5EUBA

Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
272
structure length
272
Chain Sequence
b'VKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-methyl-5'-thioadenosine phosphorylase
molecule tags Transferase/transferase substrate
source organism Homo sapiens
publication title Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-MTA and sulfate
rcsb
total genus 95
structure length 272
sequence length 272
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5eubA00
3K8QA 4U2KA 5F78A 3ONVA 5B7QA 2HSWA 3GB9A 1WTAA 1JDVA 3KHSA 2HRDA 4QARA 4G8JA 3NBQA 1A9QA 3UAWA 5F7ZA 3QPBA 1OVGA 3FOWA 1TCVA 1A9SA 1U1EA 2HN9A 1SD1A 1TCUA 2QTGA 4QASA 1PK7A 1PK9A 1RT9A 1A9RA 4L5AA 1T8WA 1A69A 2PGAA 4R31A 2A8YA 3TL6A 1M73E 1PBNA 3MB8A 1A9TA 3UAVA 5CYFA 2ISCA 4PNPA 1B8OA 4TTAA 3KVRA 1XE3A 1LV8A 1K9SA 1U1DA 1OU4A 1PR0A 4TS9A 5B7GA 3FAZA 3IOMA 4R2XA 1V3QE 4GLJA 1ODJA 1RXUA 3O4VA 3GGSA 4YNBA 1JYSA 2GUWA 1A9PA 4GKAA 4L6IA 5B7PA 1T8YA 3KUKA 3C74A 1ZOSA 1Z37A 4LNAA 3PNPA 4D8YA 3OZEA 4DA6A 1VMKA 5F76A 4DANA 1Z5OA 4NY1A 5ETJA 4F2PA 4TTIA 5F7OA 4OGKA 1PWYE 2Q7OE 4UC0A 3O6VA 5F7XA 2H8GA 4TYMA 1JE0A 4BMXA 2AI3A 3UAZA 3E0QA 4X24A 3EUFA 4TXMA 1RXYA 3F8WA 1Y1TA 3KVYA 5I3CA 5K1ZA 1V4NA 5EFOA 4JWTA 4TXHA 1OUMA 4DA8A 1PF7E 1RXCA 3LBAA 1Z34A 5C80A 4YO8A 1PKEA 1TGVA 1N3IA 1TGYA 1OTXA 1ULBA 3UAYA 4F3KA 5JPCA 2BSXA 1V2HE 3OOEA 3DDOA 4IP0A 1PR6A 4TXNA 4PR3A 1OTYA 2IQ5A 4DARA 5F7JA 4LNHA 1ODLA 1V48A 3NM6B 2QSUA 5DK6A 3U40A 1B8NA 4WKNA 1RFGE 1U1FA 3T94A 4F3CA 1Z38A 5CCDA 3EUEA 4QFBA 1NW4A 1Y1QA 5EPUA 1YQUA 3NM4A 3PHBE 1V45E 3FWPA 1Y1RA 4F2WA 3E9RA 3ODGA 4FFSA 4EARA 1LX7A 1VHJA 4QAQA 1NC1A 5KB3A 4WKOA 1PR4A 1OV6A 4OGLA 2ON6A 1SD2A 5CXQA 1JDSA 2A0YA 1PR2A 1FXUA 4TXJA 1Z33A 4OEHA 4TXLA 1U1GA 1JPVA 1PR1A 2AC7A 4YMLA 3FUCA 4D98A 4L5CA 1V41E 4OF4A 1JDUA 4LZWA 4QEZA 3E9ZA 1Y1SA 3KU4A 1T0UA 1Y6QA 1PW7A 1YR3A 2I8AA 2AI2A 4H1TA 4D8VA 1VFNA 3DP9A 1LVUA 3OZBA 4TTJA 3OCCA 3FNQA 4K6OA 1YBFA 1G2OA 4NS1A 1YQQA 4G41A 3K8OE 4JP5A 4OY3A 3UAXA 4QATA 4F1WA 3OZCA 3DPSA 1JP7A 3DF9A 1SQ6A 2I4TA 4L5YA 4R2WA 4LDNA 1CB0A 4I2VA 1Z35A 1RSZA 3OF3A 4M7WA 5IU6A 4DABA 4GMHA 2QPLA 2B94A 2RJ3A 3LA8A 1Z36A 2A0XA 1VHWA 3DJFA 1Z5PA 4DAEA 3MMSA 1K27A 5CYGA 3BSFA 1C3XA 1JE1A 4M1EA 1U1CA 2P4SA 3P0FA 2AI1A 4BMYA 1I80A 1ODKA 1Y6RA 3BGSA 4RJ2A 1A9OA 4ECEA 4NSNA 4MARA 3OOHA 4DA0A 2OECA 3UT6A 4D9HA 4MCHA 1PR5A 1Q1GA 1JDZA 1K3FA 5CCEA 3LGSA 3BL6A 2OC4A 1Z5NA 1T8RA 2XRFA 1Z39A 4L0MA 2QDKA 4DAOA 3NM5A 3EEIA 4JOSA 4GLFA 1JDTA 4G89A 5F73A 4D8XA 3OZDA 2OXFA 3EMVA 4WKBA 1T8SA 1RR6A 3BJEA 4OJTA 4WKCA 1TD1A 1RXSA 4P54A 5FAKA 2QTTA 3ENZA 1ULAA 3SCZA 4E1VA 1QE5A 2A0WA 3INYA 1ECPA 3P0EA 1CG6A 1YRYE 3OPVA 4M3NA 4DA7A 5EUBA 3PHCA 5F77A 1SJ9A 3FB1A 3IEXA 4TS3A 4WKPA 2OC9A 4BMZA 1NC3A 1RYZA 1ODIA 4YJKA 3KVVA 4BN0A 5IFKA 4EB8A 3D1VA 4KN5A 2HWUA 5B7NA 1RCTE 3PNSA 5CXSA 1ZL2A 4MCIA 4LKRA
chains in the Genus database with same CATH superfamily
1IQRA 1PQYA 3E9DA 4ZWNA 5A6VA 1NUAA 3WLMA 3P20A 3HN2A 4BBJA 4U2KA 4D9MA 5KTYA 4ZEMA 2XUAA 3UFXB 1M5RA 1HT2E 2QYTA 4EJSB 3G8DA 2N0SA 3OBBA 1D5CA 1OXXK 4OJMX 5J4KA 5CA0A 4JEHA 1J0AA 4YWHA 5AJWA 3EE6A 1C9EA 2XX3A 3KHSA 4H18A 3TQHA 2ONYA 4C7MA 4HNRA 1QRDA 4LE1A 3NHYA 4XYBA 4CKCA 4RSMA 4P3OA 3EAGA 4LHSA 2FMHA 5B6JA 2XT0A 4HPJB 1UP6A 3HVKA 4Q3EA 3JWHA 5F4ZA 1DG9A 1Z73A 2CLCX 5I7SA 1F8XA 4HK4A 1HFKA 1JHMA 4OIFA 4GP9A 3IPRA 4NV0A 1NP7A 4ATNA 4CMEC 3S2ZA 1EJ2A 1YVDA 3FYHA 3SFTA 1G8KA 3V7WA 4DZRA 4LF5B 1PTJC 1LI4A 3OWXA 3Q3GE 4GVPA 4JQOA 5AKEA 2VOEA 1G21B 5FO1A 5U4QA 2QLLA 4Y0NA 1D1QA 3NXSA 5IJZA 2VRCD 2VHEA 4CT4B 3W2HA 1G5HA 3P9NA 5DRTA 5C32A 2Z2JA 4YJ3F 2XMCA 3V4SA 1SURA 3D8SA 1PK7A 1XEXB 1GPUA 3LY7A 1I6LA 2FRDC 4KI0A 3TD2A 4OQPA 2FRXA 2I6SA 1UFOA 4KBGA 5CBKA 1ZNYA 1Q0TA 1GRVA 1JA1A 4R41A 2OO3A 3IA7A 2NZXA 4LYYA 4CEIB 3I04A 2R85A 1DRUA 3AVPA 1QG4A 1XZPA 3COYA 4L8GA 2WP8J 4L8LA 4XM2A 1ULZA 2EAUA 5DIZA 3SSAA 4CLRA 4Z4IA 1HOTA 2RMKA 4R8MA 3R5HA 5E3JA 3K5PA 4HB0A 2G67A 1I3NA 3REQA 2A8YA 1UZUA 1XJCA 1N5DA 4ZVTA 1DQRA 3N2LA 4ZOCA 5EEGA 1DSSG 2QN1A 4NV1A 5HS4A 4R1PA 5T4EA 1ZD5A 1UMDA 2ZJ5A 5ICFA 4D6PA 1NBEA 2B4QA 3IAEA 2QVLA 4M0KA 2FMFA 3GZNA 2HF7A 4XLZA 1PHPA 1T9AA 3ZVNA 1NLMA 2PIDA 1IOVA 3M5WA 1OY1A 1C0IA 4X6XA 4XPZA 2DWUA 2D4AA 4TMZA 4BX0A 3K92A 3VPXA 1A0OA 1UJNA 1XT6A 2PA3A 5DCUA 1E7SA 1Z08A 4DV2B 1YZYA 4UARA 3I8XA 5H9WA 2GN2A 1RRVA 4JLAA 4BNFA 5DGIA 4TS9A 3IURA 5BNWA 1KAOA 2RKOA 2HXGA 2QMEA 4CKBB 1IY9A 2YMLA 3I28A 1GTG1 3N07A 2YDYA 3QP9A 2SICE 3ETEA 2DYKA 2QQFA 3BKXA 3CXUA 4NBNA 3UF0A 4UAGA 3L07A 4JLWA 3ZQUA 3GDOA 5K0FA 5LMZA 1Z2NX 2GUWA 3OOYA 2FSGA 4GKAA 4E5VA 3HZHA 5LP6C 1UZAA 1POWA 2GERA 3BX1A 5C81A 2J3IA 2OPHA 1BMFD 1W44A 5BN1A 2AOXA 5TSDA 1DE0A 1X1TA 1NDQA 1NW7A 2AS0A 3GFGA 3AIIA 3UJBA 2ID4A 1COWA 5DTEA 3W8RA 1VJCA 4B32A 4DWJA 2DB3A 4GOMD 4LVUA 2IYVA 1AF4A 4D42A 4MHTA 3GD7A 3NTXA 3KUKA 3F90A 5HRAA 2UVDA 4MA5A 2EG5A 3LQYA 3MBKA 3GDGA 1NF2A 1D1PA 2OBYA 4M7RA 3A6FA 1N2EA 3UJDA 2ODAA 4MW6A 1BQ3A 4DA6A 3UV3A 1NLZA 3EUWA 1U0GA 5LL6P 3BXOA 3TQQA 3U09A 2FZWA 4REMA 3DFKA 3ZK8A 2JIRA 4JX9A 2P0YA 3LXMA 3OPNA 4EEZA 4RGBA 4M46A 4W5NA 4WZAB 2P91A 5F7XA 5J9FA 4XRGA 4Q47A 1E7RA 2AOWA 3FBWA 3LDHA 4U4AA 2IPAB 5FA6A 3SEQA 1AA9A 3UT0A 2YY6A 4HQKA 1SVSA 2CKMA 3AEQA 3Q5DA 1IU9A 3AXSA 1U4OA 4D79A 1XTTA 1SCDA 4X3OA 4G5GA 4FYPA 3F8WA 2Q2VA 2HPAA 2GH1A 3KEFA 1K63A 2IHUA 2NOAA 1T3ZA 4Q3LA 5I3CA 3K70C 4B35A 3RARA 5K0GA 5BRAA 2JI9A 4FYMA 3DUWA 3S0JA 4A2QA 3GEPA 5TXGA 3E05A 3TTYA 4HWGA 5TGZA 3PENA 1EFKA 2NYVA 4ALKA 5K0ZA 4MVJF 4YYEA 1RHQA 4WINA 2AN4A 2HBYA 2J9XB 1L7DA 1KJ9A 1JVNA 2PWAA 3LKDA 4M0DA 1JBQA 1U2GC 2E85A 1MF7A 3JQFA 4N5DA 1AM4D 1WCIB 1ZK3A 5DM1A 4LOLA 2WFLA 4IVNA 1WKCA 3PF9A 3RIGA 4AKEA 4DMGA 3UMYA 1M1UA 5EHNA 3LXUX 3JQ7B 3NO4A 3V34A 1FIUA 2NXCA 1PUIA 1E6LA 1GZDA 4XWTA 2O8FA 1G8GA 2NZYA 2YVLA 3CTMA 4C4OA 3ZN2A 2OV3A 1SXHA 5FLXA 1PNRA 4Q00A 2LWIA 1EU1A 4D6YA 2ZBPA 1RWNA 3WKDA 4G4SP 1UDXA 3DAPA 4TMVA 5DNVA 2I78A 3DBHB 4OQZA 2WB2A 3D8UA 4RA6B 4OREX 2IP4A 1XVTA 2JFNA 2JLSA 2E1RA 4BRSA 3OQMA 2C2KA 5KNBH 4BE7B 4DV7B 4KOAA 4YAJA 3IQZA 2BONA 3KYIB 4M53A 3KEMA 4GOLD 4UUPA 4DDTA 3R9XA 5CNMA 3CLUC 4EO9A 5ITWA 2AG6A 1W0KA 4H7KA 4ZFNA 2WWXA 1RBQA 1T25A 1CR0A 3V8PA 4JI6B 4V0SA 3SN6A 2OCYC 5DBHX 4ZRNA 3NHMA 4GXRA 4Q66C 3USES 3WLLA 4A0FA 5IVPA 3FFBA 1FDSA 1XG5A 2HK8A 1ACMA 3JYQA 5EJAA 5FL7A 4FUTA 3ZHYA 5IAAA 2CSXA 3DGEC 3DT6A 1Z22A 4GT1A 3X2SA 1XMQB 4X1IA 5HKAA 3F8TA 5MN6A 3A04A 4PNHA 1P91A 2YWFA 2IY8A 1W87A 2YN0A 3P0RA 4MA4A 1RHKA 2IIQA 4Z9FA 5HRCA 5JEEA 4R0MA 4PNEA 2AGVA 1IMOA 1KRXA 3CPJB 5LKAA 3KLBA 4FVTA 3SJBA 1WUTA 4XM0A 1IAQA 2C9ZA 3WIUA 3ZCRA 3BTUA 4N0QA 4WN9A 4ZDJA 4I9NA 2B3DA 2POQX 3A1VA 2IYFA 3F2VA 3PWTA 3ODGA 4Z8YA 4UZEA 4CBVA 3G5TA 4OP2A 4RIFA 2ATXA 2CV0A 4C2TA 1J8QA 5EA2A 2VAWA 1QONA 2J9FA 1ZJZA 4WMLA 3H4IA 2OO7A 3NEPX 4IH4A 1K5DA 5T67A 1JHXA 4AS2A 2PKYX 3LZDA 2PX5A 2DAPA 3I76A 1JYEA 4RY2A 2ZRIA 1QIGA 2PRIA 5BSVA 2EWMA 4AB1A 1SXJD 3PKIA 1BS2A 3JQGA 2IIPA 2BFPA 2IYNA 4TV8F 5AW0A 2GEFA 3BGDA 3CW2A 4XIGS 5IDWA 2W2QA 2ZUWA 3ISVA 3OMWA 4XQ0A 3WTBA 5HTOA 4BLOA 1SOVA 1BGXT 2H0RA 2XGMA 4AZ0B 3G2HA 5DK4A 5F52A 1PR2A 4IOKA 4FMBB 3CF6R 1WQ3A 5JLJA 4AZ3B 1NBMA 2AJBA 2JIZA 1JX6A 1NXSA 2XTMA 1DVRA 3EUAA 3LX8A 4FONA 3JVUA 4I1YA 4MYHA 4PIPA 4LXGA 5CVUA 3UMCA 3VSAA 3ZU6A 5AW8A 5C7OO 4W82A 1MX9A 3L8ZA 1P33A 3B1YA 4ZV9A 4MHOA 2VT3A 1LA2A 5EXXA 1CVIA 1LZKA 5TT0A 3FIJA 1OQAA 3RV3A 3FUCA 3TAXA 3IKLA 4AKTA 2C4MA 3ER8A 3L0DA 5KKCA 2COKA 4BN5A 3NV9A 2W2VA 1CQJB 3BB4A 3FMGA 4IOLA 4PYMA 2V98A 3QVTA 5TGTA 4E2XA 4YRIA 1ZHOA 4EW2A 4G24A 4BNLA 3MJHA 1OFGA 5IRCD 1KFCB 2H7YA 2WJJA 3SLRA 1MOZA 2NVWA 2XD9A 3TLXA 3EA5A 2AI2A 2VDWA 3EH2A 2H9AA 3SVZA 2IHJA 3LVRE 2CFIA 3LQ1A 1Z6YA 2ZJOA 4E03A 3OQBA 3QTLA 4CF3A 3VTKA 1RPAA 1XQ6A 2SNIE 3QKUA 3H2GA 1L4MA 4MKGA 4UTXA 3K2EA 1G6Q1 5IN4A 5J2TB 1X7ZA 4FHGA 1TTTA 2SKDA 5EJ4A 3AEQB 4DL9A 1G2OA 1T5LA 1CUCA 1YUNA 4IY1A 1N3YA 4B6JA 3CW8X 3DGFC 4JP5A 5E0KB 4CDRA 4FK8A 1XZJA 4BJHB 4C0JA 1KARA 1GAJA 5A7GA 2A67A 5C51B 5IDVA 1E1DA 1L4YA 3C8UA 2J6IA 3N8IA 1E61A 1NM5A 2O7NA 1FTQA 2G6BA 4WKGA 5FWXA 5JC8A 2HGZA 2I4LA 1SBYA 1ZOIA 2Q9AA 1QE0A 1GWNA 2Q28A 1R9MA 3LGXA 3OLYA 2V7WA 2Z30A 2CL7X 1D0VA 4XOUA 3VU0A 1NPTO 3PQCA 2JI4A 3WA7A 4MX8A 2QPLA 1MX1A 1XFDA 2HBQA 2ZBVA 4OU4A 3P96A 4Q3DA 2J4CA 4B5LA 1G3QA 4F5DA 3FTDA 4F9GA 4YP0A 3V5NA 1YZQA 3BBPA 3QF4A 4BMOB 4M0EA 3E4DA 4JQYA 4I4IA 2GZRA 4YCBA 3NC0C 5DISB 1EVKA 2CFRA 2I62A 3GJQA 3H1EA 4G63A 3H42B 3EF3A 3GMIA 1UBNA 4KJXA 3M4YA 4TUYB 5IZ4A 3JVVA 1QDEA 2IHBA 2Y76A 2ZE6A 2FN3A 1YRHA 3L4BA 4YECA 5HUHA 4M86A 1GEGA 5IH7A 4RVFA 4YX9A 2P40A 1DO8A 4X1YB 5TQJA 4EB3A 5DNUA 5JRZA 4OK3A 4IRMA 1XP8A 1N4AA 4HNUA 2C04A 4GI1A 3NRJA 1YA6A 1DC7A 4IXMA 4H6VA 2ZULA 4NSNA 2XYRA 4E2ZA 4RE6A 2IZ0A 1UOQA 2JLBA 3QV2A 4Q12A 1ISFA 1GHTA 5B12A 3QKWA 3MK31 2XD4A 1SCQA 3LVFO 2PJZA 2RHCA 5FOSA 4X1IB 3E2PA 4M55A 1J20A 1SUPA 1TVEA 1P1IA 5JCPA 1W36C 3OKFA 1GQFA 1NMYA 4YPFA 3KJEA 1U2RA 4M1TA 1W1WA 1B0ZA 2FUG1 4IFTA 5K0TA 1AMOA 1ZJWA 2GLXA 1S2DA 3B1XA 3P7MA 4MO9A 3H05A 4PFQA 1C0PA 2D0OB 5CB0A 1NE7A 1PNTA 2XE6A 1BDIA 2LDBA 4LXYA 3HYNA 4LG1A 5BN5A 4PS1A 1R5BA 5B4VA 5KVSA 4F4DA 2OMEA 2O19A 4IIBA 4GYYA 1XCGB 2G8NA 5DM4A 5FXMA 4JI1B 1Z39A 3ZIAD 1PGPA 2O1WA 1BFKA 3TE6A 2NU7A 3NTUA 4MIYA 5BR8B 5EQJB 2QROA 2V55B 4RTPA 2C7RA 5GGXA 1S8OA 3GCXA 1U90A 1GKIA 2WJZB 3VA7A 4XXHA 1JDTA 3N86A 1NQWA 3EYAA 4FSDA 1WCYA 2H54A 4OHWA 4EKNB 3L7NA 4EKIA 3MUOA 4WESA 4J0FA 4FMDB 3W6PA 2G63A 5BVGA 3LX5A 3VKUA 3AHFA 3A9RA 3BJEA 4BQPA 3TQCA 3ZZTA 2VSOA 4UHEA 4AZ0A 5C5CA 2EJVA 2WC1A 1ZGAA 3LYAA 4IV8A 4BFSA 4E5YA 3G9ZA 3L06A 2AMVA 3F98A 4JKYA 1W4CA 2VTBA 4CLDA 2N47A 1L6IA 5EMKA 2QS9A 2NSJA 5JFOA 4LYJA 2JBAA 3LTEA 3VKWA 3KKZA 2PQ6A 3M9WA 1J1UA 1LS1A 3RFTA 3WYDA 3M7IA 4DYDA 8ADHA 4XAQA 2XXBA 4RMHA 3JU3A 1JQEA 1XTQA 5JZVA 2JFPA 4JVLA 4OJYA 4IGIA 4P0QB 5GOTA 3I9JA 3QLVC 1FZTA 3JR7A 3CYFA 4RQAA 1G5TA 3IGFA 3H87A 1G5RA 2WIJA 1G7CA 1N33B 3TZCA 1Y8AA 3CNLA 3ELDA 4DIDA 3LT1A 2ZM6B 4ZI7A 5EJ9A 4QRIA 4V1CA 4F1JA 4Q3CA 3DE2X 1R16A 5LBTA 5ICCA 5TIIA 2HSJA 1C7RA 1YZTA 2OYRA 4FNOA 1VLZA 4YCNA 3VNBA 2R8PA 3U56A 1L5HA 4CMJA 3TQTA 1CRPA 1C7QA 1Q7RA 1KOFA 3BTSA 2YOHA 4HVAA 4YJKA 5FWYB 2GK4A 4IW3B 4WK2B 4FS3A 3LFUA 2FFJA 3DEYX 5BQ5A 3AQ4A 4A73A 4BCDA 2P78A 3RVBA 1T6ZA 2G04A 2C97A 4KAXA 3UCFA 1YZLA 2BEVA 5KQMA 3IJEB 5D87A 2HBRA 1H65A 1T4GA 2DF8A 2YN4A 2DUJA 4IEFB 3V55A 5EUMA 1USIA 2H48A 3EPRA 4I3FA 1OREA 2HT6A 3BFVA 4DDWA 4GI5A 2B5OA 1KP9A 2X8AA 3AI7A 3CPEA 2WYUA 3QOFA 4DRXA 5JW6A 4NYMR 3QSYA 3KE8A 5D5QA 1V9SA 1E9FA 2I2DA 3EMKA 2GJ9A 4LKRA 4KQ2A 4PLZA 4JR0A 2BGLA 5IBPA 3JY6A 4G25A 3GIWA 1KI6A 1U5BB 3L7CA 3UWMA 4ECAA 1YJXA 2D2XA 1A3CA 3IEVA 1IUKA 1LNSA 2IV2X 5CDFA 4B3CA 3P2IA 5AK0A 3FPEA 1KI4A 4NZOA 1GN9A 5B7QA 5I7EA 4ZODA 1RI2A 1KAQA 3FMOB 2M1XA 3OX3A 3GB9A 5HMMA 3J80A 2EX1A 4TRMA 2BHSA 3WDLA 6REQB 2B7CA 5TPZD 1C30B 3M6WA 2V0GA 3Q9UA 2WWIA 3HYLA 3FRHA 1AC5A 3JQCA 4Q48A 5SY9A 5B64A 4IH1A 3GJSA 4TUYA 1VA5A 4O2AB 5DHSA 5IBQA 3FHCB 1P8AA 5DW3A 1Q7GA 3U6BA 1UL1X 3MOSA 3PVZA 1ORWA 3EZ2A 3IIMA 4UNSA 5BYAA 2CVQA 2WW8A 3BGVA 3KWJA 3SXUB 1C80A 1U6IA 3TJZA 1V1MB 4HSGA 4EG7A 2H65A 1REQB 4K81B 4PAGA 4EFKA 1UPUA 2UVPA 1IEWA 1IZZA 1G3IA 2J6BA 3DH0A 3UWOA 2GJ4A 3CT4A 1Y5RA 3T9BA 1WMAA 1IUNA 2N75A 4AAYA 1P0IA 2VFAA 2HRQA 2V6JA 1JBKA 2Z3VA 3IS3A 4GGOA 5KTSA 4AO8A 4CR7A 4MV1A 3DZIA 3HO8A 5CH8A 3Q8KA 4J1TA 1D2AA 1LXCA 1V1RB 3ZGLA 1V4BA 5ALIA 4GUDA 4M8LA 4HB4A 3RYFB 3KKLA 3ILYA 4JOQA 2VF7A 4Q03A 4QDJA 2JVIA 1RT9A 3STXA 2ERYA 3TEFA 1N7GA 4KVGA 3V4ZA 1G66A 2B7BA 5K2OA 2QAJA 1V47A 5BV0A 1MQ8B 2GNAA 2WV7A 2NACA 4PPYA 5C18A 1SHKA 2V45A 3AFHA 4FTWA 1EFVB 3SDBA 4PFKA 4KO2S 3O75A 2VYQA 1AVTA 1EUCB 4CPDA 3MWLA 5A1JA 1E3TA 1VCHA 4J9VA 1TJ4A 3WK4A 1PQWA 2C0QA 2HUPA 4Y1RB 1E2LA 3OPYI 1PR3A 3NDRA 4RO0A 1TM2A 5KJ1A 2HYIC 2VDUE 1TI7A 2YHIA 4LCBA 3N2KA 3K9CA 2J3QA 3DOCA 4UBKA 2OCKA 1DNPA 3MPUA 5ALNA 4WOJA 2WQZA 3KKKA 4RJKA 4CQMA 4LGVA 2AOVA 3IQIX 1WDWB 4LDPA 4L7QA 5LIRA 2JHPA 1XMJA 5HZKA 3RVJA 1OFHA 3HJCA 3I9OA 4WESB 1F4PA 1E7MA 1RCFA 2QW1A 5THKA 5A9SB 5KCMA 3CVVA 3QKRA 5AXBA 2HTFA 3HCDA 2R6HA 3BXEA 4CT5A 3VNVA 2DCMA 2QLNA 3ZHVA 4DBLE 1BCSA 1XA4A 2XOKD 4M1ZA 2V7PA 1N2CB 1AKRA 2GHTA 2HWYA 2LRHA 3AF4A 1NFQA 1R0RE 1RXUA 2NUBA 4G4SO 4K9SA 1LJ8A 3VTAA 3ZHXA 4DMKA 4Y9TA 5FEUA 2ZI6A 3WWDA 1HSZA 4U5XA 1CUIA 2E18A 4NVRA 5JALA 5BPFA 1A7JA 1XPJA 1U31A 3OICA 2DKNA 1L7PA 4F1KA 3GLRA 3HR4A 4M1OA 2ZTVA 3GJ8A 2ZIEA 3CO0S 4HDRB 5THQA 4LF7B 1YR1A 1QZUA 1MVOA 1U9YA 3ZWBA 3SHQA 2ISSD 3GDFA 4EW6A 1AK9A 1Z18A 2J8ZA 2PS9A 3N2EA 5DEIA 3VVMA 4E1AA 2VI5A 1LW6E 1N3LA 2LXNA 3HBAA 3LZCA 4ENUA 4ZI7B 5DNCA 2AEMA 4V1CB 1ZGZA 4LUCA 3CBGA 4QBHA 4MVJD 1RYBA 2O0HA 5C4GB 3RD5A 5G0SA 2F00A 4JMLA 5K8IA 3OJCA 3LBYA 5JY6A 1PQPA 1T36B 4G5SA 3RBAA 2QE7D 4OQDA 2A3NA 4DMRA 3RVMA 3G2MA 4ZIRB 3E35A 3RDPA 3SR0A 3F9CA 1DC5A 2V7XA 3V4PB 4LZOA 2HU5A 4R5MA 4U9UA 3ZV3A 4ND4A 1OAAA 4FIZA 5EKXA 2V58A 3EZNA 2ZROA 5ITZB 2YVKA 3RSZA 3D6MA 4JXKA 2G5PA 1JHOA 4X24A 4G0VA 4I1IA 2DQ4A 1R2QA 4DXHA 1NWCA 4R3WA 1E3JA 1N1EA 4RPLA 3FWZA 1M75A 1ZD8A 1ZEJA 3IUQA 3CSDA 2QUBA 2XDAA 1L5RA 3KKQA 3NOXA 4YRNA 1ESEA 1F2VA 1Y4SA 3ND5A 3MS7A 4JH0A 3RROA 1YS6A 3T9EA 3UAGA 4DTCA 1L4GA 2ZXEA 5EWMA 4ETNA 4JJ6A 1WCXA 2O23A 3B70A 1A8UA 2OBMA 3IVRA 4M9SA 2B20A 4E88A 1E6KA 3PC2A 1ZCFA 4RK7A 3IMEA 3W5BA 4N7BA 2P9YA 1ULSA 3RJZA 1E5QA 3V8RA 1KNXA 5ICGA 3ADKA 1QHFA 3C6QA 1E3EA 4UJ5A 2PKXA 4B4WA 1H94A 4QGHA 3MCZA 3C43A 2AFHB 3ZDFA 3GLSA 4R2KA 4G8CA 4KZKA 1A95A 1J1IA 4XJXA 4FDUA 3DB2A 1PVVA 4J75A 2G0NA 1B43A 3FNFA 4H4EA 3DP7A 1CDEA 1A82A 2P2GA 4WN3A 3AEKB 2UVPB 1Z62A 3ZGZA 4LTNA 3P5SA 4PZEA 2QAGB 2H59A 3EMBA 1VHTA 4L50A 3BSSA 3B89A 2Q1XA 4AY4A 2FR8A 1U0EA 1NTOA 1KS2A 1P0FA 1T8UA 3QVXA 1PVDA 2PMDA 2C29D 2D7JA 3QBDA 4NBVA 3QYPA 3ZGYA 5BYBA 2JLRA 2L69A 3COPA 3BL5A 5FOTA 1FDUA 2BAGA 1AQUA 1C4KA 1VIYA 2GX6A 2O06A 3CO5A 3QF7A 3A05A 4JL5A 1FX1A 4MUAA 4WKNA 2NPOA 3L01A 3HXLA 3OJ0A 4ISBA 3UEOA 2B8EA 3G1TA 4CMBA 4EKEA 3NXKA 1UBMS 3SE7A 4DOMA 2Q0XA 1MB4A 3EUEA 3RANA 3EQ7A 4I3HA 2DEUA 1C0EA 3CE6A 4S1PA 1BAPA 5C4MA 2X3YA 3ELBA 5KNDD 3SEFA 1AV6A 1Q77A 3GXBA 1RYYA 5CXUA 3I09A 4MZXA 1HA3A 2C2OA 2QRKA 3ME5A 1XDUA 3WYCA 1J06A 1H8ED 1EP2B 3MCAA 5BN3B 3DMFA 3VPAA 3RIXA 3CINA 3M82A 4KPEC 1SUIA 5C1BA 2NU9A 3AIMA 2C0PA 5EUCA 4WK0B 3BWYA 1SXJB 5A05A 2AOTA 4ZQHA 4NJOA 2OBFA 2EVWX 1PR4A 1RCUA 4Q9NA 3DA8A 4R7ZA 2JFHA 2J5KA 1AH2A 4POAA 1I51A 3WLSA 4NYMQ 3NYQA 2J5XA 4NG4A 4ZK2A 1F51E 1X87A 1E8NA 1GL9B 1HG0A 2VJDA 3H5VA 4LJ7A 4RHCA 4XIFA 5U1PA 3RVSA 4EA8A 3THWA 4WL0A 4QVKA 4AG5A 4WZBB 1JDSA 3QFCA 3MD9A 1UPCA 4D7AA 4TXJA 2HI0A 1VIVA 4EELA 1GFZA 1MFPA 5ALLA 1RLMA 2CNLA 3K09C 1L4UA 2LGJA 1ITZA 1U1GA 3I6IA 3UA4A 4EFDA 2ZWAA 3IILA 2Q2OA 4YHBA 4YCDA 1PDWA 2VBCA 1FQJA 3SIXA 2X0KA 3EWIA 3IT0A 3BMOB 4DR4B 4IHQA 3IUBA 4J76A 4E7OA 1UXIA 1KJIA 5I7OA 1YJAA 2OHFA 2FB9A 5HNKA 4DDKA 5JNVA 1M6EX 1Z74A 1AS3A 1VYUA 3AI1A 3A1EA 3DHYA 4RJLA 4V0LA 3TZLA 4A92A 4D92A 2MSDB 5K45A 1TMKA 2NO4A 3E9ZA 4G9EA 5E2BA 5AYVA 5CNIA 2D5LA 2PTHA 1HE8B 4NATA 4DV4B 4LY0A 2DVMA 1KC1A 3B6JA 3IIKA 1EGMB 1PT8A 1G8AA 2OK8A 1L7RA 4RVDA 2CK3D 3W8FA 3DAYA 3O8NA 2WHEA 3DZJA 1BX3A 4YDRA 2FG5A 2Z4RA 3PHIA 3RYHA 4BO3A 1F3LA 3WGTA 2ZUDA 3B3JA 4YFVA 2ZYSA 5DT9A 3JTMA 4RFSB 2QZJA 3R41A 4YONB 1MIOA 2P2LA 2RH4A 3TL3A 2NUPB 3F1LA 1ZUWA 3A4IA 2O48X 3PXAA 1Y8QA 4G41A 3SGLA 4DG8A 4B3SB 1U8FO 1H3FA 4F1WA 4PR0A 3K9HA 4X95A 1P5FA 4L02A 1RZRA 1CUDA 1IHUA 1UXJA 2GN8A 4KFRA 4TKUB 4BRZA 2Y71A 3M6XA 5JISA 4R2WA 1UAGA 1LV7A 4HNQA 5EWMB 1OXVA 2JGIA 3IAS1 3B7GA 1Z35A 1Y6ZA 1Q19A 1I5OA 1YAHA 4Y9SA 1ZSNA 2BFCB 4W1RA 5GPBA 4LXXA 5H80A 1M2HA 2RHHA 1LBHA 1OI3A 4X90A 2FUKA 4I5EA 3ZU3A 5LM3A 2E5WA 4LRXA 1Z36A 1I10A 3ZJVA 4HFMA 3C3CA 3OUZA 2XWBF 4HNHA 4MULA 5BXYA 4XVCA 3ZW9A 1BYIA 2W8BB 1G6HA 3I3OA 1PEKE 3KTAA 3OCJA 5AVYA 1NP3A 4DLUA 1IE3A 4ZC1A 3U0VA 4MO2A 1DPGA 4C6HA 1WY7A 3E7WA 2GYYA 1QYCA 4II3A 1QFJA 2WVHA 3KAJA 1HYGA 4FMCB 4Z1MD 3U48A 1P4AA 4FB5A 4YWJA 4MGZR 2J5RA 4WLUA 4H1VA 2B83A 3ZVMA 1X9GA 1GT6A 1WM1A 4JUCA 1GG8A 5AHKA 3VZPA 4ZVUA 5EJIA 3AF2A 1LNQA 4JLKA 1HL3A 2JI6A 1JQDA 1MB9A 2JHAA 3B60A 4AZSA 4F71A 1FFGA 4BOYA 1B3BA 2AR0A 3OQJA 4QU5A 3MWEA 2ZI3A 4XWYA 3ZZMA 2JBHA 1K8ZB 4QYSA 3T9CA 2KMLA 2VL7A 3CH7A 3EPJA 1UCFA 1Z6AA 2GOYA 4LQCA 4U2DA 3ZV5A 4CM4A 1RVV1 4D81A 4ERXA 2QTVB 1T9DA 4P3PA 1UINA 1C81A 1TDJA 3OFND 1U4SA 3QVKA 4TVOA 4HH0A 5EJ7A 1ZIXA 4AJIA 2W2KA 3I2KA 4RLFA 3V97A 4BMCA 3D2LA 2JDID 2X0JA 3TSCA 5JCZA 1KY5A 2F4NA 2YV1A 1Z5NA 4UMDA 1G5QA 4QUJA 2QP3A 1BXGB 4HNGA 4P3KA 4G4IA 3VHLB 5GV7A 2XUFA 3G6KA 5EY5B 4U7WA 1J5EB 3VOBA 3GPLA 4C03A 3TQIA 1P2VA 1AUPA 2R84A 3CZMA 2QLBA 1SU4A 1O9BA 2GNPA 3H3FA 4RDHA 4C5CA 1ULHA 2CHUA 4UNNA 4PHCA 3CNNA 1BJTA 4LJ5A 2X22A 2LIVA 1JQ3A 4G5XA 4I55A 5ENDA 2YXEA 1NR1A 3SF8A 1OE0A 1MRZA 1KWKA 3HFRA 4DLKA 1A27A 1DP4A 3I5AA 4K3VA 4PLTA 2VYND 2B35A 3ZYZA 3Q1KA 3GJTA 1YVUA 3QXJA 4BNDB 1W5AA 3JWIA 1LBTA 2I2BA 1DCMA 1L7AA 4LC0A 3N0WA 4D9BA 2GBLA 4B3IA 2BGTA 4NU5A 4CLOB 1PD0A 3FNHA 5FQOA 3NLLA 4LWOA 5CD1A 3L7JA 4IGKA 3AB8A 1XU7A 3OP4A 5IM4F 3VJMA 3ABQB 4RYLA 3V8MA 2FW1A 2VYVD 3L0OA 5EUQB 4EA6A 5ADHA 1KI1A 1X2BA 1IQPA 4MMZB 1N2XA 4NABA 4ZT2A 2Q1TA 4KWHA 4RKQA 1BROA 1S2LA 1W30A 3SZRA 2UUCB 4UBJA 2JKYA 4I5DA 2KQUA 4IIXA 3A32A 3VYRB 1FQWA 4Y0AA 4HRVA 3RSHA 4PO3X 4UU1A 4RTJA 5CDUA 2P30A 2FJ0A 2ZBRA 4O25A 1JSCA 2QBYB 3H1BA 1AY0A 5JCOC 4ZTUB 3O3MB 3AVYA 4WNIA 2FOLA 2D1SA 5SICE 4FD2A 4PZDA 4W7IA 3T7RA 4CU5A 1ODIA 1RKQA 4CEIA 3FPJA 1AGNA 2CHGA 4ARUA 2HJ9A 5C52B 1IVNA 1DT5A 4OAOA 1EVEA 2AD5A 2OLJA 3I04M 2A9FA 1QV7A 5M5BA 4CLRB 3WBJA 1FYXA 4M9ZA 5I8ZA 4EPRA 3H1TA 2WIFA 4RFSA 1CY4A 4BN0A 5BSHA 3MIZA 4B82A 5C5EA 1P6UA 1MJGA 2WSIA 3CLUD 3UMFA 4NCIA 2HZ7A 3I42A 2WJ3A 2ZSEA 2GESA 5C0OE 5H8WA 1EP1B 3I2JA 3PDIB 3INGA 1OAKA 1T5SA 3CY6A 1JPUA 1XZIA 2G76A 2AMJA 2QNRA 1HEYA 1QHHB 1JG7A 1RMYA 3CA8A 1A5BB 4URHA 3ZUPA 3IYLW 2OCDA 3IKTA 3VR2D 4CMKA 3F0TA 1JIIA 1R18A 2C2GA 1ZM9A 1FFAA 2F1IA 4XWWA 4UDXX 3PEYA 3LBFA 1GZ3A 4D4KA 4YRTA 1Z15A 2GBGA 2HHCA 2VJMB 1L7OA 3LXRA 3SC6A 4DADA 5F78A 3ONVA 5B2EA 3K70D 3LCVB 4HBZA 3ZCSA 4NYJQ 1Q2UA 4W8HA 1K68A 1UBHS 1SBIA 2BFDB 2OUKA 4Z9BA 3NAZA 1M0SA 4I9GA 3GVIA 3S5UA 1XEWX 3TO5A 4K9OA 2X6RA 1VOTA 2J9RA 5F7ZA 1TO2E 4BLTA 1QQ6A 2YWJA 4ZZ2A 4RL6A 1PV1A 1HKHA 3RVDA 4B6PA 3I6BA 3R77A 3LQQA 2C4KA 3GROA 1HDXA 1SHTX 1JWBB 4JEIA 3ZJYA 2I99A 2VYFA 3BUSA 2WU1A 4PLVA 4XYEA 2IYUA 4XFJA 2RI1A 4FDVA 5K9ZA 2WSYB 2FEWB 1NBME 4AMZA 2CEAA 3HDVA 2OFPA 1NXXA 3DFFA 2RCNA 3BGWA 4FILA 1FBNA 1JDBB 1Z6QA 3NVMB 4DLRA 4OXIA 4CMIA 1Z06A 1JIKA 1R4AA 3CLRD 4MVJM 1AV7A 3EGDB 3QE2A 4NBRA 3HKCA 3SBOA 4B1FA 4ZXFA 3MWDA 3NHFA 5CJ2A 1SQ0A 4H7IA 4MB2A 4R9NA 4MWCA 4GMGA 1H9CA 3IDAA 4D0NA 3MWEB 4A16A 1MFZA 1Q7EA 3AESA 4JU8A 2B4AA 4N0EA 4H0FA 4C7XA 1MQAA 1ZL0A 2F9MA 1IY8A 1KEKA 3A14A 1IBSA 1Q15A 1LVGA 2NVUA 2XMZA 4LGMA 4Z9AA 3HWWA 4X3PA 3GT7A 4WZAA 1A69A 4XVQA 1EE2A 1WHSB 2R1ZA 3DLPX 3W2GA 4HEJA 1ORHA 2JW5A 3JVDA 4WE3A 4BBPA 5JSFA 2XUZA 3N7UA 5IHPA 2WJ6A 4J4BA 3TLCA 1RXWA 3KVOA 2NO6A 4C2UA 1CY7A 1AKMA 3WHIA 1IJEA 4DLZA 2YRFA 3KQOA 3STTA 1ZUHA 2XRYA 1Z0KA 4R9VA 3K0CC 5J2UA 1X74A 2W0MA 1Z8FA 3KYCA 4RVNA 2IYZA 1PG2A 1ZM7A 3D02A 3DBRB 4EW1A 3HO1A 4V3CA 1FSPA 4G5HA 4RIIA 3RBVA 2BFBA 3Q2OA 4PLWA 5DCLA 5TVKA 2YWEA 3PDJA 2FYTA 2K4MA 1AZSC 4JBIA 3TOCA 3VO1A 5BUCA 2ISQA 3TLGB 2JZCA 4D8TA 2IYQA 3E7PA 3NVAA 3BCUA 3EH1A 3WSTA 4AFNA 5CPBA 1I30A 1Z07A 4E6PA 1DZIA 2BBSA 3ZGVA 3PU6A 2HDOA 2G83A 2BC9A 4MUYA 1IK4A 1MTOA 2FX2A 4GPAA 4KO1S 4P7KA 1SKYE 3VX3A 4BV9A 3SJ7A 3GO4A 5B7GA 2AFRA 1Y3FE 3JQ7A 3IXQA 4EG3A 4YREA 1XMOB 2QTNA 1V9CA 1A96A 4FMCF 4ZT6A 3ZLTA 4CM3A 1V16A 4H3SA 5DLYA 5CA1B 3GGCA 4OK6A 1PR9A 3TKYA 3UMRA 2RB5A 3VR4A 3RH0A 4YK7A 3LTNC 1P9WA 3BD8A 3G0DA 3IDFA 3LYLA 4BFLA 3LI2A 1SBHA 1I33A 1XEAA 1QK4A 3NUGA 4DQLA 1D4FA 2BP7A 3QX7A 2FDRA 4Q9HA 1XNQB 5BNFA 1R3UA 4FIDA 1ZNZA 3M34A 1W52X 4F3RA 4PSDA 1QO0A 1QZ3A 4I9HA 3GEIA 4TS4A 3HU3A 2REBA 1P1RA 5JMOA 1VPEA 2B34A 2R2GA 2ZZNA 2BEKA 3M6VA 3S7ZA 6Q21A 2IX9A 4CM9D 5TRTA 4WHMA 3IDQA 5JPDA 3ZQJA 1L8LA 1SIUA 2R87A 3E5RA 1GQYA 4L8VA 1UDWA 1QVRA 1NJ8A 2A1UB 2OCXA 1HMPA 1RLJA 3LMKA 4NY1A 2AF4C 4OHKA 2EQ5A 2VQ3A 2QEQA 3FJYA 3VH1A 3ZDQA 5AVWA 2BMWA 2B8TA 3FBGA 5BV2P 5FFFA 3GFRA 1P5ZB 4JODA 1ZH8A 1CDOA 1GCAA 4FMDF 1NPYA 1JG4A 1YU6A 4Y67A 3K53A 1BMTA 4OL9A 4K28A 1MV8A 1PSDA 3MS2A 4Z0TA 2A5YB 2YYSA 4EMTA 2CNNA 3FG9A 3E0QA 4L57A 3I5YA 3PJDA 3C5VA 1JIXA 1C3EA 1HKUA 3D3EA 2BI7A 3RM3A 3ADBA 3H3XA 4KL8S 1E6WA 1YCFA 5FAXA 2XT9A 5AOCA 2QRVA 3QVMA 4JJ4A 4YMUA 3TNFA 5TF0A 2A14A 5HWSA 2RJNA 4JJIA 4CM7A 2QN9A 4Q7QA 4YV1A 1F38A 2H1WA 4BJ1A 2AJLI 1GR0A 3IUSA 2HA3A 4ESEA 4PQRA 3HKEA 1VI6A 1TUIA 2H1SA 3LBAA 4FWBA 3RUCA 2XQKA 1PT6A 1Z12A 3OF2A 3S99A 3W0LB 3TGLA 1E5XA 2O3RA 1PKEA 3DUFB 3RRYA 4DDUA 4PRYA 2C88A 4J49A 3OE4A 1UAYA 3AM1A 2GHRA 1X38A 3ONFA 4C3VA 3DMTA 4U02A 3CT6A 5C37A 5C8DA 1H4SA 1WAMA 2A59A 3KXLA 3DPUA 1PNQA 2PR7A 3UAYA 1Q83A 2DBZA 3NBYC 4N54A 1B76A 3I32A 1FNBA 3IB6A 3OOEA 4QTUB 5H70A 5AJYA 4BX9A 2IE8A 1ZVMA 4YDSA 4M76B 3AEYA 1OI7A 1VKOA 4OAQA 3TW8B 5DGXA 4YPVA 3AV3A 2Q9CA 3KZMA 1GTRA 2PUCA 1AHNA 5KINB 4E3ZA 3G8BA 3RKUA 1YQXA 5F7JA 1E2EA 2RC6A 3OU2A 5EZ6B 3USZA 4C78A 4Z0HO 1JG3A 1ZK4A 1CF2O 3P4XA 1NA5A 1BVUA 1TK3A 3OIUA 3GRPA 1JQJC 3W8NA 4RIGA 2BMEA 1KMHB 1JVBA 4ND7A 2C2WA 5K3EA 2JCXA 1XMVA 1JXQA 2WJWA 4MPDA 4NMHA 2YVAA 2RD2A 4DA4A 3CW9A 3QW2A 1LI5A 2H1RA 4U3JA 2G7ZA 1EUZA 2GLUA 4H31A 5ER6A 2F43B 1MAWA 1LZLA 3HKDB 5M04A 4QYIB 3TNYA 2ATEA 4J7AA 3EQZA 4GR9A 5I9MA 3SVLA 2M6SA 1QVZA 1WBJB 3NM4A 3OKAA 3VFDA 2XVAA 1HV8A 3JARA 3MJSA 5EHIA 3ET4A 4PM4A 1YJQA 4PU0A 3DL0A 1XTIA 4GBJA 1SD5A 5C8ZA 2ENWA 4NPCA 1G8PA 4AMUA 4DRZA 3PLRA 3KSDO 4QAQA 1YR8A 1RM3A 2PUTA 3CLRC 3RHFA 2AJ8A 1DC6A 2IPNA 1NVEA 2W37A 3P9RA 5FWXB 3CC8A 3PB3A 3T3OA 1NJ2A 3H2KA 4AVYA 3ZW7A 1M67A 4MS1B 5DE3A 2ARKA 3QLJA 5AM0A 3CU5A 5DHFA 5FOUA 4IEIA 3IBSA 2COEA 4LOHA 2GAAA 4X71A 2XNKA 3I1JA 2RAVA 3UO8B 5IAJA 3IAS6 1YK0A 1I6WA 1JYFA 1ADCA 1KPHA 5HOEA 1YZVA 1TCCA 2LUOA 5EXTA 3O03A 1JG2A 2IZ1A 3AB7A 4A91A 1DPFA 4WOCA 2A0YA 1R9JA 4BX2A 5JT1A 4HQOA 1P74A 5K6RA 2EYQA 3RHSA 1D9ZA 4YCCA 2ZK7A 1DMRA 4KMOA 5AW1A 1RI1A 4G26A 3CJQA 3NHLA 1E2GA 3TZHA 1QTQA 2QD5A 3T06B 4L4RA 2RKBA 5SY6A 1WZEA 2PLFA 1VCIA 2FWPA 3D5QA 4H9GA 1XZNA 2FMIA 2I1LA 4OXKA 2PT6A 4DV1B 1E0DA 4EPXA 1BU5A 3AJRA 2PVCA 3ABRB 4YAEA 1N6OA 5EL0A 1EX7A 1JQKA 4IZOA 1B3RA 4ZAZA 5DXFA 3LBNA 2CFOA 3HB0A 5ECDA 1G98A 5FYDA 4CIBA 3KPYA 2Z2XA 5GM1A 4UXIA 2ZRNA 2YJ6A 1Y1SA 4Z86A 1QGUA 4YRSA 3KXKA 4LBYA 1X1SA 2AVDA 1GKYA 1X1RA 2HA0A 1X3LA 3D8NA 2WZBA 3GN1A 4TMKA 3WNZA 2A1UA 3BSYA 1C4OA 3ANMA 2PG3A 1BOFA 4LJ6A 5DHUA 3CMCO 2BTQB 4BO4A 1KERA 3CF4G 3TMAA 1OFUX 3CN7A 3O0TA 2GB4A 3UT5B 3I4CA 4HN9A 1CF9A 2DFVA 3W06A 3WQHA 1FRQA 4PIVA 3EZYA 4HQFA 3EFEA 4MGHA 3SR3A 4UATA 1A9ZA 4J03A 3SX0A 5KX5B 4B3RB 2ZVQX 4RDXA 5AVSA 2HRRA 4ZVOA 3OMLA 1HNXB 1CUVA 4RMIA 4UFNA 4ID3A 4K6OA 1VECA 1PZGA 4BTVA 4YAUA 3VO9A 4DZZA 2IXGA 3TM5A 4F3YA 1ENPA 1QHEA 4QOSA 4E4YA 2GK7A 3VR6D 4E4RA 2Q4TA 1HY3A 1W6RA 2XAAA 2NU7B 3KSRA 3GJ6A 2X42A 3I5UA 3B85A 3O1IC 3Q72A 3AL2A 3UCEA 3W5VA 4TVSA 5CITA 3LW8A 4QOIA 4XVUA 1VSUA 5KX5F 3T3IA 1BDHA 1U0BB 3ANNA 1TTHA 1Z0JA 4M7WA 4O3FA 1UPTA 3FUWA 1VI5A 3TOSA 1TK9A 2H1FA 2RHOA 4DABA 2E4VA 4B44A 3U19A 3S1SA 4Z0NA 1QU2A 4HCJA 1PX2A 1KY3A 1V95A 1ONNA 1Y80A 2ZUBA 3BJRA 3CRW1 4AF7A 1JFLA 2J1LA 3EXG2 1VLQA 4NI5A 1LDNA 4ETMA 5I7UA 3EB9A 4MWTA 4REOA 5LBIA 1A8QA 2JNWA 4KFTA 5G53C 3GZTB 4FYIA 3BDIA 1NKSA 1T9KA 3LPDA 4FLEA 1MMFB 1ZJ5A 4OJQA 3EXG1 5F33A 1DGQA 1KC3A 2Y1GA 2X1HA 1SCNE 1JLHA 4UOZA 1VL0A 3LUPA 3TD9A 5FDFA 1P19A 1E6CA 2WUFA 3AM3A 1I4TD 1Q5PA 1QTNA 3SJCA 4N3NA 4ZO8A 2WNHA 3NHSA 1LDYA 4PTYA 1VRWA 3SXJA 4KHPB 5B5SA 3UATA 1N6KA 5TVGA 1ZK2A 4KQHA 4C4PA 4E70A 2CDAA 2WVAA 4KQ9A 2BGMA 2ILVA 4MARA 3KVNA 4QPDA 2WAXA 4XGKA 5E2AA 3RHTA 1IHXA 2RGRA 4YQFA 4Z8XA 2BMFA 2DJIA 3BXGA 1GQ2A 5IKPA 3DR3A 1EZ1A 2OCPA 1R6UA 2V8BA 2W9XA 1KYTA 1KY2A 2HQOA 1XMIA 3AVOA 1FTWA 4CL3A 4DUGD 5CG2A 3FWHA 3A6EA 1SBCA 4Q3OA 2F43A 3HKDA 3MSCA 2RGNA 4QYIA 4W4TA 4ZN6A 2Q9BA 1KETA 2ECPA 1NYTA 1O0SA 4WJZA 2GEVA 2CXXA 4XDYA 2NG1A 1DHTA 4O6VA 3UKJA 4CQMD 4QVIA 2AHRA 1GEEA 2AYYA 3NM5A 3T9DA 3UG7A 4DRXB 5KCZA 2R0QC 3K20A 2FJUA 4QECA 1N5IA 1WEHA 1HE2A 1L1QA 3IT1A 3R5JA 1AO0A 1C4XA 4MS1A 2G80A 3CKYA 4F4HA 4B40A 5H3LA 4UCWA 1L1EA 1P3JA 1V39A 2WJHA 3CR8A 3Q6NA 5T4HA 1J97A 3WOVA 2XOKA 1PL0A 4MLZA 1IN5A 2VPYA 4OFZA 2POCA 1MIHA 2X41A 3S44A 3X2FA 4G1UC 3R4VA 3EXIA 3QFFA 1G21A 2VS1A 1WPRA 3C7DB 4PGMA 4YUWA 4D9FA 5E1MA 1HTBA 1PZHA 4S3MA 3DTTA 1VJTA 4G2TA 5ILOA 3JYPA 4P54A 3GJ5A 2QHXA 3I53A 1QUFA 4XYMA 2GXQA 2G70A 4K40A 3C8HA 1XEXA 3QUCA 4XIYA 4AM8A 5A9SA 3WLJA 5IEJA 1YDMA 3ED1A 4IJUA 3A1FA 2EGGA 1EFDN 3UUGA 4H6XA 3ZIDA 4AJ1A 5TMDA 2VCEA 3T3HA 5KVVA 4NH4A 2KWIA 5L4NA 3GQVA 3Q11A 1XF9A 1DTEA 1J25A 1HBJA 4ZOEA 1JFFA 1KTIA 4NJEA 5FHRA 2EIXA 2GEJA 4D02A 2AMFA 2BFFA 2WWHA 1DARA 4GECA 3UJ8A 3REQB 2FUCA 3SFVA 1Z3CA 3FGNA 1G7TA 2JAXA 4MQ5A 1JBEA 2Z5LA 2XE8A 1QZZA 2HU7A 3AP3A 4P22A 5DN6A 4B0OA 3AWIA 1Y82A 4PC1A 4WEOA 1E2KA 2IODA 1VDZA 1EFRA 3DCNA 3QPVA 4G07A 3LD9A 5JXIA 3HVJA 2C5EA 1VRCA 3EVGA 1LRLA 1PLLA 3G89A 1WE2A 3AR4A 3FOZA 2YNMA 2C42A 3KJFA 4V0MA 3BFKA 4B2IA 1DXHA 3NIDB 2ODQA 3DFZA 4TSFD 3BE4A 1GQQA 1X7GA 1EUCA 3NEYA 1V8DA 5L3ZA 1EWQA 2IGBA 1JAHA 1DAOA 1XKTA 3DXFA 3LOQA 2X4DA 2C2ZA 2RH5A 1PLKA 4KN5A 4G9GA 4C4XA 5K0BA 5B7NA 3SKYA 1E1RD 5FUWA 1U63A 2HLNA 4DKJA 1V8ZA 3QXHA 1NFFA 1ZL2A 4Q7LA 1R5JA 5M7EA 5JZMA 2OD2A 3HB1A 2ZTLA 3N74A 3VR6H 2C4WA 4O4IB 4RZXA 2DHEA 4YMIA 3T4UA 1DV2A 1TJ5A 1VJGA 1N0UA 1BDJA 2Y1OA 3H6GA 5E9QA 4AJJA 1PJ4A 3CX6A 3BEDA 4KYTA 3IFSA 3AR5A 3PUHA 4ZKEA 1MVNA 3UOGA 5A0TA 3ZJUA 2HF8A 4R9RA 1ORDA 3BXHA 1AQJA 3QKRB 4QOHA 3D0OA 4GX2A 3X1XA 4R1MA 4ND2A 2LNDA 1FSZA 2HB6A 1CKEA 1G64A 1M1XB 2PZFA 2QTZA 2VZ0A 3G2QA 3LBHA 4QARA 3UTDA 4BZXA 4CV3A 4ZC8A 1TKBA 2BJWA 1R5OA 4JY7A 4EA9A 4HB2A 3U3JA 5F9FA 3BK1A 4K8OA 1UM9B 1S4MA 2Q7XA 1UF9A 1ISHA 1T6BY 2OM6A 4JYAB 5IFLA 1ZLYA 4NFHA 2AG8A 3ZV4A 3LX4A 3HADA 2NU8B 2RGXA 3AUKA 1ZD9A 3OCZA 1SA0B 5LKRA 3CIFA 5FNVB 1UBOS 4EHDA 4A0HA 4BCBA 2YBEA 1NN1A 3MMPA 5FR2A 5LJIA 1GZSA 2RAPA 1T5OA 4KGDA 3VSEA 4DLAA 1QF6A 1QIIA 1GPAA 3RIHA 4RDIA 3FNGA 1SB8A 4NP6A 3FDFA 1U2SA 2QENA 4RD0A 3WIDA 4R9UC 1F8YA 2C9CA 2GHIA 3RO7A 1PK9A 3CNOA 2EW2A 3LRXA 3MN1A 3OT5A 3Q1LA 4S24A 5ISMA 3CNQS 4H7EA 1M6WA 1M1YA 1R0ZA 3Q40A 4KAAA 5JVDB 2VZLA 1Q14A 2NYRA 2AC4A 1S3GA 3PTLA 1MJNA 1NVTA 3W2EA 1W34A 3EEBA 3TNLA 5EIHA 1V7CA 3HWX1 4NYIQ 2PMWB 5ITZA 1SUFA 5TNXA 3ICCA 3H19A 3ECCA 1WCIA 4R31A 2EGHA 3BQ9A 3WRXC 2Z8YM 3SC4A 3UENA 3QELA 4W8GA 1I7DA 2K5UA 1UP7A 1QFZA 5GADl 1LBSA 2IELA 1PBNA 2P77A 3MHPA 5KYWB 1PDVA 3HPQA 4QU0A 3DE7X 3PJRA 4Z53A 3KQMA 4TM8A 5HGJA 3QVGA 4BMVA 5K20A 1AZWA 1P0CA 1F06A 3NTQA 3BHNA 5AUOB 3UAVA 1W4BA 5A06A 3L8HA 4A27A 2PUAA 1ZKDA 1QM5A 2HFKA 1CS0A 2AQ8A 1E2MA 3EZ9A 3GARA 3N0TA 5AKIA 1JSRA 3LT4A 3NATA 2DQSA 2C9YA 2FX3A 3FLAA 3FMIA 4E1BA 2VJKA 4D74A 3E2MA 5LD2B 5CT6A 2C4HA 5KVAA 2F55A 2P9BA 4JT8A 3WK9A 2QJOA 3KL2A 3FAZA 4DCSA 5KJFA 3SJZA 1UWCA 4QE3A 1AKQA 1AS0A 1QO9A 1SEVA 5JLAA 4JB3A 2OB2A 1FDVA 1YMQA 2ADMA 3WK6A 5AIBA 4CF7A 1AIPA 1T2EA 1WBBA 3WL5A 4YNBA 2AG5A 1LRKA 1JYSA 1WMBA 2CLIB 4IXNA 1TVMA 4QNNA 1F7UA 2GCPA 3BG5A 1S0UA 2J45A 2P6UA 1FMJA 3LV8A 3OOJA 2IUEA 3IPAA 2BLNA 2FSSA 5EXEA 1I4OA 4WV3A 1JXOA 2P9ZA 3HWRA 4NC9A 3RWBA 1EB9A 5KYVA 4IF4A 1P0PA 4Z9XA 5I7HA 1CJKC 1WP9A 3TX6A 4TSKA 4WOPA 5F64A 3AJ9A 3I8OA 2JF0A 1BO6A 4LJ9A 5B2FA 4NESA 2Z4TA 1Z37A 3UTCA 2F9LA 1I3OA 3FTPA 3OZEA 1GKLA 1H1LA 2PMCA 2YKGA 3VSBA 1TVKB 4DANA 4QFMA 4I55F 3DBLB 5DWQA 4A15A 2GJSA 3M6UA 4G1VA 4KQCA 4TTIA 4TZTA 1PJ2A 2CB9A 3CUSA 3VYUB 3UAOA 1WSAA 2QTLA 3AXTA 1X0VA 1LPAB 3PUIA 5CFQA 4OSOA 2IEDA 5E4FA 4B47A 5J63A 1A97A 4C4RA 5EOVA 3BOSA 4QL3A 4CDMA 2VUIB 3THXB 4WUVA 3LHFA 1S1MA 3EUFA 4BQQA 2M2IA 2C7GA 1XZKA 5LIPA 1EXVA 1KYWA 2M6KA 1W88A 1G60A 2VUHB 5EXPA 5C3MA 1OV4A 2ZJ0A 3LL7A 5K1ZA 4EMUA 5ALVA 1CK4A 3L9WA 4ZRDA 2OXIA 1Q7TA 5BSGA 4CQLA 1NT4A 5E2IA 4ZGBA 2YZNA 1K2WA 1ZD4A 1RKXA 1RAAA 4GRDA 4MWDA 3WGUA 4NEGA 4MAAA 4F46A 1QPBA 3NV7A 2E3JA 2GPYA 4OHBA 3VI3B 3LC7O 5FIUA 1Z88A 5EKDA 4RCYA 4MDYA 1I7PA 1L4EA 4CEJB 1GPLA 1STOA 1XL0A 5KNCD 3S29A 1XMXA 2JLCA 5DCYA 3PE6A 3RS5A 2BGKA 3T7JA 3BMNB 3WP0A 1TC1A 4HNSA 1MB2A 4J90A 2QLFA 3NNNA 4LJYA 1M66A 4ZTBA 3FHTA 2FPOA 4Z1MA 3ZHRA 4R6XA 4OHPA 1UM9A 2QTMA 3KKNA 1N9GB 1ZM4A 1B6RA 4RXUA 2W6IA 2OHIA 1ZH4A 2ZSFA 1UJCA 2OCIA 3DEKA 1JQ5A 2XUPA 1XDSA 2WJIA 5FNVA 4CLXA 5IMBA 4J0EA 4QUDA 4HOYA 5TLSA 1JHDA 1ZXLA 5IT0A 5H59A 1XPRA 3VBCA 3VSCA 3K6SA 3PXCX 3CJRA 3CLSD 4D2IA 3DKIA 5LMUB 5F98A 1JQBA 4V0QA 1GGJA 1WULS 5EIOA 2G8LA 2PH1A 4HRAA 3D6NB 3CCBA 4RQTA 4TQ9A 5DRYA 4CN9A 2C7VA 2QY6A 2X9QA 3FDJA 4ZRMA 1ZH2A 3RS4A 4ODIA 4CYMA 1AXGA 2XA2A 4HAYA 2XRZA 3PWKA 2FRDA 1DBRA 4O2LA 2HA2A 2OWEA 4W5JA 4XD7A 2WU4A 1I5EA 4YP9A 5CCDA 3RYHB 4ER5A 2JGRA 5DBIA 3TRDA 2I2FA 4EHIA 4J7XA 3NETA 4TT8A 4IUDS 1WXHA 4AMYA 1CTQA 1Y1RA 1KFEB 2Z2ZA 2R8ZA 4HDKB 3WRVA 5HSGA 3E9RA 3M0EA 4HWPA 3NYWA 3R7WA 4F2GA 3A4YA 3D8HA 4NAVA 3A6DA 3UBTA 3QYAA 2W6JD 3SK0A 3PGMA 3WB1A 2B9VA 3GOHA 1JDBC 1Z6GA 2CLOB 3ID6C 4FE4A 3ENNA 3HACA 5IX8A 2CXNA 1JAZA 2I7DA 3HFSA 3MGKA 1AKNA 5A4IS 1OC4A 4AMBA 1AU9A 2VQ6A 2MU1A 3QEMB 1EWTA 2DQZA 5GGYA 1G19A 5AQ1A 4G67A 2O2HA 3MTIA 3ICWA 1T9ZA 2C3UA 2EDAA 5EESA 5EZYF 2N9UA 3KB8A 3NB0A 4JLSA 1T1JA 4PYOA 3SS7X 4BQRA 5AW4A 2WZCA 3MOIA 4MGIR 1E32A 1U99A 1V4VA 1D09A 3BAZA 4W63A 5H16A 3PKJA 2GA8A 1EWRA 5BY2A 1L7MA 2ZRCA 2YZGA 1CU1A 3IQWA 3K4PA 4KXNA 1A5TA 4PNZA 5J59A 4BKQA 5KQLA 3U44A 1B14A 1WA5A 1ZJ4A 2ZEJA 3EEFA 3V8BA 1GGNA 3N2IA 2V54A 2PM8A 3DKPA 1OYVA 3TAHA 3GLKA 4OL0A 3WLKX 4JD5A 1U1IA 1X86B 3E58A 1I6KA 1RMQA 3HGMA 5ER9A 3WXMA 2OXCA 4DEXA 4O4JA 1UT6A 1UWKA 4LMAA 1N6RA 1QG0A 4PLGA 3ABSB 5DI3B 1JR6A 2FZGA 2IU4A 5BN5B 1XO1A 1XTKA 4FINA 1X1DA 2FN7A 2Q4EA 1NONA 3PNLA 3S1LA 4PCVA 1IY0A 3PX7A 1E4VA 3PDCA 5KHOC 1P4RA 1PT9A 5BMVB 4PLFA 4DPLA 1PV4A 3HP1A 1Q0QA 2I8AA 2FZ5A 2Z2IA 1W76A 1RD4A 4P5EA 2WMNB 4AMVA 4NR0A 4EH1A 4LVNA 4ZQEA 3S2IA 2CJPA 1D0IA 2QTVA 5CDSA 1X7XB 1JAXA 4X66B 3HZOA 4I5GA 1AUQA 3N8NA 3ZEIA 3TLKA 4AK9A 1HZJA 4CKWA 3EXAA 1LQTA 2HF2A 3IAHA 3AVXA 3QK7A 3ER6A 4QDOA 1ARZA 1JB1A 3TQOA 3PDWA 1GUAA 5BVGB 4WSOA 2A5JA 2H07A 4QFDA 1XZ8A 2HJGA 4F9TA 3N58A 2PTGA 3G8CA 2X8WA 2XMSA 2WF5A 1RRFA 3PI7A 1W88B 4QATA 5AO9A 4OXQA 3TLZA 4F92B 2IH5A 1AKVA 1ZICA 4KK4A 2UKDA 3D6TB 5CFPA 4ER6A 1RABA 2G40A 2ODWA 9GPBA 1WX1A 3RSFA 3OO1A 4CVNA 4ABYA 2H4XA 3Q3EA 3FFAA 5EQDA 1KZ4A 1FP1D 5FUYA 4C7KA 2R00C 5AUNB 5A4DA 4RQUA 1XB2A 1PWHA 4UASA 5A9TA 1C0KA 4OHYA 3GRRA 1Q0ZA 1YE3A 4MWBA 1NVGA 2Z9DA 1FUKA 2ORED 1ELOA 1VFPA 3TSZA 2I66A 5DVZA 4DMCA 2ZBUA 4JLUA 2CXHA 5DHPA 5BWMA 1C8BA 2EKPA 2HM7A 2PIAA 3S27A 4CIXA 1WXFA 1NI5A 1GUZA 5EVJA 1YE8A 2Q2NA 4QTYA 2VT6A 4M98A 5JJBA 3CKKA 4IKEA 4ACBA 3SSOA 2WSSA 5B30A 4CLOA 4HAZA 5D2CA 3O0DA 3T99A 1JZQA 1LPNA 2Y6VA 3F47A 3PYMA 2YQZA 4FKMA 2GM9A 1AMUA 2GBCA 4P92A 2X23A 5F12A 2XUOA 3JZAA 3PPIA 1NKVA 4J9UE 5TX7A 2XTZA 5JBQA 2VPWA 1WB4A 2HLHA 4RX1A 1DT3A 1M34B 1W4AA 4D4HA 4ZMSA 1J5XA 5T3YA 3K6SB 3B8HA 3B6MA 5CRIA 4EQ6A 1X3SA 4J8PA 3L1JA 2BEVB 4QJ5A 2FSPA 3OEED 3CLKA 2TRSB 4DCJA 5IARA 4BGUA 3HYTA 1I1QB 1XDGA 3LT0A 4EOGA 5J40A 1HL7A 1DKUA 3IQEA 4AYTA 1NXQA 2C1ZA 2P9EA 3H9QA 1K6MA 3DEFA 3KJHA 4FNAA 5H4GA 5BT8A 1PS9A 2IK8A 4WXPA 3FNBA 4OI0A 5FR1A 1F9AA 2R6CA 3DE5X 2NVOA 2RI0A 3PRJA 4RELA 5ES4B 2WIKA 3QU9A 3DFUA 5EE1A 5AK4A 3TR5A 1D2EA 3L41A 4KQGA 4K6KA 1KI6B 4KGZA 1OLOA 3CB2A 1QRTA 2I0FA 3W1VA 1E59A 1KI7A 3RNOA 1L5SA 3ILXA 3JS5A 4HAUA 3D2AA 4EBBA 1GTMA 4UCFA 2DUUA 1R00A 2W70A 2IKSA 2NX2A 2WPNA 4EJFA 2OHXA 2CUZA 5FLYA 4RKEA 2ZYWX 3F96A 4XARA 1YFJA 4BVLA 2XIQA 1FXSA 2UDPA 4KVZA 5A71A 1F12A 2I7VA 4Q37A 3P9XA 1E2HA 1P1KA 2HCRA 3HL0A 4DLTA 3QEMA 3ZE9A 2EERA 3NS7A 4C4SA 3FOFC 3VZSA 1JDNA 3A1TA 3KFXA 4V0OA 5KNLA 1OLXA 1ILWA 3KCNA 3A9WA 4RF4A 5F73A 4BO2A 2IOQA 2E6KA 3SICE 4CMGA 1VBNA 3IQHX 3EMVA 2BFDA 3W3AH 4WKBA 5CDGA 1SC4A 2SBTA 5IJ0B 3VR4D 4WT7A 4JAVC 2QAIA 4WD3A 4WKCA 1RWOA 2VDQB 4MGKR 1Z7BA 4RFLA 1QHGA 2WILA 5DTJA 4KR0A 1WVIA 4JP1A 3TW4A 5BP7A 2PX0A 1GGFA 1BKSB 3JTEA 1S3IA 1II9A 2OP1A 2ONCA 5ALYA 1UWLA 3GJZA 3NDPA 5LNK6 4QEKA 1OTHA 2ZSJA 3ETLA 4UVHA 4BV8A 5GWXA 5CBPA 4DCMA 3VR5A 5A7FA 4ALNA 2A30A 4CW7A 2FSFA 4AJKA 4RM2A 4YO7A 4F4FA 3W34A 2W58A 2WJYA 3WGQA 1CYEA 2ZSAA 3PPYA 4PYNA 1NLYA 1SNYA 5K05A 3ZS9A 4ZCMA 3R3VA 1U81A 5E6UB 3TRHA 5B4UA 4PQYA 4BATA 4BAZA 1U8EA 1TF2A 3EDQA 3MWDB 4ME6A 4WCFB 4MVJI 2DWPA 3T3GA 2H0AA 3OTHA 3G79A 2B0JA 2E55A 5C8VA 1U98A 4IEEA 1J8MF 4EI2A 2SKEA 1Z75A 3FB1A 3WDKA 1CWUA 3AESB 1LBQA 3LNCA 4Y2HA 4EA7A 5A9RA 2EL7A 4UQPA 4WOKA 3KOXA 3BXZA 2NVUB 3IAUA 3KETA 1QIDA 1H3EA 1P6QA 3VC7A 3OHPA 4PPGA 4CQMB 1U2QA 3U4DA 2O2GA 4KO8A 3OM9A 3P8ZA 1ANKA 1T9BA 5CLFA 1P80A 3VKVA 4CKWB 4LISA 3CRNA 1XC7A 3M9XA 1U7ZA 1VP9A 4BNKA 4IIJA 4QBTA 1Q0SA 3C8MA 4OH7A 3TUZC 2GRAA 3LHDA 4AYXA 3NR2A 4O59O 1JLMA 1KK3A 3ETCA 2LDXA 8ABPA 1N2CA 1KO8A 2HEGA 3NIFB 4I66A 4TRRA 4A0QA 3AM4A 3IEUA 2BFBB 1E63A 1FB5A 1VXRA 2OVBA 1ZUD1 3G02A 1XTSA 3HU1A 5I8PA 3VM6A 3CVJA 3OLWA 4LDAA 3EGVA 5E8JA 3E9QA 3S8EA 2RG7A 3U3MA 5ICEA 4X6UA 3H11B 2BZ0A 2C5SA 2AZDA 3ZI4A 1IH8A 3ZE1B 2HPHA 1M7HA 3ZQ4A 4K6FA 3KT6A 4DBZA 1LPOA 4Q7EA 3H18A 3VYSB 4E08A 3U62A 2WKPA 1SCAA 3AFOA 3IP3A 5KYXB 3MRXA 3C4QA 2R86A 3OF5A 1TD9A 2XLCA 5CA1A 3NBQA 2PNJA 1P81A 2YNMC 3COSA 4N76A 2YYYA 1OYOA 4PC2A 5CURA 3RWOA 5AICA 4YMTA 1ONPA 4MNTA 3DOJA 2YQ5A 2GPSA 3PX2A 4URUR 1DCTA 2JCVA 2ZRQA 3D9QX 5FI1B 5JNTA 2YBDA 3BULA 3WGZA 2NO5A 1XZCA 2HQSA 2PT7A 4K9RA 4ZHQF 1KEVA 1A9SA 1K6XA 5KKNB 1LWNA 2WUDA 3ZXXA 3T54A 1G5PA 2Q0SA 2VXCA 4BEWA 2JIQA 3F73A 1WHTB 2JI8A 2CXUA 3SWWA 2DQYA 2ECKA 3ZI7A 4JITA 5JECA 1YFLA 2XPCA 1RDFA 2DUMA 3RKSA 4BNNA 3H8VA 3ND7A 3NTOA 2QL5A 4EG1A 4ESVA 3T35A 3RYCB 4N6NA 2ZAOA 4QDTA 4BLVA 2VYCA 3NP9A 1DX4A 2H18A 4LFCB 1CDDA 5FBKA 2OXTA 3LUJA 4QG7A 4RMJA 3B1VA 2DE0X 3B1JA 3A4NA 3FGPA 2FPGA 3PIDA 4RFVA 1LFDB 2XWJI 2J3DA 1ABBA 5IF9A 4R0VA 3D59A 4AUEA 5KYKA 1QH0A 3FN4A 2F2TA 2P4HX 3N0VA 2A6PA 4OB8A 5DZSA 5E6RB 2WHRA 3RRBA 5DM60 4C43A 4CZ2A 4GSYA 3PC6A 3BTOA 3QSGA 1OXTA 1LS6A 2OBXA 2OR3A 3OMXA 2PRYA 3K4QA 4JBYA 4YUXA 4ZHQB 1GITA 3AFGA 1FXWA 3NPMA 2GGSA 1J8DA 2AJDA 4HBGA 2FP3A 4D80A 3MJTA 2J0UB 2X19A 5L7WA 2BGUA 3R4CA 1QAQA 2QT9A 3QWIA 2X15A 4CMAA 3VV3A 2YW9A 2JK0A 3I05A 5IPFA 2QXYA 4Z4EA 2PR2A 1CR1A 2YYAA 4NBTA 4BO9A 4DUZB 1OLXB 5BWLA 3MXOA 1BMFA 1JECA 3FCOA 2GRJA 5ED0A 7AT1A 1PJ8A 2NXWA 4MWGA 1FPQA 2VPTA 4JI4B 1Z2AA 1OU4A 1XJ0A 1WS6A 3IE2A 4S1VA 2IXTA 4UOEA 1N0IA 4JL6A 1RM5A 2FHSA 1G8JA 1QVAA 2FR0A 3EW7A 4EF5A 1BTOA 3RS0A 2YMPA 1U11A 4TYPA 1FDOA 2BRUA 2Z2YA 2ZTHA 1YIOA 4L75A 2CUNA 2PD4A 1JPNA 5BPHA 2HSGA 1M2VA 1MPXA 1ZIDA 3ZV6A 4F38A 1K2VN 4D99A 1OI2A 1WZUA 2QE6A 2RHTA 1PE0A 2CDCA 4PC6A 4F5WA 3IOEA 3PTAA 3SKVA 1SZDA 3A1WA 4ACAA 3U4QB 3F71A 3ZHCA 2W8ZA 3OTQA 4ALLA 1B8UA 2D1RA 2KS6A 4QXPA 2BFWA 4QO8A 2QSJA 4UFOA 1TQ6A 1U8YA 4U2FA 1OVMA 4DNXA 1OWNA 4TQGA 5JFGA 2XBMA 3CEMA 3EVDA 1C7EA 3SEZA 4Z5XA 4EG0A 4H7JA 2WM2A 1OBVA 3B5JA 4R2IA 3U39A 1J33A 5F76A 2X2EA 4DR5B 3L0YA 5E0OA 1EQ2A 4HXEB 4G8BA 4LV5B 1BS9A 2FWJA 1A76A 3I34X 3ABOB 4GL2A 5CCBA 5FBRB 1MJGM 2A9VA 3Q9NA 3DYVA 3C3BA 2CJFA 4LKOA 2GWHA 3W05A 3ZC3A 2CYBA 1TYDE 3UFXA 4BMXA 4W6ZA 3ZHQA 4EYKA 1UKEA 1OPRA 1SG0A 3JARB 3I30X 1BG6A 2Y4OA 1SY7A 2I3ZA 5GONF 4EHKA 1NUHA 2J7PD 5J23A 3AUFA 1JSZA 4X0EA 2GUGA 5JCJD 1TMGE 1YQEA 5KNDA 4Q1DA 3IHLA 4HJXA 1H2AS 4MAFA 3K71B 1VE7A 1DUSA 3UHJA 2AL7A 4AIIA 5IMSA 5JXHA 4QJ3A 4BNXA 1WF6A 3BD9A 1YASA 5G4KA 3TCKA 3CH6A 2VSXA 3PCXA 3FM9A 1FVHA 1OUMA 2PUVA 2GKGA 4FGSA 4OG2A 3NONA 2FMTA 1KOLA 1LFAA 3QU7A 1AQYA 1AZLA 1G63A 3QBJA 3V4RA 2GTHA 3ZHSA 2AN3A 1XNGA 3EOZA 2MDTA 1UP4A 1W0KD 3IDZA 5AM3A 2C7PA 2A84A 4MXDA 4PAQA 5B3JC 1QAMA 3FLBA 1IXYA 4FEEA 3ANLA 1KYQA 3RCBA 1WKVA 2GN9A 7REQB 1I4WA 1T35A 2B2NA 5EMMA 5K0CA 2B5WA 1JEQB 5HF5A 4MQEB 2ZB4A 1DEKA 3PUVA 4FFWA 5K3FB 3ITEA 4B7ZA 3W5DA 3HUTA 4HH3C 3STWA 2CYCA 2VK1A 4TUYF 1QHNA 4IMJB 4KVFA 4EX7A 4RZUA 3LPNA 3PVSA 3QW4B 1W94A 4GO1A 4RDCA 4BCCA 1PJTA 3G2LA 1FUYB 3HCPA 3I2GA 5AVOA 3ASVA 3B7WA 4BWFB 2HHLA 2ZRBA 5BR1A 1MCZA 2AVNA 5CDYA 3WWZA 2ZRKA 2FPUA 3UJHA 4KPUA 1HNZB 1T0IA 3L0ZA 1YBAA 4V03A 4PIMA 5AW3A 1GNQA 2DM6A 3EVFA 2P5UA 2YJ4A 2FZEA 5B3JA 1S2GA 3C15C 1I7NA 2YXDA 2UXCB 3RT1A 5JDIC 5J3JA 3UT5A 3OCWA 3T94A 1E2IA 3TOZA 5D5PA 1AT1A 3GRFA 2IUYA 3TKAA 3V1LA 4MUKA 5ERXA 3IE1A 3DD5A 1JAYA 5E4YA 1GILA 4Y6PA 1OH8A 4IINA 1EX1A 4TLDA 4IQFA 1V3UA 1J2RA 1WUYA 2BFCA 4UHJA 4E33A 3KQUA 3EXFB 3R0IA 2JEOA 5TEVA 1QS0B 1U2PA 2BJVA 3B9QA 3K1JA 5CK4A 3B5IA 3VC1A 4F2WA 4XDZA 2IF0A 4UUQA 1FDIA 4F72A 1AXRA 5INTA 3CH4B 4JJFA 3OTOB 4V39A 2C4TA 4RE5A 3GHHA 4IL5A 5HG0A 4FFRA 5BSUA 4FC7A 3RI3A 1FK8A 1KJZA 4AF8A 4CL8A 3NAMA 2W8BA 3R6WA 1OZAA 1SVLA 1UBFA 4NBWA 4MINA 4P38A 4PYKA 4P35A 3GRKA 1OV6A 4YXWD 2AUMA 3HRHA 4QHYA 2QD1A 4R51A 4WA7A 1O87A 2NO0A 3U3OA 3C6YA 3N28A 5GZ3A 2XW6A 1YZKA 5HX7A 4FBGA 4J16C 1XYGA 4R1UA 5CXQA 3AOGA 3UXMA 4L8FA 4B74A 2PLWA 1FYVA 1VMAA 3RG8A 3RS9A 4HD8A 4OKNA 4JC0A 3D64A 2FQQA 4IJQA 4LDRA 3RU2A 3O74A 1Q50A 1RRCA 1G8FA 2IWHA 2V4ZA 4NWIA 1Y9JA 3ENWA 1UBRS 3HG7A 4D9GA 1O6CA 1M8FA 4U7DA 1C1XB 3CKLA 2CWDA 1DOAA 3F67A 4MRMA 3ZHUA 1C0LA 2BKLA 4XR4A 2B8JA 4OQNA 3HM9A 4Q15A 2ODEA 4N5NA 4OXNA 1N0WA 3LE8A 4UU0A 2JIBA 3QFTA 4K1LA 2BCGY 1QYXA 4BNIA 2YVUA 1MP0A 2GCOA 2PFSA 4ZZ1A 2YS7A 3PZRA 4W7HA 3W5HA 2NYAA 2HEIA 1GZVA 4G0XA 1M1ZA 2HWKA 3QWHA 2KHZA 1BH6A 5CX4A 4WJLA 4HX2A 2R62A 4CFYA 1KO7A 1NXWA 3FVVA 3AT1A 1P1CA 2J5QA 3WWYA 1EFHA 2ZR8A 5BW6B 2R7LA 4EZEA 5LB2A 4ZCTA 4OLBA 3L49A 1ZO8A 2N1MA 2RGUA 4Y1FA 2L17A 4Q9KA 1M9NA 1Y7IA 3ZZUA 1ORVA 2B4KA 4L1KA 1TMOA 4LY3A 1UJ6A 4UE3S 4V3BA 3K32A 2Y9PB 4WFJA 4F5EA 5FH9A 1VL6A 5C1OA 3SF8B 1XRJA 3IAXA 1ZUIA 2DTDA 4HGRA 4P93A 2WFLB 4E5DA 4Z7OB 1I7SB 2I4MA 1FOEB 5DGCA 4BGVA 3V1YA 3AG6A 1K4MA 3IPCA 1MJ5A 4NNJA 4BNDA 5EGNA 4ERNA 4BU1A 1HDRA 4IFIA 4G65A 3OAAA 1BD3A 3OLVA 2P2NA 4B71A 2IV3A 4DKXA 5DYNA 4DILA 4MAMA 3DBHA 2WUGA 4KODA 1NUPA 1VSTA 3M3PA 5IH3A 3IP5A 4I08A 4BGDA 3IMFA 1NQVA 1X0XA 2YIMA 1NM5C 2ZBQA 2XGOA 1U9JA 2PXXA 4KVAA 4YAGA 1NKTA 4LIPD 2OHGA 3H1FA 2ORWA 3LIPA 1UBGA 1QO7A 2VH1A 5JCXA 2FUEA 2Y0PA 3JD1A 3AOEC 3WKAA 2P27A 4FCVA 4PYIA 3FWKA 3T7AA 1K7FB 4I4LA 4JKIA 3JWJA 1AK1A 4OXXA 1ZITA 4KV9A 2BDEA 1Y6JA 3CNEA 4KP7A 5TQVA 4LN1A 3DTVB 1JEQA 3I5XA 1ZZGA 2YZMA 2R1TA 5EZYB 3C3PA 3RUAA 4FI3F 4WVFA 3EPLA 3AJDA 1QQAA 2VUUA 1FFWA 2G5GX 4LTDA 3PV0A 1HQKA 3HSSA 4IS3A 2WG0A 3RJ9A 3LP6A 1MO4A 4A6PA 2MOKA 4RXTA 3O4JA 2OVFA 3AETB 2O3UA 5K0LA 3WGOA 2WD9A 3N8HA 1O97C 2CWWA 4LE2A 1I80A 2ZIWB 1PBTA 2PFGA 3NVDA 5K3CA 1KF0A 2BFFB 4CM6A 2GZ3A 4D57A 2ZJYA 1GUDA 1PV2A 2P3LA 4IDNA 1I2AA 4RPIA 4QPPA 5IKMA 5E7IA 4PHGA 4C0BA 3OOHA 2IZ6A 4J3FA 4URFA 4WNAA 4PXAA 2YXNA 1TUBA 1E6UA 3I9LA 3UT6A 3CSSA 3PWZA 1IC6A 1G291 1OILA 4JI8B 5DLDA 1GDDA 1L4NA 1H66A 5IAEA 3I1IA 4E5KA 1ONOA 1OA0A 3WJ2A 2R5FA 4B6SA 2R6FA 2QWXA 3AUUA 3AFIA 3W2FA 5JTUA 1XU4A 4ISCA 1GTVA 1G1MA 5D6NA 5C31A 4XWKA 4CXMA 2HPZA 4HAOA 4J1SA 1K3FA 2I1VB 4MR7A 1KKLA 2P3SA 3GVPA 3JQGB 3QJGA 6ADHA 1BIFA 3EXFA 1VL1A 3T5DA 1FMCA 4N8EA 5L4SA 4LXIA 2O2YA 5BQ3A 3BCHA 1QS0A 5CLLA 3V32A 5COQA 5CA1F 2XBUA 4GI3A 4MR8A 4PYQA 4WH0A 2P6PA 3WSWA 1K6IA 3TNJA 3HM2A 4B4VA 1IOLA 2R79A 3GR6A 4FW8A 4PQFA 2VP2A 4IDCA 2Q2QA 5CNKA 1ZN9A 3IEPA 4YGYA 1ZJJA 1HYHA 1O9GA 4QDKA 4D26A 4GS5A 4RANA 1GPKA 4F8JA 4PG8A 1VJ1A 3SM3A 3F46A 2BUBA 1GGHA 3I2HA 3DMNA 1KGSA 1YJ8A 1Z6PA 2HHAA 1H5NA 4CIWA 2QRMA 1Y63A 1MC1A 3CX3A 2VDRB 2PD3A 1V25A 3NORA 4CMIB 1RYEA 4JLPA 4P36A 4WQMA 5LVAA 2VLIA 1GAQA 3QIAA 3OKCA 3TL2A 5K0SA 4E3WA 1AZTA 1T6XA 2IYRA 2R66A 4HLUA 1TD1A 1RXSA 1YZNA 3A28A 4YFYA 3WQSB 1TQ2A 3ENZA 4BKUA 1ULAA 2R751 1O5TA 4BKMA 4G1BA 3JQAD 1Q16A 1JSLA 3F5QA 4I1PA 3FFXA 1OYYA 4LZZA 4DUPA 2A0UA 4BN4A 5CLJA 5L40A 2VDWB 1QWSA 3DTVD 3KX2A 3FETA 3LPCA 4AUNA 1HWYA 4YRKA 2FQXA 1LSJA 3SS8A 5AW6A 4OQEA 1ZM3A 4NZMA 5H3HA 1N7JA 3PHCA 1YNSA 4S2EA 4V38A 1EHIA 3PUJA 4BVGA 4BB9A 5L95A 1TAQA 4BE4A 4JBXA 5HQTA 1M5UA 3ZOKA 1SJ9A 4S35A 1Y5MA 3CVYA 1X92A 1UH5A 4L9RA 4YDQA 1NGSA 4Z2AA 3IEXA 2JGAA 3ZNOA 4TS3A 1F7VA 1E62A 1BEEA 2ZI5A 4EPYA 3MGCA 5DYIA 3QWFA 3AY0A 1GVHA 3DBRA 1NC3A 3KP1A 3ZH2A 1DB3A 3C1AA 4PGHA 5HF8A 2II6A 1V11B 3NKVA 3P5BA 5LOVF 2M9MA 5IBCA 3VTFA 2A9QA 3CFYA 3OEWA 2C58A 3EDYA 2QUAA 1KDOA 3NHAA 3DDUA 2I03A 1IY1A 1Y3CE 3LYHA 4RY0A 3JZDA 2J4DA 2JLQA 2IHTA 1Z8DA 5FQNA 1L5LA 3QELB 3UUWA 3S5JA 2HNKA 1ZI6A 1NHWA 1DAHA 4KQ1A 5EHQA 3TIXB 1TVCA 1UBKS 1V43A 2XCOA 2YY7A 3PNSA 5KYWA 2WAMA 1YH3A 1OI4A 1L8AA 3OZAA 5AVUA 1OSNA 3A06A 1PFKA 2ZDQA 1ISRA 1U3WA 1RRKA 3DOOA 4OUKX 3WA6A 1CUBA 2C9MA 3SJAA 1U0LA 2KE5A 1C29B 1HGXA 1XJWA 2PXCA 1SVOA 2BP7B 5AJHA 5ITSA 5ALOA 5EJ2A 5FBVB 3MTGA 5ECGC 1FP2A 5BRJA 4DB2A 1QIJA 1TTPB 2OBNA 2COUA