4MCIA

Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with dmso, nysgrc target 029520.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
247
structure length
243
Chain Sequence
LYFQSMSKQPHICVDENQVSPYVIVCGEPDRVNRIVELMDNVELLAENREYRVFNGVYKGTTITICSTGIGAPSMIIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVRDEGGSKAYISSAYPAYASFALLKEISHFLENQSVKYYFGVVRSHDSFYTDEEDQLCQYWNKKGILGADMETSALFTVGRLRGLQVASILNNVVLYQEGVNQYVNDNKAMMNGERLAAITALETLCKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with DMSO, NYSGRC Target 029520.
rcsb
source organism Vibrio fischeri
molecule tags Transferase
total genus 86
structure length 243
sequence length 247
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mciA00
2QDKA 1V2HE 5IFKA 3OZDA 1PR5A 1SJ9A 4LNAA 3GB9A 3NBQA 4DA0A 4H1TA 4YJKA 1OU4A 5FAKA 1Q1GA 4NSNA 1V45E 4WKNA 1CG6A 4JWTA 3PNPA 1C3XA 1V41E 1ODLA 5F7OA 4F1WA 4RJ2A 3KUKA 1N3IA 1SQ6A 3OOEA 1TD1A 3FNQA 1ULBA 4F3CA 1PK7A 1YR3A 4D8VA 1A9PA 3EMVA 3OF3A 3OZBA 1RXYA 1ULAA 4DA8A 4YNBA 1K3FA 3UAWA 2OECA 1U1EA 5F73A 4F3KA 4OF4A 4R2WA 1LVUA 3KVRA 4K6OA 5CXSA 1A9SA 2I8AA 1JDTA 3K8QA 2HWUA 1WTAA 4BMYA 4GLJA 1Z5PA 1VHWA 2AI3A 3OPVA 5K1ZA 4YMLA 2QPLA 3UAVA 5CCEA 4TXJA 1NC1A 3ONVA 1Z5OA 3BL6A 3OZCA 1RFGE 4M1EA 4TTJA 3UT6A 1K27A 1JDSA 4DANA 4P54A 4GMHA 3DF9A 1T8YA 3EEIA 3UAZA 5B7QA 5F7XA 3INYA 1ZOSA 4D8YA 1PK9A 1JE0A 2A0WA 4NS1A 5EUBA 1YRYE 1FXUA 1V48A 1OTXA 3FB1A 2AI2A 4WKBA 3NM5A 4L5CA 4QASA 3DDOA 1B8OA 1PWYE 4PNPA 4UC0A 5KB3A 4BN0A 3E9ZA 1Y6RA 1T8SA 1JP7A 4DAOA 1RSZA 1V3QE 3KVVA 1JDVA 4QFBA 1K9SA 4IP0A 4GLFA 4QARA 3UAYA 3FWPA 1JPVA 1U1CA 3O6VA 1OUMA 3MB8A 1PR1A 2QTTA 5ETJA 1VMKA 3C74A 5F77A 1U1FA 2I4TA 1RYZA 3F8WA 3U40A 4DAEA 5CYGA 1A9TA 1SD1A 2AC7A 4MCHA 1Y1SA 1OVGA 1YQUA 1CB0A 4DA6A 1LV8A 1TGVA 3FOWA 4JOSA 1JYSA 1I80A 1U1GA 4MARA 1YBFA 2B94A 3D1VA 1ODIA 1RCTE 1YQQA 5DK6A 4LDNA 3P0EA 4DARA 1ECPA 3BSFA 4BMZA 2Q7OE 4D8XA 4WKOA 3FUCA 4TXMA 1TCUA 4U2KA 3BJEA 4OGKA 3LBAA 3PHCA 2XRFA 1NW4A 2OXFA 4EARA 4BMXA 1SD2A 1LX7A 5F76A 4R2XA 2ISCA 2RJ3A 4R31A 2OC4A 1G2OA 1PW7A 2H8GA 4TS3A 3UAXA 2OC9A 2A0XA 4M7WA 1NC3A 2HN9A 2A8YA 5B7NA 5B7GA 1PR2A 3LA8A 4G8JA 1RR6A 2BSXA 4G41A 3FAZA 2PGAA 1Z35A 4L0MA 2HRDA 5F7ZA 1TCVA 3EUFA 5CXQA 1PBNA 3EUEA 5EFOA 3ENZA 4X24A 2HSWA 4TTIA 3ODGA 2A0YA 1Y6QA 3TL6A 1QE5A 3T94A 4DA7A 5JPCA 3PNSA 4L6IA 3E9RA 1Z36A 3O4VA 4E1VA 1VFNA 1Y1RA 1ODKA 4D98A 3MMSA 3KU4A 1T8WA 4QEZA 1A69A 4I2VA 1OV6A 3DP9A 3KHSA 4G89A 4F2WA 4QATA 2AI1A 1RXSA 3OCCA 4PR3A 4GKAA 1V4NA 4M3NA 1Z37A 1RXUA 3DPSA 4KN5A 3DJFA 4OY3A 3K8OE 1ODJA 1T0UA 3IOMA 4NY1A 1A9OA 1PF7E 1PKEA 2P4SA 4LZWA 4ECEA 3KVYA 4MCIA 1A9RA 4OEHA 4TS9A 3OOHA 2QSUA 4YO8A 3NM4A 1B8NA 1Y1QA 4TXLA 1OTYA 4D9HA 1JE1A 4L5AA 4QAQA 5CCDA 4JP5A 3E0QA 3P0FA 1TGYA 5F7JA 1PR0A 4LKRA 3PHBE 1RXCA 3NM6B 4FFSA 3LGSA 4WKPA 5EPUA 1Z38A 1U1DA 1A9QA 1Z34A 2GUWA 2IQ5A 3SCZA 1ZL2A 5IU6A 5B7PA 1VHJA 5C80A 3OZEA 1JDUA 4OJTA 1PR4A 5CYFA 1RT9A 4EB8A 4L5YA 2ON6A 3BGSA 1XE3A 1Z39A 4TTAA 5I3CA 4F2PA 3QPBA 1Z33A 4TXNA 1Y1TA 2QTGA 5F78A 1T8RA 4TXHA 4DABA 1JDZA 4OGLA 1M73E 1Z5NA 4TYMA 3IEXA 3GGSA 1PR6A 4WKCA 4LNHA
chains in the Genus database with same CATH superfamily
1NLFA 2P9FA 5D3KA 4CMIB 4XX1A 5HKBA 1P80A 3H7AA 1VL1A 3OZDA 3LY9A 1GL6A 3RRNA 3M83A 1HNWB 2IHUA 2FXIA 4DSZA 2WTAA 4FS8A 1M6HA 2E4YA 3KCQA 2QN9A 2OQ2A 3EIXA 5LIRA 1J0XO 1E1DA 3OJXA 4PRZA 1V39A 5I51A 2W58A 4PYIA 2FFAA 3B6MA 4OJNA 4LTMA 3QLUC 3PGXA 5HIKA 3L7AA 1J8FA 2QUBA 2X4IA 3I30X 1K08A 2AVNA 4ID3A 1IHXA 1M33A 2XDQA 5BR1A 2Q9CA 2VUUA 3L93A 1TVKA 3L7MA 4H31A 3E8SA 4GLBA 4Y6RA 3U39A 3UXEA 3NVKI 3F7TA 1XD2A 3I1YA 5JQGA 3AEUB 2A9FA 4KMOA 5CIWA 1BX3A 1FMTA 3RIGA 2QRQA 3L07A 3M3PA 1EDDA 3C45A 4JVMA 1WBBA 1NX6A 4U39A 3DHVA 5LQRA 1CFZA 1DCFA 4OK3A 2JIZD 1Q1ZA 5I7SA 5IJZA 1KI8A 2I9KA 1O96A 3UN1A 1VPEA 3CH5A 7GPBA 4CF6A 5FLYA 5GONB 4NZMA 2O8BA 5KJ1A 1OZGA 4LV6A 5K7SA 1EQUA 5FHRA 2POCA 3CQ9A 2GX6A 4U1RA 3EH2A 3V3KA 4EITA 3JQFA 4Z3OA 5D2CA 1J2UA 4ALMA 4N49A 1R00A 1H0KA 3G2NA 5IKMA 1E0JA 2P68A 2AN9A 4C1BA 1WMBA 4LFCB 4EA6A 2JZCA 2TMDA 2YJNA 5BVGB 1ZVVA 4I4NA 1SKBA 3C5CA 3HL0A 4WCVA 3B70A 1FC0A 1GUFA 2ZCUA 3T38A 3LYUA 1YK1A 2AN5A 1P75A 4JCOA 2VHEA 1UXJA 2FU5C 1T2DA 3DNMA 3E9DA 5IAEA 1LVUA 5KYTA 5BNZA 1NJ5A 5J2TA 4FHFA 4I4CA 1JSCA 2EZ4A 4OM7A 3EHDA 1G3MA 1ZK1A 1YU9A 5CJJA 5J2UB 1ILWA 4BMYA 1J24A 1V43A 1ECBA 4LHEA 5JNTA 2NV0A 3VMMA 4WRRA 5KYUB 4UXHA 3GQBB 1NULA 1Z5WA 1U0GA 3GJTA 4LI0A 4R8MA 1O94D 5JC8A 1BFDA 4KIUA 3A6KA 3ZQUA 4C05A 5AVZA 2IHYA 3DHYA 3DAYA 4UCFA 3ZHYA 1I0LA 3HKCA 2J09A 3VRHA 2HZ7A 3L7BA 4ACBA 1ESEA 4QU5A 1E64A 4B3CA 3SHVA 1L8LA 2QSZA 3ZV4A 2D8AA 3RRXA 3LXUX 1ZHHA 4AG5A 1ZCAA 3GFOA 3RGWS 4U6SA 3EXG2 2C83A 4XDGA 1G9SA 3PFKA 2XODA 2Q6OA 3QKRA 3NWBA 5B53A 3SZRA 3GDGA 4QO8A 2FPGB 3QKRB 5IBCA 1Y5MA 2V7EA 2AUMA 2CXXA 2NXNA 4J9UE 3ZYCA 1XTKA 4DXAA 4TL6A 3DFZA 2WAYA 3E7FA 4WK0B 5CEFA 5HFNA 5EJFA 4FDTA 3GPIA 2J4FA 3ZWKA 4HGZA 4D9EA 1MP0A 2P4UA 4NZNA 2BUCA 3DKIA 3LBYA 1JWLA 2ZOSA 1E8DA 1QC5B 4D9GA 5IF3A 2I2AA 1GZHB 2GBCA 1YVDA 1MFPA 1F2TA 3TUIC 3E8XA 2IYQA 2YVUA 4JQCA 3JQ8A 5CVCA 3STTA 4BLQA 3WKEA 2L18A 1WD7A 1Z8FA 3IBGA 4JHXA 1Q84A 3KR1A 1PHRA 1KJYA 1GARA 1GTJ1 1ZQ1A 2ZQYA 3BMOB 1J7JA 3FB1A 3B6ZA 1K3TA 5BY2A 4Q7LA 1YRQA 3W4KA 3NM5A 1E0KA 4L7QA 3SLKA 1XDWA 4X6LA 1GG8A 3ROZA 5BR4A 2VYVD 2VDRB 3OT1A 3QJGA 4KR2A 1L4MA 2BHNA 2OORA 3IESA 4YMUA 1AQJA 1WUKS 5JSQA 4RKFA 2V0GA 4D92A 2F8LA 4D82A 1YBHA 2RHCA 4HDKA 3G68A 5TT1A 5B3KA 5DK4A 4UUPA 4S04A 3FETA 2XPCA 3P9IA 1JIQA 4FEGA 1TZ2A 5FADA 5FA8A 5JS6A 4JX9A 3PXAA 4C76A 4GYWA 4DLRA 1FVHA 3I5XA 3DDUA 3MRVA 3OLZA 5TS3A 3W7VA 1USIA 4B3HA 4MEJA 3TTTA 3RLFA 3HSYA 5CM8B 4LTNA 5D1NA 3GLHB 4EYOA 4IJMA 3LC2O 2SECE 5L3RA 3KEMA 9ABPA 1N0VC 3R5JA 2WU0A 2PS1A 1CUVA 1THMA 4J6EA 5DTJA 5KU1A 1QKKA 2IYSA 4O25A 1X1SA 3BMCA 4ZOLA 3KRTA 3GFVA 4M38A 2EOAA 2ZJ0A 4WOKA 2JBAA 1ZRNA 3L0ZA 4G65A 5GVSA 2AN4A 3ADBA 1BMTA 2VP9A 2P2SA 4BP1A 3AVUA 1U7UA 1KGDA 2BE7A 2J3DA 3UHAA 4D4HA 1X7WB 3BILA 1PLLA 1Q3TA 1DTEA 2BEVB 2O2DA 2YFYA 3EVDA 4IAOA 4E4YA 1Y48E 4FJ2A 4Z4QA 2I3AA 3KYIB 1S4QA 3GMTA 2V65A 4AXBA 1ISMA 1SBCA 5C8YF 5AW2A 2VCEA 3DWEX 4HQNA 4LZZA 5ARBA 1EJ0A 4W5RA 1ORVA 2BZ1A 2I99A 3HYTA 4M21A 4NARA 4DSUA 1PV2A 2Q4OA 2XECA 2XNDD 4MP3A 1TRHA 4PHGA 5EXPA 4ZC8A 5IBPA 5THXA 3RWBA 5LNK6 1XCOA 3DDWA 4U9HS 3NC1C 4W7IA 5ECDA 3PD7A 4B6JA 1HYHA 3FJ1A 3VO2A 1FRZA 1VZ3A 1CY4A 3DVRX 4LA4A 3H16A 1XB2A 1CBUA 2DYKA 2ZTSA 3WL8A 3ZJTA 3CH7A 2D0OB 4E5SA 1AXGA 2BJWA 2ZYAA 3SF8B 4Z4EA 2PX8A 2OSVA 2DH6A 1FU7A 1Q12A 3PD0A 5FI5A 1KYQA 1JYSA 1YI8A 3LRTA 4RUKA 5IVHA 2Y1LA 3FMOB 4GL4A 2B98A 2OMKA 2Y8EA 3E22A 4RF3A 4YGXB 1FP4B 2EHDA 3W5JA 1UKAA 3O8CA 1CXZA 4GGPA 4FVTA 3TK1A 3UCXA 1DX4A 3K0EA 4DVGA 1JFSA 1KZ1A 1ODSA 1U7WA 3KUXA 3W7AA 3NBZC 4ARIA 4GD3Q 3DE3X 4LDNA 2VHJA 1KETA 3O73A 3VDNB 1BDBA 3COPA 1W9HA 2V5VA 5BR7A 2G5CA 4X7MA 3WWZA 2C2ZA 4K6HA 4P5PA 4MVJG 3BSWA 3EMBA 3HC7A 4O5AA 3IBYA 2V6IA 1NVWQ 4YQEA 1WX1A 2X1VA 2A88A 3LBFA 2FUG1 2GCOA 2FMHA 2PXAA 3R0VA 1PTJA 1H42A 2WABA 3MQ4A 2M6LA 4D4LA 5JEDA 1OGJA 3BDVA 4ESOA 3FUCA 4WJLA 6REQA 4O4IF 2A5YB 3D7RA 1I32A 1TOAA 1QF7A 5EE1A 3P9XA 2B8NA 1JAHA 4BC0A 2LCFA 4JDPA 1ZK4A 2GBIA 4CT5A 4IIDA 3R5HA 4DE5A 1WXIA 2YWDA 1PD1A 3FDFA 3RC9A 1UK6A 1KK2A 2AOXA 3IP5A 3KKKA 2HWXA 2G4VA 1DOZA 1W30A 3K05A 4QICA 5G53C 4C0AC 1NW4A 2BKVA 3KJFA 4YFYA 3L7NA 4HDSA 2M6RA 4HLNA 4ZOAA 1WUYA 3BRSA 2IYAA 4DLTA 1QS0A 5KNBA 3K92A 1K6EA 2QJRA 4Z49A 5CLHA 4IM7A 2F43B 4B0PA 3EIWA 1SU8A 1SXJE 3PD1A 1KH3A 2RC6A 3P26A 1YVRA 2J07A 4JLJA 4RQUA 5CH3A 4FMCB 5DDIP 4C6RA 3INRA 4Z1OA 5C46F 1FK8A 2BZSA 1GZVA 3A9CA 2GD1O 5E0KB 1G2OA 3OP1A 4J3NA 1Z7GA 1OWOA 2V6MA 5DN6A 4JEHA 3RTEA 4FSDA 3Q8LA 4U0JA 4M7WA 1NP7A 4WK6A 5LZ9A 4F5EA 5HE8A 3C7AA 3MWEA 3UT0A 2WIJA 4YUYA 2A30A 2TS1A 3ED1A 1E9DA 1E3IA 1OXVA 1SURA 1Q7CA 2PJDA 3FR8A 4X8OA 2X8WA 2A8YA 1WUTA 3AMVA 4YLEA 4FMPA 2DKNA 4EW6A 5I8WA 5FDFA 1D0SA 1WXDA 4R2IA 1R6BX 1UC8A 3C5EA 1Z7EA 3FMFA 3GWGA 3F8TA 3EQZA 4XFDA 2ID8A 2OLKA 3KOXA 2NO6A 3HR7A 2VT6A 3NHFA 2WU1A 2BSXA 4MYCA 4UPDA 4RTNA 3QWFA 3F5MA 4ENTA 1DBVO 4BJ1A 4WHMA 1CDOA 3MGKA 4BWFB 1Z07A 1LF5A 1ULUA 2PD6A 1AS3A 1JBQA 4DJTA 4G5YA 1SG9A 2O7VA 1UOPA 3TRIA 4D0SA 2PZLA 2Y1DA 1CUEA 4NXMB 1PG2A 4DG8A 7YASA 2EL7A 3TX2A 4ZAXA 3N53A 3SG0A 2HNBA 1VL0A 3RHTA 2OZLB 3UKDA 5L45A 3AIKA 4JB3A 1VRVA 1CUDA 2JL1A 1W0JA 4G1FA 4JBIA 1SVOA 2GZSA 3IALA 1ZN2A 3QNUA 4RH1A 4WX2B 4D26A 1JYFA 3RVOA 4E2FA 3LOQA 4LK2A 2DSNA 3R1IA 5LC1A 1FYFA 2XZPA 3FMIA 4TQGA 1U8YA 5TF0A 3RFTA 1NI4B 2MSLA 2QTLA 4ZV9A 4ND8A 1KVSA 4TKUA 1H3EA 4F3YA 3N8NA 5LD2B 1OB2A 2CFTA 1NVMB 1UDAA 2WWGA 3PNSA 2CHEA 2FN7A 4NBLA 2MINB 2BFPA 3AJRA 4KL8S 4RDHA 2QYTA 3IEIA 3QHQA 4WLVA 1MQSA 4PXSA 1AMOA 1VYHA 1O58A 4P82A 4I3FA 5LWHA 3SHFA 3ZHRA 4BPBA 4DIBA 1G9XA 1ORDA 4O8ZA 4H18A 3CLTD 2DBYA 1B7GO 3NIWA 4Q1VA 1QHFA 1XRSB 3KOUA 4RKQA 4QEZA 3OZWA 1EEXB 1ECFA 3WLMA 1IYZA 1AKTA 1HE4A 3T3OA 2JHFA 2FG5A 4O4LB 1NVTA 3EYWA 4OQEA 1YNOA 4IUCS 2L2QA 4C78A 2G6BA 1V71A 3L0PA 4RESA 5EE9A 4N3NA 5JS7A 1Q2UA 4N9QA 1P0QA 4TMYA 1K5GA 1EDEA 5JAUA 5E6UA 4CCSA 1V4NA 5EAIA 1XCLA 1UIRA 3MOIA 5CVEA 2PXCA 1KEVA 2H2HA 1RWKA 1C0LA 4IDGA 3V1LA 2GCNA 4XWWA 1OZHA 2QN2A 3JQGB 2BGGA 1A9ZA 5HK8A 2CNOA 3KJXA 5KX5A 3VDQA 4PGFA 5B57C 2NM0A 1JSRA 4ZMBA 3LC7O 3ZWPA 4LE0A 5BWLA 1TW2A 1YZKA 5AVQA 2WKSA 2QJOA 3BD7A 3LFUA 3AM1A 4R2KA 2DOKA 4WZBE 3CMCO 4G4SO 4TV8F 3FOFC 1VP3A 1KARA 1RWMA 4Q19A 1MOQA 1NJGA 2GN9A 1FTQA 3DWGA 3D3JA 1TTPB 4E70A 1IAQA 1EK1A 1T0UA 1XEWY 3SICE 3V46A 1PVOA 2IDZA 5KTTA 3IVXA 1GUDA 3CLVA 4BMDA 2G17A 1Q19A 5DFAA 1N6OA 1WL8A 3QGMA 4RTRA 1G21E 2D62A 2J9XB 3PWZA 4WUTA 3WLLA 5CA1B 1Y0BA 3TSAA 2BGNA 1K86A 2IU0A 4LGVA 5DBGA 1JBEA 1G0NA 2Q9UA 5AQEA 1UM9B 4S3MA 2X8BA 2ZUEA 1DTWA 1E1RD 1QHHB 5GGYA 2Z58A 3E7WA 2V97A 3MS7A 3FPAA 2YUIA 3F5SA 4XUGB 1AKQA 3R3YA 4ZIRA 1HQYE 3ZKWB 4RK4A 1N5OX 3PNMA 4LXHA 2GHQA 5K6TA 3T1TA 3B78A 3Q5DA 1OI4A 4HAVA 1DJPA 3KJEA 4PPFA 2P6PA 4HWRA 5KJEA 1YB1A 2P2YA 5I4CA 3RVLA 2QZPA 2AKYA 3LDFA 3N7AA 1M10A 3PXBA 1TJYA 4GC5A 3WWOA 4XVCA 1EFDN 3I8OA 2I91A 2QRNA 2HYDA 1CQZA 2VHQA 2BFMA 4P0TA 4TPKA 5I8PA 1DFIA 5E7IA 1RXCA 3U5TA 3KKOA 1ZU4A 2QZ4A 2QZZA 2O8CB 2K4MA 2YVLA 5HBRA 1Z38A 1ZH2A 2A3NA 2XW6A 4FQ7A 4I50B 3X44A 4BE4A 1NNEA 5FPSA 4F56A 4HWGA 4NESA 3NTLA 2M32A 3MPUA 3S6JA 3T3HA 5BUCA 3S2UA 4AY6A 1RRPA 4FW9A 4IGFA 2OFFA 4JODA 5K5EA 4Y98A 3TLEA 2QAIA 4A5SA 4DLWA 4NU6A 3SVTA 1FDOA 4R0VA 5IZCC 1XRNA 1I2DA 3WL4A 4UEOA 4RKYA 3NB0A 1Z2EA 4Q3DA 1A8IA 1C9MA 3K4QA 4AN4A 4OA5A 2OM2A 1O0CA 1DT3A 4KPUB 5FQNA 4DBVO 5CFMA 3SDBA 3D0RA 1P7ZA 4FDLA 2WHYA 1T9DA 3LV8A 3ZGVA 4A23A 1FP1D 5FUQA 1N0UA 2AE1A 3DFIA 2YQZA 3E9CA 1M75A 1HM5A 1OYWA 3L0SA 3PR2B 2UZ3A 4J7UA 5F78A 2J9YB 4MW7A 4RHYA 5JRZA 5KKCA 1LS1A 1TB4A 3EVGA 1PT5A 5TXGA 5IVPA 5A6SB 5IRCD 4HYTA 2PX5A 1QH1B 1WCXA 4RA6B 1GKLA 4ZT5A 2X0IA 4QHYA 5BQ3A 2H1WA 2B1QA 1CZOA 2DHQA 3R0ZA 3WNVA 2GM5A 5LQUA 2HNKA 4Q3EA 1YUMA 3NNSA 2TMKA 5BW6B 2QPAA 2VP2A 4YBZA 5AVKA 2WTXA 3ZGYA 4MYDA 3F8SA 2O2XA 2CLSA 4DR7B 1M6WA 3U4IA 3GLFA 1E2MA 3E4DA 3GB9A 3KXIA 3NBQA 3ONNA 2VF5X 3W79A 1VTKA 2OAEA 5IN5A 3EARA 4X44A 1MENA 4C2BA 2OCDA 3MA0A 4FCWA 2VT7A 1HORA 1WQ3A 4C7BA 5BP7A 1W4RA 3SMVA 3ANSA 2EFCB 5ADHA 3JQQA 2Q4TA 3K8YA 2R5FA 4KVFA 1FL9A 2O3QA 3ITNA 3QYJA 4GSKA 4ZYVA 5M5BA 3IOYA 1SVNA 3WNDA 3GO4A 2DBQA 4RANA 3ZZ0A 5C35A 2VZEA 2ZK7A 3Q8XB 1BJRE 3IEUA 1XA0A 4C0HA 1I4OA 3GT7A 5FOXA 2EFYA 3N2GA 4S1OA 1U9IA 1F9EA 1BVHA 4OATA 4Z0NA 1GQQA 1GR1A 3AESA 5DCUA 2V8OA 3EBLA 5CURA 1C9EA 3ANNA 3IQDB 1E89A 2RHHA 3EZGA 5K2MA 1O9GA 4QUAA 2Z30A 3V8RA 1U2DA 2JIZA 1MORA 1TAGA 4BX9A 5TLSA 3HY3A 2XXAB 2Q5OA 2R8PA 3KZOA 2X5NA 2FK7A 1VPVA 1MHPA 2P2GA 4FE4A 4MDHA 4QULA 3OETA 2FJPA 2W6NA 4X7PA 3WLHA 4A5OA 4Z7NB 4UU8A 2YN4A 1LJUA 4GR9A 4TL9A 1PT6A 4CIXA 2JHCA 1PJ4A 5JD6A 4LMBA 3D8RA 2ZIGA 3OESA 5JSKA 3UAWA 3NUZA 3SJZA 4DUGA 4TYNA 3PZRA 3IQWA 3KQPA 4OXKA 5F73A 2LUOA 1L8XA 3CJRA 1GG9A 4NV1A 3TO5A 3G5MA 1G8PA 5C7IO 2XOEA 4MW1A 1RAHA 4WJKB 4CNBA 1TI7A 1QYVA 3OE7D 1YQEA 2BF7A 1DTSA 3WGYA 2Z3VA 3GVHA 2PUVA 1C0EA 1G2QA 4K86A 4NX2A 5CEJA 4NG5A 3T5MA 3UT5B 1MC1A 4JVNA 2HYIC 2B4QA 2VIIA 2UXBB 3H9EO 3NGXA 3ZY2A 1Z5PA 4W8GA 1VI6A 4H7DA 4R5MA 3RC2A 3LFTA 1FBNA 3B89A 5HZMA 3BWDD 4PYMA 3OPVA 3SR0A 1B16A 4BVAA 1PP4A 1QIDA 1SVMA 3B8HA 4EG3A 3CZ4A 3ESDA 1SHTX 3TNFA 1P29A 5DMXA 1O94A 3ISTA 1U5CA 3OJWA 1GNQA 1E5VA 1BD3A 3A2MA 3F3MA 1ZIYA 4M0LA 1JUDA 5HS6A 3O92A 5IJAA 4PVCA 1D03A 1LWNA 2QAGA 3RKUA 3FSRA 5L4NA 4J90A 4OHKA 4GPIB 3UJBA 2BFEB 2CWDA 2XMCA 4PNHA 4Z0PA 1Z5OA 1KH2A 1U7OA 3BL6A 4JQYA 2I6QA 4X8LA 1AO0A 1RFGE 1JSXA 1FNMA 2E7ZA 4I6GA 4WN9B 3TJZA 3TLMA 1E3WB 4PZAA 4RTSA 3MBOA 1FFXA 4TWJA 4HPJB 3TKYA 2JIRA 2Z8YA 2P9CA 3FHLA 1T1GA 3JWPA 1U6JA 3H2SA 2CDBA 3WJ7A 2WRZA 5ITZB 5JD3A 4OQQA 4UAGA 3SC2A 3BD6A 2A3RA 4NMLA 4E13A 5AW5A 1K98A 3DF7A 7MHTA 5B7QA 5F7XA 3EN0A 2VAVA 4O0MA 1UWKA 3DL0A 4U7DA 3EF3A 3STXA 1KE1A 4P3PA 1DGQA 3INYA 2VH1A 1D7AA 4L16A 4RFSA 1QB8A 1RJEA 1JALA 1RWVA 4KK3A 4G9BA 4TSFD 1P0CA 3K4PA 4GP7A 1J8VA 4Q3CA 5AHXA 3FSJX 4KPGA 1N2IA 1IB6A 1SOAA 2VPIA 3ND5A 4M99A 1NFRA 3N70A 4J1NA 3HCNA 5KQMA 3KK0A 2BTQB 2GLTA 5JO9A 4EZIA 1DSSG 1MB3A 4C06A 2YR0A 4IJQA 1UM8A 1BOFA 4JS0A 4EECA 4BCCA 2Q3EA 1KY5A 1U63A 4TLDA 4RYDA 4WXPA 2E5LB 1Q1NA 1A2KC 3C4VA 3I61A 1T36B 3FOZA 4B4KA 1PX2A 2H2IA 5ITWA 4YGYA 4LPSA 4KDFA 1T8SA 5IM4F 4HADA 4AQYB 2W2LD 2FSHA 3LUGA 5AICA 3UTDA 4O4HF 2R6DA 4JB2A 5LQNA 1U7HA 5AJHA 3RUIA 1BGWA 2VLIA 2Z57A 2GPTA 3HCWA 4K9NA 1L0BA 1E2BA 5C37A 3P4XA 2FQXA 2ZI3A 3RREA 1S8OA 3FCYA 3NXSA 4DC0A 3CE9A 3W6NA 4CKWB 1E6WA 3EE6A 2WWFA 4GLFA 1P2SA 1TF7A 4PSUA 4R16A 2VF2A 4P2GA 4BLWA 1E7RA 1J8MF 1MZPA 2OV2A 3VKFA 1KJQA 4GWLA 2IXAA 1QYIA 5AUOB 1NT2A 3R3ZA 5EQFA 3SIRA 1Z0FA 1L7BA 2FWRA 4P36A 1VJRA 4WZAE 3K9CA 5TX7A 2OFWA 4RVCA 2KBFA 5L7TA 3JQRA 3CY6A 3L1VA 1T9GS 1CYDA 5CGQB 5EMHA 5ETJA 3ZHZA 4DT1A 3T3NA 3A31A 4QNMA 4L75A 4Y7CA 2BMVA 4LSWA 2ZZMA 4Q4AA 3IE1A 4F4DA 1IEVA 2NO4A 1RM3A 3IE2A 3O0TA 4Q7KA 5NLLA 4CKCA 1H2YA 2I4TA 3VZCA 2IH5A 4Z51A 3K1AB 1F6BA 5IULC 4PCVA 5J47A 2AL7A 1SPBS 1AM4D 2YN0A 2I4MA 3N2NA 2XNDA 5DTQA 4KGXA 4HTAA 3TLCA 4X85A 2F2TA 3I5MA 1YCGA 2YIVX 2WSMA 5DHPA 1Y5NA 2P1ZA 4EX7A 3VSDA 2O59A 2FHPA 2WWYA 5LWQA 2LTAA 2O5CA 4MO2A 3M6LA 2BJHA 3CSUA 3CUWA 4M60A 4YUXA 1T9HA 4MS4A 4XX0B 4BU0A 4K3UA 1EWVA 1LF0A 2PT7A 3ROMA 1P2TA 2BM1A 1KKLA 3A1WA 3FMGA 3VKUA 5CITA 1HOTA 1DCTA 2Q1SA 4P7GA 3IV7A 4J94A 5C8XA 5LA6F 4XGRA 3E9YA 4YCMA 2D5LA 4HFJA 4FHEA 4QBHA 3GHYA 4M1TA 3C8ZA 3CRQA 3DPIA 4Y67A 2WILA 5BSGA 3EG5A 1VCHA 2AOVA 1KYXA 2PEZA 4E2ZA 1OI3A 1DAIA 1G5HA 2FSSA 2W83A 4ZANA 5HVNA 5JCOC 3DMHA 5L4LA 2NZYA 3BRWD 3W04A 2P27A 2J3KA 4PYOA 4GECA 4MUMA 4CHGA 4HEA6 1Y3CE 4R2MA 2RCYA 2PZAA 2ECOA 1FRQA 3B6EA 3HADA 3PIIA 1FLAA 4U9IS 4B3MB 2CFSA 2YZMA 3WB1A 3PFBA 1WULS 2DWOA 3PFWO 2R6R1 1C0KA 2V7WA 2W93A 3CPHA 4IV0A 3P27A 5BSKA 3HHEA 4YHHB 5KAPA 2RHMA 4HQOA 5HIJA 2I54A 4LJAA 1M72A 5AK3A 5CVTA 5LQKA 4RABA 3GNLA 4XJXA 2BGKA 3RUFA 5G4LA 1OH8A 1A5SB 3W2HA 4FXPA 4KR6A 4BNLA 4PN3A 2Q1YA 3NIDB 2I6GA 3HKDB 4I1UA 5IDXA 4GU5A 3R3HA 4ZO6A 3THWA 3EQ7A 2R8BA 4E12A 1N6KA 4HDAA 2BUAA 3F6PA 4D42A 5D5QA 5C52B 1N5IA 3ABIA 4AYWA 4R31A 1AS2A 3O8LA 1QQBA 4ADSG 3GA0A 3PNBA 1CRWG 2IV7A 1NVKA 2WT4A 3IJRA 4PQGA 3UAXA 2R62A 4REOA 1N36B 2ZE5A 1GPAA 3D7SA 3LCMA 2GZ2A 2O2GA 2VUIB 1IBKB 2G1PA 3O2SB 5FAXA 3OTWA 1KSFX 3ACCA 3CNLA 4I9GA 2YJ5A 4P98A 4ZVQA 2MTBA 3SXJA 3VYTB 4DPKA 2V7PA 3Q4GA 2I7XA 2ZAYA 3KFLA 4P53A 2CV0A 2W2KB 5LLDA 1DXQA 2ATXA 4OIMA 1I14A 5DRTA 2AZMA 4R81A 4A8PA 1YCFA 4BQNA 4F04A 4JNCA 4A92A 3OUUA 5FL7A 221PA 3R7LA 4DQ0A 2P8JA 1Y3HA 3EJWA 2DBRA 4ER0A 5IG2A 1DAPA 2OP0A 2QM0A 2SCUB 4LZAA 2JJ1A 5FBVB 1ESMA 1V8FA 1J99A 1FQKA 4DDWA 2I2CA 4DLNA 3TNDA 3ZDRA 1MJ5A 1VE7A 4M9UA 5LPNA 3IE0A 3KXDA 3RSCA 1XJWA 2GCEA 2O14A 2G9UA 2XCIA 1QHEA 2YWHA 3AOEA 3NG1A 3NO4A 4FBMA 4I3HA 5LUAA 3IT1A 3FVQA 3QM1A 3SSOA 1AXRA 2RC5A 3LHKA 4FFBB 3HTXA 4NFSA 4UBOA 1EHCA 4V39A 5LMUB 2BKAA 1XDUA 1Y7IA 2XCUA 3SD7A 5A9SB 3RFXA 4K6CA 4GPEA 4LBVA 2Z9CA 4B32A 3PGVA 1PR9A 3R3SA 3GCWA 4QUDA 1VJGA 4U2GA 5IMBA 4XLLA 3SJBA 3B3FA 2XUHA 3TI9A 2V6JA 4QE3A 2ZIFA 4Y2XA 4FYVA 2ZJ6A 2GK4A 1IXKA 3SOZA 1GAEO 2AOUA 2WF7A 3D6MA 3EVTA 1KQNA 1KRHA 1W8DA 3UUWA 4PLWA 5C7LO 2ZDQA 5KREA 4N3AA 3IKJA 4R6XA 1E62A 1WDLA 1F14A 3QBEA 3DVLA 1XJ0A 3PG5A 3RLIA 4F21A 2J85A 1SCBA 4JJ8A 4BMVA 3R6WA 2PR2A 2XRMA 2Z8ZA 1DRJA 3KOMA 3RK1A 4US2R 1EXVA 1XI2A 2NU6A 1AQIA 3DNPA 3WAGA 2NU6B 3A9SA 3WLQA 2YXBA 3KQHA 2H31A 4ITUA 2UAGA 2F6RA 3BXHA 4GXRA 3GGPA 1JYEA 5CB4F 2FVXA 2Q3MA 3QUCA 4PYQA 1KVUA 3DCJA 3M6XA 1J0CA 1V8OA 3ZZMA 4GKAA 3PHIA 4EELA 2Q0QA 1FUKA 1P18A 1T2AA 4N0PA 3DEZA 3VR3D 4MRSA 2IPXA 3CLHA 4CJXA 4C0LA 4MYTA 3K2QA 2B61A 1NDUA 1U8AA 2FPXA 3O3MB 3PX3A 4GXNA 5F2KA 2X2OA 4TLMB 1EGAA 3JR7A 3DPSA 3CW8X 3DR3A 2XRYA 2ZTUA 3LKVA 3VPAA 3WMXA 3FYHA 3DE1X 4IX9A 4HL6A 3AUAA 3LZDA 3WGHA 5I4IA 4KE8A 1YONA 1CY6A 2PBLA 4LOLA 4XD7D 1F3LA 4KE9A 3D7NA 4B3SB 1MT0A 1PT9A 2C7GA 3UFXB 1U0SY 1EP2B 2I71A 2PUTA 2ZKIA 4QXAA 3ZXSA 3CT6A 2W6JD 3A1TA 3KEFA 3TXYA 4YMHA 1AURA 3OQOA 4CLDA 1M34A 1P77A 4IIYA 5DM4A 4X62B 3EC2A 3U7IA 2PAFA 1FTWA 5IDQA 2AXQA 1DT5A 2P67A 4LRSB 3KYDA 2RK3A 4TS9A 4WACA 1YA8A 2G76A 3RSHA 4ENQA 2GAFA 4KOAA 4JLOA 2YOHA 2GRUA 1T2NA 3N39C 4YDHB 4AT1A 1FFSA 3RVNA 3BCHA 2FEKA 4M2LA 1SC1A 3O4RA 4Y3UA 2OQIA 2VA9A 4CQMB 4R7GA 3VDMA 5ILOA 1EMDA 3LYLA 4RMHA 5G1NA 5FBLB 4G0PA 2W8ZA 5EY5B 1C29B 3CRRA 5KTNA 3OWXA 3BBLA 4F4UA 4RXMA 3TKLA 1ZAKA 5AVWA 1CY1A 3DMGA 4B84A 4QDJA 4CKBB 4ETMA 5ALVA 2PQ2A 1SKQA 2CZQA 4IFBA 4MRAA 4D0RA 4Z2AA 2BFDA 5A1JA 1IULA 2PZFA 2J41A 2SICE 2SKCA 2WFMA 4ZTZB 5MFPA 1SH7A 3FROA 1GL9B 1D04A 1K75A 4RPGA 2ZYIA 1W59A 3QELB 5E9JA 4L08A 3X1YA 4E5KA 1A2OA 1GQRA 1PJBA 3BDAA 3ETJA 3G9ZA 4HNHA 1U1DA 1M0TA 1OA1A 2COKA 2I6TA 3NHKA 1RZ3A 1X7XA 2P2ZA 4IX1A 4G85A 4WERA 4MIYA 3PQ3A 3NBMA 1LTKA 3L84A 4ZVLA 1II0A 1O5OA 3RYCA 1FIUA 2B34A 1EH5A 4B7UA 1D5CA 2QX7A 3VSAA 3DV2A 1MA0A 3EPKA 1L1FA 5JLAA 1QG4A 1Y8RB 5TT0A 4MHSA 1WO8A 2AKEA 4XCQA 3OZEA 4TYQA 1I4DD 4E1BA 4TLCA 1OLUA 3AR5A 3L7DA 1BEZA 4WXEA 5I47A 1CQXA 1OLUB 3TF5A 3KXLA 3LDUA 3SF0A 1PE0A 3RT7A 5ICGA 1KJZA 3IEKA 4QU8A 5K3FB 4WWHA 1WZUA 2O0LA 3PWSA 5JYCA 1DDOA 3A4IA 1HZJA 2ZXUA 2BFOA 2BHRA 2OG2A 3CSDA 3H19A 5EWJB 5FR2A 3RK4A 4CEIB 4JOCA 2RG1A 2EZ8A 1B6GA 1EVQA 1D7OA 1UK8A 2GZDA 3DOJA 3OG9A 1E9RA 4TXHA 1FS4A 1SQ5A 5JPIA 5B58C 4TN5A 2MSEB 4ZVKA 3UPTA 5E6SB 1MRNA 2H4JA 4PO9A 4YA6A 1SELA 4P4SA 2GPJA 2B0JA 3KB1A 1SRRA 1L4EA 3PUVA 4R1MA 4V0NA 4GR5A 1V0JA 1PR6A 3HJBA 1KE2A 3E7XA 3BXFA 1Y9ZA 5IT4A 5L4SA 1QGOA 2VDWB 3CG4A 4WTOA 4LXXA 3A6PC 1U9CA 4IW3B 2NN3C 4OHRA 2E4ZA 2IY9A 3ADOA 1WUJS 3HEBA 1WHSA 4DA0A 1P4RA 1WQ1R 4TRNA 1MGPA 3AB8A 1T24A 2EARA 1D4OA 4JJAA 2PH3A 2QGFA 3U09A 2FRXA 4YJHB 4RJTA 1NW3A 3NEAA 1X94A 2Z4TA 3HR8A 3I04M 1ZUHA 2I4RA 2YZKA 1E98A 5ALHA 4N41A 3J80A 1BE1A 1ULHA 2FN3A 1U6KA 4WBNB 2VWHA 4PLCA 2QRZA 2QYSA 3SLGA 2C5FA 2PGOA 2WUDA 1GRRA 4AKIA 1BGXT 2YC4C 1R6AA 1T43A 1I30A 3IHTA 5F35A 3UJ7A 2HT1A 2QI9C 4EI2A 1KWGA 3QIVA 2A5FA 2LDBA 2NOAA 3H11A 3H5TA 3KS9A 4KCGA 3KO8A 4MW0A 3WFIA 5JWOA 3SQLA 4KO8A 3OT4A 3QEMA 4HWOA 3VVBA 1Z74A 1Q15A 3EUWA 1PJ3A 3CH4B 4OSPA 4P35A 4J2HA 4XR4A 5AXDA 3QHPA 5A3VA 3BJRA 1CDZA 5JQGF 3FPHA 1W35A 4QTXA 2EWMA 4D8VA 4IEFB 1DC3A 2BEKA 1X9IA 4MKFA 5IUJC 3N0RA 1BE6A 4XPIB 4FGJA 3G79A 1PL0A 3L0OA 4HQ0A 1L7OA 2WUEA 2O06A 2XUGA 3BHNA 2LW7A 3THYB 4XGIA 2OMEA 4J29A 5EXDA 1HK7A 2RDMA 5GONF 2EBWA 1K3FA 1Z7WA 3ITKA 3QA9A 3PQ7A 4LZOA 4RY0A 5IMSA 2C3OA 1OFVA 1Z7YA 3FNIA 4JI1B 4KACA 5DTIA 2G36A 1AV6A 1KNQA 1U80A 4EG0A 2HWKA 2RGCA 3NHPA 2IIQA 1WAMA 4LN1A 3I6BA 1D2RA 3ZBPA 3R24A 3R6GA 4AZWA 3KPVA 1N0WA 5DI3A 2OV8A 2JHPA 2VDOB 3UGTA 3AR2A 3QLVA 3EZXA 1TU4A 2OFPA 2JCVA 4K9QA 2Q5JA 2ZBVA 1K7EB 2ZXEA 3JWEA 1SQ0A 2HLHA 2IH4A 2ZRFA 4U8HA 3PNYA 3K2IA 3WRVA 3WYBA 5JMTA 5FWDA 5J2TF 1BCSA 1KAHA 2QPLA 3QMPA 2DLCX 1CEQA 4UUMA 3AB3A 3ME5A 1Y4UA 1ZC4A 1P4GA 1IXYA 1ETUA 2IC5A 4IIXA 4K8RB 4EVSA 1EUQA 2BH2A 3JARA 5H02A 3LDAA 1I7PA 3JARB 4G5QA 1B2RA 2ICAA 4RDIA 4MQFB 3UK1A 3QVTA 4HAOA 2CMGA 5H5JA 2AX4A 4F06A 1YR7A 4PSCA 4IFEA 2VSYA 3L6DA 4DWWA 4D81A 3IPRA 1S4MA 1IM5A 3LRPA 1RJDA 1RI3A 2F64A 5AI4A 4F6LA 1K88A 2IELA 2MYNA 2V7UA 4MXDA 1DIGA 3NYIA 3SMQA 1K7FB 4D56A 1COZA 2C3YA 1E1QA 4ZAGA 2R47A 3W2IA 1E7SA 4G0MA 4NBRA 3FYUB 3VJRA 2NZJA 1J5EB 4DNPA 1UJ6A 4H3VA 4B4UA 1IHYA 3QSYA 3WGTA 5I7UA 4DNQA 1DO8A 2DG2A 3G2OA 4KDCA 3GLIB 1C9JA 3WGJA 1IN4A 3UXYA 4DBLE 621PA 4TSFA 4IVNA 1OLXA 2WYHA 4RZIA 2H2WA 5JMOA 2NGRA 3C6MA 1QFYA 1WE2A 2W22A 2Y6UA 4R3WA 5C34B 1G6KA 2FETA 1WKVA 1YRYE 3A1EA 4LVOA 3LQ4A 4ML3A 2DUWA 2FSVC 4CIDA 1PQUA 4NV0A 2AFHE 3O1LA 16PKA 2ZE7A 4TVOA 2XMQA 4MUNA 4BFWA 2PTGA 3HFSA 2Y0BA 1CDEA 1PUIA 3K16A 4H17A 4BX8A 5CAEA 1AQLA 1MAWA 6NULA 2ZATA 4KYUA 4OI0A 1DWPA 2I4NA 2NX2A 3DZHA 1GU7A 4NMMA 2HA5A 1EFRA 2JJYA 3C6QA 3EOBI 1GQ2A 4YRPA 3N2IA 1Y6RA 4TKLA 4YRTA 4EMTA 3AIOA 2P3SA 3BMQB 4TZKA 1A8UA 1JPJA 1JP7A 2W2LA 3AI7A 3KHTA 3P5SA 4GOND 4JBLA 1DC8A 4LYHA 4MPRA 5TSDA 2B8WA 5IK2D 3TL3A 2OOKA 2YJ3A 2QD5A 2O19A 5AM3A 3MJDA 2CUKA 3D3WA 2CJYA 1JTVA 1ZD3A 5AK4A 4B76A 2Z2IA 1L4FA 5CTAA 3U44A 3PHHA 4PR0A 2F1KA 3FVVA 4LY3A 4MB2A 1O8BA 1HZZC 3S7TA 4HV4A 2WUVA 2YIMA 1LD3A 3SE0A 1E1CB 1E32A 5A4DA 1GTG1 5A4MS 7MDHA 2YYZA 5AVRA 1WV1A 1SC3A 2MSCB 3E70C 3GEBA 1LK0A 4MPJA 4WMLA 3QXJA 2ALJA 2I6SA 3AKEA 5DLYA 2HJHA 3GJ8A 1Z15A 2Z2YA 4EG5A 2EZ9A 1GPLA 4UNPA 3UO8B 3GFRA 2P41A 1A7KA 4Y0VA 3AFOA 5LU8A 4LDRA 5DNAA 1THGA 4R9UC 3UAGA 5B3JC 1GV1A 4ZOLF 1KERA 2KPOA 3VFDA 3R9XA 2W4QA 5JNWA 1TJ5A 1MV8A 1SU6A 2GXUA 3T5GA 4MKZA 3LK6A 1RYZA 1Q74A 2WAOA 4KGZA 5BSHA 1G38A 4PZ9A 2XX3A 5L7WA 5E1DA 2E48A 3WQHA 1YFKA 4M1ZA 1NMQA 2PT5A 1KA9H 4OHFA 3X1WA 2Z5LA 2LKCA 4ZV7A 1WU8A 2QR3A 2FZ5A 1LQUA 2FF5A 2OCPA 4ARUA 4EOGA 1FZTA 1HUQA 4NBTA 4JWKA 2PX6A 2PV0A 1QUEA 2VTKA 3ECAA 3R23A 3SFZA 3DQQA 3WC4A 3NHLA 3TRDA 3BZUA 3NFRA 1IH8A 4ZO9A 4CTJA 4EFLA 1E1MA 1Z4IA 1FFDA 3LZ6A 1ULSA 3CUSA 5ARCA 1UJ5A 1VG9B 2C97A 2EQAA 3NIFB 4KODA 1FPQA 2JI6A 1ZD8A 3IODA 1QZ3A 1L5OA 4QBTA 4JI8B 5A2GA 3S1AA 3CCFA 2IX3A 3I09A 4E5VA 4EA8A 5IAJA 3UG6A 1D6MA 1GGHA 4AY5A 3G9TA 1UQTA 3A0UA 5I9MA 2VUHB 2YC2C 3QV2A 4BE9A 4Q3BA 4JBWA 3BRWA 1TT5B 2BZGA 3HKEA 1EQ2A 4HAXA 3MWDB 5C9ZA 3TECE 3LT5A 3O83A 4YP1A 1TPZA 3LUAA 4IIJA 4DWOA 4BU1A 4C43A 4RKRA 3OPYA 1WOYA 3AEKB 4EHIA 1M6EX 1V7CA 1ZUNB 1I1OA 1NN1A 1IN8A 1X1TA 1KBOA 3AP2A 3QXSA 4OMUA 2EP8A 5K4HA 1G60A 1U0OC 1GXSA 1U3DA 1W46A 1T3TA 2W7TA 3A2LA 3EFBA 3NJRA 1E8MA 1K97A 1Q0LA 1R0YA 1XQ1A 2FA9A 2UUPA 3GMDA 5HNKA 3AW8A 2HU7A 2CDCA 3QLUA 4M9SA 1QE0A 1YOVA 3JYQA 5EKTA 3WOHA 4KUGA 1N33B 3V9AA 3I9MA 1BJTA 2XI4A 3AERA 1NBAA 4IHKA 3ORFA 2M6SA 1H66A 1GPDG 4A2QA 1UJ4A 1LX7A 1U1IA 4I1SA 5TJ9A 3UC9A 3ANMA 3BZBA 3QKSA 5LB4A 4H6PA 3Q3IA 1I4LD 5CGZA 4RLSA 5MHTA 1MMFB 3B6KA 3HK2A 2OC4A 3MTIA 3T3PB 2Q4EA 2W4IA 5DE3A 5BRAA 1J2TA 1JA0A 2OC9A 2P4EA 2GEUA 4FLFA 4LOHA 4P3NA 2A0XA 4WIAA 3WWCA 2X9QA 4B34A 5BV0A 5AUNB 2YINC 1GD1O 5KBYA 3ES9A 3DBOB 2ZCJA 2ZRBA 4K0KB 5KNDH 3LWZA 2XE6A 5HIAA 3B5IA 2CLDX 1TPYA 3QPCA 4DMGA 1Y5RA 2JZNA 2HPAA 4WFKA 5K3AA 1HFJA 1QQAA 4MVJM 4QOIA 4N12A 2XAUA 3IURA 4PBRA 4IQ0A 5TPZA 1PR2A 3CN7A 3GOQA 5ICSA 5JXJA 1JAIA 2LPMA 3N8IA 3NTUA 4CMEC 5I9NA 3M6WA 4Z1MD 4JDUA 4PLPA 2NQ8A 4KFTA 5F3RA 1E3EA 3FLMA 4F6CA 2SBTA 1OBVA 2YRFA 4ZFNA 1SVSA 1E3QA 3I05A 2F3PA 4KQKA 5FULA 4KITB 2OGWA 1VPLA 1NVAA 3COVA 3CEMA 2CYBA 1VG8A 2BCGY 2ZT7A 3PQFA 1UBTS 5ALXA 1BW9A 3U13A 4AURA 3B60A 4PSKA 4P1ZA 2IJGX 2P9ZA 1VE9A 4L0MA 2WTUA 4PLYA 2ZBQA 3DPUA 3KJIA 4RXUA 1IN7A 2ORWA 3G8YA 5GVRA 1O95C 3CLUC 4B3DA 3S55A 1OFIA 1R5OA 3EUFA 3U1TA 3W5CA 4GG1A 2G04A 4M54A 4QNRA 2MYPA 4U00A 3V4PB 1NWHA 4C0SA 4UFPA 2P75A 5GZ1A 1DVRA 2AFIE 3BFXA 3AI2A 3JVDA 2FZKA 4LYJA 2OD7A 3L0CA 1DJOA 5E7MA 3IHLA 5B37A 5CXUA 1USGA 3FVWA 1W0CA 2NZWA 1GFIA 4YJFA 3HNOA 1A4IA 2GHIA 1PZGA 3UMFA 2XIJA 1KVQA 4CMEA 3HCOA 5ALFA 3GZNB 3NLLA 2OHIA 3T7KA 5JH7A 4D8WA 3T5BA 3ZWYA 1BXRA 4EB0A 3WLNA 4RO0A 2HJSA 1IJKA 3DA8A 1LI5A 3KYBA 2CLEB 3O4VA 3PFGA 4XASA 3QW4B 2RGUA 4Y8VA 5UKDA 4XARA 4DCNA 1KF0A 3C7DB 3SJAA 4C21A 1XAIA 4HR7A 4AMZA 1C7JA 1ACJA 1YMVA 2R5WA 3QWIA 1IQ0A 4Y2JA 6PFKA 1Y8QB 2B0CA 1EA5A 4OQZA 1MAHA 4RJLA 5JDIC 3JQDA 3EIQA 4GBGA 4DA4A 1X77A 3KHSA 1UINA 1GPBA 4IZOA 2VNAA 1KQPA 2PWZA 1FUEA 2VHCA 2QK4A 3WK8A 1SNYA 1SQGA 5IF9A 3ABRB 3IDQA 2FMKA 3ZW8A 3VOTA 3MCAA 3H4IA 4HH1A 3TZQA 4OP1A 3LA6A 4QUGA 3OKFA 2AG8A 2DQ4A 3O3NB 1U4SA 2JAOA 4MB6A 3VR3A 4HQLA 5AIAA 4C9BA 3K2EA 1CRPA 1PFQA 3D6AA 4XUDA 1U04A 5CBPB 1DBIA 3B9BA 3FPKA 2Y92A 4MRPA 1EVEA 3SLRA 4BFXA 1QXSA 1XA3A 1HLPA 4WNAB 1EIZA 3V8QA 2RJOA 2HJRA 4YAFA 3T1HB 2DTXA 3H87A 1M6VA 2WI8A 3GQVA 2QRMA 3HP7A 4FEEA 3T7CA 4IUDS 4MWZA 3E82A 1JHRA 2W0SA 4XD7A 4ZREA 5KX5F 3JD1A 5CLLA 1ZGBA 1XMVA 3PTLA 2B3TA 4WLNA 4EMUA 1P2BA 4G07A 5LYJB 2JJ2D 1LPAB 4QO7A 3SJUA 3V4ZA 1W75A 2P4SA 5AJTA 4LZWA 1C9NA 2PH7A 4KQCA 3A70A 4A0SA 1KBQA 4BB9A 1P45A 3WAJA 2OO7A 2Q6LA 4DMKA 3D8BA 1YZQA 4A6PA 2DZDA 4H6VA 1TT7A 1DINA 3IPLA 1F2UA 1XEXA 4ZVRA 5JI3E 2YXEA 3ECCA 2PKCA 4I4TB 5NULA 3MYRA 3QE0A 3N2ZB 4Z0HO 4FDUA 1Q0SA 4TXLA 1JHUA 1T2CA 2B20A 3AF4A 4NU0A 4ZQBA 4JQZA 5IANA 1N78A 1XZHA 1XYGA 3GJSA 3W5UA 1TJPB 4EHAA 3KELA 4WECA 4OHOA 3U7QA 3JWJA 3ZCTA 3QKUA 4BVJA 2WG2A 1LBIA 3DJYA 2WHRA 4HOYA 1AX9A 3SHWA 5AXAA 4RZHA 5EEHA 5TF4A 4NEQA 5C81A 2P7IA 3P71T 1RMYA 4IXWA 4NCXA 1QAOA 1YD7A 5L3QB 4HUJA 1OLOA 3QVXA 3RHZA 4C6TA 4E11A 1O54A 1SHLA 4DY4A 4JEIA 1IRXA 1CUCA 4KDRA 3TJMA 2IZ1A 2JKVA 5IJ9B 4CQNA 1C0PA 4NQRA 5HFJA 5CG2A 3JQ9C 4X6UA 1H4SA 1II9A 3LW7A 1WHTA 5LCXA 3E18A 3TNJA 2VTDA 3BDIA 3NWJA 4DCJA 4D6YA 4I50F 1YDEA 2FHSA 4NNPA 3WGMA 1UDBA 2WDPA 4OXRA 4GX1A 5GOTA 2JLBA 3K9WA 1MTZA 4BATA 1HMYA 3OKAA 3OM1A 4Y1GA 5E38A 1G20A 2YMPA 1JHPA 1ZXLA 3QMMA 2O2JA 3CV3A 3RVMA 3IAS1 3ZK9A 3DTVD 1T13A 2DJIA 3EULA 2C3UA 1YBVA 3I52A 1X0VA 1FU4A 1U98A 3TQCA 3QPBA 1JQEA 4LYDA 2F3RA 5ALZA 1P7YA 2H07A 1ZFNA 3LX6A 2WJYA 4ZI7A 4XQEA 4GI2A 4ZVTA 5CDUA 2VRBA 3DULA 5KJCA 1AA9A 3DHEA 3F96A 3JYLA 3KXKA 3N07A 2C2KA 1JECA 3ZUPA 1M73E 4Y9DA 4I8XA 3T9BA 2EWVA 5IVIA 1EFUA 2ZSUA 3H9JA 4XWYA 5DULA 3HCBA 3HCEA 3R3XA 1R8XA 2IW1A 3HFGA 3NP9A 4E22A 1I6MA 3A58B 1NXSA 4BO1A 2OCKA 2ZYDA 4KWCA 1SXIA 3K1ZA 5CIQA 3SXUB 3ZE9A 4W1QA 4ECAA 1ID1A 2FP4A 3PJDA 4KJZA 1C7EA 5FOSA 1CULC 1YZFA 2A1IA 4RENA 1XMQB 4NCKA 3B7PA 3QKWA 3V55A 3OZXA 4RVDA 3F4KA 1HLFA 2G70A 3IULA 2DUUA 3DCYA 1L8QA 5ELMA 1JT2A 4GKVA 1G5IA 5C8ZA 5K45A 3LGXA 4G5SA 1II8A 4II3A 1VJ0A 3HA5A 1XKQA 4R1SA 3GW8A 1TZMA 4TRRA 4Q18A 1QIHA 3K6SB 4N3CA 4JLWA 1KY4A 2GVZC 3TFOA 1LTHR 3H7IA 4GPBA 4UUBA 3H2YA 3BUSA 5LBUA 1NV8A 3O1JC 2P6RA 1RBQA 4PWYA 3Q1KA 1XYYA 1NASA 2FEOA 3EWAA 3UENA 1NXXA 5AW7A 4DIOA 2Q1WA 3O8QA 1B26A 3BL8A 4ICIA 1ULBA 1FQJA 1BRMA 3LDHA 4KIGA 5DF1A 5KYXA 4FOPA 1K0UA 1DKRA 3TW8B 3PEEA 2F9FA 3QYPA 2G9NA 3HFRA 5GM2A 3KYCB 2W0MA 4RHXA 5CYOA 2W9XA 2WTNA 4UAJA 3SKVA 1KU6A 4DLUA 1L1QA 3AU9A 1X8LA 4NH4A 3QHAA 1RHQA 4NZOA 5THQA 5ICMA 2JGDA 1E4YA 1JILA 1I0IA 3NJ8A 2XB8A 1XK6A 5FBWB 3RFUA 5FPQA 1N6HA 4ARVA 2NUBA 5LU9A 1G8JA 2Z5VA 1KJWA 5KTPA 2H57A 4LRUA 3OQIB 1TNDA 3RJMA 1LX6A 3GLKA 1W85B 3KVRA 4M4SA 3ST7A 1QJCA 5LOVB 5JYBA 2VC2B 2WWTA 4ILEA 3SK0A 1ZUIA 1XLTC 2BGLA 3AVQA 4R9RA 1HDGO 4HUQA 2HRRA 5KI6A 1J90A 1E7WA 1R8YA 4DHEA 2REQB 2BH9A 5CNKA 4V1CI 3GLHE 3OU2A 4EJFA 4P86A 3AC0A 3O31A 3N8GA 1KTVA 2QG9A 1QV6A 4R3UC 4D5GA 4PFJA 3ZE1B 2EP5A 1EJBA 4QLOA 5I3ZA 3IXQA 4DIUA 1AH2A 1V4VA 1MJGM 2GYUA 3O2NA 5FP0A 1HXHA 1MIOB 3L92A 1ZDMA 2OXIA 4HT3B 4Z53A 4B3IA 3THXA 4KQHA 1N2EA 4JEMA 1BFUA 4QXPA 2JFUA 4FK8A 1GGEA 2C20A 4CIWA 1E92A 3RJTA 2ZAMA 2OFXA 5C5IA 2APJA 5FO0A 1JU3A 2ZRHA 2RK6A 3L5KA 1WWKA 1E2LA 2HAEA 3DEAA 2VPYA 3CVOA 4CN8A 1NKTA 2EC5A 4V0RA 2XHEA 1N5KA 2WKPA 4IR7A 1YGPA 4ZCPA 5JDCC 3HLTA 3WQSB 3O0DA 1LRLA 4HTFB 4DLZA 3AG5A 4X1KB 4Z3DA 5GADl 5KOJA 1IUOA 1NXQA 2PKYX 3A9VA 2G40A 3B48A 3GC6A 2WDZA 2C4WA 1NBMD 1ZOSA 2O2IA 5AYVA 2ZJ4A 1EVYA 1YCHA 4MR7A 1MB4A 2VNJA 3S81A 2AZDA 1L3CA 2C59A 1I01A 5T4EA 4DKXA 4XPZA 1DBWA 1G3UA 2JJ8A 2D4AA 3IO3A 2XZDA 3A05A 4HDOB 1DIOB 3BERA 3C3DA 4LDQA 4NS1A 1DRKA 3NDJA 4PFKA 5EFZA 3ZTWA 1HSZA 2BFFB 2HMUA 2DQSA 2D6FA 2DULA 4WKBA 5DT9A 1HBJA 1CUAA 1E6UA 2H48A 3QUAA 3O74A 1IOLA 2P9TA 3Q8MA 2E4XA 1XMXA 2H7XA 5DLPA 4ERNA 4JHLA 4K88A 3VDRA 2Q6KA 2RKBA 3ZCSA 5EP4A 1CS4C 2Z2JA 4HDNB 3T9CA 4GOLD 5JBIA 2ZBGA 3RVDA 6ADHA 1RJWA 2QLTA 4PAGA 2NT4A 2CBGA 1RAFA 2VDVE 3ETNA 4V0QA 3T7AA 3UYLA 1BWPA 3D0QA 4K9MA 3V1TC 5H16A 3FCOA 2PFKA 5EIBD 3PSAA 1OTHA 3JQ7B 2YZ2A 4K1XA 3K0BA 4DIEA 3A04A 1JZQA 3DBRA 3JCZA 3OLXA 5GWXA 5M2QA 3REOA 1RHRA 1XAJA 4MS3B 3ROFA 2ZIXA 1B3BA 1EGQA 4YR7A 5FOQA 4IP0A 4NATA 3VPBA 5A7HA 5TY0A 3ANYB 4GXTA 1FP7A 5CA0A 5AJXA 3WLJA 1ZSNA 4FQ8A 5EHGA 4AJHA 1NSTA 2PZBA 2R4QA 1QO0D 2I34A 3D6UA 5J1TB 1B15A 1T5DX 2QXUA 3KPWA 4MI1A 3KOZA 2GZMA 5EN4A 3AI1A 2XYRA 1VHDA 4YP7A 3KSBC 3BGDA 2ZR8A 3IQGX 4CEHB 4IOKA 3T61A 3TOCA 1XUOA 5HJ7A 5SZHB 3CWZA 4W1RA 4E3ZA 2RONA 3CVWA 1WW2A 2ZEJA 3G0IA 2OA0A 1WD5A 1N5MA 1FNSA 1VA4A 2OWEA 1US8B 3G2MA 1JN0A 4K87A 5KNDD 2PUFA 4FEYA 3WB0A 5HW0A 1W47A 1IL0A 3GDWA 3U40A 1WETA 4AF7A 3BGIA 4IQFA 3KLBA 4KBGA 4F4IA 2X0EA 1L5LA 3IP1A 2EJTA 4DLPA 2UZ1B 5JVDA 4RTQA 4ES6A 5DB4A 2G71A 2KB0A 2VJLA 5U9CA 2QRHA 3MFQA 2QY9A 4Y2PA 3K96A 1IXRC 4A9AA 1K6IA 2A7XA 1TCAA 2PLAA 4WK2B 3WOVA 1WW3A 2C77A 2H6EA 1K8ZB 2VBGA 4NMXB 1Z47A 2SKDA 1EFPA 3JAKA 4KPFC 5GOZA 3BB1A 4O8CA 1NLYA 1YRHA 1F4LA 2RHOA 3LECA 1U1GA 4E2WA 5IYZB 1QG6A 1FVOA 7REQA 1A98A 1T9BA 1VBKA 3WWEA 1W4BA 2BM9A 1W5BA 1UK9A 2DPMA 2RGNC 4J9VA 4M1WA 1KZ7B 3EGDB 4I5IA 4RVFA 4DDVA 2FR0A 4OUKX 1PDOA 3TI7A 5IXSA 4ZRMA 1BHQ1 3ZHSA 2XCRB 3ESQA 2XKJE 3LGAA 2HBRA 2RHWA 2CT8A 3E5MA 1RAAA 2WHEA 1NR5A 3RS2A 1W19A 2VPTA 2AA3A 2GPWA 4YI5A 1F38A 5AP9A 1RKVA 3KQVA 3VZDA 2VHTA 3CLSC 4P80A 1F7UA 1KZGB 4OD0A 2ZYHA 2Y1OA 1DO0A 3AXTA 3L82B 2GTPA 3SBEA 3D2CA 1Z17A 2JLQA 3GLRA 3PLNA 3TZCA 1TU3A 2O8FA 2G77B 2WWHA 3NYQA 5I8ZA 4B7XA 4QUEA 1IMOA 3EGOA 4WY8A 4CWAA 4D6XA 1W9MA 2JAUA 2XRFA 3HU2A 3B6JA 2PQ6A 3MN1A 2OXFA 4MINA 4LF9B 1REQB 1QX4A 3LLUA 3ICOA 4D80A 1HFWA 2PWBA 1Y37A 3WGKA 2GRAA 4C7OA 5F76A 3W1WA 3WRXC 4P0QB 2REXB 3A9TA 3DD1A 3OIUA 4AM8A 2PYZA 1RXEA 3EBOA 3BK2A 3UW3A 2RJ3A 5G3ZA 5EIXA 4EGFA 5HOEA 1U5AA 2Y2VA 3AW9A 3IRVA 1EWYA 3NR2A 4FE7A 4M0CA 1AKMA 1JG7A 2P6UA 2GCIA 2QW0X 3GRYA 4PG5A 3TM5A 3QVMA 2PIDA 3EY4A 4J0HA 4QDKA 5EZQA 3GLUA 1Q44A 1XFDA 3RG8A 5JXGA 4JYCA 4RLQA 2ID4A 4U3JA 2AMFA 4NYIR 2D2EA 3H5AA 4EGQA 3H9QA 1DWQA 5E4JA 2OKGA 4UQOA 1JQBA 1KEEA 5ED0A 4Z7JA 2NO1A 2R8ZA 1AF7A 3FD8A 3CW2A 3H0KA 4LISA 4R69A 5ECWA 3TGPA 1YL7A 2A5DA 1LZKA 3LP8A 1JIJA 5P21A 4DUYB 3GUHA 4U8GA 4Z1MA 3ABSB 4OP3A 4TMWA 3RIYA 3VKWA 5LP6B 1OI7A 2CFRA 1XCGB 2VCYA 3BICA 3RAEC 3NH9A 4EKYA 4ZRNA 1H5NA 5BN5B 3ZDAA 2ZJZA 5AKIA 5GGXA 4A8TA 3DMDA 2DFPA 3N5CA 2IKQA 4W7SA 1X7YA 5HE9A 4B5KA 1E5QA 1YS1X 1R5NA 1RIIA 2ZWAA 3GLGB 1OLSA 3JSXA 2XZTA 3HNPA 4EYQA 2WT9A 1G98A 2I03A 1WVMA 3C14C 3OLQA 1L4LA 1MJFA 1KFJB 3RH0A 3GI1A 5EP1A 3IR5A 4PG4A 1J09A 4BECA 3C85A 1XELA 3WZMA 1MF7A 3ESYA 3AJEA 1TVEA 5GJWC 5KNLA 1L4HA 3O4GA 2PIAA 2VHUA 3KAKA 3ERCA 3ZGLA 1GZDA 4AWBA 1W73A 2EBUA 1RI5A 2HIHA 2VQ6A 4L5IA 4WINA 1DWOA 4ASUD 3S8EA 1ZM3A 4KYVA 3SBOA 2C5SA 3GXOA 3FUTA 4L8GA 5BSRA 4BNVA 5IT0A 3H75A 4MW6A 1AC5A 3I45A 3I83A 1PV4A 3KDSE 1F0YA 4F86A 4LY9A 1J8QA 5JZVA 2OO5C 5BYJA 1WUIS 3WLPA 1NNI1 2C4KA 1L4BA 4R54A 3WL5A 1JHAA 3DO8A 1XEFA 4CLRA 1GRQA 3E9RA 4EEZA 2G6TA 2ZI9A 5JCPA 2ODQA 3SZGA 4FSXA 1GPKA 2RHRA 2X0NA 2AKAB 3ZTTA 2CMFA 2YVQA 2HSEA 1WS6A 1YA4A 2P3LA 2PL9A 3LWNA 3MJVA 1ML3A 4ZHQB 5JZMA 1FZQA 4YT4A 2BR5A 5AKLA 2Q45A 5DNCA 4I5FA 1ND5A 1ISPA 4UPEA 5C3MA 4NENB 3HHPA 5LL6P 4IVPA 2O20A 1M7BA 2K87A 4QOSA 4ENRA 5T6BA 3IJPA 1C4OA 3I9NA 3T41A 3INTA 5HKLA 3PNLA 3H1EA 3KHKA 3UMBA 1W2GA 2BFBA 1KAMA 2Y0CA 5DGCA 5JBQA 1ABBA 2FFJA 4OBXA 1OIWA 1XTPA 4X6XA 3X1MA 2OBLA 1XFAA 1DADA 3A32A 3EC7A 4TT8A 4XSHA 2QMHA 5FEMA 4C7JA 2NXEA 3PR3A 1LS6A 1T6ZA 1L1RA 5F4ZA 5CEEA 4KO2S 4KZPA 2QBYB 5F1YA 4JSTA 1O8CA 1H2RS 3EZNA 3RKRA 1I9CA 2ODBA 2JAXA 2OILA 2YJ6A 3BORA 5AM1A 4EW1A 3RS9A 1YO6A 1NONA 5IAOA 3AHDA 4FGSA 1PL8A 1D0IA 4QDUA 3FA2A 4ZDKA 3ZD6A 1OKKD 1MG5A 3O8OB 3CRW1 3AR7A 4I9UA 4BVHA 4GW3A 2PA0A 4MWSA 3RE1A 3CCCA 3ZE8A 1JEYA 4H2DA 2J5KA 1E2FA 2VXCA 1W4AA 3G7SA 3ORSA 4ZT2A 4EK9A 3PGA1 1C4KA 4CU5A 2HMYB 3QEKA 1YB2A 4J0EA 4F9GA 1E5LA 1V4BA 2QE7D 3BH6A 2JCYA 3O03A 2YASA 2QM8A 1X13A 4PSAA 2XUAA 3E9MA 1AB6A 3QFTA 1EUCA 2D06A 3K0FA 3LNCA 5BVHB 1BDIA 2JJMA 2XE7A 1MO2A 5FLXA 1YRAA 4KR0A 1KC1A 3TD6A 3I62A 1Q17A 3W8FA 2BYTA 1MAAA 3OO1A 1FRFS 1Q0UA 2VDLB 3V7WA 2BHLA 2O8VA 2PMBA 1XRPA 1YI0A 4I2NA 2VQEB 3GGOA 3PXXA 3RUPA 3OEWA 2CWWA 1ECCA 1I36A 1QIFA 3GJQA 3KFXA 5IXYA 1JQDA 4UM9D 1SA0A 5FB3A 3PF9A 2QROA 3Q8KA 2HMAA 3WSWA 3SPXA 1UODA 3DLIA 1PR0A 1Z6PA 3LQFA 4WFJA 3IVRA 4JYPA 3HWSA 4DJ5X 4YLYA 2M1XA 2PGDA 1EFTA 3HN7A 1KYZA 4UVIA 5HGJA 4G24A 1H4QA 1ZVQA 4QQKA 1UZMA 1YE3A 5AD1A 3QH4A 2VJDA 4G6ZA 3S2IA 1G63A 3F97A 3S2SA 1DUVG 4N01A 4CM5A 4M83A 5ESXA 1V5WA 2IQ5A 1DAOA 3K53A 1KJIA 2J5QA 1UBSB 4H35A 3WV5A 4JT2A 1IU9A 4BO6A 4XUEA 2IITA 3W9YA 5EJ8A 2B36A 1LC3A 1GGJA 2QRVA 2VDPB 2QE6A 4N7MA 2WSSD 3KQYA 4FC7A 1QCZA 3I9V1 3LHSA 4X0EA 4I81A 4OHYA 1ZZGA 1SC9A 1ZKDA 1B73A 1RHJA 3G5LA 4OA8A 1MCZA 2G72A 1ICIA 4UBIA 5SYNA 1YVPA 1G8GA 3K0AB 1FMFA 2FCAA 1QRAA 3DTVA 3QPUA 4DPLA 1EFKA 4UBNA 1Q1BA 1G7TA 1L5WA 3N75A 1QR2A 4GUDA 4TTQA 3ICVA 3V4VB 4DJFC 1OH5A 1QH0A 5JCOA 3VSEA 4IJ5A 2CVOA 1ZMRA 2FSFA 2AK3A 2Q3FA 2IEZA 3OBIA 3SZUA 3J81k 4EB6B 3RT9A 3FNGA 1QZUA 2ARKA 1TQHA 3QVGA 3H6GA 4G0NA 4RQTA 5BNTA 3UPUA 2R8YA 5K2OA 1P0IA 5AHOA 4XUCA 1EUYA 5JTTA 1TX4B 3FTPA 3O7MA 2X23A 2B21A 3B53X 3HWX1 4Q7MB 2BR4A 3LLCA 3LCJA 2W8BB 1VDZA 4IBOA 3GJ5A 3ILHA 4H59A 3LL7A 1UMBA 5EQTA 3TQFA 4E5MA 4QT4A 4JL5A 5EKSA 3QI2A 5B1IA 5LZ4A 5KVVA 5FORA 1YC2A 2FWMX 2VOEA 2XA9A 4RSMA 4L9SA 4DXDA 5KYWA 3WQQA 1ZI9A 1MO5A 2C2XA 2YWRA 2XGJA 1TW3A 3GNSA 3P1JA 5L3ZA 2K6GA 1RADA 4FW8A 3OOSA 4H0CA 2OXTA 3RRJA 3VU0A 4JBHA 4C4AA 1SUIA 1Y3IA 3TBFA 2XZOA 1Z26A 1X1QA 3RASA 3R8FA 4OLAA 1KPIA 1C0IA 3LP5A 1E5XA 2N3ZA 3FE2A 4JP8A 5DYNA 3AEQA 1AMUA 2ZSAA 2CKMA 3PUJA 4XLZA 2BT4A 3VU1A 4LCBA 3UWKA 3GUVA 3A0RB 4AJPA 1RW4A 1V1MB 3M4ZA 4F4FA 2H1OA 3ZYZA 2RGBA 4MA0A 4XQCA 3H0EA 2O57A 4OTZA 1KORA 2WJJA 1E7QA 3T12A 4A91A 2VK1A 4BO5A 4F92B 1IN5A 2VBCA 2HJVA 3MLBA 3ZNPA 4WBNF 3IBSA 3WL7A 4HC4A 1TD1A 1UFVA 1S2DA 1M5TA 4B45A 1RD4A 4TMXA 4B4VA 2IT1A 4C0QC 4R05A 1X3SA 3NPAA 2IS4A 3INGA 4PRKA 1DV1A 4G84A 3GPDG 5REQB 4D9CA 3PEYA 1ZW6A 2RSLA 4LHZA 4UCXA 4IMRA 4JJKA 3L7YA 2NUAA 3GRKA 1NR7A 1QH8B 4QEDA 3D6TB 3FYSA 3KTAB 3ZGZA 1FQOA 3EY9A 4J3JA 1A7UA 4F3TA 2DHRA 3G89A 2VDUE 3WNBA 1E20A 1PNQA 1WXWA 2P5TB 3CW9A 4YT8A 3WX0A 2QHXA 5A5EA 2JEOA 4AWXA 1OXSC 4P3KA 1ZRSA 1QZZA 3G0GA 4DCCA 4ZK2A 2DQKA 1XNQB 1Y8AA 2F3SA 1O95D 1E3LA 1NJ1A 1G8MA 2GM9A 3CLUD 2WLTA 1LNQA 4HLUC 1CUJA 1JQKA 3MUFA 3WZ2A 1AGXA 5H80A 5CXSA 4E32A 2I8AA 2VSNA 3OZGA 2Y77A 3ELDA 4JB0A 2WMNB 1DMSA 4NK5A 4IEIA 4YRMA 4RKEA 5LQMA 5KYYA 2FMUA 5CNJA 4NJEA 2VCHA 2Q5FA 4CFSA 1KFCB 2OZEA 3EAFA 3P2EA 1TEXA 1GZ4A 2JB9A 3EGIA 2E9SA 1SUBA 4QUHA 4AICA 2AVDA 4GWKA 5ADWA 4JI7B 4E09A 1LNSA 4FOLA 2QLFA 1B1AA 3B12A 3W6UA 1BZYA 3BWVA 3VGJA 4OBBA 1E3SA 5I9TA 2GAIA 3EXHC 3VYVA 2B5WA 3LD9A 1PV1A 1VE6A 4FZVA 5DX8A 4NHOA 5CFPA 1Y63A 3RTAA 1Q2XA 1T6YA 1FU8A 2XTZA 4BNZA 3IPXA 1KMIY 3OTGA 1MXHA 1S2OA 2A1UA 2OBMA 4RDXA 1EM8B 3JSAA 4C4YA 3KT6A 3HUTA 1UR5A 5EC8A 3WV4A 2JLWA 2QLBA 5AVSA 2YOGA 4RJJA 2BTOA 1KY3A 2ZB8A 3IIMA 3WIVA 1IN1A 2Q4DA 2YNMA 5I7FA 2I7VA 1QYRA 3C5HA 3SGLA 2ATEA 5EE0A 3OQMA 3KOYA 3CNBA 4E03A 1UAAA 3PS9A 3PR1A 4A8JC 1NBMA 3JQCA 4FLMA 5L53A 4B17A 4YAOA 3EYAA 1JE0A 2I6UA 2ZSIA 3PXEA 1R12A 5CT8A 1MNAA 3ZTYA 1D07A 1FUIA 3BJMA 4O2LA 5DGDA 3T5CA 3U48A 2Q21A 4UOEA 1ZOPA 2J7KA 5DBEX 3HO8A 4FNMA 3A4YA 1KJ9A 4NHEA 4QYSA 4RFVA 4PEVA 5TQ2A 1OTXA 4GOJA 3W5HA 1NI5A 4DF3A 4IOJA 4N0EA 5FNZA 4UMDA 2AEFA 1C9DB 5LDGA 1QRRA 2HSGA 1Z4QA 2I1QA 4F9TA 3AGQA 1GNSA 2B2NA 1HH4A 4DA7A 3ZZ1A 5LKAA 2OUIA 4PNPA 3SC6A 4AP9A 5DZSA 1R6XA 4UC0A 2FZEA 3F98A 4HDMA 1CPYA 4IRUB 3G3EA 5SYAA 1JS1X 3AM4A 3EBPA 4N03A 4B43A 4BGDA 1UKYA 3PX2A 4R9NA 4H3SA 3UOWA 5BV7A 2AIRA 2UUAB 3K9NA 1VPTA 3DOIA 3LOUA 3W8RA 4AZ0B 5EVCA 1IPFA 2DR2A 2IIBA 1PK8A 1UMDB 3WYCA 4YH1A 2NIPA 4BRSA 2IBMA 3VPCA 1E59A 3ZDYB 1XCBA 1W5EA 3ASVA 4HVTA 3ZS8A 4F4HA 2QP4A 1IB0A 4GBMA 5LBIA 1XT6A 5BWOA 1AJEA 1BGVA 1ACLA 4G5GA 2J0SA 4ZEOA 1ISHA 2LWIA 1W36C 1AN0A 3PDIA 4RVHA 5L6LB 1NYRA 3KKNA 5A5VA 1G42A 1W2HA 3PDIB 4PO3X 2PR7A 4EM6A 1C50A 3ZXIA 1N32B 2FMTA 2X5JO 1DZIA 3WDSA 4KXUA 2BKUA 4H60A 5C2JB 4NF2A 4S12A 2AHOA 3G85A 4FFMA 2JIPA 5EJ4A 3VR5D 2P9JA 2L19A 4IQ8A 2AXPA 4IIGA 4C01A 5A06A 2Z1MA 4GOMD 2UVPA 5HFAA 4MWGA 5E1BA 2D0DA 3M5WA 1T3LA 2C29D 3WXMA 3FHJA 2MR6A 1Z45A 2J0UB 4M0MA 2CLCX 5JWRA 5KNDA 1JDPA 4FHGA 4ZK6A 1UC5B 2HJWA 3ZDFA 3RSZA 1U5BA 4OGFA 1A0OA 2NO9A 2NSHA 3MJSA 3VNAA 1R88A 3MTQA 2OSBA 2X19A 3NEJA 4NL4H 1SVKA 1VJDA 2YJZA 5IBQA 3CR8A 1RWQA 1LY1A 1ECGA 1GGKA 1SFRA 2I2DA 3AFGA 1KK1A 1ATZA 2C1EA 1Y34E 1ZZEA 3NUGA 4JT8A 4KZKA 4ETIA 1BXGB 3OMLA 3HG7A 3BWCA 4TLEA 1E9FA 3I1IA 4G9EA 4W5JA 4DV0B 1QUFA 3A6GA 1UMKA 4S1VA 3TRHA 4ID9A 1HFEL 3PQCA 4NXNB 4LZNA 1N6RA 1BS1A 1FYVA 1HMPA 2V9CA 4CG2A 1YZGA 3Q7SA 1EI9A 3EVEA 1M2OA 3LQQA 5J63A 2DWPA 2BI7A 1V8BA 2GS9A 3PXCX 3PRJA 1FDSA 1S3IA 4ZAYA 4WY5A 4XJVA 1J0AA 2EW8A 3D43A 1O3YA 1DBSA 4WUVA 1CJKC 4FUTA 4W5NA 3A9RA 4R9SA 3PDUA 4LQ4A 2OE2A 1S7CA 1SHUX 1TJ4A 2FUG6 2QTZA 1K6MA 4N7JA 1PO7A 4N7RA 1N77A 4MWEA 3WI7A 4TMTA 2NNLD 4K26A 2IOQA 3AT1A 3KAQA 2J7PD 1AUXA 4TWIA 2GGSA 2ZSBA 3HDJA 2VEDA 4XTCS 1SXGA 2A9RA 5E3IA 3C70A 1SPXA 5BYAA 1QMPA 1SAYA 1YGYA 1YZTA 2G28A 4Q3OA 4DQLA 2ZRJA 5CFZA 2FZLA 3QXGA 2V4ZA 2QR5A 3S68A 5H70A 3DB2A 2R6GA 4JU9A 5JJCA 4MV7A 1VIDA 2G9RA 4Q4HB 4Y2VA 2YVKA 4C04A 1MQAA 1XF9A 2KI5A 3OF2A 2L17A 1TK2A 2ORVA 1ZK3A 3HXQA 3LT0A 2GB4A 3PDCA 3WIEA 2H4HA 3LUCA 3FFTA 3VA7A 2JFHA 1SXJC 2B4AA 1BC5A 2C94A 3T06B 1V11A 2NZXA 1WZ2A 2Z3WA 1Y9EA 1XQ6A 3OEYA 1EP9A 1E4EA 2CNNA 4KHZA 4OHPA 2NU7A 1ZD5A 4BX2A 4OVKA 5LMZA 1NVXQ 3LUJA 4BIMA 2V55B 3STYA 1THTA 3TLGB 2J9GA 1L5YA 3NPMA 3ZBTA 4FOTA 4NDZA 4BEBA 1E2IA 3BEOA 2WVJA 1KHHA 2Q5HA 4E21A 2Y66A 4KR9A 1AUQA 1N9GA 4G4JA 3H17A 1JMVA 5AM4A 4Q7QA 2GK6A 1A2BA 3UWPA 3E5HA 1XVLA 1R4MB 3FM9A 1L6RA 3LO8A 2VNKA 1M1NB 3OQNA 4IDAA 3OIVA 1FP6A 4INAA 2I3GA 4WE3A 3ICPA 2XYPA 1X2EA 3F9RA 4HWTA 1TIPA 1T4DA 1Y81A 2JKZA 3OIDA 4MUFA 1XU7A 5DM2A 1IM2A 3NOVA 2FPIA 2IYXA 2AMJA 4FS3A 4CODB 3JALB 3AU8A 2HUNA 2Q1XA 3CURA 5K0JA 1KO5A 1RI4A 1K6JA 2QG6A 2B35A 4ZOBA 3T4EA 4F3NA 1JKXA 1LLUA 4GKKB 1RS0A 2I80A 3KM0A 4TKMA 1GCGA 1ICEA 1YS7A 2Z8YM 4Q48A 1I94B 1VB3A 2CLIB 1GWNA 1YS2X 4ER6A 1GPUA 1P5ZB 1UJCA 1VMEA 1H8EA 2H65A 1C1DB 3AFIA 3DD5A 3MWGA 3ROTA 4NCJA 5JHGB 1E96A 2V0NA 3OWHA 4URFA 2C84A 3HB4X 5AJUA 3EGXB 1PNTA 3EUEA 4ZQIA 3MUEA 3ADCA 1Q20A 2R7NA 3JYOA 5GV8A 3KKEA 1ZN9A 5D6NA 4CCYA 4YV0A 4TTIA 3LLVA 2JRCA 3TGWA 3E7PA 2AJLI 2ST1A 2NU9A 5B3AA 2XUJA 1JHQA 4ASUA 1CUZA 1G21B 1M54A 2COUA 2CVHA 2D3TA 1L5ZA 1PTJC 4LGMA 3LT4A 3ZX4A 3DW1X 3U19A 4Y9RA 1SQSA 1KFKB 2VJBA 5JPCA 2A78A 3T5TA 1ZBQA 2J4CA 2POQX 3ADDA 2AJ8A 3ROPA 3CVJA 4G4GA 1I33A 3F5DA 1M2HA 4JIGA 4P9NA 4D4KA 2D5IA 5AKXA 1Z36A 5A05A 2QQ0A 5B30A 4B85A 4CR6A 4Q0MA 3MS2A 3EWSA 3KQTA 1SUEA 1ZGCA 3AWDA 1VFNA 4RSRA 4D98A 2PMDA 3A3KA 3M5DA 1RQXA 2HCTA 2C0CA 4DJDC 4RJIA 4EQ6B 1U0FA 3JATB 5IC5A 3EVBA 2DWQA 2EQ5A 4INJA 3UJPA 3ZGOA 2AS0A 4ZZ1A 4IH4A 3W34A 5E3JA 1GPJA 2AI1A 2AE2A 2V7VA 1EU1A 1RXSA 3HLKA 4C08A 1JEOA 4X3CA 1NG1A 2OD9A 3NHSA 3W6OA 3RS5A 2QNIA 1ABFA 1E2KA 4CFZA 4QTYA 3Q7EA 1BMFA 1DU4A 1HRKA 2XITA 4XQ9A 5HCIA 5K51A 4EG8A 4D7AA 3HPQA 2EGHA 4TMZA 3UICA 3DT9A 5FLKA 4ZXPA 3DUFB 3RU9A 5A62A 2NUPA 3GYBA 1QFZA 4RC9A 2PMEA 5AJVB 5HTKA 1UEIA 1X70A 4OY3A 1IJEA 1DIAA 3RC8A 1JFRA 3CF4G 3C5WP 4P8RA 4UNQA 1TU0A 3FOAA 4IKOA 4PAMA 1GYQA 5A5GA 5AHRA 2J3LA 3WE7A 4BBJA 1OKKA 5ALTA 4B46A 5FUWA 3LZCA 2ZAOA 3GLSA 5HKKA 5K03A 1ZOLA 2QYHA 4MQMA 1A9OA 4E94A 1X86B 3HRIA 1QORA 2WFLB 3S28A 4H7IA 2QE7A 1JG6A 3FCEA 4ZZ3A 5CBKA 2WF5A 4O0LA 2CJFA 2P30A 2QM3A 2QSYA 2IY8A 4MCIA 1HZZA 4QUBA 1JQAA 3K3PA 5K0CA 4C5BA 4EX6A 2B5VA 4G4IA 1NXTA 1UXHA 2FEXA 2JVJA 1FLVA 4MI9A 1Z8HA 1QGUA 4TTSA 4ERXA 1N34B 3F90A 2C00A 3V7UA 1QTQA 2Q1TA 1ORWA 2DR0A 1WPQA 4QFMA 2IZOA 3NJ4A 4MVJD 4D3YA 1XBTA 2EFHB 2GNPA 5B3JA 4ZMSA 2G1UA 4TV9A 4MHTA 3A6FA 3GJ7A 5IJ0A 1LLCA 1SCUB 2XYQA 5B3LA 4UM9B 3QX9A 5JADA 4DCSA 5FYQA 1YAJA 3HCAA 4EUHA 1G7SA 1MABA 5CVJA 3ND6A 5ER9A 4ACAA 3IBTA 4KEAA 5ADUS 1LFDB 3WGVA 2HWYA 3OURA 4QXQA 4EHBA 4YRIA 4CIAA 1GZSA 3ZK8A 1A7JA 2FPOA 3V7YA 1M1YB 2QXYA 2ZJAA 1JR3D 5EIAA 1YKFA 3AR4A 3KAPA 3PSHA 3R7BA 4BS9A 1G8YA 2XEDA 3T7JA 1JXAA 5C3UA 2ZVJA 3ND9A 3B20A 5LR6A 3G2KA 2OCXA 3K20A 5TIIA 3PLRA 4F9EA 2YV5A 4AQDA 1AN9A 3GRFA 2RHLA 1M2VB 1ZL2A 2SKEA 4NZYA 5B7PA 3GCDA 4NYIQ 2GNAA 5EE3A 4ZQCB 3LLMA 4O02B 4DQXA 2R1TB 1JDUA 4IY1A 4OXYA 1PSWA 2OENG 1CJVC 4IXMA 4JYBA 1RHMA 4CI0B 2YCLA 1CJCA 4PAQA 1A9XA 3NRCA 2FR8C 2X9GA 1V9LA 3ICCA 3HCDA 3QOYA 4L9WA 4YUAA 4D41A 4X60A 4ONEA 3L7IA 4F2PA 3QBJA 4O63O 2FFRA 1XYVA 3DG9A 4CU2A 2A9KA