2JJYA

Crystal structure of francisella tularensis enoyl reductase (ftfabi) with bound nad
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
267
structure length
256
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
publication title Slow-Onset Inhibition of the Fabi Enoyl Reductase from Francisella Tularensis: Residence Time and in Vivo Activity
pubmed doi rcsb
total genus 78
structure length 256
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jjyA00
1EFLA 2X5JO 3WR5A 3GUCA 8ADHA 3GA0A 3GMSA 2O23A 3EK2A 4D79A 1MGOA 3PEFA 4ZA2A 1PJLA 2OORA 4KUHA 3WYBA 1DJNA 3PLRA 3V1YA 3Q9UA 4HFMA 4FBGA 3AY6A 4DRYA 1V3UA 2C59A 2FSSA 3RFTA 2VCYA 4JBGA 4UVDA 2Y1GA 1ZMOA 4ZJUA 4PLCA 1NM5A 2FR0A 4D44A 1H9AA 4G81A 4YAEA 2GN6A 2X9VA 2YQ5A 1IZ0A 4ND3A 4BV8A 1SOVA 1YOVA 4B3HA 4CLDA 1CEQA 5U9CA 2GN4A 4UUPA 1A7KA 3FCOA 4LMRA 1BXZA 1Q7CA 1TI7A 4NBWA 1M76A 3NGXA 1CETA 2JCXA 2W2LA 3QWIA 3VAZA 5KJ6A 5J23A 3DHNA 3AM3A 3FBGA 1T2FA 1UDBA 3QW2A 4ND4A 5COBA 3I9KA 1SC6A 3CEAA 1HDCA 4JQCA 3VZPA 2WSBA 1F8GA 9LDBA 1LXCA 5ER9A 2P2SA 3DBHA 3MJVA 5L4NA 4B4UA 3KSZO 1ZK4A 4OJNA 3GF4A 4KZPA 4GLLA 3BMNB 3PQDA 1ONNA 5ICMA 5HS6A 3ADOA 2DPHA 3ZWPA 5A4DA 3R1IA 5DZSA 4ALIA 2NUAA 4HBGA 4AJ1A 4FFPA 1P9LA 2CF5A 1E3SA 2B5WA 2VWQA 2X9GA 1LQTA 2JFFA 5JFOA 5JC8A 2C54A 4EW6A 1GEEA 4F46A 2DT5A 2I66A 4UEKA 1R16A 1R4NB 4E5YA 3COSA 4L0QA 2NV6A 4U6SA 2YJZA 3LF2A 3QVXA 4YJGB 4K26A 4F3YA 1SEVA 4AL4A 1R4MB 2VTEA 4IINA 3HB5X 2GZ1A 2HK9A 3JD4A 3QP9A 2P9GA 3WYEA 1NPYA 2OBYA 4NK4A 3G79A 3TOZA 4XGIA 1PZFA 3B1KA 4UVEA 4Y6SA 2G1UA 1E3WA 5C7LO 5CEFA 1LU9A 4NJOA 4J90A 5TQVA 2CMDA 4GI2A 3RKUA 1QKIA 1KYQA 3X2EA 5F1OA 1I24A 1N2SA 2VOJA 2ZB7A 2VUTA 2D4AA 5JBIA 1BW9B 5AQ1A 4DBVO 4MVJG 2Q45A 1HDYA 4TZKA 3FWNA 2E49A 2R00C 3T7EA 3KSDO 4O59O 2VT2A 1U28A 4OXNA 4INAA 3WGHA 3D7LA 4HXYA 5F1KA 1NTOA 2GGSA 2Y1EA 3OBBA 1DLJA 3WX0A 3GFGA 3M2TA 4FQ8A 3FSRA 3U9LA 1X1EA 4H3VA 4MVJH 1A7AA 4TSKA 4YAKA 5KVQA 4PLWA 4E5PA 4BO5A 4JK3A 4J1QA 2DTEA 5IN5A 2EHDA 3OIFA 1X7HA 2CZCA 3RJ5A 4FB5A 5MGBA 5EN4A 1LDBA 4XYEA 3LQFA 4P4NA 3UUWA 2FP4A 3A9WA 4QX6A 5JS6A 2UUOA 1W4ZA 2Y05A 3HSKA 4W9NA 3PIIA 1GV1A 3ROPA 1HLPA 4N5LA 3ZWVA 2B37A 1Z73A 2IXBA 2AQHA 4NIMA 4DMLA 4IMPA 4IDEA 1Y5MA 3JQAB 1U9JA 4WOKA 2HMUA 5KJFA 3PWSA 4WK6A 1UXGA 3GUYA 3VZQA 4U0KA 4D0SA 2O3SA 2WYWA 4L73A 5JCJA 1X0XA 3C1TA 3VDRA 4HUJA 4BMSA 2BLLA 4YJHB 4XYLA 1HDOA 2VWGA 4H7PA 3A28A 4OYRA 4GH5A 3VTFA 1BTOA 1TT5B 1FJHA 3PWKA 3ITKA 4I9UA 3VH2A 1GU7A 1RPNA 5T57A 5A9SA 2H5LA 4IY1A 4WLFA 2GDZA 4M89A 3TFQA 2GF2A 3K73O 5IZCC 1YB4A 1K2WA 4R3NA 2I3AA 1DIGA 1B16A 2FOIA 2PGLA 3DWFA 2XAAA 2JHFA 3LT1A 2QRLA 2CDAA 1T24A 3CMCO 2FPGA 3U4CA 4JNKA 5FI3A 1X15A 1YO6A 2VHYA 1NBOA 3CSDA 4Z9XA 2DM6A 4YJDA 1K6IA 3GZNA 2O2SA 4BNWA 3QLJA 4MVJP 3RROA 3ZCXA 4D45A 4J1TA 2BKAA 2OZPA 2C7GA 2HRBA 3V1TC 4RPJA 3UH1A 1HLDA 1B26A 1U7TA 2P4HX 2QW8A 4KTTE 3JV7A 1Z75A 1WZEA 1YDWA 3EY4A 1Q7GA 2QHXA 3ZU3A 1RYDA 1RWBA 4M49A 1PGNA 3NT5A 4CL3A 1E6UA 3PI7A 1E1NA 2Q99A 4J7UA 1D1TA 4NNJA 4RPGA 2EF1A 2ZTVA 5JMWA 4CMJA 1SB9A 1P31A 3C3XA 5BSGA 4M87A 5K6AC 4HFJA 4I5FA 5DT9A 3WGQA 3GH3A 4AJJA 2Q2WA 5LCXA 2FZEA 3BMOA 4F45A 1E3EA 1Q7BA 2C5AA 1MG0A 2R2GA 2W4QA 3C1AA 3HJAA 2PGJA 3RUFA 2Z95A 4CUJA 1C0LA 5I9LA 3WXBA 2GSDA 3DTTA 4D46A 4FS3A 5G0WA 3SJUA 3H9QA 3LC1O 4FR5A 1JAXA 3UW3A 2X58A 4AJHA 2VNAA 3RU9A 3TZCA 2GZ3A 2PFGA 2BI7A 1Z6ZA 4R1UA 5GY7A 5A9TA 4IS2A 4R9SA 3UFXA 4BGUA 4YYZA 3FTPA 1P1IA 4XIYA 4DUPA 4XR9A 1I2BA 1JKJA 2E48A 3UCXA 3G1UA 5ENDA 3L9XA 3K9QO 3H8VA 3S2GA 3G0OA 4GVXA 4YJFA 1PX0A 1I3LA 4PLFA 3K31A 5I9MA 4AJIA 1JDJA 2O3JA 7ADHA 3DDNA 4IDDA 1EFKA 1ZJYA 3ON5A 1ONPA 1HZZA 2HJSA 1QYVA 2HMWA 2O3RA 5L7YA 3QQPA 2Y0DA 4OL9A 4PLGA 3CH6A 4OOFA 4YTEA 2QYTA 2ZTLA 1OFGA 3UOGA 3DBHB 3EC7A 1PZHA 1QYWA 4NQZA 4BL5A 3CXRA 4WASA 4F6CA 4XGKA 4B7UA 1L1FA 3AI2A 4Q9NA 4CR7A 2DBZA 3F1LA 4FGWA 5L7TA 2CVZA 1A5ZA 3D3WB 2BGLA 4GGOA 3SX2A 2P5YA 1K5HA 3B6ZA 5T8KC 4E12A 5H83A 4RPKA 3AJRA 5L7WA 2J3KA 4YXFA 3JD2A 4GX2A 2Y93A 4IDGA 3KBOA 3KM0A 1LRJA 5G0VA 3PHLA 5T64A 2R6JA 3WIDA 1GCOA 1ML3A 4DLLA 5JCJD 3WTCA 1N8KA 1CYDA 2NU9A 3AOEC 3L77A 2RAFA 2IXAA 2HDHA 4NBUA 3ONDA 4BNVA 4RCVA 5HBRA 5A9RA 3RD5A 1XU9A 2WYVA 1VPDA 4IQGA 1E3WB 1ZXBA 3DBVO 4RGBA 1NWHA 2VYND 4OQZA 1X13A 4DVJA 3W6ZA 4XKJA 1HDGO 2OO5A 1L7DA 4QT0A 3R3JA 2VWPA 3FWZA 3MOIA 1HRDA 1B8PA 1NYTA 3E6AA 1DAPA 4GWKA 1G6KA 4ONEA 5JC1A 4EZBA 2ZTMA 4BNMA 1ENZA 3EYWA 3AY7A 1HF3A 4R41A 2OGUA 1HDZA 4M1QA 3MJSA 1PR9A 2YFHA 3TQHA 1YQXA 3ETEA 2G0TA 1WVGA 4K6CA 3TL3A 1Q0HA 5G0SA 1Q0LA 3LZ6A 3JQ9A 1KY4A 3RCBA 1SNYA 5EL0A 2W2KB 4NZ9A 3MJTA 1PJ2A 3DMTC 3EVTA 1QYCA 3HN7A 2W90A 1DXYA 3GDGA 1I10A 1WNTA 4CLOA 1XU7A 4II3A 4RV9A 4P4LA 3WFJA 4PLHA 4QFDA 5EQDA 1VKNA 2PV7A 2I9PA 1YQGA 2A9FA 2VRBA 3E9NA 4OIMA 4GKVA 4CM7A 3TFOA 4R5HA 4LRSB 1T1SA 2EJVA 4ZQGA 2JD1A 4CM6A 3BHMA 5AYVA 5EERA 2PZJA 2YHIA 1U8XX 4ND1A 2Y1CA 3H3FA 4B4WA 2VYVA 1GQ2A 1MC5A 2BFMA 4ZQEA 1FDWA 3IP3A 2VTDA 3ZHBA 1ZZEA 1HE4A 4WGGA 3DFUA 3BMCA 1Y7TA 4OO3A 3LT4A 1VSVA 1QXSA 1GYQA 1XG5A 5CDSA 3GGPA 5JYDA 5TJ9A 3RC9A 1IUKA 4IJWA 4XD2A 3TZ6A 3GVPA 4PLPA 1HWYA 2Q1TA 4BNTA 1OMOA 2DUWA 4R1SA 4IZHA 5IFLA 1P45A 5T6BA 2Y67A 4A10A 3JYQA 3FNEA 4XA8A 1LTHR 4J9VA 2Z1NA 1EBUA 1PS8A 2HKIA 3EMKA 1R37A 4M55A 5HS4A 1KY5A 1X14A 4H16A 4RVHA 4YT2A 3CKYA 2EGHA 3QV1A 1D4FA 1W8DA 4B4OA 3WG9A 4DMMA 2DFVA 3FPLA 5JDIA 2C82A 3B70A 3DAPA 3JQDA 3BMNA 5AVOA 1EVIA 2I67A 3U3XA 3PDUA 4XB1A 4E2ZA 2ZJ0A 1M67A 4M8SA 3KRTA 5JNLA 4JP2A 2VOEA 2V7PA 3TZHA 5BSHA 4MVJD 1B15A 3JYPA 4L76A 4Z9YA 1TVEA 2ZB8A 5JAQA 1E7YA 1NR1A 2HK7A 1C3VA 4WCFC 5GZ1A 1PU2A 4R3WA 4DGSA 4FFNA 1WZIA 1JLLA 1NAIA 1C14A 1R4NA 1X1TA 3FRJA 3RBVA 3ZU5A 1E3IA 4XWYA 4WJZA 4YB8A 5IXYA 5IDXA 1OBFO 4GX1A 2CY0A 2BHLA 1A27A 1R4MA 4IDAA 4FFMA 2JL1A 5DULA 4KDFA 3AFNA 5TS3A 3S8MA 3TOXA 4CQLB 3U5TA 3DTYA 4LK3A 2EKPA 2VRCA 3E1KA 3H5NA 4RORA 3VOSA 3BMOB 2DBQA 5TJHA 4OQYA 4Z6KA 5JO0A 3AUAA 1XSEA 2GNAA 1DIRA 2DC1A 1YL7A 1OI7A 2DQ4A 1IB6A 1BW9A 3GEGA 1PL6A 2X9NA 4NR0A 5EIOA 1K0UA 2IE0A 4BOYA 1KEUA 1MA0A 5THQA 4D3FA 5TLSA 4PFJA 1S6YA 3DOCA 4R01A 4YRBA 4BMVA 4RZHA 5FI5A 2B4RO 1YH3A 1T4BA 5F1PA 4BNYA 1HYEA 1DC3A 2O4CA 1NFRA 4R1TA 3WTBA 1O89A 4CMIA 1LI4A 3MCVA 2UDPA 2ZJ1A 4EUFA 5BR7A 2AXQA 1GFSA 2BELA 1ZW1A 2NACA 2ZQZA 2AQIA 5CDYA 1FF9A 1DC5A 4D7AA 1LSOA 3ASUA 4YJFB 4ZGWA 4MIOA 1Y8RB 3ZWYA 2ZB3A 3H9JA 1ENOA 4XDYA 2C2YA 3K92A 4CUZA 5JSFA 1LJ8A 1Y8QB 1DC4A 2FPPA 4YA6A 1F8FA 5BT9A 1SPXA 1UP7A 2I65A 2IEBA 4K1LA 4BNHA 5HM8A 4O63O 5DOVA 1O94A 1Q2XA 4B79A 5TIIA 4CQMB 3IMFA 4ROSA 1QMGA 4DREA 4L9RA 4BKRA 1I5RA 3S2IA 4A73A 3V8BA 3RC7A 1VL8A 4R1NA 1BDMA 2J3JA 1LC0A 1NQ5A 2WEKA 2X1HA 4RO0A 4OOEA 3JQAA 3DBRB 5DP1A 2O3TA 3AUSA 2V6BA 2VYVD 1WXDA 4KOAA 4RLHA 1H6BA 5DBFA 1U4SA 1LX6A 4TRNA 3KXDA 5EESA 2C5EA 3OQ6A 1HSZA 1PJTA 4DBZA 1KBZA 3I5MA 5L45A 4NHEA 1ZK1A 4OKNA 2Q49A 2DTXA 2P4QA 3AI3A 3IC5A 3OEYA 5CDTA 1TT5A 3I9JA 3WGYA 4OAQA 1HETA 5ER6A 4ZU3A 1D3AA 3HHPA 1PJQA 5I7SA 3H2ZA 1CRWG 4J7CA 4CM8B 5FFFA 5A04A 2UVDA 4BO1A 4FGSA 2D0IA 4OKIA 3U4DA 3OIGA 1HL3A 3A14A 4OHUA 3BHJA 1UXJA 1U1IA 4ZRMA 4BNGA 3FNHA 4E2XA 4BB6A 4BO0A 3VTZA 3PFFA 3GFBA 4EJ0A 3S2FA 4IS3A 3GRPA 3H2SA 2LDXA 4AVYA 1CIVA 4Z3KA 4PLVA 5B4VA 1NQAO 1U2GA 4NU6A 4LISA 1DFGA 2DLDA 4TKLA 3JQGB 4FFOA 4DLAA 3DBLA 4B3JA 4EJMA 4BGEA 4KP7A 2EIHA 1ADBA 4KWIA 1UR5A 1LLUA 2NVWA 2VNSA 3GC6A 4QEDA 4FC7A 4ESOA 4PRKA 3SC4A 1NFFA 5T5QA 4WLVA 1VSUA 2HJRA 2X22A 5DCYA 4ALMA 1UUFA 1C0KA 4GX5A 3OJOA 1XLTA 2E4AA 1KERA 1M6HA 1A4IA 1Y1PA 4FDAA 4PVDA 2VRCD 3PJGA 3ZV3A 4CM4A 1JKIA 1MB4A 3I83A 3INRA 4AFNA 4JXKA 3F4BA 2H6EA 3ZNPA 4BO2A 1EE2A 1U4OA 2YHIB 2NVBA 3OQBA 4PG4A 4UEJA 2D59A 5ADHA 1PIWA 1KVRA 4IBOA 3ZWCA 4TZTA 4LVCA 3W1VA 1JA9A 2FSVA 3BMCB 4J16A 2JHGA 2DAPA 3HB4X 4ZHSA 3RC1A 1B0AA 4BQRA 1CWUA 2GR9A 2JD2A 5JY6A 4NFYA 1B8UA 3U09A 3EGOA 2GN8A 1YS4A 2QX7A 3PZRA 3MOGA 1E1KA 1QV6A 2EKQA 4J4HA 1DRUA 3RKRA 5JDCA 4AJ2A 1T4DA 5JAMA 2VUSA 1MUUA 2X86A 4BV9A 4RDIA 4EI2A 4NBTA 3AU9A 1XIVA 4QXMA 3OM9A 1R15A 4Q3BA 1M66A 4BO3A 3EZLA 4ZVVA 3LC2O 5HRUA 2AQ8A 3AW9A 4RL6A 5IDYA 3C7CB 1MX3A 3JQ6A 3S55A 3ST7A 3ZV6A 1YL5A 5ES3A 4FJ1A 1JW9B 3EVNA 3WQSB 1UP6A 3OH8A 4E2WA 3GN2A 4Y8VA 4WUVA 3D3WA 3ETDA 1GTMA 2DFDA 1I33A 4QO8A 1B14A 5EINA 1DRWA 4WKGA 1B3RA 2EGGA 3JQAD 5DOZA 2CDCA 1XCBA 1A72A 2EJWA 3AM5A 4BNZA 4YAGA 4Q3DA 2YZ7A 3PHJA 4J1NA 4OGWA 3E9QA 3LK7A 2OP0A 2G5CA 5A02A 3K5PA 4PG6A 3V2UA 3LSYA 1U5AA 1PQWA 3BZUA 3HE3A 4DPKA 3UF0A 2YV3A 2ZTUA 2RH4A 1IE3A 1R0SA 2Q2VA 3T4XA 1E7WA 3GY0A 3QE3A 2IZ1A 1E0DA 4PZDA 3U49A 1UZNA 4BO7A 1DLIA 2PH3A 3V2GA 5KIAA 2FY8A 2PZMA 1PJBA 3UGKA 4M54A 1VL0A 5I7VA 3PGXA 1KEWA 4R51A 2AE1A 1IZ9A 4EITA 1ISJA 4B3IA 3M1LA 1JVSA 5TX7A 4IJUA 1Y81A 4L4XA 4QUKA 5DF1A 1YGYA 2Q1WA 2X0RA 4CMAA 4PG8A 1IPEA 3ITDA 3I9OA 4BGIA 3SEFA 4BNFA 1ISFA 4EUEA 3HN2A 1WMAA 4JBHA 3UVEA 1M75A 3L6DA 4CMIB 5CG1A 1EUCA 1K3TA 2B35A 5L40A 3GLQA 3GVCA 2BFOA 1GEGA 1ONOA 1ISHA 2YHUA 2GD1O 1TEHA 2IYOA 4YEDA 3WBBA 3GR6A 4GKBA 4K28A 1KC1A 1NVGA 4EBFA 2Q46A 3D0OA 3Q0EA 1JU9A 4PLZA 2Q4BA 2W2KA 3N7UA 1EBFA 1UH5A 2GYYA 1YONA 4Y6RA 3RUIA 5IAAA 4CLEA 4DXHA 4IJVA 4A7PA 4DTIA 5IXSA 4E21A 3K2BA 3W8FA 3FTNA 2ZKLA 1R6DA 4Y9DA 1UAYA 3ANLA 3JQCA 4UVGA 4TWRA 3PPIA 3MJ4A 4QFCA 5CHEA 4R68A 2DBRA 5TNXA 4UEOA 1KVUA 5IF3A 4EYEA 4JJIA 4A2CA 4Z3DA 2CDBA 4DYDA 3ADPA 4B7XA 2I3GA 3DHYA 3E9MA 3VZRA 1K89A 2VHXA 2WM3A 3O8QB 4GLOA 1EVJA 2X5KO 1DRVA 1ZMTA 4DL9A 4GPD1 3LU1A 3OF2A 3S1LA 4BKOA 2E37A 3BMQB 3IUPA 3CMMA 3IP1A 2RBEA 2UYYA 3RIHA 1LDEA 1FK8A 5EMHA 1ZO8A 3BTSA 4R54A 5BQFA 3HDJA 1E7QA 3KEOA 4DC0A 4E31A 5THKA 4BUCA 3H3JA 2X23A 4UAGA 1W0CA 3JQBA 4K6FA 1NFQA 2W2LD 4EDFA 3GNSA 2FZWA 4GAEA 4EJ6A 4BS9A 3WGTA 2I76A 4CR6A 1P74A 1Y9EA 1ARZA 3H6KA 3ZHYA 1DIHA 1GY8A 4K9DA 1HDRA 4YAJA 3ETGA 4X54A 3GNQA 1QYXA 1SAYA 5K9ZA 1IULA 3WQRA 2DKNA 2BRUA 4IJKA 2X8LA 3WSWA 1DFIA 1W6UA 1F12A 4DWVA 1NHWA 1RM0A 4MP8A 5CDUA 1HYHA 3MZ0A 1BXGB 3U4IA 3Q2IA 3L4BC 3KEQA 4NJMB 4TVOA 3HWRA 1MC4A 2Z5LA 3LYLA 2IZ0A 3Q11A 3GOHA 3AK4A 1OC4A 1ENPA 3Q9NA 5TGDA 3DBLB 4LCEA 5G4KB 2AHRA 3BHIA 4BIIA 2JJYA 2WD8A 5DCUA 3ANMA 3NYWA 4RLSA 3TWOA 1VLLA 5KCZA 1GUFA 4IMRA 1D8AA 2DVMA 1N9GB 1B7GO 4D43A 3IKTA 1U7HA 1P1JA 3DZFA 3KYDB 4TRMA 4QQRA 3OQ1A 3KOUA 4UVIA 5BSFA 1XA0A 4S1VA 4LVUA 1LDGA 1EZ4A 3QIVA 4GMGA 1KVSA 4CQLA 3GEMA 4CM4B 3SLGA 4MINA 2EKLA 3F3SA 1QR6A 4XYBA 2HQ1A 1CQJA 1HYGA 1PGJA 1GZ4A 1KOLA 3WS7A 3ZWOA 4QECA 3RBXA 3PQEA 3K6JA 1T2DA 3ZDFA 2AQKA 3CE6A 4XJSA 3JQEA 1P44A 3FBTA 2YV2A 4Q3EA 1PGPA 3ANNA 1WDKA 3PFWO 4WLEA 1CF2O 1YXMA 4JLWA 1NASA 1YL6A 4N5MA 3SVTA 1S7CA 3JQ8B 5B4TA 1ZVMA 3D4OA 1YJQA 4ZQBA 2HMTA 3MTJA 3FR8A 3MJEA 3PK0A 4EEXA 2BGKA 2VHZA 1HZJA 4ALKA 3PWZA 4BO6A 4YPOA 3OSUA 1MV8A 5JPIA 3UKOA 8LDHA 1XGKA 3ONEA 4E5NA 2ZCVA 4JCOA 4XYMA 1Y8RA 3LT0A 3G17A 1G1AA 3ZNQA 1HDXA 1IY8A 1Y8QA 1P33A 4A26A 1VM6A 3IUSA 3V2HA 3M1AA 2FR8A 3H9EO 3KYCB 5COQA 4W99A 3F9IA 4RQTA 2O3UA 2GO1A 4CQMA 3OJLA 4ALNA 4IXTA 1MG5A 4DA9A 1LDNA 1DHTA 3PGJA 3OJFA 1J6UA 3DQPA 3ORFA 1DEHA 5HA5A 3WOHA 3BTVA 2PA3A 3DBRA 4MO2A 4BKQA 3B1JA 4FFLA 2A92A 1AHIA 2D1YA 1H9BA 3ZH2A 3IL2A 1BRMA 4ZQHA 2NQ8A 3P2OA 1BHSA 1M6WA 1SEPA 2Q2QA 2ZATA 3BXXA 3ZWWA 5KOIA 3JYOA 3NUGA 2AG8A 1ZEJA 1ZJZA 1EK6A 4I5EA 1OC2A 2I5PO 3CZRA 4E2YA 5KTKA 2IODA 1HE2A 4P38A 4AJNA 3GAFA 1E92A 3PTZA 5FYDA 3PIDA 3WGIA 5EQFA 4GGPA 5C7OO 1BXKA 4CM8A 1J4AA 1Z45A 2V6FA 1RM5A 1SB8A 2X0NA 3F5QA 4WECA 4W6ZA 1E7MA 2YDYA 1PJSA 1LBEA 4Y98A 2RCYA 4PG5A 4D42A 2NTVA 1UZMA 3I4CA 3PXXA 3VZSA 1IHXA 3NX4A 3NAQA 2D8AA 4FC6A 4E5MA 3RUEA 3WNQA 5TRTA 1Y9AA 3DFZA 5GMOA 3VC7A 2AEFA 1AHHA 3JQFC 1PQUA 5IG2A 4DPLA 3JQGA 3DMYA 3FR7A 1F14A 4RZIA 3VPGA 2TMGA 3B1FA 5BSEA 3EZYA 2FPIA 3SJ7A 4P4GA 5K0ZA 3HG7A 1GD1O 2JCYA 1U5CA 4MKRA 4NPCA 4TVBA 3LDHA 3QJ5A 5L3ZA 4FOOA 1YE3A 1XWFA 3HDHA 5G2OA 4KDEA 3GRKA 2OHXA 1ZFNA 2Y1DA 3NTOA 3RI3A 1ISGA 1X7GA 3F1KA 4GBJA 1BG6A 5C37A 2R00A 4IZIA 3HADA 3SC6A 4ALJA 1SZJG 2JAPA 1XDWA 4R69A 3TZKA 1Y5RA 4II2A 3UCFA 3VH3A 2ZYDA 3P2YA 2CSUA 1GADO 3OICA 2H9IA 4CMEC 2TMDA 1WP4A 4OMUA 3DZHA 4YT5A 5DN9A 1GUYA 2PD6A 2PR2A 5I9NA 2CFCA 2HMSA 1QLHA 2EW8A 3QVTA 4A27A 4XDZA 2C0CA 4JJGA 4R16A 4U7WA 3H9UA 2D5AA 4L75A 2PGDA 3W6UA 1A71A 3ZW8A 2WTBA 3IKVA 1F0YA 1FMCA 3EAGA 1UDCA 3W8DA 1GAEO 1DO8A 3GG9A 2J5QA 4CM5A 4CLRA 5FWNA 5KKCA 1NQTA 3OEWA 5JYEA 4QTZA 4MVJF 1E5LA 1EMDA 5U1PA 3ZU2A 1RM3A 4CLXA 1HT0A 4Z0HO 5L95A 2Q3EA 3NJ4A 3PYLA 4GX0A 4E5KA 5KVCA 4HNHA 2A94A 2X6TA 4LRTB 2NQTA 2B4TO 2PD3A 4B7CA 3WFIA 3GVXA 1M2WA 3ZHZA 4P8RA 1H93A 1HSOA 3ZNNA 1A9YA 2B83A 3KZVA 3SLKA 1E3LA 4FSHA 1PZEA 4IXWA 4L4RA 2EP5A 2EV9A 1GV0A 4MP3A 3GN1A 4R5MA 4D0RA 4XRGA 2HCTA 4CQMD 1EVYA 2O3QA 1YB5A 1ISIA 3W4JA 5IDQA 3FNFA 4IIUA 2VHVA 3NJ8A 1CJCA 3I9NA 1C0IA 2YUTA 3PJDA 4RVSA 5LDHA 1YBVA 2EP7A 3CZMA 3D3EA 1CDOA 1UJMA 1NNUA 3H65A 1DC6A 4NU5A 4UUMA 1C1XB 3LC7O 5IZCA 5A03A 4BHTA 1TB4A 3I6QA 6LDHA 3IAHA 4BNLA 2XXJA 3X2FA 1LLCA 3VPFA 1ID1A 3QWAA 4RVDA 1PJCA 3D4NA 1EDOA 2PLAA 4O6VA 2Q4EA 1E7SA 2GN9A 2J8ZA 3D5QA 2ZYAA 3O4RA 1YDEA 3CUKA 5F5NA 4U0JA 5A3VA 1SCUA 4J2OA 4RPHA 3V5NA 5KVSA 2JAHA 4C4OA 2O7QA 4IPTA 1V0JA 2P68A 4LGVA 1UDAA 3PHIA 4MIYA 4BNNA 1QORA 1R0KA 1YRLA 1NPDA 1AE1A 1ORRA 3DZBA 4BKPA 2Y1FA 5IZ4A 4GSLA 4FD3A 3TNLA 1C0PA 2YYYA 3E8XA 2B5VA 2OMEA 4PGFA 5JW6A 5IDWA 2P9CA 3VVCA 1TXGA 4JROA 1E6EA 1AGNA 5K6AA 1JQBA 2I99A 5G0UA 6ADHA 3GPDG 3NT4A 4Q3NA 1V8BA 2V6MA 1J0XO 3GGOA 3QWBA 1PEDA 4PCVA 2VZ0A 4W9NC 4LMPA 3GQVA 4NDNE 1HE5A 1H2HA 4ZN6A 5GZ3A 1D7OA 1I2ZA 3DC2A 4OH1A 4XX0A 3OHSX 4WOJA 3GDOA 1NX6A 2PKQO 4FN4A 4BNUA 2XOXA 3E5RA 5B37A 1TLTA 1MXFA 1DOHA 4CV1A 5FEUA 1FDUA 3OJEA 3LF1A 3IOYA 3UXYA 4WNIA 1UXHA 3O8QA 2Y0CA 1NWCA 2Y99A 1N1GA 4O5OA 4YQZA 4N5NA 3RC2A 4GWGA 5COAA 5IN4A 4UUNA 3DB2A 3TSCA 2ZCUA 3BMQA 1ZXLA 3INGA 4QSMA 3E48A 2POQX 5MDHA 2BD0A 2D3TA 4KQWA 4GMFA 4IIVA 1AXEA 4J2HA 2HLPA 4KUEA 4UREA 2O7SA 3WYCA 1C1DB 2C07A 4BNIA 4ND5A 3PQFA 5JMPA 3SXPA 3GVHA 5JAZA 1JKFA 1LLDA 2Y0EA 2O4UX 1NHGA 2G82A 1YBMA 1O8CA 4MVJI 4B8WA 5H81A 3DXFA 1LRKA 5I7EA 4J6FA 4XYGA 3DOJA 3DZKA 2CD9A 3WQQA 2IZZA 1PJ4A 2FHSA 5T8KA 1VC2A 5AXCA 4LSMA 4P22A 5ILGA 2GCGA 4EUHA 1N7GA 1WDLA 2BI8A 1QP8A 4XGNA 4Q3CA 1BXGA 3ROMA 4YR9A 1R0LA 5BNTA 3DOOA 4DLBA 3AOEA 4AJKA 2H1SA 4NJMA 4PRLA 4MDHA 4OSOA 1DB3A 5F3RA 1EVZA 4CV2A 3JSAA 3ROKA 4Q3AA 1I36A 5G4KA 2P9EA 1G0NA 3N58A 4A0SA 1FDVA 4TQGA 3RUAA 3R3SA 1E7RA 3WWZA 4CL8A 4WNCA 3K2EA 4B8ZA 3NTRA 4BMNA 3NT2A 3Q1LA 3QWFA 3GAZA 3D1LA 1N9GA 5B12A 4PIVA 4N18A 3KYDA 3RQSA 3C8MA 1LQUA 2Y1OA 3O03A 1PGOA 4J43A 1ZCJA 3ZWNA 1RM4A 1QRRA 2RHCA 1GYPA 3E82A 2W98A 3ZWAA 4BO8A 1YKFA 2SCUA 1U3TA 4XQGA 1J49A 3OETA 4IUYA 1VRWA 2NM0A 4M86A 3AFMA 1DFHA 3KLMX 3OFSA 1XEAA 2G76A 3AWDA 3VVBA 3ENKA 3SBOA 3A06A 3F46A 3OJ0A 9LDTA 1MFZA 1XHLA 5DDIP 3T7CA 4Y6PA 4CM1A 3T4EA 4E33A 3JQ8A 1PQPA 4ID9A 4OSPA 1QG6A 1PZGA 5I8WA 3WICA 3DMTA 5AOVA 1LUAA 3H5RA 4CLRB 3MJCA 4S3MA 5AXAA 3B20A 3ZWMA 1GPJA 4JX8A 4PLTA 3WB9A 3I3OA 3UN1A 4YQYA 3RBZA 3KUXA 4WLOA 1ZK0A 3H7AA 1DIBA 2HRZA 1LLQA 3R0IA 2VQ3A 2GASA 3ZWXA 1O95A 1DBVO 1U2DA 2B36A 2CF6A 2NVUA 3H4VA 4IQ0A 3TF5A 4CMEA 3QVOA 1T2CA 4ALLA 2RIRA 3KYCA 1PS0A 2W8ZA 4GL4A 1T26A 2VWHA 4CV0A 1EUDA 2BH9A 3I52A 2J6IA 5CP8A 1P3DA 2QRKA 3WGZA 3WNVA 5KVVA 1T1RA 2JD0A 3FN4A 4W7HA 3ZGYA 1OAAA 2XXBA 3FHLA 4LW8A 4E30A 4HV4A 4MP6A 3AUUA 1H5QA 1FXSA 1ZKMA 1A4UA 1G0OA 3W8EA 2ILTA 3F6YA 4XQCA 1OOEA 1QSGA 1BGVA 2FN7A 2X0IA 3AM4A 2VZ8A 4E32A 3W4IA 1D1SA 2NU7A 4Z0PA 4XQEA 4UVHA 3RU7A 3G1TA 4CV3A 4WEOA 1NVTA 4IM7A 4DQVA 5KJ1A 3KETA 4E0BA 5EPOA 5H82A 3UICA 1KVQA 4A03A 1B8VA 1YBAA 2PD4A 3MEQA 4NBRA 4W4TA 4O0LA 4HNGA 4C7JA 4TKMA 1LEHA 1HEUA 1ADFA 3LVFO 2X7HA 4W7IA 4BO4A 3Q2KA 3AI1A 4BO9A 3GVIA 2VT3A 1GYRA 4L4SA 4R9RA 4BGVA 1FDSA 1GZ6A 3BAZA 4WCFA 3FNGA 1AUPA 3JQ9C 5C3MA 4BB5A 4BQPA 3STHA 1ULSA 1ZEMA 4W82A 1U8FO 4YT4A 1K6JA 1MLDA 3RASA 5JAIA 2GRAA 5DP2A 3QWHA 4GQAA 4BNJA 3L4SO 1DSSG 3KLPX 2QIOA 3ICPA 2BMAA 4XIJA 1GPDG 1VI2A 2ZYGA 5ICSA 1WDMA 1ISMA 1I3KA 1DHRA 4DIFA 3ZV5A 1DAOA 1EK5A 4AJEA 3KV3O 1SO8A 3QSGA 1U3VA 1E6WA 3BTUA 2HO5A 3CTMA 3R6DA 1EDZA 2DU8A 2WYUA 3NDJA 4CM3A 1T2AA 3ENNA 4IGEA 1PSDA 1NXQA 3NDRA 1QLJA 4RF5A 1EQ2A 4J4TA 1NP3A 2CVOA 2P91A 2WJPA 2YV1A 4N7RA 4HX5A 7MDHA 2JFHA 1HXHA 1I2CA 4QO7A 5JLAA 5F21A 5TSDA 3K96A 4WPGA 1XYGA 4XEHA 1Z7EA 1SOWA 1U3WA 1JN0A 3JD3A 4AJLA 2WD7B 1F06A 1VJTA 1KC3A 1XKQA 3DHEA 3VKUA 2DUUA 3F4LA 1VE9A 3PZBA 3DZJA 4I5GA 2ZB4A 3RUDA 1HKUA 2VUUA 1CERA 1LSUA 3VHRA 2A4KA 5ENVA 2OBNA 3QA9A 3RFVA 2D2IA 2Y66A 4GVLA 4FIZA 4FW8A 5CPFA 3ZHXA 2QQ5A 3BIOA 1PR3A 2C2XA 2Q1SA 5ITVA 2ZK7A 2H63A 4DPMA 3ZWBA 4D3DA 5A06A 3H5AA 5CPBA 3DR3A 1LA2A 4LN1A 3D5TA 4U6QA 5JDIC 3TZQA 1ULUA 1LDYA 2ZIZA 3NKLA 3C1OA 5A05A 2OUIA 1ZIDA 5A3JA 1LRLA 5L4LA 4PLYA 4ILKA 3HUDA 1LDMA 1V35A 1VJ1A 2X5OA 5JXWA 1JAYA 1N1EA 1PWZA 2F1KA 3IS3A 3JTMA 4LCJA 1X0VA 4J1SA 3ZN2A 2OFPA 3GHHA 4KMSA 1O6ZA 2CNBA 2NU6A 1YB1A 3AU8A 3QHAA 4JN6B 1WMBA 1ZH8A 2WE8A 3EDMA 2VYNA 4MKZA 4MIEA 4CODB 1U3UA 5CEEA 2JFGA 3HFGA 2HK8A 4I9HA 5L9AA 4L8VA 3PHHA 3OMLA 4BNXA 3ULKA 2WMDA 3GNTA 5GZ6A 5TT1A 2EWMA 5AXDA 2VZ9A 1C1XA 4YWJA 1ADGA 3L6OO 1RKXA 4PG7A 3CINA 3VH1A 2JCVA 2AA3A 1KIFA 3AY3A 5G0TA 4J3FA 2QZ9A 4N54A 1E1MA 2GERA 3D64A 5L51A 2NTJA 4UUOA 4J0EA 2NU8A 3VPXA 4I5DA 3WWYA 1H2BA 2UV8A 3PDJA 4NH4A 4OXYA 3BTOA 5EJ2A 1AXGA 5TF4A 5JY1A 3ZNOA 5JE8A 1VJ0A 3O26A 2YDXA 4RDHA 1PL8A 3ONFA 5JCXA 3KYBA 1OZAA 1F17A 3WLFA 4FJ0A 1YWGO 3RUCA 2NADA 3WLEA 4MJLA 1Z82A 3WDSA 4RVGA 3OIDA 3JYNA 1ZK3A 1WW8A 3G3EA 3KO8A 3FF4A 3I9MA 5TC4A 3A1NA 3TL2A 2UAGA 2QRJA 3EW7A 4CR8A 1IOLA 3QVSA 5JO9A 1O5IA 5KWEA 3HZZA 3RUHA 4HWKA 3CIFA 1NQOA 1ZSNA 4BNKA 2NVUB 3ZV4A 4DQXA 4CPDA 3E5MA 4IQ8A 2PY6A 4WE3A 2VN8A 1LSJA 1YOVB 1YVEI 5BNFA 1VKOA 3JQ7A 4E3ZA 2BFPA 3O38A 3OECA 4MVJE 4Z0TA 5LDGA 3WBFA 1EEHA 2AW5A 4NMHA 4XQ9A 2WWRA 1BMDA 3NGLA 2LDBA 3NEPX 2YFQA 3W4KA 2J5KA 1CQIA 1WWKA 1VL6A 3C7DB 3BA1A 4F6LA 3FD8A 4RF3A 1H6AA 1LSSA 3RVDA 1Z74A 1XR3A 2XPCA 4IDCA 1O0SA 4JBIA 4CJXA 4MPDA 1KS9A 4YACA 2QG4A 2B0JA 1P1HA 1ZK2A 4CUKA 1EE9A 2QZZA 3VH4A 1B2LA 5A1TA 3MTGA 3C85A 3O9ZA 4J91A 4D41A 1C1DA 1ZNQO 4O1MA 4RVUA 4MVJA 1IHYA 1KVTA 2PZLA 1QYDA 5C5IA 1WAMA 1JTVA 4KUGA 4BVAA 5KNLA 4DYVA 4G65A 3ZZNA 4BKUA 4I1IA 4YCAA 4YVFA 1ZSVA 1ZUD1 4MKXA 4J49A 4IDBA 1YQDA 4MOWA 4OM8A 1H94A 1I01A 2AEMA 4WCFB 1DDOA 4FFRA 3UHAA 4AG3A 2I6TA 4PVCA 1R12A 2VHWA 3WSVA 3GPIA 2PH5A 2IEDA 1E5QA 3V1UA 5IJZA 3GMDA 1DPGA 1EUZA 1H0KA 3TDKA 1V6AA 2WE7A 4ND2A 1UP4A 2RH8A 3JCZA 4XB2A 5CDGA 1N5DA 2O2YA 1GUZA 3I4FA 1I8TA 2GUGA 4TRRA 3P19A 2FMUA 3I6IA 3U62A 3LT2A 3PHGA 3EUWA 3GDFA 2PZKA 4I9NA 4L74A 5DCWA 4E6PA 4B4VA 3ICCA 3ABIA 1TA4A 1IYZA 1GL3A 1XQ1A 3WGGA 4YRAA 3ASVA 4UULA 1RJWA 2PNFA 2EXXA 4HY3A 4RJTA 1K6XA 1T25A 4DIBA 3ZW9A 2BGMA 4NK5A 1LNQA 3F47A 5I7FA 2NWQA 2HU2A 2IDZA 2JKVA 5L4SA 2OXIA 3IIEA 1V3VA 3U0BA 4CMGA 3BYZA 3GK3A 3WJ7A 4NFSA 4AJPA 2PWZA 3DONA 3TPCA 1L7EA 5JDCC 3LLVA 2DBVO 3DAFA 4NG5A 3ROQA 3WMWA 2E6UX 1PL7A 3KSUA 2J3IA 2O50A 1I0ZA 1P0FA 1NAHA 3FPCA 3GEDA 3QVWA 3MWEB 3MWDB 1BVRA 3PJFA 4J0FA 2YW9A 4JP3A 4Q39A 5U4QA 2FWMX 4CMKA 3UAGA 4FJ2A 1BVUA 1B3BA 1JWBB 3HQ4O 2QYSA 1JVBA 5DBIA 3PLNA 4HKTA 4URFA 4U5QA 3RSHA 1NVMB 1T2EA 2OP1A 4JGBA 4MVJM 1A9ZA 3VDQA 3QRWA 4Z9FA 1H6CA 2CVQA 2B69A 2Y68A 4CM9A 2YY7A 1FDTA 2DTDA 3DZGA 3IJPA 4WEQA 1V3TA 5AXBA 4KQXA 1WLYA 2FRDA 2D5CA 3JYLA 4YDRA 4U8GA 5A9SB 5L53A 3JD1A 1N92A 3OP4A 2ET6A 3IQDB 3DL2A 1UAGA 5F5LA 3M2PA 3S2EA 4H15A 2HSDA 3HNPA 3ZI0A 3EHEA 1GCUA 2XF8A 1ZSYA 4J4BA 4G2NA 5HTOA 3GHYA 2X0JA 3L07A 5FF9A 5C7IO 4KWHA 4YRDA 5ILOA 1XELA 4TROA 4RF2A 5KKAA 1E1LA 4ITUA 3VPSA 3K30A 1GQQA 1GZ3A 3GZNB 1TT7A 4ZQFA 1PTJA 2Z1MA 1YJ8A 1JWAB 2HAEA 3I1JA 1V9LA 3IJRA 3AUTA 1DIAA 3H9GA 5KJCA 4DC1A 2Q50A 3INTA 3G49A 3RJ9A 1EQUA 1DJQA 1ZBQA 2AG5A 5A5EA 1E3JA 3E03A 3L4BA 4AJOA 2NTNA 1GQYA 3PRJA 1MP0A 4WCDA 4LSWA 3WGOA 3D4PA 1P0CA 2F00A 4D3SA 4XZ3A 3P7MA 3PYMA 5B1YA 1Q0QA 4CMCA 4YJGA 2AE2A 1PWXA 1MFPA 1KETA 4HFNA 4DIOA 2EEZA 4CLHA 3I23A 3JD0A 3GT0A 1WPQA 4ZICA 5KJEA 1IPFA 4XR4A 3TN7A 3IDSA 3L9WA 4Y67A 1RYEA 1KEVA 2FR1A 3RWBA 3NDIA 2NSDA 3P5SA 2V6GA 2C7VA 2OOSA 5CG2A 2O48X 1E77A 3A4VA 4FPXA 2IYPA 4EGFA 4I8XA 4EEZA 3DZIA 5BNIA 4FOSA 4WLUA 2G17A 2NLOA 3JQ7B 3NRCA 3E18A 2BFAA 1BWSA 3RAJA 4TRJA 1H6DA 2CUKA 4KTVE 4PZCA 2YQ4A 1X7DA 2B4QA 4RQUA 3M6IA 1P1RA 2AEJA 3LLSA 4FCCA 3I9LA 4YBZA 3AOGA 3GG2A 4YAIA 1UZLA 4TMFA 5TT0A 1QV7A 2PTGA 1NPTO 2OL4A 1MXHA 1I32A 4WLNA 2A35A 3U4HA 1P1KA 2GPTA 4NFHA 3L0DA 4A5OA 3F5SA 4E4YA 4G5HA 1O9BA 1PJ3A 2WD7A 3JQBC 5CAEA 1R66A 5T67A 3DEYX 1IL0A 3HFSA 1UXIA 2GLXA 3N74A 1P1FA 3GGGA 1GDHA 3QY9A 3OA2A 5B4UA 2DPGA 4RF4A 1Q1NA 4HADA 1AN9A 4IDFA 1ADCA 4PN3A 1ENYA 1BDBA 3WJAA 5ITWA 5A5FA 2PKRA 2WDZA 1HE3A 4XCVA 1J5PA 5I8ZA 1NR7A 3PP8A 1W73A 3NTQA 1I30A 4CMHA 4PZEA 3HDYA 3L6EA 1BSVA 3TRIA 2RHRA 1Z7BA 4J7XA 4OXKA 3DAGA 3VPHA 2V65A 4JJFA 1LC3A 1KEPA 2AMFA 3OA0A 2HMVA 3C7AA 2C29D 2E82A 4I08A 4CM9D 4YJHA 3PVZA 4J9UE 5CEJA 3Q3CA 3FI9A 5DBGA 5G4LA 2UUPA 2IRWA 5LC1A 4AICA 1I3NA 3ZU4A 4CMBA 4YT8A 3RFXA 1PS9A 2ZQYA 3KB6A 4R4JA 3KHUA 1N7HA 4DQUA 3TJRA 5CFZA 1HTBA 4HP8A 2X4GA 3DO5A 2EERA 2PK3A 4JIGA 4RPLA 2BF7A 5HWSA 3UCEA 2J3HA 1UXKA 1Y6JA 2GZ2A 3C24A 4IGFA 3NV9A 3KTDA 3GZ4A 4ZD6A 2J5RA 2PKQP 1PGQA 4NI5A 2EG9A 4E13A 1SMKA 1XQ6A 2P5UA 3WIEA 4ZRNA 4RVFA 3PJEA 4GSKA 2C20A 2Q1UA 3K8ZA 1P77A 1GR0A 2NNLD 4XRRA 3VKVA 4C7KA 3JQFA 4NBVA 3KVOA 3Q6IA 4AJ4A 5DNAA 4CLOB 3PYXA 3WMXA 4HFRA 4XJTA 1SBYA 2EW2A 2HUNA 3CPSA 1I3MA 3HDQA
chains in the Genus database with same CATH superfamily
3OT5A 3EY9A 2WHPB 1E79A 3GUCA 4QVIA 3Q5GA 3QVUA 1KJZA 4PPFA 1V2GA 1YR2A 2AZ4A 2LR0A 2VSFA 3THYA 1P4AA 1KFEB 3MBKA 3BL6A 3QEMB 3EK2A 1IM5A 3RRNA 3X1WA 3H2JA 4A8TA 3DKPA 1WZNA 1B8OA 621PA 1MT3A 1YULA 4HCJA 2V7XA 2QU7A 3W9BA 2QSJA 3WYBA 4DLVA 4LPKA 3V1YA 2WSSA 3L7OA 4FBGA 3AY6A 2R8ZA 1L5HB 1V3UA 1BH2A 1Z4KA 2C59A 2IOQA 3MW8A 4ZJPA 4ZJUA 1ZMOA 4FWTA 3A9SA 4PLCA 1FU4A 2BM1A 1J56A 3HH8A 2YZNA 4YAEA 1YFLA 2X9VA 2YQ5A 2YYZA 4H1HA 5IXJA 1EKXA 2H48A 4XCXA 3VSBA 3IPLA 3QSYA 4TV8F 3TPFA 1A7KA 2ALJA 1BXZA 3BGVA 1TI7A 2PTHA 1SURA 1M76A 2QTLA 2GHIA 4NBWA 1CETA 2JCXA 2W2LA 3VAZA 1K06A 5KJ6A 4O4LB 2H16A 4LJRA 4CEJB 4A36A 2UXCB 3AM3A 3D3JA 1UXOA 1L4FA 4AU1A 1W9HA 1B73A 2VF7A 5FLKA 2VJCA 4QA9A 3ZZ1A 3GQBB 4ZQIA 3SK0A 4CE6A 2Z2IA 4D4HA 3G7UA 1TCBA 5JQWA 2GYWA 4U00A 4Q4HB 5B5SA 4B5KA 2E5FA 2P2NA 4PW0A 2OILA 1G59A 1NGSA 1LXCA 4ACBA 1GNVA 5ER9A 3FHCB 5CM9C 3MJVA 4YNBA 4B4UA 4DJEC 4RTPA 3HCFA 1RZUA 5ERXA 1BDJA 2VDOB 1F0PA 3D81A 1ONNA 5ICMA 1JTEA 3LIIA 1NI3A 1WB5A 2ZE7A 3H19A 4LV6A 1GJRA 2DPHA 5LA6B 3NM5A 5AKZA 1MQ9A 2WUWE 4ALIA 2NUAA 1YFKA 2O05A 3PPWA 4HBGA 5DX1A 5IKEA 3IBGA 4KAFA 4AJ1A 4V2UA 1D2MA 4NE9A 2R62A 4RD6A 1EFVB 3OU2A 1GZUA 3DCNA 5EC8A 1G1MA 1ZJWA 1FFAA 1EEXB 3MS7A 4UEKA 3D0KA 3RSFA 1R4NB 1G20B 4IWXA 3V80A 3G1WA 3COSA 2WG1A 2ZWMA 4I8IA 4L0QA 1QGOA 2NV6A 1YZUA 4U6SA 1TUIA 3UGJA 4YAFA 1XZMA 3QVXA 2B61A 1KSGA 4F3YA 4IINA 4WD3A 3EYAA 1GAQA 2YKGA 4AZWA 3L46A 3LYUA 2XTZA 4HRVA 3MPOA 4NC9A 1USIA 4XGQA 4B35A 4E1BA 1PE0A 3R3WA 3GLFB 3TOZA 1E9SA 4ZZ1A 5IVPA 1EFRD 1N6KA 2XSZD 2FW6A 4UVEA 1QDEA 7YASA 2OG2A 4NJOA 3CTPA 1AKNA 4EIWA 1QKIA 1KYQA 1SUDA 2VOJA 3NH9A 4BLWA 3UPDA 1YMQA 3R0VA 1W35A 4HDCA 1G7RA 1ZN8A 2D4AA 3G02A 5AQ1A 3K8QA 3QOYA 4YMSA 4BWFB 2FPLA 4JJZA 3U4AA 1KMHA 1Y7PA 3JARA 3FWNA 1NVKA 4O59O 1P9OA 2HWUA 3QIAA 1U28A 2OHFA 4OBBA 3VC2A 4ECAA 3AEQB 4INAA 1W19A 5LQMA 1R3UA 1NTOA 1ZYUA 2GGSA 2Y1EA 3OBBA 4CKBB 5A5VA 3PRYA 4JGGA 1O08A 3GFGA 3PE3A 4DZTA 4R9NA 1H3EA 1F6BA 2VDUE 1SM4A 1S9DA 1CVRA 3FSRA 1K88A 1XKXA 4MR8A 3O84A 4K81B 2C42A 4KV9A 1A7AA 4Z7NB 3VO9A 4YAKA 1Q0ZA 4MPPA 4BGDA 4E5PA 2XGJA 1M1YB 4BO5A 2VG8A 2WJ6A 4M9ZA 4O2AA 1EVKA 1PK9A 3QE4A 3VUEA 2H2DA 1E2JA 2C4MA 1C4KA 2EHDA 3OIFA 1ZH4A 2A9JA 1X7HA 2QRHA 3STVA 3O91A 1DKLA 2YR0A 2Z3WA 2QJOA 4XYEA 5ALZA 4IIJA 1OPXA 4JVMA 4I1VA 5EN4A 3RAFC 3UUWA 1YR6A 3SZ3A 3A9WA 4X66B 4EVIA 3J81A 2UUOA 3DOEA 3ZEIA 2NXCA 3LSTA 1E79D 2OHJA 4R8RA 1TO6A 5HVNA 4X91A 2JVKA 1RLUA 2DSTA 3LP6A 2C2OA 3B52X 3HSKA 5ELLA 1I7NA 2P7IA 1JA1A 3FTQA 4B76A 2HWKA 3ZWVA 1PJRA 3L7MA 3MWDA 2IOHA 4TPKA 3K9FC 3DW1X 1LPAB 1Y5MA 2ID8A 1J24A 2OXEA 4WOKA 2IIPA 4I1PA 1CRLA 4BZPA 4PZLA 4LC1A 3UEOA 2PZAA 3P5BA 3NGMA 1SBTA 3S2ZA 3AKZA 5D3ZA 4DXDA 5JI2E 5JCJA 4BVGA 4DG9A 4OAPA 3MD9A 3RRXA 3V4ZA 1P6XA 3D9QX 5J43A 2BLLA 4YJHB 3FOWA 2XBUA 3A28A 4GH5A 1IHOA 3VTFA 1BTOA 1TT5B 3VH2A 3PWKA 1BX3A 1ESZA 3ITKA 4TLEA 5E0KB 1M7GA 1N5OX 2RGEA 3LE8A 3K2QA 1ZINA 1YR7A 3IE2A 1M72A 2INGX 3GU3A 2Z5GA 3KAKA 4POAA 4WLFA 5FNVB 2GDZA 3CRQA 3HP7A 3LVQE 1NA5A 1EZZA 2GF2A 1SVWA 1PL0A 2A5JA 2R5FA 1YB4A 3GWGA 1RCTE 1LPNA 1WW2A 2WF9A 3L8FA 4IVPA 3RTCA 4C5AA 3KR9A 4OHRA 1CR0A 5FEMA 5I7HA 1VLZA 1ECGA 4CF7A 1JUDA 1H2RS 5ARDA 1ZY2A 1WCYA 2QL7A 3OE1A 2MU1A 3D2AA 2RSLA 3HR4A 2GXAA 5FI3A 5KQPA 1X15A 1EIWA 2BSXA 1YO6A 3CBGA 4RTQA 4GXTA 2O2EA 1NBOA 1RXUA 3EG9A 1M2VA 1E60A 5AVQA 4DR4B 3X1DA 2AV6A 3MAAC 3P96A 4G4IA 4YJDA 5KHOC 1REQB 3C3CA 4NENB 5A6SA 1CC1S 5CVDA 4GICA 2VSYA 1U7PA 3QLJA 3HGMA 4RE6A 1J23A 1YRHA 4J1TA 1FRFS 2ACEA 2FN8A 4IIHA 3NAGA 4Q7LA 2X8AA 1R0XA 2C7GA 3I05A 4Q4DA 4U2DA 2YASA 3VISA 3IMEA 4RPJA 2DHCA 4EHBA 1B26A 1D2HA 2XITA 4P1ZA 2VP3A 3A4LA 1OZGA 2YWRA 2PU5A 1CULC 3SG0A 3ZGNA 1X42A 2Q5LA 2VP0A 3LBNA 3GJ4A 4MI3A 4CL3A 4LHXA 2XMDA 3EVCA 3FYDA 1E9DA 1KMMA 1U9IA 1ZN7A 2Q99A 3QLUA 4GPIB 5TPWB 3WIBA 3WI7A 4AROA 1QGUA 1FY2A 5TMBA 5JMWA 2FZVA 4JXZA 1SB9A 2XMPA 1P31A 2BHNA 5P8WA 3DM9B 3L7BA 4O4JF 4I5FA 4CFZA 3LRXA 4HQLA 4AJJA 2CYAA 1KFCB 2Q2WA 4MWOA 4QFMA 4WBNA 4R2WA 2FZEA 3BMOA 4PNPA 3GP3A 5HTOA 1MG0A 1I7LA 3C1AA 1DKMA 3HJAA 2ZANA 2VP5A 4HDMA 5IJ9B 2R7MA 5HKKD 4X62B 5I9LA 2O5VA 1Z2PX 4L6AA 3MK31 2GJ4A 3DNFA 2O20A 3AT1A 2FKNA 3OLQA 4K88A 4DFDA 3SN6A 1ANKA 3H9QA 4MARA 3GEIA 3PC4A 2EARA 2X58A 4AJHA 3GJ8A 2DY0A 2VNAA 4L02A 4NVRA 5EJMA 4PZAA 4E5SA 1IEXA 2ZRPA 3PNQA 4OA5A 3GROA 3WLTA 2FLVA 2G0AA 2XB4A 3IE0A 1UKVY 4GOND 7ABPA 3W2IA 1PT7A 4QC2A 2EEPA 2ORVA 4V0OA 5HEKA 2ZYRA 4BGUA 4F86A 3CV3A 1P1IA 4UOQA 5D51S 1E0AA 3FB1A 1PZXA 4GR9A 2GCPA 1T5HX 1TCAA 1E1DA 5E9JA 3B9QA 5FTLA 4OK5A 4X6YA 3RH0A 3UCXA 4D26A 3W90A 2C2MA 3SVLA 3TW8A 2F67A 3NDPA 4MHOA 3QTLA 5I9MA 1ABEA 2QVBA 5CFMA 2O3JA 3BFVA 4WA7A 2MYUA 3C74A 3DDNA 1EFKA 1ZA2A 4IDDA 3KKEA 3ON5A 4KSBA 2XRZA 2NV0A 2O3RA 4QRHA 1DC7A 5HMLA 4OL9A 2EAUA 3C3KA 4YTEA 4IVNA 2ZTLA 3AB3A 1P80A 5FTMA 3DBHB 1E4EB 1JPVA 3EC7A 2UYHA 3QBVA 3BSYA 4GGMX 4NQZA 4F6CA 1RBYA 1XTQA 1L1FA 2ZRAA 3OPYI 1IPHA 2DBZA 2QJRA 4FGWA 5JFTA 3HUTA 3JAMA 2P6PA 3KALA 4K5QA 3ENWA 5JISA 1PR6A 1Z5ZA 3NS7A 1OIWA 6REQA 4EQZA 2BGTA 2A0XA 2DE0X 4MVXA 4P4UA 4M36A 5FWXA 5L7WA 1X1SA 4KPEC 3C3AA 5G0VA 2ZI7A 3KBOA 4OFZA 1LRJA 1FDRA 3WIDA 2V8BA 2Q5CA 3AR9A 5JCJD 4JVNA 4QBKA 1P3JA 2AN4A 3WTCA 1TYAE 1RWQA 2E4XA 5IRCD 1SOMA 4DLSA 1H1DA 4BX2A 2WIFA 1SKAA 3G9ZA 4W63A 1YSCA 3VYTB 2NUTB 4NBUA 2DSNA 2GN2A 2FMIA 3FETA 4HTAA 4AULA 2J45A 1BD3A 3RD5A 2CCJA 3GA7A 1M9NA 4GRIA 2FZCA 3BILA 1E6MA 1M2NA 3UJAA 2WTXA 3HDVA 2GBLC 3VJKA 3GFPA 1OA1A 3BGOS 2A5YB 4MI9A 4PCAA 3BN3A 2SKDA 3IELA 5EP4A 1L7DA 3R3JA 3NIDB 3ZUGA 1GKKA 2VWPA 2COEA 4B3MB 4LF8B 4JASB 3R7NA 5JXGA 2XQIA 1XJ5A 1EDBA 4QPJC 4X97A 1NYTA 4EG0A 2YV4A 2ZSEA 4JI6B 2PL1A 3BHNA 4B73A 4EZBA 1SC3A 3FGZA 4KPUA 1ZLXA 5CH5A 1JFFB 5CD1A 5JRJA 2B9EA 2AH5A 4V1CA 2OGSA 2A3NA 1OYVA 3AY7A 3ECSA 1HF3A 3H2KA 2OGUA 4MA5A 1W2WB 3U3OA 3RO7A 4FFDA 1ZVQA 3MJSA 2AXPA 3V4SA 1PR9A 2DQZA 4YGXB 4OVKA 1NONA 3ETEA 1DBSA 2G0TA 2ZJAA 2PRKA 3UT0A 3ED5A 4BEWA 3PEUA 5EKXA 5FLYA 3SQNA 1U7UA 1P2UA 1Q0LA 2H17A 4C07A 1M8KA 4BVKA 3RCBA 1RE0A 4O1IA 4KCGA 3FMVA 5EL0A 1XD2B 1QS0A 4HN4B 1PJ2A 3CG4A 3EVTA 4H4CA 1KE2A 1O9HA 2W90A 2GPAA 3HN7A 3QUSA 1K4KA 1E4OA 3FM9A 1FTYA 4CLOA 3V3KA 4LGYA 2FP4B 2GFIA 3KZKA 2IKSA 4QFDA 1VKNA 4O4JB 4ZU6X 1YJXA 2VRBA 2XVMA 4TT8A 4RHUA 3Q7PA 1M74A 4WKBA 4RD4A 5LYJF 5FXMA 4CM7A 3TFOA 4MI6A 3SYLA 1M6NA 1T1SA 3QELA 3RABA 1BJTA 2JD1A 1JG3A 3U3ZA 4CM6A 1IJBA 5AOAA 2XUDA 1XTSA 1VBKA 3CLKA 3SD7A 5AJVB 4Z4HA 3M3HA 5E3IA 1P4GA 1YNOA 4WZAE 2O1EA 4ZOBA 3H1FA 2VYVA 3NWEA 2QUBA 1GQ2A 2QUAA 4IXNA 4KHZA 4PFQA 4YJ3A 3CNNA 4IH4A 3DO8A 4ZQEA 1WOMA 3ZHBA 2WV7A 3F97A 2PX2A 2ON6A 3B3QA 2R5NA 1O4WA 3F6RA 4M7PA 4WW0A 4DJ5X 3ZWDA 3LT4A 4BLVA 1VSVA 1GQRA 1BH6A 1XTKA 3B5EA 1V16A 4RGQA 1Y4UA 1LVHA 1QB8A 1VCMA 2FTKE 5CDSA 4NDAA 5E95A 2UUCB 4XPIB 1HYBA 2G8NA 4UNPA 3RS2A 4EKDA 1OIVA 2Z43A 4LZAA 2HPZA 5DM1A 5KDOA 1IUKA 2R7KA 4IJWA 3GVPA 4PLPA 3TW6A 2GWHA 2EVWX 4H4EA 2P79A 1WUHS 4LXGA 4IZHA 3TKAA 3G2NA 3HGTA 3RVRA 4Y2HA 1MQ8B 5DHUA 2GAFA 2V59A 1A9SA 3SBDA 3CCCA 3IUQA 4H6XA 4NF2A 1LTHR 4PPGA 5FV4A 4Z9BA 3O1LA 5FP0A 2OHHA 2HKIA 5JH7A 4M55A 1R37A 2HJ9A 3IP5A 3OUTA 3VI3B 4OFBA 5CB4B 5HS4A 2Q7XA 4H16A 2C9CA 3SYNA 3T9AA 4DCMA 2R7LA 1JJFA 5AKKA 4MQ5A 3CQ9A 2DFVA 1A77A 2C82A 4I1SA 2F1IA 2HQRA 3BL8A 2IYXA 5BNWA 1Q1ZA 1G64A 1TKRA 2XQKA 3F74A 3P9QA 2HA5A 4LZPA 4QUEA 4WK4B 4KXXA 2ADFA 2ZJ0A 3AUJB 3SXUB 4UASA 3WGUA 1NVVR 2PMFA 3B7GA 5AW0A 2VOEA 1OH7A 3OCWA 5BSHA 2ZDQA 2R6DA 1XAGA 3H42B 3ORQA 2J3LA 1B15A 4OREX 2H4JA 1K97A 2W58A 4K6OA 4DLZA 2C9DA 1EWVA 1TVEA 1X8JA 2YZ2A 5JANA 4RX1A 4R7GA 1FNNA 1C3VA 2PUFA 2V3CC 1PU2A 3BRCA 2IW1A 4Q4LA 1F0NA 3FAZA 1JXMA 3WLNA 1AUQA 3ZGOA 3CZQA 2W9XA 1JLLA 3PR1A 2ZYIA 3RU2A 3TLCA 2FOXA 4Y2SA 1SA0B 1O6CA 4WJZA 4YB8A 3O9VA 4GX1A 4LECA 4YFYA 2BHLA 4D82A 4U3JB 1R4MA 3LPNA 5I4BA 4MR7A 1OX5A 3TBFA 1VSBA 2JL1A 1QONA 4FFMA 3AFNA 3TOXA 4CQLB 2H7VA 5IU6A 5K8LA 4Z54A 1SVKA 3RHSA 4LDAA 2VRCA 1M1YE 3E1KA 3IILA 3L7CA 4RJJA 3VOSA 1OAOA 4CU5A 1PQYA 1XZQA 2D2VA 4BUZA 5KDLA 3M6LA 4PBSA 5HJEA 2C99A 2GNAA 1QK5A 4NATA 3EZ9A 4KH1A 4BZXA 2W6JD 3BFXA 3SMVA 2C92A 1YZ3A 5DX0A 3RT9A 4XVUA 1PL6A 1GQFA 2Z4RA 2P7HA 3GGCA 1MABA 2REQA 2II6A 3CLTD 3I12A 4V0NA 1T0BA 4J2TA 3S70A 3ZCQA 5JAUA 4AL4A 4BOYA 1JGTA 2FZKA 1M2OB 3FYCA 4MYCA 4R01A 4D3FA 5JD6A 2G63A 3RIMA 5TLSA 4DWWA 2HFJA 1X1RA 1UMBB 1VMKA 3JVUA 4BNYA 4XIGS 5FPYA 1ES9A 4PBTA 5FBKA 3WTBA 2VJMB 4ENPA 4CMIA 4M0KA 4M98A 5IWCA 1F5SA 1TK9A 5TMDA 4KRFA 2BELA 1ZW1A 2F1HA 1JKJB 2EG5A 2ZQZA 2ZXFA 4YCDA 1V41E 3AEZA 4L08A 3SSNA 1C4OA 2B7BA 2CJFA 4QXAA 4A9AA 5A4JA 1LSOA 1UKYA 4IHJA 4ZGWA 1J00A 1K6EA 2XTNA 3R7WB 3EIOA 1A2OA 4W5NA 1EWKA 4M8IA 5CT6A 5JSFA 1Y8QB 1DC4A 1O96A 3KOYA 3M33A 4YA6A 1L8AA 4YJ2A 3ZDRA 3ZWKA 3FKSA 5JEDA 1SPXA 3HKEB 4MKFA 1GSOA 4XGRA 4KR2A 2FEPA 2R7NA 5HM8A 4FM9A 1XLVA 2HCJB 4RYDA 1Q2XA 4RS3A 4HVAA 2IDMA 3GLSA 2GBGA 3NEJA 3QJYA 3THWB 4WXRA 1C7JA 2ZW9A 3MB5A 4FI3F 4BCDA 2V7QD 4HN9A 4CQMB 4AY2A 4C0AC 2QTAA 5D85A 2CLCX 1QMGA 5ALQA 4DREA 1MQSA 1TK2A 2PDAA 3NORA 1I5RA 1NJ1A 4A73A 1PG0A 4DUGA 1DL5A 5CTJA 1BDMA 2J3JA 5BSUA 3OOYA 3X0DA 2ATVA 3QEOA 1Z0ZA 2IV3A 2WEKA 3JQAA 3DBRB 3NWOA 1KDRA 3WXMA 3AUSA 2VYVD 1NXOA 2VCHA 1WXDA 2H1HA 1NYLA 2ZVPX 2EBUA 3UBMA 4X3PA 5K0GA 1W4AA 2VVTA 2HWYA 3Q88A 4AZ0A 3GCDA 3HFJA 4TRNA 4B84A 3NM6B 1JDVA 3OQ6A 4BVFA 5J2TA 3E0XA 3CRMA 4ZO9A 2FWRA 4DBZA 3I5MA 4DSAA 1NF9A 1UPAA 5CGZA 5DYYA 4ETMA 5TE9A 2DTXA 3OQNA 5BPFA 1LV7A 4LMBA 1DP4A 5ER6A 1HETA 5CYPA 1SZCA 3ZXUB 2RC5A 3C87A 1PJQA 1BWQA 4TLAA 1XMXA 2IHYA 4ZXPA 4QDTA 4HJRA 2BCJQ 4IGIA 2ZP1A 4GYWA 3TL6A 3TZEA 1GDTA 1FSZA 3DZCA 5G53C 3WK6A 4OKIA 4LF7B 4PX2A 3OHMA 3OIGA 5TQ2B 4D3YA 4DA0A 4OHUA 2EOAA 3BHJA 3GJQA 1GOTA 2R44A 4KQKA 1VJDA 4I0WB 3ZXIA 3FNHA 2QZPA 1CUIA 3VGJA 1BDIA 3GFBA 2XYHA 4EJ0A 3S2FA 1E2MA 4LOAA 4RTRA 1T10A 3KLOA 4UEQA 2VHQA 3GRPA 4NP6A 5FBVB 3G2IA 4AVYA 1CIVA 4Z3KA 4PLVA 3Q8WA 1NQAO 3EXFB 3FTDA 4UJ5A 1J70A 1DFGA 3T3IA 5EMKA 4DLAA 3KHSA 3UJHA 3DBLA 3EQ7A 5GIOE 1ULAA 1QRTA 1Z4IA 3OZVA 5BVGA 2EZ4A 2A9VA 5JZSA 5J1TB 2FPIB 4KWIA 1UR5A 4O3FA 2AXNA 2NVWA 4W5QA 1Z08A 5HIIA 1SBQA 4TN5A 3H8SA 4ESOA 2G1AA 3RTAA 2ZULA 1WXXA 2OE2A 2C7OA 3NHRA 1OQAA 5T5QA 2E3JA 1IZ8A 1ODSA 2BT4A 4WLVA 2HJRA 2GDJA 2B4YA 4P3NA 1OVGA 5DCYA 1UUFA 4GX5A 1VE3A 4Y7DA 1ORWA 2C3YA 2E4AA 3IH5A 2JIBA 5H70A 4DAEA 3RS7A 3SE0A 1LGYA 4EAAA 4M53A 4NOKA 1C30A 1Y1PA 4MUBA 4RZ3A 1T3HA 2VRCD 2VTBB 2R86A 4C7OB 3LP8A 1JKIA 4MAAA 4X8HA 4CM4A 4JXKA 3EIXA 4WERA 3CVVA 2VTKA 2YHAA 3HA7A 4AUEA 5L3VA 1VCIA 3LBAA 1E64A 1P75A 3AFOA 4LJLA 2QU8A 3ZJ4A 2XZLA 2YHIB 5CNKA 3A7EA 3OQBA 5JAPA 2GJSA 2IITA 3CX4A 4PNZA 1LD3A 2IHUA 3OLXA 4BP1A 3QFHA 2G8LA 4LVCA 2FYTA 3WWOA 2V1XA 5KQLA 1QTIA 3EXIA 4IIGA 4OHWA 4ZT7A 2DAPA 1NDQA 2QXYA 4RMIA 3QF4A 2PSSA 2GR9A 1J0CA 1B8UA 1YKGA 1OH6A 3L41A 2HA4A 5I5EA 5I4IA 3WK9A 4EF4A 5FADA 1QOPB 1NY6A 2XT0A 4EO7A 1K7SN 3L2OB 1EVLA 5JDCA 4AJ2A 1T4DA 1EM8B 2VA9A 1FVFA 4JKYA 4V0MA 1BD4A 1CUEA 4BV9A 1TIBA 2BC9A 5T3UA 3PVCA 3T7TA 5IT0A 1RT9A 2JFBA 2DKFA 5AHXA 4G9GA 4QXMA 5D01A 1JR3A 3OM9A 9MHTA 3HCPA 1R15A 1XZHA 2G9VA 2KSQA 3PENA 1QZZA 2F6RA 2PUHA 3U40A 2AZMA 2RGNC 4PGAA 3LC2O 4G1VA 1ZDMA 2X9LA 5ENZA 2IH4A 3AW9A 2HRCA 3PXBA 4CIWA 4GZMA 5G1NA 5ARCA 3JQ6A 1MX3A 3BKWA 3S55A 1YJCA 2RI0A 1VL1A 2ZYHA 5K0SA 2HF2A 4YMWA 1P2VA 1JJ7A 2QE6A 1MEEA 5JVDB 1SIWA 3GN2A 4Y8VA 5HZHA 4WUVA 1YBFA 5EWJB 3KJQA 3D3WA 3ETDA 4P31A 4QO8A 4DUGD 2QJWA 3S0JA 2I2BA 5KPJA 2WWYA 4G4SP 1G2PA 3MTIA 2X7JA 3JQAD 4R2XA 1JE1A 1DEAA 4QIHA 1NW6A 2OB1A 1XCBA 2WJAA 3ZJYA 3D0RA 2YXNA 4BNZA 5CXUA 2YZ7A 4J1NA 4DCUA 5C53B 1DO2A 1Z4JA 4MQ4A 1E2KA 2OP0A 5FUWA 1FFSA 3PQCA 5D86A 5DGTA 5A02A 1GTSA 1L8LA 4KFTA 1E66A 1E18A 2RKOA 3P97A 3V2UA 4EVQA 3OQMA 3BZUA 4P34A 3MWYW 4UMVA 1G5IA 1BWRA 4QNMA 4B7ZA 3HE3A 1F8XA 1Q0TA 1XMJA 5K8VA 2ZTUA 1RHKA 1Z6QA 2RH4A 3G8CA 4ND8A 1ONBA 3STXA 3GY0A 5K0TA 3QE3A 5BRNA 2IZ1A 3ZE1B 4PZDA 3HK2A 4F2GA 3L5OA 4QHYA 2PH3A 3GIWA 3RBAA 3HYRA 5C8YA 5IM4A 4G01B 3UGKA 3EIUA 4CYMA 4JP5A 4FYKA 1Q91A 2DHQA 3PGXA 4OHKA 5BSMA 4B3XA 4R51A 5ALNA 3FOEC 3G8DA 4O8CA 4JYPA 4U7TB 1BDHA 3M1LA 5AKLA 3K71B 2VJBA 5TX7A 2FP3A 5IW8A 2VK8A 3PCXA 1RZVA 3SGLA 2LVBA 1NW9B 2P9QA 3FPFA 3O7WA 3B12A 4MYDA 3UM9A 3NAZA 5D84A 1DQZA 2X0RA 5EXTA 4DDWA 2CUNA 2L82A 4CMAA 4PG8A 1IPEA 3PEEA 2W42A 1X1QA 3ITDA 3I9OA 1VKHA 4Q9DA 3SEFA 2K7ZA 3CISA 2AN1A 1N8NA 1U02A 1L8QA 3HN2A 3ZHRA 1X80A 4N40A 1PWYE 1T8PA 1RI5A 3COZA 1EUCA 1QGAA 1L7QA 2CXHA 3DBIA 4QBIA 4QUDA 5LLTA 4MV6A 1PR1A 4CIBA 2XMCA 4XUEA 1ONOA 4IVQA 4JQOA 2RK4A 1MCZA 2FW1A 2X3YA 3II6X 3Q5EA 3KE8A 3O92A 1NY5A 3ZJVA 4K28A 4B32A 3SOPA 1ISPA 4EBFA 2ZU0C 3D0OA 4H3HB 4MS3B 2VS1A 2CDNA 4C0LA 1Y6QA 1UPBA 1YONA 4Y6RA 4MZXA 4CLEA 3UB4A 3ZVKA 4IICA 3QF7A 4JIMA 4TQ9A 5JSHA 4P4TA 2K2QB 4RK1A 4NJEB 3ZIAA 1MDBA 3EQ9A 4BEVA 3B51X 2FMXA 1EGQA 1R6DA 4UDNA 3GJ0A 4UVGA 3H13A 4TWRA 2IX9A 4FLFA 4GBMA 1N0IA 3U3MA 1BXRA 2BYTA 4UEOA 1FUYB 1KVUA 2LV8A 4JJIA 4GI7A 4Z3DA 2B2CA 3ETJA 2X8WA 1F2UB 3IEKA 1OLOA 1BCSA 1P9NA 4X93A 1J2TA 3T15A 4B7XA 5KQSA 4Q19A 4B3SB 4QUHA 3OI7A 5JR3A 3O8QB 1QNLA 4GLOA 4BYGA 1DT3A 2QN6A 4DKXA 4BLOA 4CKCB 2X5KO 2J3QA 1DRVA 4N8DA 1JR2A 1KA9H 1GNTA 3ZE6A 5EKDA 1ECBA 2OZVA 2WJYA 3CIOA 1NMEA 4ZP1A 4IIEA 1CR4A 2VBGA 3BDAA 2NO9A 3NEYA 5HRAA 2UYYA 1MIHA 5CLLA 3RIHA 3LRPA 1P0PA 4MR9A 4TKVB 4JT9A 5KUTA 4E31A 3S8YA 4B6GA 4U7PB 1JX6A 5DVZA 5LQJA 4B6JA 3CNQS 4K87A 4K6FA 5FUYA 3TW0A 3UWDA 1U0SY 4BMCA 3I6ZA 4EDFA 3A9VA 2OV6A 4EG7A 5B2EA 1NI5A 1IHDA 4IZOA 1QFJA 4TV9A 2H3HA 2CZGA 3L1JA 5EMHA 3WWPA 1I2MA 5DWQA 2NPOA 1JR3D 4TXHA 2W6ZA 1ARZA 2PGIA 4P84A 3QMVA 1E5VA 4MTLA 4C3OB 3L82B 3GRCA 3ETGA 2WQZA 2V9PA 5HYVA 5D5PA 4FX2A 3O73A 3E5NA 1YA6A 5K9ZA 1IULA 4LE0A 5EJ4A 3TIIA 1XVVA 4QUGA 1W6UA 2GM4A 4KREA 1F12A 1RWMA 2QLTA 2J08A 3BSWA 3IV6A 2JKZA 3IVMA 4FZ5A 2WA1A 2P69A 3N05A 2ZIAA 3MZ0A 3JTEA 4K9SA 4KXFB 4RENA 1BXGB 4UBKA 5B3LA 3U4IA 1A9RA 5MN4A 1MB2A 5G3YA 1U63A 1GDDA 3H1GA 2JFVA 5K45A 5GJBA 4IEEA 1CRQA 3WE7A 3ZV7A 2GZSA 2Z5LA 2IZ0A 1ENPA 2PRSA 4LCEA 1NE2A 4KLAA 5G4KB 2VH1A 1UPCA 1QQTA 3P52A 4BIIA 4F21A 3C6MA 4KW7A 2HK6A 3DT8A 3ANMA 1GGNA 1SQFA 3TLGB 4A8JA 4RLSA 1Z3CA 2ZU6A 3UV7A 1GLVA 1U31A 4JSRA 4IMRA 1YQTA 2P11A 3LKBA 1B7GO 4B3TB 1PTKA 1P1JA 3KYDB 4TRMA 2E4ZA 1QBGA 1TF2A 5BSFA 1ST3A 3M4ZA 2FQQA 2VSQA 3GEMA 4CCYA 1VQ1A 3VMMA 3SLGA 4MINA 2AI2A 5ULLA 4Q4AA 1TLLA 3RLFA 3H87A 1PGJA 3BGWA 3TEFA 4HLNA 3WS7A 3ZCPA 4KSCA 3RRMA 2R8PA 2QQ0A 4F60A 3K6JA 1SU8A 1KE1A 1T8UA 1XDSA 2IA5A 4TYYA 4CKXA 1P44A 3FBTA 2YV2A 3PVSA 4Q3EA 1WDKA 1GZ7A 1CF2O 5B7QA 1NASA 1QYRA 3AR3A 1MEJA 5ELMA 4HDKA 2JK1A 3U39A 5K7SA 2O19A 1UKCA 5FI1B 1QVZA 4N5MA 8OHMA 3JQ8B 3LFHA 3HVUA 4QD3A 3C3MA 4ZQBA 3L6RA 3NOXA 3HV2A 2Q0XA 1KJWA 2YMMA 1UWCA 3I5XA 4HQNA 4EEXA 4OI4A 2VHZA 1HZJA 2RJNA 3PWZA 4YPOA 5LWHA 3DVAB 1MV8A 4QM7A 3UKOA 8LDHA 2I87A 5E0OA 1X19A 2J4FA 4TXLA 4B3GA 4D9JA 5E3HA 3LT0A 3CN9A 5M5BA 4C22A 4ZDIA 4IJ5A 1JHAA 1G1AA 1FFGA 3CJQA 1K98A 4JCCA 3ZNQA 4ODIA 1T35A 2PQ6A 3IAEA 3T8YA 5SICE 5CBPA 3V2HA 3AONB 1YTUA 3A2NA 2PZFA 2BMWA 2FR8A 1QZXA 4R6WA 1RAGA 1QHHB 1ZJJA 5DI3A 2BMVA 5TB5A 4JR0A 2WA2A 3HFRA 1N6PA 1WPRA 2B1GA 2W22A 3OZSA 3EUAA 4D5EA 4WX2B 5DGHA 1N2GA 4HLUA 1Z3IX 4AZSA 1NRIA 4ZOQI 3OJLA 1TLFA 4W5JA 4ALNA 3FOZA 3D43A 4G23A 2NO6A 5K3BA 1I7SB 1J8VA 3FDZB 5JROA 3SKXA 3PX2A 1LDNA 3CUTA 4AMUA 4Y18A 3ZTYA 2GRUA 4NRDA 3OJFA 5CCEA 4G6ZA 1U9CA 4GYJA 2V98A 3MVEA 2REBA 3IQGX 1URPA 3TE7A 1B1AA 3N7TA 4FFLA 3SJZA 3ZHUA 1AQ6A 2WFLB 4JL6A 4RV4A 3ZH2A 4K0KB 1N2CA 1NBMD 3IL2A 1DTSA 4DKJA 2YJTD 3L8ZA 4Y9UA 3T34A 1DAHA 1BHSA 1QVWA 5KYNA 4KGXA 1L6IA 1ZC4A 1CYEA 5F12A 3DL4A 2R66A 2YN4A 2XB8A 4WN3A 1FUUA 5DHFA 3U3DA 1VJCA 4RIFA 4AXBA 1FW6A 2SKCA 3PUVA 3NUGA 2BGNA 1ZEJA 2FDRA 5JSKA 1E3DA 1Q19A 2I5PO 3CZRA 1CVIA 4YAWA 5JASA 1J8YF 2AZTA 4MPTA 1TAGA 4WY8A 5AKEA 3DA8A 4H08A 4TWZA 5B2ZA 4GEGA 1Z34A 4G63A 2Z2XA 2B82A 4Q3KA 4R71A 2XE7A 1MIOB 1J4AA 4CM8A 1L8XA 2X0NA 5BWMA 2ADMA 4UQPA 3L8EA 4V02A 4W6ZA 5MHTA 1JJVA 1E7MA 4N41A 4Y98A 5KWIA 1A3CA 2MIIA 3FGNA 4PG5A 1JV2B 1UZMA 3PL1A 3R6GA 5TMEA 1IEVA 4BUJA 1SWWA 4JT2A 4E5MA 3CKLA 1KP2A 1OBCA 3KKZA 4U2KA 4BY9E 3W1WA 1KZGB 3D4BA 1V1MA 4ZANA 1JHDA 1Y9AA 3CCBA 4X8OA 3S3TA 3MELA 3VC7A 4CNBA 1YOBA 2J0SA 3A4TA 3QLEA 3VKFA 4DWJA 2EQ5A 4PN7A 1OI2A 4DPLA 3HLTA 4IOMA 4EKGA 1SN7A 3R9IA 5J2UA 4RS4A 4RZIA 1GCAA 1OFVA 4GO1A 1I9GA 4TSRA 3KNZA 1CR6A 2QRUA 4MQFA 2UZ0A 3EZYA 4BX0A 5BORA 2KJQA 3KZMA 2JAQA 4OJTA 1BS1A 3ICVA 3IUNA 5FR1A 1H5NA 2WFMA 3S1AA 5JXWA 4NLLA 1FRVA 3HG7A 5KVAA 3OZFA 4KQ6A 1U5CA 4MQMA 2JB9A 2ORIA 1A9PA 3T5MA 4EYGA 2J31A 1AKQA 2DXIA 2QM3A 2NYRA 1YE3A 2Q5EA 4AWBA 4ZCLA 3GRKA 2OHXA 4QTXA 3QVGA 4BFLA 3Q1KA 3HRKA 4DA8A 4K6GA 2IOYA 1YUNA 4HDSA 4GBJA 2PX4A 2G36A 3CLUD 4PSKA 3ZBTA 3ZE7A 2R00A 4IZIA 4Q1DA 4FZRA 2PX5A 3R2JA 1GN8A 3TNYA 3TZKA 1L8OA 2PX8A 1JR6A 5IWAB 1GSAA 3R4CA 2ZYDA 4G1FA 4D6YA 1NV8A 1II8B 3P2YA 2CSUA 1J09A 2D1RA 3MLEA 4ZAVA 3V7WA 4BRSA 2TMDA 4OJKA 4G26A 3MGGA 5JXJA 3HZRA 2C83A 5K3FB 2HJWA 2PD6A 1UM9A 2LE0A 2HMSA 2PR2A 3GRFA 5E6UA 5I9NA 2E4YA 3QVTA 1EXNA 4RD0A 1UFKA 4H3KB 4WUTA 2OECA 3LWNA 5E9WA 1LPPA 4HUQA 4X90A 3H9UA 5ALJA 2OA0A 2D5AA 1G8FA 1OBHA 1ZCZA 3CLHA 2QD1A 4KX3A 3RYHB 2HWXA 4MHSA 4J6EA 4D25A 1GAEO 3IPYA 4LRWA 1DO8A 2P3QA 4HH3C 4CM5A 1WD7A 1D2AA 1VG9B 4KAJA 3WAJA 3GRYA 2AOTA 2FUG1 2ZEJA 4QTZA 2QV0A 3RIGA 3WLKX 4CXMA 4MV4A 3L6CA 3PDHA 1SY7A 3PE4A 3PYLA 5KVCA 2J7PD 4QYXA 4E5KA 3IDQA 2R7AA 3V48A 1P2GA 2GWRA 2H9YA 3HJHA 2B4TO 3IHWA 2PD3A 3WFIA 5KBYA 3L7NA 4MRAA 1K7EB 4DMKA 3IBSA 3UOWA 1M2WA 1MPXA 3QBJA 3ZHZA 4P8RA 3ZNNA 3MT0A 4LWQA 3CC8A 3SLKA 5JRZA 2V0NA 1PJAA 4KBGA 4YRQA 2CV0A 3LECA 3MF4A 5BMVA 5LWQA 4I55A 3UGQA 2FFBA 4YRTA 2IUEA 4MP3A 1KAOA 2IZ7A 3TINA 2J6HA 3LX5A 5IBPA 2B92A 4D99A 1D9XA 1YB5A 4AK9A 4E4RA 1CDZA 2RHWA 3I2IA 5IC6A 1G17A 3OBIA 4O2LA 1IBCA 4FDUA 2WM9B 5DLDA 4CRWB 1QF9A 3TG2A 1FMTA 1XN4A 2I6UA 3PUWA 3I9NA 4ZT5A 1C0IA 3WLIA 3Q3JB 3PJDA 2JCSA 1RZRA 3B1ZA 3N2IA 5F52A 3ZQ4A 5FTWA 2EP7A 4EB8A 1CDOA 4RXMA 1L4NA 2AL7A 1E0JA 1UJMA 1DC6A 1W88A 2ONKA 3AINA 4M1EA 4QLAA 4UUMA 2B2NA 1YVRA 3RYFA 3BWEA 3V4VB 5C4GB 5IZCA 1QWOA 2C3UA 1C2TA 2BEUA 2JLAA 1PBTA 3X2FA 3AHFA 3VPFA 1HOXA 1GO2A 1JQ3A 4JLSA 1XL0A 4FZJA 4RVDA 3GX1A 3LW7A 2QMEA 3GBPA 1G60A 4KKXB 4ZEVA 1VYVA 2PLAA 1GKLA 4O6VA 4LHZA 4NBNA 2GN9A 1BJKA 1S3GA 2ZYAA 3G2OA 3O4RA 5BW5A 4DHWA 3CUKA 1UWVA 1V47A 1W5EA 1CQJB 1N6NA 4Y2TA 1AMUA 4Z4GA 1SCUA 4J2OA 4C03A 1U28C 3LUDA 4D57A 3ANXA 5KVSA 4QVKA 4D97A 3OCVA 2YY6A 2HT6A 4RLQA 3A1DA 1JIJA 4Y1EA 3MLAA 4C4OA 2OOKA 4LC0A 3RRJA 3PKZA 3RVSA 4MIYA 2BFDA 4O29A 4LY0A 4HDRB 3D2CA 4FYPA 1YRLA 1W2HA 4DJJA 1YDHA 2MMCA 2Y4NA 1AE1A 1AHNA 1EP3B 2QN8A 5J4KA 4BKPA 3K70D 1EESA 4HGNA 3KVNA 3D3NA 1VJRA 4FD3A 1G6Q1 3GARA 3G2HA 3I28A 3PCRB 4LDPA 3TNLA 1UFRA 1E59A 2YYYA 4OLAA 3I53A 3ERCA 4URHA 4LRXA 3E8XA 2B5VA 4PZ0A 3JAKA 5EXEA 2AD5A 3OLZA 5IDWA 4DCJA 1NKSA 1ZA1A 2EX0A 5J9FA 3HEAA 3PD0A 3HWSA 1E6EA 2ZSKA 5K6AA 1TYBE 1KI8A 1YIDA 3PDIB 5G0UA 3NT4A 1GFZA 4HB4A 4QXOA 1R6VA 4LE1A 4K86A 4LRQA 4JDUA 2PT6A 5LMNB 4N3GA 2F1JA 4KNWA 4LMPA 2NZUG 3WRVA 4D3XA 1H2HA 4EZIA 2ESRA 3HU3A 1KDOA 1JDNA 1XTUA 4FYWA 3WSTA 4P7KA 5K01A 1E8MA 4O25A 4OP2A 4WSOA 3AHJA 4D4GA 4XX0A 3R9XA 2HF8A 4X45A 1SULA 1NX9A 2FA9A 3OHSX 4MWEA 4BFSA 1KZ1A 3VQTA 3Q8KA 4X1YA 2PKQO 4FN4A 4X92A 4N5HX 2M2IA 4ER0A 1Y80A 4PQEA 3FIUA 3T7DA 4N0MA 4GM1A 1XZEA 1UJ2A 4PWYA 3KQNA 3F8SA 1NP7A 1QHYA 2ZI9A 3IOYA 3UXYA 4WNIA 1UXHA 1G41A