4QDXA

Crystal structure of antigen 85c-c209g mutant
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
277
structure length
271
Chain Sequence
LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYGGNGTPNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 103
structure length 271
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qdxA00
1WB4A 3VDXA 2GZRA 5ALXA 2HIHA 3FYTA 3QMMA 2V97A 1EDBA 2XUPA 1AGYA 2PUJA 4KRYA 3VJKA 4PV7A 5J3JA 1MNAA 4BBZA 4YK7A 3P2MA 3BJMA 1VZ2A 2WUEA 3LS2A 4GLBA 2QT9A 2XUKA 4BVLA 5AIBA 3STTA 3WWCA 5E4JA 3L1JA 1E5TA 1ETHA 5IVDA 4FHZA 1L7RA 1AMNA 2ACKA 5LZ8A 4QDUA 5ALVA 5ALTA 1WB5A 1UOOA 2OG1A 3OPMA 2IITA 3X3HA 3E0XA 2DHDA 2XUQA 3WK9A 2CZQA 1MJ5A 4WDQA 4PSUA 5LKAA 4C4XA 1E66A 3KDAA 1VKHA 3RARA 3ESBA 3L1IA 1E89A 4G8DA 5D3ZA 2CBGA 2PKYX 4QWWA 4H18A 3TRDA 1CUHA 1CFJA 2GBIA 1USWA 2CB9A 5HK8A 2O7RA 2PBLA 1O6FA 1ZIXA 1ZGBA 3FSGD 1DX4A 2WILA 3OURA 2BUAA 3G0DA 1ZI8A 5ALYA 1PJAA 3ZI7A 5LYYA 3UUFA 3HC7A 1EHYA 3DQZA 4FFVA 3BL8A 4J7AA 4BTVA 2V98A 2XI4A 4ZI5A 1ZI9A 5CT6A 3QMWA 4GWLA 4BATA 1W6RA 4B7ZA 1ZD5A 1BCRA 2XMDA 5ALMA 2VJCA 4GDMA 1S8OA 3BXPA 3WKCA 4KE6A 3DDUA 4EZIA 4H0CA 5LKRA 1UKBA 4OB6A 4WFJA 4ITVA 1ORWA 2ECFA 4F5ZA 3F67A 1UK6A 1XZJA 1SOMA 5JZ9A 4DSAA 2JIDA 1DT5A 3Q0TA 4RGYA 2WIJA 4BTLA 4L3WA 5LP1A 3D2AA 2CMFA 4DNOA 1UKCA 1XRQA 4LIPD 4J0KA 2ZYIA 1ISPA 4B0PA 5CH5A 4GW3A 4WDRA 5AM1A 2WIDA 2HRQA 2HFKA 1LPBB 5JADA 1YAHA 2GBFA 3GUUA 1UXOA 1LGYA 3MGAA 1WHSA 3ZWQA 1GT6A 1UWCA 2VAVA 4CFSA 4QDZA 5F4ZA 1XFDA 2HHAA 5DYYA 1BCSA 5AK3A 4UHDA 5ESRA 2GYWA 5CT9A 4H7EA 5ALQA 5ALEA 1MNQA 4U2FA 4UUQA 3I1IA 1CUDA 5DWDA 4QE3A 1DQZA 2ROQA 1CQWA 4UFOA 2VQ6A 2FUKA 1SCIA 1EX9A 4H7KA 1Q84A 2BGRA 3OTQA 4FNMA 4HXGA 3WL7A 3MUNA 4Q82A 3G02A 3TEJA 2PX6A 1BN7A 1KEZA 4OU4A 1IUOA 3D59A 3U0VA 4HRXA 4AXBA 1CUVA 2H1IA 2YXPX 1ZJ4A 1H2ZA 2JEZA 3FYUC 4HAIA 1XROA 5I7UA 2DSNA 3FYUB 2DR0A 1LZKA 1CUXA 5JALA 1QOZA 1A8QA 4L9AA 4Q3OA 2VJDA 4Q1VA 2VJBA 5JAOA 4Y2RA 4UFPA 3JWEA 3EQ9A 4UBJA 3QBJA 4O08A 3HABA 1LPMA 2HA4A 5JYCA 3C5VA 2J3QA 4MQLA 5FOQA 1Y37A 1BS9A 2G63A 4UHBA 5ISMA 4M0EA 1FFDA 3WYNA 5AK5A 1P0IA 1TCCA 4Q05A 4UBMA 5AOCA 4B81A 2OCKA 4U2CA 1G66A 5AH0A 5CBKA 2WFMA 3JYHA 2CUTA 1CUGA 1QIIA 3A70A 3WMRA 5AM2A 4RPCA 3G9ZA 2DHCA 1W4LA 2OCLA 3TJMA 4RNCA 4DLNA 5SYMA 1XZKA 1THGA 5T4HA 1YSCA 2QJWA 1A88A 2O2GA 4LYDA 2VJAA 1XZFA 5HQ3B 4ZRDA 5C8VA 2WJ4A 4UBKA 1XZIA 1EVEA 1GPLA 2H7YA 3WKBA 4UBNA 4WY8A 3LP5A 3AIOA 3VJMA 2WHPB 2PSDA 4I19A 4J0JA 2PSFA 2I3DA 2WKWA 4DSZA 3I2KA 5ALDA 2FX5A 2AJBA 4Y2TA 4IH1A 4DYHA 4BCDA 5DYTA 4MWSA 1XRLA 4G8CA 4UBIA 3BF8A 5EFZA 1XZCA 2C7BA 2C5FA 1O6GA 3EIOA 2O2IA 4QA9A 3EQ8A 2O7VA 1QE3A 4DIUA 2XQGA 2XDWA 5FUMA 5LLSA 1LBSA 3BE8A 3ESDA 4HVTA 1QONA 3QITA 1MTZA 5JARA 3B12A 3C6BA 3BF7A 5C81A 3NGMA 2GBGA 5K3AA 5AI4A 4XWGA 3WWPA 4G4JA 4J0IA 1PFQA 4CI9A 1GGVA 1QIKA 4BC0A 3CN9A 5K3BA 5FRDA 1XZHA 2EDAA 1J07A 2O2HA 5ALWA 4KE8A 2G5TA 4ZGBA 3M82A 4G4IA 5AI9A 5ALGA 1XQYA 3WKDA 5CURA 5I9IA 5EHQA 3VISA 5AI8A 4BAUA 5DYWA 1Y7IA 4FWBA 2Z8XA 4EBBA 2V9ZA 2C5GA 1P0QA 1RP1A 3DKRA 4AMYA 5ALFA 2QS9A 1GQRA 3AZPA 3HRHA 4G1FA 4JEIA 4AMZA 4WJLA 1CUIA 3C8DA 1BRTA 3DOIA 5AICA 2ZYSA 4LHEA 4PNZA 3V1LA 2HA2A 1QJ4A 4Y2PA 3FCXA 1JKMA 2ZVDA 2WUDA 5T4FA 2WFZA 1FJ2A 3O4IA 2RHTA 4N8EA 2CEKA 2PVSA 3WK5A 1KU6A 4FLEA 4EB0A 2ZYRA 5CH3A 1UOQA 1XLWA 2XLCA 4G5XA 1MX9A 5HKAA 1UT6A 5CMLA 1GKKA 2K2QB 1HPLA 2DHEA 1E8MA 3AZQA 3WWEA 5HF6A 3STYA 1ODTC 2X5XA 1MN6A 4I4CA 3M81A 3QVMA 3R0VA 4DMFA 3VKFA 3IBTA 5AM5A 3IURA 3D3NA 4QEKA 5FXMA 1RYYA 5EIEA 2JEYA 1TRHA 2ZJ6A 1WHTA 2HA3A 5BV7A 2YYSA 1JT2A 4G4GA 2QXUA 5HK9A 4H7FA 3GROA 3H17A 4EY4A 5ALJA 5JD4A 1CUCA 4JNCA 4FFWA 1ODSA 1R4ZA 3AINA 3I2GA 3STXA 1OILA 1XKTA 3NWOA 2WTNA 4TPKA 4QDTA 1LPSA 3DEAA 3WI7A 3VJLA 3O4JA 3DS8A 4K2AA 3G0CA 2VA9A 4E15A 3AUKA 2VT6A 1R88A 2QVBA 5AK4A 5E2IA 1P0PA 2RHWA 1VOTA 1LPPA 5AJHA 5JZBA 3KD2A 4K6HA 1R1DA 1SC9A 1JI3A 3G0IA 2JGMA 5CRIA 4AQDA 3TGLA 2QR5A 1N5RA 4MXDA 4Q34A 3FCYA 5AKJA 2JGIA 1JFRA 3QH4A 5HF5A 3D2BA 4Y7DA 2YASA 1YR2A 4DTCA 4Y2XA 3D0KA 1LPOA 3K9BA 5KWIA 2G5PA 5DNVA 3R3XA 4DNPA 1MO2A 2B9VA 4CG1A 1P0MA 1EB8A 2XUHA 4V2IA 5JAHA 1MX5A 3ESAA 3PI6A 1DX6A 3UMJA 5HFNA 4F60A 1ACJA 3H04A 4FOLA 4B6GA 5ALRA 3C6XA 2ZYHA 5C8XA 3FWHA 2Z3ZA 1BEZA 2AJDA 2HM7A 2G4LA 2DFPA 1JJFA 5AOBA 4JYPA 1R9NA 5HQ3A 3DLTA 3DL4A 3KXPA 3RKSA 5JAUA 4BDTA 4BZZA 2RI6A 1EA5A 3G9TA 1CUEA 2GZSA 1VZ3A 1TCAA 5E4YA 2EDCA 2WHPA 1J06A 3IB3A 1CUJA 4B80A 2XMCA 4Y2VA 2RGUA 1N8SA 2BKLA 1YA8A 5C7YA 5HCUA 2ORYA 4J0HA 1QIFA 2PM8A 3L1HA 2XMSA 4HZGA 3M3DA 5DNWA 5A2GA 4BZWA 2XMZA 3RLIA 3BWXA 5EHZA 3YASA 2XQFA 3PF9A 4EY5A 4X97A 5AI0A 4DMCA 1DWPA 5ALKA 4PQEA 1E8DA 4LYEA 2DCMA 1EH5A 5EHXA 3WA7A 4CG3A 2HA6A 3IVMA 1HL7A 3N2ZB 2OQVA 5EIHA 5AHXA 3AILA 4DM7A 3IDAA 2OGZA 5IKXA 4GBGA 4U2GA 1THTA 2C0QA 4L72A 1J1IA 4WFIA 3GFFA 3D7RA 3G0GA 1I6WA 3CCBA 4ZWNA 2DQZA 3WA6A 2WU4A 2WTMA 5K3CA 4C87A 2QOEA 5AKHA 2J4CA 4KAAA 4Q3KA 2OCIA 3PE6A 4E14A 5FPPA 5T4BA 4CCYB 3AFIA 5A7HA 2Y6VA 2WIGA 3BDIA 1CR6A 2XE4A 3G0BA 2WJ3A 1YS1X 3C43A 1L7QA 1EI9A 4GECA 5AOAA 5CW2A 1AZWA 3F9CA 2HU8A 3VVMA 2XUGA 4NVRA 1CUSA 5AKLA 5CT5A 4HRYA 2OAGA 4KR0A 1WB6A 2W22A 3FLAA 1MT3A 1F8UA 1X2EA 2XMBA 4X85A 1AQLA 3I6ZA 4W1RA 4NS4A 4IH9A 1WCYA 5KBYA 1U2EA 4DNQA 5JANA 4OSEA 1EDEA 2B20A 4QDXA 1F6WA 3QPCA 4GXNA 2CJPA 4FTWA 5CH8A 4P92A 3WJ2A 1H2XA 3SX4A 1IUPA 2PSJA 5AKGA 2HFJA 3O4HA 2BFNA 4J3JA 5K3FA 3R41A 4UHFA 2JGEA 4UHHA 4KACA 2Y6UA 4B82A 3H2JA 3NOXA 2BAGA 4MJ3A 3ICWA 2VTVA 5AK6A 1R50A 3HYSA 4OUKX 5AKIA 1H2WA 5ALHA 4G8BA 1W52X 2HADA 1ZICA 3C45A 2QM0A 4BAGA 2C0PA 2HDWA 4OYLA 4PF1A 4AN1A 4G9EA 4OB7A 4HXEB 3CN7A 1LPAB 3F96A 5A62A 5BOVA 1XZDA 2I03A 3GZJA 2WG2A 2I3ZA 4IH4A 4K5QA 3BDVA 4GI1A 3H2IA 4ARBA 1CV2A 1KU0A 4C88A 4JH0A 2GYUA 5HFAA 1ACLA 5HF9A 3WYDA 4AZ0A 2XUFA 3A2NA 3D4LA 2GYVA 1CEXA 5ALUA 2HA0A 1G5FA 1VXOA 2V96A 4WCVA 3V9AA 4EY7A 3KWFA 5JD6A 2HRRA 4AO8A 5AO9A 4EA6A 1C7IA 1LNSA 2QMQA 3H19A 4UPDA 3C5WP 1XKLA 3N0TA 2VEOA 2IX9A 3K2IA 4IHAA 1W1IA 4K6KA 2Y2UA 5ALZA 4B84A 3QPAA 1XZMA 5T4EA 1QIGA 3G9UA 4FLFA 4LXHA 4P9NA 4C01A 3GA7A 4MEAA 4FNGA 4ZXFA 1AC5A 1LPNA 4QLOA 2HA7A 3W9BA 5LZ2A 5LIPA 4J0GA 4BRSA 3U1TA 1SCKA 2WLSA 2VSQA 4MYDA 3D2CA 2OCGA 4WY5A 3T4UA 1GXSA 3S2ZA 1TAHA 3G7NA 1R9MA 4MEBA 3R3ZA 6YASA 3PICA 4C6HA 1VA4A 3FSGA 2R8BA 3W9UA 4KAJA 3STWA 1HQDA 4OB8A 2XUDA 4INZA 2Y2VA 3WK8A 5LZ9A 3C6YA 3QZUA 1JMKC 4BCBA 1JU4A 2ZSHA 2BUBA 3WLAA 4XVCA 1QGED 4Q3LA 1X2BA 3PDCA 4H7IA 5FP0A 1DWQA 5FDFA 1VA5A 3SK0A 2X8BA 5IVIA 3AJAA 3EF3A 4BYMA 5A6VA 3S8YA 3UUEA 4OCZA 3AZOA 2FJ0A 2DQYA 4LXIA 4UFNA 1XLUA 4BE4A 3IUJA 1HDEA 4EUSA 2XLBA 3W05A 1FSSA 5CXXA 2QKYA 3QYJA 4NMWA 2Z3WA 2H9YA 2CKMA 1YASA 2H7XA 5IVKA 1ODCA 2OLEA 1TKRA 4BDSA 1XQWA 1XQXA 1CUAA 4UHCA 3V48A 3LCRA 3T52A 5I8PA 4EHBA 3RK4A 4C4ZA 4PSCA 1IZ8A 2NW6A 5AKXA 2IIVA 2XQKA 2JGJA 3G9XA 3DD5A 3HLKA 2XMQA 3I1YA 5AKKA 1LZLA 4BVKA 4CCYA 3BJRA 2AJLI 1DINA 2PPLA 2Y1KA 4LXGA 1A7UA 4RE6A 2QJRA 2P8SA 5K3FB 1CVLA 4UBOA 3DL7A 3ZLUA 1OCEA 1MAHA 1NU8A 4AZ3A 2LIPA 1VE7A 7YASA 4I3FA 3NUZA 2YH2A 2ONCA 5K3DA 3WL6A 2ZSIA 5EHNA 3F98A 3OOSA 2RIPA 3FNBA 1AKNA 2WG0A 1TK3A 1U4NA 4OYYA 3DJYA 3ILSA 4GEGA 3M83A 4EY6A 4S0XA 5LZ4A 1D07A 2Q0XA 1B6GA 1GZ7A 1L7AA 4P93A 3H18A 1QIJA 3E1GA 4AX4A 3WK7A 1QFSA 3O4GA 4X92A 1W76A 3H2KA 4CG2A 1MAAA 5JATA 2XUAA 3WIBA 4F0JA 3I2JA 1ZIYA 1ZJ5A 2XMRA 3R3UA 1EK1A 4X6UA 1QIEA 3O95A 3PUHA 2OAEA 3I2IA 2QXTA 3GBSA 4IQ4A 5ALIA 1CUWA 4W1QA 4G9GA 3WZMA 2ZJFA 1U8EA 1EVQA 4DMHA 3H1BA 3WKAA 1AUOA 3A6ZA 1G42A 3IA2A 1CQZA 3SWWA 3VXKA 1NU6A 2VF2A 5AI6A 1K4YA 2PU5A 4B0OA 4YASA 1Q0ZA 4J0CA 2C58A 2PL5A 3IUNA 1Z68A 1CUZA 1EK2A 2AJCA 4XJVA 2XUJA 4XX1A 1GKLA 4KRXA 3WIOA 5D6OA 3PF8A 2WHRA 1BU8A 3HEAA 3OG9A 1K63A 4H7DA 4YPVA 1CUYA 5LZ5A 1CIJA 1QIHA 1OXMA 4W9RA 1B41A 4Y2YA 2WM2A 5ALPA 3CXUA 4ROTA 2WIKA 4MWTA 1XZBA 3LLCA 5BWBA 5KWJA 2I78A 2QZPA 1EXWA 4FDMA 1JMYA 3GELA 4N8DA 4Y2UA 4B85A 4E11A 4X93A 1UK9A 3HJUA 4ZV7A 5SYNA 4Z49A 4BCCA 1XRPA 1GPKA 4QWMA 3K6KA 5A7GA 5HZGA 4FMPA 2RAUA 4WFKA 5AM4A 3E4DA 4FBLA 5C8ZA 2XT0A 4FLMA 5IVHA 3IUQA 1XRMA 2QTBA 2B4KA 4UHEA 3KOOA 4HTAA 2D5LA 2HL6A 2D0DA 5ALLA 5CT4A 5A7FA 5AKEA 4H77A 1BEEA 1XRNA 5H3HA 2JF0A 4Y9SA 4A5SA 4ARAA 1XZGA 3F8SA 5LZ7A 3E3AA 4KAFA 5D3KA 1YA4A 2WG1A 5ALNA 2OQIA 3RM3A 3DNMA 5KREA 2PSHA 4J03A 3BIXA 3HXKA 3VVLA 3STVA 4KE9A 3H0CA 3R3YA 4BP9A 4HXFB 1ZD4A 1E8NA 1YB7A 1C4XA 1QIDA 4M0MA 3WKEA 1XZEA 2R11A 5FV4A 3FVTA 4QZVA 2PSEA 1UK7A 4F21A 3FLEA 4BE9A 5CTAA 3F97A 3ANSA 4H35A 3HZOA 4FKBA 4W1SA 2BGNA 2HU7A 2WQZA 3WJ1A 4HS9A 1ZGCA 2WFLB 3WK6A 4ZV9A 4LKOA 1HBJA 5DNUA 1UFOA 4KYVA 4CIAA 4KJXA 2BCEA 1AX9A 2OGTA 4B83A 3DKKA 3I6MA 4BB0A 2HU5A 2EEPA 3WWOA 1CUUA 2ACEA 4AO6A 2J3DA 3W06A 2WJ6A 3OM8A 1UKAA 4FBMA 1H23A 5JZSA 3ZV7A 3FBWA 4W1PA 4NZZA 3KSRA 5ALOA 5A71A 4N5HX 2Z8ZA 1XRRA 2VATA 1M33A 5FPQA 1W75A 1CLEA 3OC0A 1U65A 3FAKA 1IZ7A 5HF8A 4C89A 1VXRA 2JBWA 4IO0A 5AKZA 2PUHA 1A8UA 2BUCA 3W2TA 3V1MA 3Q8WA 2ZJ7A 1PV1A 1F0NA 4MQMA 1CPYA 1TQHA 5HKBA 4EY8A 1QTIA 5ALSA 1J2EA 5BWCA 3W04A 5AI5A 3I6YA 1DT3A 2WIFA 3LIPA 1QLWA 1FFEA 1HLGA 4X6XA 5EI5A 4BRZA 4QLAA 4YX9A 1WOMA 4X71A 1SFRA 1ZOIA 4P08A 1LBTA 2AJ8A 1UK8A 5FKJA 1UOPA 3I28A 4E46A 1TCBA 4UBLA 1LLFA 3DOHA 4AO7A 5DLPA 1UZAA 1YB6A 4X95A 3QMVA 1AURA 1VJ5A 1CUFA 3O0DA 3QPDA 4ZREA 5DTIA 3D5EA 1X70A 3IUMA 4XIIA 1BE0A 1QTRA 1MX1A 1NX9A 5JD5A 1C7JA 2OXEA 4AN0A 2PU7A 1GPNA 4RE5A 5JIBA 2Z5GA 4KE7A 4Y2JA 5AP9A 3WK4A 5E4TA 4TGLA 1BN6A 2JGLA 2C4HA 3EBLA 4J0DA 3WL8A 1Y7HA 1YCDA 1YAJA 1EB9A 3AIMA 3BIWA 5AIAA 2BJHA 1E3QA 2FJPA 4D9JA 1JU3A 4DNFA 4PW0A 3WQHA 4OU5A 3STUA 1YS2X 1DTEA 3V1NA 2WU3A 3H1AA 1ZD2P 2XMGA 1MU0A 2JGFA 1ZI6A 2XUIA 4Y2QA 4GHWA 1QO7A 3C70A 3DYVA 2GBCA 3O9VA 1SCQA 1VLQA 1T2NA 2XQJA 3IULA 1H22A 3AIKA 3FOBA 2OGSA 1Q0RA 2VT7A 3H2HA 5AM3A 5EGNA 5DJ5A 3I2HA 3C6ZA 5K5EA 4L0CA 5FLKA 1HKHA 4U2BA 5CT8A 1BROA 1QZ3A 4CCWA 3KWJA 3ANTA 1JJIA 3R40A 4BC1A 2XQIA 4OPMA 3PUIA 3C87A 3ZPXA 1DQYA 1XZLA 2XB6A 3HSSA 1F0PA 1MPXA 5D7BA 1IMJA 1T4MA 2B61A 2WUFA 4U2EA 3FLBA 4A16A 4B9EA 3C8HA 2QRUA 1K6EA 4H7JA 1ORVA 3ESCA 3SC2A 2UZ0A 4JUIA 4QNNA 4AB1A 1RWQA 1QO9A 3DYIA 2W6CX 4X00A 3QM1A 5CXUA 3EQ7A 3A2LA 1N1MA 2WSLA 1QFMA 3PFCA 3WZLA 3MUOA 4X91A 5K3EA 3A2MA 4PSDA 4X6YA 4A23A 2WUGA 3B5EA 2E3JA 3PFBA 4X90A 3B3QA 1WM1A 4K6GA 4N8SA 2HA5A 2WHQA 1XLVA 1FFAA 2H7CA 4JYMA 2ES4A 3WWDA 1K8QA 5JASA 1G4HA 4DMKA 4W63A 3HACA 1CRLA 3JW8A 1JJBA 4DGQA 2XUOA 2X76A 2WFLA 1WPRA 1EDDA 4M0FA 3ZLVA 3WL5A 1CUBA 2QUBA 3O9MA 1WPXA 3FVRA 5AM0A 4TVKA 4PO3X 1GQSA 3LIIA 1H2YA 1VE6A 1IUNA 4N5IX 2VAXA 4X3CA 1DU4A 4BAZA 1R3DA 4CIBA 2QUAA 1FFBA 3CCCA 1QIMA 1DWOA 3ICVA 5JAPA 5YASA 5IH7A 4BP8A 4U2DA 1IVYA 4B9AA 5AKYA 3H2GA 4OD0A 1FFCA 2J4FA 3I2FA 5EIAA 1Q83A 4BVJA 3ZLTA 2RONA 3V1KA 3HI4A 4X7BA 1XZAA 3DCNA 4Y2SA 2OPHA 2AXEA 4QDOA 1XQVA 4H7HA 1K5PA 3IIIA 2JGKA 3MVEA 3FYUA 3G8YA 5DTJA 3R3VA 1TIBA 4ETWA 4C4YA 1EINA 1A8SA 3ED1A 1ZD3A 4KEAA 3R3WA 1N5MA 4X94A 4MYSA
chains in the Genus database with same CATH superfamily
3FTEA 1CS0B 2B21A 4LUCA 4BMZA 3ZWKA 2G5CA 1RI2A 2JVIA 3CINA 4L57A 5F2OA 5ALXA 4ZD6A 5HDBB 5HJEA 5KQRA 1JLKA 5BYAA 3A1EA 3OOEA 2UYCA 4GZ6A 3AVWA 4IJKA 3UHJA 3F3YA 1XLTC 2V97A 1BE1A 5ADUS 3VR1A 4YDQA 4Q7JB 4ZIRA 2ZBQA 3OCUA 3A28A 4GIBA 3EZ2A 4PV7A 4G1UC 1U80A 2ZU0C 3GJ0A 1MNAA 1NT2A 1I9GA 2JFXA 1R8SA 4WE3A 1FRQA 5K0LA 5I5EA 3U56A 3TAHA 1B6RA 2ZUSA 1WUYA 4YK7A 1LC0A 1T2CA 2BKVA 3MJFA 4PCLA 3A4IA 4DCNA 3KR1A 3L9XA 1Z63A 5CFRA 3B1WA 3CVXA 1ZCFA 4A0RA 1J1UA 1JQ5A 4RD6A 3LS2A 1UZNA 5B5SA 1ZQ9A 2OG2A 1BOOA 3H11B 2XUKA 3I01M 3IPCA 1PZFA 2I8AA 4IXWA 4L75A 2XDAA 4M8KA 3VO1A 3R6WA 1KP9A 5CVVA 3OMLA 2LCQA 3STTA 3UVEA 5IG2A 1RXEA 2QB5A 1WL8A 3N2KA 3L1JA 4UCFA 1ZD9A 4KITB 1E5TA 3GBVA 1ETHA 3IOCA 2QAGB 1Z5GA 3KJGA 2XA1A 3OZEA 3PWTA 1V3QE 4I4TA 1UPTA 1C5KA 1L7RA 1G9TA 3ZD9A 5C2JB 2ACKA 3LL4A 3PD0A 4DG9A 4QDKA 3E4CA 3NNNA 4LTMA 4LF4B 3OPMA 1V25A 4DNXA 4QPNA 3DMHA 5F9HA 2IU0A 2DHDA 1B00A 1X0VA 2PX8A 3ZR4B 1K3TA 5JXHA 1TT5A 3WK9A 2JCBA 3FUTA 3TIXB 4E4YA 2CZQA 6CHYA 2FMTA 1TAUA 2C29D 2DAPA 4URFA 1D7AA 4WXHA 5FTJA 2G9ZA 1IEQA 2CNBA 3N28A 2VTBB 4R1LA 2WD9A 2XCOA 1T1IA 3KDAA 3ILHA 4ESOA 1TEZA 1XFAA 3LAWA 4RXMA 5GIOE 5LM3A 4RDCA 2PR2A 2CJFA 1G55A 1Z18A 2ZAYA 4H4CA 2C4UA 3UW1A 1U6IA 4F5DA 3TOSA 1UBHS 4LK2A 4RS3A 4C7MA 4DA0A 3L1IA 1GSHA 5KVQA 3ZCRA 4DDHA 2RH4A 4ZJUA 5IWCA 4E2WA 1MW9X 1TO6A 3QTLA 4TV9A 3TRDA 3SHFA 1SUCA 3KXDA 1USWA 5HK8A 5C80A 2BGKA 2CWDA 4KFSA 1Z9BA 2GDZA 4HTFB 3RU9A 2PBLA 3RB8A 5D85A 3FSGD 4YACA 3CB4A 1JTVA 4FHEA 3OEED 1TVCA 1H8HD 2QTLA 1J22A 3OO0A 3PJGA 3QLUA 3SC3A 3G0DA 2OR3A 4UJ3A 4EEKA 5T67A 1OAOC 1PJAA 4I8IA 3V1TC 5DRYA 3ZWBA 1FE8A 1GNSA 3ZI7A 5LYYA 1R5BA 2F8SA 3EXEA 1M6HA 2EWMA 4M3NA 5INTA 5F9FA 2IEZA 4J7AA 5U4XA 5KVCA 4G0NA 2IPAB 2LCIA 4M88A 2XADA 2PV7A 4O63O 4D74A 3G88A 4UE6A 1D1TA 4JMLA 1Q6YA 1OSNA 3GEBA 1W93A 3EB9A 3GI1A 3PSAA 4X61A 4ASUA 4PC7A 1KRWA 1YZUA 5EEGA 5FPSA 3ZK7A 4B7AA 4HJXA 2Y76A 2NYRA 2XMDA 2VNSA 4ENUA 1K7SN 5FT9A 4GDMA 4HEA1 1QGUA 2H6EA 1DJMA 2ZJ0A 3WY9A 2Z2XA 4WBNB 4FSXA 3IB6A 3CZQA 3SS9X 2FP4A 1MB9A 1UJ2A 2QX8A 3EGCA 2W2VA 4L9SA 4U9UA 4Y1RA 5DMXA 3ISJA 3JAKB 2QVXX 3OLZA 2R66A 1ZEMA 2YYYA 4H0CA 4KPYA 1KPIA 2ZWIA 4H6PA 3THYA 1HQYE 4WFJA 4GYWA 1I51A 2H4XA 3LQQA 3HKEB 4ZI2A 1HO3A 2PH7A 3HCWA 3V97A 3EXHC 1VMAA 2OTCA 3F67A 3P9SA 3V55A 4TXLA 1K3FA 5E2BA 3L40A 1UZMA 2CW5A 1ICIA 5CBPB 5HCIA 1OW3B 3EC1A 4V0RA 5IT5A 5JZ9A 4OP1A 4YJ3A 1Z6QA 1UPAA 4IG4A 4DSAA 2GPAA 1O6BA 2NV2B 2ZR8A 3V8MA 1PCXA 3Q0TA 4ND3A 5DB4A 1RQ2A 2F1JA 2NZYA 3H0EA 3HWSA 1T13A 2Q27A 3I1JA 2QEQA 3I39X 1A72A 1LX6A 2G1AA 1N8TA 2BM1A 1UT5A 2VHVA 3LOQA 4RZIA 1XRQA 5F73A 2K7ZA 3O8DA 2FW8A 2IC5A 2RK4A 5FUXA 4FIZA 3PQEA 3R7WA 4NQRA 4R9SA 5KX5B 3KAJA 5C53B 3BTVA 4FFBB 1T9AA 4D45A 4DW8A 1S7GA 3AHEA 5IJ9B 5BQ3A 3BGVA 4MW2A 4Q16A 4UMFA 4CLXA 4DE5A 3JQGB 2JRCA 1ONSA 1VGRA 1RXWA 2Z5FA 1QBGA 2QTVB 1N6HA 4JJZA 2H85A 3SQLA 2QR3A 2YWFA 3C4QA 5IS2A 1KOFA 3KJZA 2I87A 3DVAB 3QA3E 2WB2A 1JV2B 2LWIA 3WZ2A 3Q9NA 1GEEA 1LPBB 3TEMA 4YRMA 4F85A 3ETHA 3CVWA 4ZXPA 3EGXB 1UMBB 4EY3A 1UXOA 1R0YA 1LGYA 2W2LD 3IR6A 3RBAA 1FVFA 4UTNA 1YC2A 2C57A 1U0OC 2CFCA 1MAWA 2GZ3A 1JDUA 1Q2XA 2QZ9A 1CBUA 3LUDA 1HYGA 1UWCA 4RADA 2QTRA 3MWGA 4GKBA 4EITA 4I9GA 4QDZA 1H6BA 3GVXA 4WINA 2NSJA 2Y3IA 2MR5A 4LOIA 5EOVA 5C5IA 3MW8A 4ATNA 1J5EB 2O7NA 1TJ3A 3CF6R 1BCSA 2FZLA 3VV2A 4GGOA 5AK3A 1Q95A 3I4LA 5ESRA 2BCGY 2QTCA 3FF4A 3NTVA 1R6XA 5JHGB 4MUMA 3HK2A 5HS6A 1EK6A 1ZP6A 2JAQA 3TZHA 4IILA 5ESXA 3V7NA 4R5MA 2PUDA 4TM7A 2EP5A 4WV3A 3PX2A 2WJHA 4NU8X 3ZE6A 1QGZA 2YN2A 4ND7A 4IWYA 3BAZA 2O5EA 2Y0PA 1BKSB 4EA9A 5DWDA 3T95A 3BK2A 4HV4A 1LC3A 4JP3A 2RE8A 1INLA 1VG0B 1DQZA 4E21A 4FW8A 5IXJA 1CQWA 3FSRA 2DBVO 2LBPA 3K5PA 3QI2A 1Q84A 2EJBA 2BGRA 2IFTA 3WNZA 4HXGA 3WL7A 4Q82A 3BEDA 3G02A 4N3GA 3VGJA 4Q9JA 3TG2A 2VHCA 4WNAA 2ETVA 4DA7A 1JSCA 1HNXB 3WBKA 3SZOA 5G3ZA 1NYQA 2UUCB 3QKIA 2OZPA 3U0VA 2CLFB 1EZ1A 1ZXXA 2WINI 3FOWA 2EC5A 2H1IA 3G82C 3JYOA 3SIRA 2FUG6 2W0SA 1ZUD1 4XQGA 1YZLA 3WHPA 1KAGA 4HAIA 1XROA 2EXXA 4C0BA 1BS1A 3GLKA 1HORA 3F6EX 2N75A 3K2BA 3OX4A 4HLUA 2H2WA 4EG0A 3FYUB 3VM6A 4NDAA 1BD4A 1OFTA 2C9OA 1M2VB 2A1IA 2WVJA 3CUVA 3WLJA 4CDMA 5B1SA 1HEYA 3R76A 1ZXBA 1SXJC 3Q7EA 5FI3A 5T8KA 5ULLA 3CNEA 3UAOA 1WOYA 5JYDA 4IV8A 2HY7A 2FFHA 1P1CA 3RREA 2F55A 4PCVA 5BNIA 2WHXA 3EEFA 4KPGA 4EHIA 3ITNA 1ZCZA 3T3DA 1A8QA 2C2KA 3JZFA 5DGCA 2VJDA 4R1PA 5JMPA 3PRKE 4OA5A 1HXHA 1OWOA 3G5MA 4AZSA 5FTMA 4Q1VA 4KOAA 3T34A 5DO9A 2RGWA 2VJBA 1Q3KA 5JAOA 3QWIA 1CJBA 3JQ6A 3WLIA 4UFPA 4FOSA 2CVHA 1V39A 3MWEA 4UBJA 4YT5A 1HNZB 1NQXA 3F2VA 3QFHA 5EE1A 4RHYA 1VL6A 4LY9A 2GHIA 4YAEA 3CLVA 1G9SA 4JLOA 1FVXA 3HABA 5K03A 1GCIA 1V9LA 2HA4A 3C5VA 1RT9A 2OYSA 1XVTA 2W5UA 5JSFA 3MF4A 4FFMA 1M3SA 1NP3A 1RWXA 1Y4UA 4MLCA 4F1WA 5GADl 5CNKA 4QNRA 3M6VA 4E4RA 3UJNA 1XEAA 5DI9A 3T9CA 3UANA 4M8LA 3PVCA 1KJYA 2FR8C 3KJFA 1PLLA 1HG1A 1KPGA 5ISMA 2PGJA 3KEOA 1FFDA 4M0EA 4D0SA 2GPJA 4ARSA 5AK5A 5I3CA 4UBMA 1VCNA 5AOCA 4BWFB 4CUKA 4I4IA 1Q0PA 4U2CA 1UBTS 4BNHA 2DEUA 4O4IB 5FTNA 4X7PA 5DM2A 2FGJA 3UJ9A 5E9WA 3I8OA 2F2TA 2WFMA 4RZ3A 1T9GS 1VJCA 4HYQA 4TLAA 5ICMA 1MPTA 3CX7A 4DA8A 1PD1A 5LUAA 1E4EB 4QGGA 2O06A 3E3LA 5K99A 2VBCA 4D3ZA 4KXVA 4BO0A 1NW4A 3EH2A 2XGSA 1V47A 3DMFA 4ME6A 4DEYA 1KEVA 1M2HA 3HWRA 3TOZA 3MWDA 3QE0A 2OCLA 4D82A 3TR5A 5TVGA 1TYBE 2VVTA 3I3OA 3G68A 2TSYB 4DLNA 2JI9A 2V3WA 3FGNA 3SN6A 2VAMA 4IFIA 2VHXA 1Y1TA 1QR2A 5SYMA 1XZKA 3NAZA 4NYIR 4BQPA 4F6RA 3EIHA 1ZU5A 2JKVA 4QIHA 1THGA 7AT1A 1FLAA 2DLCX 2XA9A 1C3LA 4N5NA 2AD1A 4B7XA 2WJVA 1U1FA 2DG2A 3PVSA 4BN0A 1PJBA 5KSOA 2BFAA 1IY9A 3IR5A 4NCXA 3B53X 4RELA 3Q4GA 2A3NA 2WC1A 2DCUA 1XK6A 4WLNA 5G0UA 1XZFA 2G07A 2AQ8A 3JARA 2PT5A 4IKEA 1LDYA 1XZIA 1OR8A 4UBKA 5K09A 3U60B 4DV1B 2H7YA 1WTCA 3P0FA 2JGRA 1XRJA 1P1FA 3HYNA 3MWYW 4JR0A 4N0QA 3QQPA 4ZT3A 5HXAA 4NXMB 1YU9A 4RVFA 4ZAGA 4B8WA 5LBUA 1QORA 4D3XA 2RI0A 3AI7A 3LP5A 1DGQA 3L6OO 1Q57A 5ITWA 5GTDA 3RSCA 2YWJA 4LTDA 2CXTA 2HF9A 4ZC1A 1E6EA 1FTGA 1SVSA 3K9CA 3OBBA 3REQB 1S0UA 4HN4B 1DIAA 3GFRA 4OQQA 3ECCA 2ZCVA 2FPLA 4I19A 4JIGA 2GLUA 4IFBA 5JCJD 4XRRA 2PSFA 3GRYA 4LXQA 4B2PA 5DN6A 4U6QA 1P9RA 2W2KB 3TTSA 3HNPA 2DJ5A 2JVKA 1AIPA 2RGNC 4M46A 1ZRNA 3PUZA 4Q3AA 4RCZA 4RQBA 1DX9A 5H68A 3OE7D 1DQSA 4XR4A 3I0ZA 4XAQA 5ALDA 1PYDA 4PLTA 5FUVA 1YB1A 3N86A 4BO9A 4NDNE 1HFJA 5IAGA 1IZ9A 4QSMA 4RTNA 1HDOA 1RCFA 3TCKA 4YRBA 4UM7A 4BCDA 5J63A 4YV2A 1ZH8A 1Y5RA 3FMOB 5FOXA 1EUCA 5EFZA 2NT4A 4C0WA 2V7EA 2JW5A 1ZJYA 3UHPA 5BP7A 2C7BA 2C5FA 4EK9A 1Y80A 1CQIB 2V6BA 4RPJA 4PSKA 3ZBPA 4TRJA 1YDGA 1FBNA 3U5TA 5ECWA 3BSYA 2O7VA 4KL8S 4AS3A 1QE3A 1TZMA 1VCMA 3QENA 4DIUA 4EUFA 1AGNA 5I7HA 5BNTA 3D4PA 4JLWA 4ZQEA 5FUMA 1PZEA 1M73E 2WU0A 5F7ZA 4MSUA 3V7WA 1LBSA 2XECA 2H2DA 3P2YA 4HVTA 4QJBA 2HK9A 3THOA 3CZ4A 4B3CA 4HAYA 3OKPA 4PFJA 4EFLA 4DLTA 4OMFG 4E5DA 5LJIA 1JQ3A 2ZWPA 1LSJA 4MH0R 3EAGA 1V5FA 3AKEA 4MMXB 1CERA 5HKKD 4MWGA 1V96A 4QSHA 4TLEA 2CDAA 4P80A 5BQPA 3RHTA 1DLIA 3JCZA 3BF7A 1L1EA 2RKBA 2VOJA 3ZLBA 3GGCA 1RXYA 1AKEA 3R5KA 2EBHX 4FDAA 4JUCA 5B53A 1BGWA 3W5JA 5K6TA 3H8JA 3LHDA 4OH1A 3ANYB 1TMKA 3SKVA 1YFJA 1FNDA 4CV1A 5LCXA 1JEEA 3PC3A 1UOEA 2QYTA 5DZSA 3I0MA 5DIFA 5LYJF 1PFQA 2R5NA 3EYWA 5G3YA 4KWHA 4CI9A 5LDHA 5KYGA 2X8AA 3DD1A 5K8CA 4CQNA 2AL7A 1M66A 2IT1A 5K3BA 2O8BA 1GTMA 2FMKA 4YCJA 4C4TA 4F92B 4L9RA 1XZHA 4QYTA 4OI2A 2DMRA 2BGGA 2P2LA 3A9TA 1J07A 2O2HA 1WHSB 2AOUA 4PZDA 2H00A 4FR0A 4BNYA 4BQQA 1ADCA 3AVOA 3M82A 3QU2A 2ZKLA 5IM4F 6AT1A 4DLZA 2OB2A 4AG5A 4NXNB 2O0HA 1KYWA 1T3TA 1V41E 2AUTA 3D31A 3EWIA 3JYNA 4GLFA 4GT1A 5ARCA 1P44A 3E61A 3RQSA 2O4UX 4HT3B 1D2CA 1TADA 4LJLA 3VISA 3KLMX 2XGGA 4F2GA 4IL5A 3G2JA 2CD7A 3GFSA 4RX1A 1A04A 3KT3A 1D4AA 2XZPA 3GT3A 3UT0A 5DYWA 4EFMA 5JBQA 3EXHA 4DLVA 4FWBA 4R7GA 4JU8A 1UH5A 1E7WA 3AY7A 3DG9A 4IHQA 3JZMA 2XKKA 4EBBA 2V9ZA 2GGSA 3VC2A 1S6YA 1DV1A 3BVPA 4ZEMA 5JPCA 2QVGA 1RP1A 4AP6A 4CL2A 1II8A 4JITA 3IDOA 3GK3A 1EM8B 1Y3CE 1P19A 3EW9A 3AG6A 1PTKA 5KDLA 2QS9A 4JEIA 3AZPA 1CUIA 3F1KA 4F2WA 3NUGA 4BNLA 2ETXA 5FBZA 1BFUA 5CYPA 1BRTA 1PUJA 4WKGA 2EV9A 3G6WA 4NCKA 1J9GA 2PLRA 3ROXA 1OD6A 2FZEA 2ZYSA 1FDVA 3E05A 1N5KA 4LHEA 4P3XA 2IEGA 2X6TA 1JR2A 3OQ6A 3N8HA 1WEKA 1AKQA 2BFDB 3IKMB 3K1AB 1H1DA 3CUEF 5JTUA 5U9CA 1YKFA 3MXOA 5L4LA 1QJ4A 5KKAA 3B2EA 3UBMA 3LM8A 1F51E 2ZVDA 1D5CA 3LQ4A 2F9LA 3TSAA 2IDKA 5K45A 1XCLA 3QHPA 4ECEA 4WKCA 1UXHA 2PWZA 4BFXA 5EJ9A 2CEKA 3WK5A 1KU6A 1RHRA 3DONA 3NKVA 1QH8A 3LCMA 1PSWA 4FDVA 4REQB 2HQOA 2D2VA 3M0EA 1HYHA 2SKDA 2XWQA 4J1NA 4G5XA 3F9RA 1DL5A 1HL3A 3H3JA 2R1TB 4IQ8A 3DHVA 4NICA 4NU5A 5AMXA 1TQ4A 5HKAA 1R4NA 5IXYA 5K8TA 1GDTA 3LBAA 1HFWA 1WPGA 4UHKA 4WZBA 1HPLA 5JRZA 3RPEA 2H92A 5KVVA 4PSAA 3SJBA 3AUTA 4A6EA 2W9XA 2A30A 2C77A 3H42B 4LV5B 3STYA 2WJJA 4U4AA 5IAAA 3I62A 4Q4JB 4OK6A 3M9LA 2NADA 2X5XA 1R0WA 1E9DA 1O97C 3MOGA 4Q1FA 4PG8A 5A0TA 3OCVA 3P9IA 5F76A 3GLQA 3HFSA 3LA8A 4H31A 1ZS9A 4HO1X 4EKEA 3Q7IA 2C1ZA 4FDLA 5B3JC 5GP1A 4BNVA 1Z0ZA 2L0XA 3AG5A 2X77A 3IBTA 5CPFA 3VKFA 3IURA 2RHOA 5F5XA 4OX9Y 1X9HA 2VUTA 3D3NA 3BCSA 4QEKA 1RYYA 5EIEA 3MRTA 2JEYA 2H06A 2HPHA 2BH2A 4EIWA 2ZJ6A 4CV2A 1DBQA 1DRUA 1KAHA 3AL2A 4RVDA 2HA3A 1JDJA 1UQTA 1LVUA 3W8DA 2CV1A 4PQRA 1GP2A 1G8GA 5EZYF 2I33A 2JCSA 1M8GA 4G4GA 4YJDA 4KR7A 4R1QA 1G4UR 1XL1A 3EGVA 3WL5A 2QMUA 3WLRA 3VZPA 4FEAA 3H17A 5B7GA 4JJ8A 4PXAA 2Y1EA 2EERA 4PYMA 3MQFA 1JHZA 1SA0A 4F4JA 5L6LB 2LD4A 2RGEA 1SEPA 1TEHA 3BJZA 4HATA 4A1FA 2VXYA 5EMMA 4BMCA 3IEPA 3VH3A 3IVAA 1ODSA 2FF5A 1KDOA 2GPNA 3AKDA 3PJEA 4U1RA 1HOXA 1D2GA 5F12A 3S2FA 4C22A 3RIEA 3PPWA 4EHKA 4EOGA 4DJJA 1GA4A 1XKTA 3CIOA 1Q44A 3L0ZA 3N0WA 4CIXA 3WI7A 3PPYA 2CJWA 3VJLA 1QPGA 4XVHA 2OV1A 2YS7A 3DS8A 2OD7A 3A6GA 3CH7A 1NQOA 4I1PA 3EN0A 1AHIA 1B0ZA 2X5OA 3E5NA 1JIIA 3Q5EA 2HHHB 1SXJA 2VQEB 2UZ1A 1GFWA 2YZ7A 4PYQA 3V8VA 2EW2A 3AUKA 3UK1A 4E15A 4E6PA 3GDWA 5C51B 1GNRA 5FBKA 4OFZA 1EP1B 5E2IA 4QL3A 1FTQA 1C30A 2E4UA 3IV6A 3LUHA 1NDUA 4E5YA 3LNCA 3KD2A 4QXRA 1U3CA 3EARA 3A4MA 3O6VA 4K6HA 4AJIA 5DEIA 2JAWA 1SC9A 5K0CA 4DUGD 4FPXA 3OJXA 3P9YA 3UHFA 1J2YA 2BE9A 5DM4A 2NU8B 3OPYB 3RANA 1WXIA 1X42A 4MVJM 1Q3TA 3WTCA 4R8SA 4PYRA 3H8WA 4PZCA 1MB0A 4AQDA 3F1LA 4W5RA 5ED0A 1DG1G 1N5RA 4L8FA 1Q2UA 2WWXA 4WFQA 2GXSA 2CLOB 2QJTA 5FEUA 1K86A 3OAAA 3QH4A 5CEFA 5HM8A 2GHTA 1RJWA 4EVIA 3HEMA 3C1OA 4Y7DA 4YRAA 5ENVA 3ZDDA 1Z06A 4JLVA 4Y2XA 1N2EA 1QRRA 2X0KA 4YY3B 3MA0A 5GJCA 1QYRA 3TLYA 1IN7A 1PFWA 4XA8A 2V74B 3ZHSA 5BSTA 4JLKA 1ADGA 1WZIA 1EB8A 4FB5A 1XYGA 4V2IA 1YVDA 3AVTA 1JDBC 4KGZA 2ECQA 2PGOA 1ST3A 1MX5A 4CTOA 5E95A 4NG5A 1ZLYA 1V45E 3R20A 1R2QA 1Y6JA 1DX6A 2AMYA 3D02A 3UMJA 9LDBA 3OH8A 3W0LB 4BN4A 3L6CA 4K46A 5I7FA 2WTAA 1Q3HA 2G0AA 4GPTA 4IHJB 4XFJA 1ZCAA 5JJIA 2E4WA 4CMHA 1M7HA 4A2WA 2IH2A 1QFYA 3GFVA 3VNVA 3QEMB 3WB1A 4WCFA 3SLKA 2YMPA 1LB1B 4UXHA 3EVDA 4DBVO 3NS7A 3WOHA 1QO0A 5EZQA 4L22A 5CDFE 1VC2A 5KNLA 1ZRSA 2FWJA 4FOLA 4F3YA 4Q4DA 2V4MA 1AD2A 4Z9YA 4AC9A 4LF6B 3ZG6A 4JJIA 4MR9A 4GR4A 1GVNB 3H9GA 3C6XA 1RQPA 4RK0A 4F8JA 1BXRB 5C8XA 1ATZA 3PL5A 2RBKA 3NEPX 4KMRA 4R98A 5DWVA 3NIFB 3SZ3A 4CYMA 1UADA 5FD8A 2XNHA 1JIKA 3QW4B 3IO3A 4AS2A 1Y1LA 1UFKA 2NPIA 4MV7A 2GCOA 2WOOA 3NMUF 3QUQA 1YGYA 4A73A 4DY6A 4Y6SA 4GYKA 2R6R1 3FMGA 1HUQA 2IBSA 1GAXA 2GF0A 1ECPA 4G5RA 4JYPA 1TZJA 5HQ3A 4OHYA 1UWVA 5DBHX 4EHDA 3DL4A 3P5BA 3OQ1A 2GA8A 1RBZA 3RKSA 3EPPA 4EF5A 5I7WA 2X19A 5JAUA 1C1XB 4LGVA 1VSUA 3TSCA 3F4BA 1EA5A 1TC1A 2IYUA 3EVBA 4J75A 4MP8A 3G9TA 4OXKA 1CUEA 3OPNA 1EFAA 4X24A 2F8TA 2GZSA 2OO7A 4HQNA 2WM8A 3G5UA 5G0TA 2BEKA 3ZOKA 2SNIE 1TVEA 2IK8A 2I4LA 3HCCA 2OKCA 3JQRA 4UQOA 2EDCA 5DP2A 3SHQA 4YJFA 5EJAA 3H0KA 4R6XA 2O2XA 3RV4A 2Z6UA 1ZM7A 2QM8A 2XDYA 4MW1A 3FPBA 4WESA 3NT5A 1IZ0A 4MR8B 4D79A 4GMDA 4I9UA 4K0KB 4LNUA 4FZJA 3EDRA 1SD1A 4NABA 3CPHA 4OHXA 2OWDA 2WJYA 5FUWA 2RGNA 2CXXA 3VH2A 2ZFUA 2PUFA 4LAFA 2ZSAA 1M9NA 4D9HA 3T3IA 1QIFA 3K9WA 1V9SA 4JEHA 3GIDA 3MERA 1W36D 3UT5B 5BSVA 1JHOA 3HUDA 4CKYA 3IHWA 5DNWA 3FWKA 1T43A 2QV0A 2TMGA 3LYAA 3NDRA 3PFWO 1WS6A 4Z99A 2ONJA 3TWOA 4BZWA 4UPEA 1T4DA 5DBEX 2XMZA 5IN5A 1FFSA 5BR7A 2ZIZA 4XCVA 4EGJA 1GUBA 2Z0MA 3PU6A 1CJKC 4N0EA 2A0YA 2PD6A 1NLMA 3IAEA 1GAWA 1RXCA 5IEJA 1C1DA 5AI0A 5BV8A 2WTXA 2OQ2A 4BVHA 3ZDFA 3PEWA 4PAGA 4CN9A 5ALKA 5AJWA 3WMWA 4QD3A 1FX1A 4RK1A 4Q15A 1E8DA 2E6KA 3SQNA 4ETMA 2H1VA 2XVYA 1NI3A 1U3UA 3EMKA 1L5RA 1EH5A 2ZRFA 3IJRA 3EZ9A 4OSPA 1EFHA 4NPCA 4ZVTA 1XWFA 2XSZD 4QUIA 3ZY4A 5COAA 3P4XA 1DAEA 1HL7A 3CZ9A 5B6JA 1TX4B 3DM5A 3KKEA 3ODPA 1L7BA 2OQVA 2CK3A 1K3UB 5D84A 3EVZA 3KQKA 2G9NA 1OZ0A 4MB6A 4DM3A 4GBGA 2WOJA 4EABA 4KQHA 4AWBA 1THTA 5CHYA 5KDOA 4WFIA 3VVCA 4D8YA 1LEHA 5HP4A 2JI8A 3BSWA 5GAJA 3DR3A 3K6SB 3PI7A 5JT1A 1G8PA 1G8SA 3W5CA 1PT6A 2Q5OA 1M2FA 2Q6LA 2RGYA 3LL7A 1MFZA 4LSWA 2PWYA 2QOEA 4Y3UA 1SCUA 3QKTA 3QVOA 2P4EA 4J90A 1MUUA 1KYYA 1M2GA 1NJSA 2BRUA 2ORIA 2IIQA 2QX7A 4P0QB 1T2EA 2CMGA 2ZREA 3C4VA 4D9EA 1MQ8B 2AOWA 4P2BA 1K8ZB 1LLCA 1BMFD 1YFZA 2C59A 4KUEA 1OHHA 2OBLA 1JEDA 1R0RE 3FJOA 4M86A 2Y6VA 3MAGA 3ONFA 4RSHA 4DCJA 4ZVLA 1A96A 1Z36A 3KTDA 4HQKA 4XB1A 2PBZA 1CR6A 4ND8B 4PX2A 4RM2A 3ZUGA 4BV9A 4YRQA 1TF7A 1ZAYA 4TZTA 1DCMA 2OXIA 2C9CA 1ZONA 2ZWAA 2P0YA 3TDKA 5IZCC 1F2DA 4QTZA 5KMGB 5T41A 3KSUA 1TTHA 2VZLA 3CG0A 2CJYA 4DQDA 3VU0A 1GAJA 4X20B 5DSXA 4MMYB 4K9NA 3TRJA 2Z30A 3TZBA 2OBMA 4MRNA 3Q85A 4E12A 4AZ3B 3C43A 5GZ3A 1PHPA 1PYOA 4NAVA 4BKRA 2HQSA 1VBFA 1XU7A 3ZE1B 5CW2A 3U9SA 4F4FA 1GG2A 3U37A 1WB9A 2RAFA 1QWOA 2V45A 2WAAA 1BQ3A 1YOVB 2XUGA 3OFNA 4NVRA 4RY9A 3TDMA 3AH8A 3BE4A 3I8XA 4M98A 5D1HA 2O8EA 1VLVA 2ODAA 3FUWA 5HBGA 4GSYA 4V0MA 4M1WA 3AMVA 4XDHA 3BQNB 3FLAA 2HYDA 1Y6ZA 3PUWA 2C04A 1RVV1 2V7TA 1YS6A 2WIBA 1GTZA 3H2SA 2GF2A 3M1YA 3T5MA 1LV8A 3I6ZA 2GJKA 2YMQA 4NS4A 3WLTA 3REGA 3UMGA 4IH9A 3ZWOA 1T4BA 3COVA 5DX0A 1T2FA 3HSYA 4HDMB 3SF8A 1GEGA 2COUA 1V1MB 2RK6A 4JN6B 3P9QA 4DCUA 1G8JA 2ZSUA 2RHJA 3N05A 1TUBB 3OECA 4GLLA 1CX9B 1Y8ZA 1E92A 2VBIA 4BLWA 1Z82A 2OBFA 1JKIA 1F6WA 3QPCA 2OUIA 4GXNA 3BGIA 2JFZA 4G97A 4IXMA 3MOIA 3K0CC 4E22A 1SKAA 3WJ2A 5A5GA 3NX4A 3SX4A 3AVYA 2C00A 2BP7B 4IMPA 4EJ2A 3VYSB 4KIJA 2RK3A 1XHFA 2BFNA 4DV6B 4J3JA 4JKIA 1JF8A 2ZGVA 1I7DA 4ID9A 2C5SA 1Z4IA 3ZD6A 5H8WA 1YD7A 2X4GA 3KPWA 3OZSA 2P2GA 4D3SA 5A9SB 1JB1A 4QYIB 4KACA 5KWSA 4OHVA 2FSUA 4U7PB 2LXNA 4N1AA 5TR9A 5L4NA 5LDDC 3H2JA 3NOXA 3DPIA 2HNKA 2FNAA 1UFRA 2GD0A 1JSZA 5MN5A 1Y4DE 4R01A 1DBIA 4MJ3A 4OHOA 3JRXA 3UMMA 1XDSA 5A6SA 4OP2A 4UAJA 3GRRA 3JALB 4I5EA 4WPGA 4ZAZA 1IXRC 5DTMA 1QZZA 1G5IA 5AK6A 2BBTA 4A03A 2XXAB 2C98A 5ALHA 3MWLA 3FUVA 5B3JA 4MUBA 3AM1A 2YQZA 1W52X 3WHLA 3BWEA 1RVDA 1HNNA 1HF3A 1OKKD 1SOAA 2G36A 2VDNB 4BAGA 4C76A 5JVDB 5HHTA 1YS7A 4OYLA 3ST7A 4PF1A 3DE6X 2DUJA 4G9EA 1XA0A 2Z43A 1GQQA 1OIXA 3MGCA 3N6RA 4JHXA 4GX5A 1Q0TA 1FUEA 1PUXA 4X1IA 2Q6VA 3F96A 2GUWA 5A62A 2FUNB 5CD1A 1GN8A 4NH0A 4MPTA 3T9BA 3TX2A 1M76A 4EARA 1GFIA 3BFPA 3PCXA 2FQQA 2CHFA 3JX9A 3PHHA 1BD3A 2IXEA 2ZCUA 4JQCA 4QJ4A 4V2UA 1PL0A 2AFHA 3BTOA 4JBGA 4RA9B 1P7YA 2V5AA 5B3AA 2I3ZA 3CY6A 5G2OA 1P7ZA 1WW2A 2OKGA 4ZMSA 2J07A 1UPCA 1SBCA 5CNMA 3BDVA 3VPHA 3WXMA 4A6DA 4DCSA 1J21A 2C95A 1JTFA 4GI1A 3WIUA 1MH9A 5EMHA 5DFAA 4LRTB 5HG0A 5EPEA 1A98A 4C88A 5FTLA 4JH0A 3CPSA 3IP8A 4BWGA 1YB4A 3PQ8A 3SDZA 1ACLA 3CRRA 3HP7A 4DG8A 2QZ4A 4MJ7A 3WYDA 1YGPA 3ADDA 2RH5A 5I5GA 1A2OA 4S3MA 2PGAA 2PJUA 5FLXA 1IXYA 1N9GA 2QI9C 3HHEA 1QRAA 4J16C 2GYVA 1LFDB 1Z4PX 1JR3E 1F14A 4EQ6B 1LU9A 2VSOA 1BHO1 1B15A 5FPTA 2HA0A 3M6IA 2IY8A 5JVDF 4K6FA 3O4FA 3PD1A 3U49A 1I2CA 1XL0A 4EYGA 6ADHA 3Q7RA 1AV6A 5SYAA 2BDTA 1NUPA 2G08A 1E7RA 1PKXA 1PGNA 2ANCA 1F9EA 3A1UA 3TQHA 1M8PA 3VR3A 2GRJA 5JD6A 1MHTA 4GPZA 3B1XA 3FVVA 4OGFA 1PI3A 2SCUB 4ZOEA 1UJ4A 4MIOA 1AGPA 1I7LA 2DWCA 1GG9A 4AO8A 4IGEA 4PAOA 5I9MA 3UHAA 2J59A 3MLEA 3RG8A 4EA6A 1GV0A 2P7HA 1XDUA 1LNSA 2ATEA 2D74A 3A6DA 4IVRA 1NWCA 3GJ3A 3MIIA 2CSXA 1YHZA 4E5UA 3E03A 4UPDA 4DCOA 4ZCMA 5I3ZA 5K0ZA 2R7NA 1UBOS 4CLRA 4MW6A 4RF5A 4OJYA 2XYQA 4IHAA 2FUG1 1W1IA 3E7PA 4JI1B 2BBOA 3MIZA 3ZWAA 4DXHA 4EUHA 4EHJA 4MP6A 4QARA 5T4EA 1EAMA 1YK0A 1QIGA 4NJEB 1ODIA 2H31A 4KN5A 5CAEB 2V7QA 1BDMA 1D5WA 1P8AA 4MI6A 4QQRA 4LZZA 4C01A 5BW4A 4FNGA 2KE5A 2V7BA 4D9CA 4TTSA 1NKSA 2C8LA 2OSVA 2WJAA 1GUFA 4MI1A 2MSNA 5D01A 3BMNB 1NVVR 4MVJF 2G9UA 3TFOA 1B1AA 3HWWA 3TW4A 5CX1A 5HDQA 2O3RA 2C9DA 2VCHA 1SCKA 5CB0A 5IBQA 5IKMA 3O82A 1OC2A 2C31A 3K1YA 4IJUA 3ZVMA 2VSQA 3KO8A 3M6LA 5LMUB 2OCGA 1GPH1 4CM3A 3TGPA 4RTJA 2HMSA 3A4YA 3WIVA 3TGWA 2QRVA 3PCTA 3KB1A 3GP5A 1EGVB 4CMCA 1BRMA 1PEKE 4IVQA 1II9A 4ASUD 5I8WA 3OD5A 1Q0UA 3B38A 3N8NA 2AV6A 1JVBA 3PICA 3A32A 4EO4A 1IXSB 2VWQA 3DAGA 1VA4A 2I7DA 3MNFA 4LC9A 2R8BA 4ZQHA 4C6HA 4KAJA 2GXUA 1PYGA 1KNQA 4Q7KA 2QBYB 1HQDA 3R7AA 3R9IA 1GUYA 3GLFE 3W8EA 5C5EA 4EFDA 2DERA 1E3TA 3OPQA 1LQTA 1PS0A 1CF9A 2JZCA 4XX0A 4LY6A 4DA6A 5FWYA 3L4BC 4CV0A 1AE1A 3NCHA 1YVRA 2WWIA 1JMKC 4QVGA 4P3YA 3L8DA 3EQ6A 3R24A 5FBWB 1YZGA 1KSHA 1MG0A 2BUBA 4EZEA 1MAVA 3QYPA 3ROEA 3GARA 5L3QB 4I6EA 2P9QA 4NV0A 4UJ5A 1G64A 2FZWA 4YCDA 4BLRA 5DCUA 1A4RA 2EZ4A 4YIHA 1FXSA 2ERXA 4GQBA 1J0XO 2PXAA 4K9LA 4LQCA 3QLVA 1SVOA 2C0CA 3FH0A 2CNDA 3NORA 4MRSA 4RHUA 4BFVA 4RHTA 1PR0A 2F43B 2ZXEA 5ENZA 1P2VA 1VA5A 4TN5A 2CXPA 4C4SA 4W5HA 3SK0A 1XMQB 2WE7A 1J99A 3DR5A 5IVIA 1CJVC 1UBFA 4O25A 4YT2A 1RQGA 3EF3A 1UIMA 1Z0AA 3BH6A 3C3MA 3GLVA 1ZKMA 4KKVA 2EX4A 3AZOA 1QHGA 4WY2A 5KAPA 3S8YA 1JR6A 2DQYA 1Y6FA 1Y3FE 4GOND 3SIPA 5CVUA 1D4FA 1FZQA 3W3AA 1LDEA 3AEUA 1L5YA 1VDMA 1TAQA 3T7EA 5IJZA 2WWFA 3CLUD 1NW3A 2N3ZA 5ECGC 1IBSA 3DA8A 3W05A 3HA7A 1SC3A 2Q1YA 3Q9UA 2PTHA 4ILEA 2YC4C 4PGMA 4J6FA 2FH5B 1EBBA 2XVMA 3NGLA 1P2BA 1I14A 1KSFX 2Z3WA 3QYJA 4NMWA 4NRDA 1HYEA 3RJTA 2CKMA 1R0XA 4K81B 3ADOA 4M1EA 3LQRA 1Y48E 1EFPB 2H7XA 1WU8A 3PXEA 5HGXA 1ODCA 2ISQA 4JQOA 2NZ2A 4IOKA 5BSWA 2HYIC 3OPVA 3MOSA 1K7EB 2XB8A 3MTQA 5H5JA 3TVYA 1ODFA 4KXXA 3IL2A 2X4IA 4J76A 1IPEA 3F5MA 4LHWA 4ZVUA 5GQSA 5I7AA 5TMPA 3FKJA 5AVVA 1CZRA 1CUAA 1UXJA 2P5YA 3RU3A 3T52A 1Z4JA 2J5RA 3PNMA 1I30A 2WSYB 5KYNA 3QLTA 1M74A 2EJUA 1RC8A 1NTOA 4NYMR 5J2TA 1O6ZA 1Z6XA 2NW6A 1JYFA 3IT0A 3EZNA 3WXBA 2ONYA 1E6LA 2R2AA 1GRVA 1X1BA 1GHTA 3EZLA 2WJPA 1CVRA 4BN5A 5TARA 5IC6A 3W4KA 2OYCA 5EXTA 1N2CB 3HLKA 2WLTA 2H07A 1IEWA 1BGVA 3KYCB 1KJWA 1NFFA 3IKVA 3KIPA 2YDXA 1P4JA 1WXHA 2HQRA 3B9BA 1WCIA 1LZLA 1E59A 1BA3A 3BJRA 3KHTA 3P9NA 3IFSA 4CCYA 1E1CA 1EUYA 3K6JA 1SGWA 3W7AA 2PPLA 1I5OA 2AG6A 1DEHA 3FKSA 2ZDHA 3ZBTA 1E69A 5F4BA 2QJRA 5FAKA 4CVNA 1H6AA 3T41A 1HY3A 4A9AA 4KU4A 3Q9LA 3SR3A 4B71A 2B8NA 2VSYA 2YUTA 4EYOA 3TZLA 1KVRA 4U6NA 3Q3EA 5SY6A 2WM9B 3LDGA 3C3YA 2O2YA 2Z2IA 3HHPA 1HRDA 1EWRA 2YOFA 4XJXA 1D4OA 1JP7A 2O1XA 4GEKA 3PWSA 1XDDA 3M4YA 4AG3A 4U7TB 2PQ2A 4C29A 3ONWA 1XIVA 4YS6A 4M9ZA 2NQ2C 1NJ6A 1DJNA 1E2FA 5HE8A 5BNWA 3AI1A 2G8LA 3JAWA 1QQBA 5JI2E 1NF3A 3HKCA 3BL6A 1KH3A 3GPCA 4IDPA 4KQKA 3UWPA 4G81A 3D3WB 5EXEA 5LMCA 2PJDA 4YMUA 4Z4IA 3DLCA 2COKA 2G6BA 1DAGA 3GAAA 4OMUA 2FLWA 5IF9A 2GAJA 4TYPA 3LI2A 4G1CA 3PEFA 3FNBA 5A4IS 1S1MA 2YQ5A 4MW7A 4EJSB 2OL4A 1M83A 1QVAA 3PIIA 5I4CA 2RBGA 4BZPA 3DJYA 3ILSA 4GEGA 3M9WA 3OJCA 1F20A 4NOMA 2B2CA 5HKOA 2B83A 1JPJA 3HO1A 1NURA 4CTNA 1K06A 4V1CB 4S0XA 1KPHA 1J2TA 4GX1A 7YASA 1XEWY 2IW3A 2Q0XA 4L4XA 1Y6QA 5GPBA 1ECBA 5LD2C 1E3WA 1W96A 3REFA 3H18A 1NBOA 1TA9A 3BCRA 1Y9ZA 3K3PA 2XAAA 4QICA 4UKDA 5DV9A 4CMGA 1KVTA 1HDXA 4Q00A 1E2BA 4ZDIA 3FB4A 2H2IA 4B3SB 1Z2NX 2ZRIA 1OA1A 2FOIA 2GZMA 2HCFA 3FW1A 3MGKA 4ZOLF 2SKCA 3CLSD 5LB4A 3WK7A 3ZE0B 1YVPA 2BFFA 3EEQA 3CE6A 5EZSA 5EIWA 4OHBA 3H65A 4FYMA 3SYLA 2O05A 1FDOA 4NK5A 1PS9A 2PIAA 2J9XB 3H2KA 2GR9A 2HSZA 1WLSA 3QF4A 4L4SA 4ZVOA 3PGA1 3FWZA 3ZKWA 4NFHA 4DDTA 3JR7A 1JEYA 2NU9B 4NOLA 3V4RA 4MS3A 1Z25A 3GD5A 3CF4G 1SKYB 2IZOA 4O2AF 2D1RA 3C85A 1G21E 2B82A 1I6MA 2NO4A 2WKSA 4KH1A 5BUQA 2YJ4A 3BB1A 2PEYA 3EEIA 3LHFA 3TXXA 5BY2A 3ENNA 1WCV1 2ZRBA 2A14A 2DGDA 3I2JA 2C4VA 4YA6A 2RGBA 1N2JA 3KZVA 4BVBA 3RF6A 4ZYXA 2JJQA 3EZFA 3JATB 3BD7A 5LQRA 1V6CA 3QFRA 3R3UA 2Q29A 5EG5A 1EK1A 4X6UA 1Y42X 3O95A 2NYVA 4YJ2F 1HK7A 3JWIA 2ZRNA 3PENA 1R5JA 5CK5A 2F1KA 3KKMA 1LF5A 2X9VA 3KHSA 4BB6A 1BHSA 1FPMA 2WY2D 1KI6B 3ORQA 5ALIA 1IL0A 4ILKA 2VYND 1SQ0A 5EJGA 4Z0HO 4RY8A 4KW7A 1TCVA 4RLFA 4UXJA 2PQ0A 2WP8J 3LTEA 3ZZMA 4AYXA 1QX4A 4GPEA 3I9V6 4HGNA 2OV2A 4KAXA 5EP2A 4ZYTA 3FYCA 4FCVA 1YACA 3EA5A 1A9ZA 3PWZA 1SVUA 4F4IA 4NLLA 1E2LA 3ZWVA 5DHTA 3K15A 3BZWA 1N9ZA 2F1OA 3FFTA 2IU4A 2YIDA 3H1BA 4IVNA 4R1MA 3WKAA 2X86A 4B34A 1AUOA 1GWNA 4D97A 2ZEJA 4MUJA 5E7MA 1JALA 3I34X 3L7DA 5F1OA 1G42A 1U9CA 3EMVA 4EO7A 5G1PA 2WPNA 4URZR 3V42A 2IVFA 3I12A 1NVFA 1DBPA 3TUJC 3DZFA 3ZS9A 4CEJB 3RVOA 1MGPA 1LDMA 1XX6A 3RD5A 2R9VA 9ATCA 5KKNB 2AC7A 2JLSA 1J97A 1U90A 4KYUA 4UTOA 1QQ6A 3QUAA 4YASA 3VAAA 3F6SA 4XVRA 4TZKA 3U39A 2CLMB 1SQGA 1VPEA 1KO5A 3CSUA 5K1ZA 1SJ9A 1Z12A 3WNVA 1Z68A 3TUZC 1CUZA 3CGWA 1W2GA 2C42A 5A06A 1EK2A 1RQ7A 3IQHX 2PRJA 1M7BA 1G3MA 3E5RA 5ENDA 3SNHA 2AJCA 3ZE8A 1Y6GA 2AZXA 4EPWA 1EPUA 4QAQA 3WJ7A 3QRWA 3AI2A 1GKLA 1ZVMA 4MIKA 1ABFA 5D6OA 4WNIA 1U0JA 4EPYA 1Z4NA 2WHRA 3JQ8B 3L6BA 5DI3A 4QNMA 4UTXA 3TLCA 5EXXA 4EAAA 2HKIA 4ZYYA 1K63A 3RC8A 1E2KA 3UF0A 4KCGA 3TMAA 3CC8A 4MVJP 5TQ2B 3O8QB 1QS0B 5BO5A 1QIHA 5AR1A 3IXLA 4RSMA 4V0SA 3PC4A 3LCUA 2OXFA 1B41A 2EZ8A 3WRWA 1L4YA 2GB4A 4WECA 1G98A 3QSGA 3CXUA 4A8JB 2HLDA 5U1PA 1XZBA 4UQLA 2GPTA 2UUAB 1E5QA 2YZKA 3IERA 3VI4B 4B5KA 1E58A 3F6YA 1VJ1A 2IHZA 4M60A 4LQLA 3U3KA 2I78A 1P1JA 3LGSA 4GOJA 2W7TA 1X1DA 3EZ7A 5LU9A 1KFCB 3FDZA 3T61A 3D4IA 3NBYC 4WOJA 4PHCA 4UEOA 4Y2UA 4E11A 2FWMX 3S1LA 1UK9A 4RY0A 1OT5A 1YIOA 1UZLA 4IVPA 3LO8A 4M1OA 4UCQA 2E21A 4ZV7A 4ALIA 5DGIA 1BYIA 1GRQA 2HQ1A 2V55B 1YVEI 1KERA 1PNOA 4O2LA 3WG9A 1ZH4A 1XRPA 1BVYF 4G0MA 1OI3A 2QRQA 4G89A 1W36B 1GPKA 5GONA 4UEKA 2CXNA 4X63A 4F9GA 4DV4B 2YWBA 5KNBA 3GHHA 2JIQA 1JL3A 4IIJB 3ER8A 2W70A 3R23A 1ISGA 2R97A 1M6VB 3H6KA 4F2HA 2PH5A 4D5GA 1KZ1A 4US0R 2B4KA 3T3HA 4E5NA 1J8FA 1JI0A 2C3PA 5AW6A 3WMFA 1XZPA 1NUSA 1P2GA 4FYXA 4HNGA 2I7XA 2Q50A 1ABBA 1CF4A 4DSOA 1SWVA 2CNKA 5ALLA 1PRYA 3QQ5A 3EVTA 4I1OA 5DCWA 2PX3A 1S89A 1OBOA 4H77A 2Q9CA 1RMQA 4PS0A 4EDFA 3MBIA 2IUTA 1IQPA 3WLMA 1ZN9A 3NHPA 2NUPA 3SNKA 3BMOB 3ELUA 4KUGA 1SO8A 1V8DA 3AC0A 3ES9A 4MYUA 1EG2A 3F8SA 4BRWA 4OV6B 5LZ7A 4ZVRA 1KI2A 2BM9A 2ZJAA 5D3KA 1NRIA 4HGPA 2M1XA 3S28A 2VHYA 2BMWA 2WG1A 3IH5A 2FN7A 3QU4A 1T5SA 2ARKA 2JNWA 4AVYA 2HW8A 3R4CA 4G36A 3RK0A 1H0HA 1Y0BA 3E3OA 2Q7OE 1WDLA 2A3RA 3RM3A 1V16B 3BKWA 2QZJA 4ABYA 1DS6A 4ML3A 2AMLA 2FSGA 4FVTA 2X9NA 3FNGA 1P1RA 3HXKA 4PQFA 3RC2A 3ETCA 1FS5A 2CN1A 2Q62A 3DTYA 2HAEA 4M1TA 2YNMC 4H6VA 4L3OA 4A1OA 1WUTA 2X2FA 1YBHA 3M4ZA 4RIHA 1AF4A 4BP9A 2R96A 5J4KA 3JASB 1DJOA 5JJLA 1NYLA 1ZK3A 1ZD4A 2GX6A 3BT7A 4ZOBA 1K9VF 1SUFA 2BMEA 4U39A 2EZ9A 4ZOAA 1OBVA 1C4XA 2BLLA 2OAP1 2IP2A 4M0MA 1WKVA 2G09A 3RIMA 4QZVA 2QP9X 4FYKA 5HMMA 5CYGA 1EBFA 3Q3VA 1NR5A 1UK7A 3BOSA 3JWHA 3K0AB 5EWMB 5H80A 4TMXA 4BE9A 4PTZA 2B1RA 5IKEA 5CTAA 4O29A 2V1XA 4MKZA 2PH1A 3UB2A 4H35A 1JZTA 4O1MA 3HNOA 3K1JA 5TGTA 2HPAA 3SJCA 5JUWA 4AXXA 5JDCA 1E2DA 2JFBA 3IAUA 1J70A 4W1SA 4EYSA 1E62A 1JECA 1CF2O 1XMVA 5CP8A 4QATA 4YNBA 4BMVA 4OX9B 1MF7A 4HUQB 1VMKA 2BGNA 2WQZA 5BSUA 4YUVA 3WJ1A 1DC8A 3ZDBA 4D42A 1QHXA 1JLLA 1R4MA 2WYHA 3L6RA 4IW3B 2Q07A 1AGXA 1NY5A 2P4UA 2W6QA 2WFLB 1AS0A 4X84A 2F48A 3LT2A 4B17A 1R8YA 1PL7A 1M1UA 3H83A 1QCCA 1D1PA 1ZNXA 1SCDA 4KJXA 3ZDCA 1OB5A 1M5UA 3JQCA 3RRZA 4JBHA 1WQ4A 3D6JA 3Q2OA 4Q0MA 1WSWA 1AKTA 1KMQA 3MSCA 1J1ZA 4I1IA 4KPUB 3U3JA 5HVNA 5JO0A 2OBXA 4QQ8A 3ESXA 1EFKA 1K8RA 1ZC3A 3ZZTA 3AEZA 4JGBA 4G09A 4JS0A 2CMKA 4DL9A 3TN7A 4MVYA 2XWJI 1M1NB 3UGQA 1HDCA 5IF3A 1HURA 2WI8A 2ZE6A 5F2KA 1YI1A 1U5BB 1RRKA 3QE3A 4ZFNA 3M70A 2C94A 2RHBA 5ER6A 3W5UA 5DULA 4D6PA 4OBBA 5JHHB 1NHGA 1M1YE 1ZSNA 5K51A 4A7PA 3F4LA 3KSRA 2H52A 1EGAA 1GYPA 3KB8A 3GJ8A 4UZEA 3JQ7A 5A71A 2P1DA 1NUHA 2D4AA 4HX5A 1SULA 2Z8ZA 1XQ6A 2OORC 2GPSA 3C3DA 5REQA 1KBZA 1C7QA 1XRRA 2ZVQX 1RXIA 2R7LA 3D8UA 3TTXA 1AUXA 1K6IA 3WMGA 4DR2B 2I4TA 2QIPA 4HNAB 4ZYWA 5B4UA 1XD2A 3GLUA 2A6PA 2Y1OA 2YZGA 1H05A 1W75A 2KX7A 4M1KA 1CLEA 1KBOA 1X8KA 2P9BA 5FV7A 1IY8A 1SUWA 3CPJB 1U65A 3FAKA 1U8YA 2IS1A 4URVR 4B3TB 4ZJPA 3EJ6A 1JQLB 1VXRA 2CEAA 3SZUA 5K3SA 3UV7A 1ORDA 1M2EA 2JBWA 1JSLA 4IO0A 1N36B 4IJVA 2H8GA 2PUHA 3BMQA 1PE0A 2ZU6A 3K0BA 3RRNA 5JFOA 4TMYA 1A8UA 3GDFA 1KAOA 4RL4A 3I23A 3V1MA 3AVVA 3L92A 2BYTA 2FDXA 4FYYA 4TMFA 3I5AA 1X1TA 3CH5A 3CX3A 2VYVD 4HLDA 2CYAA 3RABA 5HKBA 2XB9A 1P74A 4IG9A 3C5EA 3VKWA 4AY5A 2ZM6B 3GPLA 1SC1A 2QL7A 3GX1A 4AJ2A 1L4KA 5AI5A 1Z0FA 1NZFA 5B1HA 1SXJD 4LDJA 4OMDA 2EGUA 4Q6WA 4MRMB 2WZBA 3A1WA 3LIPA 4YJKA 1S5PA 1G5TA 4HLCA 2BJWA 4XWWA 3G2PA 5IUKC 4NFLA 2BSQA 5IKPA 2IYFA 1G5RA 4MW5A 5JS1A 5T3YA 4XKJA 5IAEA 3NHFA 5JFTA 2IYWA 1WULS 2R48A 3NNDA 1MABA 4OO3A 2I2CA 1E64A 3IVCA 4X71A 5J1TB 3ETDA 4C0HA 5BV1A 7GPBA 2F7SA 3TAXA 2I8LA 4HDSA 2JC3A 2ZUWA 4U7JA 3T3EA 1KKMA 2I1QA 3R3HA 2WU1A 4G24A 4CMIA 2HJRA 4S1PA 5EP3A 4IXDA 2FFJA 4L0QA 3E9QA 1FTYA 1U8UA 1VYHA 1BXGA 2QY9A 3O2SB 4QQFA 4K9SA 4E46A 1TCBA 3UQZA 4U7DA 4OBWA 4RKWA 3DPUA 4NZMA 3DQPA 1O8BA 1Y9AA 1RBYA 1F6BA 4W5JA 1NJGA 1YB6A 1G2IA 3SZLA 1NLUA 2B8TA 3QMVA 4YT4A 1VJ5A 3N2KB 1L3CA 1K75A 1QRDA 3LUFA 5I4IA 4N6NA 1W7AA 3O0DA 1T9KA 3TVTA 5JS2A 5CA1F 5JXIA 1US8B 1RYHA 1ABEA 3AERA 4G1BA 3IUMA 2BC9A 4A2PA 2VDUE 1QE0A 1KWGA 3CF4A 2IYPA 1T5IA 1PQUA 2ZI7A 4OVKA 4MB0A 1AS2A 4TT8A 4A4DA 4F3RA 4RETA 3NDBB 4DC1A 1P7CA 2VWPA 2XV1A 1ZG3A 4MPRA 1G5HA 3RYFA 3RS3A 1GPNA 1QO0D 5IDWA 5JIBA 3KOZA 4Z6KA 4LF9B 4CKZA 1DAIA 2PS0A 1GGEA 1RXUA 2J45A 2VDMB 4YAFA 4CKBA 2ZM5A 4UM9D 4JJ4A 4N5LA 4HP8A 2I2AA 1ES9A 2RIRA 4RWZA 5E3JA 1E1DA 3TTYA 2MTBA 5CIYA 1M5TA 4XGIA 5FQOA 4ND6A 3BYZA 4P86A 1MP0A 2HO4A 4Q9NA 1Q91A 1GTSA 5BSGA 4DA9A 4EKIA 3LZDA 2DFTA 1GNVA 5E1MA 3TJZA 5K01A 3DM9B 1EB9A 1NQAO 1TF2A 3AUUA 3EEOA 1AZTA 2ZSJA 3AIMA 3NVDA 2QRLA 5AIAA 5FF9A 3QVVA 3W5HA 4XTCS 4TV9B 4BASA 1U2SA 3SEAA 4BYGA 1QYIA 3MCZA 3PTZA 5I45A 1EVJA 3E7DA 3NHUA 3SKYA 2CNLA 3PQCA 3A1NA 4G37A 4CM8B 4DNFA 4DYDA 3OJLA 1QZTA 1K68A 2MJLA 2ZSBA 3H11A 1GO2A 2WRZA 3IVRA 2NZVG 4DZRA 4QGSA 4IS3A 1NHWA 1VJGA 2BDUA 3GPIA 1E2HA 1JE0A 1EWVA 1UXGA 2ZRCA 4X54A 3ZHTA 4RVCA 1P4SA 5GZ1A 4Y2QA 4P58A 1LA2A 2QAGA 3EXEB 1P3JA 2IZZA 3RC7A 2J0QA 1G6HA 5K0BA 4AY6A 3DYVA 4MPPA 1WSAA 4G07A 1KY4A 2GNOA 1BXKA 4CRWB 4JEMA 2PLWA 4M0DA 1EP2B 4JT4A 3EZ6A 3NHYA 3AIKA 5IHPA 4A0HA 2RFLA 2CFTA 1QCYA 2HV9A 1QOQB 2VT7A 3RUDA 1TLLA 5DNAA 1Z16A 1Q7CA 2J0UA 4FFSA 1RLIA 4WN3A 3RVBA 1QGUB 1NW9B 1Z17A 2H4ZA 1I7PA 3B5JA 3X2SA 3I2HA 2BFPA 3E70C 4GP9A 3CZ5A 4OLFA 2GJ9A 3C6ZA 3M6XA 4Q4LA 4RFVA 3VOSA 4GI2A 2J9YB 1SQ5A 4UUNA 1USVA 1QYWA 4MGEA 4UE2A 3W7BA 5EJ5A 1PNRA 3P71T 2AWNA 3TNLA 1ULSA 4C4RA 4U2BA 2RC5A 3CX6A 1BKDR 3KKOA 4FFLA 3TNYA 5EQTA 4R1TA 3CW9A 4MX8A 2WQ7A 4K0RA 3O8OA 4QPDA 5J2UB 3R40A 4DHEA 3IUPA 1QCDA 2PFSA 2O8CA 3AGPA 1WIWA 2YMMA 4OPMA 2IELA 5TF0A 4FN5A 4BO2A 1O95C 4D4JA 1Y5IA 2L42A 1FMLA 5FBHA 1GZUA 3C1TA 3C87A 4DAOA 4EP1A 3GA0A 1XMJA 5CLLA 1N6LA 3GGOA 3CKMA 1ML3A 3TQQA 1SQ6A 1XZLA 1GNPA 2RHDA 4URYR 3R75A 5KEIA 1Z0JA 1C3EA 2HEIA 1JHUA 2ZUVA 2XT6A 3F7MA 4HX2A 1B8NA 2COEA 2CK3D 1IC6A 4RF3A 4LZJA 7REQA 2H18A 2GESA 1HFKA 2WUFA 4U2EA 4LF8B 4YWJA 4Z4EA 2R1VA 3FPAA 3H8VA 2AT1A 4G8JA 1L5QA 3UUGA 4OYHA 3P19A 4B9EA 4O2BB 1XBTA 4IJMA 3FMPB 2PGDA 2GD1O 1OXUA 1FYEA 1YVUA 3P8ZA 4MI9A 3ZGZA 4E70A 3CKLA 1C2TA 1TIPA 1LLQA 4V02A 4AKSA 2NU7A 3DE7X 2ID7A 1UC8A 4JUIA 4C0QC 2A8YA 1O4VA 1PZXA 4HB0A 2FLKA 2X6RA 1AS3A 3IMEA 3KTFA 3VSEA 4ALKA 1QO9A 1TQ2A 3EG5A 4BGUA 4QDJA 4X00A 3QM1A 3IP6A 3HBLA 1O5IA 3A2LA 2FB9A 3GJSA 4DT1A 1TECE 2V3VA 4WMLA 5JEDA 2A88A 1QRUA 1JDPA 1N1MA 3RS0A 4BGEA 1TCUA 3PFCA 4D4HA 3PHIA 3MGGA 4RWEA 1D1QA 1OHHD 5EMLA 2YV5A 3VU1A 3WGQA 4KIUA 4MYCA 1DAKA 2BTQA 1PDVA 3NOQA 4AJKA 4CF3A 4OHZA 1YHYA 2X0JA 5J2UF 3S4YA 2IHJA 1Q1QA 4DGSA 5HOEA 4ZPXA 1RLJA 3B5EA 4JROA 2AK2A 3O1IC 1XXHB 3L79A 5CBPA 4JVLA 5K8JB 1DQPA 1WM1A 3B9RA 3HXOA 3O1JC 5C8YA 5KUTA 2XKAA 3LX4A 4K6GA 5KOIA 3LUKA 4YCBA 2HGZA 1QHHB 2PQ6A 1MO6A 2W2TA 1BDBA 2QM7A 5TF4A 4DIOA 4KR2A 3OIDA 2D1QA 3C2QA 1NF2A 1W19A 3OFND 2HIGA 2Y1CA 4O3FA 2XY4A 3E15A 3L7IA 4C0XA 2ZTVA 2QE6A 1EGMB 2GASA 4LISA 4FFBA 1XU9A 3HCOA 4O2BF 4CMAA 4DCTA 4NZOA 3WWDA 2WAOA 3EPKA 1K8QA 1NG9A 1O7JA 5IJ9A 4AKGA 5AVRA 3C74A 5DNCA 2W48A 2Z4RA 3L4EA 3JQGA 3LZ6A 1ISFA 1TC2A 3UMVA 2Q28A 1C9YA 1RLOA 2QTVA 4BLPA 4NE9A 4Q1BA 4DMKA 3INGA 3RW9A 3L6DA 3ASZA 3DVAA 2ZETA 3MMPA 4PC3A 2GAAA 3H84A 2A33A 3EGXA 1E20A 1GT91 3EY9A 3GEIA 3S2SA 4TROA 3TOCA 4CWAA 2VPWA 2XVXA 1TZBA 4A8PA 4DABA 9LDTA 4R7ZA 1KYVA 3I09A 1JAHA 1L0BA 2GERA 4OAQA 1NXVA 3PQ2A 4M0FA 3AQ4A 2HT6A 5B58T 5D87A 2JGDA 2A1UA 1IN8A 5E9AA 4R8KA 3RSZA 1ZK4A 4A91A 5I7VA 3FOCA 3P0HA 3OJWA 1NVKA 4TVKA 3QELA 4CTJA 2OCBA 1GQSA 2XBLA 1JFFA 3A3NA 3PXDA 1J0DA 4JVSB 5ARDA 5KSWB 4QT4A 4L8GA 4FE4A 1IJEA 3RJ9A 2XUZA 5ABPA 5T7BA 4GOLD 5JAIA 1VG9B 3K4PA 1TVKA 1J8DA 1EJ6A 2VAXA 1S01A 3SMVA 621PA 1SKBA 1ZIOA 4X3CA 1DU4A 2QQEA 1H69A 2DC1A 4AJEA 1G8MA 2IKSA 1N0HA 3S8MA 4E5MA 3M5DA 4B87A 2OXRA 4OREX 3HU3A 4WERA 1O77A 1FFBA 4EEZA 4GP7A 3CCCA 3LV8A 3QBTA 1SXHA 1DWOA 4LZNA 5DLDA 3GEEA 4HLQB 5EXDA 3TQSA 1G2QA 4PQGA 3WGJA 1XKXA 4HWOA 1NI4B 2UZ3A 3NOOA 2G1UA 1Z8NA 1U9YA 1NPYA 3B1VA 3UOAB 1O97D 2IHUA 3HMQA 3MTDA 3WQRA 4B6OA 1VPWA 2I91A 2WF9A 4KO3S 3C3AA 2ZBUA 5AKYA 3FPSA 2P90A 2JLQA 2HHJA 2OXTA 4JB0A 4DIKA 5KVSA 1T1EA 3RRFA 4B3DA 3QJYA 2ZKIA 1PSZA 1IAVA 2BI7A 2E2WA 2O8NA 4M8SA 1LI4A 4HGYA 1KS2A 5H82A 3TNJA 3UPUA 1WG8A 1Z08A 2NZJA 1B8UA 3Q8LA 4RCVA 2YVUA 3HR8A 3Q3JB 4U3JB 3HI4A 2FEMA 5HSGA 4RKFA 1W6UA 1XZAA 3DZIA 2FWAA 5G02A 1C3XA 4D9MA 1BDHA 1ADBA 2DQKA 4H1UA 1C29B 3A9SA 1P1HA 2JGKA 3FYUA 3G8YA 2YXDA 3AWIA 1GU1A 3BXHA 1M2VA 5EY5B 3W2HA 4CQMA 1ISJA 2XNDA 3O31A 3UFBA 3WSVA 2FWIA 3K8ZA 1EFR