3BFVA

Crystal structure of the chimerical protein capab
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
241
Chain Sequence
DKRIKDEEDVEKELGLPVLGSIQKFNMTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Membrane protein CapA1, Protein tyrosine kinase,Protein tyro
publication title Structural Basis for the Regulation Mechanism of the Tyrosine Kinase CapB from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 81
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bfvA00
2A30A 5L8VA 1G8FA 2A5JA 2AN9A 2WWHA 3CH5A 2OM2A 2V8OA 3GJ4A 2JAQA 4S2EA 3UG6A 1NKSA 1OFIA 1CRPA 2ODBA 4RZXA 2WJVA 1E2GA 4Q1EA 2ORIA 2CVFA 2QRNA 2WKQA 4OQMA 1XFAA 4GI7A 4URYR 3TSOA 2V55B 2XZPA 2C9YA 2OSBA 2BDTA 1G7TA 5BXQC 1HEIA 4QGAA 2CXXA 3NH9A 4TQ9A 1AS0A 3M6AA 3R7WA 4DBLC 2B21A 3CX7A 1JEEA 2GNOA 4B2LA 2P5SA 3SYLA 4KFTA 3DZ8A 4MGKR 4BZXA 4HAYA 2BWJA 1UBEA 3ZS8A 1D8TA 3U6BA 3AF2A 1P2SA 1U8ZA 2V7QD 3FMPB 5EE0A 1R10A 4GBMA 4NBSA 4GDFA 4NP6A 4JLOA 3GEEA 3C15C 2JLUA 1N6HA 1COWA 3N2IA 3QIAA 2VH5R 4MRPA 4JBXA 4PHHA 4F91B 5J5CA 3TNFA 2HDNB 1GILA 2C78A 5CK4A 2VSFA 2NO0A 1KK1A 2A7QA 1RVDA 3BBPA 1AJEA 3GLGA 1TPZA 2VYFA 4I81A 4B3BA 1E2IA 2X77A 2JCSA 3DZDA 4K8OA 2A2ZA 3T34A 3L8YA 2IUUA 1CEEA 3BIFA 2AFHE 1U99A 2IT1A 3AV0B 4B73A 3CBQA 3V4FA 3QG1A 3K53A 2Q0HA 2J7PD 2CDNA 2OAQ1 3SC3A 3R8FA 1A82A 1BKDR 3BRWD 4ZDWA 4QOSA 2C98A 4AK9A 3K0AB 4DB2A 4DDVA 2ZREA 4C7OA 3PCRB 4DVGA 1XMSA 3D6TB 2OAP1 4PC6A 4C30A 1U2RA 5JLJA 3IDQA 1YR6A 4L15A 4M1SA 2QA5A 4KFSA 5H1YA 5BN3A 2XITA 2ASEA 3LA6A 4QXAA 3OIYA 4RJLA 5B64A 4ACAA 1IXSB 2ZRFA 4TLBA 3RYTC 4KLNA 5FUWA 4QFMA 3IKJA 3TH5A 3LH5A 2BKEA 2OE2A 4XWKA 2H17A 1F5NA 3TQCA 2QMEA 1R6BX 1QHGA 4A1FA 2LKDA 4V0KA 2QP4A 1DELA 2QY9A 5DN6A 1IY1A 2XNDD 3RC3A 3AVWA 3B7GA 1N6LA 1NSFA 2B6HA 2OHFA 4QG7A 2ZSEA 5FOSA 2IF2A 1WQ1R 3G82C 4C0QC 3QKUA 1COWD 3ETLA 2WIAA 2MMCA 1CTQA 4D82A 2L0XA 2ZYTX 3W8RA 1DTSA 1T91A 3PFIA 3AVVA 1Z0DA 2ERXA 2DY1A 2HF9A 4JLNA 4ILEA 4F93B 3CNNA 4A2WA 4R2IA 2R6DA 5FTLA 2QT1A 3AKEA 3JZAA 4DT1A 2WV9A 2GHIA 3DKVA 4ASUA 2D74A 2ZSAA 4DLRA 1X6VA 2CL0X 2REBA 3OIWA 4HLQB 2G88A 2VSXA 1WDTA 3EXAA 2QAGB 4YMVA 3F8TA 3Q9LA 4KBFA 5TB5A 2PT7A 2PEZA 2R44A 1DAFA 4BFTA 3MJRA 4DLXA 4EQ6B 1VPLA 3EC1A 2IS2A 2ATXA 1E1QA 1W1WA 4NYMR 4Q47A 1W4AA 2WZQA 1ZIPA 3CWQA 1XEFA 2IEYA 5C4MA 2ZU6A 2CCKA 4Z54A 2H1LA 1FMJA 1XDBA 3VKWA 4U7DA 4P0TA 3TUIC 3HU1A 1DG1G 5DYIA 2ZAOA 3VR1A 1OFHA 4LJ5A 5E7MA 1RZ3A 4JL5A 5JI3E 1S4QA 4Q00A 2BMFA 2XTMA 1XF9A 1YZGA 2O8DA 2W58A 1ZW6A 1II8A 2ZI7A 4F7WA 1G1MA 5CLLA 5DN6D 1J7KA 3O8BA 1VCOA 3A8TA 3MSXA 5FUYA 4BECA 2CL6X 1VG8A 3EZ7A 4X8HA 1EFRA 1CLUA 4HB2A 5CDFA 2ZVQX 3AP3A 1Y3AA 1RYHA 3Q7PA 4PPGA 3IHWA 3VFDA 3VHXA 3SN6A 1LS1A 1ZRHA 2ZRPA 3CX8A 3WMGA 4B71A 3K09A 5KPJA 1JEDA 5DO9A 5TARA 5L3RA 2CJWA 4C0JA 3C14C 5JJLA 1AKYA 1IXZA 3TVTA 2I1VB 2BJVA 3QJYA 4YDHB 5ANRB 4TN1A 1E9SA 5HE8A 5AJZA 3U4QA 2XSZA 4PANA 1E98A 1AQUA 5CB6A 2C2HA 2PMDA 5AJVB 2O5VA 2XZLA 3QXJA 1FNMA 2GXAA 2JLXA 5DGXA 2JA1A 3U61B 3GJ7A 4JIMA 1SVOA 1IHUA 1FUKA 4NYMQ 4M22A 1RRGA 5CJPA 5HE9A 3QF4B 1KAGA 5G53C 4MUBA 2ZI9A 1OLOA 3QKRB 1E1QD 4N0DA 5FBLB 2O8BA 3EX7C 4PR0A 4TMKA 4A0RA 5JZVA 2JEOA 3RDPA 1IN4A 1TUEA 2OCYC 3WNDA 1EESA 5E4FA 1GG2A 1NSTA 3LO5A 5FPHA 4TZ6A 1Q1ZA 2CHVA 5EP1A 3KZ1E 3GFPA 2VHTA 1EFHA 1E2DA 3NBZC 2PH1A 3A58B 4R9UC 4TLCA 2Z4SA 3T12A 1VECA 3W5JA 2BM1A 3SJAA 2F3TA 3FWYA 4LJ4A 3R8CA 1NBMA 4PC2A 5K8IA 5HKKA 1E2LA 4OI1A 1E2FA 3TLXA 1E9CA 4QM7A 3AF1A 2GVDC 2FFAA 1EFRD 4V03A 3H2YA 1IOZA 1OFTA 1NN0A 3BS4A 5AUPB 5FI0B 2ZR0A 1TU4A 3NIBA 4IOKA 1N3BA 2BIFA 1HE8B 4JLMA 2K5UA 2WKPA 1S8FA 1G3MA 3ND9A 2ZJOA 1LFDB 1S3SA 3GFTA 2AL7A 4UNRA 1NY5A 2JLRA 1E99A 2YWHA 4XVQA 4JMPA 3CRVA 2F55A 2J41A 2E87A 2H16A 3F5FA 1GITA 1I4TD 3B1YA 2XSZD 3TW8B 2QM7A 3K70C 1NI3A 2ZRKA 4HB3A 3UG7A 1A2KC 3PEWA 1KSHA 1G21E 4PXAA 1R5NA 2RGCA 3MWLA 4G5GA 1E2HA 4RZ3A 1P2UA 3R20A 1QHHB 3Q72A 3P20A 2ZR9A 3GFOA 4JLBA 4OQNA 1W7AA 1Z0KA 4JLAA 4IXNA 3RHFA 1DS6A 1Q3HA 4N3NA 2CL7X 4Q4JA 2QTVB 5EE1A 2P6RA 2YVUA 2H5EA 2QEQA 1NLYA 2X1VA 2YC4C 1N6NA 5FPYA 3LXXA 4N1AA 4WXPA 2IYYA 3I3SR 2JASA 2N1BA 1G6OA 2CCJA 3IQWA 4IKEA 2PL3A 1ZD9A 2P3SA 1P60A 2EFEB 5BYJA 2HEIA 4D0NA 3KUDA 5FL7A 3IEVA 3QOFA 4D80A 5HCNA 4F92B 3W3AA 3U44B 4CEHB 1NBMD 4OQFA 5P21A 1KOFA 5HKKD 1SVMA 3O8RA 4B32A 2AWOA 1D5CA 1US8B 3FFAA 3EG5A 4HAWA 2IYSA 4Q7KA 4QGGA 2F1IA 3KKMA 5JFGA 1YHNA 4PQRA 2YOHA 1G5RA 1Q22A 2OT3B 1MRSA 4M9XA 1J99A 3K9LA 1Z6TA 1C1YA 1NJGA 3FPAA 1R4AA 2FFBA 1P9RA 4ESHA 3A1TA 4NYIR 5DSZA 2A5FA 4PPNA 3NG1A 4LV6A 5AR1A 2CMKA 3RRNA 3K70D 2RH5A 1NNEA 4PAMA 2D06A 3E5HA 1LTQA 4BGDA 3CRW1 4D0GA 5K8TA 3U5ZB 1XMJA 4TMTA 2WWIA 1E2EA 2YC2C 4G5QA 1H8EA 2RGGA 4M9QA 1R8SA 1GM5A 4JT4A 2PLFA 1AS3A 3CPJB 3THYB 3THXA 4RD3A 3RWMB 2EYUA 2ZANA 1U8YA 2FMXA 4DCNA 1QBKC 1L8QA 4ZKEA 2Q3HA 3TBKA 4ERNA 2PT5A 5C4GB 3TSZA 4YMSA 3H86A 3IQXA 3PV0A 5EXXA 1UBGA 3ZYCA 1KJYA 2REXB 3EASA 1ZIOA 2GEUA 2XXAA 1P61B 1G4UR 2QI9C 2JLYA 1NJFA 1YZNA 4P31A 1EFCA 1C4OA 1MO4A 4MGIR 5FL7D 1R0ZA 1CP2A 1GWNA 2IK8A 1KI6A 2ZS9A 3F3YA 1T3HA 1ZYUA 2RGAA 3QBTA 5DISB 4POAA 3I5YA 3AVYA 2FEMA 4F38A 4HAXA 1W46A 3GLGE 3CRMA 3OE7A 1ZD8A 1N6KA 1UKZA 4AURA 1QDEA 2CE7A 2A5GA 2IYWA 3MUFA 3P27A 1DEKA 2WJJA 4Q48A 3OIUA 1U0HC 2AK2A 4UNNA 5L3QA 1KMHB 1AIPA 1T3SA 4O0MA 2ZRDA 3GLIB 4KAXA 1HE1C 2VL7A 3A6PC 5EP3A 2ORVA 1GL9B 3FB4A 2W0SA 1RPZA 1XNJA 2KSQA 3U3OA 4DLUA 1PVOA 4IXMA 4C2TA 1L2TA 2NPFA 4UKDA 4B48A 1FP7A 1NG1A 4O3MA 4BFXA 2ZS7A 3UWKA 4PZZA 5C46F 4U02A 1H8ED 2JLVA 2RB4A 3ECCA 2IUSA 4M1TA 2J0QA 2OLJA 4D4MA 2ZQ5A 5IK2A 4TT3A 4US0R 1N5JA 3KQNA 3PEVA 4HAZA 4NCHA 3A37A 5JCZA 3WYFA 3M1IA 1RRCA 3NH6A 4JVLA 1P4SA 2IHYA 1Q3TA 2G3YA 2ZI3A 1KI1A 4UXHA 4ZDIA 3TSWA 1ZJ6A 3VR4A 1GTVA 4BE7B 1K8RA 3NHAA 5G41A 3BXZA 1S1MA 1P5ZB 5FPTA 2IYRA 4GL2A 4JYBA 1BS1A 3GLIE 3SYNA 3T1TA 2PBRA 2CHGA 3IEUA 1N0VC 3TE6A 2ZRGA 4ZV4A 2JLSA 3IUYA 3RRZA 1X86B 3GJ6A 1WBDA 1OH8A 2BBSA 2OCAA 3KFXA 1CR0A 3OE7D 1DAGA 3QI2A 3FMIA 4TTPA 1J8YF 1II8B 3OAAA 4PPQA 3LQQA 4QRHA 4A8JB 1UEIA 2ZRLA 5AWFC 1MV5A 4Q66C 1JB1A 4Q7JB 1TU3A 2N46A 4KCGA 3WNCA 1NVVR 2O0JA 2GILA 4FMBB 4Z1MA 4ITRC 2QE7A 3S1AB 4C0BA 4QHYA 4DLYA 4M53A 1NLZA 4LYAA 2BEKA 4MA4A 2H57A 1T8UA 1AKEA 521PA 1HTWA 2QRZA 4HUTA 1ZM3A 3OESA 1E2NA 1XXHB 4KV9A 2UVQA 3PIRA 1AS2A 3J81k 3KQLA 2A9KA 4RD0A 4CEIB 2WKRA 1Q12A 1VG0B 1NVUQ 1QHYA 2V9PA 2V6JA 3B5JA 1F6BA 1HA3A 3GEIA 1Z28A 3H0KA 4G1UC 3LW8A 2G0TA 4OK5A 4P33A 4IVQA 4DSNA 1RRFA 3GD7A 1F2UA 1KK2A 1QHXA 1IXRC 5LBIA 5IK2D 3PJRA 2FSIA 2J1LA 1M34E 4DCVA 4H1UA 4IFBA 4TT3D 4FN5A 4LPSA 5G3YA 5J4LA 4PFSA 3UWOA 3QSYA 4CEJB 1G6HA 1C9KA 4V0NA 3THWA 1MT0A 2C8VA 5SZIA 1WXQA 1XPRA 4RSGA 1W0KA 4NMMA 2O8BB 4RFVA 3WBKA 2GBLA 3QBVA 1TADA 3HR7A 5EQTA 2ECKA 4A6PA 4AYWA 4HYYA 1G3IA 2E1RA 2GBLC 2JJ1A 2OBMA 3H4MA 3AVUA 5E7JA 3U3JA 5D3MB 2H92A 1R8QA 3VR5A 1CU1A 3T5DA 3CM0A 5EP4A 4DCTA 2FSFA 4JLKA 2HLDA 1GRNA 4HAUA 4LSGA 3HU2A 4LHVA 4Q1CA 4PTLA 3N2EA 3OAAD 2NPIA 3KJIA 5DE3A 2BJWA 4DJTA 1NVVQ 5DNYB 2O52A 3FE2A 4KJZA 5L3SB 5JEEA 2FFQA 3C5HA 4CGZA 1X1RA 1J8MF 1KY3A 2F43A 2OFWA 4LZZA 3UK6A 2QE7D 4Z1MD 1G16A 1TEVA 4G0NA 2NMVA 3BOSA 4P4SB 3ZD6A 2O8EB 4O25A 3FGNA 1NIJA 1E32A 1OE0A 2EFDB 4TYWA 2PZEA 3SHWA 5SZKB 3B1VA 1RJ9A 1EK0A 2GCPA 3PUVA 5AK0A 2REOA 5FTNA 4YQFA 3L0SA 3QEOA 4M1YA 4LJ7A 3X1DA 1G20E 5J47A 2B7BA 3I61A 3VKHA 4LBWA 1DO0A 3LLMA 4CDGA 1FQJA 4RFSA 1G7SA 3DMDA 3RS4A 5E3HA 1CKEA 1ESMA 1UBFA 4URZR 5FOVA 5DI3B 3B78A 4MRVA 5FPKA 1E2QA 1GNPA 1ZU5A 2VIIA 2YZ2A 3KJGA 3KL4A 4EKDA 5KTYA 1KKLA 3SS8A 3T1OA 4AG5A 4DUGA 1MO3A 2N42A 3PUXA 4ZCMA 4ZI2A 1NBME 5GJWC 1W0KD 3W8NA 1I2MA 1N6IA 3T15A 1Q57A 1G8HA 2JJ1D 2VHUA 2XAUA 3KTAB 4HZIA 1FQKA 3WP0A 2FNAA 4TZ0A 1W5SA 1X8JA 3FDIA 4B2IA 4ZIRB 5KSYA 4PAOA 1VCNA 4HLCA 3Q3JB 4KODA 2KB0A 3DPUA 4JSYA 3VQTA 1TF5A 2NG1A 1YZKA 2YWFA 3M4YA 3LFUA 4NCKA 3EZ2A 4L8GA 4IW3B 4H1VA 1ESNA 1QHSA 2W6JA 4OI2A 3ZQ6A 5EXTA 4DIEA 1QHNA 4W5HA 1HH4A 1PLKA 1XTQA 421PA 4NHOA 4GMXA 2E9SA 3QKTA 4LJ9A 3HYTA 3GMTA 4B3GA 4LRWA 3MMPA 4TMVA 1T5LA 4DCUA 1NY6A 3FTQA 5TXGA 3RS7A 3TUJC 2RHMA 1K5GA 4KFUA 4NCNA 3KKNA 3K0EA 1OH7A 4OKSA 3AUXA 3SJZA 3EPJA 1JXMA 3LNCA 1M74A 3LAWA 1K5DA 1JBKA 3VNVA 2WSSA 5DYGA 4URUR 5KOYA 3P4XA 1F2TB 3EIHA 1UF9A 2F7SA 4DHEA 4P4UA 1MABB 2IEZA 1II0A 4YMUA 3VMFA 4PO9A 3B9PA 3G0HA 2GETA 2J3EA 4B33A 2R2AA 3KFVA 4CYMA 1XD2A 4AY2A 4PAQA 3CKLA 1P75A 2FSGA 4HZUB 1XEWX 3FKSA 4DUGD 4RD6A 1KO7A 4HLDA 1S0UA 2FPLA 4OL0A 4PHTA 4RD2A 5JWHA 4CVNA 2IS4A 5CLQA 1Q20A 4BLRA 2QSZA 3AVXA 5JS8A 1QHIA 3X1ZA 3TMKA 1M7HA 2G1JA 2NGRA 1MKYA 2X2FA 3M0EA 4IOLA 4NDZA 1RE0A 2WBLC 2D7CA 4WW0A 4E09A 2WWWA 2WJHA 3AF0A 3MWJA 4PSKA 3W6OA 3TUZC 2NZJA 5EE9A 5KUTA 3B2EA 4MRRA 1KHTA 1KSFX 3OEHD 4A0GA 1P9NA 3PITA 2XXAB 1KK3A 3HR8A 1KI7A 2FJUA 1XMVA 1XTJA 3NEJA 1OXXK 2J45A 2VP6A 4A9AA 1N5LA 2FSHA 1DBSA 2HYDA 5A4JA 4C4PA 2W6JD 2IS6A 2P5TB 3H1TA 3PR1A 4OHZA 4AKGA 2FH5B 1SVWA 1YQTA 1OXUA 2C5LA 2F3RA 5FTKA 2BMEA 2R6FA 1GKYA 2I3BA 1XD8A 1YJ5A 3I8SA 3B1XA 1AZSC 4TLDA 5F3WB 2ZI5A 1XPUA 1KY2A 3LBIA 2V4ZA 4BPBA 1DARA 2WSSD 1E4YA 3C41J 3E70C 3L8ZA 3NXSA 5KU1A 4GSYA 3QE0A 1WBBA 1BIFA 2GA8A 2GTPA 3W6PA 3GLHB 4K46A 3GPLA 4HI0E 4DEYA 1T0HB 4LBVA 3LD9A 2D3WA 4QBFA 2ZI4A 1ZU4A 3KXLA 3WYAA 1T9HA 3ZIAA 3I92A 3LVRE 4AKEA 4D4JA 1FPMA 4FCTA 2HT6A 4YLGA 4BUJA 5J4HA 2O8CB 2VP0A 2ZSBA 4OHVA 2B8TA 1KNQA 4PHGA 5FBRB 1WMSA 5CYPA 1L4UA 2RGEA 1FZQA 1HT2E 1XPOA 3BORA 4Q21A 1HQCA 5EXSA 1ZUNB 4KYIB 1EWRA 1NVXQ 2ONJA 3EPLA 4AC9A 2AHOA 1XRJA 4URXR 1EX7A 3LQRA 3ZDQA 1EFUA 2A5DA 3Q8XB 721PA 5LDDC 3CZQA 3P26A 4Q4AB 1AM4D 4EJSB 4TLEA 5SZJA 3AGPA 4M9ZA 1OIXA 5JWRA 1GRQA 4R71A 1VCIA 1ELOA 1E9DA 2F9MA 2AWNA 3DOEA 1BO6A 3RVBA 3KDSE 1ZC4A 3GLHE 2IBMA 5BWMA 3CPEA 3OEEA 4BFVA 1IN6A 1FNNA 3WXMA 4IHQA 2QP9X 2O0KA 1Z6YA 3O8DA 1KO1A 3HPQA 1G41A 3PENA 3T06B 3PEYA 1W2HA 3VR3A 4P32A 3A4NA 3I32A 2W6IA 1EG7A 1KI8A 4M1WA 3AGQA 2BHRA 1DG3A 2HV8A 4GP6A 5HZKA 3WRXC 2IUTA 3CRRA 4JLPA 1G19A 4EPWA 2GCOA 4XWAA 1XU4A 2WTUA 2OBLA 2EYQA 1Z3IX 2IC5A 2QTHA 1WB9A 3C8UA 3CZPA 4JKYA 2KBFA 4UJ3A 1JXOA 4G5SA 4BFUA 1W36C 1GP2A 2JJ2A 2ONKA 4B35A 1Z6XA 3E2IA 4LYFA 4RVCA 5CM9C 5FBQB 1AK2A 3ZIAD 1SXJA 1D6JA 3AVQA 3B13B 2DB3A 2R6AA 1KSGA 3K09C 1KZGB 4EUNA 1EX6A 1YRBA 2X2EA 2CK3A 1CJUC 4ASUD 2QPOA 4WOPA 4K81B 3REGA 2CHQA 1CIPA 3AB3A 3W6NA 1RW4A 2YYZA 5EUMA 1WE2A 2KI5A 2ZVPX 1Z0FA 4KI0A 4CRWB 4TYPA 2BKUA 4F4JA 2D4HA 3A1WA 4Q7LA 3UIEA 4BQSA 1DPFA 1PUJA 2RGNA 4B3FX 2RGDA 1M2OB 1G5TA 3IILA 2JDIA 3GLFB 2GZAA 2RGNC 1UKEA 4NCIA 3ADCA 2V6IA 1E3MA 1ZINA 1VDZA 4KLZA 1Z08A 1G3RA 1OSNA 1Z5ZA 3B60A 3EAQA 1E0JA 1VYUA 5FFMA 1U8AA 2P6UA 2FA9A 5CJ2A 3QENA 4I99A 2IWHA 1NMXA 2IL1A 3WNBA 2OESA 2O8FB 3FHCB 3OEED 3FVQA 2OZEA 4MRSA 2OV2A 2QMHA 1XJCA 3BH0A 5SZHB 4H9GA 2ZYUX 1XZQA 1A5TA 1KSJA 3DM5A 4QJ4A 3D31A 4YXWA 2W6ID 1NN5A 1GKUB 3I73A 5FTMA 4EPXA 2ZRNA 4V0MA 3ADDA 4HUQB 3FYHA 2G0NA 1XEXB 1TNDA 2R8RA 3BC1A 3ZVMA 1S2MA 4KSCA 6Q21A 2JIZA 3NVAA 2RMKA 4Q4HA 1DAIA 5BW8A 1W36D 5JSZB 2HT1A 4BLQA 3EPHA 4XTRA 1X8KA 3PQCA 1P6XA 2G77B 2XNSA 2JJ2D 3GLFE 2VSOA 2EW1A 2GJ8A 2IYTA 3TVDA 4OI0A 2VP5A 4AG6A 1Q44A 3BB3A 3QY0A 1Z0AA 3RSLA 4UXJA 2G9NA 4NCJA 2CK3D 4TLAA 2IX3A 4CF7A 3AP1A 1IN8A 3LY5A 2FGKA 3OFNA 4M1MA 5LB4A 3VU9B 5KSOA 4RD4A 1IM2A 4TL9A 4EAQA 3A4LA 3BFXA 3IHLA 1XJ0A 5FTJA 3QKSA 3N70A 1YRAA 3A36A 2QENA 4IDQA 5KYKA 1DE0A 3WHLA 5B30A 1VHTA 4UNPA 1N6OA 3ZZTA 2JDID 1UBCA 2P0EA 1W4RA 2C77A 1XB2A 1AA9A 4IDOA 5J4KA 1KI4A 5JMTA 3NTUA 4HDOB 1O87A 1YR8A 4RCZA 3MG9A 2QROA 2MSEB 1M7GA 1ZM9A 1M7BA 1NVWQ 1KI3A 2AXPA 1SULA 2HYIC 1JR3A 1B23P 1S1CA 2BMJA 4TQUS 2JLQA 2OXRA 3TJZA 4DSTA 2DFTA 3OHMA 2C99A 3QUSA 1UEJA 3KX2A 4LV5B 3DL0A 1TF7A 3TQFA 4LC0A 3OZXA 5BN5A 5TMPA 3NBFA 4YXWD 1E2PA 2IHBA 1XBTA 1BYUA 3QQ5A 4JBWA 2J7KA 4KITB 2QBYA 4Q9IA 2BBTA 1ZNZA 3BFKA 2D2FA 2XJ4A 4ARZA 2HUPA 4EPYA 3ZS9A 3HYRA 1GNQA 2NO9A 5DI9A 3R7WB 4A82A 2XX3A 2JGNA 3EA0A 4W5JA 2KE5A 5LB2A 1Z47A 1SZPA 4QBGB 4CT4B 3AVTA 4O2RA 1JAHA 2F9LA 4Z8XA 2H7VA 2R65A 4LHWA 1GIAA 1GSIA 5DLQC 2FFHA 1ETUA 5KNBA 4MUAA 2C9OA 1DO2A 4KVGA 3ZJYA 4PX9A 2QNRA 2CLDX 2Z4RA 2QU8A 3EWAA 3JVUA 2Q9BA 2NO1A 1E9RA 2BCGY 5AUQA 2XZOA 1ANKA 3X2SA 3KXIA 5JRZA 3OFND 4MKGA 1ZMXA 4B74A 3GLGB 5AJXA 2VO1A 2SHKA 3GJXC 1D2MA 3SOPA 4ABYA 5K8LA 3CLVA 1JJVA 3NC1C 4LPKA 4DEXA 1YVDA 2ZS8A 2LKCA 2QPAA 3QXSA 4CIDA 3I4LA 5EZ6B 3CUEF 3WMFA 3CF0A 4TL6A 2WOJA 4OJKA 2R6GA 3WBJA 3QG5A 2J46A 4FW9A 4IDNA 4DZZA 2HXSA 4G3XA 3RS3A 3GEHA 4MRNA 3RRMA 1P72A 1OB2A 3DOFA 3U7FB 2XB2A 2VPPA 4L9SA 4C7OB 1KI9A 1AZTA 1JR3D 2ODNA 3RC8A 2F6RA 3JVVA 4BASA 3U2QA 3MWYW 1W0JA 1WF3A 2GZDA 4QKQA 1GUAA 1GZSA 2XB4A 4DDUA 1ZC3A 4G5OA 3A1UA 1T6NA 1JQJC 1LW7A 5BYKA 2Q9CA 1NMYA 121PA 1OH6A 1E9BA 1KI2A 2QQ0A 3P32A 4HEJA 4QM6A 3BH6A 2IYUA 4PO8A 2ZSFA 1E6CA 3K0AA 2C03A 2ZRHA 3I8XA 4KU4A 1Z0IA 3WMEA 3WYGA 1PLLA 4Q01A 4TL8A 3RRYA 4Z8YA 2GKSA 4TMWA 3B1ZA 5GADl 2DYKA 4QL3A 4I1OA 2ZJZA 4ZKDA 1G8YA 2IXGA 1IJFA 1F60A 4XIGS 2FU5C 3I5XA 2J59A 3VNUA 4Q5IA 4IRUB 1JR6A 1D2EA 4QBIA 5J4YA 1MR3F 2WPDA 4FWTA 4HDQB 1LV7A 1TQ2A 2QP3A 2WAYA 4AYXA 2BOVA 3SFZA 5L3VA 1OT3A 2ZU0C 3HPRA 1F3OA 5IT5A 4DT1B 1ZAKA 3CWZA 3X1WA 1V43A 3ONWA 4M2LA 221PA 1DAEA 2O0HA 3I62A 3SQWA 3K0SA 3HP1A 1W49A 2BBOA 3KKQA 1R0YA 1H8HA 2VTKA 4LJ6A 2F1RA 4AKIA 1T8TA 4D4KA 4ZI3A 1W0JD 4LBYA 4ZDJA 3MRSA 2EWVA 5TY0A 3LXRA 1NRJB 2OO7A 2VBCA 1DADA 1SHKA 3DHWC 3MGCA 4GNKA 3RNLA 1W2GA 5A5GA 3GQBA 2TMKA 1XZPA 2GCNA 4FCVA 5E95A 1ZCAA 2PCLA 5FOTA 3Q5DA 4NYJR 4DSUA 3KXKA 2W2TA 4RZUA 2GVZC 2CNWA 3AEZA 2QAGA 2ZXUA 3V4RA 2O8DB 4B3XA 3K0FA 1W47A 1QRAA 2ZETA 2QAGC 4EQ6A 4IEIA 4I1UA 5TDHA 1CF4A 2C96A 4UNQA 4BZPA 2AR7A 2GJKA 4FCWA 4DKXA 1U9IA 3QXXA 4V0OA 4R2HA 2F1HA 4HAVA 5TVKA 2R62A 3CRQA 1U9IC 2ZJ2A 1J90A 4RD1A 2J0SA 1YZQA 2NO7A 4C0AC 1SKQA 1BMFA 4GRAA 4DLWA 4HLUA 1P62B 1P2VA 3Q5EA 2RKOA 2IW3A 1W44A 4HLUC 1OH5A 1Z6GA 3WY9A 1OF1A 1KDPA 2CJWB 3SQXA 3EZ9A 3BAFA 1G8GA 2XJ9A 4PSAA 1G8PA 3R9IA 2OILA 4UJ5A 3U4QB 1QVAA 3A1VA 3EARA 3LLUA 2PMKA 3IBYA 2A78A 4I1SA 4E22A 2NOAA 4QGHA 1ZM4A 4JJZA 2I4IA 3DKPA 2WJIA 2R6CA 5FUVA 2QM8A 2QZ4A 5F98A 1E9FA 4ZCIA 2FN4A 4QC2A 1TQDA 3B9QA 1H8HD 4TQAA 3PUZA 1RKBA 2ZJ5A 2CLSA 1VG9B 3BFVA 3X1XA 5CDFE 2WICA 4A92A 1XCPA 3CW2A 4OYHA 2FEOA 4ZO4A 3CF6R 2XEXA 1ZVQA 2FWRA 3NEYA 4HB4A 2LWIA 4XOIA 2J9RA 1Z29A 3B85A 4B3CA 4Z51A 4NYJQ 1KDTA 3IPXA 5TV2A 5JHHB 1KK0A 1KDRA 2ZR7A 5ELXA 2ZM5A 2W83A 4U5XA 1R0WA 1ZD1A 2QL6A 4LDJA 1YE8A 4B3DA 3QF4A 1CJTC 3TW4A 1BOFA 3EWSA 4U00A 1GVNB 1UDWA 3ZGXA 3QKRA 3B8HA 5JWOA 4MH0R 2P6NA 4XSGA 1NN3A 1N2CE 4PPFA 1VYTA 2YHSA 2BC9A 4NE2A 5FR2A 2EWWA 4A2PA 2QAJA 1LY1A 2QG6A 3N5CA 1BMFD 1OIVA 4GOXA 5E7IA 1O3YA 5JEDA 1SVKA 1SKYE 2V54A 1ZNXA 2GAOA 5CB8A 1GAJA 4AIIA 2W2XA 2PJRA 1XCGB 2ZJYA 3THOA 3ZZUA 1HV8A 4AWXA 2Z43A 3K70B 3RS5A 3UKDA 1JPJA 1CJMA 1SQ5A 2Q21A 4ZPXA 2WVJA 3AUYA 1D2NA 4CW7A 4RKFA 1SGWA 2NTYC 3TKLA 4Q4LA 4XWOA 4D25A 5JJKA 1UJ2A 4BRUA 1P7CA 1TUIA 5CYOA 1ZM7A 2ZJBA 2QMUA 2OFXA 1GL6A 5EP2A 2UZ3A 3D3QA 3D8BA 2DWOA 1YZLA 2H18A 3T61A 1E2KA 4US1R 4RZ2A 2QT0A 2V7QA 2HXYA 2ZSDA 4V0ME 4DCSA 1NLFA 4Q4JB 1TAGA 2ATVA 4FMCF 4JBYA 2WSMA 3KJEA 5IHPA 4OHYA 4YONB 3PUYA 4IJMA 8OHMA 3KUCA 2BBWA 1W48A 4CZ2A 2VLIA 4UXIA 2PX0A 4Q9LA 5C18A 2HLDD 2ZRJA 4PQYA 5JJIA 2AD5A 1VIAA 3NHBA 1DVRA 2B7CA 1QHHA 1G3QA 2FX3A 2RGXA 1GOTA 1E4VA 2WWXA 2JLWA 4Y0AA 3BWDD 5GJVC 1NL3A 3T5GA 1QF9A 4G01B 4YMWA 2EFCB 5KNDA 3FHOA 2J7PA 4JLVA 5HZHA 4X8OA 1OJLA 2KWIA 3SJCA 4IVRA 3CONA 1SVSA 4RKEA 1II9A 1QZXA 3C7KA 3KQUA 2QGZA 1PV4A 2J0VA 3AVOA 5JI2E 2ZYVX 4JVMA 2IWRA 2GESA 1CR2A 4EPRA 4ACBA 1E96A 3U7GA 5F9HA 2IA5A 1G4AE 3KQHA 1CBUA 4DSOA 1DAHA 3UMRA 1YR9A 4TMXA 3ZVNA 1G291 3U44A 4A8JC 4CEHA 1VKJA 1KO5A 1BH2A 1AQYA 2PZFA 3F0TA 4FI3C 5HCIA 4B76A 2WM9B 5GJCA 4RY2A 4OK3A 1FL9A 1JR3E 1UM8A 1NG9A 1GDDA 1US8A 3H84A 4WA7A 2QQEA 1FW6A 4AD8A 1NN1A 1U98A 3B82A 1Q1EA 2XNDA 4A15A 3THXB 1TL7C 2OCBA 2VF7A 3ZVRA 1OV4A 4WVFA 3VX3A 1S9HA 2YJTD 1YKSA 1TQ6A 3D7MA 1UDXA 2ODEA 4WZ6A 1T0JB 2GJSA 4WXRA 2IYLD 2BVNA 5F9FA 2WOOA 5B57C 3QF7A 3BB4A 1IAQA 4B43A 3DO6A 2IF0A 1FFHA 3Q7QA 1A4RA 2C95A 4MGZR 821PA 5JS7A 3EIEA 5KHOC 5BQ5A 4N0EA 4LOAA 1KI6B 1G9XA 2PCJA 4A4DA 5EUQB 1R0XA 2CVHA 1X3SA 4LI0A 3VAAA 5FH9A 3THYA 2JATA 2VHQA 1E94E 4BEJA 4WZBE 1GKIA 1DAMA 1JALA 1Z6AA 3G5UA 1P9WA 1WCV1 4XH9B 5DHFA 5GVSA 5B2ZA 1P2TA 2B92A 4J0QA 4TSFA 3X1YA 4Q1FA 3SI7A 4Q03A 3FHTA 2VEDA 1PUIA 3B6EA 1CS4C 1QG2A 1RIFA 4DIDA 1RRPA 1OKKA 1OHHA 3L0PA 5JRJA 4A0HA 3NBYC 3L82B 1NF3A 4TTQA 4WAUA 4GOKA 4D81A 4EPTA 5L3QB 2QGNA 4KVAA 1GRRA 4M1OA 2GF9A 2RCNA 2Z6VA 4HDCA 3LRPA 2OFOA 2GDJA 3BD9A 4OQXA 2GAAA 1D9XA 2RHDA 2FV8A 2C9CA 2UZIR 3AF4A 4IOMA 4TMZA 3VR2A 1LF0A 1OXTA 2P2LA 3FKSD 5IRCD 4B6EA 2QMOA 3DVLA 4OJQA 4NTZA 4KSBA 4XJXA 2YOFA 3CO5A 2ANBA 5JBQA 1CJVC 3C4JA 4Q18A 4PHFA 2V1XA 1KMHA 3AKCA 2DPXA 2H8KA 2EU8A 4IFEA 3GLIA 1FOEB 1IY2A 1EXMA 2ZUDA 1K6MA 2VP9A 5LD2C 4BEBA 2W0MA 4MYCA 5CITA 2Z83A 4B75A 5FUXA 4BLPA 1E1RA 1EGAA 4URVR 1S96A 3L2OB 5FOXA 3K9NA 1IJEA 3QVUA 2GXUA 4L5BA 4LJ8A 4NONA 5H70A 4DC9A 5J40A 1FX0A 5HPYB 5CK5A 1ZNWA 1E9EA 1ZBDA 1JQLB 2AXNA 2FG5A 5G40A 1G5PA 4DRZA 4KHZA 1L7VC 2YNMA 5CIWA 2G6BA 4C9BA 4QHSA 4TSFD 1I4DD 4LK2A 3K0FB 5FOUA 2ZRAA 3HDTA 1RC8A 2BEJA 2J0UA 4OI4A 4DWJA 4E07A 4MGYR 1M6NA 1X8LA 2ERYA 3WRYC 4PC1A 1JPNA 1OKKD 1OHHD 1PZNA 3RS2A 3UATA 2AKAB 4YDSA 3L0IB 2Q3FA 2BCJQ 3ZLJA 3R9WA 4PZLA 4JSTA 4B2PA 1KYIA 4D6PA 5J4VA 1YZUA 3IO3A 1ZCBA 1XEWY 3U3KA 5DIFA 3K9HA 4D0LB 1HY3A 1OIWA 3BK7A 2MSDB 1LB1B 4FWIB 3T35A 1E0SA 2D2EA 2ZRCA 3MD0A 3GJ5A 4GPTA 5FL3A 3U60B 2EFGA 2BM0A 1NKTA 4Q7MB 2ZJAA 3UANA 4LCBA 3HWSA 4DLSA 4C0KA 4JL6A 4A8JA 4ESVA 4L9WA 4FMDB 3NKVA 2AD1A 3PEUA 2Q3MA 4KBGA 2WAXA 4B44A 1Q21A 2HJVA 2PX3A 4NZYA 1ZP6A 1XCMA 3K9GA 2P65A 4QJ5A 4LBZA 1S3GA 1VHLA 1XTKA 2ZRIA 3UMFA 5FI1B 1SXJC 1F2UB 5AUNB 3S1AA 4A0FA 3RANA 3RSOA 4BRWA 2ZTSA 3EIQA 3MFYA 1LF5A 2FZ4A 2VHJA 4EFLA 1XXHA 1IONA 2J87A 3THWB 1OPXA 3EA5A 3W5IA 4GZLA 1S9DA 2GJ9A 2GXQA 4DDWA 2GEVA 1E1RD 1XWIA 1YZTA 4CEIA 3EW9A 2OLKA 1GFIA 3GCGA 3UPUA 1H65A 2EVWX 1Y63A 3TAHA 1AGPA 4BLSA 2GEDA 5FOWA 1E0KA 3I72A 3KKOA 1A7JA 4P3YA 4OHWA 3QPWA 4TYNA 1XTRA 4CEJA 1LVGA 3SBEA 1OYWA 3WHKA 1UKYA 2Q9AA 1OXVA 2DFLA 2WJGA 4V0LA 1N0WA 2J5XA 3VR6A 3SZRA 4W5WA 2F43B 4NL4H 4G5RA 2OUKA 3RAPR 1M1YE 1Z2AA 1IN7A 4LX0A 1SHZA 4NKRA 1R5OA 1SVIA 4LJAA 3PXGA 4FIDA 2DWPA 2PZGA 4M8NE 1N6RA 5D3MA 1TF2A 2NIPA 2XTNA 5CM8B 4DLTA 4MYUA 2WMOB 3BE4A 1RJ9B 2FGJA 3GJ3A 3ZQJA 3WP1B 3CX6A 1VTKA 2QUZA 3LWNA 5FBVB 3Q85A 3TIFA 3SYKA 4NU0A 3NDBB 3OIVA 1WRBA 4TWZA 1G64A 2C04A 3T1QA 3BH7A 4D2IA 5H8WA 1UAAA 1SXJD 4RFSB 4JT2A 4BFZA 1CR1A 2HF8A 4Q19A 5L3SA 1KO4A 3NBXX 4W7SA 3PUWA 1JI0A 1HYQA 5EZ5A 2D7DA 3AVPA 2KBEA 2ZE6A 4P4SA 3W34A 5B58C 2O8EA 4AYTA 4FD2A 5JHGB 1N5IA 2VQSA 1XX6A 2JJ8A 3SFVA 3V9PA 3QNUA 1UFQA 2V3CC 2IYZA 1E2JA 1KIMA 4EFNA 5KDDA 1TEXA 1Z07A 2GF0A 5CIQA 4DB4A 2WHXA 2PLRA 4KYUA 1J70A 4URWR 3CR8A 2ZEJA 3AP2A 4PQFA 4Q1AA 5UKDA 3LX5A 1FUUA 621PA 4X8LA 1ZNYA 1E79A 4YC7A 3E1SA 5DI3A 1E69A 4DLVA 1N6PA 2VHCA 5DH9A 1Z63A 3DDCA 3O47A 2GJAA 3TGPA 4XTCS 3AQ4A 2FPMA 5AJWA 2XOKA 2GXSA 2VF8A 3LBNA 4UNSA 5H68A 4MYTA 2JLZA 5AUOB 3SHFA 3QVVA 3MLEA 4M9SA 1U0JA 1XTIA 4LWZA 1ODFA 3KTAA 3TR5A 2W00A 1CRQA 1HQYE 2JIZD 1T5IA 4FMCB 4ZIRA 3IBGA 2MSCB 4LJYA 4F4CA 1NIPA 4B6FA 4R7ZA 4AI6A 3SE0A 4WIAA 4HB0A 3GJ0A 5EXPA 3FKQA 2QN6A 1E2MA 4LV8B 1EWQA 1U90A 1ZUIA 3HU3A 3ICQB 1Z22A 3T1VA 3TAUA 1WP9A 2AFIE 3VKGA 4A6XA 4LHZA 4BFSA 2HJGA 1QG4A 1NP6A 2P67A 4XD7A 1PJRA 5K8UA 3SEAA 3BJIC 3QEJA 4US2R 1Q0UA 2FOLA 3FMFA 2FZLA 1KTVA 1XD2B 1DAKA 3R9XA 1G7RA 1R7RA 3CNOA 1U0LA 2GRJA 3SNHA 1XTSA 4M1KA 4D4LA 1N5KA 4XSHA 5BN4A 1KKMA 3AKYA 4C0HA 4MDEA 2ZE5A 1OYYA 4OQLA 4S35A 2R9VA 2OG2A 1IN5A 1HUQA 3QPUA 2DWQA 4BFWA 1MO6A 1TTTA 1QVRA 5KO2A 3TRFA 2A3RA 1ZM2A 3DMNA 1U81A 1F2TA 4E03A 2EFHB 4QNRA 1TMKA 2F1JA 3GP8A 1R2QA 3NC0C 1LS6A 1MABA 3BGWA 4TL7A 1E79D 2IXEA 3TR0A 3FMOB 3EZFA 3RLFA 1G18A 5KDOA 5G3ZA 3U7HB 2RGBA 3O8CA 5KDLA 3CNLA 2AX4A 4LHXA 3ASZA 2CE2X 2WIBA 4HZUA 5FBWB 1KDOA 5EE5B 2GWHA 4KFRA 2RAPA 3CR7A 2NO6A 2XOKD 4EDHA 2G83A 3K1JA 3KB2A 1RYFA 1P3JA 4PZYA 3VTKA 4C2UA 1VYVA 3P1JA 3ADKA 4GFDA 4KO8A 4F4IA 3NWJA 3RABA 4EPVA 3FFBA 3LX8A 3IIMA 2DCUA 4IOJA 3UMSA 1CR4A 1T4GA 2WWGA 3LDAA 3W90A 2ZE8A 2BV3A 1YR7A 2ZUBA 3EZ6A 3ASYA 2ZI6A 1KJWA 1VIYA 3L0OA 1KJZA 1G3UA 3PVSA 1AN0A 1MO5A 5EJEA 2ZITA 4MITA 4Q1DA 3I1FA 3DM9B 1FP6A 4BLOA 2NZ8A 4QHTA 4EIWA 1AGRA 4DLZA 4XD7D 2OCPA 5HTKA 2QTFA 4BLTA 3ICEA 1UADA 4JS0A 2YINC 3ZD7A 4MKIA 4EFMA 4C0LA 3V00A 2AK3A 4O2LA 2Z0MA 4X8MA 4CT5A 1XMIA 1MRNA 1Z0JA 2OBNA 1M8PA 5LPNA 4TYYA 4GMDA 4LGMA 2ZPTX 4LC1A 4NYIQ 1HT1E 1A1VA 2QSYA 3K8YA 2QORA 3ZZ0A 2QPTA 4A2QA 2CLCX 1EFTA 1IY0A 1YU9A 1NMZA 2FF7A 1CXZA 2WWFA 4OHXA 5D3QA 4B34A 5LD2B 4JVNA 1XP8A 3QXHA 4JJKA 4MQBA 1MOZA 5EE3A 3GLHA 4GZMA 3IPYA 1FTNA 1KGDA 1TQ4A 4OK6A 1DOAA 4LYJA 2Y8EA 1Q1QA 3P4YA 1Q1BA 3VX4A 4RCYA 4IDPA 4MKHA 5C2JB 4FINA 3W9YA 2O8CA 1FX0B 3NDPA 2Q6TA 2ZAMA 3OF5A 5DHAA 4BWYA 2ZRMA 2NQ2C 5F2EA 1A2BA 3EC2A 5GVRA 3PG5A 4ZCLA 1WA5A 4PSVA 1B0UA 2CCGA 2GK7A 2WJYA 4FMDF 1Z83A 2YWGA 1IBRA 1P73A 2IYQA 3AH8A 3MCAA 1OFUX 4JYCA 3CF2A 4JVSB 2J0UB 3U6KA 1VG1A 4E5UA 4JL8A 3UXMA 4ZDKA 4YMTA 3ZVLA 1VCMA 4Q4AA 4EJSA 2WWYA 4IDHA 1CJKC 5C1BA 4QJ3A 3SR0A 2IYXA 4EJSC 2GCOB 4GOJA 4B47A 4I1VA 1Z2CA 1W36B 3IIJA 2LCFA 3ZH9B 4XVUA 1N0UA 3SDZA 1KAOA 3QXCA 2BMDA 4UQOA 5KPDA 4NPHA 1G17A 2WPDD 5HR5A 4M21A 2B8WA 3U3MA 2FDCA 1SXJB 2VP2A 4R98A 4DDTA 2ZYWX 4C3ZA 3RWOA 5A0FA 2AKYA 2ZUCA 3SBDA 2WMNB 4JZKA 3W3ZB 3KJHA 1R5BA 3CIOA 4I4LA 3CB4A 2FPKA 4JLDA 3U7EB 1I4LD 2KJQA 3BERA 4NH0A 1VMAA 4QNMA 3CPHA 1J2JA 3LBHA 2UKDA 3AM1A 3GJ8A 5GJBA 4M4SA 4M0LA 2MMGA 3QPVA 4Q02A 4BZQA 1JNYA 1FMLA 4Q1BA 1SKYB 1KO8A 2ZIAA 1OW3B 1W4CA 2OEPA 2G1KA 4HATA 3L43A 4JLJA 1ONBA 4Q9HA 4W9MC 5FR1A 1LNZA 4Y0VA 5KNCA 4C0SA 2IYVA 4QBHA 4XVRA 4MDFA 2CEAA 2VA8A 2ODWA 3FOZA 4MYHA 1TX4B 2FE4A 4BFYA 3BB1A 1CULC 2CNWD 2VP4A 4JKIA 1L4YA 1HURA 3A1SA 1SXJE 1JECA 2PJZA 5JECA 1KZ7B 5JCPA 4GT1A 4GP7A 3GLFA 1V5WA 3B1WA 4OBEA 2XGJA 1W4BA 3C16C 3MJHA 3K0CA 3KKPA 4LYHA 4PO1A 3DEFA 4Q4HB 3REFA 1E9AA 1GNRA 3K0CC 1MH1A 4PC3A 1XXHE 2X19A 2ZE7A 4LHYA 2O8FA 4FXPA 4D26A 2GZHA 1F48A 1RFLA 1SVLA 2XTZA 3LV8A 1Z8FA 2YWEA 5AJYA 4HSEA 4QGFA 1E0AA 1IQPA 4L4UA 2ZRBA 4WZAE 3LVQE 2OXCA 5IDVA 4HUQA 1XEXA 5IF9A 4KXFB 4A36A 3C5CA 1GL7A 4AKHA 2V1UA 1I2DA 2DFNA 3QKSB 2DR3A 5JSZA 2Z5FA 4LUCA 4II7A 2IXFA 1JJ7A 3A4MA 3AF3A 2IS1A 3TK1A 2YV5A 2CBZA 4ON9A 3EPKA 1G7CA 4DXAA 3VHLB 3AKDA 4V02A 3ADBA 1FTSA 1KMQA 2DHRA 1T3LA 2VRWA 2ZROA 3RS0A 2HCBA 2EQBA 1OXSC 1OB5A 4PC7A 3VU9A 2YOGA 1XD9A 3SU8A 1PLJA 2DFKB 1XJQA 3CH4B 3HJNA 4Q9KA 3IIKA 3ND8A 3KB1A 1Z06A 1U94A 1X1SA 1ZUHA 1JAIA 3JZMA 3U3RA 3MAAC 4P4TA 4TTRA 4MKFA 2ANCA 3IO5A 2I1QA 2PEYA 1D9ZA 2GK6A 2D62A 3KQKA 1UPTA 2DBYA 3IGFA 1KNXA 2QBYB 1W5TA 2HCJB 2ZJ8A 4ARZB 3SJBA 3OEHA 3LW7A 1N25A 1BYIA 2ORWA 4L16A 4IVPA 2W2VA 3MWKA 1UKVY 2YKGA 5KSZA 4LY6A 5KSPA 4WBSA 5FPSA 2A5YB 5M04A 4TYQA 4Q9JA 2X8AA 4IEEA
chains in the Genus database with same CATH superfamily
1AUQA 3RV4A 2P75A 2P2NA 1WUJS 1Y9JA 3H1FA 3CH5A 2OM2A 3GJ4A 4EJ6A 4JI2B 3UC9A 4RQBA 1OFIA 2G17A 4GLOA 4KUHA 2OORC 1VFNA 4Q1EA 3OOJA 5CX1A 1Z4JA 1PN3A 2QRNA 2WKQA 4M9UA 1XFAA 2V03A 3TSOA 1BGVA 4I5IA 2V55B 2CL5A 2NU6B 3KPUA 1CLEA 1CK4A 2BDTA 4ZV7A 1KFKB 3BAZA 2VQDA 2VK8A 4QGAA 4JR1A 4B84A 5BXQC 5IU6A 1KY5A 2B21A 2QTCA 3QM1A 2O5RA 4AWAA 1LJLA 1XRMA 2GNOA 1FFAA 1Y6JA 1OVMA 3CLSC 4JSRA 2BTOA 2SCUA 4HH4A 4PEVA 1UBEA 4JXKA 5JQWA 1L7RA 3KOMA 3CJRA 3HKBB 4BNYA 1U1EA 5HGXA 4DMKA 4TRNA 2C7OA 3QVMA 3D7KA 4ILKA 2CKDA 4P35A 4HJXA 4QASA 4BCDA 4G0ZA 1GTZA 1N6HA 1COWA 3VNRA 1D6SA 1RAEA 1W5FA 4KLAA 2FDXA 4NZPA 4ZQHA 4F91B 5J5CA 1VJTA 3TB6A 4X20B 4B82A 1XMPA 1KK1A 2A7QA 2MWMA 3BBPA 3QHQA 5FOQA 1JXQA 1QIMA 3HJBA 4II2A 3GLGA 3PQ6A 2H07A 1QK5A 4PZAA 4NE7A 2O4UX 1DWPA 5EXDA 5KNDH 4NULA 2X77A 2JCSA 3QBEA 4CODB 3OX1A 1V48A 4FGSA 5DT2A 3S1LA 4BQPA 4CKCB 2I91A 2TECE 3BIFA 2AFHE 3CBQA 1C30B 2DH5A 5BSWA 5B5SA 2OAQ1 2XGMA 1BKDR 3OMLA 1G1AA 4QOSA 3CZ5A 3K0AB 1EWKA 5FCDA 1HRKA 2DG2A 2ZREA 3HFSA 3Q88A 1LI7A 2JEZA 2PTGA 2R97A 3OOEA 4LRTB 1ISMA 2FR0A 4I1IA 3UMCA 2W93A 1JU4A 2EZ4A 4N82A 3BRSA 1UDCA 2NUBA 4QAJA 4FGWA 1JSLA 1WV1A 1XZCA 2YMLA 4KLNA 5FUWA 3EDYA 3IKJA 4U3JA 2QVLA 4WNAB 3O91A 3TH5A 4RK4A 1FW8A 1C9MA 4DIOA 1YB6A 2IP2A 4RF3A 1PT9A 4PBRA 1JYSA 3VISA 3QK7A 1T2EA 4I5EA 5CA0F 2FB9A 2QP4A 1DELA 2QY9A 2OBBA 3D6AA 4HO1X 4PLGA 2AXEA 4ETWA 2XNDD 3RC3A 1UXGA 2O8NA 3CJQA 3FOAA 5AVJA 2CXUA 2DT5A 4FKMA 1NSFA 1B16A 2B6HA 2Q41A 1YACA 2OHFA 4Q3EA 4BWVA 4Q93A 1VLLA 1EG2A 5FOSA 3UTCA 4PX5A 1KWKA 4IXDA 4CTOA 3UCFA 3HADA 3OZAA 3DF9A 3DMFA 3ETLA 1DIRA 2MMCA 3RYHA 4COKA 4D82A 4OSOA 1TZMA 1EJ6A 1NU8A 2QVGA 2ZYTX 4V2IA 1NTRA 3V32A 4EG3A 4EGAA 3MOIA 3DTTA 3L46A 4JLNA 2PTHA 4U7HA 1GA6A 1XMOB 4A2WA 4L7QA 2ET6A 3EXHB 2CBXA 2G9QA 3S6JA 2R6DA 5DJ5A 1ZVKA 3CCFA 3KQYA 4MKZA 1GQOA 4MYDA 4C4AA 4DNPA 1A4XA 2JRCA 3D4OA 1TKBA 4KPGA 1IHXA 2JHGA 1ORHA 3H83A 3W8DA 5B64A 2G88A 2VSXA 4LRXA 5CM2Z 1WDTA 1CZHA 3ZU6A 4EOGA 5IX8A 3SKVA 4UE2A 2NU7B 4WT7A 2IU4A 1E92A 2QAGB 4YX9A 4G23A 3VR0A 3Q9LA 1R64A 1IN1A 4Z86A 4EQ6B 3NLLA 3A6ZA 3QYJA 2HC9A 3TBHA 1K6IA 5D00A 2G1UA 1ZLYA 2RSLA 3O9ZA 4KAFA 1XEFA 4RPLA 3DMTC 2IYPA 4UHBA 3IFSA 5F5XA 3RASA 2WQ6A 1PGQA 1XDBA 2V6GA 2WUDA 1JG3A 1TJNA 2ADFA 4KB5A 3PX3A 1OU4A 4XWWA 2R3SA 4G0PA 3VR1A 1OFHA 1XDUA 3I2GA 5K0NA 2HNKA 4HFNA 2PSSA 4JL5A 1T8YA 4YRGA 1S4QA 4OOFA 1YZGA 2AI2A 2O8DA 2W58A 4PLFA 4ZVVA 4X00A 2NZYA 6GPBA 4F7WA 3E0XA 1LTKA 1G1MA 3A8TA 2XEDA 4BECA 3PQ4A 3D8UA 3RYCB 2J31A 3GRZA 3HXTA 2H9AA 1U0OC 1QYXA 1ISHA 3ZV3A 3ZHUA 5BP7A 3LQ4A 1BG6A 1YE5A 4MV5A 4HH0A 2I7XA 1E5QA 2HLPA 2QJWA 2ATEA 4NOMA 4X7PA 3AP3A 3PHHA 5EMNA 3RG8A 3FFXA 3HMQA 4GYWA 1Y3AA 2YHIB 1HLFA 2H00A 4ZV9A 4PPGA 5EIBC 4Z4IA 2AG8A 1PU2A 2PT6A 1QGUA 2GPYA 4Y2SA 3D2CA 1TOAA 1ZX1A 2GTHA 2CD9A 5K0FA 1NC1A 5L3RA 1Y8RA 2FPPA 3C14C 4KRGA 4X1YB 1A7AA 1YVEI 1AKYA 2P11A 4J0GA 2MCFA 3TVTA 3QJYA 5ANRB 1QP4A 3MLAA 4CL2A 3H2GA 2P7HA 5HE8A 3ZW7A 1D5WA 4L9RA 2ZWPA 2XQJA 5LYYA 1SRQA 2WWTA 4ENUA 2BUCA 3TZLA 4DLBA 4QXRA 1ZIDA 4CF3A 1STOA 1V16A 4IICA 1U8CB 5CCBA 2JLXA 2R6JA 3L1JA 1Z8NA 2JA1A 5DGXA 5BVGB 3WADA 1IHUA 2VPZA 4NYMQ 3RSQA 3VOTA 3SHQA 1N9KA 2FLWA 1IK6A 2JCVA 2PL1A 3M2PA 1OLOA 3I5YA 1E1QD 3QVSA 3IV6A 3ZJTA 8LDHA 2R5FA 3F6PA 3RDPA 4QELA 4YGXB 1UJNA 1WJGA 4OCZA 2CKMA 1EESA 3LO5A 2OQIA 2VNJA 2EJUA 4D44A 4EGSA 1IJBA 4OX9Y 4DMUB 2CHVA 1BJRE 1EFHA 5BXYA 1RYDA 1OREA 2PH1A 3BDAA 4R9UC 3RVNA 4TLCA 1G21B 3NR2A 1B14A 2ZK7A 3BJEA 3W5JA 2BM1A 4F6RA 4WE3A 3N9IA 2F3TA 2G9ZA 2VRCD 2VNIA 4WKGA 3SX0A 4PC2A 4ZI7F 5HKKA 2DQ4A 1XRSB 1E2LA 1E2FA 1XTBA 1RXIA 1L5HA 4OF4A 1PJLA 3AF1A 2PPLA 2G5GX 2FFAA 1EFRD 4KIFA 3NONA 4Q3DA 4V03A 5ER9A 2OB1A 2XDQA 1E2BA 2P9EA 3A1FA 5H4HA 4U39A 5KOHA 2EP8A 2JBAA 3KOOA 4UBKA 2GAJA 2OAGA 4QUAA 1RADA 3KG2A 2V58A 2NAFA 1PT8A 2ZR0A 1JP7A 3ZWVA 1TU4A 3KSRA 5EJGA 1NV8A 3PZRA 3FDXA 1EZ1A 3QVJA 5CT4A 3NIBA 1K98A 3B3AA 1PNVA 1NPYA 4WOBA 1EFVA 1WAMA 3A1EA 2K5UA 5A5FA 2GZ3A 1G3MA 3LHDA 3WISA 2AL7A 1A9ZA 1NY5A 2ZJ6A 2HY7A 3ZCVA 1E99A 3IJPA 1E4EA 4JMPA 2BEUB 2C3UA 3F5FA 1XF1A 3IXMA 3IDZA 2ZRKA 1GGEA 3UG7A 3VR6H 2IXDA 3BHNA 4ZK6A 2CLFB 3AW8A 4PXAA 1R5NA 2RGCA 2WKSA 4G5GA 5L3ZA 3WAJA 1CG6A 4WXYB 1QBGA 3UUWA 1QHHB 3MTQA 3Q72A 2YJZA 3P20A 2ZJFA 1K8ZB 3PPYA 2NNWB 1CFJA 2ODPA 3L1UA 4UUMA 4DIBA 3WLFA 2C1ZA 2XVAA 5EE3A 3RHFA 3P9ZA 1K3UB 2BFDB 4NLLA 3G0OA 2CNDA 3H13A 4WBNB 2PGNA 4NBVA 3D59A 3FSGA 2P2CA 4URHA 4RKQA 3PA8A 2PMFA 5PGMA 4FHZA 2QUJA 3CG4A 1EPUA 4A16A 4MUMA 4MRMB 1QAMA 2X1VA 3KT8A 4I9GA 1QH1B 3I4CA 2IRWA 3KT6A 4FHEA 4N1AA 5THQA 3VDQA 1CQXA 1U31A 3IHTA 3I3SR 4G6ZA 1JHUA 2JASA 4MUXA 3W1WA 4YRPA 1M0EA 4Y1EA 2CCJA 2E2WA 5A4DA 3P52A 4IKEA 3A4VA 4L0QA 5ULLA 1ZD9A 2P3SA 4P58A 2SKDA 4YJ3F 4AY5A 1QZTA 3FYDA 3BXEA 3FPEA 3G49A 2QLMA 3M6XA 2UDPA 5H83A 4C29A 1FP4B 1X80B 3BXFA 4MWSA 1NBMD 3S2SA 1YRYE 4HK4A 4EB0A 2PKWA 3C85A 4B32A 2AWOA 5K09A 1NSYA 3N3BC 4MIOA 1WXDA 4CKEA 1D5CA 2X23A 2XIQA 3M5DA 4MHOA 3I28A 2XWQA 3FFAA 4UW9A 3EG5A 3VPSA 1V47A 2FPOA 2H9YA 2IYSA 3G0CA 4Q7KA 3TG8A 1RI5A 1YHNA 2KW5A 4C06A 1SNYA 1SCIA 3BMCA 3DLPX 4OUKX 1C3VA 1Q22A 2QYSA 1YA8A 3OO1A 1KRHA 1W8DA 2VVTA 1MC5A 2Q3CA 2X8JB 1Z6TA 3IYLW 3ZE2B 4CLOB 5CCEA 4YJ2B 1P9RA 5EWMA 1Y5IA 3GUHA 5DSZA 5B4TA 3C4QA 2HMTA 4PPNA 3AEKB 2FQWA 4QPPA 2X86A 3QW4B 1USKA 3IBFA 2CMKA 2W4IA 5L40A 3ZGYA 1KQFA 1NVTA 3RNOA 2BP7A 1LTQA 2ZTVA 2W2MA 3ZY2A 5FBZA 1ARZA 2R1TB 4TMTA 3FX2A 2O0MA 3UCEA 1TAHA 2H59A 4G5QA 1H8EA 5EJMA 4GKKB 1HETA 3NALA 3ZEIA 4M9QA 1AGNA 2D2XA 3CVXA 1H23A 5BPFA 5HRAA 4KK4A 5JIBA 1TFUA 3IS3A 3PQ8A 2G36A 1NURA 2GARA 4MARA 4E1BA 1IZZA 3DNPA 4G0VA 1U8YA 1O57A 3WGLA 1X92A 3GEPA 2RAFA 3AY7A 4LZWA 4UEKA 3OJCA 3OE1A 2JCBA 1IPHA 4AO6A 4X94A 4B9AA 4YMSA 3MUOA 5IYZA 4LRYA 5F1YA 5LIPA 3F1LA 3ZYCA 1KJYA 3J80A 3HA7A 1KOGA 5GOZA 1ZIOA 1NOKA 1TYCA 4FYMA 2F3PA 4QVGA 1G4UR 5FQNA 3WV5A 3EEFA 4IUYA 3SSMA 1YZNA 2IP4A 2Q4DA 4P31A 1EFCA 1C4OA 2I55A 4G0YA 1H9BA 3CXRA 1CD5A 2POCA 4BCCA 2P68A 4POAA 3X44A 4IIYA 3PNSA 3X0DA 4F38A 4HAXA 4AFNA 2E4ZA 4IJQA 3A31A 3IVXA 2CFRA 1UANA 1HMYA 3GLGE 3OE7A 5F2NA 1WCXA 4MWGA 1X7XA 4HXEB 1UKZA 3IC5A 4J94A 1UAGA 5A6SB 5JAMA 1NI4A 4L5AA 1BW9B 1DEKA 3WAGA 4G9BA 3LXUX 4U2CA 4L02A 1KYXA 1GZ6A 4WXHA 3L92A 3C5WP 4QUEA 2H65A 5SY9A 1KRXA 3OIUA 3V1LA 5MN6A 3HWRA 1C7FA 4O0MA 3SSNA 4KAXA 3DFUA 2ZG6A 1VHDA 3PFBA 3A6PC 3CVVA 2NTVA 5IN5A 3AJEA 1PF7E 3OQBA 1AY0A 4RV4A 1P2BA 1P4GA 2KSQA 1CY6A 3N0WA 2M6LA 4NMXB 1K92A 4BLWA 2VJLA 4H1TA 4J0KA 2GM9A 1JEQB 1LBHA 4EYSA 1ZK2A 4B48A 1FYFA 1NG1A 1NVAA 3DE1X 4KNWA 5E3IA 1SBNE 4BFXA 2O48X 2JLVA 2Q8PA 3PLRA 3G0BA 2IUSA 3IULA 4M1TA 3WWPA 3WLKX 3IKVA 1TEHA 3C6KA 5I01A 3JAKA 4BJ5A 2BGUA 2I6XA 3OKFA 3L8CA 2CDBA 4RKRA 1Q0HA 1ZY2A 2NNLD 1BEEA 1NZFA 1ZKDA 2O50A 3SC2B 1N5JA 3W05A 1Z4NA 2W2LA 3KVYA 5KKAA 5TS3A 5KHLB 3PEVA 4NCHA 4QYTA 3EGDA 4MVJH 5A62A 1ZUNA 1IATA 5EAIA 4IUDS 1QFMA 2FPGB 4UU0A 4MKRA 5HK8A 5K5EA 3CVYA 4QU0A 2IHYA 4C6RA 5MFZA 1EP1B 4BE7B 1FRQA 3L1HA 1B15A 2YIMA 1N8TA 2YV4A 3T7IA 1QV6A 2AYYA 1PD0A 3DVAB 3P2EA 4LCJA 2NPOA 4GICA 5FPTA 4GL2A 1BDMA 4QOGA 4BO8A 2WEKA 3TF5A 5K0EA 2Q8NA 3GCWA 3OQJA 5BUQA 1NNI1 2XADA 4EB6B 3OZGA 4ZZ1A 1RWKA 2ZRGA 2C9DA 1XZFA 2C5GA 3FIUA 4LVUA 5BMVF 2IV7A 1OH8A 5EPUA 1C8VB 4KNVA 1M5TA 3KFXA 4R81A 3QI2A 5LP6B 1DAGA 3KOWA 3PF9A 4TTPA 3WLEA 5KKCA 1II8B 3EF3A 4NU6A 5KVAA 3HK2A 2VHXA 3R44A 3IMGA 3U3DA 2AF3C 2CYCA 3NRJA 5EWJB 1G98A 4JB0A 1WDLA 4Q7JB 4TUYA 5ICEA 3D6FA 4BDTA 3FTNA 4A10A 4Z1MA 3F6RA 1QK3A 4GL4A 4WASA 4ES6A 5F5LA 2F62A 4QDTA 1YMQA 2CLKB 1R5JA 3A6DA 3E7FA 3EDMA 2YWDA 3L01A 4LYAA 4PONA 5DMXA 5B1SA 5LJLA 1AKEA 5HMMA 4RY8A 2MSLA 4B6OA 2QRZA 4Z9YA 3OESA 1NASA 2EFJA 4FKZA 4QPCA 5CD1A 4QECA 4C3UA 1J5PA 4GOOD 1XXHB 5AVZA 2UVQA 3PIRA 5HKBA 5EJAA 3BSWA 1FYEA 2PSEA 1ZJWA 1KEZA 2V96A 4JBGA 2R8XA 4OHUA 2PRYA 2L17A 4Y6OA 3IOCA 4XWTA 5IAEA 2CZQA 4PCAA 1NVUQ 1JKXA 3B5JA 1EB9A 2V6JA 1F6BA 3DZKA 1PHRA 1Z45A 2GPBA 3GEIA 3H0KA 4G1UC 1HDIA 3ET5A 4MR8B 2DUJA 2B69A 4MROA 4EEXA 4DPKA 2BONA 1OT5A 7YASA 1N2EA 3O0DA 4KR3A 4G1VA 3IUJA 4R8RA 1C2TA 1IEWA 3KSDO 4R1UA 3VR4H 4DCVA 4H1UA 4TT3D 1JF8A 5K0JA 2ZIZA 3KKKA 4I8DA 4LPSA 4P83A 4IJ6A 4PFSA 1GV0A 1G6HA 4IH9A 3RTGA 2RGRA 1V9SA 3R5KA 1EUZA 1ACLA 3GEGA 3OIGA 3PLAE 2JC3A 5D1NA 1WXIA 3THWA 1OC2A 1GA4A 5F1KA 1XPRA 3UJBA 1T8SA 3FCYA 2BH9A 3DUFA 4ALMA 4GSLA 1TADA 2VDNB 5JNUA 2WV7A 3MF4A 5EQTA 1M2WA 2O2YA 1G3IA 4C22A 3T3NA 4RQAA 1W1IA 1IHPA 2HRQA 2JIDA 3C8ZA 4RETA 3U80A 3U48A 3VC7A 1A97A 5D6OA 4ENPA 4YRJA 2QW8A 2COKA 3HSKA 4WLEA 3PFNA 4REMA 2AC7A 2FSFA 3H2JA 1T9CA 1ONPA 3IP6A 1XZLA 5E1OA 3HZOA 5HF5A 5KCZA 4HAUA 3ZYZA 3LF2A 3LG2A 1EHCA 5C34B 4LDPA 3MTIA 3DONA 4ZODA 3OAAD 1I1HA 5LXTA 4G0OA 2NUTA 1ZH2A 3KJIA 1QYIA 4A8PA 2QD5A 1PR0A 3FPKA 1NVVQ 5DNYB 3GZNB 3FE2A 2XH8A 1A72A 4RS4A 4KOEC 3QITA 4CMAA 5JEEA 3LTNC 4TKVB 4M3NA 1X1RA 1J8MF 1JDBC 2QE7D 1NP7A 4K1XA 1G16A 5ALPA 1NKVA 3M6UA 1ZS9A 4ZEOA 3B6KA 1OAOC 4O25A 2PMEA 3D6HA 4KR9A 3ZHRA 1M1NB 1PL7A 3JALA 1AKQA 4CM4A 1E32A 1HDRA 1OE0A 5BMOA 3MWDB 2EFDB 1XHLA 5TPWA 5SZKB 3B1VA 5AK0A 2HTFA 3AHGA 5FO0A 2GYUA 4YQFA 5KNCH 1EFPA 1XQWA 3RJTA 2RIPA 1JHYA 3L0SA 4M1YA 4YRIA 2NXJA 5J47A 1B8OA 3O4IA 3VKHA 3ESAA 1FQJA 4DKJA 2B1GA 2JAXA 5H3LA 3DMDA 2JI7A 2WUEA 3DD1A 4M8IA 3IAAA 5HFNA 3WYDA 4PBSA 2PUTA 4BMNA 5JH7B 1I7QB 1GAWA 3I9LA 1JX6A 2E4XA 2IIPA 3B78A 3TRIA 1CJSA 1GNPA 1SQ6A 1ZU5A 5KQMA 3OFJA 1YFJA 5I7EA 1T0IA 4QATA 1J1ZA 4ZO9A 1ZN9A 5KTYA 4RHTA 2RGUA 4OAOA 5BSUA 4AG5A 3G2IA 3NTOA 4DUGA 3KIPA 2N42A 3PUXA 1GLGA 3HBMA 5GJWC 3YASA 3V4SA 1W0KD 4YJHB 2BW0A 3G9ZA 1M6EX 1MB4A 1ZMRA 2W90A 3Q1KA 4R3NA 4X91A 4EW6A 5ITZA 1Q57A 3ROZA 3O84A 4N5DA 3HACA 3QA3E 1SUPA 1X1AA 1Y98A 2XAUA 4R8KA 1FQKA 1QDUA 5IW8A 5IUKC 2NADA 1W5SA 5D86A 5CFLA 2NYUA 3KQSA 4HLCA 3OFVA 1U6KA 2VI5A 4IFIA 4KODA 1NYTA 1TF5A 3FPCA 4BFCA 2IIVA 4L73A 1RZRA 1RM0A 3EZ2A 4FKBA 2RAUA 4IW3B 4L8GA 5HMLA 4R2JA 3WB2A 1I6LA 5DULA 4IHAA 3T6KA 1SU4A 2OZPA 1A1SA 1P0PA 4FWBA 3JRNA 2OVFA 4NHOA 1U7OA 1TCBA 4K1LA 1NNUA 2JFWA 3TX2A 4ND3A 3WLSA 3O5AA 3AXSA 3KUXA 2ISSD 3Q10A 1VKRA 4R16A 3II6X 3ORSA 4TMVA 5AJUA 4GPAA 5IARA 1ODIA 4LC9A 4FGJA 4A2CA 3R9XB 1T5LA 4B6SA 1TLLA 1EWYA 1NY6A 3GDFA 3RK0A 4NENA 5F76A 2JZNA 2QE6A 2RHMA 2PH5A 4HRAA 1VI6A 1EVJA 5K3AA 5H80A 4OKSA 3AUXA 1F06A 4S24A 3LNCA 4M83A 5JALA 4KXUA 2C1XA 5FIUA 3INNA 2WSSA 4CNBA 5DM0A 2RDMA 2XPCA 1J20A 4JI4B 4P3PA 1DQPA 1QQAA 3EIHA 1S89A 4BNTA 1Q50A 3MBOA 3CVJA 1KFBB 4MULA 3ENNA 3M9LA 3G89A 3W9SA 4F5DA 2QGFA 2X14A 3LPCA 4QU9A 1E3IA 2PL5A 4TKUB 3LHFA 4B33A 4CQJA 5KTPA 4O6VA 1R8YA 1XD2A 1ZUWA 1Y7PA 1U9ZA 4I8XA 3CKLA 2IELA 4NJMA 1H9CA 4AZWA 2V7EA 5AKHA 5BYBA 1XEWX 2I7CA 3HABA 4F2WA 3AIMA 4CVNA 4OL0A 4ALNA 2IS4A 2E85A 4KE8A 2QTBA 5EEGA 1CQIA 3UMVA 5LLDA 1UZMA 4AW9A 2MSNA 5G0WA 1VE7A 4EKEA 2QSZA 2GLUA 4IX1A 4LZJA 1PKEA 2BFMA 1QHIA 2GKOA 3TMKA 1M7HA 2GRAA 1FJHA 4IOLA 3V8BA 1RE0A 2XF2A 2AH5A 4HVTA 4UVIA 4B4VA 3E3OA 4OHKA 3TD2A 3WQHA 1QIHA 3AF0A 1AKWA 3DTYA 3MWJA 4GPBA 4PSKA 2NZJA 1EK1A 5EE9A 3B2EA 2WM2A 3OJEA 3VXKA 2DQKA 3T54A 3PITA 4ZMBA 5JXWA 1QS0B 4ZVKA 5CIYA 1KK3A 5MGNA 2XXAB 1KI7A 4ZOBA 1CERA 1VQ1A 1XMVA 1XTJA 3NEJA 1KMNA 4TRRA 1XZBA 3O73A 1ZQ9A 2FSHA 3CN9A 3WYBA 1L4HA 1UK8A 5A4JA 5B53A 4C4PA 2W6JD 1J56A 1ZK4A 3PCTA 1TC2A 1O6CA 2FEXA 3ANMA 1YQTA 1IQUA 2F3RA 4V24A 5FTKA 4OQYA 1PRYA 4HDNB 3T7RA 2AZXA 5EYPB 1ZVJA 3PB3A 1GKYA 5CMLA 1DJPA 2I3BA 2WF9A 4J0JA 2IGBA 1OX5A 4TLDA 2ZI5A 5BOVA 2PD3A 3IX7A 2V4ZA 4KUEA 1TA0A 3DJFA 3HY3A 4ZOEA 5ECWA 3UMYA 4DYDA 4BPBA 1E4YA 3NXSA 2WVAA 4GSYA 4QQ8A 1QNFA 3B36A 1QKJA 1M0WA 1BDBA 1J97A 5ALOA 1KTIA 4JX8A 2GA8A 5JCOC 1N34B 2OLEA 2GTPA 4GMHA 2H2HA 3PKIA 3W6PA 3GPLA 3ZEAA 2XGGA 1GNLA 2IGTA 4FU0A 3LQ1A 3IE1A 2Z04A 4YFYA 2AJCA 2D3WA 5CB0A 1ZU4A 1BSVA 4XXHA 3WYAA 4D8WA 1BFDA 4RIEA 4NDAA 4AKEA 2D1FA 4JWTA 4AQYB 4OUDB 4BUJA 2QIOA 1GQFA 2WG1A 3NC4A 4OTZA 3U49A 3V33A 2QVXX 2B8TA 3EXFA 1TZKA 5FBRB 3MUEA 3OKCA 4UZFA 8GPBA 1L4UA 2RGEA 1EXDA 4NH4A 1XPOA 3BORA 1SXHA 5I45A 3ZCPA 3DJYA 3HV2A 1IM8A 1N4DA 3V55A 3V5NA 2AHOA 1ECJA 4MS1A 4ZAZA 4URXR 2XQFA 2FPWA 3DZGA 3K6RA 4C3OB 4KN9S 4DV5B 1O77A 1W29A 3N0RA 3OI7A 5DRTA 4UDOA 4HVCA 3SVLA 5A7FA 1IDOA 4F9GA 3E9RA 3NOOA 5SZJA 2XVXA 2H5IA 2WE7A 1OI7A 1E7MA 3AGPA 3AM5A 3NZEA 4L4YA 4MP8A 5F3DA 4R71A 5I9LA 4F6CA 5IKPA 2BEVB 5JWRA 1E9DA 4NC9A 2XDAA 4KFCA 3GLHE 4P7KA 2IBMA 1QPZA 3KYIB 5BWMA 3OEEA 1ULBA 3PT5A 2XT0A 4P5DA 3WXMA 4QFDA 2CJYA 2QP9X 1R6XA 1Z6YA 3O8DA 1V8FA 1KO1A 2I22A 3BD7A 1G41A 5JAUA 1WLYA 1UJ6A 5JARA 1WW8A 1ZEMA 3N2ZB 1NJ1A 3IV7A 3D3JA 5I9MA 4A1OA 2YL2A 4L3VA 1U1CA 2Z4TA 3V3TA 3VRHA 3WRXA 3V2IA 3SEQA 4C78A 3C3YA 4WCVA 2DUWA 4FUQA 2VJMA 1VKNA 4WNCA 4GP6A 3V80A 2LPMA 5GAJA 2BFCA 2QLJA 2JFPA 4XIIA 2EJTA 1YVRA 4EDFA 4EPWA 2BZSA 2GCOA 4PZ0A 5C80A 1Q3KA 3DLHA 3AVUA 1DXYA 2QTHA 1JMKC 4MI9A 3RFVA 5ALZA 3RYFA 2WT8A 1GUYA 2ZT5A 3M6VA 3CZPA 4JKYA 1YA4A 3S2FA 1RFGE 4L5CA 4EATA 1JHVA 4O1HA 1JXOA 2CN1A 1K6EA 2NSDA 4OB6A 5AXAA 2JJ2A 2KMLA 2ONKA 1Z6XA 3EGEA 3HUFA 4X6LA 4F1KA 5FBQB 2A9JA 4YAKA 2BJHA 1AK2A 4GMFA 4P3KA 4E4RA 2A1UB 4KIGA 1FU8A 2WIDA 1JHAA 1KR5A 3G8CA 2JI4A 3GUVA 1KZGB 3OIDA 2PSDA 1KSGA 1JNXX 2X2EA 1G4HA 3WA6A 2B99A 2IEGA 2ZUTA 4BBZA 2AUTA 1H6AA 4ASUD 3GBSA 4YAGA 1N2CA 5BR8B 1ULSA 2X5NA 3IXQA 4PIMA 5BSTA 3R4VA 1P7YA 2H51A 1CIPA 2IHTA 2WABA 3FKJA 2A9PA 3HL4A 4OFBA 5FJIA 3RO7A 5KOJA 4RZHA 2RHBA 2Z30A 3DYVA 1CCWA 3FI0A 5EUMA 1WE2A 5KAPA 3UH0A 2ZVPX 4JUAA 2XGSA 1GCAA 3I2HA 3MXTA 2BKUA 4F4JA 3TLGA 2FW9A 3DWEX 1OXBB 3IILA 3C3KA 1RYBA 2RGNC 1T8WA 1HOTA 4NCBA 2VQ3A 4N5NA 1ZINA 4KLZA 2H1VA 4E2FA 1Z08A 1OSNA 3VM6A 5C1IA 5BT9A 1NE2A 5LZ9A 1E0JA 1G5HA 2PBFA 3JVEA 4I50F 4ZMSA 1BX1A 3SDSA 3WNBA 4IIJF 1NMXA 2IL1A 2IWHA 4ARVA 4DC0A 1P0IA 1D2CA 2D2VA 4AL4A 1VZ3A 3FVQA 4BGVA 4MJ3A 4RMGA 1T5OA 4Y2GA 1XR3A 3E05A 1XKXA 3HS3A 3OQ6A 4WACA 1WMBA 2FF5A 3COPA 2ZRNA 2QMQA 1YK1A 4HUQB 3R0XA 2G0NA 1XEXB 4GZ3A 3BTSA 2NUPA 3BC1A 5A4IS 4KSCA 3KYDA 2BISA 3BE5A 4IIGA 1DP4A 4ARBA 4IVNA 4IY1A 1C4KA 3R24A 2JIRA 5BW8A 1W36D 3ACDA 4JEIA 2VYNA 4U9IS 1NM5A 3CKYA 3IPLA 4CCWA 5DRYA 4L08A 4Z2AA 2E4VA 1L5WA 4ETMA 5K9ZA 1ZJ4A 2GBIA 3LA8A 3VU3A 1KR2A 2M6KA 1ISIA 4A6EA 5D8DA 5CFPA 4FZ3A 1PYDA 4WESA 4L74A 2EW1A 4YGYA 1UQTA 2R8OA 2VP5A 2VOEA 4AG6A 4ADSG 4ZCSA 3FPJA 3QY0A 1ILEA 1U2SA 4KQMA 4IWYA 3DH0A 2GD2A 3HKEB 4QUHA 3SD7A 3HNPA 4CF7A 4AQ7A 4M1MA 3VU9B 3F5DA 2J8ZA 2B78A 1WLSA 4IF4A 3BFXA 4UC0A 4ZFNA 4MV4A 3E5NA 3QKSA 3T8YA 3W4JA 3N70A 3WSTA 5CDTA 2B4AA 2Q3DA 3OLZA 4JI7B 2Y0DA 1CQPA 1DE0A 1GADO 1PWZA 3K1AB 3FRHA 3P0RA 3WHLA 4EF6A 5B30A 4K6OA 1N6OA 4U6NA 5CB4B 1O97D 2JDID 1UBCA 3UJ3X 2HNBA 3ZDRA 2VTBA 1SQ0A 1XB2A 3R3SA 4RMIA 1MX3A 5FPPA 2A4KA 5IHXA 2PSHA 4E6EA 5B36A 3G2QA 3EXG2 2CDCA 1M7BA 4GI2A 3ZBQA 3ZXXA 3O2NA 4JOQA 4R84A 3ZW8A 3KSAC 2HYIC 3QXJA 4MEJA 4TQUS 4WY2A 3ZDBA 2JLQA 1U5CA 1QOZA 4TV9B 2DFTA 2D0OB 3OHMA 4FEEA 3UGQA 2O3TA 4M9RA 1JZQA 3QUSA 3VNBA 3AEQA 3DZBA 3VPCA 3MRVA 3HCFA 5CTAA 4C89A 2RGWA 4MJLA 2BRUC 2PS9A 5CVCA 1SKUA 1TDJA 3IBTA 4E14A 1CDEA 5BN5A 5K99A 3DFIA 3E9MA 1PVVA 2HHJA 4GWLA 1R0KA 2J7KA 4W1SA 4R51A 1T1IA 2QBYA 5KYWB 3K6SA 2D2FA 4Z3DA 4IDEA 2F2TA 4EPYA 5FEUA 3PR3A 5FB3A 1GNQA 3EIWA 3R7WB 3ABOB 4EJ0A 2JGNA 4W5JA 1XLTA 1D7AA 5LB2A 1DEAA 4E2XA 4AF8A 4Z9BA 4CT4B 2FEWB 3AVTA 5DLQC 3PXGA 4M8SA 4JXZA 1L5YA 7AT1A 1MDBA 1JFRA 1ETUA 2D5IA 4HQLA 4G41A 2JHPA 2NVWA 4MUAA 2C9OA 3IUQA 5IVDA 3VKVA 4EG7A 1HRDA 1THMA 4YRKA 3GUYA 4PX9A 4TLMB 4DIMA 4DWOA 3VZBA 2BHTA 3U13A 4ISCA 3CT6A 4I8IA 3H75A 4JJ7A 2VPYA 1B6SA 2VPQA 1E9RA 3IKTA 3LE8A 4W7IA 2BGLA 2CNNA 4TYMA 1W76A 2VO1A 3LBYA 2VXOA 1W6UA 1D2MA 3PE6A 3ZHBA 4YECA 2EBFX 1ULTA 3CLVA 1JJVA 4LPKA 4ABYA 5K8LA 5CNIA 3QXSA 1JN0A 4HGOA 1VE1A 3CUEF 4WGGA 5DF1A 3WMFA 3S2YA 3IDAA 4OJKA 1VE9A 4EO4A 2AMJA 2PIAA 1T13A 3IAM6 4PN7A 2P6PA 1EIZA 4P7FA 1PJ8A 2FPRA 4JAVC 3BCHA 2MINB 4P3NA 1YDHA 3MBIA 3PRKE 4RPGA 3UAWA 1Y8QA 4F11A 3VOSA 6REQA 3GEHA 4MPDA 4MRNA 3CX3A 5EHZA 3OZ7A 4W5RA 4DV0B 1HDEA 3QEKA 2JH3A 1OB2A 2XB2A 3SFTA 2HIMA 2JGRA 3GRFA 2D4AA 2Z56A 4C7OB 3A11A 3EMVA 3AU8A 3R4CA 1JR3D 3OCWA 2ECPA 2M6SA 4BASA 4E94A 4JU9A 5C4IA 1DPGA 3VTZA 4EKGA 5JFOA 1WF3A 2X0NA 1QM5A 1FDWA 1GUAA 5AI6A 3JQBC 3DVRX 4NOLA 5C8YB 3A06A 1HF3A 4D3FA 1U0NA 2D3TA 1X19A 2FWNA 2LVBA 4O2AF 1PJ2A 3L4BA 3OZWA 3GDGA 2FR1A 1DMRA 1OH6A 2QQ0A 1KI2A 2A9RA 4HEQA 4HEJA 4W8HA 3RLIA 1B1AA 4RSHA 5HQJA 3AL0C 2C03A 1AXRA 1ZSVA 2XYGA 1EWTA 3EFOB 3WMRA 1SZDA 5JVDF 1T2FA 3REOA 1Z74A 3ETEA 4YFVA 1WTAA 4P7BA 3KYBA 3NIFB 2BPOA 2FETA 2NSLA 5GADl 2VAWA 3QU5A 4WEOA 5CFOA 4I1OA 1EAYA 2I6QA 2WF8A 3PWSA 4ZKDA 1S2NA 3QX3A 3DTNA 5ICCA 5M29A 1CY1A 2OD9A 2WIKA 4G1FA 1IJFA 1F60A 1GG9A 5B3AA 2FEKA 3GLRA 1KJ9A 3RE1A 2ZWMA 1HG1A 1ZH4A 3I5XA 3HDVA 1L7OA 1YRQA 2VXYA 5TMDA 5LA6F 1MOPA 1D2EA 1QSGA 3OTIA 4QBIA 2YJ4A 3EYWA 4BXOA 4TS4A 1S5PA 1MR3F 1PW5A 3AHEA 2M6RA 4WLNA 2HQBA 3GN1A 4BB0A 2BOVA 3QWFA 2VDOB 3VDMA 5C5DA 5L3VA 2XLCA 2APJA 1OT3A 4BNDA 3TQOA 5TVGA 4LFBB 1G9TA 1TM3E 3HKDA 1UPBA 3OURA 1OR8A 1UK6A 4I6EA 3ROKA 1HDCA 4NG5A 221PA 1NI5A 2AMYA 3FDZB 1S3IA 3R5XA 3L0DA 3I62A 4FFDA 1RLTA 4RIGA 1GXSB 2DC1A 4JDUA 1UH5A 3F7NA 3FYUB 3K0SA 4YRDA 1CP3A 1W49A 1X87A 3DOOA 4YCJA 1U5BA 3DKIA 3NEAA 1TGVA 4H1HA 1R0YA 2OV8A 2VTKA 1XWFA 4FYHA 4LJ6A 4MW0A 4O4LB 3RVLA 4AKIA 1ULHA 2B35A 4YS6A 3CY6A 1AD2A 3B1KA 1DKPA 1KZYC 3L02A 3QOWA 4FFSA 4BNJA 1J2TA 3U09A 3A3NA 4YBRA 3A9UA 3MRSA 2AC4A 4BZZA 2FFRA 1M66A 4ZD6A 4JC0A 3EXHC 2JARA 4HQ6A 3IPCA 4ZAGA 4EENA 1W2GA 2BTQA 2TMKA 2GCNA 2P30A 3GQBA 4MVJM 2B1RA 1NBOA 1WO8A 2PCLA 3NHKA 3Q5DA 2ORYA 3TIVA 1YC5A 3JQ7B 1M2KA 3V4RA 4LJSA 3K0FA 4B4DA 1ENPA 1TT5A 2CLOB 2ZETA 3MB5A 2QAGC 4M7RA 1RM5A 1Z36A 4E12A 1CF4A 3C3JA 1E1NA 1QNLA 2ODAA 4KTVE 1A8PA 2GJKA 3G6WA 4BZPA 1VPEA 3P2KA 3TTYA 3WL3A 4B85A 4PX3A 4R2HA 3NUZA 2VJOA 3LMKA 4TVKA 3C3DA 3NHYA 1BD3A 4C5AA 3CRQA 4RD1A 1N7JA 3W5VA 1YZQA 3FSEA 1SKQA 2IV3A 4GRAA 1SD5A 4HLUA 1NW3A 4CKYA 1P2VA 3EGXA 3K3PA 4BMVA 3W7VA