3ER6A

Crystal structure of a putative transcriptional regulator protein from vibrio parahaemolyticus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
192
structure length
192
Chain Sequence
b'KNLRVVALAPTGRYFASIISSLEILETAAEFAEFQGFMTHVVTPNNRPLIGRGGISVQPTAQWQSFDFTNILIIGSIGDPLESLDKIDPALFDWIRELHLKGSKIVAIDTGIFVVAKAGLLQQNKAVMHSYFAHLFGELFPEIMLMTEQKALIDGNVYLSSGPYSHSSVMLEIVEEYFGKHTRNLGNQFLST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator protein
publication title Crystal structure of a putative transcriptional regulator protein from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
total genus 62
structure length 192
sequence length 192
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3er6A00
2VPIA 1QDLB 1FY2A 3ER6A 1GGKA 4Y1FA 4I4NA 4Y1GA 3WFZA 1QF7A 3R76A 4ENTA 5JZOA 1QVWA 3UK7A 5LIRA 3TTYA 2ZUUA 3NVAA 3NONA 1T0BA 3SF8A 1CS0B 2ZUVA 3TTXA 2YWCA 2GK3A 4LRUA 3ZJ4A 4GE0A 4Y0NA 1OX5A 1T3TA 5SY6A 4ENWA 1K9VF 1GGFA 2H2WA 2RK4A 4P5PA 4QYTA 4AUNA 3L3BA 3GRAA 3M3PA 3EWNA 4L7QA 4ENPA 5E9AA 3TTSA 4UCFA 4RKWA 1OI4A 4QYXA 2R1TB 2RK3A 3PQ7A 2ISSD 1PE0A 4OIFA 4WXYB 3UGJA 1U9CA 5SYAA 3TTUA 1VCMA 3F71A 1P81A 1KWKA 4I46A 3PQ2A 4BIMA 3BHNA 3F5DA 4L8WB 3PQ4A 4OGFA 5SY9A 4BFLA 1A9XB 2ZUWA 3L7NA 2NV2B 1OX6A 4WINA 5DFAA 4E5VA 4ENRA 4I2NA 3TTTA 2AD5A 4MNTA 4XLLA 1CF9A 1OY1A 4ZDJA 3D54D 3MGKA 2YWJA 3MIIA 1VCOA 4Y1RB 3CZAA 2ZUTA 3OT1A 3ZR4B 4AUEA 2YWBA 4Y1EA 3P9QA 1PV2A 5SY4A 3CZ9A 1C30B 1CE8B 1G2IA 2R1UA 4OQ4A 5IP5A 4B5KA 1KA9H 3PQ6A 1IZZA 4L8YA 4ENQA 3B38A 4ENVA 2ABWA 4ZDKA 4P35A 3R75A 1PDWA 2XF2A 2R1VA 3UOWA 4UOZA 3TTWA 3PQ3A 4RKYA 4N12A 4L78A 4ENUA 3ZJ5A 3UMMA 3P9RA 1JDBC 1M6VB 1T36B 1OX4B 1P7ZA 3KKLA 3L4EA 4E08A 1GGJA 1ONSA 2ZUSA 2D7JA 2W7TA 4ENSA 1KWGA 2RK6A 3NOQA 3R74A 1P80A 2A9VA 3EN0A 1GG9A 3B36A 2WJZB 4AJ9A 2AB0A 4JQSA 4L8FA 4L95C 3PQ5A 4AUMA 5BV2P 4ADSG 4MGHA 2R1TA 3EJ6A 3NORA 4B40A 4LGYA 4AULA 3CNEA 4B2YA 1VCNA 4HCJA 3CYFA 3TQIA 2YWDA 2VXOA 3N7TA 3P9SA 4P36A 3RHTA 1IZYA 3SF8B 4MTCA 1KXJA 2FEXA 1WL8A 1GPWB 1P7YA 1R9GA 2OR3A 1PDVA 3NOVA 4ZGGA 1J42A 4OGGA 3B3AA 1SOAA 3CY6A 3P9PA 3L18A 1QVZA 1S1MA 4K2HA 4PXYA 1BXRB 4S0ZA 3NOOA 4Y1RA 3VU3A 5JZMA 2VRNA 1P5FA 1Q7RA 1VHQA 3UJNA 1QWSA 1QVVA 2NV0A 3EFEA 4OJYA 2VKTA 4ZDIA 3PQ8A 4B31A 4P2GA 3EZGA 3FSEA 1Q2UA 1GGEA 1C3OB 1I7SB 1I7QB 1IPHA 4UNIA 1I1QB 3FIJA 2IUFA 1N57A 1O1YA 4BTEA 1OX4A 3OT1B 2GHRA 4P34A 2V4UA 4N0MA 4R7GA 1GGHA 4B7AA 1L9XA 1FYEA 1UCFA 4GUDA 4OFWA 3SOZA 1JVNA 4GE3A 1KEEB 3TTVA 1GPMA 2LXNA 5K4AA 2VDJA 1SY7A 3BWEA 4UOQA 4D1YA 2R1VB 4UZSA
chains in the Genus database with same CATH superfamily
1VBFA 1P0QA 1Z0JA 3C3DA 4BMNA 1MLDA 3GP3A 1SXJB 3HZHA 3QGMA 4HH3C 4DV3B 2IYFA 2FK8A 5CB4F 1G7CA 3ES9A 3NBYC 4I50F 4RZ2A 2C07A 1DJQA 1XZAA 1ZZGA 2JGAA 4EBFA 2QL9A 2WJWA 3SEFA 3PKJA 4G07A 1GGFA 2NO7A 3AM1A 2GPJA 2JAUA 3GOQA 3HDYA 4RLFA 3C98A 3VYUB 4N41A 1FFWA 2Q8NA 2XSZD 1HYHA 3M8KA 2PD3A 1NW4A 2AXNA 2RGNA 3G9ZA 2REBA 3PQ7A 4HQNA 4U7FA 1XMIA 4ZU6X 4EW1A 2X5JO 5AUOB 3KLMX 4M1OA 4MJLA 2OG1A 2NSDA 2VP9A 3KV1A 1TT7A 2BBWA 3EUAA 3F74A 1Z5ZA 3QKUA 3QLTA 4MPPA 1H8EA 5I9SA 4TT3A 1GNLA 3B1XA 3IV6A 3L7NA 2NV2B 4UUBA 1JHAA 4XVQA 3WBJA 2ON6A 2OXFA 1C1XB 1QHFA 3T5AA 1J0AA 2ECKA 3QTLA 1GQSA 1LK0A 4G4SP 4N8SA 5I5GA 2ZAMA 3HXOA 1B16A 3I2KA 3M82A 3TOCA 1MOPA 2HV8A 4CMAA 2X5OA 5IZCC 1ZNYA 4IX1A 3U80A 1SZCA 3J80A 1E4OA 1TD9A 1YIOA 1R0XA 2XECA 3U49A 1DL5A 4O59O 1N3YA 4HNUA 3K0FB 1F0NA 3LCRA 1OGIA 3OZFA 1VHLA 2AJCA 5AK0A 2JLQA 5BQFA 4YPFA 1CQXA 2ECOA 3OEED 5DK6A 1DKMA 1FW8A 3QNUA 2BT4A 3V4FA 2B37A 2P7HA 5C8YF 4CQLA 1XALA 4JFAA 2D1QA 2IOHA 2JJMA 3VC3A 4R1PA 2JIZA 2P67A 4M37A 4QUBA 4UHBA 3HJUA 4CV0A 3I23A 4PHHA 2FWPA 4PZUA 4H59A 4EUHA 1VYVA 3KOOA 1GV1A 1HZZA 1BKSB 1NP3A 3QXHA 4OUDA 1JZQA 1L8LA 3PB3A 4XM2A 1YF3A 1JH9A 3RQSA 1VKJA 1DRKA 4FONA 1AGYA 3TLKA 5L8VA 2OV4A 1MB0A 1ZN2A 2NZYA 3I6QA 4B4KA 4JLPA 3ACDA 2R1TA 4R1UA 2YUTA 3GGPA 3I64A 1UEXC 5TX7A 3WBBA 2A33A 5JJBA 1EUCA 3GJTA 4H7EA 5AK4A 3DLIA 3CRW1 4R2HA 4TM8A 3EA5A 4ZZIA 4DLZA 1Y8ZA 4RD2A 3BL6A 3AFMA 3R7NA 4CODB 4ZALA 5HUQA 1GPWB 4OQQA 2O8FB 1ZBDA 4FU0A 3V2IA 3VH4A 4CCYB 5DIZA 3I53A 2O0HA 1TVCA 1JSXA 3DOOA 3FMPB 1I0LA 4HFMA 4XGRA 3TJMA 3AEZA 4F12A 4J4TA 4QLOA 1QIFA 1SPXA 2P91A 4D81A 3FYTA 3KAQA 2QX8A 3CF6R 4EB8A 1R10A 2PH1A 2JLWA 4HMOA 5EWMA 4GSLA 1GQRA 2IZOA 3G2HA 1MTOA 3QVMA 1G8FA 5BUQA 3KQQA 3ADDA 1EGAA 2ZK7A 4PSAA 1TMYA 1AHNA 3HB0A 2QY6A 3TNYA 1AO0A 4CU2A 4M99A 5GJBA 2WM9B 1SG9A 5HIJA 3UXYA 4ALKA 1WMSA 4S2UA 4HV4A 5EJ4A 4H3SA 2JFBA 4OU5A 2VAVA 3KR1A 4ZVRA 2PK3A 3ZXSA 5I7SA 3T7RA 2OHIA 1CUCA 1EVYA 1JALA 1KDTA 1QX4A 1PO7A 1P61B 2XIJA 3PGA1 4DZZA 4FB4A 2QUKA 1Z62A 3DD5A 1ZW1A 4FKZA 4A9AA 3DZ8A 3KNZA 4B6GA 2AFIA 1RI5A 4HDRB 4OXQA 1E63A 5BYAA 1CTQA 3FM9A 5A1JA 4YH1A 3MT7A 4YRFA 4D8TA 2EKDA 4L6CA 3L7LA 1N0UA 3L1UA 4YASA 2ZIWB 4JELA 2Y0PA 3OKCA 4LS3A 1J8DA 4WXEA 2NIPA 4RGQA 4OQYA 1PN3A 4RM2A 4OHCA 3U31A 3WNBA 5CDYA 4U1RA 1YS2X 4JGIA 1R6VA 3S29A 3GEMA 1VYUA 1ESCA 2PXXA 3K70C 2OLEA 4XTRA 3WIUA 4FDLA 4EJ6A 5GMOA 3PQEA 1HM5A 2O6LA 3K6JA 2ZQ5A 4L02A 4TWAA 2ZDQA 3H87A 5AVXA 1QWOA 3IRUA 1N9ZA 1Q44A 5ESRA 5KOJB 3U4MA 1VC2A 1ZCBA 5LMUB 1E0SA 4JLVA 5DSZA 2YZNA 4Z4HA 3ZWWA 1OX6A 2CXUA 4DHEA 1T3GA 2EEPA 3CX6A 2YS7A 5BQ3A 4JJ8A 4G01B 1WNFA 4JUIA 2XTAA 3CX4A 1PJLA 3NT4A 2ZWOA 3AWDA 1KIAA 1NF3A 1J2RA 1JXQA 4UUPA 3FLBA 5J4KA 5D5PA 5ADHA 4P84A 2GXAA 1N2JA 2A2ZA 4HH4A 2Y4OA 1BMTA 4PFJA 3WR5A 4ZI2A 1BCRB 3BH0A 4GOLD 2DR2A 2AYXA 3B6MA 4MS1A 2FUG6 1YK0A 4BLVA 4RTOA 3DZDA 3LCVB 2JLYA 2R8EA 4JEUA 2LUOA 1U5CA 1UBSB 3I4LA 1ULUA 5H70A 4ZAFA 1NBMA 5ALNA 5C46F 1TB4A 2DWUA 2GFIA 2ZUSA 4NJOA 4YAJA 2NU8A 4DS3A 1RQRA 4MW7A 7MDHA 4QQNA 2PTGA 4WESA 1VSVA 3H4IA 4ZCSA 1VPDA 1GQ2A 3KJEA 1CZRA 4QHTA 3R0XA 3U16A 4ARIA 1RI1A 2PWPA 2OXTA 1B3RA 1UQRA 1RJDA 4ZGGA 1S3IA 2CEAA 5FYQA 2DXIA 3GFRA 3UY4A 3OJEA 4E13A 1A5SB 2XNSA 2B8WA 4X1YB 3BQMB 1ADBA 1W5FA 1A9QA 3TKAA 1THZA 2F9FA 4WGGA 2BUAA 5I47A 1OBOA 1YD7A 4CG2A 3E5HA 4OB6A 4RAOA 4R9NA 4Y18A 3EEQA 4DSOA 4ER3A 1LKZA 2W58A 1LEHA 3PVSA 4O1HA 4X7MA 4EMTA 1KSHA 4EW2A 4YR9A 2NSLA 1GXSB 4IV5A 1ECGA 2IW3A 2H8KA 2NVOA 3KWFA 1OLUB 1S01A 2DUUA 4R1QA 5BSUA 1IN8A 3NASA 2EDAA 3BTUA 3L84A 1WA5A 2XQJA 4CCWA 4XYMA 4Y8VA 1QGZA 3EBOA 2H7CA 4GI5A 3NBMA 3W1EA 5AD1A 4UNIA 5AUNB 1EFLA 1WPGA 3UT6A 4QQRA 3CLUD 3WIVA 1XMQB 3AF4A 3FR8A 3L07A 3N58A 2OHOA 4DCTA 3AKCA 3GWZA 4B76A 3R9XB 1DKNA 3FFTA 1AUVA 4J1TA 3R6WA 3JQ6A 4JS0A 5LQAA 5IWAB 2JGMA 2YJ5A 3CVWA 4PHTA 2NO0A 5DV9A 1FP2A 1ZXBA 4ZGBA 5A0TA 1WR8A 3OTHA 1TA4A 4EM6A 3JR7A 1AOXA 1RM5A 1YR3A 4W8OA 2CNLA 4E6PA 3S40A 5H3CA 3DCNA 2JGDB 4HQRA 3RUAA 1ZGAA 1ULZA 3RU3A 4AJJA 1YQQA 1IB0A 1G3UA 4AJPA 4ZK2A 4YVFA 1IONA 1X0XA 1CU1A 1X8XA 4HKTA 1G7RA 3KD3A 4V0OA 4JA2A 1U3FA 3QKIA 2IS6A 1OPXA 1A9SA 4G1UC 4KQCA 4AUNA 1GTJ1 2QV7A 3GNSA 3AVYA 1U8CB 2W6JA 2PA0A 3T9CA 3OOJA 1VKZA 1GU1A 4MB6A 4TWIA 4IL5A 2GT1A 4CGYA 3C15C 3Q2IA 3GJ5A 5T4BA 4OH1A 1Y34E 3H83A 4H6WA 3OFJA 3LYAA 2NTVA 4F84A 3GAFA 4YRNA 4W5RA 2WKSA 1XYVA 3DE4X 1LPMA 5DHUA 5EIEA 1F2TA 3MOIA 4EVIA 1B00A 1CR4A 1IWOA 3O4HA 3S28A 2J30A 2JFOA 3Q3IA 3DDZX 1ODKA 2BJHA 3DVAA 4R1OA 5FBVB 5CVVA 2A9RA 2G0TA 4JQCA 1XGKA 4UZFA 3FMGA 1FTWA 4QJ5A 5KC9A 2GJ9A 5E0KB 4ENVA 3EXFB 4ER0A 3NHBA 4G9GA 3DA8A 4CUJA 1DKUA 2QT9A 5JAHA 1TM4E 4B6QA 4Q19A 1WUJS 3TSZA 1YHZA 4JEHA 4H3VA 4IOLA 4KO8A 2NNLD 3QX3A 3N39C 1TCCA 2JZNA 4IXNA 4WJKB 3AINA 3DHVA 2M32A 4DQUA 4UFPA 1P1IA 5IVHA 4C05A 1TD1A 3OUUA 2Q3CA 3R8FA 1R5BA 4WPGA 1PYGA 1WX1A 16PKA 3A4VA 4ENSA 2C2BA 5CDTA 1EMDA 1XXHB 2OY0A 3A1NA 4INZA 3UT5B 2YV3A 3UXMA 1J5EB 2WLTA 3HTXA 1K6MA 3N7UA 1OBCA 2ZBEA 3OZUA 5A9RA 2FQXA 4TLBA 1A9PA 4GGMX 1OFUX 3ZIDA 1W93A 4RH1A 1ZU4A 3OE1A 4A6DA 3F6CA 1Y1QA 1NC1A 1V6AA 5CJJA 1H0SA 2E2WA 3LS2A 3LKBA 2C59A 3W2FA 4DAOA 1K68A 3TBHA 1GL7A 5CAEA 3ABZA 1TUBB 3JQRA 4BCCA 1Y7PA 3PUWA 4RHCA 3RVJA 3T7TA 4CEJA 2Y0DA 2ZVJA 4ABYA 3GLFA 4RPJA 2Z5VA 4Q1EA 2PZJA 2XTMA 2CYAA 4NBKA 4TXHA 1QQ6A 1QVZA 5GV8A 2A3RA 1X2EA 1DIGA 5ALIA 3QWBA 2NO5A 3LQFA 1F1JA 2J3IA 3QPCA 3EF3A 4OY3A 6NULA 5HM8A 3E7XA 1OWPA 1NBHA 4K6MA 1WXFA 4G37A 1F2UA 1O54A 4DDHA 4HX5A 5LZ5A 3OICA 2NNWB 1JBEA 3AF2A 1SQGA 1O03A 3PR2B 1I36A 1XQVA 3KYDB 3CZQA 3TLGA 2FVXA 1LLCA 4FZVA 5D5HA 3W34A 3K0CC 1EUZA 3M89A 4BIIA 5JQGF 3ROKA 1WZIA 3B6JA 4EGJA 4YJ2F 1JI0A 3Q1KA 5FKJA 4GXTA 4FEGA 4JB8A 4R16A 3Q5GA 4YXWD 1SMKA 4UEQA 4B46A 3C8MA 2JFWA 1HRKA 1IIBA 4HLDA 2UYYA 3TRKA 5JFTA 5BYKA 4EA7A 1V96A 5CT5A 5CXXA 4YRTA 2PKYX 4MDFA 4IHJA 2YVAA 2GZDA 3B9QA 4H7DA 1HFEL 1Z6TA 1YKSA 5KYYA 4KXYA 1X9GA 3L04A 3V1YA 3T9AA 2VP3A 3ZLVA 1AUPA 4NVRA 4BLRA 3HCOA 2RHHA 4GRDA 2RCNA 4KBGA 3TAHA 1HGXA 1H2RS 1NLFA 2ZDHA 4FGSA 1GCOA 3H9UA 4QATA 3DZCA 4F4JA 4PAWA 3PNOA 4GWGA 2ZYUX 4J90A 4YRBA 3I58A 4WXYB 1LLFA 2GD6A 4I4LA 4YDRA 1JPJA 2A3NA 4OHZA 2NVUB 4F91B 2QUIA 2XMBA 2WZQA 5LZ7A 4OGWA 1IY1A 2PUJA 4YACA 3GJZA 3Q9NA 4JUDX 1ANKA 4QELA 4KG7A 5ALKA 5GOTA 1B1CA 1EA7A 1R50A 2X3YA 1PTJC 3DV2A 3R6DA 3LDHA 1W19A 4NU5A 4PO9A 1C50A 2HJSA 3JU3A 1NWCA 2RKOA 4DV7B 2P68A 2XVXA 2XYQA 2XY4A 5ALZA 3O1JC 5AVVA 3TUZC 3SEAA 3PX7A 4N3BA 3MCAA 4EL0A 2F1RA 1U3TA 1GNQA 3AI1A 2IYEA 1KYZA 1JE0A 2BM9A 1HDGO 2ZWMA 3GT3A 1XAIA 3M9XA 3N8NA 3N9IA 2XBMA 4QRHA 1RCFA 2HIAA 4YHBA 4OA5A 4IIJA 4E12A 2V45A 2RGDA 1ISHA 2O8DA 3DE5X 1VLZA 1EXMA 1XLUA 3EUFA 5THKA 2OM2A 5TGZA 2YNMA 2OESA 4MPDA 4MVYA 1JSRA 2IYWA 1NM5C 1CNMA 5IWCA 1QYDA 2JAPA 2V9PA 4KSBA 4NPHA 6PFKA 3T3OA 1BVYF 3LC0A 3PHGA 2JHAA 4IEEA 1E3WA 3PEUA 4CM7A 1QYRA 3C5CA 1TZ2A 3R74A 9LDBA 2B6HA 3WP0A 3IUPA 3H5VA 5FLKA 4PEVA 3ZXYA 4AN1A 2VQEB 1VCIA 2UYOA 4MXDA 4LDRA 2J7PA 3GMIA 5HUJA 1SUSA 1XC7A 1XK6A 2R65A 1Z39A 4MYSA 4QDOA 2VHZA 4QBIA 1B3BA 1QUFA 2VNKA 5FBQB 1MG5A 4PBSA 2ZPTX 5CXSA 4B0OA 2SECE 2QU8A 1GPNA 4M8IA 4NBWA 2FPMA 5EIBD 3BG5A 4EHIA 1EIWA 3CU5A 4X90A 2ZSIA 5C2JB 3HN6A 3MTJA 1A3CA 4I3FA 1MMFB 3PA6A 1WD5A 3IUQA 2FXIA 1ZNXA 4L22A 5JDIA 1JU9A 3WNDA 1E4EA 2VKTA 2PRIA 3LCUA 2QTNA 1KK2A 5A9SB 1ZKMA 2F1JA 1L2TA 2JAWA 4TL8A 4PNEA 3QP9A 1L7DA 4C3ZA 2FY8A 1NUSA 1U8TA 4LNHA 3RJ5A 3PRYA 2VTDA 3IL2A 3IDSA 2JHCA 2EEZA 1YVPA 1IQUA 3GLUA 5F5XA 2WJHA 1U0RA 1VHWA 1E3JA 1XTRA 3C3CA 4JZKA 4YLEA 5L9AA 2ZM6B 3IAAA 3OKFA 3DHEA 3VX4A 3I2IA 3I2JA 2WD7B 5CJPA 2H85A 2MMCA 3TRIA 2VDMB 3JYNA 1PL0A 4EZIA 4QFDA 2I7TA 2ZRJA 3UCXA 3GLVA 2B61A 3GRCA 1EK0A 1EUDB 2OYCA 1GZ6A 1PZEA 2SCUB 3OPYI 4IEIA 1S96A 1XMPA 2EZUA 4CG0A 2WU8A 3RFFA 3H1BA 1E79A 3ENNA 4QWWA 5LB4A 2IOFK 3CJQA 1YMUA 4XA8A 2BE9A 3MGCA 3ANMA 2O59A 1PFVA 1H9CA 4QGBA 1G41A 4GM4A 5H0IA 3A3NA 3G49A 3GW8A 3DV0B 1RLJA 1TM5E 3GROA 5C81A 4MYCA 1ZRHA 2H9AA 1RCUA 3T12A 3A1WA 1BE6A 5F2NA 4EJ0A 3JWIA 1LDBA 1OF1A 1YS4A 1NDHA 4J0IA 4AJHA 3KHSA 5M2QA 1E20A 4TMXA 3ZWPA 2I6TA 1W0JA 2ID7A 3QKSA 4D0LB 1AURA 4EI9A 4IIEA 3MGGA 4I55F 3KDPA 4OXIA 2VNAA 4M54A 2WP8J 3CUTA 2F7SA 3DHNA 4TUYF 5I7EA 3DAYA 3KEOA 3GLGB 3SNHA 2FWIA 4DZRA 2AOVA 5FFMA 3GI1A 3DO5A 2QI9F 2GN6A 1JWBB 2YYZA 1UT8A 3CKYA 5DYTA 1LUAA 3IQEA 2OBMA 5AW7A 5KREA 1YJ5A 5C4IA 5AW0A 1Z2PX 2PBLA 3A26A 4TWZA 1BG6A 1L3IA 2OLKA 2C95A 5IFKA 3FX2A 2PKXA 2UZ0A 4GG1A 4DLRA 2H11A 4O4LF 4F46A 3EVFA 2Y99A 1Q3KA 3G82C 2CJWA 3QPDA 2JI8A 3KR2A 1KAOA 1HURA 1XTUA 3PL5A 1O5IA 4IAOA 4M9XA 3TOVA 1IXZA 3PPIA 2EX0A 1ONSA 1C9DB 4JJZA 3C5EA 1JLLA 1TM2A 3VBEA 4CLEA 4QQKA 3OCYA 2JFZA 4HDQB 4DA7A 4DILA 2FPOA 1G5TA 5HA5A 1BNCA 1K0UA 4JLUA 2QUAA 3U4IA 1TU4A 2FHPA 5COQA 4TLCA 3WGIA 4JASB 1L5QA 3UN1A 5K0NA 5CA0A 2W2KA 1T3HA 3O8LA 3EPJA 2BR3A 4N0PA 4ZQEA 1OLSB 4RKEA 2XUFA 4AZ3B 2FEPA 2ZS9A 3NHPA 3DDWA 3RARA 2OGZA 2QGFA 1RQLA 1V37A 2WV7A 3DP9A 5FNVF 2AFIE 2GKOA 4FOSA 1AQYA 3Q7QA 5MN6A 4A15A 1HE1C 2JGEA 1Z37A 4FMCF 1FVOA 2I71A 1SOAA 2ZI5A 3P9PA 4KXLA 4RF5A 3VPFA 4D8WA 1NMQA 2QQFA 3NOOA 3Q2OA 4BNIA 3JQDA 3R9IA 5CB0A 5LIPA 3FWHA 4O1MA 3PQFA 2DFDA 3IT2A 2I6QA 1SKYB 1TE2A 4X1IA 1XYGA 3VVLA 3W2GA 1IN7A 2V59A 2B69A 3AUFA 3P4YA 4PPNA 4GL4A 4BQNA 3ROFA 2FUKA 5IM5A 2CHGA 4EBBA 3VYRB 3ZVKA 1WMFA 2F2TA 3QPUA 4AJKA 1E0KA 2P0EA 1B42A 3G2NA 4OO3A 4M1MA 1EEHA 3IEXA 5B2ZA 4IDBA 3RIXA 2QTVB 5BR7A 5I4CA 4G23A 2W6ID 5AJXA 2BZGA 2QRUA 3ZLBA 2KHZA 2I65A 3V1NA 3ASYA 2QZZA 4N0MA 5EI5A 4LZJA 4B7AA 3A3PA 2XCIA 3O7WA 5CBPA 1IN4A 5E8JA 2O2XA 1W9HA 3G7NA 4G4JA 1R12A 4K86A 5HCNA 5IDVA 3RI3A 4CFSA 3KYCA 4Q7EA 2D62A 3MK31 2IV3A 4E15A 5GAJA 1FRQA 3NEJA 4EUNA 1C1DB 4ZICA 1G5QA 1JQJC 2H54A 3IDAA 1CUDA 3KYIB 3PP8A 4MH0R 2VYQA 3FMOB 3H86A 3O9VA 4FN4A 3EVNA 2MIIA 4JBWA 2Q6TA 3H2HA 4WZAB 2XX3A 1SC1A 3GZTB 1LV7A 5F9HA 1U3VA 4Y0VA 4DLAA 1RZRA 4M9UA 5C4GB 1F4VA 1VYHA 4ZO4A 4GD3Q 1HYEA 4Q9NA 2PSHA 1YL6A 2ONKA 4WKBA 4WY5A 3SM9A 3D4BA 4Q7LA 1DV1A 1IDN1 1XZJA 3NALA 3GT4A 3LRTA 4ENPA 4AKGA 2P9QA 1NI5A 4JL6A 3UMGA 4KPYA 3CLSD 4H6VA 2G25A 1PJAA 1NBME 2WHXA 4WLUA 1BROA 1QG2A 4C43A 4QKQA 2R00C 2K5UA 3NDJA 4Y98A 1UBUS 2AA3A 5G3ZA 1EFRA 2H4ZA 4TKLA 4MS4B 5TQ0B 3RK4A 4B87A 4FS3A 2IWRA 3EVCA 3G0IA 3QVOA 2NU7B 2JGFA 4IIBA 4PIVA 5DFAA 3TTTA 3UA4A 3I52A 1AK1A 3QX7A 4BX8A 4EJSC 3AUUA 4X1KA 2LNDA 1H8HD 3M5PA 1YVEI 3SKVA 3EOBI 3K2QA 3KZCA 4P33A 3W5IA 3ZIAD 3ADCA 1OIWA 1JEDA 1JAYA 1MPTA 2NPIA 1S4MA 3COZA 3KZMA 3N2ZB 2IDZA 1U28C 2G28A 1C7ZA 2NSYA 3AONB 5FOSA 4IWNA 3WSTA 5FBHA 3AHIA 1STOA 4IQ4A 3U17A 3ZWBA 3AVVA 3BJMA 1G64A 3C87A 1QV6A 4OHMA 5FOWA 3HI4A 1EGQA 4YXWA 4OHFA 3AEQB 2XOXA 3B1VA 3EZ9A 3KLBA 1Z15A 4AJEA 4AB1A 4JP3A 1CEEA 3LK6A 1TZKA 4D3ZA 1PQUA 1EHCA 5KDLA 3VKUA 2PV0A 2ZSAA 4Y9RA 3E1SA 4XVCA 2DZDA 5CD9A 3A11A 2IPOA 4NSNA 5IFLA 1EX1A 4GR9A 2RK6A 5B3AA 3Q0TA 4N5HX 3Q5DA 3DMNA 1QBKC 3C3EA 3O9MA 5JY6A 5IJ0A 4JQSA 1E2BA 1V7PC 1F0YA 3E3AA 3CT6A 4O4JF 4PS0A 5K2MA 4B47A 3HHEA 3BXEA 1G5HA 3LQQA 1G4AE 1JLKA 3HZOA 3L0BA 3UHAA 3ZY3A 3U6KA 3MUOA 1QQBA 4ZHQB 4A36A 3CNBA 3GJ7A 1ZEMA 5DNUA 1EFAA 3OLXA 5DN6D 3CLVA 1A9XA 4MW9A 3MBKA 3QTBA 3FF1A 3NNNA 1DBSA 4WUTA 4P3KA 4O4IF 3AK4A 4C5BA 1WSDA 3KR0A 3TLYA 4R2WA 1QX3A 2PUTA 4V24A 4BO3A 1R0WA 1RWXA 3DO8A 3LIIA 4TS3A 3TVYA 2ZT6A 3FZYA 3OZBA 3R40A 5HKKA 3G17A 4QXPA 4HS9A 1IN5A 4O2AA 2X5KO 1NMZA 3TZQA 3WISA 4B7ZA 3KUCA 3R3WA 2H48A 1BXGB 1M73E 2BR5A 3KFVA 2Q0QA 4X3OA 5H3LA 1XTBA 3K1YA 4BJHB 1D5WA 4IDGA 4RV5A 4JN6B 1KEUA 1ZRSA 3ZCPA 5HIAA 3NYQA 2O5EA 3VZBA 4M7PA 4FILA 4E30A 4LSWA 1L8QA 5LQNA 1N57A 4L4SA 4FYIA 4FFMA 4LRYA 3K9BA 3AH8A 4NJMA 4D3SA 4BNXA 1YBMA 1YFKA 4GEKA 2YW9A 1E9VA 4YP0A 1KEEB 4U9IS 4BB5A 5JH7A 2OB2A 3NV7A 5B37A 3BWCA 4X6XA 2M6RA 2VDJA 3BGVA 1PR4A 3BZUA 3WGZA 3DYVA 2A58A 3BWEA 4BNTA 1GPUA 1SUCA 4AURA 2R1VB 3QX9A 3A9TA 3BH6A 3HKEA 1WETA 1LFDB 2GETA 2QPLA 2VJYA 3V2HA 2PZBA 3E9CA 5F2OA 4ZT2A 4V2IA 3ZDEA 2ZYSA 4EF6A 8ADHA 4U00A 5H4GA 1T0PA 3J81k 2OZPA 1Y37A 5IC6A 2V7QD 3MWJA 2PUCA 1KK1A 2YY6A 2X4IA 1Q14A 4KGZA 2UKDA 4D3DA 5BSHA 4J16A 1EI9A 4RKWA 1UDCA 1X1EA 3A37A 1MO3A 3LRPA 3SYLA 3SJBA 2ISSD 4WMLA 2QDXA 4BFCA 1CX9B 1ZYUA 4CTOA 3FLEA 1P0CA 2WPDD 4K9SA 4N4AA 2DPXA 1RJFA 4NZNA 2ZE5A 1II9A 1WB6A 1UR5A 3WLPA 3T61A 1KIMA 2YXLA 3SXUA 3W3AH 5FULA 4FMDF 4NHEA 2UYHA 1T4DA 2GXSA 5B6IA 5LBTA 2F64A 4Y1RB 1HORA 1L5ZA 1LQTA 2PNFA 2PX6A 5CB8A 1U8YA 4DADA 3ROZA 3F9IA 4XGIA 1I2MA 4DGQA 4CDGA 4BZZA 1E1RA 1O94C 1D7AA 5DGHA 3O90A 1I1OA 1W1WA 3TNLA 3UAGA 4AP6A 1D2RA 2FWRA 4WE3A 1QCZA 4GPTA 1CIJA 1NXVA 1ONPA 4OBXA 4Y2SA 3V7YA 3FROA 1RWOA 2Z5FA 5IHXA 2OORC 4AO7A 3MWFA 2VT3A 4UHCA 1U8FO 1ZK4A 4FLMA 1UJ2A 3ITNA 3OA0A 3OJCA 3ZWMA 5EMLA 4AQYB 4KXWA 4ID9A 4FFNA 1ZJ6A 5LDGA 3IT3A 4A4DA 4CN9A 1WNTA 4DHWA 2GZSA 1C2TA 1C8KA 4TOIA 3P26A 5DOZA 3OCXA 1KJYA 3TPFA 3O47A 4D45A 3D0RA 1LNSA 2I8CA 4ZVKA 2OAP1 1EM8B 1O2DA 1PNTA 2WJZB 1IBSA 3C3JA 3PQ5A 2HLPA 2G9ZA 1QDEA 2VNSA 5AKXA 1HUQA 3BE6A 4IDAA 1UMCA 3I5YA 3OM9A 2RGXA 3LKVA 4C4TA 3LGXA 1V8PA 2ZREA 3DFIA 4M21A 5KU1A 3L79A 2WSYB 5KVVA 1JMYA 1V9SA 5AKZA 2EKPA 3U39A 3QXCA 5KB3A 1YWGO 1JECA 1NLZA 2PT7A 4BJ6A 3EIUA 2HF9A 5DX1A 2DUNA 1ILEA 1Q0HA 1XU4A 3CM0A 3N0TA 2O05A 4KE8A 3EXIB 1Z22A 2I2XB 2W6MA 1V26A 2QVYX 3NDRA 4R2LA 2I91A 3BGIA 4D0RA 3SQXA 3MIZA 1A50B 4LQDA 3HE3A 5JRZA 1ORVA 3SYNA 3A1FA 4GOXA 4TL7A 1BMQA 2HDNB 4KAFA 2BGUA 2H5LA 3JTMA 4OHOA 5GJCA 2ONJA 4IV0A 4DMKA 4Z3KA 2FWMX 3JQ8A 2FOLA 2GO1A 1ATIA 2VTKA 3GA7A 4YJGA 1GY8A 4D8XA 1CY1A 1FYEA 2BFCB 4U7TB 1JTVA 4EZBA 5IJ9B 1EHYA 1L4EA 1QGDA 3ICCA 3QNWA 4OQMA 5E7IA 4J49A 4RXTA 4UOQA 2QPOA 2FSFA 4BFYA 4BKUA 3NTLA 2M1ZA 2OHGA 1S3FA 2AN4A 2WWGA 4KGXA 3KT8A 2PFSA 2XMQA 4GX5A 4IZIA 3FOCA 1KEWA 1WD7A 2MSNA 1BD3A 1O9GA 3OQ6A 1OHHA 4OB8A 4DYHA 4LYJA 3NBZC 2BOVA 4PGMA 1CIPA 1XK7A 1O3YA 2BISA 2BPOA 3EQ8A 3E82A 1JLRA 2E4YA 3JCZA 4DREA 4RX1A 1QV9A 2N1BA 4J7UA 4LG1A 3CCBA 4G5XA 4BLWA 2V55B 3E9NA 5BNTA 3AKYA 2ZR9A 4CLRA 4LOKA 1K9SA 3N2EA 4IDHA 4QU8A 2ZT7A 2F1HA 4Q24A 2AQKA 1AA9A 4A5OA 2PUHA 2VAMA 2X0IA 1OOEA 2SBTA 5DBGA 2HMUA 3DFKA 5F21A 2JK0A 4DR1B 1KC1A 3K1AB 4NRDA 5CX1A 4L50A 2VS1A 3DTVA 4RA9A 3N8IA 5J47A 3ADOA 4RVFA 2IL1A 3EWAA 1UH5A 2CMHA 2O2JA 3K4QA 3U9SA 3KPJA 4D4JA 1XRLA 5EWJB 4J0GA 1N8TA 1XXLA 3KT3A 3UMRA 3JVDA 1Z5WA 2IKSA 3EQ2A 4WCFC 3FTEA 4LOAA 3KKNA 3ZV6A 4FYPA 1T29A 1L7OA 1V5FA 1HQDA 4JT4A 4URUR 1G21E 3QWFA 2LV8A 3LBIA 3SQNA 3GWGA 3IQIX 2QTFA 3QE3A 3WWPA 1H4TA 1P7PA 1SXGA 2DCUA 3MUNA 3PC2A 4I4IA 3ETGA 4KLZA 3U7JA 3MINA 2IXBA 3L46A 4FGWA 3H4TA 2O3RA 4LSZA 4KJZA 4CKEA 3BD9A 4ZC8A 4MZDA 3U4QA 3AR4A 3KEQA 3W90A 4KDFA 3GARA 5BVGB 3IAM6 3PFGA 4P5EA 4Y2YA 3H9GA 4HFJA 4GAEA 3ORSA 3G89A 1EFDN 4W5OA 1E3IA 1KSJA 4XFDA 3W2IA 2A14A 5BMVB 3VUFA 5IEJA 3NORA 1CYDA 3AFIA 5BQPA 5AKGA 4CIYA 5TVGA 3KAJA 4E88A 5A0VA 2ADOA 3HJNA 4P36A 3UCEA 2VT2A 3DZHA 4YGXB 4PRLA 3Q0IA 1HTBA 4R8MA 4WNAB 3UAZA 2J9FA 3K5PA 4FEEA 4NMWA 4IVRA 3QJ5A 1G0OA 4HLCA 4Z0PA 4Y0AA 4DCJA 4P7KA 2E5FA 1JA1A 4OVKA 4YONB 1UOEA 4KXQA 5AVJA 1P5FA 5HKOA 4MS3B 4M1KA 3IQXA 3M4XA 4N18A 4C9BA 2XGOA 1M1YB 2GXUA 3FF4A 2E55A 1DAIA 821PA 3P96A 1N92A 2WTBA 4JK3A 4BZWA 1A8UA 3L0OA 1OWNA 1RPAA 1T6BY 4K28A 4EG5A 2WWIA 1V5IA 2PDAA 4R2KA 3DH0A 3RROA 2OCDA 1YMVA 2CFTA 3SDZA 2GEUA 1IQPA 1FDUA 3JW8A 2IV2X 1JEYB 1FDOA 3P2EA 3K5WA 4JP5A 3GFPA 1FBNA 3QW4B 5DYWA 2ZZKA 4U63A 5LZ8A 1B0AA 1NAIA 2X0EA 4D9MA 5JC8A 2XKAA 4MWDA 1PTKA 3C4QA 2BFFB 4WXHA 1BFDA 3MQ4A 3I9MA 1T26A 2ERCA 4WH0A 3SKXA 4NXNB 1ID1A 3U60B 3P20A 1TTHA 4GZ6A 1DBWA 1TKBA 2D3WA 4DOMA 4KVAA 4Y30A 1J2YA 1L1QA 2IP1A 4UTOA 5FX2A 1IZ7A 4ZYWA 3WOVA 1Y8QB 3RREA 4XKJA 3BMNB 3IV7A 1OLOA 1DTEA 1X8LA 2VN8A 1RLIA 2NADA 3CCCA 1RWVA 1Z4OA 1RVV1 1FUYB 2XCLA 1S2LA 3HDJA 5LQJA 2XGSA 4MJXA 3ZK8A 5JCPA 3BMOA 2N3ZA 1WQ1R 3CLTC 4JLJA 2H1CA 3VSAA 1Z7YA 4RM3A 1M7GA 1W44A 1XLTA 3KXLA 3TTSA 1NJSA 3VTAA 4AP9A 4C87A 1JHQA 2W4QA 3EZYA 1P7VA 4DM3A 1Y1SA 3GY0A 4CIDA 4F4CA 2AOXA 1QRDA 2CKDA 3F2VA 4Q9LA 1GKUB 2YHIB 5EESA 1FYVA 2CMGA 1JHYA 4HYTA 4A0RA 5CLIA 3IUSA 1IPEA 2RBEA 2ZIVB 4D46A 4YCMA 3IC5A 2BSAA 5JH7F 2B83A 3OFVA 5JBQA 1HG1A 1R0LA 4DWVA 2IHNA 2N75A 3OT1A 2VK1A 3HU3A 1A98A 1PU2A 2X76A 2VPQA 1TPZA 2ZJBA 1EESA 1H93A 5LP6A 3Q9UA 2I03A 2VYVA 2Q45A 4RXMA 1EVKA 1DS6A 4JUBA 2PJDA 1I2CA 1YDEA 3ZV5A 2W0SA 3K2EA 3DL2A 1T6NA 4HDNB 4XQ9A 2PPLA 3UOWA 3FB4A 5H9WA 5LU9A 1CUGA 5HBGA 1TEZA 5HILA 1N34B 3AERB 3VR0A 4JWTA 3ZN2A 2PRYA 2R3SA 5CEJA 4F4FA 5KQPA 4NV1A 5AVUA 2JG3A 2AI2A 2IBTA 1XAJA 2PWYA 2QL6A 1FS4A 1ORDA 1BQ4A 4Y2VA 2ZR0A 2WWWA 3MXTA 2FZGA 2CDCA 3IP9A 3K30A 3B36A 3LRXA 4E51A 3EQ7A 1XIVA 1M34E 2E89A 2MYNA 2V7QA 1PAUA 1MO5A 4Q18A 4XW2A 3V8EA 4XJTA 4B6RA 1G4UR 3MT0A 4ADSG 2DKNA 2XNDD 3DTTA 4UQPA 5TR9A 5LQKA 4V0NA 3GFSA 3OCVA 2BI4A 1BA3A 1PJTA 3PWZA 3ZCQA 2FI1A 1VECA 4J6FA 3TXYA 1MT0A 4BWGA 5BT8A 3RJTA 2XRMA 3OZIA 1RRGA 4GR5A 3TOSA 2QQGA 1NLUA 5DGIA 4EFNA 4Y2XA 4YTEA 1UIRA 1PF7E 4W7IA 4F2HA 2QLTA 2RHJA 1PLKA 2VDWA 3A4YA 3DAFA 3KXKA 1BRTA 3EXAA 3MCWA 4J03A 3RIMA 4YJKA 1T5IA 4RJJA 1YQTA 3VU3A 4P83A 3EFBA 3ZNNA 3EVDA 3GT7A 1VZ2A 3SLRA 2Y77A 2AW3A 4RCYA 1BDBA 2QNBA 4NK5A 2JIBA 4GI7A 3ZOZA 3DLCA 4AJIA 3A9VA 4LYAA 1Y7TA 2W6NA 2P4SA 5T3UA 3MJEA 3T3HA 3UUFA 4DPKA 1PGJA 1TCUA 2E1RA 4KKVA 3EMVA 5DYNA 4BECA 4XB6B 4F2DA 2X22A 5F3DA 3T1TA 3CF4A 4FLFA 3VR3D 4D99A 1TZMA 2A9QA 3SZLA 3GLHE 4DT1B 3FSGA 4CF7A 4OHUA 5BSGA 4D7AA 2XCRB 5DHPA 4E5DA 4CLXA 1CJMA 1NP7A 4NNJA 2WSMA 4WI1A 3X2FA 3D2LA 4BO2A 5CIQA 2I87A 4EHKA 3H2GA 1YIAA 3H1TA 5KTKA 3ZHUA 2YBDA 1B8VA 2C54A 2E4AA 4JI0B 1JYEA 2ZIEA 3UTDA 3R3HA 2XRZA 1KH2A 1XDBA 2YINC 3LF2A 4LOJA 4ZO6A 5FPPA 3SQMA 4BNKA 2HA4A 4R4JA 3R9KA 2ZUUA 3JQPA 1DC4A 4MW4A 5T64A 3RYIA 5IPFA 5DNAA 3BJZA 5TF4A 1AM4D 4Y0NA 1OX5A 3W6PA 1KARA 3PITA 3EWNA 4F5ZA 1HE8B 4LQ4A 2EIXA 4LXQA 1L6RA 1AU9A 2Q3MA 3I1YA 5LJIA 1B41A 1DKPA 3RVKA 1LPAB 2NTYC 1A8IA 4IY1A 4G0MA 4UTXA 4BAUA 4WOKA 4CLHA 5B4VA 5KVCA 5LOVF 2WEKA 3VR6A 3DWEX 1U0BB 2WZCA 2JJQA 3PHHA 4ZEVA 3QELB 4MV6A 4QL3A 1RP7A 4UU0A 3H1FA 2VDLB 4QARA 3H05A 2JKYA 1DNPA 3PC4A 1HTWA 1J9ZA 4IILA 1EE1A 3LC2O 1K6JA 1Y4SA 3P2IA 1ULAA 2BN4A 4LPKA 5JNRA 5J2TF 3QRWA 3EIXA 2YIVX 4B5KA 3GVPA 1NKTA 1U31A 4GO1A 3BSYA 3L1JA 1OC4A 2E87A 2WOJA 3M6MD 3VJMA 3ZU5A 4MUBA 2ZPAA 3JARB 2QB5A 1E69A 2WJPA 2XMPA 4FE3A 4FNOA 5ESWA 4WBNA 4LI3X 4R01A 2AR0A 4IH9A 1Q1AA 3ZQUA 1T36B 1U80A 1NF2A 1J8VA 2P6UA 5AOBA 4FSXA 1Z0IA 4RTRA 1BMFA 4S2EA 3WLSA 3T35A 2GYVA 3MJHA 1N5MA 3W5CA 2C77A 5K6RA 1R16A 3G5TA 4WN9A 1Z8HA 1E61A 1T13A 3V1TC 3VM6A 1GG9A 3IUEA 1Z4LA 2IELA 3UV6A 1PJBA 1IM8A 2C4NA 2GXQA 2ZU0C 3OTWA 5GGYA 3R5JA 1U2GA 2IZZA 4I0WB 3QOYA 1NVWQ 3DR3A 4HK4A 1K7SN 1PLJA 2O2DA 4YI3A 1T3LA 4PR0A 2RB5A 3CNQS 3CCFA 5IANA 5JSZB 3ZKWB 1Y89A 2XUZA 3CZPA 2GHIA 1GTSA 4FK8A 2QT0A 4QSHA 4E2WA 4RK7A 2VQDA 4DIKA 1I01A 1L7NA 1P5JA 1KVTA 2MINA 2WDZA 2ZRQA 3DMRA 4HUJA 3DW3X 3HU5A 4RXUA 5EE5B 1CUZA 1X7XB 3N6XA 2DR3A 4LA4A 1RABA 3D2BA 4QDUA 4ZEOA 4F56A 4QGSA 4KXXA 2HRDA 3DNPA 3V1LA 3W5JA 3B2EA 5GONB 4B4DA 2QBYB 4BBAA 1KDOA 3H6HA 2NV6A 5IUJC 4P2GA 2VK2A 1BE8A 2QVZX 3TZ6A 3C1OA 3PFKA 4Q1FA 1XMXA 1ZIXA 2EFDB 4LSMA 4YX9A 1NLYA 1R6TA 1TYBE 2FOIA 4L15A 2GOYA 1CY2A 1Z26A 2VK8A 3WOHA 3ZCXA 3TMKA 2FUEA 3PI7A 2VHQA 5GGXA 4BC0A 3O8DA 2HWKA 3N6VA 5J4LA 2FFAA 3G79A 2ZI3A 4I9GA 3NHRA 4AF7A 2FRXA 1T8UA 4G5OA 3N53A 4BDSA 5AVZA 5IYZF 3EIFA 4UVEA 5BOSB 1JDNA 4LC9A 5EHIA 1VCHA 2O2GA 2FFJA 3DEAA 4RLHA 3NWBA 2OD2A 3K09C 4INOA 4P7FA 1GITA 2ECPA 2J4FA 3QK7A 4Q4HA 2H5JA 4A10A 6ABPA 3PTAA 4V1CB 4ETIA 1U3WA 3TVTA 1R0KA 3H5TA 5LXTF 3VRHA 4NAHA 1ML4A 2PXCA 2EHDA 1R6UA 3OLZA 3U09A 3RKRA 4GI3A 3U1BA 1PRYA 4B7UA 3NBXX 5IT4A 3D3KA 1N75A 2I34A 2C94A 5FI3A 5KIAA 5CDGA 5AW3A 1R0RE 1WXGA 2V7XA 2FPGB 3BIOA 4P4NA 4R98A 4X62B 1AN0A 4QJ4A 1YFJA 3A2MA 1O6CA 2JIRA 1RJGA 1QMGA 1Z06A 3CUSA 3SDBA 2OEPA 3D7SA 1FP6A 1Z6XA 2WJGA 3KBOA 4TSKA 2NUTA 5KU7A 3THWB 2FQ1A 3MMPA 4OHVA 1DWOA 3H2YA 1TC1A 2ET6A 3DDCA 1G8YA 4LE1A 3FKSA 3OEHA 1DRVA 3H42B 1QYIA 3VNAA 3BXPA 4PY2A 1K0FA 1TEVA 1I7DA 3LLUA 1XX6A 2HRRA 4MGZR 2N47A 4H4EA 3RCBA 3EPRA 3EAQA 1V3VA 2W48A 3KV3O 5JAUA 3KAPA 3DB1A 4KH0A 3O83A 3B2NA 3QE4A 4P4UA 1ND6A 4ZAXA 4BN0A 3BGWA 2VA9A 3IJ5A 5TDHA 3HGMA 1A4RA 3ULKA 1Z13A 2QROA 4QEDA 3W1WA 1MFPA 3FHOA 4LYHA 1Z4NA 5BN4B 2JL1A 3GPIA 4ND7A 3JQAA 3VO1A 1IUPA 4DPMA 2R60A 4HDSB 3IE1A 2EFYA 3V1UA 3K70D 5SICE 3NVKI 3AHJA 2BDUA 3DBHA 2HPZA 3MRXA 4TWRA 3WAKA 1ZJWA 1LU9A 2GD0A 2IU3A 4J7AA 3WIDA 3KO8A 3OQVA 4F45A 2OO3A 1LRJA 2A4MA 3D02A 3QVJA 1OH6A 3TNFA 1QUEA 4KRGA 4QDTA 1T2EA 2O8EB 3R3UA 5AKYA 1XLWA 2KW5A 2OBBA 3VNQA 3HGTA 4JYMA 3EMDA 3WGMA 5HKLA 2O2CA 2QG9A 1VJTA 1OBFO 4IJMA 4GBMA 4UM9D 3ZH2A 4ND4A 3I42A 4MI9A 3K96A 5T3YA 2P4EA 4WZBA 1B73A 1KF0A 1PD0A 1YAHA 5K0EA 3OOEA 4RO0A 1KJ9A 3U13A 1RXCA 4OK5A 2BHTA 2M6SA 1V39A 4IICA 1E9CA 4PHFA 4IHQA 4OSPA 3RS8A 4DA8A 3SC6A 3U0VA 4YLYA 2YUIA 2HO4A 4KH1A 1SOWA 2OWEA 2QK4A 2VJLA 1BHQ1 4L8GA 3LSYA 1YL7A 1XWIA 5DP2A 3L6BA 3ZVRA 2PIDA 1Y7HA 1KP9A 1P31A 2JIMA 1GLNA 3G2MA 3H19A 4ARUA 1YBAA 4NYMR 2PAFA 2YYYA 3D4LA 3TZCA 3OUTA 1J23A 3CO0S 1J2EA 1GU0A 1P73A 2Q8QA 1GZ3A 1U11A 3JWJA 1UXHA 3VV3A 5TARA 4JLOA 1MA3A 1F3LA 4ITRC 1U9IA 4C0BA 3AHCA 4U8GA 3PPWA 3AHEA 1C9YA 1FFBA 3ASUA 1E0AA 3QMMA 1U0FA 1THMA 2C96A 1ZP6A 2QIPA 4DDKA 1OJ7A 4S0XA 5JMWA 5JCOC 1ESDA 3WGLA 4DRYA 1EP2B 4MUGA 1R3UA 5JV5A 4ZMBA 1Y7IA 1RJEA 4QDXA 3DEJA 3PUHA 3C3YA 4K5QA 5GZ6A 3M4ZA 3O75A 4HZUA 1G4HA 1WZUA 2QMQA 3DAGA 5HRAA 3ZDCA 4RETA 3O4IA 4BBJA 1M10A 2PMWB 2GNOA 4CQLB 1SU7A 3MWKA 1RXYA 3BE5A 3H18A 1AKQA 2YXNA 1N9GA 1X80A 1K89A 1Y1RA 1Y1KE 4QPNA 1L5FA 4R9UC 3KEMA 2XNDA 3P0RA 1KK0A 5EWLA 3RIHA 3WLAA 3NHFA 2OA0A 4OUDB 1Z2AA 3P45A 1E2LA 4QPZA 1NXPA 1WB9A 2F8SA 1G5IA 4D98A 3ND6A 1J56A 1Q20A 5AFSA 5C37A 2XI4A 5JWOA 2R1TB 3PUKA 4BMVA 5BNWA 4JLDA 4RD4A 1EUCB 4JLNA 3EULA 1K7XB 4HNGA 1EUYA 1NQ5A 4QYIA 4WKCA 3LZCA 4QECA 2NVWA 4PYLA 5MDHA 4WINA 1C9NA 3DTNA 4WXPA 3G68A 2GCOA 5KNDD 2DFTA 1D6SA 2BW0A 4HDAA 4LFAB 1LNZA 2FUG1 1NZFA 1F0PA 1ZGBA 4PGAA 4W1PA 5K7SA 1M2HA 4D2IA 2DU8A 4AYXA 3CW8X 1DQRA 4J0EA 4C14A 3NYIA 2DF8A 2AG8A 4I5EA 4WUVA 5EWMB 1RPJA 1Q83A 1F7VA 4KE6A 1GPAA 1ODTC 1V16A 3LIPA 4KPUA 1GPH1 1EE2A 1X92A 4CM5A 1UPXA 3A10A 1I6LA 2JJ1D 3GRZA 3QBTA 4J1NA 5IN5A 4HB3A 3WLEA 3A4IA 3MMSA 2YVKA 3JWHA 4RFSA 1T9KA 3KKQA 2P5SA 5SZKB 5K9ZA 2B4QA 1WBJB 1QZ3A 2WJ3A 4NEHB 2LGJA 1QO0A 1YJBA 2FWJA 2PL9A 4HN9A 3P32A 5LQSA 1LLDA 4BB0A 3REGA 4KSYA 1DAPA 1UKAA 2AFIB 2R8ZA 4NK4A 1J24A 4HN2A 4D74A 5DF1A 4BATA 4B0PA 2JLSA 1HE2A 4DXAA 5CA1A 2C9YA 1MB9A 4JY7A 4C3UA 2Z08A 1GG8A 2CYCA 2XD4A 2FE1A 1UAAA 2EJWA 4JVSB 2PSJA 4ESOA 4QVIA 3KZ1E 3P9SA 2WKRA 3EAGA 2IW1A 3AOEA 3R6GA 5ALJA 5DRTA 4B6SA 1ZM4A 2D74A 1YUNA 4QU0A 1NAHA 4CF3A 2X8JA 1BWPA 2IYPA 2QU7A 5T4FA 3H97A 4RY8A 4PHGA 4FHCA 2QL5A 5KX5A 1K6XA 2VTEA 3RF7A 4CLDA 2HQSA 2ARKA 2R7KA 5CH8A 4F5EA 1FQJA 4XCXA 3QM1A 1CVRA 1D3AA 4X5OA 3U62A 2IOFA 1G63A 1Z33A 4RIIA 3T6KA 1BS1A 5GV7A 2OBNA 1EFVA 1Y4ZA 3KUDA 4LV8B 4BAZA 1V9CA 1XN4A 1IZ0A 1WU8A 3IJPA 2QE7D 3OIUA 4LXHA 5F51A 3TDNA 1P4HA 1UKEA 4H4CA 5A02A 1LJUA 4H77A 4II3A 1XA0A 2D1SA 1DV2A 3R8XA 3OZXA 3ZXIA 1YRAA 3U3XA 3GIWA 2VWGA 1MVNA 2CDBA 3F6EX 3SM3A 3W9BA 1NU8A 4UASA 1IMOA 1N5DA 5E7MA 3RRXA 5ALLA 4I7EA 2SHKA 1SY7A 2IHJA 3FLAA 3HEMA 5JNSA 3ZHOA 4MS1B 1QPZA 1X9IA 2HIGA 3FJOA 1JIXA 4J2HA 4JOCA 3PHCA 4OGKA 3I9KA 1U65A 4FZ3A 4TRNA 1M67A 2PQ6A 4WXRA 4M9QA 1NUQA 1PFYA 1GHTA 3IP7A 3HDHA 4FKMA 3KELA 1E4YA 2GLXA 3AIOA 4GUAA 2Z2YA 3AILA 3AR9A 4H6XA 4UD2A 2NU8B 3BK7A 5I7UA 3KG2A 3PHBE 1DAKA 4WESB 3TTXA 1VJGA 4QHYA 4G85A 5J43A 1T3TA 2C7GA 3JRWA 4I1PA 1ND5A 4G36A 3VTZA 4H1WA 1E6EA 1E2DA 2C2XA 2HC9A 3HZZA 1D1TA 1L6IA 2CNKA 1MKYA 4TTPA 5EJAA 1MX3A 1VP3A 4QG7A 1MH9A 5HQ3A 1GG5A 3DYBA 3RUFA 3FVQA 1K27A 4GS5A 2ZGVA 4P7GA 1KDRA 1X3SA 1ADGA 1IHOA 1U2DC 2VA8A 5K4GA 3T9EA 4ZT6A 1CY8A 1AX9A 1DBRA 1XRJA 4BVEA 1R9MA 3MAGA 4JR2A 3TLEA 1B0PA 5AI0A 1EK1A 4G1CA 3FPAA 5A05A 4FOOA 3B85A 1N1EA 5KKNB 2NAPA 4JYCA 1KTVA 2JLUA 1IDOA 3S2ZA 5AW8A 1BHJA 2IXEA 4OYLA 5CNKA 2PKQP 4EI7A 1NW6A 2NQ8A 3I32A 3AR5A 4IDDA 5AW1A 1G0NA 2DSTA 1E5LA 5HNKA 4X65B 1XZNA 1ZGJA 1LLUA 2XMSA 1U6KA 1KL7A 1TKRA 3L7JA 4YAEA 1JDSA 4H0NA 2CNBA 2OYRA 2EJTA 2PMFA 2BTOA 2CD9A 3HWSA 1WQ4A 2O5VA 2PANA 4RCVA 4YMTA 5JADA 1WLSA 1N5OX 2CEKA 5EHXA 1E7MA 1NXWA 2B35A 4ZV4A 3QVGA 2B7BA 4KQHA 4X93A 3S2SA 4IKPA 5KTNA 5LMZA 3H84A 5L6LB 3WMEA 3VYWA 5C8DA 2EC5A 5FUVA 1SD1A 4MW5A 1LW6E 3T38A 3V32A 4KXUA 4GLBA 3IUNA 4Q21A 5JD6A 5LLTA 3M5WA 4PG4A 1JQBA 5ALPA 2BM8A 5JRJA 3UW1A 4AF8A 3CYFA 1E1DA 3ILVA 3RTGA 2FEXA 4MV0A 1SBIA 1B1AA 4B3RB 2OYSA 1JUDA 3G2LA 4GC5A 1EB8A 5FQOA 4IS2A 3WSVA 1GVHA 4KLRA 3ADBA 1X7ZA 4B6EA 4MCAA 5B6JA 2NPFA 4L0QA 2C9MA 2XJ4A 3A1CA 4QEKA 3CC8A 4R9RA 2IUTA 2NXWA 4MKZA 5HJ2A 3JQFC 3SBXA 1BGXT 4DQ0A 2QZPA 5K0BA 3S44A 4NBRA 1Z5VA 3VU0A 1R8JA 4M0PA 2DHQA 4ZYLA 2A9FA 1F2TB 3QPAA 1DTSA 2WRZA 4FFSA 5JUWA 5FV7A 4E22A 4WLEA 4PYRA 3DVAB 3U19A 3BIFA 1DO2A 1L5SA 1U3DA 3E7FA 2H06A 3FDJA 3ILHA 5FD8A 3MB5A 1JZSA 3N8GA 5EP2A 1K98A 2XKJE 2IH2A 3UMYA 2AX4A 2C8JA 1CWUA 2C4KA 2AZDA 2OQIA 4BE7B 5IX8A 4K9OA 1PR9A 2TMYA 4R1MA 5B1YA 4MUYA 5KOHA 3SPXA 4DG9A 3L1KA 2XBUA 3KJZA 2L2QA 3H0CA 3QX8A 3WL7A 3LQ4A 5FBKA 1ZISA 4Q02A 4C08A 1FLVA 3KTFA 3A6PC 5LWQA 4LRUA 1P0MA 3PUXA 2GESA 4S04A 1FIUA 3X1YA 1CQJA 1G60A 4TZTA 2A1UA 2I1WA 3ZW9A 4U39A 4EHHA 4FS8A 4RTJA 1QO7A 2HQ1A 2R6R1 4IZOA 5B58T 1VIYA 3NX4A 4MB2A 4BRSA 2REOA 2EWVA 1ORHA 4ECAA 2PXHA 4H1HA 5CAEB 5BNZA 2IYTA 4JI1B 3WMRA 4NDZA 2QQEA 1QLJA 3ICPA 3KBBA 2R4TA 3PEEA 4GYKA 3DULA 4KDRA 4MVJD 3LW7A 4ESVA 3F1LA 3GLFB 2RGYA 1NIPA 4LUCA 3OE7D 2PKRA 3GQVA 3HB1A 4MNTA 1RTTA 3LQ1A 4BQSA 3PFHA 3CUEF 3MGKA 4UZEA 1QG0A 4WQMA 3HH8A 1QLHA 3JYQA 1EVZA 4M2LA 1Q19A 3EISA 4D4KA 2WTAA 3OM8A 2J67A 3EXG1 1CQPA 3A1UA 1F2UB 2V3VA 4HJRA 4KR7A 2O2HA 3IO3A 4L5CA 5IK2D 1CZLA 5FJJA 2J0SA 3USES 3QLJA 4XD7A 1AHPA 2LW7A 2WVJA 4IG9A 1NKVA 4V03A 5FOXA 3S81A 1TK9A 3X1KA 1JG7A 4UOZA 4IGAA 1EP9A 3TLGB 2VI5A 3MWLA 4UBNA 4ZAGA 3RBAA 1W7AA 2A0UA 4PX9A 4YMWA 2HQBA 4W9RA 4B3IA 1QORA 1V3QE 1SUEA 5ALTA 3MJSA 3L4KA 3KTAA 4RK4A 1BZYA 1ZD3A 2B1GA 2G82A 4I5GA 4LYGA 4YP6A 2Q2NA 3IESA 2BTQA 3UH0A 1PVVA 3E8MA 3F8SA 1C3OA 1LSJA 1MHPA 1YU9A 5A4IS 5IKEA 3AUAA 2AQ8A 2O7QA 4D02A 1IC6A 3HR8A 3GUVA 4PZLA 3TAXA 4LECA 5IBCA 2WYWA 4IHJB 2FZEA 4PTZA 5LR6A 2QD3A 4YQZA 4BMDA 4EG3A 2P41A 2NP6A 4JVMA 3GUUA 2ID4A 3PI6A 1V43A 4DBZA 1L4YA 1H85A 3CEJA 2G0NA 4WSOA 5CFOA 3CKMA 1SHTX 4XEHA 3LY8A 2V6JA 3TRHA 4COKA 1DELA 2C2OA 4KYTA 1LZKA 2FLVA 4CI0B 5IUNC 4ZAWA 4C7BA 4D97A 1ECPA 1YS6A 4ZOLF 1XDGA 1E66A 3RT1A 5IDXA 2BGMA 3T1NA 5KNDA 4CT5A 1SBTA 5AWFC 4CIAA 2OOSA 4GWLA 2BFDA 1V3TA 3RSHA 4LCJA 1F8YA 4JU8A 4LF4B 2J85A 3GVXA 1Q3TA 3FGZA 3NM4A 1CY7A 1XL0A 2W71A 4BLQA 3UPUA 1DKOA 2NMVA 3LUFA 3U5TA 2HDWA 2HHAA 4IQ8A 3HCAA 1GZ7A 2G04A 2J33A 3AEYA 2MR5A 2PRKA 1IHDA 1JFVA 1NVGA 3OTIA 3O9ZA 1P2BA 3BC1A 4NS4A 4CETA 1U4SA 4PX3A 5MFPA 2RIRA 1XD9A 1X1AA 4V3CA 1VPTA 2PLNA 5KINB 2H18A 2XT0A 1M74A 1WTAA 2FEOA 1XQ6A 1YH3A 2HEGA 2V4MA 3AHGA 5IG2A 4C0KA 4IIJB 5F76A 2Q29A 2O8DB 3QUSA 2Z3VA 4G9BA 1MT3A 3IHTA 3NTUA 2PFGA 4LV5B 4O2RA 2C5LA 3B51X 5HGJA 4TRJA 1H4SA 1Q0QA 3COJA 2ODAA 2B94A 2J3KA 1ONBA 1TF2A 3P2KA 1ACLA 1VSUA 5CYFA 1E3WB 1OTXA 2YYSA 2GK6A 4ODIA 4UBOA 4LYYA 1JG2A 1YR7A 5G40A 1H0HA 4EKNB 1WVIA 5A3SA 2YWHA 2CD7A 4BLPA 1L1EA 2VTBA 1MQ8B 3N2GA 4ZQCB 1H2HA 4EO9A 1DX4A 1ADFA 4DCNA 2IXFA 3NIDB 3NDIA 4QAQA 5IZ4A 2FFHA 3LUBA 3Q3VA 4YUXA 2YC4C 1HPLA 4V0KA 2CV1A 4C4PA 1ZOOA 2JLAA 5KPDA 1IVSA 2WJYA 1IOZA 1WV1A 2YWEA 2O3UA 3M33A 4W1SA 1I7NA 3S5UA 3TLBA 1JHPA 2A94A 1FU4A 3Q3CA 1WZEA 4UUMA 4C7OA 5DCLA 1QK4A 1R0YA 3UMJA 4K46A 3STHA 5KC8A 2DLDA 1QE5A 1E4EB 4ZI3A 3AP1A 3STTA 3BM5A 3PC8C 3W6NA 3U26A 3HY6A 2Y6VA 4S1VA 3DAPA 4U6SA 3IIEA 1GAQA 5F9MA 3S7TA 2DX7A 3E48A 2CMFA 2H0AA 1QKKA 3K9QO 2GM5A 3M7IA 1E2IA 1JMVA 1P6QA 3UNXA 2CZQA 2HU2A 3IO5A 4QEZA 4G0VA 1XCMA 2C9DA 2AKYA 2UU9B 3U48A 1VE6A 1Q6YA 3ZZNA 5E2IA 1Z28A 4V3BA 4MITA 1MN6A 5F52A 4AF6A 4HTFA 5EZYF 5MN5A 1NG1A 2ENUA 5CM9C 1GYRA 1N2SA 3AM4A 1KJNA 3B3FA 2CE7A 3KOZA 2ORWA 3PGVA 4J0FA 4Q6BA 3VR4H 5CCBA 3COSA 2IX3A 5EPUA 4G86A 2JH3A 1ZNWA 1KOFA 2Z8YM 4JUCA 5ECWA 4GKVA 3Q72A 2UVPA 2LE0A 3R3JA 4M49A 2ZSHA 1KXZA 4V0LA 4P3NA 1WCV1 1J9GA 4R5HA 3GJ3A 5CVCA 2WG2A 4B9EA 4TS1A 2BRUA 3KB1A 4AJOA 4JCOA 1QTIA 3O1LA 3IKJA 2OR3A 4BVHA 1M5TA 2FZKA 1XVLA 3FI0A 5KWSA 2VK4A 4NCAA 1WEKA 4RIEA 8ABPA 3E84A 1ZK1A 2IYSA 1XZHA 5KJFA 2XGMA 1T3SA 3Q7EA 3QKSB 5EIWA 1EDOA 4KFRA 2H65A 3MRVA 1X19A 2V7PA 3HZRA 4RJIA 1KVSA 1GRQA 5H1YA 4EO7A 4AJ1A 4M8LA 3II6X 4A8JC 1IPHA 1K2VN 5DOVA 3SE7A 2RBGA 3K4PA 5KJ1A 1TXGA 3CVYA 3T4UA 5FADA 4A6EA 1GSOA 2KS6A 2Z1MA 2B3DA 3K9GA 1Q21A 4RE5A 1NFQA 2A5FA 2X1HA 3V34A 4MQUA 4C6HA 4L6AA 4LJ6A 1X1SA 1N5LA 2L17A 4MKRA 3QYFA 4KGDA 2J46A 1K3UB 1ZW6A 3P7MA 2QN3A 3OKPA 4PO8A 4RY2A 3FTDA 3UW3A 3L1VA 4D44A 4YRIA 4I50A 5CB4A 1WF3A 2ATEA 3D6AA 3KZVA 1XUOA 1FDSA 3AW9A 5F4ZA 2CJWB 4GRIA 2HA6A 4YRLA 5H9VA 1IY2A 3V48A 4UBLA 1JHRA 4X3CA 3Q0EA 1DQPA 5KNCH 2IKQA 2WYIA 3I62A 3MD9A 4NZZA 5KWIA 4TROA 1JLLB 3KOYA 4S1NA 4BB9A 2LIPA 4MWBA 3DC7A 3F6YA 2DQYA 1J1IA 5EJGA 3UB3A 5AVWA 3IGFA 3L6DA 4RDCA 1BGVA 3GG9A 1OYOA 2OP0A 1JJFA 3ZXXA 2Q4RA 2R2AA 3M5DA 1PCXA 1LI5A 4G1BA 4XM0A 5CA0B 2W2KB 1R4AA 3E3NA 3EGXA 3OZRA 4ZVUA 5EKXA 2WV9A 3TTUA 4MRNA 3A7DA 4RTQA 721PA 3P1JA 3UTCA 2RI6A 4WAUA 3ZWKA 4XWWA 3V9PA 1L4BA 4CQNA 2VJQA 4JBNA 1MRNA 1Z68A 4P53A 5CRIA 5FO1A 3O84A 1NM5A 1NN0A 2V97A 4NABA 5TPWA 5J1TB 2ZWPA 3NBUA 3WYBA 2OMKA 1K5PA 3UIEA 2Z4SA 3G8BA 4DVGA 1TLTA 5CJ2A 4FW9A 1JA0A 1N2EA 1SHKA 3CIFA 4M0LA 5EQJB 4AG3A 4DFDA 5KVAA 3OOWA 4KXVA 5C8YA 2JLCA 3WLMA 4TVOA 1N5JA 2AZTA 1WKBA 3RB8A 2I8LA 4HQLA 2BFBA 4G5QA 3D3QA 4NBUA 3O94A 3NHZA 4IGEA 3WSWA 2JLBA 4PG7A 1FP7A 1B8PA 1HZZC 2ZB4A 3PGJA 2L42A 3I05A 4I1VA 4EGAA 4CMGA 3BB4A 2JIPA 4ARVA 5CBPB 3DEYX 1MG0A 3CVVA 4LK2A 5HMLA 3EZLA 3HU1A 3KYCB 4OSEA 1OXUA 2Q6KA 3MCVA 1DC6A 1WSWA 4N40A 4XARA 4ZCLA 2NP7A 1AF7A 4MLZA 4ZQIA 4R68A 4ZQBA 4DARA 4N76A 1AV7A 3LBFA 4BMZA 4NOLA 5AQEA 1DHTA 1GU7A 1D1PA 1OW3B 2EBHX 3GZJA 3IUBA 2FW8A 4XLZA 2R97A 2F00A 2Y68A 3IAS1 4HB2A 3RU2A 5IVPA 2X8WA 5KHLB 4Z4FA 4Q0MA 2P2YA 1UOPA 1JEAA 3BSSA 3CONA 3FFXA 4X95A 3VUEA 4IQFA 4JOBA 5LM3A 5DO9A 1GUFA 3DLPX 1TK3A 1PSWA 1O94D 3LLSA 4FR5A 3WDSA 1GCGA 2FEMA 3N1UA 2O2IA 1N8SA 3FI9A 1U1EA 2N1MA 4H08A 1U0TA 3OIWA 1GPJA 4RPIA 1EVQA 4UQOA 3O03A 2NGRA 1E4VA 3EFEA 1BN7A 2A9PA 3C6BA 4FMPA 3KALA 2ZBFA 2YTZA 4N8DA 3V2GA 5HFJA 2EBWA 3NUQA 5AJVB 2DT5A 1AZSC 1FP4A 5KNBD 2CL5A 4ARBA 3ODPA 4FFVA 4M53A 1WZ2A 5DI9A 2QW1A 5IK2A 1YNSA 3MJRA 4X1KB 4N48A 3UJCA 1BVHA 4B8YA 4FYJA 5HMMA 3AVOA 3WHKA 3LKDA 1QOZA 2E4XA 5JHHB 2H2GA 3OUZA 3FE2A 4F3RA 1NNLA 2Z98A 2B2NA 3N8KA 3PCRB 3WLTA 1XZCA 1X7WA 4DCGA 4D96A 2C04A 3IEKA 5AP9A 5SYNA 2C84A 3JZMA 4BPRA 4TMYA 2ZRAA 3X43A 2Z2IA 4XYLA 3Q3EA 2HMVA 1EDBA 1KZGB 3M3HA 3K16A 3WYNA 4A23A 5HUHA 2GPWA 3S1AA 2P3OA 1XNQB 3ANNA 3B9PA 4NCBA 1WZCA 2XE4A 2YHUA 5JE8A 2P11A 2I4RA 2GPSA 3ZZTA 1WTCA 3EF0A 2XWQA 1UBGA 1WCYA 2VDVE 4M0FA 1W73A 2VTVA 4E2FA 1FMLA 5CDSA 2XE6A 1US8A 4FFPA 5IJ0B 2KWIA 2J3JA 1Z9BA 3RT7A 4QG3A 1GAEO 2P9ZA 1UM8A 3RSZA 4JUAA 1A2KC 4GI2A 4LYEA 4TV8F 3RE1A 5IT5A 2IZ7A 3KQMA 1ZCFA 3AL2A 2FU5C 3LAWA 5J59A 3BFPA 2XB6A 1N7GA 3HCCA 2HU5A 3PQ2A 4H0CA 3RAPR 3Q8KA 1A9XB 4DN6A 2F9LA 4RVUA 4GXNA 1RPZA 2QD2A 3ZTYA 2GMWA 1DWUA 4RF2A 1X13A 3LT4A 1ZVJA 1B6RA 5G3YA 1TADA 4P3OA 3I4FA 5IN4A 2W70A 1J2UA 4O2AB 1T9ZA 1V11A 1DEXA 5FTJA 4MUFA 5L4SA 1GQFA 1GZDA 2CLLB 2WU0A 3AU8A 3HC7A 1JJ7A 3QU9A 4EMUA 5B4UA 5B5SA 1NR7A 3SVTA 4EEZA 1KZYC 1KYVA 4NOKA 4RQBA 5IKPA 4F1WA 1K4KA 2D3TA 4C2BA 4W5QA 4HSGA 3DUFA 3PUZA 1RXUA 4I6JA 3JWGA 3HYRA 3KT6A 1WAMA 3ECAA 3F3YA 1VRVA 4GVXA 4PG6A 2X0KA 1MPXA 1RIIA 2I4IA 3B1ZA 2W7TA 4NJMB 4O2LA 4UHHA 5HS6A 3T3GA 1DRUA 3EFOA 5JH7B 3JVIA 2X5NA 5G1OA 5LYJF 2BTEA 2OFOA 1FDTA 4MW6A 1J70A 1I5OA 3VSBA 4N03A 1H5UA 1XSEA 2WA1A 2AQIA 5FH9A 3HKEB 3HYTA 1R27A 4MW1A 5IABA 2HXGA 2JDID 4IHAA 4EYOA 2X2OA 5CDUA 3HA7A 4B40A 4GPZA 1TOAA 4WK6A 3HJBA 4IW3B 2YDYA 1LK7A 3KKEA 2WD9A 4H7IA 2VKQA 2TMDA 2Z04A 3WLOA 1A9OA 2CJXA 1M1NB 1N2XA 3L7BA 3KSRA 2XLCA 3HNRA 1XKXA 4R3WA 2BL4A 4DKJA 1P7YA 1UJBA 3LY7A 4OHBA 1Q1NA 1FU8A 2I9KA 3SU8A 2P1ZA 1JT2A 4LHZA 3UFBA 1LVGA 1PJSA 2ZULA 3N2KA 4PPQA 3PDWA 4MWZA 2IE8A 4PXAA 4F04A 1C30A 1QVVA 4PZYA 5GP1A 1NF9A 5LA6F 4F21A 1HT0A 1JKXA 3P9KA 4IYJA 4ROTA 4P3PA 3TIFA 1T4BA 4F9TA 2A5YB 3X44A 4Y6OA 5H82A 5YASA 1UOQA 1O77A 4J1SA 1BX0A 3SXUB 4Z1MD 2ECQA 4G09A 5JCXA 3LXXA 5SZHB 3Q9SA 4AKHA 2ZTUA 2CZGA 1OLXA 5JPIA 5FP0A 4N6GA 2RAPA 4EPTA 3NUGA 2WF5A 1FDRA 1Q91A 3DOUA 5TS2A 2IEAA 4QO7A 4UCQA 3SCZA 1TYAE 3DDOA 3DKPA 2ZIXA 1UKVY 3DBLA 3PNMA 4UBKA 1U8UA 3A58B 5DNEA 5K4AA 3RPEA 2PIAA 2IEDA 1EP1B 2QAIA 1KDZA 4AWAA 4DC0A 1E5XA 2F9MA 2IP2A 2R00A 5BNFA 1JHZA 1F51E 1J4AA 3CMMA 5E9WA 4QM6A 1SXHA 3SC2A 3H7IA 5E4YA 1H6AA 5ITZA 3TIXB 4QBKA 4BJ5A 4ZTZB 3MT8A 1ZUD1 2HHLA 3PGXA 3QBJA 5DNWA 1OXBB 1SCUA 1NN3A 3LZ6A 3W77A 1WUIS 2EARA 2JFVA 3JZDA 3WQHA 1PKEA 3DBVO 3GGDA 3M3PA 4Q3NA 4BNMA 3RS2A 3WKCA 1REQA 5J5VA 3NBKA 3G6WA 3RYCA 3F97A 5BR1A 1U7XA 1AXRA 3QUBA 4YCAA 1UMCB 2GHTA 5JAQA 4RV9A 5FTNA 3F4KA 5E8RA 2F55A 1GKKA 3HSKA 1X7GA 1I94B 4FYMA 1CR0A 1R2QA 1P5HA 2QTMA 2ZOSA 3HUDA 3EYWA 1EVIA 5BN1A 1G6KA 4HP8A 2HJRA 2BGTA 4GQBA 2ZUTA 5BUZA 4IMIB 2WNSA 3ZR4B 3OZEA 3EOAI 1FXWA 1PV2A 1GFZA 3GPBA 3OPMA 4FHFA 2Y3IA 3EIQA 4OU4A 4F5DA 4M86A 4BDTA 3Q8WA 2FW0A 4ER5A 3OQMA 1W30A 1P9RA 2OK8A 4B2PA 2C9ZA 5BWBA 5AOCA 1XRRA 1VXRA 2XWPA 2KYRA 4UM7A 4BQOA 1BDMA 5A06A 3CLTD 3HBJA 2WFLA 3JQ8B 3P9RA 4WVFA 4L9RA 3IBGA 4YJGB 1ABFA 1Q92A 5EUCA 1SBNE 1N2HA 2ATIA 2K7ZA 4ARZA 4LE2A 1M5RA 3ML1A 5G4KA 5FPTA 1WHSA 1AKUA 3D5EA 3RBXA 3ZW7A 4N7MA 4D6PA 3HXQA 5KSZA 1P39A 1XO1A 4BJ3A 3MJFA 4L95C 1XCOA 3LSTA 1EFCA 1NVUQ 2AD1A 4WHMA 3T7AA 1YL5A 2DGDA 3FPEA 2DY1A 2EERA 4W99A 5A6SA 4EB0A 4L28A 1P9LA 1EFTA 4J75A 1JIIA 1YZHA 2ZBGA 5BV0A 1NRWA 1SFRA 4B6PA 4IH1A 4QOJA 3VR3A 2XCTB 1PT6A 2PUDA 2ZKLA 3Q12A 2HWWA 3D1JA 3DJYA 3IB3A 3QBEA 1K7EB 1QHNA 3PA8A 4XWKA 2RH9B 4HJXA 4CLRB 1N32B 2CXSA 3HWX1 1AQIA 3EWIA 3ZGZA 2FMKA 3ELBA 1RBYA 3O1HB 4Y2UA 2A1TR 2FZWA 4B79A 2E4UA 4PYJA 5JQGA 4P4SB 3ONFA 3HM2A 3KHUA 4YJ2A 5CX1B 1Z73A 3B5IA 3T0GA 5I51A 2FEWB 3DTVB 4JUFA 4RA9B 4EQZA 2OVBA 3QOFA 1N2CE 1M6VA 2CHEA 1IJFA 1CRZA 2XV1A 1E96A 4ZODA 2IJGX 5D87A 3SZMA 5ERGB 5FNZA 3TW8B 4XGNA 1U2SA 2J45A 1E6KA 4R7TA 3ZX4A 3IKTA 1SU8A 4KQWA 1CJUC 1NBAA 5A03A 5K0JA 3JAWA 1K7CA 2QXYA 2GCEA 1KPHA 2HTEA 3P2JA 4B75A 3HYNA 3EGDA 5I6DA 4C0XA 2IHUA 1YCHA 3LO8A 4KUGA 4RD1A 1NY6A 2ZFUA 3ER6A 2CMKA 2YOFA 2IPMA 5AJWA 4EF4A 4D25A 3VFDA 1T43A 1RWMA 3FPJA 3MINB 1TPYA 2V1XA 3F3SA 1XD8A 2B21A 2RDMA 3AR3A 4CKEB 5HZHA 4XWTA 5CVUA 5A4KA 2O3SA 1YS1X 3U4QB 1PVDA 1Z08A 1Z6YA 2ODTX 1JEJA 3L0PA 3VR5D 1RLMA 4H2DA 4MVXA 2GPAA 3OZDA 3EFHA 1TUEA 2VPPA 1LDNA 2YASA 3UAVA 1W52X 2QVLA 5AO9A 1EAYA 3ROTA 2Q2OA 3TQCA 1DB3A 4DMRA 3U44A 1GADO 4YV2A 1O94A 2ZVQX 4BGDA 3D1VA 3RUCA 4I4TA 2WU4A 4OLAA 1M72A 4HI0E 4N7JA 1YKGA 5HDBB 4US2R 4J0CA 5LZ4A 1JHXA 2AH5A 4BIMA 4BO0A 1Y8RB 4FC6A 2J9FB 3WLIA 4YV0A 1TMOA 4HEJA 4KXFB 4ASUA 4CQJA 5KQGA 1E92A 1KMMA 5DGDA 1SN7A 3R20A 1HYQA 3VHXA 1TI7A 1VCOA 4JI4B 2XOKD 5DBIA 4GKKB 5A2QA 4TV9F 4CM8A 5FWAA 1I5RA 1W5AA 3OE5A 4R0VA 3KQUA 2FWAA 1A88A 1E5TA 2JK1A 3D8UA 4LMPA 4L3OA 3V7NA 5U9CA 1WSAA 4LTDA 5TPZD 1Y5NA 2J4DA 2YNMC 2Q9CA 3CVUA 2YN2A 5F3WB 2JF0A 2H2AA 3QVSA 5IDYA 5CT9A 1PHRA 4ZZ1A 3CSUA 5JJCA 1Z0AA 2W4MA 2JBAA 2Q5FA 2BKLA 3PQ3A 1JHMA 4RCZA 1FMJA 3MRTA 4JQYA 1W85A 3JZIA 3OD1A 3ZS9A 3RGWS 2CLIB 2M2IA 4UPEA 3DE6X 2YZMA 3TG2A 2H59A 1H22A 2IXGA 3C6MA 3ZY5A 5IARA 3H2IA 2O3QA 2R44A 3ER8A 3LPDA 3KSBC 2NXJA 1PJ2A 3FNRA 2JVIA 5IASA 3VVMA 1IHUA 5DNCA 4TSRA 5PNTA 1V8ZA 3B6KA 2HIHA 2R8YA 1QZTA 4FJ2A 4LZLA 4IJQA 3G7UA 3GNQA 2DC1A 4LGYA 4UXJA 3S2IA 4DNFA 3J81A 2PO5A 3RRZA 3DOCA 4NPAA 1F20A 3EVGA 3B3GA 1E2FA 5DNVA 1D8TA 1URPA 2QXTA 2WWFA 2ZTSA 3GFVA 3INGA 4F06A 3LUHA 2BIFA 4RKFA 1I4LD 1KDPA 2OECA 4H3HB 5JDIC 3B8EA 2Z3WA 3E03A 1C0KA 3BMOB 4GIBA 4K8OA 3U7RA 4IUCS 5FL3A 3HY3A 1WCWA 2PU7A 4DPLA 1CXZA 1B14A 3EZ2A 2ZWVA 4X6YA 3PXBA 2W22A 5J5CA 1LVHA 3RUEA 1XCPA 4I66A 2C5EA 1E1KA 3YASA 4B31A 4EAQA 4LJRA 3FVVA 2H52A 2PX5A 3ZOKA 1SBYA 4YJ3F 3ILYA 1IOWA 2IEGA 1IE3A 4J3FA 5E3JA 3VSDA 2IS2A 1XCJA 2EQBA 4PC3A 1EUQA 1K2WA 2JD0A 3K8YA 3OT1B 4OQFA 4FBMA 3VGPA 2CVHA 4C07A 4EA6A 2CXNA 3KE9A 5LP6B 1T1EA 1M2FA 3CFYA 3B12A 5L7TA 3C3BA 4ZVQA 4IKOA 3L7CA 1HLPA 4B82A 4OFXA 3SC4A 3CNNA 4QYSA 1EG2A 4JT2A 4LN1A 3VH2A 1Z2EA 3TJZA 3EZ6A 1Y80A 3LECA 2A5GA 4QA9A 1ULTA 4O08A 2VPIA 5SV2A 3RS7A 1HQYE 2DFLA 2WAYA 5BUSA 5KYVA 2GEDA 5K1ZA 4B3BA 3JAMA 5HJ5A 1GUAA 1R00A 1K8RA 4P93A 2JDIA 3RFTA 2ZRBA 3B2QA 1EAMA 5G4LA 3U4GA 4BNVA 2A57A 3NV9A 2WJ4A 3BRWD 1NLMA 1SCQA 4K9KA 3FOEC 4MWEA 2C03A 3AKEA 3PJFA 1JYSA 4I55A 4R8SA 4JCCA 2ZUCA 4MKHA 4Z9BA 4WCFA 5EMMA 4DCPA 1Q3HA 1VKNA 1XTIA 3D8SA 3SGLA 3IEMA 2P2LA 2RK3A 2QQ5A 3UQYS 1DO8A 3A32A 4X8LA 3ZNOA 2GYWA 3BB1A 4WOJA 3ILSA 4BMXA 5BN5A 4C7VA 2G88A 3WLHA 3IVXA 3H11B 2Z2KA 4OGFA 3UJ7A 1W2GA 2PGLA 1UFVA 4N5NA 5DE3A 3OCWA 2PV7A 2VDWB 1ZUNA 3UJHA 4RC9A 4BBZA 1EQAA 4C4YA 3R5HA 3SQLA 1OZHA 3LBAA 3D8NA 4RS4A 5C7IO 3SHTA 5JRDS 1T5DX 1EBUA 2F3UA 3EBPA 4MR8A 4O4LA 5HF9A 4AMVA 3ADPA 1X7YA 5G2OA 5BMVF 3HKBB 1A4IA 1OJLA 4ND6A 2GB4A 3AV3A 5J2UF 1KIFA 2B7LA 3BWMA 4P35A 2W4IA 3OIGA 1D2NA 4NICA 3RH0A 1E2NA 1VE1A 5D85A 1F06A 4AU1A 4F5YA 5EIXA 1SXQA 2I2DA 2H07A 3QEMA 3ANXA 4MR7A 1GKYA 3WYEA 3TCKA 2ZRMA 2ZB2A 1D2MA 1VZ3A 1CS0A 5GJWC 5JY1A 1N3IA 3VVBA 3AM5A 4RJTA 1YRLA 4Y3UA 4DDMA 1K92A 3GGCA 3L8ZA 5I9BA 1KGDA 4DUGA 1UK6A 4Z7OB 4ZGWA 2FZ5A 1G291 1P80A 3STXA 2O50A 3V4VB 2V65A 1P2UA 3HVJA 4B33A 4CKCA 5EUMA 3A6LA 4YIKA 4HXYA 1HY3A 3D6MA 1UPAA 1C3XA 2R66A 4QGGA 4G0XA 3RSQA 2QGNA 3CEAA 4V1CI 4N5IX 3RYIB 5ALGA 4RE6A 1GDTA 2ZAYA 2VPXA 2IEBA 2E0IA 1K1EA 3OG9A 3R0QA 1WMDA 3V42A 5LQRA 2PKEA 3AF3A 3OURA 4DR3B 2G5TA 1Z74A 1YGPA 4LX8A 1FUIA 4BVBA 5CIWA 3B6ZA 3H3JA 4BNHA 1TF5A 3EGOA 4KK4A 4TMVA 1UINA 3UM9A 4Y9UA 2JI4A 2UVQA 4L8VA 5M04A 4Q9IA 5JI3E 1Q1BA 4JV5B 3LLMA 3KQSA 4UEJA 2VJOA 2OFFA 3IQFA 2QRKA 3JD0A 1FS6A 2P4UA 2P6MA 1N2ZA 2GASA 3E05A 1G9SA 3HDVA 1KMQA 3MZ0A 1YZYA 2KSQA 1O4WA 2Z1NA 1N6OA 4KGVA 4OREX 5IBRA 5ILQA 4B3SB 1S2IA 1UWCA 2CFSA 2ZTLA 1F4PA 2CW5A 3FVTA 3OCZA 1I24A 2L69A 4AZWA 2B4YA 1O0SA 4X84A 2YW2A 1FQKA 5JCOA 2DPGA 5K0ZA 5HG0A 1ZAYA 3L7OA 3A9UA 3OPVA 4HG2A 1RRFA 4MRRA 3G5LA 1R64A 3WAGA 3S2UA 3PUYA 1LS1A 4Q16A 3CH5A 1SCDA 3QUCA 3OHPA 3GL9A 3ZW8A 1Q1QA 3AKZA 2JAOA 1LK5A 2FPRA 1ARZA 1FY2A 1I8TA 2RGAA 3ORYA 4OK3A