3BFVA

Crystal structure of the chimerical protein capab
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
241
Chain Sequence
DKRIKDEEDVEKELGLPVLGSIQKFNMTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane protein CapA1, Protein tyrosine kinase,Protein tyro
publication title Structural Basis for the Regulation Mechanism of the Tyrosine Kinase CapB from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 81
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bfvA00
4XVUA 3K1JA 3MUFA 5HE8A 5J4KA 4G1UC 1F6BA 2FH5B 1LF5A 5EE0A 1SVMA 3AH8A 3QXHA 2B8WA 3GJ8A 3RWOA 3EWSA 2CHVA 1E79D 1PZNA 4V0MA 1XJQA 4JSTA 1PV4A 4A8JB 1WA5A 2O0JA 2AFHE 3SE0A 5CLQA 3TR5A 3GEHA 5BN3A 3E70C 3A36A 2MSCB 3QKUA 4FMDF 1R0YA 1KI8A 1XCMA 4DLVA 3CNNA 1NVXQ 2B21A 4TMZA 4XIGS 1P9RA 3K0FA 4V0NA 4JLBA 1KK1A 3A1WA 3FE2A 1GKIA 3EPJA 3W90A 1ETUA 1VYVA 4MH0R 2EYUA 4JT2A 2WOJA 4DXAA 3U44B 4CEJA 2JATA 3TSOA 2CNWA 5B57C 1DO0A 4KODA 1M8PA 1FUKA 1ZVQA 2BOVA 2BIFA 1GL6A 2MSDB 2IHYA 1X3SA 5EP4A 3CLVA 3REGA 3VFDA 1G64A 4ILEA 4BLOA 1DO2A 3EARA 4HLUA 4DZZA 5L3VA 2F55A 2D3WA 4UNNA 5CYOA 2WJVA 1N6PA 2IUSA 2D2FA 3U4QB 4KLNA 2NPIA 3CX7A 4I99A 4M22A 4O25A 3R9XA 1I4DD 2OE2A 2PZEA 3C7KA 3EW9A 1E1QA 3KXKA 4KLZA 4RVCA 2QG6A 4MQBA 1OXVA 3ZVRA 4US2R 3VMFA 2EVWX 3LY5A 2ECKA 2IYZA 2BCJQ 3VKHA 4TTPA 2V3CC 2GJAA 4BZPA 2PT5A 3PUZA 2I1QA 3H0KA 2FFBA 2N42A 2GDJA 1GG2A 4M9QA 4O2LA 3DZDA 1A2BA 3QOFA 2QGZA 4PO8A 2VP6A 1KK3A 2BHRA 2MMCA 4JS0A 4JIMA 2A3RA 4EKDA 4RD6A 1YRBA 2OXRA 4C7OB 4QNRA 1E0AA 3IIJA 2FGKA 4MITA 4CRWB 1W36D 4CYMA 5JS7A 4MKFA 1ZUIA 4RD3A 2JLYA 4A36A 1HE8B 2OZEA 1I2MA 1CBUA 2BDTA 4LJ6A 3SYLA 1NVWQ 4EQ6A 5JJKA 2GJ8A 4DB4A 1Z0DA 3LW7A 1M2OB 3UKDA 1NJFA 4WBSA 2QGNA 4L8GA 1Z0FA 1D9ZA 1NMZA 2KE5A 2XSZA 5KUTA 3V4RA 4QM6A 1W4CA 1Z3IX 4NKRA 3KQUA 3N70A 2L0XA 4A0GA 5F98A 1X8JA 2WTUA 2YOHA 1BMFD 5BXQC 1ODFA 4C2UA 1G7RA 3IO3A 4GI7A 3TVDA 4KITB 1VPLA 3VR5A 1E0SA 1E9CA 4FWIB 4L4UA 1PJRA 4M1TA 4BPBA 3WMGA 1RRGA 4YMUA 4AC9A 5DNYB 1OKKD 1YVDA 2J5XA 2ZI5A 3B9PA 5AUPB 4BLPA 3EZ7A 4MDFA 5CK5A 2GAAA 1US8B 2BEJA 2I1VB 1GKUB 2D4HA 2PEYA 1FP7A 1E4VA 3TW4A 3LNCA 4B3BA 5ELXA 4TLDA 1OXUA 1W36B 1NN1A 1UAAA 3I5XA 2EWWA 1IBRA 4Q9IA 4GFDA 2ZS8A 4F92B 3LFUA 4C30A 1VDZA 1CR4A 2RHDA 1YZUA 4QOSA 4OHZA 4MRVA 5LBIA 3VHXA 5JRJA 2AR7A 2OAP1 1TU3A 3X1WA 2XTZA 1IHUA 4OJKA 4LGMA 1KKMA 1E9BA 1KO4A 3ZLJA 4UNPA 1OE0A 3AF3A 1S9DA 5E4FA 4PZYA 2BV3A 2CHQA 4KI0A 2P6NA 1CJMA 1ZUHA 2HV8A 1NIJA 2FFQA 1COWA 4FN5A 5KTYA 4E22A 3GEIA 2RGDA 1XXHB 4CZ2A 1JJ7A 2W0MA 3Q85A 2JJ1D 4MUBA 4TQAA 2ZU6A 4IVQA 3SFVA 3QVVA 4ERNA 4LYHA 1GITA 3GFPA 1YR9A 4PQFA 4CEJB 1E0JA 1Z28A 3BJIC 2NO0A 4TL6A 1Z29A 1AZSC 5EXPA 1SHKA 3THOA 2C9YA 3X1XA 1CR2A 4BASA 1NBMD 1OYYA 2YOGA 2VTKA 5JCPA 5FTKA 1XRJA 4JL6A 1QHGA 1EFRD 3BC1A 1UKZA 2G88A 1KI2A 2REXB 3LQRA 2CK3D 4JL5A 3RDPA 4Z51A 1G9XA 2KWIA 2OV2A 2H1LA 2R44A 3K9LA 3NH9A 2ORWA 4DCTA 2QM7A 2ZREA 4CGZA 4P31A 3AUXA 3QJYA 4BLRA 4O3MA 2XSZD 1MO6A 3PV0A 2PL3A 1JI0A 3CZPA 2DCUA 1JNYA 1PLKA 2NO7A 2PLRA 2QT0A 4Q4HB 2H8KA 4B6EA 1B23P 3NEJA 3VKGA 2F6RA 1OT3A 5KU1A 2ZRCA 3U2QA 1IONA 1R2QA 3PVSA 5BYJA 3W6PA 3RAPR 3GLHA 1JB1A 4OHWA 1YR8A 4Q19A 4S2EA 4G5GA 3BH0A 4ZKDA 1JXOA 3C16C 4FIDA 3MFYA 1DELA 3F5FA 3NDPA 4KO8A 3DL0A 1N6LA 2Q21A 2ORIA 1HT1E 1QRAA 4MA4A 5HE9A 3EX7C 2H18A 2FSIA 4HB3A 3LDAA 3T1VA 1NL3A 2WKQA 1KHTA 1Z2AA 2OM2A 3IQWA 4HSEA 1YHNA 2HF9A 3IO5A 3TQCA 2DFNA 4Z1MD 1R10A 5CJ2A 4GL2A 4TSFD 1EG7A 1ZD8A 3RWMB 121PA 1G19A 3KUDA 1KDPA 4E5UA 1IQPA 5IK2A 3K9HA 4NL4H 1VCOA 4PXAA 4EQ6B 2G0NA 4KJZA 1E98A 4PAMA 1EWQA 2WWXA 2QP4A 5SZKB 4M1WA 1Z8FA 2EYQA 4L9SA 3THWA 1XTJA 4PC7A 3V9PA 4XSHA 1SKQA 4XSGA 3BB1A 1LS1A 3DMDA 4IDOA 2O8DB 1V43A 1COWD 4HB2A 3R20A 4JYBA 3D31A 3WYAA 5JZVA 2ZE7A 3B1ZA 1Q44A 3T1QA 5F2EA 4Q1BA 1XTRA 5DYGA 4BEJA 4NYMQ 2JIZD 5KO2A 1OXXK 4A15A 3U3KA 3A1SA 4LYJA 5GJWC 3RLFA 1W1WA 4QRHA 4ZCLA 5H68A 4D4JA 4FMCB 2FEMA 2HXSA 2QPOA 3PUXA 2ANCA 5K8IA 3FHCB 3FHOA 1HV8A 4GP6A 1NLFA 1OH7A 4DEYA 2YINC 2ZRKA 3W3ZB 2P65A 1NRJB 1XF9A 4JLMA 5EE1A 3MSXA 4UJ3A 3QVUA 3WP1B 2ZRMA 4LPKA 4AKEA 4BFZA 3FPAA 1N0UA 5FI0B 2ZJYA 3D6TB 3UXMA 4AWXA 4KHZA 4QKQA 5J4YA 1G1MA 5JECA 1AS0A 1NSFA 2QORA 4NH0A 3D3QA 2IEZA 2ZXUA 1AKEA 1TF2A 4ZDKA 4AY2A 4JYCA 2VSXA 1R6BX 1NLYA 3VX3A 4B43A 5FR2A 4C0AC 1U8ZA 2AD1A 3P4XA 1CJVC 3MG9A 3BFXA 3NTUA 5L3QA 3RS3A 1AA9A 1OLOA 1T4GA 4HATA 3VQTA 2PMKA 1TF7A 2W2VA 1VYTA 1WBDA 1JPNA 1N3BA 2ZI7A 4HAYA 1M1YE 1NI3A 1P2SA 4QGHA 2ODNA 4R2IA 5JHGB 1NIPA 4OQFA 1G3IA 2W6JA 4EAQA 3AVUA 4DCSA 2X2EA 5JSZB 1AS2A 2C2HA 1N5JA 4DIDA 1TUEA 2IBMA 1E2MA 1IAQA 4DLTA 3B2EA 5JS8A 3KJGA 4QNMA 5LPNA 1TQDA 5IK2D 4DDVA 3AVQA 1T0JB 4NHOA 1XNJA 3H4MA 2QMEA 4MGZR 4TYPA 5DGXA 2JLXA 5LD2B 2RGNC 1UJ2A 2IYWA 3Q8XB 1R5NA 3QENA 4IOMA 5CK4A 3CRRA 3FMOB 1KSHA 3LD9A 1GZSA 2IYXA 1HA3A 4POAA 4A0FA 5KSPA 3DZ8A 4JVLA 2A78A 4UXJA 4MGKR 5FPHA 3QKSA 4URVR 2W6IA 2ZR9A 1RKBA 2BM1A 3GLHB 4BFUA 1C4OA 3LVQE 5KSYA 5FL7D 4Q5IA 1CKEA 3AV0B 3M4YA 1W46A 2FOLA 3KZ1E 1KI9A 4N3NA 5GVRA 2ZAMA 3ZZ0A 2GWHA 4JVSB 2R9VA 3AEZA 4A82A 1XDBA 5JRZA 2J0UA 2WSSD 2XXAB 2OUKA 1OFHA 3WHLA 3SZRA 3I32A 5FBRB 1E1RA 5C18A 2X77A 3IHLA 4TTRA 1VYUA 3OAAD 2NIPA 3B9QA 3VHLB 1M7GA 4Q7JB 4LJ7A 2GCPA 2WIBA 1OFTA 3LW8A 4RKFA 3CX8A 4ACAA 2ZI6A 1G7CA 1FUUA 3B1YA 3KKOA 3AKEA 1JJVA 3P4YA 2G1JA 3R7WB 3KQNA 2ZRNA 4ON9A 3I3SR 3NEYA 2CLSA 4DLSA 4TLAA 2P6UA 4A4DA 5KYKA 1LV7A 4DKXA 1U0HC 3LQQA 5AUQA 2WICA 2X19A 3TNFA 4C0HA 1F2TA 3A4NA 4XD7D 2F1IA 4B73A 5FUVA 2I4IA 2QUZA 3QUSA 3ASZA 1R0WA 3AP3A 1NN0A 1EX6A 1S3SA 4PR0A 3AVTA 5L3RA 1KDTA 1KSFX 3KTAB 1KDOA 3AKDA 1JR3A 2RGNA 4N0EA 4XWOA 1JPJA 4EFMA 5FPKA 3GLGB 2RAPA 5FPYA 1QHNA 2ODBA 1EFUA 3WMEA 3WMFA 4RZXA 5AJVB 2LWIA 2KB0A 5E7JA 4MYHA 2AK3A 3WNCA 2O8FA 1C9KA 4EJSB 4RFSB 4A8JC 3TUZC 4U02A 1G8HA 5FBLB 1TQ6A 1J8MF 4JMPA 4XVRA 3GLFE 3GJ5A 4LC0A 4D81A 1II8B 2VH5R 4CF7A 1K6MA 3LLUA 1OB5A 3GLIE 5J40A 3NG1A 1EFCA 2V6JA 1ZUNB 3CW2A 1TF5A 1W47A 5FUWA 4BFVA 4RZUA 1KSGA 3BERA 4PPGA 1GM5A 4UQOA 1FL9A 2NZ8A 3BIFA 1NP6A 3EG5A 1PLJA 2ZRIA 2ZJZA 2VP0A 1G20E 4H1VA 2R6FA 5L3QB 2EFHB 2WKRA 4JVMA 3HWSA 1VIAA 3GJ3A 4D0LB 2QY9A 5FL3A 1NMYA 4I1UA 1TMKA 2DFTA 3AF4A 1XD2B 2O8BB 4LJ4A 1V5WA 2ONJA 5C1BA 2FNAA 2OESA 3AF2A 3M6AA 1HEIA 1AN0A 2F1JA 2VPPA 4D4LA 1W4RA 1RIFA 3DOEA 4Q66C 1KI1A 521PA 4DT1A 2QAJA 1OV4A 2HCBA 1II9A 4PHGA 2OCYC 3CPHA 4B44A 1MO3A 3QSYA 2F3TA 3B85A 5DN6A 4URZR 4DSUA 1ZU5A 1BOFA 4G01B 2FPLA 1KGDA 1RFLA 3MGCA 2BKEA 3U3MA 4E03A 4XJXA 1H8HA 2Q3FA 4A8JA 2IXEA 1EXMA 1XU4A 2A5JA 2GKSA 2P3SA 4P0TA 1CJKC 4AD8A 3U5ZB 3CRQA 2ZSFA 2W58A 4PC6A 2I3BA 2QMUA 1UBFA 2J45A 3KJIA 3ZH9B 4PC2A 2ATVA 4MYUA 2E1RA 4Q9JA 4AKHA 1KNQA 4EPXA 2QSYA 4Q4AB 1XEXB 3K0CC 2OCPA 2ZS9A 3LAWA 4IOKA 4X8LA 1UKEA 4LJAA 3DKPA 2VL7A 2DFKB 1XTIA 2GETA 3WBJA 3U3OA 1NVVR 4JLDA 4LJ8A 3I5YA 1YZGA 4HZUB 4OI1A 2CCJA 4P4TA 2FEOA 2QP3A 3RVBA 1NY5A 2GCNA 5DLQC 2D2EA 3VTKA 2FJUA 3CPJB 1IOZA 5FOWA 2ZE5A 2VQSA 2XX3A 1JALA 2X2FA 4GMDA 4DLYA 3D8BA 2OILA 4R7ZA 4JLKA 1YU9A 2H7VA 1P75A 1FMLA 1AQUA 1VHLA 2ZE6A 1JEDA 1PUJA 4ITRC 1E79A 4A92A 1XWIA 2WIAA 3LX5A 4WVFA 1N2CE 1WQ1R 1AGPA 3QKRB 4RKEA 5AK0A 1F2TB 3PR1A 2FDCA 3T1TA 2ZJOA 3O8BA 1E9RA 4Q01A 4N0DA 4CT5A 2OSBA 1D8TA 4KSBA 5G3YA 2QAGB 5B58C 2NQ2C 5C4MA 1A7JA 1O87A 4MYCA 1Q1QA 2P5TB 1P72A 2V54A 2GVDC 2F1HA 1G5TA 1XMJA 2C8VA 4NPHA 2CBZA 5JI2E 3F8TA 4C7OA 5M04A 4YMWA 1E0KA 1DE0A 1Z0KA 4NCIA 3TAUA 3KXIA 4A2WA 1OFIA 4Y0VA 3FDIA 4L15A 5AR1A 4DWJA 4QGAA 5EP1A 5FTLA 5DN6D 1C1YA 2FPKA 1NF3A 1S2MA 3K0CA 4CIDA 3MJHA 3C5HA 1U99A 2BBTA 4OK6A 1VG9B 1I4LD 2A2ZA 1W0KD 4OBEA 4Q21A 4C9BA 3NKVA 2VHQA 3OIYA 4HDCA 1H8HD 3QI2A 4NCNA 3ZS8A 4C0QC 3CF6R 5A0FA 1SXJE 2NO6A 1DAGA 2OAQ1 3IUYA 4M8NE 4B3GA 4B33A 1N25A 1W4AA 5LB4A 1Y63A 3LBIA 3ADKA 3FFAA 5FOSA 5EXSA 4YDSA 2OT3B 4AIIA 1AGRA 2IK8A 2C03A 2QENA 4LWZA 1G5RA 4JLJA 1E94E 4FMCF 3JZAA 4WZBE 3WY9A 5EUQB 2AHOA 4RJLA 2ODEA 2AKAB 2V9PA 1VCIA 2WWIA 1GFIA 1ZBDA 4AYXA 2J9RA 1IXRC 3U61B 1E69A 1US8A 2OCBA 5JJLA 2GJ9A 2A5FA 3DVLA 2F43B 4LZZA 2JLRA 4BGDA 2JLUA 3HJNA 4M9ZA 4WW0A 8OHMA 2ZRGA 3SN6A 2NTYC 1B0UA 3TSZA 1A5TA 2IXGA 2RGXA 1ZM2A 1NLZA 2OLJA 4JLPA 4HLCA 2WKPA 3NXSA 4NYJR 2QQEA 3L2OB 4BZXA 4E07A 3LX8A 1YKSA 2ATXA 2MMGA 4IVRA 3VR2A 3P1JA 4HUQB 1OHHD 2P0EA 2RGEA 3I62A 1UEJA 2AL7A 3R9IA 3ZJYA 1P3JA 1GSIA 3K9NA 1N0WA 3KUCA 1N5KA 1SHZA 2IYTA 1E6CA 2OCAA 3RSOA 4R71A 1BMFA 1T5LA 1XD8A 2D74A 5FBWB 1KK2A 1XXHA 221PA 2G6BA 2HF8A 2QE7D 3VR4A 5JJIA 2HYIC 2QU8A 4M21A 3DO6A 2J59A 4IDHA 1CR0A 1XMSA 3SEAA 2FPMA 1GP2A 2QEQA 3SYKA 5B64A 4DHEA 1OKKA 2F9MA 2XITA 4B3CA 2VP4A 1KDRA 1QVRA 4F91B 3QF7A 1DADA 4TL8A 1YE8A 1TX4B 3C4JA 2ZUBA 4K8OA 4KAXA 3QXJA 1E2LA 3CKLA 2CLDX 3I4LA 1VKJA 1FNNA 3AB3A 4LSGA 3LH5A 3AKCA 1DAHA 2BBOA 2IS6A 1IJFA 2FSGA 4K81B 5DE3A 4IW3B 4HAZA 2WAXA 1GIAA 2QRZA 1E2GA 2P67A 2REBA 4PPFA 4Q4HA 1WF3A 2BJWA 2VHUA 5E95A 5P21A 2IC5A 2VHTA 2C04A 5F9FA 2Q9BA 2C96A 4B35A 3O47A 2AXPA 2CJWB 1QHSA 3VKWA 1IN4A 3AVWA 3ZGXA 3B6EA 2JJ1A 2RGCA 2C77A 2BBWA 1Y3AA 4OQLA 2FA9A 3U7HB 1NNEA 3AGQA 2JJ2D 3SI7A 1E96A 2C5LA 1W0JD 1OH5A 4HB4A 1DS6A 5JEDA 3VU9B 3RRZA 3BS4A 4ZDIA 4NMMA 3TQFA 1E32A 1JXMA 2IUUA 1XP8A 5ANRB 2QN6A 4ZV4A 3ZS9A 1P2UA 3THYB 1DBSA 3B13B 2H17A 4BRUA 1II0A 1NBMA 3NH6A 4XVQA 4LHZA 1UEIA 1Z6XA 4E09A 1EFRA 4YDHB 2RH5A 2CK3A 1FW6A 4RSGA 1FNMA 3UWKA 5FFMA 3KB1A 4RD1A 4BLTA 4UNSA 1U0LA 3SBEA 4L16A 1KJWA 1D2NA 2BC9A 1KO8A 4W5WA 1G5PA 2O8DA 2ZETA 2J87A 4B75A 4ZPXA 4TMXA 2BM0A 3N2IA 2G3YA 2CE2X 3UPUA 3B1WA 4B6FA 2GILA 3A1TA 1KY2A 4NCHA 2JEOA 4C0SA 1EWRA 5KPJA 3MWJA 4NZYA 3LA6A 3QF4B 2DBYA 1T6NA 4NTZA 4KFUA 2QRNA 5LD2C 4HEJA 4B76A 4URYR 1Z0IA 5JBQA 2WVJA 2C9CA 1G8PA 1G41A 1ONBA 4Z1MA 3UMFA 2ZSAA 4IEEA 4TSFA 1FPMA 3T61A 2RGAA 1ZM4A 4GDFA 5TV2A 1CF4A 4GBMA 2JGNA 3T12A 2RKOA 1R8SA 1U0JA 3KFXA 4NYIQ 1DAFA 4DLXA 4LJ9A 4Q1AA 2Q9CA 2ZSBA 2PJZA 5FI1B 2C98A 1SVOA 2C99A 2BWJA 3LO5A 2ZRDA 2D7CA 2NMVA 3KQHA 1JAIA 2QMOA 3GJXC 3N2EA 2PMDA 3SR0A 4B47A 3LXXA 1TEXA 2QPAA 5CDFA 3W8NA 1L4UA 4PANA 2KJQA 2IS4A 2YV5A 1J2JA 2JIZA 4JVNA 5LB2A 1HT2E 2WWGA 5J5CA 1HQYE 2PLFA 2XOKD 1DAKA 2ZI3A 1VG1A 3OIUA 2O8EB 4I1VA 5JSZA 2NGRA 4YMSA 4B3FX 2ZPTX 2ZU0C 1OSNA 4QJ5A 1SKYE 4WOPA 5FOTA 2VA8A 5UKDA 2ODWA 1WRBA 3G5UA 1GVNB 5CM8B 1A2KC 4BE7B 2FFHA 2GRJA 2VSOA 3A58B 2VF8A 2XAUA 3GCGA 4UKDA 1OW3B 2ERXA 2FSHA 2J7PD 1M6NA 3NBZC 2GJSA 4QHTA 1XFAA 2CVHA 2F3RA 3SOPA 5B30A 4IOLA 4EUNA 1YZKA 3R8FA 3VNVA 1Q1ZA 4ACBA 3IEVA 4DDUA 1LFDB 2LKDA 2RCNA 3B8HA 2A9KA 3FFBA 1XEWY 1P61B 1OYWA 4EJSC 1XBTA 2BMJA 2WAYA 2GVZC 2D06A 4W5JA 3C8UA 4C0LA 1CRPA 2WWHA 3PUYA 1G21E 1ZNZA 2GK7A 2V8OA 4D0GA 4EDHA 1WP9A 5KPDA 3A8TA 1ZM7A 1ELOA 1KOFA 3SU8A 2FG5A 3PG5A 4X8MA 3SC3A 1IXSB 2EFCB 3QKTA 3PUWA 2V1UA 2KSQA 3TKLA 3W8RA 2XXAA 1RYFA 1T3LA 4A2PA 2UZIR 4Q1FA 4HLDA 3PEWA 1W7AA 2BCGY 1SZPA 2VP9A 2PBRA 2GXUA 3EWAA 3WRYC 2O8CB 2H92A 4QGGA 3AQ4A 2YZ2A 4TN1A 1IN6A 2XB4A 3R7WA 1BS1A 3CF0A 1BYUA 3PITA 5B2ZA 3RS2A 1WB9A 4ZDWA 1MOZA 1QVAA 2A5GA 3AKYA 2DHRA 4DBLC 3BH7A 2GNOA 3T5DA 3T34A 2BKUA 3VAAA 1CJTC 3FWYA 1LS6A 2ZYWX 3FKQA 3AVOA 3BFVA 3ONWA 2IUTA 3KTAA 4GOXA 2R62A 3I1FA 4JL8A 5FL7A 1XEWX 4QBHA 2FMXA 2IL1A 4LHYA 3VNUA 1XTKA 3PEYA 2A7QA 3KJHA 2FFAA 3GLGA 1FTSA 3EASA 5JWRA 2WSSA 1XCGB 3C15C 1A1VA 3EXAA 3NBYC 3K0EA 4LK2A 1SQ5A 1LVGA 4PHHA 4EJSA 2J46A 3DEFA 4RFSA 1F48A 3CF2A 2ZJ5A 3P32A 4GT1A 2DB3A 1EGAA 1JBKA 4IVPA 2OO7A 3OAAA 2C9OA 4QGFA 4LHXA 4MUAA 1IJEA 4W5HA 4OL0A 1II8A 4KFTA 2DWPA 3SJCA 2R8RA 4UNQA 2PJRA 4Z8XA 4PO1A 1A4RA 1Z6TA 1WE2A 2ZVQX 4YXWD 1RW4A 4FWTA 2ZQ5A 1BYIA 2Z83A 5GJVC 1UFQA 4QJ4A 2VP5A 3PCRB 3C41J 3L8ZA 1UF9A 1BH2A 4TWZA 2A5DA 4G3XA 2XJ4A 1XMIA 2ZROA 4PO9A 4UJ5A 4US0R 4XD7A 2AD5A 5CJPA 1JEEA 1I4TD 3BXZA 4DSOA 3HPQA 3TIFA 1NJGA 3RRMA 2YYZA 1SVSA 1RRPA 1ANKA 1JAHA 5EQTA 5KNBA 4PPQA 1XD2A 1GNRA 1X1RA 1QHIA 4O2RA 5BN4A 3OF5A 4EIWA 3MAAC 2O8BA 4KYUA 2AX4A 5E7IA 3OEEA 2YC2C 4NBSA 3TBKA 4G0NA 1OIVA 2AWNA 2NO1A 4JKIA 1S3GA 3NC1C 3ADBA 4OHYA 2FN4A 2JCSA 3AP1A 4M1KA 2CCGA 1CLUA 1CR1A 2XEXA 1NKSA 2MSEB 1FFHA 1GL7A 3GLIA 1DARA 3GFOA 3MD0A 2HDNB 4Z8YA 4H9GA 3CB4A 1OF1A 2QAGC 1Z63A 2YHSA 2WBLC 4G5SA 4GSYA 4LBZA 4FMDB 1XB2A 4XTRA 1ZNWA 6Q21A 4U00A 2GZDA 2GZHA 2OBMA 4Q1EA 4GMXA 1E2NA 3T35A 4Q02A 4WAUA 3B1XA 1S1MA 3TR0A 2AN9A 2AFIE 3ASYA 4FCTA 4RD2A 4TMVA 4B32A 1T9HA 1HE1C 5KNCA 1G8GA 2GA8A 1IXZA 2PX3A 3KQLA 1LY1A 4Q4AA 3WYFA 4D6PA 4JLNA 1XEXA 2GCOB 3NIBA 5A4JA 1N6IA 2ORVA 2HT6A 5HKKD 3AGPA 1Z6YA 2G77B 2KBEA 3PUVA 1TADA 2HEIA 3CX6A 1JQJC 4IHQA 3EZ6A 3L0IB 4L9WA 5JI3E 3TW8B 3L0OA 2FX3A 1ZYUA 4HZUA 5TDHA 2R6DA 4GOKA 2XB2A 1K5GA 2XJ9A 3OEHD 4PPNA 1EESA 4AG6A 4DVGA 4BFSA 3AF0A 1G6HA 2CEAA 2DFLA 3S1AA 3EA5A 4XTCS 1KI4A 1X8KA 2ZITA 2HYDA 4WZAE 1CRQA 1XPOA 2G1KA 1P6XA 3WRXC 5KDOA 4ZDJA 4M1OA 5TXGA 1ZMXA 4F4CA 3BD9A 1P73A 5JMTA 1RPZA 2ZAOA 4JLAA 4WXRA 3U7FB 2XNDA 2ZR0A 3QKRA 5FUXA 3ZD6A 2ZRPA 1F60A 2QAGA 4Q00A 4ZI3A 4ASUA 2JASA 2Z6VA 1ZRHA 2FF7A 2OG2A 1P4SA 1MH1A 3KDSE 4LDJA 1Q21A 1KTVA 1UDXA 1GRRA 1OIXA 2WJGA 3MLEA 1U8YA 3OEED 5CYPA 2FV8A 1KO7A 4NU0A 3NBFA 4ZCIA 4G5RA 4MKIA 3LRPA 4DB2A 2O5VA 2YNMA 4P4SB 4PHTA 3IKJA 2J1LA 3Q5EA 4Q4JB 2HT1A 4NYMR 3R9WA 4AYWA 3I8XA 1FX0B 1Z08A 4HDOB 3LV8A 3E2IA 1NN5A 1Q3HA 1GDDA 1J90A 2QSZA 5JLJA 1IY2A 1KZ7B 4BQSA 3JZMA 1GKYA 5SZHB 3OFND 4NP6A 2WJIA 3TUJC 4DRZA 4MGIR 4DUGD 1CXZA 3QEJA 3W3AA 1DOAA 1L2TA 1YQTA 5L3SB 1O3YA 1Z6AA 3K70C 3FHTA 4OYHA 3I72A 1N5IA 1L8QA 2K5UA 1Z6GA 4A2QA 1UADA 1OB2A 2GEUA 1SVLA 2PZGA 3PEUA 1W4BA 1W49A 2F43A 3IBGA 2GXQA 5AJZA 5LDDC 2PT7A 1S9HA 2Z5FA 1G291 3THXB 5DI3A 3ICQB 4F4JA 3GLFB 2WJYA 1ZM9A 1KO5A 4QC2A 4H1UA 4V03A 3W6OA 4MDEA 3HP1A 5D3MB 3GLIB 4PZLA 3A4MA 1GAJA 3U6KA 3K9GA 1FP6A 5C46F 3U7GA 3ZDQA 2CXXA 4IFBA 4PX9A 4JJKA 2ONKA 4HUQA 1AKYA 1W0KA 2KBFA 3MWKA 1Q12A 1OXSC 3UIEA 5BYKA 2XNDD 3HDTA 1RZ3A 3PXGA 4NCJA 3ND9A 4IDQA 1EFHA 1Z0JA 2NPFA 1GRQA 1ZC4A 3BRWD 1W44A 1AJEA 3AVPA 4ASUD 1NG1A 1GILA 3GD7A 2WMNB 3FGNA 1ZU4A 2ZYVX 2OLKA 3G82C 3K09C 4HAXA 3VR1A 3W5JA 1W2HA 5J47A 2VBCA 4I81A 3MMPA 3HU1A 5H8WA 3ZYCA 3KKPA 3HYRA 3CWZA 3K8YA 3IGFA 2H57A 2OFOA 2QA5A 1E9DA 4URWR 4TTQA 4UXIA 3B7GA 4KXFB 5EE3A 2IW3A 4LBWA 3CO5A 3TK1A 4B3DA 1Z22A 1KSJA 3TRFA 1AS3A 4JBWA 3QY0A 2O52A 4LV5B 2GJKA 3OHMA 4B34A 3S1AB 1G3QA 2IWHA 3GJ0A 4OK3A 3GJ6A 3N5CA 5JWOA 4JT4A 1G6OA 3LVRE 3ZIAA 1QF9A 1OHHA 1DG3A 4X8OA 4DCNA 5HTKA 4G5QA 1Q3TA 3BB4A 3NC0C 1JR3E 1X8LA 1RJ9B 2FZ4A 1WDTA 1ZINA 2QZ4A 2GTPA 3BOSA 3NBXX 2P5SA 4LOAA 2ZE8A 2CJWA 3CIOA 3PFIA 2BMDA 1IN5A 3HU2A 3MWLA 2IWRA 2D7DA 3A6PC 2QE7A 4HYYA 4EPTA 4IEIA 1CS4C 3B60A 3RRYA 2FSFA 2Z0MA 3VU9A 3WP0A 4BRWA 4L5BA 1KI6B 2XTMA 4IXNA 3FKSA 4PAOA 3BAFA 1M7HA 3THYA 3EIEA 4KFSA 4IJMA 2PH1A 4LCBA 2IYYA 1ZJ6A 4QBFA 3K09A 2PEZA 2C78A 2ZSDA 4UNRA 2WJHA 3KKQA 2ZRJA 1GUAA 1SXJD 1RRFA 5IF9A 4LY6A 4EPWA 2YJTD 3I92A 4GNKA 3U3RA 5FTNA 4CEIB 1SULA 1G7SA 4Q18A 3X2SA 3ZD7A 2GBLC 1TEVA 1OH6A 4TYNA 1JR6A 4DSTA 2IYLD 1N6NA 1U94A 2FGJA 1XMVA 2GEDA 3Q5DA 1T3HA 1CP2A 2F1RA 1G3RA 2WM9B 2OBLA 2X8AA 3IDQA 2WWFA 2P6RA 1MR3F 3OIVA 1P7CA 1WCV1 3RRNA 3K0AB 4Q7MB 1M7BA 1G16A 2V4ZA 2JJ8A 3QXXA 4RY2A 3Q7PA 1DG1G 1QG2A 2GEVA 3RHFA 1X86B 1KAOA 4ESHA 821PA 4ABYA 3QF4A 4C0JA 2JLZA 3K53A 3DM5A 1VCMA 2JJ2A 3SQWA 2J0VA 1W0JA 2ZVPX 1TU4A 4J0QA 4JLVA 2EU8A 5FOUA 3K70D 2QPTA 5TMPA 5EZ5A 2QNRA 5DHAA 3CPEA 1DTSA 1VG0B 5DI3B 2ZYUX 1U90A 4D25A 4UXHA 2WPDD 4DJTA 3BB3A 1OXTA 3CNLA 1Z5ZA 1P2TA 2TMKA 4DDTA 3RABA 4CVNA 4EFNA 4ARZB 1N6KA 1SXJB 5FBQB 3U3JA 2IA5A 5IHPA 1KIMA 3ZIAD 2F9LA 2VYFA 1M34E 2QTHA 2GAOA 2PZFA 4US1R 4A1FA 721PA 3G0HA 1E2JA 4IDNA 1YRAA 5CM9C 1CU1A 5HZKA 2E87A 3X1ZA 1TUIA 1AK2A 4OK5A 4D82A 3KQKA 1Q1EA 2R65A 4KSCA 3HU3A 5FUYA 3RS5A 4QJ3A 5EJEA 4NCKA 1YZNA 4C0BA 1QHHB 4ZI2A 3QG5A 3H86A 2QMHA 1SVKA 3U7EB 2GBLA 5SZIA 2ZR7A 1VECA 2ZRAA 4YQFA 2O8EA 4A9AA 3ECCA 4HI0E 2IS2A 3GPLA 3HYTA 3T5GA 2DWQA 1X6VA 3FKSD 4B2LA 1TQ4A 3C5CA 1MV5A 1U8AA 4PHFA 4V0KA 4U7DA 1VIYA 1Q22A 3K70B 2QTFA 2WHXA 3B82A 3EPLA 2WV9A 3UMRA 1G8FA 2Q0HA 2CHGA 1DAIA 4DEXA 3U6BA 2HJGA 2KI5A 4M1MA 4Q1CA 4Q7LA 1Q1BA 1LW7A 4RZ3A 1UBCA 4BFYA 1E2IA 5AUOB 4EPRA 3RS7A 4FD2A 4AKGA 3GJ7A 3DOFA 4BZQA 1HY3A 3CBQA 1AM4D 1E9AA 4X8HA 1XX6A 4B74A 4B2IA 5BWMA 1ZIOA 2ZIAA 3PEVA 3OE7D 5G3ZA 2QBYB 1KMQA 1Z06A 2GF0A 1VMAA 5AWFC 1XZPA 1IY1A 4ZIRA 1IN8A 1D9XA 4WZ6A 4DLRA 4YONB 1BO6A 4LHVA 4MKHA 5CLLA 1GWNA 1R5OA 3L8YA 3REFA 3ADDA 5CITA 2ANBA 3Q9LA 3NDBB 2XOKA 4KBFA 2NOAA 3BFKA 5EE9A 3ZQJA 3K0SA 4IOJA 2WOOA 3BBPA 1E2DA 1Z07A 3MJRA 2CL0X 3PJRA 5TB5A 1N6RA 3WXMA 2O8CA 1NKTA 1F2UB 3R8CA 1MRNA 2W2XA 4I1SA 3U60B 4OQNA 1G17A 3EZ2A 1MABA 3M1IA 2IYRA 5IDVA 3EIQA 3TSWA 1EK0A 1XJ0A 4CT4B 5FBVB 2J7PA 3AVVA 4G5OA 4AYTA 1W5SA 3QBTA 4FMBB 4C0KA 3WYGA 2YWEA 2JLQA 2HUPA 4IDPA 1IY0A 2VP2A 5J4LA 1T8UA 3KL4A 3SHWA 4M1SA 2IT1A 2YWGA 2JDIA 5BW8A 2D62A 3KB2A 1TL7C 4MGYR 2CDNA 3JVUA 2AKYA 4A6XA 5DO9A 1R7RA 4URUR 2V6IA 3IBYA 1CULC 1G4UR 5K8UA 4OQMA 3UK6A 2FE4A 4JBXA 2NZJA 4W7SA 2BBSA 4DLWA 4LHWA 5HCIA 1LF0A 4BFXA 4C2TA 1GNQA 3CRMA 3DMNA 4PAQA 3RS4A 4C3ZA 3OZXA 5DIFA 2QI9C 4TYYA 4NDZA 2UZ3A 2VF7A 1S8FA 3H84A 3QG1A 4MRNA 1Z2CA 2ZTSA 4V0ME 4FI3C 4OQXA 5KNDA 3FB4A 5L8VA 2LKCA 2ZI9A 3TMKA 5EE5B 5TVKA 4C4PA 4EPVA 2Z43A 2R6AA 3TLXA 1XXHE 1KI7A 2CNWD 1PUIA 4R9UC 2PX0A 2VLIA 2BJVA 4M53A 4P4UA 4DLZA 3UG7A 3X1YA 3PENA 1ZCAA 2ZJBA 3CZQA 3DKVA 4F38A 3GEEA 1QG4A 1A82A 4Q9KA 4DSNA 5HCNA 4D26A 1DAMA 2FZLA 1FQJA 2O0HA 4MRRA 4TLCA 4V02A 4MRPA 1H8EA 3LLMA 2WWYA 4QL3A 1L4YA 4HAUA 3ZVMA 2HXYA 2Q3MA 5HZHA 5KDDA 4YC7A 2CMKA 1GRNA 1E1QD 4GPTA 4QG7A 2B8TA 5KDLA 2FWRA 2IXFA 2PCJA 4JSYA 4HUTA 1VHTA 2QT1A 2ZRBA 3QIAA 1OH8A 1KAGA 2J41A 1UKVY 1AQYA 1E2QA 3A37A 4LI0A 4TQ9A 3FMPB 1NVUQ 4LC1A 3WNBA 4D2IA 2XNSA 3CONA 2JA1A 3EPKA 1Q57A 3OIWA 2UKDA 2XZLA 1ZM3A 5FR1A 1AZTA 3P26A 1GL9B 1QHYA 1XTQA 1MT0A 3K0FB 3V4FA 5AJWA 2GESA 1E9SA 3GMTA 4IKEA 1ZNXA 4YXWA 3BE4A 4TT3A 3NHAA 1XEFA 1FQKA 3TJZA 3MRSA 1G8YA 5C2JB 4HAWA 4K46A 4DLUA 3UG6A 1Q0UA 4LBYA 2IHBA 2O0KA 3EAQA 1U98A 1FTNA 2JDID 1HTWA 1R4AA 3LBNA 2AK2A 4ZIRB 4AK9A 1K5DA 3T06B 1KZGB 2ZJAA 3NHBA 2GCOA 1SKYB 1KO1A 4OI2A 4Y0AA 3QNUA 2DYKA 3DHWC 4D80A 1NBME 1W2GA 2P2LA 2YKGA 3KKMA 1R0XA 3GJ4A 1KYIA 2ZJ8A 1QHXA 1X1SA 4GZLA 4NONA 2X1VA 1IN7A 1SGWA 3BK7A 3F3YA 1PVOA 4P3YA 1OPXA 5J4HA 2DPXA 2GF9A 4I4LA 4MKGA 4BFWA 4TYWA 4FCVA 3SFZA 3QEOA 4V0LA 2QL6A 3TE6A 4ZKEA 5HPYB 2WWWA 1J8YF 1MABB 4PC1A 5CB6A 4CEHA 4HLQB 4KV9A 1GOTA 3KX2A 2GXSA 3E1SA 3QE0A 2ZI4A 2G0TA 4P33A 4TLBA 1XTSA 1YR7A 1JQLB 2G83A 3VR6A 1UM8A 3IHWA 5H70A 1DAEA 4A0RA 5EP3A 1D6JA 1KMHA 2V55B 2ZRLA 1ZIPA 3D7MA 2Q9AA 4KVAA 3ZZTA 5BN5A 2YOFA 2SHKA 4EPYA 5JCZA 3UATA 4OKSA 4BECA 1H8ED 2CCKA 5CB8A 2GHIA 3PQCA 2XZPA 4QBGB 4HAVA 1E2EA 1MKYA 1G3MA 3F0TA 4IXMA 2DR3A 3DM9B 5HKKA 3RS0A 1VTKA 3KKNA 5E3HA 4EFLA 4LBVA 1PLLA 2AWOA 4LV8B 4FW9A 3ICEA 3IPYA 4P4SA 2QTVB 1E9EA 1L7VC 5DH9A 3OEHA 4Q4JA 4O0MA 2J7KA 4PSAA 1P60A 4M1YA 1RRCA 1U2RA 4QXAA 3IQXA 1FX0A 2VEDA 4Q9LA 4OHVA 2AXNA 4YLGA 2YWHA 1P2VA 2B6HA 5KHOC 1Q20A 4WXPA 3SNHA 5CDFE 4YMTA 3A1VA 4TT3D 1HQCA 3W6NA 4XWAA 4A0HA 3SJBA 4A6PA 5AUNB 5FTJA 3ZVLA 3FOZA 1XCPA 4TLEA 3QBVA 4S35A 1SVIA 2J0SA 5L3SA 1CEEA 1FOEB 3B1VA 4HB0A 1S0UA 3SHFA 2BEKA 4PFSA 3LBHA 1ZP6A 4PSVA 1DPFA 4F93B 1E99A 2DWOA 4NYIR 5EP2A 3EC1A 3A4LA 5FOVA 3FMIA 3SJAA 1E4YA 1RVDA 2N1BA 1BIFA 3CR8A 1YZQA 4GRAA 2VRWA 2CVFA 3FVQA 3EC2A 1T8TA 3KXLA 4RCZA 3GLFA 3THXA 2IYVA 2OFWA 3MCAA 4WIAA 3NWJA 5D3MA 1QBKC 5A5GA 3IEUA 3A1UA 1FMJA 3SS8A 1N6OA 3RYTC 2HLDA 2EFEB 5FPTA 2V1XA 1N0VC 4B48A 3BGWA 3ND8A 4BEBA 4ZO4A 2IYSA 1LTQA 1KY3A 1NY6A 3GLHE 5E7MA 1TTTA 5CIQA 4ZCMA 4DIEA 4OHXA 1XPRA 3OFNA 2JLSA 2IYQA 1T5IA 4DUGA 2JAQA 5KSOA 2ZSEA 4GP7A 5DYIA 3IIMA 2IYUA 4BUJA 4CW7A 2Q6TA 3CM0A 4TL7A 1Z47A 3EIHA 5GVSA 3GP8A 1MRSA 1VG8A 1J99A 4RD0A 3CNOA 3SQXA 2Z4SA 2OHFA 4KU4A 4TYQA 3ADCA 1UBGA 3JVVA 4M9SA 5DHFA 4M9XA 3O8CA 3I73A 4WA7A 4D4MA 1D5CA 1KK0A 3UWOA 1XZQA 1YR6A 5BQ5A 4BWYA 3RNLA 3ZZUA 1NVVQ 4N1AA 1MO5A 5CIWA 5GJBA 3SJZA 2DY1A 1ZW6A 3IPXA 4JBYA 1TAGA 1H65A 3FMFA 1HYQA 3RANA 4LJYA 4CEHB 3E5HA 3WHKA 5K8LA 3QPWA 2RMKA 3P20A 5FH9A 1XPUA 3NVAA 1RJ9A 1EX7A 1Z0AA 1T0HB 3TUIC 2ZYTX 1RC8A 2A30A 2OBNA 2QM8A 1HH4A 2ZRHA 1JECA 3UANA 1XD9A 2HCJB 4IRUB 1KMHB 3CRVA 3GLGE 2HJVA 3B78A 2NO9A 4M0LA 4HZIA 3AVXA 3W34A 2RGGA 4II7A 3H1TA 2NG1A 4Q47A 5FTMA 5JEEA 3RC8A 2GXAA 2REOA 4R2HA 4RCYA 621PA 4LJ5A 1SXJC 1KI6A 4Q03A 1WBBA 1KJYA 4DC9A 2H5EA 4TL9A 1OFUX 1U9IC 4KFRA 4DCUA 2V7QA 2LCFA 2VHJA 4LV6A 3BH6A 3THWB 2G9NA 2BVNA 1S1CA 4URXR 3BWDD 1R8QA 5DISB 2HLDD 3QQ5A 2R6GA 4W9MC 2CE7A 2IF0A 2OFXA 4JKYA 1NMXA 1YZLA 2J3EA 2W2TA 2ASEA 1P9WA 4B71A 4CEIA 2A5YB 5TARA 2EWVA 4XOIA 1ESMA 2W6JD 1P9NA 1E3MA 2WZQA 2CL7X 4D4KA 4V0OA 5GJCA 1N6HA 1NN3A 2WJJA 1QDEA 3DDCA 3P27A 4QM7A 1BKDR 1I2DA 3T1OA 3CH5A 1YZTA 1TNDA 3QXCA 3X1DA 2IS1A 1G4AE 4P32A 5KSZA 3K0AA 1WXQA 1HUQA 1KNXA 3O8DA 1S4QA 1TQ2A 1QZXA 5G41A 4BLQA 3EA0A 1EFTA 5JHHB 3AP2A 1Z83A 5AJXA 5TY0A 3Q7QA 1D2MA 4Q4LA 4RFVA 4AG5A 4QFMA 1DVRA 2EFDB 1F5NA 1RYHA 1KI3A 3ZVNA 2VSFA 2EW1A 2N46A 2B7CA 1SVWA 2H16A 3L0PA 2Q3HA 3AM1A 3AVYA 1E9FA 1NSTA 1E2HA 2ZEJA 4JZKA 4DCVA 2W6ID 4LRWA 4ARZA 5J4VA 3SYNA 1SXJA 1KJZA 3CUEF 2ERYA 4NYJQ 3TVTA 1LNZA 5G53C 4IFEA 4KVGA 1U9IA 2GK6A 2BMEA 2ZUDA 2R2AA 3H2YA 3EZ9A 4TZ0A 2IX3A 5JFGA 3ZQ6A 4FINA 4RZ2A 3TGPA 3IILA 4GOJA 3QPUA 1E1RD 4M2LA 2CLCX 3VR3A 2CL6X 1UBEA 2RB4A 2QQ0A 2VHCA 1QHHA 4LPSA 2B7BA 2ZJ2A 3TAHA 1T91A 3GFTA 2YWFA 3L43A 4QHYA 1CIPA 5IT5A 1ZD9A 1UPTA 4NE2A 1N5LA 1ZCBA 2IF2A 3HR7A 5D3QA 3CRW1 3ETLA 4TMTA 2JLWA 2W83A 2V7QD 4Z54A 3PIRA 4PQYA 4I1OA 2IEYA 3FTQA 1W48A 5G40A 1W5TA 4AURA 1ZAKA 5F9HA 1CJUC 1T3SA 1K8RA 3BORA 3J81k 4U5XA 5FOXA 2WSMA 1G3UA 2WPDA 5JWHA 5DSZA 5EUMA 3QKSB 5F3WB 2YVUA 3W9YA 3DPUA 3MWYW 4M4SA 2RGBA 1JR3D 1TPZA 4KYIB 4LYFA 1S96A 4B3XA 3VX4A 4R98A 4TMWA 3U44A 1VCNA 1OIWA 3OESA 3I61A 1NG9A 3KFVA 2J0QA 5AJYA 3T15A 2VIIA 4Q48A 1XJCA 2QBYA 1E2KA 1F3OA 2J0UB 3CH4B 1U81A 2QP9X 3C14C 1E2PA 2W0SA 4TQUS 4FXPA 4PSKA 2XZOA 4KBGA 1R0ZA 5C4GB 1YJ5A 2E9SA 1ZC3A 2JLVA 4PQRA 5DI9A 3GQBA 1G18A 3U4QA 3HPRA 4Q9HA 2UVQA 1ZNYA 4XWKA 5FPSA 2R6CA 2EQBA 3W5IA 1HURA 5SZJA 1CTQA 4JJZA 4BFTA 4OI0A 1F2UA 3CR7A 1GNPA 3O8RA 2QROA 3CWQA 5EXXA 2W00A 4B2PA 3QXSA 4DDWA 2XGJA 1W36C 4MYTA 1GTVA 1MO4A 2RHMA 4OJQA 4BLSA 2BMFA 2B92A 2Y8EA 2ZS7A 1P5ZB 1UKYA 3SDZA 2ZANA 4MRSA 421PA 1ESNA 5IRCD 2Z4RA 3I8SA 3EPHA 1AIPA 2EFGA 4LX0A 2WMOB 4LYAA 1J7KA 3IIKA 3OE7A 4YMVA 5EZ6B 2FU5C 3WBKA 4PC3A 4TMKA 4CDGA 2O8FB 5EXTA 3Q72A 4QHSA 3UMSA 1OJLA 4KCGA 4ESVA 4TZ6A 3LXRA 5HR5A 3LWNA 4OI4A 3L0SA 1KKLA 2C95A 3L82B 3HR8A 4XH9B 3V00A 2ZM5A 4F4IA 4QBIA 3WNDA 4RD4A 5K8TA 4AI6A 1G7TA 2XTNA 2ZRFA 1E2FA 3RSLA 2PCLA 4AKIA 4PTLA 1J70A 4HDQB 3M0EA 2GZAA 2VO1A 1IM2A 1WMSA 2YC4C 3AUYA 4JLOA 3SBDA 4LUCA 1ZD1A 4PZZA 1LB1B 3QPVA 3TH5A 1RE0A 3FYHA 3Q3JB 1UDWA 4HLUC 3RC3A 2OXCA 2ZUCA 1D2EA 3B5JA 4D0NA 5GADl 4FCWA 4F7WA 2F7SA 5KOYA 1P62B 3AF1A 1R5BA 3KJEA 4Q7KA 5H1YA 1DEKA 1FZQA 4GZMA 4DT1B 3EZFA 1M74A 4Q1DA 2OEPA
chains in the Genus database with same CATH superfamily
4C7JA 1ARZA 2AEJA 2AJCA 2JAPA 3GHHA 3OHPA 3U80A 4D3XA 5J4KA 4MVJD 1I6KA 4IHJF 2IOYA 1W0CA 5DN9A 3V32A 1TO1E 2DR0A 2B8WA 2QW1A 4RVSA 1Y1TA 3DV0B 1N8TA 1W4ZA 1XJQA 2EV9A 4A8JB 3ZHTA 1FQOA 5J1TB 1O96B 2AFHE 4HQ0A 5B53A 3MYYA 2AZMA 2B8NA 4TQGA 1HDEA 3AI2A 4TV9A 4HBGA 1GNVA 3O93A 1FVFA 1G60A 4LDQA 2I7XA 4K0RA 1KI8A 3CNNA 1NVXQ 1DWQA 2EZ9A 2L18A 1P9RA 4MVYA 4V0NA 3B6JA 3QE2A 4NK4A 1C3OB 1GKIA 4MUYA 1N32B 1NYLA 4MB0A 4AZVA 2QVYX 1B1AA 3AINA 3NDJA 1SU7A 2CNWA 3NUZA 5B57C 1NXTA 1DO0A 2PG3A 1ZVQA 2A0FA 3IESA 3KOOA 4KXUA 1XDDA 5LA6B 2X23A 1RFGE 3CBGA 2WDPA 1MORA 2XVMA 4OD0A 3BTSA 5JCOC 2IHYA 3ESBA 3JARA 4QOHA 3M5WA 3CLVA 1T0PA 5DLPA 4QJBA 4F5YA 3LPDA 3E03A 2D3WA 4JOQA 4O4IB 3B20A 4YMIA 4B6GA 1JHRA 2PXXA 3BGVA 3WLJA 4I99A 2PZEA 3EW9A 1RHRA 1L8OA 1MV8A 1U04A 2CZGA 1OGYA 2J5KA 3NGLA 3Q1KA 3D6JA 4GKBA 3NUGA 3I05A 4US2R 1RKUA 1QV7A 3PRKE 2Y1DA 4DILA 1DDIA 1RAEA 4I5FA 4OXIA 4QQRA 4UEWA 3K0BA 1DUVG 4OYLA 4DLNA 3ABIA 1TC1A 2B3TA 2I1QA 3CZMA 3PUZA 4NJOA 1YQUA 5BW5A 4H7PA 3VPGA 4LMPA 4M9QA 9ATCA 2R86A 3K71B 4QPJC 3INYA 4WNCA 1CFJA 4W5QA 2IHZA 1F06A 2FQYA 2QRVB 4XCXA 5GQSA 3EF1A 3KCNA 2A3RA 2OCIA 4EKDA 1F14A 3R5XA 2UU9B 4QNRA 1Y9DA 4MITA 2F3QA 5KI6A 2JZCA 2LE0A 4Q05A 1JLSA 3RFVA 4BL5A 5DOVA 1ML3A 1SKBA 1XZGA 1NA5A 3ET5A 4A36A 2OZEA 4AZ0B 1CBUA 4NZPA 5G1OA 5FUQA 5KB3A 1J22A 3ZW9A 1TE2A 4QTZA 1V47A 2I9KA 5JJKA 1NJ5A 4Q9NA 3LSTA 1Z0DA 2XGMA 3EEBA 3QW2A 4ZU3A 1Q95A 2IIQA 1WB6A 4WBSA 3N6XA 5JYCA 3F9CA 4B6RA 1SN7A 2I4LA 3DOCA 4EHLA 3FFTA 2VAXA 3NHMA 1EJ0A 1W4CA 5DF1A 1DKPA 4NKRA 2ETXA 4AZ3B 3N70A 4BP8A 3KQUA 5JQWA 4RK4A 2BR4A 2OGTA 5JCOA 1GYRA 5EIBD 1HFJA 2GPBA 3HA7A 2PMCA 4RGYA 1YB2A 4MR7A 3LYHA 1XZCA 2JIPA 2G36A 1DHRA 2Q5LA 4WY5A 3ZI7A 1VBNA 4BEWA 4U2EA 3UJ8A 2BT4A 3FJ1A 3TVDA 4KITB 3FA2A 4BC1A 3VR5A 4I4TF 4NBKA 1C8KA 5ECYA 4L4UA 4A5OA 4OA8A 4BWGA 4P1ZA 3MWDA 1Y9EA 4URHA 4QD3A 4PYOA 2WJWA 4BAUA 2L17A 1YZ3A 1LRKA 3R5KA 4BLPA 4KFCA 1QYWA 2GK3A 2REQB 1FK8A 2I1VB 1GKUB 2D4HA 3O4IA 1E4VA 3TW4A 1N36B 1H4QA 2V7EA 4GWGA 3VI4B 1JSLA 4RM2A 3K05A 3P9XA 1DBRA 5LP6B 4K1LA 4MS3A 1U6KA 1AK9A 4X71A 2IHTA 2ZAGA 3NGXA 5ETJA 1Z6PA 3BMCA 3BDIA 2H4JA 4MRMA 4Q9IA 4J29A 1QGZA 3LFUA 3OVMA 1RQRA 1CR4A 1VDZA 2GN6A 2RHDA 2HGSA 1GFSA 2AR7A 4FN4A 2AG8A 3AU9A 4GF5A 1RKVA 1V96A 4N5IX 3R40A 4ONEA 3WHIA 4G2TA 1NWCA 1KO4A 1GU7A 4P80A 4QFDA 4O2AF 4FB5A 3IEKA 4PZYA 3LJKA 1JG3A 5HF6A 2OBYA 1ZUHA 3RRBA 5K5EA 5T4HA 3L6RA 3GIDA 3N2KB 2X1LA 1COWA 4BFLA 2H31A 2XUHA 3JAWA 3QWHA 4LXIA 3NIGB 4JI4B 1QYCA 3FVVA 4KJXA 1QQ7A 3Q85A 2FZVA 1UJCA 2JJ1D 3WIVA 3DTVB 4Q3LA 1WMBA 2UAGA 3V46A 5C5EA 4MCJA 3AR7A 1MAUA 4ERNA 3QVVA 3C1OA 1GITA 1MN6A 1UH5A 1ZL2A 2BONA 1PT7A 1YR9A 2GT1A 2O7VA 3GFPA 3HDQA 3QKIA 1EUCA 4G0YA 4HDSA 5I7WA 1E0JA 1XALA 1Z28A 2NO0A 2X8WA 3BJIC 3CURA 1Y5IA 2FW7A 2GSWA 4QEDA 4WKOA 4TL6A 3RHSA 4DCGA 4CEJB 4C5CA 1SVNA 1H5UA 1WOYA 3X1XA 4C08A 1L4BA 1MC1A 1XV5A 1OYYA 1XLWA 1EHYA 1XRJA 4Y8VA 5G4KA 3RYIA 3IAEA 1ODIA 4MS1A 1W5EA 3R7LA 3UT6A 2G88A 2IZOA 4C6RA 4CM8A 5KYXA 2O14A 5C51B 4AY6A 2J6HA 2RC5A 1C4KA 2GD6A 3U3ZA 4CGZA 4HCJA 4ZTBA 4HNAB 3WRWA 4QTUB 1GARA 1XSEA 4CBVA 1MDBA 2D00A 2X2OA 1JI0A 3H5TA 2DCUA 3OCVA 4S1OA 5JVDB 1D4FA 3PDIB 3HJRA 4MP3A 4EY6A 3NEJA 5KU1A 1NULA 4MX8A 1B93A 4DXDA 2ZRCA 5EEHA 2O2JA 4MW2A 1IONA 3U2QA 3W6PA 1HLDA 5BYJA 2ZZNA 1QCZA 5CVEA 5GWXA 3GLHA 3PJGA 3QYAA 4V0RA 1Z45A 1SCUB 4I50A 4G5GA 4S2EA 3S5UA 1AQNA 4N5HX 3MCVA 4IRXA 4CQLA 3OJEA 4X20A 3KQTA 2R87A 4M9UA 3MFYA 4ZCSA 1ORDA 4OAOA 2PKQO 5J2TF 3DL0A 4MUJA 1MD9A 2P4UA 4QOEA 3ANXA 3L4KA 1HT1E 3ESAA 1V2GA 3A0UA 3OZVA 4L72A 2OC9A 2R4TA 4MCHA 5HE9A 2FSIA 2DP4E 3BXPA 3CG4A 4HB3A 3TQTA 2H63A 1YB4A 1Y0BA 2Q45A 3GO4A 3LDAA 1EBUA 2A1UB 3KOUA 4HSEA 1DP4A 1VI2A 1UDAA 2DFNA 2HF9A 1YOBA 3GRUA 3TEJA 5DCWA 4XFJA 3AWDA 1EG7A 3TYXA 2Q28A 1G19A 3KUDA 1A8HA 2P4EA 4E5UA 1UKAA 3FRJA 1Q5PA 2JKVA 1BWPA 2VHWA 5DHUA 2I5PO 4DV3B 3BUSA 5G02A 1UBNA 3M6VA 5KTOA 4PXAA 2QN2A 1L7PA 4IUCS 1ODLA 2WFLB 4RQUA 2IODA 2QTZA 4KJZA 4K9QA 4L3WA 3EUAA 2ADOA 3IOEA 5HF8A 3E5RA 3VC7A 1FCJA 4AZWA 1PL0A 4EM6A 3C1TA 3MOSA 3WTBA 1U3TA 1HMPA 4BUZA 4S04A 5BSTA 2Q3EA 3HRIA 4EDFA 4EZEA 4XSHA 1XNGA 4WZAA 1LS1A 1I13A 1EVJA 3DMDA 4RHXA 4BGIA 4ESEA 3Q87B 3FX2A 3JQ7B 3PD1A 2XNJA 3R20A 4KIFA 4JYBA 4LXGA 3WYAA 5DP1A 4DFDA 3B1ZA 3T1QA 1XQVA 4MYDA 4Q1BA 2P90A 5K7SA 3GNQA 4NYMQ 4E7OA 2GN0A 1GGJA 1GGEA 4LYJA 4NENB 2JFNA 3RLFA 4QXQA 3A1FA 3AW9A 2D54A 2NU8A 4D4JA 1TKRA 3DZHA 2FEMA 4FMCB 2QPOA 2Y1CA 3PUXA 5TEWA 4C6SA 1QX3A 4KBYA 1F38A 4HGQA 2ZK7A 4Z9FA 1NLFA 3W1EA 2X1MA 4WY2A 4DEYA 3O8OB 4ABTA 3LECA 5TPWB 3Q15C 4RELA 2G1PA 1WXGA 3B6KA 4YJ2A 4YECA 3N7TA 1ZGJA 5BSEA 5EE1A 3KEFA 4BVAA 4UJ3A 1HDIA 1ZJ4A 3QVUA 4I5IA 4LPKA 3TI7A 4AKEA 4ANFA 1N0UA 2ZJYA 1O6BA 3COZA 4ZVTA 3UZUA 3D6TB 3M2PA 1JBQA 4LVCA 3IULA 3UXMA 5E6SA 4AWXA 4MHTA 2E48A 1G1MA 1NQVA 1AS0A 1NF8A 1GCUA 3LNTA 2YXLA 4R1PA 4NH0A 3W3AH 4EGQA 2YMQA 1XDZA 2C0PA 2NU7B 1TF2A 1UOOA 3EGXB 2PSJA 4XPIB 1SK8A 3CLTD 1BQ4A 2YW9A 3VX3A 1I7NA 3G02A 3H1AA 4JT8A 3OF2A 2AD1A 2EL7A 1EUYA 3C5WP 1CJVC 2NNWB 2H06A 3P8ZA 4R8KA 3VV2A 3ZBTA 3RS3A 1AA9A 1T4GA 3B2QA 1WTCA 4E2ZA 1PKXA 2B1JA 3GUUA 1JDZA 2A86A 1PEDA 1YMVA 4ZJUA 2GN1A 2PMKA 3ZHYA 4LXQA 4D26A 2W2VA 2B5OA 1I4EB 3R3VA 1P2GA 4GC5A 2IV7A 4HAYA 4QGHA 1YOVA 1NI3A 5JHGB 4QWWA 4UHJA 1TTHA 3RADC 1NIPA 2HMUA 1G3IA 3HXTA 4QDTA 3COSA 4EAQA 4EX7A 3PRYA 3BICA 4JYAB 3MW8A 2X2EA 1U2ZA 2AR0A 1QU2A 1AS2A 2QK4A 2XCUA 1AD2A 7ABPA 1MAAA 3FR7A 1N5JA 5ITVA 4P7FA 4CUKA 4DIDA 4PSDA 4YB8A 2IBMA 1MLDA 3AFOA 5ALMA 5C52B 1E2MA 1IAQA 3ORQA 3THRA 4TUYF 2GTHA 4DLTA 4EHKA 4UTNA 2QTCA 3MWEA 5JH7F 2V9CA 3ZD9A 5IK2D 2XUKA 3TN7A 1CCWA 1BRTA 3JX9A 5CW1A 4AO6A 3FCAA 3AL0C 1DC7A 4K03A 4TYPA 2QMEA 5DGXA 1PZGA 1U8FO 4TRRA 1G8JA 4WMLA 2P4QA 2RGNC 1UJ2A 5A4IS 5F5NA 5HJ2A 4J4TA 3EAGA 4IOMA 2EAUA 3CRRA 1NVTA 2BFCB 3AYZB 1GZSA 3K9CA 3LD9A 3R75A 3UVEA 1KEEA 2GKOA 3DZ8A 1QCCA 3EDOA 4HH0A 5DTIA 5IBCA 4PIPA 5FPHA 4ZI5A 1PT9A 4U2GA 3DT6A 4G1MB 2W6IA 2PNJA 2ZR9A 5KJEA 4I5EA 3A6EA 3LVQE 3SAJA 3V4ZA 2PUBA 4Q5IA 2JH8A 4JKOA 4K8RB 1U1CA 1KI9A 3WLSA 1VRCA 1KYYA 3DXFA 2R9VA 2F48A 4A82A 1GPMA 3QVGA 1VHJA 2GAJA 4GPEA 2XXAB 3TTYA 1T26A 2VRCA 3I28A 4JLWA 3ORFA 2DT5A 4K9LA 4MHOA 1VLHA 3IHLA 1VPVA 2B98A 3ZJUA 3MERA 4QUIA 2A6PA 1M7GA 1K6JA 4JLSA 4YJHA 2J08A 2GCPA 4TZKA 4YPVA 3LW8A 4CJXA 2FPPB 4ND7A 1FE8A 3ZHUA 3B12A 3CN9A 4ACAA 4DIKA 5JOQA 2VN8A 3TQSA 1ENPA 4FNGA 1ZR4A 2G1JA 3RM3A 3NIDB 2XB9A 5HMLA 2BSQA 3SMQA 3NEYA 2CLSA 3EZNA 2I78A 3N0RA 3ITKA 2P6UA 4NOJA 4DLPA 4V2IA 4DKXA 1U0HC 1QS0A 3LQQA 4Y2VA 3EVFA 4OJNA 1ORTA 3R3SA 4C0HA 2O07A 2F1IA 3OPXA 3JQBC 1I9CA 4A23A 3DL4A 3K94A 3M6XA 1DRVA 3CFYA 4H0CA 3GZNB 3STYA 5IAJA 1IYZA 4QQFA 1J0CA 1S3SA 2XUFA 2YJ6A 3LT1A 4PR0A 4D98A 3PQ4A 1KSFX 3KTAB 1KDOA 4K3UA 4ZPJA 4BMDA 1JR3A 3C70A 4FU0A 2RGNA 4MQFA 4N0EA 3PDJA 4IIJA 4P86A 4QVKA 4FGJA 4DRXA 2I91A 2RGWA 4PYIA 2UVPA 5FPKA 3WK6A 3INTA 1T6ZA 1W8IA 2JFPA 4AN1A 3GLGB 1TD9A 4RK6A 3WMFA 2EC5A 3WNCA 2O8FA 3CGWA 1LDBA 3DUWA 4RJKA 4MVXA 1XMQB 3Q7IA 2J3KA 1XA0A 1TQ6A 2XF8A 4UDYX 3LQ1A 3S99A 3EPPA 3U4IA 4D6XA 4DQ0A 4DCMA 3FSEA 4BB0A 3NHFA 1H85A 3CT6A 5KS2A 3LLUA 3EISA 3QP9A 1JLKA 3IEPA 3GLIE 4TKVB 1ZUNB 1E1YA 5FUWA 1W47A 3AFMA 3JQ8B 5G1PA 5CVVA 1QP4A 1GM5A 1ZDMA 3H04A 1SURA 3RIMA 3GLUA 1H22A 2CD7A 1A2OA 3GHYA 1QXSA 1SEPA 5B6IA 2F64A 4FGSA 5LWHA 4RJ2A 4FT2A 1G20E 1NQOA 1PDVA 5LP1A 1HDRA 4BQPA 4J07A 3ZKWB 2EFHB 4S1WA 2PRKA 2WKRA 3WNQA 3OQJA 1ORVA 1YR1A 1VGQA 4FR2A 4H27A 4X7PA 3R23A 3GJ3A 1OXKB 3WL4A 4I1UA 1TMKA 2C2BA 1YWGO 3CVOA 3U9SA 3KYJB 3QVJA 5IZCC 2ONJA 4GKKB 4M9RA 4DMHA 1VMKA 2H9AA 2O6HA 3MC1A 4MA0A 1JMVA 2X8JA 3RCBA 5DT9A 2HA2A 1XEAA 5LOVA 3JQBA 3SG0A 2Q27A 2VPPA 3LXMA 1P1KA 3OM0A 1RIFA 4YUAA 1NFQA 3KU1A 2O2XA 1JT2A 3EOAI 3RVPA 4DT1A 1G4HA 1CYEA 3B2NA 1TAHA 1IK4A 5JISA 1MO3A 3BQNB 1Z73A 2F3TA 2ZCUA 3B85A 3DEHA 1BMQA 3QK7A 1ZU5A 4J9UE 1N2XA 2FPLA 4LRTB 4Z3DA 3W6ZA 1Z4JA 3UJPA 1PWEA 2VJMA 1UK9A 4MO9A 3CSUA 2QLMA 3DWFA 1D1PA 3F7OA 4L0CA 1HEYA 1H8HA 1K7SN 3E22A 4FYKA 2OYCA 3VZBA 2Q3FA 4NFLA 3L07A 1UBMS 5ER6A 1R6VA 4GKAA 2A5JA 2GKSA 2P3SA 3ENVA 4P0TA 3SHOA 3U5ZB 1T9ZA 1WDWB 1U9JA 4PC6A 5AW1A 1PTKA 1QIKA 4A8HA 4UHEA 2F1KA 1RI2A 2OFFA 3VYTB 1AQLA 1M34A 2ASVA 4B4UA 1FFYA 1A9TA 2AC2A 2ATVA 4HMQA 4PC2A 2Y71A 1DG9A 2PUGA 3GZJA 4RF3A 4G4SO 3B7WA 2ZB7A 4Q9JA 2JFHA 1BEUB 1V16A 2HZBA 1R4MB 3K1YA 4LQCA 2ZYSA 3EUWA 4KDEA 2BEWB 1I3NA 4W8OA 1SCQA 2WF9A 3IUSA 3K9WA 2DFKB 1AKWA 5EHIA 2G4CA 3LUCA 4C0WA 4BYGA 1NVVR 3OPVA 3GFGA 1SBQA 1QPGA 3UO8B 1FFGA 3KT0A 1SWVA 5K0SA 5LQCA 3DLBA 2XQIA 3DZJA 3D64A 2E89A 2QP3A 2WPNA 1RPNA 4J1NA 2GCNA 1ENYA 1R9MA 2CYCA 2D2EA 3EULA 3DBVO 4PBRA 3ZHZA 1JT9A 2LIVA 5IZCA 3WGIA 2VJBA 1L4FA 3MGBA 3LT5A 4G0QA 2XX3A 3CZ5A 3KQWA 1G8AA 1JALA 2HCFA 4J16C 4GMDA 4DLYA 5A7FA 1JG4A 1KH2A 4IX9A 3LGXA 5DGDA 2H7VA 3L7IA 5DYWA 3FCXA 3VZRA 4I36A 1X87A 1JEDA 1U8UA 3HR4A 4QPDA 2SKCA 3BXEA 2WZBA 2B8EA 3GBVA 3W3AD 1MB2A 2XDQB 2WIAA 5ENDA 4WVFA 1WQ1R 4A92A 5I01A 3RF6A 2VPTA 3PE6A 4RKEA 4OHRA 1MENA 2A14A 3TSCA 2Z1DA 4EJMA 4UUPA 1E9RA 4OHCA 4CT5A 4JI8B 3GGCA 2QD1A 3KR2A 4QYSA 1N1EA 1SOUA 3DLIA 1Q1QA 2BM8A 3HS3A 4RYLA 4HHEA 4I4IA 3VNBA 2Q4DA 2GJ4A 2J85A 1G5TA 4JUAA 9GPBA 2B34A 1TJPB 2X0JA 3RIGA 1KWGA 5JI2E 4C7OA 1M2NA 4ZOLF 4NU5A 2X3UA 3TAUA 5FOQA 3V8VA 2FG7C 5IAKA 5TVGA 2IV3A 1BOOA 4Y0VA 2LW7A 3EZXA 3FDIA 3JQPA 4YASA 3FUXA 4IIXA 1NXWA 4BLVA 1ZJ5A 5EP1A 2QYTA 5LKAA 2PS1A 5FTLA 1GCOA 3ZJTA 1OU4A 2NUBA 2JGKA 1KP3A 4EYSA 2NXJA 1PR1A 2FWNA 5EIBC 4LHSA 1VE3A 3RYHA 3HV2A 3A1DA 3C5EA 3TD6A 4XDYA 1VG9B 1GA1A 2EJBA 3KHUA 3GH3A 5G0WA 1RYYA 4Q21A 3JQEA 4AKSA 3NKVA 5EIAA 2X4GA 5AHKA 3VMMA 3FW1A 1WUJS 3OIYA 4I2NA 1IL0A 3REOA 3RVKA 3GFQA 1Y7IA 3EHDA 3WE7A 3CF6R 1B2LA 4E5YA 2R8BA 1XK7A 2E21A 1B8UA 2NO6A 1B0AA 1ZRMA 3Q2KA 4XIJA 1L3IA 5K2OA 4CL8A 2EG9A 4EKEA 1YRLA 4CKZA 3PUJA 3FFAA 1T4CA 2ZWVA 2QW8A 1GT91 2OT3B 5IH3A 2IK8A 2VFAA 3BWBA 3I9OA 4G85A 4XJTA 4YAWA 2ZBGA 5C34B 1R6AA 3H65A 4J16A 3VVCA 4CMGA 1G5RA 4J7XA 4JLJA 4Y2QA 2CXSA 2RGYA 2OWDA 3T1NA 1WSAA 5EUQB 1IRXA 1LCIA 4X6UA 5EJ6A 2AHOA 4RJLA 4I9GA 2ODEA 4UEQA 2AKAB 2EHDA 2POQX 1GFIA 1CK4A 5M3BA 4R0MA 2HSWA 1E69A 1WULS 2HFKA 2IHUA 4Q4DA 3EVAA 2WVAA 4R7TA 3DVLA 4UAJA 4WDRA 3SXUA 2YDXA 2JLRA 1GZ3A 1NMSA 4OREX 2D5BA 4RUKA 1L5KA 4D9MA 2ZRGA 2NTYC 1XN1A 2YIMA 2RGXA 3G9QA 2AC7A 3LCVB 1NLZA 1ZOPA 1ULTA 2BUAA 2Q50A 4JFAA 1V71A 4JUIA 3I6MA 4KR0A 3T9BA 1M6VB 5HBGA 3LIIA 4HLCA 3WVNA 1PYDA 3MBKA 1THGA 3R77A 3RRJA 1YKSA 4BVJA 3D7SA 4CXMA 2ATXA 3CEPB 4IVRA 4MAAA 2G17A 1XZ8A 2ISSD 3A6LA 4HUQB 1JMKC 2P0EA 3KHTA 4NR0A 4DPLA 3I62A 4BE9A 4JGGA 3LLCA 1P3JA 3DH0A 2X8LA 1EP2B 4E4YA 1UAGA 1N5KA 4OLFA 4BN4A 5FB3A 3CKYA 2PJDA 2FE1A 2OCAA 1RRVA 1T5LA 2QDXA 1PQPA 4PG7A 5ESDA 1OZGA 3M3HA 3UW3A 2G6BA 1O95D 1LDEA 3A3YA 3EJ6A 3ZHBA 5AKGA 2QE7D 1NXSA 5JJIA 1H23A 1XCJA 3BD8A 5IASA 3ZE2B 1QKJA 4QIHA 3L1JA 1NUQA 5B64A 2GBGA 1RNLA 5K51A 1DLIA 2XIQA 2XITA 3PHBE 2EG5A 1UMCB 3AMVA 4RM3A 5JQGF 1CP3A 1KVTA 2XMSA 2Q8NA 2X4LA 1HT3A 3D3JA 1RJEA 2VRBA 4KK3A 2C29D 5CB4F 2QOEA 3RUDA 3GXOA 4YUWA 1ZL0A 2QTRA 3PPYA 4G09A 1DQYA 4UM9B 5CDYA 3GAAA 4GOND 2FKNA 4L6AA 4ZVSA 4IXWA 4EB6A 4UZFA 4QLOA 1VKJA 1FNNA 3AB3A 1CUDA 4M8IA 3WBFA 1WDLA 3G2MA 3G9XA 3OFVA 3PP8A 3DGFC 1IJFA 4YN3A 4IZHA 4K81B 1ZSYA 4MQLA 5E0KB 4YRNA 5AM3A 3O7WA 2V45A 7GPBA 3GCXA 1GZUA 1ZQ1A 2H52A 3GARA 3HSSA 4OAPA 4JI7B 1ZICA 3PFKA 4JI0B 4L74A 3DEAA 3LDHA 5LN1A 3GZTB 1FY2A 3WZ2A 3MILA 1H3EA 1V1JA 4MGEA 2I2AA 2O7SA 4A6EA 2C96A 3CLSC 4B35A 4YDRA 3O47A 4J4BA 1PAUA 4UTOA 4NG4A 3VRHA 1EUQA 1IN4A 2PUAA 3KYDB 2JJ1A 2RGCA 2C77A 2P6MA 2FA9A 5SYNA 1NDHA 4K6OA 4HVTA 1Z18A 1RJDA 3WFIA 2GBIA 1P5JA 1I6LA 2C07A 1R0LA 2OY0A 3BS4A 4D3ZA 4S05A 1VXOA 2W2NA 2ZOSA 2Q41A 3NHJA 3TQFA 4ZTUB 1NATA 2IUUA 1VQ1A 1OLUB 5ANRB 3ZS9A 1P2UA 4I6JA 4RVHA 5E2IA 5EWLA 3LUGA 1DBSA 3B13B 5DLDA 2VXOA 4LOLA 2H17A 3P9PA 5L40A 4XVQA 4CKXA 3QYPA 4HNHA 4PYRA 4R40A 1MJNA 4DCPA 3U62A 4E09A 4RPGA 4JB0A 3IR5A 1H9AA 5E2AA 4CMBA 2BFWA 3AJRA 4AM8A 4C78A 2B78A 5KYYA 5CH5A 1FW6A 4F8YA 2TRSB 1XVUA 4RJIA 1FP4A 1P4AA 3FN4A 4BLTA 4UNSA 1TRKA 2HH9A 4L1KA 4B5KA 2C8LA 3HUDA 1GUBA 2I1WA 2OHXA 1M0WA 2WIKA 3DC2A 2ZETA 5AVJA 1APBA 1FJXA 2IBTA 3GGSA 2FQQA 3PYMA 3NASA 2CE2X 2PA0A 3K30A 4B6FA 4YAEA 1JEAA 4FR5A 4ENQA 1PWYE 1KY2A 4XJVA 2I67A 3UWMA 3BD7A 5K4HA 1EWRA 4K9PA 1BJKA 1OC4A 3C3MA 3PPWA 4YFYA 1YQDA 3F46A 2X9NA 3LA6A 2WTXA 2DBYA 1T6NA 2E3JA 4NTZA 3BIWA 3OBBA 1AB5A 4ZAFA 1VC2A 1YHZA 2QRNA 2JAUA 3CG0A 3D8RA 3E9MA 2CF5A 3KVYA 4I55B 4WCFB 2VWHA 1UT5A 5JD3A 1XG5A 1KJ8A 1HBJA 1V7ZA 3CLTC 4URYR 5JY1A 2ATEA 2X40A 1SAYA 5EXDA 4YJ3B 3OQIA 4H77A 3D81A 4QSMA 3RK0A 4BKOA 5KNLA 4II3A 4BP9A 2QVCA 5TV2A 3U13A 4GBMA 1I14A 2JGNA 2YVLA 3T12A 3VNRA 2Z9DA 5K2MA 1DQRA 1R8SA 4I9UA 1JLRA 3MELA 3PGLA 1AHHA 2J9ZB 4P7JA 1VMDA 1AVTA 2J4FA 5E3JA 1L9KA 4LDNA 2OPHA 2NMVA 3VO2A 1FJHA 1USWA 2FG6C 3GJXC 4PE5B 1I7PA 3ZY3A 4B6PA 3RARA 3NNDA 4TS1A 2RBKA 1C9DB 2QPAA 3F5DA 1L4UA 2ABWA 2KJQA 1N3IA 1PGPA 3U0VA 4LQDA 1SUSA 4DQXA 4XRGA 5IABA 3MHTA 3EHEA 3EIFA 4PFKA 3T7DA 5I4CA 5ERGB 4CR8A 1PR2A 1TTQB 4XI9A 2WB2A 3NT4A 5J5CA 4GWKA 3SZGA 2XOKD 1DAKA 2ZI3A 3OP1A 3EYWA 3KL2A 4I1VA 3JTMA 1KDYA 3DVSX 3O4FA 3L7BA 4QJ5A 1SKYE 4WOPA 2HAEA 3F97A 5GAJA 4OB8A 2HHCA 2VA8A 3P2JA 2F62A 1EP9A 3AYXB 1WRBA 4R5HA 4WKCA 4BE7B 1KP9A 1GPDG 3P9CA 1V11A 3A58B 2XMGA 2VF8A 5JADA 2PUDA 1P3DA 2OO5C 5IVPA 4HNVA 1DLJA 4HJXA 4FGKA 1OX4A 2ERXA 3AJ9A 1OILA 3IQEA 3RYFB 4KQKA 1SG0A 1AGXA 1M6NA 1P2BA 4PNZA 2W71A 4ALLA 1XTTA 3PYXA 1Z0UA 5IDYA 3ZDRA 1XFAA 2F3RA 5B30A 1GSHA 3VKFA 5F77A 2OVFA 1N2BA 1Q1ZA 1T9CA 2JGAA 1SWWA 3LBFA 5F3RA 1SXQA 4C7BA 4EY4A 3H05A 1RHUA 4DMFA 3TLMA 1B16A 1PJCA 2RCNA 4L0QA 2CBXA 2AMVA 1FEZA 1XEWY 1P61B 1OYWA 3L6DA 4CG1A 3J80A 1VP3A 4OFBA 1U6JA 3RSQA 2AVNA 4HXGA 4W5JA 2GPWA 4MUGA 2A5LA 4LISA 1S3IA 3HEMA 3JU3A 2GK7A 2V8OA 4H3KB 5D87A 3ZOKA 1WP9A 2ZT5A 4EDHA 5I9SA 1EXVA 4L6IA 1K97A 3SC3A 3M9LA 3PUWA 1IH8A 5FQOA 3T1TA 3NC4A 5D84A 1T3LA 1F8XA 4TS9A 5ALEA 4CIYA 1DCFA 2VJYA 3AR5A 3PF9A 4YBZA 5FLKA 1EK2A 4FCCA 3EWAA 3K92A 1NOKA 1TCUA 2EBFX 3HL4A 2ZAYA 4Q1VA 3WRYC 1SOAA 3AY6A 3KB6A 4WNAA 4TN1A 1NBAA 2ZIGA 5KNDD 1BVRA 4D3YA 1IN6A 1UMBB 2X9GA 1Y4UA 4MW5A 3R7WA 3BXHA 3ML1A 3PITA 4N82A 5B2ZA 3TQRA 1V9SA 1QR6A 4ZDWA 2CB9A 4MPDA 2MINB 2GZ1A 2C2YA 3IV6A 3LT2A 1RQ7A 2HADA 5EPOA 3VJKA 1CDDA 1A04A 2BEUA 2P7HA 2OO5A 4B8WA 3A31A 3C45A 2Q4OA 3FWYA 3FKQA 3QRWA 3X1KA 3CU5A 3BFVA 1K2WA 3BEDA 4DV2B 2OXFA 1OA0A 2IUTA 3QPDA 5ALQA 4LNHA 1DJOA 3DBHB 1ENZA 4JLUA 3IE2A 3RT9A 4MQEA 5GONA 2Z8YM 2Q5FA 3Q11A 4JP2A 3EXG1 3C74A 4MJLA 1PR4A 4LHYA 4KHPB 5U1PA 5HQ3A 1A4UA 1J00A 2A7QA 2FFAA 3F4BA 3KJHA 4LGYA 1FTSA 3H2HA 2AG1A 4J1SA 1B8OA 2E4VA 4LZNA 4UPVA 1FYVA 3F78A 2TSYB 3NBYC 3OFSA 4MV9A 4ZO7A 5B4VA 1M72A 2I34A 2Z95A 1M2VB 1IZ7A 1QFYA 4PHHA 3DEFA 3H9UA 3MOGA 1F48A 4RFSA 5FCDA 2ZJ5A 5LZ2A 1B7GO 1EGAA 1F6WA 1SZDA 3AILA 3UQZA 1GGVA 1OFUA 3TXAA 4KNWA 2C9OA 4JBLA 3FPJA 4ZI7B 1YTUA 2MDTA 1XQWA 3GEGA 3ACBA 1DX9A 1QZ3A 3GYBA 1Z6TA 2ENWA 4D8TA 3TW6A 3ICOA 1IN1A 3V33A 2SKEA 4QOJA 4WINA 2ZQ5A 4DW8A 1WXHA 2FX5A 5FFFA 4IG4A 4QJ4A 3PCRB 4D9JA 4XUGB 1UK6A 3PIIA 3C6KA 5CG1A 1T5BA 2IZ7A 3W5HA 2PGAA 2LUOA 4G3XA 4NV0A 1KH1A 3L4EA 2ICAA 4US0R 1R3UA 5KBYA 2PUJA 1DGQA 2XYQA 3FCSB 3BXZA 3M8KA 5CFOA 3ME5A 5ALLA 1RI3A 3QI7A 2NZYA 2YYZA 3ILYA 5EQTA 1JAHA 3WO0A 2P4SA 3TSYA 3ZWPA 4PPQA 3IP7A 1GNRA 4QU0A 1QHIA 4UEOA 1O54A 3F7TA 5F4ZA 4YV1A 2JAHA 3OWHA 3T4PA 4QTYA 1VSQA 5E7IA 3OEEA 1JIUA 3I42A 4F6LA 2NO1A 1UBRS 5CPFA 3SXPA 5B55A 2IYPA 5DLEA 3JYPA 4XR4A 2FN4A 1CJBA 2R79A 4CCSA 3D7LA 4F9FA 3EH1A 3D4IA 1CR1A 1O8CA 2IZ1A 1NKSA 1Q0HA 1FFHA 2MSEB 4OP3A 2JBAA 3UH0A 1V1RB 3MD0A 3A6DA 3WGOA 1GTRA 4HPWA 1BCRA 1OF1A 4B9AA 1PW7A 2YHSA 4G5SA 4IV8A 6Q21A 1TGYA 2JS7A 1B8VA 1QGYA 1ZNWA 4LJRA 2GZDA 2J31A 1A1VA 4JODA 3W79A 2AA3A 2FHSA 1EJ6A 1XVTA 2P2NA 5EA2A 1KEPA 3G89A 4LY0A 3O4VA 3TR0A 1FLNA 1WDMA 2AN9A 2V6FA 5CAEA 3VTFA 3NS7A 4RD2A 4TMVA 4FDUA 4AJKA 4ND8B 5BQ3A 1QAQA 2G07A 1HE1C 2QUAA 1L5QA 3ENZA 1IXZA 1ULBA 2PX3A 3G2QA 3LZDA 3OLWA 1CDEA 3WDKA 3PJFA 2AI1A 5KTPA 1ZXBA 4Q4AA 1I0ZA 1P9LA 2GCOB 3NIBA 4N0PA 4B6JA 4Y6LA 5A4JA 5IYZF 5A6SA 4RDXA 3FCOA 5LZ5A 1ZK0A 4HDKA 4R41A 2QJFA 7REQB 2FSUA 1Z6YA 2KBEA 4PVDA 4IM7A 2HEIA 3EZ6A 3AFIA 1NQWA 5BVHB 3N0VA 4O1HA 1JEQB 1E77A 2FX3A 1ZYUA 2R6DA 4V0QA 1K5GA 1RTKA 4RVFA 2MIIA 2Q6IA 5BSRA 1BS9A 1G6HA 3QE4A 4O4IF 4U7HA 3KKLA 1DC4A 3QMWA 1VL8A 3U7IA 4WZAE 1XPOA 2G1KA 3UMMA 4KLRA 1KA9H 1O1YA 3D3WB 4HDRB 4F4CA 1QHEA 1RPZA 1GPLA 2LD4A 1V6CA 2IU0A 2ZR0A 1RXUA 2Y67A 1SCNE 2FEXA 3DDOA 3C6YA 3I2GA 4K3VA 3GRZA 4TGLA 3IMKA 3SY8A 3W2EA 3HVRA 1SUDA 1GNSA 1M2GA 1Y3CE 3L1IA 3TTTA 4ASUA 1X7GA 4DLAA 3EDRA 3KPVA 1P4SA 1IATA 2M32A 2XUQA 1V4VA 3KDSE 1N5OX 5BN5B 5BOSB 1KTVA 3DE1X 2UYCA 4M1ZA 1LFAA 3QFHA 5EG5A 4LY3A 3CLHA 1WUTA 3OM1A 2Y1EA 4D5EA 4DV1B 4AQYB 1T1RA 2HA3A 4C2BA 3QV1A 1L7MA 3BHJA 3DZCA 3HP4A 3WL6A 1FJ2A 3MRXA 1KO7A 2CNDA 1T5SA 1SELA 2H1HA 2KHZA 2WG2A 3KO8A 5AOVA 2B69A 2W4MA 3ZCVA 2WT9A 3NV7A 2YZMA 4FS3A 4I5DA 5HW0A 1YS4A 3G2OA 3EG9A 3GIWA 4YRCA 4DB2A 1LC3A 3ETCA 3ZZ1A 4H18A 2H51A 2J1LA 3UV6A 4LOIA 2I2DA 2A84A 4AYWA 3I8XA 1VFPA 5F1PA 3ZQ4A 4UE3S 4KXLA 2OHIA 4ZQIA 3LV8A 1M1NA 1N2CA 4P22A 5AVOA 2WABA 3N7UA 3ND7A 1GDDA 5JLJA 3AUSA 4BQSA 4FSXA 5HBRA 2V97A 2X9VA 2Q1XA 1GKYA 5AI4A 5SZHB 4Y1EA 1SXIA 5CXXA 1H4VB 2XHEA 3R4VA 3TUJC 3DDWA 4DRZA 3AUAA 2XKBA 4KVFA 4NX2A 1CXZA 3W3AA 1YQTA 1V5IA 2Z1MA 3IE1A 3K70C 4NEQA 4N41A 3WYCA 5KNCD 1KVQA 3ID6C 3GNSA 5TEVA 2BZSA 4QFCA 4PLGA 4A2QA 1XA3A 3WXBA 2F8LA 1UADA 2YRWA 2QUHA 2XMPA 2A35A 1F4PA 5CU7A 1TQHA 2Z8ZA 3MTIA 1YB1A 4RAOA 5AHRA 1H5NA 4AKTA 4HTFB 2P11A 4DCCA 1YRQA 3OICA 5AJZA 5BV0A 2PT7A 2I7DA 2YJ5A 3H4IA 3V34A 1G291 4KKVA 2RHWA 3WKDA 5BT8A 1NM5C 1H3NA 2WJYA 1KO5A 4H1UA 1NJ6A 4BO7A 3N8HA 4CM4B 1UPBA 2ZJ1A 5KYUA 5AW6A 1E3WB 4BASA 1X7HA 1WHSA 3A4MA 3C4QA 3P0FA 5AKHA 5DGTA 3K9GA 5KC9A 5C46F