1RA 4KZPA 1R0CA 1NQOA 4I5DA 2P40A 1V26A 4TUYA 1XTZA 4FK8A 1L5VA 4N5HX 3UAWA 2C7BA 3ME5A 2O57A 4LOKA 3PGVA 1J0EA 1XKXA 4XA8A 2X9VA 3QUTA 4ITUA 1LDYA 3ZE8A 2GDZA 5G40A 2HSDA 2FOXA 3CZAA 3UK6A 4OP2A 4LV6A 4AKHA 4CIXA 2AQ8A 4A5SA 1REQB 1F38A 3CF4A 1UIMA 3E5NA 3LYUA 5JTUA 4AJ9A 1SCUA 3QX3A 1GL9B 4G0OA 2XUDA 1K7SN 2QJRA 1MZVA 3LO5A 4MS4B 1IMJA 2XE8A 4YYZA 1NDUA 1NLZA 3H5TA 3VU9B 1Y8ZA 1CUHA 1LWOA 2VSQA 4MZXA 2V6FA 2QZ9A 3M3DA 4X65B 5EVCA 4OJNA 4EY4A 4UVIA 1PVOA 1Z82A 2O8CA 3NHKA 3IR5A 4AJOA 3LCVB 3U9TA 3CVVA 3JASB 4ZRNA 3U9SA 1PGNA 1EVQA 3E0XA 4E5VA 4E94A 1N1GA 4HAZA 1LI4A 2VF5X 1EE1A 1PQWA 4KHZA 5A1TA 3DSRA 2DUNA 3GVPA 4TMFA 1O95A 4Q6WA 2Y1EA 1MEOA 2X5OA 4RD4A 4WCDA 3UMJA 4AF6A 1RLIA 3HVUA 2FZ4A 3ZG6A 2AJBA 1SOUA 1QYRA 2KE5A 4WY5A 2X40A 4TKUA 2DXIA 1FS4A 4B6EA 4D97A 3PF8A 5I47A 4I9GA 3V1KA 1M2OB 4X97A 4D9HA 4QDUA 3DE4X 2Q5IA 2OZVA 2V3VA 5LQRA 2DERA 3D43A 4ZV7A 1ENYA 3U7QA 3LQYA 4DZTA 1Z22A 2LV8A 5C4GB 3UHPA 2GN2A 2FA9A 4PGGA 3UJ9A 1W0KA 2ZIUB 4AMZA 1I4WA 1CF2O 2AV6A 1JN0A 1TKAA 1V6CA 1J8MF 5I7UA 1APBA 4XDZA 2X8LA 3REQA 1MEEA 3NCTA 4ENVA 4TTSA 2VNJA 1ZUWA 1EX6A 2W2MA 4A0QA 1DXOA 3NAQA 3AWIA 1SVSA 4NWIA 2JGDA 3KQNA 1I3LA 2X1HA 1VKNA 1OHHA 1X7DA 3HKEB 1H8ED 1PEYA 3EFBA 5F12A 3TQRA 5LQJA 2ALJA 2RKOA 4NENB 3T3HA 4ESEA 3HVJA 4OSEA 5A3RA 5I9IA 3RYCB 4NBTA 4LF4B 3E3LA 4KFTA 2H1WA 2QJOA 2YYZA 3EF3A 4JJFA 3SM9A 5A5DA 2FG7C 3TLEA 3E5RA 3DBHA 4B6JA 5D5QA 1J2TA 1H9AA 2I7TA 1GQOA 3PU6A 1JLSA 4HHEA 4IRXA 4KR2A 1YU9A 5KYWA 1VC2A 3HQ4O 2FEPA 2BT4A 3HKCA 3WWCA 3GDGA 2VWPA 2P0EA 4PZ0A 4V1CA 4E5PA 2P2GA 3RS3A 5BQFA 4HB2A 1GILA 5CD9A 3WK7A 2ERCA 3AO0B 2X14A 4GO1A 4OP3A 4QFDA 9ATCA 1P9RA 4H7IA 4C6TA 4Z1OA 3AVTA 2HMYB 2B99A 4E5KA 4HF7A 1K6XA 4MW2A 4AJJA 2ATIA 4JN6B 1M83A 4FN5A 2A4MA 3R1IA 3ITEA 3CW8X 3GJ4A 3MPOA 2V65A 2BUBA 2CMDA 3BIWA 3FD8A 1AMUA 3CMMA 3HVRA 2PUHA 5DLEA 2BHLA 3WIDA 5GZ1A 3ZI0A 1CS0A 4IDHA 2P90A 1QCCA 3M4ZA 4ESHA 3ITDA 4D96A 3KJXA 4HQLA 4HWRA 3CVJA 5MGNA 4B35A 1YI0A 3NVAA 3GVHA 1RQ2A 1SQSA 1ISGA 1V1RA 1TUBB 3N7TA 4Z0HO 5F4BA 1DUIA 2B61A 5CX1B 4BN4A 4TGLA 3LYLA 3PLNA 2ZI4A 3BREA 3SLRA 4S24A 5BMVA 1P2SA 7ABPA 1B2RA 1LLCA 2JZNA 1RRCA 2ZUTA 1OLOA 1WKCA 3UMCA 1TTTA 1EFPA 2O2DA 2J46A 1AS3A 5CDTA 5B55A 2GR9A 4ILKA 1M2HA 5CA0B 4RS4A 5FYQA 2OG1A 2QQEA 3DQQA 2DQSA 1RTTA 2BMJA 2QX4A 4JFAA 4TLCA 4UHCA 5DZSA 1I94B 1UOOA 1KYXA 2FP4A 3PFIA 4JUAA 5HZMA 4UDYX 1SHUX 3CW2A 4P7KA 4ZODA 1NVKA 3BWBA 1DB3A 1DZIA 3GP5A 2QT1A 3OQHA 2II6A 5EINA 1IHUA 5L40A 3EH1A 1CDDA 4C22A 2EQBA 2EJTA 3RAGA 2GBFA 5C31A 2WT8A 1M2FA 3SWWA 4AUNA 1PQYA 1R2QA 4HYTA 2OLEA 2P2NA 1Q3HA 4L15A 2B7LA 5K4HA 1COWA 2W2LD 1W19A 2G72A 1Z34A 5GVRA 4D4KA 5DCUA 1UMBB 5T5QA 4BMPB 5HIAA 2P4QA 5BT9A 3M3HA 4FZVA 1X80B 4UU7A 2PUJA 3KKKA 2A57A 3HP4A 1CQWA 2VAVA 3L9WA 3G9QA 3T0GA 3B1YA 4J1QA 3PZBA 5K2OA 2YY5A 4JC4A 3L8CA 1H5UA 4OATA 4PYIA 4MPRA 1SUSA 4B44A 5CDYA 3UAGA 3CW9A 4R8MA 1D0VA 1AT1A 1QE0A 2CMGA 1E3IA 2N42A 1BX0A 2N1MA 2Q9UA 4D8XA 4A5OA 5J4VA 2WUWE 1WD7A 3BFXA 5K3BA 2FJUA 3H13A 5DTJA 4AMGA 5HF6A 3GLQA 1XMSA 2ZJ5A 5CVTA 2OECA 4FFDA 4HSGA 4TXMA 3ZCVA 4KXQA 4MH0R 1E1RD 1HURA 2GTPA 4FUTA 3ZXUB 2BBSA 4JHLA 1AA9A 1ULTA 4LRXA 1ZJJA 4RZ3A 1CR1A 4B46A 2EG9A 4N0EA 3TO5A 1ANKA 4ALKA 4RJKA 4CTMA 2QJTA 1WB6A 5G0TA 2QPTA 5E7IA 1A9XB 1HE2A 4WTOA 3TL6A 3JQQA 2P2DA 1SWVA 4MWZA 1KPIA 4F4IA 4U7WA 4B6QA 3MCZA 1WEKA 4LNHA 2FYTA 1H5NA 3NFYA 3PG5A 4QEDA 5CDFE 4DEYA 3PZRA 4H0CA 1DAKA 3OEWA 4UE2A 1KL7A 1Y63A 1I13A 5L3QB 4PW0A 3SXUB 3OCUA 2EAUA 2HCJB 4PPQA 1CNFA 2NUTB 4Q1FA 1Z56C 2QV0A 1KFCB 2Z9DA 4R8VA 1M75A 3AR3A 3T3NA 3QWIA 1U8ZA 3HHPA 4YROA 3RKUA 4EQ6B 5JU6A 3E35A 4DRZA 3I0ZA 5C5DA 1V35A 4RF5A 4AUMA 1PJTA 2CFTA 3VOBA 2PEZA 3MA0A 2NPFA 4O1IA 1OTHA 1QV7A 3NEJA 1YVRA 1AB5A 4KXMA 3N6XA 4PLTA 4DG8A 3CF6R 3K3PA 3GGPA 4AQDA 2XY4A 4GRIA 4DUGA 2AXQA 2O7SA 3RTGA 2KLBA 5INTA 3SE7A 1OGYA 1DTWB 1NR1A 2GNPA 2VQ6A 1QNLA 2J0EA 3M9LA 4GL2A 2Q5EA 4TWAA 5CT9A 2HNAA 1S96A 3JTMA 5HZHA 2H5IA 2W43A 4N41A 2GFIA 2NZXA 3D5QA 3UEOA 1QIKA 4D6XA 4EFDA 4YCBA 3IHKA 3GX1A 5C51B 2JI7A 5IK2D 1OI2A 1GA1A 3ZGLA 1DQSA 1ZGBA 3R7AA 4JI6B 3FYHA 3G0OA 4ZI5A 3ND5A 3P27A 1I9CA 3L0OA 3NRBA 2HCTA 3RLIA 2COKA 4QUIA 1LZKA 1O6BA 4MQLA 4IXWA 2ZVPX 4U9UA 4DMUB 3HB5X 1M5RA 4XWGA 1XF1A 4ZP1A 2MIIA 4MRRA 1S2LA 1THZA 4PS1A 2Q5JA 1RYYA 2Y0EA 4OA8A 5T64A 3LV8A 2C2MA 4IMPA 2GUWA 4DBVO 2XUGA 2OY0A 3WKEA 2OQRA 4G0XA 3TMKA 4B7ZA 1K0FA 4HDKA 4F4JA 3EEQA 4WBXC 4LV5B 2XGMA 3IUYA 4JEMA 3EWAA 4OAOA 4BNJA 1HLDA 2HQRA 4FQ7A 1K89A 4DJDC 3R3SA 3NTQA 1E2FA 5GIOE 4D8VA 2O14A 4HQKA 2PYZA 5EKSA 1W87A 1NW5A 2C20A 3QMMA 4Y2UA 1NR5A 2C4HA 2V96A 2QG6A 3N8GA 4MRMA 1L3BA 3WIEA 8GPBA 5EQTA 4C3ZA 4CF7A 4FEEA 1SVLA 4JVNA 3QVWA 3AF4A 1C1XB 1P2DA 1LX7A 1Y8QA 2RIRA 3HCCA 4KQ1A 4LYHA 3GH3A 4RPCA 2PS1A 1I1HA 4ZVPA 1CFJA 2XHZA 1LEHA 1WMBA 3IVCA 3GIDA 1RAEA 2QZJA 5ILGA 4EOGA 1Q1BA 1E2KA 1W1IA 1X7XA 1X0XA 2HRBA 3AY7A 2X4IA 3GN2A 1KI1A 4Q39A 4W63A 2J5KA 4L3VA 4BOYA 1L5HB 2IY9A 5EHNA 1QH1A 2HW8A 3EXHB 2Z2JA 3QEKA 3KXLA 1RHQA 3N5KA 4UMVA 2XDWA 3PIRA 2PUCA 2VK1A 2IIQA 1VBNA 2WAXA 1J22A 1KVQA 1PWXA 2EWWA 2WT4A 4WNAB 4I3GA 4XB6B 5IKPA 1I7NA 1TZBA 2EX1A 3HU2A 4HDRB 4HI0E 3B6EA 3V8NA 3EXIB 3H4MA 3KS9A 2F55A 4PRYA 3KYIB 2VZ9A 4Z0TA 4F3YA 4K9RA 3DFIA 3TSZA 1I6MA 2Y1WA 4OX9Y 421PA 3OLYA 4F12A 4K9SA 5H3HA 1E4EB 2QSJA 4MVJM 1E1CB 1TD9A 2P69A 4F11A 1N8NA 3QELB 1XAGA 1U99A 1U9IC 3QF4A 4NJOA 4KWTA 5DEOA 3AJRA 1EQ2A 2D62A 3VJRA 4EW6A 1W4BA 3GJSA 3HY4A 1OE0A 4JBYA 2EGUA 5CXQA 1WXIA 3SZOA 1O89A 3RSHA 2VYVD 1W96A 3DKKA 1U65A 3PDWA 5D8DA 1HEYA 2PO5A 2DAPA 3DZHA 1BSVA 3KEGA 1I3OA 2NVUA 3L6BA 3MEQA 4NQRA 4RESA 4EMBA 4CL8A 4GPEA 5KOHB 4ZYUA 3K0SA 1NZJA 3U4GA 1PTJA 4HAUA 3V2GA 2AWOA 1X7WB 3KXPA 4TLEA 5U1PA 2C9OA 2EJCA 2PANA 1IM5A 1SC3A 3DEZA 4QBFA 2R85A 2BZ1A 1ZCBA 3QFHA 3VNSA 3QLVC 3IBGA 2JHFA 3BN3A 4MWCA 4POOA 5B6PA 2JLVA 1JKJA 4MAAA 2HNBA 1DRVA 4TKMA 3VTZA 2H0QA 4F91B 5LQMA 1E18A 3OCXA 4LJSA 4R6XA 4DUPA 3RVNA 3NBXX 4GMDA 4HZUB 4PZYA 4X61A 3ZX5A 3UYLA 3T9CA 1GJRA 4LGYA 1RWOA 3R74A 2Z3WA 3BB3A 1PFUA 2IK8A 4KR0A 2PHZA 2ZWIA 1ZK3A 4BP9A 1ZD5A 3BXOA 3JU3A 3PA8A 4YK7A 3EWIA 3PE6A 4BV2A 1RKBA 2BFCA 4MUXA 4QKQA 4CKZA 3D8TA 2QUAA 1R4ZA 3NH6A 3X2FA 1Z6TA 4IVPA 3BE6A 3LS2A 5K6TA 3NLLA 2I91A 5JQWA 3K9NA 3ANTA 4YXWA 5FBLB 1MAAA 4IKPA 3N2GB 4TMKA 2HIGA 2W0MA 5IYZA 2ZM6B 4FM9A 2GN9A 1DNPA 2Y6UA 3QBDA 1U2ZA 4ZAFA 3K30A 2XT0A 4KPGA 3IILA 5DNAA 1HMPA 4LCJA 1SD2A 3EC2A 1JEAA 3N39C 3U48A 1Q7GA 2HQOA 2FU5C 5A1JA 3A3NA 4PLCA 1KI4A 2B20A 4M86A 1OF1A 2JLSA 3RUPA 3H97A 2PZEA 4EY7A 3E7WA 1OGJA 2FRXA 1KMHA 2CK3D 1SBZA 3TAXA 1E2NA 1G5PA 3IUNA 1B8OA 1D2AA 4UTVA 4B76A 2AZDA 2OSBA 3R5FA 4C1BA 3AHIA 3B6KA 3TRJA 3IMEA 3ZX4A 3A6FA 1Y6GA 2XZPA 2GAIA 3Q0IA 5LZ9A 5LQSA 1XZEA 1F0YA 4AIIA 5JJCA 3H04A 2DQZA 4LZWA 4G01B 3LDFA 3A11A 4Q18A 1IG0A 3AR2A 4L27A 2C4NA 2J6IA 4CM9A 1KETA 1FL9A 1Q21A 2B4QA 3DS8A 3NVKI 1TM2A 1XVVA 2RH9B 4FOOA 1SZCA 1D2EA 4BV3A 4EYOA 4AS2A 4MDEA 1EB9A 2QUJA 1OKKD 3GFPA 5L6LB 5TGDA 2WYOA 1MG5A 4PLYA 2OHXA 4ZV9A 1ISSA 4YI5A 1U02A 4X3CA 2NU9A 3I5MA 4AUEA 4CKEA 4ND1A 4HRVA 1TJNA 1FXWA 3LUPA 5AW3A 3KVYA 1PHPA 3WWDA 5JNTA 1NXQA 1V8BA 5KOYA 4MPTA 4CTNA 4ZD6A 3CKLA 2WAOA 4KDRA 5KVAA 2XKBA 2R00A 1ONPA 1XDBA 1KTVA 1GSAA 2OC4A 3AH8A 2JH9A 4PWZA 1PP4A 3IHWA 1G8JA 1Y1KE 4P3YA 3RE1A 3WYFA 3T41A 3BAZA 1YQUA 2O5VA 3MJDA 3PICA 2J3QA 3LSYA 4DWWA 2ZULA 4XPIA 2RJ3A 1YKSA 1XKQA 2ZJ2A 3LL7A 5BSKA 1X7YA 4ETIA 2C42A 1BHQ1 4S04A 3B20A 2PMCA 4PBRA 2H7YA 1G8HA 2JBAA 2PXAA 4RF4A 2EKLA 3NIWA 5F21A 4A6PA 1FNBA 1H65A 4G1FA 4BQOA 4EARA 1PBNA 4O4IB 5C1BA 4Q3LA 1WCIA 2XUJA 2Q50A 4XFKA 5GGXA 2XOKA 4PC1A 3JAWA 3PPXA 4NPHA 1H2EA 2A0XA 2ZIWB 2GEFA 4I9NA 2WWVD 5HM6A 4QBGB 4TLAA 4TPKA 3O4HA 3GFTA 2RAUA 4RYDA 3RJZA 2HSEA 4G4GA 2H1FA 3CPSA 4GDFA 1HNWB 1Y9DA 5DIZA 3ZE0B 1BW9A 1PR4A 3O75A 1OA0A 1G21E 1ZH8A 4V2UA 1IN1A 1C1YA 1CK4A 1XUOA 1T0IA 3HACA 2BH9A 3C3MA 3VR6D 4DCGA 3MWEB 2IUEA 2ZBRA 4C29A 4DLAA 1N7GA 2H4YA 5DGHA 4LOJA 4PGHA 3GCXA 1B14A 4WIAA 1ADBA 4WXYB 3DL4A 1GZ4A 1POXA 2GO1A 1T9CA 3DBIA 1BKSB 1E2GA 3LF2A 4MA5A 3TLAA 2ETVA 1V1MB 4AJPA 2DVMA 3H4VA 3FDZA 1CDZA 3LLMA 4NYJQ 2WMDA 4Q1EA 1ODCA 1P7ZA 4RAQA 5ALDA 1XDUA 4KKVA 4WZAB 5FHQA 4OJMX 1KAGA 1KXJA 1LV7A 1YI8A 2ES4A 3OICA 3GUZA 1RM4A 3PXXA 1L4GA 3SQDA 2YJTD 2JLWA 2HX1A 1EFRA 3BL5A 5LB2A 4BO4A 1JSXA 2BPOA 3PGA1 3TTSA 4CGYA 2VJAA 3W8RA 1XLTA 3EXG2 1GUBA 1A8PA 3UMRA 1Q77A 2ORED 1S8NA 1LB1B 3GGSA 3B60A 1UMKA 4WZZA 2PR7A 3UGQA 5CVEA 1W0CA 4RXUA 2R7AA 3EIQA 1ZA1A 2PMFA 3KZOA 1E3WB 3DUFB 3PC8A 4DR4B 4F9TA 2NIPA 4Q37A 3WDMA 1NBAA 3JYOA 4BIMA 5CPBA 5HPYB 5I3ZA 5J2UA 2OAQ1 3B9QA 1FLAA 3H9GA 2PS9A 4HC4A 3ZWDA 4FFLA 1X1AA 4NEHB 2H3HA 4B71A 3B5IA 3AEXA 5ALGA 4DE5A 2CVPA 4FXPA 2UUPA 3OTIA 4B5LA 1W4ZA 2O7NA 3VI3B 5EPUA 1A5AB 1JHPA 5FOVA 1I5EA 2GS9A 4DM7A 3IUJA 5T4EA 2ZM5A 2A78A 4FWTA 3VZQA 5FLEX 3U4IA 2O8DA 3GMTA 4JL5A 1SUCA 1KC3A 4JH0A 4D02A 2KW5A 1GKIA 3AHGA 4AN1A 3B3AA 3NWEA 2R2AA 4NIMA 3AF6A 1OJLA 3KHTA 5KOJA 1OWOA 3IPAA 4M36A 3AM1A 1MB9A 5A4IS 4G5QA 2JVKA 3RNOA 1BXKA 1V16B 3EVBA 3TXAA 1FMCA 1HG1A 4IBOA 5CB4B 1I32A 2ZYRA 3PI7A 4EG5A 5KJCA 2EHJA 2CLDX 2LTAA 4MNTA 3UBTA 4MV4A 1UDBA 1E92A 4PSDA 2FOLA 4JR0A 4HS9A 4RL6A 4MQMA 4NARA 2L18A 4Q3DA 2O52A 3T6KA 3KELA 2Q3BA 3LK7A 1BAPA 1PCXA 4Z5XA 3CRZA 2F17A 1NN0A 1KKUA 3KQOA 3WLTA 5C2JB 1Z73A 1REQA 3E82A 3PNQA 2HUNA 1L8OA 2F67A 4Y6SA 4YP0A 1G7SA 3VKWA 5KTMA 1C5KA 1PFWA 2I2XB 4MS4A 3ZHSA 3KTOA 3VU9A 3KP1A 3TJRA 3NONA 4XSHA 2V7VA 3Q6MA 1ZH2A 1PR1A 5IMSA 3B1XA 4KC0A 1RWKA 3ILXA 3TZLA 1QHXA 2BFNA 3PHJA 4GAEA 4BBPA 1HH4A 3JASA 4CG2A 4F93B 2I66A 1Z4QA 2CXSA 1WOYA 2QMOA 1NSTA 5GQSA 4AJ4A 3IDAA 1WCV1 1ZMBA 2O3RA 1PGPA 3VTFA 2BFMA 1A04A 3GD5A 4QPNA 4BFCA 4TWIA 3ABIA 2VPYA 5EHQA 1IVYA 2OR3A 1Y4AE 2FQYA 2VJLA 4BFXA 4DLUA 1I6WA 4INOA 3L5OA 2JGJA 1Q57A 1M2OA 1XK7A 3OE5A 4H27A 2EEZA 3WFZA 1SPXA 4UOZA 4YO7A 2TRSB 5FOSA 2Z2IA 1DX6A 1AHPA 1PJ2A 1TC1A 2B1QA 3M81A 3KV3O 2W2NA 1XN4A 1DX9A 1YQWA 2A5DA 4F4UA 1C0PA 5DB4A 4CV1A 4JGIA 4GWKA 5ALPA 3IS3A 1F3LA 4NH0A 2QXUA 1V7ZA 5TGZA 1EDDA 5BQ3A 3HKEA 2LCQA 1TAHA 4EVIA 3WSVA 4AYXA 4LWPA 4A73A 3FBTA 5JQGB 1F51E 3CEMA 4Y1EA 1BDHA 3NGXA 1S8OA 1EEHA 4NENA 3VO9A 3RYCA 1KOLA 1JFTA 4LN1A 2X8WA 1ZD2P 3BGDA 2Z08A 1TVMA 5P21A 5JAHA 4TVOA 1KI2A 1WW8A 2C58A 3ZDQA 1FA9A 5K05A 1EXVA 2QVGA 1S4QA 2ZAOA 3NAZA 1YB7A 4KXVA 1SRRA 3LXXA 4MV8A 4K81B 4QA9A 5COAA 5AI0A 3LUDA 1UQUA 3D4LA 3CX4A 3EPHA 4F06A 3OOSA 1HI9A 4HDOB 2CE2X 4QG3A 3F5FA 3LTEA 1UKEA 1FEZA 1TLFA 1YZQA 4K5QA 3FOZA 4RPJA 3ZJ5A 5JCJD 2X23A 4AZ0B 2YN4A 2IUFA 4CUKA 1AZLA 1GU7A 1T5HX 1DWOA 2I6XA 4KWEA 4PCVA 5EESA 5EYPB 5K3CA 4GF5A 4AJHA 1JEEA 4JITA 2RHHA 3BHIA 2FVXA 4H0NA 4KOEC 1KTIA 3C45A 1G8FA 3PCXA 4J0CA 2AE2A 2C2YA 2AJTA 2HDWA 3KDAA 4KQFA 5HGJA 5BYKA 3TAHA 3B36A 2Q4BA 1XX6A 5D86A 1SKBA 1M8GA 2JFBA 4R9RA 4J1TA 4YT4A 1A1SA 1BOOA 3NHWA 1SU4A 3MWGA 5DH9A 1W47A 4PAOA 1O0CA 1PT8A 4TT3A 9LDBA 1H6BA 2W2PA 3CKMA 3EQZA 3OMXA 6AT1A 4C0JA 5CT5A 4I5IA 3D8HA 2H4FA 3VR6H 5DNCA 1TUBA 1P45A 4EMSA 4MJXA 1IUOA 5CLQA 1OWLA 5CX1A 3SG0A 3GCDA 1E1YA 3P9ZA 5GADl 4H16A 5EJ4A 1FU7A 5EP4A 4AQYB 1TK3A 5FOTA 2PV0A 1Y7PA 4IWNA 4CNQA 1VLHA 3PJDA 5COQA 4BCCA 5LXTF 1B3BA 5KQGA 3JW8A 5CA0A 1UFQA 3PDCA 3OQMA 1IM8A 4JLNA 3JQFA 1JBKA 2CNLA 3W9UA 1T4CB 3QEAZ 4QOSA 1BRTA 5BUQA 4HEA6 2HO5A 2VIIA 3CXUA 4ARZB 1QVWA 4M76B 2NV0A 3AEYA 4RK6A 2HSWA 1ODJA 3TW0A 5IHXA 3UWMA 2VH5R 1E1KA 1UPTA 4CR7A 1C14A 1KIAA 1N5MA 1ZC3A 1XXHB 3MT8A 1C8VB 4HNUA 4RJ2A 5JTTA 1HTBA 1U3VA 4GLFA 2XQFA 2P6NA 4UM9B 1ABBA 1UMBA 1U3UA 1GU1A 2HXGA 4DLXA 2J5QA 3ZIAD 4JLVA 1X80A 2J33A 1G291 3HL4A 5AVVA 4ONEA 3HFJA 1PLLA 3C3CA 3VV2A 1P2FA 3HS3A 5BR1A 4YMSA 1KJNA 1K3UB 2FDRA 3WFIA 1ZL0A 2G76A 2ZI7A 3ZHZA 3MTEA 3C5WP 1DG3A 2PLAA 2Q46A 4TTTS 3PXDA 2HPZA 4I4CA 3SBEA 2BSXA 5HKKD 3OIVA 4JU8A 4HAXA 5AM3A 1Y3DE 4CRWB 3P2YA 1Q92A 2F8MA 3WL6A 1KS2A 4CFSA 1C9JA 1VOTA 1V5WA 2F3TA 2LE0A 5HRAA 3M4YA 3SDZA 2CHUA 4KE6A 5MN6A 5J3JA 2IJGX 3UV3A 4G67A 1OJ7A 2YWFA 4LS3A 1NJ6A 1IHOA 2TYSB 2EP5A 3ROFA 4YHHB 3WLLA 2PKQP 3WY9A 1QFZA 3KIPA 2A35A 2HHJA 1UEJA 1V71A 1TQDA 2NGRA 3B9BA 1P2UA 3VO1A 1XMQB 4YRKA 1Z0AA 3P94A 2HA7A 1GM5A 3LUKA 2OBLA 1IB0A 2QRUA 3OFKA 2G25A 4G81A 1BFKA 5AVOA 2R9VA 3AUTA 4OREX 3WNZA 5LP6C 2J87A 2PUWA 2ZS7A 1G8SA 4DC0A 1VL1A 2JVIA 1PT9A 4BJ1A 4HNVA 5L3QA 3SXUA 1SEVA 1FNDA 1QG4A 2B9EA 1QHNA 2FEOA 5DM4A 1Y80A 1J1ZA 1RI4A 3E1KA 4M55A 3KSUA 4XGRA 2NUTA 5C34B 1IYZA 2D54A 4TSRA 3NHLA 4JVMA 1BXRB 2LZ0A 2GN8A 2CB9A 4G1MB 1WLSA 1F20A 2D1QA 3HA7A 4B7UA 1N3IA 1C8BA 3ZE6A 1KDRA 1PDOA 2VF4X 2NV2B 3STWA 4AZTA 2REXB 1ZM7A 5HF8A 1C4XA 1P3Y1 1U2GA 1SU7A 2GPBA 2J9YB 2P8JA 3DJFA 5GJWC 3WC4A 4JV5B 3CEAA 4XIGS 4X7RA 5IANA 3SIRA 1NQWA 3NNSA 4DA8A 4B48A 4U2KA 4F2WA 3ICPA 4HL6A 9GPBA 1A7AA 1T8WA 2VJMB 4YUAA 1BDBA 1RLOA 1DTWA 1ZINA 3B2NA 1HETA 1ECFA 2ZTLA 1GQQA 2QKYA 3D2CA 3FX2A 3QMPA 1T1GA 3L01A 4KV9A 4C4XA 1SELA 2HY7A 2NNLD 2WU4A 1F2TB 3FYDA 2PVPA 4HDAA 4O6VA 4OB6A 3AUJB 3DNMA 4NL4H 3VSBA 4ZCMA 4OQLA 4D4IA 2E4VA 2FPPB 1AO0A 3F2IA 4YMGA 1VIMA 3VBEA 1Y7HA 3UWOA 5TVGA 2J3KA 3TM5A 5FTLA 5JAOA 2OCPA 1RHRA 3OX4A 2XYQA 4FWIB 1ARZA 2O5RA 3L1UA 2VAWA 4V0QA 1SXGA 3EJWA 1ZNQO 5CK5A 2XGSA 1CG6A 2QE6A 3A0RB 3QUCA 4S1WA 1D2GA 4DNQA 3KZXA 1SIOA 1KY2A 3KOYA 4RWEA 5HJ5A 3O3NB 2O2JA 2OZEA 3H75A 4WDRA 1JALA 2BMAA 1A8QA 1XRJA 3WRYA 1IHPA 3FTEA 3NMUF 2PZBA 1KEEB 3B7WA 5CH8A 1JH9A 2RHCA 1XVUA 2QL9A 2YV3A 3DOHA 4D25A 1Y1QA 1ZNYA 2OXIA 2F00A 3N2LA 3WP1B 1U0SY 3FOFC 5ALUA 2PS3A 4TQ9A 1FB5A 3DWEX 2XAAA 3JQ9C 3NJ8A 4XGQA 5E6UB 3CZ5A 2WR8A 4TVSA 3Q72A 1L3CA 3K31A 3N28A 5BNWA 3KOWA 3OLXA 4V02A 4UOQA 3EW7A 4L78A 5LYJF 1X8LA 3L0CA 1OI3A 3DEHA 5DTIA 3KSMA 4GPD1 5AESA 1V6AA 4ZVNA 1AZWA 1MENA 2GAOA 3VKHA 5CCXA 2NOAA 2F1KA 5TNXA 1C1XA 3LUCA 4ML3A 4HGRA 2A86A 2J3EA 2YY6A 3QYPA 2OBBA 1ACJA 1ZHHA 2JD1A 5L3ZA 5LD2C 1OH8A 4DLWA 2XMZA 1TMOA 3AI3A 2ODBA 2A59A 1KO7A 2NZWA 3E1GA 3IE2A 3LXUX 4U0KA 1MVOA 1UK9A 4DCSA 1DBRA 1BTOA 3EMKA 3FI0A 2WJHA 1WDTA 2VJCA 3CQ9A 4MMZB 3RRXA 4DTIA 4N7RA 5DCLA 1L5HA 2LP4Y 5CDUA 2PDAA 2NTVA 3DVAB 4BKQA 2P0AA 3EXHA 1UT5A 4EJSC 2R8RA 1EWYA 1Z7EA 3R0XA 3H5WA 3ANMA 5A4AA 2PAAA 3LYAA 4WNAA 2BKVA 4YJ2B 3ROZA 1K7YA 1IRIA 2BISA 1WW2A 3NXSA 3CEJA 2B8WA 4FEGA 4G41A 3EXIA 3IMGA 3LC1O 4PIMA 4WK4B 4YP7A 1BD3A 3U2QA 5DSZA 1SCAA 2R8PA 4ZO8A 4HUQB 1J8VA 1O6CA 2BAGA 5AD1A 2P6RA 1ZICA 2YZMA 1E4EA 1RRFA 3IBFA 1E1CA 2CCJA 5F3RA 1GLVA 4B81A 5I9SA 1A9OA 3QELA 4JX9A 5LLSA 1XPOA 4TZ6A 2HJVA 2R48A 4ZVOA 5ES3A 3C6ZA 1Z4JA 1GSOA 4JOCA 3DEKA 5KS2A 1PJLA 1PJ8A 5CFNA 2XODA 3ODGA 4A26A 3VSCA 3TL2A 1S9HA 3IT3A 2AGVA 5FTWA 4UDNA 5IG2A 3RF7A 1D7OA 3IHTA 1FRNA 3ZCRA 4ZZ3A 4Y2SA 4ZAVA 5AWFC 1KRHA 2H4HA 4ATNA 3M5PA 3K32A 1FUYB 2Q1XA 5EEHA 4FHEA 2O2EA 3O93A 4QUHA 5A3SA 4XI9A 2R2GA 3JYNA 5A9TA 4DV0B 2GPSA 2WPNA 3BJEA 1C4KA 1TZJA 3HRKA 1Z5NA 2VRNA 2TMKA 2WZCA 4GZLA 2Q7OE 1KJQA 1M72A 1IVNA 3TZKA 5KOHA 3I6ZA 3BXHA 4H2DA 4XOUA 2W6NA 1WULS 1X7WA 1BQ3A 1G3RA 3GYGA 1ZITA 4QQFA 5JECA 1P1CA 3LWBA 5I7HA 2PNFA 2ZWOA 2WJ6A 1X9HA 4N4AA 2Z0MA 1VM6A 4GXQA 2WB4A 4M0CA 5IF3A 1O5TA 2VO1A 1DRJA 1OT3A 2IXDA 4KCGA 4GXTA 1JPNA 1KDTA 1FBNA 2FB9A 4O4JB 5H59A 4HZUA 1GFWA 4N3NA 4XEHA 5AJYA 2CV0A 4IQGA 1W30A 4IDFA 3TRIA 2FWBA 4FW9A 3CG0A 1I2AA 4L5YA 2I29A 4QLAA 4MVJG 1ZOOA 2NYRA 2AQKA 1CY0A 2MYUA 4HWKA 3Q6IA 1ZK4A 1M5TA 2RB5A 4HH1A 4G8CA 4YFVA 5B1YA 1I2DA 2XV1A 1QO0A 2C2BA 1UUFA 4YJ3F 4B47A 1DAEA 2VPIA 3C1AA 1SN7A 1FSFA 1PX2A 1QHYA 2VHQA 3BRWA 3DWFA 4RVUA 4W8GA 1AJEA 3N2GA 4FKZA 5I4KA 3MWFA 2JFYA 2NQ2C 3KUDA 3EGDB 2TMGA 4MAFA 1JECA 3BK7A 3QPCA 5H4HA 4ZWNA 2WD7B 1VBMA 1P31A 1MPXA 1U6KA 2I1WA 4CM5A 3KOMA 3V8PA 4PX3A 3V9AA 4QPCA 3H5RA 5E3HA 4S0ZA 2INGX 3GMIA 1DLIA 2I6FA 3GUVA 4J03A 4BRWA 2BGJA 3W04A 4GD3Q 1OB5A 1Y6QA 5B5SA 4L6AA 1QDEA 1M34B 1AE1A 1SD1A 3H9EO 1JDBB 2JKZA 3WGVA 2CJXA 5KTNA 1X8JA 2LWIA 4JOSA 4P86A 4PR3A 3AINA 3ZWCA 5F1OA 5DYYA 2V5AA 1GQFA 4RK1A 5HKOA 3GHYA 3TW4A 4MS3B 4AURA 3LE8A 4BZWA 1UJBA 1MX9A 3DNFA 3PUHA 3AESB 3OLWA 2OHJA 3DOIA 3WYEA 3T7SA 5JALA 3TTVA 3I1JA 1WSBA 3GLTA 2QSZA 1ESNA 1SVIA 121PA 2P11A 3C7DB 3QI2A 5IC6A 3RVOA 3WVNA 3PE4A 3ES9A 1MMFB 4I1OA 3GWGA 3VRHA 1XCJA 3WG9A 1I0IA 3B38A 2IYZA 1YZKA 2RKBA 1N2ZA 1XP8A 1UBTS 1NBEA 2C83A 4RIEA 5CU7A 4E5YA 3M82A 4QYWA 5C7OO 3L49A 4Q9DA 4PZCA 1E9VA 3QM1A 4H3HB 4RY9A 4GX1A 2AJ8A 1KO8A 4D98A 2Q3LA 1AKUA 4MRAA 5TB5A 5CP8A 1QQ6A 4UVGA 5AKHA 3DE1X 4A6DA 3IYLW 2C00A 1IPFA 3TCKA 1XMVA 4Y2JA 2GBLC 1YCDA 3I12A 4CIAA 1NBIA 4XKJA 3HB9A 2PKRA 4XWWA 1WS6A 1WAMA 1B43A 2AN1A 3COVA 1AF7A 3TQIA 3ZZNA 3ESZA 4Q4CA 3HABA 4YX9A 4C0KA 4WA8A 3SIXA 2NPOA 1Z39A 2QG9A 5I9TA 4EFNA 1JHZA 3OQJA 2P5SA 1DUVG 3JALB 4JWTA 2NW6A 4UHBA 4Y9RA 4QO7A 4BS9A 3A4IA 2E9SA 4ER5A 2BLLA 2PBLA 1GOTA 1P4GA 2W70A 4ZRDA 2JGMA 1OA1A 2ATCA 4KBFA 4ZHQB 3KKZA 1L4UA 1N4AA 3ILYA 3GQVA 2WM8A 5IVKA 1QRRA 2EXXA 1LI7A 3G5AA 1NM5A 1WKVA 2IVZA 4HEA1 4YDSA 3H42B 4O4IA 4GUDA 2R6FA 4YQZA 2Z6QA 3GFFA 1QRUA 2D1RA 4YGXB 4QVIA 4EG6A 2QTCA 3G7SA 3P26A 3QXSA 3JQ8B 1A8SA 1OHHD 1EJ6A 1YULA 1Z5WA 4TYQA 3UB4A 4L28A 3CVXA 4OHKA 2NADA 1A4IA 1YZGA 1ZIYA 4PZPA 3AZPA 16PKA 3NM4A 1SQ5A 3MLEA 3ICOA 1DG9A 3C85A 4AP5A 5FUQA 1M7BA 1RP7A 2AC2A 2XGGA 2WINI 3MWEA 1NL3A 4FEAA 1GGHA 2F6RA 3CSSA 4KLCA 4JBWA 1HQDA 4AZWA 4WVFA 4D8TA 4UE6A 1IOWA 1T1RA 3FROA 3KXIA 3QQ5A 4R8LA 3U1TA 3WNBA 5LWHA 4IOKA 4LKRA 2XJ9A 1R6TA 3FDXA 2ERXA 1F8GA 3H1PA 2BKEA 3AKDA 1L0BA 2V45A 3DLPX 1W75A 1B42A 2XMCA 2O0JA 5KKAA 3RNLA 1V1MA 3DE6X 1H4SA 2XVYA 3W9SA 5IDWA 2FY8A 2J7PD 4NJEB 2HIAA 3FPCA 5IFKA 4XJSA 1VLJA 3FSGA 1Z6AA 1Q7CA 1M6VB 1QTRA 5EMKA 4WZAA 2DR3A 1UDAA 3QPDA 4TV9B 3ESAA 2DKFA 1F8UA 3OQ6A 4XDHA 3STTA 5JROA 1CNEA 3OEEA 3OMWA 4OTZA 4H1WA 4NNJA 1KH2A 5HIMA 2GLXA 3O03A 3DR5A 1NV8A 3JQBA 4RTLA 4OFZA 3MLAA 1SMKA 4ZA2A 1ESDA 1NW6A 5TPZD 3GK3A 4PSAA 4TTRA 5FUWA 1IB6A 1J42A 2QRVA 1O97D 1BEZA 3K0HA 4RA9B 1E3WA 1RIFA 3DUFA 4AL4A 1PT5A 1RMTA 1DKMA 1PK7A 3DO6A 3FHOA 3QEMB 1KWGA 2FWAA 4P34A 2WM9B 5JSQA 3HJRA 3ZHQA 2Y1XA 4FGLA 5A4MS 1WRBA 1HXHA 2EJVA 3MJFA 2QNRA 3NBMA 3DVQX 4NCHA 5A6VA 5BSMA 3N70A 1ODIA 3DTYA 3HPRA 1Q44A 3ZJUA 4ZEVA 2Q5LA 1NNI1 2WILA 1VMIA 4GOMD 3B8HA 4L5JA 3GEHA 3ELYA 1G1AA 3GC6A 3TLKA 3LWNA 2C1ZA 1TM1E 2HV9A 3O0DA 3L7JA 2IYOA 3T7TA 1JJAA 3PKIA 4I7EA 3LQRA 4HCJA 3V46A 2I80A 5E8RA 4EB8A 5IVPA 3T5PA 2OAP1 5L8VA 2O3JA 5CFOA 3MILA 1W5AA 2QD3A 1BGVA 2VR1A 4ZO7A 1N33B 1XAIA 2H0AA 1WKBA 2CKDA 2WIDA 4IKEA 2WQ6A 1K2WA 1V16A 4QXQA 4LOLA 1UP4A 4K3VA 4KIJA 4RDIA 5CB4A 2FRDC 1NUQA 3JQCA 2GFHA 2O7VA 4DV5B 2EX4A 3R3YA 1Z13A 1COWD 1IOVA 4K9QA 2RKWA 2X9NA 4IWXA 2EKBA 2O2GA 4YC7A 3BQ9A 3E27A 3JPYA 1TQ2A 2IYXA 1HUQA 4F46A 5K8CA 1SCBA 4BGEA 3W77A 3EW9A 2BRUC 4WACA 4LVCA 4I1IA 1CTQA 4GNKA 1UT8A 3E1SA 4PINA 3GT3A 3ND7A 4QOEA 2XF8A 5BT8A 2F3QA 4HY3A 5JYDA 1WDWB 4OL0A 3F46A 4NV1A 2OWDA 4KXNA 1II8B 1R9MA 3E3MA 1IOZA 3SSAA 5HZGA 2DWOA 1Q0PA 1CUXA 2DFTA 1RI2A 2G3YA 1SOAA 1CY1A 2GCIA 2PZKA 3C48A 3LQQA 1HQYE 3EEFA 4L02A 4TVBA 3V80A 3WZMA 3MQFA 2BFWA 1Y6FA 1A96A 3VPFA 1OBOA 4IIVA 3WAJA 2FK8A 1Z6ZA 1ORIA 3MCVA 1RXIA 2GK3A 3B1VA 3OIDA 4FIZA 4GBGA 5EXDA 3EASA 1UDCA 1O95C 1QGED 1Z2AA 3MM4A 2JD0A 1QR6A 4C87A 1KVTA 5ISMA 4WFKA 1LBSA 4L8WB 1P8AA 4PTZA 5KIAA 2UZAA 3AY0A 3WDLA 1T9GS 4KE7A 4GXRA 4D4MA 5BV7A 4N0MA 1HEIA 1BS1A 1FP7A 2B0JA 2I6QA 2IW1A 4RS3A 4R3WA 5GV8A 1XYYA 4TTAA 3OZCA 1PJAA 4AMYA 2H2AA 5DKFA 5H81A 5FFMA 5ED0A 2QI9C 4D9KA 1XVTA 3W5JA 3K71B 1I7LA 4C0WA 4CNBA 3CLTD 1JTFA 1SKMA 3K4HA 4QDOA 4BCDA 4J8PA 1NNEA 3RBZA 3JD1A 2QZ4A 1G2OA 2A0KA 4ZANA 4CWAA 3T9EA 4GI5A 3DLCA 2VN8A 4WFJA 3S70A 4DJAA 3WWZA 2FZWA 3G85A 5EJEA 5JQGA 3MLBA 2FW7A 2GZ2A 5FUVA 2XNDA 4BMYA 4BVAA 4EYGA 3AFHA 4OHPA 4IJ5A 5F7JA 5HF9A 3S4YA 1YQGA 1UINA 2X86A 4AG6A 3A4TA 4YAGA 5KDDA 1F7UA 1GRCA 2JLXA 5BWMA 3F2VA 2DP4E 2CXTA 3INGA 3TTTA 4OMCA 1JAZA 5KX5B 4G84A 3ESDA 4M1EA 4DBZA 1NQTA 1L7VC 2OPBA 4PQRA 1JMVA 1P8JA 4US0R 1BJRE 2PXXA 4GOND 3AV0B 3TOZA 1R15A 1UBEA 2CNOA 3T5DA 5A0FA 1T0PA 4AZ0A 2VPZA 5JCXA 1TA4A 2XX3A 3T7KA 3C8ZA 2H9IA 4MW0A 1NWCA 3S7ZA 5EYPA 2ZYSA 3IRUA 1HFJA 5CX4A 3HNOA 5D85A 4EWLA 3NTUA 9ABPA 3U3MA 3EMDA 4BCBA 5DHQA 2HN9A 3JQ7B 4Y2QA 4EPRA 3N6VA 1B2LA 4DRYA 4LC9A 1FQWA 1GCGA 2FPRA 3EZLA 1OFGA 1GD1O 2XA1A 4TVKA 3THRA 4XQCA 5HJ7A 4GBED 5JS2A 2O6LA 5IAAA 2J6HA 4ZEMA 1G1MA 1I4LD 3AUYA 4MV5A 2DUJA 5GMOA 4LXHA 1D2RA 2H5EA 2V0CA 1PGOA 4H0FA 1G42A 2VPWA 2C4TA 3WISA 1EVEA 2JIZA 5HGXA 1Q11A 1UFOA 5FQNA 3CZPA 4JFRA 2X7HA 3A32A 2PMDA 4KZKA 2QPAA 3BF8A 1ECGA 2OP0A 4JLMA 4UDXX 5FKJA 4EG3A 4KQXA 4B84A 3TRFA 3WTCA 2G04A 3H2JA 2ILTA 1YBHA 1UAAA 1T9AA 3B7PA 3H16A 3ZY3A 4EUNA 4P7JA 2X19A 1U1CA 1V11B 4NKRA 4W9NC 1BYUA 3T4EA 1IXSB 1T4CA 1K4KA 4LQDA 3DXZA 5BSGA 4HB0A 4P4LA 2A0WA 3AR9A 5AI5A 3PTZA 3UH0A 4ARZA 2BFEB 3O3CA 4F2DA 2QORA 1NXSA 2NZJA 3PD0A 4NRDA 4PY2A 2BH2A 5FPPA 4RDXA 5CG1A 3SNHA 4LF6B 2X1LA 1XXHA 3RIMA 4E21A 3N8HA 3P9NA 4E6PA 2XKKA 1QNFA 5D6NA 1F5NA 1HNXB 3RKSA 1NA5A 1NP7A 1ZQ9A 3OWXA 3NXKA 5BR8B 1PJZA 1VGVA 3VH3A 4DC1A 4BV8A 3D4PA 4XEUA 4KTTE 1R64A 1OROA 4M99A 1NNUA 5E1DA 4CCWA 5D5HA 5K51A 2WZDA 3TKAA 4DG9A 1P75A 4BLWA 1CT9A 4XQ0A 1OB2A 1TGVA 1AKWA 1SB9A 1W581 1G3MA 2DY1A 3O94A 3KSAC 3PA6A 4M1ZA 3A9TA 2XB4A 4RLFA 5H70A 1D04A 1PFYA 2YV1A 3P7MA 1U8AA 1YMVA 3FMOB 4ZJZA 1E61A 4UEKA 1NVFA 2X42A 5BUZA 4P7GA 2G4CA 3OOJA 4BU1A 2YZ7A 2GLUA 2ZI6A 4TSFA 4EF6A 1FOEB 1N6RA 2ZAGA 1QVZA 4Z9BA 4ZMSA 4WESB 4O1MA 4YRIA 5KJ1A 3AKZA 1FFSA 4CLXA 4MV6A 5JZOA 3VPCA 5C9ZA 3M4XA 2WKWA 3D3WB 2HCFA 3KOZA 4UU1A 2PJDA 3D0OA 4U7GA 3F1KA 4OQFA 5FOQA 2WEKA 3KM0A 4W1SA 4HN2A 1KNQA 3KLOA 1ADJA 2OGSA 1OX4B 2BFOA 3TS1A 4PZEA 4COOA 1FTYA 1Y48E 3C4VA 4EFKA 4QSMA 3C5CA 2IL1A 2IXBA 4MVJA 1E9SA 1TM4E 2P5TB 4TV8F 2FTKE 1PNRA 3FOWA 1PR3A 2OFOA 2NNWB 3IPLA 3NHPA 3QPAA 4JBXA 3W4JA 2I65A 3CUYA 4UNQA 3BBLA 3HG7A 2RGGA 2GAAA 5GZ6A 1U94A 4Q82A 4EKIA 3NRCA 2E55A 2R4QA 4JLSA 3V1YA 2QTZA 3SIWA 3FF4A 1BXRA 5L3SB 1MO3A 3TMYA 1XLUA 3ABOB 2IGTA 1LF5A 1QZTA 3NDJA 4IRUB 4M6WB 3MHTA 3Q2IA 3ZHYA 4PZ9A 4HAYA 2J3DA 3KAKA 4RK0A 2BGTA 3KHUA 4Q3BA 1JE1A 4QUDA 5FHRA 1FRVA 4NCKA 1W34A 2W0SA 4Z4HA 2YRXA 3EG9B 1ODKA 1AD2A 4JSTA 2F8LA 4L0DA 1NTOA 1XMPA 3QSYA 2IX3A 2ZIEA 5DMXA 3U4QB 2AN5A 2VJMA 4INZA 4PLZA 3WL8A 3IVMA 1JF8A 2QM8A 3BWCA 3CS3A 3FYUB 3HADA 2QAGB 4H1VA 1M6WA 1F2TA 2QP4A 3VR1A 2ZLBA 4NBRA 5C3UA 5KYTA 1N2EA 1QZZA 2XNCA 2ZR8A 1HDXA 2FPPA 2UDPA 3BH6A