4MCIA

Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with dmso, nysgrc target 029520.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
247
structure length
243
Chain Sequence
LYFQSMSKQPHICVDENQVSPYVIVCGEPDRVNRIVELMDNVELLAENREYRVFNGVYKGTTITICSTGIGAPSMIIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVRDEGGSKAYISSAYPAYASFALLKEISHFLENQSVKYYFGVVRSHDSFYTDEEDQLCQYWNKKGILGADMETSALFTVGRLRGLQVASILNNVVLYQEGVNQYVNDNKAMMNGERLAAITALETLCKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with DMSO, NYSGRC Target 029520.
rcsb
source organism Vibrio fischeri
molecule tags Transferase
total genus 86
structure length 243
sequence length 247
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mciA00
5B7GA 3PNSA 2A0WA 4TS3A 4WKNA 2I8AA 1LVUA 1OTXA 1V45E 2QTGA 4YJKA 1OTYA 3C74A 3O6VA 3MMSA 1K3FA 1JYSA 1TCVA 1PR6A 4JWTA 4QAQA 3DF9A 4WKOA 4QATA 3GGSA 5F76A 1YR3A 3EUFA 4JOSA 2HWUA 2A0XA 5F73A 4EB8A 3KU4A 1RR6A 4M1EA 3OZDA 3KVVA 4D9HA 2RJ3A 2QSUA 1A9PA 3LA8A 3NM4A 5IFKA 3FNQA 1T8YA 5CYGA 1PBNA 4BN0A 1ECPA 4DA0A 1JDVA 1N3IA 4L0MA 3OZBA 3K8OE 1VHWA 1NC3A 1YBFA 4LZWA 4YNBA 4NY1A 4H1TA 3ONVA 1T8WA 4LNHA 3FOWA 3ODGA 1U1FA 3OF3A 1XE3A 5CYFA 3FUCA 1A9SA 1ZOSA 5CCEA 4F1WA 2HRDA 1TCUA 4TXHA 1T8RA 4DARA 4IP0A 3U40A 1A9QA 1JDUA 1A9RA 1Y6QA 4LDNA 4DA7A 4TTAA 5C80A 2AC7A 3NBQA 2OC9A 5EPUA 3KVYA 3PNPA 1RYZA 1RXCA 3OCCA 2OXFA 1PK7A 4PR3A 1JDSA 1JDZA 4QEZA 3P0EA 5CXQA 4MCHA 4OGLA 4EARA 2H8GA 3EUEA 3P0FA 3BSFA 4DANA 1Y1TA 1Z36A 4DAOA 5F7OA 1RXYA 1JE1A 4D8YA 4DA6A 5I3CA 5ETJA 4K6OA 4MCIA 4NS1A 2ISCA 1Z5NA 3UAVA 3DPSA 4WKBA 2OECA 3KVRA 4M3NA 4YO8A 1OVGA 1FXUA 3IOMA 5EUBA 1RFGE 4ECEA 5JPCA 1V48A 1VMKA 4BMYA 3K8QA 4OEHA 1SJ9A 5CXSA 4TXJA 1PKEA 3FAZA 1ODJA 4QARA 4TYMA 3DJFA 1PR5A 2P4SA 2XRFA 4NSNA 1WTAA 3EMVA 4M7WA 4JP5A 1T8SA 1V2HE 4R2XA 1TGVA 2ON6A 2QPLA 3BGSA 1PF7E 4UC0A 4GLJA 4YMLA 4E1VA 2GUWA 3NM5A 1ODKA 4F2PA 1B8NA 1JE0A 3UAXA 1ULBA 1OV6A 2BSXA 4D8XA 1U1CA 1ODIA 3F8WA 4GLFA 2IQ5A 1A9TA 4D8VA 1TGYA 3UAZA 2AI1A 1QE5A 1YQUA 1Z5PA 3LGSA 3OOEA 3UT6A 4TTIA 4LKRA 4L5CA 4BMZA 1ZL2A 4TXNA 4U2KA 1C3XA 4I2VA 4OJTA 1OU4A 5DK6A 1PR4A 4L5YA 1U1DA 1TD1A 3OZEA 3UAYA 3LBAA 5EFOA 3ENZA 4L6IA 1Z34A 5F78A 3EEIA 4WKCA 3INYA 4P54A 1Y1QA 3SCZA 1PWYE 4LNAA 1JP7A 2AI2A 4OF4A 3OOHA 1Z39A 1I80A 1RT9A 3O4VA 1CB0A 2QTTA 5F7XA 3NM6B 5B7NA 1PR2A 5IU6A 5KB3A 1SQ6A 5F7JA 1M73E 5CCDA 4F2WA 1RXSA 4G8JA 3BJEA 5FAKA 1SD1A 4TXLA 1ULAA 4TS9A 4TTJA 1Y1SA 3QPBA 3E9ZA 1PW7A 4QFBA 5F77A 2A8YA 5K1ZA 4F3CA 1Q1GA 1OUMA 1JPVA 1Z38A 1Y6RA 1CG6A 1RCTE 4FFSA 1U1GA 4OY3A 1V41E 1K9SA 1B8OA 4GKAA 3D1VA 1LV8A 2QDKA 3FWPA 5B7PA 3KUKA 2PGAA 4R2WA 2OC4A 3GB9A 1NC1A 4GMHA 4D98A 4DA8A 3DP9A 1VHJA 4BMXA 3BL6A 2B94A 4WKPA 4RJ2A 5B7QA 1A9OA 3PHCA 1YQQA 3PHBE 1Z37A 3KHSA 1SD2A 2AI3A 1G2OA 4DAEA 1PR1A 2HSWA 1T0UA 4TXMA 1PR0A 1RXUA 1V4NA 3IEXA 1V3QE 1U1EA 1Z5OA 3DDOA 1YRYE 1ODLA 4G89A 4OGKA 2I4TA 1PK9A 3UAWA 3MB8A 4QASA 4PNPA 2A0YA 4KN5A 1RSZA 3T94A 1VFNA 1Y1RA 5F7ZA 2Q7OE 4L5AA 4MARA 1NW4A 4DABA 4F3KA 3FB1A 4X24A 3E9RA 3OPVA 2HN9A 1LX7A 3TL6A 1A69A 1JDTA 1K27A 1Z35A 3E0QA 4G41A 3OZCA 4R31A 1Z33A
chains in the Genus database with same CATH superfamily
4HJRA 5EESA 4HAUA 2CDRA 4TTTS 1GNLA 1V1MB 1F14A 4ZEVA 1L2TA 2ZIGA 4WKNA 5IWAB 3IDQA 2R65A 4DV7B 5IH7A 4HLDA 1PEDA 3GD5A 2GCOA 1DQRA 3SEZA 2I8AA 1ODTC 1YF3A 1R8JA 3OP1A 1ZEMA 2UUOA 3U13A 4EAQA 3BXPA 3EIUA 1L5VA 3NALA 4X61A 1CJBA 3D2CA 3LKDA 3L7DA 5G4KB 1BX1A 2ZRFA 1IMJA 5EJIA 4DE5A 3EXIA 2HMVA 2WB2A 2VPQA 2ZJAA 2XA9A 1VE3A 2XZTA 4JWTA 2GEUA 1J25A 1QX4A 2C98A 2PH1A 3KQTA 5J2UF 4EI2A 4J4BA 1WX1A 2JAHA 5AJTA 4DLKA 2QN3A 2F55A 1TO1E 3HXTA 3C7CB 3ID6C 2EF0A 4RIFA 2HMUA 2UVPA 5L3SB 4JWKA 1HDGO 4BU0A 2AMYA 3NBXX 1ISSA 2WSMA 4WLOA 4PN7A 3R9XA 3JWPA 1SB8A 2LIPA 3E03A 3NRBA 1GQQA 3GEDA 3ZQUA 1LEHA 2QM8A 4A23A 5C1DA 3FCUB 3QUQA 4G0QA 2QVZX 3LP8A 1U8YA 3R6GA 3GFQA 3QVVA 3ZZNA 5LMZA 1RD4A 1WSBA 3NQ41 2VZ8A 1Y1KE 3LO8A 1QTIA 3LWBA 3LZDA 1JFRA 5IP5A 2Z9CA 4G24A 1QTRA 1QANA 2PR2A 1VXOA 2EZ4A 3S5JA 4YT8A 1N6HA 1BSVA 1SU6A 2G77B 3B6ZA 3F6RA 1TKBA 1P4HA 2N75A 3AJAA 1U28C 3FLAA 4XJTA 4YJ2A 2CSXA 3AVVA 4KQIA 2EG5A 1TJNA 2J5QA 4P7BA 3PJEA 3QHQA 3K5IA 3BG5A 4X66B 1SM4A 3LA8A 2UZ4A 4KQHA 2FDRA 3E8SA 4PTYA 4F4UA 5FADA 3EX7C 5KAPA 2F1IA 5IDVA 2JFGA 1VLHA 3KRTA 4CIVA 2D2EA 1KC1A 3C3BA 2R6ZA 3KPYA 4BQNA 5HZMA 1EXVA 2XI4A 2IZ0A 4B34A 4C4PA 3OZBA 5C34B 2ZSAA 3DULA 3DVRX 1KJ9A 4XR4A 3WSTA 5AWFC 3JQGA 2V7VA 5HBGA 3BRQA 4II3A 3TCNA 3FMOB 5BWMA 5I8PA 1FIUA 2FK8A 4QBTA 4A0SA 2I0FA 5CLHA 1DKUA 5E6SB 3CH6A 4INAA 4KSYA 3JSAA 3BWCA 4MUXA 4NY1A 5HRCA 5GVSA 1JHMA 4P31A 2HXGA 4QOIA 2GNAA 1KORA 5HOQA 1PGOA 3ZXYA 3DLHA 1AQNA 1U7ZA 3AETB 5T57A 3C5EA 4B48A 3IKTA 1P0PA 1QSGA 2P8JA 2WTMA 4CDGA 1OH6A 3HJNA 5EHIA 3U3DA 2A33A 5LP1A 2YHIA 3PD0A 3BH7A 3HCEA 4FE4A 1KI4A 4L50A 4O5AA 1ZOPA 1QWSA 3KSZO 5J63A 3VR5H 3WNBA 2WVJA 4KO1S 2D0IA 1D09A 3H4IA 2FRDA 4KVAA 1V39A 1RPTA 2G76A 2NQTA 3DOUA 4ZAFA 2F43B 5J40A 4U2BA 2OLJA 4NG5A 5J47A 2J8ZA 1V1RA 2D00A 4BUCA 1R4MA 1MTZA 5C4MA 2CHEA 1A9RA 1V7QA 3EZFA 4URHA 3VKFA 1NHGA 4B09A 1W29A 2JAPA 3O1IC 3SF8B 3QPUA 3UANA 5A2GA 5HX7A 2ECQA 5ITZA 3FUTA 1UC4B 4KTTE 4XLLA 5BQOA 4BGUA 4EUSA 1J0XO 1E18A 1CT9A 4Y6PA 5D87A 4N9WA 5LD2C 4L4SA 5CG2A 4XVUA 3TR5A 3E3NA 3HL4A 4Y2VA 2PDAA 3H3FA 4HLCA 3IV7A 4UVIA 4F9TA 3QLTA 4ZHQF 2O0KA 3IHTA 4KUGA 4NZOA 3W6ZA 2F1OA 1N32B 2PJZA 1KSHA 2HKIA 2P2ZA 4I4TF 1JHUA 1JV2B 2O2XA 3N7AA 3TW0A 2PX3A 1DE0A 2VYVA 1JDZA 2JFWA 3DHYA 3FYTA 4P83A 4GVLA 3ZDZB 2Z6VA 3F46A 1TVKB 4PGAA 3P0EA 3MZ0A 3C0KA 5FBKA 2REXB 5AJXA 4CQLB 3EGIA 3TRDA 4BVFA 5EIAA 2ODBA 4ROSA 3DB2A 2HQBA 2NM0A 5HTKA 2BJVA 4OBEA 3ZXXA 5AVZA 1G55A 2BL4A 1AN0A 4JOCA 4BDTA 2BHSA 3IT3A 4M83A 4UKDA 2OHGA 3FWYA 2XY4A 2HK6A 2PQ2A 2AKYA 3OA0A 4LYJA 4A8JA 3D0KA 4DDUA 2G1UA 5JNVA 3F5FA 5EE3A 5L95A 4DYVA 3FZNA 4DWVA 4I55F 1N9GB 4IY1A 1GKIA 2CFTA 3LYHA 4BAZA 2VXYA 2IH2A 1PL6A 3KJHA 4O4IF 1IHUA 5K0LA 3WLSA 4L28A 1T1GA 1FYDA 1GY8A 2H3HA 5BSHA 2A30A 1JB1A 1FK8A 1CIPA 1RM0A 2V65A 3CR8A 4PY2A 4M8KA 5BSRA 5FV7A 5KPDA 4HBZA 2ZI7A 3MBIA 3OI7A 4DHWA 1HFKA 2B8JA 1NT4A 1I01A 1SKUA 2WF6A 1O08A 4RIIA 3ND5A 2J3IA 4DIUA 1M6YA 2QT0A 4RIEA 5J5CA 3UUFA 4O4LA 4DTIA 4CM9D 1YCDA 5FEUA 1QZXA 3DE6X 1QQAA 2RAPA 4A2PA 2EBUA 3CPJB 3ZGOA 1NNEA 1FYVA 2C5FA 2PHZA 2WVHA 3NGMA 2GARA 4JH0A 1BQ3A 1Q83A 4AKEA 1U0LA 4RW0A 1RLUA 2HNAA 2BONA 5DX8A 3IQWA 3CRVA 2RG7A 3TPZA 2FX3A 4R3WA 1VECA 4WN9A 4LF7B 1ZUNB 1G42A 1XZJA 2C7OA 2J9FB 4PYIA 2HPVA 5LQKA 2FSHA 1DAGA 5C46F 5BNTA 5EQJB 3LI2A 2DP4E 3IKLA 2ZRPA 3OTGA 4GBGA 4HGPA 4QARA 1IZ7A 3CVXA 4AL4A 1TFUA 4AY6A 4XX1A 4MGIR 2W7TA 4BZZA 2HR1A 2DTXA 3A4LA 3IQHX 5MN4A 2DKOA 1T9KA 2YS7A 1KFJB 3KTAA 3L5OA 4XH9B 3VR5A 3MRVA 4PPNA 3WC4A 2CC2A 3EMVA 2PT7A 2QAJA 2D2FA 4W5NA 2BISA 1JA0A 2H48A 1Y5MA 3LT2A 4P3XA 5HJ2A 3FVVA 1FUEA 2QPLA 5JD6A 4UMDA 1R5JA 3DV0A 3FB4A 1PFQA 2Y2UA 4QYIB 4I5GA 1QYCA 2B9VA 4FD3A 4YJGA 2J0QA 4UHHA 1FSZA 1Z28A 1UPCA 1E7YA 1NLUA 2J5XA 3ESBA 3D8RA 2CXOA 2GFQA 4F2PA 1EDZA 2IY9A 3R3HA 4UMVA 2EQBA 4B83A 2XCSB 1XTJA 4AKTA 3U5ZB 3D6UA 1ODFA 1H5UA 5LA6F 3AYZB 3CXRA 3NP7A 1CR4A 3JD0A 3F3YA 1XA0A 3FLBA 4ZEWA 3VAYA 3IAEA 3T3IA 1VCOA 1XVAA 2IQ5A 1OXTA 4LHXA 5HQ3A 5IZ4A 5JZVA 3NIGB 5DCLA 3OJCA 3K70D 4AZ0A 4OP3A 3DBOB 1ESNA 2NNWB 5DMXA 1Q0QA 2BLLA 1JMVA 2VHJA 3AEUA 3FFAA 3WLQA 2ZB3A 4KR0A 3G5TA 3PGKA 4JBYA 3USCS 1Z5PA 4KLAA 4TMVA 3A1NA 2R8RA 5JI2E 1OPXA 4K9MA 1L7NA 4K9KA 2WJAA 1YFKA 4H1WA 5TE9A 1P73A 3V4VB 3K1AA 1T91A 4FYKA 1UPTA 2V74B 2EATA 4X84A 1NNSA 3KQOA 4LUCA 2VRBA 5ER6A 1YQEA 1Z6QA 1SOUA 3CE6A 4EDHA 4L16A 1D4OA 2HYIC 1U1DA 4CXMA 3UFBA 1YUNA 3ODPA 5DCWA 5GMOA 2Q3JA 4G1FA 3N6RA 1GCGA 3DTVD 5GM1A 2GZRA 3WQRA 3EXG2 3OY7A 1ZGBA 1CJSA 1EM8B 3TSZA 2YRWA 3FETA 1AG9A 1AMUA 1HEIA 1M76A 3TK1A 4FHFA 3TL3A 2DHEA 1HGXA 3INYA 4CF5A 1BO6A 4Y1EA 4DJAA 4OH1A 5K8CA 3E9MA 1DFGA 2BMVA 3QFCA 5ALSA 1HQCA 4Q3EA 1PJ2A 1W35A 2JFYA 3WAJA 2GHIA 2YMQA 4GR5A 5IZCC 1VHQA 1MAVA 1RPAA 1XO1A 3NCHA 1C41A 3VVCA 4IFTA 2VYQA 2FWAA 4YB8A 4DR7B 2G5PA 3OLXA 4E94A 1X19A 2SNIE 3A28A 3VUFA 3KKMA 3BGOS 3LG2A 3S2FA 3KDAA 4MQUA 3EWIA 3C3XA 4HY3A 1RM5A 4GPEA 4MXDA 1ZD3A 4WN3A 5DF1A 4B2IA 3MIZA 4CMHA 2Q2OA 4QSHA 3DO6A 1R2QA 1KQGA 3RLIA 1KDVA 4MMXB 2QMHA 3UCEA 4AKIA 4E46A 4BQFA 3J80A 4RZIA 4GQAA 3CSSA 4BFCA 3P45A 3GPDG 5DXAA 4YCCA 2N0SA 2VTKA 3LA6A 3PNBA 4HH0A 2ORED 3WIVA 2X2EA 1ZSYA 3CZMA 1V1RB 3CUUA 3WG9A 1J0EA 1M5TA 1SY7A 4MVJD 2JIZD 3QPBA 3FF4A 4B6JA 4DMUB 1T4CB 5IXSA 1QB7A 2YJTD 4LV5B 3URKA 1SVSA 1WEKA 1OLSB 5LDHA 3L4EA 1SKYE 3PQ4A 1ZC4A 1SK8A 1KNXA 4FZ5A 4JBIA 5FPQA 3U4HA 1CZHA 3E9ZA 3AQ4A 2WNHA 1OD6A 2J4FA 1NBMA 2JIMA 5NLLA 2IUSA 3N0RA 1QHFA 1QH8A 1RMQA 3IUSA 5TJHA 2CV1A 2DKFA 3R1IA 4ILKA 4Z4IA 3PYXA 2PZLA 1BXRA 3GRCA 3L0YA 4TZ6A 2VPWA 2EHJA 1EK2A 2W4IA 5CPFA 3UJAA 3CVUA 2O8DA 2DH5A 3KAPA 2O3SA 4I14A 4E33A 1JZTA 3IE0A 4JJAA 3AGPA 3QTBA 5FTNA 4EG7A 4PCUA 3X1YA 1E3IA 1XU7A 1EK5A 1Z0UA 2H4YA 3GP3A 3FCXA 3NYRA 4M1ZA 5IULC 3RTDA 1RQPA 2D4AA 2CBXA 4MQBA 2L19A 3PXXA 1N7IA 2XBMA 3NXSA 4W1RA 2XNDD 3AKZA 3D1VA 1KK1A 3TDMA 2OGWA 3R5TA 2P5UA 2VH5R 4L8WB 4TMKA 1E1LA 4QBFA 3VKUA 4QDKA 5LP6F 4KODA 1VKJA 4YJFA 1JZQA 1QHSA 4ZV9A 1ONSA 2PIDA 4FMCB 4AJOA 1R6AA 1VJTA 2YFYA 3GB9A 1XKXA 3GUUA 1NURA 3EZ2A 4ZMRA 5LIPA 2KLBA 2OILA 3BVPA 3FXAA 2JLCA 1TT7A 5AJYA 2IIVA 3V3TA 1A71A 3KJEA 3OC0A 3PCTA 3HU3A 3WHLA 1AO0A 2CNWA 1GN8A 4BFSA 1ULZA 2WJVA 3ZGLA 2X4DA 3O31A 5I9IA 1W4CA 1AGNA 1M7GA 4DV0B 1NXXA 4LRYA 1KP2A 3UIEA 4Q1CA 2PLRA 3KHSA 4EGQA 1ZNWA 2J5KA 1ZCJA 3QKSA 4B3BA 3ZZ0A 5ALPA 4Q7EA 3QBTA 1MU0A 3LWZA 2X13A 4LYHA 2ZYHA 4R2MA 3A6HA 5EJ5A 1BXZA 3DH0A 3KOOA 4YHBA 3TNFA 1CD5A 4LRTB 2QVYX 2YWXA 4HADA 2RGEA 1V4NA 2VHEA 5FFNA 1SVMA 1WBJB 5FIUA 2VQFB 4PSVA 1MB3A 2H8KA 4ZJZA 2WTUA 4LJ5A 3PZRA 4WN9B 3KLMX 3JRNA 4ZYXA 3PK0A 1YS9A 1KU6A 2I34A 3A4MA 3GPCA 4OGKA 1ETUA 1K4YA 2C4VA 2E18A 1M54A 3DZKA 3JZIA 4G2NA 2XLBA 3KR2A 4G81A 4XB6B 3I6YA 1I94B 1I2ZA 1Y3HA 2DPLA 4LSWA 1BW9A 3E9QA 1Z0SA 4KN5A 1ZK4A 1H6BA 1LPBB 3PCRB 5JR3A 3V48A 2X5NA 5IC4A 2WPDA 1A77A 3VJLA 3KD2A 1RJ9A 4BHTA 3KTAB 1OHHD 1SVWA 1FU8A 3K0FA 4IHQA 5CHEA 1DKOA 5ALIA 5BYJA 1VE9A 3MHPA 4X64B 2VJMB 5GADl 5KWIA 4MRMA 3U7FB 3PX2A 3S5UA 1O6GA 3HB5X 1W9HA 1PW5A 4C0XA 1QOQB 1WOMA 1XZKA 3HYSA 3FPKA 4BMVA 1R74A 3CS3A 5JD3A 3QKTA 2KBFA 4YJGB 1JWLA 3FGOA 2QRHA 1XVUA 2UYOA 2UZIR 1TA0A 2PX0A 4B7XA 1LX7A 4RF5A 1GCAA 4FR2A 2FPGB 2R6DA 4KG7A 5KSZA 4ARIA 2AN9A 1M2JA 3UATA 4EMBA 3ILYA 4P2GA 3HE3A 5SY9A 2C5HA 4JLWA 5IN5A 1WULS 3PDWA 4B45A 4EW6A 3SJAA 1FS5A 1TUEA 4ZYTA 1L5MA 1LD3A 4KQJA 5HQ3B 4G41A 5B58C 1IEXA 4W8GA 4E5MA 1JIVA 3KOWA 4R31A 1W4RA 3IBTA 4Q1FA 1DU4A 3O2QB 3K0CC 3BXGA 2OT3B 1SVNA 1EX6A 4OSPA 3TBFA 1HLFA 2Q3DA 1O96A 1NY6A 1R0SA 1KH2A 2PZEA 3ZXIA 4N65A 1P75A 3BB4A 5M34A 2FMXA 1G8KA 2C7GA 1OFHA 3CIFA 1FDWA 4NC9A 5DOZA 1OR8A 3JQBA 2NUAB 5AUNB 5HIJA 2HB6A 2AN3A 4B7ZA 5TQ2A 3EEBA 4CLDA 4K0KB 4NESA 1G16A 4YRNA 4JYCA 2PGJA 1C81A 1ZNZA 1U0RA 4YECA 1PBTA 3AR9A 4UUPA 3WKAA 4BX8A 4GRDA 2OXEA 2WAOA 2QTCA 3AVQA 3WHIA 1CY6A 1H2XA 4DLLA 5A06A 4V0OA 2OO5C 1JALA 1N6KA 1N0VC 1QIHA 1XZEA 1Z0FA 3GGSA 3K9CA 2CVFA 2G5GX 4MZXA 1YR3A 4PBTA 1QTQA 5ALZA 1FTSA 1UH5A 3DBVO 3M2TA 4GW3A 3ZDDA 4QWWA 3FJYA 4HJXA 4MQLA 2XT0A 1DIGA 3VV3A 4C6TA 3Q15C 4C3ZA 1I4TD 5ENZA 4EGFA 2FSIA 3E3MA 4IFEA 1FFDA 4O59O 2VJAA 4B85A 5JNRA 2YDYA 1A4UA 3BGWA 1WXQA 1GUYA 1W6UA 1BWRA 2AEEA 5JSKA 4JI5B 2ODTX 3D0QA 4CPDA 3VTFA 5JMOA 2Q4BA 2BI4A 1W34A 2OCKA 2OG2A 3IOEA 3PC6A 4MA0A 4OQ4A 1TMKA 3HY4A 3U0VA 4KE9A 4LXTA 3K4QA 3MERA 1YR8A 2R68A 3U7QA 3TRFA 3KVNA 1QIGA 3QFRA 2QUZA 2GNPA 1UQRA 3GJSA 2D3TA 2EGUA 2RHRA 3KOXA 2OHHA 4NU8X 4ZVMA 4LTMA 3WIEA 3L79A 3EZLA 4AUKA 3FBWA 1YK1A 1BVHA 1X8XA 2EP7A 4ND7A 1EWKA 1CHDA 4KLNA 1B42A 3I5XA 3PDHA 1QLWA 2BOVA 4L07A 2PUWA 1TQHA 1U8FO 1ZLYA 3N2KB 4EDFA 3V8EA 4MHTA 3TCXB 1KEZA 1VB3A 3HSYA 3H17A 3KOYA 3VPCA 4ANFA 3ZWOA 1E2KA 1MRZA 4J0GA 1INLA 3A6JA 2BJWA 2BZGA 2VPYA 4KQCA 3N07A 2QP3A 1H1DA 3I1YA 4RHTA 1P1RA 4CFZA 2EFYA 2Q5FA 3I9KA 2O8DB 5HEKA 1GG8A 3PA6A 1NNLA 1C7FA 1GPYA 1TYEB 3VU9A 1DDGA 4PZ9A 3MSXA 4LOJA 2D59A 3L93A 1ONOA 5JXGA 2AC4A 2VP0A 3KZKA 4UCQA 3RK0A 1PAUA 2P7IA 1BN7A 1CFZA 2IY8A 2BEWB 5CK4A 1U1IA 1CUBA 1W73A 3PNLA 5E8RA 2QW1A 2ZBVA 3B8HA 4PQEA 1PI3A 1DCKA 5FOSA 5HF6A 2LUOA 1OXKB 3RODA 3DVLA 3WGIA 1HA3A 2ZUBA 2H57A 4JEMA 4OGFA 1IOVA 2VRNA 2G1PA 3GY0A 1LDYA 4FDUA 5BNZA 2E37A 4GICA 3HB9A 4LAFA 4LRXA 4OQDA 5A2QA 3PNQA 2QUKA 2A9JA 4IIXA 2ZRMA 1X6VA 1EK1A 1ZOIA 2HT6A 2WM8A 1FVOA 1A72A 2PU7A 3A1WA 3EF3A 3HCRA 1ZKMA 1JDUA 2YIDA 1ZSNA 1SCIA 3IXLA 4HUJA 4NBLA 5E7IA 2QU8A 4DLTA 5C81A 5K0GA 3ZDCA 3IUNA 2IYOA 4YI5A 1GZ7A 3RSLA 2C9DA 4MOWA 2QJTA 3BD7A 1T5IA 1HKUA 4BO2A 4JYZA 3ZWMA 4I5FA 2PEZA 2YZGA 2GB4A 2PS0A 4ATNA 4Z7OB 4GS5A 2HTFA 3E05A 2WC1A 4GDMA 4ARCA 1Z8FA 1ZQ1A 5DGTA 3QKSB 2FFBA 5ARDA 4CYMA 4HDNB 4RE6A 4PR3A 1F4VA 4NTZA 3HN2A 1ZBDA 1LSSA 1I1OA 1V5GA 4TQUS 5JO0A 1KAGA 1LZKA 2BMAA 2P9QA 4IZIA 4OQMA 3KLNA 5FBZA 5JNLA 2Q07A 4ZT3A 3QY0A 4ECAA 5IVPA 2RHMA 3ISTA 4YQEA 4ZV4A 2Y2VA 3N3AC 5I6DA 3PGXA 4BAGA 3DBHA 1A8UA 4AYWA 3ZI4A 2DCUA 3BF8A 1YIOA 3PFNA 4YUZA 2PUHA 3H6KA 1E6KA 3OE4A 3OFVA 4OUKX 4YRMA 1Q7CA 1DCFA 3I2KA 1GZ6A 4PS1A 4WXYB 4DANA 2QTNA 2IZ7A 4N7MA 4BMDA 5FI3A 1EBUA 1GWNA 2VAVA 1II9A 5JY6A 2OV1A 3MOIA 2H9AA 1Q2XA 4IRMA 4RMHA 2PWBA 5K3EA 4N3BA 3ROTA 3UB2A 3V1YA 3Q72A 4FMBB 5JYBA 1FNNA 1UOEA 3ND9A 4R83A 3FOFC 5DTIA 2FOIA 1SXGA 4B6OA 1YDFA 2RGUA 3AUUA 3SHWA 4AECA 3DE0X 4I46A 1Z5NA 2H0RA 2ZTVA 3NH6A 1CRLA 4TKMA 4XIFA 1LWNA 4V1CA 2Q49A 1NX9A 5ALOA 1SQ0A 4RQUA 3EDQA 3E0XA 4KDEA 3TF5A 3OJFA 3F73A 5FD8A 1MC4A 2Y68A 3H6HA 3MAAC 4B7CA 2TYSB 3HBMA 3PSAA 3ENWA 1R5BA 1SXJD 5FBLB 4HH3C 4FNGA 1MQAA 2C3UA 4NBKA 5DULA 1TAQA 3SS8A 2HLHA 1JJAA 1AVTA 2ZSHA 3GT0A 3N05A 3KV3O 4ENRA 3RNOA 2WJ3A 5EE0A 4U02A 3WLRA 4ECEA 3OTIA 3OM8A 3NBYC 4R01A 3B3QA 2P0AA 4IH4A 4V03A 5DHFA 1T5HX 2XUGA 3CKKA 1LVHA 1SJ9A 3UMGA 1V1JA 1EFCA 3SHQA 4EVRA 4RPKA 2AFHE 3LU1A 4LA4A 1H2BA 1O96B 1OXSC 3O2JA 4L95C 3DJFA 3NVKI 3FRIA 3HFSA 4AX8A 4JLMA 3AEZA 1ZCZA 1POWA 1LPAB 1QAQA 3N8IA 2K87A 5ECYA 8ADHA 2PXAA 4B76A 2VKQA 1FP2A 1TU0A 2C9YA 3L8ZA 4GOLD 4HMQA 5GAJA 4BCDA 2K7FA 2GCPA 2OFXA 3SC2B 4AO6A 1OMOA 3K2EA 4M8SA 4JJZA 2GN6A 4OLFA 1A98A 2F48A 3DHEA 3MCVA 3UN1A 5JTUA 2QNBA 4NCHA 2H7XA 4DWJA 1H4TA 4OL0A 3A1CA 3BWMA 4RSGA 4HS9A 5LWQA 3HLTA 2ZT5A 2C83A 1KJZA 2RGRA 1CETA 4LNUA 1W8IA 3D3JA 2Q9UA 4KWHA 2CUTA 2WAYA 1KI8A 1ULBA 3E70C 1FTGA 1S6YA 1CZRA 1FW8A 3MXOA 4MUAA 5FJJA 1ZN8A 3AESB 1SBHA 1Q7RA 2IT1A 3B5IA 3D4OA 2XT6A 3NJ4A 3MMXA 1Q20A 3HEMA 1NE7A 3OF2A 4LMRA 4WFIA 3ED5A 3TPFA 4HNUA 2VO1A 2F1KA 1OU0A 1TGYA 1Z56C 1U9IC 4MVCA 3AUYA 3CPEA 1UM8A 1STOA 4AB1A 3DTTA 4AIRA 1XZQA 2JCGA 2IXEA 4PO8A 3N3BC 1TRKA 2FP3A 3TIXB 4BBJA 2E5LB 2RGXA 4F6RB 1V6CA 1KMHB 1YH3A 2DWUA 3IVRA 3OWOA 4I7EA 4F96A 1M7BA 2AE1A 1XTVA 1Y63A 2BGIA 3FOBA 3QU7A 4G4SP 4GOMD 2HJGA 4ARZA 2H4FA 4FB5A 3V5NA 2GZAA 2MDTA 5SY4A 2ADOA 1RBYA 3KFLA 2B0JA 3VM6A 2H2FA 3GBVA 3OIDA 5T6BA 1QGUA 3QBDA 1U3FA 3COPA 3U44B 1DRVA 3ZUGA 1QAMA 3M4NA 4MW5A 3LBFA 2IXAA 1YR6A 3QYAA 4A7PA 3DQQA 3ZDYB 4P0QB 1RRGA 2O3JA 2YINC 2FP4A 2NADA 2PLFA 4I2NA 5JARA 3RADC 3UAYA 3MMPA 3BUSA 5JJLA 2Y4OA 1UBUS 4XVRA 2O2SA 2CXSA 3ENZA 1NSFA 1P44A 5EY5B 3AB8A 3NBKA 2QNRA 3B7WA 3KALA 4HNAA 4DB2A 1FRQA 3U60B 3QLUA 5A4MS 4U4AA 1M1XB 1RWWA 4UM5A 4GOOD 3TAUA 4D43A 1JSLA 4EW3A 2DFNA 4CN8A 4XWTA 2X1HA 2XA1A 1MP0A 1PFGA 1Y37A 3PTLA 4REMA 1OYVA 4DNXA 2O7VA 3SD7A 4ZRNA 5INTA 1Q7TA 3R6TA 3LKVA 3K9BA 3Q6NA 1OBCA 1UIRA 5CUQA 4RABA 1UF9A 4TRRA 5AW8A 3L1JA 3A04A 1HT2E 4V24A 3K96A 3M5DA 4FBMA 1GTRA 2Q6VA 5EA2A 1CNEA 1H4SA 1G66A 4YYZA 5JY1A 2BFEA 1I80A 3RI3A 1OJLA 5ECDA 4FLFA 5EIHA 3NLLA 2ZANA 3HHEA 3H65A 4JSYA 5GZ6A 1WMAA 1QC5A 1WMSA 2QRVA 2C8JA 2W6NA 4KPFC 3WMWA 1LV7A 3FYDA 3IUYA 4KWEA 4RUKA 5EP4A 2WF5A 5KJ6A 1PJLA 2Y1CA 4UD6A 3IP9A 1LWOA 5JAPA 5BR7A 1RWXA 3L40A 5JJCA 2RHDA 3HCCA 4F2WA 1U2ZA 2NX2A 1L4LA 2WINI 1KKUA 1P9NA 2KJQA 4J1TC 3VC3A 4C76A 2V4MA 4PC2A 3R3WA 4XUDA 2IEZA 13PKA 1D03A 3EC7A 3L8FA 4J0KA 4IG4A 4TXLA 5JAIA 1JFSA 5AW5A 1KEVA 1O95D 3L7IA 4AO7A 1TYAE 3COVA 3I6QA 4IQFA 4W6QA 3L4BA 4Y0AA 1OBHA 4KDRA 3FHLA 4TUYF 1ENPA 1YI0A 4RHFA 4YCDA 5I8ZA 3SEAA 1YU6A 1I3OA 2CK3A 3MINA 1CUEA 3QEKA 5DM2A 5JCOC 4M0LA 2CLKB 5L8VA 2XNSA 4QFBA 1IJKA 1CZUA 2VUHB 1HEUA 1R00A 3AJ8A 4FN5A 4NV1A 3WL4A 4BB6A 1B6TA 3D3KA 1TLFA 2VDUE 1VLVA 3ZV4A 2CNDA 4GMFA 3RF6A 2NMVA 1EJ2A 4RCZA 2NU7A 4B3MB 2HUPA 1MBZA 2NWQA 3FNFA 2GM9A 2DZDA 2IF0A 4DLSA 1L7OA 2AZXA 3AYXB 2XB9A 1P2TA 3H7AA 3O92A 2YJ5A 3AUTA 4NDZA 2IV2X 1JWBB 2OVBA 3AT1A 3KSBC 3ZW9A 3RRMA 1PYGA 3VJMA 4IDEA 3RB8A 4W9RA 2P2YA 3UXMA 1ACLA 3U3RA 5AI8A 4QTUB 3T3MB 3DBHB 3E9EA 1MAHA 4X1YB 4K86A 3ADDA 3OWXA 2PA3A 3AKDA 3HDQA 3I4CA 4L5IA 5B7PA 1CQZA 1L5YA 4ESVA 5TEWA 1ZVJA 5CHYA 2TRSB 4AKGA 1KMQA 1VP3A 4DR5B 1M2EA 2J87A 5JD4A 2SCUB 3TOVA 3SC2A 4OXQA 3L6UA 1FDTA 1CZNA 3KXPA 5TT0A 4NENB 1OF1A 1CEYA 2IH5A 1CVRA 1RRPA 3JQFA 5D1NA 3GVIA 4LDAA 3WLJA 1OI7A 4BVBA 1C8LA 1Z6PA 5B7QA 1I2CA 1BFKA 1BFDA 2FPLA 2RK3A 4V1CB 4M49A 4JMLA 2W0MA 1BA2A 5BWNA 4W6ZA 4FILA 4HFNA 2LPMA 1MC8A 5LXTF 5BMVF 2VC2B 2YRFA 1V43A 2J3QA 2FMFA 4MV5A 1LRJA 4OMFG 3SICE 4JVMA 1T4BA 3KC2A 4M8LA 3IUMA 1CSEE 5CB6A 4DLPA 1VKOA 1RC1A 1T8PA 5EWMA 3M4YA 2CMHA 3TRIA 2V6MA 1E9AA 2EJWA 4ZTUB 5B53A 3DDNA 1FP1D 1LLDA 2QN6A 4X3PA 5FTWA 3EZ9A 4GOKA 1XZAA 1MOQA 1MAWA 4HH1A 4UUBA 2I9PA 2PR7A 3VOAA 2Z5FA 3L7CA 3F6EX 4RU1A 2WYVA 5DK4A 1V5FA 1B8VA 3IMKA 3EQ6A 3CF4A 4R2KA 3D7MA 5JADA 1EK0A 4KI7A 2ZRGA 4PYOA 3MD0A 3DA8A 5A4AA 1QK4A 5EPEA 3K70B 3BH0A 1GR1A 3CF0A 3H2BA 4LK2A 3DYIA 4MPRA 1B3BA 3SM3A 5C5IA 1U2RA 3IODA 3UMJA 3WWOA 3KKOA 1O87A 2YBEA 1PZEA 4B3TB 1PDVA 2XVXA 3UMVA 1WPXA 2QZ4A 3DD1A 3IAS1 3FA2A 4FGUA 4H3HB 5LU9A 3DL7A 1Y98A 2YCLA 2F4VB 3BMQA 4XGKA 2GK6A 3KB2A 4CEJA 3N2NA 1FJGB 4CR8A 3OQBA 3LSYA 1ZM7A 3SC4A 2G6TA 4BFVA 4QPDA 4LNUB 1E0AA 1DL5A 2G0AA 5IKMA 1L5WA 2YN0A 2JG3A 5BT9A 4OGWA 5JE8A 2XCTB 3PGMA 4RHEA 3W6OA 3BXEA 1M34A 3QJGA 3X2SA 3DTVB 5TMBA 2FHPA 2O05A 2EX0A 4GRIA 4I50A 1XZIA 5E9JA 1PJQA 2IQIA 5GOTA 3VO8A 1F1JA 1QPGA 5BV7A 4D4HA 2B37A 1ECJA 2C94A 5JDIC 4E70A 2PFSA 2G09A 1KYIA 3NBMA 5H5JA 1XPOA 4KO2S 2FPWA 2CW5A 1G3IA 5A3SA 5EXDA 2FW1A 3O8QB 3VR6D 2B1GA 4NBUA 1E0SA 3A3NA 5H02A 3W7BA 4DWWA 4NU5A 4XJSA 1F2DA 3HP7A 4IXWA 4O29A 2R1VB 2RGNA 2IUUA 1KR2A 1E4YA 3I2IA 1K88A 2FRDC 1C1DB 5P8WA 4LF5B 3RAFC 4TL6A 4BLRA 4D5EA 1YA4A 4Y30A 4AMBA 1UKYA 1EFHA 1DAEA 2ZBQA 4GKBA 3IH5A 2C4MA 4N39A 4UBJA 2ZR0A 3M2PA 2E55A 3ZD6A 2OBXA 5CYOA 3T5TA 4TLCA 3R0QA 4Q47A 1BMTA 4BKMA 1LK0A 1TZJA 2GN0A 2XDQA 2B1RA 3MIIA 4XRRA 2R87A 3TR0A 5I7AA 1E4VA 3ZE9A 1TB4A 3G3EA 5E38A 3WWEA 3LW7A 1BQ4A 4V2UA 4HNAB 2G28A 2QD3A 5TY0A 2BBOA 2V0NA 2BDUA 1F1BA 4F84A 2YOFA 4F0JA 1JQLB 5HVNA 1ORDA 1ZG3A 1AT1A 1I7NA 3RUDA 4QDOA 5LQJA 2Z04A 2PQ6A 4R1OA 3VU8A 3GJ5A 2OUIA 5HRUA 2JGMA 4JOSA 2XQIA 2OMKA 2BFNA 3Q9SA 2VG8A 1FTWA 3OTQA 4QFMA 5THQA 3MJRA 5F3RA 3C6XA 2A0XA 4BX2A 3PUZA 3RYHB 4LJYA 2I65A 3SSAA 1RLMA 3JR3A 1RXVA 4MS4A 5WRFA 1FC0A 1IZZA 2EFGA 3IDFA 4AMVA 4L7QA 4QJ3A 4NMXB 2AHOA 3WLKX 1PUJA 1XTKA 5EMLA 2PMEA 3RTAA 2YNMC 4H59A 3VH1A 2QRVB 3CUVA 3KVVA 2P62A 1PT7A 2PKYX 4A8JC 5KJFA 2BPOA 1Z16A 1SU4A 5AJUA 2ZUDA 3UWKA 4A5OA 3N0TA 1NN3A 3I6IA 3R9KA 2RH5A 1NKVA 4S1OA 2GQ0A 4IFIA 1P2GA 4ZO6A 3RAPR 4GOXA 4PAMA 2NAPA 5LQAA 1XD2B 2NNLD 1TMOA 3AHIA 3RS8A 1GDHA 5I01A 4M9XA 4RIGA 1IIBA 2JKVA 2E4UA 2M98A 5IRCD 5AW9A 3DXFA 2ZUCA 4L0MA 1U0OC 3G6KA 3MPUA 2B5WA 3ZTYA 1D8AA 4S24A 3VSBA 3MINB 1ZK2A 5EP2A 2R5WA 3AFHA 1FMLA 1RI2A 5BVHB 2BM9A 2HRCA 3ZKWB 4JY7A 1P6UA 4HN4B 1RQGA 2HJWA 3WYGA 1JEYA 1RZRD 3QYFA 4LZWA 2L18A 5DM4A 3K9NA 1ND5A 5FWXA 5ALUA 3KXDA 4LHWA 3NHSA 3PT9A 4RETA 3A1FA 3PYMA 4GNRA 3RC1A 5C7IO 2JH3A 3BL8A 3PEEA 2JFVA 1XHLA 4LCJA 4OOEA 1DXOA 3HDYA 3ZC3A 4C5AA 1WXDA 2E4ZA 4F91B 3UJBA 4HDSB 1AS3A 2PMWB 5HA5A 4OFZA 1FP4A 3ZDEA 1L5HA 4M7RA 4X20A 3PF9A 4HNSA 3R8CA 1FQJA 3K5PA 4NI5A 4BNVA 5A04A 1IUOA 4AUMA 1YL5A 4HX2A 2DHRA 2WOOA 1SH7A 1DIOB 3DNFA 1NAIA 3LHDA 4ZGBA 1NTOA 3OQJA 1P5HA 1LW6E 2EL9A 3DOCA 3ELDA 3K6JA 2XUHA 2J3KA 4HEA6 4L4RA 4L7VA 1QE0A 5CVDA 3WNZA 1YJBA 2OFOA 3DHNA 2CLLB 3U40A 4UZFA 2GCNA 1A9QA 4BTEA 3ANSA 1VKZA 3FWKA 1I9GA 3WB0A 3H4TA 5G2OA 1Z17A 2XIJA 2PAAA 3NWPA 5H80A 4C7XA 2VQSA 4TGLA 3SDBA 2YC2C 1IN4A 2JLSA 4MS3A 4PPFA 1YBHA 1VE6A 5EPUA 3OZWA 2PLNA 5LQSA 4XAQA 1UEJA 4KB5A 3E3OA 1TJ3A 2VUIB 2YV2A 2F17A 2V5VA 4EFLA 4D3YA 1X3SA 2BCJQ 2GPJA 4V39A 1PK7A 4B5KA 4OYRA 1RWQA 2G83A 1PQ4A 3B1JA 1CUYA 5DHQA 2FZKA 2PBLA 2B25A 3EGVA 3Q87B 5HF9A 3WJ2A 2Q4RA 3AP3A 3CINA 3QVTA 3F98A 3BERA 5ITSA 3HV2A 1VZ2A 1V8BA 4G0WA 4EY7A 4AKHA 2JHFA 3DEHA 1GAEO 2OBYA 2FEMA 3VZDA 5GZ1A 1XTPA 2WYHA 3IMCA 3NASA 4U5XA 4CL8A 3L3BA 1WEHA 4EJMA 3ENNA 2WU8A 2WY2D 3CJRA 3SE0A 1REQB 2EDCA 3BTVA 2X3UA 5TF4A 1RTKA 3L0DA 2ZE7A 3NC1C 4KIWA 4OBWA 4Q1EA 3ZEIA 1WZ2A 4TYWA 2QX8A 4WK2B 1ISRA 5DTJA 4ZJUA 5BN3B 4RKFA 3RHSA 2DWOA 2GA8A 1UZNA 2OUKA 1P0MA 3KZOA 3M49A 2YIJA 4PFQA 5HNKA 3AIKA 3P26A 1YQDA 4E5VA 1CUWA 2CHVA 2BTQB 5B2EA 4DA6A 2RI6A 4KOEC 5I4KA 1SVOA 3E9YA 1E3SA 3OEHD 5CBKA 2OCIA 5EGSA 2VT7A 4C21A 5ESWA 2I5PO 4CEJB 5E6RA 4CKYA 1MNAA 5EPOA 3DBRB 3UV7A 1N6IA 1Z06A 1FUYB 2IPLA 4EKNB 2W2TA 2GRJA 4EEKA 3W5UA 1U0HC 1WXXA 1V6SA 2BE9A 3DKIA 4CMIB 4DLNA 2Z1DA 1PNTA 1SUDA 3DFZA 4AFNA 3NIDB 4XCXA 4WY2A 1E5LA 1BVRA 3K9LA 3TLGB 3KFVA 4I50B 1QIJA 4NMMA 1N2XA 2HYDA 2ZLBA 3C8ZA 3GAZA 5EUBA 2BI7A 3M9XA 3PD7A 5FI0B 5IK2D 2QRNA 1JS1X 4NCBA 2B2NA 2YMMA 2CLSA 1NHWA 1NIPA 3SS7X 2NPOA 2WPNA 3EQZA 3H4MA 1QCDA 4JJKA 3QX3A 3HVKA 4FD2A 4KAAA 1O1YA 4CKBA 1UBTS 3HNPA 3T7KA 2BFFA 3GJTA 4JUAA 2WWYA 2SBTA 4C03A 3IB3A 2WKSA 3GT4A 1IXRC 4YUAA 4X8LA 3RTEA 1NVEA 1W85B 3CRQA 1NQAO 4LZJA 5ALRA 3C6ZA 3GEBA 3JCZA 1E9EA 2HJHA 2NZXA 2Y77A 4A36A 3RIXA 4MPPA 5I3ZA 4ARBA 1AHNA 4RYLA 4S1NA 4XA8A 3O8OB 4FEYA 5EXPA 2L69A 1THGA 4ENUA 2SHKA 3V7NA 2VBFA 3W3AH 2XDQB 5KNDA 3ZV6A 2BGWA 3G79A 4LJLA 1Z4MA 2HXYA 5HXAA 4KRFA 1ZY2A 2ZWOA 3FFTA 2B20A 4YMHA 1TQ4A 3LL7A 4E1VA 2Z6QA 3BPSA 5GJVC 3ZWVA 3U4GA 2PGDA 4LXGA 1B8NA 3UAXA 3IQZA 3EXHB 3EULA 4PC1A 2JFBA 3BE5A 2D1YA 3KHKA 1XT6A 4K03A 3ES9A 3OC6A 4G65A 4GXQA 5CBPA 3P0RA 3KTDA 4QUKA 3K0BA 1S8NA 5KREA 4JI0B 4IIJA 4DQDA 1CUVA 4F45A 4EYOA 4UPEA 3IL2A 4EPTA 3LPNA 1TA9A 3OEYA 4I4CA 4Z3OA 4S35A 1QBKC 1D6MA 4PG8A 4QRIA 3VTAA 2M1XA 2H2HA 5IVKA 1UIMA 1ZIDA 2MINB 4JBHA 1L8LA 3RKRA 5JOQA 1ZNYA 1ZL2A 1ARZA 1R0LA 2OGSA 2FGJA 2FZVA 2XMSA 3SEQA 3FHTA 4C2AA 4COKA 1JYEA 2WJWA 1TFRA 2ZB4A 1CLUA 1R7RA 2EYQA 2I6QA 3QOWA 2CVPA 5MHTA 3FPLA 2XSZA 4UREA 4UHJA 4I1PA 1BE0A 2J6IA 2H6EA 4NH4A 6CHYA 1XMJA 3PHHA 4JLJA 2JCBA 1TUBA 3G5UA 1JNXX 1NP6A 1UDRA 3OO0A 4L6IA 1IYZA 3K0AA 2IIQA 5K4AA 3O3NB 2ZT6A 4IUDS 3AM5A 4QLBA 3C48A 2IS6A 2CLDX 4RPIA 1VPVA 3IAUA 4TLLB 5TMDA 4EUHA 1RJDA 1F4PA 4J7XA 3Q98A 4G0NA 4AMUA 2OKCA 3IDSA 1Z07A 1ZUD1 1T13A 1LKZA 2FW9A 1DS6A 4IDAA 5I7UA 3WV4A 5K3FA 1S2GA 1E79D 2BFCB 3C5HA 4HXYA 3UHOA 1I3CA 2PH3A 3V1MA 2RKBA 4EMTA 2FPSA 4P3YA 1P33A 1YDWA 5EE1A 3LAWA 3G59A 5DGDA 1TPYA 2DLDA 3KEFA 4UVDA 3JRXA 4G0ZA 5EC8A 1RT9A 3HUEA 1XKQA 1HRDA 1RAEA 3DFMA 3CX8A 1C4KA 3F6PA 4BXOA 3MWDB 3KEQA 4D96A 1IATA 4YAFA 4G9BA 1JR6A 2DUMA 1FP4B 2H17A 3E7PA 2CYCA 1FFAA 1P0CA 3FYCA 3HU2A 3T7TA 1SUSA 5F7JA 1NVUQ 3BWBA 2DQSA 1T5TA 5C7OO 3WGZA 4MCAA 4NZNA 4AQ7A 1QYVA 1BROA 2FMUA 3SYRA 2D1TA 4XR9A 1C1XB 5H3LA 3SFVA 5A6VA 1XDSA 4WCDA 3RR2A 3RSFA 1XUOA 3X1XA 2O2JA 1WV1A 3STXA 1Y1SA 3KQNA 2PT6A 2XCLA 4U8GA 4TKVA 4FOLA 1JLLA 4RTPA 1TM3E 2Y1XA 4KE7A 4P35A 4EPXA 2MT9A 3CRNA 3IMEA 4UZSA 4BNFA 5KTSA 1QPZA 1ESMA 3CW9A 3EFOA 2ZJ8A 1OREA 1K1EA 1XRPA 2RC5A 4MS3B 1UBLS 4Z9FA 3VHLB 3BRWA 5JNTA 3W3AA 3FRHA 5FBRB 2QVBA 3F49S 3H8JA 4FINA 5E3HA 5IT9A 3BT7A 4YRFA 4NZMA 1EHIA 5LMNB 2AOWA 4D79A 4B5LA 4RYDA 2PX4A 1T6NA 3GF4A 2IYZA 2ODQA 1HNNA 4IX1A 4KNVA 3K72B 1P2SA 4IIUA 3MGAA 5EXSA 3RHZA 2HNKA 3WFIA 2O5EA 3ND8A 5CVUA 3IE2A 2YWCA 5C5EA 1I33A 2HBYA 2B5VA 2PWPA 2QXUA 2RB4A 2AUMA 4HSGA 4OUDB 3BFVA 1W4ZA 3HQ4O 1RM3A 3KOMA 3PENA 5EHNA 4E2WA 1AHPA 1R8QA 4CKEB 4M9QA 2X0DA 5F5LA 2DX7A 5A1JA 4BKUA 4GOJA 1SXJB 3OETA 1NGSA 4NYIQ 1VJCA 1Z7WA 5KKCA 3DOIA 1T5SA 4R05A 3SLRA 4DQXA 1XJQA 1KO4A 2VJNA 1LS1A 3L0OA 4Z4CA 3JQBC 2QZ9A 3VBEA 2B1QA 2CDBA 1VDZA 3RRXA 2VTDA 1UBJS 2VK4A 4GX2A 4N41A 2ZIWB 4BX3A 2FQYA 3W0LB 2CXTA 2PLAA 1QPBA 2A9OA 2H52A 3KYCA 2I3GA 1KPHA 3ADPA 4HDQB 4KXLA 3VR3D 3DP9A 6REQB 4FBLA 1EJ6A 4FYVA 2OXIA 3SIWA 1HE3A 2IU4A 3UWSA 1EXNA 3LKBA 3USES 2CL5A 2G1KA 3FNIA 4Y1GA 1JR2A 2EFJA 4P33A 3PVZA 2BEVA 4LRWA 2II6A 4IWXA 1T0JB 1IL0A 2HM7A 3O9ZA 3PHCA 4JC8A 5EIFA 2FSSA 4K6CA 4M88A 3RFXA 1CJUC 2JGJA 4EYEA 1XXLA 3V8RA 5JQGB 1CR6A 1W5SA 3A1TA 2V96A 3C3JA 3CVOA 2WSSA 3O90A 1G2OA 2NO6A 3R3SA 4ZHSA 1X7XA 1V3UA 3FYHA 4QGSA 1C3JA 3OZTA 3IRUA 2VKTA 2NYRA 3LUCA 3CFYA 3A31A 4LOKA 2ZTSA 2PMCA 1F2UB 5HMMA 3GC6A 2X1LA 3HFJA 1UFRA 5IHPA 1FSFA 2YVUA 1NXQA 3WGYA 4Z53A 5AVJA 1IG0A 3H5AA 4QUIA 3LC7O 4LISA 1Y6FA 1IBMB 4N48A 1G9TA 3IP8A 1FP6A 1GFZA 3IURA 1AXEA 3JAKB 4EHIA 5BQ3A 3RHFA 5EWJA 1XYYA 1C0IA 1WHTA 5IWCA 1IY8A 5KTKA 2X76A 4G89A 2F8SA 3E9NA 1O7JA 2JGIA 1H8HD 1T0IA 1NQTA 4E5DA 2GEVA 2HWYA 3OQOA 3V4RA 1FYFA 5H9VA 2YYAA 3W5AA 3TZEA 3RUAA 3CZRA 3DKRA 1P1BA 1O5TA 4RGBA 4AN4A 3K0KA 2FG5A 3DMRA 1PVDA 3DGFC 3KZVA 2NUTA 3VNBA 1ZA2A 3TSCA 1Z3IX 5F1KA 4EI8A 1KQFA 4Q24A 3BGVA 2JIPA 4JKOA 3MAJA 4F3NA 4A6DA 2XHEA 3ACBA 1U31A 1Z6AA 2B36A 2I3ZA 4ALJA 5BVGA 4TMTA 3WWCA 2VCYA 3JS5A 1E2HA 5F7ZA 5C31A 3WMEA 4DZZA 2PXXA 3DPUA 3UJ9A 3U3KA 4OJQA 1GOTA 2J7PD 2Z8XA 3IKVA 4RIHA 1VL8A 4JBGA 1KH3A 5SZIA 3BXHA 3HSKA 4BNGA 4F3KA 4BNKA 3TGPA 1U0BB 2CV2A 2B61A 5DWQA 3C7KA 4LE1A 5CLGA 2AVDA 4B0OA 4RELA 4RFSB 4ZKEA 3WL3A 3AW9A 2J4DA 2I6GA 1DC4A 4BQSA 2JJQA 3ORHA 3KQWA 2CYAA 1DINA 1I8TA 4BP8A 4G0OA 4ITVA 3ZZ1A 1MFPA 1RPJA 3LDFA 4BX0A 1U3GA 1J2JA 4JYBA 5CBPB 4K9QA 3LUAA 4OI1A 2FW8A 5D5QA 3KAJA 1US8A 2BEUB 4G4GA 4O1HA 4XSVA 4PBRA 5DBHX 3ROXA 2DQ4A 4AXBA 5CNKA 3ZDXB 1JVBA 3H5NA 1POXA 2HQSA 3WBKA 2NO9A 4K6MA 3QG1A 2C54A 4ZZ1A 1IONA 3H84A 3DDZX 4URVR 5JS8A 2I2CA 4ARUA 3C3EA 5L3ZA 3SZRA 1W5EA 2PZJA 2PZAA 2BGUA 2BKEA 3G8DA 3OCXA 2W6ZA 4TN5A 1JH8A 4D8WA 2XUQA 2O8VA 1O9BA 3PNYA 1IVSA 2Q45A 3H9UA 4HAYA 4OAOA 4M8NE 3Q2IA 2OO7A 3TVTA 2X0IA 4HGNA 3HKEA 4DSZA 5JIBA 1K3FA 3SC6A 1QO0A 3WADA 4FT4A 1IY2A 4EAAA 1GCOA 1TUBB 3L6RA 5GGYA 3QX8A 2AR0A 2IP2A 3CKMA 3VH3A 4BDSA 3P2OA 4OD0A 1DJMA 2EDAA 3K6KA 1NP3A 4M6WB 4X45A 1XP5A 2P35A 4J0IA 3AVWA 3UMBA 4BVJA 3AVYA 3CCFA 5AYVA 5K51A 2ZIVB 3EVGA 1QHEA 4N6NA 4QLOA 4WLFA 1JEAA 1AF7A 4BC1A 2O7RA 2W4MA 1ZJ6A 4QDXA 2ZEJA 3AW8A 3PDIB 3BJZA 2W90A 3PKZA 1NNUA 4CLXA 2FTKE 2I66A 4K46A 2GA9A 1IAVA 3MTIA 1ONNA 2WU4A 2V5UA 4ENSA 4MHSA 2I2BA 4OHVA 2A1UB 1ZWLA 2VSYA 4MW9A 3HC7A 1JFLA 3QWFA 1D6NA 2VHZA 4JLOA 2M1ZA 2F62A 4AG6A 3LTNC 2OWDA 3C8HA 4MZDA 5DM1A 4B4WA 4XWKA 1G5PA 3NC4A 3UICA 1M2HA 3NTUA 1XMXA 4M1EA 3WJ1A 4P4LA 3WYCA 5CFRA 1B00A 3CNOA 4MW4A 1AH2A 1RAIA 1VRCA 3BGDA 2NTNA 3E2IA 3LPDA 3B1KA 2L17A 3TOZA 3I4FA 1HETA 1UDBA 4RS4A 4CG2A 3PNKA 3KJZA 3P8ZA 5TJ9A 4WFKA 1SZCA 3QBJA 4WK0B 1E62A 1IIRA 2HDHA 5E3IA 5CEJA 3IJRA 2PPLA 1R0ZA 2R00A 1G3QA 4OQXA 5HKOA 2QLLA 2PX6A 4NMLA 3UEOA 2X58A 2DFDA 3A1EA 3OLQA 2KE5A 3ZV5A 1VL0A 3K8OE 5DYGA 3HJTA 1OXVA 4DQUA 1Z4PX 2PRSA 2O2HA 3MJCA 4DT1A 3H9CA 1I4OA 2IUEA 5JJ5A 4K3UA 3WRWA 3KB6A 3JALA 2I4MA 3QX7A 4DREA 1H8ED 2AYXA 3C5WP 3KAQA 5THKA 1DAIA 1R0XA 3CZ4A 3V7WA 1EXWA 3H2SA 1B26A 4JJ8A 1JWAB 2FEOA 2GM3A 2HIMA 1B0UA 1ZZEA 3LC2O 3OCUA 1V7PC 1R0RE 1XZBA 4JELA 5BSUA 2VH2A 4IF6A 1SBYA 5K0CA 5I7HA 4U7TB 2DY0A 3N2GB 3ODGA 1THZA 5AI4A 1XG5A 3G1TA 1U1FA 2NVOA 3K2IA 5CR9A 2P6PA 1VLLA 4QDTA 3TQRA 1JPJA 3CLTD 1MGPA 1BA3A 2OP0A 2Q3BA 1TYDE 2Z43A 3CF2A 2YUTA 3AX6A 1Z4NA 2HF2A 2E1PA 3B1WA 3ZHYA 3C15C 3OT4A 4B6EA 2ZW9A 4K88A 4KJXA 4DUYB 1M3SA 4AS1A 4ZCMA 3DXZA 1KEKA 5KNLA 1T8RA 4GEGA 2V5AA 2VNJA 1KJQA 4BLVA 4WK4B 5ERGB 4TROA 1I4WA 1QGZA 4ZVOA 3GLSA 2TMGA 2EX4A 4BO8A 1LS6A 3W7AA 3T3DA 3G2NA 1N2CA 1ZH2A 2GFHA 2P9EA 1Q0HA 3JAMA 1WUYA 2PUBA 5KWJA 2F3SA 4BV3A 5GJBA 1N4DA 2ORIA 3VZSA 2PUDA 2E4YA 4NHOA 3EOZA 3N2ZB 1G8SA 3NBQA 4Z8YA 2C31A 3X1DA 2NVUA 3O0DA 5EEHA 1X7XB 1QIEA 3NNNA 3H1TA 1BNCA 3SJ7A 3DXXA 1UDXA 1TJ5A 1VIAA 2AYZA 3ET5A 2KBEA 3PI6A 4FQ7A 2Y3IA 4RZQA 5FBHA 1F60A 1H3NA 2NYVA 1Z2AA 4UXJA 3TJMA 2Y0DA 2JH9A 4FU0A 3CV3A 3REGA 3W2IA 1R16A 1ZI8A 2O20A 1BD4A 2ZT8A 3NVDA 5C53B 3FX2A 3RSCA 2XE4A 1GYPA 2AL7A 1GPKA 1HZZA 1JRLA 3QVMA 1P1KA 3PV0A 4MHOA 4P3KA 4QTXA 5LKRA 2DQZA 4LPKA 1T2VA 5A05A 1O97D 1PZGA 3EIXA 3EG9B 4Y1RB 3SJUA 1JDBC 1J00A 4RVHA 5F2KA 4IDDA 2TMKA 4XDHA 4NULA 1HLDA 1ONBA 2VDWB 4YN3A 4Z1OA 1EDEA 1WXIA 4YCNA 4CQNA 1G8MA 3U7IA 3DTYA 4HDOB 3HACA 1IN8A 1VJRA 2DLNA 2CUKA 3I72A 4LOHA 3T7AA 2JI6A 5J4VA 3GVPA 1HG0A 3DJYA 2NUTB 5CFNA 3UH1A 2FEPA 5CM8B 4ASUD 2WHPB 2HK9A 4H7EA 3ZIAA 1VPEA 3L0IB 4LRUA 4CI9A 1IE3A 2JJYA 5CVVA 3D8NA 3H1AA 4PZYA 3UGKA 4DCGA 4EJ2A 2J9GA 3EVDA 1QYRA 1OLOA 2PKQP 3BWXA 2EHDA 1VL6A 3E1GA 3CVWA 3U4DA 2G08A 3QLUC 4MUEA 2VF8A 1UJ6A 3RV3A 3QSGA 1TIPA 5EMKA 3W34A 4MVJM 4TVOA 5FKJA 3LCJA 3V4PB 1W44A 3C3WA 3BULA 3NAMA 4FFBA 3PKIA 3QBVA 4U2FA 1YOBA 3LUKA 2XKKA 1BMFD 1ORHA 1U5BA 3AY7A 3H87A 3RQSA 3RS3A 2IW3A 1UADA 5J2UA 3K53A 1R8SA 3THXB 4BVAA 2OGZA 2XUJA 1HG1A 2IYAA 1QKIA 3O84A 4O4JB 4PPQA 2JZOA 4C06A 1XZMA 1AKMA 4ER5A 3KJFA 3PFCA 1US8B 3OJLA 2AZDA 4YJ2F 3FWZA 5FP0A 2F00A 3LO5A 4TXJA 1K98A 3ECCA 3Q6IA 3UJ8A 3ZU6A 1MW8X 5IG2A 4LEIA 2MIIA 4JDPA 2BM1A 4QGBA 1Y7TA 3OHSX 1PR5A 1UODA 1KZ1A 1XQ6A 1AGXA 1TDJA 5AFSA 1ZO8A 3FOEC 1B3RA 4NSNA 4QREA 1GPBA 2NG1A 3G2JA 1ZMXA 3L4BC 1KR5A 3NT5A 4WGGA 1RRFA 4DHEA 1EVIA 3HKEB 5FPYA 1T8SA 4KRGA 1PJRA 2ATIA 2GXSA 2RGYA 4R2XA 2PUFA 2PN1A 4GUAA 2TECE 2O8NA 3MOSA 3OTOB 4FSDA 3A7DA 1V8DA 1ZYUA 2CJXA 4TWAA 4WFJA 4I8IA 2AJTA 4EP1A 1TJYA 1R6XA 1SC6A 3G7NA 1GQRA 3UHJA 4HUQB 2QL5A 3D5QA 2EEPA 3FKSD 4G09A 4QGGA 1JSCA 1BX3A 4A0QA 1WXFA 5IKPA 1X38A 1JE0A 4TYPA 3BQMB 1G2IA 1H2RS 1XX6A 1SCUB 1Z8HA 4RJLA 3QI7A 4FT2A 1P7ZA 3ET4A 3KQYA 2VNAA 4WZAA 1GGFA 1JKJA 2VBIA 1PL7A 2XZOA 1EWTA 1HL7A 2A59A 2ECFA 3UJ6A 2WIGA 2ZIUB 3GZNB 4BU1A 1PL8A 2IHNA 4NARA 4YGXB 3S29A 2ZG6A 5IUNC 1WJGA 1YHZA 5D3MB 1PG5A 5CVEA 1T0PA 4G8DA 1XEFA 3HKBA 1VG1A 3LGSA 1BQEA 4QU5A 3UT6A 1CS0A 1WP9A 5BV2P 3N0VA 1KEUA 4LKRA 4ZO9A 5IARA 2XDYA 1OY1A 5ICCA 1YUBA 2JGLA 1TLTA 4BMZA 1ST2A 1DEXA 2JLUA 1X7GA 4LXIA 1KHTA 4B4OA 3EEOA 3H11A 4NATA 1V11B 2HCBA 3L0BA 4ZVRA 4UBMA 5KSYA 3FCCA 3JQFC 3ABRB 3SKXA 2JJ2A 2H1SA 4YT5A 3LBAA 1EFVB 4G2TA 2ZBRA 5BOVA 4RY8A 3RBZA 5A62A 4ER7A 4DCSA 3TDNA 2NU9A 5CA1A 4MVJI 1J2TA 1WZUA 4TV9F 4L4XA 1BS2A 1R4NA 1XTZA 2W37A 4ZT4A 4DT1B 2O5RA 3D54D 1TAUA 1T4DA 3CCCA 3LBYA 3NYWA 3AI7A 3BOSA 5HQTA 3SCZA 3TLXA 3H75A 3VOBA 4INPA 2GJ4A 2GAFA 4BUZA 3V80A 1OILA 1AQYA 3AZPA 2QN1A 3TLCA 4JUBA 4A03A 4BWGA 1FXWF 1EZ4A 1E3LA 1F5NA 1K7SN 4YTEA 5EQDA 5DX0A 6NULA 1IXYA 1SG0A 3WKCA 3R3XA 4R2HA 4DUPA 2IEYA 3FRJA 5L4SA 4ZZIA 3PHGA 2QTTA 3CWCA 4JB8A 1QGDA 4CMJA 1XRMA 4FP9A 4AG3A 5KJ1A 4MGHA 4HKTA 4PYKA 2IHYA 2PKRA 4I4TA 1SC1A 1GN9A 4IZOA 4O4HF 4OSOA 3ZNOA 2NT3A 2MSCB 1XQVA 5E1OA 4BTLA 4JVSB 1GP2A 3B5JA 3BIFA 2XUFA 4NXNB 5KB3A 2ZWVA 2R8PA 4NBRA 1E3QA 4EGAA 1UXHA 2Y1EA 5LNK1 5GWXA 4EZBA 1S2OA 3PX3A 2VAWA 1WMDA 3KKPA 4JL8A 3BJEA 3ESAA 2LTAA 1SD1A 4PFJA 4M89A 5KQPA 1Z9BA 2RB5A 4WH0A 4HWSA 4PZ0A 1WLSA 2WWFA 3RVQA 2R60A 1QF9A 2OESA 4RA9A 4IJVA 1YRQA 4RF3A 1E1QD 3WGGA 3EZXA 4EELA 1EFDN 1N2CB 3AO0B 3C85A 1LPPA 3RT1A 1Y3AA 5DWVA 1WU7A 1S2IA 4AWBA 4DR3B 1PW7A 3QE9Y 2IBSA 1DHRA 2BP7B 2I8CA 2WHXA 4O4IA 2FOXA 2Q1SA 2HF8A 4QUJA 2OZKA 2AEMA 1TEVA 2XCQA 2XR1A 4PYLA 1OUMA 4QULA 2UYYA 3R4VA 5GY7A 1Y82A 3PITA 2EV9A 1LA2A 1WL8A 3EW7A 3JU3A 2ONJA 4EUNA 2RARA 1WVGA 4EB3A 3JD3A 4LX8A 3GFRA 3D0RA 4XD7D 2NU8A 3WK7A 1C3LA 4XM1A 3N87A 3HCAA 4G37A 4BFTA 3IPXA 3AM1A 3AG6A 2XRZA 3W6PA 2K4MA 1S2DA 2VWQA 1ZXLA 4BNYA 4LFAB 2GCGA 3MRSA 3O4JA 3PI7A 4B3CA 5F4ZA 4X65B 3A0RB 1KVSA 2RGNC 3H99A 3DMGA 4HEQA 5JPIA 3D9QX 5A9RA 3EB9A 4F72A 1MZVA 1TUIA 2QR3A 2Y0PA 3BJRA 4OXXA 5JDCA 2AQKA 1YZ3A 2O6LA 1Z08A 2PM8A 3VJRA 5ICMA 2J31A 5FTJA 3B1XA 4B35A 1UZUA 3BD9A 4D98A 1YZQA 2EFCB 4MVYA 3TUIC 1TYZA 1NKSA 2IWRA 1ML4A 3I64A 4Q03A 1XJCA 1E9CA 4HAIA 2NLOA 4RH1A 1I36A 3OOWA 1KAQA 1NVFA 4IGIA 1DC7A 3ORRA 5LZ2A 2JFNA 2AN5A 5CFLA 3B60A 3JWGA 4WXMA 1GTVA 4KVGA 3TQFA 3GFGA 3I32A 1DAHA 1Y8AA 3IEKA 3GHHA 4WBNF 4W5RA 1L4MA 2C29D 3D6TB 3CJTA 5HKAA 1Z0IA 3BMOB 1XTBA 3T9FA 4C0KA 5E6UB 2BR5A 4L5BA 1MJGA 3KOUA 3CLRD 4LOIA 3RS0A 3Q0TA 1JQEA 3W6NA 2A3NA 3O4RA 5IT5A 4TMZA 1RI4A 5J2UB 5LB4A 1WE2A 1E6WA 1T0UA 1KK0A 4ZCSA 4Y6OA 3S40A 3O75A 1UEXC 3KZXA 4B3JA 3T9CA 3O3CA 4J91A 1E1DA 1A2QA 4ACBA 3ZH2A 1L5SA 1QVAA 2XUDA 1E3EA 1N2HA 5F3DA 1KU0A 4YRJA 4EJ0A 4F97A 3U4QB 1YQGA 3G6WA 3DYVA 2HDNB 4I1OA 4KPUA 1SAYA 5LA6A 3TM5A 1U9ZA 3QQPA 3LDAA 3AFGA 3UAWA 3CH4B 1J9ZA 2EKQA 2EWWA 2KLHA 3VPHA 1PZHA 1U7DA 2HDOA 3H5OA 1DJPA 4I3GA 4MJ7A 1NMSA 2UUCB 3RJZA 1RE1A 2A7QA 1PQYA 1FBTA 1ZOLA 5IBPA 4RVUA 2CLFB 1SKQA 5AKIA 4KQMA 2W6JD 4PSUA 1QH1A 2JGAA 3D4PA 5JSYA 3EDYA 1ZICA 4FI3C 4GI3A 3S4YA 5ALXA 2YWGA 4LBZA 4ZC8A 1NW4A 1N2BA 3D6FA 1GR0A 4HXGA 4RWZA 3TQOA 4BKRA 4DYDA 2CVHA 4DCUA 3ONWA 1OLUB 2ZAMA 4CU5A 4CKZA 1DAOA 3KWMA 2B30A 2B7LA 3V7FA 1SBIA 4CM9A 3A9CA 1ADCA 1F12A 3DT9A 5DGIA 5D3KA 5K0BA 2Q3LA 4RVFA 1JB9A 1ISPA 2PMDA 1X8JA 3F5DA 3K1TA 1A2KC 4WZAB 5EZ6B 4LE0A 1CKEA 3HXKA 4G5QA 4ND1A 3SJCA 1FLNA 4D42A 3C6QA 1IY1A 3OFND 4C3UA 2XD9A 1HEYA 3CA8A 1NDHA 2V0CA 3E0QA 3MWJA 2X9QA 1VSVA 4QXOA 5AM0A 1NLMA 3ND6A 6YASA 4IGKA 1VL2A 4IEFB 2BUBA 3T5GA 1G0NA 3OKPA 4BE4A 3PEWA 2GJ8A 1KPGA 1R9NA 3D6NB 1B93A 2ZOSA 4QG7A 1HI9A 3HKBB 1GAQA 3GELA 1NRJB 1R6TA 3HBLA 4G1MB 2P4QA 2WFLB 3EODA 5I9TA 4IJKA 2RHTA 4PAWA 3PFGA 3HB4X 4TS3A 1NUUA 2ZU0C 3W4KA 1EAYA 5AUQA 4EO9A 1G0OA 4FGJA 5IPFA 2VNIA 2OQVA 4YR7A 1ILEA 2NZ8A 3MJEA 4V0SA 1RHUA 1PTJC 3CU5A 2QTGA 3A9UA 1QF7A 3CBQA 4MYCA 4YJKA 3R75A 2GM5A 4AJIA 6ADHA 2QHXA 4EHHA 1PG0A 3V4SA 1PWHA 3RH0A 4CM3A 3ZYZA 4BE7B 1NX6A 4RMIA 1BVYF 4B33A 2OZLA 1RMTA 3WMFA 1PLKA 2PL5A 2ZAOA 3UWOA 1UBEA 2WIDA 3DCIA 3PRYA 5FA8A 3VU3A 4OXNA 3WHPA 4WKOA 4CKWA 2OENG 2CF6A 3EIEA 3KYDB 1XWFA 4G5GA 1Z2NX 4Y9SA 3P5SA 3VNSA 2BMJA 3SQWA 3RUHA 5C8VA 5BMVA 1W59A 5CITA 1ZIPA 2AWOA 1JVNA 1SB9A 3B82A 2JHGA 1WNTA 2PJUA 4MPDA 5K8VA 3PE3A 4A1OA 4LGCA 2Y71A 1DAFA 2R7MA 4LPSA 4RVCA 3FPBA 2BELA 3TQSA 4CL3A 1P60A 2HX1A 5DM0A 3WR5A 1H22A 4UEJA 2HBQA 2VF2A 4E2ZA 4E6EA 3ZLTA 1O6BA 4HFJA 1NQ5A 1WW8A 1I7PA 2Q3MA 3AXTA 4MMYB 1P29A 4OAQA 2DOKA 1QFYA 3NIWA 4PIMA 1OC4A 4PYQA 4H7PA 4L78A 3TVDA 2OHJA 1G8AA 3ICWA 3OE7D 1W5TA 2YVLA 2OLKA 3FY4A 2GTHA 2ZRQA 2A58A 1GKLA 5FJIA 3SYLA 3UT5A 4DCNA 5AMXA 1A9PA 3DAYA 1UKVY 5AI9A 5T3YA 3VH4A 3WSVA 3PL1A 4WHMA 4N03A 5IFKA 2EGGA 3LDGA 2FETA 4F06A 3LF2A 5F5NA 2FWRA 2JNWA 1AK2A 5E2AA 4YPFA 1J0DA 1PBNA 1U7TA 3SSOA 4AJ2A 4A26A 5ES4B 2JIBA 4R69A 3WRVA 2JDID 4ZCPA 4WNAA 1VG8A 3DEIA 3EN0A 1GFSA 4AYXA 2WUWE 5JYCA 3IAM6 3TG8A 4GMXA 1NF9A 1V5WA 4YRBA 5HJEA 1E1CA 1ZJJA 4CEIB 4PTLA 4I55B 3QVSA 5F9FA 2WWVD 3AP2A 4O4IB 4NDNE 5P21A 4YCLA 4PSAA 3IBFA 3CGWA 4C29A 1H9AA 3DBLB 3NWJA 4KK4A 2BSAA 3ZJTA 1Q7BA 1C8VB 3OURA 4H1TA 3TTUA 3CY6A 1RYDA 4RFVA 3ONVA 2F3PA 1E5XA 1Z73A 3BD8A 1HYQA 4XW2A 3TCKA 1PG2A 3Q5EA 4BMNA 5A4FS 3HMKA 3AIIA 3L41A 4EJFA 2PD6A 4LNHA 3CRZA 1WPRA 3FNRA 2PZFA 4DG9A 4TYYA 4XKJA 3AH8A 1TYCA 5JROA 2Q0XA 2X9VA 5HYVA 4XLZA 3GEPA 3IPCA 1IEVA 2QLTA 4A8HA 3H2HA 5C35A 4CG1A 1Q1NA 2OYRA 2I7CA 4GMGA 5T4FA 3JQ9A 5FWDA 5HF5A 5A6SA 3ZZUA 2QTMA 3L0CA 4MROA 4FFOA 1V9CA 1SUIA 1THMA 2BGRA 3F7OA 3MK31 4CT0A 4LFBB 1XJWA 1GL7A 2IDJA 4ZYZA 4DUGD 3GUCA 3VAZA 1P81A 4QGAA 3T4XA 2AOUB 2XB2A 1XVTA 2NP6A 2QY9A 3UOWA 3CLUD 3NDRA 2JIZA 5D00A 2P91A 2CBGA 4RKYA 1DIRA 3A10A 3ILXA 1LSOA 4WL0A 1A50B 3FDFA 3EPPA 5KBYA 9LDTA 1KAMA 1QFSA 1IZ0A 2ZJBA 3STVA 4D0RA 4E22A 5K3CA 5C8XA 3HCNA 4HWPA 4Z7QB 1OW3B 1WETA 3TTVA 5AVKA 2O1XA 4DIFA 2X5JO 4HYTA 1G8YA 2IHUA 5CFPA 1S0UA 3G0BA 3PWSA 4LHSA 4MKHA 3UAGA 4MWDA 4UCFA 2CUNA 1MB2A 1X70A 2RHLA 2XYGA 2NUPA 2ZYRA 4DV6B 4EPWA 1YFLA 1G5FA 1XR3A 3M5CA 2A57A 4OXYA 5H59A 3THSA 1RYNA 2HA4A 2QR2A 3D59A 1ZMTA 5ALHA 1EFPA 2Z5LA 1AUPA 1JG1A 1MQ8B 1NQUA 1U0EA 2GR9A 3COSA 3F4LA 2LCIA 3EE6A 3WYBA 4BE9A 1E94E 4BQRA 5CXQA 4H4EA 4UTVA 3OQ1A 2VQEB 1KVUA 3KQVA 4M1SA 5D84A 4BAUA 4KPUB 3WMGA 4D6YA 2JH8A 4F5ZA 1SXJE 5DTQA 1E2LA 4LJRA 1KJYA 1O94C 4JZKA 3RUFA 1EVJA 5LN1A 2VDMB 1KRXA 4HVTA 1UWVA 2FQ1A 4JCOA 2XWPA 5KOJA 4I1SA 1KZ7B 3CSUA 3GG9A 3MTAA 3GDOA 1GSHA 4P4TA 1RXYA 1E1MA 1YO6A 3FSGA 4R40A 4PHFA 5HRAA 4JXXA 3L7BA 2V3VA 4B3DA 3QMVA 3W8NA 1QH1B 5I3CA 5IJ9A 2OM2A 4MGKR 4C3OB 4ZZ3A 2G4VA 1QUEA 1YE8A 1JYFA 1W1UA 3LYLA 4H1VA 4RMJA 3TL2A 2QI9C 2ZJ1A 4RJTA 1MZPA 3E7WA 4XQCA 3EXFA 1OXUA 1RHMA 4S1PA 1DWQA 1FXSA 1JUDA 4UUQA 1L1RA 1JEJA 1M10A 2DUWA 3C39A 3SSMA 2BMEA 2CWWA 3EGXA 9ABPA 4BRWA 3DWGA 3GGCA 4I9GA 5AW6A 121PA 1S7CA 3AERB 4DIEA 2HLDA 4U63A 4K87A 3V6LA 2O8EA 1RPZA 4YASA 4Z3KA 2XBUA 3WL5A 5ECGC 2XYVA 1RAAA 1SG6A 3BMNA 1TA4A 3NBAA 4MV0A 3OIWA 1XL1A 3IEIA 3NOXA 5DYYA 3F9CA 4C4SA 4UBKA 3DSRA 2R86A 4UEKA 5A3QA 4B3GA 2AYYA 3K1YA 3QH4A 4EIWA 1P5FA 3ZK9A 3HCFA 1F9AA 2VIIA 2WSIA 5TNXA 4N5HX 1ENOA 2KYRA 5KO2A 5GINE 3K5WA 1SIUA 1G19A 2Q4DA 4BLSA 5BWBA 2A1IA 2Y6UA 4IDOA 1M2OB 3UWMA 3CRMA 4NOLA 1N0UA 3JQAB 2P4SA 2OOKA 2JLBA 4K9SA 1OHHA 5JC1A 2LD4A 2NW6A 3H0KA 3P94A 2D13A 1U3CA 2PZMA 5DP1A 4N1AA 3Q8KA 4RDIA 1JLMA 4QUGA 2GF2A 1XC7A 2OD2A 4QDUA 4G5YA 3RARA 3RVBA 3MMZA 7ADHA 3KQHA 4UC0A 3JAWA 1OQAA 3JV7A 5HG0A 4N6OA 2D5LA 1ECLA 4YMLA 2XE6A 1TNDA 4G25A 3S1LA 5IAAA 2OBBA 1JHRA 4GXRA 1G20A 1NF2A 4IIHA 4DCCA 5FX2A 4LMAA 1YZVA 3D6JA 3FG9A 1SCBA 4QNNA 3WLOA 4FJ1A 5HM6A 4KL8S 4PGHA 4D8XA 5L53A 3M6LA 2XYRA 4PHCA 1A0OA 1TVCA 4MGYR 5BWCA 3DEJA 3NEPX 3R3UA 4FVTA 3T9BA 2VOEA 3IQFA 4EG3A 4NG4A 3FIUA 3TRKA 4YO7A 2AI1A 3OM0A 1MEJA 3FBTA 1E9SA 3KLBA 1QE5A 4RH3A 5DZSA 1NVWQ 2BFBA 4P0TA 3E4CA 4HFRA 1CY4A 4KI0A 3UQZA 2WM2A 4D9FA 5HJ7A 4EMUA 5JCZA 2RHGB 3FJ1A 4HDAA 4WZZA 1GUDA 1QHYA 4HK4A 1EUZA 3QWHA 3R76A 5ICEA 2LKDA 4LQLA 4ONEA 4U2KA 4JT8A 4MI1A 5E8JA 4I2VA 3P0JA 2JLZA 4PZLA 1QYIA 1T1EA 1PR4A 4Y7CA 1QGED 4YP9A 4CODB 1A8HA 4PWZA 3HO6A 1F48A 4BGDA 5KWEA 4AULA 3L05A 5FHRA 1XALA 4QZVA 5J1SB 1NN1A 3KUCA 5LP6B 2ZAGA 4LWPA 1C9KA 5ED0A 2B82A 2SICE 1ZN7A 2I87A 2M6RA 1Z3CA 4OU4A 3W2FA 3WMRA 5I48A 3NJRA 4P9NA 4EPRA 1TADA 3Q1LA 4FIDA 3KYIB 3KJNA 4C2UA 2QM3A 2DG2A 3QMMA 4MUGA 4DMKA 3WQBA 1TT5B 2FFRA 1HOTA 4A10A 3U3MA 2IDZA 3FHJA 1FS6A 2ID8A 2EG9A 3MGGA 4WECA 4OK3A 4B47A 4C7BA 4JLSA 4DMCA 2BM0A 2ADFA 1FQWA 3AB7A 1PZFA 1ANKA 4K9OA 1RADA 2QRPA 3WKDA 2H1FA 4FBGA 1JHAA 3AILA 2ZBFA 4JVNA 3KT3A 2HAEA 3AINA 4X93A 3ZCRA 4R9RA 2BTOA 2OKGA 3BSSA 3KKKA 3T3PB 4RK0A 2I54A 1WPGA 3BCHA 3MAGA 3WRXA 1I7QB 4U6QA 3OIYA 1XZGA 3HA2A 5CCDA 4AJHA 4LF4B 1Q11A 3NWEA 1QMPA 4QOHA 5A6SB 4JFAA 1TEXA 1NASA 2HNBA 1RXSA 4HRYA 4UU0A 1HYHA 3LFHA 1MD9A 1YQXA 2Y0CA 4MVJP 3NUQA 3T41A 5FAKA 1LLCA 2OD7A 2QXYA 3G2QA 4RHUA 3BWVA 5G53C 5KSWB 4OH7A 4DIDA 2C03A 2W6QA 2Q99A 3QPCA 1VFPA 3A6LA 3GT3A 4JENA 1U4SA 2YJGA 3FLMA 3G49A 4R51A 1HLGA 4ZOBA 1W0KA 1DQPA 2C2XA 3AZOA 3CRRA 4F6CA 4N6GA 1XEWX 3IE1A 1G38A 1RJGA 2NZUG 1PV4A 1R37A 4LYAA 1IFXA 2JIQA 4HX9A 2J7KA 2XX3A 4PM4A 4AY5A 1ZK0A 1P0QA 1RYMA 2FFJA 2WKWA 4PRLA 1Y7HA 3F9RA 5BORA 2X40A 4ZDJA 3ESZA 1PQUA 3VPBA 1ADGA 1E7RA 2FUG6 1DXHA 4HQ0A 3U3XA 3EIWA 5FUXA 5CT5A 3PRKE 4BJ1A 1J2UA 1H9BA 1YBVA 1VPLA 2IHJA 4ZVLA 4Q3LA 5KTYA 2VDJA 1EGVB 4GSYA 4Q93A 4XGIA 2IV3A 4MX8A 4WA8A 4RZ3A 3IDAA 5J59A 4NCJA 4K5QA 1KOLA 4XIIA 1AQJA 3LBNA 2QZJA 2C04A 1E2IA 2R6GA 1L4KA 4GKAA 5K8TA 3T99A 2ZJZA 1PYDA 1FDIA 2Z5GA 1GPUA 2OCBA 2ZREA 3FWPA 4KFTA 3PC8A 1Y1PA 2HZBA 4WCVA 4US1R 4CW7A 2C4NA 3V32A 1YOVA 5T6MA 3ABQB 2QRMA 4YAJA 2IEBA 4K28A 1UZMA 2AVNA 2ZIEA 2XXJA 1XBTA 1IUPA 2JANA 3UKJA 3GK3A 1H3EA 1TZMA 4FCWA 4UZEA 4PAOA 5F98A 4FFMA 5ENVA 2QVCA 3GPBA 2ZZMA 2O8CA 3MN1A 4EB0A 2JATA 5IJ9B 4NAHA 2A1TS 1G98A 3BL6A 1XQXA 4Z49A 5IJWA 2PVSA 3KR9A 4H9GA 4ZQEA 3ZCUA 5K6TA 4UM9D 4Y9TA 1H85A 3DC2A 2EERA 2A0FA 3D6AA 3X43A 4PX9A 1BH6A 3QUCA 1A2OA 1Y8RB 2XAUA 3ETJA 4NJMA 3ZWYA 4TL7A 1WZCA 2IXGA 3ACCA 3AIOA 1EFAA 1YB1A 2QRGA 2B99A 2A5FA 4L2IA 3RRYA 1KYQA 4YMGA 3UW3A 4RZSA 3SDSA 1UAGA 5FPHA 3MMNA 2ERXA 3A9WA 3JWHA 1R6DA 3L1VA 4NWIA 2O8EB 4WLNA 4FXOA 1QOPB 3M8KA 2JIDA 3OP4A 1DMSA 1J06A 2QG6A 4HLUC 3JD1A 3P71T 4IJQA 3T61A 1T9GR 4D4JA 4TTQA 2AG5A 3FUXA 5FFMA 3LL4A 3V2GA 1XTTA 3RU7A 2J48A 2CXQA 2DBYA 3U31A 5JHGB 5LWHA 3VSDA 4WOBA 2B1JA 1I2AA 2A0YA 3DDWA 2XXAB 2YYYA 4CDRA 2J3HA 2UZ1A 4I8DA 5FUMA 4A6EA 2C5GA 4EPYA 5IBRA 2X2OA 2ET6A 3X0DA 4D9KA 1GPAA 5HW0A 2OE2A 1H5NA 4IOMA 2WABA 4N49A 3RVOA 4AO8A 4ESEA 4IZHA 4D9EA 3JQ8A 1AS2A 1Q3HA 4N5IX 4P36A 1F6DA 2C07A 4IWYA 3LT4A 1JG3A 2XDWA 4NBTA 1X9IA 5KUTA 5AQ1A 1O03A 4IO1A 3QEBZ 1LDNA 3L02A 5U4XA 2PZ8A 4WEQA 2X86A 1QCCA 1KQPA 1ZCBA 1CUXA 1K6XA 1QFJA 3BSYA 1NLZA 1UK6A 1W96A 1M1ZA 4I6JA 4HVCA 4DR1B 1ZJZA 3AI2A 3QPWA 4MW1A 3QKIA 2ERCA 3L4JA 2OK7A 2QSZA 1Z6XA 4H27A 4XWGA 4QHTA 4KR2A 2VR1A 4JX8A 3OJOA 2WLSA 3X1ZA 3HRKA 4NL4H 1BWQA 2RMKA 4TQAA 4XX0A 3ZY3A 3UHPA 3WYNA 4EB6A 5DNDA 1KDRA 5EJMA 4FKZA 4ZXFA 1HYBA 4CIYA 4Q9JA 2M6KA 2XTMA 5KU1A 1J39A 3BE8A 4MUNA