3ER6A

Crystal structure of a putative transcriptional regulator protein from vibrio parahaemolyticus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
192
structure length
192
Chain Sequence
KNLRVVALAPTGRYFASIISSLEILETAAEFAEFQGFMTHVVTPNNRPLIGRGGISVQPTAQWQSFDFTNILIIGSIGDPLESLDKIDPALFDWIRELHLKGSKIVAIDTGIFVVAKAGLLQQNKAVMHSYFAHLFGELFPEIMLMTEQKALIDGNVYLSSGPYSHSSVMLEIVEEYFGKHTRNLGNQFLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative transcriptional regulator protein from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
molecule keywords Putative transcriptional regulator protein
total genus 62
structure length 192
sequence length 192
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3er6A00
1VCMA 3F71A 4UZSA 3B3AA 1OX5A 3TTYA 3L3BA 1N57A 1T0BA 2VXOA 3EN0A 3CZ9A 4S0ZA 5SYAA 2ZUTA 1JDBC 1PDVA 1P80A 3PQ6A 1GPWB 1OX6A 3L18A 1KEEB 4LRUA 4N12A 4ENSA 3CNEA 4N0MA 4UCFA 1CS0B 2FEXA 2V4UA 4I2NA 2R1TA 4GE0A 3PQ2A 2ZUSA 2VDJA 1Q7RA 4PXYA 4AULA 3TQIA 4L8FA 4P5PA 4Y1FA 4WINA 4Y1RB 4BFLA 1C30B 4I4NA 3MIIA 3ZR4B 5BV2P 2YWJA 1GG9A 1GGFA 1T36B 1T3TA 1P7YA 4XLLA 1GPMA 1O1YA 1UCFA 2ZUWA 2R1TB 3PQ7A 2NV2B 4OFWA 1C3OB 4L8WB 4OGFA 2R1VA 3PQ8A 5JZOA 4ENTA 2R1UA 3P9SA 2XF2A 4L7QA 1M6VB 2W7TA 3PQ3A 3TTTA 2GHRA 1IPHA 1FYEA 1IZZA 1PV2A 3F5DA 3NOVA 3NVAA 2ISSD 4RKYA 4B2YA 4ENRA 3BHNA 1CF9A 3NOOA 4ZDJA 4B7AA 4AJ9A 1VHQA 3TTXA 2GK3A 2AB0A 3UMMA 1Q2UA 1K9VF 4HCJA 1I1QB 2VRNA 3FIJA 1I7QB 1KWGA 4UOZA 1J42A 1PDWA 5SY4A 3RHTA 3FSEA 1SY7A 3EJ6A 4R7GA 1P7ZA 3B36A 4Y0NA 4E08A 4UOQA 4ENWA 4Y1EA 2RK4A 3EWNA 4I46A 4OQ4A 4ADSG 1VCNA 2ABWA 3M3PA 3ZJ4A 2NV0A 1OX4B 4B31A 1CE8B 3GRAA 1L9XA 4MNTA 4P36A 4ENQA 1OI4A 3UK7A 1KXJA 3R76A 2VPIA 3SOZA 3NONA 3TTUA 2IUFA 4LGYA 4B5KA 5JZMA 4ZGGA 3TTSA 5IP5A 3OT1B 1I7SB 3N7TA 3CZAA 3D54D 2YWBA 1QVVA 2AD5A 2RK3A 2D7JA 4B40A 1JVNA 1WL8A 4ZDIA 3ER6A 4D1YA 4L95C 2WJZB 2YWDA 1QDLB 4QYTA 4OGGA 4BTEA 3OT1A 4AUNA 3EFEA 3UJNA 1FY2A 4Y1RA 3TTVA 5SY6A 4P34A 4ZDKA 1P81A 3MGKA 4P2GA 1PE0A 3CY6A 4ENVA 4RKWA 3BWEA 3L4EA 3TTWA 1KWKA 4MGHA 4AUEA 1QVZA 2R1VB 2YWCA 4P35A 1SOAA 5DFAA 3ZJ5A 4AUMA 4GE3A 2OR3A 4ENPA 3UOWA 1U9CA 3WFZA 3EZGA 3L7NA 4UNIA 3NORA 3R75A 3SF8A 4E5VA 3B38A 1QF7A 3NOQA 4L8YA 5SY9A 4K2HA 3P9RA 1OY1A 1QVWA 4JQSA 2VKTA 1P5FA 4QYXA 1G2IA 3VU3A 5K4AA 4ENUA 2ZUVA 3PQ4A 1IZYA 2H2WA 4GUDA 1ONSA 1KA9H 2RK6A 1GGJA 1GGEA 2ZUUA 3KKLA 1QWSA 2A9VA 3P9QA 4WXYB 3R74A 3CYFA 4BIMA 2LXNA 4Y1GA 1GGHA 3P9PA 4MTCA 1R9GA 3UGJA 1S1MA 4L78A 4OIFA 1OX4A 5LIRA 4OJYA 3SF8B 1VCOA 5E9AA 1BXRB 3PQ5A 1GGKA 1A9XB
chains in the Genus database with same CATH superfamily
2G5TA 4BFCA 3KR0A 2VT3A 1U3TA 1GPNA 4RPLA 1WW3A 2WHYA 3OCXA 1T2FA 5F21A 2OYSA 2O5EA 3LC2O 4QTZA 2V7XA 5HOQA 5EXPA 2RHTA 2X5OA 1Z4MA 4KPUB 1JUDA 5IC6A 5J3JA 4G37A 3N6XA 3VAYA 2NWQA 1OFUA 4NYIQ 1JIKA 3IEPA 2VAMA 3SHTA 5IN4A 2ZB7A 5K20A 2VDJA 4MWOA 3HQ4O 4N5DA 1AGYA 4E5PA 2VA8A 3MIIA 3AR8A 3C70A 2ZRNA 2W6ZA 4IH1A 2FQ1A 5DBGA 1RC1A 1VXOA 2WWIA 3CX8A 5JBNA 3EMKA 1TW3A 4M0EA 2I67A 4CGZA 3KZ1E 1L4KA 2OPHA 5KO2A 4OCZA 4H6VA 5DZSA 1LVUA 2GZ2A 3TTTA 4EX7A 2RHMA 3NVAA 2PKCA 4RKYA 3FDZB 4CT5A 2DERA 1Y5NA 1H0RA 1RI4A 2M6SA 1IBMB 3GT4A 2IXTA 1GUDA 1RVV1 2OYCA 3LC7O 1NJ6A 5LU8A 3GLHB 2FEWB 5BQ5A 3UMVA 3WA6A 3GCZA 3HI4A 4Q3DA 3OEWA 4P84A 4OHBA 4WZ6A 4AY2A 3KWJA 4W1PA 5AM5A 2H31A 1EFLA 3HEMA 3VR4D 4XKJA 1TKAA 1RP7A 1U3DA 5BUCA 2CJWA 4HZUB 4TYNA 2QPTA 1BVUA 2JVJA 3DQZA 3R24A 4KAXA 5DOVA 5JPCA 2OTCA 1X9HA 4WWHA 1DARA 1MA3A 1UT6A 2NZVG 3R76A 5HIIA 4ZI7A 3ER8A 1G5QA 1X7HA 1PJ4A 2Q2NA 4AY6A 1NW4A 2Y76A 4PRKA 4QTTB 2PMWB 3ISTA 3KSZO 1OH8A 3HV2A 4XWYA 2V96A 4ZXFA 2H4ZA 2C04A 1AM4D 1FU8A 1MJHA 1FXSA 5AUPB 3N7AA 3ZIAA 4NHEA 1PFVA 3OLVA 2WWVD 3OF5A 4BVGA 4DAOA 2PQMA 1N7GA 4PR3A 4DJTA 1YRHA 1HKUA 2GILA 4MV4A 1Z5WA 2X5XA 4K28A 3MJCA 2ZB4A 2JFGA 2W93A 1K27A 2F3RA 3ELWA 3OF3A 3PFFA 4TRMA 3R7FA 3KJZA 2HIAA 3M3HA 1HTTA 3P8ZA 3B9PA 1Z26A 3PKJA 1P7WA 2PTHA 4PSCA 3YASA 4L15A 5F7JA 5KTYA 2OXCA 3NI2A 1DELA 3I6MA 2F8TA 3SLRA 3T1QA 2JZCA 3WL6A 3SP1A 3VR6D 1HNXB 4WTOA 1A7JA 3O9VA 3BG5A 2L42A 2WYOA 4EZEA 3PX7A 2XNJA 4B3TB 1IIBA 3EYAA 4R51A 3KUDA 2PBRA 3BCHA 2BMEA 4IQGA 4ZMSA 5AICA 1RWOA 3OWHA 3PHHA 4Q4AA 4J29A 1PJBA 1U8FO 3VHXA 5KYNA 2IZZA 3L1HA 6YASA 4MUMA 3EXIA 4K6KA 4MS1B 2AR9A 3FGZA 1WIWA 3THWA 3VSBA 3GLGA 2QTHA 4QDJA 1A8IA 2P67A 2NMVA 5JPIA 1K6MA 2VJDA 4MDYA 3ZGXA 4ZYLA 2Q9CA 3FGPA 4GMGA 1QANA 3BXZA 5AVWA 1UXKA 3PXBA 1KI2A 5H1YA 4LRYA 3VR3D 1KAQA 2R4UA 2WINI 1M34E 2FN8A 3ILXA 4FXPA 4Q6WA 1KDOA 2D2FA 1ODKA 1K68A 5L45A 4CUZA 2VNKA 5LKRA 1PK9A 1RXUA 4PNEA 1E2JA 4JVOA 1DL5A 5HF5A 2E2WA 3QSGA 4RL4A 1HYGA 4EB6A 2ASEA 2P2GA 1NM5C 3CZRA 5A06A 2OB1A 1WU8A 5CCXA 2J6CA 4P5PA 4IVRA 2MMCA 4C2AA 4WLOA 4FUTA 3KAKA 1VJ5A 3BZBA 3NW9A 3QWBA 1I2MA 3KYCA 4MVJD 4D8VA 4DM3A 3PPWA 4Q47A 5BMVA 1FVFA 1J09A 1R8YA 2G9UA 2D06A 3SE0A 4UM9B 2XB6A 2BEVB 2R0QC 2F62A 1W94A 3G2NA 1FPQA 3P9SA 1UBTS 2NTVA 3M7IA 2FFHA 2G5CA 3PUKA 4KRFA 3TZCA 3PXDA 3QYFA 4QOFA 5ELXA 1LB1B 1FYWA 4JVLA 5FPSA 1JI0A 1G3QA 3KD3A 2PZGA 2WPNA 4IOKA 5ALHA 4L74A 3DNFA 4AN1A 2IBSA 1DKUA 1ZHHA 3BWBA 3U80A 3A9UA 5DSZA 2VNJA 4IVQA 3DD5A 4YJ2B 1BYUA 2TECE 2CV1A 1K7SN 1LBHA 1VKJA 5B7PA 4BKRA 1SGWA 5C7YA 2GBIA 1Z6PA 5E9QA 1W8DA 1BE1A 3EWNA 2YFYA 2CHQA 3GR6A 3HJBA 2ZIXA 2C9MA 5EVCA 3PVCA 1K3TA 3UATA 4BFXA 1F14A 4K5QA 4CR8A 1E1YA 3CRQA 2PZAA 3EUFA 4F4CA 2V4MA 3IOMA 4YBRA 1RI5A 2OBYA 1ZNXA 4RXTA 2XMBA 3SOZA 3MWJA 1Y6FA 2CE2X 2HNBA 5EE3A 1LI5A 1U0FA 2FRDC 2XQKA 3TI7A 5FV7A 2BDUA 4LJAA 4A16A 4NU8X 1DC7A 5FUQA 2NPOA 3U7RA 5IUJC 1C4XA 4NYJR 1KRXA 2AVNA 2PCJA 2DFTA 3DOHA 3FY4A 3QUBA 4JFRA 5FXMA 2OLEA 3PTZA 4ZJZA 3MUEA 3DC7A 4PM4A 1NG9A 1XDUA 2ZATA 2WJZB 3V8VA 1VMEA 3DBLB 3R9WA 2OQ2A 3ZHBA 1PSWA 4DR1B 5BMVF 4HN9A 2QSYA 4HGYA 5KAMA 4FMBB 4FYMA 4RF2A 1HEYA 3GAZA 2GN2A 3GOQA 3Q4GA 1CSEE 3TAXA 4ABYA 2Y27A 4P2GA 3TNFA 4K81B 4DBZA 1E3DA 4YR9A 1F6BA 1MPXA 1NW5A 1NAIA 5KVAA 1WABA 1XCBA 5B57C 3JALA 1KWKA 1CS4C 3A6EA 3OT4A 1AVTA 3I32A 5FA5A 4RUKA 2P4EA 4E5NA 3VYTB 1T43A 1WCXA 2PZ8A 3BEDA 4EAAA 3CUYA 1ILWA 1GPAA 1JB1A 2ZP1A 1RSZA 5ALUA 4OHOA 2WIKA 1T5DX 1EE1A 1LQTA 4HWTA 4KQGA 1KFJB 2BFDB 1Q1AA 4I1RA 1FUKA 4O1MA 3D6UA 2CMKA 2O2EA 4PRLA 1A9ZA 4OYLA 5LD2C 4LCEA 1OOEA 2GHTA 3I9NA 5D2CA 3FPEA 2JKVA 3AYZB 2G71A 4Q4AB 3BGDA 3VHXB 5ENDA 1LEHA 4MV6A 1GZUA 1MVOA 1ODIA 2A9VA 2AEFA 2F3SA 4XGIA 3ET4A 4Y30A 5ALOA 1W5AA 2FUG6 1CRPA 4YUXA 4FHDA 1VLHA 5IEJA 4ZOQI 4BUZA 1H9AA 1L1QA 1NMZA 3L0ZA 3OIGA 5F3RA 5FJIA 3LYAA 4RYDA 1BTOA 3W2IA 4ERXA 1OV4A 1H1LA 2G04A 3ANNA 3GYBA 1DIOB 4PPYA 2PO5A 4DJEC 5ALRA 2ATXA 4YMHA 2B5VA 2V74B 3FVVA 2QUAA 3MXTA 4QQRA 5LU9A 1JDTA 1M2HA 1H0HA 5BRJA 3BORA 1IJBA 1I9GA 1PEAA 2X0RA 4KR0A 2FB9A 3AL0C 3ZDRA 3A1SA 1YOVB 3U5ZB 2O8FA 3D7MA 4BFLA 3G6KA 4HDCA 2BBTA 5L6LB 1C30B 2Q0HA 1NW7A 1HYBA 3F6CA 1TL7C 1CUEA 3I73A 1VDZA 4OB7A 2OBMA 4UVGA 4WADA 1O0SA 2C9ZA 3HCAA 4A2PA 3ZD9A 3FF4A 3W5DA 4W6QA 1SO8A 2C5HA 2D3WA 2YV4A 3JSAA 4Z4GA 1UM9B 4M21A 3L9XA 4C06A 1E94E 1XAIA 3GUUA 3IVCA 2I4TA 1GU7A 1GN8A 3BGIA 5L7WA 4AMZA 2ZZNA 3AEQB 3QFFA 3NHPA 1FLNA 4DDHA 1NI3A 5CDFE 3ZD7A 3H4IA 1S96A 1XQ1A 3IKMB 2AEMA 4HLUC 4B7AA 4E5DA 1J00A 3A3NA 3DL4A 4KQ6A 5AR1A 1OA0A 1X6VA 2QXYA 5K0GA 1P7VA 1S1CA 2GGSA 1F0NA 1QTNA 3H5VA 1KVUA 2DTDA 4CKCA 4E31A 4ZYTA 2ZBRA 2NO4A 3N8HA 4HVTA 1P18A 2IIQA 4QXOA 2NVOA 3IOBA 1MP0A 3SSOA 3WDKA 4EFDA 5G2OA 1R5OA 1JDSA 2PXHA 2ZWAA 3SM9A 3V9AA 2XUOA 1NBEA 2HXYA 4GYJA 4KLRA 2P6RA 5AXDA 1CQIB 3UPTA 2QAGA 2C9BA 2EKLA 2IHBA 4X7MA 1IXKA 3TTUA 4XCVA 1BH6A 3ONWA 1FSGA 5GOTA 2V5VA 3NIBA 3GJZA 3MC1A 4AZWA 5WRFA 3NDPA 1E0KA 3E0QA 3G23A 5FPQA 3H6GA 1VM6A 3NHLA 4HEJA 4Z4IA 3CW9A 1Y5IA 1T4DA 2CEKA 1N9GB 3HB1A 1IWBB 1HSOA 4GECA 5CK4A 2B2CA 5DEIA 3UMGA 3F4LA 2DB3A 2VQDA 2Z30A 2FUKA 2DQ4A 3K3PA 4OAOA 5KX5B 2YMPA 2AXNA 3U1TA 4I19A 3B52X 1II8B 1EUCA 3SSNA 1T9CA 1YZHA 4U7JA 3EY9A 4FZ3A 3ZUGA 2JBAA 2Y92A 3FAZA 4IJ5A 4J43A 4G67A 3RH0A 3WRVA 2WJWA 2AJLI 4JOSA 2IEAA 5KHAA 3AUSA 5L4NA 4IIUA 3GLGB 3IELA 1ZM7A 4ME6A 4YAEA 1ZGJA 1BGWA 1UFRA 4Y6LA 4A7PA 3E5MA 3PD1A 2ZJZA 3IUEA 3EH2A 3DYIA 1XO1A 3E8XA 1YR6A 2WHEA 2ZJ8A 3AYXB 5B7GA 4C6SA 1DAKA 1TQ4A 5AM1A 4BFUA 5JTUA 5G3ZA 1RD4A 1XT6A 5HDQA 3D6HA 3KU4A 4C2BA 5HE8A 5KTTA 3I8OA 3OJ0A 4LZNA 2XTJA 1R6BX 3W2FA 4KYUA 2E1RA 5JT1A 1JSRA 1HE2A 2V7PA 4MQFB 5JYEA 1K89A 1G8JA 1H85A 1NLYA 4I1IA 1R6XA 1ISJA 1RMQA 4IMPA 4Q7LA 1TI7A 1D8TA 4B83A 5IULC 3KZOA 5ALZA 2UUAB 1GYPA 3TM5A 5H82A 3AEUB 4D9NA 1MB9A 3D8TA 5AVQA 5DLPA 4EHIA 3ZH9B 1KZ9A 1RWNA 1VE9A 1UZUA 4IBOA 4IV5A 3UAXA 1EVQA 3CUKA 3K05A 1U31A 1YI0A 4NAUA 2F7SA 3LH5A 2I9KA 2C82A 1Z0UA 4US0R 3GT7A 1U7UA 1MQ9A 2I03A 3THYA 2O8VA 3CZMA 1Y6QA 2PUCA 1TTQB 1WRBA 4EP1A 5EESA 2GJSA 3G8BA 2CLHB 5FFNA 4GMKA 4WD3A 1A9PA 4D6PA 4KG7A 3DE1X 1QGDA 1GG9A 4DCMA 1ZN7A 1S89A 1GPMA 3B6MA 1J90A 1WCYA 4N7JA 3SNHA 3ESZA 4QHTA 4E1VA 3GMDA 4LPKA 5GZ6A 1UWKA 2BN4A 4OGFA 1D03A 2FPPB 4L07A 4WFKA 4AURA 3TW4A 2AOTA 5LMNB 3D0QA 4Y0AA 5LXTB 3TUIC 4BLPA 2PUHA 2OV6A 3USZA 4E0BA 2B7BA 2QM0A 3HBJA 2ZYHA 4FYVA 1IH8A 4QQ8A 4TS1A 5ALDA 2GLUA 4I1PA 1RBMA 4OMCA 3PEVA 5A02A 1N9ZA 5HX7A 2GK3A 1XSEA 2LKDA 4BC0A 4YQEA 3EW9A 2C2BA 1DAPA 4V3CA 4E5YA 3V4LA 1X39A 2HSGA 1GA1A 4D3SA 2VK8A 2JGKA 2NQ2C 3F4BA 3FDZA 2QN7A 3WE7A 3EAFA 3UMCA 4G5YA 4B3GA 4TTAA 3WGGA 3QHQA 2FXVA 5JAUA 3DLBA 1DNPA 3EGXB 3AF4A 2YICA 5JRZA 1RPJA 5D7NA 4L2IA 2K2QB 1XEWY 4ZANA 2X19A 3EH1A 1E63A 2VPIA 2Y99A 3OAAA 3OPYB 3RVNA 4CCAA 4EYQA 4I8DA 4HATA 4J3JA 2IXGA 1KMNA 4WNIA 2JGMA 1XROA 3E8SA 2C5EA 3CWQA 1NVUQ 1YSCA 2XHEA 3MFQA 4GHWA 5DX1A 3S2FA 4F11A 3QPCA 4UEKA 3K8OE 2BMVA 3PXCX 3RU7A 3QXHA 3WA7A 2CVZA 5DLQC 3B1JA 3G6WA 4K6MA 4BFYA 1Z6XA 3O92A 1OJLA 4K40A 2JFWA 4OQQA 4URFA 1YIAA 7ABPA 3RF6A 1ULHA 5EZQA 2VF7A 5KYVA 4UKDA 4QOHA 3WWDA 4J76A 2WSLA 2G0AA 1HTWA 3CX3A 4KR9A 3AI1A 4RTPA 1YUBA 3JY6A 5ER6A 2YRFA 3A1UA 1QRRA 1R5BA 1OD6A 4ND8B 2YL2A 5EMJA 2HQOA 3GA0A 1WB6A 1JLKA 2NUAB 2XCUA 1ZI9A 2XRMA 2P3OA 1H1LB 5GAJA 3GLFA 3A2KA 5TY0A 2HK6A 1IN8A 2VRWA 5GONF 2ZRIA 4M4SA 3AWDA 3H2SA 1U9ZA 2HXGA 2JL1A 5DO9A 2WK1A 1XD8A 2RBGA 2Y1DA 3ZW7A 5IDQA 2IXBA 2Q5OA 1KH1A 4URXR 1IZYA 2DT5A 3CJTA 3SR4A 5HZHA 2EP5A 1DKQA 1YB6A 3WAGA 3CYFA 4OMUA 2FSIA 3O3MB 3KFLA 3N1UA 2DHCA 1M75A 4Q9HA 2HZ7A 4XX0B 1QFYA 3IILA 2A1TR 1PZEA 3II6X 1QZTA 1OAAA 3K0KA 4NZYA 4RK7A 1CC1S 3LBYA 4PYRA 1EFAA 2C5FA 2FSFA 1XELA 2OM2A 3JWHA 3LBIA 4JBIA 4KOAA 2XVAA 2PMCA 2CFRA 2CSUA 4KO3S 5ERGB 3V1LA 4XARA 5BY2A 5IAOA 2H54A 1EVIA 4F2DA 2BGNA 1FFSA 3B3FA 3HNRA 1KU0A 2BV3A 3QF4A 5DNEA 4JV5B 1UJ6A 1V11A 2J0UB 2QL7A 1Y34E 4OAPA 2IEBA 3TZ6A 4ZHQF 2ZWMA 4S2UA 3ORRA 1BMQA 4JT9A 2DCUA 2PKQP 1TC1A 3GH3A 1LDGA 3I4FA 1IULA 3QM1A 2VHJA 5BT8A 4UAGA 3KBBA 4PWZA 1WW2A 4OQMA 3W8NA 2XCOA 3STVA 5GONA 1NC3A 3DEFA 5DE3A 4JZYA 1QHEA 3KD2A 1KEKA 3FDXA 2GNOA 1YNOA 2Q6VA 2O5CA 4DLSA 4HDOB 2AR0A 4EY4A 1ISRA 4ZQEA 5DM4A 1DIBA 1Q1GA 4RSRA 4CV3A 3LCVB 3F7NA 4LRSB 4CKEB 3LP8A 2EGHA 2ZIXB 1AKEA 1R10A 2HN9A 2R6CA 2VEDA 3I2IA 3LHFA 1ADBA 3PRJA 3QYPA 4OSEA 5HS4A 3I1YA 5K0CA 3CNNA 1F2DA 1P7ZA 3DO8A 4O25A 4PLWA 5FL7A 1S3SA 4FMCB 5BSRA 4Y9TA 3VM6A 3PHIA 3DO6A 3K9BA 4X3OA 2RI0A 1KIMA 1QH8B 2J8ZA 4UHEA 1FDTA 2FW6A 2PGLA 2BC9A 4MV9A 4E3WA 4PN3A 3HADA 3V33A 3KHTA 2JA1A 4WACA 1JR6A 4WFQA 3GRCA 4RELA 3TLJA 4D9MA 1KZYC 4KJZA 4BX9A 1LLCA 3TRKA 5SZKB 1SKYB 1T5SA 1FMTA 1COWA 3GLIB 3FD8A 3KUKA 3I5UA 3RKSA 4Q6BA 2DF8A 2QBYB 2P11A 2XMCA 1Z73A 1S8FA 4DDWA 1PAUA 3HDYA 5CXXA 2ZUEA 4JGIA 2Z0MA 3H17A 1F2UA 3U7IA 4CMGA 1QGUB 3O83A 2WSYB 4ZU3A 4YHBA 1SIUA 3ZGOA 1FFXB 2DPGA 2GNPA 2SCUB 1UANA 4H08A 4RE5A 1OIXA 3ND5A 2E1PA 2YXPX 5CLQA 1V7QA 4EQZA 2IYNA 1DWPA 1QMPA 1ZOSA 2J31A 2XUFA 3RLIA 1XBTA 2HK8A 4REMA 4DKJA 1J23A 2G1PA 1XZJA 1ISFA 4C78A 1EWKA 4FMCF 1R88A 4XYEA 3CZQA 4IUCS 3V7UA 3MHTA 1LQUA 4PLFA 1ESZA 1Z2NX 2EFJA 3VGPA 4IXWA 1NE7A 1JKJA 4LHZA 2OKCA 4PRYA 3OX4A 3RSSA 1XDBA 1RHRA 4FFSA 2ILVA 4M0UA 3QTTA 3ZE9A 2NYAA 3CE9A 4P6VF 3FCOA 1ZI8A 3ESCA 2VH5R 2ZJ6A 4PO1A 2I8CA 1GPBA 1DC5A 1RJ9A 3LHKA 1DKNA 1L5WA 2LE0A 1FYFA 4LG1A 1CWUA 4Y2GA 5JARA 1XDDA 4P3PA 1QTQA 4Y9SA 1K06A 1MC5A 1Z8NA 4RADA 2ATVA 3FDJA 4S1VA 2IVZA 3V7WA 4HLUA 4YMSA 1JA9A 1U0JA 4RULA 2F00A 1N5IA 1TTHA 2Q1WA 4LDJA 1E3WB 1EHYA 1W5BA 3H3XA 1GKYA 4LHWA 3WLLA 1CZNA 1MIHA 3A9SA 3LUGA 4A4DA 3U39A 2HEIA 4B6FA 1M8GA 4N8DA 1W0CA 3ZV4A 3EZ7A 1VB3A 4S35A 3J7TA 1J8VA 3QUCA 3W6PA 1NJ2A 3UZUA 4LJRA 4FLEA 5GGXA 3AERB 4WJZA 5HP4A 3HFJA 1KFCB 1KF0A 3CMCO 4XVHA 4IY1A 5K5EA 1OWLA 2G9ZA 4K9RA 3H8WA 3HKDA 5PGMA 2Q8PA 2JLCA 2R68A 4QFCA 4YA6A 1I2CA 5KCMA 2Y6UA 4PQRA 5TC4A 1F0KA 1U8TA 4RK0A 1VG8A 3JARB 2X0EA 3JD3A 5L6MB 5DDIP 4IDQA 3DT9A 2WTXA 2R66A 2DKOA 9GPBA 1ZM4A 3AJRA 4GOKA 1Q5PA 3M1YA 1RKVA 2R6GA 1R5JA 5MN6A 4XQ9A 1VFNA 4X95A 3PR1A 3HCOA 3BGWA 4D02A 3E4CA 2OORC 3PGJA 5KYWB 5K0FA 3GB9A 2H1WA 3HUFA 3BF7A 4LX8A 2D4HA 4DF3A 1AE1A 1PS9A 5CDUA 4KIGA 2GFQA 1H4VB 2VLBA 4TN1A 3ONFA 2QQEA 5TPZA 3RRZA 3VJMA 4DXDA 2I9PA 5H5JA 2ZITA 1C1DA 1V4BA 2E6UX 3GDGA 1T9GR 3NLLA 4PINA 2R85A 5ALEA 4B3CA 2F67A 3V8NA 4DR4B 4OJQA 1L5MA 2H0QA 2VHVA 3LOUA 3QI7A 1WUYA 2WHPB 1NF9A 3FPJA 3FPCA 4LYAA 2IYOA 4KBGA 4ADSG 4DCTA 1YS7A 1T3LA 2H9IA 2O5RA 3CR3C 3MT0A 4IKPA 1D1SA 4BNKA 2W6JA 4F4FA 3IESA 1U3GA 2WJPA 4QOEA 3B3JA 2CFCA 1AB6A 1JA1A 1ZM9A 5TQ2A 1AN9A 5FFFA 3DQQA 1KTVA 1XEXA 1UZNA 3AUXA 2XMZA 3O90A 4II3A 1V11B 3GVIA 4R40A 3R4VA 3ZHOA 1L5VA 3EFOA 2DBQA 1YE3A 2MYUA 1YZGA 2ETVA 2YC2C 5LUBA 4F96A 5BN5A 5BV8A 4OXKA 5ECWA 1JAXA 1ZH4A 2PJZA 5ALYA 2CUTA 2JLUA 3GC6A 1QTIA 4J7AA 3ECAA 2YINC 1AQYA 3GCWA 4PPFA 4ZI2A 1DJQA 2WYIA 2VDWA 2YWFA 5FI0B 2E7ZA 3SYTA 1Z08A 4H2DA 4LV5B 1QNFA 2YIMA 1G66A 2XHZA 3W5VA 4QOIA 5C18A 1PJSA 1NVAA 1P33A 2C5AA 1TADA 2QR3A 3T52A 2AF4C 2BEKA 2RGNC 3HFRA 1DQRA 5EJ2A 3QV2A 3NKFA 3EMDA 3QLVC 1B2LA 3TOCA 2ADOA 4NG4A 3IQZA 1LTHR 3JX9A 3EA0A 4D45A 4IUDS 3CLSC 5ALTA 2PZFA 1U5BB 2RBEA 4B6PA 1WWKA 4RMHA 3ZHCA 2EW1A 1NLUA 1VA5A 1XMPA 4FDVA 3JRNA 4U9HS 4MYHA 2CL7X 3MLBA 1CY1A 1E5DA 2BGRA 3SIPA 1HY3A 5AO9A 3PFNA 3QXJA 1E60A 3TQTA 3FSGA 3HKBA 2VF5X 3KX2A 2XNKA 5FO1A 3RRJA 2A58A 1Q21A 4Z0HO 1FRQA 1MEOA 3TLKA 2PJRA 1HOXA 2WV9A 4U7PB 1AO0A 1SVWA 1PG5A 3BXGA 3A6HA 3M8KA 1YB2A 4UULA 4JC0A 2PNJA 4XSHA 4IWNA 3KE8A 2BM9A 2O7QA 1XTTA 4HEHA 1YVDA 3KEQA 2WG1A 3W7BA 1LJUA 1E2QA 1ES9A 3I6IA 3OU6A 4QJ4A 3W79A 4EB0A 3R0VA 5A4DA 3L18A 3PRYA 1HE4A 4UDXX 1TT7A 2DHQA 3A9TA 1T5BA 5EFZA 4ZVKA 1Y7HA 3F4KA 4F6RB 2CMGA 3RS2A 5E2IA 2VQEB 2AS0A 3PPXA 3U7FB 3UWSA 2V1UA 1UH5A 2BJVA 3B82A 1N3BA 1PGNA 2QDKA 3CGWA 4L6CA 3C7DB 3B12A 2HL6A 1BXGB 3BB4A 4BKOA 4OQXA 4RA9A 5E8JA 4AYTA 1YVRA 1OAOC 2Z5LA 4RY0A 1RTTA 3F67A 4PCVA 4GBJA 4G89A 1EGMB 3C6MA 5JIBA 3H9UA 5ERXA 1X1AA 5EEHA 1ADYA 3AHCA 1NIPA 5ADVA 1QLWA 5FI5A 3PITA 1TK9A 2PKXA 4FDMA 3F3SA 1LPNA 3GNTA 5EKDA 2D1FA 5TR9A 3WTBA 3DZCA 3H05A 5IZCA 3N8GA 4FBGA 1Z0SA 3H87A 2PLAA 3RSFA 1AKQA 1TKRA 3WFJA 3ICQB 4PC2A 3IEUA 2O1XA 3QI2A 5B1HA 3UHAA 3AZPA 4F72A 5C1PA 4OHWA 9LDBA 3I64A 2I8AA 1T2VA 4P83A 4C4XA 4OLAA 5FADA 1ONBA 3VRHA 2O2YA 1E6MA 4B1FA 3SX0A 4MR8B 4RFVA 1VSUA 3HWWA 2D2IA 4U2CA 4HGRA 1Q1EA 2RAFA 5CMLA 4D56A 4DNQA 4P36A 1IWOA 4M54A 5EQTA 1S7GA 1SVNA 4ZAWA 4FILA 5BN3B 2PIAA 3G9UA 3R2JA 3GJ5A 5JZ9A 3UXYA 1WDTA 1EAMA 2Q4OA 2QX4A 5BN4B 3ZWBA 4Z2AA 4H1HA 1IXZA 4NEHB 5DXJA 5E4TA 2IZ1A 2Z4SA 1WB4A 5BR4A 3T15A 4CDGA 1DCFA 3A06A 4O2RA 4Z49A 4ZREA 1BX3A 3QKSB 5B3AA 4J16A 4GEGA 621PA 2XUPA 1ARZA 1L5YA 1JL3A 3K0FA 2Y1EA 1IEXA 3AUYA 2JJQA 3CSUA 3IMCA 4UVDA 1XRQA 2JHFA 4D0NA 4G1CA 1E8DA 1VLVA 3R5SA 2VDOB 4ND3A 3TZKA 4BNJA 3SCZA 2IF0A 4X45A 1YMVA 3G0OA 4HMQA 5EG5A 1YRYE 1FZTA 2II6A 4P35A 5BR1A 4RTOA 1IY8A 2G6TA 4NZPA 1J4AA 1AH2A 4PNHA 4G5HA 5LBIA 4RD6A 4ZYUA 4BNGA 5IXYA 5J2TB 3HY6A 4Y2YA 1QDEA 4LRWA 1K6EA 1TVMA 3HNOA 4Z86A 6AT1A 1PX0A 2C94A 2VDVE 5J5VA 3L7JA 5JMPA 4D82A 4IOLA 4QUAA 3DDNA 3KJQA 4C2UA 3ULKA 3FWNA 2XCIA 4BB6A 1QU2A 2G40A 3M1LA 4G07A 4GUDA 5TPZD 3ITNA 1GV0A 1Z5ZA 1T4CA 3PDHA 1VB5A 1TZCA 2DUJA 2V98A 3UWPA 2YWGA 4KLNA 3T5MA 1J2JA 3Q3VA 1ZGGA 1SFRA 4YRTA 2FQXA 1L8LA 4CTJA 4NJEA 3KQHA 1W34A 3R44A 5LQJA 4LMBA 4TMZA 3QPVA 1I4EB 3T4UA 5K0JA 1W36D 3VPCA 3HEAA 3IMGA 4M46A 2V7UA 5K6AA 5G1NA 4LVUA 4UXIA 5DHRA 4TXLA 5IAGA 5F1KA 1JHOA 4KQ2A 5FHQA 5FTWA 2QBYA 1GRQA 4GLFA 3EISA 5EKTA 1M8PA 2QXTA 4GD3Q 2PVCA 3RYFB 1WMEA 2Q5EA 5I9BA 4Z0TA 3RU9A 1UC8A 3K6RA 3PX2A 4GI3A 3V00A 2RJ3A 1FUIA 3EUAA 1KYIA 2O2DA 1L5SA 2ZUCA 4B33A 5IJ0B 2I4NA 5T8KC 1PD1A 3WXBA 4XVRA 1Q0TA 1PK7A 1E3SA 2SHKA 1C4OA 2EYQA 1XCJA 2K2WA 3MTDA 4R6XA 4BLOA 3ZVNA 4MQEA 3QFCA 3JSXA 4JSRA 1CTQA 2M6RA 3MAAC 1N32B 1T36B 4BECA 1CULC 2CMFA 1AN0A 2GCIA 5CB0A 1PEYA 5CR9A 3VSAA 5LQKA 1I2ZA 2OZLB 1THZA 5FWYA 3ILVA 3PWTA 4ZALA 4OLFA 1NHWA 4W5RA 4O1HA 3ZQKA 3W6NA 1ZCZA 5HKBA 2E37A 2PJUA 1J2UA 3QMVA 1OE0A 2O6LA 4FT4A 5BRNA 5DOZA 1EZZA 3NRCA 3ZY2A 1Z4PX 1JU4A 1XDSA 3PSHA 2GR9A 4R68A 2DMRA 3BQNB 4WXHA 3UNXA 4FWIB 1FF9A 3LWBA 3VU1A 3DZKA 1L7BA 1PDWA 2KS6A 1UFQA 3H16A 4HFMA 4Q34A 4HNGA 2X6RA 5TMBA 4CUKA 5EE5B 4ENWA 5AVZA 2RK4A 1HRDA 2X4LA 1QHGA 1TIKA 3ST7A 1TA4A 3W77A 1ONNA 3OTIA 1DI0A 1PS8A 4NBWA 1HORA 4DIOA 1PGOA 2BI4A 2P4UA 2ZCVA 3QY9A 1K6IA 4FIZA 4UNSA 4C0KA 2AHOA 4KU4A 5KQMA 5KTMA 2VN8A 3JRXA 2IHUA 3MXOA 2FRXA 1UZLA 4NTZA 2D5CA 4OGWA 4RENA 3WGJA 4BXOA 1JHZA 1JLMA 4KL8S 1O0CA 2CT8A 2IPOA 2IXDA 1YO6A 3QWFA 1Z6TA 1LWNA 1MJNA 2QF7A 4M8LA 5DT2A 3VPBA 1SULA 1KJQA 2WNIA 2FUG1 3AEKA 5DNAA 5E1BA 3C8HA 1CR0A 3OT1A 1N1DA 4JHLA 1E2IA 4P34A 2CLIB 2DM6A 5IBQA 4QKQA 1CQIA 4PX9A 3GLGE 3BWEA 4MB2A 3KWFA 1W2HA 1NMSA 4BDSA 1QVZA 3TVTA 1G291 4R0NA 3R9XA 4KRXA 2L18A 4M6WA 5EA2A 2I7VA 3ZZNA 1ZGCA 4FEGA 3FIUA 2OT3B 4GC5A 5FT9A 4G23A 1Q91A 1PUIA 1Z7YA 3DYBA 1QZXA 4I5DA 3D3NA 5F77A 2I2FA 4OQNA 4DG5A 3H2HA 3CIOA 4DUZB 1MW8X 3V6LA 2Q45A 1HC7A 1S2GA 3RASA 4EKIA 2DUWA 4P7KA 2NO0A 2Q8QA 3TOSA 3GLIE 5AVRA 1GGJA 2CF6A 3DR3A 4O0MA 4P31A 2QJTA 5C31A 4Q1FA 5CP8A 4FGWA 3FNBA 1IHUA 2PPVA 5E6SB 1KRHA 1CIVA 2H2AA 2NM0A 3VX4A 5LIRA 2CFTA 1KH3A 1X7YA 3AY0A 4YP6A 3WHPA 4K1XA 3QE0A 1Q0HA 3UF0A 5CB4F 3NHRA 1BQ3A 3ZVKA 3DZGA 1GN9A 1QO0D 4R2MA 2XOEA 4YREA 4YV2A 1OI3A 1QGOA 1PI3A 1Q7BA 3IKLA 4X93A 2I6TA 5FBKA 1YBMA 2VF2A 1OGIA 2BSAA 3RFFA 2X6TA 4U2GA 5F52A 4ACBA 4XYGA 1YQUA 4U5QA 5KMGB 4X64B 3FYUB 3GEIA 3IOYA 5FLKA 1TUBB 2FSPA 3JQFC 3OG9A 4PAMA 4UD6A 1GPKA 3Q8KA 3I62A 4OF4A 5ER9A 2OHHA 3TXYA 4ASUD 4FCWA 3S1AA 1NOIA 2VTDA 3PYMA 1V5WA 4YRAA 4N3GA 2P9HA 4WOCA 3R5XA 4UJ5A 3NFYA 3F3MA 5DNVA 3RARA 4ZOAA 4D9GA 1P7CA 2A9JA 2OV3A 3FUXA 4L7QA 4GOMD 2H48A 1TLLA 2QNRA 3GXBA 2X0JA 3GRPA 3JRWA 2I4LA 1BQ4A 1E0AA 2DZDA 3MUNA 1O6FA 1VE6A 2H5LA 2PMDA 2ZU0C 3NWPA 3ZLUA 2K4MA 3L0CA 3RS0A 3BH7A 2QTVA 1Z33A 3FHTA 3BWDD 4UZEA 3BDAA 4PVCA 2R5WA 4BLWA 1XKTA 1G42A 3IGFA 3T3PB 5D51S 3V42A 5K0SA 3HJFA 5T4HA 5CLGA 3BMQB 3GHYA 5KNBD 1GAXA 3ASUA 3IPCA 3EXHC 1GPYA 3O4GA 4IO1A 3FYHA 5AQEA 1WG8A 1FFAA 4LDQA 1KZ6A 3M49A 1M1UA 5CBKA 2ZS7A 4MO2A 1WCIB 1SD2A 4D0GA 4OXNA 2O8NA 1PNVA 1QVVA 2Q3CA 1SHTX 2JD2A 3W7AA 4DABA 1N5OX 1MABA 4BJ6A 1XA4A 3OX3A 4RSHA 3R7BA 3BB1A 4L5AA 4YJGA 4B71A 3NB0A 3EXEA 3SKXA 3EGEA 1DFIA 1ZJZA 3AJ9A 1EXVA 1UJBA 1ZBDA 2B3TA 2FSHA 3HUDA 3AFOA 5ESRA 4V03A 3SICE 4E22A 4RKWA 1SWVA 5G0WA 2ODBA 4QOSA 1QFSA 2VKQA 2O2CA 4ZJYA 3I9LA 2H0RA 1NI4B 3SFVA 1I30A 2GZ1A 3W90A 2C0CA 1MO5A 1CCWA 1L2TA 5HMMA 4WK2B 3K1TA 1PTJC 1I10A 4LYJA 4O4IB 3HGQA 2DKFA 1BO6A 3K2EA 2BHNA 2JW5A 2UVDA 4RE6A 3H75A 3C5WP 3D5EA 5F1PA 4BQOA 1VPWA 3BULA 5FWAA 3G88A 3LKDA 2JGEA 2NAPA 4IQ4A 2IT1A 3VKUA 4QYXA 2IP2A 1UK9A 3QUAA 4KQXA 3P0HA 1HKHA 3TRDA 2ZUUA 1MVLA 1PT5A 2GM3A 3FOFC 3MTAA 3VNRA 2LZ0A 1IVNA 1JEYB 1DAOA 2EX4A 1G3MA 4I55F 3GJ0A 2GEKA 1HMPA 1PT6A 3C3XA 4RA6A 5I7FA 3L0IB 3KYCB 2JFOA 2V54A 4IFEA 4M0LA 1DRKA 1MPTA 4O5OA 5J1TB 1L8AA 1J0CA 3ZV3A 2H9AA 1PL7A 3DE7X 4BB9A 3SHVA 4LXQA 3TO5A 5CCBA 1IB6A 3IHKA 3R3XA 4CIBA 4YUYA 4M8NE 4IXDA 3JWGA 1ZS9A 2X40A 1EFRD 2YOGA 4W8GA 1UJNA 4BVJA 1RP1A 4ZTBA 4ARSA 1J7JA 1NQ5A 1T3ZA 1GQSA 2XUDA 3DMTA 4RZ2A 3RJ5A 1TAUA 1ZRHA 2LIPA 4H17A 4WY8A 4PXYA 1ONOA 5CYPA 3VDXA 1IU9A 4JITA 4UTPA 2C7OA 2RKWA 3BJEA 1GG8A 1SVIA 4MR7A 1D2NA 1W5EA 3FUUA 4H7JA 4JJIA 4MVJA 2M6LA 3WDSA 3MYYA 4LCBA 4IIEA 4J94A 3ZBQA 1PBNA 1M2NA 3P94A 1E6WA 1Z2OX 3DSRA 3JQ9C 4EG8A 4YT2A 3GMTA 1Y3CE 3TNLA 5DNCA 1JAIA 3AUAA 5JCZA 5FTMA 1VKZA 1YQEA 2QXUA 1D2EA 1T5TA 1R1DA 2FUEA 2IY9A 2IY7A 3EUEA 3IXLA 3DVQX 3GQBB 2WQ6A 3WYBA 3ZVMA 1LLUA 1GRVA 3HMQA 3T3NA 2X2PA 3T1OA 3HLYA 4OO3A 2IQIA 2QZSA 3K0EA 2FPOA 5CFLA 4KC0A 2HD4A 3NOXA 3WS7A 4F04A 4MRVA 4Q93A 2DTXA 4EYKA 4V24A 1E2LA 4TT3D 1Y82A 4XM2A 2Q6IA 3DWIA 1KZ1A 1TU4A 4U00A 3AVQA 5EJAA 1FP4B 3LCCA 5H3HA 4D81A 2HW8A 4EY3A 4DNXA 3CO5A 1QONA 1Y9AA 3C1UA 5J2UF 2HF8A 4P08A 4HGOA 1WUJS 4V1CI 1P4SA 3AB8A 1IOVA 4XUGB 5AW5A 3QNUA 3TBKA 4LGYA 1UWVA 5BPHA 2XKKA 3DL2A 2H5IA 3FBGA 2W8ZA 4H7DA 2B1IA 4IGKA 4LDPA 3R7DA 4AXBA 4CM4B 1N9KA 2C03A 3Q3GE 2AJCA 1J9ZA 1F48A 3C3EA 3H7IA 3HSSA 4R9UC 4ZCQA 1P77A 1YCFA 1GPJA 2N46A 1EB9A 2GEFA 3ESRA 1ZNWA 2VP4A 5KB3A 4FKMA 2G72A 1VI5A 1X9IA 4QZVA 4TTPA 2P62A 3A1CA 3A3PA 2PYDA 5EYPA 4HDKB 1F8YA 2PWBA 1K5GA 2X4GA 3RK4A 4N8EA 4RVHA 1B76A 4JIGA 2NT3A 3GBVA 2QV7A 4J0IA 5LQRA 2QZJA 1H6BA 1L7PA 3JQ9A 5TX7A 4Q7QA 5EIAA 1OXMA 521PA 3Q8MA 3BRSA 3L7KA 3UOWA 4RKEA 5EHQA 5I4KA 4M1QA 5IHPA 3W5AA 5AVOA 1L4BA 2A5GA 1GLGA 4WK0B 1X7WB 4I5FA 2A0XA 4EOGA 1ZY2A 3COPA 5MF6A 2G1UA 5INTA 3I42A 1NJSA 2VT2A 1GSAA 5GIOE 3D8BA 4MA5A 2FWJA 3WGQA 2QVZX 3JQ7B 1I3OA 3OQJA 1QWSA 4NX2A 1Z28A 4GI2A 3JAMA 1FFDA 4KH1A 5J2UA 2V0CA 2ZJ5A 5T5QA 4IIXA 1DWQA 1G60A 1QF9A 3OO1A 5DGCA 1WKVA 4CLOB 1YV9A 1QQ7A 2V4ZA 4X44A 1J8YF 3BIOA 1UKBA 1YQGA 3ON5A 3OOHA 4M8KA 4AMBA 5BP7A 4KXVA 5ADUS 2PBZA 3AINA 2H1LA 3UB4A 1V3QE 3WY9A 1QVAA 2WVHA 1YFLA 4FD3A 4LJ9A 2XCQA 5HGJA 1HT1E 4BN5A 5DU2A 1JQLB 2EERA 5EVJA 3BEOA 2A9OA 2I65A 3H2IA 2XB9A 5JWOA 2OY0A 5CG2A 2P0EA 1XR3A 3ELBA 2ZM6B 1UWLA 3IA2A 1W5SA 4I4CA 4QDZA 5HQ3A 1J0EA 1EE9A 2PKQO 4EJSC 3GJXC 4R1TA 3P2OA 4KDEA 4O4IA 1BDMA 2B1QA 2BWJA 2MINB 3IVXA 3L7BA 1XLTC 1XVTA 4GZ6A 4PEVA 1RKQA 2WLSA 1X1BA 3OZ7A 3ZJYA 4MV7A 4YEDA 2B5WA 1YONA 3BBLA 3FXAA 2HSEA 4W5TA 1BMDA 4FX5A 1JKFA 2X23A 2C7PA 2PN1A 4NS1A 2GA9A 3ROMA 3T61A 2P65A 5KOJA 4V0SA 1SXGA 1NUAA 4J75A 1CEEA 1C5KA 4ALNA 2PSSA 3PF9A 3GNLA 5K3CA 1MH1A 1PEDA 5HW0A 3KO8A 1DRJA 1Y6JA 4R9NA 3TFQA 2WNHA 3O7WA 2ZSDA 1ZI6A 3CMMA 4LHEA 3B36A 4Z4EA 1EBBA 1BYIA 3FLEA 3L7CA 1MO4A 1FJ2A 3EBPA 4B7UA 2JHPA 3GBSA 1L1EA 4RVOA 1M2KA 5DCUA 1AK9A 1WCV1 1SC1A 5REQB 2ONYA 1NW9B 1EPUA 1OREA 2UYYA 1XMIA 5CHEA 1R6VA 1ZISA 4QUEA 4YJHB 4U9UA 1W88B 4CV1A 5LB2A 4D4GA 2BSXA 2B4RO 2WIFA 5DM60 5FLYA 1RW4A 3O4FA 3VSEA 3UJ3X 4IAOA 1ZUD1 4GPAA 4TYPA 5TPWB 2I7CA 3WK5A 3X1ZA 4DQLA 2W4IA 2WJGA 4HUJA 1KS9A 1E4EB 1NZFA 3U49A 2OAEA 4J3FA 3L6UA 2ZWIA 4NR0A 4RZXA 1YA8A 1QTRA 5JAZA 1YASA 4BDTA 4HLNA 4U5XA 2CXRA 1ZD9A 3BD9A 3EAGA 3HKCB 3QVWA 4K3UA 4X0EA 5G53C 1OYOA 3GQVA 3ZCQA 5JH7A 4ES6A 1QCYA 2I1WA 2ZCUA 2JJ1A 3NX4A 4PFQA 1P9WA 4Q9DA 1HH4A 1P4RA 2I62A 5G0SA 5JJCA 1FUUA 3JXEA 3ZHYA 5ETJA 3ADPA 4YLYA 4KLZA 2NPFA 3RVDA 2OESA 2RH4A 3HZHA 3GPCA 2HK7A 1TM4E 4R0VA 3MJEA 2JI8A 4D6XA 3RADC 3REGA 5AJXA 2QR2A 4OSOA 3QQPA 3O4VA 2J0SA 4ZEWA 4NATA 4QXMA 1RPNA 1FU7A 2ID4A 3I5MA 4NZZA 3KOZA 1ODFA 2A35A 3UY4A 1DFHA 3FZGA 4D4KA 4KHPB 1DXYA 4E3ZA 4F3TA 1OXUA 3KOOA 5A6VA 2Y0EA 1L7QA 4JC8A 3K9WA 4L9RA 4F1JA 5I4IA 2PAFA 1PF7E 4I4TB 2HMUA 1YFKA 5THXA 3QELA 4BFVA 1U1GA 1E3TA 2HMYB 3AF2A 1GIAA 3QVXA 5KNBA 1HXHA 2XBLA 2PZMA 1VCMA 4GICA 2QI9C 4UZSA 2FKNA 3GGPA 5FI3A 2EW8A 2BFCB 4HUQA 3K9NA 1N57A 1NJFA 4ZQHA 3WLPA 2AC2A 4KGZA 1UR5A 4NCIA 5EP2A 1RIFA 3H99A 1R6TA 3JATA 4NKRA 4Z7JA 2C20A 4ZK2A 4N0MA 4QAQA 4EBBA 2J3JA 4KIUA 2BEWB 3ZBPA 4I2NA 4J0KA 2O3JA 5L3SB 4RCVA 4CGYA 4HUQB 2YXNA 2OSBA 1WY7A 3OKPA 4G97A 1PT9A 1G9TA 1B0UA 1SHLA 1ZH2A 2A0KA 1XRJA 4XB6B 3G49A 3V4OA 1NR1A 4QWMA 1NWHA 3ZDAA 1S2MA 2NTNA 1NG1A 1MAVA 1O1YA 2C4UA 2FETA 2VDQB 2EJTA 3CCBA 3G9XA 4MI1A 4UW9A 5BQXA 4IJQA 5L3ZA 3F73A 3I28A 4XWGA 2VR1A 1VGVA 4NBNA 4KXNA 1MJ5A 2DJ5A 1QJ4A 4XI9A 1E6LA 1Q57A 3GA5A 3S6JA 5LDHA 4ANFA 2TMGA 4D80A 2I7XA 3T1HB 4KGVA 1DIAA 5BSTA 3STWA 4B2YA 1LTKA 2ALJA 1WX1A 2HJWA 2BRUA 3NOOA 4NMWA 4ER3A 5A0TA 1CQZA 2MU1A 1HEIA 2WAAA 3H5RA 4F93B 4PHTA 4BP9A 2D1TA 3O6VA 2VSYA 4FB4A 3K5IA 3H3FA 3LQKA 1XHFA 3OT5A 2HT1A 4Z53A 2QMYA 3L0PA 3NWEA 4P7BA 4D46A 1LD3A 1RM3A 2IXEA 3NC0C 4AL4A 1OPXA 4D4IA 3AW8A 5AKYA 2XUHA 4GXNA 3B2EA 2N42A 2A7QA 4ZD6A 4UTOA 3WNVA 5JCPA 1SU7A 1RR6A 3L1VA 3NUZA 1JLSA 3DB1A 2CKDA 1P0FA 4L9SA 1T9KA 2RG7A 3D3JA 1ZRMA 1Z22A 3G89A 3SZGA 1GVHA 3ZWDA 3TM4A 2KBEA 1P2SA 5DBIA 1U0TA 2GD2A 1A2OA 2Z95A 3OJCA 1EP1B 1BWQA 4HBZA 5KVCA 4W9MC 5EZYA 5EHIA 3H4MA 2XYVA 2WTBA 2HU2A 2L69A 3K9QO 3N0VA 4DWJA 1CVLA 4F97A 1E3QA 4P3XA 3SEAA 4MEAA 4FGSA 4LYEA 5ECYA 4D3ZA 4DT1A 2DR2A 1RAHA 1YA4A 3BPSA 1KK2A 3PNKA 4AD8A 5K8TA 1D0VA 5E7JA 2GFIA 2XPCA 4DNPA 2H1VA 2PANA 1XYGA 3W9YA 4G4SO 4NYJQ 4CODB 4JUIA 3P0RA 1KHHA 1E99A 4FLMA 2PT9A 5GJWC 5ALXA 4MIYA 1XD2A 3KHUA 4FOLA 4ZZ3A 1C8LA 4Y6SA 2QMZA 3MS2A 4QOJA 3EDCA 1EFTA 3IT2A 3L43A 4UXHA 5KOIA 7MDHA 3H5WA 5LMZA 1H4TA 2RB5A 1DE0A 5LPNA 1XZKA 2QORA 1IBCA 2IQ5A 5DGXA 1O9HA 5DI9A 2GESA 2NU9A 1I51A 3LQ1A 1P4GA 3P9QA 1W88A 1PEKE 1U3CA 4PXAA 5AK3A 3LUDA 3RC1A 1SOVA 4OHYA 4JSTA 4WESA 1EFDN 4MJXA 4Y1GA 4CEHB 1YQQA 4EPRA 3F3KA 4CCSA 3L8CA 3NHBA 1WXEA 3WBJA 3F1LA 5FUMA 4LFAB 3HXPA 1MFPA 2ECKA 3FIJA 3ORYA 4ZO7A 4I8IA 4M1KA 5T4EA 1K3UB 4EMBA 1E1QA 1MNAA 2C4WA 1GSIA 3O8BA 1J7KA 4RH3A 3NP9A 4KPGA 3O8LA 1XJ5A 3WRXA 2P9JA 2BR3A 3ZZMA 2Q5IA 1BX0A 1E2HA 4OQDA 1Y4UA 2GXQA 2OL4A 1JQ3A 3O47A 4LZPA 1O89A 4Q82A 4BASA 1NU6A 3P2EA 3SWWA 3OSZA 1LBSA 1T8TA 4CT4B 1CR2A 2V7TA 3MSCA 3R1IA 2DWPA 3NTXA 1L8XA 4E03A 3E9YA 2P90A 4X6UA 5EC8A 2DPYA 1ODCA 1R16A 1VMAA 2IZ5A 3PZRA 4FFDA 4IZHA 5E38A 3COJA 2JJ2A 3ET5A 1S02A 1L4NA 2QI9F 1V9LA 3PENA 2FWAA 4NOJA 4O2BF 3N7UA 5EIEA 2D7DA 4H15A 4D9CA 2WA2A 1R5NA 1TIBA 3DAFA 1FMFA 3BGSA 5LYJA 1ZD2P 4YC7A 1K88A 5ICGA 4M1WA 2P69A 1NJ8A 3BRCA 1PQPA 2GA8A 1J21A 2PDAA 5K6RA 1RRGA 1UBEA 1X7WA 4BVEA 1P2BA 4CWAA 1ATZA 1HUQA 1I1QB 1Z5VA 3O3NB 2XQFA 4TKLA 3B3QA 4NC9A 2ZSIA 4TPKA 1T91A 2HAEA 2NZXA 1Y4DE 1G6HA 4F2GA 4HAWA 5IAEA 2OQRA 3IQGX 2D2EA 2IOFK 4UPDA 1BJKA 4N4AA 1TJ4A 2GSDA 3N2ZB 4MR7B 1GUYA 4U7HA 1CJCA 1D5WA 2O48X 4WZBA 5TS2A 3KJEA 3MS4A 4JB8A 2QRLA 1Z2EA 4ZDWA 8ABPA 2UZ4A 4P3NA 3NBMA 5JZMA 1JNYA 4MS4A 3KYDA 5CAEB 2XQJA 2DBYA 1M6NA 1WZCA 3DMGA 3W8RA 4OXXA 1KO4A 1UBKS 3HMKA 2JK1A 3BFPA 1SBNE 1U5AA 2PX6A 3TRIA 3ER6A 1L7DA 1M34A 4ZVMA 3PFWO 1V5IA 2G0NA 2PGJA 4XSVA 2QHXA 3DW3X 3VR2A 5AH0A 1A2KC 2LR0A 5AW3A 1XRPA 3H1TA 2ACEA 3OOWA 3ZGNA 4DLXA 1X86B 3G13A 4LOKA 1BA2A 1U3UA 2HNKA 2Q0XA 3CLSD 4LYYA 2JFQA 4GPZA 4R2LA 3MB8A 3DOFA 3A4LA 2E87A 3MINA 3RS3A 1BDBA 2WG2A 2BL4A 3E3MA 5ALMA 1E5TA 1S4MA 4KP7A 3AJAA 5BQPA 2NU8B 1TM3E 2QTZA 2X15A 3S5UA 3T9FA 1NMQA 3B6IA 3G7UA 4N76A 3X2SA 1ZIXA 4TM7A 1ULAA 3L0DA 3F5MA 1AS2A 3EK2A 4AI6A 5KQPA 1DOHA 1R0RE 3BMNA 3DT6A 4GVXA 1GAEO 1M10A 4D8WA 1GEEA 1B8VA 1U2TA 1XZPA 4Y2PA 1HQDA 4PNZA 2PS1A 2GO1A 4BMCA 4U7FA 3HU1A 1J0AA 5CG1A 1E1MA 1TX4B 5LZ9A 1CVRA 3HNPA 3WAJA 4QVGA 4EARA 1LPOA 4B3IA 2VYFA 3NRJA 3ZDXB 2ZG6A 3VOTA 3AC0A 1L6RA 1QX4A 4NMMA 3VZQA 2VSFA 1CRWG 3KEFA 3GGJA 5EQFA 2RGDA 5HF9A 1OIWA 3NBAA 3GV0A 3QMMA 3A1VA 4OGKA 4AMVA 4C4AA 5TLSA 3QA9A 4X8LA 1IZ8A 4BGEA 3OLYA 3IRUA 4J90A 4EG7A 3GT0A 4RFLA 3NYQA 2ZJYA 4G5XA 3WLOA 3QEOA 2DTEA 4OVKA 5JG7A 5JPDA 1W7AA 1JVBA 1FUYB 2FZCA 2R47A 4ZVTA 4DRZA 5H4GA 3I2GA 5JCXA 4WOJA 1OPRA 1PGQA 4RHFA 3AFMA 3NTUA 3GEPA 2WKSA 1GO2A 2DSTA 1LK7A 2DH6A 4WGFA 5KU1A 3VYUB 1EFVA 4Q00A 4XUEA 5D6OA 3W2HA 2J32A 4BQPA 1EZ1A 1YR1A 2WD8A 4HX5A 4WBXC 3SS8A 1UCFA 3D59A 3WO0A 3CF4A 4Q3CA 5DNYB 2FGJA 3W34A 1DVRA 4K0RA 1B43A 4BVKA 4EUHA 1GUAA 1FFYA 2IPAB 3O73A 1PNQA 1U1FA 4GOXA 4Z7OB 4MDHA 3QEMB 2QN1A 2WZQA 1STOA 2H4XA 2H52A 3E18A 3TE7A 4DSOA 4RKQA 3HLTA 1KP9A 1Y63A 1TOAA 2J0VA 4JYCA 1NQOA 2X8LA 3PC7A 2OOKA 2PGDA 1HOTA 1AUQA 4CIDA 3TJMA 5BN5B 3GVHA 2VJAA 3LFTA 1O3YA 5B3JC 4HAYA 1A82A 4TV8A 2AXEA 3WQBA 4HXGA 3CX6A 4CE6A 1F38A 3L1IA 2QUBA 3N53A 1VGRA 3A25A 1QYRA 1K1EA 3C3YA 4KH0A 1E62A 2NSYA 2PMBA 3EF1A 4OP3A 5AHRA 2NV0A 4B31A 1FZQA 4C7JA 4GT1A 1QS0A 2WWTA 1CY8A 4KLCA 1WJGA 2CZCA 2P9GA 1XVAA 4E33A 5K03A 1PG2A 2Z9BA 1P1FA 3EVBA 3RRMA 2V7VA 4Q7KA 4C01A 3A1NA 4IG9A 1EEHA 1TNDA 2BEVA 4TXHA 3AIOA 5AOCA 3UAYA 1ZK3A 2A30A 3DUWA 1NRXA 2H00A 2H4YA 2SECE 3VXKA 4Z3KA 1JHPA 4MVJG 1GRRA 4X85A 1EJ2A 5EIWA 4DM7A 4HEA1 4DNFA 3HYSA 2GF0A 4IR7A 5EE9A 8OHMA 2FVXA 3GRRA 1SG0A 3IOCA 3MELA 2P2NA 4EJSB 5HKLA 1YA6A 1FRFS 1RWVA 3GJ4A 2MCFA 5K0EA 3SEFA 5B1YA 3RVJA 1WQ3A 2V6IA 3BX1A 5HA5A 5IU6A 1A27A 1S9HA 1YDWA 2BEUA 1TYZA 5IWCA 3RVRA 5CCEA 3E05A 1MB4A 1EWYA 3F8WA 1Z63A 2YOHA 1YULA 3P1JA 3T99A 4CCYA 4EJ0A 3BMCA 1SCIA 4RNCA 1PZFA 3DLTA 4UNIA 4FGUA 1LDBA 4OTZA 1A72A 1MX9A 1OY1A 3A11A 3B3GA 4IHKA 4J7UA 5B1EA 2VEOA 2YN4A 3B6KA 2VSOA 4A0SA 2J85A 1CBUA 3HU2A 1P91A 5TQJA 2TS1A 3VV3A 5LLSA 1CYDA 4LXHA 3RKUA 3ROPA 4GH5A 4BZZA 1LW7A 4GXRA 4B87A 3MWEB 2Y05A 3G82C 1E9AA 4G5SA 3BL8A 3QRWA 1ZIOA 5EIBD 4ZQIA 3VSCA 5AXAA 1DBRA 3I23A 4UDNA 3IR7A 2QR5A 3R5JA 1N3YA 5BQFA 1C1YA 3NZEA 1EFPA 5DT9A 1I3KA 2FR0A 2Z04A 2NU8A 1MEEA 1X3LA 3OLQA 4E70A 1V8PA 2P2SA 1ZIDA 1CY4A 4GP9A 2GN9A 2IBTA 1GZDA 5DTJA 2PLFA 2ZUTA 3NATA 4QIHA 3RKRA 3V8QA 5IASA 4N40A 3GFQA 5DSXA 3ZI4A 5B4TA 2QN8A 2XOXA 3VPAA 2H2GA 3E1KA 4Q9IA 1CS0B 3GRUA 1NW6A 3AHEA 2OZKA 3V3KA 1JEJA 1K0FA 2ZBDA 4EY8A 3I61A 1HM5A 4X65B 1S8AA 1C8VB 5K3FB 1UKCA 2EKQA 2H65A 2WD9A 3SZMA 3A6KA 3KZMA 4JLUA 1R3DA 4F5DA 2COUA 1VBMA 3KOXA 4C0QC 5IRCD 4A26A 4D4MA 2K7FA 1O77A 5IC5A 4XFJA 3H1GA 1E5LA 5B2ZA 2Q2QA 2PBLA 1QIHA 1EVKA 3TBFA 3URKA 3N5KA 1PQUA 4E13A 1KO7A 3G2LA 1I3LA 1QV9A 2EHJA 1ESDA 3NRBA 3TB4A 1KE2A 1TQ2A 4O2LA 3EEOA 4CHTA 2JFYA 2CLDX 2P1DA 1GL6A 1GT6A 1PJ2A 2CXUA 3DBLA 1RPAA 1Z4KA 2ZE7A 4ZVUA 1QX3A 4CMCA 3GG2A 4C7OA 1BDHA 1Q0SA 2PSHA 4S1WA 5I7OA 4KUGA 1LBEA 3I3SR 3HC7A 1J20A 5J2TF 1DKRA 2IV7A 3U4QA 3OJXA 4JLVA 4OQ4A 3JR3A 1Y98A 2JIZA 4Z9XA 1KPHA 2B34A 1I36A 4K26A 1X7DA 1N3IA 4LJ8A 4PLGA 3RRXA 2XYGA 5CVJA 5CEFA 2YY5A 4QSMA 1DRUA 5HJ2A 4A10A 2DT8A 5DV9A 4EF6A 3D3WA 3LWZA 1T29A 3HVRA 1OUMA 3DE4X 2VJMA 4NCHA 5E7MA 2IYPA 1UXOA 2JBHA 4TKVB 1NNSA 3WGTA 4TLCA 3UANA 3DAYA 1T9BA 3DBIA 4UFPA 4HNVA 4XWKA 2WMOB 4GX2A 1Y8ZA 4L95C 2C88A 4JBHA 4YT5A 1N2JA 1XCOA 3P97A 4GI1A 2PL9A 3H8VA 1YBVA 4KHZA 4QPNA 4D43A 1EFKA 4YXFA 3GLSA 2QD5A 4E6PA 1X7XB 2J08A 4U7TB 1KJWA 2OO7A 2C4KA 3KYJB 1P6UA 4RD3A 5GQSA 5CDSA 1NN3A 1W5FA 2FJUA 2WZBA 4Y9UA 1USVA 4IMIB 3UTDA 5L7YA 2ZBFA 4CV0A 5C5IA 3C48A 2VHEA 4ALJA 5GZ3A 1IJEA 1YB1A 4ATNA 5E95A 3T9AA 3ZW9A 1J9GA 1VKNA 4GE3A 3RV4A 3AEQA 1N0WA 1LSJA 3FHJA 4P80A 3UBMA 2WQZA 1WPQA 3LY9A 4YASA 3TOVA 2VP5A 3EWIA 3STUA 2H4HA 2QUZA 3T5AA 1ZUWA 1I5RA 3K4HA 4INJA 3IAXA 3QX3A 5HFJA 3VC3A 3KYIB 1A4XA 4OHVA 2QJFA 2WAYA 1WDKA 4F3CA 2Q9AA 2FMHA 2HCJB 3RFUA 2FZKA 3A1WA 3CUUA 4G6ZA 2GAIA 1PNTA 4B3BA 4DGSA 5C4IA 3WMRA 3F7MA 3C6YA 2WSIA 4IEIA 3C8UA 4UCXA 5G0TA 4A27A 1UC9A 3CUSA 3ILSA 3IAM6 3DGFC 1KETA 4B7XA 4NPHA 4WLVA 3R7AA 4X1KB 1AKTA 2JAWA 3DBHB 3KPWA 8LDHA 4E5MA 721PA 1W29A 3EULA 4YXWD 4YY3B 1T9DA 2Q5HA 2YASA 1KIFA 1XJ0A 2EF0A 2QX8A 2Z1NA 3KKNA 4FOSA 5I7RA 1OAOA 2FUNB 4Y7CA 3S5JA 4CU2A 4LYHA 5M2QA 3WGIA 4Q3KA 2NN3C 2WMNB 2JIDA 4GVPA 2AQKA 4UHBA 1RCFA 4EAQA 3FVTA 5I3ZA 5IABA 5IH7A 4CTKA 2QLFA 4P33A 5FA6A 4MV0A 4V3BA 5ESWA 1JWAB 2VF8A 3AUKA 1WTAA 4F3KA 1XYVA 3BE5A 4JP8A 4GL4A 3TKYA 3ZXXA 2Y6VA 1JHQA 1CLUA 1J0BA 1WEHA 3K2QA 1NT2A 3O9ZA 4JB3A 3LKBA 3NDRA 1WDMA 4MMYB 4ZOEA 1YUMA 4F6CA 3OQNA 5EIXA 1H2HA 2R1UA 4GOND 3RSHA 4XGNA 1AKUA 1M74A 1Z15A 4OAQA 1P62B 3RT1A 1P4HA 5IJ0A 3A9WA 2PSFA 3N6RA 2VUSA 1P2DA 5KYXA 3OIVA 1M33A 5DYNA 3ZYZA 4NENA 3TQQA 2COEA 4C4SA 1FOEB 2I6XA 2X7XA 2OOSA 4XLZA 2G5GX 2Z6UA 1DRVA 4K03A 2FPWA 4FNMA 3ZHTA 4Z9FA 3EDOA 4AMUA 4JXZA 4QE3A 3T12A 3OMXA 2I55A 4GLLA 1QK4A 5FIUA 3QE9Y 4EF5A 5JNUA 3LX5A 3H5OA 1O96B 1CG6A 1N6NA 4C0SA 2O3UA 1KL7A 1QH9A 1W1IA 5DTMA 1K8YB 1M2FA 4OEHA 4AJLA 1PN3A 2V7QD 2ZSJA 3L8ZA 4JEHA 1P1CA 2GD6A 3QX9A 1E1DA 1RI1A 1SIBE 1U7DA 1DDGA 4JR0A 4P4UA 2PGIA 1QIDA 4LBVA 1OBOA 4PZLA 1VOTA 4D98A 1CEXA 2GF2A 2B8EA 4UASA 4UDOA 4EVSA 1BMTA 3A1DA 5A71A 1OMOA 3OLWA 1ZA2A 1U6KA 1NYRA 3D9QX 3QVKA 4J16C 4KWEA 4NENB 1U9JA 3U62A 4YCCA 2XOKA 4R81A 4D4JA 1R6DA 3FYUC 2Q5QA 4R5MA 3A7EA 3G3EA 1O7JA 4I3GA 4NJMA 1S2DA 5THQA 3SJUA 4QSHA 3UT6A 1VSTA 4H7PA 1I4WA 4UCWA 4Y0VA 1OZAA 2ODEA 2FWRA 4LMRA 4LV6A 2FPPA 1N4AA 2AN1A 2X1LA 3HWSA 2O52A 4QARA 2YHBA 4YQFA 5KJCA 3IUSA 2C2GA 2GOYA 1ZKMA 4JJFA 1WD7A 2Z8YA 4I9HA 4KKXB 3NS7A 3PNPA 4JH0A 4KSCA 4TYMA 1RQPA 3ND9A 2C2YA 4WEOA 1V0JA 2FDRA 3FFTA 5TJHA 4AZSA 3C74A 5EJ8A 4PGGA 5EHGA 4LHYA 4AZTA 3HDHA 3E22B 2VBFA 5FHRA 5BR8B 4N47A 4F4JA 5E2AA 3GN2A 1RAIA 4B46A 2UUCB 1ID8A 2XZDA 5CLIA 4IRUB 4MZXA 5FTKA 2PZJA 1JFFB 1OFUX 4YUVA 2PIDA 1G20E 2JAHA 2R9VA 2B0JA 4W1QA 4RZSA 3ZY6A 2JNWA 3T5PA 1PQYA 5FCDA 4F91B 4OQPA 2OGWA 3L05A 2P27A 1N6RA 1X0VA 5FBRB 2NUTA 5CD1A 2WT8A 5AOBA 3K1JA 1E7WA 2ZJBA 3WGKA 3Q88A 3MUFA 2YZKA 3AH8A 3UYLA 3ZGLA 2EFHB 2VTKA 3EVAA 3B8EA 4KO8A 1T0BA 1WLYA 2QMHA 1RLUA 1G0NA 1R4NA 1UFKA 2IDKA 3DDHA 1QAMA 2OFXA 4IRXA 4PLHA 3HI6A 3VH3A 3WADA 1PR6A 1XU9A 1UODA 2O06A 3CWCA 1V9CA 2OMEA 4NQRA 3CPEA 5CFNA 5HKKA 2NQ8A 3HB5X 1AUPA 2OD2A 1Z39A 3AXSA 3TQHA 1UOEA 4CLDA 4ED9A 1U0NA 2FPGA 4BYGA 4BN0A 1K7FB 1T2CA 1YZFA 3KXIA 3SZ3A 4RK1A 4A1OA 3ZS8A 1NE2A 4B6JA 4DDTA 1XPUA 4A0HA 1N92A 3D3EA 3OEHA 4WXRA 1QIFA 3W5JA 1TW2A 5HZGA 3R6WA 4X66B 2IYSA 3BCUA 1Q74A 4KAAA 3ESAA 2I6QA 5JH7F 1R8QA 3OZEA 1W19A 2Q1TA 4UM7A 3CNBA 2W2KA 2OGTA 3DHNA 4QEZA 2HO4A 2WW8A 3KDSE 3F6SA 4QTYA 5KYUA 1EG7A 4NG5A 4DV5B 1XMVA 3OH8A 4C4RA 3EIQA 4L6AA 2EG9A 4YX9A 1BCSB 1L5HB 1I2DA 3K5PA 4GU5A 2AV6A 4F3YA 2CMDA 4XFKA 1D2GA 4BUCA 1KRWA 5KIAA 4H4DA 1QO7A 3GZNB 5TSDA 4H7FA 4EEXA 5J1SB 2FZGA 2QB5A 1QKIA 2IGTA 3I6QA 3ELDA 4WN9B 4YCAA 3SLKA 5CNIA 1KI3A 3TVYA 1Z17A 2GN8A 4DOMA 4BQEA 5DVZA 4FIDA 3SSMA 3O91A 4EQ6B 4DR3B 3HWX1 3KSUA 4XIIA 1T5LA 4HRVA 3I6YA 5AM4A 1JE1A 2D74A 2IGBA 2VATA 1IMJA 2WTNA 2X9GA 4NCKA 3THSA 5KTSA 2YVQA 2GTPA 3ROFA 1I7LA 1E9FA 3ONEA 1ZEJA 4KFUA 4YLEA 1TDJA 1WXWA 3EOBI 1V95A 3NIDB 5F7XA 3IA7A 1O94A 3LQQA 2WMDA 1ZCBA 2IUSA 2DQKA 4B5LA 2XQGA 3C5VA 1CFJA 3C85A 3UXHA 1W49A 1X94A 5JVDB 3DKVA 4CLOA 2ZS8A 4FE3A 4EFMA 1SEVA 4G56A 3TG8A 5KVQA 2Q3HA 2BR5A 2ZXFA 3D7NA 4DQUA 1ZYUA 2ZBVA 3VUEA 5TQ2B 4R71A 3KSRA 1XP8A 1MDBA 3IQHX 2JK0A 5CYOA 5DCLA 4LTMA 4R4JA 2OVFA 4TWRA 4N7RA 5DHAA 1NRIA 3SZRA 4PTZA 1ZMRA 3TZBA 3V1UA 1OHHD 3GMSA 1KJ9A 3QEMA 4HNHA 5HBRA 1EFUA 1BWRA 4BMXA 4YCDA 3CGGA 3L7LA 4Q1DA 2ZB2A 5LFAA 1GPLA 1GRNA 2W0SA 5JATA 2WSMA 2O7SA 1CJKC 4RF4A 1RZRD 4Q9NA 1IFXA 1VKHA 1YH3A 3JASB 3LUFA 3MWYW 1X7GA 5KYWA 3ZJUA 2GVZC 2HCFA 4ZHSA 2BJWA 3D4NA 2TMDA 3BUSA 3ETNA 1JMYA 2JGNA 4MRNA 2G88A 3CVOA 2J7PA 2P9QA 4UE2A 1P1BA 1XVIA 1D4ZA 1VE7A 2NSHA 4GKVA 1MU0A 1SJ9A 3CEAA 3A0UA 4J1TA 1O9GA 1QGUA 3GO4A 3SF8B 2RIRA 3LRTA 3O8RA 1PVOA 3EIFA 5CYFA 3ZEIA 3AM5A 2YBEA 3M6LA 3PE3A 1SQGA 1UBGA 2H57A 3PP8A 1NYTA 5KNBH 1NQAO 3U5TA 1NBHA 4M2LA 4RPGA 3O4HA 4C08A 3FNGA 4MV8A 3LUAA 4QTUB 5CFMA 2OGSA 4YAUA 1R2QA 5IG2A 3IUYA 2GEBA 3IAHA 2CNOA 4DPMA 1FYDA 1Y80A 4DZTA 2Z9CA 4LC1A 2QJRA 2YHUA 4PC1A 5CBPB 3HJHA 1JE0A 3BERA 3PLNA 3PPVA 4MUIA 4WZBE 4X84A 3THOA 2BDEA 5L4SA 5BR7A 3U1VA 2CXTA 4PZ9A 2PHZA 2Q3MA 4XH9B 2BZGA 1G21E 2MR5A 3KLNA 1M66A 1ELOA 1TJYA 2OXIA 3G5AA 5D8DA 4YUAA 3EZ2A 4JB0A 2BGJA 3UKDA 5P8WA 2IKSA 2QVCA 2WKPA 5D85A 4BV3A 4Y2HA 3NWBA 2A1UA 1Y3FE 3EOAI 3VOSA 1E1CB 2W00A 2WWYA 1V2GA 3O4IA 4HB0A 4UHFA 1R0YA 1KJIA 1ETUA 1Z2DA 2I54A 2IEZA 1AF7A 1CUIA 1ONPA 4KI0A 4MQUA 4DLAA 4HNUA 3PLAE 3MBIA 3D5QA 5EMMA 3H2KA 5ICCA 4HAXA 4RK5A 3WBFA 3WL7A 3OQHA 4MYRA 3EJ6A 4PAOA 1LPSA 3WFIA 3GARA 4PQFA 1XXHB 1RLJA 3D2AA 3T0FA 3ZK7A 5FTLA 2Z8YM 4MVJH 1AT1A 1YKGA 2B3DA 1VZ3A 2NVWA 4YMWA 4ER0A 4NAVA 1PZXA 3TX2A 5DK4A 1CR4A 3DO5A 3O3OB 3TW0A 6GPBA 4X5OA 4C03A 3G8DA 5IFLA 3C3KA 3TD6A 3CEJA 4B9AA 5HPYB 4KO2S 3RYIA 1SUAA 2VUHB 5GVRA 3RTDA 3SI7A 4P0TA 5CITA 3KQVA 2PT7A 1JKJB 2QVLA 3THRA 4ZYVA 2NGRA 5JSYA 1KDPA 1XKXA 3D6FA 3M9LA 4E32A 2I87A 4QUBA 5T41A 4MO9A 1E9DA 3SC2A 4YCJA 4X3CA 5AM2A 1DGQA 4MPJA 4Y1RA 2IEYA 4NBRA 1YQ9A 2OFOA 2VDMB 1YU6A 4U6QA 2XSZA 2Z5FA 3TBHA 2YZGA 3LHSA 2CHEA 2D5LA 4H31A 4RTNA 3IP1A 4AIRA 3U48A 1N2GA 2N9UA 1T9ZA 2OFWA 2OHVA 1CEYA 3OEHD 3AWIA 1S2NA 4GEKA 3WZLA 4XWOA 4A73A 1I3CA 1GU0A 4Y6PA 3FOZA 3MMNA 3RJMA 5BWMA 1F1BA 3L8HA 1ZSVA 3O82A 3EVEA 1TEVA 4DLVA 4HDQB 4LGCA 3SS7X 3ADCA 4FMDF 2Z2IA 3HZZA 3ITDA 3L7DA 3QUSA 3S27A 5LQMA 4D25A 3UJDA 4JI3B 1OKKA 3MTIA 3ZH2A 4F2PA 1O9BA 1UJ5A 3MERA 3V2HA 3ZLVA 4GWLA 3VHLB 1K7CA 1JZQA 2HA0A 4RJTA 2XUAA 4PFKA 1ZESA 3NYIA 2WIBA 1S7CA 3CINA 3P96A 4ZRNA 2QEQA 3P52A 4Z99A 3EXEB 4Q03A 4YQZA 3VR3A 1OLUB 2HJGA 5JECA 4XGRA 2H1SA 3K1ZA 1M7BA 4J6EA 3W8DA 2Q29A 3OE7D 1NVBA 3T0GA 2R60A 5LOVB 3T4EA 2YX1A 4MVJM 5FR1A 1O95C 2W2OA 3KB6A 3RK0A 3U7HB 4RFSA 3LSYA 1J49A 4EJSA 5CIQA 1Y7LA 3IQEA 4G26A 1Q1QA 3OEED 4MW4A 2F9MA 2OG1A 4R2KA 5EI5A 2UUBB 3AEZA 4B81A 2ODQA 2XBUA 3N8KA 4IHAA 5IW8A 1RBQA 2FH5B 2R8BA 3EVZA 2CVFA 4XD7A 2YV2A 5D1HA 3U56A 4EO7A 2E85A 3AF1A 3BXPA 2ZQYA 1WQ4A 1BRMA 3ORFA 4JJ4A 4NK5A 4TS9A 1D4FA 5B3KA 4EZBA 4R01A 5A9RA 3C24A 5IT5A 2XWPA 1FBNA 4O4JB 1DUVG 2G28A 1VP9A 2XD4A 3GIDA 1Q0ZA 1SBZA 3QVUA 2O1WA 3H0KA 4Q1BA 5ITVA 4KV9A 2ZIZA 3KUUA 4O59O 3CG4A 2IOFA 3PZBA 1DQSA 1BN6A 5D5PA 3S2EA 1YI1A 2NV6A 3VZDA 4XM1A 1Q14A 3JR7A 1SUCA 3T35A 4L0CA 5DP2A 1U1CA 3CTPA 4WOKA 3T6KA 5FBVB 4X00A 4TL8A 1OH6A 3D43A 3SS9X 5DWVA 3EMBA 3CEPB 4P2BA 5HJEA 3WGZA 3IEMA 3BD7A 4UQOA 5EWLB 3KQLA 3QEBZ 1B3RA 2ZCJA 1R0BA 1UK8A 3RIXA 1L4MA 4BQRA 4C4TA 4GYKA 1DKMA 2RONA 3IBTA 3R7WA 4PAQA 3OM9A 3FN4A 3OE4A 2R7MA 3OFJA 4MKZA 5BWOA 2ARKA 3AHJA 4BRSA 3H04A 4BV8A 4C4PA 4DLLA 4W5WA 1D7OA 5CDGA 1ZSNA 4LA4A 2IDJA 1LKZA 1Y7PA 2ZUDA 2E4WA 3Q3HA 4M7RA 3LUPA 5AKIA 5K0TA 1GQFA 4BLSA 1FQOA 3B5EA 1A7UA 2GK7A 4DPLA 4NMXB 4PN7A 1WNTA 1AKYA 3GP5A 3M2TA 3UWDA 4UHHA 4EMSA 2AFIE 4JIMA 4QXAA 5F51A 3DVAA 2MDTA 3P4YA 4ARVA 5B1SA 4BWFB 4CT0A 4DHEA 4IGIA 4S04A 4HLQB 2H8KA 2WG0A 5LNK1 4LF9B 2VDUE 3K5WA 2H0AA 4JBGA 5KOHB 3F74A 4MKFA 2BGKA 2IRWA 1XZCA 2DLDA 2OENG 2KQUA 2QJWA 2WTEA 1SCDA 3H2GA 3SQOA 4KN8A 4JLWA 4MLCA 5DFAA 5HK9A 4HF7A 2Q5FA 1FX0B 2FPKA 4YDSA 3USES 3ERCA 5HE9A 1JQBA 2J67A 3QXGA 5UKDA 4YMVA 1DAMA 3W78A 3PWSA 1AHIA 1ML3A 2AXPA 4K1LA 4PFSA 4A23A 3E9CA 4INOA 4FONA 1U94A 3E5RA 1MRSA 4DLUA 5DM2A 5EP3A 3VU9A 1GTVA 1SKYE 1XG5A 3DXXA 4M7PA 4BEWA 5G0UA 1XTUA 3VH2A 3B5JA 4C2TA 4D8XA 2Y0CA 2Q7XA 4CW7A 3KSBC 4ZT3A 3TFWA 3VNBA 5D5QA 1NDUA 1P9RA 3QK7A 2IEIA 1EFHA 3QE3A 5IDXA 4F4IA 4Q1CA 1N8TA 2QPLA 2O4UX 2UVQA 1QOZA 3HSYA 4ER6A 3ZDZB 2PY6A 2WICA 1MW9X 2VK1A 2R5NA 1U3VA 4CJXA 5D3ZA 5ES3A 4YIHA 4U7DA 1RRKA 1XA3A 1PIWA 5ALWA 1A0OA 1NV9A 5T7BA 1E1CA 1H9CA 1DAIA 1KFBB 2WU3A 3IJEB 2IP1A 3DV2A 4QFMA 1D6MA 1SM4A 1W0KA 3HCFA 1BVYF 2PD4A 4QBHA 4RPCA 2JI4A 2QQ5A 3JW8A 3ONVA 2NXCA 4CM8B 5EUCA 4BNUA 1JQ5A 4ZT2A 3MCWA 4NVRA 1XTKA 3NJ4A 3AR5A 4LMAA 5C7LO 2AI3A 3WNZA 5M5BA 4EBFA 3RIMA 5IAJA 4EEZA 3R7NA 5B6JA 1QPGA 1WMDA 3AV3A 1L5HA 2R87A 4P7FA 2GNAA 4Z8XA 1JYFA 1ZA1A 4WXEA 4YRSA 5C8YB 2DX7A 1I32A 2WA1A 2IOQA 1S5PA 1NMXA 3ETLA 4GKKB 4N48A 3FW1A 3UHJA 1IN4A 3E15A 3ESYA 3A6LA 4TSKA 2ZS9A 3NBFA 3B70A 3G2IA 4X9XA 1QP0A 2W6NA 2JHCA 1ZWLA 3ZU5A 5KYYA 4QPCA 1DPGA 4OQEA 2LIVA 1YDGA 1U3FA 3JWEA 2Q9BA 3LUJA 3QOFA 4R6WA 2YYAA 2D0IA 3CU5A 3B1XA 2BMJA 2B9VA 3KEMA 1TD9A 4KTVE 1GEGA 3BA6A 1XAHA 3FNQA 3QIVA 2REXB 3N75A 4DWWA 1Z2PX 3AGQA 3ZXIA 2Z09A 2C8LA 1UBLS 1MOPA 3PFIA 3N2YA 2ET6A 1NZJA 4Z4FA 4XIGS 1KU6A 4NFHA 1T4GA 5DRTA 3GGDA 3JYOA 3L2OB 5JJBA 1QP7A 2XDAA 4MVJE 1VRVA 4BPBA 3WIDA 1NT4A 3MJ4A 3K15A 4MLPA 1AMNA 1DUSA 1U8YA 4KZKA 5C8ZA 3MHPA 2YUIA 4LS3A 2Z6QA 1XRSB 2ZT5A 3TLBA 4PZCA 2YWDA 1H93A 4EJ2A 1JIIA 1IMOA 3OJFA 4CQLB 1XFAA 3PC4A 4KJXA 3FTDA 2H85A 3BXXA 2M1XA 4CL8A 2XGGA 1MB3A 2Y67A 5SY6A 4W5OA 5E6UA 3MGKA 2R6FA 3U7GA 4GPTA 2R7KA 5M29A 1EMDA 1S2OA 2FJPA 1T4BA 3PNVA 3IDSA 2Z2ZA 4QPDA 3DMTC 2C0PA 3AVPA 3NXKA 2QRKA 4MGHA 1XDWA 4YK7A 3GX1A 1TEXA 4M38A 4C0AC 5KC9A 5H8WA 4MQMA 4PO3X 2UZIR 2EU8A 2HH9A 2ODWA 2PK3A 2WI8A 1HFJA 1PL8A 1M1NA 4O0LA 1DQNA 1H2FA 2PEZA 3IAM1 4N5LA 3VU0A 1BVHA 2LDXA 2PR2A 4NARA 4GDFA 2W70A 1OC2A 2GB4A 1NFFA 1GZVA 1B15A 1JR2A 3L6DA 1UJMA 4EPXA 3KQUA 3RSCA 4BGDA 2Q62A 1OLXB 1CF2O 4BBAA 2HHCA 3PQ4A 2H16A 3K9FC 2IU0A 4DA0A 4Y98A 3WRWA 4IG4A 4TL9A 1R8JA 3VJKA 2FFQA 2N1BA 3E2IA 2WUDA 3IEIA 5FBZA 2ZLBA 2W2LD 1BCRB 1K2WA 2IOHA 4XOIA 3ZCTA 4A6EA 3B85A 4XVQA 1NBMD 2B7LA 2HU8A 2WHPA 1WVGA 5FQOA 3QLEA 3KR1A 4OUDA 3ZQUA 2XGSA 2J7PD 3HYRA 3KR2A 1FDOA 1NLZA 1AQ6A 1LRKA 3EN0A 3LO8A 4L6IA 4TTIA 3KXDA 2BKVA 3NIWA 3UAZA 1YR9A 2J3QA 1P74A 2GD0A 3N76A 1JU9A 2IHZA 1KEEB 1VIYA 4GMXA 4RVGA 2EZUA 2CLLB 2RH9B 4NHOA 4DMRA 1SOUA 3MOGA 3CLTC 4HRXA 3N59A 1H2XA 2VPWA 3UFXB 1LCIA 1QFMA 2PUBA 1F4VA 1DUIA 3QKRA 1KP3A 1RE1A 2YHSA 3WKEA 3TGPA 3BB3A 1OIVA 4OHZA 4RTQA 4Z3OA 3DONA 4EY6A 5JJLA 2VPXA 2X3YA 4BO5A 3B2QA 5FPYA 2PBFA 3IAS6 5JQGA 1PZHA 4YYEA 4UFOA 3ZOZA 3MWKA 4LYDA 4BC1A 3LO5A 1XWWA 1Q50A 3L7MA 2QRZA 1VA4A 2FA9A 3M4JA 3AV0B 2FKAA 2WJAA 1K0UA 2PD6A 3PUYA 5EY5B 2VQFB