4QDXA

Crystal structure of antigen 85c-c209g mutant
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
277
structure length
271
Chain Sequence
LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYGGNGTPNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 103
structure length 271
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qdxA00
3ZLVA 1XQWA 3H0CA 2HA7A 2HFKA 3G0DA 3E3AA 1QIKA 4B85A 4X6YA 1E3QA 1A8SA 4H0CA 2YASA 4Q1VA 5K3DA 4JNCA 1JMKC 3EF3A 1Z68A 1G66A 2AJDA 2JGJA 1UOQA 4Q82A 3I2FA 5ALHA 4DMKA 3QPAA 4UBIA 1YB6A 4LYDA 5ESRA 1D07A 3E1GA 2VT7A 4UHCA 3F97A 1GQSA 1XRMA 4G4IA 3QPCA 3OM8A 3WJ2A 2WG2A 2DQZA 1CEXA 1Q0ZA 5DNWA 3V9AA 3F9CA 4Y2QA 4DSAA 1ETHA 1M33A 2PKYX 1CQZA 5AIAA 1JFRA 2VJBA 3CN7A 3G9ZA 2WG0A 2V98A 1CUIA 4FDMA 2G5PA 5LZ9A 1CUHA 4QLOA 2V96A 2EEPA 2JGIA 4AZ0A 2XMSA 3HLKA 2WJ6A 2OCLA 1FJ2A 4U2DA 1R50A 1UXOA 1O6FA 4L0CA 4OB8A 3WWPA 2Y2UA 1DWQA 1YA4A 5FV4A 1TK3A 4PV7A 5AKLA 4HRXA 5CT6A 3DKKA 1CUEA 5CTAA 2NW6A 5AP9A 4C88A 2QTBA 4PSDA 1LPAB 1A8QA 3F67A 2O7VA 1XRQA 5AKIA 5DTIA 3ZLTA 5K3BA 1ACJA 2G5TA 3FYUB 2OGZA 1ZJ4A 2AJ8A 3QZUA 3D3NA 1CVLA 2J4CA 4BRSA 1BEEA 3ESBA 2I3ZA 2H1IA 1U65A 1EK1A 1AQLA 4N8SA 3BF7A 3H2JA 5AI6A 1XLWA 1XZFA 2FUKA 5I9IA 2RIPA 5JIBA 5HQ3A 1XZKA 3C87A 2WTMA 3H2GA 2XLBA 4ZRDA 4C4YA 5EI5A 1MT3A 3AIMA 4G4JA 4XVCA 4DMHA 4CG3A 3H18A 1OCEA 2DCMA 3C43A 1XROA 1K8QA 2VA9A 5AKEA 1VJ5A 5ALUA 2GYWA 1W52X 4CG2A 5ALTA 3IUNA 5CH8A 3AZQA 4LXGA 1XRLA 2BJHA 1EDDA 1WPRA 5LZ5A 4M0FA 4WFKA 5KWJA 1YS2X 1LPPA 4AN1A 5IH7A 1AGYA 3IBTA 2V97A 3BIXA 3HABA 4CI9A 3G9TA 2QXTA 3BJMA 5AM3A 2Y6UA 2WFLA 2IIVA 2Y6VA 1F0PA 5ALNA 5DYTA 4U2BA 4J0GA 3SC2A 1FSSA 4QDZA 3W2TA 4X71A 3O4IA 3MGAA 2XQGA 2VEOA 3C8DA 1J06A 4DNQA 4OYLA 3DL4A 1FFCA 5K3CA 1X70A 2HU7A 4JEIA 2XLCA 1HLGA 1TCAA 1C7JA 4B82A 2EDAA 5E4YA 2XMCA 1WB4A 4TGLA 4W1PA 2GYVA 3W9UA 5C8XA 4K2AA 2HA2A 4H7IA 2IITA 2ZYRA 5F4ZA 1YCDA 2H7XA 1XRPA 4YPVA 1CLEA 4UBMA 3MUOA 3V48A 2QVBA 3DS8A 4RE5A 5A2GA 2BAGA 3DD5A 4WFIA 5AKJA 3MVEA 4BCCA 1HPLA 5K3FA 1UK8A 4WJLA 1YB7A 5AI8A 3WZMA 5HF9A 4UBNA 5AI0A 4BAUA 5A7GA 5CURA 3O4GA 2WM2A 1CFJA 4HXEB 4I3FA 5EIEA 5AH0A 1NX9A 2XUJA 2B20A 4O08A 1UKAA 1I6WA 2XUOA 4MQLA 5YASA 5BWBA 2VSQA 4PF1A 3RARA 5JZ9A 1R4ZA 1AX9A 5JAHA 3ICVA 5IVKA 1SCQA 4U2CA 3AZOA 4IQ4A 3WWEA 2YH2A 3I2IA 4FNGA 5ALEA 4BRZA 4J0IA 3ICWA 1LBSA 1H23A 1YASA 1HQDA 2WFLB 2WFMA 3WL5A 5T4EA 2J3QA 1EINA 3G0IA 3PUIA 4LKOA 1ZIYA 1JKMA 4E15A 2AJBA 2HA5A 4WDRA 5ISMA 5AM4A 1P0PA 1UWCA 3P2MA 2VJCA 3AINA 3LLCA 3STWA 2XUGA 3DDUA 1QIMA 4B83A 4X93A 5HCUA 3O9MA 1QFMA 4LXHA 4AN0A 3BJRA 4Y9SA 2B61A 3FBWA 3TJMA 5CXUA 4GBGA 5HK8A 5A62A 4BVKA 3RKSA 4N5IX 2O7RA 5BWCA 3QMMA 1QO9A 5E2IA 4J0JA 5JZSA 2B4KA 2ORYA 1QFSA 5K3FB 4BCDA 3WYDA 1NU8A 3C8HA 4X92A 2HHAA 3HC7A 4CCYA 3WL8A 4UBKA 4X6XA 3KD2A 4KRXA 1XZGA 2FJPA 1MTZA 1X2BA 4UFNA 3HRHA 1RWQA 2RI6A 4G1FA 4P9NA 2OCKA 1U8EA 1CUUA 2C0QA 5I8PA 1QIJA 3ANSA 3WYNA 4Y2TA 3ZLUA 1XZIA 2BUCA 4OU4A 5LZ8A 1XZAA 2PM8A 1W76A 4BBZA 4BDSA 1XZHA 5JALA 4KACA 1LPNA 1T4MA 2ZYSA 4UFOA 3H2HA 4FKBA 4RGYA 3PI6A 4H7DA 2PUHA 1CR6A 4OD0A 3EQ7A 2QUAA 1H2ZA 2YXPX 3UUEA 3W9BA 3G0GA 2OGTA 3D7RA 4H7FA 2XUQA 4HXGA 5ALMA 1GZ7A 3PUHA 4ETWA 5JADA 2OAEA 5C7YA 1XZDA 2CZQA 1LGYA 1XLUA 2PUJA 1R9MA 4WY8A 4BZWA 5ALVA 5D3ZA 2DR0A 1AMNA 2R11A 1MX1A 2HA0A 3HACA 3L1IA 2PU7A 3DL7A 4K6KA 4CCYB 2C7BA 5SYMA 5JD5A 1CUCA 1S8OA 5ALXA 2JGLA 3A70A 2VJDA 3FYTA 1QTIA 7YASA 4P08A 1CV2A 2WIFA 4CCWA 4BVLA 1XQVA 4S0XA 1DWPA 3ZPXA 4IHAA 2DHDA 4OPMA 4DNOA 1E66A 1Y7IA 1LNSA 1ZD3A 4FLFA 4G8BA 4HRYA 4ZI5A 1LZLA 4I4CA 1E8DA 2WKWA 3CN9A 5AOBA 4Q34A 5AOCA 1TKRA 3D2AA 3D0KA 3ZI7A 2WIJA 4J0CA 4L3WA 5ALSA 3TRDA 1Q84A 1CUSA 5HF8A 4C87A 2FJ0A 4AX4A 1MX5A 2CEKA 5EFZA 2HRQA 4H35A 1GGVA 1QIIA 4EY7A 5DWDA 1K5PA 2ZYIA 4HAIA 1GKKA 3ANTA 5ALQA 2CJPA 1A7UA 1EXWA 4FBMA 5DTJA 2DQYA 2QJWA 3B12A 5C81A 3IURA 3A2NA 2PPLA 4BE4A 2ONCA 1SOMA 5CT5A 5AI9A 3IUQA 3RLIA 3H1AA 3DKRA 5AKKA 3FSGD 5ALWA 3AJAA 2GBFA 3HI4A 4UHEA 3R3VA 1FFAA 5LP1A 2XUFA 3FLBA 5IVIA 1QIDA 1MAAA 5BV7A 4FMPA 2JF0A 4EUSA 3H04A 1GQRA 5IKXA 3WWOA 3PFCA 1EVEA 3F8SA 1DTEA 3IVMA 2XB6A 2XUPA 4BATA 4Y2PA 5HKBA 5SYNA 3R0VA 2PVSA 3F96A 4V2IA 3DOHA 2RAUA 2CUTA 2ECFA 2WIKA 1O6GA 3DEAA 2VTVA 1LPMA 3O95A 4B0PA 2XUHA 1E5TA 3Q8WA 3W05A 2UZ0A 3HXKA 3WJ1A 3UUFA 1VOTA 2WTNA 4OUKX 2AXEA 4MXDA 5AKHA 5AI5A 5CH5A 1CUXA 3IUJA 3PF8A 1SFRA 1G4HA 4F60A 1THGA 1VZ2A 4M0EA 1ZD4A 4GW3A 1DINA 3NWOA 5FPPA 3DJYA 5HF5A 1EB8A 5AKZA 2Q0XA 3X3HA 3O0DA 1VLQA 2QUBA 1JT2A 4Q3KA 4EHBA 3C6ZA 4PQEA 3B5EA 4BTLA 1N8SA 3ILSA 4CG1A 3M83A 1IUNA 5EHQA 3A2LA 5EGNA 3LS2A 3PFBA 3I28A 5JASA 5LZ4A 5CW2A 4X97A 3BIWA 2IX9A 4BB0A 5AM5A 1JJBA 1EX9A 3QH4A 3I2HA 4JH0A 3O4JA 4AB1A 4ARBA 1IZ8A 1T2NA 4X91A 2XUDA 3GBSA 1WPXA 4W1RA 1TCCA 2ZJ6A 3I1YA 3AILA 4C6HA 4X3CA 2OCGA 5CRIA 1QOZA 3QMVA 1XZLA 4YASA 2WHPA 3QVMA 1A8UA 2BKLA 2C0PA 4PSCA 4HS9A 5H3HA 2GYUA 3LIIA 2OAGA 2ROQA 4B9EA 1SCIA 4EB0A 1ACLA 4X85A 5AM2A 5E4TA 4G8DA 3A2MA 5EIAA 4C4XA 3JW8A 3R3YA 4A16A 4A5SA 5T4BA 5FLKA 1ZD2P 4FFVA 3K2IA 2XT0A 3WKEA 4IO0A 2O2IA 2XMGA 2PSFA 4H7EA 2V9ZA 4WCVA 2HIHA 3IUMA 4KAJA 3I2GA 4KE6A 1TIBA 3VXKA 2OLEA 1H2WA 5C8ZA 2Z3ZA 1FFDA 1EI9A 3VKFA 4DNFA 2XQFA 1OXMA 1ZI8A 4QE3A 4RNCA 4QEKA 5ALGA 1GT6A 1DU4A 4PO3X 2QR5A 3FCYA 5JYCA 1CQWA 3FCXA 5K3AA 4RE6A 3D2BA 3FWHA 5HQ3B 1JI3A 4GEGA 4ZXFA 4EY8A 3M3DA 5JAPA 1KU6A 4OSEA 3QITA 5K5EA 4OB6A 4FBLA 3VISA 1WHSA 4DLNA 1J1IA 1AKNA 5A71A 3H2KA 1DX6A 3V1NA 1G5FA 4MEBA 3WWDA 1JU3A 5D6OA 3ZWQA 2RGUA 1H2YA 2XMDA 3GZJA 5LYYA 3WK7A 1BROA 4ZREA 3ZV7A 4H77A 2HA4A 5AKYA 2QZPA 2BCEA 4Q3LA 3FLAA 4K6HA 3JWEA 3STYA 4NMWA 3E4DA 4BCBA 3KWJA 2RHWA 2VT6A 3WL7A 3BE8A 5FRDA 3WIBA 1KEZA 4HVTA 5T4HA 1W6RA 4QA9A 1GPNA 4OU5A 2HL6A 3C5WP 5DYYA 3A6ZA 4BE9A 1HBJA 2ACEA 1BN7A 2WIGA 1CUJA 3U0VA 4CIAA 2QM0A 3VJMA 2BGRA 1TAHA 3I6ZA 1LLFA 4IH9A 1AUOA 3HEAA 2WUEA 3D2CA 4KEAA 2VF2A 1CUFA 3F98A 3H2IA 2JGMA 5LKRA 1UOPA 4G9EA 3W04A 2RONA 2PSDA 4DIUA 4WY5A 5ALDA 5ALPA 4L72A 3K9BA 5LLSA 4P92A 1VA5A 2JGFA 1UOOA 2FX5A 3G8YA 2XUIA 3WKAA 3I6YA 2DHCA 2I78A 4K6GA 2QRUA 1JU4A 2XUAA 4BYMA 3UMJA 1EH5A 4WDQA 4ZGBA 2Z3WA 2WU4A 4X00A 1XKTA 2JEZA 2OPHA 1F8UA 3KDAA 4N5HX 4J03A 1J2EA 6YASA 1MNAA 4EA6A 1QIHA 5AK3A 1H2XA 2C58A 2ZYHA 3R3ZA 2CKMA 2OQVA 2R8BA 4GDMA 3BDVA 4QWWA 3PE6A 1MPXA 1E89A 1MN6A 3ESDA 5K3EA 4QZVA 1F0NA 5ALKA 4X7BA 2XMQA 1IZ7A 3SK0A 3G9UA 3U1TA 3N2ZB 3OPMA 4J0DA 4MJ3A 1F6WA 4NVRA 5HFNA 5HZGA 2C5GA 2ZVDA 2OGSA 3L1JA 1IVYA 4AMZA 3NUZA 3V1LA 4AXBA 3K6KA 1B41A 4HXFB 1NU6A 2I3DA 2WHRA 2BUBA 4OCZA 1CUGA 4AZ3A 1K4YA 4INZA 4ARAA 3H17A 1ZJ5A 1QIGA 4BP9A 3I1IA 3AZPA 3C70A 4U2FA 4Y2SA 3RM3A 1BRTA 4Y2JA 1EB9A 1XQXA 1XRRA 1VE6A 3M82A 2B9VA 4UPDA 3DNMA 4C89A 1XZJA 4B7ZA 1UK6A 1WOMA 2XUKA 3WA7A 4N8DA 1HKHA 4OYYA 5LZ7A 1YA8A 5A7HA 3C5VA 2HRRA 5ALZA 4QNNA 4KYVA 1CPYA 4W1SA 1QIEA 1N5RA 3GA7A 3WK4A 4FLEA 1P0MA 2OG1A 4IH1A 4Y2VA 5CT4A 2JEYA 4XJVA 3WWCA 4UBLA 5DNUA 4NZZA 1MAHA 1R9NA 5LKAA 3AUKA 3IULA 1Y37A 4W63A 4AMYA 4JYPA 3E0XA 1HDEA 2XMRA 4W1QA 5AKGA 2X8BA 1AC5A 4H7HA 3TEJA 2JBWA 1MX9A 2HADA 5FXMA 1UT6A 1XLVA 4KAAA 4BC0A 4MYSA 2YYSA 4B9AA 3R3XA 4U2EA 1DQYA 3JYHA 4YX9A 4HZGA 5LIPA 4QDOA 3O9VA 2AJCA 4PW0A 5KBYA 1XZEA 2XQIA 2BFNA 2LIPA 5HFAA 2VAXA 2D0DA 2HU8A 3EBLA 4EY4A 4MQMA 2PX6A 4UHFA 3SX4A 3WI7A 2G4LA 4YK7A 3AIKA 4U2GA 5CT8A 3KWFA 2C5FA 2JGEA 4NS4A 5AI4A 3R3UA 3LIPA 3FYUA 1K63A 1EK2A 3VDXA 2X5XA 5A6VA 1RYYA 5LZ2A 5KWIA 1CIJA 5AOAA 2WUGA 1ODTC 5ALJA 4BTVA 1DT5A 3CCBA 5AICA 2PSJA 3FAKA 1VXRA 1OILA 4DYHA 3KSRA 1E8NA 3V1MA 1WB6A 1XFDA 1X2EA 2X76A 1QLWA 4H7KA 1Q83A 3STTA 1BEZA 3MUNA 1YR2A 2EDCA 3CCCA 1G42A 1TQHA 3EQ8A 5AHXA 3LCRA 1QONA 4BVJA 2QJRA 4MWSA 4QDTA 1H22A 1ZICA 4LIPD 3CXUA 2BUAA 4LXIA 5ALIA 1HL7A 1ODSA 1PJAA 3QYJA 4GECA 5AIBA 4W9RA 1ZGBA 4XWGA 4Q3OA 4G8CA 1GPKA 5ALRA 3H1BA 4XX1A 4E46A 4E11A 1ZI9A 3I2KA 4MEAA 4UHHA 4GXNA 4GHWA 2CMFA 3WMRA 5CMLA 5AM0A 2WUDA 2I03A 4GWLA 3V1KA 5JZBA 1XKLA 3WK9A 3WKDA 2WLSA 5DJ5A 3BL8A 2CB9A 3ESCA 4FWBA 2D5LA 1CUVA 2GBCA 3H19A 1N1MA 3KXPA 5AKXA 3D59A 2DFPA 1LPOA 4HTAA 4DGQA 1U4NA 3WIOA 4C4ZA 1QO7A 5EHZA 1WB5A 2DHEA 3WK8A 1VKHA 1BU8A 4XIIA 2HDWA 4QDUA 5AM1A 1FFBA 3T52A 3G0CA 1N5MA 1MO2A 4EY5A 1KU0A 3VVMA 2PL5A 3OG9A 1GKLA 2XI4A 1VZ3A 1ZD5A 4I19A 1BCRA 1EDBA 1MJ5A 5EIHA 1ZIXA 2PU5A 1J07A 5C8VA 4BDTA 1LPBB 5JARA 4QWMA 2E3JA 4RPCA 4CFSA 4OB7A 1UKCA 1C7IA 2WUFA 1R3DA 1GPLA 1XZBA 1AURA 4DMFA 3EQ9A 2J4FA 4AO7A 3STUA 5T4FA 2XDWA 3C6BA 2VAVA 2W6CX 1QTRA 4E14A 5JATA 4LYEA 3IA2A 4X90A 4F21A 1Q0RA 1XRNA 2K2QB 1YS1X 2J3DA 2GZRA 4DNPA 2WQZA 5AJHA 1UK9A 3STXA 3FYUC 3M81A 2OXEA 4PSUA 1THTA 3DOIA 5ALFA 2WIDA 2PBLA 4LHEA 5JD4A 3PF9A 1BS9A 1USWA 4DMCA 1L7AA 1DT3A 2ES4A 2O2GA 3QMWA 3W06A 2XMBA 1AZWA 1CUWA 4M0MA 3HSSA 3R41A 4Y7DA 4PNZA 4UHDA 1CRLA 5FKJA 2WG1A 4EY6A 5JAOA 4A23A 1WHTA 3S8YA 4KRYA 4CIBA 1UK7A 1CUYA 1CUZA 1LPSA 3L1HA 3T4UA 1BCSA 5AK4A 1ZI6A 3R40A 4KE9A 4G5XA 4UBJA 1JMYA 2XE4A 2Z8XA 4MYDA 1IUOA 1VXOA 2QXUA 1XQYA 1TCBA 3OURA 5JANA 1XZMA 2ZSHA 4KAFA 4Y2YA 4J0KA 3D4LA 4DTCA 2Z8ZA 2Y1KA 1VA4A 5JD6A 1ZGCA 2H9YA 1WM1A 1YAHA 5BOVA 4TPKA 3SWWA 1K6EA 1ORVA 1RP1A 3WKCA 4N8EA 2BGNA 4BZZA 2PSHA 4ZV7A 1IUPA 2HU5A 4ITVA 2WHPB 5EHXA 1UKBA 1W75A 3AIOA 3G0BA 5KREA 1SCKA 5FPQA 1SC9A 2VJAA 4G4GA 4FLMA 2WILA 1BN6A 2WU3A 3VJKA 3QM1A 3G7NA 1MU0A 4D9JA 4ROTA 4F0JA 4J0HA 4C01A 4BAGA 1W4LA 2O2HA 3QBJA 2WFZA 4Y2XA 2RHTA 4B81A 3O4HA 5IVDA 1TRHA 3OOSA 4FFWA 3G02A 3STVA 1ODCA 5AO9A 1E8MA 4EZIA 1DWOA 4EBBA 3NGMA 2CBGA 2WJ4A 2ACKA 4X94A 3BXPA 3NOXA 2OCIA 3KOOA 2ZJFA 3FSGA 5DYWA 3N0TA 1LZKA 4Y2UA 1W1IA 1JJIA 4H7JA 3B3QA 4QDXA 4BC1A 2Z5GA 5CH3A 1YAJA 3FOBA 2GZSA 4F5ZA 3TGLA 1QIFA 3D5EA 4FOLA 1C4XA 2QMQA 1A88A 4K5QA 1IMJA 3WK6A 4B0OA 2G63A 5DNVA 5JAUA 2VQ6A 4Q05A 3GFFA 3IB3A 1JJFA 3VJLA 3HJUA 2Y2VA 3VVLA 3C45A 5E4JA 1L7QA 4B80A 3GUUA 4QLAA 4DSZA 2QS9A 2W22A 4IH4A 3I6MA 5HK9A 3R3WA 1B6GA 4ZWNA 3LP5A 3DYVA 2HM7A 3HZOA 1BE0A 5ALOA 5FUMA 4J7AA 3BF8A 3PDCA 3FVRA 5D3KA 3WZLA 2WJ3A 1DX4A 2AJLI 5HKAA 1VE7A 5AK5A 3DCNA 4JUIA 2JIDA 4ZV9A 5DLPA 5CXXA 1LBTA 3WK5A 2ZSIA 4Z49A 1QE3A 1CUAA 3BDIA 1XZCA 3FNBA 4FNMA 1FFEA 4UBOA 2DSNA 3C6XA 3EIOA 4P93A 4JYMA 4J3JA 2HA3A 1R88A 4AQDA 1CUBA 4UHBA 5IVHA 3WA6A 1L7RA 3AFIA 2HFJA 4AO8A 1YSCA 5EHNA 4AO6A 5FOQA 1WCYA 3FVTA 4KR0A 1UFOA 4GLBA 3WLAA 3GROA 3WL6A 3DLTA 4MWTA 1PFQA 3G9XA 2XMZA 3BWXA 2WSLA 2GBGA 1MNQA 2WHQA 2HA6A 5FDFA 5FP0A 4Y2RA 3S2ZA 3QPDA 1DQZA 4X95A 5D7BA 2XQKA 3PICA 1ISPA 1UZAA 2H7YA 5CBKA 4G9GA 4BP8A 5A7FA 4B6GA 3DQZA 3RK4A 4DM7A 4X6UA 2C4HA 3WKBA 1EA5A 2P8SA 1GXSA 3DYIA 2OQIA 5CT9A 1EVQA 2ZJ7A 2QKYA 1PV1A 4BAZA 3GELA 1QGED 3WQHA 1R1DA 3HYSA 5ALLA 2PSEA 3C6YA 5AK6A 5HF6A 2GBIA 4TVKA 1EDEA 4WFJA 1Y7HA 3IIIA 1U2EA 3OC0A 1QJ4A 4KE7A 4UUQA 1ORWA 3YASA 1CUDA 2JGKA 1QZ3A 5I7UA 5ALYA 4UFPA 5J3JA 1P0IA 2QOEA 3Q0TA 1ZOIA 4FHZA 4GI1A 1P0QA 2VATA 3IDAA 1EHYA 4B84A 3I2JA 3OTQA 3ESAA 2QT9A 4L9AA 4H18A 4KE8A 2XQJA 3ED1A 2H7CA 4FTWA 3FLEA 4KJXA
chains in the Genus database with same CATH superfamily
4L5BA 3JATA 4M88A 1NVMB 4A36A 3LBHA 3LPDA 1MXFA 1XQWA 3MS7A 5KNDH 4TX1A 3I72A 1NN3A 3OX3A 2J07A 1DRKA 4EG7A 2JFGA 1Z62A 3AUXA 3E9MA 4EYEA 3T6KA 3N2NA 3AK4A 2B4QA 4NYIR 1FJXA 4LOJA 2E7ZA 2HFKA 2IZ0A 4ZO9A 5AJYA 4EATA 4LYAA 3E3AA 3BC1A 3JARB 1SU4A 3C7TA 4ZQFA 3ZI4A 5E8JA 4X6YA 1A2OA 4IMIB 4AQ7A 2NTNA 3I52A 5IRCD 2LPMA 3PPIA 2MTBA 3WFIA 1C4WA 2VTBB 2OILA 5BWLA 3MXOA 3SVLA 2WICA 1HDXA 3EF3A 3F7TA 5KVSA 1S3SA 4NLLA 3FTNA 4DLBA 1K06A 3SEFA 4XDYA 3P9SA 2AJDA 2ZSKA 3G5AA 4B79A 2P2YA 3KKOA 3A6JA 1KHTA 4ZALA 1ADFA 1VPLA 3PLNA 1ZC4A 3PT9A 3R76A 3U0BA 4Q82A 2P2LA 3PWTA 4I50B 4ZVRA 2FWMX 3QPAA 1OXUA 4OSPA 4UBIA 3O7MA 2C5BA 1Q7GA 1L7PA 3FDXA 4PC7A 5BQPA 4EFMA 5BSWA 4EI9A 1A9TA 4J9UE 1KQPA 3E1GA 3KJHA 3DVSX 4TOIA 3R6LA 1EVZA 4AKEA 3F97A 2II6A 2NU6A 5IFLA 4L95C 2ZRGA 1XRMA 4G4IA 4HAYA 4OGWA 3T4PA 2YFKA 1SC4A 3P9YA 3F4LA 1QUEA 2C97A 1NQTA 3NBYC 2OBFA 5B3LA 3BTOA 3L0YA 2DQZA 4OXKA 1Q0ZA 4MRMA 2MCFA 1NAIA 2GF9A 1IWPB 3BX1A 3HCNA 1Z07A 3HUDA 4ACAA 4H6WA 1P7WA 3V9AA 4WLNA 2Q3MA 5EP4A 2XE7A 5TF0A 1LV7A 4R9RA 4Y2QA 4DSAA 1OX4A 3QXGA 3H9EO 3NTUA 1GPUA 4OAQA 1DELA 1BHQ1 5FBWB 1RWPA 2QTLA 3CRW1 4WVLA 1FSPA 2PGLA 3FKQA 3TR0A 2R44A 3CN7A 3F1LA 4A26A 1N6PA 5H8WA 1L8OA 3O8OA 5JCOC 5E9QA 4E5NA 3ZV4A 4BGDA 1H5QA 4CMEA 5MFZA 4O4HF 4FUTA 3HDTA 1Y9JA 3TLGA 2W6MA 1CUIA 4L9RA 3WDSA 2GDZA 3IAUA 4UOQA 1T35A 2WOJA 1CVRA 1V8FA 4QQNA 5DSZA 3R5KA 1Z0DA 2RHHA 4UDYX 3LWZA 3QELB 5BSRA 5CDSA 2AEFA 2XMSA 3SYTA 1H8ED 3L1VA 5FULA 1LCIA 4B7AA 1IQPA 2P77A 3IEVA 4HZUB 1K4KA 2W2MA 1KORA 1U04A 4J16C 4ABYA 2PN1A 1FP7A 4I1YA 1AKWA 1MA0A 4PG6A 1QP8A 2C9BA 5CHEA 3D0OA 4DCVA 3QVSA 5J2UF 1XFAA 1UXOA 1KYXA 3GMDA 2HMVA 1QH1B 1GTZA 4L0CA 1J6UA 3A9RA 1PUIA 1U9IC 3WWPA 5LMUB 1B0PA 3B3GA 1JQAA 2ZIXB 1XDDA 5JH7F 2XITA 1E2PA 2WD9A 3GVPA 1J5PA 2Y4OA 3KM0A 3V5NA 1VE9A 1DRVA 5TY0A 3WLKX 2YBEA 4UATA 4MAAA 5HEKA 4BVBA 1SKUA 2BF7A 3DXFA 4HRXA 3DZGA 5B3KA 1VLJA 2QL6A 2ZB8A 3T7SA 3UICA 3RE1A 3TMKA 3GH1A 3TOVA 3K0HA 5CTAA 2G9QA 4XRRA 4LDQA 5AP9A 3JATB 5IAEA 4EZBA 5CCXA 2QTBA 4QFDA 4JS0A 4MMZB 4L07A 4QQFA 1LW7A 3DOUA 4RWEA 1A8QA 3BMNA 1Y5NA 2IWHA 3EDCA 3F67A 4JJKA 5CGQB 5AKIA 5LA6B 4D4JA 1SM4A 1JFLA 1KGSA 4IILA 5K3BA 3QWAA 5JFGA 1E3EA 1G6OA 2OBBA 3ILVA 2F8SA 3M6VA 2K7ZA 3L7MA 3LY5A 3DKVA 1VHLA 1B73A 4G1VA 1TFRA 2ZB2A 1E1LA 5IF9A 8AT1A 1POXA 3BA1A 1CVLA 2PQ2A 2C1ZA 4BRSA 3PG5A 4KDCA 3VSBA 1IN6A 4BIMA 1FP4A 1RZVA 3VZQA 4R7GA 2QT0A 4PR0A 2WJPA 4PNHA 2AF3C 3JD4A 4ALLA 2DKFA 3K53A 4DZZA 3WX0A 2L69A 1FFXA 2R6JA 3BF7A 3HWSA 1VL5A 4KKXB 4RKYA 4RD3A 5K6AA 3IQWA 3N0VA 1FE8A 1XZFA 2FUKA 2FW8A 3AF1A 3VR3D 3R23A 4E08A 4O6VA 3BA6A 3UWOA 1U1GA 4BB5A 4Q7KA 1XZKA 2FOLA 2I65A 2NU6B 1G19A 3C87A 5BWOA 5HJEA 1X13A 1NLUA 2XLBA 3ABOB 2GZHA 4RPHA 4ZRDA 5EI5A 5IYZF 4G4JA 3AIMA 2DUNA 1U7UA 5T6MA 1WVMA 3RS2A 2O57A 1Z12A 2J5BA 2Q4BA 3A1DA 2ZTSA 1OCEA 1TIPA 1Y82A 2QX7A 4MRMB 3EOZA 2OWEA 2Y1FA 3OO0A 1ZNZA 1VE3A 1OI3A 2J9RA 4JT9A 3W4IA 3C43A 2BELA 1YWGO 3V4OA 5BRJA 4QYMA 3EAFA 1DLIA 1DAOA 4DR7B 2MJLA 5IC4A 3RFCA 4TWAA 1OX4B 2CFSA 4HUQA 4X9XA 5T3YA 1GDTA 5EIXA 3Q7SA 3VBCA 2OCDA 1VG1A 1L5HA 5B1EA 4LQLA 3PJRA 1RPTA 3BK2A 1C3JA 1HDIA 3AY6A 2Y27A 3RIXA 3I05A 3CLKA 4P0PB 2C2ZA 3NC0C 2XKKA 2QORA 3EW9A 3B8EA 3O8OB 3PCRB 4DG5A 3GGJA 3VHQA 1MQ8B 2OHVA 1W0KA 5CTJA 1EDDA 1WPRA 3TLGB 4JK3A 1AHHA 1U81A 2IPAB 3UJ3X 2XY4A 1F14A 2JJ1D 1W6UA 5B2ZA 2VYND 2VSYA 1E79A 1Z8DA 1M72A 2J3JA 2I6GA 3QNMA 4QYSA 4WPGA 3OF5A 2LD4A 5FPTA 5LJLA 3LTNC 4Q03A 1I7SB 4YUWA 1P17A 5F7XA 3OQ6A 5TDHA 4ATNA 1C3XA 1P1RA 5FI3A 2I99A 2Y1GA 2XHEA 3F3KA 3IBTA 2A35A 1X1SA 5BNWA 1W9MA 2OA0A 5UKDA 5EJ2A 1D1SA 2WV9A 3BFKA 1C8VB 4RM2A 2QXTA 1OTXA 3LXXA 2R6R1 1MAUA 1LF5A 2ZJ8A 1AGNA 2LGJA 2ZBFA 3T5TA 2FPXA 4BO5A 1MKYA 1ORRA 1ZOOA 1P2VA 1RI2A 1RLIA 2X6RA 2Y1LA 4I1SA 3UQYS 3SC2A 3QFRA 3WNZA 2QI9C 4OLAA 3DG9A 3WBJA 3IC5A 3MINA 1A1VA 2ZWAA 4OREX 4N0PA 1MOSA 3DMNA 3IA7A 2F3RA 1UAGA 2XQGA 5DKFA 1RTTA 3TNJA 2BMVA 5D2CA 4ZDKA 3N2GA 6ADHA 3WIVA 1DAPA 3C8DA 2OR3A 1P2DA 1VL1A 2QT1A 4O4IF 5F33A 3KAJA 1M2WA 4IICA 3FSEA 3VO9A 4ANFA 1H9BA 1I4LD 4AJHA 2PV7A 3BMNB 1X70A 2HU7A 4JEIA 1E7SA 4XARA 4QGBA 4CL8A 4MVJG 1P8AA 2DFNA 5HZHA 3T7KA 4IOMA 3D3EA 4NHOA 4XCQA 3LL7A 2JATA 1XVVA 4B82A 4BEJA 4NJMA 4C1BA 1JIVA 3AGPA 2JD2A 4FIDA 4GICA 2LW7A 5DGIA 4C0BA 4TGLA 3UWKA 5KNCD 2GYVA 3IT3A 1AS3A 3DHEA 3ZQKA 2ZRAA 1HZZC 4GSKA 3I6QA 5CDUA 4FJ1A 1NSTA 3CWZA 4MDFA 1YCDA 3HJGA 1E3DA 1EXNA 2FSSA 1FP4B 1XRPA 2MSNA 1QGDA 4NPAA 5DPMA 4HYTA 1SCAA 4C6SA 5SZJA 1I0ZA 2O6LA 2G76A 1RHRA 1YONA 2B8JA 4UBMA 4JYAB 2IK8A 2ETVA 2QVBA 3ZW8A 4XWYA 1ISMA 2PIAA 3QTBA 2V0CA 1AGRA 4D96A 4KFUA 5IJAA 1IEQA 2HSGA 1VHJA 4K8OA 2BC9A 5C5EA 2RK6A 4YMWA 2DX7A 2IV2X 3KVYA 1WPQA 3CU5A 3QX3A 1N92A 1HEIA 4WJLA 1TQ8A 2PL9A 4GMXA 1ODIA 3B1YA 2F9MA 4FNOA 4KZKA 4U7TB 5HF9A 1IDN1 2IYFA 4EBFA 3NBKA 2ISCA 3Q2KA 3QRWA 5ENVA 1P1KA 2HWKA 2EXXA 1JP7A 2QIOA 3LF1A 1GLVA 4EY6A 2UYYA 5AVSA 1BAPA 1E92A 2EHDA 2WM2A 3OZ7A 3TLCA 4HXEB 4RORA 2VQSA 3FPKA 2XGOA 3Q1KA 5JJBA 4QRIA 4RZXA 1ULSA 1GL6A 3MHPA 5AH0A 1EKXA 1NX9A 4BV9A 4K81B 1A82A 2QUKA 1ESNA 4HUQB 2XWPA 1UC4B 3I2YX 1RWWA 1QYRA 1V48A 1L5HB 3IO3A 1E0AA 2G1UA 3E84A 1RZ3A 4WHMA 3D1JA 4IIYA 5EPOA 4CI0B 5IU6A 1AMOA 4G0XA 1T3HA 2P78A 2AC7A 3U17A 3FG9A 2YOGA 4J1NA 2QRQA 2BI4A 3F71A 1W5TA 1JFSA 2QD1A 5TE9A 5JZ9A 1PNRA 4DARA 4DMRA 1PO7A 3R5FA 1N5JA 2QD3A 3HN7A 1I2CA 3P9XA 5C3MA 3KSUA 4XR4A 1NE7A 1IB0A 1L2TA 1OXBB 5JMWA 3KL4A 2QLJA 2WB2A 1HFJA 3AX6A 4LWQA 2WWVD 4KI7A 5CYPA 5CX1A 1N8NA 3OZWA 2D7DA 4PNEA 3ZW7A 3T41A 3K32A 4JWTA 1P19A 4FNGA 1RWMA 1C0IA 1FL9A 1FUUA 1MRNA 1U8CB 2V4UA 4JXJA 4AY5A 2R47A 2GPJA 1YASA 4DW8A 1TU0A 2IYAA 5CLJA 5BN4A 2EV9A 2DUWA 2FN3A 3KFXA 2P65A 3I1JA 5K6RA 5T4EA 3IT0A 3X2EA 2XDYA 1K2VN 3E3MA 3ASUA 2ZB4A 2J3QA 3KLNA 4C1NA 4EQ6A 1GJRA 1X8XA 3ISTA 4R5MA 4X3OA 5DU2A 1EINA 3T35A 3K4PA 3G0IA 3PUIA 1HK7A 1M6YA 2OESA 3C3KA 3PXCX 4K0KB 4PRLA 2TS1A 2PRZA 2VEDA 1ZFNA 2PD3A 3AONB 2Z5LA 1Y8AA 3DLPX 3N2GB 4I9FA 2R8XA 4E15A 3FYDA 3HB7A 2HA5A 3I30X 2ZTUA 3KKEA 5CIWA 1T5OA 2HDHA 3CW2A 4H59A 3RU7A 2PO5A 5L6LB 3LK7A 2R9VA 3L0CA 1ZCAA 3DV9A 4KMOA 3DL0A 4PTZA 3GPCA 2FDCA 4L22A 1VLLA 3QKTA 1E61A 4MGYR 5FTKA 2MYPA 3S2UA 2VSNA 1CG6A 1KYWA 4BKRA 3CPEA 4YMHA 1W47A 4IDNA 4NJMB 3LRPA 5CDFE 4MR7A 3D7SA 1NP7A 3MQFA 4RANA 4UUPA 4RSMA 2CEAA 4AG6A 1OX6A 2P0AA 2ZIUB 4QM7A 3NFRA 4OQZA 2JFQA 1FFSA 2V0GA 5IXYA 2JH9A 2NU7A 2VNHA 3IXMA 2OVBA 1R16A 4BP3A 1UBFA 3CNOA 4URVR 4AN0A 5ILGA 4BKMA 4FOPA 2QUZA 4J1TA 5M34A 4W82A 2B61A 4G0ZA 3VNSA 5TMPA 2XYHA 3OCJA 2P3QA 4ZGGA 5CLQA 4BLRA 1RXCA 2CKDA 4B5KA 5C1PA 3OWHA 5A62A 2XNCA 1TI7A 3FB4A 2O7RA 2QROA 3PQDA 5DGTA 3ZE2B 5E0OA 4HYEA 3T7EA 3AF3A 3G79A 4IKEA 1TK2A 3EVGA 4BFVA 1VSQA 2ORYA 2WT9A 5JZSA 1QFSA 3L41A 2PE5A 1JA1A 1KMHB 2WMNB 2AOVA 1P4RA 2JD0A 2XOEA 3U9SA 1TW2A 2D5BA 3WYDA 5IX8A 3SZRA 1U63A 4XLTA 3ZQJA 2A3RA 4AI6A 1UXHA 4EYKA 1OLSA 3AR7A 2Z8YA 1KDZA 5MHTA 3HC7A 3K0AA 3R0ZA 4PO1A 1MO6A 1I7DA 3CT4A 1KYYA 3Q41A 3PNKA 1DAFA 2OAQ1 4X6XA 5BUQA 2W4MA 2J46A 4C2BA 1N78A 4OK3A 1DQSA 5CVDA 1U7WA 3RTCA 1MTZA 2QQFA 2Q50A 1EEHA 2K6GA 3C4VA 1XN1A 3SX0A 4F3RA 5ESXA 2AX3A 2X8AA 1RWQA 2RI6A 2BEWA 4BFLA 4H1VA 4TKMA 2GAJA 4Q7LA 1XTIA 2R6CA 1SOWA 1NIJA 2IPNA 3ZZUA 1QMPA 2YICA 4QUBA 3WB2A 4MHOA 3ANSA 1SWVA 1Z2OX 2NX2A 2V9PA 3IBYA 2R8ZA 1U3UA 3EQ2A 3OSUA 3Q2IA 3RTBA 1R5OA 4Y2TA 3E23A 1NM5A 3DBRA 4QSMA 1PJTA 5FB3A 1DBQA 1G9SA 4EI8A 3GAAA 2AWNA 5G0VA 2C54A 3FOEC 3LWNA 3QG5A 3FMFA 1W76A 1WMFA 2EGHA 2NG1A 1SKMA 2PUWA 2I9PA 4BDSA 2GVNA 4WBNF 4O4IA 1VP3A 4L6IA 1U0LA 3CLVA 2V03A 3TNDA 4QG7A 2ZYSA 3BCHA 4UFOA 1T6ZA 4TL8A 2BGGA 5CX1B 2AUNA 2OZLB 2P9QA 1RLMA 3HNOA 3L7AA 4PQFA 3TSWA 1OUMA 1QYDA 3HA5A 2FFJA 3EULA 4QXQA 3RREA 4CFYA 1GZDA 5IUKC 5INTA 3M34A 2ETXA 2Q45A 2WTAA 2ZATA 4LE1A 3LT4A 4GU5A 4YQZA 4CMCA 3RU2A 5BN4B 3U80A 2BMWA 2E55A 4BUZA 4M89A 4OD0A 4JZYA 2NP6A 4W5OA 3GGCA 4GP9A 4MK4A 1H2ZA 5JCPA 5LVAA 3RF7A 4ZRMA 1WJGA 3LT0A 1JWAB 1XEWX 4O4LA 1T15A 2MIIA 1A72A 2EL7A 2BF4A 2GO1A 3PRHA 1G4AE 4MAFA 4JI0B 2A88A 4UC0A 3M9WA 1GFSA 3RU3A 4YONB 2JFFA 4CM9A 1MG0A 4OBEA 1QNLA 1O2DA 2E4XA 1HNNA 1NZFA 1X42A 3HJBA 4DHEA 4ERNA 1NUSA 1UBRS 3EGWA 3PUHA 3TJRA 1L8QA 3I4LA 4MICA 2NM0A 5A0VA 4NE7A 1JSZA 3A6EA 4EKGA 4O1IA 3CS3A 3LA6A 2PKQO 2YKGA 5C7LO 4D8UA 1A9QA 4Y1EA 2M6RA 1ODJA 3NB0A 4XI9A 4JJ8A 4KSCA 3GMIA 4N0QA 3ZHSA 4DRYA 3L4KA 4H27A 3NATA 2OFFA 3ZE8A 1J2TA 3FZEA 5TQJA 4UTVA 3W1WA 3I34X 1QTQA 1JNYA 2KPOA 4XR9A 2NU7B 3I0ZA 4FQ7A 2IE8A 2IW1A 4BZWA 4DQLA 4JQYA 3CGWA 2FZVA 2HDNB 5HIIA 3CR3C 4FKMA 1B43A 1U9CA 2O05A 4V38A 1FK8A 2TECE 3MZ0A 3FPGA 3E53A 5D3ZA 5E7MA 4YQEA 4M0LA 1OH7A 4EYOA 3QVGA 3KK0A 3D6VA 4JLKA 3CVOA 4WW0A 3OZAA 2V1UA 4YLYA 4D0SA 2HA0A 4WKPA 1E0KA 1F48A 1WZNA 3MTQA 2XODA 4M1ZA 3M3PA 3W7BA 1WF6A 1Z2AA 3KPYA 2O2CA 3BL5A 2HQ1A 3AW9A 3I37X 3NFYA 4RFVA 4MR8A 1KMIY 3MUFA 1KS2A 3L6BA 3L1IA 5K2OA 3HTXA 1HETA 1JQLB 1YZLA 2MDTA 2WWXA 1OZGA 1U28C 3E6AA 4Q19A 3DOFA 2X23A 3HDHA 4TRMA 2EYQA 3TW8A 4Z1MD 2IY8A 2FDXA 2PS0A 1OLSB 2X5NA 1BG6A 5KTSA 2H4HA 4RD6A 5KQPA 4RVNA 3GP8A 4W7SA 1KARA 3K0AB 5A4MS 1HQYE 3JXEA 3WGYA 1AJEA 1J9GA 2FN4A 1CUCA 2RI0A 3M9XA 2O50A 1VP9A 1W30A 4F6CA 5CDTA 1PGOA 5LXTF 4RTJA 2WJHA 1KZ7B 4R51A 1H8HA 1JDNA 2BFAA 1V43A 1XNJA 2QEQA 2YUTA 3EIHA 4Y6OA 1H0SA 2FK8A 3T7RA 3P2KA 5CB4F 3AHCA 1BWSA 1QANA 1K3TA 2REQA 1Y6JA 2ZT5A 4G89A 1YQXA 4JGGA 2QPLA 5F7ZA 3A70A 3T5CA 3SYNA 3W5AA 4A8JA 4KMMA 3L7CA 2O5VA 2G07A 2JA2A 1NQWA 3PT5A 4CIDA 2ZIEA 4P08A 3X0DA 2IL1A 2Z8YM 6Q21A 4TM8A 1ECPA 4YXWD 1JPNA 1LEHA 3AJ9A 4U6QA 1TAUA 3AUJB 1RQRA 2B4YA 3MTGA 1XTBA 3MWFA 1V6CA 5K8JB 1CY0A 2YZKA 4P4GA 4LXYA 3H6HA 1H2RS 3JQBC 4S0XA 4B3JA 4JLWA 3OJCA 3ZPXA 5TIIA 1OGJA 3QE0A 3F5DA 2AD1A 1Z0KA 2PNJA 1E66A 2QY6A 2I2CA 4PBTA 3GRUA 4FYWA 1FFGA 2CVQA 4ZO8A 3NXKA 3GLVA 4BE7B 1RBQA 1HDRA 3NTOA 2B35A 1SQ5A 2F3SA 3BFVA 4U4AA 2CNNA 4PGGA 2NN3C 1Q1NA 4UMFA 1LZLA 3ULKA 4I4CA 1V37A 4BGVA 4C4PA 2JCVA 1TYCA 5H16A 4DFDA 1NC3A 3E9NA 5KTMA 3CN9A 4DWOA 3BK7A 3WOVA 4ZV4A 2ZYTX 1C3OA 3O1HB 2GEKA 1SIOA 5AOCA 2QVXX 1GCUA 3EDMA 1T2CA 4J3FA 3ZQ4A 3LECA 3BWDD 3D0KA 3MTAA 3PC7A 1LLUA 3EEOA 3WVNA 3AM4A 3PC6A 5TV2A 5AW2A 1E1MA 2AZDA 5JQGF 1G8HA 3TFOA 3PZBA 1E62A 1WXWA 1G8JA 3V4PB 4BB6A 5TS2A 1N2CA 4O4LB 2WT4A 2B37A 3AOEC 4MRRA 4UE3S 5HXAA 1W7AA 2VJMA 4RDIA 3RVNA 5ALSA 4RZUA 5BPFA 2SKEA 1IK4A 3IOBA 4KHZA 1CUSA 5EJ8A 1I30A 4WLFA 3T5DA 2E6UX 3ZDZB 1YQ9A 5BYBA 1R15A 1JKFA 4U7JA 2FJ0A 1W8DA 3OCXA 1E1YA 1OF1A 6NULA 1X3SA 3EXG2 3INNA 3L3BA 2FSIA 2PXXA 2XYQA 4LOKA 4MYUA 1ULTA 4RQUA 5EFZA 4NCAA 1JJVA 3OY7A 4OHXA 1EZ1A 2H2GA 4NBLA 5AVWA 1OXKB 3OUUA 4MWZA 5K9ZA 1FNDA 1T5SA 4JQOA 4EY7A 4YWJA 4BPRA 3AT1A 3VI3B 1GKKA 1N7IA 3DXYA 3QLVC 5IN5A 3OF2A 4E4TA 2Q21A 1OAAA 2HUNA 2Q5CA 3QVOA 1A7UA 3UB3A 4BQEA 3HV2A 3OLCX 2P1RA 4X66B 3OPQA 1QAMA 5CVUA 5EGSA 3QX7A 3HY3A 2R8PA 1B93A 2QJWA 3CF2A 1EFCA 2GD0A 3T15A 3PDIA 3QVGB 1R0SA 3JQFA 3ZWMA 4ZYLA 1XTSA 3B12A 4R4JA 2YWHA 5C81A 3OE5A 1QG0A 4GI3A 2PPLA 2V54A 3UK1A 3LUPA 4B6SA 2YMMA 5K0EA 1MHTA 1DTWA 2QYOA 4XUEA 1LS6A 3HCDA 5FT9A 4BNFA 4BZPA 1IY1A 4ND8A 1EIZA 2HY7A 3RDPA 3VNVA 2YXNA 3JSXA 2PTHA 3N8NA 3USZA 3BGDA 3KOYA 4BMXA 3A1VA 1PVOA 4YJFA 1U0SY 2OFXA 1K7XB 1XNGA 1QFZA 3TZEA 1AQYA 4RU1A 2PMKA 5HPYB 3AOGA 3M1YA 1PK8A 4KLAA 1EFKA 3RLIA 3SY8A 3DKRA 5AKKA 3ILHA 1IZZA 3S2SA 1M34A 2Q3LA 4B45A 4CLOA 3GJ3A 1E3WA 4KN6A 4KX5A 5IZ4A 1XD9A 1XMIA 2DRIA 2GS9A 1XC7A 4RM3A 4EARA 3G5TA 3M6AA 4YRTA 1O94C 2FE4A 3AJAA 1E1NA 3E5HA 3FMGA 5ALWA 1F1BA 1O4WA 5HKKA 4UEJA 1ABBA 3RADC 5ECDA 3JASA 3LUDA 3AR2A 4RHYA 2QQ0A 2V5VA 3HBAA 5JHHB 1A8IA 2PJZA 4A8JB 1ML4A 5C4MA 1XTKA 3T3IA 3QP9A 3H87A 1HF3A 3KT6A 4OHVA 3FLBA 1QIDA 2H1LA 2PXAA 2JAPA 1UC8A 2I6XA 3WL4A 3FOCA 1MAAA 4XD2A 4CIYA 1FVHA 3CO5A 3NORA 1V6SA 1VIDA 2AB0A 3N8KA 2OB1A 4LAFA 5IKXA 2GLXA 4LSGA 4TLMB 1Y1SA 1RADA 2VXBA 2OC9A 1UEJA 3PFCA 4Q9HA 2V7XA 3IVMA 4HN4B 4QX6A 3TSOA 2XUPA 2IDMA 4FU0A 5SYNA 3TQIA 2PVSA 2FMHA 4D8TA 3SAJA 5CPBA 1E4YA 1JE0A 2RAUA 3R6WA 4RHXA 2XWQA 4HRVA 1SVWA 4P84A 2JJMA 1KZ1A 2QMEA 5JWHA 3SZLA 5A1TA 4LSMA 4EVQA 1C3OB 1TIKA 1OAOC 3O95A 1MENA 2XUHA 2GTHA 3NEJA 3ZWOA 4E3ZA 4A8PA 1STOA 2IYPA 1OZFA 3DE0X 5TARA 4OO3A 3HXKA 3WJ1A 4ZJYA 4AC9A 3U4QA 1XEFA 5HE8A 4QC2A 2V6IA 2WTNA 2XCLA 4EJMA 2O0HA 1KSJA 3T3PB 1N2CB 1QQTA 2C3OA 4KGVA 1E6KA 4F4DA 5ARBA 4RTPA 4OUKX 1UBSB 1CQJB 2VJMB 3DKIA 5FBVB 2DUMA 5AKHA 5F9MA 1VRVA 2X77A 1X1TA 4GT1A 1KI1A 3GMTA 3PDHA 2RE8A 4WLEA 3QHQA 3PITA 4WZAA 1D0VA 3AI2A 3NHWA 3OCVA 5KCMA 4KITB 4ZU3A 5C37A 4G5FA 2QX6A 1QPZA 3TM5A 5C80A 3SDSA 3GEIA 5EKSA 4X5OA 2Q2OA 1VHTA 4CJXA 4EYGA 3H5AA 3G2LA 1WSWA 2IOQA 3OOJA 4HS4A 4X8OA 5BV2P 3IAM6 1NTRA 2ZUSA 1O95D 4DSUA 2YY7A 4AMVA 1MEJA 4AMBA 2BZSA 1NF8A 4OI2A 1GA6A 4RXUA 1XCJA 4G67A 5CDHA 3HJNA 3LFTA 1Z4MA 2X0RA 4FWIB 4W5HA 3TL3A 1VBNA 2B7LA 3V4RA 1EFPA 4R05A 4B6QA 2O8FA 2J3LA 4PO8A 4LV8B 3AUAA 4Q9JA 2VWHA 5DLYA 2QR3A 3B7GA 3OQIA 1XYVA 2IUFA 2SBTA 2WABA 3PHIA 5LQCA 3K9GA 1QHIA 2BL4A 4B74A 1L5SA 1Z5ZA 3FD8A 4WXYB 4JUDX 3T3MB 3T0IA 1FX0A 2X4DA 5IKPA 2OD7A 4ZCSA 1N8SA 5KYYB 3GX1A 3HCPA 3N8HA 2PZFA 1DTWB 2H8GA 1Z6QA 3GJYA 1PEKE 1VKRA 3EZNA 1ESDA 3L7BA 5EHQA 3PJEA 3LC0A 4YV7A 5JMOA 2RH4A 3R3SA 1HDGO 5JASA 3LQ4A 4PQYA 4C0JA 2AYZA 3H9UA 2QM8A 2PEYA 4YJFB 1J23A 3BIWA 2IX9A 1E1QD 3SC3A 3A4YA 5ADWA 2PAFA 1JJBA 1YBVA 3HLYA 4HWTA 3WDLA 4YJ2F 2CCKA 5HX7A 6CHYA 3M6WA 4R2WA 5LQSA 1J0XO 1M34B 3QYPA 3CUVA 3O4JA 3GJQA 1WUTA 4IPTA 4MVJF 5AHOA 3QKUA 1E3WB 3DHVA 3RU9A 4AB1A 2PMBA 5E1DA 5JYBA 4ZDJA 2OYSA 4MVXA 3GW8A 3RKUA 3R8XA 3PX7A 1L5FA 4XYLA 1DTSA 3H2YA 4JQSA 2XB9A 3JASB 4P3YA 3ZU6A 1N0HA 4MP3A 3ESXA 1Z29A 3CEJA 5JS6A 3JD2A 4BBPA 2QN6A 5F5LA 3GAZA 4GXQA 3H5WA 3QUCA 2GXQA 4RH3A 4QVKA 2JCSA 3I1YA 3DUFA 4PLHA 2YW9A 5CFRA 1JDBB 4LRYA 3QMVA 1RR6A 1XZLA 4QATA 2Y1XA 1YJ8A 2MSWA 2NTVA 5LUAA 1YQTA 3LG2A 2EIHA 2YIVX 3DKPA 4C05A 4F5WA 3D64A 5TC4A 1A8UA 1GG9A 2QTWB 1ISSA 2WF7A 1F4VA 1NVVQ 4BX3A 4IIVA 5DMHA 4TVSA 1U0OC 4Y9TA 4YAOA 2GYUA 3FYCA 4MTCA 4OJMX 3Q3VA 2J33A 2OAGA 3DFMA 1GL3A 1WDMA 3B2NA 1PQUA 4EB0A 1ZM3A 4KTTE 1SXJA 3W5SA 4BS9A 2CL6X 4NNOA 3A2MA 3CJRA 5EIAA 3WHKA 1HE8B 4FIZA 4IFEA 1ZGZA 3TRKA 4DILA 2JGDB 1N75A 4QOEA 5TX7A 1RRVA 4A5SA 5T4BA 3U4QB 3BS4A 3LKDA 2R8RA 1ZD2P 3CG4A 1VDZA 3EXHC 4N3NA 1E1DA 4B73A 1B4DA 4D46A 3MK31 1V8DA 3DF9A 2P2GA 3Q7QA 5CX4A 2B1JA 4TTVA 2OCXA 3RYTC 2ONZA 2FP3A 4RDHA 4D9KA 3KZCA 1ZMBA 2PMEA 3WHLA 4Z4HA 2QP3A 2E6KA 3NQ41 3OQVA 1Y1QA 2Z6UA 4WZAB 1YS6A 3L0OA 1I7NA 2QUHA 3MRSA 4H7EA 2GPAA 3ORQA 1ZCJA 1ZISA 2V9ZA 4MUHA 4FXOA 4RAOA 4EGCB 1C8LA 1PKXA 2VHWA 4WCVA 3U16A 2HIHA 4HVCA 2PH7A 1UCFA 2AQHA 3ZCSA 4Z4QA 3KL2A 4D9CA 3I2GA 3GWZA 3VXKA 4NMHA 5C8ZA 2ODAA 5KQSA 3RD5A 4YMLA 3C3AA 2NSYA 2VF8A 2FEWB 3M5WA 2VPWA 4FYHA 5IWCA 3CTPA 1D2HA 2I2WA 3KRTA 2XQFA 4IQGA 1ZI8A 3JQDA 1S96A 3KEOA 5BO5A 5AESA 1EFPB 3I5YA 3CJQA 2R1VA 1N6RA 3N53A 3PJFA 3A04A 1NA5A 1U3TA 1DU4A 3EDRA 3OA0A 4PO3X 1F4LA 3OQIB 4B5LA 5BVHB 4OFZA 3MD0A 3FH0A 4BL5A 1Z63A 3WRXC 3Q6MA 4INAA 1FXWF 2MSLA 1FX0B 3E7DA 3ASZA 3KELA 1E98A 2J0SA 1GCAA 3AM5A 3IP9A 5DXAA 2CB0A 3ETJA 3REGA 5CD1A 2PD4A 5I4BA 4Q39A 3EY4A 3D2BA 4EDFA 2B94A 1ARZA 4TMYA 1MORA 2O3JA 1V1RA 3GGPA 4JP3A 4NF2A 1RRGA 4EY8A 3S3TA 2K7FA 3UCEA 3U4MA 1ANKA 1Q1EA 4KHPB 4BMPB 2XB2A 4EMTA 4RXMA 1LJUA 4RO0A 1KRXA 2FMUA 4L50A 1DS6A 4OSEA 1GPYA 3KD3A 3AJ8A 1RNLA 1LDYA 4GKAA 3PTAA 4OB6A 3VISA 3M4NA 2QTCA 3AB7A 4HDMA 2ILVA 2KBFA 3OT5A 2CL0X 1X8LA 5I9BA 3VPAA 1Y34E 4DLNA 2J9YB 3DAFA 2PZMA 5BV0A 1JSXA 4EYSA 2BCJQ 3P20A 4D9NA 1HTBA 3MSXA 1L8XA 4I8XA 1V9CA 4MYRA 1ZK4A 2Y0PA 3KVOA 3V1NA 3TSAA 4H3KB 1G5FA 4B1FA 4II2A 3UJHA 1M0WA 2HMTA 3ICEA 3EHEA 2R66A 7REQB 3DUFB 1KR2A 2R60A 1S3IA 4UNIA 4F72A 3WWDA 1JU3A 2QAGA 1NVTA 5BMVB 1JSCA 5D6OA 4ZD6A 1N5LA 2GRUA 2JW5A 1OXTA 2QLFA 3K09C 1U2GC 2CVZA 2I4TA 2PZKA 4IDDA 3WLSA 2C2BA 2W6NA 3VTZA 2PGOA 1H2YA 5KTNA 3SM3A 3KZXA 4RNDB 3GZJA 2P1ZA 5LYYA 4EI7A 5IS2A 1E9FA 4KR2A 1J25A 1RPAA 2GI4A 2Y8EA 4LTNA 5EE9A 3ZV7A 3A6LA 1C3EA 1NE2A 1OFUA 4OX9Y 1IHOA 4WN9B 2IUTA 1SVUA 2CD7A 3UMGA 3SZOA 3D7KA 2C20A 2FFAA 2C3PA 1LDMA 1G8SA 3GUVA 3JPWA 4AJOA 3FWPA 4K6HA 3JWEA 3K9QO 1FLAA 4D43A 4DANA 3K6SA 4YCDA 4CF4A 5FQNA 3R6TA 3EOAI 5J4HA 2QPOA 2R96A 3LQ1A 4EL5A 4YQFA 1RI4A 3DDSA 2IPMA 2VUHB 5B58T 1BWRA 3T94A 2Q46A 2BFBA 3PA8A 3X1XA 5D8DA 2QLBA 1VLVA 2J5QA 3T3EA 1ZH0A 4Q4JA 1RQGA 1P5RA 1L7EA 3ZDYB 4MEJA 4QA9A 1UFVA 3DJFA 3H83A 2YC4C 4X1IA 4OU5A 2DYKA 4TYQA 5IC6A 3AJEA 3EDQA 4BEWA 4MUNA 2HL6A 2PJRA 3C3XA 1DXYA 2FH5B 2G25A 3ITEA 5KTTA 2D1FA 1XTUA 4HQLA 3B53X 4CTNA 4DSOA 4PQGA 1TJ4A 1ORHA 2W4IA 4BE9A 2A5DA 3JQ8A 5EXXA 1W2WB 2JARA 2ZBEA 4E6EA 1GNTA 1ZUNA 2M1ZA 3AR8A 1IU9A 4RCYA 1CU1A 3OIVA 2E4AA 4MUEA 2PFKA 1B8VA 2XTMA 4EHNA 1M10A 1H1TA 2CMKA 2H3EA 4EHAA 3BXFA 3T5GA 1WUYA 1QP0A 3JWGA 1YDWA 4FYPA 2GAAA 5ARDA 2VBIA 2GN0A 4XGIA 3E7XA 1ZHHA 2BD0A 2KS6A 2PYIA 2WUEA 3G8BA 3UWPA 1E0DA 3D2CA 3V4FA 3S1SA 2XVAA 4NWIA 4UD2A 1M2VA 4UHKA 4YMIA 1L5VA 3WWYA 3ZUGA 1LB1B 1IRXA 4EHFA 1RXSA 3H2IA 3FUTA 4J94A 4EY3A 4TXJA 3PFKA 1R0CA 3GFSA 4OLHA 3NHYA 4XQ9A 4ZVMA 3SBDA 2NSLA 8OHMA 1V1RB 1R8XA 3BJEA 2BSQA 3ILXA 3WRYA 2VJLA 3E58A 2PWBA 4C04A 5HUJA 4WXPA 3Q8XB 4AK9A 4BQOA 2CLLB 4IZOA 2JFOA 3NANA 4HGOA 2GD1O 4Z7JA 2PUAA 1QR2A 5LLSA 5LQNA 4D3FA 1XX6A 3ONVA 1VA5A 2QRVB 1AVTA 3ONWA 4RMIA 4JDPA 3L4BC 2IU6A 4HDMB 2XCRB 3A1TA 5H9VA 3OHMA 3RWOA 2JIZA 4AG5A 2ZTVA 2HLHA 1ABEA 3WBFA 2XVXA 2YDXA 1HKUA 2AE2A 2I78A 3LCVB 1N1DA 3FUUA 2NNLD 4BUCA 1XCLA 3F3SA 4CCSA 1M0EA 2CMGA 5JNWA 3UMJA 1DEAA 4DLTA 3GVXA 4M8NE 4JLVA 4ZQHA 1DDIA 2QAGB 4WDQA 4PSKA 3V3TA 1Y7LA 4NZ9A 3O31A 1W5FA 4CV3A 4Q16A 1SXIA 3V55A 5EJ7A 5FAKA 3D3WA 4X00A 2QI9F 3L6DA 2FFQA 4TN1A 4WIAA 3UTDA 4AQYB 1JN0A 1V16A 4MB0A 2CC2A 1AV7A 2VDMB 1F8UA 4D57A 1QYWA 3O3OB 2FWJA 1CZKA 3KDAA 4WKGA 5AVYA 1Z45A 1J2EA 1PJSA 3K0EA 1UWVA 2DBZA 5FOVA 2CHFA 2UXDB 2Q3DA 4NYJR 2FWPA 3ORSA 1E2EA 1UINA 3E7WA 3H42B 1GA4A 5M29A 5ED0A 3V46A 4Z9AA 3K6SB 3UENA 3ZJ4A 1U0FA 1A5TA 4X7MA 2KI5A 2C95A 2OQVA 3REQA 2R8BA 5JDIC 2IV3A 3ROPA 1EJ0A 3BDVA 2GTPA 2IY7A 2Y66A 4O2AA 1QDEA 3W77A 2XD4A 5F2KA 4QWWA 4AJ1A 2ZZNA 2BFBB 4QQRA 4AY2A 4YAKA 3O8QA 3J81k 1W25A 3D8NA 1FTSA 5K45A 2NMVA 2CXRA 4GG1A 4QZVA 1KQOA 4X7PA 5DM70 2ZG6A 5CBPB 4Q9LA 3L82B 2XMQA 2OHIA 4H6PA 5GONF 1KEUA 4OXNA 4AJLA 4UTPA 3PEYA 5KDLA 4NEHB 2P3OA 4MQBA 3RC8A 2XZTA 4J43A 3RG8A 2AMYA 3OPMA 3MD9A 2VUUA 1E69A 3G2IA 5FIUA 3QU2A 1M1NA 2VI5A 1RXIA 1W0KD 2Q5HA 2C8KA 3IP7A 4JJ6A 1F6WA 2C2XA 3WGIA 2WUWE 2ZI5A 3E61A 3BM5A 2OXFA 4GSYA 1YZVA 4DLAA 1ZUNB 3A3PA 1E79D 2F59A 2N47A 3TF5A 3WGLA 3H5NA 4FEYA 3JZAA 3TRHA 1CX9B 1COWA 1TZMA 4KVAA 1S2IA 9LDTA 3SBEA 3DC7A 4HH0A 2WYUA 2OGSA 4FKZA 4HBGA 4AJ2A 3L1JA 1D6JA 1EE2A 1YBMA 5EE0A 1IVYA 1J56A 2H2WA 2P9TA 4X24A 4TXLA 1B16A 5CM2Z 2JLVA 2R6ZA 3V1LA 4AXBA 1HI9A 3NASA 1M2VB 1JILA 1PJ3A 1O6BA 1S2DA 2BUBA 1V7ZA 1JPUA 1MV8A 1A9RA 2DWPA 2FVYA 2SKCA 1UBMS 4NV3A 3KPWA 1RYMA 2R4TA 1PNQA 4OCZA 4GOMD 4EWLA 5A9RA 4AZ3A 1GGJA 4NEGA 4P80A 3AF4A 4ARAA 5B5SA 5BORA 6REQA 3PSHA 1ZJ5A 2XCIA 2UUAB 4F9EA 1YBAA 3GZNA 1YS4A 2Q6VA 3AZPA 1JDSA 4U2FA 1VG9B 1SQSA 3AEYA 1SAYA 3RM3A 4QG3A 1RI3A 2Y99A 4FEEA 3U6BA 2O1SA 2F2TA 3D7MA 4Y18A 3N1UA 1XRRA 4RELA 4CMIA 5L3VA 3KQKA 2A9VA 1OI7A 2FZKA 1UM9A 2JJ2A 3WJ7A 4L4YA 1RWBA 4LBVA 4W5RA 4RVHA 4ESHA 3WLOA 2BJWA 1T8SA 3ED5A 2DULA 3GHHA 3CLSD 4MI1A 4P6VF 3USCS 2HX1A 3QW2A 1WOMA 4DCUA 2XUKA 3WA7A 1GTVA 5C31A 1HKHA 2PS3A 3OQJA 4UU1A 3C5VA 3T7AA 1PU2A 4WWHA 4URUR 1DGQA 2HRRA 1GU0A 2ZQ5A 2FG7C 3D3WB 4QNNA 3VM6A 2VF7A 5J47A 3SQWA 1QIEA 2VKQA 1UXIA 3IAM1 4CM1A 4FS8A 2P62A 5GZ3A 1ULZA 1P0MA 1JZSA 2BHSA 3BIFA 1CQIA 5B64A 1YU9A 2OG1A 5JCZA 2WF5A 2XGSA 3KV1A 1YDEA 3ETDA 4XJVA 1Z5PA 5ERXA 3ZHBA 2DCUA 1H85A 2J0EA 1PX0A 5CLLA 2I5PO 2EX1A 1DRWA 2JZCA 4G3XA 3V6MA 3IULA 2CMHA 4ME6A 5JJIA 1Y37A 1EVJA 3OLYA 1ADGA 4JYPA 1TMGE 2IZOA 4QM6A 5DX1A 3ETEA 1RWVA 3REQB 2ZUBA 1LI5A 3ZIUA 1Z4NA 4WNYA 3JYOA 4O2AB 3DCIA 1AC5A 1A9SA 1WPGA 3HYTA 2JBWA 3ZC3A 4UNRA 5EUQB 2YRXA 4QPPA 3G82C 2HADA 2B8WA 1UT6A 1Q95A 1MC1A 5KSPA 1R18A 1XLVA 4EF5A 5KJFA 1OREA 3RVKA 3NVDA 2YYSA 2CHGA 4LDRA 3VI4B 3WMEA 4BQFA 3FN4A 2YINC 1OGIA 1U1DA 1WXIA 1ONBA 2WJYA 3FZNA 5IEBA 3EPPA 4XVRA 1HO3A 4DV7B 1CULC 2A67A 4DG9A 5E6SA 2WA1A 1L5GB 3T61A 1E64A 3LPCA 1HH4A 4Z8YA 4DV2B 4HUTA 3LUGA 3TLKA 4FYIA 1OIXA 3QOFA 3DPIA 1M8KA 8ABPA 2UVQA 1N2XA 1M1NB 2LIPA 5HFAA 2AOTA 3UOAB 5B4VA 2HU8A 1GKIA 2A0UA 3A9CA 3KUUA 1T2UA 3WI7A 3TECE 1M2EA 3AIKA 1V41E 2QSUA 2WA2A 3KJXA 2XECA 4LBZA 1WXQA 4U2GA 5CT8A 1JDTA 2QQEA 1FW8A 1G2OA 2C5FA 4IYJA 5H02A 2PLRA 1C9MA 5AI4A 3OZDA 1VTKA 2VCYA 1AHNA 3Q6IA 4J90A 4YNBA 1Q0LA 4INOA 2C4KA 2XA2A 3EGEA 1XXHE 5JI2E 3A4TA 2NSJA 2O7SA 3BD7A 4Q1EA 2Z2IA 1RMTA 3TBFA 1RJEA 9ATCA 2WV7A 4IJUA 4KDRA 1AMUA 2WP0A 5KWIA 3NV9A 1QZZA 1SN7A 4IXNA 3LHIA 1ST3A 3JR3A 6REQB 3Q3EA 2G7MC 4URZR 1F8FA 2H57A 4R2KA 1I1HA 4UZEA 2EJTA 1E99A 4RGQA 2R8YA 3GZNB 4YP0A 1ZC3A 4MKIA 3L7JA 1RRMA 2RHOA 2RGWA 5D5HA 3T5BA 2AG1A 3B7WA 3EDYA 3P9PA 3ZX5A 4BTVA 3CCBA 1FMCA 3VZBA 3VRHA 4Q37A 3EFOA 3FAKA 1KEEA 4RKQA 4CMIB 1QCCA 4E5DA 1VXRA 1JEJA 2B1QA 2ZSJA 4PS0A 1PS0A 5KTKA 3KQHA 1UM9B 2BGWA 5LOVA 2ACWA 3LCMA 1Z2DA 4QFCA 1M5UA 3TE7A 4R2JA 3WG9A 1OFHA 2BKEA 3DZFA 3AC0A 4V24A 3N6RA 1VSTA 2GPTA 2V8BA 4IMRA 2QP9X 3KAQA 4NFSA 3TXXA 3SZMA 1K8RA 1E4OA 3R3HA 2X7JA 1R6VA 5JSQA 4EMBA 3GJ0A 1KZ9A 1L1EA 1Q83A 1A7AA 4FP9A 2OBYA 5JWOA 4EJSC 1D6MA 1T4GA 3N8DA 2WTUA 1YDGA 2EDCA 2IIQA 2WP8J 4A6XA 1HEYA 3KHKA 1JXQA 4N0EA 1NVEA 1G42A 1F6DA 1PZHA 3EQ8A 3QV2A 1RYBA 1FFYA 1NVKA 3LCRA 1XD2A 1I1OA 1DBPA 2V58A 2QJRA 3LQFA 2IXGA 4KQHA 3PUVA 4ALJA 1CQIB 3BPSA 2H2HA 3C7KA 3UXHA 1QQ5A 5JS8A 1IVSA 3EIEA 1J22A 2ZAIA 5JBNA 3JQ9C 5ER9A 1TF7A 5EERA 2NZJA 2X0IA 3HH8A 3CXUA 5H81A 3ROXA 4KSYA 2LE0A 1YK1A 1XVUA 1G291 3OEYA 3OZFA 3BXOA 3K8YA 4PX5A 4DY4A 1IEXA 4GECA 1HLFA 3QTTA 5A4JA 2GB4A 1LUAA 4KO2S 2GZ2A 2NZYA 2R1TA 1REQB 3D0QA 2Z6VA 1DAKA 3LH5A 4LW8A 1SRQA 1U1IA 5HOQA 2F8TA 3EZYA 3FJ1A 4ZT2A 1OI2A 1SBHA 2FEPA 4EW3A 2O8BB 4D4IA 4K9PA 1N6KA 2EQAA 5BPHA 1SEVA 3BWYA 2W2OA 2GXSA 4GSLA 4XX1A 2JAHA 2I4LA 4OP3A 3I2KA 5BSTA 3O8RA 1SXQA 4GXNA 1ZEMA 2D5CA 4GHWA 2P9HA 5JVDA 2WVJA 5CFQA 5LP6F 1CJMA 1MZVA 3SDBA 3WMRA 1YR1A 5CMLA 3D4IA 3H6GA 1CS0A 3F2VA 4ZI3A 1WXHA 2EQBA 1JBEA 2WMYA 2ID9A 4M4SA 3RRFA 2WUDA 4FMCF 3V8MA 4GWLA 1C30A 3VU9A 5DZSA 3NKVA 1OYYA 3KB1A 3ZI0A 3V9PA 3T95A 1XDBA 2WLSA 4G01B 4TSKA 3WKDA 1HNZB 5DJ5A 4TZTA 1YBFA 4YMUA 1IOLA 2GCPA 2VPYA 2AOTB 3E8MA 2OOKA 2QTMA 3NCTA 3KP1A 1EHIA 4NQZA 3ND5A 1VQ1A 2V6FA 4AWBA 4Q3CA 4E22A 4RPKA 3RSOA 4FN5A 3RJMA 2J45A 3S7ZA 3SLRA 4A6EA 2Z2XA 4ZYTA 1EFHA 1MQAA 4Q24A 4MIOA 3A1WA 4IUYA 4U7GA 1NI4B 3E70C 3JR7A 4PU0A 5KAPA 4BNHA 2D0OB 2H2AA 3RYIA 1YFJA 3QHAA 3FGPA 2EVWX 2JFBA 2Y05A 1RCUA 5FUWA 4URXR 3U1BA 1MC4A 1R5NA 2IPOA 3F5FA 3AM3A 4F3TA 2XB8A 3PPYA 3QEJA 2FUG1 4KK4A 4OKSA 4JITA 3RPEA 4DWJA 3UJNA 4RDCA 4R68A 3M6UA 4HNVA 2ZRFA 3HVIA 3EC7A 3DMHA 3RUCA 2C5HA 2ZS9A 1E9CA 1XG5A 2DHEA 2DPYA 1NBMD 1VKHA 4Y9UA 5C5CA 5KPJA 1JR3A 1Z56C 3P2IA 3LSTA 3LVFO 5AM1A 3FI0A 1YZUA 3LOPA 4WXMA 1KAQA 1KJ9A 2REXB 2VXCA 1E2IA 1YUBA 1MO2A 4BNMA 4HH4A 1WULS 1AQ6A 4EY5A 2BHNA 1X7XB 3HCOA 4ZDWA 3OG9A 1GKLA 3RK1A 4C3OB 1HYGA 3EFOB 3ID6C 1F20A 1VZ3A 3ASYA 4QJBA 4WLUA 2P4UA 4C78A 1JLRA 1SU8A 3A6FA 3FYHA 2G0NA 4KGXA 5LOVB 2D6FA 2UVDA 3WGQA 2HCFA 3U56A 3ZDDA 4F4UA 3GFTA 3T5PA 2ZR8A 3ITNA 2HWWA 1Q6ZA 4ZEXA 4ACBA 1T8UA 1JDVA 3A1FA 4WCFB 3VBEA 3IPLA 2A2ZA 3UPDA 3UOWA 5COAA 3HVUA 2GZ3A 2JD1A 5D51S 1JJAA 4MIEA 1XTQA 3FRJA 3O83A 3S7TA 3U4AA 4DC1A 3GEEA 2YTZA 4J29A 1AZLA 2K2WA 1GPLA 2AXNA 4BHTA 1EDZA 1LH0A 2IYZA 4I1VA 1XD2B 3B70A 1YC2A 1GGHA 2NQ2C 4G23A 2FW6A 2PZLA 3C6BA 3WRVA 1XJCA 1FUIA 4PG7A 4TWRA 4BQSA 3KX2A 1X74A 4AMGA 5DNCA 2ZS7A 3RV4A 1W5BA 2BVNA 2J1LA 4KN8A 4XUGB 3H86A 2GWRA 4FNAA 4N9QA 3SR0A 3WADA 1XRNA 4DIKA 4REQB 5KSZA 1EWYA 4AN4A 4HMQA 4NBRA 3TO5A 3GJZA 1NUPA 2CFIA 2R1TB 1OH6A 4L8LA 4DNPA 3K20A 2IBSA 5KOHA 4FGLA 2JFHA 3SJUA 2CJWB 3WP0A 3STXA 3TIVA 1SUPA 4EKNB 2AG8A 4GLOA 3M81A 2WYIA 2EZ4A 3LOUA 4WA7A 1NNI1 2ZJZA 2ZJYA 2HQSA 2PGXA 3DOIA 4BGUA 5EYPA 4KODA 2A5JA 2H85A 4RZQA 4E30A 1B2RA 4BXOB 2PBLA 5HNKA 2H65A 2IZ1A 3K70C 1YI1A 1CFZA 1H8HD 5B55A 1S9HA 3UAYA 1MW8X 5JD4A 1H9CA 1J0EA 2QYTA 2J5XA 1EWTA 3CUSA 4Q18A 2E5FA 1N0UA 1CS0B 3JD0A 3CZAA 5CYOA 4BMYA 5JS1A 1OROA 2JHPA 3W06A 3VU9B 2XMBA 1C30B 2Z83A 3F6RA 3HUFA 2ZRKA 1BIFA 2FKNA 3V2HA 4COKA 1CRLA 1TA4A 2RHLA 1IM2A 1A96A 2I2DA 3L7OA 5I9SA 3UK6A 1ZGGA 5G4KA 4A23A 4AECA 1IAQA 1XCBA 4HGYA 5I5EA 3N9IA 3QE3A 1IK6A 4X1KA 3JWJA 2AI1A 2YRFA 2YS7A 1E9RA 1TM5E 1ZW1A 3ZVRA 3L8ZA 5TB5A 2DU8A 5BQFA 3C98A 1LNQA 1NXSA 3K31A 3RYIB 3R40A 1L4NA 3GT3A 3M0EA 1DKUA 1EE1A 1NJ2A 3EFHA 3LI2A 4G5XA 5FD8A 1MJGM 2QW1A 3S55A 2Z8XA 2DPGA 4GPAA 4JJFA 2IEZA 4DG8A 5JHGB 2HGSA 3HHEA 5KVQA 3L8GA 4AXXA 5AW0A 1VXOA 2I4MA 3DAOA 3EWNA 4LJSA 5FBKA 1JG7A 2WWIA 3B3FA 4CKBB 5H5JA 1O8BA 2E1PA 2RDMA 2ZI6A 4AZTA 1TCBA 3CZ4A 5H70A 2IS4A 2HBQA 4C29A 1X80A 3OZSA 3OZBA 5JANA 5IWAB 2ZUUA 5C52B 3M5PA 1JR4A 2ERYA 2P9EA 1Z9BA 3H9GA 5TT1A 4KV9A 4NS1A 4OQLA 4PN3A 2Y77A 1TM3E 1I01A 1SKYB 2W93A 3GYGA 4FINA 1TTTA 4DTCA 4W9NC 5FTNA 1B8UA 5L7TA 1ZGCA 2CXOA 2H9YA 2RHBA 1Z08A 2V6BA 5BOVA 3R0IA 3V00A 2Y1WA 1KETA 2B4TO 2J09A 2VUSA 1Y3AA 4HLCA 4HNRA 4LE2A 3KQMA 2PK3A 1U6IA 2QRLA 3LLMA 5EG5A 5KKCA 3OEWA 2C96A 3WRWA 3OJ0A 5FEUA 3MS2A 1RP1A 2E0IA 4YJKA 4R8MA 5AVRA 1GWNA 2QQ5A 2FEAA 1FLDA 2BGNA 2RHCA 3OM0A 3PNMA 4B6EA 3L6CA 3RYCA 5AVVA 4AY6A 4RBNA 5SY9A 4IIXA 2HU5A 4LI3X 1UKBA 3TNYA 3GBVA 1T9BA 3GLHE 1CR2A 4CQLA 4GNKA 2ZCVA 5JY6A 2I54A 3IPAA 5D87A 4QKQA 3IMGA 2VDOB 1BKDR 1OBVA 2E2WA 5KREA 1Z37A 4UARA 2VOEA 5FPQA 5LP6A 1SC9A 1J9ZA 1OV4A 1SHKA 2VJAA 4KOAA 4OQXA 5K4HA 1AUQA 3OTIA 3RHTA 2H06A 4ZYYA 1IZ0A 3VR2A 1LC0A 2HF7A 2OYCA 3ZYZA 3EG5A 1GP2A 3HV0A 3G7NA 1MU0A 3G2MA 4RMNA 4WOPA 4RY8A 1WETA 3P2YA 2WPDA 2V6MA 4J0HA 4Y98A 2H4ZA 2FLWA 2PKQP 2X1HA 2HSWA 4BAGA 2DC1A 2A86A 4MIKA 4H7PA 3SPXA 2Z30A 2O2HA 6ABPA 2JL1A 4DXHA 4PLTA 5JPDA 3WYAA 3GA5A 3HDYA 3LRXA 1P18A 2A5YB 3BERA 2JAQA 1RQ7A 5IVDA 1Z88A 2GHIA 3PUYA 4LZLA 1PLLA 5KOHB 2O2EA 2Z3VA 1CY2A 1ZH4A 4LISA 2GSDA 5D3MA 3UWSA 1CEEA 1L5WA 4KVFA 4JI8B 2HBYA 1LTQA 2NYAA 3DFIA 3TLMA 2OUIA 3R4CA 2QE7A 1NOKA 2DPMA 1NXOA 2HNBA 4YQYA 1OFIA 2G36A 2NO1A 1E8MA 1DWOA 3OCYA 2YXEA 3SHTA 1VJCA 3D3KA 4WRRA 3NGMA 5HKKD 4JLDA 2WJ4A 4ZI7F 2VLIA 5A06A 2BEVA 4XE5A 4G1CA 5CNMA 1L4BA 4TLAA 1C7QA 3NOXA 1H69A 1P44A 4XZ3A 1JEYB 3NIGB 2I8LA 1FXSA 3SE0A 4E88A 1E9SA 2XUZA 1HYEA 1P5ZB 2GGSA 4KP7A 2C3UA 3MM4A 5G4KB 4Y2UA 4YCNA 2RB5A 1KYZA 3MWDB 1W1IA 3F78A 5FUBA 2C82A 1WZCA 2IHJA 2JVKA 4IDHA 4MUMA 2ZU6A 4RK4A 2NUTA 3Q6NA 1HDOA 4V0MA 1VYUA 4BC1A 3SFZA 2HK9A 2Z5GA 1P9WA 3ZGOA 2BFDA 2BKAA 3QUQA 2NXNA 1V11B 4G4SO 1NOJA 1UBCA 3SVZA 1Q50A 3TB4A 2YWBA 3D6TB 1GCIA 3VZDA 5JISA 3P9NA 1P45A 1DJLA 3TGLA 3OOHA 5IANA 1QIFA 1GL9B 3Q72A 1VCOA 2X41A 3WNQA 1C4XA 3PFIA 3IKTA 4S3MA 4D0NA 4UREA 3WK6A 1SUEA 1N77A 3C3MA 3GNLA 5DNVA 1FF9A 5G2OA 2O8CA 2GARA 4G8JA 4F2WA 1I3LA 3G59A 2RGBA 3L8MA 4BKOA 4PLYA 5I9LA 1X80B 3UK0A 1XOIA 3FPHA 4M1MA 1DZ3A 4HEJA 4IV8A 4WKCA 4QLOA 2X7XA 3RRNA 3CRVA 2C77A 3WBKA 3IOCA 4J7UA 4HX5A 1CB7A 1QVAA 2GHQA 3GG2A 1OHHA 4YJHA 4YMSA 1D4AA 3T7IA 2W22A 1SG6A 5JH7B 1ZSYA 2NLOA 3PGJA 1H0HA 4JT8A 4X41A 1B6GA 5BQXA 3HBNA 1M9NA 4R1QA 4CM6A 4ALNA 1D2CA 5L7WA 4JKIA 2C9OA 2QP4A 3ODPA 2HZ7A 4NFYA 4FONA 2F67A 4OHCA 3X1KA 1BE0A 4X20A 2W4QA 3FDZA 1RRFA 1ZXBA 3HCBA 4J7AA 3BF8A 5I51A 3RYCB 2GJKA 3BSFA 5EZYF 1T5HX 5D3KA 2KB0A 3MCTA 3MWEB 2LTAA 4GE0A 3EWAA 3O03A 2QTAA 1VBMA 4EGFA 1MB3A 1TRKA 2EGUA 2FKAA 3OIUA 1QKIA 1FU7A 5EMJA 5SY4A 5BVGB 3LF2A 3JZIA 4WJZA 3S2YA 2IOYA 4D9BA 2B1RA 4U02A 4NJOA 1YXMA 4CG0A 1TUBA 2ZCJA 1XMJA 5KI6A 3AETA 4S2EA 2JIDA 2VH2A 2FPWA 1DIGA 4LYGA 3UJ9A 4ZVKA 2X15A 1KOLA 1PV4A 3GI1A 2PG3A 1KWGA 2CWDA 3GJTA 5DLDA 3KOUA 4OH1A 4ZV9A 2IEBA 4WY2A 4PAWA 2D1SA 4TMXA 2ZSIA 4Z49A 4B32A 3F6EX 3W90A 4HB4A 1FMFA 3MEQA 3F7OA 3QFSA 2O48X 1HE4A 2OHOA 3E05A 3VR5A 2GPNA 3IALA 4Y6QA 5J5CA 3B3AA 3LDHA 1RHKA 3PD0A 4IZIA 5D3MB 3VYSB 3ERCA 4XD7A 5LB2A 1VKNA 2DSNA 4BNYA 2WWHA 3CB2A 3ROGA 3IX7A 3LP6A 1K6JA 1FSGA 1H1LB 4PGAA 2IW3A 2VJYA 2NVBA 3L92A 4XLZA 3WJAA 5EUCA 3WBBA 1RRKA 5AK0A 1CY1A 2POQX 1Z6TA 3EAQA 2WIBA 2RB4A 1L6IA 2EFEB 2I33A 4NU8X 4KH0A 1DX9A 1RAAA 2C0CA 4YRFA 4R1TA 5B37A 4OQFA 3SX2A 1ZGJA 2IEIA 5EHNA 5LSAA 1N0WA 2ASVA 3MPUA 3P94A 2LV8A 1T8YA 4ILKA 1U99A 5GMOA 1H93A 3FVTA 4AULA 1Z2EA 1BDHA 1RYDA 2G1JA 2JK1A 2Q5EA 3A31A 2Q5JA 2OSVA 4KX3A 1PFQA 4MWTA 4O29A 4B34A 2NUTB 2QGFA 3BFPA 2JI6A 4TZ6A 1M8GA 1NASA 4MYHA 2SECE 2XYRA 4BJ6A 2BFDB 5A04A 2IELA 5BSFA 1B8PA 3RRZA 4OHPA 2WSLA 2V6JA 3OLQA 1QDLB 4M53A 1YS9A 2AEJA 4NOMA 2F3TA 5DP2A 2RGEA 4TV8F 5DGCA 1TT7A 2HA6A 4R83A 5LYJA 3MGCA 4RC9A 2JB9A 4G0PA 1U0TA 5FLYA 2XVYA 1RLOA 4YMGA 4Y1FA 3ZD8A 1WD5A 2AF4C 1E20A 2PZEA 2WAAA 3EZ2A 3PICA 3MF4A 1V5GA 3LTEA 3ZEAA 4AWAA 4K0RA 5CJJA 1XTRA 2XMPA 2YVLA 2ZRDA 2G80A 4F2DA 1TM2A 4E5YA 4Y9RA 3OFKA 3QA9A 4HMOA 4RV9A 3PXAA 3EMKA 3JVEA 2GK3A 3O90A 4JSYA 2C2OA 4OHKA 3V4SA 5LQRA 4PWYA 1U7OA 1NKSA 4H9GA 5DULA 1C0LA 4G0NA 1UUFA 2NNWB 3DTTA 4RH0A 3IDOA 2VFAA 2B7BA 4J4HA 1F8GA 2GK4A 2EFCB 4KMRA 3OX2A 3K15A 3RGWS 3CTMA 4BZXA 3ZBPA 4BX8A 4PCVA 2C4HA 2ZTHA 1DG1G 3VOAA 2FF7A 4JHLA 4M7PA 1LDNA 2DLCX 1P91A 1RQPA 4BU0A 3T5MA 2WMDA 4RS4A 1CJSA 2WZQA 2H54A 2W98A 4MLCA 2W48A 3GR6A 4RZSA 4UCQA 3EN0A 4YRKA 4X20B 3FDZB 4URWR 3HO8A 5HJ5A 1EVQA 1SQGA 3TD6A 2J7KA 2F4VB 1JDZA 3DV0A 3LQYA 3NTXA 4MKRA 4WNAA 3WL3A 5E7IA 2OD2A 4BAZA 5IM4A 3MLAA 4G5GA 1JDJA 1PT9A 4J07A 4WXEA 5GM1A 5JAQA 1DDGA 5KSOA 4AYXA 4L7QA 1RCFA 3HYSA 4XEHA 4ZYZA 1PVVA 2PSEA 1VG8A 5ALLA 3TQHA 2E4WA 5AK6A 4UVGA 1VC2A 5B4TA 5JXGA 4J8PA 1Q7BA 3KC2A 2QYSA 1Z5WA 1WDLA 1XKQA 3CZCA 4OQEA 3DZBA 4K1XA 1TUBB 2Q0HA 4HQKA 1VPDA 2X5KO 3PQCA