4QDXA

Crystal structure of antigen 85c-c209g mutant
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
277
structure length
271
Chain Sequence
b'LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYGGNGTPNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 103
structure length 271
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qdxA00
5ALGA 1CUBA 1H2WA 1XRPA 3HC7A 4A5SA 1SFRA 4WY5A 4H7IA 5ALUA 2OCIA 2JGKA 3DLTA 3M82A 4LIPD 5A62A 3R0VA 1QFSA 2HM7A 3FYUA 4PSCA 1X70A 1Y37A 2XT0A 3RKSA 4J0DA 2AXEA 3D59A 2C58A 5FPPA 1SCKA 4G4JA 4K6GA 3VVLA 4DYHA 3GA7A 4MYSA 5LZ7A 4G4IA 1OCEA 3HYSA 4BCBA 4QLOA 4WCVA 2XMQA 1EINA 4DTCA 4INZA 5K3BA 2WUGA 3C43A 3GROA 1R9MA 1SC9A 2DSNA 3R3UA 4FKBA 5T4EA 1J1IA 3WK4A 4FDMA 1VA4A 1EB8A 3HLKA 1VJ5A 1A7UA 4FBMA 1BROA 2I78A 3F96A 5LKAA 2WSLA 3L1JA 3Q0TA 2RI6A 3L1HA 1AUOA 3G0IA 5HCUA 4JUIA 5ALNA 4KEAA 2OQVA 3C70A 3IIIA 2YASA 3WLAA 1CUFA 1EDBA 1XRMA 2PX6A 3C45A 3A6ZA 1AZWA 3WA6A 1GPKA 1JU4A 3H18A 5ALQA 1MX9A 1LZLA 2HA4A 1ORWA 4TGLA 2E3JA 2Y2UA 1ODTC 4W1SA 5CH8A 5JD4A 5KWJA 1XZDA 2BUAA 2VJCA 3G7NA 2PU5A 3VISA 3H04A 2WFMA 4QDZA 5EHZA 1WHSA 1VZ2A 2WILA 1CEXA 5AKEA 4A16A 4FMPA 5CTAA 4EUSA 5AM1A 3FCXA 3I2HA 3DKRA 2I3ZA 1WOMA 1LPAB 2NW6A 1G4HA 4YASA 5DWDA 2WIDA 1ORVA 1ISPA 4Q82A 3AFIA 4UUQA 2XUGA 4UHHA 4M0MA 1XLWA 4E15A 4Q3KA 2G5PA 3WWDA 2LIPA 4Y2JA 2QUAA 4WFJA 2VA9A 1O6FA 1UK7A 3IUNA 3AIKA 1EX9A 5ALEA 4G1FA 2JEYA 2CB9A 3G02A 4BCDA 1KEZA 5AI4A 1ZD3A 4BE9A 1Q84A 1VA5A 4J0GA 4BAUA 1R50A 5JALA 3LIPA 4KJXA 4P9NA 4TVKA 4QEKA 5EHNA 4EZIA 4X91A 5A6VA 3DYVA 3MGAA 4UHCA 4HS9A 4X92A 4U2FA 4B9AA 3GUUA 1TRHA 2OGZA 2J4FA 4L0CA 1XZJA 4W1PA 1QIMA 1JJFA 2ACKA 4CG1A 2RIPA 2Q0XA 2X76A 1HBJA 2ZYRA 4LXIA 1ODCA 5DYTA 3WKCA 2PSEA 1VE7A 1XZMA 4AMZA 2CKMA 3H2HA 4H7DA 2XLBA 3G9ZA 5A71A 4EY4A 2JIDA 3ESCA 4H0CA 3WK8A 4N5HX 3DOIA 4GWLA 4BC1A 1XZIA 5LZ5A 5DTIA 1YASA 3D4LA 3DEAA 3QPAA 3DDUA 4WFKA 4OU5A 1XLVA 2XQJA 1ZD2P 5AHXA 2GBIA 1DQYA 4U2GA 1RYYA 4FLEA 2OXEA 1CUHA 4KR0A 1BCSA 2WHPA 3PUHA 5DYWA 1EHYA 3WWPA 2GYUA 4BB0A 3ESDA 4WY8A 4L3WA 2XUPA 2JGJA 5BWCA 3STVA 5AM3A 1CUEA 5I7UA 1QJ4A 4UBMA 2ECFA 4QDTA 2VTVA 1LPNA 1LPPA 4LKOA 2VF2A 3R3VA 4JNCA 1TIBA 2JGIA 1T2NA 4PW0A 3IUJA 2CJPA 4Y2VA 4FTWA 2VT6A 3DL7A 4RNCA 2J3DA 1BCRA 1K8QA 4MWSA 4WJLA 2PSHA 3EF3A 1EH5A 4DNPA 5C8VA 3PDCA 1ACJA 4DNQA 4HRYA 1ZGBA 4C89A 4MQMA 1EDDA 3WK5A 1Y7HA 5FXMA 2CBGA 1E8MA 5FV4A 4X6YA 3R3ZA 4GLBA 2H7XA 2J4CA 3G9XA 3S2ZA 5ESRA 3D0KA 2CEKA 4X00A 3AIMA 1K63A 5AK3A 2RHTA 2Z8ZA 3G0GA 2O7RA 2RHWA 1X2EA 1XFDA 3N2ZB 2V96A 4H77A 3AINA 1JI3A 4F0JA 2DCMA 1AX9A 1CVLA 2WKWA 3JW8A 3W9BA 1L7QA 2X8BA 4LXHA 2HIHA 4RPCA 4PNZA 4BAGA 1ZIYA 1KU6A 3O9VA 4QDOA 3A2LA 1MU0A 3QYJA 5JAPA 4BC0A 2GZRA 1CUZA 4W9RA 1ZJ4A 1MJ5A 4DNOA 5ALXA 5JD5A 2XI4A 5AKKA 3FCYA 4FHZA 2ZJ6A 4XJVA 3WWOA 5FKJA 3KOOA 2XMBA 4S0XA 4Y2PA 3T52A 1XZAA 2BAGA 1HL7A 3ZWQA 2GYWA 2H7CA 5K3DA 2HU5A 3F98A 2QS9A 1THTA 3WKAA 5AI8A 5LZ8A 3V48A 5HQ3B 2O2HA 2WG1A 4KAFA 4MWTA 1JKMA 1NU8A 3MUNA 2WTNA 1GZ7A 4UHBA 3AUKA 1WM1A 4FNMA 1CLEA 1QIIA 3FAKA 3ANTA 4Y2UA 3QPCA 1A8QA 2ZJFA 2GBFA 3FSGD 4Y2XA 1DX6A 2JGLA 5CT8A 1CUSA 1VXOA 3U1TA 5HFNA 2ROQA 4DNFA 3BIWA 1XKTA 4O08A 4XVCA 2Y1KA 2EEPA 2QR5A 2XUQA 3F9CA 2Y6UA 3GZJA 2VJAA 5AKXA 5ALOA 1CUXA 1EVEA 4B9EA 1ZICA 3WWEA 4P92A 3KSRA 5HK8A 2B4KA 3I6MA 1UFOA 5AKJA 4ZREA 5HFAA 3QITA 2WM2A 3I1IA 4C88A 4OCZA 2QKYA 1XRLA 2WUFA 1W75A 4KRYA 2WIFA 3DKKA 4ITVA 3V1MA 2XUDA 3WMRA 1HPLA 3WZLA 1CQWA 3PE6A 5DNWA 1YS1X 4KAJA 1W52X 5C8ZA 4UFNA 1P0PA 5KREA 4YX9A 5FPQA 1PFQA 1CUIA 5ALTA 5F4ZA 4FLFA 1BN6A 4C4ZA 5JIBA 2Z8XA 3H2KA 1MAHA 1P0MA 2HA0A 4P08A 1EB9A 3WKBA 2WHRA 5LIPA 1AGYA 2VATA 5D3KA 5HZGA 4J0HA 4OB8A 3BIXA 2R8BA 5LLSA 3V1NA 1OILA 4IH1A 4G8CA 2QXTA 3QM1A 1LPMA 4HVTA 5K3CA 4K6KA 3I2FA 5JZBA 4EY7A 5LYYA 2XUAA 1AC5A 3WL5A 1YCDA 1TCAA 4BTLA 4AN1A 1BE0A 3GFFA 3ZI7A 5E4JA 3BJRA 2GYVA 2HA3A 3KD2A 4Y2RA 1UOPA 3HEAA 5FUMA 1GKLA 4Y9SA 1AURA 4KE9A 2WU3A 5AM4A 5J3JA 2OCLA 5FDFA 3SK0A 3K2IA 5AKIA 1Q83A 4J0IA 5HKAA 4W1QA 3H17A 4UPDA 2QVBA 2VT7A 2QXUA 1A8SA 1VZ3A 4MYDA 1DQZA 4M0EA 4F60A 4H7JA 2QTBA 1MN6A 2HU8A 3WK9A 4AO8A 4BDTA 1CR6A 2ACEA 1ZI9A 1UXOA 5A2GA 1Q0ZA 3R3WA 5ALWA 4UHFA 2V9ZA 3K6KA 4Z49A 5SYNA 5DTJA 3FVTA 4ETWA 4G9EA 5T4FA 1H23A 5CW2A 5E2IA 1M33A 3CXUA 5CXXA 3H2GA 1F0NA 3OOSA 2HADA 2XQIA 3IULA 5ALIA 3W06A 2C5FA 5LKRA 2QT9A 2V97A 4J7AA 3QMVA 1JT2A 1XZBA 3DJYA 5AP9A 4UHDA 3HABA 1EDEA 3DS8A 1F8UA 1UK8A 4FLMA 4ARAA 1HKHA 1CV2A 2FX5A 2OAGA 5ALSA 3L1IA 3FLAA 4MJ3A 4AN0A 2PUHA 3A70A 4K2AA 1FFDA 3VJKA 3D5EA 2WJ4A 2AJ8A 5I8PA 2WFZA 4BZWA 1IUNA 1GGVA 2ZSIA 1YSCA 3I2GA 3WIBA 3LLCA 3IA2A 4X95A 3G9UA 3F67A 5HQ3A 4H7KA 1WB6A 5C81A 3PF9A 3GELA 4P93A 3O4HA 4B81A 3ESAA 5ALVA 2XB6A 1RP1A 1BRTA 3R3YA 3BF8A 1YAJA 4G8DA 3QMMA 1Y7IA 3R41A 4J0KA 4HZGA 4UBOA 2OCKA 3JWEA 3HXKA 4G5XA 3STYA 3IURA 1CUDA 1QIKA 1XZEA 4BATA 2OCGA 1BN7A 3IVMA 2VJBA 1N1MA 3LS2A 2AJBA 1CRLA 2UZ0A 4N5IX 5KBYA 2JGEA 5AM5A 1DINA 1JFRA 1AMNA 3N0TA 3WYNA 2PKYX 2Z3WA 4AO6A 3H1BA 3WYDA 1NU6A 5HF6A 4MEAA 1TKRA 1TK3A 1DT5A 2XUJA 3C8HA 4BCCA 1QLWA 2VJDA 2ZSHA 2RGUA 1H2YA 4N8SA 4X7BA 3E4DA 5HF9A 2PM8A 1GXSA 1THGA 3T4UA 2VAXA 3KWJA 2JBWA 2Z5GA 4QE3A 1J07A 4E14A 1LNSA 3WJ1A 4I3FA 4QZVA 1C7IA 3CN7A 3H2IA 4EHBA 4PSUA 4QA9A 2FJPA 1N8SA 2YYSA 4BP8A 3AIOA 5ALLA 2YXPX 1FFCA 1WPXA 4X93A 2O2GA 1E89A 4XWGA 4JYPA 2WIGA 2WIKA 3IUQA 1DX4A 2ZYSA 2QJWA 3DQZA 5A7GA 3STTA 1IZ7A 4G9GA 5FRDA 1B6GA 5AIBA 5AI5A 1S8OA 2PSJA 1WPRA 3DL4A 1WB5A 4WDRA 3OPMA 2H9YA 3ANSA 4UFPA 3S8YA 1Q0RA 1QIEA 4BRSA 3BWXA 1LBTA 3I28A 1QTRA 4BBZA 4UBLA 2XQGA 1U8EA 4OU4A 2DFPA 3PFBA 4U2CA 1CQZA 3G0BA 3SC2A 4UBNA 2WG2A 3FYUC 2I03A 3TRDA 3WWCA 4UBIA 5AOCA 5AM2A 2OPHA 5FOQA 5JADA 5EHXA 4F5ZA 3C5WP 2QOEA 5K3FB 2VQ6A 3I2KA 4DSAA 4X6XA 2XMDA 2WHQA 1TCBA 3OG9A 1J06A 4J0JA 5AK4A 2FUKA 3G9TA 4G8BA 5JATA 4DMFA 1UKCA 3NOXA 2D0DA 3SWWA 4HAIA 2O2IA 2JGFA 1LLFA 4GECA 2XMCA 4Q3OA 1YR2A 4OUKX 4F21A 3E3AA 3NWOA 4UFOA 1EI9A 4ZRDA 4CG3A 5EIHA 3ICWA 5HF8A 1CPYA 3IB3A 4OD0A 3VJLA 4BVKA 2Y2VA 2XUFA 3TGLA 4UHEA 2DR0A 5CXUA 1P0IA 4BVLA 1L7RA 1TCCA 4W63A 3FWHA 2HRRA 2ZJ7A 3BE8A 3DCNA 4HRXA 5CT9A 4AZ0A 1N5MA 4QDXA 1PV1A 3A2NA 4I19A 4HXFB 4HXEB 4B6GA 3STUA 4J3JA 5K3EA 4Y2TA 3DOHA 1YAHA 5EGNA 1HQDA 3G0DA 1U2EA 2HA6A 2HA7A 5LZ2A 3MUOA 1PJAA 5YASA 1MX1A 4B85A 1UOOA 3KXPA 5AI9A 5AOAA 3WKEA 4WFIA 2WQZA 1BEEA 3UUEA 4YK7A 4BRZA 2CMFA 4ZV7A 3KDAA 1QO7A 3PF8A 1MPXA 4ZGBA 3O4IA 1WCYA 4MEBA 4QLAA 4IHAA 3R3XA 1EK1A 2C4HA 2PSDA 1XZHA 5DNVA 5JAHA 2BKLA 5C8XA 1UK9A 1N5RA 1XZFA 1W6RA 4Y2QA 2D5LA 4BAZA 4LXGA 3QPDA 2DHCA 4GI1A 3FLEA 3LP5A 1QZ3A 2JGMA 3VVMA 3ESBA 2BCEA 4RE5A 1ACLA 2O7VA 3BXPA 4PF1A 3YASA 4LYEA 3ZLTA 4B80A 1MX5A 1G5FA 2OGTA 5HKBA 4Y2SA 3BDIA 3D2AA 2IX9A 3G8YA 4AMYA 2WUDA 1USWA 1GQRA 3EQ9A 3F8SA 4ZV9A 4BZZA 3OTQA 4CIAA 3D2BA 5AIAA 3I2IA 1CUCA 3DYIA 3O4JA 3HSSA 3I6YA 4QNNA 1EVQA 3ZV7A 1GPNA 5ALDA 2C0PA 3D2CA 5DJ5A 2PSFA 5E4YA 3F97A 3ED1A 5JZSA 1BS9A 4Y2YA 5LZ9A 7YASA 1GT6A 3FBWA 4A23A 1AQLA 2VSQA 3R40A 1JU3A 3H1AA 3STWA 1P0QA 3M81A 3DD5A 5CMLA 2XUKA 1CUJA 4N8EA 1ZI8A 1A88A 3O0DA 2GZSA 2BGNA 4FWBA 4B83A 3Q8WA 3JYHA 4GW3A 4EBBA 2OAEA 5JYCA 4RE6A 4XIIA 2WFLB 5AKHA 1R4ZA 4H18A 4BVJA 3WKDA 4L72A 4MQLA 1ZD5A 1AKNA 5JZ9A 1OXMA 1QTIA 3QBJA 2PL5A 2XMGA 4PQEA 1XRRA 3FYTA 3K9BA 1KU0A 4HTAA 2JF0A 2B9VA 4TPKA 1XROA 2QMQA 3KWFA 1H2XA 3O9MA 3ICVA 1W76A 5K3FA 1UK6A 4PV7A 4PO3X 1Z68A 1VXRA 5DLPA 1QIGA 1JMYA 1FFBA 3RARA 3WIOA 1LPBB 5H3HA 3H2JA 5AH0A 3DNMA 2HU7A 5IVHA 2WTMA 1ZD4A 4X90A 2G5TA 1W1IA 3I2JA 4Q3LA 1JJBA 3M83A 4J03A 1DU4A 5EFZA 2ORYA 1JMKC 3QMWA 1QE3A 1ZGCA 2WIJA 3D3NA 4BP9A 4OYLA 4XX1A 3SX4A 2QUBA 4GHWA 5FLKA 1EXWA 2H7YA 4IO0A 4DIUA 4OB7A 1FFEA 1XQWA 1E66A 4HXGA 2OG1A 1GPLA 1F6WA 3O95A 4B7ZA 1XZCA 5AKYA 4BDSA 1WHTA 2XUHA 5FP0A 2J3QA 1DWOA 1J2EA 2HL6A 3GBSA 4GDMA 1RWQA 5AKZA 4ZXFA 4CCYB 3G0CA 5CH5A 2QJRA 1LPOA 4U2EA 1YB7A 2QRUA 3UMJA 5D6OA 4OB6A 1XQXA 2WJ6A 1R9NA 4NZZA 3AZQA 4WDQA 5ALMA 1TAHA 1BU8A 4CFSA 2WU4A 3I1YA 4FFWA 2ONCA 1R3DA 3P2MA 1YA8A 3W9UA 1YA4A 2WLSA 1JJIA 5KWIA 5ALRA 4ZWNA 4DM7A 5EHQA 4K5QA 1CFJA 2IIVA 3IBTA 3W04A 1XRQA 1XZLA 2XE4A 1MNAA 2OGSA 1F0PA 1TQHA 3WK6A 1ZOIA 4E46A 2B61A 4U2BA 3LIIA 2BJHA 5CT5A 1G42A 2PPLA 4DLNA 4C6HA 4G4GA 1QIJA 5BOVA 3BL8A 4AXBA 1O6GA 3PUIA 4Q1VA 1WB4A 1CUAA 4X6UA 4X97A 2BFNA 5AK5A 3C5VA 4EA6A 2HA5A 2XLCA 2XUIA 3A2MA 3FNBA 2HFJA 2DHDA 1CUYA 5EIAA 3E0XA 5BV7A 3X3HA 1ZJ5A 2XQKA 4KACA 2WUEA 5ALPA 5JARA 4W1RA 2AJDA 4DMCA 2HRQA 4FBLA 4KE6A 2AJCA 2ZYIA 3WZMA 3RLIA 2RAUA 2W6CX 5AI6A 3B12A 1VE6A 5D7BA 3VDXA 2WJ3A 2RONA 5AO9A 2Y6VA 2GBGA 3LCRA 1CIJA 3HRHA 1K4YA 5K5EA 1XQYA 5AKLA 3FSGA 2VEOA 4E11A 4C4XA 3BF7A 4NMWA 3WL6A 4U2DA 3CCBA 4FOLA 3FLBA 1XKLA 2K2QB 3OM8A 1UZAA 3W2TA 4IH4A 3O4GA 1MT3A 2R11A 1SCQA 4CCWA 2ES4A 1GQSA 5LZ4A 4N8DA 3V1LA 4B0PA 5ALFA 1FFAA 1DWQA 2XMSA 1EA5A 5JAUA 4UBKA 3VKFA 3HZOA 3EQ8A 1H2ZA 2P8SA 2PUJA 4IQ4A 2PBLA 2PU7A 4B82A 4KE7A 2BUBA 4CG2A 2B20A 5CT4A 5EI5A 3RK4A 1ZI6A 4KRXA 3H0CA 1QO9A 4BYMA 5JASA 5LP1A 1U4NA 1YS2X 1LPSA 3V1KA 5ALJA 3PICA 1XLUA 5IKXA 2JEZA 4L9AA 3WL7A 3RM3A 3C8DA 3EBLA 5JD6A 4FFVA 4H7HA 5ALYA 2WG0A 4PSDA 5CURA 5T4BA 4C4YA 3EIOA 2DQYA 3TEJA 1IUOA 2HDWA 5HF5A 3FYUB 1UKAA 4AZ3A 2CZQA 4B84A 3HJUA 4BTVA 1QIDA 4Q34A 2WFLA 3C6ZA 1DTEA 1QONA 2ZVDA 3BJMA 3FVRA 2G4LA 4AO7A 3WK7A 1CUWA 4Q05A 2YH2A 1BEZA 1SCIA 3HI4A 3NUZA 3UUFA 1QIHA 4C01A 1DT3A 2I3DA 5ALZA 2W22A 2XQFA 1VKHA 3NGMA 4D9JA 4AX4A 5ALKA 4ZI5A 1L7AA 3FOBA 3WA7A 1HDEA 2AJLI 5AKGA 1HLGA 5A7HA 4JEIA 4QWWA 1K6EA 5C7YA 5AK6A 1FJ2A 3IUMA 1MAAA 1QOZA 3STXA 4MXDA 3ZPXA 5IVKA 4B0OA 5T4HA 1X2BA 4BE4A 1LZKA 4GEGA 4X3CA 3B5EA 3IDAA 3C6YA 4GXNA 3E1GA 2X5XA 5HK9A 5ISMA 4DSZA 3TJMA 1W4LA 1I6WA 2Z3ZA 5DYYA 1B41A 5AICA 2QM0A 3CN9A 3W05A 1R1DA 2DHEA 5K3AA 1R88A 1LBSA 1ETHA 2G63A 5AJHA 3QVMA 1U65A 4UBJA 4CCYA 4RGYA 3VJMA 1XQVA 4EY8A 2EDCA 1IZ8A 4EY5A 2C7BA 5E4TA 4OPMA 4CI9A 1UOQA 2HHAA 5D3ZA 4H7EA 2QZPA 1CUGA 4X85A 4AQDA 4DMKA 4NVRA 1NX9A 4KE8A 2CUTA 4QDUA 1DWPA 1G66A 5AM0A 1IMJA 2BUCA 3WI7A 3M3DA 3C6BA 5A7FA 5JAOA 1QFMA 5IH7A 3V9AA 2C5GA 1E5TA 4NS4A 4J0CA 4GBGA 5SYMA 2FJ0A 3H19A 1UKBA 3WL8A 3OURA 2C0QA 1T4MA 5CBKA 3AILA 1SOMA 1UWCA 2IITA 2XUOA 1UT6A 4ARBA 6YASA 3PI6A 2V98A 4JH0A 1MO2A 2GBCA 3I6ZA 3ZLUA 4H35A 4KYVA 5CRIA 4ROTA 1VOTA 3QZUA 1ODSA 2PVSA 3MVEA 3B3QA 2EDAA 4QWMA 5AI0A 4FNGA 5CT6A 4JYMA 4DGQA 2OLEA 3C87A 4LYDA 5ALHA 4X71A 3AZOA 3OC0A 1YB6A 4LHEA 3CCCA 4DMHA 4M0FA 2XMRA 2HFKA 1D07A 3EQ7A 1GKKA 2BGRA 2XMZA 5DNUA 2HA2A 1H22A 1C7JA 3HACA 1QIFA 4CIBA 5JANA 1A8UA 4YPVA 1E8NA 4I4CA 3ILSA 4IH9A 2ZYHA 1EK2A 4X94A 2DQZA 4V2IA 2XDWA 5BWBA 4KAAA 1E3QA 1ZIXA 4OYYA 5I9IA 3VXKA 4AB1A 5EIEA 5CH3A 3U0VA 1CUUA 1K5PA 3PFCA 4EY6A 1FSSA 1QGED 3BDVA 4Y7DA 5AOBA 2WHPB 1XZKA 3QH4A 5IVDA 4C87A 1MNQA 3AJAA 4K6HA 1MTZA 2H1IA 1LGYA 3AZPA 1E8DA 1VLQA 1XZGA 3C6XA 1C4XA 3WQHA 4EB0A 2VAVA 1IUPA 3D7RA 5IVIA 3WJ2A 1XRNA 1IVYA 2OQIA 3ZLVA 4OSEA 1CUVA 4H7FA
chains in the Genus database with same CATH superfamily
1N9GA 2P35A 2QZJA 3ND8A 3SKVA 1USIA 5G4LA 1E62A 4I5EA 5CDGA 5L3QA 3KQLA 2Q3DA 4L85A 2YL2A 1WLYA 1VLJA 2ATXA 4PQYA 1H2WA 1ZH0A 2OBMA 3HC7A 3C3YA 3OUUA 2X2FA 3HDYA 4IMPA 4QQRA 5SY9A 4A5SA 1E7QA 1XVTA 2V4UA 3RVNA 2XNSA 4UM7A 2V8BA 1ZGAA 4OQQA 2PSSA 3FROA 1X1CA 3GV0A 2E9SA 4IIXA 4IMIB 4MV3A 3P2OA 1Y34E 2VTKA 3QEJA 1X80B 3TTWA 3ZHZA 4FYJA 3I0ZA 1M8GA 1G20A 2O2YA 4R8SA 3H9UA 4YAGA 4NBTA 5KOJB 1QFSA 2VH5R 4UASA 2HM7A 2EJCA 1A50B 3TECE 3ZV3A 4BV2A 3C6KA 4R41A 3KVOA 4LFCB 4EOGA 1ETUA 1JVNA 2VPYA 1PJ2A 2XT0A 4DQDA 4KHZA 4R3WA 1GDDA 2BMDA 2Q4BA 4ZVKA 2VHZA 3MWLA 3MTBA 2ZTVA 4TYPA 4Q3DA 2C58A 1KRHA 1T6YA 2H85A 1GLVA 4YQZA 5EJ8A 1IOWA 3BCRA 2PBFA 3U17A 1WW3A 2CKDA 2CXSA 2XTAA 4Q7MB 4K6GA 4KYIB 5DP1A 3VVLA 4G0XA 2PWAA 5F7JA 1RM3A 3O91A 3GA7A 4MYSA 3X0DA 4HCJA 4FNAA 4QOJA 1DXQA 3RWOA 4PPQA 2HCFA 4BGVA 1KP2A 3PX7A 1OCEA 1TKCA 2YZGA 1X1EA 3IDOA 1N34B 5DLQC 2PZ8A 3G82C 4WCVA 3UHAA 2XMQA 3DEZA 3GJ8A 4MV4A 4YXFA 2EWVA 3G2PA 2ZRBA 4INZA 3ROFA 1N2BA 3UT5A 3ZR4B 4LF4B 3ZQ4A 4G0WA 3F90A 1L5RA 2PUWA 1GD1O 5K3BA 5DCYA 4ZYVA 1Z88A 3I30X 3GARA 2HQBA 2IQ5A 4M1QA 1NAIA 2WUGA 4HBGA 4PLYA 5NLLA 1W36D 2DSNA 3KYCB 1FVOA 3BH7A 5T4EA 4UE2A 3PQDA 4ZVSA 1DKOA 4Z3OA 2CLEB 3P0JA 4W9NC 2FEXA 1QPBA 1U8UA 1E1RA 3HY4A 4X8LA 1VJ5A 1GRCA 1XJQA 4KCGA 4R2HA 3BKXA 2J9ZB 3QWAA 5CJJA 2RGEA 2WTAA 1XAIA 4N82A 4OQEA 5GGXA 1JNXX 3T0IA 1HOTA 4IRMA 3KZNA 4YHBA 2I2FA 1TADA 3Q0TA 4HVLA 4D0LB 4Q7QA 2WA2A 1AN0A 4KBFA 4BX8A 3VYUB 1JIXA 4YMUA 2RI6A 4M9XA 4R98A 2R2GA 2O0MA 3I72A 5T5QA 5JDIA 1AUOA 3L6EA 3X1XA 1T1JA 2ZANA 1PAUA 1RHUA 2PUEA 4CKXA 1RMTA 5HCUA 1UDCA 3EVBA 3U5TA 5ALNA 3V7NA 2GMWA 5CPBA 3AXSA 3CLKA 1KDYA 4FI3F 3IIIA 2YASA 4MV7A 3WLAA 4GR5A 2FN8A 2E48A 1EGAA 2FUCA 4KVZA 4LDRA 4R69A 4YJ3A 5IM5A 2PX6A 3UKOA 4JI5B 3JVIA 2ZUUA 3MXOA 2VF8A 3JYQA 1JJ7A 4PINA 4FE7A 4XD2A 3VDMA 4B71A 3PHJA 1QG2A 3A4YA 3K5HA 3AESB 1JU4A 1IB0A 3T4PA 3C3KA 1WKVA 3LW8A 4RJKA 5I5GA 4B31A 5K09A 4WASA 1MX9A 3K70D 3OZ7A 4KGZA 3HKDB 2RB5A 4F5WA 1AQ6A 2OM2A 2C61A 3E8MA 3ZWAA 4YUAA 2OM6A 1SBTA 2HA4A 3K6JA 4WVFA 2P2LA 3JQAB 2VTDA 2CCGA 4MW2A 4UUAA 1TM3E 2E3JA 4IRUB 2Y2UA 1HYEA 1OTXA 1MB3A 2J0UA 4UEKA 3GO4A 2G04A 5DM1A 4S24A 1H2FA 3QP9A 1Y6JA 3TR5A 3UJPA 3U4DA 4RKQA 2GM5A 1Z34A 5BOSA 4DC0A 3K20A 5C5IA 2H2IA 4QQNA 1IONA 1JYEA 1MOQA 2BUAA 3L0YA 4HNAB 3JQRA 4DV0B 1E2BA 2PU5A 2VUTA 3L93A 5AW6A 5G0UA 4C9BA 3BGIA 1TJ5A 4Q6BA 3U39A 3VR4H 2OZEA 1RFGE 2O8BB 3OZEA 1U94A 3V97A 1WHSA 5FADA 1VZ2A 4O4JA 4RS4A 2WILA 1TUGA 3GGDA 1PKEA 3FW1A 3COSA 3W8RA 1SK8A 4QDKA 5AKEA 4BMDA 2CXUA 1M6VA 3D6NB 1ZIOA 3PXCX 4A16A 4BO7A 2GAIA 2WB4A 1NYQA 3ETDA 3JY6A 3R5XA 3V32A 1X8LA 3DE6X 4IIYA 4GPZA 1YRHA 1M2NA 4U7JA 5AM1A 5SY6A 1WE2A 3ONNA 2CZGA 3FCXA 1P7CA 3PNBA 1ZGJA 4FOSA 3I2HA 1HE3A 1J6UA 5HPYB 4L8GA 3DKRA 3RNOA 2ZG6A 1WOMA 4JV5B 1NQOA 3GLHB 3KXIA 2VI5A 1G4HA 1J23A 1PZNA 4I50A 4RTLA 2VUUA 4OHOA 4XGNA 2AN9A 2FDCA 3OQIA 4Q82A 3HLTA 1PWHA 2R8PA 2IZ0A 2R62A 4OFBA 1I3LA 1V37A 4YBRA 1OBHA 3LVFO 3BXGA 4I5IA 1POWA 2F9FA 2LIPA 2V45A 4P7JA 4ABYA 4F4FA 1HNXB 2I7XA 3K70C 2WD8A 2GEVA 2XNCA 4MV0A 5DYNA 3U3KA 2P9YA 3M6LA 3FVWA 3LNCA 2CSUA 4ER7A 3HB7A 1KK0A 2ZXEA 3AIKA 5DGXA 3LYUA 4GE3A 2FMIA 5EINA 3Q11A 2JEYA 4N5MA 2CB9A 3C7TA 1P8AA 3AI1A 1X39A 2YHBA 4MIYA 3OIGA 5AI4A 4W5OA 2NO0A 3P27A 3U7HB 4HI0E 3U9TA 3IALA 4J0GA 2NZ2A 1E3WB 1W73A 3W9BA 4BQNA 1PUJA 3NXKA 1FQWA 5BSTA 1KSFX 1RBMA 2Q8NA 5KYUB 5EIBD 2GEFA 1IULA 4PYNA 2DR3A 3MSXA 4BUJA 5EHNA 3HCBA 3HDQA 4U7PB 3NBAA 4X91A 3BM5A 3MGAA 4DDKA 5KNDA 2AOTB 2JW5A 1EFVB 3UMMA 3HV0A 3M8KA 1GHTA 4DARA 4UHCA 2P62A 3BQ9A 4G25A 2P6MA 2WD7B 4DLWA 1QC5A 1XR3A 2MT9A 5EQDA 3V4PB 2CNKA 1XAHA 3OMWA 4YT5A 2BHTA 2DWPA 2YVQA 2VNKA 3RV3A 3AEUA 3GUUA 4A3SA 3K05A 1RYEA 1Z83A 3KZ1E 5TSDA 3QU7A 3QVOA 2R751 2OGZA 2A35A 4OM7A 3PD7A 3U81A 3OQNA 2P90A 1ZMXA 1TJ3A 1O77A 1UJCA 2V74B 3U44A 1II8A 4HDRA 4JC0A 1TAGA 5JCOC 1DI0A 1O9HA 2OYSA 4EA7A 5CB6A 3ZGNA 1GNSA 4BMZA 2G9VA 2Q9CA 2OAP1 4ZDWA 5HHTA 4BMPB 4KDRA 3WMFA 1HBJA 2P2CA 4UW9A 5EHGA 3LDGA 1JQLB 2UVPB 1T2FA 4U0KA 5G0TA 4FFBB 1SVUA 2REBA 2ZAOA 3AT1A 2CHGA 5B55A 2CNDA 4X66B 1V0JA 4BNLA 4Q4HA 1XZMA 2EFHB 1KZ6A 2L2QA 3H2HA 3B1JA 3ZDFA 1O3YA 5A5GA 5AW4A 4WW0A 4G2TA 1QHHB 3MD9A 1UDBA 4GZ6A 4BQQA 5IJXA 3I5XA 1P1JA 1JDSA 2ABWA 3T5MA 4V0LA 3WK8A 4HPXB 1WZIA 4Q4JB 5EJ9A 2CXHA 2H6EA 5ITZA 4L74A 1MA0A 3M2PA 4BC1A 1B8UA 1T2DA 4Y6OA 2BONA 1OKKD 4K9QA 4MQ4A 2YHIA 4HDCA 5ICMA 1JEYA 3P9XA 5AUOB 4B4UA 3DTVA 1YASA 3RUAA 2B7LA 3DEAA 2OPBA 3GFVA 3QPAA 4XM1A 3RSGA 4CKCA 1FLAA 3L6UA 4IGAA 2EKPA 2XQJA 1QDLB 1ZR4A 3SC3A 4NXMB 1D5WA 4OEHA 5AHXA 3UMRA 1V8FA 2YOFA 3H6GA 2EJUA 1QYRA 3BFVA 4HX2A 4KH0A 2GBIA 1DQYA 1NSFA 2BEWA 5DBEX 3E9DA 1VE9A 2OXEA 3ND5A 3S1AB 4KR0A 2R44A 3IHTA 4G0PA 1YWGO 7AT1A 1SUSA 2QRVB 5LCXA 3RQIA 3KYIB 1OB2A 1T1IA 3LX6A 1RRMA 3HUTA 1W4AA 2J3JA 3AEYA 3MJEA 4EUKA 1RQ2A 2Q2QA 5TPZD 5IXSA 5DYWA 1EHYA 1P6UA 2AD5A 3AO0B 3PENA 4ZO4A 2X14A 4L07A 3EY4A 4MUIA 5TQJA 2UZ1B 3M1IA 4ZEMA 4XVHA 4UUOA 4RCYA 4C3UA 3BDAA 3R0JA 2FPIA 3NHFA 4KPUB 2DUUA 4PFJA 2Z3VA 3STVA 3CNEA 2VDWB 3UANA 2W6PA 1EAMA 1CNEA 1YI0A 4O2RA 1LI7A 3DVLA 2HUPA 1YHZA 3DKPA 5I7UA 2CLOB 3BD9A 3LPLA 4JLSA 3NT2A 4KPYA 2VYND 4UBMA 1WQ1R 1EUZA 2BF4A 2FMHA 2FPOA 3PSAA 1Q3TA 3PGMA 4I5DA 2A3NA 1JQKA 5H83A 3IH5A 2CVFA 1G8SA 3PC4A 2VF2A 3R3VA 4PG8A 2E5LB 3EIHA 2HJGA 5T7BA 1TIBA 2GHTA 3AEKB 2KSQA 4YHHB 5BORA 4FW9A 3TXYA 1A2QA 2MSDB 3IUJA 1YUBA 3K1JA 4DE5A 1A04A 1RHMA 1RTTA 1VJRA 2RHRA 2R8RA 4LCEA 4PC1A 2J9FB 4PLGA 1P45A 4FTWA 4DV7B 2DLDA 1JAZA 3E9QA 1YQUA 2QROA 4QICA 4TKUA 3U5ZB 1FFYA 1H05A 4BU0A 2QVGA 4AJ9A 4TYNA 2J3DA 3GJ7A 1JDVA 1RPJA 3AQ4A 3QJYA 4QAQA 4WT7A 5HWSA 2WTEA 2H1RA 2PSHA 1R0ZA 4WJKB 4YPOA 5AJUA 1UBMS 4TV8B 4DNPA 1NG9A 3K1ZA 2ZJ4A 1TO2E 3T3DA 1WXHA 1XCJA 3DEYX 4DNQA 4HRYA 1A76A 3B2NA 4D4JA 1Z6AA 3JASA 4FIDA 4LOAA 3L0CA 5M3BA 3TIGA 2QJOA 4V03A 3V7WA 5ICFA 2ZRKA 2P5SA 3H5RA 3N07A 2G9QA 4WN9A 2JCBA 3A7DA 5EE3A 3A6JA 3HB0A 1KI6B 1OT5A 1DLIA 1K0FA 5FXMA 2XCRB 3OHMA 1NZDA 1NY5A 1H2EA 1NVEA 1GYRA 3W0LB 5B7GA 2ODAA 2AN1A 1E8MA 5FI1B 1KDZA 3O2NA 5K6AC 1DC7A 4O2LA 5EOVA 2Y0BA 3G23A 2RSLA 1Y98A 2V7QA 4NU5A 3G9XA 1ISRA 1ORRA 3HCNA 3OEEA 1RNLA 3T7CA 1VMDA 1BDHA 4QHSA 2CEKA 4X00A 4XWOA 1R9JA 4V0MA 4F45A 1K63A 2C84A 2W6MA 2RHTA 4FZ5A 1LRKA 2IZOA 2Z8ZA 3J7AC 2XZDA 3BAZA 3KT6A 3AIIA 3NBZC 4NH0A 1BH2A 1ZVKA 1Y5IA 2V5VA 1X2EA 1XFDA 3PTZA 4RJJA 5LQNA 2EZ4A 1NVWQ 3WICA 7ADHA 1XMQB 1SQSA 2OK7A 2R6R1 1D1PA 1Z08A 3AINA 3EJWA 1TO1E 3Q9SA 4FFPA 4YI5A 3ZKWA 1UDWA 1SVSA 3A4IA 3VAYA 3C3MA 4GZ3A 2EZUA 1AX9A 4XYMA 1T5SA 4QIHA 4DBVO 1K8XB 1Q1GA 1SIUA 1PCXA 1YZYA 2FPGB 2FY8A 2V7VA 3JW8A 1L7QA 2X8BA 4G24A 4MW6A 4X20A 4G23A 3UBTA 3GRPA 1EFTA 1KMMA 3ZY2A 2X3FA 2RGRA 4W8GA 5JSKA 4RPCA 1P8JA 1D9ZA 4BAGA 1ZIYA 5HG0A 1Q77A 3RFXA 1IE3A 2DU8A 3KL4A 1CZNA 3W8EA 5K8LA 4QTYA 1MU0A 4MRNA 4XR4A 5I9LA 5JVDF 2ZT8A 4P0QB 4B2PA 2FPUA 2N46A 1PT7A 1L4UA 2IPXA 2GZRA 3DV2A 3KOMA 3UAOA 4UHKA 1L9XA 1YL6A 3IB6A 4Y6LA 2OXIA 3SSOA 2V3CC 1FTWA 3A4NA 3L8ZA 4QGFA 1EPUA 5COQA 3UTDA 5ALXA 1GAXA 4WX2B 5J2TF 4QU5A 2VFAA 3HCCA 2AH5A 4FGUA 4JQYA 4L6CA 1DDGA 4LWPA 2XPCA 2XMBA 3ITKA 4S0XA 2FCAA 3OFSA 4LSGA 2BAGA 2CFSA 2ZBDA 4IIJB 2M2IA 3V8EA 1F9AA 3ZBQA 3ZWQA 2GYWA 3KLBA 5K3DA 4M1SA 3THSA 1EK6A 2E55A 1OFTA 2G80A 2A1TS 2HT6A 3CGWA 3LDHA 3EXFA 3LX8A 2QS9A 3MQ4A 3CONA 3V4RA 1NI4A 3TK1A 4ASUD 2X1HA 4S2UA 3VSDA 3VHLB 1QRTA 3FZQA 5TT1A 3UXYA 4QD3A 4FYMA 5KOYA 2E4ZA 2WG1A 4S35A 3T1NA 1TMOA 1JKMA 4MCIA 4GOLD 2SCUA 3OCZA 5K7SA 1ZWLA 3HR4A 3M7IA 2FPSA 3MUNA 1WW8A 4EYEA 4CLRA 4YVFA 3RVDA 4GM0A 4DJTA 5K8VA 3WXBA 4PGFA 4UHBA 5CFOA 1FSGA 1R4AA 1WM1A 3GB9A 3ZCTA 4GKKB 1N2EA 4JI8B 1PX0A 4ON9A 3TF5A 2Y4OA 1CIPA 2ZTLA 4BO2A 2QBYA 4Q3AA 4QG3A 2IOFA 3QPCA 4Y2UA 1N5KA 2QUIA 4MVJP 4O4HF 1I9CA 1NUSA 1YQQA 2P4EA 1E0KA 5FD8A 2WJWA 5GTDA 1A0OA 2RCNA 3IPAA 3H3JA 3NWEA 1Y5MA 3H6KA 1DX6A 3CUUA 1NJSA 2AUTA 4Y2XA 1KKUA 4YV1A 5A1JA 3ZW9A 2R4QA 4QPDA 3FIUA 3FGPA 4NCXA 1OU0A 2EFCB 4ALLA 5F3WB 2C7VA 2FSUA 2C8KA 4BB5A 3BC1A 2Z2XA 3UWSA 1CUSA 3AKEA 3FBGA 1BHO1 1Z35A 5HFNA 3E61A 5FHRA 1VMEA 4JB8A 2ZDGA 1RLUA 3BIWA 3E35A 1NWHA 3K9GA 4BE7B 4CV3A 3AVQA 4O08A 4R2IA 1C9DB 3A6DA 4PZEA 1PO7A 3EAFA 1ZUWA 2F90A 4QECA 1JFFA 1G7CA 3DBLB 3F6PA 3Q3HA 4QBGB 4WACA 3VNQA 2XBUA 4TQUS 4UATA 3EZXA 4EGCB 1K8ZB 3HBFA 2OAQ1 1B0UA 1MEEA 1YBAA 2HF7A 3T38A 1I3MA 3GJSA 1O0SA 2VJAA 3GZJA 3I4FA 5AKXA 1Y81A 2NUAA 4GXRA 3WR5A 3D6TB 2Q4RA 3ZU5A 3TTYA 1XCGB 1DIHA 2YWFA 3NCTA 5ANRB 1IDN1 1SCUA 1T9KA 3FKJA 2C4NA 2VWHA 2HGZA 3I6MA 4L0QA 5D3QA 4KPFC 4ZREA 5HFAA 4Y67A 2IY8A 1PZMA 1KI3A 1NC3A 3F71A 2XIQA 1T5LA 2J6CA 3WNZA 4BLRA 1I4EB 2WUFA 1OLSA 5CVCA 3QJ5A 3VZCA 1V1RA 5IEBA 5CP8A 5CDYA 1RS0A 2V6JA 4IIEA 2BN4A 2X41A 3FWZA 3PUVA 4Z0NA 4DANA 1X8KA 1ZOSA 2M9MA 2X6RA 4U7FA 3TSYA 1XXHB 1YZHA 3VDRA 5A3RA 2FQWA 4LQDA 4KG7A 4N6GA 3GRAA 1O8CA 1FMCA 5ECDA 5GONB 1U7ZA 4WESA 4D44A 1RAEA 4PZ0A 1GXSB 2EFJA 1ISIA 4MGHA 2BFFB 3MTQA 2VRBA 3BMCB 5AXCA 3PWKA 4EF5A 4U6QA 4F7WA 1SB8A 2EFYA 2FR0A 4XJSA 1P0PA 3TQTA 1U9IA 3INTA 2VT3A 1YQWA 1YQ9A 2YJTD 3K5IA 1ULAA 2QORA 4XUDA 1CUIA 3KR0A 4DLXA 2NPOA 4XW2A 5B53A 3KCQA 1Z3CA 4NC9A 2ZUSA 4Y1FA 5A3JA 3T7IA 1KI8A 4LV8B 1T0PA 4U9UA 4A36A 1V47A 5ALTA 4QTUB 4HJRA 5EA2A 1UKEA 3T0GA 1X77A 2QR3A 3GUCA 4W6ZA 1ZAYA 2NXCA 2IYTA 3UKDA 2P91A 2PNFA 2ZJ1A 4ZQBA 3PJFA 2ATIA 5IRCD 4IJKA 2X4DA 5GIPE 1YIOA 2GCGA 4J07A 2BFMA 4YRKA 4DV5B 3THRA 3ONEA 5CA0B 2HA0A 4KO4S 4P08A 3B6MA 4NENB 3X43A 4I55F 4ZDJA 2D1QA 3P9KA 1EX1A 1Z6PA 1KO8A 1PW7A 1YE5A 1EB9A 4P4GA 3W8FA 3K1AA 5LIPA 2IW3A 5BN4A 4L0DA 1JKJA 3E15A 3LPAA 2R8BA 3CH7A 3T0FA 3O8QB 4I2VA 4IKPA 2BZGA 4FONA 4FQ8A 2IOFK 1KETA 4FT2A 3UCFA 3CKMA 2R8YA 4I1YA 2EJVA 3TKLA 3CE9A 1M7BA 4MVCA 4XE5A 4YP1A 3LT2A 4MR8B 2QTZA 2F9LA 4HFNA 4IH1A 2PWYA 4UXJA 1TZJA 3RRNA 1GR0A 7ABPA 2RHHA 4E3WA 1SVIA 5K3CA 4K1LA 2QNRA 2X0NA 2RBKA 4LECA 1GPUA 4WL0A 3LOPA 5JZBA 1W49A 2ZSDA 1A27A 1FTSA 3LUPA 4BP3A 4GP7A 3M6MD 2ISCA 1IY1A 4RQAA 2FLWA 2PH7A 4M4SA 5JQGF 4AY3A 1AC5A 2CK3A 2MSNA 4YLYA 2IYNA 1JVBA 2BC9A 1Z7GA 5J63A 1YCDA 3ESYA 4ZVLA 4PC3A 3ZNNA 1HDOA 4CKEB 1KEEA 1MUUA 5CU7A 3N2KB 3HP7A 1FU8A 3CPJB 4Y9RA 5BUZA 4V1CB 2Z6QA 4RTNA 3D8HA 4UVIA 4ONEA 3UWKA 4C6RA 3F4LA 4NMLA 5E4JA 4YRIA 1JB9A 1QVWA 2WI8A 5JT1A 3LFTA 4MMXB 2GYVA 2HA3A 3DEIA 1F17A 3UV3A 4A26A 1BX3A 1DP4A 4ZT4A 2W48A 3ORRA 3A25A 4MUEA 1IPHA 1AZSC 1QLJA 2REOA 2XQVA 3COVA 3OZVA 1RW4A 3LSTA 4PPGA 4GQBA 2YYAA 3QRWA 3O1JC 1P2UA 4HSGA 3ZEAA 3ZWKA 2BKAA 3DE3X 3IAHA 5JR3A 3QV1A 4OM8A 1ONOA 1UJ2A 2FOLA 3GRCA 1G4AE 1LSOA 3A8TA 4IF4A 3IKVA 4MVXA 4Q3NA 2OORC 4MI6A 3UEOA 3H1FA 2BWJA 3FPSA 3UENA 1JZSA 5EIWA 3GJ4A 2IEYA 3A6LA 3ILVA 5EWMA 3GIDA 2IZ1A 1V5WA 3F4BA 3G7SA 2GBLA 5HKAA 1X7DA 4Z6KA 1KO7A 4RV4A 3H17A 4TXHA 4UPDA 3SXUB 2QVBA 2V6FA 2VT7A 2CSXA 2QN9A 1XHFA 1G98A 2BL4A 3GZ4A 4EI8A 4WK6A 4GX2A 1DQZA 2J1LA 2OQRA 5L9AA 1I32A 4I1SA 4PYLA 4B5KA 1ONNA 2H4YA 2OV6A 3MERA 5C32A 2FUNB 2Z6VA 1L5MA 1IBCA 3L41A 1LF5A 1L5OA 4KQCA 4R6XA 4RTKA 1CR6A 4HO1X 1RBQA 2DYKA 4MRRA 1ZI9A 3OZBA 5IBRA 2P4UA 2POQX 1OH5A 2OILA 2FN7A 1V3TA 5ALWA 4UHFA 3MCUA 1H5UA 5BXYA 3PFFA 2V9ZA 3TPFA 3Q6IA 4I36A 1EE2A 4AT1A 4DJEC 3WISA 4CQMB 5LWHA 5SYNA 1XCOA 5DTJA 2NO1A 4F7DA 4BZPA 4UDXX 4IQFA 1GUBA 2O05A 1Q44A 4B2YA 4YRMA 1E3MA 2FFAA 2Q27A 1U5BA 4HNGA 5TVGA 4G0ZA 9ATCA 3K2EA 1DZ3A 3PDHA 5T4FA 3W2HA 1E2GA 4CTJA 3EDOA 1TTQB 1KVSA 1H23A 2ZIVB 1TTTA 2ZTHA 3CZCA 4LSZA 4UAJA 3DZJA 2HXYA 1E9CA 1M33A 2V3VA 3I92A 3ZCQA 1JR6A 3DR3A 1T4CB 2KWIA 1RLMA 3D5TA 2PLNA 2NXEA 3FA2A 3GJQA 3T1YB 1IY2A 2OYCA 3OOSA 3L7LA 3L4BC 2JI6A 4DR4B 3KDSE 4BVFA 4TYYA 2HADA 3MHTA 3DT8A 3B51X 1D6NA 3OICA 2QT9A 1A9ZA 2V97A 3MRTA 3TYXA 1W4ZA 1FRZA 3H2YA 1KS9A 3K1TA 4NNOA 4OQDA 3T9FA 5C46F 1ULHA 1JDNA 3T7DA 2C5LA 3NHWA 3QMVA 1G8YA 2VZLA 3DMTA 1XZBA 3DJYA 5AP9A 5LU9A 3T7KA 4HEA6 3KPYA 1QV7A 1A9RA 1EMDA 1TGVA 1YK1A 1YULA 1Z25A 2P6UA 4MQBA 3W2GA 4JQOA 4W5NA 1Z0ZA 4OJNA 2P0AA 2QAGB 3LM8A 3K6SB 4FLMA 1T2VA 1UPCA 3TIIA 5A4MS 3IYLW 4FHDA 4LNUA 1KERA 2OAGA 4DCPA 5ICGA 1VBFA 2FSIA 3L1IA 3FLAA 4X1KB 5FB3A 1Q7RA 4MJ3A 1VGRA 3HV2A 2ZJOA 1J8YF 1G3MA 1FY2A 1R6XA 2HIAA 4FYYA 4WZBE 4AMVA 4AUEA 3TOZA 3VPXA 2ZUBA 3W5BA 1FFDA 4JR0A 4PBTA 4V0RA 3D7SA 4G4SO 1NGSA 4LW8A 3UJ9A 1L5YA 4JEUA 1JXOA 2AJ8A 3INYA 1E7YA 1UMDA 3C6MA 3RNLA 1BMQA 4AJPA 4BZWA 5BSGA 2V1UA 1RAAA 3H9GA 4QJBA 1IUNA 2ZSIA 2Y71A 3P0HA 1GCAA 3IBSA 5A3SA 4L6AA 1OFHA 3H9EO 5FA5A 4ZHQB 2R6GA 5INTA 1G5TA 4DEVA 1K5HA 2Q46A 2EFDB 3IT2A 3LLCA 4JT9A 1GTL1 1I7DA 4N0DA 4OL9A 2YVKA 3IA2A 4XB1A 3OJ0A 4X95A 1N2HA 5FOUA 3RT9A 5AW8A 2IP1A 1E3SA 2NIPA 4HQNA 3QYAA 3PGKA 5SZIA 5BV0A 1EX7A 5CTJA 5HQ3A 3PC2A 3KUKA 4OHPA 1ZRSA 3D5QA 1GZUA 1FYVA 1U3VA 4IVQA 3ZXYA 1US8B 2JCGA 4EELA 2EYUA 4WNAA 3GELA 3ZCSA 1TL7C 4RHUA 1ULBA 1YBHA 3D8NA 3ESAA 3VVBA 3BXEA 3CSUA 2CJWA 2CYAA 2ZROA 3F1LA 2XB6A 4JBNA 3SIRA 2FPWA 1F5SA 4B3DA 5HIAA 4M6WB 4WIAA 3FUWA 3WFZA 4BGEA 1YAJA 4RF3A 4LZZA 1H4SA 1DS6A 2DE0X 2JCVA 1E6WA 4G8DA 5J5CA 1JQ3A 3B2QA 3EH1A 2RC6A 1FRQA 1Y7IA 1XTBA 3R41A 1W0KD 1IZ9A 4HDNB 1NNLA 1WCV1 1X7XA 3UYLA 1VQ1A 3O92A 3UJBA 1NVGA 4UBOA 5JVDA 2ZXFA 4XWAA 3RAPR 3IURA 4LQCA 3KB1A 3W3AA 3HI6A 3SIXA 1K3UB 4KGVA 2B1IA 1XZEA 3JAWA 3TDKA 3VOTA 1VFNA 3GJ5A 3FHOA 3QUQA 2OHVA 2CXOA 2GJ8A 3TQIA 3IVMA 5J2TA 1U2SA 2XNDA 4DT1B 5K2OA 5DTEA 1PNOA 2RKBA 4Q9JA 3LS2A 2DULA 1CRLA 1FPMA 2CUKA 2UZ0A 4JL8A 5C8YB 3MCZA 2RC5A 5FWYA 1PZXA 3EXG1 4N5IX 5K8JB 4S2EA 2VXCA 3CS3A 5TQ0B 2IPNA 1NI5A 2BFAA 2JGEA 4ZDIA 1GO2A 1MIOB 2I66A 4G0OA 1T5DX 4LUCA 5CEJA 1UXJA 1OWPA 2PGXA 1D3AA 2QUHA 4QU0A 5ARDA 1PGOA 5A4AA 1KDPA 4PYQA 1AMNA 2VOEA 2R84A 4JP2A 4Q01A 1OUMA 1QJCA 2PT9A 4AO6A 4Q00A 3QE2A 5LB4A 3WYDA 2GN4A 1DXHA 1ZS9A 2IHZA 3AF2A 4JUBA 1UQTA 1QANA 1T36A 3R0IA 4KIFA 2H2WA 1C9YA 1VE3A 2HQSA 5EMKA 1QH8A 1TK3A 4ZAZA 2D6FA 5IT4A 1DT5A 4HH1A 1GRRA 4I81A 2R4TA 3ZWVA 4M7OA 2YOHA 5ERYA 4CF4A 8LDHA 5JFOA 3PGXA 1JA1A 1LDBA 3WVNA 3A1DA 1W4CA 2GPYA 2VJDA 2ZSHA 4ZYLA 5GINE 4IJWA 4ILKA 1TUBA 1OC4A 1RAFA 2C2MA 2RGUA 1H2YA 5CK4A 4ZKDA 4KQ2A 1ONPA 3RTGA 1TX4B 4KVFA 4PZYA 2JFHA 4TV9B 5FHQA 1QF6A 4O4HA 2Z9CA 4MYCA 3LV8A 1K89A 4NL4H 4NCJA 4P84A 4YRZA 3T4UA 3PNKA 2V7EA 3BUSA 1Z7EA 2JBWA 2ZCUA 3KWJA 1ID1A 1PSZA 2QRLA 1CY7A 3MJRA 4PZCA 2DKFA 2I3GA 1AGPA 1LNSA 4TM8A 5TRTA 3QQ5A 4CI0B 4E03A 4L78A 5HBRA 5KSYA 4AVYA 1A7AA 3FDIA 4DDTA 3WP1B 1J20A 1EHIA 2HZ7A 3CN7A 4MVYA 3VKUA 5TS3A 3NVKI 1ZRNA 1WZUA 5HVNA 2DETA 5KX5B 4QA9A 4BUCA 1HEUA 3RAJA 1EKXA 3GJTA 4MP6A 4RENA 1EBFA 3K9CA 1Y3CE 4E7PA 5JMWA 3EK2A 4YJFA 5I4BA 3L4JA 2LPMA 4BP8A 4G0UA 2RMKA 1N7IA 3AIOA 4P3PA 4RHYA 4EG5A 1EFKA 3MJFA 4GPIB 3USES 1X1DA 3NANA 4XWGA 4HDSA 2ZE6A 3TN7A 3WB2A 1OIWA 4D4LA 2ZRQA 1I2ZA 2O1WA 3GL9A 1YFKA 4ZOLB 3ZXXA 3ZDDA 1N3BA 1KAQA 2ZUEA 5EC8A 5KSOA 5TMEA 1M1YA 1NIPA 1DO0A 3SDZA 4NE9A 4DSUA 1XXLA 4GX1A 3I0NA 1JTVA 3AK4A 3EMDA 4RVDA 2C1EA 1KNXA 2PG3A 1F7UA 2MINB 4ID9A 2I34A 3ZWNA 4EKEA 4PRLA 1Y5RA 4PYIA 1J33A 5A7GA 3Q40A 3N2YA 1J99A 3P96A 4G9GA 2WVGA 3RC7A 1CQIB 1A1VA 3IL2A 3F7MA 2VZ0A 3NHYA 4RKRA 1JWBB 2P0EA 3W9YA 2AEMA 1S8OA 4RLQA 1PK8A 3L3BA 3PUXA 1M83A 1WPRA 4DJJA 4JLOA 3QBTA 3DL4A 4F9GA 3RC9A 1WB5A 4WDRA 4A8JA 4GM4A 8ATCA 2WYOA 3EDYA 3OPMA 1BE1A 3V8MA 2XB2A 2H9YA 3LQ2A 3DFUA 4YYZA 3GMIA 3IHKA 2R6FA 5LMZA 3TSCA 3P9NA 4XM2A 4J2OA 5BN3A 4BIIA 1QIEA 4AY6A 3LPCA 3CKYA 1E1RD 2P2DA 2OECA 2R8EA 3BWXA 1SCBA 1Z0JA 4NG5A 4RD3A 4BBZA 3HKCA 1CHDA 1SMKA 2IUSA 1XG5A 1TLTA 3JQ7B 3UAGA 2WR8A 3TMAA 1TM1E 4OU4A 2X13A 1PFGA 4DSTA 4BBJA 4QT4A 2D4HA 3N87A 4US0R 3PKJA 1M8FA 5EN4A 2EGHA 3HJTA 3LY9A 2C3UA 1HGXA 1P1IA 4LOLA 4O0LA 3X1WA 1DBVO 3PFGA 1ZH8A 5CG1A 1DIGA 1HYHA 4IYJA 4Z2YA 2XWBF 4DLPA 5CAEB 2IC5A 3A37A 2G28A 3LP6A 2BJWA 3NHMA 3QEOA 5F21A 1FNSA 3T6KA 4BO8A 2V0GA 3FRHA 4MHTA 3RYFB 5FOQA 2OPHA 2QM3A 2AOUA 1UJMA 4I55A 5EHXA 3DWFA 2P6NA 4F5ZA 3WAGA 3SFZA 2W6JD 2BFDB 4UMFA 4BN5A 2L0XA 4EKYA 1QGOA 5K3FB 1V7QA 2VQ6A 4YFYA 3FIJA 1E2IA 3ZWPA 3CY6A 3WGQA 4K05A 3QPBA 4CM5A 3OJOA 4OJYA 4L3VA 1KZ7B 3VJRA 3EVNA 1TCBA 4F38A 3FTNA 1E1NA 1YACA 3ZH9B 4U7HA 2EGUA 4HJXA 3CJTA 2ZB3A 1UC5B 2KLHA 3DH0A 4OG2A 1U31A 5JATA 1TK9A 5KDLA 1O6CA 4EG8A 3HZRA 4R1OA 1U8CB 1KOFA 4NCAA 1DKMA 2V7XA 5FPSA 4R1LA 1SBQA 2D0DA 2FHSA 3C3XA 4WXMA 3L8DA 1CD5A 3IDFA 1DO2A 3FPHA 4RX1A 5BQFA 1SHJA 2AFHE 3MBKA 4GECA 4TRRA 4Q3OA 1QSGA 1G8AA 3GDFA 2UZIR 2G1UA 3OZXA 4L15A 3AFHA 2B98A 3BWCA 1VIVA 1YU6A 4LI3X 4R9VA 4F21A 1WL8A 2ILVA 4UFOA 2CLCX 2HJRA 3ONVA 1P7VA 4HDOB 3F7NA 1UBLS 4ZQFA 4NPHA 1OB5A 1GNPA 1Q3KA 2IE0A 3ZW8A 5L45A 5KJCA 1S2GA 1WOYA 1A77A 5JISA 3H4MA 3OPVA 2C00A 2XCUA 4C0JA 3F6SA 4RUKA 1GRQA 4JLJA 3ICWA 1TA0A 3E3OA 3R8XA 3K0SA 5HF8A 3IGFA 3B52X 4JB0A 4DR6B 2CCKA 3CZ5A 2QB5A 2HCRA 3AHJA 1JTEA 4HUQA 4WK0B 4OD0A 2P3LA 5DI9A 5LA6F 1JR3A 1CJKC 5K8CA 2C2WA 1CF9A 4BVKA 1XTQA 4A03A 4FDUA 4XPIA 1ILEA 1LWNA 2DR0A 3BBPA 1P0IA 1L7RA 3ETNA 1TCCA 1WW2A 1ISHA 1E2HA 2ZJ7A 3BE8A 1DV2A 1JHZA 3KUDA 4HRXA 1L5LA 1JR4A 4MS4A 5JMOA 1CP2A 1LWOA 1XEWX 1TRKA 1N6HA 3EZNA 3DAPA 2A6PA 3ZHCA 2E7ZA 1GILA 3NAZA 4CMCA 3TZQA 4HXFB 4CW7A 4C7OA 3BAFA 1NUQA 4KKVA 2IYFA 2O7SA 3CLVA 1EWRA 3KZKA 4GOXA 5E7IA 4D8TA 4EF4A 1KTVA 2BYTA 1JPUA 1DQRA 1FTNA 1HQDA 2PTHA 4U7WA 1O54A 2HMWA 3QX8A 5UKDA 1G2OA 3NXSA 2IQIA 1W0JA 4MROA 3SEZA 5BT9A 5KSZA 4V1CI 3E9ZA 3VH4A 3DE7X 3OM0A 1YDEA 4BTEA 3E9CA 3JWHA 1GZ4A 1P2GA 5JW6A 1UAGA 1PJAA 1IJBA 3G59A 3G8DA 3L8EA 5LXTA 2ZB4A 3WKEA 2M6KA 3WSWA 2AE1A 2WQZA 3PHBE 5KNDD 1N32B 3PQ7A 2D5CA 1BEEA 2HREA 3UUEA 4RLSA 2AQIA 1B3BA 5D3MB 1MVOA 1NP7A 1QR2A 3ENWA 2HF8A 3PPYA 4P36A 4YK7A 2QW0X 2FRDA 3ZIDA 1VSQA 2ORIA 1H5QA 1N9ZA 1X7WA 2X2EA 4FN5A 1RT9A 4EQ6B 4KFCA 3SDSA 2Q1YA 3H9QA 1MJGA 1QAOA 4IFBA 4DV3B 3EXIA 3PF8A 2OHXA 5U1PA 4YRDA 4ZGBA 5DSTA 3UBMA 2CDCA 2ZSBA 1HQCA 2D62A 5BYBA 2AMYA 1OC2A 4MUHA 3S28A 1GGKA 3FTPA 3ZU6A 4BFZA 4IDHA 1J8MF 4KIGA 3BMOB 2EP7A 3ON5A 2V6MA 4IHAA 2J5QA 3OOJA 4JJ4A 2EZ8A 1G8PA 2GPWA 3DV9A 2X5KO 2VJYA 2WDPA 3EGXA 1JS1X 5HUJA 3OFKA 4ZXPA 1K7EB 3HXQA 2AF4C 4BKUA 4UTVA 2O8DA 4XDYA 4LYHA 3PEYA 3C3JA 4NV3A 3U4GA 1IHPA 1RPTA 4MVJF 3MYYA 4WCFB 4QGGA 4JJGA 2PFKA 7MDHA 5J2UB 5JAHA 1GT91 4K87A 1CULC 4DNXA 4I4TF 2DBZA 3PFIA 4X54A 4NYMR 4UEJA 3ADDA 3K9NA 2IYLD 5CIYA 4DILA 2NQ8A 4LJRA 4YR7A 4PE5B 3BTOA 1YIAA 3RIEA 1BS2A 2XEXA 3GYBA 3DLCA 1N36B 1NNEA 2ZVQX 3K2QA 4WY2A 3VX4A 3LUDA 2DQKA 3GNTA 4ND8B 1PQ4A 1PJRA 4EMBA 1W48A 2LVBA 3A10A 4XCQA 1MRNA 1K1EA 3LVBA 3QPDA 3UFXB 5KYNA 1Z63A 2FG5A 4DUYB 3VVCA 1PR3A 4HNUA 2W90A 3FYCA 1BX1A 2G40A 3LCJA 1Q0HA 2CVHA 4ERNA 1ZM2A 4S05A 1Y1TA 1X0XA 4M9CA 4OF4A 3KSZO 2FRVA 2JGMA 3O74A 3RCBA 3HYLA 3WYFA 4B3IA 3JWJA 4OV6B 2D5AA 1KAOA 3OLYA 4JGIA 2P11A 2BCEA 1S89A 2YMQA 1RZ3A 1Y9ZA 1DIRA 2ZR0A 2ZJ0A 3I73A 1C7ZA 2NSLA 4D4KA 1FJGB 2O7VA 3WMEA 4ZAGA 3BIFA 3RW9A 3JQGB 1IBMB 3GWZA 3VH1A 3LVQE 1JFLA 3AEQA 2ZZNA 3BXPA 1CNMA 3FTFA 1OIVA 2Q8QA 3FB4A 1QP8A 5EERA 2XR1A 3A05A 3ZLTA 3DP7A 1FUYB 2QLBA 3D6FA 4B80A 1MX5A 2ISQA 2PKXA 2AYXA 1DBQA 2ZEJA 4W99A 4HPJB 5L53A 3Q98A 4RPKA 5EMNA 1H1LA 2ZIZA 3PX3A 2B5WA 3D2AA 2GJKA 4TMFA 1I5OA 1S1MA 1NAHA 1JLRA 5BR8B 2OD9A 3KKMA 3H16A 3PNOA 3TAUA 1KAHA 1T3HA 4CGYA 1L6RA 5LJLA 4ZV9A 1P6QA 3OE4A 4G5FA 1PJCA 2HPZA 3C6QA 3RU7A 4B8ZA 3RG2A 4PYJA 5LDDC 1E5DA 4TS9A 4LF5B 2H07A 2AT1A 2DFKB 3PG5A 3QTTA 1SBYA 4M0PA 4M88A 4OHFA 3ZS9A 1MH1A 2Y66A 2XHZA 3I2IA 5EJ7A 1G6OA 1I4DD 3VR6D 1NF2A 3ZCVA 3KTFA 2A94A 3HSSA 3AR6A 2I7TA 2QXYA 3OHSX 2ZTUA 4L22A 1ADCA 1FRFS 1QXSA 3LZ6A 4PYKA 1G60A 5A9SA 3HJNA 2RHJA 1T1GA 2G0TA 1X9HA 1IXZA 1RXCA 2BEVB 4DXDA 4MUKA 5B6JA 3KUCA 1CTQA 4J0EA 1V7CA 2XF2A 4F4UA 2WWYA 4ZQEA 4I1VA 3UK2A 5TMDA 5JZSA 5F7OA 3GEHA 4Y2YA 2JLUA 2LRHA 4CM7A 5LZ9A 1ENYA 2VK1A 2C2ZA 7YASA 4II2A 3RODA 4KIUA 1PVVA 4XARA 3RVRA 2EG9A 2B2XA 2OE2A 4BPRA 3KZMA 4QU8A 4A23A 2P9ZA 4COKA 1P4RA 1TW3A 2HIMA 1GCUA 2W4QA 3H1AA 5BQ3A 2F4VB 1P17A 3M81A 2IWRA 1G59A 1Y4SA 1FU4A 4ZI7F 2GFIA 4Z4QA 1EVIA 3KC2A 5DV9A 4JASB 1CUJA 4NBNA 1TPYA 1I4LD 2IU0A 3RU2A 5HSGA 3NNDA 1WSDA 1A88A 3IPRA 3O0DA 3OEED 4ABTA 4FWBA 3P4XA 4B83A 5J58A 3BEOA 2GD1O 3CWQA 3R23A 5FWDA 4RELA 4A27A 2IW1A 4HV4A 1KA9H 1YCHA 1YKSA 2C3PA 4C7MA 3NGXA 4G5HA 1J8VA 2OAEA 1U0SY 5D87A 1WG8A 4WSOA 3WGOA 2WFLB 4ZCIA 4LDJA 4QASA 4F2DA 2X1VA 4V0ME 3IX7A 2RGCA 2Z9BA 3IXLA 1ZD5A 1RVV1 2YZ2A 2AR0A 1TW2A 2DG2A 3FUUA 2HNAA 2J4DA 1QQBA 2IS6A 4MO9A 1ZVQA 4MS3B 1GJRA 1QTIA 3SSNA 3E8XA 4H1UA 5A3QA 2DLCX 3D0RA 2NVWA 2XZLA 3K32A 3KT0A 3IT3A 4XAQA 1P2VA 3Q85A 3OE7A 3P20A 1F2TA 4I5GA 4XD7A 4OVKA 3MIZA 2OSVA 1TF2A 2H16A 2C96A 1FDTA 2GZAA 3MNFA 3IMCA 2JF0A 2B9VA 2RGGA 3DMPA 5HXAA 3WG9A 5JS7A 4CNBA 3TD6A 2QMQA 3HA2A 3O8LA 4GL4A 5EJ6A 4XGQA 2VT2A 3C3BA 3RSZA 5FULA 2L42A 4PV7A 4RA6B 3AERB 3PCRB 1Z68A 4PZDA 1A4RA 4CF5A 3FRIA 1QIGA 4CEIB 4URFA 5H68A 3K09A 2C4TA 5HCIA 1B0AA 4QHTA 1FFXA 2PYZA 1FFBA 4AMBA 3OCUA 4GZLA 1LPBB 5TARA 3R6LA 3L18A 5H3HA 3AOEA 4I0WB 1Z0DA 1TVEA 1SQ6A 1Z7YA 2HU7A 3BK2A 2X9GA 1N2CA 3DF9A 2AG5A 3L7BA 2QP4A 2O5RA 2F64A 3OD1A 5FPPA 2XZTA 2ZSUA 4CTMA 1JLLA 4RMNA 2Q4EA 2G5TA 2HTFA 4DQLA 1C0PA 2QTCA 4PFSA 4U7DA 1ZCJA 3TMYA 4LYAA 4NFHA 5A4KA 4QYIA 1DU4A 1EGQA 1JG6A 5JPCA 5A05A 3W2EA 1Z5GA 3NHZA 3ET5A 3NTRA 1VGVA 2ORYA 3MAAC 2W9XA 4G1UC 1LU9A 5GVRA 4E31A 4QXQA 3U3MA 1XA4A 2EQBA 3PD1A 3TRIA 3LF1A 5A0TA 1BXGB 5CX1B 1VB3A 5BWNA 3ZD8A 2JBHA 3DMFA 3EEFA 5ARCA 4XX1A 1XP5A 3SX4A 4L0MA 3U4QB 4QYTA 3KZXA 4GHWA 1EXWA 2PRJA 3IAFA 4IO0A 4DIUA 1JAIA 3HRKA 4IUBS 4KH1A 2O8NA 2UVQA 2OD7A 4UAUA 1A69A 3QVJA 1XQWA 5LOVF 5EMJA 3U0BA 4TTVA 1Z28A 2KMLA 4YUVA 4HXGA 2IBTA 1Y3FE 2OG1A 1Z0AA 1N8KA 2A14A 2G9RA 3F6BX 4X7RA 3UAWA 4XD7D 4E5NA 2JLQA 2X5OA 3I83A 2HBQA 3BCHA 4C07A 1JIIA 1WHTA 1KJWA 2AEFA 3E3LA 1J2EA 1XO1A 1Z4QA 4PZ9A 4MDFA 1RU3A 1R0SA 3AFNA 4F6CA 1W36B 2P1DA 4CKZA 1LPOA 3L84A 4DR3B 4WI1A 2COUA 2QRUA 3PXEA 3UMJA 4C06A 2ZPUA 3EQ2A 4LJKA 1SUCA 2INGX 3TJRA 2IKSA 1Y6GA 1TD1A 3KSMA 2Y93A 4J4BA 2IFTA 4BRWA 1GV1A 1QUEA 2KYRA 1NF3A 1RABA 3LRXA 5CFQA 3E9YA 3BQMB 3M9XA 1WMSA 2QVXX 2WU4A 3CLUD 2WVHA 3I1YA 1DJLA 3EGDB 1CJSA 3GOHA 5LU8A 1R3DA 3P2MA 3IKJA 1GPAA 2QMZA 1L4MA 3IOEA 4EGJA 1YA8A 5IS2A 1OD6A 3N53A 4UU0A 2W42A 5A4DA 2B99A 5CM8B 4RIEA 1JJIA 1KFKB 4KO2S 4QOEA 2GZHA 1U04A 3AB7A 5EPEA 3WDMA 4C1NA 3J81k 4PXYA 1FRNA 3G2HA 3KB2A 3L4SO 1UWVA 2OC9A 4OI4A 2PE5A 2XWSA 4K5QA 1VLZA 2CGEA 1G64A 1NRXA 3LUGA 3NC1C 2PEZA 4PAGA 1VG9B 5HFJA 1S8FA 4PBRA 3I42A 4YNBA 1XZLA 3D8TA 5DF1A 2JIMA 2I5PO 3GZNB 4K9DA 2DTDA 4I9NA 1NTOA 3X1MA 1Z6TA 2APJA 2EATA 2PV0A 3DAOA 1UFVA 1NPDA 4NIMA 5CNJA 4B45A 3KQQA 2RHMA 4P34A 1XMVA 4V39A 3EGVA 5F51A 1TTHA 4JY7A 5GAJA 1HT2E 3WLOA 2XNKA 3KL2A 4H60A 4M38A 2H31A 3S7ZA 3L1KA 3HWSA 3T3GA 2CCJA 2HGSA 3W4KA 3TWOA 3OO0A 8MHTA 3FGOA 3TRFA 4ZC8A 1NQ5A 4GRIA 1XVUA 3N2NA 1QU3A 2D3TA 5LA6A 2M98A 2ZVJA 1R27A 4LHYA 5SZKB 3OMXA 3BMQB 3ITEA 4FI3C 3UT0A 4CM6A 3BL8A 4RVGA 2WW8A 3T4XA 1O6GA 3MWEB 1GGMA 3PUIA 4AXBA 3NM5A 1UMCB 4R68A 1AJEA 3B78A 3JATB 2WZCA 1JDZA 4C6SA 2H2DA 1J1ZA 2BFNA 4B7CA 4DG8A 5AK5A 2ZYAA 4C4TA 5FUBA 2UUCB 1EDOA 1JHQA 3FPEA 1MD9A 3A2MA 5G41A 4D82A 3FNBA 4CLHA 3OZWA 4FGLA 1Q3HA 1XC7A 5E8RA 3KUXA 1LDMA 2W83A 1AXRA 3JALB 5BV7A 1SQ0A 2I99A 1ZJ5A 1UMBB 1UC8A 1Z22A 3TPCA 3VR2A 4KLAA 3DUFB 3ISJA 2FJUA 4KACA 2G09A 4QFBA 2YS6A 2FX2A 3HRIA 1IN4A 5DH9A 1EWYA 2GI4A 2AJDA 2COKA 2Q1WA 1P9WA 2P27A 3SXPA 2GVDC 1M72A 4DMCA 1X13A 4BO0A 3N2GA 1O0CA 5FPYA 3WGUA 5JRDS 1OLXA 3W79A 2ONYA 1L4KA 4DZZA 1PYGA 4XIJA 1RKVA 3RLIA 1YS7A 3UMYA 2H4FA 3VKHA 1MDBA 3L8MA 1I14A 4UNRA 5KZMB 5E95A 1DAKA 4DBZA 1YHYA 3IMFA 1L1QA 2MSKA 2REQB 3B12A 3QLTA 4MJXA 4R3UC 3SJBA 5L6MB 1GGJA 1RSZA 4FJ1A 1P0CA 4PAOA 4XJTA 4UARA 4CODB 2W2MA 4UDYX 1I6MA 1NJGA 3I45A 4V3CA 4DSOA 4EYOA 3QIAA 1UIRA 2DQ4A 4M9QA 4IXNA 4LBYA 2QX8A 4RJ2A 5LFAA 3CH4B 2JBAA 4HF7A 4R1UA 5B1EA 5KTTA 3LCRA 4FCVA 3CKLA 5KYWB 3HRHA 4AKTA 2OCAA 3NH6A 3QELB 3E84A 1XIVA 3R5SA 4IXWA 4NICA 2O7QA 3ORHA 3ILHA 5AVOA 5K5EA 5E2BA 1K8RA 3L7MA 3ZE7A 721PA 4IDCA 1K7CA 1X42A 2AC4A 1C0LA 1DRWA 2A57A 1HLPA 1IHYA 4JLNA 4NHEA 1VPDA 1C0EA 3O7MA 1A9XA 1DKLA 3Q3IA 1X7ZB 3F2VA 5F52A 4YQEA 4WKCA 1U9IC 3ETHA 3PK0A 4JX8A 5DBFA 2VWQA 2AKYA 2EYQA 3OM8A 4ARSA 4PSKA 1V3VA 3P2JA 2VDJA 5J4YA 1IL0A 3P0EA 2EW8A 1Q5PA 2WVJA 1GUDA 1N5JA 4UTZA 4IQ0A 5G1OA 2R11A 2CBXA 4TMKA 1MFZA 5A5VA 3SJZA 4MVJA 4CEJA 1DNPA 1XEAA 4MR7A 3KB8A 3RHSA 5IUNC 4I99A 5T6BA 1XHEA 4OGFA 3KQKA 4XYLA 3NDBB 1GQSA 4I4TA 4BMXA 3DZFA 4LWZA 4UU7A 3SR4A 1ZOOA 3PTLA 4HEJA 5CLHA 2Q3FA 2W58A 3DDHA 4K3VA 3FCSB 4F5YA 1L5HB 1P2TA 1HEYA 4Q12A 5FTJA 3F5QA 3K15A 4AMGA 4B43A 2FP4B 3C98A 3W6UA 4P7FA 1EJ2A 1BMFA 3DUWA 3HZOA 3MTIA 4DTIA 1C9JA 3ZUGA 1OH8A 2ECKA 3GN1A 1UQUA 2BMAA 4HWRA 5K0LA 3ZHOA 4F9FA 2AZDA 1SGWA 4LMBA 3I05A 5FPTA 2AKAB 4DWWA 3TMKA 1NM5A 1UPBA 1U98A 3OTHA 2CL7X 4RD6A 2WY2D 1X1TA 4I6JA 4EHLA 1NNSA 2BUBA 2PN1A 1PQYA 4CG2A 5AVWA 1FFWA 1UAAA 1SVKA 2GCOB 1OF1A 2F1RA 2YV3A 3KO8A 3PWTA 4PG6A 2XCLA 1RKUA 2TSYB 4QELA 5EI5A 4EG1A 1BKDR 4KRXA 1YMUA 4Z7JA 5HX7A 3D7NA 1ELOA 3TFOA 3CRNA 5LP1A 4BO1A 1U4NA 1OXBB 1YS2X 2LR0A 1C4KA 5EKSA 4YRCA 3KYBA 4BQRA 1RI5A 1COWA 2PMWB 1REQA 4AF6A 3QNWA 2A4MA 3L7OA 3Q72A 3QOWA 3HYCA 1R12A 5IMSA 1EM8A 4JXZA 1TEHA 1Y1RA 3LC2O 4DWVA 2FR8A 1SRRA 2FEWB 1XLUA 5AMXA 5H4GA 3UJAA 1FP1D 2C7GA 2VWGA 3MGGA 4UVHA 4L9AA 3ZI0A 1L5SA 3EEIA 5AW9A 1U4SA 1HOXA 3MM4A 3C8DA 3RM3A 4TX1A 4BQOA 4FFVA 3QVVA 4X7MA 4DR5B 3CVWA 4RKYA 3QG1A 2HWXA 2JI9A 5CURA 2YMLA 4RU1A 2QP9X 3RS8A 2VZEA 2A84A 4ZVOA 5JQGA 2AX3A 2PZAA 5B7NA 2VBIA 1MEOA 1OAOA 1N2JA 1USGA 1JHMA 1M6NA 1OHHA 2AI3A 1XQ9A 2CZQA 2NYRA 2O6HA 2AX4A 1OFGA 2PFSA 3E8SA 1QIDA 2ZI3A 1HC7A 3C6ZA 2AYYA 1DTEA 4QQKA 3TIXB 5FNVF 3VMMA 1QONA 1RZRD 3ZY6A 4CL3A 4AURA 1WMDA 2G1KA 1FS4A 4DWOA 2PZLA 2WT8A 4AKEA 4CF6A 3GWGA 4UJ3A 3BJMA 3R6DA 3MQFA 5DCWA 4EW2A 3EWAA 1MVNA 1J70A 1S0UA 5FUWA 2JVKA 3WTBA 1GGEA 1L7XA 4JYBA 4NY1A 1AA6A 4FSHA 4UNQA 4ZD6A 1ZL0A 5CYPA 1L4YA 1SCIA 1MC5A 3L8CA 5GP1A 5KTOA 2LDBA 4HQ0A 3ZU2A 4LMAA 4A92A 3PUZA 3OA0A 4BQPA 4N47A 1E4VA 1JDTA 3GH3A 4Q37A 5ALZA 3PGVA 1NJ6A 2OCDA 4DLSA 3WGNA 4EL5A 3NGMA 1U7TA 3UAXA 2YNMA 2Z6AA 1TA9A 4AX4A 1C0IA 4TSRA 4DXAA 1LJ8A 4ZI5A 4E5DA 2ZIXB 2W6IA 1QOQB 4D57A 3HY3A 1YE8A 3F8WA 5C1DA 4DV4B 4PQGA 1N5LA 1NVVQ 1UH5A 2BZ0A 3SHWA 2PRKA 3R7AA 2FV8A 1FNCA 1S7CA 2BD0A 1UANA 2GM9A 1HDEA 2Q2OA 2AJLI 2ZATA 3D0QA 3H1EA 2WLTA 4PLZA 4YXWA 3SG0A 3HLYA 1LNZA 3Q7IA 4ZI7A 5C7YA 5AK6A 3LLVA 3NI2A 3PT9A 2H1WA 1AGXA 3DWGA 4NV1A 3MGKA 3QU4A 4JWTA 3VO8A 5AJZA 1HFEL 1XZPA 4EW6A 1YR8A 1EFUA 2TECE 4JENA 3FWPA 4ZO9A 5FTWA 1OMOA 5T4HA 2BFPA 4AWAA 3VH3A 4FEAA 4FYKA 3TZHA 2E49A 3HCRA 2IXFA 5SY4A 1ORTA 1P31A 3HE3A 4XDZA 5FA6A 4O3FA 3K1YA 5AVYA 3WMXA 2XEDA 5FJIA 3E1GA 1PQPA 1P2FA 2C59A 1HEIA 4B4WA 4FJ2A 5ISMA 5LMNB 2Z1DA 5IJ9B 1LI4A 3GQBA 2FX3A 4GOJA 4ZA2A 2B78A 2WWHA 5KS2A 1W4LA 2Q3BA 3QXHA 4H0FA 4PG5A 1I6WA 5DM60 2FHPA 1X1RA 2HO4A 4ITUA 5EAIA 5BUSA 1FBNA 1MB2A 3GIWA 3UWPA 1PJLA 3E2PA 5GY7A 3DMTC 5AICA 2K5UA 1TVKB 3CN9A 3H11A 5AUPB 5BNZA 3ASYA 4JUAA 1R88A 4IPTA 1XTIA 4KXUA 4LOHA 2Z08A 2NO4A 3H7IA 1ETHA 3LOUA 2CMGA 3FKSD 5A9TA 3NC4A 3WL4A 5K20A 4HUJA 2EBUA 4AP9A 1U2PA 4NRDA 2HPHA 3AETB 3JAKA 3QVMA 4FT4A 1NBMA 1OJLA 1MKYA 1T2UA 4PBSA 3TTXA 4DKJA 1GKYA 4UBJA 3CVYA 1A3CA 4DEXA 3U3DA 1OXKB 4QM6A 3SOZA 4A6PA 4FN4A 4Q15A 3ZXUB 4LHSA 3FB1A 2DUJA 3W3AD 4TXNA 4BJ1A 3DD1A 2IVZA 3T12A 1M0EA 1S2LA 1MP0A 1XQVA 2OOKA 2Y1FA 1NKSA 4K81B 4EY8A 2I67A 3SZUA 5ELXA 3RVQA 1TVMA 2XNDD 5J5VA 5TY0A 1ZBQA 4MDHA 1IVSA 1ARZA 1YA6A 3H5LA 2MSCB 1JHOA 1B1CA 3HFRA 2YRFA 1ZJYA 3HY6A 5GZ6A 3TQRA 4CI9A 4RHCA 1UOQA 2EKDA 2HHAA 2HWYA 3GFBA 3LA6A 4J2TA 1WUKS 5TQ2B 1ANKA 4H7EA 2GJ9A 4PAQA 3HM9A 2BFCB 4IILA 3P5BA 1CUGA 1KJZA 3ESZA 4U6NA 5JQWA 1FNDA 1GVHA 2CDRA 1JLHA 2SKEA 3VM6A 3D7MA 3LF2A 1NX9A 2H59A 3G3EA 5KTPA 1LX6A 3N7TA 5TPWA 3SNKA 3OJLA 2J3HA 2WWRA 3VI3B 2R0QC 4OXQA 3WI7A 4B6FA 4HC4A 1WPGA 2OA0A 5JXGA 1U8XX 2QV7A 1P72A 4H3HB 1T0IA 1QFMA 4A0QA 5LLTA 1GN8A 1OV6A 3HKBA 4AJIA 3S7TA 1QB7A 1TYCA 3Q7RA 4D9CA 4DMLA 1KKLA 1TYDE 2BSAA 1M2JA 1ECCA 2BGJA 4NX2A 3R7WA 4L1KA 5KDDA 1BYUA 1JXMA 1RQRA 2VHYA 2DJ5A 2RK4A 3LSYA 4I14A 2PMEA 4XWWA 4QYXA 5JDCA 1B73A 3KR9A 2B25A 4G36A 1LFAA 2QLJA 3C74A 5TQVA 1LNQA 1H1TA 1SXGA 4PTLA 3BJEA 1A4UA 4OHVA 4TYMA 4W5HA 1KWGA 3DT6A 3JRXA 5TC4A 2XUOA 3H9BA 2XDQB 5HMMA 3JSAA 3ZWDA 1RHJA 4ARBA 4Q39A 5LL6P 2V98A 1X7GA 4YAJA 4D3ZA 5JY6A 4N01A 3BWMA 1KEUA 3RRXA 2F17A 1KQPA 5L6LB 2GBCA 3FZEA 3ZLUA 5KMGB 4H35A 2Y0DA 2ZS8A 2PIAA 4KYVA 3SPXA 3SZLA 4MR9A 1QWSA 1L2TA 3GRUA 2DPHA 5CRIA 1HZZC 4AROA 1I7QB 3MJSA 5DXAA 5EZ5A 3QZUA 2OFOA 3DCJA 3CR7A 3CR8A 4ITRC 1CZOA 2QG6A 1Q7BA 3MVEA 2Q99A 2QJFA 4BFCA 2ET6A 3QVGB 5LP6B 3W5AA 2EDAA 3R09A 4DM3A 1S4QA 5JI3E 5AI0A 4FNGA 1PTJA 4YO7A 2P2NA 2YRWA 3CFYA 2OO3A 2VN8A 3C87A 4KVAA 5F1YA 3VSAA 1J2YA 4CVNA 1DEXA 3LYLA 2BFBA 2FZEA 4G4SP 4X71A 4JEHA 4OXRA 5DNCA 4G41A 3QEBZ 2Q4DA 3JARB 4GZ5A 1ZC4A 1YB6A 2PGIA 2WB2A 4JODA 3V55A 4DMHA 4M0FA 3ELBA 1M1YE 3FNEA 3E5HA 2YJZA 3RS9A 3P94A 2XA2A 2IVFA 4F4DA 3RYHA 1G9SA 3ZW7A 4CDMA 3THWB 2ZUFA 2QUKA 2QN1A 1GKKA 1NOKA 2HRBA 5BYJA 3WB9A 4UJ5A 2OV4A 2Z4TA 4G0YA 3DBRB 1QYXA 3DKVA 2DM6A 2YJ3A 3HACA 5GOZA 3ZCRA 3BWYA 4UXHA 3D8BA 4ZCTA 3UXMA 5JANA 2WVAA 1A8UA 4ZPXA 4RETA 5KOIA 3EUEA 3AHFA 1SH7A 1I3CA 4I4CA 2IH2A 3EQZA 4HX5A 2IYVA 3T95A 1YDHA 5CVJA 4FB4A 1M54A 4ZTZB 2O8EA 1NJ2A 2PL3A 1ZITA 4X94A 3C1UA 3VO9A 2RGNA 1GNTA 1DUSA 2GTIA 1Q20A 4V2IA 4AULA 4MAAA 1RLJA 2ZSJA 3WRYA 2EFEB 3HB4X 4WH0A 4LY9A 4B3SB 1LSJA 1ZIXA 3AB8A 3JRWA 2HCBA 3FMOB 3L43A 1UM9A 3V46A 2WYVA 2BKUA 3E4CA 2A67A 3VXKA 1E3DA 1KMQA 2LCFA 5EIEA 2XRZA 3OZFA 2RGYA 4V24A 1Z36A 1ADJA 1ABBA 4RSHA 1EP2B 3G1TA 1AM4D 2IHVA 1YZFA 2JK1A 2VAWA 1W46A 1Q7EA 1TZ2A 4G63A 4O5OA 1CE8B 3HL4A 1LKZA 1YJ5A 5DYIA 4ZN6A 2R6DA 2KLBA 2IXTA 2ZWIA 4R7TA 3JQ8B 4ZCSA 5KHLB 1BCSB 4OHXA 4REOA 2WHPB 3JVEA 1ONBA 2M6RA 4Q1FA 4Z9YA 4QYSA 3DLHA <