5EUBA

Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
272
structure length
272
Chain Sequence
VKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-MTA and sulfate
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase substrate
molecule keywords S-methyl-5'-thioadenosine phosphorylase
total genus 95
structure length 272
sequence length 272
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5eubA00
4LKRA 5CCEA 1PK9A 3EUFA 2OECA 2OXFA 3LA8A 3UAVA 1YBFA 1Z35A 3C74A 3FAZA 1Y1RA 5B7PA 2QTGA 4GLFA 3LGSA 1TGVA 1SJ9A 1U1GA 1V3QE 1ODIA 1PKEA 1OTXA 4TXJA 1B8NA 1ULBA 3NM4A 1T8SA 4TXNA 3E9ZA 3INYA 1ZL2A 1RCTE 4UC0A 4DAOA 1B8OA 4NSNA 1T8YA 1Z33A 3KU4A 1VHWA 4QATA 3NBQA 1PBNA 4OF4A 4OEHA 4JP5A 1QE5A 4R31A 3TL6A 2A0XA 4L5AA 1RXSA 1ODKA 3KHSA 4M7WA 4DABA 1RXUA 1Z5OA 1JYSA 2AI2A 3SCZA 5EUBA 4IP0A 1YQQA 4P54A 1PR4A 4DA7A 4EARA 1U1DA 1U1FA 3OZEA 1VMKA 1WTAA 1A9QA 1RYZA 1OV6A 2RJ3A 1Y1SA 3DF9A 1SQ6A 2HRDA 4F1WA 4BMZA 1OTYA 5CCDA 1T8RA 1Z36A 4LDNA 5B7GA 2QTTA 5FAKA 1C3XA 3ODGA 2QPLA 3NM6B 1A9RA 3E9RA 2A0YA 3IEXA 4DA8A 5B7NA 5DK6A 4LZWA 4WKNA 5I3CA 4D8VA 4DANA 1Z38A 1Y6RA 1VHJA 1V41E 2AI1A 3OPVA 3GB9A 1XE3A 1A9SA 3BJEA 5ETJA 1K3FA 4QAQA 4D8XA 3IOMA 4L6IA 3T94A 5F78A 3UAWA 4WKOA 2GUWA 1Y1QA 4EB8A 3O4VA 5JPCA 1PF7E 4DA0A 4I2VA 1PR1A 1OU4A 3OZDA 4NY1A 1NC1A 4OY3A 5F7ZA 3DPSA 4ECEA 1T0UA 4G8JA 3ENZA 4M1EA 1SD2A 4BMXA 4PNPA 3PHCA 2I8AA 1PWYE 4L0MA 4LNAA 5EFOA 1PW7A 4WKPA 2QDKA 3E0QA 2ISCA 1T8WA 3DDOA 4TTJA 3P0EA 5EPUA 1TCVA 3FWPA 4YJKA 1JE1A 1PR6A 3OOEA 1V4NA 3DJFA 5K1ZA 1N3IA 3OOHA 5IFKA 3EUEA 5F7JA 1JDZA 4TYMA 4K6OA 2OC4A 1LX7A 3FB1A 3EMVA 2HSWA 4TTAA 2QSUA 3BL6A 4LNHA 1PR5A 1ODJA 3UAYA 4BMYA 4OJTA 4D9HA 1CG6A 1JDVA 1YRYE 2H8GA 5CXSA 1Z5NA 5KB3A 2ON6A 3MMSA 4D8YA 3O6VA 4E1VA 4QARA 1TD1A 3KVVA 1ZOSA 5F7XA 4F3KA 2IQ5A 4MARA 1A9OA 5F73A 5IU6A 1V45E 4TXHA 1RSZA 2OC9A 4MCIA 4OGLA 4YMLA 4L5YA 3OCCA 3UT6A 4F3CA 1YQUA 1CB0A 4L5CA 4F2PA 1Y6QA 4JWTA 3U40A 3DP9A 3F8WA 3KVRA 1U1CA 1JDTA 4TTIA 3NM5A 5F7OA 1OUMA 3UAZA 2HN9A 3PNPA 4F2WA 3LBAA 1Z34A 3OZCA 1JDSA 1RT9A 3OF3A 2B94A 3OZBA 1Y1TA 3FUCA 4U2KA 3FOWA 1ODLA 3P0FA 1Z37A 1RXYA 1JE0A 5CXQA 3EEIA 2Q7OE 4X24A 1ECPA 1RXCA 4TS9A 4YO8A 3BSFA 3KVYA 3QPBA 1JPVA 2PGAA 3MB8A 4OGKA 1JDUA 2I4TA 4WKBA 4GKAA 4YNBA 4QEZA 4R2WA 1LV8A 1LVUA 1Q1GA 4KN5A 1TGYA 4G89A 1U1EA 4PR3A 1G2OA 4GLJA 3PHBE 1A9PA 1RFGE 1I80A 1M73E 4TXLA 2A8YA 4DARA 4G41A 1PK7A 4TS3A 4D98A 4TXMA 4JOSA 2AC7A 2A0WA 4BN0A 1ULAA 5F76A 3GGSA 5CYGA 2BSXA 3K8QA 3FNQA 1YR3A 1SD1A 2HWUA 4QASA 1Z39A 1FXUA 1PR2A 1JP7A 3ONVA 3KUKA 4GMHA 4DAEA 4QFBA 4H1TA 2AI3A 4NS1A 4WKCA 5C80A 1TCUA 2P4SA 1NW4A 1V2HE 1RR6A 4R2XA 1A69A 1OVGA 3K8OE 5CYFA 3UAXA 3BGSA 4FFSA 1A9TA 4RJ2A 1Z5PA 4M3NA 3D1VA 1V48A 1NC3A 5F77A 4MCHA 2XRFA 1K27A 1PR0A 5B7QA 1VFNA 4DA6A 1K9SA 3PNSA
chains in the Genus database with same CATH superfamily
3IOBA 3RWBA 2WU1A 4OGFA 1CUFA 3VHLB 2RCYA 1CJTC 2X9VA 4A73A 3IQFA 4FNMA 4O2AA 4BHTA 1VPEA 1QWSA 4DDTA 1ARZA 1P7ZA 1NPTO 3IA7A 4QU9A 4PYKA 3JASA 4XM0A 3EDMA 4DRXB 4E70A 4NE7A 3PUVA 5L6MB 1S2LA 5AVKA 3QI2A 2PFSA 4C4PA 4Z53A 3WKAA 1J22A 2NZVG 3CEPB 1UC5B 1YGYA 3G1UA 2GK6A 3G89A 4ILKA 4O4IB 5EWJA 2OYCA 3RT7A 3UPDA 4D9NA 3D2LA 2XGOA 1J99A 2EX0A 2JFZA 2MR5A 2ZT5A 3ZZMA 2OKCA 3VR2A 3NALA 2VXOA 1OBCA 1WVMA 1L5WA 5G4KA 3W5IA 5C5IA 2XB9A 3O2JA 2A9PA 2QRVB 1NNLA 2GA9A 5LP6A 4AXXA 2VPWA 3TSZA 1M7HA 4QTTB 4W9NA 2I2FA 2H48A 1UIRA 1G20E 2I3BA 2FWIA 2PDAA 4ND6A 2R8ZA 2OWDA 4YMHA 1DJQA 4GP6A 2O57A 1P33A 1GTZA 4MQBA 1X77A 4MHSA 2WA2A 4HQRA 1HDZA 4QUJA 4ZT2A 5HK8A 1YXMA 1ID1A 2GEBA 1I01A 2ZT7A 2XTNA 4NR0A 1NWCA 1HOXA 3O1JC 3RRJA 3INYA 3VR5H 2Q29A 3WYBA 1Z2CA 2I7CA 1YOVB 3T7EA 2X0IA 3GT7A 4WOCA 3C4JA 2GF2A 1S4QA 3M1YA 1FYDA 2K7ZA 4BJ6A 2ZJ2A 4EECA 2IXEA 1FEZA 2R6AA 2IHNA 1VHWA 1MEJA 5FULA 1UKZA 2F3UA 1ZL0A 2IHBA 1FYWA 2V54A 2JGFA 3JATA 4OH1A 5JS2A 3KKQA 1YJQA 2OM2A 1T5TA 2A59A 2NACA 4GBED 1Z6AA 1JFLA 2WILA 4YV7A 1MO2A 1S2MA 3NEPX 4WERA 1G2IA 3W05A 1NMZA 1RXSA 4DDUA 1KVTA 2R6DA 3KHSA 4MGHA 2JCSA 3QLTA 5HE8A 2GAJA 3QOYA 2BKAA 3BMNB 1E1RD 2G04A 2BEJA 3W9UA 3JZDA 1FRVA 1DV2A 3AO0B 4INPA 1L7PA 1E9BA 5DULA 5C81A 1QYIA 5AICA 5BV0A 4RHCA 2G36A 4D0SA 2WZQA 1NXOA 4DEYA 4RY8A 2RC5A 2VS1A 2IUSA 3BG5A 3RV4A 2ZPAA 4C4YA 2VK1A 2V7EA 2HNBA 4OGGA 4W1RA 1U9ZA 2H52A 5AHWA 2VEOA 2NYRA 3FNHA 2BIFA 2H1RA 3ILYA 4F46A 3DKRA 3OBBA 4J0GA 2NZWA 2CY0A 4F85A 3I1YA 1UQUA 1RRKA 2E85A 2RSLA 2EOAA 3OLWA 5MDHA 2WAMA 3A06A 1ECFA 1T8RA 3ZQKA 5K0JA 5LZ2A 2BFCB 2WHEA 5KNBH 4UUPA 1VQ1A 4OU4A 5DYGA 4NAHA 5A4MS 4BO0A 1KY5A 3HJBA 5KNDD 1XD9A 1WG8A 3GRPA 4MYSA 3EQ8A 5D8DA 4A92A 4YMTA 5HEKA 5CXUA 1RJDA 3ZX4A 3OQBA 2FZLA 3W5HA 4B76A 1S3FA 1KAHA 3D8SA 5AH0A 4W8HA 1FYVA 3C4QA 4UUBA 3UUFA 4XGNA 3IILA 1IZZA 1RP1A 1EQ2A 3RNLA 4DLPA 2VK2A 2ZDQA 1E2UA 3OIWA 3BWYA 4A4DA 8AT1A 5JWOA 1BTOA 2NSLA 1GKKA 1LS6A 3CF0A 1WW8A 4A36A 3UMGA 2CDCA 1PNTA 2XDAA 2CXUA 1GPJA 3MQ4A 1B74A 5FB3A 3E5HA 2V5VA 1ZBQA 2HIHA 3E1SA 2WWXA 4MP8A 3TZBA 4HVLA 1CDZA 1GGMA 4YJGA 1GZSA 1WLSA 1AOXA 1ZVKA 1XTBA 3TJMA 3U4AA 3WL6A 3JYHA 4Y2PA 4IDFA 1KP9A 3BH0A 3G0BA 2RH4A 221PA 3BF8A 4MQLA 2GTIA 3UH0A 1ADJA 1BMQA 7REQB 3MNFA 4E14A 4N5DA 5IC6A 1WCYA 2GETA 1MIOA 1D4OA 1MJ5A 1Z5GA 2HO5A 2IX9A 4GGOA 4QAQA 5TT1A 3QTBA 3F7TA 2VTEA 3BWDD 3DTNA 4K9RA 2VRBA 3LF1A 3T5AA 5E4JA 5ADVA 1Y8RA 2OQRA 3O4FA 1BXRB 1QV6A 4GYKA 3WMFA 1JDBB 2G9VA 2Q1XA 1JJAA 2AJCA 3R5HA 4JT9A 4LEIA 3W34A 4DRYA 3U16A 1NTRA 3IUPA 2NO6A 3AOGA 2REBA 2VJCA 3Q88A 1VSBA 3ASVA 3GEDA 1PJQA 4BTVA 2R60A 3CUUA 3H1GA 1QYDA 2P1ZA 4GX5A 4MUGA 4Z8XA 1BCRB 1M0SA 3I01A 4E2WA 3BTOA 3K6KA 3MWJA 3AB8A 3TSWA 4ZZ0A 5IVPA 1I9CA 4QPPA 4UOQA 1HSOA 2RH5A 3JD3A 4RLHA 2X7JA 1GXSA 2IYAA 1KOFA 1SCNE 4OA8A 4C0WA 3IB6A 4F4CA 5DK4A 4RV4A 4N47A 1X9IA 3LT1A 3ROQA 4B7AA 1XHFA 4P38A 4ZCTA 1QR2A 4JLNA 2GEFA 5C4IA 1UWCA 2QQGA 3BCUA 3D3WA 3PF8A 3Q5GA 5JS8A 1E9CA 3I4FA 3IV7A 3DMRA 4HF7A 4IZHA 5KQGA 1PZNA 3FCAA 2IHKA 4RK7A 4YFVA 2WTEA 2IUTA 1KOJA 4HB3A 4TV8A 3VZQA 1R37A 2CZQA 4F5DA 1T5DX 1QCCA 4LNAA 1W87A 1QQ7A 2B35A 5CVCA 1NBAA 5A0FA 1E2DA 2V9CA 4EJ2A 2QDKA 1CR1A 3I6MA 4KO1S 1F8YA 4MVXA 5CX1A 5HKLA 1U2DC 2WIJA 1S2DA 2J0UB 5DGDA 2XIJA 4S2EA 3PXCX 2WSYB 3LUAA 3E9CA 3E18A 1JIKA 3PC7A 4KKXB 4MINA 3W77A 4LGVA 1TCVA 4D4JA 3NHFA 3CSDA 2H4ZA 4WLVA 1ONSA 2C7RA 3KJNA 1TU3A 2JFNA 4GUDA 3ZV7A 2QPTA 1U94A 2JC3A 1C9EA 3CX6A 3ZD6A 4YRBA 4LJRA 2ZJZA 4FB5A 1LQTA 2QE6A 5M29A 3JRXA 2O1WA 5JLAA 3OP1A 2WDZA 1J2EA 4Q01A 1JJ7A 4LNUA 2BFFA 1EFCA 1T9BA 1MBZA 5AK3A 1FDUA 1R0WA 3L2OB 3L8FA 4NYMR 4DW8A 4L4XA 3KYCA 4OXXA 4Q3BA 4C7OA 3LO8A 3PDUA 4DLAA 1QIEA 2VHCA 4HGPA 3SF8A 2DUWA 1CE8B 3PB3A 1SEVA 4INOA 1QE3A 4J2OA 4B74A 1L7VC 1BE6A 2YW2A 1XCJA 4Y0AA 5FX2A 1XDDA 2EVWX 4BEBA 1JHQA 3FDFA 2BR3A 3B78A 2A94A 4MLPA 3D7KA 4PM4A 5HZHA 3H6KA 4KZKA 5IX8A 1TRHA 3ESBA 2V7WA 4FMDF 4Y9TA 4AY5A 4EB3A 2PX2A 3RROA 3BXZA 3ONNA 4O5OA 1DEAA 1XWWA 4CF4A 5BSKA 4QYWA 1R0SA 1X9HA 1A5ZA 3RSOA 4OB6A 4KGDA 1P4RA 1Z07A 3V6LA 3IDZA 2JRLA 4F4UA 3ZEAA 3HKBB 4DQLA 3S8YA 2Z57A 2C57A 3FWHA 4NLLA 2C5EA 3TAUA 1BH2A 2EHJA 4XUDA 1T1SA 3WK7A 3RFFA 4C3OB 1T9GS 5C1OA 4NICA 4XYEA 1E8NA 5DXAA 3GFRA 3PEFA 4MWDA 3DOHA 1ZRSA 5FORA 3ZXIA 1TD1A 1XR3A 2OFOA 3LY7A 1WMFA 4FSHA 4GPAA 3JVDA 5F7XA 2WMYA 1S8NA 2F8TA 1CRPA 2FK7A 2JPDA 4RDXA 1TVKA 3OTHA 3H5OA 3PNOA 4ZWNA 2ZE5A 3F4BA 3CT6A 3GT3A 5LP6F 1W85A 2G1UA 3PHHA 2FY8A 4IXNA 1ORRA 1KI8A 1ZH2A 1BX0A 3MOSA 5IJZA 1XXHB 2NVBA 3KL2A 2JANA 4H31A 4I46A 4OGLA 4CIXA 2HBQA 4MV8A 1DWPA 5HF6A 3V1TC 4ZGWA 2YFKA 2O8EA 1TO6A 4DR3B 1XNHA 1I1OA 4O2BA 1MABA 3KOUA 2XE8A 2QUIA 4QVKA 2QN9A 2C04A 1L7RA 4A15A 2O2CA 2ZBRA 3E15A 2YW9A 3ZDYB 1P7YA 2FFQA 2H2AA 3F8WA 3MJVA 3G0IA 3TGWA 1GTJ1 2QMEA 4FW8A 2UZ1A 1E1CB 2RAPA 5AM5A 5JVDB 2C3OA 1HLFA 4TTIA 3A9UA 4U63A 1CQIB 4U00A 5FUXA 1RWOA 3UBTA 5LQAA 2M6RA 3UAZA 4FKBA 1DZIA 4KYTA 5BNTA 3LX4A 5DN6A 3KQVA 2IV7A 4C14A 5FT9A 3GRYA 3D1JA 5AI8A 3V9PA 4LI0A 3BHJA 3OF3A 4TVKA 3ZK7A 4BVGA 3VOAA 2VJNA 4EI2A 3SQWA 2CNLA 4AJ9A 3ZHCA 1K08A 1QGYA 4XSGA 4NZPA 5AJTA 1JL3A 1SBTA 4K86A 3UXEA 5JWRA 2A78A 4W5HA 1NLYA 3PJEA 1THMA 4QECA 1UC8A 4U3JA 4X71A 2FMKA 5D3QA 4YP1A 4O2BB 3V6MA 1C3LA 5ESRA 1RVV1 4XWOA 2QZ4A 2Q41A 5K3EA 3C8HA 1V5GA 4M7RA 2GVDC 5DMXA 2HJRA 2QL9A 2V7TA 1G6OA 1TUIA 2P6MA 3TS1A 1J07A 1ELOA 3LH5A 4Y98A 2G1AA 3WGJA 3SX4A 3B3AA 2RGGA 4ZI3A 3CNQS 5CXQA 4KYIB 3LGAA 1OAAA 1C2YA 1XLUA 2P68A 2ZDGA 4F4FA 1GPKA 4JYBA 4RL4A 2OXRA 4D9GA 4KO2S 1KY4A 2PKQP 4HWKA 2R5NA 3TQCA 1HYQA 2E1RA 1C3OB 1SBYA 2XGGA 1U0HC 1TKCA 2Q7XA 4FOLA 4J9VA 5E6RB 4JVMA 5DTRA 1NBHA 1UMBB 1D1SA 4K9MA 2QQEA 4IQ0A 5T64A 3WQHA 2DECA 3PS9A 4G1FA 2IU3A 2BM9A 2AN5A 2G9ZA 3IJEB 5BT9A 1UM9B 3ZYCA 3HVHA 5K8CA 4HNUA 1IULA 4Q4AB 3GLFA 3JTMA 6REQB 2VHYA 4GKAA 3QWBA 4HPJB 3ZOZA 4TMTA 1JQDA 1V5FA 2BMAA 2FR8A 2IYWA 5G0SA 3V5NA 3RAEC 1E5QA 3K05A 2EYUA 1PG5A 3WL3A 3WLIA 4HGOA 5E9WA 3IL2A 5FA5A 1LVUA 2ZRFA 4HXYA 4IV5A 4KPUB 2H16A 4QQFA 3K5WA 4P32A 4JCOA 1E18A 4XDHA 1TO2E 1GU7A 3Q87B 4FYMA 2HWXA 3K0FB 2BP7B 5IH7A 3RSLA 4X85A 4L2IB 4U4AA 5L3ZA 2PLAA 2WF8A 3TCNA 4B4WA 1NIJA 2VZEA 3CLTC 1RJGA 1CB7A 3HBJA 1UZAA 3H2SA 3OIYA 4IUBS 3OC6A 5ITWA 4P3PA 1CQXA 3NI2A 3NU1A 4G0PA 3MGBA 1CZOA 3P71T 4JLMA 4KMOA 4RX1A 4RXTA 4TMKA 4NHOA 2CNOA 2FETA 3T1OA 3VTKA 2HF9A 3GEGA 3KZXA 3NPAA 3RK1A 4BLWA 2AC7A 3G2IA 2A0WA 4M9ZA 1ZMXA 1V35A 4YCMA 2E49A 3EJWA 4MYHA 1G21E 2QW1A 1YVEI 4GYYA 4Q9IA 5KOHB 1U4SA 1CIVA 2AR9A 2P4HX 2ZFUA 4B4OA 1V9SA 4BX8A 2GAOA 1VHTA 2RGDA 3HHPA 3P2KA 3N74A 5BN4B 3ZS8A 1UFRA 1Y81A 4OYYA 5FJIA 3WGUA 3CRRA 3FNQA 1QLJA 1CETA 3FSGA 3KOMA 3H05A 2MSLA 3UCXA 1Q17A 1VLQA 1LW7A 4JXKA 3EIEA 4ZCLA 1QK4A 1GJRA 1K89A 1Q44A 2HHJA 1T1GA 4JN6B 5THQA 3REQB 4MHTA 2R6ZA 1ZN7A 1QS0A 3QLEA 5KTSA 3QE3A 4A8TA 5FPSA 2W00A 2E5WA 2VVTA 1T4CB 2EIXA 1PS0A 3AETB 1WPQA 4XQ9A 3GA0A 2QN1A 1E2JA 4YRLA 2CLOB 2ZBQA 3KTDA 4JBYA 4S1VA 4WXHA 4AZ0A 5KPJA 4YP7A 3ZE8A 2ZYHA 5UKDA 1IG3A 4WGFA 3OJFA 3HCDA 3HA5A 3BQNB 4QUBA 1TX4B 3ZKWA 5TQJA 4AJLA 1EK2A 4DAEA 4E2ZA 5JAMA 1HNXB 4ZC1A 2Q5JA 2DETA 1A8SA 3OLQA 4R8VA 3QWFA 5EZQA 1WU7A 2XUJA 3U09A 3RT1A 2QJWA 3WA7A 4E13A 1XWIA 1WB4A 1BX1A 1LC3A 5BSTA 4KPFC 2VC2B 3D43A 3JYNA 4QNRA 2GWRA 1BD4A 3CKKA 3NUZA 3EJ6A 3K8OE 2P5SA 4RA6B 1WZCA 3BGSA 1Y3HA 4OCZA 4F5WA 1F1JA 1Z63A 3E9DA 1D2RA 1T2UA 2YWBA 3IFSA 2GCNA 3L6DA 4QYIA 3TK1A 2WE7A 4LC9A 4DSAA 5KPDA 4ZQIA 3WLNA 1ZD8A 4Q9LA 2AFHA 1WQ1R 2XTMA 3PNYA 3SZRA 4GPIB 3L01A 4ESOA 4TROA 3M1LA 3WADA 1XNQB 2CB9A 3DW1X 1P2TA 3OHMA 3EQ7A 1G59A 2BFDA 1YL5A 4M46A 4O08A 1ISHA 4DADA 4LTNA 3PNSA 4WE3A 1F20A 3JV7A 2YNMD 3CONA 2BELA 4MWCA 4C1BA 1DRWA 5AJVB 2JCBA 4GF5A 3R3VA 5FBQB 3A9VA 1ZXXA 1ADGA 3BWCA 5IC5A 2YWGA 4NX2A 1ZGAA 1ISFA 4WJLA 3QMPA 1U02A 1EVKA 2VJBA 3DMDA 5FUYA 4D81A 3FSJX 4PR0A 4I1YA 2VWHA 1RBQA 4NBUA 5BNZA 4KW7A 4J49A 1VG0B 5HGJA 3FAZA 3QE4A 1OLUA 3HV0A 4KVZA 3OZVA 1T26A 2R6FA 2O7RA 3C97A 1ZK4A 2QTGA 5LZ8A 4DB2A 3CV3A 1M33A 1YFZA 3HR4A 5ALDA 2OFXA 4MS3B 2JIZD 3DV0A 1U1GA 4KSBA 3OX2A 1ODIA 3COPA 2ZZNA 1OTXA 2AN4A 2O1SA 2UUOA 3C8MA 1C0KA 3GJYA 4MVJE 1ULBA 1XTUA 3ICVA 4O02B 4TXJA 3RIYA 1M1YB 4FEAA 1W36B 4E6PA 4XSHA 1VFPA 2TS1A 4OOEA 1JB1A 1Z0KA 1F0KA 3IE0A 4PQFA 2PPVA 4F3NA 4J90A 3OO0A 1MQ9A 1NKSA 1C29B 4H9GA 4BUZA 1NVBA 5HRCA 2Z1DA 4IFBA 4HTFB 5C8YA 2IV3A 3LQRA 4BUCA 2R9VA 3CC8A 1NW3A 1L5RA 2V9PA 4JU8A 1ZMOA 3UJ6A 3QKUA 3KEMA 3C45A 5K3BA 4RIEA 3BIWA 3RABA 3R8FA 2ZJ3A 4GM4A 3FYHA 1SKAA 3QA3E 3U7EB 1RYFA 4TLEA 3ZKAA 2Z8YM 2JNWA 2D0OB 4D9JA 4FFBB 1XB2A 3KKMA 2P0EA 1CY2A 1RHMA 2OYSA 1PQUA 1OJ7A 1ORHA 4WUTA 2UVDA 4FOTA 2GEDA 3UUGA 3SJUA 1GAQA 2W6PA 3M3PA 1F5SA 5IXYA 4XARA 1VZ3A 1RQLA 1SHJA 2ST1A 4HAWA 3L6RA 3A10A 4RHFA 1BC5A 3NBKA 3EQ9A 2NW6A 5JISA 1P8AA 2ZT8A 1WVGA 3N2GA 4O4LF 3HSYA 2W6IA 4ZEWA 3CT4A 1E20A 5DBFA 2YFYA 5CA0A 3ZGXA 4Q5IA 1E8DA 4KIJA 1ILEA 2HMSA 4JC0A 5EUBA 1GTMA 4L5BA 3B60A 2R8BA 4GECA 1X8XA 4Z9XA 1YQQA 1H5UA 1QV9A 4P54A 1QCZA 4OH7A 3L1HA 4XQEA 2Z3WA 1SCBA 1B1AA 1RYZA 4G5HA 1OV6A 2EWVA 2C3PA 1VBMA 3OE5A 4J7UA 2ZJBA 1SC1A 5IUKC 1OQAA 4AZTA 2ORVA 3RRFA 4FDTA 1Z7YA 2D5BA 3X1DA 3KQSA 4CFZA 1OGIA 3A36A 1P2SA 2M9MA 4MDFA 3PGJA 1OTYA 3H1AA 5EL0A 5JPIA 4BZPA 1PTJC 3HP4A 5TPWB 4XWGA 5KKCA 1WQ3A 2BM0A 2ZWVA 5HPYB 1JJIA 1FB5A 3HCEA 3I30X 4QHSA 4Q34A 1VI6A 3VKHA 4PQGA 2Q6VA 2NO9A 2VZ9A 4Q18A 2UVQA 4RFVA 5I7SA 2QTVB 4IO0A 1SVUA 1BJTA 1WDKA 3BN3A 4PNEA 1MKYA 4GOND 5IVHA 2X5JO 2D0IA 3N75A 1TVKB 1DQRA 4EENA 1GQOA 2HF7A 4M7PA 4LXYA 4RK5A 4PZLA 4LF6B 2B83A 4EG6A 4BVKA 5T4BA 2JGLA 4INAA 3PRKE 4YAFA 4F6RA 3EPPA 5DNCA 2QGFA 3A6EA 2F3RA 4U7FA 4DANA 5JNWA 3A9SA 1CY8A 3DMNA 3PKZA 5MF6A 2EV9A 4RD3A 2IBTA 4DNPA 4M22A 1QRUA 2IE0A 4C6SA 2LV8A 1XVLA 3H65A 2FH5B 5EE0A 5B58C 2NTNA 3BXHA 3RK4A 2GD6A 3E7WA 3WGVA 1HQDA 1DPFA 1JAZA 4KFSA 1U7DA 3V7WA 3FRIA 3MT9A 5ETJA 2GK7A 2ZR0A 1OYOA 5B1SA 9GPBA 1BYUA 1TA4A 1LDEA 3LPDA 4CMGA 4ZHQF 4EA7A 4DR6B 4UTRA 3MVEA 2JVJA 3RIGA 3FLEA 3IB3A 3L7KA 4WKOA 1JZSA 4JI3B 2R86A 4FQ8A 1AXRA 3DV2A 2NP7A 1GXSB 5GV7A 3EOZA 2JA1A 3G9QA 1CUJA 1UWKA 5F2OA 1GWNA 3QVOA 4CDNA 3AFIA 3MW8A 1CE8A 5B4VA 2FQQA 2XYRA 2QSYA 1H1LB 1UM8A 2OV1A 3H2IA 3KR2A 3PD7A 1E94E 2V0CA 4J0IA 4MPDA 4PINA 5JI3E 2W6CX 4I4TA 4C7OB 2ODQA 2FMUA 1E61A 4U5XA 1LPMA 4X1KB 5EJGA 3AKEA 3G79A 4LHZA 4JA0A 3TQHA 3IRUA 3LZDA 3EH1A 4NS4A 5C37A 3GOQA 3THYB 5GM2A 8ATCA 5JJIA 2E37A 3A58B 4N6GA 1IBKB 2D2XA 1TKRA 2HC9A 3CNLA 2KE5A 3D2AA 3FBGA 2EGHA 2GQ0A 2FX3A 4MV5A 4L78A 3FUVA 3GGOA 4M1EA 3ZV6A 4ZCRA 1SD2A 3VPFA 3HJAA 2ZIFA 4Q1AA 3V8VA 3PHCA 2PT9A 2C2OA 3VC3A 3O5AA 3ECAA 4WFJA 1PJTA 3OLXA 4OI2A 1GPLA 3UJ7A 3UJ8A 4E11A 3ANSA 5D3MA 4V2UA 4XYMA 1V4BA 1SZPA 3TNYA 3O03A 4AK9A 5AW8A 1GNQA 5CG2A 3E6AA 1YO6A 1NF3A 2FJ0A 5CBPA 3GCZA 5JE8A 3EXAA 2FG7C 4KCGA 3VTFA 5HRAA 3RFUA 3PPVA 5BYJA 1C50A 1JZQA 4J0JA 3E9YA 5JXWA 4ZHQB 2EARA 1JQEA 4B3GA 1OT5A 3PE3A 1N0HA 3LWNA 1WY5A 1TAHA 3FWPA 4JHXA 3GH3A 4TX1A 5EG5A 3AL2A 3UFBA 4WL0A 2FQWA 2E3JA 4R2MA 4DSUA 2EKQA 1DGQA 1ZW6A 3OIDA 4BGVA 1RHJA 3PTAA 3L9WA 2GT1A 4LOIA 4EIWA 5A2GA 1TVMA 1EGQA 3ACCA 4R8MA 4OXIA 5TGTA 4M8KA 2GILA 3T7AA 2RAVA 5ITVA 4QDUA 5IABA 2OG2A 2MTBA 3EXIA 1RYEA 3WJ1A 4EGAA 3FTFA 3T1VA 4EDHA 4XX0A 2F43A 5GPBA 1VGRA 3I73A 4RY9A 2J46A 3C3DA 1YWGO 3D8UA 4TQGA 3LF2A 4DCPA 3TI7A 2WWHA 1N2HA 3ZHVA 2BHTA 2R6JA 3BQ9A 3JQCA 3GLVA 1JFFA 4WY8A 1JILA 1ZZGA 2QUHA 5FYQA 4DKXA 3MJCA 4LOJA 4MW0A 1MV8A 3DJYA 3S8MA 3H2ZA 3HB7A 4JYAB 1KFEB 4PXAA 1SBIA 1XRSB 1ZP6A 1L6RA 2NV0A 4RZXA 3B2NA 2LW7A 1MGPA 3LHFA 2BGNA 3I2KA 2IUYA 1J2RA 5F3RA 2XIQA 3VNQA 4HHEA 2ON6A 1TMOA 4O4HB 1SQGA 5DSTA 1G3IA 2VAPA 1E6KA 2Y1XA 3A4TA 1II9A 1YQTA 1ZM9A 4AZWA 5DGIA 3KJIA 5HS6A 5JJBA 5ALOA 1M6VB 1YK0A 4I5EA 2A1IA 4FFOA 4X20A 3RC7A 3TMAA 4J8PA 1DCKA 5LD2C 3IP1A 1CUEA 4G65A 1ISJA 1C4XA 2GTPA 3C70A 3HXMA 2OO5C 1ZK2A 2AG0A 5HCNA 2D5CA 4IHJA 4DBZA 3ER8A 1X92A 4X6YA 2NU8A 3R0IA 3GFGA 2I54A 1UK6A 3ORYA 5DWDA 3K1JA 1KMQA 1K88A 2AUTA 1GY8A 2DQ4A 2GRUA 2XNDA 1MAAA 3C87A 4JSYA 5CFLA 5IWAB 2Z9CA 2DLNA 1GUZA 1C7ZA 2XR1A 1D4AA 3E05A 5JSKA 1AUVA 1KBZA 2NQ8A 1NNI1 4YMLA 1NT4A 1JQAA 2BD0A 1USUA 1EI9A 1QIDA 1BS9A 3AJAA 4O8ZA 1DT3A 3U7QB 5CEEA 1K75A 4LRXA 3K6RA 4LE2A 3TB4A 5CDYA 2MYUA 3MGKA 4UVGA 3TLJA 2YV1A 4QFCA 5EA2A 1JH9A 5EZ6B 1UBJS 2R48A 4H1VA 1D0VA 4ALJA 3DBHB 1U63A 2DKOA 4F56A 2NO0A 3KE8A 1BGWA 4CLRB 2D8AA 1KZHA 2PD6A 2X1VA 3IVAA 1KSFX 1NZJA 2P69A 5FFMA 2JLZA 2VLIA 1DKMA 1Q1QA 5K4GA 1W36C 2NVUA 1BQ4A 1K8XB 1W4BA 4V0QA 2Y05A 2J0EA 4JLOA 5C5EA 4JI0B 4HB4A 4WY2A 3KHTA 1Z34A 5JY6A 2I8LA 2IS4A 3CN9A 2GARA 5DNDA 3HM9A 5BSRA 4LPKA 1JSXA 4IHJB 4YI5A 5I9LA 1NATA 3WJ2A 3VOSA 3SYLA 1F6BA 1NQWA 1TM3E 5JSFA 2HWWA 2H4HA 1JNXX 1ULHA 4X94A 4YJHB 1JA9A 4EY5A 3CVVA 3H8SA 5LZ7A 2R1ZA 1IVYA 2TRSB 3M0EA 3O7WA 1N9GB 1C0PA 1FP4B 3IIKA 2VP4A 3H2HA 3WYDA 5BWBA 3TVDA 3N86A 2GOYA 2HO4A 1FLNA 2AZMA 2FRXA 2PWAA 3OEYA 4TTSA 2PMFA 4PIVA 5D87A 4Q3OA 2RHOA 1U0OC 3PYXA 1SQSA 4XVQA 3W90A 2BUBA 4AUMA 2HOQA 4DCMA 1U2GC 1XZQA 2CGEA 3B82A 1HLGA 1PHPA 1GRQA 1W96A 4DLVA 1MB4A 3LE8A 2GXQA 2ZZKA 1G3RA 4DZTA 5K9ZA 4WCFA 2R7LA 4FR5A 4CG0A 3V4ZA 1OB2A 3EBOA 3TRHA 5FBRB 1GG2A 4HNQA 3EVGA 1FP7A 1ZD5A 2G8LA 1ODCA 3NT4A 4AY3A 4BMSA 2GK3A 2I7DA 4REQA 1O77A 4RS3A 3DZCA 2PGIA 5AK6A 4YLYA 1Z0IA 3GCDA 2EW8A 3CH5A 1LF5A 1QRTA 1DAHA 2WICA 4WIAA 3OP4A 4J1SA 4WAUA 2LVBA 3BE6A 3H5WA 4HTAA 3LPCA 1H69A 4P80A 4YO7A 5IANA 2O1EA 1M2OA 3OWXA 3BVPA 3NAMA 3PTLA 4L4RA 4F9GA 5FWYB 3DHNA 3DUFB 3WQBA 2PGLA 3KB8A 1BAPA 4MIKA 2ZXUA 1XQWA 2OP1A 4IGFA 4QEZA 1QPGA 2VQ3A 4YBZA 3EGVA 3EGDB 5CTJA 3IQWA 1ECGA 1ECBA 3G8CA 4KQGA 2IRWA 4XFDA 1KQGA 2BFMA 5G4LA 2BV3A 3BX1A 4IS2A 2XDYA 2VJLA 3UWOA 4TLMB 4E21A 4O4LB 1M73E 4PZ9A 1RQNA 4MCJA 3CIOA 2CXQA 2G8NA 2PGXA 3LXMA 4O33A 2IY7A 1AGNA 1SRRA 2NU9B 1W4ZA 2ZWPA 2FWPA 2FR8C 2BTOA 1QKJA 4PWYA 1ZD9A 3LLSA 4TS3A 2B8NA 3U7RA 3ZCPA 1OU0A 4BMOB 5BR4A 1JXAA 1UZUA 4OHYA 2ID9A 4DSTA 2J4DA 3U5TA 2W58A 2IYSA 1RD4A 3IP9A 2OZLB 1K5DA 1S2IA 2VP9A 2VOJA 4RVSA 1ULAA 5P8WA 3JYOA 4DGSA 4F60A 1L7AA 2O0MA 3NLLA 2Y0BA 3KL4A 4DN6A 1V11B 1EHYA 3IH5A 1E2EA 2FN7A 3FOBA 4G5FA 5T6BA 3T9EA 3TOVA 3C3BA 2AMJA 1KA9H 3DOOA 2HNKA 1JRLA 4KAFA 5KO2A 2GFQA 3QEBZ 4Y2GA 5F9HA 1VE5A 1GRCA 3HCOA 4S05A 1AB6A 1Q7CA 4OMFG 1X7YA 3ACDA 3R5TA 4FIZA 2GO1A 3EQ2A 4KLCA 1VG1A 4NCNA 5DXFA 2OAGA 3GC6A 2EXXA 4R8KA 3M6FA 4CYMA 1NDQA 2AHRA 3L7LA 4IY1A 4KMSA 1BVYF 3E1KA 1BG6A 2FSVA 1Z06A 1VKOA 1KQPA 2C07A 4C4OA 1F06A 2P9YA 4CR7A 1MN6A 3ZWNA 1LD3A 4F93B 4UEQA 3RTCA 4FHFA 1G20A 5B6IA 2XQJA 3KWMA 4R1OA 4WOJA 3RIEA 3OAAD 4HT3B 4QFBA 4R7GA 6Q21A 5D01A 3TTYA 3CLRC 3LFTA 4B6SA 5KWJA 4MR7B 4NS1A 1LU9A 2AVNA 3WFZA 3VPHA 4YR7A 1QHYA 1NWHA 3LLMA 1XK6A 3HKCA 1TCUA 3RUHA 5L3QB 2QBYB 2W93A 5FBHA 2CNWD 1GFIA 1K7EB 4A8JA 3W8DA 2FUG6 3MUNA 5COBA 3RU2A 2IKSA 4PYNA 3UAXA 2IHUA 4ESHA 3M4NA 4CM9D 1EWTA 4O2LA 2EW1A 3B1JA 3HU2A 1O0CA 1D0IA 1M6YA 1XFDA 2GZRA 1QTIA 5EIAA 3CVOA 3TNLA 3ETEA 5CGZA 1ISIA 3BXPA 3GUCA 3LQKA 4IKEA 1WXHA 3P9SA 2WJIA 5F77A 4KX3A 4MA0A 4EJ6A 1K27A 4OU5A 3MT0A 5A6SA 2EERA 2I65A 5TF0A 3BHNA 1EJ2A 4A8PA 5HSGA 2CCJA 1CFZA 3HA7A 2IDKA 1AGXA 2O4UX 2QLNA 3NS7A 4WXYB 1XZNA 4X95A 3WMEA 2FP3A 1L3IA 2WKQA 1XVIA 2WUVA 4N5MA 3GUHA 3O95A 4QTXA 3ZTTA 4FC6A 1K5HA 2ZB8A 4AYTA 1OLOA 3VYUB 2Y27A 4CTMA 1AO3A 3GLGE 3ZDFA 2HSEA 1M75A 3B6KA 4F2GA 4L85A 2LD4A 4ZEVA 1XRQA 1ZH8A 1Q50A 2ZP1A 1KZ9A 3R5XA 2DERA 3KPYA 4QREA 1NJ5A 1XQ1A 1NM5C 2C82A 3BMQA 3DNPA 1OBFO 1QH1B 2BC9A 3DQPA 4TMVA 2TMDA 4KRXA 3I42A 3NTOA 2QMYA 5HTOA 5DLDA 1J7KA 1YZHA 2O0HA 3BH7A 3F1LA 4M2LA 1LZKA 4JP8A 5IBQA 2OUIA 5K8LA 3FVWA 2V7QA 3MTEA 1DC8A 1OPRA 4US0R 4ZOQI 2FEKA 4AUKA 3I52A 1N6NA 1W34A 2VJDA 3RS0A 1MXHA 3WWYA 1DRJA 1SJ9A 3ESZA 5JXHA 1D09A 4LV6A 1FDSA 2P0AA 4BX3A 2GH1A 2IP1A 4FR0A 4M1KA 5JSZA 2C4NA 4PPQA 3WMWA 4JL5A 2YVKA 4COKA 4NENA 4QL3A 4ZVOA 4YWJA 2HIGA 3D3QA 1KZ4A 5G3ZA 3SJAA 2JG3A 4MUMA 4P84A 4AZ3A 1I3CA 3W5BA 2NSHA 2O06A 4P4SA 1MG0A 4RGYA 3VPXA 3ZXYA 3WLMA 1HE8B 2VRNA 3SXPA 4Q1FA 5C52B 1J1UA 3E1GA 5LB2A 1XHLA 4IWXA 4EO9A 2WWWA 4OD0A 3ROZA 5GP1A 3HBMA 3KO8A 2O8FB 1JH8A 1YUBA 4I36A 3UW1A 3KB6A 1KU0A 1KJWA 4KPGA 1N5RA 1T0PA 1JT2A 3I3SR 4ZI2A 1W6RA 3K9FC 3JU3A 1EVJA 3OCXA 1V95A 3KELA 4YUWA 4POAA 1QH8B 4LMBA 1DX6A 4R5HA 1HFKA 2D54A 5G1NA 5MN5A 3ENNA 1SCQA 1JWLA 4X3PA 5K2MA 3WFJA 5HDQA 3PX3A 2I03A 1ZS9A 4WK6A 4I9UA 4D96A 3A05A 2IXDA 4Y18A 4GG1A 5CFZA 2Q5CA 1HDIA 3H42B 4A6PA 4B17A 4QLOA 1SXJA 4RK1A 3Q5DA 2OCDA 1HDGO 1JBKA 3B12A 3FFWA 2FUEA 2BSQA 1Z5OA 3NYRA 3KDSE 3QYAA 4C3ZA 3L8MA 1YR8A 2J4FA 5JSZB 4YEDA 3EZFA 1GZ4A 2XCOA 4YMUA 3SEAA 1NRIA 4G0QA 4TTPA 4YJFB 1E1QA 1LK5A 2BLNA 1PR4A 3NDJA 4B82A 1XMQB 5T8KA 4CQMA 3KTFA 4YAIA 1H8EA 3JYLA 3VU9A 3WHLA 2JHPA 4AF7A 1NR7A 1NTOA 4K6KA 4K8RB 1A7JA 2B5OA 3E7XA 1XZBA 4RVHA 2OGSA 3E3AA 3IP8A 1YZYA 3WGMA 1IN6A 2HRDA 3RJZA 4RVGA 4Q6BA 4NOJA 3HXQA 4DBLC 4GOKA 5CFQA 4ZVKA 1Q0RA 3B8HA 3GN2A 1DKRA 2AN9A 1E2BA 1C3XA 1QAQA 2D00A 4CLHA 5IAEA 2HWKA 3HXKA 1H2WA 1OIXA 3NM6B 3TTSA 4F8EA 1DWOA 1CEXA 3P4XA 2H00A 1D0SA 3EX7C 1S3IA 4WBNA 1DP4A 3HYTA 3G0CA 1GKLA 2IYLD 3D9QX 3OESA 3QFTA 1P1BA 4MTCA 3KP1A 1SXPA 1ADFA 4TYNA 4KH0A 6LDHA 2DUUA 4R16A 2EFDB 1CUXA 1P18A 3P9NA 3PQ8A 2QM7A 5ILOA 5JFOA 1ETUA 1RAGA 2AXNA 2J6HA 3GEPA 4N03A 1M9NA 1P31A 2XYQA 2Y3IA 3QEMB 2F8LA 4HQKA 4V0NA 3SJBA 3FTEA 1XNGA 1B0AA 3F6PA 2JJYA 2O0KA 2QU7A 2VKTA 4RESA 4HFMA 1P3DA 1Q7RA 4JI8B 1URPA 2LNDA 1YK1A 2BEKA 3KJXA 1HG0A 1JGTA 2FMTA 4MOWA 3V1MA 4DLZA 3LWZA 3AM1A 4AYWA 1X7HA 2QRUA 1H2EA 4DYDA 3NT5A 2ECOA 4U2BA 4INJA 2OYRA 1WPXA 2YWEA 3FRHA 1M6NA 3INNA 3VSCA 3ELWA 1LI4A 1XN4A 5C5CA 2MDTA 3E4CA 3QELA 1AUOA 1FNBA 3ZDQA 3HY4A 1I9GA 3WY9A 4QGFA 4HQFA 4MQ6A 4QSMA 1Z6TA 1AQYA 1IRIA 1FCJA 1GNSA 1NUSA 2DUMA 3P1JA 4RPJA 3PZRA 1UPUA 4NMXB 5TDHA 3MYYA 4HXEB 4QGGA 1KQOA 1MHPA 4M1QA 3WC4A 1MJGM 1V37A 4FZVA 3ZV3A 2IT1A 2XGJA 3CF6R 1SUWA 2A86A 2JIDA 2W71A 3QY0A 4DG5A 1Q7EA 4W7HA 1HT0A 4BJ3A 2O2SA 4DMFA 1L5ZA 2PX0A 4G8JA 4ZREA 2AW3A 3NNSA 4M99A 3H8JA 5I51A 4YQZA 4CF7A 3LTEA 1LDYA 3HC7A 3I64A 2YJ5A 3DG9A 3R3UA 3MWYW 4X00A 5IN5A 5HJEA 1SK9A 3F6SA 4NAVA 1FXSA 5TPZD 3R7SA 2KM1A 2GCOA 4BMXA 3D4BA 4TT8A 5IMSA 2JJ1D 5M3BA 4NBWA 3A1EA 4RMJA 2C0CA 4W9NC 3UJHA 5BN4A 2HZBA 4ATNA 3DFUA 4L0MA 2OHHA 3W2IA 2B69A 2O8VA 1ZU5A 2VPQA 3PHIA 1U9IA 1RZ3A 4WA8A 4WKPA 1DC4A 1UAAA 1Q6ZA 3FZNA 4U6NA 5IUJC 3G68A 4RF2A 5KWEA 1XVTA 2XUZA 3WLPA 1T5LA 1QF9A 1TZCA 2P79A 1JU3A 1RTTA 3EE6A 3PPYA 1NNSA 3DAGA 4AP5A 4QQ8A 4IOKA 1ZW1A 4LQLA 2ZKIA 3R41A 1YMVA 3H2YA 1L1EA 4A6EA 2QD3A 3Q6NA 1ZD4A 4BP3A 1K1EA 3P0EA 1N75A 2ORED 4PZPA 4I55A 1DXHA 4W4TA 1RI3A 3BTUA 5TY0A 4LX8A 2QI9C 4MJLA 2H65A 2QE7D 2WB4A 3L49A 4R41A 5DNVA 2JAPA 2XB8A 5EQDA 1ML3A 4EGJA 1G42A 4G23A 1VJCA 1XZFA 8ABPA 3N8NA 5AVUA 2ZRAA 1GRRA 3DLIA 5K1ZA 3IJ5A 1KDVA 3SYTA 4EELA 1J90A 4YMVA 3SQMA 1PV1A 3GUUA 3LUHA 2D1YA 3TFWA 4UNNA 1P17A 3EY9A 4M8IA 1T43A 3NBMA 4QVIA 4WSOA 3PNQA 2Y1WA 5JOQA 1CY6A 1OFGA 1DOHA 3L8EA 1FRZA 1LX7A 2PHZA 2O6HA 3PLRA 4LCBA 1E9DA 3EEOA 4K9DA 1K06A 4YT8A 3WLAA 5LYJB 5TX7A 2AX4A 4BL5A 2I91A 2O23A 3GAFA 4DV0B 2G6BA 2QV7A 2V6JA 1YFJA 1PR5A 2E6KA 1U9IC 3FOCA 3G5MA 4Z99A 5IKOA 4B3DA 1NMEA 4FDVA 2FEAA 3HN6A 4OJTA 1C4OA 4FN4A 3QXCA 4WCFB 3UW3A 4D9HA 4EW2A 4GZLA 5TMPA 1J00A 1BXKA 2WFLA 1RI4A 2OV4A 2Z2IA 4WNYA 2V1XA 3EFEA 1CUWA 4QJ5A 4R1QA 1YCFA 1E1RA 3VMFA 4MVWA 3KIPA 4LBYA 3VM6A 2PXAA 4D8YA 3D6NB 4EUNA 3CJTA 4E1VA 2H1FA 3PJFA 4QAJA 4F38A 3N39C 3BSYA 5CYOA 1MORA 2E1PA 5MN6A 5SYAA 4RH0A 4N5IX 1A9OA 1NV8A 3HPRA 1QIMA 1KK3A 1WB9A 2XDWA 2ZCJA 4JLDA 3LC1O 4ZVPA 2BDUA 4OHOA 1LBEA 4NYIQ 2GAAA 4UE3S 5ALLA 1XCOA 4LZPA 4CKBB 5BW8A 3VYSB 1Y3AA 4IUDS 3MJEA 3ZNNA 4EAQA 3S99A 3GHYA 2E7ZA 4JA2A 4CLRA 2QRGA 4W63A 3RSHA 2OBBA 4X61A 2OGUA 2QT1A 3GGGA 2Z6VA 2X9GA 3ABIA 3CGGA 4JKIA 4L72A 2VXBA 4OFZA 3SXUA 4PN3A 3WFIA 2DJIA 1FFXB 1DI0A 2ZJYA 4LWQA 5DBHX 3SEFA 4RWEA 1NXTA 4J0EA 2ES4A 5AOAA 3IBTA 2BI7A 5DRYA 2YYSA 3ER6A 2AC2A 3R40A 4MAFA 4DUPA 1JDTA 3AVUA 3DFFA 3GP8A 1L5MA 5IAAA 3DR3A 3E0XA 3QF4A 3TOXA 3A2NA 1ECJA 3I9OA 2Q4EA 4F06A 4E7OA 2VHJA 4ZJUA 5D00A 5ENZA 4YRAA 3IKVA 2BFEA 2N75A 1YACA 5IULC 5KS2A 2YL2A 4NARA 1Y7HA 2GNOA 2HRBA 5H4HA 3PGVA 2FZEA 2P6PA 2XBLA 4WUVA 4ND1A 2BRUC 3B51X 1RMQA 1NRJB 1Y6ZA 2WUWE 2VK8A 3E81A 5EHXA 1HORA 2ERCA 5EERA 1MQ8B 1X1QA 5FBWB 3TZHA 1I5OA 1X1CA 2B94A 2O3JA 3USCS 4Z51A 3EGEA 1I2DA 1T4MA 3O4GA 5JR3A 1RRMA 4BN5A 1ZM3A 1QP7A 1M6VA 3T4PA 2CXSA 2H57A 3PC3A 2W6JA 3UUWA 3W5JA 3O9MA 4EY7A 2ZIWB 3TPFA 4Y6SA 3ZHBA 1E7QA 4BJ1A 5BVHB 5I8PA 3GLGA 4GI1A 1VI5A 4MUIA 1F8GA 4XTCS 1FTSA 3VU3A 3KSAC 3CUVA 4J1QA 4MV7A 2IWRA 2XA9A 9LDTA 4NONA 4IDQA 3R7FA 4K26A 3ZZUA 1RXWA 3BICA 4HDAA 2GPBA 3OE7A 1K7YA 5ALZA 1JJFA 4H7PA 1RMTA 3LT2A 4TV8F 3VAZA 4AO8A 1ZESA 3P9XA 4RJTA 1SVNA 4FM9A 2VBFA 4JOCA 2TECE 5E6UB 1B7GO 1ZIXA 4UTOA 4C20A 3NDRA 4GFDA 1AQUA 3DM5A 2MR6A 3NRJA 2VZLA 2IZ1A 2RHMA 1MB9A 4DC1A 4PX9A 3VZSA 3LX5A 3PDIA 4H3VA 3WJ7A 3ZQUA 4EMUA 1P1IA 1VBFA 2C7GA 3NANA 4OP3A 4FU0A 5TARA 4B34A 5IEJA 2YHAA 2PL1A 1GPYA 3JATB 4AJIA 4B80A 3C8DA 1JHZA 1D9ZA 3MJSA 4PLCA 1YS1X 1Z0JA 1AE1A 4LMAA 3Q7QA 3ZY3A 1G291 4OGKA 1T2CA 3EXFA 2F3PA 5J1TB 2H0RA 4TQUS 4F1KA 1JAHA 4HTFA 1NBOA 5FOWA 5JH7B 3RTEA 2WFLB 3O8DA 3FNIA 4JWKA 3ZTWA 1LV8A 1G41A 4HAVA 3ZLTA 3I62A 3WLJA 5KREA 3DKPA 1E3SA 3KVOA 4KN5A 4IIJF 3ENVA 4D0LB 5LLDA 2O0LA 3Q8XB 3H3XA 3II6X 1CFJA 3ASYA 4LVUA 3VZPA 1HEUA 1E96A 1RI2A 3PHBE 2ZSHA 2CYAA 3PBKA 2CLMB 4UCWA 3ZJVA 4RHXA 3UOAB 1Y82A 2JASA 4HNAB 1X7XB 4I6GA 3ENQA 4A7PA 3IE2A 3EXEB 1PK7A 4UVEA 5DJ5A 4UKDA 1YC2A 5KX5B 1B42A 1MHTA 2QVCA 1EDBA 1QB8A 1RLIA 2OHOA 3U37A 3H99A 3CGWA 2XVAA 5ES3A 5CLFA 1WXQA 1L3CA 5EWJB 3GJ4A 2JD0A 4MB6A 5JDCA 3ZGNA 2ZE7A 3LU1A 3DBIA 3FDZA 1RC0A 2BSXA 1EM6A 1THGA 5C7OO 3HEMA 1EZ4A 2WTXA 4DWWA 3MA0A 5HYVA 2VF8A 1TL7C 3EVNA 1KAEA 4GI3A 4ZO7A 3M3DA 1RRFA 3OCYA 5FA6A 1GN9A 3CF2A 2PPLA 3GJSA 4U9UA 3DAPA 3MTDA 4I50F 4DCVA 4Z4FA 2R1VB 3AM5A 4HDNB 5DH9A 2CHUA 2G88A 1OB5A 1IY0A 3QX9A 5EZYB 3R9IA 1LC0A 1Q22A 2B9EA 1WTCA 2O8BA 5EIBD 1R9GA 5DP2A 2OLKA 1HL3A 1WA5A 3PE4A 1DBVO 2YYYA 2WHRA 1L5GB 1E9EA 1E79D 2B4AA 3EASA 3FZYA 3C1OA 1CP3A 4K2AA 2QY9A 2AI3A 2G4VA 2VYFA 1XZEA 1XV5A 1DRVA 1IDOA 1H66A 3PHJA 4MMZB 5F4ZA 4MIYA 3U1TA 4X62B 4OQFA 4RE6A 3O90A 1MB3A 1OA1A 2VHUA 1ENZA 1SVKA 2OPBA 4LJSA 2ZYUX 1GG9A 3EVZA 4R2XA 1NE7A 4XWYA 3MPOA 5HFJA 1JDNA 5C8DA 2AFIB 4PZYA 2BBWA 4ZVUA 1U0FA 1A9TA 3WAKA 5KJ6A 1S1MA 1UEJA 4MR9B 4PSAA 4PRLA 3WA6A 1H5NA 3S5UA 2OZVA 3K6SA 1ZCAA 3H5LA 2C3MA 4HNTA 3W4JA 3PQ3A 1L1RA 1TZBA 3OX4A 5SYMA 5D6NA 2RI1A 2HLPA 5TRTA 2VRCA 3VU8A 4DA6A 5AVWA 3T0IA 5JCPA 2NAFA 4G5OA 4NABA 2GLXA 1N7GA 1VJGA 2R6HA 1F4VA 1NF2A 2GHTA 1GGEA 3IAM6 4EG3A 1ILWA 2I1QA 3O26A 1ENYA 2QTVA 1VKNA 2Q2WA 3A6JA 5DGCA 1UINA 4IJMA 2IPNA 3GW8A 3OZTA 3EUWA 3KG2A 4EPTA 2VTBB 4AQ7A 4PGFA 4DR5B 2ZUTA 1BDHA 4NBNA 2AZDA 3GD5A 4ALNA 5G1PA 1F8XA 3JWEA 3F5SA 5TPWA 3VI3B 1BWQA 3ESCA 5ALGA 4FFVA 4CQLB 3NW9A 4X9XA 3B53X 3TLEA 3WK9A 1Z0AA 5L3VA 1QOQB 3JSXA 1MF7A 3C74A 5I8ZA 3SZOA 3WWZA 1Z4QA 3VR4H 2CHQA 1TUGA 4AI6A 3CTMA 3PUXA 3WGTA 4BKOA 1ML4A 4PYRA 2Q3HA 4R8RA 4QQRA 2X9QA 5CCXA 1DZ3A 3N05A 5I6DA 1OJLA 2VFAA 5FBLB 1AU9A 1Y3DE 4PLWA 4XPIB 1PKEA 4EHDA 4RTLA 5KYUB 4QXMA 5TS3A 4CDRA 4YREA 1KEEB 1SCJA 1IZ0A 3EGOA 1JKJA 3BHIA 2YMQA 1T25A 3PFWO 1FJXA 4K3UA 2Q3DA 4KPUA 5IPFA 3Q9SA 1PJLA 4ER5A 5IJ0B 4HNRA 3U3JA 3HFGA 5EWLB 1E2IA 4KODA 2A9QA 1AA6A 1GITA 4J03A 4CI9A 3LMKA 5JD5A 2P5TB 3NOQA 1GSOA 4Q3AA 3WZ2A 2O2HA 4M89A 4N8EA 4WXEA 2RHDA 1LRJA 2X40A 1E7MA 4JSTA 2JGRA 4ALMA 9ATCA 3VSEA 3HNPA 3LBNA 3BD7A 1EX6A 3AR4A 1RWMA 2ORIA 3VZBA 1UMBA 3P32A 4WXRA 4IIDA 3VYTB 1X70A 2KYRA 3L1UA 4OM8A 1EFRD 1ZD2P 2QN7A 2XNSA 4NBSA 4M53A 1KPGA 4QM7A 3ZWCA 3DLBA 3RVQA 2PH3A 2DT5A 3DT8A 5E0OA 2IEDA 3V4VB 3QV1A 1U7UA 3DDHA 5LPNA 3TIXB 4Q03A 2I7XA 2IZ0A 3C98A 3O8BA 1ZIPA 3FFTA 4R68A 4W5NA 2RBGA 4QDOA 3I8OA 5D1HA 4AO6A 4BZZA 4EW6A 4IWNA 3HYNA 3VBCA 2YVQA 5DM70 1WZUA 3I6QA 1RADA 3AINA 5K09A 3JQRA 1RXUA 2WYWA 4H77A 2XYGA 3PUKA 4H08A 3TPZA 3RBXA 5I5EA 2HY7A 1SHTX 3FN4A 3KZ1E 2G1JA 3M5WA 3KPJA 4KLNA 1IK4A 3K1AB 3X1JA 4QIHA 1UOEA 5H4GA 5CJPA 2QAGA 2AOUA 1JR2A 1PQYA 3BILA 3R6WA 4IVNA 3LL7A 1UOOA 1UDWA 4MQFB 1L7MA 5JQWA 4OMDA 2NXJA 4MRPA 3FSRA 1JQ5A 1JR3D 1IH8A 4K81B 3NB0A 4OXRA 4AZ3B 5MGNA 2I6XA 2BOVA 1YJ8A 2EJBA 2HF2A 4CU5A 4EO4A 3CKYA 1UBEA 3DTVD 2IOHA 3ANNA 4MVJA 1IRXA 2VNJA 3W5VA 3PWZA 4JBXA 4ZTUB 2O05A 1A4RA 1T1RA 1PQWA 2CVOA 2JB9A 2RHTA 3STHA 4CEJA 1HK7A 3JVVA 1E2FA 2JJ2A 4U39A 5HIAA 1BHJA 4BS9A 1VM6A 2J8ZA 1EESA 2JLCA 1UT6A 4TPKA 2P62A 3W8EA 2IU6A 1NVVQ 4NV0A 1QORA 3DO6A 2ZRMA 1RRGA 2I2AA 4CCYB 4TUYB 2Q4BA 2OVFA 4F9TA 3W4KA 1MW9X 9ABPA 4K87A 3WQRA 3ZI0A 2Y77A 4AFNA 4FJ2A 1B15A 4D0GA 2Z5GA 5FUMA 1P9OA 2D1RA 1KARA 1XXHA 2NU7B 2WAYA 2X42A 4DY4A 1Y6RA 1QM5A 1KFKB 1TO1E 3JQPA 2VP6A 4IV8A 5BYAA 3CUYA 5FOVA 3NYIA 3LPLA 1DS6A 3G9XA 1DDIA 1QP8A 1TNDA 3CX8A 1IHPA 1ONNA 3A6KA 4YRDA 4YGYA 3OKFA 1E2QA 1J0AA 3DDNA 5LQCA 1F0NA 2QGZA 3FWYA 3L0DA 5H80A 1I7QB 2OBYA 4UE2A 5LQMA 2BMVA 4MB2A 4NQRA 2VUTA 4NDNE 1MTOA 3AZQA 3UAWA 1N2SA 3HZHA 5AOVA 4WECA 5AKLA 4R6XA 4YAEA 3VSDA 2C7PA 4ZKEA 2VR1A 1YASA 2UZ3A 2BE7A 1KH3A 5FQOA 2L19A 3SS7X 1K86A 2DPYA 1YQWA 2CDNA 2I22A 3K9HA 4JD5A 2DFVA 3OX1A 3ZYZA 4KIGA 4LY0A 3IVRA 2REQB 1DEXA 1ESCA 1L5HA 2DBVO 1M67A 4PX2A 4A5SA 1CNFA 1AKMA 3LQQA 1V4VA 4BMNA 1IIRA 4BFXA 1XC7A 1SNYA 1W49A 3DPSA 3HYSA 1DHRA 1EJ6A 1SKUA 3KEGA 1G19A 2D5LA 2BBOA 3FUXA 3WO0A 4DNOA 4CM4A 4WBXC 4CTKA 1DVRA 3TJZA 4X65B 2VIIA 4DR2B 3TD9A 3G5UA 1NAIA 1OA0A 3D7RA 3Q3GE 3P19A 4PNPA 4FLFA 3WLEA 1O95A 1QCDA 5FWXB 2WRZA 4Z8YA 4HLDA 3O0DA 4DVJA 2C58A 2NSJA 2A7QA 3MTBA 1SKBA 1JLRA 2DU8A 2PWZA 1G8MA 4HFRA 2ZITA 3NWBA 3V4LA 5CU7A 4EI7A 1RWNA 5L4NA 1MRNA 1GTRA 2QT0A 4OO3A 1EDOA 2D6FA 2Q6KA 4X41A 1MO6A 2PYDA 5DHRA 4IEFB 1A8QA 3K73O 3KHKA 1M7GA 4B6PA 1N3LA 2B4TO 3EZXA 4K8OA 4PIPA 3CX4A 4R9RA 5A04A 1ZUWA 2H9AA 2OA0A 3SHWA 1BEZA 4DQUA 2YRXA 5EPUA 4JBWA 5HZMA 1S3SA 3L8ZA 4G8DA 1SIOA 2V55B 3NBUA 2XNJA 5EKDA 4HYQA 2CD9A 3FCOA 4OLFA 4A27A 4YJKA 4KQ1A 1EBFA 1XU9A 1SBZA 4QGBA 3A4NA 5AVQA 1EM8A 3S55A 1E4YA 1XL1A 3EAFA 3WOHA 4PXYA 2AUMA 3TW0A 4LS3A 3KHUA 1GHTA 3M83A 3SNHA 3DJFA 2AKEA 4CHTA 1KHHA 4LXHA 2ZBVA 1UT8A 4OOFA 5K3DA 1W2HA 1JG6A 1NQ5A 3IQDB 1E6MA 1I51A 3GMTA 1JF8A 3KALA 1SOMA 4FDLA 4RFSB 3QU2A 5DNYB 2PKYX 4KXUA 4I19A 4DBLE 4EA8A 3V1UA 1UM9A 4IIYA 3S2ZA 4CT5A 3FPHA 2XKJE 3R7DA 1TFRA 1VPTA 2A35A 3WP0A 3ZVRA 4R2LA 4CQJA 4KR6A 3ICCA 3SIWA 4EKGA 8OHMA 4O4LA 4DWJA 5KU7A 3OQVA 4ER3A 1SUFA 4MGIR 2YJZA 4BVLA 3UXHA 1YVRA 3IHKA 3IVGA 4QDXA 4ZICA 1WUTA 2GPWA 3C0KA 5GADl 3MPUA 3RE1A 3VZRA 3Q85A 3SZMA 3PSHA 4DPMA 2HW8A 1XZAA 1NUTA 4D25A 3MWFA 2Y1OA 2KLHA 1W19A 2GD2A 4I1VA 3J80A 3UK2A 2DMRA 1C7FA 2B1IA 4FYIA 4WLFA 4CJXA 3RSZA 2ZJFA 5DYIA 4BB9A 1AK2A 5E7QA 4LZZA 4OKNA 4YRGA 3AW8A 3MMSA 1VGQA 1GV1A 3FMPB 5FL7A 4G1UC 3WIVA 1CZHA 4QARA 2Q0XA 4D79A 4IVQA 3KYDB 2FFJA 1P3Y1 5G2OA 5TGZA 1DXYA 1H1DA 1CUYA 2IZOA 1B16A 1EINA 4GXRA 4P92A 1I2BA 2K5UA 5MFZA 4G81A 1X80B 4MARA 2WR8A 4KSYA 1KO5A 2CBXA 2OCPA 1DINA 2ZDHA 4HMPA 4RADA 4Y6RA 3TQQA 2L17A 1F12A 3E2IA 4LRYA 4V39A 4EYKA 3GDHA 4CFSA 5KINB 4X8HA 4J76A 1P80A 2V6BA 1KXJA 1M1NB 1GL6A 5CURA 4FLEA 3AP3A 1V8DA 4HMQA 1QAMA 3LAWA 4AECA 3V48A 5CAEA 5IHPA 2D62A 2VJYA 4CMCA 4IIUA 3L0YA 3KPWA 2OGTA 1G66A 1U5BA 3I3OA 4JVSB 3RT9A 2CMFA 3OEEA 4DC9A 3JQFA 3QMVA 3EWSA 1NYLA 3FZGA 4IKPA 3L0OA 3ZHRA 4WBNB 3U3KA 1PJRA 2HLHA 4TYPA 1CQIA 2RGWA 1QQTA 3BGIA 1A2OA 4IUCS 2VJPA 3E5RA 4MWBA 1JSZA 1JIVA 3C6YA 3I1IA 3ANXA 2B61A 4UM9B 1E1CA 7MHTA 3V2HA 1ST2A 2Y68A 4UU8A 5KSWB 1KWKA 4I14A 4JC4A 5FPPA 3T6KA 3SHVA 4UJ5A 4I8IA 4C7BA 3GGJA 1K7CA 4IDBA 2F1JA 2EJCA 3DLCA 2AXEA 2I76A 1HQKA 3ITKA 1RM0A 4TLAA 2WQZA 4D99A 5IF3A 4PC1A 5D51S 1SKQA 5JARA 3U7HB 5L7WA 4DBVO 4XRGA 3IQHX 1B14A 2Q3BA 4ZMSA 1OD6A 3AY3A 3JRWA 2WOOA 3IA2A 1SUCA 1TEHA 1Y3FE 3WLLA 4UHFA 1ZINA 2JLWA 1F14A 1E2GA 3WRXC 2J5KA 4FCTA 4GXQA 1I1NA 1QO7A 2YDYA 2G3YA 1ZSNA 1FS4A 1TC1A 3QHAA 4GQAA 4OFXA 1SHLA 2RC6A 1COWD 2EBFX 3FPBA 1Z22A 2AMVA 2C8JA 3AERA 5CB4F 1X2BA 3EODA 2G0TA 2J5RA 3NDPA 4OI1A 5FNVB 4WHMA 1XUOA 2P0YA 3QEOA 5CIWA 5E1MA 1F60A 4X1IA 4B48A 1BNCA 1D6JA 2HRRA 3OUZA 5LSAA 1JHDA 3PDWA 4RVCA 4ZYUA 1BU8A 3NHZA 2JL1A 2FMFA 3CZAA 3DVRX 4M0EA 3VR6D 4BKQA 1FSZA 3I92A 3HVKA 3N9IA 3TQSA 4N0DA 3QIVA 1KMNA 3R09A 3GVPA 3AESA 4KN9S 5EXXA 4DQVA 2IHJA 4YLGA 3AVYA 2X2EA 3FCEA 1OLSB 4OBWA 3WL4A 1IBLB 4J1TA 2ATVA 1O6ZA 3G9UA 3GIWA 3OEHD 1QJ4A 3STWA 1K2WA 4M88A 1JEYB 1G3QA 3ONFA 4HQOA 2PM8A 3UPTA 1QPZA 1N9GA 3R8CA 3ENKA 1N6IA 3JXEA 2VNAA 1EXMA 5KNDA 1J0XO 3KWLA 4C6HA 1PNRA 5EOVA 5J23A 1BYIA 1XP5A 2FUG1 2ZANA 3P96A 2VDJA 2HSGA 3QEKA 4MVCA 4QEDA 2FSVC 3DDZX 2PGAA 2QV0A 1NN3A 3GRZA 3B3FA 2ABWA 3MB8A 5GOTA 3TZLA 3UCEA 3ZHOA 4CKCA 4FGJA 1LJUA 4YONB 2I4TA 4JL8A 2QVGA 4EL0A 1BS1A 1YOVA 1YE3A 4EPVA 4IZIA 2WQ7A 3Q10A 4DR1B 2D7JA 4FW9A 2VN8A 3I9V6 3NUQA 2G1KA 1J8QA 3AY0A 1TVCA 4Y1EA 1ESNA 3CN7A 2FYTA 3RQIA 3DEFA 4FD3A 3SS9X 4YPVA 3PXAA 2XMSA 1CYDA 4GYJA 1UJ2A 2F1RA 1FUKA 4TSFA 1V5WA 2XQKA 4Y1GA 3OFNA 4CODB 4GLJA 1IOZA 1FNNA 1KEUA 3QUCA 4LOKA 2JIMA 3EEQA 1BWSA 1W4CA 1RFGE 3DWEX 3GFBA 4KKVA 1NBEA 4YK7A 4YJ3F 2FPIB 3OMLA 3O83A 1S4MA 3NH6A 1FZTA 3LA6A 3QLVA 3H1FA 4G9BA 3L7OA 3MTIA 4IL5A 2H54A 4LWOA 4RF4A 2VSNA 1Q95A 1G5QA 1QYXA 4GWLA 1JI3A 3OOJA 1KWGA 2FMIA 2VBIA 3BA6A 1K0UA 1M8KA 3LVFO 4HFNA 2N1MA 1P2UA 3OIUA 4R01A 4RA9A 4CUZA 4BQEA 4L8VA 3ICQB 2VDKB 3WAJA 1XLVA 3IKTA 4ZCPA 2REOA 3B6MA 1UP7A 5AHXA 5DLYA 2VCYA 3ET5A 2Q46A 2GXUA 5JATA 16PKA 1A95A 2ID4A 1SD1A 4PC2A 3MRVA 2VPPA 1TEXA 2JFPA 2YXEA 4NEGA 2WF6A 4U7GA 1M7BA 4HO1X 3CSSA 3PUIA 3WB9A 3U4IA 4DPKA 3SE7A 4ALKA 1MZPA 2WJ4A 2LGJA 3R9KA 1QZUA 3G0GA 1XROA 3EH2A 3LQ2A 4B9AA 1ZM4A 1SBQA 2GBIA 5B37A 2W2QA 4K6HA 4MWSA 5FI0B 1U3DA 1N8TA 2FP4B 2YJ6A 2IYQA 3IAUA 4RTMA 1JR3E 2XPCA 4W99A 1HY3A 2Z1MA 1Z6XA 4J3FA 2I3ZA 3COZA 2YMPA 4CVNA 1YB5A 3OF5A 4GWGA 3BK2A 3EEBA 1LDMA 3M2TA 3WIOA 4CIYA 4DJTA 3HA2A 2Q6IA 2O20A 2P8JA 2W8ZA 4LHSA 3GHHA 3IEPA 3HDQA 4YMWA 1E2PA 1N2OA 1ZGBA 2HT6A 1QZTA 2IY8A 2ONKA 4PS1A 4QOHA 3L4KA 3DQQA 1VC2A 3UB2A 2ODTX 3LV8A 2V7GA 4RHTA 1RHQA 1USWA 3GVXA 3K5IA 3LC2O 4F3RA 3FTQA 1WZNA 1PFYA 5AJWA 2FMXA 1I6KA 1KNXA 2DHDA 3GAAA 4R5MA 1UBTS 2ERXA 4A2WA 1I3OA 3VR4A 2EFJA 3N2IA 2XRFA 4OKIA 3D8RA 2HRQA 2Y8EA 1V9CA 3PA8A 5AUQA 2X58A 1JQKA 2R5FA 4ZHSA 1XJCA 1MU0A 4ID9A 1NBMD 2FPUA 2DR3A 3OPMA 5KWVA 2A14A 2OD7A 3GMDA 4GT1A 5IAGA 4F84A 3GL9A 4R0NA 1V6SA 3BMOB 2QMZA 2DWOA 3ONWA 2AK2A 4JJKA 4Q3CA 5FIUA 3NBFA 3C3YA 3ZXSA 2PMDA 3TMKA 2ATIA 4C7KA 4L28A 1WBBA 2R11A 2TSYB 4OHWA 4F92B 4CEIA 2QN8A 3SJZA 4PAOA 4GMXA 3UAVA 2PQ6A 2XEDA 5HG0A 2O5RA 1UAGA 1KSGA 3A1SA 4BRZA 4PQRA 3FPJA 2FCRA 3CLKA 3U3OA 4I1RA 2XLCA 1EVQA 1NR1A 1Q16A 3EIHA 1PNOA 1NKVA 2I55A 3LK7A 3DH0A 3W79A 1P75A 2PKWA 1TYEB 3IR6A 3ZK9A 3O1IC 3LDAA 3AKZA 3WB1A 4BNKA 3QPUA 3UJ3X 3ZG6A 4DA9A 5BQXA 3TO5A 1LRLA 2QOEA 1IE3A 2GKOA 1IEVA 4QHTA 5ABPA 2W2NA 1A8HA 1OAOC 2FG6C 1YRHA 4FWIB 2E89A 4AJ4A 2F90A 3IAS6 2A5DA 5T57A 5CB0A 5JMTA 3LC7O 1ZUIA 3K9NA 4A10A 1K6JA 2DT8A 4URXR 3EAQA 3SFTA 3KSRA 4Q1VA 1Z4OA 2J9XB 3T3EA 1ZL2A 2QRQA 3PFBA 4UULA 5IXSA 1Y1PA 1ZIYA 4J4BA 1VMDA 1H1LA 4MKGA 4YY3B 2HHAA 1Q2XA 4EOGA 2VA8A 2C2XA 1LDBA 1O94A 2P1RA 2REXB 3KJHA 4G56A 2AJLI 1YQEA 1Z28A 3GRCA 3OCWA 3QFHA 1H2HA 1KS9A 2E6UX 2BGRA 4YJ2F 4CMIA 4Z4CA 2X7XA 4B3BA 1JFRA 2I33A 2E5FA 3AEZA 1VDZA 3DFZA 1SFRA 3UANA 2Q8PA 4BZWA 1ACJA 5HVNA 1W36D 2CJFA 5F64A 1PBNA 4BNVA 2RMKA 5F23A 2BFAA 4AKTA 5JS6A 4W1QA 5JSQA 4WT7A 2H31A 1JS1X 5CVVA 4GPBA 1OLSA 3W04A 4IDOA 3MBIA 3E23A 2XXJA 3SYRA 2GS9A 2FI1A 5BSWA 2XVXA 4Z54A 4E5PA 4PAWA 1NW7A 4IUYA 2ZR9A 4RA9B 3P20A 3KV3O 2O2DA 1S2GA 1XTVA 1AT1A 1U28C 1YU9A 4US2R 4EI8A 2AI2A 3IPXA 2H1OA 2VSYA 3SCZA 5L8VA 1SOWA 4AX8A 3AR6A 1SB9A 4XEHA 4LUCA 5JW6A 2C59A 4HGNA 2HMYB 4NCJA 3OE4A 3HKDA 4Q6WA 3RREA 3S2UA 5LNK6 3Q98A 1A9QA 1WMDA 3QKRB 4LDZA 3H3FA 1JHMA 5EJ2A 4CKYA 4BWFB 5HJ7A 1U0TA 4CLXA 1UL1X 1MO4A 1GVHA 1QGED 3K8YA 4AL4A 1L4MA 2ACVA 2VF4X 4MKRA 4FYYA 5BW4A 4JJGA 2J09A 5A9TA 2X8JA 5BSVA 5AKXA 4LDNA 4V3CA 2QN3A 4CM8A 2AV6A 2RHLA 3HN7A 3NHUA 1T0BA 5F3WB 1NJ6A 3QU7A 1QHIA 4D3DA 3JWJA 2X7HA 2C1ZA 4N4AA 4M1TA 4X8MA 4XVHA 2A88A 1RLMA 3KVNA 1ADBA 1L5OA 1R0CA 3EXG1 5C31A 2BZ0A 3VTZA 4URYR 3W2GA 4BFZA 2JAOA 1TM4E 2WKRA 1GFZA 2ZXEA 1FJHA 2CLCX 2GYVA 4GZ6A 4C88A 5IZCA 4LQCA 1TB4A 2H0AA 1EIZA 1FIUA 3HADA 4DILA 2VA9A 4BYGA 4E32A 4EFLA 5LU9A 3A2KA 1K9VF 4U9HS 1O4WA 4GKVA 3R2JA 1RLJA 4KU4A 4I2NA 3QU9A 1AUPA 1VSQA 4LRUA 4LSGA 5T7BA 5J43A 1LQ2A 2DQZA 4FYPA 1RYBA 3E8XA 1ZWKA 5KOYA 2WAAA 3DCIA 1SOAA 4CL2A 4N1AA 4CG2A 3MBKA 1DEOA 1NR5A 4DCCA 1HE5A 3JAWA 1ULUA 4UDNA 3JQGA 4B33A 2ATCA 2R2AA 4B0OA 1IHXA 3KLOA 4MGYR 1XSEA 3DBRA 2CNWA 4MS4A 3UENA 1SHZA 4CIBA 4L51A 4PZDA 3CZRA 1TCAA 3T3HA 1GOTA 2ZS9A 4L0CA 5KYWA 1W59A 4BMPB 4OK5A 3ZIAA 1DO0A 1VLHA 3O4VA 4HXGA 2OBLA 1ZUNB 3AHJA 4PZUA 3T5CA 5JPCA 5JFGA 3D8HA 2ARKA 4D82A 2EFEB 2NUBA 3ZGZA 5IF9A 4GR4A 3BWVA 3H0EA 4QWMA 2YV2A 5GZ6A 4QRIA 2O8DB 5JYBA 1AKWA 3HU1A 1NC1A 2PMKA 1HYHA 2Q5EA 4EF5A 3K96A 5AW4A 1GGJA 1U9YA 1V0JA 3H9EO 3GZNA 9MHTA 3F5FA 3EVTA 3UJCA 1H6CA 3A8TA 3IBFA 4XGRA 1VMAA 5EXSA 3R7AA 1Z5VA 5FOQA 3THXA 1QG2A 2Z2YA 3ES9A 3L6EA 4HS9A 1Q7TA 2QVBA 2CMDA 2C3YA 1RZRD 1UBGA 3A1NA 2A5JA 2FUNB 1UT5A 3IR7A 1WULS 2Q1WA 1HTTA 1C8LA 3Q15C 4NEQA 4A2CA 5BW5A 1LCIA 4RJJA 2PUCA 4L1KA 4H3SA 2J87A 1XTQA 3X1ZA 3GK3A 4L76A 4LOHA 3X2EA 3ZDZB 1QHEA 1GFWA 2BHRA 2Q6LA 5CBPB 2QYHA 1QH1A 1TC2A 1TU4A 3ZK8A 1U8ZA 1U7ZA 4P58A 1RQPA 4FYHA 1MZVA 1I36A 3DDOA 1W1UA 1Y7TA 1JPNA 1NYTA 2WE8A 3DZHA 3EA0A 4OBEA 2ZUFA 5EKUA 4YQYA 4IHKA 4GRIA 3J7TA 4PHCA 3DE3X 2A2ZA 1W0CA 2V7BA 2V6GA 3NHKA 3OY7A 1ZH4A 1DU4A 5AHRA 5DM2A 3VHRA 5CA1B 3K92A 3T52A 1TJNA 2F1HA 1OLXB 1AGRA 4MW6A 4MRAA 5D86A 4DZRA 3QVKA 2BMJA 3I0MA 3PI7A 721PA 1X80A 3I28A 5C7LO 5L6LB 3G13A 1DIOB 3VTAA 3NFRA 2FA9A 3DVAB 1M2KA 2IP2A 4I1PA 3RS5A 2IU4A 2UDPA 5DHFA 1QK5A 3I2HA 2QYOA 1IZ9A 4GU5A 4H7FA 4IIJA 3NCTA 5FBZA 5DHSA 1ZK3A 4FK8A 4NF2A 3VDXA 4DSNA 1A5SB 3RADC 1V96A 2VYNA 2H1VA 1RPTA 3WRYC 1PUJA 3DAOA 4BPBA 3HMKA 4FFDA 3LUPA 3A1WA 5JDCC 2PRJA 1YRLA 3PL5A 1PZHA 1SUPA 3H84A 1E3LA 3DXFA 4LSZA 2HSWA 2RGCA 1TTQB 2LWIA 3TLAA 4U02A 2PZJA 1N2GA 1TTHA 4QLAA 4XLLA 3KB1A 5DWQA 4N49A 2DPXA 3AEUA 3D4NA 5DTIA 3V97A 1KJZA 3DONA 1CZLA 3EW7A 2ESRA 1T3GA 3AR9A 3KAJA 4L57A 2C61A 3NC4A 1XCPA 3IT2A 5J40A 2QENA 3BMXA 3KQOA 3PQFA 4WRRA 5A05A 1CUUA 1RKXA 4KQ2A 5E6SA 1HTWA 3IMCA 1SOUA 1U7XA 3O6VA 2Q6TA 2YWXA 2Y0EA 1RWBA 5BNIA 3A28A 1FMFA 3P9RA 3DE5X 3LLCA 4WXPA 5JD6A 1V8BA 3HO8A 1R6DA 3ESYA 1I2MA 5DM60 5GJBA 3DCYA 1ZXBA 1Q1ZA 3KQNA 3KR1A 1ETHA 4LXTA 5IRCD 3DMYA 3GH1A 5ALUA 4LQ4A 3WLRA 3N70A 2RGRA 1TK9A 1CY1A 5AM0A 3WNQA 3ABQB 5DRTA 3O8OB 3DAFA 5K6TA 3AH8A 1NDHA 2Q9BA 1M2HA 1NVDA 1QFSA 4P5EA 1HT2E 4HYEA 2WF7A 1N8NA 4YAGA 4L3VA 5F3DA 1SCKA 1QHNA 5KNCH 2NQ2C 4D44A 5I01A 1B2RA 4BIIA 2XZDA 5ICEA 1HYGA 2G71A 3NJ4A 5TQ2A 3G82C 3SNKA 2AIRA 4IJ6A 3ZV5A 4E09A 3MCTA 2H3HA 1J5XA 1OXMA 1H6DA 3D7MA 5FWXA 4YQFA 2BM8A 4MVJP 3PR1A 5FQNA 1GU1A 3HWRA 3K0CC 4AN4A 1SN7A 1TAQA 3HWX1 3PVCA 3RUDA 1GNVA 2PZBA 3ON5A 3U56A 1HE2A 3PI6A 1PVOA 4KI7A 3E22B 4W9RA 5KHOC 2VF7A 1HZJA 5C8VA 1J2TA 4BZQA 2XVZA 3NM5A 3G2KA 3M6VA 4DXAA 3WWPA 4H6VA 1CZNA 3PPIA 3W3AD 4KXFB 4QYSA 5LJLA 3SLKA 4RTOA 4F71A 4PG8A 3G88A 4NJEA 1RRCA 3DW3X 3WK8A 3ZVMA 2FFBA 3W2TA 3FFBA 1GTSA 3TOZA 3SC4A 2FJUA 2RHBA 3H0KA 2WHPA 1M2OB 1VRCA 3OE1A 1C1HA 3ETJA 4RENA 1YS6A 4HVAA 2D7DA 2AWOA 4N3CA 3DKVA 3KEOA 4HUQA 3VU0A 3OZBA 4OHRA 2NZUG 4RETA 4CF5A 4QGHA 2JLYA 2PS9A 4EF4A 2JZOA 4C76A 3CKMA 1FP6A 2IZ6A 3DL4A 1HDRA 3MQ2A 1J49A 2BGMA 2AYYA 2NUAA 4G01B 1E9SA 1ODLA 2P11A 5GONF 3P0FA 3E9MA 1VPDA 4NOLA 5E3JA 2MJLA 3RS7A 5FO1A 1GGVA 1LGYA 2X0KA 4B4UA 5KOJB 4LSMA 5JS1A 2CV0A 1VXOA 1H3EA 3T7KA 2O2GA 3CB2A 5IVKA 5T67A 3G7NA 4EJFA 1NMYA 1BKSB 3TL2A 2AJ8A 3A32A 1L1QA 4DJJA 1E89A 3SMQA 2QORA 1CUGA 1ICIA 2PANA 2N46A 3ZBQA 2EC5A 2A1UA 4TS1A 4TS9A 1F17A 1QIHA 1T5HX 3ANMA 4QXPA 3RGWS 3UMBA 1J0BA 3F8TA 2JFXA 3ISTA 1MLDA 4TV9A 4V0KA 4D9EA 4UCQA 2QUJA 3L7BA 1IBSA 2M6LA 4FPXA 3RKSA 5A4KA 1ZIDA 4G1BA 4PX5A 5K3FB 2OT3B 3B7GA 1VJRA 2HSZA 4HLCA 5DNWA 3ZQ4A 5AVYA 1HOTA 1LZLA 1R6UA 5LU8A 2B8JA 3PZBA 1Y4DE 4L0DA 1C3VA 3WWOA 2N47A 2YY7A 5FWNA 4FOSA 4HEA1 4HWOA 2UV8A 3RBZA 4D9MA 1TGYA 4YV2A 3U61B 1LVGA 1P91A 3CTPA 2DH6A 2X8BA 3I23A 3PEVA 3GLSA 2R47A 1Q1NA 4HNHA 1L4HA 4RLFA 2I4OA 5BV2P 3A9TA 1IOWA 1S8AA 2FF5A 2OD2A 5CLLA 1ZIOA 1XTJA 1I80A 2C0QA 3WB2A 5EXPA 2Y9MB 1GSHA 4ZU6X 2HXGA 2R62A 2VF5X 3BWBA 2ZUVA 3CMCO 4HPXB 1ONPA 2AQIA 4P7KA 4WFQA 4UU1A 2VAVA 4GX1A 4EW1A 5LLSA 5DISB 4GSYA 4TXMA 5E9AA 5HR5A 3ZJ5A 2X1MA 4KYUA 3L6BA 1KERA 5BSFA 3KCNA 4H0CA 4HZUA 3U6BA 2VZ0A 1Z13A 4LN1A 1NQAO 2IK8A 2GVZC 4MWZA 4HATA 2C2GA 3LOQA 3AQ4A 4BLVA 4DA4A 4JU9A 2IYNA 5EKTA 2ZR7A 1PL7A 1SUIA 3BE8A 2WLSA 5ICMA 4HNVA 4J1TC 4BP1A 3B9PA 3TFQA 1JU4A 2ZE8A 1M2VB 3BXOA 3HVUA 3VOBA 3ZGVA 3ZNOA 4LCEA 3NMUF 1AV6A 2PEZA 1CXZA 2M6SA 2PN1A 3GLUA 2XB6A 4IX1A 4RIIA 3IEVA 1VIDA 2D4HA 1ZGHA 1SVWA 4HVTA 1WU8A 4BQOA 1O5TA 2I9PA 3PIRA 3LL4A 1AKYA 3RV3A 5KEIA 3JAKA 4MKZA 4QOIA 1HFWA 3JQ9A 2JI6A 5CM9C 3LC0A 4I4LA 4KDRA 4KBFA 2OQ2A 1U1IA 2VHZA 3KM0A 5J2TF 3VJLA 4F7DA 2ZYDA 4ZMBA 4TKMA 4ZDJA 2J3QA 3AFOA 3E48A 3PU6A 4KUEA 4NVRA 2HA5A 4EVRA 3TRDA 1N33B 5FWDA 3USES 4QE3A 4OK3A 3AF6A 1QS0B 4LJYA 1IWBB 3UWDA 4JLVA 1H2RS 2HSJA 4UBIA 3EVFA 1Y6JA 4F9EA 3O4RA 3VAAA 4I9FA 5GQSA 1MAHA 1OVGA 3M4JA 4Z9YA 2RB5A 5U4QA 1VJTA 2XCLA 3AJEA 4EBFA 2FVXA 1WNFA 3K9CA 5JUWA 1W581 2ZAMA 3A6HA 4ACBA 1EX1A 1QBKC 4ZEXA 5D6OA 1WR8A 4EHJA 2QB5A 2CVHA 4WFIA 1AZWA 1IQRA 2ZW9A 2OQVA 1N2XA 5I9NA 4IRUB 1FNDA 3T61A 1P8JA 1EXVA 3IKLA 1YDHA 2QL5A 1MAWA 2QK4A 3RBAA 1JFSA 1GADO 1W5AA 5DBGA 1EWQA 4IMIB 2QMOA 5A9SB 1Y8RB 5KTMA 5ITSA 5ENVA 1X87A 3VV3A 3UF0A 4P2GA 3DVAA 3UBMA 4NCKA 1WQ4A 3R6LA 3CRW1 2R1TA 4YYZA 4G0XA 3I6YA 1S8OA 4EW3A 2YWFA 5B58T 2OECA 3GRAA 4FX2A 2X3UA 2J5QA 3DMTC 4LC1A 1AQLA 1ZSVA