4QDXA

Crystal structure of antigen 85c-c209g mutant
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
277
structure length
271
Chain Sequence
LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYGGNGTPNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 103
structure length 271
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qdxA00
1MTZA 2P8SA 4UFPA 5JZSA 2OCLA 3R3UA 1EB9A 1HBJA 4BDSA 3OURA 2XB6A 4EY5A 4BAZA 4ZGBA 2WG1A 4RPCA 5LZ9A 3DJYA 1DTEA 3C5VA 4LXGA 4DNQA 3VVMA 2RGUA 4Y2UA 1XRRA 4PF1A 3C6ZA 4MWSA 4KE9A 2G5PA 3FLEA 1AGYA 3OC0A 3ANTA 1BROA 1H2WA 1ZI9A 2WJ6A 3RM3A 5ALIA 2VEOA 3T4UA 5EI5A 4P08A 4DNPA 5EHZA 3BDIA 1UK8A 4UHCA 3A2NA 5K3BA 5E4TA 2GBIA 1ZI6A 5CBKA 3TJMA 4C4XA 3RARA 4B80A 4DGQA 1IVYA 4UBNA 1THGA 3B5EA 2JEZA 1UKCA 2C58A 4Q3OA 4UUQA 3W05A 4NVRA 4PSUA 3WWCA 2DCMA 2VSQA 4JNCA 4ARBA 1XQYA 1VJ5A 5BOVA 2X5XA 4MYDA 4ZV7A 5EIHA 3QPAA 3RLIA 1W75A 5AKXA 1UOPA 5JIBA 4NS4A 3FSGA 4MQLA 4KRXA 2BUAA 5AKZA 4BRZA 1CUGA 4OU5A 4DMHA 4X3CA 4E46A 5JARA 3VXKA 5ALWA 5ESRA 4QDUA 4C88A 4LYEA 4X71A 2WUGA 1MT3A 3WKBA 4V2IA 3C8DA 4PW0A 3VJLA 1YB6A 1K5PA 1UK7A 4IQ4A 1XZDA 2YASA 1WM1A 3N2ZB 5JADA 1CUIA 3BF7A 5JATA 3B12A 4J0KA 4Q3KA 1J06A 1L7RA 2QZPA 5HKBA 1XRQA 3EQ8A 5JAUA 3ESBA 2QRUA 3ILSA 1K6EA 3FYUA 1JMKC 4HRXA 2WG2A 4KE7A 1WPRA 1Q0RA 2WFLA 1XKLA 3NGMA 3PI6A 3BIXA 1XZKA 3QMVA 3HACA 4AN1A 4DMFA 3WL7A 4BCCA 2PSHA 3W2TA 3FCXA 1FFEA 4KAAA 4QEKA 2H7CA 1SCQA 4WFIA 5FP0A 1AKNA 2W6CX 1BN7A 4W63A 3QH4A 1K63A 1SCIA 4E14A 4FNMA 3WL8A 2EDCA 2JBWA 4A5SA 2AJ8A 4K5QA 5HF6A 3MGAA 1L7QA 4DSZA 2I3DA 1ODCA 3QZUA 2J3QA 3ZWQA 1BEZA 4FDMA 5ALPA 1CUZA 1FFBA 2HU8A 1UK6A 4G9EA 3NUZA 1JJBA 3SWWA 1HL7A 1PJAA 2OAEA 1UKAA 4ARAA 4H7IA 2ONCA 1MNAA 3HRHA 1K4YA 5K3FB 2XUOA 3PFBA 4U2DA 5CH8A 2QR5A 3ZLUA 3HEAA 3A2LA 4X97A 4BP9A 3F98A 2V96A 4K6GA 3IUNA 1H23A 1CQZA 4MXDA 4ROTA 4W1PA 2QXTA 3D3NA 4N8DA 5C81A 5ALNA 5FDFA 5LZ2A 1BCSA 7YASA 4MJ3A 1LZKA 3FLAA 2O7VA 1ACLA 1XZLA 3R3VA 3A70A 4N5IX 1G42A 3DLTA 4B85A 3BF8A 4EBBA 1W52X 1MX5A 1QE3A 4OB8A 5HK8A 1BU8A 3PE6A 3ICWA 4KJXA 1DWQA 4I19A 1AZWA 3DKKA 2PKYX 3PF9A 4Y2SA 5CXUA 5JAHA 4H7FA 1FSSA 3FLBA 5AOAA 2VF2A 4GLBA 4H7JA 3E0XA 4AMZA 3H19A 2XI4A 1R88A 2XMDA 5T4BA 1TCBA 5IVKA 1A8UA 1TK3A 3OPMA 4C4ZA 5FV4A 2UZ0A 2VAXA 3OG9A 4G4JA 3I28A 4CIBA 5HF8A 4DIUA 5ALUA 5ALDA 2WHPA 3B3QA 2IX9A 1A8SA 1QIKA 3VISA 1P0PA 4GI1A 1IUPA 3STTA 4BDTA 2WM2A 1BCRA 5ALTA 3BIWA 1U8EA 1DWOA 5FXMA 3GUUA 4XVCA 3HABA 3AUKA 3HJUA 5BWCA 1XRLA 2QMQA 1GKKA 3DCNA 3H1BA 3YASA 5HQ3A 1WB4A 2ORYA 4B83A 2WFZA 3C70A 3DEAA 1R4ZA 4UFNA 5ALZA 4LHEA 5ALSA 1A8QA 3P2MA 1VLQA 1E89A 1J1IA 4YPVA 4QWWA 1JU3A 1DU4A 4AO6A 4CI9A 1AMNA 3O9MA 1HQDA 2PSFA 3W04A 4CCYA 3ANSA 3D4LA 4GHWA 3F9CA 3KOOA 1VE6A 5SYMA 1FFCA 1H2ZA 3U0VA 1THTA 2OGZA 5JD4A 2QJRA 3WK5A 4N5HX 3STXA 5T4FA 1VZ2A 3WKDA 1LPOA 1LGYA 4G4IA 1FFDA 1LPSA 2WIGA 3C5WP 5AK4A 3DYIA 3WK6A 2RONA 3D0KA 2PL5A 3F8SA 4M0EA 3DNMA 1AUOA 3BJMA 1Q84A 3L1HA 2AJDA 2H9YA 1YS2X 3WYNA 4I4CA 2Z3ZA 4DYHA 2XUDA 3CXUA 4H77A 4FLFA 3NOXA 3M83A 1EK2A 2GBGA 5FOQA 1CUDA 5EGNA 5JD6A 4BP8A 4IO0A 3S8YA 3KDAA 1ORWA 1R50A 5AI4A 4KR0A 2Z8XA 3O9VA 5CT4A 4GECA 5HKAA 1CPYA 4Y2JA 4Y2PA 1G4HA 5ALQA 1OCEA 5LKRA 3G0BA 2O2IA 5D6OA 5AI9A 3H2IA 2C4HA 3WZLA 3HI4A 3I6MA 1E3QA 1YR2A 2YXPX 4GXNA 5K5EA 2WIKA 4L0CA 3JWEA 4BZWA 1P0QA 1VA5A 1RYYA 1Z68A 1OXMA 5EFZA 2G63A 4UBKA 4HZGA 1IMJA 2HA3A 1N8SA 1Y37A 3IA2A 3OOSA 3WA6A 1QZ3A 5F4ZA 1ISPA 2PU5A 2B4KA 5ALOA 3FWHA 1U2EA 1XQXA 3WYDA 4DSAA 5K3EA 1BS9A 1ZD2P 1ODTC 4C89A 1N5MA 3QM1A 2ZYHA 2X8BA 5LZ8A 4WY5A 4WDQA 1UZAA 5AKKA 1CUUA 3CN9A 1YA4A 4BYMA 2ZJFA 3PF8A 1A7UA 5K3AA 1IZ8A 1HDEA 4QDTA 3O95A 2B61A 2XT0A 4H35A 5FRDA 4W1RA 4N8SA 1F0NA 1ZOIA 1EINA 4ZI5A 1NU8A 2XUJA 4AX4A 1CFJA 1GPLA 5DTIA 2HRQA 4FLEA 2XMZA 4J0GA 4PO3X 4PV7A 3EIOA 4BC0A 4EUSA 4L9AA 3AIOA 1FJ2A 2CKMA 2Y1KA 1XLUA 4BCBA 5AO9A 5FLKA 2QT9A 3CN7A 4HAIA 5AM1A 1X2EA 1N1MA 5A7HA 4BE4A 3QYJA 3GROA 1CUXA 2CUTA 2HDWA 4Z49A 2R11A 4X91A 2C5GA 1YCDA 2VJBA 3LIPA 4QWMA 2XLCA 5IH7A 3NWOA 3WK8A 4ZXFA 3C43A 3FSGD 1TKRA 2BJHA 4J0JA 3AZOA 3H17A 5D3ZA 2WU4A 5ALHA 3RKSA 2HA6A 4LXIA 2HL6A 4QNNA 2VA9A 4HVTA 2Y6UA 1RP1A 4CG3A 2GYUA 4M0FA 4ETWA 5FPPA 1TIBA 1DWPA 1BE0A 1CVLA 3WZMA 2VQ6A 3IB3A 1XRNA 2JGJA 1AQLA 1QIEA 5AI6A 2QJWA 3I2HA 1F0PA 4G4GA 3PUHA 2XUQA 2PU7A 4INZA 4TVKA 3WJ1A 3WWOA 5IVDA 2BFNA 3H2KA 5K3FA 1LBTA 3I2IA 5C8VA 1LPAB 3H18A 1EH5A 4P93A 4E11A 1MN6A 1KEZA 1ZGBA 5CRIA 5J3JA 1EXWA 4F60A 3ZLVA 4TPKA 4QLAA 1ETHA 5CH5A 4JEIA 2B20A 4Y2QA 5A7FA 2XMBA 1XLWA 4RE6A 5JZBA 2FUKA 5IVIA 1R1DA 1C7IA 3WA7A 3D2CA 3UUEA 5A71A 5JAOA 2QOEA 1QO9A 2I3ZA 1LPBB 4QZVA 5ALGA 4Y2XA 1CUFA 5SYNA 3H0CA 3I6ZA 1I6WA 2CJPA 3FBWA 3LCRA 2AXEA 2HU7A 3Q0TA 5DNUA 3KD2A 2HHAA 1ODSA 1GQSA 1BRTA 1XQWA 2DSNA 2XQJA 4U2EA 4B7ZA 1ZD5A 2DQZA 4GBGA 2CMFA 1DX4A 4HTAA 5DYWA 4BAGA 3VJKA 2VJCA 2OCKA 4UHHA 4UBMA 3WQHA 4BVJA 2Y2VA 1F8UA 2WLSA 3AFIA 3BL8A 1WPXA 4ZREA 3U1TA 1ZD4A 4J3JA 1Q83A 2XUAA 2XQFA 4LIPD 3EBLA 3R3WA 1E8NA 3WIBA 2BKLA 4FTWA 2XUHA 3RK4A 3HYSA 1CUWA 3QBJA 2H1IA 1MO2A 1JJIA 5AM3A 2XUPA 2HFJA 4B6GA 4ZWNA 2IITA 3SX4A 1PV1A 2C5FA 3IULA 4XJVA 2Q0XA 2DHEA 2BUCA 2I03A 5HF9A 5CT5A 1SCKA 2DHDA 4BCDA 4DNOA 3WL5A 4N8EA 4BB0A 5AKYA 2VT7A 5BWBA 5LIPA 1O6FA 1CQWA 2HA4A 4B82A 3QMMA 1QIMA 1CUBA 1CUYA 4AO7A 2PX6A 4FOLA 4MWTA 4WY8A 5AKJA 2HADA 4M0MA 4FKBA 2ZYRA 3T52A 5CH3A 1S8OA 3S2ZA 4HXEB 1AX9A 3HXKA 2J4CA 4HRYA 5CXXA 1WOMA 3GFFA 3EQ9A 4PNZA 3EF3A 1C7JA 3Q8WA 5EIEA 4KEAA 2PSDA 5T4HA 2VT6A 2JGIA 1UWCA 4BAUA 4CG2A 2PM8A 3IIIA 2FX5A 1KU0A 4WJLA 2XQGA 1D07A 4HS9A 3E4DA 4EHBA 3K6KA 1C4XA 3H2JA 4X6XA 2O7RA 4FMPA 4KACA 5DYYA 1GPNA 5AI0A 3AZQA 1XZMA 1YA8A 4J0IA 5I7UA 3ZPXA 2JGLA 2O2GA 2DQYA 5AK5A 1LBSA 5A7GA 2WFLB 1X2BA 2WUFA 4G1FA 3WIOA 5E4YA 1CUSA 3V48A 2V9ZA 3FAKA 1KU6A 5AK6A 1CR6A 2C7BA 1R3DA 1JU4A 2VAVA 3W06A 1XZBA 5AKEA 2C0PA 4UBLA 3A6ZA 1DT3A 2OGSA 3D2AA 1MJ5A 4FBMA 1VXRA 4JYPA 2RIPA 4MYSA 4UBJA 3DQZA 1GT6A 2I78A 1XLVA 5AJHA 1NU6A 5LP1A 2OG1A 2GBFA 3D5EA 5KWJA 4AB1A 3I2FA 1CUHA 4X85A 3TEJA 3KWFA 4G8DA 4GDMA 3E1GA 5DTJA 1MX9A 4H7DA 3VVLA 1EVEA 1RWQA 4IH1A 2OGTA 5CMLA 5LYYA 1J07A 2H7XA 3STUA 4ZRDA 4BTLA 4AN0A 4F21A 3BWXA 2XMQA 4BVKA 5T4EA 2AJLI 2H7YA 2OPHA 3H2GA 2QUAA 5AI8A 5KWIA 4BZZA 1NX9A 4QDOA 1XKTA 1E66A 4KAFA 1XZGA 1DX6A 1ZGCA 1W1IA 4GEGA 4QDZA 3LS2A 5AKLA 3V1KA 5D7BA 3WKEA 4AXBA 1EHYA 1MPXA 1LZLA 1SC9A 3STVA 4EB0A 3ESAA 2C0QA 5LZ4A 2DHCA 2J4FA 3I1IA 3QITA 4OYYA 5LKAA 2W22A 5AH0A 5ALYA 4P9NA 2XMRA 2YH2A 5E2IA 4HXGA 3ZI7A 3VKFA 4U2CA 2BAGA 6YASA 3HLKA 1G5FA 4LKOA 2R8BA 5JD5A 3IUQA 1HLGA 2EDAA 1DT5A 3ICVA 4H18A 4O08A 1ACJA 2GZSA 5HK9A 2PSJA 3UMJA 5LLSA 1UFOA 2X76A 1U4NA 1QOZA 1EB8A 4YASA 5DLPA 3WWPA 2WFMA 4B0PA 1E8DA 1MU0A 1DQYA 4FLMA 4I3FA 2WILA 4UHFA 2WJ4A 1LLFA 4XIIA 4A23A 4EY7A 4RNCA 1LNSA 2OQVA 3TGLA 3I1YA 2IIVA 4BRSA 1K8QA 4BVLA 1QTRA 1EVQA 2QXUA 3I6YA 3LLCA 4UBOA 1VOTA 1Y7IA 4OPMA 4YX9A 2GYWA 2XUKA 3AIKA 4WCVA 5LZ7A 2XQKA 2XMCA 4KAJA 5C7YA 4LXHA 4X92A 5DYTA 3V9AA 2WU3A 2XDWA 4KE6A 2E3JA 4BTVA 3FYUC 2EEPA 4G9GA 1BEEA 5AKHA 2D5LA 3AJAA 2XUIA 4J03A 2V97A 4UFOA 2XUFA 5FKJA 4JH0A 1LPMA 1CV2A 4RE5A 1JFRA 4JUIA 5HF5A 3V1MA 5KREA 1G66A 4AZ0A 2JIDA 2XQIA 4GWLA 3C45A 2LIPA 2HA0A 4X6UA 3OM8A 4C87A 3H04A 4RGYA 1L7AA 1TCCA 5HCUA 3G8YA 3IBTA 2XLBA 2Z3WA 3WWEA 2OCGA 1GKLA 2PPLA 3GBSA 3D2BA 4WDRA 5ALKA 2WJ3A 2GYVA 2FJ0A 3IDAA 3FVRA 2V98A 2DFPA 3ESCA 1JI3A 3AINA 2WIJA 4P92A 1W76A 1WB5A 1QIDA 3L1IA 3M81A 1XZFA 1VA4A 4J0CA 2WG0A 1AC5A 3D59A 3QPDA 2ZYSA 1QJ4A 2XE4A 3G9TA 4K6KA 5EHNA 1N5RA 4C01A 3FOBA 4U2FA 1YAHA 3V1NA 3VJMA 1USWA 3PFCA 2WHQA 4FFVA 1JJFA 1O6GA 3EQ7A 3QVMA 4Q3LA 1TQHA 5KBYA 4CCWA 2QM0A 4WFKA 3H2HA 4L3WA 3FCYA 4CG1A 1XZJA 4Y2RA 3AILA 3FNBA 4X6YA 4D9JA 4UHDA 1EA5A 2VTVA 2ZSIA 2OLEA 4XX1A 1DQZA 3TRDA 3KSRA 5CT9A 4AZ3A 3KWJA 1LPPA 5FPQA 3LP5A 4X93A 4NMWA 1ZIXA 2RHTA 4B9AA 2WHRA 2CZQA 3W9UA 1H2XA 4X00A 4H7HA 3DOHA 5AM5A 5CURA 1MNQA 5DNVA 1CLEA 1JMYA 1ZD3A 3UUFA 1MAAA 2HA2A 2ZVDA 1UOQA 2QVBA 1ZICA 4QLOA 5CT8A 3IUJA 1F6WA 3BJRA 3GELA 1VKHA 3WL6A 1W4LA 5I9IA 4PSCA 3F96A 1TRHA 1GZ7A 2HM7A 1WB6A 2WIDA 4FWBA 3G0CA 3AZPA 1QO7A 5C8ZA 3R3YA 4IH9A 3H1AA 2AJBA 3WK4A 2WUEA 3VDXA 5AM0A 5CT6A 1R9NA 3D7RA 5AHXA 2Z5GA 3KXPA 5AIBA 4OD0A 3I2KA 1XZAA 1IUOA 4H0CA 2VJAA 5A6VA 5AOCA 1JT2A 1J2EA 1ZIYA 5E4JA 3WJ2A 2FJPA 5FUMA 2JGKA 3I2GA 2YYSA 4OCZA 3QPCA 3C87A 2GZRA 5ALJA 2OCIA 1SOMA 1FFAA 5BV7A 4F0JA 1P0IA 1QFMA 4X90A 4CFSA 1A88A 4Y7DA 1B41A 1T2NA 4F5ZA 4J0HA 5ALXA 4EY8A 3DL4A 4OYLA 4BBZA 5JZ9A 3R41A 3SK0A 2WTNA 2Y6VA 2RI6A 3DOIA 3BXPA 5AM2A 3N0TA 1Y7HA 1MAHA 1MX1A 2DR0A 3DS8A 5HFAA 1UT6A 2BGNA 1AURA 4X7BA 4WFJA 1H22A 1XRMA 2PBLA 4UHEA 3WI7A 3WWDA 3G9ZA 2XMSA 2ZSHA 3C8HA 5CTAA 3C6YA 3CCCA 1LPNA 4GW3A 2JEYA 3BDVA 5ALMA 2CEKA 3WMRA 1E5TA 2OAGA 4X95A 2RAUA 5AICA 3K2IA 1QLWA 2NW6A 3G9UA 1YASA 1XFDA 1HPLA 1Q0ZA 1EDEA 4J0DA 4IHAA 5AKGA 1XRPA 1TCAA 5AP9A 5DJ5A 5JAPA 3M3DA 3LIIA 2Y2UA 4OU4A 1SFRA 2JGMA 3WKCA 5D3KA 2ROQA 1UKBA 4Q82A 1XZEA 1GGVA 4K2AA 2AJCA 4KYVA 4X94A 4B0OA 4E15A 4UPDA 3G02A 3R40A 3F67A 1YAJA 1UOOA 4B9EA 4Y9SA 3X3HA 3O4JA 4OB7A 1HKHA 5K3DA 4TGLA 3C6XA 2WIFA 1QIJA 4KE8A 1UK9A 1GQRA 5AI5A 3A2MA 2CBGA 4FNGA 2BUBA 2HIHA 2PUHA 2WUDA 3O4GA 3G7NA 3FYUB 5AOBA 5ISMA 2ES4A 4CIAA 2PSEA 1EDDA 2ZYIA 3DDUA 5DNWA 2QKYA 2J3DA 2VJDA 4HXFB 3L1JA 1QIGA 4Y2TA 4H7KA 1BN6A 4BE9A 2WKWA 4A16A 4W1SA 4Y2YA 3V1LA 1QIIA 1VZ3A 2G5TA 2ZJ7A 4U2GA 1CUAA 3HZOA 3ZLTA 4FFWA 2OQIA 3JYHA 1OILA 5YASA 4DNFA 4NZZA 5A2GA 3PDCA 2ACKA 4XWGA 1XZHA 2XMGA 5HZGA 5H3HA 3R0VA 5HFNA 4QE3A 4FBLA 2PUJA 4Q05A 4EY6A 1CRLA 1EX9A 3DL7A 2G4LA 5DWDA 1E8MA 4OB6A 2OXEA 4DLNA 1QONA 3F97A 5JANA 1ZJ5A 1QFSA 3GA7A 3WKAA 3G0DA 3IURA 5EIAA 2PVSA 4G5XA 2XUGA 4PSDA 3CCBA 4DMCA 1QTIA 3GZJA 3DD5A 1QIHA 5CW2A 3JW8A 4YK7A 4QDXA 5EHXA 5JYCA 2HU5A 3W9BA 3FVTA 1YB7A 3G0IA 3IUMA 3MUNA 5JASA 3SC2A 1TAHA 4LYDA 1WHTA 2VATA 2JF0A 1M33A 1VE7A 5AK3A 1VXOA 4C6HA 1QGED 4BC1A 4K6HA 3OTQA 4BATA 2WSLA 2QUBA 5ALLA 4EY4A 1YS1X 2GBCA 2CB9A 3ESDA 1H2YA 4UHBA 3AIMA 4G8BA 3QMWA 1B6GA 3M82A 4UBIA 2WQZA 1PFQA 1U65A 4IH4A 1R9MA 3DKRA 1XZIA 5AM4A 4QA9A 5IVHA 1ZI8A 3ED1A 5A62A 4PQEA 4MQMA 1CIJA 2WTMA 2JGEA 4KRYA 3WK9A 1XZCA 1P0MA 1GXSA 3G0GA 4B81A 1W6RA 4AMYA 4DMKA 2WHPB 4FHZA 4DM7A 1ZJ4A 5ALRA 4OSEA 4Q34A 2HA5A 2JGFA 2ACEA 2D0DA 5LZ5A 4ITVA 3STWA 4OUKX 3E3AA 3O4IA 3G9XA 4B84A 2Z8ZA 3ZV7A 1CUVA 1IZ7A 2ECFA 1WCYA 3IVMA 1JKMA 3R3XA 3I2JA 5HQ3B 4EA6A 4MEAA 5C8XA 3STYA 4G8CA 5EHQA 4ZV9A 3K9BA 1UXOA 5ALFA 1WHSA 4H7EA 1DINA 2QS9A 4W9RA 3O4HA 1EK1A 1CEXA 2B9VA 5K3CA 4AO8A 5I8PA 1X70A 2BCEA 4CCYB 2HA7A 1XQVA 5ALEA 5AIAA 2O2HA 4S0XA 3O0DA 4DTCA 3MUOA 4JYMA 2K2QB 4MEBA 4J7AA 4Y2VA 1CUCA 4W1QA 1CUEA 1CUJA 3WLAA 4L72A 1YSCA 3C6BA 5ALVA 4AQDA 4C4YA 4Q1VA 1EDBA 3FYTA 3PUIA 2RHWA 5AKIA 5JALA 3MVEA 2QTBA 3HC7A 2HRRA 3PICA 1EI9A 1T4MA 1GPKA 1XROA 3R3ZA 4EZIA 1ORVA 2BGRA 2ZJ6A 4U2BA 3WK7A 3DYVA 3HSSA 5IKXA 1IUNA 3BE8A 1QIFA 2HFKA
chains in the Genus database with same CATH superfamily
1MTZA 1WZ2A 1R4NB 3GLHA 4UFPA 2WKSA 3EEQA 4C0SA 2HBRA 3G1TA 3P96A 2AE2A 1NDHA 1S0UA 1TVKA 4ZT2A 1Q16A 2X9VA 3R3UA 3BX1A 2ZG6A 1HBJA 2GESA 3ROXA 1HG0A 4DV3B 4LJ8A 4BDSA 1VG0B 4ZGBA 1CR2A 2I65A 2WPDA 1OBVA 4EY5A 1KFCB 2P0YA 2VSXA 5C1PA 4NOJA 1EUCB 4UXJA 3EAFA 3BA6A 3A4YA 2RGUA 4G63A 2JH9A 1L5ZA 2WNIA 4PF1A 1B15A 2PA3A 3QF4A 3C6ZA 3KQWA 4MWSA 1HSZA 1GR1A 1Z38A 4IZOA 3GO4A 3KRTA 4H6WA 4YUWA 4K9QA 1Z33A 2P9FA 4IUBS 3OC0A 1EJ0A 4UE2A 2QYSA 5IUKC 3QFSA 3TXAA 1BROA 4HUQB 4F9GA 1ODFA 1HFKA 3B5JA 3MHTA 2X0FA 2I33A 3AF0A 1JYEA 5HGJA 4KOAA 4JLMA 1EYZA 5B2FA 3QSYA 2AN3A 5H59A 4RK6A 3OCJA 2H7VA 3F1KA 2ZETA 4ZPJA 5ALIA 3V8EA 4GRIA 4N76A 1PGOA 8GPBA 1U2DC 2JCSA 3F4LA 2QMZA 1PK7A 3PXAA 2CJWA 3T4UA 1U31A 5EI5A 4WKPA 4P08A 4EZEA 4FB4A 4B79A 2W48A 1JSXA 1L7DA 4MB0A 4BJ5A 3MWJA 1J09A 1UK8A 1WVMA 3C48A 1AGXA 3K1ZA 4EG7A 4FR2A 1PAUA 1TM7E 3A1VA 4K8RB 3TM4A 2QW8A 3M8KA 4PYOA 5K3BA 5E4TA 3WOHA 4DJAA 2QE7A 4RADA 2Z2JA 1C3OA 1JG4A 3GJ0A 1I4LD 1NNEA 1KP9A 3PDJA 4KNWA 4EKIA 3OKFA 2C7PA 2H31A 2NXJA 2EWWA 2KMLA 1AHHA 2WD7B 2Z09A 2Q3HA 1IWBB 4GNKA 4QJBA 5A3SA 5TF0A 2JI7A 4P84A 3HKCB 3LY9A 4G84A 3LQ2A 2PNJA 5KWVA 1VBMA 1TUBA 4MVJI 1B93A 3GZNA 1BSVA 4Q3OA 1P2TA 4RS3A 3QLEA 2R8ZA 4C3ZA 2ZSDA 1DC8A 2JCGA 1E7RA 1X7WB 3ZVMA 1BFUA 4PZ0A 1JEQB 1U90A 2ENWA 3PKIA 2G17A 4A6PA 4ARBA 3MMPA 1QOQB 1Z8HA 2WSBA 4D0SA 2X1HA 1QQBA 4M0LA 5MN4A 1VJ5A 3GLUA 8AT1A 3EODA 1Z6GA 1MA3A 1WSWA 1W75A 4LYYA 5JIBA 3JPYA 5DM60 3GRAA 4RIIA 3IVAA 4FB5A 1JPVA 1YR1A 1X0VA 2QIPA 3Q12A 1JBQA 4J2OA 3RU3A 4DDKA 3FFWA 2FPIB 1TU3A 4LRUA 4MVYA 2YZ2A 3SQWA 2CNWD 1XJ0A 1TZBA 3FUWA 4UD6A 3DKVA 3GWZA 5I7AA 3UHOA 5G41A 5GTDA 1CUGA 4GM1A 5GZ1A 4QM6A 1Y1LA 1ZMTA 4MJ7A 3KYCB 1XA3A 4XASA 2B2NA 4X3CA 4RANA 1I2BA 3QXSA 1RYEA 3ZCTA 1IDOA 1BWSA 3L8EA 1HETA 4DLPA 1EJ2A 5HQTA 5LR6A 4HEA1 2PZMA 3OF3A 4NNJA 3ADDA 1Y9ZA 1WV0A 5G4KA 5CG1A 5KKCA 4QEZA 4Y30A 5DYIA 2HQOA 2XCTB 2W6MA 3NWPA 3WKBA 4V2IA 4YROA 5ITWA 3OPVA 1L4UA 1YRAA 1DDOA 2IYXA 3EW7A 1N2XA 4CU2A 2J0UA 4D96A 1SD5A 3V2UA 4WWHA 1Z5UA 3ANYB 4CGYA 1K5PA 2XAUA 4PR0A 2DGDA 4GQIA 2JFHA 1Y5RA 1W0JD 1I5OA 2YY5A 4WN9A 5JADA 3D1LA 4X61A 1OYYA 3LBAA 1R8QA 5JATA 3KTAB 1WZIA 1BJRE 2AHRA 3UJHA 5BSGA 5G0SA 4CLDA 5IJ9B 5HIKA 1F17A 2B4YA 1C8LA 1ESMA 4UW9A 3UT6A 4B7XA 1Q0PA 1QF6A 1L7RA 3PVSA 4KNYA 3SVLA 4M89A 4PPQA 4A26A 1JHXA 1M8JA 4FFPA 4TKVA 1PFGA 3QU2A 4HAXA 4RACA 5D5PA 3EQ8A 521PA 4QUGA 3TBFA 1JSLA 1R5NA 2DY1A 4JHLA 4Q21A 4OJYA 5FNVF 4KN5A 3RD5A 3ILHA 3UC5A 4DCVA 3ILSA 4EYKA 1K6EA 2VYCA 2FQXA 2P2GA 3FYUA 4WLUA 5HBRA 4EYSA 2IQ5A 1J20A 1YDFA 1IHXA 2E82A 3BMNA 4QPPA 3C8MA 2WV9A 2BEKA 3T3IA 1E0AA 5BQOA 1KK0A 2RCYA 1LBEA 3R9WA 2CNWA 2VHVA 1EFUA 3OJFA 4D3DA 3TRFA 1AQNA 1Y9AA 2OGUA 1NUQA 2ALJA 2Q5CA 4KFUA 2B37A 4QHTA 2WFLA 1T8PA 2XY4A 3PI6A 3M5PA 5DIZA 4URYR 2PR7A 3BIXA 1FY2A 1EK0A 2F1JA 2OD7A 2WHXA 3C3DA 3OQJA 1WXGA 2YMQA 2PZGA 2AT1A 4KVFA 4DV1B 1NNI1 4AN1A 2QTHA 4DMFA 1H4QA 2GXAA 1VRCA 1HT2E 3W2FA 1RLIA 3K73O 2R6ZA 1I30A 1JTEA 2JL1A 1XWFA 4AY5A 1JH9A 4QEKA 1P2FA 3RRBA 1U1EA 4EO7A 1YQXA 3KQYA 2X8JA 2WTUA 3DE1X 3F71A 1GFWA 1GARA 4M87A 3THWB 1W0JA 2A0XA 3AVVA 4BEBA 3UT5B 2RGWA 3EGEA 3MS4A 3FRJA 1GLNA 4TMXA 3EVAA 1C0KA 2RGBA 4RVCA 1K63A 4WZAA 1SCIA 1NI4B 1P61B 4E14A 4TKLA 3NGLA 3UCXA 5IFKA 2EDCA 4W82A 5J4VA 2EF1A 2EL7A 1UDBA 1VHQA 3Q85A 4WOJA 3SYLA 2J6IA 5BPFA 1QYIA 1P73A 2R7NA 4HR7A 1B7GO 1V48A 2EVWX 3QA9A 4K5QA 5HF6A 3OECA 1YIOA 2DTDA 1KEWA 2QTZA 1PIWA 2EKPA 2Q3LA 1L7QA 1OJ7A 3C4VA 4PZEA 4EVQA 2ZIUB 5J43A 4NSNA 3P20A 2ZUCA 1BDJA 2J3QA 1MGOA 2PL9A 2IA5A 4KNVA 3ZWQA 1GUBA 5K9ZA 4AN4A 4LDJA 4FDMA 5ALPA 1FFBA 3Q11A 3KQVA 3G13A 1IEXA 3NI2A 4CEJA 1MJFA 2GPNA 2RGDA 5ELMA 2RJNA 4PO1A 5FR2A 2JLWA 1X1BA 3G89A 1JJBA 3LOUA 1R00A 1WA5A 3HCEA 2HSGA 2ZBRA 1HR0B 1HL7A 4OHKA 2OAEA 1EJ6A 1T15A 3BMCA 2Q5HA 5LU8A 1BFKA 5KTRA 2IHYA 5JC1A 4GX2A 5D5QA 3INGA 4C4TA 3A3OA 3D1JA 3MUEA 2DHQA 4NYJR 1K97A 1VCHA 5LP6C 1BW9B 3C3WA 4TM8A 5EOVA 3A04A 3FSRA 1ZD1A 4C0JA 1K4YA 2VC2B 4KQ6A 3R9XB 3ZQKA 1ZK2A 2C82A 3DBRB 3IQZA 1SQ5A 3ZWKA 5A4KA 3TUJC 1NZDA 3RSQA 2O4CA 4I5EA 3LY5A 2FWPA 3ZHQA 1QTQA 1S3IA 1XCLA 1UPXA 1QHGA 3K9NA 4JOCA 4MWDA 4UUAA 3VYTB 1FYVA 4IILA 3HXOA 1U11A 1QVVA 4OA8A 4X97A 5GM1A 3PRKE 3ZUPA 4BFSA 4ER0A 1QH9A 3DFKA 4K6GA 3IUNA 3KLNA 2CHUA 1W8DA 4KMMA 2GA8A 4WL0A 3AP3A 1CQZA 4MXDA 3AI3A 1KSGA 4N7MA 1ZAKA 4JASB 1A76A 4NAVA 4BFUA 1VYTA 2QZZA 1ISHA 4CMKA 1N2CA 4MUHA 5C81A 1PHPA 4KN6A 3RHFA 5JPIA 5FDFA 1RXUA 4GX5A 1G8FA 3O8LA 4N7JA 4A2QA 4EL5A 5CDFE 4X60A 2IS4A 5EWJA 4O5OA 3SEQA 1NBWB 1QPGA 4IG9A 1N2HA 3T38A 1BCSA 2DECA 4PS1A 4Z1MD 4PN7A 4AYWA 4PXAA 1JTFA 1Z3IX 3FWNA 3KXLA 5EKDA 2I22A 1OZHA 1KMQA 3FLAA 1NFRA 4H6VA 4HP8A 3ZVRA 3R8XA 3DT9A 3TNYA 1IXSB 2YXNA 5EMHA 4LK2A 3W8FA 1E3WA 3F6BX 3IAS1 4AJHA 1G42A 3PE3A 3NBKA 5KQPA 2E37A 4JIGA 4CLXA 5INTA 1XXHE 3R7DA 4KI7A 4Z8YA 2XKKA 1KJWA 1R8XA 2BFCA 1Y3AA 2KLHA 3HKBB 3MB5A 4KLRA 4TTAA 3ICEA 4EBBA 3GUHA 1W52X 1MX5A 2ZRMA 4Z4FA 3ABSB 3DHWC 4RZ2A 2TMKA 4PS0A 5IYZB 5BSFA 3PE6A 2VTBA 2H1VA 2YL2A 1ULAA 4RU1A 5E6UB 4B47A 2WP8J 1RE1A 1J0BA 4B6OA 3K1TA 1CJTC 4I19A 4U6SA 1GGMA 2O0JA 2QMUA 2WYIA 2ZIVB 3DKKA 2C03A 3RYHA 3CPJB 2RG7A 1Y5LA 4G86A 1YONA 3FLBA 4Y1GA 4DLZA 2AI2A 4J16C 2H16A 3V55A 2B8WA 4IV8A 4H7JA 2VCHA 3I23A 3E0XA 3FR7A 4AMZA 1T1IA 4ZU1X 2XI4A 1KEPA 4H4DA 4RZIA 4XEHA 5ARCA 4ZYXA 5KWEA 1DFIA 1SXGA 1TCBA 5T4BA 5GIPE 5IVKA 2VDRB 2ZE8A 5TY0A 2H2IA 3P52A 1O97D 2D1FA 3KC2A 2FG6C 5CJJA 4L28A 3R7FA 1FF9A 4C4ZA 2JFZA 3IP9A 5FV4A 1CRWG 5AJVB 2VAXA 4D5GA 3R5FA 3TVYA 2VJOA 3AR6A 4CL2A 3I1FA 2HPVA 2C4TA 4QM7A 1OLSA 3VKVA 3IAXA 3HB5X 1ND6A 4NJEB 4CIBA 1FYDA 3FPKA 4J7XA 4NYMR 3K9WA 4R31A 4OHWA 1P80A 1D6JA 1XX6A 1L5RA 3CX3A 1IIBA 1MQSA 2D7JA 2VQFB 3OJXA 2JG3A 3HCFA 3JD1A 2IX9A 3QKSB 5FCDA 1QIKA 3KOYA 3HJCA 5JMPA 2VF8A 2MMCA 4GI1A 1SCBA 4S05A 5HWSA 1YV9A 3WMFA 4YNBA 4BJ3A 4ARIA 3DBIA 2QPAA 5IJWA 2RAFA 2R8OA 4TTVA 4LFCB 2E6KA 1YWGO 2R00A 4EQ6B 1GZ5A 1HH4A 5KDLA 1GEGA 3RANA 1NBOA 1X7YA 1DBRA 1DWOA 3BH6A 3T4XA 5D1NA 1RIIA 2AR0A 4M88A 4RPJA 4RIHA 4XVCA 1N3LA 1QYDA 2IP4A 5JWRA 3OI7A 2QMQA 1GKKA 1G64A 4Q3AA 3KAJA 1GNRA 2V58A 1NJSA 4XB2A 2AUTA 4NV1A 3UA4A 1KERA 3D8SA 3H1BA 2WZBA 1Z62A 3B3AA 1W93A 1WB4A 3FUXA 2ZE6A 3PNSA 4CT4B 2WFZA 3DEAA 1R4ZA 4UFNA 5E7JA 4YRPA 1G3IA 3LCMA 2FSIA 3VDMA 1YZGA 4TTTS 2AQIA 4P8RA 2CLHB 4Y2GA 1IBRA 4NABA 3NOQA 3EA0A 1ADJA 2WM8A 1VLQA 1E89A 3MCAA 3THXA 1DMSA 2D7CA 3WTCA 3LW7A 4D81A 1MABB 3OP1A 4YXWD 4DR6B 4QWWA 2YV1A 3BBPA 3L6EA 4JP8A 4WKOA 4AO6A 4YJHB 1AKWA 3P26A 4OLAA 1RD4A 1NP3A 4GPTA 4ZKEA 1JQKA 1WXQA 5JY1A 1R0ZA 2JGRA 3TQSA 1C81A 3V46A 2GDJA 4GHWA 1YL5A 1AV6A 2AVNA 2P4UA 1EP2B 2X14A 4UREA 5KWSA 3DT6A 2X86A 3EGDB 4O33A 4NJOA 3V1YA 3RWBA 1U5CA 1XVVA 1FFCA 1F60A 4L5JA 3EN0A 3U0VA 2R7LA 2B1JA 4RTQA 3D3JA 2PO5A 4YFYA 4W7IA 4RTJA 3WGUA 2B92A 4DCJA 3WKDA 1VZ2A 5FLEX 1Z5VA 5BUZA 5DHUA 1LGYA 2YY7A 1MIHA 1T9HA 3OUTA 5AXAA 1DNPA 1JXQA 4HI0E 4IXMA 4G4IA 2ZB7A 1RPZA 4ICIA 4C04A 3S1SA 2I2FA 5CR9A 2E4ZA 2QM8A 3AI7A 3TW6A 3WK6A 3BTVA 2YQ4A 4EAAA 2PH3A 5JXIA 1J24A 1FB5A 4O0MA 1N75A 2DT8A 1AUOA 3BJMA 4DLKA 4E32A 1Q84A 1WW3A 4JUBA 3VRHA 3EFEA 1Y3HA 1YS2X 2CHGA 2ZBEA 1KYXA 3D8BA 3KZKA 2Z3ZA 4URZR 1ZAYA 5IF9A 2Q9UA 3F6RA 1FUEA 1NYRA 3NRCA 2O8DA 4TS9A 4YJGB 1KAGA 1RCUA 3NOXA 4KQGA 1CXZA 2SHKA 1L5MA 3M83A 5K0LA 1G8SA 5HQ3A 2B0CA 2JLBA 2YWXA 3CKMA 3W2HA 1H4SA 1WW2A 4G23A 4ZYVA 3ONNA 4Q3CA 5J5CA 3H6HA 1BVHA 4R69A 1CSEE 4TV9F 4ADSG 5KNDH 1H85A 1BMQA 3B38A 2BGMA 2D4HA 3JQAB 4HNVA 1CRPA 3KDAA 2JCVA 2RGAA 4S12A 4EIWA 3TUIC 4DLBA 1Y1SA 3EPRA 5L3QB 1OFGA 2Z8XA 2QMOA 3IV7A 5TMDA 3QFFA 1ICIA 3HJFA 1YJCA 3IEIA 5BVHA 2BKUA 4Q47A 2ZOSA 4QGHA 4JI5B 3G2KA 2Q0HA 5ALQA 1UXJA 2NTNA 2W6OA 1UDAA 2FN8A 2UVPA 1ZA2A 4ND4A 1CE8B 4DE5A 1PNRA 2BZ0A 3Q3JB 2XB9A 1GAJA 3I5MA 1QNLA 5EWLB 4EUNA 3S29A 2FPSA 2KWIA 3BRWD 4ALIA 3P9ZA 4C0QC 5KOJB 2HREA 1WMBA 4Q15A 3ZJYA 2PS3A 4MVXA 3JQQA 1O2DA 1D2EA 2QSYA 5DHAA 1K6IA 3QVGA 4C7BA 1D3AA 1DMRA 2YXPX 3KKZA 5DP2A 2CNNA 4DTIA 1R0SA 1FSFA 3C1AA 5HZKA 1GG2A 1HFEL 1ZOOA 2AYXA 1DBIA 4PAOA 4Q7JB 5KVQA 4JLKA 1KVSA 2QTCA 3JR3A 1M8PA 1AXGA 4CWAA 1RYYA 2QU8A 1Z68A 2O7QA 1JRLA 1LD3A 3U81A 2G63A 5H5JA 4O25A 4DDHA 3HVKA 4L85A 4D98A 2YHSA 3P9RA 4GE0A 4HZGA 1XNJA 3VO2A 5ED0A 3H0EA 3L93A 5ITZA 3KAKA 4AYTA 3SZOA 3DT8A 2QLMA 3A1NA 3H13A 4L76A 4C4AA 1C0LA 1TJPB 3SPXA 1N8SA 4TWZA 1Y37A 1OVMA 2N0SA 3IA2A 1SB9A 2ERYA 4WOBA 5B4UA 2P35A 3S2YA 3HVJA 2B30A 1AN0A 2GCGA 2WJWA 4DBVO 4A2CA 2VJPA 4BEVA 4HUTA 1D9XA 4R1NA 2Z57A 3B5IA 3BDAA 1ZGAA 3E2MA 2X2FA 1VE1A 2AH5A 2YN4A 4OM7A 3IMGA 3TCNA 1SEPA 3SF0A 4DJJA 4ZI7F 5I7HA 1KAOA 2GWRA 4PANA 4L4RA 3G1UA 5L51A 4M1QA 2XCRB 2B4KA 2XEXA 3FSEA 3P0FA 1G8PA 3U09A 1XQXA 1HLDA 1UIMA 4NNOA 3FUUA 3COPA 1R5OA 2NTYC 3QXCA 4DIEA 1H8ED 2QRKA 4R2JA 1FNDA 1AM4D 5K3EA 5KTOA 4N65A 2BWJA 1NVVR 2NZ2A 2DR3A 2PJUA 5ESDA 4Q9HA 2ZT8A 1OUMA 3MXOA 2Z4SA 3WB1A 1KS9A 1NLFA 1JDUA 1FUKA 1GSAA 2A2ZA 4K81B 4PLPA 3RVNA 4URXR 3IL2A 2N1BA 1NBMD 1XTBA 4DC9A 1Z5ZA 2X8BA 3INNA 3X1YA 3ZW8A 1FC0A 3F4KA 1O5TA 3VR5D 1NFQA 4UEWA 3WQQA 1ZESA 4RSHA 3SJAA 4FHCA 2JEOA 2VL7A 1QF7A 5I3ZA 5AKKA 1HQKA 4TL6A 2DOKA 4XCXA 4MQ4A 2JFVA 4IAOA 4RHUA 4HYEA 5AXBA 1VL8A 5H9VA 4JUAA 1VKZA 3EWSA 3SS9X 3GZ4A 3H8WA 3ETNA 4EYQA 2IGBA 1WP9A 3OZSA 3P9KA 2XTNA 4HQ0A 5DULA 5TJ9A 1NUHA 1A7UA 1F7VA 5K3AA 4NNPA 2HK8A 2H2HA 5EQTA 3EGCA 2MWMA 5JHHB 2ZWIA 4PZUA 4B4DA 3AB7A 4B76A 2J7PD 5EWMB 1UP6A 1ILWA 3NAQA 1YULA 3L0DA 2B2XA 4MMXB 4QDTA 1F3LA 3A6KA 1SBZA 3W0LB 2W42A 3IKVA 1JHRA 3O95A 3LZ6A 3MOIA 1Z0ZA 1OSNA 5FOSA 5ADUS 2QRVB 4MVJD 4XE5A 4OHZA 2BFDA 3GR6A 2YZ7A 3KR1A 5JCJD 4EHDA 3A6EA 5EP1A 3PCRB 3BC1A 4N8SA 1F0NA 4EPWA 2CVOA 3DMDA 1JEYA 3GXOA 4OXNA 2HK9A 3OTGA 2GM4A 5SZIA 1NU8A 3P2OA 1XELA 4AX4A 1W36C 3ABQB 1C9JA 1Z73A 4JLOA 4BGIA 1A27A 4J43A 4YCDA 1FP4B 2BCJQ 1PLKA 4FLEA 4YAEA 5DSZA 5F52A 1PUIA 1BHO1 1XVTA 2OFPA 4OXIA 5LQNA 4RQAA 1HYHA 3QWIA 4IIJB 1IBKB 2EFGA 4GYWA 1P7VA 1M7HA 2CKMA 3C1UA 4FGUA 2Y1KA 3TW8A 2I4IA 2B1QA 3AM5A 3VR5A 4DM4A 5A03A 3UMMA 5FLKA 1SQ0A 1TJNA 2GN1A 2BC9A 2PG3A 5C7IO 1CIPA 3BE5A 4TKMA 1NPDA 2W5UA 2NTVA 3ABIA 4HO1X 1N1MA 1C9MA 1L5FA 1TF2A 3QYJA 2BM8A 4TQAA 4QBTA 1CUXA 3X2SA 2VHYA 1G20E 2R11A 4ME6A 2VDPB 3QPBA 5L9AA 1WXEA 3II6X 3WGVA 1YCDA 1KIAA 1JHVA 3C7CB 4RTSA 3GN2A 2QTNA 5CDSA 1MF7A 3L7BA 3QKRA 1DO8A 3BFVA 1C50A 5LVAA 4PEVA 4BNDA 4B7AA 1YFLA 1UJ6A 1VIDA 3V4LA 2J7PA 5BSVA 2WVAA 5IH7A 3NM6B 4LVCA 1OFTA 2PKRA 5ECYA 5HM6A 1GL9B 1AQUA 1NTRA 3ETHA 3M2PA 3NT4A 1OC2A 4NAUA 4I9HA 1Z2EA 2XSZA 2BRUC 4AJPA 5ILQA 3IXQA 2A30A 3JYLA 1NW7A 1SCJA 2HJRA 2IPMA 1TKRA 2VDUE 2XEDA 3FG9A 3FPSA 3K96A 4EJSA 1U4SA 2QG9A 3DWGA 1FJHA 1IPFA 1O6ZA 2WIBA 3M1IA 5D3ZA 1R6AA 3M9XA 4LMAA 4OAOA 1LB1B 2FEOA 1T5LA 3GJSA 3ORSA 4RK7A 4UZEA 2CJYA 3GDFA 5AHWA 2BGIA 2HA6A 2FPWA 2ZRIA 4MS1A 4EF6A 4YRBA 1V5WA 3ABZA 4ZD6A 4TUYF 3TGWA 3CWQA 4QNNA 3HNPA 3L0BA 2JAUA 1XF9A 1U0LA 4FSDA 4HVTA 1XQ9A 3LUDA 3P2YA 4O2LA 1QZXA 2A9QA 2A9JA 3KB1A 2GM9A 2WYWA 1MFZA 3HQ4O 5F12A 1LRJA 2XKBA 1XPJA 3MS2A 5DB4A 2WAYA 4P2GA 3U3XA 1D4AA 2PNFA 4Q1AA 5I7SA 1JLRA 1K5DA 4HF7A 5D86A 3WZMA 3OZXA 4FYWA 4EPTA 5JQWA 2F59A 3IT2A 2GR9A 1NM5A 4YAOA 1JNXX 3UTDA 1ZCAA 2Q3DA 4ZFNA 5DM2A 2WVHA 4JR0A 1P72A 5LWQA 4HWTA 3M4YA 2YVLA 4BMCA 1CY2A 3PXUA 4MLPA 1KZ7B 1JVNA 4RXMA 5C80A 4INZA 1OTXA 1W35A 4ESHA 1QHHB 2PMBA 1Z06A 4I08A 4B3XA 2C57A 3WJ1A 5JW6A 1EUQA 1KYTA 5BNIA 1DRUA 5K8UA 2BFNA 5BN1A 3TD6A 4M8NE 5K09A 1N5KA 3HBAA 4N0EA 2QTMA 3DM5A 3WL3A 3H2SA 1V8ZA 3W3AH 4N5MA 4P22A 1KE2A 2PN1A 3KCQA 3GUVA 4PWZA 4ZOEA 2IWHA 4YQEA 1KC3A 1KY3A 2A58A 4ARCA 1J8MF 3EFBA 4CXMA 3K09C 1QDLB 4N01A 1X38A 2D06A 4PZCA 4AKTA 5J2UA 3OZ7A 1KSHA 1PFUA 2I80A 1JEEA 3OFNA 4G3XA 2V0GA 2Q21A 2E87A 3RDPA 3LA8A 1JHQA 2QYOA 1UDRA 1EXWA 3QLUA 4HAOA 4R4JA 3OJCA 4F60A 5HMMA 3AF1A 2F55A 4KR3A 2I0FA 4OHUA 4CKBB 3VU9A 3WNZA 4DBLC 3D8NA 3HCOA 3ZLVA 5KDOA 2OBXA 1UPBA 3GXBA 3N9IA 5IG2A 5IX8A 2VDWB 3ANMA 3PFWO 3VBCA 2GEVA 2DWQA 1C5KA 2I6XA 5HOQA 2O05A 2XMBA 1ZN2A 5FV7A 4A73A 2V7UA 1T6YA 3O2JA 1TE2A 4YMVA 1JQJC 3JSXA 4JKIA 3ZHCA 2FUKA 4CTOA 2CT8A 5FWYB 1R1DA 2JW5A 2HQBA 1A71A 2FWBA 2J31A 4A0HA 2GF9A 3MW8A 2P9TA 4W63A 5A71A 1QQ7A 3KEFA 4OQZA 4IUCS 2QOEA 2GAFA 1XIVA 3OZVA 2HV8A 5DASA 4BP1A 3SKVA 4CM9D 4YJ2F 4E08A 2IP1A 4EHFA 5AW7A 3EDYA 4RWZA 5LBTA 3HB0A 2BF7A 1MKYA 2IZOA 3M5CA 4J1SA 4IOKA 1DAHA 5IKOA 4AZWA 2ABWA 5EIBC 3L46A 4RFSB 4Q4AA 4BASA 5ALGA 4JV5B 4YLGA 4N9QA 5CDFA 4AKSA 4MPJA 2RHJA 2G9NA 2PH1A 3H0CA 4QPDA 3VSAA 4RKQA 4JGIA 3FBWA 2JVJA 4P54A 2A7QA 3IDFA 1II8A 2HU7A 3KJQA 4F4UA 2H54A 2H6EA 5DNUA 2R6GA 2HHAA 3DDZX 3NORA 1ODSA 4OLJA 4TV8B 2Q2VA 4P5EA 2TS1A 3WLHA 1A97A 1AKYA 3QNMA 4ZCPA 1M2FA 4K9RA 1ST2A 4WCDA 2P4HX 1XXHA 2XQJA 1Y8RA 3I05A 4WV3A 4B7ZA 5BWMA 5BYAA 1ZD5A 4IIFA 2B8TA 1Y6GA 4GBGA 1IWOA 4XR4A 1E0KA 1H69A 1ZUIA 4GIBA 2ICAA 5HIAA 1E3MA 4HTAA 1VB5A 4RFVA 4GL2A 2J9FB 4NCBA 3L4KA 4WESB 4BO7A 3FNIA 3ZWCA 3KQTA 3W5VA 4PU0A 5DI3A 1V4VA 3R2JA 1NULA 2WKPA 3OQBA 2VJCA 2OCKA 5KVCA 3UWMA 1R6BX 2HJGA 2XVZA 3PGLA 2GNPA 3IIKA 4JUCA 4MKRA 5AVWA 2JZOA 4MAFA 3B9QA 4A36A 1XA4A 2AHOA 3T9EA 2P1DA 3V00A 5JFOA 2H5EA 3AJ9A 4BVJA 1ONPA 5TGTA 1SELA 2WLSA 4MLDA 2BN4A 2RG1A 4NCNA 4OHOA 4ASUA 2EOAA 3FCEA 1UMBA 2QXYA 1YUNA 3RHZA 4MSUA 1GADO 3AFIA 3PUJA 4MRRA 4QRHA 1WPXA 2PLNA 3SF8B 2VYQA 3U1TA 1Y6JA 3CU5A 3MQFA 1DJMA 5A1TA 3HGTA 3KOMA 5K4GA 5JVDF 2QRPA 2EKQA 4URFA 3ZZTA 1F12A 2SECE 4LIPD 4ZMBA 1JR2A 3VSEA 3HGMA 5JCZA 2WHEA 5EE3A 2YJ3A 1V8FA 1PJLA 1ORDA 1F14A 2DXIA 4C3UA 2NXCA 3OQPA 3ECAA 2WC1A 4FTWA 3GEBA 2FY8A 2R8XA 5KX5A 3RK4A 2HQRA 2X13A 4ETNA 1UPTA 3MWKA 3D4NA 4L57A 3RFVA 1I4OA 2IUUA 4C06A 1YQUA 4H3SA 1MO2A 3QBTA 3ZV4A 1SH7A 2RARA 4FU0A 4Y9RA 3ONFA 2Q4EA 1I6LA 1L7PA 4TL9A 5AVYA 4R9VA 4BLTA 2C2BA 2AN4A 3MN1A 1JJIA 1NW5A 3AR7A 4S2EA 1COWA 1K68A 3H5LA 3IBGA 3OX2A 5D8DA 2Q7OE 5AM3A 1OBOA 1S9DA 3EJ6A 4QQNA 4W99A 1XMPA 3IDOA 2AWOA 2GD1O 2K2WA 1E0JA 4PBTA 4ETMA 3UXYA 2O2XA 1NBAA 3EGXA 1CY6A 4URVR 1I0IA 2V7BA 1BH2A 2EXXA 3NVAA 3PQFA 4XJVA 5ESXA 5TGDA 1H9CA 4RVUA 3O2NA 4AP5A 4WXEA 3GARA 3QQPA 4R6WA 4EMTA 2PZFA 2O52A 4D3FA 5CYGA 1SCKA 2DHDA 1DRVA 3L8ZA 2L2QA 4HG2A 4WNYA 4DNOA 1YB1A 2ZPTX 5DIFA 4BNLA 4CPDA 2FMXA 4AZ3B 1UQUA 1VKOA 4EI7A 3ECSA 2XB2A 2XV1A 3MGBA 4MARA 3TO5A 3VPSA 5EAIA 3IIMA 3IAUA 2HF9A 4JEHA 4BMVA 3OE1A 4J07A 4L74A 2DZDA 2BE9A 3QE9Y 5I4IA 4YT5A 2Q8NA 4GF5A 5BN3B 3H4TA 3U80A 1CQWA 5FJIA 2HA4A 3T9AA 3ZGNA 3DTYA 4ZICA 3GA5A 3KTDA 3OJEA 4HTFB 3VI3B 5IM4A 2H5IA 3JQ8B 3QMMA 1PJZA 1QIMA 3D7NA 4F84A 3RYCA 1OROA 1FVXA 3KQPA 3L1UA 4B87A 1FW8A 2H51A 1L7OA 3QG5A 1AUVA 2IHBA 5IASA 4ENRA 4J7CA 1L1FA 1QUFA 4WY8A 3QI2A 2QD2A 3DVQX 2AE1A 1N7JA 4WK6A 3LWDA 5AKJA 1UANA 3PWTA 2HADA 2Q3JA 2H92A 3QLVA 3RK0A 3R9IA 4B45A 5TQ2A 4FKBA 4FYMA 4LRTB 3I34X 4N6NA 1K92A 2WAMA 1JYFA 2YHUA 3EPKA 3AEKB 3BQNB 2X0DA 3U4HA 1K27A 3K92A 1F6DA 3CS3A 4K6MA 4L8VA 1T24A 2A4MA 1UEXC 3T7RA 1PJRA 4DQVA 1AX9A 3HXKA 2J4CA 1K2WA 3ONVA 2LVBA 4I55F 3ZD6A 4HRYA 1NMQA 4JB8A 4WOKA 1WOMA 3GFFA 2ZUUA 3KAPA 2AXPA 5HQJA 5DCUA 1CY0A 2CFCA 5E6SA 3R7WB 1NUPA 3HP7A 3AHJA 1CULC 2I4MA 3FOEC 3S2GA 1F2VA 2K5UA 3IVRA 2VNSA 3ILXA 3M6MD 3OOJA 4FFDA 4D0GA 1N6IA 1W94A 3G8AA 5C1BA 1C7JA 3CH6A 4OAPA 4LI0A 5JS2A 3L7YA 4LF6B 4B8ZA 3UTCA 2NVOA 1Q1QA 2IH2A 2VJMB 3ED5A 3GIDA 5ERGB 2FFJA 1ZEMA 4HFMA 3AEUA 3S8MA 4CT5A 3MYRA 3UH0A 5J4LA 2NP7A 3FDXA 2R85A 2FX5A 3CVJA 4RHCA 4M54A 1D07A 1GG8A 3Q2KA 3WFIA 4Y6RA 2PZEA 4D8WA 5EUMA 1L5NA 3F73A 1L7NA 2FAXA 1ZMRA 1C4XA 3G6WA 3H2JA 4NU0A 3UGJA 1FDUA 1I1NA 1XTRA 4JVMA 1E7MA 3NDBB 2XNCA 4FMPA 3WBKA 1REQB 2A0KA 2R6R1 1GZDA 3AZQA 3R5JA 5JQGF 5M7EA 5MN6A 4LXUA 4J0IA 2O20A 1JFTA 2ZR9A 2AEFA 1L8LA 4IUDS 2IXGA 2Z5VA 4FOTA 3ZPXA 4AROA 5IPFA 2I7XA 3UJ7A 4QQFA 4Z9BA 1F20A 3CJTA 2RK3A 2O2GA 5DSXA 4UXHA 5A7GA 3PXXA 3OX3A 1OY1A 1MO5A 4GBJA 4U3JA 3SR0A 4JP1A 4X84A 1PWHA 3ZCXA 4JL8A 3LNTA 2BP7A 4WN3A 2ASEA 3ER9A 3EXG1 3AHFA 4BNTA 4JGBA 1IXRC 4OI4A 3T1OA 5IK2D 1YJ8A 4BQQA 2AF4C 1HGXA 1DKLA 5M34A 2QLJA 5DHSA 1YBMA 2AG0A 2HK7A 4X63A 5I01A 4B74A 5JHGB 3VZQA 4PC6A 3QMPA 2Y92A 3IXMA 3P0JA 5EE0A 4F97A 4ZEWA 3DBOB 3EDQA 1RAHA 1JU4A 1QVAA 2NXNA 3VHQA 2VAVA 1BDIA 3EXEA 2ENUA 2GZ1A 3L9XA 1XZBA 4I8IA 5ECGC 4E5KA 2L19A 1DEAA 3IKTA 4UBLA 5BYJA 3IP7A 3ROEA 5GV7A 1D4ZA 1H66A 1ENYA 3T3NA 2O0LA 2RIPA 3DSRA 4IDHA 4Q01A 2AZXA 1OX6A 5AJHA 4D74A 4MS3A 3L8CA 3U44A 2R3SA 3H7IA 2W6IA 1NU6A 1KQNA 4LCEA 3ZQJA 4MCHA 3UK2A 1V8OA 2BY4A 3LPDA 3QHQA 5KWJA 2V9PA 3MQ4A 4O8CA 3RK1A 4HQRA 2AOXA 3HB1A 4NE9A 1JAHA 5CLQA 5CUQA 4BIIA 4P98A 1MJGA 2VYFA 4OLHA 3GJXC 3OFKA 3PBKA 2R47A 1LJLA 1V3TA 1DEHA 2IXTA 5A6SA 2IS2A 3TEJA 3KWFA 1PQUA 2BI8A 1OH7A 2OHVA 3GPBA 3ESQA 4II7A 3R44A 5AW6A 3KKQA 5A4DA 5CPBA 5IJZA 4BNHA 3GG9A 1X87A 4P4TA 2VRCD 1NXWA 3EMDA 2VXBA 4HGRA 5BWOA 3KJGA 2G0AA 1C30B 1P5ZB 2JK0A 1JV2B 1RLTA 5CFLA 2G4VA 1Q50A 1NRJB 3HJBA 4R1LA 3PHHA 3U3OA 2QZ4A 4D6PA 4UU8A 1QO0A 3TNDA 2HXYA 1DEKA 2CWDA 4RDIA 2XNDA 1K8ZB 3A10A 2BL4A 4Z9XA 4G9BA 3DE4X 3OPXA 3EYWA 4Y0NA 2JCYA 3EQ2A 3FNRA 4H35A 1QTNA 1P6XA 4DARA 2JLYA 3TSYA 3J81k 3VNAA 3VPGA 1RSZA 2VH1A 2OPHA 4D8UA 2BKAA 1GTSA 3FFTA 5CLHA 4KMRA 2GETA 4OFBA 2VP5A 5EVJA 2Y93A 1UKEA 3K70C 1SY7A 2WWXA 4LHWA 4RUKA 2JFPA 2IHNA 1HDIA 5C5EA 5FADA 4HBZA 2EGHA 2F9MA 1AMOA 3EFHA 1I13A 4N4AA 3O31A 2ODBA 2J59A 1PR5A 3SC3A 4JP2A 3SBEA 4HDOB 4BMYA 3QY9A 1E66A 5JNRA 1ZGCA 1Z0UA 3AF5A 1CS0A 2NUPA 2QLTA 3NUQA 1G3RA 4HBGA 4QDZA 2LNDA 3MJVA 3SIRA 1Q7RA 2JAOA 3V1KA 3W5JA 1U1FA 4AG5A 1SUAA 2IF2A 1QH1B 1U0RA 3VX3A 2P77A 4IS3A 1BVRA 4XZ3A 4CF6A 4I6JA 5IT0A 4ABTA 2JJYA 5JFTA 1Z0FA 1BKDR 5TS3A 3ESAA 2VPZA 5LOVA 3D6VA 4LA4A 3BQMB 5D3MB 3WNDA 2R2GA 3QE4A 5LZ4A 4XWTA 2J4FA 4ZAWA 1WJGA 2MU1A 3LRXA 4ZCQA 3ZHTA 4XI9A 2ID4A 1ZOSA 5DLQC 3H9JA 3MIIA 4B33A 3DMNA 4K87A 2PV7A 2POQX 4I4LA 4NXMB 3AWIA 2FP4A 1VDMA 2JPDA 3NKFA 4FM9A 1TM1E 3MXTA 3I9NA 1UFKA 2C95A 3SVTA 5EHIA 1JDBB 4JWKA 3O83A 3PL1A 4I6EA 5D00A 1ZBQA 2BFWA 4HXGA 4PX2A 3CNBA 4F86A 2GZ3A 1FDTA 3T0GA 2QL6A 1G0OA 2V1UA 1PR9A 1W30A 3CUSA 3M0EA 3R23A 4U2CA 5K8IA 1G6Q1 2QM3A 5DMXA 6YASA 3HLKA 3IVXA 4LKOA 2GRUA 2OHFA 2G06A 1IEVA 3FZEA 4HMPA 2DU8A 3IUQA 4NPHA 5JD5A 3MTGA 1L5YA 1PUJA 2XXAA 1QV6A 1XDGA 4ESEA 4P86A 2PEZA 4EF4A 3PD1A 2QLFA 4DILA 2I8AA 4P38A 3RYIB 3FNHA 2Q99A 1SBTA 3LO5A 1OKKD 1DIBA 1NBIA 1DT5A 4IZIA 5HBGA 1F7UA 1ID8A 3N0RA 3ROGA 2OUKA 3FA2A 5ED4A 2B2CA 3NC4A 3EIWA 4BO4A 3C14C 3IOEA 4H31A 1RZ3A 1PEDA 4RH3A 2A67A 1K66A 2I7TA 3AJRA 1QOZA 1AKEA 2AMYA 2G83A 2MINB 4HDSA 1U9IC 4YASA 2SBTA 4EFDA 2PAFA 1QS0B 4PSKA 4JDUA 4DLYA 1BXZA 2WFMA 2ZI4A 1MG5A 4R8KA 1IJFA 3CT6A 3T54A 3PHLA 2FZVA 4H60A 1DIGA 3QXGA 2JBAA 2GHTA 4XIIA 4IS2A 4A23A 3GUCA 2F3QA 5B12A 4DBLE 4FDUA 3A9RA 5LDDC 3VAZA 1RM4A 3P2IA 2H4FA 2R4UA 1V37A 4O1MA 3H8JA 2P6MA 4HDRB 4S04A 1P8AA 3LUHA 3I52A 3I5XA 2PD3A 4PG8A 1V35A 3H1GA 3F2IA 2D8AA 3I1YA 5AJYA 3IDQA 3TIXB 3TGLA 4HDQB 1G0NA 1UBSB 4GSLA 2QV7A 5SY6A 3V6LA 1DS6A 5C34B 3UN1A 4F9TA 4UM9B 5I51A 3I6YA 3LLCA 1ES9A 2HO4A 4UBOA 3UYLA 2G82A 2WY2D 1QAMA 2YUTA 1Y7IA 3JQBC 4FOPA 1SXJB 4LBZA 1C7EA 3EUAA 4OPMA 1E7YA 5LYJB 5CM8B 1PFWA 4OYHA 5JH7A 4EW3A 2EC5A 2XQKA 1EFVA 3LGXA 3Q3GE 4Z9YA 4X92A 3W6OA 1VC2A 3NIDB 1ZOPA 5DYTA 3IOCA 3WRXC 1XTQA 1EFPA 2GCIA 5DT2A 3O0TA 3V9AA 3PVZA 4QYWA 3TTYA 3JCZA 3AESA 5BRAA 4BTVA 9LDTA 1LCIA 1L4NA 2D54A 2VH2A 4A8JC 5B3AA 1BO6A 5L53A 1FCJA 1X8XA 5AKHA 1ZUHA 3AJAA 2B98A 4KXFB 3MT8A 5MFZA 3N59A 3OTIA 2V97A 4D4GA 2Z43A 3BEDA 3EOZA 3QTBA 1J7JA 3R9KA 2ON6A 3LSTA 2PQ2A 1CY8A 3G2JA 4FGZA 3N2KA 4JH0A 1Z47A 4MR8B 3WHLA 1CV2A 2G7ZA 5LMZA 3JR7A 1Y80A 2B94A 1VJTA 2AFHA 2XAAA 4ETIA 4OOEA 2QMHA 3AR9A 2B3TA 2EATA 2VYND 1WSBA 4GLFA 1XU4A 4MICA 4JUIA 2LRHA 5FBWB 1UXIA 3G2LA 4NBWA 1N6HA 1TMKA 2YIMA 3GGDA 4KYIB 4LYHA 5EEGA 4AZ0A 4FI3C 4E03A 3K1JA 3OPYA 2XH8A 2XNHA 5I7OA 5FYDA 4X6UA 3UA3A 1JB1A 3F47A 5G53C 1GDDA 3WQBA 1QYXA 4RGYA 1QC5A 2J0SA 1EVLA 3D9QX 2PGDA 4HEJA 1VRVA 2F1IA 3BEOA 3BG5A 4IINA 4N40A 4PO9A 1JZSA 1AMUA 4IV5A 4LX0A 1MB0A 3OESA 5FPTA 1SEVA 2W0MA 3U4MA 3IBTA 4TSRA 2XLBA 1X19A 1OIVA 2ZBQA 4N5DA 3EPPA 2DPGA 5FI0B 4XUDA 3KXDA 1DAMA 1NV8A 1OZFA 4O6VA 1J2UA 1GKLA 4JSYA 1WD5A 1WOYA 2EAUA 4QODA 5B6JA 4XIFA 5EZYB 1TQ4A 2I76A 1W88B 5LL6P 1WHTB 3MCUA 2WJ3A 4WA7A 3Q5DA 1W4ZA 2WZCA 2IS6A 2BFFA 3STHA 4B4OA 3GDOA 4LRSB 4IOLA 1WUTA 4IJVA 4OXRA 3KUCA 1S7GA 3PUKA 2B34A 2PRZA 2WP0A 4NMHA 4JK3A 4R8VA 2I6SA 3AINA 2O0KA 2NPOA 4WNAB 5TS2A 5IULC 3RNOA 1M6WA 1U9ZA 1HORA 2IDZA 1P2GA 3Q5EA 4ODIA 4YRGA 1IJKA 3U7QA 1E0SA 5JNUA 1NP7A 2IYVA 3U40A 1GYQA 4BNWA 5JECA 1JJAA 1HA3A 5L6MB 3L1IA 1M9NA 3KFLA 3M81A 1XZFA 4PCLA 3FDFA 3AJEA 1ZH6A 2W37A 4CM4A 2FZCA 3EZFA 1OLOA 4F45A 2EKDA 1YBFA 4Q66C 4YI3A 3QVKA 5LBUA 2VYNA 3ENZA 3ZGZA 1LFDB 3SOZA 1JIVA 3ZTTA 2NVUA 5K6TA 4CE6A 3WDSA 3EWIA 1TEHA 5CPFA 4EYEA 5EZ5A 2Q6KA 1Q0UA 4U2FA 5LU9A 1HLPA 2QVZX 4CNBA 1R0LA 4ZVUA 3TB4A 4NBSA 3RYTC 5FUQA 5L45A 4L5CA 3WLFA 1GJRA 1E1QA 3B60A 3N5CA 3OCUA 3E8XA 3V1NA 3ZZ0A 1P7CA 5JV5A 3VJMA 1Q0TA 3PFCA 3NEJA 1XDBA 1ZCJA 2J41A 3I4LA 4HUJA 5K20A 2H06A 4KTTE 5KINB 3IR7A 5FQNA 3RVLA 4CF7A 5LN1A 1JG7A 1O6GA 4FT2A 1MOQA 1YZKA 3VR2D 1B6TA 1DJOA 1YS9A 2O1EA 3H11A 4G5FA 3MBIA 4J1NA 1G21B 3QEMB 4ZCSA 4BX0A 3UFXA 2Z6AA 5PNTA 2QM0A 1JE1A 1YVPA 3R6TA 2ZRAA 2GEDA 3I73A 3RRZA 4ZO9A 4Y3UA 5GVSA 2PUBA 1EQUA 4N03A 1LY1A 1XKXA 4DA9A 3QUTA 5JOQA 2BDUA 2IVZA 3DMTA 3IDSA 2NYRA 4HAWA 3DVLA 3FNBA 3B70A 3H86A 3VHXA 1O58A 4PLVA 1VLVA 2EBFX 1ULSA 2VUIB 2H17A 3GRRA 4X6YA 2VPTA 5E1DA 4LYJA 4F38A 3VBEA 3K8QA 3E9YA 4OQEA 4RTLA 2PGOA 5HE9A 2YUIA 2JAWA 1N2BA 4MGZR 3U7GA 3VNUA 3LT0A 3TMKA 4MYCA 4D4HA 2P6PA 2CF6A 2OLEA 2Y4OA 4XX1A 1T29A 2PIAA 5H68A 1DQZA 2F2TA 3TRDA 5IJ0B 1ZW1A 2REQA 3VNRA 5CT9A 1NUTA 3U62A 3KWJA 1YCGA 2PGIA 5FPQA 2QR3A 3HKEA 4NMWA 4Q9DA 1NF8A 4X93A 2QTLA 1Z74A 3F6EX 3V2GA 1GVHA 4C0XA 1RRVA 4KLNA 4MS4B 1D2GA 2H18A 1KY4A 2YHIB 4EOGA 3DL0A 3MCTA 4MIYA 5LNK1 2OAP1 3AEXA 4HPJB 1C1HA 4OQMA 4CYMA 4IMIB 4Q3NA 4IDNA 2DTXA 2D5AA 1I2ZA 3E9MA 4RA6A 3E2IA 2VBFA 4AWXA 2G8NA 4IM7A 1LI5A 2IE8A 4CTMA 2I1QA 1P9NA 1JKJB 2I2CA 5SZKB 2R66A 5GOZA 2FWAA 3A1WA 3GT4A 2XYRA 3VR2A 4DQKA 5ADHA 1M1YB 1AUXA 4KQWA 3GJ8A 2FUG6 4NG5A 4GPEA 4DWJA 2CYAA 2F1KA 4C5CA 1MBZA 4J1TA 1ENPA 3UUFA 3PGA1 2WLTA 2QMEA 4RLQA 4LDZA 4ARZA 1KJZA 1TA0A 2XGSA 3NW9A 3QJGA 4WBXC 1SHZA 3UK0A 5IVPA 4IZ6A 3RU7A 5T3YA 3TFWA 3K15A 2ZVDA 5EQDA 2QVBA 3AQ4A 1UMDA 1HWYA 1TVEA 2HBQA 4R1OA 3LDGA 3LE8A 4YCJA 2ZQZA 4PVCA 2FXIA 3B7WA 4IIXA 1S3SA 4Z86A 1XLTC 1N9GA 3ZK9A 1R0XA 4CM9A 4MUXA 2EHDA 5BNTA 4JXJA 2BEWA 3UM9A 3UPDA 4CKCA 4LISA 3F1LA 3L6DA 4L4XA 3AR5A 4JAVC 4ZAVA 3UG6A 4C7VA 2OM6A 1M5RA 1H1LA 2ZSJA 1PI3A 3RVJA 1JWLA 4LHYA 1IN1A 1NR5A 5LXTA 5JWHA 1W4LA 1RLUA 4QTTB 1JA9A 2PQ6A 3L4EA 3FTNA 4RGQA 4TTIA 4EMSA 3K5HA 5A9SA 3DTVA 1TRHA 3EC2A 1Q0SA 2R65A 4PYQA 1DKNA 4R16A 3V80A 3OM0A 1CJBA 4DEXA 4BO2A 3B53X 1HL3A 3D3QA 5J4HA 3WLNA 4NBUA 4XYEA 1XEXB 4Q7EA 4U2KA 2V7EA 5JNSA 2VDLB 4M38A 2OZPA 3LLVA 3FBTA 3UCEA 1KDZA 2MTBA 4JC8A 2JJ8A 3JWHA 3R3YA 4IH9A 4TYMA 1E1YA 4UEOA 2NU7A 4AP9A 2JLSA 1ZVVA 5EESA 4JU8A 2WUEA 3PC7A 4KK4A 2FKAA 4E1AA 2X6TA 2IQIA 3KTFA 3MT7A 5CT6A 1XNHA 5LD2C 3ELDA 1HDCA 3TTXA 1P3Y1 3D7RA 3NXKA 5KYNA 1N5DA 4QPZA 1I10A 4MAMA 1IEWA 1IK6A 2WU0A 3I2KA 3LM8A 4RPGA 5GJWC 3GLHB 5LQCA 1J9ZA 4P4UA 1IBSA 3RAFC 1TVKB 1C7ZA 1CT9A 1K6MA 3C3YA 4B31A 4ZCTA 1ZJYA 4EB6A 1FOEB 1ZIYA 1E6MA 3A27A 3WJ2A 3KU1A 3TECE 3ET4A 3WWYA 1M74A 1JLMA 3FPGA 4R7GA 3U3MA 1RHMA 1VP3A 3ZD8A 4MR9A 5IYZF 4CM6A 1S02A 5ALJA 2OCIA 3BS4A 2KYRA 4N7RA 4EEKA 3Q8MA 4QDKA 1L4FA 2FGJA 2DUNA 1WBJB 2Q3BA 1TT5A 1QGOA 1C3JA 1RQGA 2RHMA 3CRRA 2FSVA 3QF4B 5JLAA 1R0RE 2PO7A 7ADHA 1B8VA 4JJ7A 4KW7A 1WEHA 3CURA 4EATA 1JJVA 2GFQA 4BNZA 3GBVA 3ROTA 3F3YA 4A6DA 5EJ4A 4X90A 1XEFA 1V0JA 1XBTA 2PIDA 3KKPA 3PHJA 1E9EA 1E0DA 4WGFA 1T2NA 3SIXA 4LSGA 4X41A 2EBHX 5DNAA 3UB4A 2NUAA 2WMOB 4EY8A 1NY5A 1HDRA 2PKWA 3GFSA 3ZU3A 4OYLA 1E3IA 2JGDA 2QZ9A 2W70A 5FUYA 3OICA 4J0QA 3IEPA 3RCBA 2Y0CA 3K05A 2CJWB 4M9SA 2JC3A 1I80A 3KELA 3PUWA 3GVCA 1ULTA 4J7UA 5AXCA 2Y6VA 3DGEC 3SFVA 3BXPA 3SZ3A 3R7AA 2B8EA 3WADA 1OZAA 4GYYA 4QUDA 1OLUA 4YP1A 1KE1A 3FZGA 4CMHA 4WJKB 1RRGA 3U7RA 3DZBA 1MX1A 2ZKIA 1QP0A 5KJ6A 1I0LA 1IB6A 1PTJC 1TRKA 5AK0A 1C3OB 5HFAA 9ABPA 4UCFA 4G0MA 3AM4A 3UJAA 4D26A 1T9GS 1VIAA 3MTDA 3B48A 3G5UA 2CVHA 4J6FA 4M8LA 1RCTE 1H22A 2CBXA 2WAAA 1JGTA 4NDAA 4IJKA 4NPAA 4UHEA 4PC2A 4XPZA 4BYGA 1RQXA 1PT6A 3U26A 1TUBB 2O8EA 1WPQA 3ZH2A 4AUKA 5TEVA 1OPRA 3BMQA 3GZNB 4FILA 1TA9A 5F23A 2OK8A 1P5HA 3G9ZA 4J49A 1Z5OA 2P91A 5LQDA 2ZZNA 2PD4A 3C8HA 3LJKA 5CTAA 3EXIA 3Q3VA 2O3SA 3CCCA 4WCFA 3HHPA 4TSFD 3ANXA 2JEYA 1AQYA 3CNLA 3Q7EA 4NMLA 5ALMA 4ZJPA 3KJXA 5EJ6A 5IHXA 4JT2A 2H0RA 3WMRA 3FNEA 1J00A 1QSGA 2OAGA 4X7PA 1PQYA 2A8YA 2FETA 2Q5OA 3K2IA 1U8AA 2QR2A 2VKTA 3UB2A 3HRKA 4AKEA 4XW2A 1RFLA 1Q0ZA 2M2IA 4J0DA 2QAIA 1AKQA 3L1KA 3DE2X 2OHJA 1IG3A 1XRPA 5A4JA 1M2HA 1AT1A 2OG2A 1BD3A 5DJ5A 5IZCC 3E81A 4TZTA 3UAYA 6CHYA 3IALA 3A6JA 1B73A 2R60A 1OA1A 3GK3A 2NO6A 3Q15C 1IIRA 4GZ3A 4R51A 2JGMA 3OEWA 4F46A 3WKCA 1I7SB 3EDMA 1QJCA 5KHAA 3GLFA 3KX2A 1O8CA 2IYWA 5F3DA 4JJZA 4AUMA 3TLYA 2XD4A 2MMGA 5TQJA 4B3RB 4QXAA 3LOQA 3QXXA 4Q82A 5C32A 3HPRA 2DUMA 2WW8A 4MKGA 4TRMA 3T12A 5HVNA 1SUBA 3MJFA 4X94A 5FO0A 3ND8A 1CJUC 3O6VA 4PZYA 1BMFD 3O75A 4L4ZA 2AXNA 3C7KA 3G02A 2ZIXA 3R40A 3F67A 1YAJA 3N8DA 1UOOA 2Q8QA 1W2WB 2J0UB 2L0XA 2RHGB 5C8YA 5K8TA 3GPLA 1N5IA 5JSKA 3C3AA 3O4JA 5ADVA 1N8TA 4WN9B 4WHMA 3PIDA 3AEQA 2KS6A 3FI9A 4R8LA 2F8SA 4TGLA 4OQFA 3OIUA 3EIXA 3C6XA 2WIFA 4BN4A 1RWNA 2LPMA 4KE8A 3AY3A 3ESYA 2WHYA 2PXCA 3IIEA 4GPBA 5BYKA 1HMPA 1NG1A 1UT5A 1ZJJA 1QVWA 4O63O 2H07A 5DSTA 2JIMA 3NOOA 3SQDA 2PZKA 3GRVA 2WT4A 1P62B 1RWBA 3ICPA 4RXUA 2OFFA 3B1WA 3M6AA 2OYRA 3VZRA 3WGTA 2PT7A 3KUXA 3Q7RA 2BELA 4TKVB 5IMSA 2QTRA 3JALB 1SU7A 4NY1A 4MQFA 3UGQA 3TXYA 4RHEA 4PRZA 3TKYA 3O4GA 4KG7A 3NPMA 4TTJA 1KNXA 3QU7A 3FYUB 4YAWA 1T2FA 1YUMA 4PYJA 2G1UA 3O03A 1EMDA 2Q1XA 3PR1A 3BMNB 4A10A 3GYGA 3LVRE 4DDWA 4EAQA 4KPUA 2C07A 4G5YA 3ROKA 2BLNA 2HHJA 4EUHA 5F64A 1CR4A 2VFAA 3CZAA 3K1AA 1U7OA 2Y0PA 2QX9A 4YJ3A 4CV2A 3T3MB 2ZYIA 2O59A 4A15A 1U2GC 2QKYA 5TGZA 2GLTA 4MIKA 4QEDA 2Q6TA 1A2KC 3JRWA 2W6NA 1VPLA 4QELA 2EFYA 3KFVA 1Z83A 3AKZA 2C88A 2BJWA 4ILKA 1ORIA 1XV5A 4KHPB 4ND3A 4H7KA 4TN5A 4IICA 4YWHA 1BN6A 1TECE 4UZFA 4KU4A 1W8IA 1P91A 1L9XA 1TC1A 2Y66A 3TW0A 1XHFA 3DWEX 4AJIA 4IXTA 3V2IA 3PSAA 4W1SA 2MIIA 1H9BA 3RC2A 3V1LA 5TMPA 4XJTA 2QQFA 3WDLA 2X8JB 1BEUB 5E9WA 5THKA 1G8KA 2G5TA 1TI7A 1VSTA 1L4BA 3I9V6 4D8TA 4UE6A 1M34E 1CUAA 2AMVA 1NSYA 4WZAB 2JLAA 4TVBA 4O59O 2JJ2A 1YU9A 4FFWA 1W1UA 1NMZA 1OILA 1E18A 3AOEC 1XVAA 4BKUA 2LKDA 5YASA 3EMVA 1J22A 4LG1A 4J0EA 4PHHA 4Z99A 4FGLA 1LI7A 4QSMA 1L5GB 4LF5B 1P44A 2LXNA 5JPCA 4B4VA 1M83A 1CIVA 1EU1A 5I5EA 5E8JA 4DR1B 2LCFA 5H3HA 2WD9A 1A8PA 5AYVA 1IH8A 1RM3A 1YQTA 2AFVA 1UWVA 4B7CA 2HJWA 2I1WA 1QG4A 4Q05A 3KBBA 4QPJC 1GY8A 1TMYA 3W90A 2LBPA 3H1PA 5EKTA 1V4BA 4HC4A 2OV2A 3H5WA 4PONA 3DMRA 3IB6A 1EX9A 1VLMA 1RQ7A 3DV0A 5AW4A 1JXMA 5F7XA 2GWHA 1E8MA 3BMCB 2O3JA 2OXEA 3V4PB 3ONEA 2C99A 3FJ1A 1E2HA 2PKEA 4LOHA 2NU9A 2ZSBA 5ITSA 2ZFUA 4Q48A 5ERYA 1E4EA 2WJYA 4E07A 1OXBB 4P3XA 4V0KA 3G0DA 4Y7CA 5KHLB 2XHEA 3HDYA 4IMPA 3M3PA 4RSGA 1QHSA 4G5XA 5EJEA 1GGNA 4F93B 1Z6ZA 1IHDA 3CCBA 4JLBA 1KK1A 4DMCA 4F6LA 4RTKA 4OGKA 3AF6A 5LMCA 3B52X 1RJWA 1QTIA 3LUJA 4CEIA 2CMHA 2FPLA 3AY7A 4M37A 1LQTA 4TRRA 3KZNA 3DD5A 4YBRA 5DM70 4KI0A 4RF4A 1NXSA 1DBPA 5CW2A 3TR6A 3ZWDA 4DIBA 1RI3A 1G5QA 3ES9A 5DXJA 1RBYA 3O3CA 4KDEA 4BQSA 1UC5B 2FUEA 3LX8A 4JZKA 4Y9UA 4HJRA 5E1OA 4WINA 2UUBB 3I58A 1TD9A 3IT1A 5TF4A 2ZUFA 1EFHA 2IW3A 2XDAA 2NWQA 1QYVA 4ANFA 3UK6A 3W9BA 4QHYA 1GGEA 1OXKB 3D1VA 3L0IB 1N2CB 4FZVA 3LYAA 2HKIA 5DN6D 4YMGA 4HX9A 3PT5A 3PE4A 1H3FA 4I7EA 4NIMA 1QLHA 5EWJB 1YBVA 3E03A 4B6QA 4IDQA 1BCSB 1JQAA 1YB7A 3G0IA 2ZYWX 1OHHD 1RBQA 1Z37A 3PRJA 5DM4A 4EGQA 1GNPA 2P8JA 5JASA 1ZH4A 3DVRX 5DLEA 3BK7A 4JJGA 2YICA 5B1HA 2OMKA 5COBA 4BV2A 1WBDA 1SA0A 3CSSA 5JTUA 1R74A 7MDHA 1E3WB 1EWVA 1GTL1 3JWGA 4G1CA 2A0UA 3IV9A 3I61A 2VATA 4JB2A 3Q6IA 5FWXA 2BFCB 1NZFA 1C14A 2G0NA 2OD2A 2ZTUA 3GYBA 1PRYA 1OREA 1ECCA 3QG1A 5KPDA 1W29A 2WJAA 2B3DA 4K6HA 2CHFA 2DTEA 3L7AA 4ZTZB 2X0RA 2ZEJA 2VOEA 4E33A 2VTBB 1LF0A 2ZUSA 4OMFG 4OY3A 4BNUA 3U5ZB 3GRKA 1L7BA 1RACA 1KO4A 2QUBA 3O1JC 4GGMX 3L0PA 3WX0A 1YS1X 4EY4A 1OAOA 2JFXA 3RYFA 2CB9A 1CZOA 3QVLA 1KAQA 2WDPA 2XITA 3JTMA 2OLKA 4UHBA 3RYHB 3WRWA 4ECAA 5F98A 3K9CA 2GARA 4LRXA 1IAVA 4YRNA 2Q5IA 3L8GA 5G2OA 1U28A 1N4DA 4J3NA 3UAGA 2WQZA 4LBWA 5C4IA 3L7KA 3RREA 3EEOA 2PH7A 3T1TA 3TG8A 1DRKA 1OH6A 4BHTA 2FTKE 4UDOA 1DJNA 1U65A 2ZRBA 5F73A 2LDXA 1R9MA 4FHGA 3BWMA 3OM9A 3FHOA 3LK7A 1T36A 4NR0A 1CKEA 4BNIA 4I1VA 3W7VA 2IOFA 1E7SA 1K8XB 3DLCA 3OUZA 3HO8A 1ZI8A 3F3KA 4CFYA 4Q4CA 1L4HA 1QRRA 1BDMA 2YC2C 2FQYA 3BHNA 4UCXA 5A5GA 3NONA 4BO0A 4P5PA 3I83A 4E21A 1CIJA 4G24A 1X1DA 3HU1A 4IIJF 3RVPA 4QVIA 4FFNA 4HWPA 1B8UA 3HCWA 1WNFA 4PWYA 5JJKA 3LBYA 1OLSB 3GLKA 4R2LA 3WK9A 4O5AA 2CNBA 3K20A 3TIGA 4BWYA 1GXSA 1MEEA 3GL9A 4WKNA 1W6RA 4MGYR 5EJ2A 2YJ4A 4AX8A 4YCSA 3JVEA 3EWAA 1N6LA 2R1ZA 3LZCA 2PX2A 1QGDA 3NQ41 5DYNA 1ZJ4A 4TYWA 3QPUA 1E94E 1XCJA 1Z4LA 1MXFA 4MWBA 5AJZA 3RU2A 2ZCJA 3A3KA 3KQUA 4OSEA 4Q34A 4HGYA 1F2UA 2W11A 2C8JA 3W8NA 3AVPA 2ACEA 2D0DA 1KHTA 4ITVA 4KB5A 3VPHA 2V0NA 2VK2A 2FPKA 2A0YA 2W93A 1T5TA 2FLKA 2YW2A 3H3XA 1M0WA 1X7YB 3FWZA 3G9XA 3MINA 3O4IA 4HN4B 4LTDA 4PHFA 4PPGA 5AVKA 3ZV7A 2ZXFA 1RLOA 2AR7A 1OH5A 1QZTA 1WCYA 4D8VA 1ULUA 1TUGA 3QK7A 5GY7A 4YRMA 3W2IA 3UWKA 3MGCA 1NLYA 3KSAC 4BMOB 4KDCA 1WZUA 2H2DA 2OZKA 3IVMA 5A5DA 4ZAFA 3FHTA 5AXDA 1US8A 3SS8A 1V96A 2R1TA 3TR0A 3TAHA 3ER6A 1VJGA 3D54D 1WDKA 3QI7A 5KTTA 4D1YA 2HUNA 4B3SB 2YC4C 3CB2A 1QH8A 2J8ZA 3P5BA 5KTSA 4G0PA 3GLGE 1XEAA 1ZOLA 1UPUA 2F00A 4GPI