4MCIA

Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with dmso, nysgrc target 029520.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
247
structure length
243
Chain Sequence
b'LYFQSMSKQPHICVDENQVSPYVIVCGEPDRVNRIVELMDNVELLAENREYRVFNGVYKGTTITICSTGIGAPSMIIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVRDEGGSKAYISSAYPAYASFALLKEISHFLENQSVKYYFGVVRSHDSFYTDEEDQLCQYWNKKGILGADMETSALFTVGRLRGLQVASILNNVVLYQEGVNQYVNDNKAMMNGERLAAITALETLCKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with DMSO, NYSGRC Target 029520.
rcsb
source organism Vibrio fischeri
molecule tags Transferase
total genus 86
structure length 243
sequence length 247
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mciA00
1YQQA 3EUEA 5B7NA 1K9SA 1Z35A 4EB8A 1Z39A 1ODLA 4DANA 3PHBE 1YR3A 2A0XA 1B8OA 4NY1A 4DAOA 3KU4A 4WKOA 4D8VA 3INYA 1Z36A 2RJ3A 1JP7A 1QE5A 5ETJA 1A9OA 4BN0A 1JYSA 3OCCA 1V48A 1Z37A 4TYMA 3OZCA 3UAWA 3OOEA 1OVGA 1N3IA 2OC9A 4QARA 2QSUA 1JDVA 1JDTA 3OPVA 4YO8A 3K8OE 1JDZA 5CXQA 4LDNA 4F3KA 4EARA 1Y1TA 4JP5A 4TS9A 5F76A 5CYGA 3BGSA 3OZBA 1ECPA 4WKCA 1ODKA 1CB0A 1T8WA 4G89A 3ENZA 1OU4A 4F2WA 3P0EA 2P4SA 1CG6A 1PR6A 1LVUA 4WKBA 3MMSA 3NM5A 3K8QA 1T8RA 2B94A 4DARA 5K1ZA 4E1VA 2HRDA 1VHWA 1OTYA 4QASA 5DK6A 4K6OA 1NW4A 1NC3A 2I8AA 5IU6A 4WKPA 3UAYA 2OC4A 4F2PA 5EPUA 5B7QA 3E0QA 4LNAA 1PK7A 1LV8A 1A9TA 4X24A 3MB8A 3OZEA 4BMZA 4L0MA 1G2OA 3KVVA 4JWTA 4ECEA 1PR5A 4M7WA 4MCIA 3BSFA 1K3FA 1Z5PA 4R31A 2QTTA 3DJFA 3OZDA 1TGYA 5CYFA 4BMYA 3SCZA 4GLJA 3FUCA 1U1EA 3DPSA 4IP0A 1K27A 1RSZA 1U1FA 4PNPA 2QDKA 3O6VA 1JDUA 1SD2A 1SJ9A 1SD1A 1PR0A 4QAQA 4DA6A 4OGLA 4YJKA 4DAEA 1JDSA 3P0FA 1RFGE 4MCHA 1T8YA 5EUBA 4GLFA 2IQ5A 1FXUA 5F7JA 4GMHA 3U40A 3OF3A 2AC7A 4DA0A 3NBQA 4UC0A 1Y1RA 1PKEA 1YRYE 1ULBA 5F78A 1RXSA 3UAXA 2HWUA 4NS1A 1ULAA 3OOHA 3UAZA 1PBNA 3UT6A 2QTGA 1YQUA 1Y1SA 4OJTA 1V2HE 3IEXA 5CCDA 3NM6B 4NSNA 3UAVA 4L6IA 1C3XA 1A69A 5F7OA 4L5CA 1U1GA 4DABA 1OUMA 3BL6A 1Z34A 1PF7E 2GUWA 4R2XA 3C74A 4TS3A 5FAKA 1A9QA 3ONVA 1V3QE 1V45E 1VHJA 5JPCA 4OF4A 4PR3A 4TTIA 3KVRA 1SQ6A 2A0YA 3GB9A 4TXLA 1PR4A 1PR1A 2OECA 1XE3A 1YBFA 1B8NA 3KUKA 1T8SA 3BJEA 3QPBA 5C80A 3DF9A 3FB1A 4L5YA 1RR6A 4LKRA 3LGSA 1I80A 3PNSA 1WTAA 3PHCA 1TCUA 4TXMA 1RT9A 2I4TA 1ZOSA 1NC1A 1Y1QA 2H8GA 4OY3A 3FWPA 5IFKA 1V4NA 1Z38A 2HN9A 2AI3A 1OTXA 3TL6A 4D8YA 1Z5NA 1PW7A 4YMLA 1ODIA 1T0UA 4TXNA 3E9RA 4OGKA 1RCTE 4TTJA 4I2VA 1RXUA 1Z33A 1Z5OA 3FNQA 1JPVA 5F7ZA 3E9ZA 1PR2A 2A8YA 4TTAA 3DDOA 4G8JA 1A9PA 1LX7A 3T94A 4TXJA 4P54A 4GKAA 3EEIA 3PNPA 3DP9A 4KN5A 4M1EA 4D98A 5F7XA 5CCEA 3EUFA 3KHSA 5CXSA 1TCVA 4BMXA 1V41E 4QFBA 5F73A 3NM4A 4F3CA 5EFOA 4L5AA 5I3CA 4F1WA 2AI1A 1VFNA 2XRFA 4DA8A 3D1VA 4OEHA 2A0WA 1PWYE 5F77A 4FFSA 4MARA 1A9SA 2Q7OE 3EMVA 3LBAA 4WKNA 1Q1GA 2ISCA 3FOWA 1JE0A 1Y6QA 1ODJA 3FAZA 1RXCA 2QPLA 4R2WA 5KB3A 4YNBA 2AI2A 4U2KA 1A9RA 4D9HA 1JE1A 1OV6A 4H1TA 3O4VA 3ODGA 4TXHA 5B7GA 2ON6A 1RYZA 3KVYA 4DA7A 1RXYA 5B7PA 1U1DA 1ZL2A 4M3NA 1TGVA 4D8XA 2HSWA 1M73E 2PGAA 1TD1A 4QEZA 1U1CA 1VMKA 3F8WA 3IOMA 4JOSA 2OXFA 1Y6RA 3GGSA 4QATA 4LNHA 2BSXA 4LZWA 3LA8A 4G41A 1PK9A 4RJ2A
chains in the Genus database with same CATH superfamily
3FVQA 4ZO9A 4DF3A 1W34A 1J8MF 2QR5A 3BX1A 3TCKA 2O3TA 3QY9A 4YQZA 5HZHA 5J58A 3AFGA 3O4IA 2JJMA 3V4RA 2ZE6A 1EH5A 1WZCA 3HVJA 1P1JA 1O2DA 1W6RA 3BTOA 5CXUA 4PG6A 4ZGBA 1HX7A 3D8SA 1ODFA 5E3HA 4DCSA 1IY9A 3H2HA 1CPYA 1N8TA 1V9SA 2WWYA 1OIWA 3HADA 5EMNA 5IAAA 2EKBA 2FRDA 1Z2AA 4DR3B 2V7EA 1VJTA 4HNRA 1YBHA 2MU1A 5A62A 1RAFA 3RUCA 1S6YA 3AY6A 4QEKA 4RA6A 2QUIA 4WZ6A 3DXFA 3RJ9A 3CR8A 3HUEA 4CL0A 3OT1B 3GA5A 3MWDB 2OAEA 4FS8A 3EQZA 2JLCA 3IUPA 3L0OA 3DVAA 1Y9AA 2VZ8A 3NS7A 4JVNA 1UP6A 4JH0A 4RY0A 4NICA 1MNQA 5IKMA 1M2EA 3TFQA 3VNUA 4IDHA 3NIDB 4MA0A 2W43A 4M4SA 3TE6A 3VZDA 4GXQA 4G01B 3VNSA 1YZYA 3B1JA 1PJBA 2FPRA 4U5XA 2HSGA 3L7OA 2EP5A 4KG7A 2QL6A 3E27A 4GMKA 1ONOA 1O95C 1LJLA 2AJ8A 1QQTA 4KX5A 4LQDA 3IP9A 1WM1A 3KUXA 1NBEA 3NBUA 2RFLA 3REOA 1MAUA 3GK3A 2QTMA 1GIAA 2D1SA 2HRCA 4IJQA 3N8KA 1VE1A 2ZXFA 3FOAA 1FVHA 1SXHA 1KOFA 3BXOA 3VR5A 4RWZA 2VHZA 1I5EA 2A4KA 4YO7A 3TKYA 1JHYA 5E4YA 4CU5A 3C4JA 5GVSA 2Q5IA 2O2XA 3O95A 4IWYA 3PHJA 3BJZA 4QUDA 4O25A 3GFFA 2C4MA 4AKIA 2HIHA 3C0KA 3T7SA 1BDHA 2BEVB 1RC1A 4WKCA 5A4MS 1T4CB 2O3QA 1ETUA 1T5DX 4AUKA 4W5JA 1SHLA 3MCWA 2ZI3A 4G9BA 5EE1A 3R3XA 4G89A 4X60A 3QZUA 3RASA 3RK0A 2WTAA 4PXYA 2H54A 2PL5A 4JEIA 4XVHA 2K6GA 1I6KA 3PVZA 4EMTA 4RDXA 1YE8A 4OQNA 5EHZA 1CG6A 3I9JA 3KWLA 4URUR 3WL7A 5JWHA 4JFRA 2ZKLA 3DCYA 3MMSA 3BH7A 1HYGA 1JEQA 1X7WA 2VYVD 3KJIA 3QK7A 3QMVA 3TR6A 3NXKA 3FOFC 3ZDDA 4YONB 1IB0A 1IJKA 3QTLA 1GGFA 1COZA 1MUUA 4JOQA 1NW4A 3FVVA 2Y1FA 3DGEC 2CFCA 1QR2A 2A9VA 3CF4A 3U48A 3TW4A 1QHNA 1WQ3A 4V03A 5K0LA 3R3JA 1MDBA 1QVAA 4U9HS 5HM6A 2VHVA 1R4NB 4Q7KA 1L5FA 5CB4A 4RTPA 1T2EA 2OC4A 4U8GA 1Y0BA 5D5QA 5ITWA 4E21A 4YJ2A 1G5QA 1HDXA 2P68A 3EXAA 2IXAA 1I30A 3Q7TA 3K3PA 4RIIA 1RM3A 3VH3A 3C41J 4LECA 2PXHA 2QN2A 3PQ2A 4A4DA 5EZSA 3OCVA 4EGQA 1H8HA 1OXKB 2DT8A 1IOZA 3DFFA 4IIUA 3THWB 1T9KA 3Q3EA 1HT0A 2W2KA 4UAUA 4RU1A 1WMSA 2DHDA 1YV9A 4LQ4A 3WGUA 4YMHA 2PUAA 4ALJA 3FRJA 2MIIA 2YWXA 3LKDA 5BV8A 4DDTA 5IW8A 3RAFC 3CZMA 4BN4A 1CE8A 3UF0A 3K20A 4DIOA 5FLXA 3NC1C 3DEAA 3KEGA 4EBFA 3OZDA 2GPYA 3P9QA 3QE3A 3FHCB 4CQLA 1G20A 5EE3A 4IJKA 1AS0A 2NYVA 1L5RA 2ZJ6A 3K0FB 3ZG6A 4R7ZA 1Z4PX 3A1VA 5CK5A 4ZK2A 1U1EA 6YASA 1L4LA 2WVJA 2BFDB 4Q3OA 3IULA 3PNBA 3IMFA 4NP6A 1RS0A 4CCYA 1TKCA 1LSUA 2XYVA 1ANKA 2I2AA 2ZJYA 5P8WA 4OO3A 4NIMA 4MUMA 2Q2VA 2EQBA 3IGFA 1KE2A 4C0LA 4HZUB 1J21A 4MH0R 4NAVA 5C8XA 4YCNA 1GA1A 2QLJA 2ZBRA 3GHHA 1PR0A 4FHDA 5CT8A 1NXQA 2CZGA 3K5WA 4Q1VA 3QVUA 3ZUGA 3B3GA 4YJKA 1GPAA 2RG1A 1E77A 1KPHA 4EYKA 5HXAA 3ZS8A 3IEVA 1WXQA 4ISCA 2PGOA 4UEJA 5F4BA 3TIVA 5TVGA 2FX3A 3KKPA 4R5HA 2OD9A 2OEPA 4GOLD 1P7WA 4I5IA 4BFTA 3R8FA 2G5GX 2GZ2A 4P7FA 3ABZA 3O0TA 4S0ZA 5ALHA 4A92A 3MSXA 4D9BA 3MOGA 4Y9SA 4IDEA 2ZI9A 3MGAA 4PS0A 3W90A 2ID8A 4KRFA 1MHPA 2WP0A 3BXPA 2CDAA 4QEDA 4MI9A 2HSEA 3AEXA 2I3BA 4O2BB 2VRCD 1PGPA 2YC4C 4POAA 4RELA 1SUBA 5ADHA 2VKQA 1UQRA 4MXDA 4LV5B 3NHBA 5D85A 1KYYA 5AM2A 3VU9A 4PRLA 3KPVA 4FYVA 2GEDA 4BGIA 4EG1A 1B8PA 1H2AS 1XR3A 5KYGA 1EDZA 1ZGCA 1R00A 1AKNA 4FN4A 3QXHA 2GS9A 1ZJ6A 4LMAA 5C32A 1SCJA 2B2NA 1EHYA 2P4EA 3SC6A 5ABPA 1YJAA 4GYKA 2VR1A 3OQOA 3ZEAA 1DQSA 2XUOA 3TLGB 1HEYA 4NCKA 1BA2A 1YQGA 5FUWA 3LUJA 3OTHA 4WL0A 3B9QA 4WZBA 3EIFA 1Y8AA 3WHKA 2X6QA 1IUPA 3A9RA 5B1DA 2LGJA 3KOWA 3BKWA 1Y1SA 5AI9A 1DX4A 1HQYE 2C3PA 4CMKA 1V2HE 3GCDA 4F38A 1GTRA 2NWQA 4WFJA 1UOPA 4B6FA 1OXUA 1LDMA 1SQ0A 3JQDA 3RRXA 5K3OA 5KX5F 3DF7A 2JLRA 3HJGA 4FBMA 1NVUQ 1OX4B 1TB4A 2H1CA 4KAAA 3NRJA 4M8SA 5HTKA 4X6UA 1DTWA 3N59A 5F21A 4Q1AA 4ZCTA 3U19A 3BUSA 3TEMA 1B14A 1XD2A 4FYXA 4GMXA 2Q4TA 4XDYA 2Q49A 3H9UA 4R2XA 4D9FA 3RSHA 1NJ2A 2NZYA 3C74A 1K8ZB 2O2ZA 3HP4A 1YFJA 3ZJUA 3MIIA 4Z9XA 3HH8A 3IQWA 3TLEA 2FP4B 1DQRA 5CX4A 1CQIA 4Y2TA 1EUYA 1RYFA 1JFFA 4NZYA 3TRKA 1ZJWA 1JMYA 4QWMA 1T3ZA 2EC5A 2C1XA 3GQBB 2R8YA 4DLUA 4PLWA 3UENA 5BRJA 4QUEA 2IITA 1I4EB 5AVVA 4Y9RA 3T3MB 4BX8A 2RH5A 2R5WA 4JC5A 5A5EA 4R8MA 3K1YA 4EX6A 2JFUA 4EJFA 1XEAA 3OE7D 1VBNA 5BMVB 2F1JA 2JBWA 4KCGA 1DKLA 1GUZA 2WIFA 4ER7A 5LMUB 2GPJA 2C5EA 4Y3UA 3G7SA 3QTBA 4CT5A 1I7NA 1J33A 1N5KA 2QE7D 1YCHA 1NOJA 3HKCB 5G40A 4DMMA 2JEOA 4L95C 3L0ZA 4LYHA 4YT4A 2GEKA 1G60A 4TGLA 3KZVA 4HDMA 3IP7A 3KC2A 2IYRA 1RRGA 1GNPA 4BB6A 5A3VA 3WL6A 4YV2A 1MQ9A 2M2IA 4NU0A 1U0TA 4IKOA 5D3ZA 2M9MA 4BNVA 4TRNA 1I2AA 5FNVB 1NVTA 1RXWA 1JH9A 1AQNA 1WY7A 5GJVC 2DFDA 1A1SA 3ZWKA 2QLBA 1P29A 1W1UA 1MO4A 1Y9JA 3KYIB 3LFHA 4P9NA 5EKXA 3RUEA 3VMMA 2DFPA 1BDIA 4NJEB 3S1AB 4DUGA 4MI1A 4XM2A 4ZYWA 4AF8A 1MJNA 1Z73A 2BGIA 1T2NA 1DC3A 1FLAA 2YV4A 4FCWA 1EVEA 4NFSA 4EUFA 2BMEA 2ZB8A 1QGOA 3M4NA 3LSYA 2W8BB 4B6JA 4QUBA 5A4AA 3BJIC 2H4ZA 3OFSA 2ZIZA 3DB2A 1RT9A 4TXMA 5ALYA 4NOMA 3CLUD 4JAVC 3V2IA 5LQNA 3AIIA 1E2UA 3AF5A 3C85A 2OZEA 4CG1A 1NJ1A 5BYBA 2KHZA 5KZMB 3RYCA 3VVBA 5LUAA 3PX3A 4OH7A 4LUCA 1NVXQ 1APBA 1NU8A 1EG2A 1KKUA 2JIDA 2C2ZA 3IQGX 4NBTA 4MUFA 3LTEA 2PWAA 4ATNA 1HMPA 4IEFB 3AL2A 2A7XA 2DLCX 1OZGA 1R5NA 1EVLA 1NW5A 2WZQA 2QV0A 3EZLA 1X6VA 3PNVA 1ISPA 4EPXA 5JS6A 4JZYA 1EPUA 3DWFA 4KV7A 3SXPA 3TCNA 4RK5A 3T1QA 4C1BA 3GUHA 3RT7A 3ASZA 5CA0F 4A0GA 1SUDA 4A8JC 1OYYA 2EEPA 1DWPA 2BM8A 3FJ1A 4PAMA 1RE0A 2EKQA 3AWDA 3JY6A 3TKLA 4DLPA 2F62A 1DAIA 4NARA 1MO5A 2F00A 4QHYA 3ONNA 4G5QA 5FWDA 1TT5B 3T5GA 3GWGA 4ARAA 4EKYA 3H7IA 4BLWA 4C3OB 2F8SA 2J7PA 5L45A 1E3DA 1HY3A 4JI0B 1PFYA 3BICA 1QH0A 4IS2A 2D1RA 2R7KA 1N0VC 2VBFA 3NALA 4OXKA 4IVNA 4NAUA 4UBIA 1P74A 1WXDA 3WLMA 4AWBA 2C54A 4XX1A 1ZGBA 3FDZB 4ZO8A 3RVQA 2CZQA 3ZWXA 3Q3IA 4HTFB 1EFPB 3N2KB 4JP8A 4F4UA 5F35A 1U0RA 2D2EA 3LVBA 2HF8A 5BN3B 1WBDA 3R7DA 2X5NA 4LA4A 4WFQA 2DETA 2Q6VA 1V11B 2HQ1A 1N2XA 1JDPA 4RYDA 4RY2A 5AVQA 4RKFA 1CUXA 3BG5A 2IE0A 3M6VA 3TBHA 4CLXA 4EMUA 3PNPA 2GN9A 3N8GA 2CHGA 2PO5A 5CFZA 1MA0A 4FGLA 1CRPA 4MKXA 5EPOA 5K99A 3HDJA 1T29A 3DZGA 3KJHA 5HA5A 1KIFA 2PUGA 1H65A 1DQYA 1OI4A 2C2BA 2GXUA 3OE4A 4DOMA 5TLSA 4Q9JA 2I3ZA 5ADUS 3KXIA 2CNDA 3RFFA 1UZUA 4BJ1A 4D9KA 4RABA 2ZJBA 3DZIA 5I7AA 1JJBA 4RX1A 3WGLA 2SECE 3URKA 5EEHA 2GTHA 2CKMA 1A76A 2ZUEA 2O8VA 2FOIA 3PA8A 4JQZA 4KXFB 2ACKA 3VI3B 1J70A 4V1CI 4UOQA 1YR7A 3FCCA 3MHPA 1R74A 2QKYA 1AKEA 4OBWA 1PLLA 3JAKA 3TQRA 4F1WA 5C5CA 2HK6A 1Q1AA 1UODA 3TNYA 1FC0A 3RABA 4QQNA 5I7WA 3BF8A 2FCRA 2PWYA 1W581 3MMXA 2HBQA 5F77A 5J40A 4C7XA 2PGDA 2EEZA 3CCFA 2FUNB 3RTCA 4NH0A 5DCWA 1WCYA 1WDLA 4KVGA 1LWNA 4BBJA 3W78A 1JLRA 4CNBA 2YJ6A 1UT6A 5KKCA 2B4KA 3E7WA 4XGRA 5JD6A 1UDRA 3OKFA 3BIWA 2JIZD 3MLAA 3HEAA 3LCJA 4IDCA 3WLOA 1D3AA 1M6EX 2Q0QA 3KFLA 3ETCA 5DHFA 4UE6A 3UJ7A 5CB6A 5JBIA 3D6UA 3FAZA 4AZTA 1SC3A 4G2NA 5FUBA 4RTRA 3B48A 1CUWA 3OJEA 1Z7YA 5DRTA 3A2KA 4N48A 4U2KA 4CKWB 1DBRA 2QM7A 3U0VA 2W42A 4UAJA 5E38A 2NUPA 5AXDA 5JDCC 4MKGA 1CQZA 3D54D 4K9DA 5C1BA 1YJ5A 2W70A 3C98A 2RSLA 4WBSA 2W2NA 4XI9A 2QR3A 2IGBA 3PCXA 3H9JA 3LDFA 3UAOA 3P97A 4TLLB 4EY8A 1PDVA 4XJVA 1Q2UA 4WBNB 1F2DA 4OA8A 3JR7A 1KDVA 1PI3A 1HT1E 2AYZA 2NNWB 3KEFA 4P31A 1NOIA 3HU3A 2QMEA 1AXEA 4X1IA 2CF6A 5KSOA 1JNXX 1P0CA 3THYA 8ADHA 3EVAA 3NBYC 3JYOA 4EHDA 5TGTA 5JRJA 2FZCA 4FKBA 4AF7A 2NUTB 5I9LA 2YXNA 3DVLA 3WGVA 4M3NA 1VSBA 2YH2A 4LV6A 3OJXA 4J90A 3MN1A 2JH9A 4HDNA 3HCDA 5LYYA 5HFNA 1L5WA 2B8JA 1QLHA 5L3ZA 1FDOA 4IJVA 4ZU6X 3R0JA 1N25A 4QEZA 4IGEA 1NMQA 3K09C 1KEPA 1XIVA 4XWKA 1SIWA 2YRXA 3EH1A 4GUDA 4M0DA 4YJGB 3ZWQA 2QA5A 2JJ8A 4N47A 3TINA 1G98A 2AF3C 4ZFNA 4XDGA 3C5CA 7MHTA 4A0RA 4U63A 2G9QA 4AKTA 5JFTA 4K0KB 3TIGA 3OC0A 4BJ3A 4AXBA 3OM9A 4CR6A 3UKDA 1D6JA 2HXGA 3B6EA 2OV6A 2PM8A 2VF7A 1HTBA 3DBLB 1Z68A 1GG5A 2OCPA 2RGWA 2VCYA 5K0CA 1VE7A 4LGYA 1VG1A 4RPGA 1LV7A 5FHRA 3HBJA 3UMGA 4IIDA 4EZBA 5IC4A 2O5EA 3R8XA 5A5VA 1N0WA 1ESZA 2AEEA 3RKUA 3HXMA 2R79A 5CBPB 1FP6A 2HDHA 2B20A 1N77A 4DANA 4GKBA 3U7GA 5E6RB 5BV0A 2OZVA 3FOBA 1BIFA 4KR2A 2QRVA 2VLIA 2W0MA 1JEYA 3BA1A 1LLDA 3ABSB 4Q18A 4RV9A 4WASA 3SJ7A 5HZKA 1T9GR 3EXHC 3AIOA 3MTBA 4YT5A 4EAAA 4TYNA 1EX7A 3GUYA 2VYVA 1M2HA 1N6OA 4GBED 4LX0A 1Q6YA 2XNCA 1LBTA 1GDTA 4A7PA 3U3JA 2ERXA 2FSGA 4DV5B 2AOXA 3GZJA 4FW9A 3SBEA 1CQPA 2P9FA 5BSRA 4NBLA 5J63A 1T10A 2YHIB 3C6BA 3M6LA 5GOTA 1DXOA 2KW5A 3BC1A 4MR9B 1CY4A 4UMEA 1CULC 1FFYA 1PG2A 4M98A 3F9CA 4UQLA 5JAZA 4D3DA 2Y1WA 3KAPA 4QREA 1NKTA 1NN3A 3IUYA 5AJVB 3NGMA 2PLNA 5PGMA 4FTWA 1JDVA 1BHSA 3IV6A 3H4MA 4F8EA 1Q0QA 3ZGZA 3GH3A 1NVBA 1WQ1R 1P44A 3JQAB 3CVXA 4R84A 2PPVA 3FPCA 2FR8A 3RFUA 1HDZA 3S27A 3TDNA 1TU0A 5ARCA 1LKZA 2FZGA 1JFSA 5TE9A 3WYFA 1RWWA 2GK7A 2UVPB 1HV8A 1N2OA 5FQNA 5ESDA 4B45A 3H4VA 3BGOS 2I7DA 3KOOA 1N9ZA 3OX2A 5DTQA 3WBBA 4DNFA 5IDXA 3S81A 2EF1A 2ODQA 2VT3A 1QRAA 5FQOA 2OY0A 3A3NA 4N8SA 2WHPA 3W7BA 3TTYA 1RU3A 3L77A 4JL8A 1XJWA 2X6TA 2XMPA 1G4AE 5CM2Z 5H4HA 3RSOA 3FLAA 1D8TA 2ZJ7A 3LKVA 4L1KA 3FYCA 1BD3A 1E6UA 2H9IA 3U4GA 1PR6A 2YVQA 4PNEA 2B94A 3I58A 3FLEA 3SDSA 2XQKA 4Q82A 1WABA 2YQZA 4Z7QB 4Q4HB 4ES6A 1F6WA 1HOXA 3KJFA 4RTLA 1ZA1A 5FTLA 5KU1A 3DM5A 1RQGA 3BHJA 2AOTB 2Y66A 4KE8A 4MUNA 1ZN2A 3THRA 5C1PA 3F4LA 3IA7A 3SQLA 1NSFA 1H6CA 1HE5A 5NLLA 3TNJA 4F2PA 4ALIA 5E1OA 1C7RA 1KH1A 5AM5A 3CLTC 3S28A 4LOIA 1YNOA 3BB3A 1FNSA 1PNOA 1YOBA 3FYTA 4LG1A 4QNMA 4D6XA 5AW8A 1NVEA 3MT9A 1XRNA 1RQ2A 4HX5A 4YRLA 1VDMA 1P2DA 1XCMA 3RRYA 4DDWA 4S05A 3WTCA 2JVIA 2V7GA 1IDOA 3CRW1 3D43A 2HFJA 4IIEA 1U65A 3ZVKA 2ZYIA 3ZK8A 3WB1A 3T95A 5JJCA 5EZYA 4QODA 4PYJA 2VAXA 2AOUB 1K7XB 1US8A 3DOIA 4XGIA 3TLKA 2HMTA 2GD6A 1NASA 2H31A 1RJFA 4G8CA 4URFA 2X8LA 4IHJF 3OZFA 1Z4OA 3LP6A 4NF2A 1WZNA 4XX0B 5DTIA 1JAHA 1TGYA 2HYDA 2J3QA 2KI5A 4K9QA 4L5IA 4MPJA 3SCZA 4O4HF 5CLIA 1AE1A 3ERCA 2E85A 3S2IA 3L4JA 3CGWA 2XMSA 4OI1A 3PDHA 1A5BB 4F1JA 1B1AA 4I6JA 5JWRA 5GGXA 4CETA 1QKKA 4DPLA 2PUVA 1ADGA 1F0KA 2WINI 1S7GA 2QDKA 4YRMA 4B3MB 4Q3CA 1JHMA 3HDVA 2P40A 2W6IA 3RPEA 1D9ZA 2X9NA 4RVNA 4Z6KA 2WVGA 5E1MA 1J9ZA 5CTJA 1IN7A 4NK4A 4MGHA 3AYXB 1SHJA 2PH3A 1EWQA 2NM0A 2ZAOA 4MV6A 3W2GA 3QHQA 1T8UA 3VJKA 3LUAA 1MAVA 1N0UA 2C9ZA 1YKFA 2B5WA 1XEFA 3CQ9A 1KVTA 3EIWA 3WJ7A 5DTRA 2XAAA 2I1VB 5JS1A 2X4IA 4MOWA 2D5IA 2GQ0A 4ER6A 4Q4AA 1U3DA 3ANXA 1DRWA 1FA9A 4L3VA 2WIAA 4URWR 5B2ZA 3UCXA 1T2VA 3FFXA 4AJLA 3EOBI 4HYTA 4RQTA 1D03A 5TMDA 1OLSB 2J3JA 8OHMA 1FPMA 2FWAA 2O3RA 2D5BA 3DNFA 4OCZA 1OMOA 3V2GA 3IMKA 1LBSA 1OI3A 4HK4A 2F64A 1QQ5A 3T0FA 3O92A 3ZXIA 3JD3A 3CVOA 3FY4A 1SVNA 1KMHB 4HUQB 2VZEA 5KOIA 4F6RB 2OZLB 4G1BA 4EYEA 2XKBA 4UEQA 4HWOA 5DW0A 3C6YA 5G0SA 1DIGA 5LDDC 3CH7A 3IKLA 4WESA 4BDSA 3E2IA 4QICA 1XNJA 3ZGOA 4E70A 2PIDA 1IBCA 2YQ4A 4CF7A 3NTLA 3TW8A 5KNBH 2ZUTA 2QD1A 4NS1A 3FBWA 4JYMA 1TO1E 3CZ4A 4LBVA 4NRDA 2J6CA 3C6QA 4PXSA 4GX2A 5C5EA 3OE7A 4DV1B 1QU2A 2RDMA 1H6BA 4L0QA 3NDPA 5LXTA 1ODCA 3S2EA 3JATB 4REOA 3UAZA 4GQIA 1FYDA 1ZOPA 5EPEA 2RIRA 3SQWA 5KTNA 1OXVA 2C2WA 2O2JA 4KH0A 1BEEA 1R3DA 2HREA 1TJ3A 2F6RA 1DX6A 2VPYA 4NOJA 3RC7A 4E5MA 1KDZA 2WWVD 1B7GO 3VVLA 4Z7NB 2E4AA 1MFPA 2VF8A 4YIHA 4N76A 2QD4A 4E11A 3WRXC 2EJVA 2H1HA 3MSCA 1CYDA 2QE6A 2VH2A 1D2RA 4AJPA 4WX2B 4KC0A 2JLBA 4PY2A 1XTQA 2RB5A 2YWRA 3U3ZA 2AK2A 1IHPA 2PKQP 4ZALA 4YYEA 2IBTA 2I4MA 3R75A 4BJ6A 1ZCZA 2Q45A 1RWBA 1AMOA 4CEJB 4HDCA 3PTAA 4NMHA 2KLHA 1TIBA 1HGXA 1RLMA 1SUCA 1U1GA 2HA6A 2WI8A 4MV3A 3JVDA 3QH4A 5IJWA 2CDNA 2Q7DA 1L5KA 4U00A 4MV7A 1VSTA 4O5OA 1GHTA 2GWRA 1RLTA 3L0YA 4IIGA 4L4ZA 3X1DA 2JIQA 4R9VA 3L8MA 5JQGA 1RYDA 3NORA 4R8LA 5HCUA 4G1EB 1CDEA 3NFRA 3VI4B 2LUOA 1N0IA 1U2EA 2N0SA 3JWHA 4FEAA 1U02A 2B99A 2XCTB 1NP7A 1PG5A 1T2UA 4GT1A 2ID7A 1J9EA 3F1LA 3SEZA 1Q0LA 3IT0A 1QIMA 3KYDB 4DLRA 2ZBPA 3A27A 1F3LA 1ZUNA 1OC2A 1CY6A 2UYCA 2HHAA 4Z4GA 4V0QA 4YK7A 4EYOA 2VUSA 3IOCA 2FJPA 4FGJA 1NR7A 2BP7A 1J4AA 1KC1A 1H2ZA 1C1DB 5D86A 3UWMA 5BUZA 5K0EA 1K3TA 1T15A 1VHJA 3PPVA 4LXXA 4WOKA 1Y63A 1W0JD 2PZKA 3KRTA 3H19A 3FIUA 1O9HA 2R68A 3OQPA 4MIKA 5CVVA 4M54A 5AHOA 1M6NA 1GEGA 1MC4A 1MFZA 3MMPA 1I2MA 3D4IA 3GEDA 1BKDR 1TM1E 5HIAA 1JDNA 1Q20A 1OILA 4RA9A 3HDYA 2P5UA 4AY6A 1P60A 4NABA 4DIMA 1BRTA 1LB1B 1PR9A 4NZMA 1MLDA 1ZMOA 2B98A 1ECGA 3ISJA 1EQAA 1D2NA 4MJLA 2XNDD 2K7FA 3I8OA 4OPMA 4L5YA 3CEHA 5B36A 2QMUA 4GF5A 3QFCA 1A0OA 1ZIPA 2O2CA 1XPUA 1SURA 1JQ5A 5CNIA 1TYEB 3IMEA 3OLYA 4QJBA 4OHUA 1MVOA 3H16A 3F2IA 4Z9AA 5EYPA 4N65A 1MMFB 1UKCA 2HXSA 2BEJA 1VHTA 1ZRHA 4L08A 2B4AA 3KV3O 2F3QA 2RI6A 3I64A 3VPBA 1KS9A 3FN4A 5K3FA 3PQFA 1G66A 3P9RA 4FFRA 3NIFB 5AKEA 3DMHA 2WABA 3CT6A 4ERNA 2BL4A 2PVSA 2AXNA 1ND6A 2W11A 5ALNA 1NC1A 4OQLA 1Z63A 4RYLA 5E9QA 621PA 5HQTA 3NEAA 1R1DA 3MWKA 1DWQA 2P2NA 1MP0A 2ZRJA 4M2LA 2YW9A 2AD1A 1E96A 1QAMA 2AZDA 4MKFA 4JLNA 4KN9S 2XE8A 5KYXA 2O8DB 4B32A 1HLPA 3P5BA 4QM7A 1XYVA 3OI7A 2D7CA 2IOYA 4BVEA 1NHGA 3EGCA 1QWOA 4G09A 5IAJA 4PN3A 4PHGA 3GRVA 3LCVB 3OEHA 3PCTA 4Y2GA 3TQFA 1Z17A 1TIKA 3BF7A 3NPMA 3SX2A 1FLDA 3DKVA 2QSZA 1JN0A 3DPIA 4QTUB 4XE5A 2Y05A 5GGYA 3TL6A 3FOEC 2BSAA 4QKQA 1W49A 1KQOA 1IATA 1NDQA 1PT7A 4D4IA 2YYZA 3EODA 1NF8A 2BUBA 2HMSA 3PSHA 2Z6VA 4JJAA 5ILGA 1EGVB 1KZ9A 1T0UA 1OBCA 1EUZA 2Q0SA 1CDZA 3B7WA 1UBGA 3B52X 3MWDA 5J59A 4A9AA 3FCXA 3VX3A 2WKWA 3ZTTA 3CV3A 3RS8A 3LUGA 4I19A 1GUAA 3VQTA 2LCFA 2PPLA 4KQCA 3UOGA 1BQEA 3OF5A 2J0QA 4Q21A 1YVUA 5LNK1 2GFHA 1WWKA 3NUQA 4Q9DA 1K4KA 3RVRA 2IU4A 2O3JA 3DEHA 4L73A 1UBLS 2AJDA 2OV1A 2Z98A 4A73A 3O5AA 4B3HA 3NHJA 4X94A 3SKVA 2NXCA 3VNVA 4UCWA 5CA1F 1LX7A 2P0EA 2V1XA 3LQKA 4L4YA 1L5GB 4ZQCB 5ICMA 1T26A 2P11A 5BSMA 4WA7A 3I5UA 3RC3A 2PUHA 4WA8A 4P54A 1KJWA 3N3BC 2OCYC 3RAJA 2G1JA 2YYSA 1JBQA 2D00A 4II2A 3TGWA 2O20A 3L0IB 4I1VA 1L5HB 4PBTA 4EHNA 3P2IA 3I01A 5KDDA 1HNNA 1Q7CA 5HW0A 2BAGA 1RWXA 5BWOA 1Q22A 2JJQA 5JALA 2BEVA 3RVKA 5LP6F 1T4CA 4EGSA 4CM9D 4PEVA 2YASA 1MT0A 3NWOA 3AM3A 4C06A 3I9V6 2BDEA 4TYWA 2E4WA 4QBGB 3E15A 5EG5A 1QM5A 4AZSA 1TCVA 3GGCA 1PWEA 3W3AH 1FDRA 2HWWA 5IH3A 2VJCA 3I2YX 4CWAA 4G23A 1E9VA 5HE8A 1NBIA 3C6XA 3D4BA 4M36A 2WOJA 1UBNA 4MQ5A 5CX1B 4XCXA 3U13A 1TEZA 1L9KA 1MX5A 2JI7A 1XJQA 2Y1XA 1W35A 1A88A 3EA4A 3FMPB 2RGDA 4V0OA 1CT9A 1C8LA 4YP5A 2EYQA 4C7VA 4DQKA 2P9CA 3R74A 4KAXA 1ARZA 1Y82A 2HJWA 3C6ZA 1OBVA 4K9RA 5JY6A 4K9NA 1R4NA 4FHFA 3L84A 2XUDA 2CL0X 3A37A 3OJFA 4IF4A 4QPPA 4RV4A 3GT3A 2G67A 5KHAA 5T4BA 4P82A 1U0BB 1EWKA 1N2GA 2EFYA 3Q0IA 3HP1A 1ULSA 4HLUA 1X1RA 3A6DA 3WKEA 3EZYA 3JQAD 2XA2A 5FPKA 3OQBA 1KP2A 2BKEA 2ZSAA 3QWHA 4TMWA 4U7TB 2QMHA 1FU7A 4YECA 2GTPA 3UA4A 3INRA 5DM70 3THWA 1OV6A 3R7SA 1FMJA 3IXMA 2JASA 4FJ1A 4NE2A 4B3SB 4R81A 4FM9A 2AVNA 4LMRA 5T8KC 4O5AA 4ZJZA 1L8XA 4J0IA 2JFYA 2VEDA 3PC8C 4Z4HA 3F6PA 1R10A 5A6VA 3KXKA 1D1QA 2GF9A 5CG2A 1D1PA 4GSYA 2B8NA 1U28A 2H65A 3HKBB 1A9XB 3CINA 2NVUB 1QVRA 2C7BA 4J0JA 1RYBA 2SICE 1MQSA 2XZOA 5FTKA 3K0FA 1WZIA 1RXYA 3D3EA 4G5GA 3IVRA 1U1DA 3H86A 5FOUA 5FA6A 3KV1A 1JXAA 1DV1A 3X2SA 2CNKA 5JVDB 2BFDA 1I7DA 4CMCA 1D6MA 4EJMA 1C9YA 1MNAA 3EUWA 4FYYA 1DIHA 1FNCA 5CVDA 2DR3A 3IP3A 3LK7A 4L9AA 1WXEA 4R54A 3U3RA 4WCFC 1N6IA 1S2OA 3HTXA 2OVFA 2ZUBA 3KOZA 2AFRA 4ZRDA 4ESOA 2X22A 5D5PA 1HPLA 4IV5A 4BMVA 3GH1A 4MV8A 4PR0A 3Q2OA 1J0CA 4K9PA 3DWEX 4YUXA 1O89A 3ORFA 1OIVA 2ZI6A 1RRCA 1IB6A 1S2GA 2YIMA 2LCQA 3IDZA 3HUUA 4OHMA 2EDCA 5DCYA 3UMMA 4K05A 5A5DA 2RHHA 4FQ5A 3WQBA 5HKAA 5C53B 2ETXA 5CB4F 1L2TA 1PEDA 4A0HA 3C43A 1CVIA 2V3VA 4PPNA 4YJ2F 1FFWA 5AW9A 3GV0A 3NHRA 2IODA 2QUZA 1B43A 3GAZA 4RJIA 5FBVB 4X97A 3FTQA 1P4HA 1O6ZA 2R6AA 4XWGA 3KKKA 4O2BA 1WHTB 4Z4IA 1CTQA 2JF0A 1IN4A 4XLTA 4MRPA 5BRAA 1YS6A 3LBFA 1TEVA 5E8JA 1JQEA 1B8OA 1SZPA 2SBTA 4DIDA 1P3DA 1NT4A 3T3PB 1T1IA 2WTBA 3R5SA 1RAHA 1O08A 2CD9A 5AICA 1TCBA 5EIXA 3I4FA 3ZXXA 2O0KA 4G07A 1E9BA 1G1MA 4HUTA 4G0MA 3TLGA 1MVNA 3A25A 1YO6A 1QP8A 3EVNA 4HUJA 1VRWA 2E6UX 3HB4X 3OCXA 4OLJA 1U9YA 1YDFA 5KYUB 1I4DD 1UPFA 4B6SA 2Q6IA 4NPCA 4F9TA 3DMTA 3I9KA 1S1CA 3TIFA 1JALA 4CM6A 1FP4A 2O3SA 3RROA 1K75A 4CN9A 1ZMTA 1N1MA 1A97A 3OPVA 5CT4A 3GJZA 2IJGX 3PPIA 4JI6B 4PO8A 2C2MA 3FHOA 4ETIA 3CZCA 3V1MA 2I7XA 3FZQA 4RM2A 5AKZA 3R7LA 3VPAA 1OX4A 1TA0A 3U16A 1XGKA 1K66A 2QLFA 2JGDB 3UBMA 4B5LA 2WJ6A 1U7XA 3E5HA 4JI4B 1L5MA 5D1NA 1JKMA 1G2PA 3T9AA 2CXUA 3E7DA 3GPBA 4FEEA 4NNJA 4WTOA 4PZDA 4ADSG 3K6SB 2YXEA 2XWJI 3UMRA 2FR1A 2Z8XA 1XQ1A 2MDTA 5C8YA 1NXSA 3WGJA 3T7DA 4B87A 1K86A 2I2BA 1SY7A 5KWVA 5LKAA 4RTKA 1RYMA 1C9KA 5KYNA 2P9QA 3TH5A 3LY7A 4OB6A 1M0TA 3O8CA 2DM6A 4ID9A 4ZXFA 2QSJA 4JBGA 2PKYX 3T7AA 4AN4A 4KSCA 2G1AA 4FPXA 2H9YA 2HRDA 4KVZA 5BMVA 4JBHA 4R9NA 4H6VA 3I62A 4QASA 3UK6A 2R00A 1KQFA 1F8YA 4BNZA 4DWWA 3O7WA 1P4GA 4HEHA 3TRIA 5H5JA 5IT9A 3HKCA 1BWPA 2I8AA 2QPAA 1TLTA 3L7KA 2O4UX 1GFZA 3MB5A 3C3AA 2V6JA 4YT8A 2Y9PB 2YV5A 5AWFC 2NU8B 4G5SA 5K8TA 2IK8A 1HORA 2QW1A 3MD9A 4MLZA 5SYAA 1S2DA 3E61A 3CC8A 2IQIA 4UXIA 3RHSA 1FFGA 4EP1A 3ZVLA 3ZVRA 2DULA 4BP8A 4KN6A 5T7BA 5ECWA 5FNVA 1L1RA 3WRWA 1JLLB 4J4HA 3JQ9A 5CNKA 3NAGA 1U0GA 2WNIA 2NADA 1UJNA 4H59A 1YQWA 1GAWA 1B41A 1G7CA 2I4IA 3PQEA 4CV0A 2HO5A 2Q3JA 1RP7A 1QZUA 1KIMA 4EL5A 1VHLA 3F49S 2QDXA 3A05A 5AKXA 3CLSD 3PFCA 3S5JA 1ZLYA 3TBFA 3VTAA 3GPLA 1MTOA 2V5AA 3NANA 4JLAA 4MVJI 1VPLA 3QWFA 4MCIA 3VZPA 2W8BA 3W2TA 4M8IA 3BMNB 2BFFB 1CHDA 3H13A 3N6RA 1Z5PA 1VJ0A 3ADCA 5ERXA 3LLVA 4V2IA 4ZVQA 4L5JA 1WR8A 3GNTA 3UAGA 1OXMA 2AJBA 1TA9A 3N39C 1VHQA 4NBSA 1I1QB 4ZCSA 3WOVA 2Q8QA 3WV5A 4WLNA 3A1WA 4II3A 4BCDA 1CS0B 1QNFA 1QRDA 1XWIA 3D64A 3DOJA 4GLJA 3R9XB 2QTAA 2UDPA 4CHGA 5JD5A 4MK4A 1D5WA 2VNHA 3NWJA 1K27A 3UKJA 1BOOA 3W6PA 2XGOA 2FH5B 3RQIA 1X7YB 2YTZA 5J4LA 2IHNA 4LBYA 4YR7A 4C0SA 1U1FA 2ZBFA 4MUAA 3MUOA 3V4SA 4XYLA 1DRUA 3E8XA 2OOSA 5KHOC 2YJTD 3KT3A 4Q3KA 3SXJA 1VZ2A 2RKOA 3C3KA 1QE0A 2PKQO 1E62A 1SD2A 1CR1A 3QVXA 1Y4AE 2PMEA 5GINE 4R2IA 2Z1MA 4HP8A 1C2YA 2ANBA 3JQBA 4G0OA 5CW2A 3VDRA 3WO0A 4AX4A 4OXNA 4REQB 4Q05A 1JF8A 1CQXA 4KIUA 1JPJA 2Z9CA 3UFXA 3F46A 1TT5A 4V0MA 1MJHA 2D2IA 3OE1A 4JYPA 4YDHB 4KEAA 1XALA 1FFSA 1OBFO 3FCAA 2B78A 2WHYA 2FN9A 3JX9A 3TJZA 2OXIA 1LI5A 1M1ZA 1WEKA 2BPOA 2HPZA 2P1DA 2VCHA 3HV2A 1T6ZA 3NC0C 3CLTD 4PYIA 4BO2A 5C4MA 5HUJA 2I6XA 5JS2A 1LDEA 1S3GA 1SEPA 1AB5A 3FDZA 3LPNA 4EX7A 3QEBZ 3ETDA 1GXSB 1EFPA 3N2KA 3PGKA 4HTFA 1NRIA 5BN3A 3T0GA 2XWQA 1GZ6A 1J2TA 1BMQA 1FFXB 1QIDA 2G4CA 2OV8A 1V5IA 2ORED 2VJLA 3LP5A 4FT4A 5EE9A 1V11A 1LK7A 4ZZIA 4X20B 3W9SA 4ZICA 2FW1A 3SJUA 5HK8A 1KTVA 4YQYA 3RSZA 4JUAA 2XT0A 3UAXA 5K4GA 5K45A 2XUHA 5LQRA 3CCCA 2ZTUA 1PTJA 5FO0A 4A8TA 2WWTA 3HBAA 3EH2A 2QTZA 1DTSA 4OJMX 3WICA 3LOUA 4LWPA 2OAGA 2CXPA 2QIPA 1PJ4A 2Y8EA 2ZPUA 3LNCA 2XQJA 5CJPA 2AWNA 3TZLA 3ZUPA 2FX2A 2HJHA 3EMBA 3RIXA 1DDOA 1NFQA 3RAGA 5MN6A 4TT3A 5F1KA 2Z56A 3OJOA 1SBZA 4PLTA 1GPH1 1MH1A 1PS9A 5FXMA 2P2CA 1HBJA 5TF4A 3EEFA 1C80A 2EZTA 5AM3A 4R3UC 4M86A 1MT3A 1YJBA 4ND7A 4C0HA 1YA6A 3RTGA 1Y3BE 3RANA 3RR2A 1GQSA 2BM1A 4BC0A 4TUYF 4OGGA 4L6IA 4ZDWA 1GU0A 1HFWA 1M76A 5FBRB 5SZKB 4AECA 1HXHA 5I47A 4XCVA 2WM2A 4HOYA 2ZM5A 3DUFB 1WVGA 3QKSB 4IUDS 4XUEA 4WXEA 4D42A 3ETLA 2PL1A 1N0HA 4RHXA 4RVOA 2QNBA 3I05A 3OUZA 4MHOA 4QSHA 2NPFA 3TBKA 2AR9A 3GX1A 2DBYA 5A1JA 6CHYA 4IQ8A 4G9EA 1TOAA 2G04A 4LXHA 4KI7A 3PGJA 3K0CA 3VTKA 1AKUA 2ZRMA 5JI3E 1XDDA 1UEIA 3R5FA 3LOPA 3UMBA 2DQYA 4D6YA 4DCUA 1QYCA 4IYRA 5DO9A 1U4SA 1CYEA 2FPIB 1H2WA 1P1CA 1B8UA 1JT9A 4QYWA 3FMFA 1I13A 4Y2JA 4DR7B 4CKWA 2OOKA 2R8XA 4G8BA 5AKLA 1SQFA 5JYDA 2PRZA 4I08A 3RU7A 1W87A 2JCSA 2R47A 5D3KA 1Z6YA 2Z2IA 2NOAA 2RCYA 4PIPA 1NG1A 3FUVA 4QO7A 3A6LA 4TZTA 4EWLA 2X0IA 4WBNA 4KSBA 1PJSA 2H4YA 1GRNA 1TVKB 3DHNA 1LQ2A 1M10A 4OHZA 1X1QA 4QG7A 2BBWA 1Q12A 4EH1A 1E5LA 1UDBA 3NAMA 1YBFA 1J2RA 5ISMA 3C3MA 1YR6A 4MITA 2PL3A 3W4IA 2G5CA 5K6RA 2CLLB 3KB8A 1I51A 4K9KA 2I65A 2C9CA 3LXRA 2E21A 5C31A 5KTTA 1U5CA 1E1DA 4YJFB 3I2JA 4EI8A 2Q3LA 4PNHA 1Y48E 3KFVA 3EVEA 3W5IA 4B4KA 3L92A 3ZE0B 2BR5A 4FNGA 3OLWA 4RVGA 3T0IA 1QBKC 4BMCA 1YIDA 4W1PA 2F9MA 3N6XA 4YJGA 2D5LA 1EGQA 1ATIA 2VL7A 3V6LA 1KXJA 5ARBA 2FHPA 3AP3A 5ESWA 3PNSA 4BGDA 1OE0A 3K1TA 1ISFA 3SC2B 1W4ZA 3OSZA 3ZZNA 1KSHA 2J6IA 3T9DA 1U9ZA 1YS7A 4MPPA 2XVYA 3K7EA 3DBLA 2XVMA 4KMSA 2CD7A 1U2DA 4PSUA 2R8ZA 4MYRA 3VR5H 5H3HA 1MG0A 1WUHS 3EWIA 1E5DA 3G0BA 5FL7D 4BNWA 4CCSA 1YCDA 5C4IA 1OB5A 1Z0IA 1QF9A 2HQOA 2X4LA 3H65A 2F3UA 4UMFA 4PRZA 1ZD2P 3HS3A 3PWSA 1JRLA 1W1WA 2IXFA 4X5OA 1L1EA 4CM9A 1Z13A 3F73A 1MENA 3A6GA 4ENPA 3VO9A 5CBPA 3AOEA 3FWPA 1JFVA 3KLPX 1KQGA 2IBSA 1Z4IA 3SSMA 1V3UA 4QYSA 4OFBA 5E6RA 1PYGA 3C8UA 3QLEA 2JAPA 3O93A 2ZXEA 3UHAA 3D6JA 5DBHX 2Z2XA 3KPUA 5MN5A 4BZPA 1WS6A 4Z99A 1NW6A 4Z1MD 3NU1A 2VPQA 4P81A 4KWIA 4EA9A 1F14A 1HSOA 1FTGA 2SCUB 1NWHA 3CUVA 1AUVA 1KMIY 2X23A 3R4CA 1DOHA 3LXUX 1DJPA 2Q1UA 4D1YA 5H3CA 3HCEA 3Q5DA 4PVCA 2IZOA 3U7FB 2DMRA 1Q7BA 2Q3HA 2YHIA 4MR9A 4ZI5A 1VE9A 1QZXA 2GN8A 2NV0A 1IONA 1X8LA 2NYRA 2YV1A 2ZWPA 1K0UA 1JVSA 1P31A 2DCMA 3MWJA 4DLWA 2WJIA 2W6JA 3QXXA 1F6BA 4WY2A 3WRVA 2VTBB 1HFKA 4XCQA 1Z6PA 3BZUA 4JLJA 5BN1A 1PUIA 1M7HA 1X7ZB 4ZEWA 4EDFA 2X0EA 3A9VA 4ND8B 5DFAA 3JQAA 4FX5A 3BHMA 5F98A 5KJ1A 4FGSA 3PJFA 2MINB 5A4JA 5CD9A 5DM1A 2OR3A 1ESNA 2BBTA 2XCOA 4GEKA 1O5TA 2UVPA 1NJGA 2XUGA 4YPOA 4QDJA 4BE4A 2PHZA 4AUNA 3TTUA 1ZLXA 1EA5A 2XF2A 1K06A 3AV3A 3FPLA 3P9SA 3PU6A 3I9MA 1E99A 4MVJP 2OLJA 3QBDA 5JO9A 1Z2DA 3UJ3X 2JFOA 4E4RA 2Y1OA 1HWYA 1QPGA 3BULA 2C5GA 3FB4A 1SPXA 3LUFA 3REQB 3LYAA 4FYIA 3OZAA 4XFDA 4FFBB 1XD8A 3BEOA 4DLAA 1QJ4A 4DNPA 1FYFA 3N0TA 2XHEA 1UK8A 1LBQA 1QH1B 4L5AA 3HXOA 3JAWB 1RACA 1KJQA 1TNDA 1THGA 3BH0A 1QCCA 3D1VA 3IIKA 5D1HA 5IUNC 4Q4HA 1SU4A 1XLWA 4BOYA 5HUHA 4YQFA 1PWYE 4DDUA 4RJLA 3PR2B 3CX8A 1F2UB 3WKCA 4AM8A 2QZ9A 1FDUA 1YCFA 2AOTA 3BERA 4N12A 1T9HA 2YNMC 5IC5A 4AULA 3GGPA 1V7CA 2O5VA 5D5HA 1BHQ1 4C7BA 2ISCA 2QORA 4IH1A 2JIBA 4D92A 4BQFA 1TUEA 1TJNA 4B3JA 1U3CA 3KEQA 3GLIB 1GV0A 1DO2A 4NX2A 2ISSD 1SBCA 4I81A 4O2RA 5A6SB 1JEJA 1XZQA 1YS1X 4TQ9A 1G291 1CY0A 1FJ2A 4GHWA 3M8KA 4B8ZA 3B2EA 4EB0A 4DSTA 1X9IA 5K4HA 1ULHA 2NSLA 1QUEA 2GPAA 2DJ5A 1F6DA 3EHEA 3FFTA 2AOUA 3EWAA 5AKIA 4QBIA 2EJTA 2YL2A 2BGKA 1FRFS 3C7KA 3O7MA 2R8RA 3A14A 3FTDA 4FYPA 4LW8A 1F9EA 5H7XA 3DMFA 4B31A 3FOZA 4XX0A 2PZGA 4B71A 3UWOA 3AF1A 5A7HA 5BWBA 3ES9A 1A98A 2ZW9A 4HADA 1RYZA 5FR2A 2O8BB 1Q92A 1EFKA 2J9FB 4DA7A 1FRZA 2K5UA 4UCXA 2XMRA 3VR4D 1JLKA 1FEZA 1L1QA 4DR5B 5SV2A 2DWUA 1IZZA 1LZLA 4F2DA 5JHGB 3MJHA 2IIBA 3AY0A 3MXOA 3Q9SA 4QLAA 3W2EA 4JKYA 1K4MA 3GCZA 1PZEA 2WU8A 2IXGA 1GR0A 2OFXA 3I0NA 1BS9A 3JQFC 3PI6A 3K0KA 3K9WA 1NVWQ 3LC1O 3FTNA 2GSDA 2Z5VA 2UXBB 2H2WA 3KZCA 4UARA 1CZRA 2OXFA 2AQIA 3DG9A 3RARA 4UHFA 2BE9A 1EDEA 2WTUA 5FLKA 2MTBA 1XEWX 2H1LA 1CJTC 2FFBA 3CZQA 3QE0A 1TZKA 2NG1A 2A0UA 1GFIA 1XQVA 4HFMA 1PZGA 2B6NA 5HOEA 3C5EA 3V4VB 1EZ4A 1KYTA 2Y1DA 5CHEA 3TXXA 1DLJA 3DLIA 3JW8A 1DMRA 3LX4A 2JHAA 3RFCA 1ZEMA 2YFQA 3NW9A 2R2AA 3IAM6 3O4GA 3GFPA 3AR8A 4MIYA 3L8ZA 4WZAB 1U8UA 1OLSA 5B4TA 1HR0B 2QN1A 2CXNA 4S1WA 1GYQA 3Q72A 4N5IX 1VG8A 2DWQA 2HY7A 1E20A 1X2BA 2YN2A 4HGPA 1OV4A 2IPLA 1ZKMA 1KMHA 2GN4A 2YDXA 4HUQA 3RBXA 4F6RA 2OZLA 4J0QA 4KFTA 3MQ2A 4QQRA 3RTBA 9GPBA 2UYHA 3FDJA 2CV2A 1SA0B 5AVZA 1D4OA 2WUEA 5BQ5A 1UZAA 1ZGHA 4G0XA 4B9EA 3HUFA 4DKXA 3TO5A 5AOCA 5A4FS 1DKOA 1WV1A 4PZPA 4YAOA 2J0VA 4DAOA 2IS2A 3INYA 5T4FA 4HXYA 4JYZA 4NU5A 3JATA 3K0BA 4P98A 2VSQA 3I8SA 1A96A 2RG7A 3LBYA 5K3DA 1QX4A 1A9YA 4PLPA 2NYAA 5HYVA 3QLUA 4GECA 4V0KA 4XUGB 1Y5LA 3GFSA 5CIWA 2FMUA 4Z0TA 5L40A 5F2EA 1HRKA 3ILYA 1JI0A 1ORRA 3MZ0A 1Z7WA 2PZAA 5D84A 4XR4A 5EZ5A 1M2NA 3QBEA 4TN5A 1BTOA 1BXGB 1FTNA 2AFHE 2EXXA 4MO2A 3CLRC 3A9SA 2ZR0A 1BDMA 5JAPA 2WM8A 3ZZMA 1KK2A 1XK6A 1L4HA 3NEPX 4A10A 4EPYA 1H9CA 1HYEA 3DW1X 4KKXB 2Z4SA 4IMPA 5GTDA 1WKVA 1CZOA 2VF5X 3C3WA 5EJ7A 4NK5A 5K6TA 3QG1A 4RFLA 1OW3B 4V1CB 3STXA 4M1SA 2ESRA 2FZ4A 1I6MA 4DR6B 1MAAA 2WYUA 2CGEA 4JCCA 3VOSA 4EARA 1Y6FA 1MKYA 4LF6B 2GVZC 2ZR7A 4HQNA 3VKHA 2X9VA 1H2FA 1J1ZA 2HNKA 3BGWA 4MS1B 3QBJA 6ABPA 4F6LA 3UWKA 3U3OA 1Y6GA 1DP4A 2JIPA 5BN5B 3HBNA 4XVQA 5EJ4A 5JHHB 3PR3A 2NZWA 1IN5A 2FZWA 3ZCTA 3KYDA 3P0EA 5L6MB 1RI4A 2C04A 1KEUA 3GD5A 3DQZA 2WE7A 3KZ1E 3HMKA 3WDLA 2C2KA 4H7FA 3GGJA 1MO6A 2VCEA 1C1DA 2RHCA 3ZXUB 1XV5A 1GL6A 3RUDA 3VSEA 3W6ZA 1VCOA 3ONEA 4P4TA 4YUZA 3V1NA 5FWNA 1CVLA 1JHZA 4UTXA 4KWTA 1M72A 3K9LA 4M0PA 5D3MB 1VBFA 3ENWA 1V6CA 3W5SA 3EMKA 3BJMA 1HDIA 3H97A 4DC9A 3HCPA 3D4PA 4LRYA 3DOOA 2CE7A 3SEAA 2I3DA 3PS9A 2IP2A 4TSFD 4GO1A 4BNDB 3WXBA 5LXTF 4LWOA 1HURA 4MQFB 3ZGXA 2XCLA 2PX8A 2G4VA 3D7KA 4YI3A 1KO1A 9ABPA 5DHPA 1PJ2A 1R12A 2WJYA 4KQ1A 1C1HA 4UUAA 5I7EA 1AK9A 1TMOA 4YXWD 3E0QA 3P96A 5IUJC 2WFMA 1ENYA 3WQQA 3TSWA 3EFBA 5A2GA 1I4LD 5K0JA 2EARA 1RBYA 4CF3A 1XZJA 1Z6QA 2YXPX 4IMIB 4RK0A 5JFOA 1B8VA 2WWFA 3IB3A 1FYVA 3JWGA 3KPYA 4MW2A 3HI6A 4Z4FA 5DLDA 1GGKA 3L0CA 2CEAA 1GL7A 1N6PA 1NUUA 3R0QA 4L0MA 3VJLA 5DSZA 2ZIXB 3VPGA 2F48A 3I76A 2IU0A 2P5SA 1FMLA 3BB1A 1XJ5A 1C8VB 3BBPA 5CM8B 3E1KA 3W05A 4CM3A 2ES4A 2V0GA 4A6XA 2O8EA 1MJ5A 5FOSA 721PA 4IOKA 5LJLA 4F2GA 2GN6A 1B3BA 2W93A 3ZYCA 4PN7A 3ZI0A 2Q9BA 2LRHA 5HS4A 4BJ5A 3QY0A 5JQGF 5MHTA 2GDZA 2V7WA 1OSNA 1V1MB 5JANA 2O2YA 4R1LA 1GITA 4MWTA 4MO9A 3QLVC 4GI3A 2VYQA 2GBGA 3SZGA 2VF2A 1P1IA 4HAVA 3GYBA 4RZHA 4GRDA 4N6OA 4U7PB 1E6LA 3AHFA 1Z4QA 1QV6A 4F96A 3O6VA 4G4SP 1EP2B 2CMHA 3PUVA 2EGUA 1Y4UA 1YKGA 2QLLA 1NJSA 4G9GA 4HEJA 1GCIA 1KMQA 2VAPA 5DHQA 3W5HA 4ARVA 4YV7A 3GJ3A 2ISQA 3A4NA 2N1BA 3L43A 2FR0A 4MVJE 1Q7GA 2H1OA 3UOWA 1NV9A 2BR3A 3OCZA 1EJBA 1L7MA 2P4QA 4R8RA 2Q2QA 2JFVA 4XTCS 3A11A 1JDSA 4CBVA 4EEXA 3ABQB 3AWIA 4M1QA 3V42A 2QMZA 4ZOBA 4EO9A 2HU7A 3Q1LA 1MZPA 3ZHSA 4TTRA 2D3WA 3WGZA 1ZUD1 5LFAA 1G5PA 3TAXA 2F1RA 3VC1A 3FPFA 3P27A 5GM2A 4PIMA 1OJLA 4ZVTA 1EI9A 5KDOA 3GA0A 1VIDA 2J33A 4C0AC 4ISBA 3BE6A 4IO0A 4LAFA 3U7HB 4URXR 1T5HX 5CH5A 3B1XA 3C2QA 2BZ1A 3CB2A 3PDIB 4KGDA 1GGJA 1Y5NA 4BO0A 5I45A 3ER8A 3LU1A 4PYRA 1S8AA 1DAEA 3EULA 1TC2A 1B0ZA 3FCYA 3U80A 3V8EA 5KUTA 3BT7A 1C41A 2HLPA 3C5VA 3PLNA 1H93A 3BTSA 4INAA 5E95A 3BWDD 3SLRA 2C2XA 3NAZA 4KXVA 1YDHA 2KQUA 4L3WA 4TMVA 3U7RA 3X1KA 3ZNNA 1QYVA 4CUKA 3FLBA 1K89A 3COJA 4H1WA 5CP8A 4ZQGA 1MW8X 4JLVA 4I36A 4BY9E 2WF5A 2IHTA 4I14A 4J0HA 3JQQA 1ZCAA 4YR9A 4EFNA 1P7CA 5KNCA 3EUAA 1G9XA 2CE2X 3CSSA 3P9ZA 1HDOA 1WB5A 4GOJA 4V3CA 2IY8A 4DLTA 1U7PA 4M9RA 1JR6A 2F3SA 2ZRHA 1Y4SA 4ZYVA 4F4CA 2JLVA 1FW8A 2FSVA 1R66A 1XZGA 2F3RA 3DHVA 1QONA 1MHTA 1E32A 3TMKA 1Z2NX 4HN9A 2QTBA 3ZQKA 4CMAA 4DM7A 5KINB 5LOVB 4BQRA 3VSDA 5CX1A 5FADA 4HDRA 3E3OA 2JAQA 4QLOA 2PJDA 3FCEA 4EZIA 3VR3D 4RVDA 3GJ5A 3GFVA 1YA4A 3I53A 4IDBA 3DW3X 1IPHA 2HSDA 3LK6A 4BLSA 4IILA 1U6KA 3GEPA 4R9SA 2OO7A 3AUAA 1G8HA 3I23A 3O38A 4GBJA 4NNPA 5JD4A 3KZXA 2AMYA 2GAFA 2FWIA 4CI9A 2BKXA 2OO5C 4MVJA 3DCJA 3L0PA 3T34A 3OPYB 3JQ7B 4H4CA 1S8FA 1FLVA 2VSNA 3PUYA 5FL7A 1IDN1 5IM5A 3IKTA 1NAIA 4EUKA 2QVCA 4DR1B 1C2TA 1R6XA 2EG9A 2VWGA 5KWEA 1GYRA 4I5EA 2Q2OA 3KAQA 1E4VA 3I1YA 3T3DA 3DZHA 3ELWA 4CEJA 2IOHA 2ZUCA 5AKKA 1EB8A 4W6QA 3EZNA 2UZ0A 2WIGA 3PXBA 2R8BA 4Z0PA 3RS4A 4DCMA 1Z29A 2E55A 4DCCA 1MW9X 3USZA 1BU5A 1VOTA 4OU4A 1SVIA 3CW2A 3G2HA 1G9SA 3QSGA 4KR3A 4ZZ3A 4LFBB 6Q21A 1KI3A 1N5LA 1SUPA 1UMDB 3IL2A 1X7HA 2WA1A 4NZ9A 5AM0A 3HKBA 2BDTA 1TW2A 2QLNA 3ELUA 2NVUA 3CT4A 2DUWA 1SB8A 5FOQA 1O94A 3GVCA 3QA9A 4RGVA 4W1QA 3TW6A 4N3CA 4R1PA 3LH5A 4J9VA 4ERXA 1GFWA 3NHSA 4WUTA 2NU9B 5EIEA 3QPBA 5JVDA 3DOHA 4RZXA 3OKAA 1WCV1 1B6RA 4AZWA 1K92A 4B4VA 1JAYA 1G2IA 1NFRA 2XYHA 1FBTA 4KDRA 3GDGA 4LSGA 2A0FA 5FFFA 5G2OA 1ZM2A 4NCBA 2NXNA 3S4YA 4PAOA 3WFIA 2COKA 1YGYA 4PRYA 2NVWA 2ZIVB 3DB1A 3SFVA 8LDHA 2XB8A 4JUBA 1ZFNA 4EEZA 2IBMA 2O07A 3CZ5A 4GZ5A 4BMDA 3ZDQA 1SBIA 2FDXA 4D96A 1Y8ZA 4ZT6A 1W0CA 1BXKA 3N0XA 1JR3D 3DPUA 1R6UA 2BD0A 2VNJA 1PJZA 3IT2A 4IYJA 3ZK7A 2ZJ5A 4DXDA 1QCDA 2QVZX 2P8JA 1AG9A 4GMDA 3BCHA 2V45A 4Z9YA 3RVMA 4E51A 4M9XA 5CU7A 1VRCA 3PC2A 4G1MB 3DYBA 3T06B 1JZQA 2WIJA 4HGOA 4RETA 4ALLA 1GEEA 3CRMA 3IDSA 5JAIA 4NWIA 4NBUA 2ACVA 1B2LA 1WHTA 4M21A 5AVJA 2P9TA 2IZZA 5BV2P 2BFEB 1INLA 1U8EA 5EHIA 2VQ3A 4IDNA 4PSVA 1AKMA 2MSCB 3ZY3A 1J42A 1QYXA 2JAXA 1Z5NA 2Y1GA 3CJTA 2Q6OA 1R0YA 3RFVA 5HK9A 3BWEA 4D9NA 4MQUA 4J6EA 1TJPB 4P2GA 1H5UA 2EDAA 2H4XA 5FTNA 3T6KA 4CLDA 7ADHA 1BMTA 2BM9A 4FKZA 3I9LA 1GG8A 1XKQA 1BYUA 3M89A 5JZBA 1QHIA 4WJLA 2JLUA 3FCUB 4XWAA 5HKLA 2GBFA 5KYUA 5KAPA 5KX5B 2PTGA 1OWNA 1FU8A 2C5LA 5TF0A 2A8YA 4TTAA 5A03A 3BCSA 3W5UA 3LVQE 4G8JA 1TTPB 5HTOA 2ZWVA 3HXKA 1EBUA 2J9YB 5FWAA 1IZ8A 3HFRA 5IARA 1DEXA 2CHFA 3C48A 3HJAA 4GLBA 3L7CA 4EZEA 1TQ8A 2EG5A 2W2XA 2YFYA 4ZAYA 4YMSA 5IT4A 2JJ1D 3V8BA 4AJ2A 3I9FA 1QJCA 4EMSA 5JTUA 1TAGA 1DBWA 1TYCA 3HA2A 3KD2A 1GZHB 4TM8A 5AVOA 3PL5A 4XWYA 5C37A 1D8AA 2A67A 1XPJA 4RHFA 3RV4A 3K6SA 1N33B 1U63A 2OSBA 1VPWA 4IFIA 1LTKA 4WNYA 4ZHQF 5EJ6A 1NVDA 1ZK0A 2F1IA 1SD5A 1LPAB 1SG6A 4RLHA 4ZQEA 5B12A 4R4JA 1UKBA 5F7XA 4D0NA 1B3RA 1PN3A 5TNXA 3LXMA 1N32B 5LBIA 5JZVA 1E3IA 1FS6A 2R7NA 1Y98A 2BTOA 2UYQA 3EBLA 4AYWA 3VSBA 5CT6A 4QXPA 2DBZA 4L8GA 1XVUA 4X3CA 1RQXA 3E2MA 5GZ1A 1LC0A 4K8OA 3BGVA 3T15A 4P53A 3FWZA 5ESRA 3CEAA 2YMLA 3LRTA 2B35A 3QQPA 4H6PA 1MPTA 1TAUA 3HA5A 2FPWA 4Y18A 4B6OA 1DAFA 1RQPA 1TO2E 1VYTA 4PGGA 3TZBA 4JLKA 3VOBA 1G6KA 2Y0EA 1SUEA 2G83A 2C1EA 2A78A 2JVKA 4RPJA 3NXSA 4FLFA 4ZA2A 5F3DA 3FMGA 4UEOA 3TJRA 4F4JA 3LLSA 3FXAA 4GIBA 1FRQA 3RAEC 4PO9A 4OKIA 4F3NA 1I0IA 3LC0A 2XUKA 2NU8A 4CFSA 5LPNA 2R7MA 4KLRA 4X6YA 1GAJA 2OHIA 1O03A 4NAHA 5BQOA 4Z9FA 1ZOOA 3AUXA 4UCFA 5TJHA 5ELLA 1BNCA 3PGVA 4N0EA 2D0PB 5JCOC 3PHGA 4GPTA 2HU5A 1JLLA 3TSCA 4QPCA 2AOVA 2JZNA 3M5WA 2JFGA 2A5JA 5DYTA 5KOYA 2VPIA 3TNDA 4NPHA 1KP3A 4IGIA 4Z7JA 3Q9NA 2D0IA 2CBGA 2PUCA 3HJFA 1DDIA 2VBIA 1G8AA 4PGMA 3T7CA 4LOAA 3WVNA 3LY8A 2GPSA 2I6SA 3IPAA 2XVXA 3BMNA 1O8BA 4LXTA 4MS4B 1XFDA 5T8KA 2FFHA 1BJRE 1I7SB 2G1PA 3IVAA 4P7GA 4G5XA 4RJKA 3QX8A 2AN3A 3EF1A 3PVSA 4ITUA 1CJUC 2CCJA 3AI3A 4WNAB 4JT9A 2P27A 3Q3JB 1T2DA 2ZJ8A 2ZZKA 5K8UA 1CS0A 3ECSA 5CGZA 3R9XA 2V7QD 1ZD8A 2K2WA 1QG0A 1W75A 3HCBA 1J7JA 1SRQA 3CEJA 3HHEA 4LOHA 5C8YF 2HNBA 3VC7A 2GBLA 1IOWA 2GAAA 3N8NA 1I94B 3E53A 1DUSA 4XIJA 3C4QA 4ZVOA 1IE3A 1PLKA 3IBFA 3Q4GA 3NNNA 5CJJA 2F9LA 3GROA 1XDZA 3TOZA 3CN7A 4GICA 2A4MA 4EGCB 1NWCA 1ECJA 1SOWA 3AIMA 1MQAA 2A1IA 4L5BA 3V4OA 5A0VA 2ATVA 1J5PA 4YCLA 1N4DA 2I8LA 3AW9A 4INZA 5KYKA 4LISA 3JTMA 1FRNA 2OCXA 4NG4A 3EASA 4B2YA 4REQA 4RLSA 1P2VA 4Y8VA 4ZVSA 1ISRA 4F45A 3B3JA 3K6JA 4FSXA 3V1LA 4WADA 2Z08A 4O0MA 4Q7QA 1JBKA 3AERA 2ROQA 3DDZX 2FMXA 1M1NB 5IT5A 1E60A 3ILVA 1JLHA 3UKOA 3VR0A 1QWSA 2JCXA 5EIBD 4UHDA 5AJYA 1CF9A 1K7SN 4RNDB 4D5GA 1GXSA 4AO6A 3RG2A 3UN1A 2WKRA 3DC7A 1SBTA 4ON9A 5FNVF 5B7NA 3NWPA 1BMDA 1FFXA 3IFSA 1CBUA 1OXBB 3DS8A 4OHBA 4X20A 5C8DA 3O31A 3U44B 1ZJYA 4Y0NA 1YR3A 5BWNA 1ZIYA 3D0QA 4B3TB 1N75A 3VNAA 4ZI7F 4DJEC 1K6MA 3U4QB 2PSHA 2VYND 3EDCA 2JLYA 2Y77A 1M2FA 3RREA 1I2DA 1AN0A 1PL8A 1Z7GA 1SUSA 2HUPA 1HDEA 2CMFA 2I7VA 2Q6TA 2XMQA 2ZLBA 3BEDA 3C3DA 1LC3A 3SI7A 4CQMD 1LBEA 4FK8A 2NPOA 1FXWF 1IRIA 1TZBA 4GOOD 1QVWA 1LRLA 4L02A 2KYRA 1SELA 4BNFA 4Q7MB 3V7FA 3A8TA 4TSFA 4OFZA 1U7WA 4QFMA 1RYNA 3MJRA 3R77A 2UUCB 1D5CA 3GJYA 4C6RA 5AKGA 2CVHA 4DZTA 2I71A 3UOAB 4YXWA 2AFIB 4C20A 5K03A 2X2OA 4M87A 2QZ4A 1V8DA 3T54A 3KD3A 4BFYA 1KSFX 5E6SB 3P9CA 5CAEB 3UG7A 5H8WA 1Q77A 1YA8A 1DAKA 3AUSA 4HEQA 3RRFA 2HYIC 3DUFA 3QKSA 4KXYA 4NEQA 4DYVA 2A92A 1CWUA 2H2IA 2PX2A 4A91A 4N5LA 2KLBA 4C7MA 1XROA 5A06A 1NURA 1H6DA 4YRCA 3OKPA 3ZU3A 1AY0A 1G4HA 1B74A 3T5MA 4BTEA 5C7LO 2IRWA 1G7TA 1S3SA 2N9UA 1QDUA 2EWWA 4RK4A 5F76A 2AN5A 5IJXA 3GJ6A 4D99A 5GV7A 1N6HA 1X7GA 2WJGA 1SVKA 3HCFA 3IAAA 4HRAA 4E4YA 1KDTA 2PFKA 1OF1A 2CLFB 1KS2A 4N49A 4FINA 3GJXC 1T8WA 4G67A 2ZULA 5J5CA 1ZHHA 1IY8A 2HQBA 3MWEB 4Q37A 1QMPA 2BLNA 1DBSA 1L7BA 5IJ0B 4IRMA 2I6TA 3IRVA 1LGYA 3PZBA 5JEDA 2MWMA 2IXTA 4FOOA 4NMXB 5EJEA 1H1TA 1FSFA 4N5MA 5J5VA 4G4SO 1O0SA 2HAEA 3IQHX 3S29A 2BGWA 2IOFK 5C1DA 1WHSB 1IUOA 2WT4A 4WXHA 3U3DA 4EYSA 4NYIR 2WAAA 1DCTA 3TLBA 1XTVA 3TYXA 3ENQA 3X3HA 2FK7A 3OEEA 5TPZD 1TVKA 4GBMA 1WQ4A 4C4ZA 4FFVA 2BCJQ 1NUTA 1PWXA 3UHJA 2EJUA 5EHXA 1LI7A 1G4UR 1G7SA 4MRRA 2YCBA 4X3OA 2ZJ4A 3EYWA 4AS1A 3UY4A 4YUYA 4WXPA 3A70A 1IEWA 1L7OA 1P9NA 4LRSB 5E3IA 3FZNA 3ZHBA 1G17A 2X5KO 2FE4A 2J5KA 1NUPA 1J0XO 1O6CA 1XLUA 4G85A 4YJFA 5FUYA 4DPKA 5BW5A 1F7VA 4BLOA 1Z7BA 2J67A 1MOZA 3HU5A 3LPLA 4ZO6A 4ALMA 4DDVA 4OTZA 1Z0UA 1J25A 1PP4A 3EVBA 3H6KA 3WZLA 4EJ6A 1CZNA 1BS1A 1WY5A 1J99A 3GMDA 1FQWA 3EARA 3ORYA 5AVUA 1AKVA 1VZ3A 3HNRA 1R8XA 1XKTA 4N9QA 4UCQA 1SCIA 3F5DA 3SC2A 3CCBA 2AZ4A 3IR7A 4GXTA 4CKYA 4DSNA 1EVJA 4OJKA 5DHUA 2EQAA 1UMCA 4KQ2A 4TZKA 1N5OX 4IV8A 1GNVA 1PJAA 1BEUB 1V7ZA 3EIUA 3U4MA 1KBOA 2HMVA 3AJ9A 3H4TA 1UXGA 4YMIA 4A82A 1B2RA 1P19A 1SC4A 1SG9A 2IPMA 2PDAA 3EDOA 4WZZA 3MLBA 2F90A 4Z3KA 3F6RA 2JGFA 3DVSX 4LRWA 5HF9A 1E63A 1LWOA 2ZVDA 3E22B 3P71T 4NI5A 1V6AA 5DDIP 1EVKA 4AMVA 1PFQA 3WAGA 5DKFA 3T1YB 2O9JA 1SHKA 2OK7A 4S2UA 1KF0A 4IIVA 1VFPA 4B40A 2IP1A 1JDUA 3LECA 3UJPA 4ZO7A 1KIAA 4JT2A 2GJAA 2YWHA 2VPPA 1YBAA 1K63A 4LRXA 4U8HA 5DNAA 5EFZA 3EPLA 1T1EA 2SCUA 1Y6ZA 2Q5HA 1SCQA 2JCGA 4W5HA 3UUWA 4UU8A 2ZRNA 4OH1A 4HSEA 4WBNF 1J97A 1DXHA 3RKRA 1G6Q1 3AHIA 2I99A 1Z8DA 2G06A 1A7UA 2JGKA 2OCDA 2RARA 4FIZA 4JR1A 5FKJA 5AT1A 3RYIB 5J2TB 3RG8A 3QKIA 3U1BA 3CH4B 2O57A 3MD0A 2FFQA 2KB0A 1M1YB 1FYXA 2EZ4A 4OHPA 4DB4A 5EWJB 4MUJA 2XODA 1RCFA 1H3FA 1E3LA 2VTBA 2OXCA 1E3TA 3OEWA 1LTHR 4BVJA 1XNHA 3WWYA 4AJ1A 1XRPA 1M6VA 5MGNA 1X7ZA 3U40A 5LQDA 1RI3A 2W2TA 2OFFA 1E59A 4ND8A 2CBZA 4F11A 1USWA 1Z6GA 2R751 2VJAA 4HNHA 4BQIA 1RBZA 2Y0BA 2XBUA 1RXSA 2MYUA 1R0LA 3G0DA 5B58C 5KVVA 5JASA 4P08A 1EZ1A 3P0RA 1M75A 2JFFA 1F38A 5LQAA 3KQLA 5K8LA 3BOSA 2Z6UA 1NKSA 4FQ8A 4IOJA 2G40A 1WX1A 3OCYA 2ZREA 3PC6A 3B7PA 5BMOA 2CT8A 2VPXA 3MILA 1GQFA 3L06A 10MHA 1SHZA 4E7PA 1AUOA 1FJXA 4P8RA 4YS6A 4PG8A 3HBLA 1DBIA 2I4RA 2WAMA 3DC2A 5E7QA 1N2CE 4PTYA 4D0LB 4EELA 1KH2A 2JLZA 3Q7IA 4IF6A 4M99A 5EWLB 4BE7B 4U2FA 1XOIA 3CUYA 1ZUIA 3Q6IA 2H1IA 3A28A 4FFBA 4H3SA 1O97C 1YQUA 2IPOA 3L9WA 4IIYA 4JEMA 4C0XA 1QH1A 2JGNA 2PFSA 3JAWA 1NP3A 3E3LA 3H9GA 3PLRA 4ID3A 3I04A 5M3BA 2DPLA 3WHLA 5IKEA 1X3SA 1SU7A 2ORWA 2P2YA 4IRUB 3WHPA 1VKJA 3NO4A 5FRDA 3GVXA 1Q0RA 5A3JA 5ULLA 5CRIA 3FNHA 1F2UA 4ZVMA 2A3NA 5HEKA 1YQTA 1PZMA 1P1RA 3AU8A 4I7EA 3ZIAA 1I9GA 5AHRA 4YP9A 821PA 1VPEA 5ALFA 1UMBB 3IVGA 2O7QA 1BE8A 1N1GA 1M5UA 1VI5A 3OIDA 4GOXA 1CX9B 4KNVA 1JR3A 3MWYW 3SKYA 3VKVA 1CUVA 4YAGA 5IVDA 3GLIA 5IKPA 2WYOA 2C9DA 4OMDA 3PUXA 1SXJE 2AN1A 2IL1A 3GLHB 3OX3A 3OQ6A 3PQ4A 2F8TA 2P9EA 4JXZA 4CM1A 5KQGA 3AT1A 1ZHOA 3M82A 5A6SA 2DH5A 3QPDA 5I7UA 4JKIA 5BSEA 3WGMA 5F3WB 4PC2A 1B0PA 1LH0A 2WF6A 1NW9B 3OVMA 4G0NA 3GOQA 4KI0A 1EJ6A 1V3QE 3T7JA 1PNQA 3DDNA 3NASA 3QYFA 4H1VA 4AJEA 3RF6A 2IS6A 1QK5A 1A5TA 2IYZA 4MUKA 2OFOA 1JH8A 4OB8A 4O4HB 3UQZA 4CPDA 4XYEA 5FYDA 5BN4B 1GILA 1ORVA 1HE3A 2QTNA 4M0UA 5CH8A 4B3DA 3RVSA 1PR4A 1J09A 1PVDA 3C3BA 3IQXA 2GRJA 4KNYA 1NM5C 2ONZA 1QV9A 3E23A 2ZWMA 3UV7A 1P9RA 4DLXA 2O8BA 4EG3A 2J9FA 1JG7A 4F9GA 1UAYA 3VJRA 1M2VB 2Y4NA 1UBEA 5HP4A 4D9IA 4L28A 1KI2A 3FSJX 1DIRA 3D6NB 4MVJM 3I1IA 3PXAA 4C0JA 2O7SA 4Q3LA 2AS0A 3UJAA 2IH4A 4C0WA 2PT6A 3PZRA 3FYUC 3KSZO 4HWPA 2VP3A 1TM2A 4MKIA 4ZYYA 4YREA 4EJSB 4R1SA 1JHAA 4F1KA 3F5MA 2WA2A 3OWXA 5BNTA 3PNYA 2DAPA 1O77A 4KXWA 2JJ1A 1KVRA 2GLTA 4PLHA 2C5FA 1EFRA 1Z8HA 4B35A 1UEXC 3P9XA 4OKNA 4YRBA 1JKIA 2JJ2A 3UB3A 2NV2B 2BI4A 4HQ6A 4LDJA 1V39A 4WZAA 5GJWC 4M22A 3AZOA 5EP2A 4F2HA 4GDFA 5BWCA 2J32A 1JFLA 2BUAA 4OY3A 4Q3EA 2Z8YA 3EDRA 4UTOA 1YF3A 4IJ5A 4CMEC 3PPXA 3WK4A 4N18A 3QLJA 2PGJA 4PIVA 4YAFA 3LWDA 5EIWA 3EC7A 3WL8A 1SA0A 1GSAA 1QZZA 3MQFA 1ODTC 3DE3X 1NN1A 1ZH4A 4FWBA 4RGBA 1XAGA 4NYJR 3D9QX 3LUDA 1XSEA 3U17A 4EO4A 5LD2B 2I87A 1QFMA 4J16C 3K32A 2VTKA 1OA1A 3K4HA 1BW9B 5CCBA 2Y6VA 3W7VA 2DQKA 4ZU3A 4O0LA 2HKIA 3V6MA 3PEUA 2O0HA 4OP3A 5BUCA 2FRVA 1KY3A 4YMLA 2V7XA 1M7GA 1L5SA 4OGKA 3AJRA 5IU6A 4NQZA 2DY0A 5K0SA 4HB4A 1JUDA 1WCXA 4JVOA 1P6QA 4RENA 4JHXA 4OSPA 4DCOA 3C5HA 2PJRA 4YFVA 4AX8A 1NN0A 3PNMA 4Q6WA 5K8JB 1QPZA 4UUOA 5FBKA 1BXGA 4ZVUA 2FUG6 4Z4QA 1OAOC 2O14A 2VJDA 2WP8J 3G9ZA 1K97A 4G25A 1N92A 3QENA 4HNQA 2ZUWA 4IXMA 4B8WA 1ZGGA 3VO1A 1N7JA 1DINA 4QU9A 2YV2A 4TLEA 1KL7A 1GUDA 2Q5LA 1KO4A 3DT6A 4N4AA 1W85B 1QYWA 4PGAA 3R5KA 4IKPA 1P0FA 3PRHA 3FCSB 4GR9A 3ZPXA 4LXQA 4F12A 3WQSB 4EG7A 1U04A 4KFRA 1GARA 4X66B 2PU5A 2JRCA 4D81A 4V1CA 3GFBA 5CFQA 1KO7A 3F7TA 2ZPAA 4LYEA 2HDWA 3SLGA 3ZJ4A 3J80A 5L3SB 1JDJA 1WAMA 4WFIA 3F74A 1KQNA 2AV6A 4NDZA 4WAUA 4XQGA 4Y6LA 3F2VA 2NO0A 3G0OA 4GGMX 4BATA 3F5QA 3KSDO 3GFOA 4IEEA 4MS1A 1UAAA 2EF0A 3GZTB 3MJEA 2IYNA 4P35A 1CP3A 4WVLA 4AIIA 2Y93A 5BN5A 1G55A 4UEWA 4MKRA 3JRXA 3EUFA 5C35A 1A4IA 1XHFA 2YY7A 4HKTA 1PFUA 3L41A 4O08A 3AL0C 4DR2B 1D2EA 1W48A 4US1R 1GNRA 4JB3A 3LQQA 1CR4A 5F73A 5LA6B 3M7IA 2PXXA 2VP4A 4QYXA 3P4YA 4RD6A 3OMWA 3BVPA 2QN9A 3I9NA 3QFRA 1AUXA 2ZDHA 4OEHA 5IHPA 5D3MA 1JG1A 2DBVO 2QY9A 3ZHTA 4MARA 3NVKI 4GBGA 1VXRA 3RGWS 4UVHA 5BSVA 2FEPA 4BNDA 1ZQ9A 2PSSA 4HAOA 4AKGA 5JPIA 4GRIA 3PHIA 4MQFA 1AT1A 3NKFA 3IPRA 4IJ6A 1A4UA 5AVSA 1TTTA 1TF2A 3ZCSA 2Q8NA 5EINA 1JE0A 2FDCA 1FXSA 2V55B 2QXUA 4LHYA 1TIPA 2WOOA 4E31A 2W6ZA 1JR2A 1ZD3A 4EG6A 4L4XA 3PK0A 2HA0A 2WJAA 2PX4A 2V5UA 3QI2A 4PLFA 4YGXB 3C4VA 4XXHA 4R2WA 4L8VA 3TVYA 1EQUA 4EECA 4C0BA 3TQQA 1KEKA 1JVNA 2TMDA 2P2LA 3EZGA 4LX8A 4U02A 5AI6A 3NUZA 5SY9A 4C07A 1I5RA 3R9WA 4D56A 2OCKA 1E3QA 2P5TB 3CONA 4UU7A 2GPNA 4FNAA 1YMUA 4EY3A 4UUNA 5IABA 5KSZA 2AJLI 2OMKA 3TAHA 2W98A 5I9BA 2EFCB 3DBHB 4LZOA 2VDWB 3AESB 3WX0A 5DGHA 3WJ1A 1GZDA 2FLVA 4PE5B 1EAMA 3M2TA 4MW4A 2E5WA 2VYNA 1CK4A 3X0DA 2WSSD 1QR6A 3FA2A 4WE3A 1E0DA 4D45A 2H85A 5JMWA 2YJ3A 3A06A 3I2GA 1RPTA 3KDPA 3M3HA 3F6SA 4IQFA 1TTQB 4P3NA 2HQRA 5KYTA 1V1MA 4KMRA 3KR1A 1KI6B 2VK8A 4LJ5A 3N7AA 3RIHA 5JG7A 3EK2A 4RKQA 1OASA 1FX0B 3TB4A 3W5JA 1TT7A 1EK2A 4HQ0A 2P8SA 4QGSA 1XL0A 1WW2A 1W73A 1U8ZA 2PGAA 1YL7A 2QX8A 2ZJAA 4K26A 4P2BA 1LQTA 1XU4A 3HHPA 4R69A 1ZI8A 1VMKA 3E9YA 4R1QA 5L4NA 2ZQZA 2VDNB 3O1JC 3EE6A 5A7GA 1KPIA 1EAYA 4DQUA 4S35A 2ZRQA 2WF8A 3EZ9A 4ZRMA 1E7WA 2PXCA 4URZR 1SWVA 1B93A 4KQEA 3F98A 1GG9A 2JHGA 4H6WA 4DCGA 2RE8A 1GCAA 1OB2A 3LE8A 1TLFA 1VCMA 1WMFA 1SOUA 4GNKA 1SBQA 4WDQA 1DG1G 1CRLA 1JVBA 3EAFA 2BSXA 3LGXA 4PSAA 4QGFA 3SF8B 2ZBVA 5CA1B 1GFSA 1JL3A 2O8FB 1SOAA 1AKTA 1E5VA 4UHCA 5GVRA