3ER6A

Crystal structure of a putative transcriptional regulator protein from vibrio parahaemolyticus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
192
structure length
192
Chain Sequence
KNLRVVALAPTGRYFASIISSLEILETAAEFAEFQGFMTHVVTPNNRPLIGRGGISVQPTAQWQSFDFTNILIIGSIGDPLESLDKIDPALFDWIRELHLKGSKIVAIDTGIFVVAKAGLLQQNKAVMHSYFAHLFGELFPEIMLMTEQKALIDGNVYLSSGPYSHSSVMLEIVEEYFGKHTRNLGNQFLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative transcriptional regulator protein from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Structural genomics, unknown function
molecule keywords Putative transcriptional regulator protein
total genus 62
structure length 192
sequence length 192
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3er6A00
1QF7A 4B31A 4ZGGA 3UGJA 3ZR4B 1K9VF 3ZJ5A 2RK4A 1ONSA 1UCFA 2XF2A 3PQ6A 3TQIA 4ENWA 4GE0A 3KKLA 4K2HA 3R76A 4WXYB 5LIRA 4P35A 3CZAA 3CY6A 3EN0A 2GK3A 2IUFA 1I1QB 3EFEA 3PQ2A 1IPHA 1M6VB 1QVWA 1QVVA 2FEXA 3EWNA 3TTYA 4ENQA 3SF8A 4L78A 4Y1EA 3ER6A 1SOAA 2VDJA 1QWSA 1KWKA 4GUDA 4UCFA 1T0BA 5SY9A 3MIIA 1PV2A 1VCOA 4AUMA 4P36A 2YWDA 3UOWA 1CS0B 3OT1B 3R75A 1CE8B 3TTVA 1P81A 4GE3A 3BWEA 1KEEB 1OX5A 5IP5A 2A9VA 4RKYA 3FSEA 4Y1FA 3NOOA 1WL8A 1GGEA 4AUNA 3FIJA 4Y1RA 3TTTA 1P7ZA 1VCNA 3CNEA 4ENUA 4OJYA 4AJ9A 1OX6A 2AD5A 3F71A 1SY7A 3TTUA 2VXOA 4OQ4A 4E08A 5JZMA 2GHRA 4I2NA 1GGHA 1OX4A 4MNTA 3P9PA 3M3PA 3MGKA 2LXNA 3PQ7A 4L8FA 4ENVA 1I7SB 1C30B 2OR3A 3WFZA 1FY2A 3NORA 1JDBC 1S1MA 1A9XB 2ZUSA 3D54D 4S0ZA 1VHQA 2R1VA 2R1TB 3L3BA 4OIFA 4B40A 4ZDKA 1GGKA 4ZDIA 5BV2P 4L8YA 3B3AA 3L4EA 2V4UA 1GPMA 1GGJA 2VKTA 3TTWA 1R9GA 4ADSG 4B7AA 3PQ8A 4UZSA 4D1YA 3PQ5A 1IZZA 1IZYA 4L95C 4B2YA 4L7QA 3TTSA 4LGYA 4Y1GA 1P7YA 3ZJ4A 1J42A 5E9AA 1KA9H 2ISSD 3NONA 4P5PA 1GGFA 4P34A 2VPIA 3UMMA 4PXYA 3N7TA 1C3OB 2AB0A 3SOZA 4WINA 1VCMA 1N57A 2ZUUA 3UK7A 4B5KA 4ENRA 1OY1A 1G2IA 3PQ3A 1PDVA 5SY6A 1Q7RA 3VU3A 4E5VA 1T36B 3B38A 4OGFA 4OGGA 3UJNA 2W7TA 4Y1RB 3L7NA 3P9QA 4QYXA 5SY4A 2YWBA 3L18A 2D7JA 1P80A 4MTCA 5K4AA 1GPWB 4JQSA 4AULA 3RHTA 4UNIA 1U9CA 4RKWA 1KXJA 3CZ9A 4BTEA 2YWCA 4R7GA 2RK6A 3SF8B 4ENSA 2ZUWA 4ZDJA 1GG9A 3NOVA 1OX4B 3B36A 4N0MA 1PE0A 1PDWA 2H2WA 5JZOA 1QVZA 2R1UA 3EZGA 1I7QB 2NV2B 2R1TA 2R1VB 1Q2UA 3CYFA 1P5FA 4N12A 4QYTA 3P9RA 1L9XA 4UOQA 3OT1A 3NOQA 1KWGA 3P9SA 2WJZB 1T3TA 2ZUTA 5SYAA 4BIMA 1FYEA 2YWJA 1OI4A 4BFLA 1CF9A 4ENPA 4AUEA 1BXRB 4XLLA 2ABWA 4OFWA 3PQ4A 2RK3A 3F5DA 4UOZA 4L8WB 3TTXA 2NV0A 1JVNA 5DFAA 2VRNA 3EJ6A 3GRAA 4P2GA 4HCJA 1O1YA 3R74A 3NVAA 4MGHA 4ENTA 3BHNA 4LRUA 4Y0NA 4I46A 1QDLB 2ZUVA 4I4NA
chains in the Genus database with same CATH superfamily
3TRKA 3CW8X 3A4TA 1DC3A 3IAXA 2VDOB 3IBYA 2IEYA 5DYNA 4EHNA 2V7XA 1J90A 1I2BA 1J2UA 2QTCA 2WB2A 2R8EA 1BX0A 4ZEOA 2JIZA 1YDFA 1Y1TA 1KI6B 2IYAA 1P8JA 3CW2A 3FDIA 3QU4A 3ROFA 4Q03A 4BMOB 4IY1A 2D8AA 4CTJA 1C29B 4TKVB 3WSVA 2OOKA 2QM3A 1IIBA 2CNKA 1XRLA 2V4ZA 3ER6A 2CN1A 2E1PA 1EQAA 5DYIA 5EE9A 2F8LA 1PJSA 2JI7A 1QG4A 3H5TA 3KVVA 2WIGA 2QYHA 3UWSA 5IMSA 3OZGA 3MT7A 3R09A 3SJAA 5DM60 5FLXA 2Y9PB 3UOWA 1JECA 4G0UA 2BGGA 3Q6IA 3MRSA 2QT9A 4BZQA 2QAJA 2WAYA 2X2FA 5DOZA 4X1IA 3VZBA 1TRHA 3W5CA 4RVGA 1D1PA 4PQGA 2QE7A 4PIPA 2NZWA 3E3LA 3H04A 4AY2A 1ZITA 1XD2B 2AOVA 2G67A 1TTHA 2MSDB 3IUSA 3L92A 2B36A 4LECA 3R8CA 4WBNA 1DKMA 3U48A 2NXEA 3I2JA 3T12A 2ZBQA 4C6TB 4I2NA 4JYCA 3M3DA 4YJ3A 4ZVLA 4A15A 4KL8S 4CV2A 2AIRA 5HQ3A 3KOXA 3I23A 1VHJA 2HIMA 1T1RA 1CUWA 3G2KA 4IOJA 5F4ZA 1BDJA 5TT0A 3X1DA 1QFYA 1VSUA 1G3IA 3IPYA 1FFAA 1NQAO 4R1PA 1KS9A 3OTQA 2QF7A 4BRZA 4DCJA 3EODA 1M0EA 1SOMA 4YB8A 5AM0A 1CC1S 1E4VA 2AFIE 1DTSA 1JYEA 3N2GA 4WADA 3ZVRA 4CWAA 4ZICA 4EH1A 3TZQA 4KUHA 4LDNA 3GUCA 5AO9A 5KKNB 1JEJA 2C1EA 4EENA 3LUPA 5BPFA 5IABA 3KAQA 4PHFA 3KEGA 2ZANA 5D51S 2ZJ1A 3C85A 4GPBA 5GJBA 2JPDA 3IAAA 5E1OA 1NRXA 4HGNA 1UPUA 3KS9A 3TCXB 2DTDA 4X7MA 1JIIA 3NVKI 3TRDA 1UBTS 4JWKA 2EZ9A 5IS2A 4PSCA 1F2TA 4FOLA 2PXHA 1WZIA 1NN0A 4KXYA 4PNHA 1V5GA 2C97A 3C14C 4G9EA 3WJAA 4PAOA 3RHZA 3CRMA 3USCS 2HC9A 3EPKA 2FP4B 4BZXA 1FFWA 3KM0A 3PJGA 1JFVA 2OGZA 1KL7A 2X86A 4Q3DA 4DUGA 2J3MA 2OUKA 1J49A 4C21A 1J25A 1ORHA 3WZ2A 3M2TA 4YXFA 1VBMA 2HZBA 2IOYA 3OVMA 3PXAA 5KAPA 2AC4A 4GH5A 5EIHA 4S1OA 2P9FA 5AVJA 4N9QA 1MLDA 1U2DA 4IH4A 4B3MB 4QUIA 1P4AA 1G20E 2YV2A 3M83A 3IIJA 2EDCA 3AH8A 1D2AA 4IXMA 3LT2A 1GPH1 4JLWA 2A3NA 3HVHA 2WFZA 5EJ5A 2MR6A 4ZRDA 3AQIA 1DAOA 4EHKA 2YXPX 2R60A 3U4AA 1E96A 2NQTA 1K8ZB 2HJGA 1YRYE 3B6JA 3L8EA 4M1ZA 5CD9A 5D7BA 4QXOA 1PSWA 4J1TA 4QPJC 4RZ2A 2R8BA 1I1HA 3HB7A 3M4ZA 1KDZA 2JFBA 1A9QA 2QX9A 3JVEA 3QYFA 4GKAA 3AR9A 3RYIB 1C30A 3OJCA 3DXYA 3EDYA 3T1OA 4N7BA 5LKAA 1ZYUA 2CDAA 1GPJA 1X9HA 3FG9A 2NP6A 2WJ4A 2YQZA 3B9RA 5BOSB 1NLZA 1W75A 2PX4A 1E1LA 4B80A 1YRQA 3OFJA 1L4NA 4P53A 4G0PA 1AHHA 3WGKA 1ZZGA 2AFVA 2A4MA 1FQOA 3AEUA 3OC0A 4ZO7A 3PIDA 4C0HA 2GN8A 3FWYA 2NIPA 2MINA 4B6SA 2QD2A 4MV5A 2Q5JA 1TEXA 2ZJ0A 3V4FA 3JATA 4GVPA 5F73A 5JQGB 2OM2A 1QHSA 4LOAA 1X6VA 3NBXX 3D7RA 3KQQA 2DFKB 2EYUA 1ISGA 4HS9A 4RU1A 3WIOA 1J06A 1VIYA 1NAHA 1E3TA 3BKWA 3KCNA 1DBIA 4RTQA 3RS9A 2XZTA 4CL0A 5DNCA 1Z82A 2GTPA 1Q21A 1PVDA 1JA1A 2J5QA 5TPZA 3T7JA 1MD9A 4DCMA 1WXFA 4Q3LA 5BYAA 1ML4A 2QEQA 3BQ9A 1FTYA 4FFWA 1JBQA 2JH3A 4ALNA 2I67A 3GY0A 3FRHA 2RGXA 3EBLA 4GNKA 1M7HA 4OM7A 4FOSA 2HBZA 4KXLA 4Y3UA 1NNLA 4U8GA 2VPYA 1DCMA 2TMDA 2SKCA 3EPLA 3ZVMA 3X1XA 3CB2A 2DKFA 2REOA 3M3PA 5JAPA 4YMHA 2W2VA 1N0IA 5IJAA 5G0UA 3QE2A 1MB2A 2DX7A 2XQGA 1JDVA 1T5SA 1Y63A 2O2XA 3LVFO 4TZ0A 3WLOA 2YRWA 1UOQA 2CLDX 3O8LA 3DEHA 1NFFA 4BB6A 1XNRB 1HLPA 1OXTA 3PLNA 3NHBA 1FS6A 4ZVTA 1QGZA 5FYDA 4Q18A 3N8KA 1DAHA 4QOJA 1LPNA 2BELA 3VVMA 3QPWA 4YP0A 2TRSB 4MICA 5HS6A 3W5UA 2FW7A 3WMGA 4YY3B 4B17A 3GLIB 5DSZA 2C3OA 3V2IA 4UCWA 2R5WA 3QVXA 2WA2A 1EWYA 1J00A 2OV3A 2JFYA 4C3OB 4HTFB 3OU6A 4Y2HA 2QD1A 5DK4A 1FP6A 2OGTA 2XUGA 3HXKA 3KR0A 5IVIA 2WP0A 3ELWA 3IPCA 5HOEA 1KPHA 3CUSA 1PR0A 2IKSA 2OBMA 3DKPA 4FGWA 4WXHA 1LTHR 1Q91A 4MRSA 3DE2X 4Q4HB 4Z4HA 3GI1A 3NIWA 3V42A 2CXNA 3W2EA 1N2CA 3PDJA 4N5HX 3Q3HA 4MLPA 1DJQA 4PF1A 1VLZA 3W5BA 1I36A 1BW9B 3EZGA 1LQUA 5I8PA 1GSOA 5IFLA 2PT6A 1KARA 3C6KA 5H0IA 4JLVA 3GLTA 4TV9F 1CR0A 2ORYA 4D6XA 1U94A 2FJ0A 4RHUA 3BK1A 3DP7A 5ED4A 3KUUA 4KSYA 4N5LA 3MBOA 4LVOA 1QHYA 3A1DA 3A10A 3SHTA 4TLAA 2A9JA 3K7EA 3BBLA 2EQBA 1IJFA 2HLDA 2P4SA 1U6IA 3JWGA 3JX9A 4JT8A 4QQKA 1E59A 5F7OA 1Z4QA 4IVRA 2V7EA 4XQ9A 2AJCA 2MU1A 1LW7A 2XYQA 2VJBA 1HQDA 4I5EA 2YFHA 2ZI3A 4URHA 1JG3A 2R5NA 1CYDA 1A82A 3E23A 4R81A 1G8MA 3OETA 5GAJA 4AX4A 4EYSA 2EJBA 1L4EA 1YAJA 3I53A 1XQ6A 2GJAA 4JLAA 4ALMA 2UZ3A 2WHPB 4BCDA 1DLIA 3EFEA 1CZNA 3V1NA 3QBEA 3TIVA 3HB9A 1N33B 4DW8A 2VDMB 2CHUA 3RVMA 3A37A 4TT3A 4JLDA 4DG9A 5HS4A 5JVDA 4PGFA 4RQUA 5CYPA 3ADPA 3CGGA 4YYEA 5A3JA 3UXEA 1VPEA 3BDAA 3NTOA 3GLQA 1AKUA 4RA9B 4H6XA 1JFFB 4KXNA 5C7OO 3DBLB 4NDAA 5A5EA 4J0FA 5A3SA 4L51A 3OWXA 3LUDA 5B6PA 5J4LA 4DC0A 2P9CA 3QVKA 4H1VA 4RTMA 4FGZA 2D8MA 3FXAA 5JUWA 2IHBA 5LA6A 3ZLUA 1M6HA 1ZAKA 1P5JA 1DBSA 4KYVA 2OBBA 2OHJA 2WWWA 2VYQA 3DPUA 2H9YA 1PJQA 4BB5A 2G5TA 4R71A 4DDMA 1CUVA 3J81A 2QLJA 2R751 1YMVA 3RKRA 2DF8A 4D3ZA 2BUBA 1NP6A 2GN2A 3HBMA 1ZJ4A 3R7WB 4JYAB 2PZKA 1XA0A 1Z36A 3FPEA 4REMA 3TL2A 2FGJA 3JQFA 2ERXA 4PLHA 2O7QA 1VP9A 4F71A 2NZ2A 4GFDA 1MEJA 4PZCA 4DM3A 4DDWA 3IUYA 4P31A 5I9NA 4HAXA 3VZPA 2QENA 3EF3A 3EPHA 3LVBA 3SQOA 1Y9AA 1T10A 2FZ4A 3AERB 3L8YA 5DM2A 4NJMB 1R0BA 3D3JA 4O2AF 2W22A 4LJ8A 2W8BA 4MB2A 1YB7A 5BSHA 1FLNA 4OHFA 3UJAA 4IZ6A 3HVUA 4UPVA 1RWXA 1OILA 1SCUB 3T3DA 2NX2A 3PDIA 1RXIA 3TSAA 1VCMA 1U63A 3BUSA 5CDTA 5AYVA 3VO1A 5F51A 1DFGA 3BXZA 3OQOA 1A5SB 1USGA 3WDLA 1QO0D 3N5CA 3A2KA 4MV4A 1TM1E 4RORA 1GGNA 2VS1A 3TAXA 4LQLA 3ZCPA 4NG4A 1M76A 1V2HE 1MXHA 2GCPA 4FFMA 3UC5A 2G1KA 2OUIA 4FMDF 1LB1B 1ZN2A 2E5WA 1G4HA 1X14A 4B76A 5K0CA 3IKMB 3CISA 2HLHA 4C0JA 1FDVA 4YCDA 4MR9A 2CZQA 3HWRA 5U9CA 5FV4A 3ZWCA 2QXUA 2ZUBA 2WW8A 1P5RA 3M6MD 2O0HA 5K51A 1ZLYA 1X7WA 4KACA 3TVTA 2GA8A 1T6ZA 3L6CA 2BL4A 2ZRQA 4O3FA 1KMNA 4MITA 1DC6A 4P81A 2A1TR 2A5JA 2XUZA 5DNDA 4K9NA 5JI3E 5F9HA 1XB2A 1S8NA 1FUUA 2GPWA 2J5KA 2UV8A 3PDWA 4QJ5A 1I33A 1UMBA 2DHEA 4ZCQA 1CJUC 1XEWY 4IRUB 5JDCC 3ZEAA 3KVNA 4M0LA 4HDNB 4BRWA 1S4MA 4Z9YA 5C8VA 3KKNA 1SD5A 1XCMA 4L8WB 2I6XA 5L3ZA 3BWMA 3RG2A 1YRWA 4JI4B 2GPBA 2AOTA 1PNTA 3JPWA 3RYCA 3FDFA 2NO4A 3H6HA 3A6KA 1JG2A 4QQNA 4ZCPA 2R48A 2PIAA 3E48A 1T15A 3F1KA 4G81A 5A3RA 2BZ1A 5G0SA 3N0XA 1D7AA 4ARUA 1GV1A 1ZQ9A 3RVSA 3C8ZA 2HU8A 2IDJA 2IYOA 3QU9A 4FSHA 4AO6A 2HHCA 2EZ4A 3X1WA 3UBMA 3ESZA 2Z6QA 3NC0C 3R44A 2F3RA 5HJ5A 1V3TA 4LMAA 5E6UA 3IQWA 1LRKA 1TL7C 1X1RA 1NU8A 2LDBA 5A0FA 1PGNA 1W36B 3N58A 2UVDA 4H27A 4J2OA 4LDPA 121PA 3PSHA 3JARB 4QUGA 4U4AA 4HY3A 1LJ8A 1NYQA 4TYYA 3TI7A 2OE2A 3G2HA 2WSMA 3MGBA 3F78A 3PJRA 2YCLA 4MH0R 2BFPA 2JLSA 5CH3A 1S2GA 4M6WA 4A4DA 1U2RA 6ABPA 2Y1KA 1ZJJA 1BGWA 2HSJA 2RAFA 2YFQA 3F7MA 4PS0A 3TXAA 2P30A 5CK5A 4IM7A 1YZFA 2PX5A 1CUYA 1UL1X 3TBKA 2DSTA 4EY6A 3A9RA 3GUYA 1SURA 1TZBA 2YH2A 3OPXA 4UVGA 4B3IA 5AOBA 4O8ZA 4TUYB 3WWCA 2A2ZA 3JALA 3LX4A 2PNJA 1Q92A 3GLHA 4K1XA 2WKRA 4A1OA 3AR8A 1YVPA 1FMTA 4CMIA 2VHUA 3NASA 2R96A 1AD2A 1ZG3A 4JI6B 4F45A 2I71A 3LHSA 4Q66C 3FYHA 3EUAA 3JVIA 3Q5DA 5KC9A 4R83A 3AUFA 1M6VA 4QOSA 3V8PA 2ZTLA 4WMLA 3VPCA 1DMRA 3TPCA 1YGYA 1N92A 1DQRA 1SG9A 2BGIA 5PNTA 4YRCA 3WGUA 2OQVA 3VNRA 1SPXA 2I4NA 4BO8A 4BFYA 13PKA 1K2VN 4N6GA 1OXUA 3EA0A 2PHZA 3F8SA 3R3YA 3WLTA 4Q1CA 2FTKE 1CUXA 3DT8A 3HV0A 1WDMA 4EM6A 2C29D 3BMNA 1WKCA 1MX1A 3PFFA 3HU2A 4OY3A 1BVYF 1D6MA 1JMVA 1SUCA 2OFPA 2ZTUA 3A6JA 3DL0A 3S0JA 4FWTA 5COQA 4FCCA 2OCBA 1SU8A 1BFUA 2DBVO 2LUOA 3QH4A 3CVYA 2YXEA 4MVJD 4N6NA 3EEOA 2ZJAA 3CUEF 1PI3A 2ADFA 4YMGA 5THKA 2ONJA 1KIMA 1Y3HA 2WHQA 1NUQA 4XVCA 4BO5A 3OOWA 2J0UB 3RFFA 1QFXA 2PX6A 3QXCA 3JV7A 3QUQA 3IAS1 3VNBA 4EVIA 1YAHA 5BRAA 5JY6A 1RXEA 4KFCA 1M10A 3MSXA 5JZ9A 1L4FA 1PD0A 1N9KA 1H69A 5ALKA 2G83A 2B35A 4AF6A 3WJ1A 3BXFA 1OJ7A 5K3AA 4DJAA 1V3VA 3EQ8A 3OH8A 2GF9A 3P9XA 4GLBA 4JROA 1XU4A 1E3WA 1U8AA 2FR8C 2LZ0A 4XOUA 4K9SA 1GA4A 3OHSX 2RJ3A 1Q0PA 4KI0A 4Q7QA 4OFWA 3RSCA 5KMGA 2QAIA 3O94A 5JCOC 2JVJA 4JXZA 4H60A 4RFSA 4MW9A 1A4UA 4H7JA 4LSMA 2G4VA 4XEUA 3KQNA 1IJBA 1HDGO 2JRLA 5AW7A 1XNJA 2AJTA 4LGMA 4XYGA 3BIJA 1PNVA 2FSUA 3R24A 5ALYA 5T4EA 4FNMA 4CMCA 1K6EA 2G28A 4RF2A 1PO7A 4ZTBA 1OTXA 5JH7F 5JS8A 1JEYA 2WMDA 2GXAA 1J07A 1T91A 5F35A 3KHTA 1UAYA 1UOEA 1UBKS 3MT9A 5FF9A 5HFJA 4PLPA 4I99A 1S8AA 4F3NA 3DZDA 2HDNB 4N8DA 3NBAA 3HXQA 1N2CE 4PRLA 5I7EA 4MS4B 4XIGS 3J80A 1Y8RA 4QJ4A 4BY9E 1B76A 1U8TA 1ZM2A 2QUIA 1QZZA 1D09A 1H9AA 4IMJB 4IW3B 3GLFB 3K1JA 1B41A 1JG1A 1XELA 2MIIA 4RY0A 3QPVA 1BE1A 4RPKA 4C0BA 5FAKA 2Z43A 4MW5A 1MIOA 3FAZA 3EVBA 2PLRA 4AJOA 1UF9A 1U9IC 3KV1A 1F51E 1J22A 4G41A 1NJ1A 1N2XA 1CUIA 1P3Y1 1XRJA 2ONKA 4OQXA 2E4ZA 3ICPA 1SUAA 1R8QA 3PBKA 3CB4A 4RCVA 4Z2YA 1B3BA 1C8KA 3Q8LA 3CLRD 3IAS6 2ZRBA 2VHCA 1FUYB 2WLTA 2RHHA 1PHRA 3L4SO 4I7EA 3G1TA 1TB4A 2X4LA 3ZV5A 2OXCA 3QMVA 5ALDA 3AWIA 4K5QA 4LYEA 2Q5OA 4QJIA 4AQ7A 3DQQA 2C7QA 3DBRA 2Z30A 3HCFA 3E70C 3I05A 2J7PA 2ORED 1Y5LA 2J0EA 4FE3A 2HF2A 3BMOA 3DEZA 5EERA 3PFHA 4O4JB 4U6NA 1UZLA 5G0TA 2HADA 1J8FA 3GHHA 1Y3IA 2QM8A 3L9WA 3WNDA 4C4AA 2WNIA 4HWKA 1B8NA 4D97A 4B3BA 4L7QA 4MW4A 1B6GA 4WXRA 3QELA 5BRJA 3NHSA 2OV8A 3EIUA 4L9AA 1DJLA 2XA9A 3AV3A 1UMCB 2OOSA 3DEAA 3M4XA 2C2XA 4NCNA 5DTJA 1AZLA 1XDWA 3NT5A 4X1KB 1QDUA 2VJLA 2J67A 2P1ZA 4BE9A 1FZTA 3IPXA 4BGEA 1I3NA 1BS1A 1KMIY 1XTBA 4M9RA 1EVEA 4M8NE 1VPVA 2FETA 4R98A 3WRYA 4CKWA 4XCVA 1SO8A 1XK6A 3A0RB 2D62A 1BS2A 1Z25A 1N9GB 1QPBA 4O4IB 1IATA 1KVTA 3L02A 4I36A 4RV9A 3ABQB 3UCFA 1DKPA 2IS4A 2NOAA 3IV6A 3DVAA 3FX2A 4J0HA 2P1RA 1QNLA 1C1DB 2QRGA 4PSDA 2RHBA 3EZXA 2F1RA 2DQYA 1IY1A 3DYIA 4LW8A 2CXQA 4X44A 1KR2A 1M2JA 4ZN6A 1P4JA 4RA6A 1OI3A 2GLTA 5IBQA 4GPAA 3H6GA 2FUG6 3FYTA 1JU3A 4HAYA 1DE0A 2WDZA 4QFCA 1RXSA 1M5RA 3AINA 3OHPA 2VP6A 2UZ0A 5HM6A 1W2HA 1QH9A 4R54A 3V2UA 1H1DA 4XWTA 3M1YA 2BWJA 3NT2A 3H0CA 3ROEA 1HA3A 1P0PA 2BI7A 3C16C 3N2KB 4NU5A 5C1BA 4L0QA 4DLNA 1VLVA 4EX7A 1WO8A 4L5CA 3B1ZA 1X7GA 4YAWA 2J5BA 3BA1A 4XDZA 5EJAA 4DA7A 5EIXA 1X74A 4DNXA 1NJGA 3ZHCA 4Z3OA 4LJLA 4OHBA 3C3XA 4ATNA 3S8YA 1WZ2A 1LXCA 3WK6A 5HJEA 1K7SN 3KXIA 3LC2O 1PR2A 3T9FA 1P9NA 3H1TA 1P4HA 1N6PA 4HDCA 5DIFA 3GOQA 4TQGA 5DHTA 2IRWA 3C2QA 1U98A 1GTL1 3D5EA 3G8DA 2XZPA 3DOOA 2FOLA 3A4NA 4RGYA 4GKJB 4XCQA 3JQAA 5BOVA 3SF8A 1AGNA 2FKNA 2I1WA 3G88A 4E7OA 1V7ZA 2O3QA 1UK6A 2CXSA 3FMIA 1XTVA 2LGJA 3R5SA 1DIGA 1B0PA 5DW0A 1DCTA 2DEUA 2DWCA 1NUAA 4N5NA 3WGYA 1FS5A 1S9DA 2GCNA 3ZHBA 1MAVA 1O94D 4QAQA 4B4KA 4NHEA 4NDZA 3CVWA 1CE8B 3C1AA 1DUVG 1NDQA 1Z3CA 2D1RA 4JOSA 5HR5A 1XX6A 5IP5A 4CKCA 4MVCA 4GRDA 4K87A 4N0DA 5H70A 4G5FA 3KPVA 1W0KD 1E5VA 3H5LA 4ALLA 3C7KA 1Y81A 2XMPA 1BH2A 4H35A 4UHBA 4J3JA 3CPHA 5H02A 3VOSA 1RT9A 4RF3A 1TJYA 4LF9B 1WX1A 3L0PA 2QLNA 3KJNA 1LDBA 4I50B 5LYYA 5AVUA 3OQ6A 1OX4A 4OXYA 2NM0A 5J40A 2F67A 3E53A 3NJ8A 1UJNA 4OGLA 1OAOC 4KLZA 4OP1A 4R2LA 1BA3A 2C2OA 4AP5A 1VHQA 3AGPA 4XQ0A 1YIAA 3UV6A 4L8YA 4ZO9A 1MB0A 4OK5A 8AT1A 1N5MA 1X2BA 2I1QA 4L95C 3TM5A 5TMPA 5CYOA 3FTEA 1M1YB 1NLUA 5E2AA 4F96A 1YA4A 3ZE8A 1GGFA 1I9GA 3GJ3A 1GUBA 1KZ6A 3UAZA 4MUJA 4L3WA 3T61A 1QIHA 1TM3E 4W9NA 5JC8A 3WB1A 2C8JA 3EIWA 2XNKA 4E7PA 16PKA 1V96A 2ODBA 3PQ3A 4HAVA 4P3PA 2QTWB 2P8SA 1F3LA 4E32A 3H1EA 2O57A 3KNZA 3OC6A 3REQA 4L0DA 4GQIA 3NALA 2GZ2A 1X94A 3E7XA 1OYYA 3RUFA 1EA7A 3IFSA 5FD8A 3GQBB 3CLUC 1BCRB 3TS1A 3QMPA 3CZQA 3FFBA 2WUVA 4FZRA 1TLTA 4DR1B 1I2MA 1N1GA 1K75A 2BGRA 1P77A 2E4XA 2FOXA 4HGRA 4JOCA 3LOUA 2WA1A 3A32A 4EYEA 3F7NA 4B81A 2D1YA 1TM4E 5F3DA 1YQQA 4JC5A 2H1CA 3AC0A 4JP1A 2H1FA 3SX0A 4QREA 2B9VA 2OBYA 2ZSKA 3ZE2B 5BMOA 4I9UA 3IV7A 1K7XB 2XRZA 2I2CA 4IVNA 1AGPA 4DZTA 3AEKA 2AV6A 2JK1A 1F4VA 4OVKA 3THYA 1K92A 4MROA 2RK3A 3F5DA 3NDJA 4KRGA 4EY3A 2BJWA 1VHWA 3TLJA 4TTTS 1BNCA 4MV1A 4F3TA 1RQRA 4PZZA 1U0JA 3INGA 4BNMA 4EKYA 1CDZA 3T5CA 3U7FB 5EUQB 3TIGA 3T99A 3RC9A 1R3DA 3DHEA 3EA5A 3OUZA 4RX1A 2UZIR 4P54A 2IPOA 3IT0A 5FI3A 3OQNA 2I54A 3UOAB 2PE5A 2GYWA 3E7WA 3L4KA 4JUDX 1F2VA 2XCOA 5CNJA 2NNWB 5F77A 4FX2A 4NMXB 5EKXA 3FGOA 1B42A 3BH7A 2BEKA 4KSBA 2RH4A 3RF6A 2ICAA 3KSRA 4OBWA 2NTNA 5DWQA 2XE4A 3ZTWA 4R8KA 1HT2E 2PRZA 2WVAA 2Y93A 3BIOA 2X4IA 3P4XA 4FGSA 4JA2A 4KH0A 5HJ2A 3F6PA 3R3ZA 3LLCA 1GPLA 3LGXA 1R64A 1CQZA 5CT8A 2C3UA 2VIIA 2P9ZA 4B2LA 5JDIA 1OJLA 2P4UA 4LCJA 1JLLB 1VPDA 1ZD2P 3JQCA 4RVDA 4D0NA 4GQAA 4TM7A 3CLRC 2DFDA 4A6PA 4AG6A 2B4YA 2DWQA 2VUSA 4AECA 3CT6A 5F5XA 5EGSA 2QVXX 3OZTA 3NDIA 3SBDA 2YS7A 3PU6A 4ER6A 3OLQA 2CD7A 1E1CA 1IEXA 1TYDE 1SUFA 1C3XA 1FX0B 5EMLA 1THTA 3KQPA 1QYWA 3PGMA 3QVUA 1S01A 3VI3B 3ECCA 1X13A 4OQ4A 3U1TA 4AWXA 1NIJA 5LQUA 2ZB4A 3H6KA 1TAQA 2AN1A 2ZJOA 3WMEA 2Q6IA 2UXDB 1JR3A 1KY3A 4Q4LA 4DJDC 1GFIA 4JJKA 3ABZA 4KQXA 1SN7A 2XZOA 1U7DA 5AVYA 3OO1A 1TK3A 3FETA 2CBGA 5K5EA 4FOPA 4IJ6A 4IMPA 3JAMA 1YFLA 4H3VA 3WLNA 1PL8A 2FFBA 3D54D 5K8CA 4KHZA 4Z6KA 4FYXA 4G23A 3P20A 5JZBA 2AC2A 1DIRA 4ID9A 1OXKB 2G07A 3U4QA 2QR3A 3MJHA 2WYOA 2J08A 2H1LA 4JI2B 5LBUA 3TECE 3IKLA 4N1AA 4UM7A 4WXMA 2F1HA 2IPMA 2NPIA 2X0IA 1NASA 1WMBA 2DG2A 2HEGA 1S9HA 1U1CA 5FFNA 3OF3A 5FQNA 5JMWA 3RTGA 3GMIA 4B6EA 1Z0FA 1L5QA 1TT5B 4ZU3A 4DV3B 3PITA 4WESA 1YNOA 3R20A 4M55A 2L82A 4HNRA 2PR2A 2W6OA 1AMOA 3L8FA 4L72A 4E5VA 3Q87B 3PEUA 3W4JA 3S7ZA 5FOXA 3AI2A 3BMCB 3G0IA 2J3LA 4FW9A 2EJUA 4OL9A 2WWTA 3QVGA 5CLIA 3ZCRA 1G9TA 4AJKA 4ZYWA 2FP3A 3G8BA 2HJHA 1Q0ZA 5K4AA 4DIEA 5L40A 2IA5A 1U2PA 3ONDA 3VKUA 5C37A 5IT0A 4TZ6A 1R5JA 1IONA 2L2QA 2QNRA 3QUAA 3WNQA 2AJLI 5IEBA 1QX3A 1PE0A 1XMVA 3EY4A 8ADHA 3D4IA 4ZV7A 2PGOA 4DCGA 5LZ7A 2VXYA 4B8WA 1NSFA 3TJRA 5I4BA 4M36A 5B3KA 2D3TA 3K8ZA 4XD7D 3HB1A 1YIDA 3UAGA 3WK5A 2JAQA 4CQLB 1G59A 3PLAE 2F62A 5ADHA 5CA1F 3GRFA 3QYJA 1E7MA 3SYLA 4JMPA 1IQUA 3VZSA 5KNBH 4RKQA 3OJOA 2MSKA 1XCJA 5EJIA 3RIMA 1CJVC 1IBSA 1RBYA 3NTQA 4XOIA 1YR7A 3PA8A 5DCLA 1INLA 4BPRA 4EWLA 3U5ZB 3A3PA 1J0CA 1EQUA 1HYBA 4MWGA 3B1JA 2G9RA 2O0MA 1XPOA 1QO7A 1G0OA 3GZ4A 5J9FA 4LI0A 2A1UA 3MUNA 3JRWA 4I46A 3HHPA 1BQ4A 1R0SA 2HRBA 1ZVQA 1DQPA 2ACEA 1U5BA 3AB8A 3T52A 1DOZA 1UODA 3EG9A 3GT3A 3LY8A 4WCFB 5C18A 5LQRA 5KPJA 3VU8A 2AS0A 1GARA 2PXCA 5HG0A 3QNWA 3H0EA 3GFTA 3QU5A 5JZVA 1Q3TA 2J6BA 4RUKA 5G1PA 1XLUA 5LL6P 3OMLA 2GK3A 2VPXA 1UC5B 2O06A 3M6UA 4OH1A 5EIAA 4AMUA 4HH0A 4Q00A 4BNXA 4Y7CA 1ODKA 3A06A 4YRMA 2R7NA 3G5LA 1V8BA 2I34A 2X6RA 5DV9A 4UFNA 2P62A 3MMXA 2WMYA 5EYPA 4RNCA 2VXCA 4PV7A 1Q1AA 1CEQA 2C00A 3U9TA 5FTNA 1XF9A 1P9LA 2RHWA 2GSDA 4A0SA 1P19A 2XXBA 4RSMA 2C95A 2GI4A 4YHHB 4WNAB 1CNFA 2PXXA 5K05A 1FFHA 4HDMA 3ENNA 2ZFUA 1UAAA 3N0TA 1EZ1A 4YP7A 3MAJA 5DYGA 5JZMA 4BWFB 2I6QA 2Q4EA 1E98A 2RD2A 3UVEA 4V2UA 3EUFA 4IXDA 5DLYA 4L9RA 4NAUA 3ZU6A 1HI9A 3AETA 4D4HA 1PWXA 1VBKA 2QMYA 3EDOA 4DQVA 4LK2A 1RI4A 1GAXA 2Q49A 1D9ZA 3AWDA 4J0EA 4K81B 3CVXA 3IMEA 1E3DA 3KJHA 3G2JA 2BHRA 3OJLA 1UFRA 4I66A 2AXPA 4YRBA 3WBJA 3MXOA 4IFEA 3PF8A 2AXEA 1A8UA 2P3QA 2XCLA 3H11A 4PZLA 5CGQB 3DE4X 3SEAA 5CCXA 2IS6A 1ZISA 1D2NA 2Y27A 4Q3CA 1KQGA 2VZLA 3KYCA 4KQKA 2J9GA 3RGWS 3VHRA 2W2KA 1Y9DA 4F4JA 3ZTTA 5L7TA 5CURA 2XNJA 1CJMA 4V24A 2XUDA 2W42A 4RC9A 3H8JA 1R1DA 3L7DA 5AOAA 3VR6H 1ACLA 1UJ4A 2WKPA 3Q3GE 2PUTA 3N6RA 2XWPA 3UJHA 5I7VA 3ZLTA 1C3JA 2BP7A 2PD4A 3PYLA 4G1UC 4DSAA 1FRVA 2HFJA 3MMSA 4O6VA 1DAGA 1NUTA 3FY4A 4RVFA 3ZD9A 3MJFA 4Q5IA 3SC2A 2ZAIA 1ZH6A 3D3EA 3I4LA 4M9UA 4EUNA 2I2WA 4RTOA 2C9DA 3BREA 3HBJA 2JGDA 1BAPA 3P9KA 4R7GA 2YINC 3JYOA 2JLXA 3ENQA 3GEGA 1GR1A 5EZQA 3AFMA 1AGYA 1JDTA 1X3SA 2EV9A 3A6HA 3KAPA 1D3AA 1QVZA 3RRFA 5TQ0B 3DE7X 5JZOA 1I7QB 5B3LA 3U1BA 2ZJ8A 4G5HA 3SDSA 4ZCTA 1C7JA 2HTEA 3MCAA 1TF7A 1RP1A 4NICA 1UT6A 2OKGA 2Q5QA 3HADA 5EL0A 5BUZA 3H2HA 4IKOA 3GHYA 1Q74A 4KMRA 2JL1A 1X19A 2QMQA 4FHDA 1ADYA 3K0HA 1OZ0A 1SC4A 5AVOA 4JI1B 3ACDA 2D7CA 3G1UA 3GFFA 4CTNA 2BM1A 4TXJA 4BKPA 2AUMA 3BTVA 4ASUA 2UU9B 1G18A 2PT5A 1M2FA 3H86A 2I1VB 4MQEA 5AXDA 3WRYC 4EA9A 2YFYA 2R6AA 1F12A 2WJWA 4UEWA 1RMYA 3FOFC 3PXBA 4CLXA 1CY2A 1DG1G 1BG6A 3WWEA 1V2GA 3VSAA 1Q83A 4JGIA 1VBFA 2CMDA 4C4XA 2RMKA 3EQZA 1GY8A 2GAOA 2XF2A 1P2GA 4J7AA 3UKJA 4LC0A 4YDSA 4OFXA 4IICA 1E2JA 3MHPA 5DHUA 2Q7OE 2YY7A 1XV5A 1JE0A 1NW4A 2HF8A 4AL4A 3GA7A 1T5BA 1XZKA 2LBPA 3EC1A 1QGED 4H1UA 3A1NA 4X24A 3PCTA 5H82A 3HVJA 3T7DA 5CLGA 3QVJA 3MCVA 1BOOA 3T4PA 1NVUQ 2HBYA 1I80A 1BDMA 3KXKA 4P3NA 1ZL0A 4F2DA 1ESEA 3M33A 1ZUHA 1QQ5A 3ZPXA 1P5ZB 4JEUA 4C7MA 5DX0A 1KEKA 5FAXA 2QIPA 2GKGA 1XJQA 5ICFA 2GYVA 1D4ZA 4RGVA 4Y8VA 5AIAA 3OZDA 3ZDYB 4YC7A 5B36A 4IXNA 2B8WA 3DBHB 3K9GA 4ALJA 5E2IA 3D2LA 1AB5A 3QFHA 1HE1C 3THRA 3QUSA 2JFZA 2X22A 1ZD4A 5BUQA 3DZGA 4ROTA 4PM4A 1U3CA 2P2LA 1OIVA 1FLVA 3G9QA 4Q01A 4IHJB 1UQUA 4JHLA 3PQ7A 4L3OA 1O9HA 3QXHA 4IZOA 1ORDA 1WCXA 4S0ZA 5DGIA 5DNWA 1RJEA 4Q1AA 3AVXA 4Q9HA 3DR3A 1MX3A 1W88B 2P78A 4F4CA 3EAGA 4WXEA 1Z74A 3E9RA 1YS7A 2OCDA 4C3VA 1WABA 5AI4A 2ST1A 5KHLB 2V9PA 3PKIA 3G8YA 4PU0A 3OWHA 3EWAA 2PJRA 2P3SA 1ISSA 2VG8A 1OT3A 4N18A 4R0MA 2PEZA 3F6CA 4C7VA 1SHKA 4P4SB 2VK4A 1NF2A 1RYZA 3WGJA 4OQLA 4B3CA 2NYVA 1VCHA 2B7CA 1JW9B 2A5GA 4KLRA 4RZ3A 5LCXA 2FSSA 4BEBA 4QFDA 1C5KA 3KALA 4J1NA 2Y0DA 2Y67A 3B2QA 4ER5A 5TIIA 4KN9S 5E4JA 4C7OB 1R8SA 2PMFA 4KO2S 1K66A 4U9HS 5HMMA 2NVWA 4FC7A 2DT8A 2Z98A 1J8MF 2H2WA 4FK8A 3WP0A 1OLSA 1Y9EA 5F2KA 3ZU5A 5HQ3B 2VQEB 4EJFA 5G1NA 1I5EA 4XD2A 2ZSHA 4BCCA 1SUBA 1XKTA 2PD6A 2QORA 3HZZA 2QM0A 4OH7A 4ZI7F 1I2CA 4PICA 2ZUTA 1R9MA 4AT1A 4ZI3A 1L4HA 3E8SA 2VWHA 3OAAD 1FTQA 4GW3A 2OWEA 2KLHA 1GM5A 2MCFA 4AI6A 1XAGA 3E22B 3KZOA 3FSRA 4KU4A 3RYFB 4JDUA 3H42B 3RIEA 2H1SA 5EWLA 4MJ7A 2EYQA 3ZHRA 3TGLA 1VL8A 1LQ2A 1YUNA 4I8DA 3E58A 1K6JA 2GZDA 1HYHA 4CMJA 3QMMA 4M83A 1W59A 4ENWA 1A9XA 3D8RA 2HUPA 2YY5A 1GCGA 2HA4A 1OFGA 3OTHA 3ZLVA 5SY4A 5BWNA 1JR2A 4OXKA 2Y77A 4Q12A 1Z4OA 2QSYA 5E4YA 5JW6A 2Z1MA 1DP4A 1ND6A 2JIOA 3ZLBA 2Z9CA 2P4HX 4OMFG 1J8VA 5FX2A 2FSGA 1UC4B 4YT5A 1FQWA 5IKEA 1C3OA 2DP4E 1XAIA 4KQHA 1PJZA 1V4BA 4YJ2A 3QM1A 1Y3FE 4NENA 1OX5A 2WAOA 2VHVA 4MRVA 2JI4A 3JQDA 1XWWA 5K8VA 3PT9A 3SG0A 3G9UA 4QYIB 3TTTA 3SXPA 5CDGA 1JKJB 3PDCA 1NWCA 3THWA 3HKCB 1NQUA 4Q1VA 4F5YA 5JS1A 4A91A 3KT8A 5IT5A 1JEQA 3MJSA 1BO6A 3DDUA 3DULA 1K1EA 2WJHA 2HK7A 4LOKA 4EKDA 5MN6A 4V0LA 2UUAB 2E6UX 3ZS8A 2QSUA 3I9JA 3TI9A 3E15A 2AG8A 2BFBB 3C3CA 1B6RA 3FWPA 1CB0A 1A69A 1CVRA 2C2ZA 4IFTA 4U7DA 2D3WA 3MUEA 1JQKA 4DIUA 3BTOA 3SQMA 4ZOEA 5BXQC 4O63O 3I1JA 1IDN1 4TTRA 3EZ2A 4ZAXA 3W78A 5H3LA 2KYRA 1MV5A 5BN1A 4QEDA 3Q72A 2QAGA 3HKBA 4KAFA 3DLHA 2YYYA 1F0PA 1QYDA 2IXDA 2OESA 1IWOA 1T2FA 1P45A 3DBIA 3FVWA 4NBVA 4OHKA 5DLDA 1A9OA 5J5VA 1I2AA 1XTIA 2I9PA 2VYNA 4LC1A 1X38A 4KP7A 4RXMA 1PNQA 4LSWA 5A5DA 4JXXA 2ZIUB 1SBYA 1WSWA 4BZZA 1T9AA 4FHEA 2IDMA 4F46A 1ZCJA 4XYBA 1HEYA 5IT9A 3HDVA 5AVZA 4LXGA 3V2GA 1UQRA 1ZRSA 2EFYA 1JSZA 4ZEMA 3BB1A 1DXHA 1EE9A 1QTIA 2CMKA 3FDJA 1JL3A 1AC5A 4O2BA 5B37A 4RJIA 3R0QA 3WC4A 4BAUA 4OKNA 2R5FA 3HCNA 4LBYA 2ZZMA 4OLHA 4CW7A 2HPVA 2VDWA 3RRZA 4ARAA 4WZBA 1CRZA 3EYAA 3U31A 3IO5A 1DAFA 2HIGA 5CT6A 1LNZA 4XJVA 4KFRA 221PA 5IKMA 3EIOA 2JI8A 3U4GA 5CMLA 2HCRA 3TX6A 2RB4A 3U80A 3AK4A 3CX7A 2CXTA 3ZHXA 4KCGA 2WNSA 4M9CA 3SLRA 1DC8A 3B13B 2HMAA 1R12A 1J4AA 5KB3A 2ZJYA 4M2LA 3A70A 3D6UA 3NTRA 2XRYA 5HDQA 4D80A 3FFAA 3VO9A 3C3BA 3NAGA 4B4VA 2VP0A 5DIZA 2PRIA 3WTBA 4KREA 2JCSA 1ZM3A 4ZOLF 4CLDA 1D2RA 1SUWA 4LZAA 4DCPA 1RW4A 2ECPA 2QLMA 2VUIB 5T8KA 2J7KA 3EXG2 1JV2B 4HTFA 1EPUA 2HMYB 3SJZA 5E9WA 5IVPA 3GP8A 4AIIA 3SXJA 4XSGA 1XDGA 1TXGA 1UWKA 2JFGA 5ITVA 3K0CC 5K3SA 4D92A 2OFWA 5IM5A 1LPSA 5BQXA 1SIUA 4UJ5A 1K68A 2H29A 3K0AA 2E55A 4CBVA 4RVUA 2C2HA 3V1LA 3HY4A 4C6HA 2G7ZA 5E7JA 7ABPA 2YQ5A 3AIOA 2X58A 5EP2A 3OEED 5K20A 1IHPA 2B4KA 3GDHA 4AO8A 4DLRA 2VTVA 1RYNA 5EJ4A 1P0MA 1TYZA 4RV4A 1BE0A 1Q0RA 3CNHA 3VU1A 3TGPA 3STUA 1FMLA 4OUDA 3SEFA 1UC8A 2O8EB 2QD4A 3ZCSA 3GP3A 2PX2A 1BIFA 3QEKA 5HIKA 5T5QA 3GXOA 1OT5A 3V8NA 3RGGA 5TV2A 1CY8A 1TGYA 4D9CA 4M1YA 4EB8A 4LRWA 3HBAA 5B1HA 4IXTA 1T0PA 1TF2A 3AU9A 1GDDA 4QHYA 4BLWA 4BHTA 4EEXA 2BGWA 2ZDQA 2AXNA 4TV8F 4DLBA 2FJPA 2X5JO 4ZKDA 1CK4A 1E9FA 2VHXA 4K6GA 4KHPB 1I0IA 1I4LD 3BXPA 3HVRA 5LC1A 1L7VC 4KE7A 1J33A 1EXDA 1KVRA 2NSHA 2P9TA 1EGHA 3ASUA 2D5AA 1AF7A 3BGWA 2CJWB 2OHXA 3E9ZA 4HRYA 4HXFB 1GPNA 4H16A 5FBHA 3U7RA 4EF4A 4IIXA 1YS4A 1RNLA 2WT4A 4ESHA 1R0RE 4HNGA 2R68A 2WHPA 4LI3X 4A0QA 1EXMA 1T13A 3FLAA 2DGDA 4G63A 2ODNA 1EGAA 5AH0A 4LJRA 1VSVA 2FSVA 2XA1A 2UYGA 1H6CA 2QGZA 2YZKA 4IMRA 2JW5A 4MKFA 3FYCA 3LLMA 3IHKA 4DNFA 2XCTB 2QG4A 3SZOA 4IX1A 4IZHA 2NSJA 4C0QC 3IILA 2ZBFA 3LG2A 3TVYA 1RACA 4D44A 5F7XA 1XTKA 3DDOA 4XX0A 2ZPAA 4G36A 3LPMA 4QOFA 1XWFA 1II8B 4F9FA 3SWWA 4CN8A 1KETA 1BE8A 1FTGA 2C7VA 2VOEA 2WTNA 3D4OA 1RRPA 1RVDA 2AJDA 2OV4A 4KAAA 2Y2VA 4LJKA 4Q1EA 4XWKA 5K4GA 2PU5A 4GO1A 4YJHB 3TW8B 4C0KA 3BZBA 1XMQB 4KIFA 5CXXA 5L7YA 5A4KA 1ZC4A 2Z95A 4KIUA 3HRIA 1MOQA 2Z2IA 4QDXA 1UDWA 2A9KA 3AJ8A 5LMNB 1HNZB 1XKLA 3HEBA 4YK7A 4ZI7B 5KYUB 1Y1KE 3HCWA 3IUPA 4RFLA 3KUDA 2ZI7A 4N0MA 4E2XA 3FVTA 2NVUA 2XX3A 3NRBA 3HUFA 3ONNA 1OFTA 4BB9A 1G16A 4C3UA 4HOYA 4JAVC 4DAOA 4ZTUB 3LF1A 1EU1A 3DE6X 4YCCA 2XODA 3TDNA 1NPYA 4A27A 3BL5A 4P4GA 1Y6JA 4CKEB 5JOQA 1LBQA 2G5PA 3PA6A 1CEYA 1GCOA 1Q16A 1Z6PA 5ALHA 3CHYA 3S1AA 3BFJA 4XGIA 4F12A 3QWIA 4FMDB 3MQFA 4IWXA 5CEJA 4V0MA 5LIPA 3DEJA 5E4FA 5U4XA 3HJNA 4ACBA 1MDBA 1O95C 3ZE6A 2CWDA 1CB7A 1KO5A 4I3FA 2JCGA 3OFVA 2O2ZA 2BGMA 1EUCA 2XLCA 3A28A 4BB0A 4LRUA 4IAOA 1ZI9A 2OAGA 3MEQA 1LVUA 2D0OB 1YHNA 5JCXA 1EWQA 1AKWA 2C04A 4V1CB 1TA4A 3WYEA 4DS3A 3N05A 5F4BA 1HNXB 4JSTA 3U7EB 1HTBA 2XLBA 3DBVO 3ZOKA 5HHTA 2F8TA 4LVCA 2JNWA 5F21A 1QPGA 1XNGA 2G8NA 4F7DA 1UPXA 3D43A 3A7EA 3L7OA 2OCLA 4HSGA 2YX1A 4EO7A 4NAHA 4EVSA 2G9VA 2B2CA 1ORRA 1RLJA 3ACBA 2BIFA 2GN9A 1NXQA 4P98A 5KOJA 4WOJA 4GDFA 2RKBA 1X7WB 2UXCB 3OKAA 1IB6A 4GUDA 5FPSA 1L8LA 4RK4A 1LWOA 2QL9A 4XUDA 4Y30A 4LNUB 2ZJBA 3TQFA 4HYEA 3CQ9A 5C7LO 2AOUB 1Y5NA 3W1EA 4W5RA 3ZHYA 4PTZA 4CM3A 1YR9A 3PXCX 4BO7A 3TK1A 1I13A 4GXTA 4YN3A 1E2PA 1FSPA 2RHDA 4GC9A 1ZGBA 1QYXA 2XV1A 4NH4A 2ZYSA 3IA2A 1D03A 2MSNA 1QF9A 2VTBA 1DOAA 3Q0TA 3OAAA 1SUPA 3E9DA 4RAOA 2QZSA 2X14A 3VXKA 3H1AA 1DQSA 2AOTB 4XWYA 3RYCB 4XA8A 3MUFA 1I01A 2W6NA 2GT1A 2WINI 3NGXA 3OZUA 4PHCA 3B2NA 1QYRA 4WI1A 3WYFA 3FCSB 2QS9A 3G0DA 4EFLA 1GUDA 2W6ZA 1W4AA 2IYNA 5DHAA 2IEIA 3WLFA 1E9AA 3BZWA 5C8YB 2REXB 4NLLA 1XTUA 4YUZA 4QXMA 3PNOA 2A0XA 2F00A 1E9EA 2NSDA 2Y1CA 4IH9A 5B2ZA 2DLCX 5E6UB 2IY8A 2ATEA 3QI2A 4X41A 1C8LA 1U2ZA 5CM9C 3RRJA 1YULA 1WVIA 3AKCA 3OIDA 4ARVA 4OXQA 4BFVA 5JASA 1YT5A 4Y98A 2Y9MB 3CKMA 3QV1A 1R0XA 4DTIA 4EUSA 1CUAA 1TM2A 2W58A 3SD7A 2V6IA 3OD1A 3EXHC 1Z0UA 1C41A 1F1JA 3IIKA 2HB6A 1WKBA 2P0EA 4RABA 5D01A 2NZYA 3QOXA 5TLSA 3RLIA 1Y8QB 1LLQA 1SBIA 2D7JA 2R7LA 4KIGA 2XRMA 4YASA 1OXSC 5E9QA 5JQWA 4PG5A 5I51A 3AF4A 3NMUF 3ZD6A 3ZUPA 4TUYA 2WILA 1A97A 1XSEA 2HA6A 2M1ZA 1TE2A 2G8LA 2CHVA 2HIHA 3RABA 4GRAA 2W6QA 4AY6A 3DV0A 5TPWB 2PANA 4RZHA 4OHCA 1YK1A 3V6LA 1WEHA 3HI4A 5J47A 5JBQA 1G7CA 4UQOA 4HWOA 3RUDA 4N12A 1MA0A 3T3OA 3A1CA 4EJSC 2OFFA 3SGLA 2ZTSA 2OCKA 2QQEA 2OSBA 1A77A 3AT1A 4I4CA 2ODPA 4JK3A 5MHTA 1EM8B 2EKLA 4XZ3A 3GFSA 3ZV6A 4BN5A 2CNOA 3LRTA 2NTJA 3L82B 2PKEA 4OLBA 1OFVA 1YCHA 4J16C 6REQA 1MGOA 5E1MA 4EHJA 1IY0A 1NMYA 1ZGCA 2WF9A 5LUBA 5B1YA 1JJ7A 4GBJA 4MV9A 2DWOA 3DFFA 4K6HA 5HUQA 3NBMA 1ECGA 5SYMA 3UV7A 5EXSA 1NBWB 2FRVA 5EINA 4V3BA 5FA8A 4Q7KA 3B1WA 4E5KA 3BF7A 1BDBA 1I2DA 3CO0S 3HQ4O 1YBVA 4EL0A 3EJWA 4X1OA 1NU6A 4X71A 2OAP1 2D54A 3BSYA 3EF0A 3ET5A 1Y5RA 2QN2A 4E4YA 3RFUA 3GLSA 4UUOA 5CVDA 1J2YA 2CK3D 2V3WA 3U9SA 5AW0A 5HRAA 4ZZIA 4MKHA 4KC0A 1EJ6A 4NPAA 4B3RB 3RASA 2IFTA 3ZDEA 1PZHA 4BXOB 2VQ3A 1QTNA 1UK7A 3C8MA 4FYIA 3BCRA 3CZ4A 5BVHA 1I0LA 4ZCLA 2O6LA 5IAKA 3F6SA 3OQ1A 5JZSA 1TX4B 2CFRA 1OTYA 3GVXA 4IOMA 2PA3A 4BLVA 1IEVA 3IQXA 4TWBA 4EBBA 5B5SA 2DT5A 2FMHA 2RI0A 3VZQA 1ULBA 5CFMA 3NUGA 1M7GA 3DR5A 1FP7A 1PR4A 2L17A 4FTWA 4KXQA 4MPRA 1E4EB 4NMHA 3GRYA 2ODTX 2JAPA 3AM3A 5IF3A 2C1ZA 2Z5LA 1JAHA 2ZT7A 2NTVA 4MWOA 1XHEA 1IBKB 2WKQA 4TV9A 4R1LA 5FXMA 4EQ6B 3RK1A 2ILVA 5A6SA 3DLBA 1TW3A 3AYXB 3HMQA 3IOBA 2NXWA 3HJUA 3D3QA 2A0WA 3O2NA 3SLKA 1DJOA 1SOVA 1SULA 2VTDA 1N3LA 3VMFA 4FFVA 2AH5A 4TTIA 3RRYA 2G88A 3EWIA 2JIMA 1DHRA 1HK7A 1WSBA 2IODA 2NLOA 2D59A 2RFLA 3GAFA 1JVSA 4KOEC 4JI0B 1M1XB 2FVYA 4YI5A 3ZZ1A 1ZK2A 5JH7A 2JFPA 5KVAA 2VBGA 3D6FA 3HGQA 4GZMA 5IHXA 4DRZA 4NNJA 3SY8A 3KWLA 4P6VF 3SHWA 4BN0A 4F84A 4WJZA 3H05A 3EAQA 5DM0A 3PRJA 1XDBA 2B4AA 3CBGA 3EOZA 1A9RA 1SGWA 3HU1A 2GCEA 3O1HB 1QZ3A 1QC5B 2FWRA 9LDBA 4N5IX 2J45A 4FMCF 5A05A 1J7JA 1PNOA 4B5KA 4OBEA 1TA0A 2EXXA 4E15A 2P77A 4V02A 4HN4B 4F8YA 2VPQA 1TC2A 3ND8A 3R40A 4K86A 1MTOA 3K0BA 3OE4A 1PUXA 4RHXA 3WO1A 4LF4B 4FX5A 2DKNA 3ZNPA 1D4AA 2WZQA 5MGBA 4HADA 3AEYA 3I37X 4JC4A 1GG9A 3HN7A 1QRSA 3IOMA 5FBVB 1XFDA 1G21E 4QARA 2IZ6A 3RRMA 3VKHA 3G68A 3FUWA 3VKGA 1JIXA 3SLGA 3AZOA 2G0NA 1Q2UA 3NTVA 1QOQB 2KBFA 4AB1A 3UAOA 3KK0A 4XJXA 2OD9A 3T35A 3O7MA 2RI1A 3OM9A 1VSTA 1P1RA 4B3TB 1HFJA 1IPFA 3TDKA 3ERCA 3NYWA 1RXUA 2B0CA 3E81A 4OI0A 5AW9A 3ZY5A 4HZGA 3VR4D 2PAAA 1AKTA 2QN3A 2QUKA 1C1HA 4D4GA 1FNDA 2D0IA 3TSYA 2ZJ7A 3SP1A 1UPBA 2NU6B 5BN4B 1U8CB 4CCSA 5IVHA 3OEWA 3CX8A 1OTHA 4BAGA 3RI3A 2IQ5A 3TQIA 3UJ7A 1ULAA 4AF8A 2I2FA 4CKWB 4UE6A 1ACMA 1FYVA 1T35A 2J4DA 3PGJA 1G98A 2ZCVA 3S29A 3KQKA 4Y2RA 1XCBA 1XP8A 2FLVA 2V6BA 4ML3A 1C14A 1IN5A 2CLEB 5AVSA 1ZFNA 3D4PA 4S05A 1MO5A 1VE7A 1QTQA 3BB3A 1C1DA 3UQYS 5A3QA 1DO2A 3CLUD 3IKTA 4AJLA 5GWXA 1Z62A 3HB5X 4JASB 5HVNA 3D6MA 4RA6B 1TKAA 1ECLA 1MGPA 4INJA 4IIJB 3P4YA 3EXIB 4K9LA 4RD4A 1JXAA 1R7RA 4HAUA 4TL7A 5BYBA 3ROZA 4Z3KA 2N42A 3WMRA 5BR7A 2ZPUA 3H5IA 3ZDAA 4MQMA 1UMKA 1Z47A 3TE7A 5BXYA 5ALXA 3HPQA 2UDPA 2VSOA 3FSEA 3L6OO 4GYKA 3V8EA 4C2UA 4TWJA 4OHYA 5CTAA 1NA5A 1PR9A 4LCEA 1JWBB 2VDKB 1P1IA 3AUSA 4FW8A 4L15A 4K6FA 1SY7A 1TTQB 2AQ8A 2Z3VA 4UFOA 4AYXA 4EW6A 1U0EA 3UY4A 1XROA 1CNEA 4Q4JA 2F1IA 3T7KA 4UUMA 4BMDA 1XQYA 1NXXA 5IK2D 2ES4A 4QPZA 3LDUA 3ZGLA 4DFDA 4O4HB 1X7DA 1MKYA 2TYSB 4PZPA 5C34B 4EY5A 3TFQA 3MW8A 3IIEA 1DX4A 2OMKA 4QECA 3T4UA 3PC8C 4DJFC 1HLGA 1UBNA 3KQUA 1AKQA 2ARKA 2RI6A 2WE8A 1Z2PX 1L7BA 2J5XA 1G8HA 1VPTA 3LBNA 4X3PA 4EGAA 3T4XA 5ALSA 2E37A 1QH1B 1RLOA 4H7DA 2VRCA 4US0R 2VDNB 3PUYA 5LQDA 5CIWA 1HEUA 4CM9A 4EB6B 1AUPA 4QA9A 1I7DA 1U7WA 2E4VA 3WLEA 2ZR0A 4JB0A 4OQEA 3I6QA 4G26A 3FBTA 2I6TA 3P5BA 4GLJA 5BSKA 1YKSA 5KINB 4POAA 3AKEA 5K6RA 1MH1A 3V8RA 1YA6A 1W5BA 3RYTC 1RJ9A 3FNGA 3VC7A 1F9EA 5F2OA 3WHLA 1Q57A 5KJFA 3D3NA 1T8UA 2O9JA 5IX8A 3PX2A 1EAMA 3UENA 1R8JA 2GARA 4D8YA 1KJQA 4YRJA 2ZB8A 2WPDD 3FCXA 1OX4B 2VXBA 3FTPA 3ST7A 4B9AA 4BVFA 1AKEA 5EXPA 2VCYA 1O08A 1QS0B 3BL6A 3F0TA 3PNKA 4C1NA 2V4MA 1U0BB 1GHTA 2NV2B 5B7NA 2YASA 1RBMA 1WZNA 5JAUA 1QP7A 1UWVA 3TW0A 3AM4A 4TZKA 3ZJYA 2CHGA 3K0FA 5H7XA 1MAUA 3O4GA 3NPAA 4Q05A 2DPXA 1DL5A 4L4UA 1YR6A 5EXDA 3KBOA 4PYJA 5AVVA 4DR5B 1C3EA 1PEDA 1F6BA 1DDGA 1QAOA 1MP0A 1ZGAA 3UJ8A 5JAHA 5H3HA 3KYDA 3C6MA 1SXJA 1QFZA 3DQZA 5CHEA 2OT3B 5K09A 3DGFC 1QP8A 3AYZB 2NO0A 3W8NA 5ARCA 1L7PA 1Q1ZA 3BWCA 3AFOA 2FUEA 1NBOA 3UIEA 4UEKA 5DTQA 3RSHA 1W4ZA 1P2VA 2Q7XA 3WRXC 1YVUA 3FFTA 3RRNA 1Y6FA 3KPJA 1ODLA 1D7OA 2J46A 4FB4A 2Y1FA 3OY2A 1WSAA 4J4TA 5IC6A 4LZWA 1F48A 3PDHA 3WYAA 4DJTA 5DNYB 4A0RA 3BG5A 1ENOA 3KPYA 3PJDA 1U2TA 4X0EA 3H18A 5DEIA 3U4CA 1BCRA 1KJJA 4BWGA 3JD1A 1H65A 3IVGA 1YIOA 1UKYA 4BYMA 1HTTA 2QV0A 5AICA 5TGTA 4JBYA 2FMUA 4H6PA 5D1NA 3AJDA 1KGDA 3NM5A 1LDNA 1S7GA 5AW5A 2CV2A 4R9RA 5LMZA 1YJ5A 4KQIA 4TX1A 4HWRA 3PF9A 5D3MB 3KZNA 1PV2A 2FN9A 3HY6A 1AUVA 4TKUA 3IMCA 3WX0A 3HA7A 1CS0B 5DXFA 1PCXA 1Y0BA 3UEOA 1C7RA 2O6HA 2ZRJA 4KRXA 1FP1D 2ZCUA 1IRXA 4LWZA 4OQYA 4Z99A 1YQWA 2WJYA 2X2OA 3FOWA 3G2IA 2XF8A 3IB3A 2P91A 2Y1LA 4TV8B 1NF8A 1XEXA 5ALFA 4HDSA 4BL5A 5A62A 3S55A 3LF2A 5CA1A 5JDIC 3F9CA 3B1XA 1E2QA 1Z5NA 2AX3A 3HYTA 4BVAA 4GM4A 4PIMA 4DGQA 6AT1A 2WFLB 4GXQA 1PJCA 4GC5A 4C0AC 1NXWA 2NUAA 2XH8A 3OKCA 4P22A 4RPIA 2NO5A 2ZYAA 5BSGA 5YASA 2AQKA 2P2CA 3D6HA 1NYRA 1W73A 1PWZA 1Z2NX 3N8DA 3NORA 1T9HA 2WD9A 1J0BA 4IDEA 4MYDA 1YASA 2HHJA 3GO4A 3QJ5A 4UXIA 4BV9A 2WU3A 3KWFA 4WLUA 4YRQA 2O7VA 2ZCJA 4IIGA 5GGYA 1PVOA 1Z16A 4JBIA 3T3GA 3VSEA 1NNUA 1UBJS 2Z2JA 1T5DX 2B1JA 1GL7A 2GPTA 3K8QA 2X9GA 4OQFA 1S2MA 3CLSD 1F0KA 3HLKA 3OX2A 1TDJA 4KQGA 2G5GX 4GPD1 1HG0A 4B44A 1K3TA 2BHSA 1W6UA 2V8OA 3PR2B 1C4XA 4JODA 4WFQA 1B8UA 1IZ8A 1FXWA 3V00A 1JKXA 4PQFA 2V58A 3DYBA 1I3CA 1DTWB 1C0KA 1FDUA 4F9TA 2RGDA 2CFSA 2M2IA 3PQCA 4LJ7A 4Y1RB 3V32A 4MP6A 2G77B 5TARA 2YN2A 1ZW6A 2LCQA 4MX8A 3GJ8A 2FA9A 2M32A 2NTEA 1JEOA 1BWPA 4DXDA 5DP1A 3W2HA 4JQYA 1M66A 4MXDA 1AUOA 3OY7A 2N3ZA 1NYLA 1XK7A 4I14A 4UCQA 4YAJA 3TLEA 4EHFA 5CB4A 1MABB 5FA5A 5CCBA 3WGHA 1CFJA 3IC5A 1QX4A 3H19A 4LFAB 2HA3A 4O08A 4D96A 1XNQB 4AYTA 3R6WA 3E5RA 2PUEA 1J2JA 3FMVA 2JLAA 3E6AA 4MYRA 2JAWA 2Q8QA 2QVYX 1GFSA 3JTEA 1JLRA 4HAZA 4NYIQ 1JXMA 1GNSA 1TQ4A 5C5CA 4EUEA 1VPLA 4BNKA 4EGQA 3W79A 2PVPA 4PQRA 1MQAA 2EJWA 3UFXA 4B73A 1UAGA 4IIVA 4CNQA 5LXTA 1PJBA 1UFVA 1SCQA 3RLFA 4LQCA 4OBBA 4RF5A 4ZTZB 1YSCA 3UMBA 3FZYA 4P38A 4B8YA 1SOUA 2AUTA 1YFZA 4HMPA 2CL0X 4QZVA 5HM8A 1AKVA 1AZTA 4TWIA 3O1LA 1W47A 2O2EA 5B57C 2GM3A 4L6AA 2LKCA 2R25B 4HDOB 2WHRA 3OESA 1FVOA 5G3ZA 2WWYA 4OL0A 1PU2A 4IV5A 4YJGA 5CIQA 3ZWAA 1E1QA 3F8TA 3B20A 1KE2A 3B1YA 1IMOA 3WLSA 2FUNB 5CFLA 2VJAA 3KSAC 5I7AA 2D00A 1NW5A 1KZ1A 2CYCA 3JQ8A 1QQBA 4GL2A 4W5NA 1U1GA 2QUZA 2V7TA 3JS5A 3OBIA 1SBCA 2C4WA 4LYAA 3ZI0A 4Z9BA 4BVBA 1FRNA 2H4YA 2EKBA 1ICIA 4DLZA 4Z5XA 5BP7A 5K8UA 5LYJF 2WF5A 4H4EA 3NRCA 3WZLA 4Q4DA 3ZVNA 4DLLA 1QE3A 2Q5HA 3FUUA 3QBVA 2OORC 3AOGA 3WNZA 1E5TA 1W52X 3HJGA 4RKEA 3I04A 1W49A 2OZEA 2CMGA 3VH4A 3FIJA 1BXRA 2OZLA 2ZRIA 2FG7C 2QZJA 1VMDA 2FW0A 3D2AA 4OJYA 3HY3A 3E05A 4KQ6A 3SZ3A 4DYVA 1KEUA 2JJ2D 5BMVB 4KR0A 5AK3A 1Z18A 3TZCA 5JAQA 3I39X 4FB5A 2FWPA 2YV5A 1LFDB 2N0SA 4HEA6 2OG1A 3S2SA 3ZQJA 2FPIA 3DXZA 3HJRA 4B5LA 1DAMA 4JYMA 4KNVA 4V0QA 4YP6A 2DHDA 1WV1A 2ODWA 5BWCA 5HW0A 3U17A 8MHTA 3M4JA 3L5OA 4I5IA 3RO7A 3HR8A 4MJLA 2FX3A 3HB0A 3IAEA 3EXHB 2NPFA 4EW1A 1IN1A 2YYSA 3JXEA 3GDWA 3BRWA 4RZUA 4MW1A 1F9AA 2C2GA 1E7SA 2PGNA 3G85A 5JI2E 2BFFB 3DC7A 4CEHA 3NT4A 1P4SA 3O0TA 5JARA 1UADA 2ZSUA 4AVYA 1RM0A 1YGPA 1MVNA 2DQSA 3WYCA 5I7RA 3M34A 3HXPA 3EZYA 1OE0A 3ZIAD 3DFIA 4PPNA 3HSKA 1M2GA 2HLNA 2CLFB 1EUZA 2F8MA 2H7VA 2RAVA 3DKVA 1MRSA 1YDMA 4PSUA 1DWPA 5IAOA 1QZTA 3K8YA 1GADO 1EP2B 2IH4A 4YV1A 4WNAA 3E2PA 1YL5A 4HGQA 1U8YA 3DDZX 2IP1A 4M1WA 4MCAA 1OZFA 4EZIA 3W2FA 3RAJA 1IY2A 2IX3A 1KQNA 1TCUA 3NATA 3PWSA 4R1UA 1NY5A 4TKVA 3TG8A 2QRMA 3GF4A 1LK0A 1Y33E 2CL5A 2H9IA 2VYVD 3S2EA 4YRSA 4YV2A 1MPTA 1NJFA 7AT1A 2YZ2A 1EX9A 1E1DA 3M9LA 2R2GA 3UMCA 5I7SA 1SR8A 1C4KA 1ZBDA 1HT1E 1UBLS 1JYSA 1MXFA 3QFCA 5GJVC 3PHBE 1EFUA 1GCUA 1Z37A 5KYGA 2AFHE 1KU0A 2IYEA 5B3JA 2F17A 1PIWA 1FYEA 1F1BA 1TJ4A 4MZDA 1OI4A 2XDQB 2ZLBA 4FKMA 1A9TA 4KI7A 2OBNA 3CNLA 3F46A 1ZA2A 2AQHA 3N1UA 4NBRA 4N7RA 2I66A 3QZUA 3KSBC 2Q0QA 2W2KB 1L5GB 1WDWB 3PNBA 2QPAA 3VDNB 4QUKA 1SVUA 4UNRA 2ZJ2A 2CVOA 3R74A 2WU1A 2B25A 3NBFA 1J56A 4C6TA 1NUHA 3CF4A 1ZWKA 4KVZA 1A5AB 1QF7A 2DHRA 2HRRA 3HA2A 4C5AA 3UATA 2P3LA 3NHJA 4HQLA 5JE8A 1JKMA 1QMPA 1XRSB 4ZAYA 3WL4A 4AWBA 4R5MA 1KEZA 3MA0A 1A96A 1XJCA 2IDKA 5ALPA 1F8XA 1U3VA 2GAJA 2BM0A 4JQZA 3URMA 5CG2A 2G1PA 3DTVB 3DZ8A 4ZT7A 4JUAA 2I0FA 1GTG1 1NSYA 2D1SA 3L0ZA 3QW4B 3ZQ4A 4DIFA 3GCWA 4JP5A 4CCWA 2RE8A 1TQDA 4POOA 4YRKA 1CR6A 3K09A 1O4VA 1EJBA 2CC2A 3CU5A 4J9VA 5K8TA 3H4TA 3RPEA 1DKUA 3IXQA 3OPYA 5KOHA 5KOJB 3S2FA 3ML1A 3G0HA 1OC4A 4WJLA 1L4BA 1ULTA 3KKEA 3BCHA 3N76A 2NUPA 1FVFA 5TGDA 2H3EA 3O73A 1UBHS 1YR1A 5BMVF 1JLHA 3P0RA 4I1OA 5CVEA 3BXOA 3QKRA 3E27A 3P0FA 3PT5A 1GZ4A 1O97C 5H8WA 4H7FA 2QRVB 5I4CA 5IM4F 4K6CA 1TCVA 4HHEA 4B7UA 3FPGA 3OCZA 2BKVA 4HGOA 2VJPA 5FUQA 4HEA1 4Q24A 1BS9A 2IYTA 1TJPB 4LVNA 1SZPA 4V38A 3LNTA 1Y7HA 4P0QB 4ZDKA 2ZBRA 1G38A 4WX2B 1MQ9A 4B09A 1GVNB 3MS2A 4ZO6A 3D0QA 3RB8A 4WK4B 3ZGNA 5ECYA 5L3QA 1J0EA 2PQ2A 2VAXA 3GNQA 3ZE9A 3OWOA 3V9PA 1PF7E 3BRSA 3WNCA 1ZHHA 1DADA 4YP9A 2O8BB 4UTXA 4HK4A 1AQLA 5A7FA 4O4LF 1QHHB 3FUXA 2V1UA 3O83A 3B85A 4L5IA 4BMPB 1EDBA 2I5PO 4CODB 1YU9A 2G25A 1KK0A 4RD0A 4TTAA 2O3SA 2RB5A 3IBCA 1Y3CE 4H1HA 3K35A 4R7ZA 4EY8A 2FPOA 4CQMD 1OYOA 2O7NA 3NV9A 4LYGA 4U2GA 2PSHA 2JIRA 2Y99A 2Z58A 1K5HA 3W8RA 2B78A 4KWIA 2I3AA 3BJIC 1ADBA 2HNBA 3D6AA 2P75A 4C14A 1GPWB 4D6PA 1N36B 4MW2A 1NNEA 4KBGA 5BOSA 1I6LA 5FL3A 1HFWA 2OC4A 1DUSA 3WQHA 3N8HA 3LZCA 3WGVA 4PG7A 3IBTA 1U7UA 3AEUB 2MINB 1N7JA 2JIPA 1Y34E 3F47A 4A2WA 4QYMA 1P9OA 3VYVA 2Z6UA 2AEEA 1DAKA 1AE1A 1KY2A 1NG9A 1EWRA 5CVJA 2QMOA 2AZTA 3ZDBA 5CA0F 2CZCA 3JASA 1WSDA 3TEJA 1SA0A 1SEVA 1WPRA 4KG7A 3VVBA 3H17A 3QVWA 5DBOA 5CM2Z 4KPFC 3UFBA 4YV7A 2H5EA 3P0HA 1PTJC 3FTDA 4GEKA 3KD3A 5HRUA 4DIDA 1TAUA 5K8IA 4MUGA 1E6KA 2Z0MA 3RS7A 4C3ZA 3T4EA 4QQFA 5JU6A 1VDMA 3SJBA 3FLMA 3IVAA 2XCIA 4XTRA 4WUTA 3RTDA 4BRUA 2EAUA 5LQCA 2XOXA 3IXLA 4F8JA 4QICA 4ZGGA 4MQ5A 3L0SA 4AZSA 6CHYA 3D6JA 1XCLA 1SB8A 1YE3A 2GBFA 4HH1A 4LBWA 3R7LA 2XT0A 4DLWA 4UATA 3OQVA 5LLDA 1JJBA 1JTEA 3BL8A 1I1QB 3RVLA 1VDZA 5JFGA 1FQJA 1WS6A 4J1QA 2B69A 2Q9BA 4GI3A 4Q9NA 2FG6C 4IH1A 5ITWA 3D02A 3PXDA 1KERA 1Y3AA 2YXLA 3OCJA 4OI2A 4X1YB 1NW8A 2X2EA 1YFKA 3N2ZB 2A0YA 5JNRA 1GG2A 3T5AA 1US8B 2GEDA 2VT3A 3LS2A 4PYMA 2FEWB 1VIAA 1TFRA 3TN7A 2FSVC 3ESYA 4FOTA 4DHEA 1K98A 1CJCA 1SIWA 3ZY4A 1SHZA 2JGFA 5CX1B 4TRJA 4RMHA 3A58B 4C6RA 1E0SA 4OB6A 3WRXA 2V45A 1I3KA 1XDZA 1W2WB 2X5NA 4R8LA 3BRCA 4HZIA 4TRRA 4WNIA 1X39A 1OX6A 5FUWA 4YIHA 4MB0A 3E22A 1GTVA 3CLTC 1B8PA 1GKKA 1N9ZA 1X0VA 2PGJA 1ADCA 1N2CB 2ZB2A 3AJEA 3G6KA 5K3OA 1I6MA 1RYDA 4W6ZA 2HBRA 4D43A 3O7WA 1C30B 2P11A 2YZNA 3WHPA 1BW9A 3GFRA 2ZUSA 1WCYA 3ZDZB 5IVDA 2Q3CA 3WI7A 3R3SA 3WA7A 1TKRA 3NHKA 3R6DA 2IF0A 4BLRA 1O6GA 4G0QA 1KI9A 2Q50A 1NI5A 1Z73A 1R6TA 1C1XB 4BFUA 3MF4A 2Z9BA 1U2DC 2Z57A 1L5ZA 3QSGA 3LOQA 1U7TA 3DOHA 1XCOA 4XDGA 3VTFA 4DR3B 4BMVA 4ZI2A 1EP1B 2YJ3A 4AZ0B 2QRHA 3FHTA 5CFOA 2QN8A 1HF3A 4R9NA 3U60B 4L85A 4TXMA 3SKYA 4AYWA 2I91A 4HQFA 4IGKA 1BX1A 1JQ3A 1RLTA 4KQ2A 1XPUA 3FJYA 5KS2A 4GX1A 2FMKA 4Z49A 1GP2A 2OBLA 1V39A 1A9YA 1EAYA 2R7AA 4EKIA 2A58A 3RS8A 4OMCA 4QYIA 5JXGA 1EHCA 2HDOA 4ABTA 4ZOAA 1AKMA 1ZGZA 1RP7A 2CHEA 1PL6A 3DMHA 2QE6A 3HU3A 3LP5A 4XVRA 2WU8A 1VECA 5JIBA 5M04A 2NUTA 1M75A 2R6CA 2YC2C 2VJMA 1KSHA 2BKLA 3L84A 1Y6GA 1Y3BE 5LFAA 2R9VA 4AKTA 2BFBA 3L0BA 3QKSB 4BQFA 4G2TA 3OLYA 4BVEA 2AYXA 4DJ5X 3O8OA 5BRNA 3L0IB 4JJIA 2H08A 4LWPA 4BBAA 4RA9A 1D2GA 1M6WA 2IY7A 2A1IA 1ECBA 1ZESA 4X8HA 4DA6A 4EP1A 5L53A 1T2UA 1PZMA 1Z8HA 4TWZA 1M1NA 1H22A 2VQDA 2IZ0A 2W9XA 2E4YA 4PRYA 3NRJA 3D4LA 2RGUA 2OK8A 1K4KA 1C7IA 3KJIA 3OPMA 4P3KA 3SIPA 3Q98A 1E7WA 3SNKA 3ZXSA 1E92A 1EUDB 1MW8X 4KGXA 2AN3A 4DMCA 2EC5A 3RJTA 2I8LA 2D06A 3TSZA 1SKYB 1K08A 1DXQA 1M1UA 5DGXA 4F5EA 4F4HA 2OQ2A 1IWBB 1MJHA 3CIFA 3LVRE 5DM4A 4PQEA 1QBGA 4DMKA 3F3MA 1M5TA 1BCSA 1OAAA 2P9YA 4KTVE 4YLGA 1LFAA 2OL4A 3OOEA 4O2BB 4ED9A 2V98A 3UPUA 4NXNB 2VWQA 3P0IA 4Q3OA 3CEAA 1W35A 4BKMA 3ELYA 3BPSA 1WVGA 2AFIA 2FN8A 5I9IA 3DGEC 2QW8A 4P9NA 3G2OA 2AWNA 1AXRA 1UPFA 1XVAA 1UEIA 4QTXA 1M34A 3BH0A 4LPSA 3ESXA 3FOCA 1E8NA 4B0PA 2HNAA 2O52A 4JWTA 1EJ0A 5IBCA 4D25A 2QX4A 4TMZA 1Y80A 4YI3A 3WDSA 5DU2A 1UMDA 3QRWA 1MJGM 3OCYA 4HZUA 4Y6QA 1KQPA 4R3NA 3OIGA 3RUHA 4UFPA 2A9OA 2R4UA 1AQYA 1GTZA 1KKMA 3IJPA 5M3BA 4JCCA 1G4AE 2CXUA 4RPLA 4G07A 4YRPA 4DL9A 3DL2A 2D2FA 2CD9A 3CRVA 4RY9A 5HUHA 3MOGA 1JIUA 4Q7JB 4BP9A 3JQBA 2GF0A 3DNPA 1YFJA 4QO7A 3DO6A 1UBGA 3HCRA 4MWTA 4OBXA 1ENYA 1HSOA 1N78A 4KB5A 5ES4B 1X15A 3M70A 3WIUA 4F4IA 5LPNA 2R00C 2QUBA 4JY7A 1LRLA 4M8KA 4KLCA 2HZ7A 4R3UC 3PEVA 3UGKA 2IXTA 5KTYA 3GZJA 3WKBA 1G20A 4R1MA 1G7RA 2ASVA 4IV0A 1Z6XA 4JBXA 5TT1A 4RF4A 3LWBA 4AKEA 3I9LA 3ZHSA 4IXWA 5A4DA 1FVHA 2FY8A 1N3YA 4IKEA 2JJYA 2VH1A 2YOHA 2ZRMA 3IP9A 5FEUA 3L4JA 4AM8A 4PHTA 3IO3A 4JB8A 5IMBA 4OUDB 1HE5A 1G8KA 3WL5A 1AU9A 4ZCSA 2OB1A 3UH1A 1LDEA 1MJNA 2AKAB 4NS1A 4E5SA 1GILA 2QP9X 1Z6TA 1Y98A 3GD5A 1N3IA 1Z0ZA 3L0YA 3PNPA 3R3UA 2FDXA 3ZN2A 5JQGA 3X3HA 2MSLA 4ETWA 1OW3B 4EEZA 4F9GA 1T3LA 4ZCIA 4ZZ0A 1CHDA 1GYPA 3KU4A 4ZVRA 1VI5A 3LC1O 2IBTA 1V47A 3MUOA 1ZH4A 4ENSA 1IE3A 4QD3A 1XXLA 2JATA 4E14A 4R2IA 1VTKA 3K5PA 5IG2A 1UZNA 1YR8A 5EA2A 3ROGA 4DCOA 4WVLA 3SZRA 1WXWA 4TKLA 3QA9A 4ZKEA 2GAIA 1JXOA 1NX9A 3DOEA 4MDEA 3E0XA 4UVDA 2D2IA 1KFEB 4JX8A 5DT9A 2X0DA 4HUTA 3IP3A 5CCEA 4YTEA 2D1QA 1MFZA 5HIJA 1NC3A 1D0IA 1K7FB 3IE1A 1EE1A 4GOJA 3AXTA 5FUXA 5EOVA 2ZYTX 3ZC3A 1AV6A 1XCPA 2ABWA 5M7EA 2I7TA 3EGEA 1FBTA 1CIVA 1IEWA 5KYKA 3I04M 2E18A 4MVJM 1Z5PA 5AK6A 1WLYA 1P5HA 1WW3A 3QVSA 5FCDA 3AHIA 2PMWB 3VKVA 4K9RA 3GLHB 1Q5PA 3AF0A 3O5AA 4MJ3A 4CMIB 4JX9A 1Q7GA 1NV9A 3MWGA 1MHTA 3KKLA 1C0EA 1H2HA 1GNRA 3ZWBA 3PQ2A 2F4VB 2WZCA 4XLZA 5AKLA 1UANA 3VAYA 1PT8A 1PK7A 2ID9A 3I9KA 1Z06A 1KEWA 1AK9A 2RHJA 5I9LA 5LA6F 3FDZB 2F1OA 1T0BA 3FWNA 2IS2A 4UM5A 5KSWB 1QF6A 4LHWA 2HREA 3S28A 5K0EA 2OCGA 1VYTA 2AE1A 2F3SA 3O47A 4ARSA 2WWHA 1EZZA 5EIEA 2APJA 4PR0A 5KWSA 3PI6A 4CF5A 1B73A 5D5QA 1GGEA 3ANMA 1T8YA 4L22A 4EUKA 1E3SA 1XJWA 4IFIA 4KR7A 3GEDA 2FZLA 3JZAA 2BHNA 4RACA 1EDDA 3LPNA 5BW6B 2I87A 3FGPA 6PFKA 2FPSA 1BWRA 3RROA 4NV1A 2J0QA 3ZNNA 1XRMA 5KWEA 5BO5A 1OI2A 3AY3A 2GVNA 4V1CA 1JMYA 4FE4A 5FWXA 1JN0A 2DECA 3F9RA 3FJ1A 3B5IA 5D1HA 4BP1A 2CF6A 1ZK4A 2BF7A 3L79A 3U0VA 5AFSA 4HN9A 3C5CA 3REGA 5C5IA 1ESMA 4LRQA 2Q6OA 1S2OA 1TLFA 1ST3A 1S7CA 3H2KA 3GWZA 3L04A 4EGSA 3A04A 3SVLA 5FTKA 4AG5A 4REOA 3I2FA 4I9FA 2NQ2C 5ECGC 2DRIA 5KNDD 3X2EA 1P39A 5IH3A 4EGCB 2CUNA 4LNUA 3WJ7A 2C20A 4NZOA 2JBAB 4MRMB 4LISA 4ZIRB 3ELUA 2MT9A 4TVSA 2CLKB 4UXHA 2CFTA 2DSNA 2QMEA 4RQAA 3VU9B 1G2IA 4K28A 3ZIDA 1EH5A 1ISFA 2O14A 2ZDGA 2F9LA 1KVUA 3HSSA 4JBNA 4TYQA 1LD3A 3IQIX 3E3MA 4KFSA 5EJMA 3V1MA 4DB2A 2QRZA 3PNYA 621PA 1GZ7A 1UZAA 3PPXA 1KZGB 2BR5A 1BDIA 5C1OA 2IVFA 3I3OA 1XAHA 1V6AA 3DOFA 1PGJA 3ZTYA 4BGIA 2NXNA 5B30A 4U5QA 2JF0A 2QTLA 1GQ2A 4A8JA 2HFKA 3BWDD 4G6ZA 3D6VA 2ZBPA 5ALIA 2BMDA 3OUUA 2VJKA 3L46A 3I34X 4J1SA 4J16A 2WZBA 5IZCA 4EA7A 5KSPA 3VV3A 1CEXA 3VYUB 4P84A 1W0JA 4KUEA 1NNI1 1XEFA 2X9LA 3H1PA 1VSBA 4GLLA 4E5UA 3E1SA 1TIPA 1LK7A 1LI4A 3K1AA 2ODAA 3VR4H 4CLRA 4LBZA 4HMQA 1WPQA 1FDOA 2VP5A 1GZUA 4I1VA 1HYGA 4NMLA 3SE0A 3NVMB 1Y1QA 4GHWA 1ZDMA 4TQ9A 1L7AA 4IIUA 1B8OA 2J3QA 5FKJA 4JHXA 5D7NA 2OBFA 2PL5A 2XPCA 1XZMA 2EBHX 5BV8A 4KDFA 3ABRB 4D9FA 3EOBI 4NKRA 2EX1A 2FHPA 3EK2A 1JA9A 1DWOA 2OQIA 3QLJA 4NZ9A 4OI1A 3SQWA 1NZJA 2NWQA 4ZT2A 3AVQA 2Q9AA 5EXXA 1WBDA 4WT7A 3NJ4A 3AW9A 1MORA 2YN0A 3DFKA 1Q12A 1KFBB 1MX9A 4O1IA 3VA7A 3T9AA 1HZZA 4Y18A 3N7UA 4L4YA 4R6XA 4P5DA 1YS2X 2CJFA 2BKAA 2E7ZA 1BXKA 4FHZA 4B34A 1Z2EA 1RJWA 1EP9A 2IU3A 3I9FA 3O6VA 5DI3A 2OTCA 3JQ6A 5BT9A 3V4PB 5EEGA 3X1JA 2GD6A 3A2LA 3PNQA 1NZFA 4YO8A 4ITUA 4X1KA 5KCMA 3MK31 4CNBA 4OQDA 1ILWA 1Q1BA 3NX4A 2VAPA 2ZKIA 2GD0A 1JEEA 1MF7A 3IAUA 2H6EA 3ZXUB 4JI8B 1E3WB 4HP8A 4BX2A 4BECA 1QIGA 2FWIA 3C3KA 4KVGA 4BQQA 6REQB 2ZYWX 5GVSA 1V8FA 1WG8A 3PNSA 3HJBA 2CXOA 4J8PA 2ZIZA 3SC4A 1N9GA 3G2PA 4O4IA 5G0VA 1GA6A 2V74B 4PYKA 2CXPA 2OCXA 3KQHA 1WULS 1E79D 4KJZA 4TM8A 2ZJ3A 3DVAB 1SC3A 2Z5FA 3BERA 5E4TA 4BIIA 1JAZA 1LF5A 2QMZA