4MCIA

Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with dmso, nysgrc target 029520.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
247
structure length
243
Chain Sequence
LYFQSMSKQPHICVDENQVSPYVIVCGEPDRVNRIVELMDNVELLAENREYRVFNGVYKGTTITICSTGIGAPSMIIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVRDEGGSKAYISSAYPAYASFALLKEISHFLENQSVKYYFGVVRSHDSFYTDEEDQLCQYWNKKGILGADMETSALFTVGRLRGLQVASILNNVVLYQEGVNQYVNDNKAMMNGERLAAITALETLCKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with DMSO, NYSGRC Target 029520.
rcsb
source organism Vibrio fischeri
total genus 86
structure length 243
sequence length 247
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mciA00
1PR6A 4NY1A 1TCVA 5CCEA 5CXQA 3OOEA 5F7OA 2Q7OE 3NM6B 1VMKA 1PK7A 1PF7E 1JDTA 1Z34A 4KN5A 1JP7A 1RFGE 4QASA 5B7PA 2RJ3A 3DJFA 5IU6A 3OCCA 1JDSA 1JPVA 5F78A 2A8YA 5EPUA 3O4VA 4K6OA 1JE1A 2A0WA 3U40A 3FB1A 1A9RA 1QE5A 3KVRA 1JDZA 4G41A 1V41E 3DP9A 5K1ZA 2HN9A 5CCDA 4F2PA 3P0FA 2A0YA 4L5CA 4LNHA 3LA8A 4YMLA 1M73E 1XE3A 4D8VA 2I8AA 1VFNA 5C80A 5CXSA 3E0QA 3IEXA 4BMZA 3KVYA 1A9SA 4MCHA 3O6VA 1PBNA 4QARA 1PK9A 1ECPA 4IP0A 3OZEA 3F8WA 1V45E 5CYGA 1OV6A 1V2HE 4QAQA 1T8SA 3OZDA 4NSNA 4M3NA 3FUCA 3FNQA 4L6IA 2QTGA 1A69A 4WKBA 1A9TA 1K3FA 2QPLA 3LGSA 4TS3A 1RYZA 3T94A 3DPSA 1C3XA 1VHJA 3BSFA 1ODJA 1Z5OA 1LVUA 3EMVA 4LZWA 1WTAA 3OPVA 5F7JA 3SCZA 2XRFA 4TS9A 4MCIA 1RR6A 4TXHA 1PKEA 4JWTA 4LNAA 3E9ZA 4G8JA 2AI3A 3P0EA 4BN0A 1T0UA 1Y1RA 2A0XA 4F2WA 1VHWA 4D98A 2B94A 4BMXA 1PR5A 1ODKA 4DA6A 4YNBA 4PNPA 1T8RA 5F73A 4MARA 2QSUA 5F77A 1N3IA 4QEZA 1K9SA 1SJ9A 1RT9A 4OGKA 3EEIA 4TYMA 3PHBE 1I80A 2OC9A 2AI1A 3DF9A 3NBQA 4M1EA 5IFKA 1YR3A 2HRDA 1K27A 3NM5A 1Z37A 1CG6A 3OZBA 4D8YA 2I4TA 1PWYE 1OUMA 4X24A 1OTYA 4NS1A 2ISCA 1Z35A 4BMYA 4OJTA 1ZL2A 1T8WA 1Q1GA 4QFBA 4U2KA 3OF3A 5FAKA 1G2OA 1Z39A 1RXYA 4P54A 4PR3A 1TD1A 1ODLA 4EB8A 1RCTE 1Y6QA 3C74A 1SQ6A 2OC4A 2HWUA 1B8OA 3FOWA 2AI2A 4TXJA 1V3QE 3EUFA 4UC0A 2OECA 1LX7A 1ULBA 3UAZA 4TXLA 1A9OA 1CB0A 4I2VA 1Y1QA 1JDUA 4WKCA 4TXMA 3EUEA 1ODIA 5CYFA 1PW7A 4RJ2A 4L5AA 1Y1TA 1TGYA 5I3CA 4G89A 1YQUA 1RSZA 3OZCA 4YO8A 4R2WA 3PNSA 5B7QA 1ZOSA 3K8QA 3NM4A 4DAOA 4DANA 5B7NA 2GUWA 4F1WA 1Y1SA 2BSXA 5JPCA 1TGVA 5F7XA 3FAZA 2P4SA 1PR4A 4LKRA 4WKPA 3UAXA 1V4NA 4D9HA 2H8GA 3MB8A 3E9RA 1LV8A 2QDKA 1OVGA 3GGSA 1U1CA 1FXUA 1V48A 4FFSA 4WKOA 4ECEA 4DA0A 3PNPA 1PR0A 1PR1A 4M7WA 4DA8A 3FWPA 3QPBA 4GLJA 4D8XA 3K8OE 3BGSA 2AC7A 1U1GA 3KU4A 1JE0A 4GKAA 1Z5NA 1RXUA 1OU4A 2PGAA 1U1EA 5DK6A 2QTTA 1Z33A 1B8NA 1A9QA 4JP5A 1TCUA 1Z38A 4DAEA 1U1FA 5ETJA 1OTXA 4JOSA 3UAYA 1A9PA 1NC3A 4TXNA 3KVVA 4OGLA 4H1TA 3PHCA 3UAVA 1Z36A 1NC1A 4R31A 1Y6RA 4DABA 3D1VA 4WKNA 5F7ZA 3BJEA 4R2XA 4QATA 1PR2A 4L0MA 5B7GA 4DARA 4GLFA 5F76A 3DDOA 4LDNA 4OEHA 1YQQA 3GB9A 3INYA 4L5YA 1T8YA 3KHSA 5KB3A 1SD2A 2IQ5A 1JDVA 4TTIA 4YJKA 4F3CA 1U1DA 3ONVA 5EUBA 4TTJA 4GMHA 4EARA 1RXSA 3ODGA 3ENZA 3BL6A 1SD1A 1YRYE 1RXCA 4OY3A 3OOHA 5EFOA 1Z5PA 2OXFA 3KUKA 4OF4A 3MMSA 4TTAA 3IOMA 1ULAA 2ON6A 4F3KA 3TL6A 1JYSA 3UT6A 1NW4A 1YBFA 3UAWA 4DA7A 3LBAA 2HSWA 4E1VA
chains in the Genus database with same CATH superfamily
2C1ZA 3KHKA 5FBZA 1TCAA 2V03A 2XOKD 3L0PA 1UOQA 5FR1A 3ET4A 3I42A 5KKCA 2OCBA 3WGTA 3AO0B 1SBIA 3O74A 2HJVA 4IHAA 5AI8A 3RAGA 3IKTA 3H19A 2B2CA 1G8YA 2P5SA 4CM4B 4LE1A 3ZS8A 3IAS1 3KQKA 3FKSD 4N5MA 1OJ7A 3H4MA 4UZSA 4P3KA 3Q0TA 3H9EO 3U4IA 1AUVA 1AS3A 4DV4B 5AWFC 3VFDA 5EHGA 5E2IA 2RD2A 3GGGA 1EFHA 4H4DA 1AXEA 4G5SA 4JR2A 3TQIA 5KDDA 1KZ7B 1I7QB 1EP3B 3SP1A 3R41A 1G4AE 2W2OA 5GONA 1ZK4A 1LSJA 1JI0A 2OFOA 3LZ6A 1SCUB 1WXDA 1FU7A 1NLFA 3OQOA 4EEKA 3I0ZA 3KOXA 4F06A 4I5DA 2VO1A 2R4TA 3NI2A 4NZZA 2O8NA 3W8RA 2PL1A 2UUCB 1JFSA 1KETA 2PYDA 2R6GA 4HLUA 2XXAB 3DVLA 1U4OA 2VXBA 3C5HA 1R0XA 3GZNB 3TKYA 6AT1A 2GPNA 2GILA 5E8JA 3VJRA 4DWOA 5BR1A 3EC7A 3S0JA 2JBAB 4B6SA 1SUSA 3OJCA 1GAWA 4FX5A 4PLWA 4WLFA 3CUYA 1LZKA 4M86A 3SYKA 1WUJS 4DSUA 1TL7C 1DG1G 2EKZA 4IIHA 1I6WA 4CKWA 1TW2A 5GZ3A 2O8DA 3ZHQA 1TQ8A 4OSOA 4F9EA 3M4ZA 2EEZA 3OFNA 4FCWA 4MQUA 4JLUA 5NULA 1MO3A 3FKJA 2Y3IA 3HB9A 5KCMA 5FFMA 3WNVA 2R60A 1GPAA 2ES4A 2OBYA 3N39C 4Q9AA 4KUGA 2NPOA 2Y77A 1T26A 5SV2A 2WTXA 1TM4E 5HM6A 2QTFA 3Q1LA 4PANA 5FWYB 4B74A 3S99A 2PO5A 1ZVKA 5LA6B 3I39X 4ESVA 2XRMA 5AVWA 1VLJA 5C1BA 3NKFA 2IYOA 1VLQA 1E1RA 1I32A 5LZ2A 3DGFC 5JMWA 2YX1A 4EYKA 4RJJA 5JDIC 2VK1A 2F43A 2WJPA 1CZUA 3DOOA 1YRBA 4KLNA 4MYRA 2H0AA 2CBXA 4FKBA 2QXYA 3OJLA 2LCQA 4DRZA 2D0PB 5KOJB 1RHUA 5IK2D 1E32A 1PBNA 1U2ZA 5ILOA 4D42A 4DLAA 1O0BA 1E9FA 1XJQA 2OWEA 3KXPA 4RS4A 3ZV3A 3SC4A 1RYFA 1CB7A 1WSDA 2V8BA 3LX6A 3PXEA 4CR7A 3H6KA 4KITB 3NZEA 4NJEA 3O4GA 2JEZA 4UTRA 4Y9RA 1ECJA 1XTIA 1GUAA 4G0QA 4OQXA 1SXPA 5IYZA 1TUEA 3HBJA 4B6OA 1Z2OX 2VYCA 4BGUA 2C4MA 1JU9A 4XXHA 1KK1A 3LPDA 1QK4A 1SIOA 5EIWA 2G08A 2CLCX 4OGGA 1JG7A 3AOEC 5FI0B 2QU8A 4C07A 2CHFA 4EB0A 2FWMX 2POCA 2JL1A 1AGRA 1BS1A 1R6TA 3I2GA 3TLKA 5I7SA 3GW8A 1G1AA 1Z5OA 2JKYA 4AUMA 1NUUA 5EJAA 5GJBA 2JCSA 2R6HA 4KXFB 2WUVA 4NOKA 2DUWA 4FYKA 3QPVA 2DH5A 3Q1KA 4JQZA 4LZNA 3MCZA 3OOYA 1RMTA 3EPRA 1Y48E 2XDQA 5IAGA 3N07A 4HQKA 4JJGA 1Q1EA 3HRHA 4IHJF 4JBNA 4MKHA 4BYGA 2WG1A 1EK0A 1NT4A 3FHCB 2YZMA 4CI0B 3L8DA 5AVJA 5LBUA 3ICQB 2RGUA 1JSCA 4FPXA 3NRJA 3S29A 3VNAA 1HDIA 2OHJA 5L3QB 1JHZA 1GL3A 3AB3A 3FDXA 3Q7PA 1YNOA 1CRZA 4FINA 1ZP6A 3KJNA 3G59A 3NGXA 4BLTA 4JI0B 5D7BA 4IUDS 2D7CA 4LRSB 2NU9B 5KBYA 3QYAA 4MAAA 1QYWA 2NSJA 4XAQA 3TQQA 2A0XA 2CLOB 2XNKA 1O97C 4P7GA 1SAYA 3N87A 4XYLA 2HK6A 3CX7A 1W1IA 4UUOA 4XQCA 4UTNA 4XFJA 1QK5A 2YCLA 3RQIA 2REXB 1DAEA 4Z4FA 1X7GA 2EBFX 1MZPA 4QHSA 2UUBB 2WSYB 3CKYA 4GFDA 4KMOA 1PR5A 3KOWA 2PR2A 1LPAB 4NIMA 3L5OA 4A73A 4M7PA 3KLNA 4BVLA 5KVCA 1Z4KA 4FYYA 4MITA 4V2UA 1UJCA 5EXPA 4MI9A 4ZVVA 1UPCA 4BMVA 4EB6B 4HGNA 4KR7A 2JGDA 3IVAA 1IAQA 3OQHA 4MWGA 4DBLE 1KKUA 3I92A 2B5VA 5K0EA 4BMSA 3EULA 4C7MA 1EXVA 1JEOA 1TQ4A 2REQB 3FLAA 2GA8A 1P75A 1N3IA 1Q7RA 1DQPA 1V11A 2PJDA 2H1VA 3KTOA 5B3KA 2CJFA 1AH2A 3DEIA 5ALEA 5BV2P 1RLMA 1GPNA 2O2YA 2Y1GA 2YFYA 3C2QA 2PX3A 1MB9A 3OUTA 3HTXA 2Q45A 3FVWA 1ZRNA 3PHBE 2VSNA 1LBTA 3P4UA 5JISA 4GKJB 1EAMA 5AM2A 1LF0A 4MAFA 4RKEA 4V0RA 4P7JA 3H3XA 5FNVA 3T4XA 4QOHA 1ZM9A 3U61B 1COWD 1I51A 1RTTA 3SQXA 1C8BA 4BLWA 4M98A 1CEQA 2ZRCA 3EIFA 5LP6A 4Q47A 1HL3A 1BS9A 2WVGA 5D8DA 2RGRA 3PC2A 4OFBA 2XSZD 3RFFA 3F6SA 1UJ2A 2BUAA 4UU7A 2GM4A 1W0KA 2HBZA 3DYIA 4P4GA 5FLXA 3GLKA 5CT4A 3ESQA 2REBA 2YVAA 4E5YA 1YFJA 2EP8A 4YIHA 2HHJA 4G0MA 3B9QA 2Y68A 3DXFA 3C45A 3ILSA 5FBQB 3VUFA 1AB5A 4D8YA 1XU9A 4X6UA 3G3EA 4LOHA 1R4MA 4KK4A 5JAPA 5KTRA 3WGZA 3K9BA 2AA3A 1AUQA 2C2ZA 3OEHA 3QVTA 5CR9A 2R1TA 3HU2A 3PJDA 4LA4A 3EXHC 3H17A 1IY2A 4L4ZA 3IPYA 4M8KA 5HTOA 4AKEA 3CNNA 4AN0A 1ZM2A 1C0IA 3FR8A 3K9LA 5H80A 4ED9A 3ANLA 2XVXA 5LQCA 5FAKA 2P77A 1E7MA 4G0XA 4B3IA 1M8GA 2MYUA 5HWSA 3ITNA 3MS2A 3V4VB 4K5QA 3CJQA 4PR3A 1MVNA 2YMLA 2W6QA 2ZATA 3AFMA 4IDEA 3PUYA 3LTNC 2VWPA 4Q3CA 5EE3A 3O1HB 5FFFA 3GLGE 1KQPA 3GU3A 4JHXA 3ZCUA 3LO5A 4C04A 1BA3A 1NM5C 1WCV1 3AQ4A 3W3AA 4DKXA 4EY7A 4XIYA 1NJFA 5DM2A 4G9GA 1XLTA 5D3MB 4MJLA 2RGEA 1QLHA 1L1EA 2ANCA 4RVHA 4QWWA 5D51S 4IIEA 5E2AA 2L42A 2OORC 3A1UA 2P5TB 4E07A 5C52B 4UU1A 4GWGA 4C4OA 1KXJA 2XZDA 2JFGA 2D1QA 4FFBB 4QREA 2EP5A 5LXTA 4CEIA 3GFSA 3O95A 3C97A 1LY1A 1RHQA 3N70A 4OUDA 1ZIDA 1ICIA 1CB0A 4U8HA 1A27A 5JNLA 5FA6A 1O5TA 2H85A 3WMFA 2EWMA 1Q44A 2AUNA 5ALDA 4TUYF 2R86A 3RJMA 3EVZA 2VPYA 1OPRA 2GEKA 2PVPA 3C24A 4N76A 5EIOA 1NUQA 5B53A 2P3LA 3DAHA 1PJBA 2UVPA 3HO1A 4C4RA 4FM9A 1HEYA 3KEMA 3R0QA 4Y2VA 3RRBA 3K7EA 4BWVA 1HZZC 3KJHA 1XJ0A 1JKIA 4XARA 4LY6A 2ACKA 1SC3A 4WLEA 2C7BA 2JAWA 3U4CA 3WSWA 3A1DA 5BUCA 3U7JA 1YQUA 1KS2A 2YIVX 2D1RA 3K2QA 4UHFA 1IXYA 1I3CA 1E1NA 5DRYA 5HHTA 5B3JA 1QGYA 3NEAA 2DFTA 3OZGA 5BV7A 2HV8A 2ZI7A 1OWMA 2TS1A 2HNKA 2X3YA 1AF4A 4MQFB 4V0OA 1RU3A 2AVDA 3I52A 4ENQA 4XRGA 5BVHA 3RRZA 1NFFA 2UXBB 4DAOA 3FRIA 2R66A 4LJ4A 2ID9A 2QUHA 1ZKMA 4Q16A 1YIDA 1NW8A 2IYXA 2J48A 1L5QA 1OPXA 2X9VA 4MUAA 5J43A 4URHA 4YFYA 4ZQIA 2J3HA 4HH0A 4OL0A 4R9UC 4WZ6A 3QSYA 4IIYA 1E61A 1UC5B 2JFWA 4G25A 4PYRA 1SVMA 3L7CA 4LC0A 5A4DA 3TQFA 3WLQA 5JPCA 1MDFA 5FO0A 1F0KA 3JQCA 1EH5A 1U2GA 1P4JA 1WY5A 1F0YA 2R6DA 1Z8HA 1OMOA 1C0LA 1KQFA 2NNLD 3KKQA 5E7QA 1QOQB 1ZD1A 2QQFA 4YVFA 1LQTA 5FUMA 3AKZA 4GZLA 1VG9B 1AQIA 1K6MA 3QXJA 4G84A 5IXSA 1ZK1A 4BVKA 3HKCA 3WWOA 3HP4A 1EUCA 2QTZA 3BVPA 4IF6A 5JBNA 5TLSA 3RC8A 4FMDF 1IDOA 1EE1A 4JT8A 1CUIA 2QM7A 3ADKA 4K6MA 4QVGA 3UJAA 1ORIA 4K3VA 1DVRA 1CQPA 4A4DA 1A04A 3WGOA 2EEPA 2IWRA 4D9GA 3ZVMA 1XQYA 1UXJA 4K9KA 1P2SA 2A94A 2WHRA 3NG1A 4LWQA 3JARA 2EG9A 3H5NA 2W5UA 4FFSA 4IJKA 1G66A 3U16A 2FEXA 1OA1A 4B2IA 4YRAA 4KR9A 1MB2A 1T13A 2RC6A 2V65A 3OPXA 1AV6A 2E0IA 3TBFA 5BN1A 1FVOA 4B48A 1Y8QB 3I2JA 3AW9A 4QELA 2QE7A 4EPYA 5J9FA 4YPVA 4ND1A 3FWPA 1B0AA 2GQ0A 2EHDA 2ZS9A 4FIDA 5IXJA 3NAGA 4UNPA 4Y2JA 4PQGA 4NZMA 3A32A 3GGJA 3BDAA 4Q9NA 1YTUA 1Z8NA 2NV0A 3PLNA 3BXOA 4UQPA 1HNNA 4H18A 2WJWA 3KU4A 4MR7B 1QPBA 3FNIA 3PQ7A 5LU9A 5AVXA 4CDNA 4E2XA 5IAEA 4EYOA 2PRKA 3PTZA 3TQTA 2C31A 3L1UA 1KWKA 1GA4A 1U9JA 4S0XA 4BTLA 1AKUA 1R0ZA 4ZEXA 2YV4A 1U0TA 2CHUA 1Z0IA 2QNRA 1SA0A 4OQZA 4F45A 4MRVA 2X8JB 2R5WA 3H5VA 3O0TA 1ZDMA 1B8NA 1YCGA 1I1OA 2HLDD 1BEUB 5G3ZA 4NP6A 5GZ6A 4N01A 5L40A 3SQWA 1VL6A 4HEHA 3ST7A 4OXIA 1SUFA 4KX5A 1OB5A 3B1XA 1DO2A 3MFYA 1RWXA 1SOMA 1E8NA 3K30A 4KRYA 3RVLA 2O07A 1IEVA 4Z9AA 5E4FA 1MJFA 4LXQA 1ONNA 4FSHA 1L7RA 3T4PA 3QEBZ 3B7GA 1U2DC 2V6MA 1QJ4A 621PA 1M0SA 5JLJA 1TM5E 4Z1OA 4INJA 2IHYA 2NU7B 2QPOA 5FEMA 4JA0A 5D5QA 5LZ5A 3UUWA 4MWBA 3A1EA 4WKNA 3KG2A 3ILVA 4WNYA 2ID7A 5F7ZA 4QLBA 2X58A 2FFRA 1R10A 1UBOS 3B52X 3K6KA 4BXOB 2O0KA 1PSZA 1NXPA 2QWXA 2FPSA 4E94A 2YRWA 3MCUA 4CIYA 3EF3A 5KNCD 3UT5B 2YVUA 1RBQA 3DOIA 3KOYA 1EVZA 2PLAA 2Z5GA 2EKPA 5I47A 3M9WA 2IOFA 5HMMA 4F46A 4EIWA 4JXZA 2DC1A 1YQQA 2XUJA 2E18A 4LZLA 5GMOA 1JHXA 2BM1A 2H5LA 3GB9A 3NWJA 4QDTA 3CF0A 4RZIA 4WL0A 3UC9A 3ENKA 3SC2A 4BKQA 5IZ4A 1OX6A 2MJLA 3KLBA 1I6KA 1KEEB 5JJLA 1SD2A 3ZS9A 2WFAA 5CB4A 1W6UA 2WOJA 4HDSB 3DZKA 2RBGA 3EQ6A 4I14A 1T6XA 1V9LA 2IEYA 2OBXA 2PUDA 1RAHA 3W4IA 1KMHB 1G63A 3MUNA 2QA5A 4RA6B 4TTJA 1A2QA 4UATA 2C4WA 4GMHA 4J0KA 4Y0AA 4JCCA 4KSCA 4UKDA 1JIJA 4E5MA 3WDLA 1W7AA 2CEKA 3NTVA 4Y6PA 1WV0A 3ZGVA 1US8A 3ZLVA 3U1BA 1U3DA 1GJRA 2Y1XA 2RE8A 3CX4A 5DISB 5LIPA 1HLFA 2O1EA 4KE6A 2UYYA 4OATA 4AG3A 1B0UA 5KJCA 5MN4A 4Y6GB 4BUJA 1I1HA 3ANXA 2CEAA 1KIAA 3P9QA 4WUVA 2FSGA 2X5OA 1NE2A 4G0VA 5TQ2A 4D0RA 1TM7E 2FMIA 4LWZA 4WOPA 4ZT6A 5BOVA 1CR6A 2B78A 2ZI5A 1YR1A 3B89A 3F3MA 4FOTA 4K3UA 5HYVA 3IAM6 4NCHA 1OIXA 2R7LA 1S4QA 1YBFA 3KM0A 4KQIA 4BFLA 1IJEA 1P3DA 2B7CA 2MYNA 3QLUA 1HNXB 2HQSA 1VMIA 3G0DA 5COQA 3VU3A 2JJ8A 2DWPA 1UADA 3SIPA 5ED0A 1DFIA 3LVQE 5DBOA 1FQJA 4I6JA 3TNDA 1QMGA 4DNXA 1EJ2A 1RWNA 4Z2YA 1EI9A 4GOOD 4A8TA 3ZWQA 5A9SA 3FNHA 2VDQB 1T1RA 3NWBA 1KYQA 1TYDE 3D1JA 1U28C 2V9PA 2OV4A 2X23A 3IIIA 3WK7A 3NIDB 3R09A 1UH5A 3EXFA 1O1YA 2HK7A 2QX7A 2SKDA 2V6GA 1QH9A 4LY3A 5AHOA 4KO2S 4I9GA 2X4GA 4CUJA 4PPGA 5L45A 3P2JA 5DGXA 4ZAFA 2NO7A 3W79A 3NJRA 3TKAA 1G1MA 4GPIB 4GKKB 3BS4A 4REQA 1II8B 3WZ2A 1VBFA 3VJLA 3TI7A 2LZ0A 3D3EA 3KO8A 2I2BA 3F46A 4ZJUA 2B36A 4GU5A 4NH4A 4OAOA 4E51A 2WWHA 4CL3A 3NNNA 1N2IA 4OLJA 3RNOA 1AA6A 2CUNA 2XNDD 1YZYA 2JC3A 2NPIA 3GJ5A 4HDAA 1MW9X 3DAPA 4HYTA 3QPUA 5KQMA 4HN2A 4FOPA 4DXDA 6ADHA 5EPUA 1W36C 5AKJA 5DNUA 3HBAA 1R3UA 2ZBFA 5H5JA 5JATA 1VOTA 1P17A 4KQ9A 1H93A 2VQ3A 2V3WA 4MYDA 4Y30A 3U40A 5EQDA 3LCVB 4RD6A 3VOAA 4C3VA 4ZN6A 4KX3A 3NCHA 4M55A 5IDXA 2CB9A 3F7MA 1NFQA 2G88A 4O1MA 4CMCA 2FZGA 3T9AA 2JGLA 3GI1A 3ZJYA 4MKIA 1X74A 4BX3A 4L73A 1HTTA 1L7QA 3PDIB 1O77A 4FEEA 3ZD9A 3FNEA 4IV8A 4QOGA 5DYYA 5T5QA 1MNAA 3T5BA 4DV0B 3LL4A 3H5IA 3TINA 4BN4A 3AU9A 5CCDA 1T5HX 5ALFA 1Q0SA 3P0FA 3BT7A 3FLEA 2PK3A 2XD4A 3LOUA 3HYCA 2BHNA 2COUA 4Z7OB 1MJGM 1QYCA 2PGDA 2EF1A 3VV3A 4P5DA 1PL8A 1LC0A 2QRVB 2WR8A 3BDVA 1E92A 2NT3A 4PC3A 4BKRA 4C0HA 1JT2A 1PFQA 1AUPA 1P73A 2PYZA 2X1VA 4YJGB 5BWCA 4P32A 2DHDA 3AR3A 4PSCA 1GGJA 2V4UA 2V6JA 4R3UC 2HA6A 4YDQA 4Q3OA 5GVRA 1JZQA 2JIRA 4B33A 2H2FA 2HRRA 4NZOA 1EFCA 3RUCA 2GZAA 2P9CA 1H2XA 3B1YA 5JYBA 1EWQA 2FMHA 4C4SA 2PH3A 3KLMX 1WPGA 4ZVTA 5IKXA 4RPJA 3C6YA 1UJMA 2PD6A 1QLWA 1IJBA 3AHJA 5CVCA 2RHWA 4BNYA 4F7WA 4FYVA 4OBWA 1VXOA 1JIVA 3HY6A 4LJ8A 3UK6A 1V2HE 1UZUA 2OY0A 2A14A 4HDRA 3TL3A 5KEIA 2IOYA 1T3HA 4B4WA 3GZ4A 2ZBGA 3TNJA 5CNKA 4RCVA 3PUJA 3EAGA 2QTGA 5T4FA 2ZWPA 5HCIA 1DLJA 1WW8A 3JQ8A 4F6CA 3CURA 1G17A 2QPLA 4MRAA 4QECA 3ZJTA 3DLPX 3HZOA 3OIFA 1NRXA 3RO7A 5J5VA 2VJPA 3V6MA 4B4KA 3QY9A 1BROA 3STYA 1PFYA 3A4VA 2FOXA 4LMPA 3OP4A 1TT5B 4M36A 1JRLA 4ZCLA 1BJKA 3IXMA 2JPDA 3MAGA 3V8RA 1AQJA 1FVFA 3OX3A 4LVNA 2ZYTX 2WA2A 4UTOA 4WECA 4Q24A 1L5HB 3T54A 4GQAA 1QK3A 2VN8A 4XJVA 2OCAA 5F7JA 1I4WA 3KTFA 1Z47A 2IHJA 5JJ5A 3I9KA 1T4BA 2EXXA 2R96A 2VZ0A 3TAHA 1PVOA 1P1FA 5FJJA 1J8DA 2H06A 3ONEA 4EMSA 2BEUB 4G65A 4HDMB 1XDBA 4TYWA 4DUGA 3O8BA 4KQJA 5FUWA 4J0CA 9LDBA 2R6FA 5EC8A 1CRPA 3F8SA 2JS7A 4G8JA 4CM1A 5D5PA 5AW6A 3H11A 3EGWA 3N2ZB 4HVTA 1J1IA 3WL4A 3ZDBA 4ZI7F 1V5FA 4V24A 5CT8A 2V3VA 4Z86A 2VDWB 2IYRA 4CFYA 5F1KA 4Y6OA 3VDRA 4YMVA 1MIOB 1QQAA 4UAVA 3QQ5A 3DDWA 1E89A 3RK1A 4C43A 1TJ4A 3UBTA 1EUDB 1OGYA 1YBVA 2G67A 4Y18A 2GM5A 1KU6A 2JB9A 4UUMA 2PXCA 1LB1B 3HPRA 2YH2A 4HNVA 3X1WA 1ECGA 5ECYA 1RLJA 2NP7A 2D5AA 3AR4A 2NV6A 2VRCD 1RXWA 2A9OA 1R37A 4CYMA 3HJNA 2DR3A 3DMTA 1E3QA 1PEAA 2RGBA 3HDJA 1W9HA 3ZY5A 4PFKA 2X7XA 2YINC 4G67A 4I19A 4PM4A 2DPMA 3LIPA 3SR4A 4CIWA 5FWNA 4GUAA 2IP1A 2HRBA 3BX1A 3DHEA 3FJ1A 2BKAA 1C9DB 3DUFA 1DUVG 1N2CE 3Q5DA 2FMKA 2OO5C 4G0PA 4D5EA 1SJ9A 4DR6B 2DPYA 2IDZA 3U44B 4XYEA 1AMOA 1BDIA 1DAKA 1KHHA 1NXTA 2IYNA 3K9CA 1XRRA 4G5GA 4IRXA 3E8MA 3GVHA 3LWNA 3T7DA 2WJHA 1DCKA 1SOWA 1XWFA 2O3SA 4NMWA 5H68A 2IY9A 2F90A 5J4HA 4KIGA 1KF0A 2WFZA 5K9ZA 3QFFA 2Y1OA 3NMUF 4TTTS 4O02B 4ZU1X 4F3KA 4DRXA 3KNZA 5BWNA 4YY3B 2HPZA 4NXMB 3YASA 3VKGA 2I4IA 5IAJA 2QTVB 5F33A 1P9NA 4XQGA 1NJSA 1N77A 4Q1BA 3JTEA 3KQTA 4RK1A 4IY1A 5ECWA 1RJFA 2GWHA 3SOZA 4KLRA 1TJYA 1T1IA 2XNHA 3AHIA 4MW1A 5CK4A 1IEWA 2ISSD 4TSRA 2OMEA 3AESB 4LOJA 5IKEA 5THQA 1Q7EA 1ZL2A 3FVQA 2B25A 2W43A 2EGUA 3KQVA 3M1LA 1FUIA 3MWEA 2FSPA 3QKTA 4FE7A 3DS8A 1NGSA 4AJ2A 3P5SA 4TRMA 2PLNA 3O3NB 1SOUA 3BHJA 4MUHA 4QQFA 3E3MA 2WWFA 2PMEA 3SMQA 4P38A 3DWGA 2D7JA 1BQ3A 1O4VA 4FMPA 4OQPA 3FKSA 3I05A 3BQ9A 4LZJA 1BKDR 2G1KA 3GCXA 5LOVB 1NPDA 1SNYA 3SDBA 3UHOA 5FH9A 2PWYA 4MUIA 1SCBA 4J16C 2CXXA 1Z3CA 4MVWA 3D4PA 1JJVA 1NPYA 3BSSA 1V3VA 2A5LA 2P5UA 3OCJA 4EOGA 5C8VA 4MCJA 1L5YA 3TLCA 2PZMA 4NI5A 4PEVA 4HS9A 4JXKA 3O94A 3B3QA 4IVPA 3JD1A 1U0SY 5ALRA 2P6OA 1B8OA 4JKYA 3K9WA 2AMYA 4B2LA 3BTUA 4F97A 4JB2A 4B3XA 1KI6B 1QOZA 1M6VB 2CLDX 2NO9A 3GA5A 4PZAA 4ZPJA 5IBQA 1MMFB 2C3MA 3SLRA 1EAYA 3LY7A 3ONNA 4EY5A 3MTEA 3NGLA 3B7WA 3T3MB 1SBHA 2OSVA 4YAEA 4KPFC 1GUYA 3T3IA 3ZCVA 1V6SA 1PG0A 2XUIA 3B6IA 3V8MA 2B9EA 1BOOA 2MSEB 5I9SA 5AOBA 4C3UA 1E1MA 5BQFA 5ICGA 4OYHA 4DJFC 3PD0A 4LJ6A 3RGGA 4JITA 4F8YA 4KXQA 5EHIA 2ZT6A 1U5BA 1S5PA 4L4RA 3V2UA 2J30A 3F1LA 1R5BA 1CY0A 2JZOA 2PQMA 1J0AA 4R0VA 4TL9A 1H94A 3F6PA 2FG7C 1DTWB 5KQLA 4K9QA 3W6OA 3QEAZ 2XQFA 3DDUA 3OAAD 1MP0A 1TA4A 1THZA 2H52A 3QKSA 5J5CA 3QPAA 2C98A 4JP8A 1MG5A 4GBED 1PFWA 5LMZA 1TGYA 2ODNA 4K8RB 1XTPA 2G83A 4M1TA 2XVMA 5FF9A 1M2VB 2GAJA 4MQMA 2P0EA 3V6LA 4EJ2A 1XZGA 3IUYA 2D54A 5KHAA 2RHTA 3ZKWA 4OV6B 2OHXA 2C3PA 3IHTA 3MOSA 1YJCA 1H2ZA 1RTKA 4ROTA 4BJ5A 8ABPA 2XZLA 3T1OA 4XASA 2VQ6A 2AW5A 3EGIA 1SRRA 1N8KA 3NETA 5JUWA 1EJ6A 3ACBA 3KWJA 3BICA 2GR9A 1OZGA 4KAJA 1NWCA 3NV9A 1OC2A 3QEKA 4ZQGA 2PVCA 1QHEA 3EDYA 4KVGA 2XB6A 2ZJ2A 3ZGYA 1G6HA 1BXGA 1VIAA 3L8GA 4MW7A 2ZXFA 3MD0A 1H3NA 4IDBA 1WXWA 4RSGA 4ETNA 5EJ4A 3VZQA 5M2QA 1RJWA 3GMSA 3IX7A 4L9RA 1WLSA 5CGZA 3CNOA 4IX1A 1Q17A 3KSUA 5KVVA 2YWFA 3I2FA 1SC6A 1PTJA 4ZIRA 4H6VA 1P72A 3DTVB 1UKEA 3UHPA 3QNWA 3B3FA 2PLRA 4AWBA 4XFKA 3T4EA 5DDIP 2ZDQA 3VYTB 2DG2A 2LNDA 4KMRA 4LQCA 4FVTA 4HDQB 4PPYA 1T5TA 3DKKA 5LMNB 3VXKA 3I0MA 3AF5A 3F4LA 3WJ2A 3E9YA 1DBSA 4NYIR 4FX2A 2GERA 1X9HA 1QYRA 4NMLA 4X6LA 3S2UA 2Z3WA 1Q6YA 2QY6A 1G6OA 3BXGA 4R41A 1YBMA 1R4NB 1OVGA 3AIKA 5FV7A 2CCJA 3T6KA 1Z8DA 4GGOA 4BNDA 1A8HA 1N6NA 1NKVA 1M1XB 2DULA 4NZPA 3UHJA 2J0SA 2VAWA 1BMDA 4LOLA 1W0CA 2WIFA 2YN0A 1E1LA 1NRWA 3BEOA 1WOMA 3SZMA 1JXOA 3B36A 1QZ3A 4U0JA 1VKNA 5JAHA 1RABA 5AHXA 2Z98A 1TQHA 1UBSB 1W5FA 2LXNA 3R3XA 3SYTA 1F20A 4DA8A 1QS0A 1FFWA 1CFJA 1E7YA 4NC9A 3PB3A 3PDUA 4QBKA 1K4KA 4D5GA 2I54A 1K1EA 1Z26A 4KE8A 3E1GA 3OEYA 2QHXA 2Q21A 2MT9A 3VR6A 5DPMA 1X1DA 5JQGA 4YAFA 3PIRA 2X4DA 3IAXA 3BL5A 1IBKB 4M7OA 1A71A 1ODCA 4RE5A 2JD2A 2PWPA 3O5AA 5EVCA 3WGJA 1NBMD 2BI8A 5TPZA 3HR4A 3NT2A 4KPEC 5FOUA 3SE7A 5E7IA 3CF4A 1AQUA 4TV9B 2YICA 2RDMA 5EE5B 4CLOB 3CRRA 5KJ6A 1T6ZA 3EWNA 2H7CA 1F8FA 2LBPA 2H2DA 3HI6A 1QH8A 1DFGA 1R9JA 3DE0X 4LXYA 2JEOA 4D4JA 1DI0A 1R66A 1YV9A 4OI0A 1OX5A 1J7KA 2NUPB 3O31A 1ZS9A 3DO8A 3GARA 2O23A 1GL9B 2QN7A 1MKYA 5AT1A 4IJVA 2ECPA 4M53A 2Q62A 3ESAA 4I9NA 1D6SA 3BHNA 3TRKA 2XWBF 4CMIA 4P7KA 3NYRA 4Y2RA 5FPKA 2FWAA 3K3PA 2FY8A 2VI5A 4FCVA 4E15A 4Y7CA 3I9OA 1RLTA 4IQ8A 3DP7A 3QE3A 4JOSA 5DNDA 1HLGA 3RHSA 4KWTA 2YW2A 1NVVQ 4GYJA 1W30A 2OA0A 4PU0A 5CLIA 4DJAA 4N3BA 1SVSA 4KCGA 1FSSA 3T34A 3HG7A 4OA8A 4OBXA 1L7MA 1ORVA 2H9AA 1V6AA 3RUAA 4YRDA 4EG6A 1N34B 2A9JA 4IH9A 4CM4A 4YRRA 1X13A 4EFKA 1SKYE 3D6NB 3RROA 5LQMA 1EXDA 3FLMA 4B40A 4POOA 2PMWB 1NTOA 2V5UA 3OTOB 1R5NA 4IWXA 4MP6A 2FEMA 1KFJB 2BUBA 5EN4A 3UXEA 3LF2A 4G81A 2X6QA 3QMPA 4OGFA 1AUOA 1BX0A 2FHSA 2NP6A 4JC5A 1K89A 4Q9IA 1BN6A 1KK0A 5KNDD 2QLJA 1RKVA 2H8KA 4RXUA 1ISMA 1FXWF 1SVLA 4QBHA 4GLFA 4C0JA 4EJFA 2C03A 2QJTA 1JG6A 3M3HA 1OLXB 2IZ0A 4X8OA 1Z6TA 1MAHA 1AK9A 2WF5A 521PA 4CF3A 1QRUA 2GZ2A 1Q0TA 1FNDA 1U0FA 4WLUA 4NEQA 1X1SA 1DOHA 2ET6A 5K05A 1Z7GA 3A3OA 3AL3A 3FTQA 5EZSA 2XXAA 3MC1A 3CN9A 3QV1A 5LDDC 3OM1A 3F98A 4G1EB 2DP4E 2YV5A 2BJWA 4MKXA 2JBAA 4GOJA 3THYA 1SU8A 1GYPA 2LWIA 2ODWA 1XTSA 2HYIC 3T5MA 4AZTA 4DG9A 4XR4A 3ZWDA 3FLBA 4GX2A 2WF7A 1ORHA 4GGPA 3PQ3A 2D1YA 4QBGB 5FTLA 3IUNA 1DWPA 1FDOA 5BT9A 3KKKA 3RBVA 2Q5QA 1P7CA 5HFAA 4EGQA 1PAUA 3F5FA 1P77A 2WMOB 1DC5A 2E4XA 4GT1A 3L8ZA 4JT2A 5AM0A 1Y3BE 3C3AA 3SDZA 2CN1A 5BN3B 2VJMA 1X1AA 4IILA 1EX9A 3ETGA 4ROSA 1YFLA 5FWYA 1JR3D 4TTAA 3B7PA 4RSMA 2WFLB 4FFRA 5HFJA 1QC5B 2JAQA 2EFEB 5LA6A 4C0QC 4B9AA 2JFYA 3OF5A 4YGYA 5K8CA 4O63O 2YJ5A 5E6RA 2ENUA 4MEBA 2D1SA 4KXNA 4PX3A 3PS9A 2WIJA 3W5VA 3IIJA 5KTNA 4F9GA 2KI5A 5DXFA 5BQOA 4YECA 4AZ3A 1T36B 1XEFA 1Y7IA 4WX2B 1GRCA 4V2IA 3W1WA 1B1CA 1N2BA 3V42A 2YYYA 4XM0A 3L0CA 3IVMA 4AJIA 2XDYA 2J0EA 2BFBB 1YL7A 1IFXA 1NW4A 1PHPA 4ZI5A 2HPHA 3IP8A 3KKMA 1WY7A 1I9CA 3VR4D 2W2PA 3OIGA 1KJIA 3PFGA 5TGTA 1P4GA 5CLLA 1YGPA 3QW2A 3J81A 3VA7A 4ZYYA 2IU0A 3TJRA 2N46A 2RJOA 4II3A 2FKAA 5DGHA 1IG0A 3IDQA 4MI6A 1DXQA 2CNBA 4DPMA 1TYAE 3WRXC 2ZB7A 3FYUC 4GPEA 3E81A 4ZU3A 3ECCA 3BK1A 1NXSA 1VPVA 2AN4A 4RVOA 4R54A 3ZW7A 1G6KA 3RVSA 5IKPA 4EHFA 3I6MA 3THXA 4BQRA 1NJ8A 4RTLA 1FXSA 1X38A 2YJNA 3CB2A 4YP0A 2P9EA 3CZ9A 4EHLA 4G56A 3V8VA 3LO8A 2XPCA 3IBGA 1ZJJA 2BGLA 4AKSA 1TKCA 2J9ZB 4J2HA 3F4BA 4HLNA 4DC9A 2JK1A 3TTVA 5CCBA 4AIRA 1WEKA 1QFJA 2Z2XA 5KSYA 4RGYA 2B98A 3ED5A 5DYIA 3B60A 4CIVA 2ECOA 1SKMA 4D4HA 2VHCA 1JDSA 4MUNA 1JPVA 4B5LA 4WDQA 3LLMA 4EFLA 2HF2A 2XBMA 4M38A 2YW9A 2QROA 2V5VA 3LCJA 3O4VA 2A92A 2NU9A 1GO2A 1TIPA 1SCKA 2AFRA 3MUOA 5AP9A 1KAHA 3T3PB 3LOPA 5JTTA 1UBUS 3BXXA 3DZIA 1AURA 4RF5A 1XXHE 1F14A 3NT5A 1YI8A 1O3YA 1F3LA 4FCTA 4LJLA 4LRWA 4KQEA 2G1PA 1PE0A 2D0OB 2ZRJA 2PGJA 3AUUA 2B9VA 4JD5A 3DFIA 1T8TA 5DO9A 5JS2A 3WICA 1NA5A 2V1XA 2VPTA 2YIDA 5T41A 1K4YA 1R2QA 1T0JB 1JGTA 4B3RB 2Z57A 3DOJA 3W5SA 1Z07A 3TNLA 1CSEE 2I8AA 1E63A 1GLNA 4XYGA 4IFTA 3OJFA 4QIHA 4IICA 3QXXA 3AB7A 2QMHA 3OKCA 2X2EA 2QXTA 1PV1A 4KREA 3L02A 4ZO6A 4B7UA 4QL3A 1NLMA 4XR9A 3A9VA 3LT4A 3EGDB 3V5NA 1JA0A 1M1YE 1QXSA 4RMGA 1U3FA 3WLKX 4YR7A 2HDNB 5AIAA 3U4QB 1P3Y1 3F8WA 5EUCA 3DD1A 4KXYA 5AUOB 3F2VA 3H5OA 5AIBA 4G8BA 3VPXA 2RCYA 4E21A 3WGKA 1XFDA 4Y9DA 5K0JA 4KNWA 3RUEA 4FGUA 2BEJA 4ZANA 3NONA 4BNNA 2G9UA 4YMWA 1A8IA 4M3NA 2UUOA 4CCAA 1ATZA 3U48A 4GM4A 2J5KA 4BN5A 4EKYA 3T5AA 3EPLA 1AN9A 1UPBA 3ZV5A 4KVAA 3KUDA 3I09A 3C6KA 2B61A 3G9ZA 4BNZA 1BVRA 3VNUA 4FP9A 1QIGA 1E77A 1RI2A 2NV2B 3CF6R 3H65A 2BBWA 4H7FA 4ZVLA 1HTBA 4CQMD 3T5TA 1U2PA 4D96A 1B8PA 2FFBA 1EWTA 2GK6A 2QI9F 4KQXA 3NHLA 4BVAA 4QGFA 5JSQA 2BGJA 4DM7A 5AVYA 1Z06A 4CV1A 4WHMA 4J3NA 4XW2A 5KTTA 2VP0A 3IILA 3I04A 2J3IA 1K3UB 4GR4A 4WXYB 2HCRA 4OLHA 4F6LA 5AM4A 3DBOB 4F5WA 1ZXLA 3UK2A 3F5MA 1EP2B 3ICOA 1KSHA 1AC5A 3LVRE 4MVJH 4CKYA 4HSGA 4GI2A 2Z2KA 4MUMA 3KE9A 4POAA 5C4GB 3ZHSA 2OGZA 4KQHA 3EN0A 4JWTA 5A1TA 5KNCA 3U3KA 4LNAA 3ASVA 4Y0NA 2AI3A 5D3MA 1OA0A 1C29B 3I1YA 4BN0A 4CDMA 2PQ0A 1V8DA 2I87A 1JVSA 3FROA 4PLTA 4Q05A 3S4YA 3N0WA 1YK1A 4PO8A 1WMAA 1UFKA 1Y3HA 4LISA 4QXOA 1C1HA 3RU2A 3ISTA 4BKPA 4C2BA 1GDTA 2A84A 3GT0A 1V0JA 1IDN1 2HUNA 4FFBA 4PG6A 3ZV4A 2CXHA 5ESXA 3LHDA 3CVJA 1FLNA 4F1JA 2JKVA 2PEYA 1Y4SA 2V7XA 5IBPA 1GAQA 4JFAA 5BSUA 4CHGA 1QU3A 1MJ5A 4Q12A 3WDKA 2YZNA 2XWQA 1L6IA 4YNBA 5CFZA 5A4AA 2ZB8A 1IVYA 2CVFA 2GK7A 2I22A 4OQYA 4PV7A 4NESA 2P6UA 1NBIA 4TLBA 3RS7A 3EY4A 4AJ1A 2AB0A 4DLPA 4YHHB 3PZBA 1OAOA 4M8NE 4MMYB 2PKEA 1GQSA 2WWIA 3OC6A 4X20B 1LPOA 3PGJA 3AERB 1MLDA 3ZK9A 4ENVA 2RGCA 3HL0A 1MB0A 1I1NA 3EEIA 1W46A 4CW7A 3K6SB 5GJVC 1TPYA 2FK8A 1ZCBA 4BCCA 3GFTA 5BSEA 2JFXA 4F04A 1TIKA 1Y6ZA 1ZM3A 4ZO9A 1NP3A 1NMSA 4N5LA 1G0NA 4A8JA 1N0WA 2JVJA 4WLVA 4LCBA 3WWYA 1MORA 2RGYA 4EZBA 5EJ2A 3TK1A 3UK1A 2G07A 3FPJA 3OE7D 4RNDB 3EFEA 4N6NA 3BRQA 4DYHA 2WHYA 4Q1VA 4BL5A 2HXSA 3LGXA 2OQ2A 1TVKA 3DEZA 3TG8A 1GTJ1 1SXGA 1Y7LA 3R4VA 3RU9A 4F4DA 2JJYA 2JARA 1XA4A 4AL4A 3A26A 3QVGB 3CG4A 4HXGA 1IH8A 3ED1A 3WLIA 1MXHA 4TQUS 1XAGA 1XDUA 1EM8A 4LSZA 2BHSA 1SXJB 4DQVA 2UDPA 5M29A 3Q7QA 2WB4A 1NT2A 2ZSUA 3CISA 2N1MA 2ZTSA 4QXMA 4AWAA 1D2MA 1ESNA 1VSQA 2WWGA 4OQQA 4ADSG 1Z2NX 4O2AB 4Z8YA 1UKBA 5EE1A 1Z39A 1WR8A 2Z5FA 2NQ2C 4NATA 3EVNA 3ADPA 4IDOA 1L5GB 1BA2A 1E7WA 2WAAA 3D2AA 4QLAA 2Y9PB 3JQ9A 4TMWA 1MG0A 2NVUA 3A9RA 2QV0A 3AOGA 3KZMA 4EB8A 3EGXB 4M0DA 4JU9A 1BCSB 2QL6A 2ZSBA 4HD8A 3NEJA 1C4WA 3FMGA 1V26A 1A2KC 1T9ZA 3WKAA 1DIHA 1Y8QA 4D4KA 4IXMA 3E5HA 4R2KA 4QUIA 2PA3A 2XNDA 3RYCA 5U1PA 1FRQA 4G4SO 1HX7A 2WUDA 5AKIA 2JJ2D 2P79A 3L06A 4FJ0A 5HIJA 3FOZA 1HE4A 4UC0A 5IBRA 1ID8A 5KYVA 3NDJA 4WOCA 1D1SA 2QTMA 1OROA 4A1OA 3C7AA 5TIIA 3PDHA 2O7RA 3R7BA 3M5PA 1CJBA 1ULBA 4MW9A 1O6GA 3VNRA 4LBVA 5HIIA 2J45A 5JCJD 2CLSA 4MR7A 3UJDA 1T6YA 1ZQ1A 1KDTA 2QRUA 4XWKA 2YXDA 4R71A 1P1CA 2Z1DA 3D5QA 5HA5A 4NJOA 3LJKA 5JYCA 3KXDA 1RLUA 4YMHA 1EESA 1C9MA 3UJ9A 4OD0A 5AVQA 2Y4OA 4Z8XA 3ONDA 2RHCA 2LGJA 1MQSA 2X8JA 2RHHA 3FD8A 1Y1TA 3ZX4A 1H9AA 4DIDA 3F73A 1L8QA 1QQTA 1N25A 1XDDA 1VL2A 4JBLA 4L50A 1XPJA 5DHFA 2Z2JA 2OKGA 2OPHA 1P9RA 1XYYA 5AH0A 4U7JA 4N12A 2GESA 3ILYA 3K9NA 5CDSA 3OZCA 4R2WA 1J0DA 3L9WA 2Y93A 2FTKE 3BIXA 3JQ6A 1BWQA 5EYPA 2AN1A 2B5WA 3DAFA 2VHWA 4MVJE 3CXUA 3EVGA 1GADO 2GJ8A 3IAFA 1L3IA 1GA6A 3NM4A 3S1LA 2IYLD 2ETVA 2QQ0A 5CDFA 2VSYA 4COKA 2A1TS 3DE3X 3WL8A 1KJ9A 5IZCC 1GG8A 3VGJA 1ADYA 4RIHA 2A0KA 4E2WA 2NU7A 3JAKA 2FFAA 3Q12A 1Z2DA 1MW8X 1EFKA 1G64A 5TF4A 4LFBB 2DFPA 4R9RA 1R18A 4DDKA 1J90A 2BMFA 2HWYA 4PAGA 5IVDA 1WAMA 3JU3A 2R8PA 1Z83A 3KWMA 2CLLB 4RADA 4I81A 2VPQA 2F3PA 4E03A 2OFXA 2EZ9A 4CCSA 1DAFA 1E66A 4I55F 3UT5A 2GZ3A 3OSZA 2R6JA 1H66A 5J4YA 4R5HA 2P1ZA 1BHJA 3KB8A 3IELA 4GXTA 4MI3A 3WNBA 4ZEWA 3IT3A 1BU5A 2KBFA 2IS6A 4NE7A 4KV7A 3MBOA 3WP1B 3Q7RA 1JMKC 2J9FB 3WB9A 2Z56A 1NW5A 5G4KB 1EJ0A 2DRIA 1R0KA 3AHFA 3S2FA 5IS2A 1P33A 1DELA 1KEEA 1NUAA 3HKEB 2NUTB 4XLLA 4ZAXA 1I94B 3LC2O 1DT3A 1VGQA 4W5HA 3LYLA 1CDOA 4MTLA 4D0SA 4RMJA 1T9GR 3DXZA 4B6RA 3D3JA 1DB3A 1Y9EA 1WVGA 4ALNA 1I01A 1W5EA 4DV6B 2CNLA 5GP1A 4F12A 2I2AA 4ZOCA 1YL6A 4E5PA 3MT7A 3WAJA 4HSEA 4OK6A 5B1YA 4E2FA 2GBIA 4KWHA 4EX6A 4ZTBA 1WCYA 4GC9A 5A3JA 3TM5A 3VZBA 2YIMA 2IGTA 4BEJA 2DSTA 5LXTF 1HOTA 1QGOA 2RHRA 3CA8A 4KW7A 1KYIA 2FJ0A 3VYRB 3P2YA 3H2ZA 4MGZR 3CN7A 3QWBA 1D1QA 1Z22A 4G0UA 3KLPX 2H63A 3HHEA 4YX9A 3PHLA 4LZAA 3PWKA 1CE8B 1VMEA 3KPYA 2GM9A 1T2CA 2Q7XA 5FPQA 3I62A 4DF3A 3IKLA 2RGNC 3RVQA 2C96A 2WM2A 3O7MA 4EUNA 1E9SA 1VKHA 4PRYA 3TRFA 3FZQA 3V2HA 1U6KA 3QKRB 3DR3A 2CJWA 4PSVA 1QPZA 4I5GA 3P32A 1AS0A 4K0RA 4AKTA 4JVOA 4J2OA 4XVHA 2DHCA 1A4IA 1TB4A 2QUBA 2FN7A 3IBFA 4O2LA 3ILHA 1ILEA 2N3ZA 1KDRA 3JQFC 3FDZA 3RVNA 2W98A 3NC0C 4OHRA 3JWGA 2OHGA 5ETJA 1OTXA 1PFUA 2F4NA 1SPBS 4J49A 1FPQA 3PGMA 5IC5A 3W90A 1GUFA 3C1TA 4TXNA 4D44A 3QJ5A 4DIOA 3ZWPA 4H1TA 3I6ZA 1CQZA 1NBWB 1QWOA 3CH5A 2C97A 3DDSA 3VI4B 4C01A 1FQKA 4Q3NA 3WB1A 1YMVA 1E59A 1VA4A 2HAEA 1QTNA 2W2KB 1UAGA 2WJJA 1E4EB 3BE5A 4YJ3B 5CX1B 3Q88A 1CR4A 1U9YA 2Z95A 3TRDA 2IZOA 2CMDA 2DR0A 4EZEA 4YRMA 1CS0B 4UBMA 3BHMA 2J0QA 1II8A 2JI6A 1Z4LA 1OHHD 2NVOA 1XDSA 4C89A 1VE9A 3NBFA 5F76A 3IMEA 3SJ7A 5CFOA 3DDOA 3V4PB 2VUSA 4QUGA 2EARA 2GZMA 1YU9A 4JYCA 1VFPA 5JXJA 2QJFA 2JFBA 2JGEA 3INYA 5CA0A 2I6GA 3C87A 3QLVC 2UYGA 4FEAA 2EKLA 1G5IA 1MT0A 4ZVQA 1NZDA 1UIMA 2Q49A 3X1XA 1LS6A 4HFNA 4E22A 3N7UA 4EY3A 1NI5A 2GN6A 2VJNA 2O5EA 1TC1A 1OBFO 2K2WA 2WUGA 3EA5A 3N05A 3OOWA 2B21A 4GZ5A 5TT0A 4I4TF 4J3JA 3U39A 4OLAA 2AK3A 1IK6A 3B1ZA 3L8HA 2OV1A 4BLRA 1I4TD 1XZFA 4AP6A 2VPZA 3PDIA 4JROA 4KFSA 3WHKA 2VEOA 2BGRA 4YLEA 4ZCRA 721PA 1OY1A 5DCUA 1B16A 3CEMA 1Z0AA 4JIGA 1C3LA 4L78A 4HP8A 4JDUA 3DV0B 2Q41A 3KUKA 1DC4A 1ZW1A 3QBDA 1UBGA 3QVLA 5K0SA 2HMAA 5K3DA 1W85B 2WBLC 4IHJB 1EFTA 1OI4A 3CYFA 1KVTA 4C0SA 2OV8A 5DM0A 2ON6A 5JNSA 4YJGA 1Y9AA 5CTAA 5C1PA 3AZPA 2Z4SA 4YRTA 3DZDA 4ITRC 4DMRA 3U26A 3WA6A 1I2BA 1J09A 1DC8A 4Q4CA 2XWPA 3GEGA 3KK0A 1GNRA 3PR1A 5LB4A 2QSYA 1KQOA 4ML3A 1KYWA 1V37A 1RE1A 4H1HA 3NCTA 3W4KA 5EZYA 1U3UA 3AI2A 4HWRA 5DEOA 3UAWA 3PKJA 2P4HX 3WDSA 1O0CA 4MI1A 2XE4A 3RT9A 3RU7A 2WK1A 4QYSA 3JYHA 4NBUA 4D80A 1B42A 5JAOA 3HM9A 4GL2A 2IZ5A 3GFPA 1XRNA 1MR3F 4QOFA 2R25B 3I6BA 3OOEA 3R3YA 5IWAB 4YWHA 2H2WA 1VE6A 3CFYA 5C4MA 4RV9A 4LHYA 1FP6A 3AM5A 1KPHA 1F5SA 1ZPDA 2O0HA 4P81A 1RIIA 2YVLA 4H6XA 2Q7OE 5FUBA 3B6ZA 4IKEA 3NB0A 1I7NA 1ABBA 5FBWB 5BNTA 2P9BA 1ZMBA 3B1JA 4AUNA 4MGEA 1RAIA 2WAXA 1EQ2A 1XMPA 1TT5A 1I0IA 3MWJA 5T8KC 1IXKA 4L51A 4KVFA 4RSHA 2PMBA 1JLLA 2X2FA 5CD1A 3DTNA 1J22A 1SBCA 2CHVA 1FTGA 1T0BA 4WZBE 1M6EX 3V3KA 3WA7A 5MHTA 1L5HA 1S2MA 1VSUA 3GR6A 2GI4A 1ZOIA 4X8LA 3WLTA 1RD4A 4AURA 4DW8A 2Y66A 5J4LA 3OJOA 2P9FA 3X44A 2WYHA 3T4UA 2YFKA 1AE1A 4B46A 1GPMA 4C9BA 4G5XA 2Q2WA 3OA2A 1MEEA 4UXHA 1FJXA 3M4NA 4HDMA 4UD6A 5CFRA 2HSEA 3C85A 5KWIA 3X2SA 3PD1A 2C4VA 3QRWA 1Z2EA 4PZLA 2AJTA 1NFRA 2IHVA 3OT1A 3CG0A 5A3QA 1AMUA 3HUUA 3BUSA 3DZHA 4HEA6 4K6OA 4RVUA 4J03A 4M54A 3K1TA 4MS1B 1ZJ5A 2IH2A 1SCDA 2G9ZA 3ICCA 4NU0A 1E1QD 2WD7A 2WRZA 2YWBA 4P7FA 5CB4F 2VDWA 1NJGA 1R15A 2QNBA 4QC2A 1G18A 1JKFA 3OUUA 1J06A 3JWPA 2I6QA 2J0UB 3CZCA 4GEGA 3VR5A 2DT8A 1EUDA 2D2XA 2FRXA 4PX9A 7REQB 3EGVA 5MF6A 4GE3A 1KGDA 4GSYA 1VYHA 4Z4CA 1KAMA 4RVSA 3O93A 1IB6A 1TYBE 2YRFA 3FPBA 2PGIA 1ZGJA 4JLJA 2QT1A 2BMEA 3WGNA 2R8OA 4W6QA 1DIBA 3QG1A 4FI3C 4QVKA 1QCYA 4CM5A 3BJMA 2BGKA 2GJ9A 3NVMB 3A7EA 4QFDA 2BEVB 1ZN9A 1M7BA 2BEWB 2FW6A 2NAFA 2DGDA 3E22B 4MQ4A 4MICA 5FORA 1U8ZA 4ZPXA 3SAJA 2AE2A 2EW1A 1VFNA 2XLCA 2P2CA 3LDGA 4HAUA 4CKEB 2EFGA 4KO4S 2D59A 1LA2A 3E0QA 1M8FA 4MW5A 4TLDA 2DUNA 4LEIA 4YRJA 1R3DA 5K0NA 1A96A 1MX1A 3DZ8A 4ZHQB 2GYUA 5REQA 3O6VA 4UZEA 4B43A 1FP4A 2HOQA 4DR3B 4LTNA 4WVFA 1UXOA 2AOXA 2IXEA 2WYUA 5E7JA 1NZJA 3JYNA 1V45E 3OTQA 4MS3B 3GLIB 3MUFA 2RAPA 1ZHHA 1WUIS 2V5AA 3LYAA 4IDQA 4ODIA 2Z1MA 3ZVKA 4I4IA 121PA 4DSZA 4S1VA 2R00C 1H0RA 1FDVA 3EH1A 3LOQA 1PG2A 1OXSC 1QH1B 3N3AC 1IM2A 3FPLA 4FWTA 4Y2HA 3D0OA 3OX1A 3AVXA 4ZYWA 3SOPA 4TUYB 4UUPA 2A3RA 1T2UA 4GI1A 3MJ4A 1E7QA 3MWFA 4RKFA 3Q7SA 3U2QA 3ND6A 1QZUA 3OUZA 3FFAA 2HJHA 4H4CA 5KHLB 3DMDA 2Q5IA 3AESA 4PAMA 3SFTA 1Z28A 3H97A 3MQFA 5ELXA 1YC2A 3R9KA 2ZTHA 4C4XA 1W6RA 2EIHA 3B53X 3EW7A 3HUTA 1JG1A 1AQYA 3UV6A 4HQOA 1WDLA 4NBRA 5ILGA 3RUFA 1E6EA 2Q1TA 2AJCA 3H2BA 1IUOA 4GLLA 4BFCA 2XRFA 4UHKA 3MHTA 1AT1A 3ZDQA 3OY2A 1PJ2A 1C9KA 2V74B 1XIVA 5H59A 1Y5RA 4H3VA 4J8PA 3FRJA 3PC7A 2FN3A 1BMQA 4YP9A 5LZ9A 1CHNA 1K2WA 4QWMA 4QTYA 5KNDA 3PL5A 1ADJA 1CUYA 4AYWA 4KR3A 3P0EA 3JQEA 4RDIA 1X8XA 4LOIA 4M1OA 3S7TA 4JFRA 4B81A 2YFQA 4CTOA 5F2NA 2B37A 5HRCA 4B3CA 4M89A 1KI6A 5FUYA 4F2WA 4FSDA 1GCAA 1YB6A 4M9SA 2GHTA 4QJ4A 2VNJA 1J8YF 4MV9A 4C6HA 1UAAA 2ASEA 3CC8A 2PL9A 1HYEA 2H92A 4MAMA 3TTXA 4GRAA 2G1AA 1NVEA 2QJWA 3M6WA 5DWQA 2ZB2A 2WQ7A 2QN6A 3W7VA 2BTQB 1X80B 3A6ZA 5B6PA 2GB4A 2PCJA 4ZQCB 3SI7A 1ECBA 1R4ZA 2GO7A 4IHQA 2GSWA 3UFXA 4DIMA 1AKQA 5CUQA 5B4TA 5HJEA 3QF4A 4J4BA 2BWJA 4LZPA 4NU6A 1DJMA 1G5RA 2QTWB 2GAOA 4ZEOA 4BPRA 1ITZA 5LBIA 2VRWA 4TKUA 2IVZA 2OTCA 4YWJA 2O54A 4L76A 3DR5A 4FOOA 4MQLA 5LIRA 3QBTA 4BFYA 1TTPB 2ZBVA 1C2YA 2H7XA 4I99A 1W73A 5FHRA 1SVWA 3P8ZA 1M2VA 4AY3A 4II7A 4M9RA 1FNSA 1JR3A 1YMUA 1PYDA 3CX6A 4DJDC 2A1UB 5HS4A 3DF9A 1BHQ1 2F55A 3VTKA 2IH4A 2HJSA 3TEJA 3BWEA 1H42A 3L7KA 3RYFB 3ZIAA 1F0NA 5EQFA 1ETUA 3ZZNA 1K27A 2NX2A 1TQ6A 2XODA 2HTEA 4I0WB 1W19A 3EZ7A 5JSUA 3MGGA 3PL1A 1GL7A 5B37A 3DBIA 5AR1A 3L4JA 5CPBA 3TMAA 3VR4A 2EJCA 2I4TA 5H3HA 4FHGA 4ND5A 4WCVA 4LHZA 4A27A 3ZHCA 1PQPA 3T7EA 4PZ0A 5BN5A 4DKJA 3F6CA 3GT4A 4WACA 3RVRA 4DUPA 5JV5A 4UFOA 4OJTA 2ZSAA 1MABB 1QF7A 2IFTA 3FH0A 1XMOB 1E3IA 1R6AA 4I50A 4BRWA 5JASA 4JUFA 4QFBA 5DT2A 3HZZA 3T7IA 4KLAA 5DLDA 4M0EA 3V1UA 3TZQA 4DQUA 4RJIA 2FSVA 1CF4A 1N0VC 1G7RA 1R4NA 1TVCA 1QYXA 2A88A 2XA2A 4NICA 2O8CB 1DNPA 1N0IA 3DSRA 4G5QA 2JG3A 4LVOA 5K3SA 2NU8A 4BQQA 1S8NA 1HFEL 2G5PA 4WESA 5JCOA 5KYUA 2VIIA 5GV7A 1OR8A 4BC0A 2NXJA 2G72A 4QDKA 3RUDA 1KL7A 1VIMA 2XUFA 1VMAA 4E7PA 5BPHA 1G3MA 1G8GA 2QORA 4GRIA 3E4CA 5ALSA 4FHEA 4KFRA 3FOWA 5EXEA 5KJFA 2QRNA 2VAPA 3LNTA 3RADC 3GD5A 1U9IC 2QRJA 2Z1NA 1ACLA 3NPAA 2HXGA 1LI5A 1QIMA 1EK6A 3OZSA 1RDFA 3HLKA 4E4TA 3UAZA 3W9YA 2J46A 3AYZB 3NUQA 1D4AA 5DCWA 1TJNA 1X1BA 4YC7A 1KOLA 4A6DA 1O0SA 4EJSB 3SWWA 4CLOA 1NI4B 4TQAA 4BZWA 1SFRA 3D7MA 4F86A 2FW8A 3H05A 4GBMA 3O9VA 3CLTC 5EFZA 2BR4A 2B7BA 2QLMA 3R8CA 1JKXA 1KDPA 3K92A 2HRCA 3KT0A 4XKJA 4DDVA 2XB2A 1RPTA 1LNSA 3EVBA 4MVJF 1L4MA 3TYXA 2W11A 5GWXA 4ZRMA 3ZIDA 2CCGA 1JEEA 1RSZA 2GA9A 2TMGA 2ZI9A 4HAWA 3VC1A 2D62A 1O6BA 2OAEA 4EL0A 3RAEC 4H7IA 5FNZA 2IS2A 1N2ZA 3GDGA 3NWPA 3G2IA 3UOAB 2I99A 3FY4A 2FLWA 5CXUA 1NOJA 4QGGA 5JMPA 4B79A 2HWXA 2QPAA 1TF5A 3QMMA 4RLQA 1ZUHA 2XCRB 3MJSA 5JCZA 4PF1A 4M1QA 2VNKA 2ZTMA 1NUHA 4MEAA 4LF5B 3KXKA 4B9EA 2I8CA 3GWZA 1EFRD 1TZBA 1U3WA 1Z8FA 4FR0A 4KBGA 3V7FA 3S70A 4BC1A 2IIQA 5FTKA 2GJKA 1U2TA 1E8DA 1BFDA 4MO9A 2P4SA 4TSFD 1T6NA 1JXAA 1NASA 4LK2A 1BX3A 3BOSA 4D97A 2G71A 2XMGA 4OJNA 4BV3A 3FNFA 3A6PC 5EJ6A 1NNUA 3GCGA 1OLXA 3THOA 1EFPB 3G5UA 4KRXA 3QZUA 3T0GA 5JDCC 4IDNA 4IIXA 1TLTA 2QG6A 3I34X 1ZI8A 3EUWA 1B8UA 4CQMA 3A9CA 3DWEX 1N2HA 3W1EA 1BHO1 2GF9A 2GSDA 2Z2YA 4LDAA 3R9XA 1EGVB 3TSAA 4U9IS 3VQTA 5H9VA 2YQ4A 2IGBA 3AEYA 1OLSA 4Y6QA 4PYIA 1H8ED 4Q1EA 1QP0A 1MZVA 2P27A 4QUEA 2C8LA 4MX8A 4B4VA 2FR8A 3X0DA 5CW2A 3WTBA 1ADCA 5D2CA 5LZ4A 5FWDA 1XYGA 4AAYA 3W2IA 3GGDA 5M04A 3VR0A 3AILA 3ENVA 3GP5A 4PGAA 3ZUGA 2EL9A 2HF9A 2B8EA 1ONPA 2IZZA 3EZYA 2C2WA 4LMBA 3RG2A 3HYSA 2QZJA 5ERGB 3UQZA 4AP9A 4ETMA 4IIUA 2JJ1A 5B1SA 5B58C 1KNQA 4CM9D 2PZFA 3GJXC 1V7QA 2WFLA 2AC7A 1ABFA 1QC5A 2VEDA 3M6LA 4X45A 4D43A 5E1BA 5IT4A 1U1GA 2VSOA 4G0YA 3RSOA 1HDOA 2QQEA 5GIPE 3GXOA 2W2LA 3G9XA 1QGAA 1YR6A 4CMKA 4WW0A 3D54D 2C4UA 4ZVUA 5CXXA 2WU0A 1DJPA 1EB9A 1LLQA 2Q2NA 3DM9B 4I2NA 4FFPA 2GN1A 5EE9A 4YV1A 4JQYA 2G1JA 1JSLA 4RQAA 4D9BA 1Z7EA 3OH8A 3V2GA 3FYTA 3V32A 2BFBA 1LK7A 2ATIA 4FHDA 1YUMA 1UWVA 1AS2A 1H9CA 3ER9A 1R7RA 3VHXA 1QANA 2ZIGA 2QLLA 2IHBA 2PKYX 4KAXA 4OG2A 4IFBA 1UM8A 4R1UA 5CFQA 4QO7A 4ESOA 5AJZA 4LS3A 2J59A 3U81A 2VBGA 3TUJC 3VSBA 4GX1A 4A6PA 3DKIA 1YIAA 3D8RA 4XEUA 5IARA 3RC3A 3GLTA 1QFMA 2DHRA 2NO6A 3S1SA 5L8VA 3TLMA 4GDFA 4L0QA 3OTHA 2ZM6B 3C3MA 1EDBA 1G20A 2HMUA 4CE6A 1EUQA 1PNQA 4WCFA 3B6JA 4KAFA 1YQXA 4BTEA 2ZYHA 3WZMA 1FL9A 2H51A 1NKTA 4CTKA 2Z9BA 1EVEA 2WHEA 1GFIA 4REMA 5G2OA 4ZVSA 1LDEA 3E3OA 1CEYA 3E27A 4X8HA 2CF6A 1BE6A 3AXSA 1N7IA 3MERA 1YDGA 1N32B 1N36B 4QATA 5EGNA 3GDWA 3CUUA 3F5DA 4NG5A 3ZWKA 1YRWA 3FCOA 4QULA 1JF8A 3TQHA 1P80A 3ONFA 2ERYA 4XVRA 1HMYA 4ARAA 3IP1A 3N8GA 3PQDA 1NF9A 1TUBB 1UJ4A 1DIAA 3BGVA 3NHUA 1G291 1ISJA 5KKNB 1J49A 1NY6A 1P91A 2O1WA 4PG5A 4BYMA 1IE3A 4GLOA 1UPXA 3EXEA 3IA2A 4QHYA 4EFMA 4XIGS 4UMEA 1E18A 1JDVA 3AUYA 3H7IA 2HSZA 4TPKA 5AKXA 4C08A 2QNIA 1LC3A 3O9ZA 3DVQX 3ONVA 1M1ZA 5D85A 3NH9A 2QX8A 2CMHA 3WKBA 3L49A 5T67A 4LN1A 5A4MS 2YUIA 4YJHA 3LUGA 1R0LA 2Q99A 4G5RA 3OG9A 4TWBA 1SUCA 1C4XA 4ALMA 5C8ZA 3N6XA 3ENZA 3PNKA 1CD5A 3EQ7A 1O5OA 3LAWA 3Q3CA 3SG0A 2FMFA 1HNZB 3O3CA 1UEJA 3MTJA 4J1TA 4RHYA 5H8WA 1NUSA 4XI9A 4YT2A 3A04A 5JVDA 3Q7TA 1OZHA 3CX3A 3R75A 3F67A 3T3HA 4BNJA 1UP4A 1IOZA 5EJ5A 4PLVA 4QEDA 1ZH0A 1EWYA 3R44A 5T7BA 1CNMA 1B00A 4Q4AA 4WVLA 3LQFA 3VPBA 4IDPA 3CIOA 3AI1A 4EPRA 1DWUA 4H6PA 1ZH4A 3VHQA 5I4CA 4B75A 1W59A 4PPFA 4QPCA 4R7ZA 3TWOA 1DAMA 1N9GA 5JCJA 1IN6A 4HEA1 3FX2A 2XKKA 4P2BA 1PQYA 4ZI7B 3AR8A 2PXAA 1Q16A 3I4FA 2WTNA 1DU4A 4J4TA 3U4QA 2ZBDA 3BK7A 3N58A 4YHBA 4DY6A 1W4AA 5HX7A 2HSWA 2X41A 4MV7A 3NVAA 2VHVA 3ZU6A 4BQNA 4BUZA 4QM6A 4MA0A 1C7JA 3T7SA 1RKQA 3DC7A 5IJ0A 1ZOLA 3QVWA 3MXTA 1TTQB 5DNVA 2FLVA 5DTJA 5CCEA 2RH4A 4DLZA 4MGHA 4QU5A 1ZRSA 1PK7A 4K9LA 4P36A 4ZGBA 1QNLA 5AO9A 1V25A 2ZQ5A 3IO5A 4LMRA 3TMKA 3GP3A 3UA4A 3H9QA 2X0IA 2IOFK 4JWKA 4HEJA 3CT4A 4HO1X 2RC5A 1EA7A 1IATA 3LW7A 1B76A 4DXHA 4G0OA 1QYVA 5HVNA 3ZDDA 1SB9A 4RPGA 2PBRA 2H00A 5J58A 1YVEI 1Q95A 4B0PA 4W5WA 5ITSA 1PEDA 4X5OA 2ZULA 2RI0A 3DJFA 5U9CA 1IN4A 3OCCA 1Y9ZA 4X3OA 1C3VA 1L7DA 1Q50A 3CLTD 5BSRA 4HTAA 4EY8A 1ISGA 4AJPA 3OZAA 3LBNA 1HTWA 1JHAA 2BI4A 4EHNA 3AJ8A 3N5KA 4HGQA 4HL6A 4JUAA 5I8ZA 3HHPA 3GLVA 2WJ4A 5HCUA 1XI2A 3LQYA 3H1EA 4NOJA 4DMHA 4R84A 3P9YA 5TR9A 5DI9A 3L01A 2H4HA 4GOND 3HYLA 2WG2A 3B6KA 2PSJA 3ND8A 4N5IX 1CUWA 3KTDA 4GZ3A 2FQXA 4O4IA 1M2JA 4MYCA 3PFHA 1FZQA 3MTDA 2XUOA 3BFVA 5JALA 2IE8A 2WHQA 1FC0A 4G41A 4J0EA 4HWOA 1VSVA 4HLCA 1FSGA 5TMBA 1BE1A 1UWLA 1FRZA 4N7JA 1P2UA 2VAMA 1H3FA 2AF3C 2FX5A 2ID8A 3HFSA 4YYEA 4A2WA 4Y6LA 2ZKIA 5GV8A 4ZV4A 2ZS7A 2VWQA 2AVNA 3LPNA 3HMKA 5CYOA 1CJSA 3U3MA 1LJ8A 4JLOA 4M88A 4AWXA 3INNA 3NVDA 3PXXA 5J1TB 1L8OA 2WAYA 5LJIA 1NMEA 2NUBA 3SLKA 3WXMA 5KINB 1XCPA 1RQNA 4LHEA 1VPEA 2JLRA 4CEHB 1BD4A 4HATA 4WXRA 1SQFA 2AOTB 4L7VA 4A6EA 3BGDA 3IMFA 3ASZA 3MS7A 4TT8A 1O08A 3B3AA 1LW6E 3IOCA 1TRKA 4YEDA 5ILQA 4FS8A 3UAOA 2P4UA 2VHTA 3ME5A 4FWIB 4QJ3A 4JI4B 1HYBA 4P5EA 4BDTA 1U9ZA 5B2ZA 3L46A 1WUTA 5BMVB 1SBNE 1HETA 1UKYA 2BRUA 4I5IA 3R9IA 1IOLA 4EHHA 4JLSA 4X1YB 5KNDH 3OZDA 3P2MA 1FFGA 2QXUA 3GDHA 2Y0CA 2Q4TA 4PYNA 3G68A 4HYEA 4LC9A 5BN4A 1T5OA 1XZDA 1HH4A 4B87A 1B2RA 1BE8A 3VZRA 4QPDA 4DYDA 3NRCA 1A5AB 3IB6A 2V0NA 3NEYA 2XHEA 2AG1A 2HO5A 2YHAA 3AONB 4M1MA 1UXKA 2CV0A 3LGSA 5DU2A 3PJFA 4XA8A 2W71A 5B2FA 2SKEA 1VECA 3WNDA 4KRFA 3K70B 2VBIA 4PTZA 4R7TA 3OKFA 3N2NA 1I4EB 2AD1A 2VP9A 2WICA 3AUTA 2QD2A 2X0NA 2QVBA 1FBTA 3LHKA 4FDMA 4UEJA 2ZBEA 1UP6A 1NLYA 2QT0A 4DC1A 5AW7A 2PFKA 1XVUA 1ZG3A 1WTAA 5AW4A 3WP0A 3GYBA 3S40A 1V6CA 2VJOA 2E4WA 5L3RA 1W0JD 3RRMA 3GRAA 4NECA 3C5WP 1Q2XA 3GFQA 4W5OA 4WY8A 2RH5A 1T1SA 1Z16A 1OI2A 1MV8A 3N7AA 3CCCA 5EXXA 1JXQA 2EL7A 4FDLA 1JSXA 4QJ5A 1VIDA 3C3XA 1IOVA 3HCNA 2YV1A 1SELA 2BTOA 5TPWB 2CCKA 1OHHA 1XTRA 1GZ3A 2W7TA 3OEWA 4ALIA 4BRSA 1K5DA 2HD4A 2R87A 4HZGA 1R5OA 2W83A 5CBKA 5C35A 1BSVA 3P2EA 4C03A 5IFLA 9MHTA 4X94A 3V4FA 1BTOA 1Y1RA 2ZE8A 1FP7A 3U3ZA 1UQTA 1NAHA 1P6QA 3RIYA 2V9CA 1JDBB 1LJUA 1EFDN 1YD7A 5A62A 4FJ2A 4G86A 4Q3BA 3D4NA 1HLDA 1ZMXA 2E4YA 3PRKE 5CIQA 3RT7A 1KWGA 4MVCA 3VH2A 1CYDA 1QORA 3R20A 4KPUA 3L0OA 5CDTA 3OZUA 4GYYA 1KI3A 1USUA 2XKBA 2P65A 4Q4JB 2PKCA 4ZZ1A 1A8UA 3OQ6A 4KQFA 4XCVA 4BU0A 2JLUA 2GAIA 4NDNE 4PNPA 1A1VA 4U1RA 3UCXA 4B6GA 2IYFA 3FYHA 1LK5A 3L1KA 2I2DA 3T0IA 1E3WB 2AR0A 2V97A 2EWWA 4YR9A 1Z5GA 4K88A 3S2ZA 1DV2A 1H1LA 1PI3A 2JFHA 5JC1A 3ZE6A 5BXQC 1AHHA 4FDAA 2VJLA 2PUGA 1LU9A 2DKFA 5DE3A 1VI6A 3GMDA 4PAOA 2E49A 4I1VA 3BB4A 1VKOA 2OILA 1SMKA 2AQHA 2ZWVA 4YBZA 3NBQA 4JH0A 3A11A 3GFGA 3ICWA 4BNKA 3IHWA 5ITWA 3IPCA 1WD7A 3D43A 2Q2VA 1QRRA 3SX0A 2J3MA 4INZA 1FDSA 5KJEA 4X0EA 3TAUA 2FSHA 5IHXA 2I1QA 3UATA 1S2IA 2I0FA 4WCDA 4ZTZB 4AI6A 5CNJA 1KOJA 4OQLA 1KJZA 3FM9A 1O8BA 1DRKA 5IVKA 1QG6A 3M6IA 5I9MA 1Z5WA 2O2DA 1NBME 3OZBA 2UYQA 3PSAA 1XD2A 3WXBA 4D9IA 2XIJA 1TO2E 2FPMA 4X24A 4UUBA 3AUSA 3QUBA 4L8VA 5CVDA 4ZYVA 1Z35A 4U7HA 2PX8A 2VKTA 2PT6A 4CF4A 3U1VA 4BQFA 4O0LA 2IF0A 5FWXB 2EOAA 1M75A 1T2AA 2BFEB 2JH9A 3SQLA 4HAIA 5DYWA 3OE5A 3RF6A 4ES6A 4U2KA 3GEIA 5ANRB 3L4BC 2CJXA 2AOVA 4U7PB 2P8SA 1VHTA 5EWMA 4F72A 1ZHOA 1VIYA 2J9FA 5JANA 2DB3A 4IS2A 5G4KA 1T4MA 3FIUA 1MVOA 4MLZA 2D2FA 1EEXB 2PHZA 3TB6A 3H8VA 3HKEA 4P54A 1XROA 3AK4A 2NUTA 3I5YA 1WDMA 3PHJA 2IUUA 4Q7QA 1I0LA 1UXGA 2EJBA 2PS0A 4BE9A 1XTBA 2ONKA 5E1OA 5A05A 2AQIA 5CHEA 4CM9A 3O8CA 4FOLA 5F5XA 1DJQA 5E3IA 4L22A 4U6QA 1ISRA 4GI5A 2JCYA 4URUR 4FFOA 4V3CA 2XYVA 2C2MA 3F6RA 1DBPA 4HVCA 2YWXA 2BY4A 3ZHUA 1Y6GA 2DR2A 2VXCA 2FE4A 2WABA 3LWBA 1P9OA 1U6IA 4J90A 4OKSA 1BZYA 2E4ZA 4LI3X 4R3NA 1SXIA 2PAAA 3CQ9A 2HU7A 3EH2A 4FLFA 4KACA 5FPYA 4CT0A 2ZYSA 3ZQUA 1DDGA 1TIBA 1EZZA 1U6JA 3PGLA 1A9OA 4XD7A 2B1RA 2XECA 3KUXA 5CAEB 1E1QA 3FTFA 1F2TA 1RC1A 5GTDA 3OD1A 4R1TA 3OA0A 2PH1A 2W4QA 5KQPA 2BP7B 1CE8A 3RHFA 5B57C 2QMUA 3RUPA 4KO1S 3LP6A 2GPWA 1PBTA 2M98A 2PSSA 1IXZA 2VT3A 3QKRA 1C1YA 2H07A 2YR0A 3M6VA 1CUZA 4OREX 3TIVA 2FG6C 4RVFA 3A4TA 3KQNA 2NO5A 1ENYA 1R4AA 1S2GA 2BHLA 2DQYA 5EXTA 4LDQA 3TQCA 2OCPA 5JJBA 4M1YA 1OWNA 5FADA 2MR5A 1SU6A 5IDQA 4KEAA 5EHNA 2JK0A 2GNOA 4ZC8A 1DCMA 1C2TA 5KHOC 2XCTB 1OXXK 4N39A 5DJ5A 5YASA 1SCNE 4O59O 2PTHA 1Y7PA 1EA5A 1T6BY 2LKCA 4TV8F 3E9CA 4HRAA 1H0SA 5D7NA 2ZRKA 1KQNA 4M60A 4K9RA 5FBLB 1ARZA 1SZCA 1JR3E 4XJSA 4EF6A 1RMYA 3DMNA 1N92A 3KPWA 1HLPA 5BQXA 1E69A 1XZPA 4BE4A 1XL1A 1E4EA 1GZVA 4FJ1A 5CDHA 3TIIA 5CX1A 1X9GA 3N5CA 3MVEA 3OQNA 4RW0A 4AK9A 5AM3A 3LKDA 3Q4GA 5DP1A 1G2PA 1CS0A 1ULTA 2EBHX 2O6HA 2UAGA 1ZC4A 2OT3B 3BMXA 1V43A 3K1AB 5BSTA 2IWHA 2Y8EA 1RHRA 3WYDA 4LC1A 4S1WA 1RRMA 2HPAA 4WKPA 5TDHA 2I1VB 3UJ6A 3VO8A 1UJNA 4IH4A 4JNKA 1CQIA 4XFDA 5AXDA 1TO1E 5BV8A 3T3NA 1P4SA 2Y71A 1SKQA 3PBKA 2MYPA 5B36A 2A67A 5ITZA 4CEJB 4DIKA 3O38A 3LT0A 4EKIA 3MB8A 2A9KA 2ACVA 3LL7A 3IDSA 4CLEA 2K4MA 4Z5XA 1KKLA 3IMGA 2CFRA 1JS1X 1TJPB 2GVZC 3F78A 1VJCA 4EI9A 3VSEA 3B8HA 3KR1A 3IDZA 2VJAA 5LZ7A 1XP5A 1VC2A 4IVQA 5DHTA 3VU1A 3JQPA 1IY8A 2CW5A 1NVGA 1E2PA 1LDMA 4M0CA 4A2QA 4X84A 5BV1A 1JAZA 5ALIA 1MUUA 4NK5A 4ZVMA 4CNQA 2I03A 1CBUA 4XQEA 2ZAMA 4ZREA 3PNPA 4I8DA 2C99A 1L5KA 1XTJA 2DFVA 3RW9A 3MZ0A 1GRVA 1P1KA 3F3SA 4DCCA 2OEPA 1TQDA 3FXAA 3EJ6A 4S24A 4GLJA 4U9HS 1IRIA 1DQNA 2AZTA 3RS8A 4KSYA 4AW9A 5C7LO 3K8OE 5J4KA 2FZKA 2Q3JA 3G0BA 3DV0A 4OK3A 1CDDA 3I8XA 1W85A 4IHJA 5K2OA 2YXEA 1GAEO 2A58A 1U3TA 5TVKA 2W0SA 4MDEA 2GS9A 3KETA 1Z5NA 4IMRA 3HCPA 1LLCA 2B8WA 1ZSNA 1J0BA 2PGAA 1T3ZA 1B4DA 2VUUA 4MV3A 2EAUA 3I73A 4BIMA 3G6KA 4L5JA 3VBEA 2J32A 4ZMBA 1II9A 1RXEA 4WE3A 2B4TO 1Z33A 2ZTVA 2FP3A 4FBLA 1D2AA 5DGIA 5DTEA 4Y2XA 2OVFA 2P3QA 4EEZA 1GYRA 4Q9DA 3UTCA 1XHEA 1L8XA 3I9JA 4IIJB 1NF8A 3DHYA 2WWYA 1NG9A 1WHSB 4KC0A 4LRYA 2H1FA 3U62A 3HBMA 4PIVA 2ZI6A 2GHIA 3A0RB 1WMDA 1XZBA 4K6GA 4YJ2B 4OHCA 5CURA 3N0RA 3TLGA 4BJ3A 1F12A 5LNK6 3P97A 3C8HA 3WO1A 3K2BA 2JKZA 3DZCA 5AJYA 4CU2A 5FD8A 1RAEA 3BH0A 3DPIA 3E7PA 2HMTA 3CSUA 2X3UA 3GPBA 2WG0A 1LI4A 2YJZA 4RDCA 2CFCA 3SS7X 4C0WA 2RARA 5KWEA 3FOAA 1VSTA 2Q5JA 3CNEA 3RH0A 2HA2A 3TZ6A 2W58A 5IM4F 4BLQA 3NWEA 2XIQA 3GOQA 4CMBA 2W6MA 1NE7A 2XRYA 3D6VA 3EXAA 2DCUA 3Q10A 3U37A 4ISCA 4DJTA 4JSTA 2DTXA 1EGQA 1WMBA 3UH0A 2L82A 1RCUA 3TD9A 3KJXA 4DNOA 3IDAA 4NEHB 3AEKB 3EGCA 3KQQA 4XZ3A 1AM4D 4QYXA 3W2HA 1N78A 3ZWCA 4WBNB 1G8FA 3L8CA 2KM1A 2W2TA 3V46A 4YCCA 1KZ9A 3ROMA 4G0WA 3C3WA 1D0SA 4TKZA 1WZEA 1CCWA 5AKEA 2Q1WA 1AF7A 1JPUA 3IUJA 4MVJI 4PG7A 1HDZA 5LMCA 3HDHA 3R0JA 3IT0A 5KSZA 3D6AA 2WNHA 4JMPA 1C3OA 5KB3A 4FHFA 5EZYB 4ALJA 3K6JA 1T2DA 1RBMA 2P90A 3FCEA 3GBVA 4DDHA 1KSFX 3H0CA 4KQGA 1WCIB 4KBFA 5C5DA 1Z74A 4RFLA 3SC3A 4NU8X 5EJFA 5FB3A 2J0UA 1QHIA 1E20A 3VO2A 2H9YA 1K6IA 1DPFA 3WAKA 2H4YA 3GV0A 1TKAA 1Q7GA 4HWSA 1L4KA 2VCEA 3JALA 3MCTA 4I7EA 1RXCA 5GVSA 1GAXA 1IPEA 4CMEC 4X95A 4B09A 3LC7O 3M49A 4IAOA 5DBEX 1SXJC 2LKDA 2JVIA 3BB3A 4JODA 2YQ5A 3D9QX 3BWBA 3KDPA 2UXCB 2BEVA 2BEWA 4IGFA 2GD0A 3KJIA 4US1R 2CZCA 4CMGA 2I76A 3I01M 4TLLB 2PZJA 2ZRAA 3GUUA 3AV3A 2YBEA 3M1YA 4N8DA 2CJPA 1DT5A 3HL4A 1DAPA 2IDKA 4BP8A 4JLAA 4KK3A 3EVTA 4D9KA 2ZXUA 1H2BA 4OPMA 3TCXB 4TOIA 3FN4A 3C1OA 2VZ9A 4CUKA 2WMYA 4BFWA 4UBKA 4EH1A 2W6JD 2VP4A 2CK3D 1DKRA 4M0LA 1MPXA 2HCJB 2RONA 3H1BA 4D3XA 1RM3A 5I5EA 1YFZA 4Q6WA 1U2SA 1KA9H 4B45A 4PLGA 3H42B 4GVLA 1E6CA 3GLIA 3HEBA 3GRVA 3AEZA 2WMNB 4XLTA 1YZKA 1L5FA 4WAUA 3HWWA 4EPWA 2O8DB 1J7JA 1X39A 4G4GA 1U2EA 4HFMA