4QDXA

Crystal structure of antigen 85c-c209g mutant
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
277
structure length
271
Chain Sequence
LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYGGNGTPNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
total genus 103
structure length 271
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qdxA00
1EVEA 3FAKA 3PF8A 3V1MA 3H1AA 1BCSA 2PBLA 4H7EA 3IUNA 4A23A 2CEKA 1MAHA 2XDWA 5EFZA 3F96A 1XZCA 2HU5A 1CR6A 4FLFA 2K2QB 4UFPA 3K9BA 3D59A 5AKIA 4K6KA 3K2IA 3H18A 1XZEA 4Y2QA 4Z49A 1SFRA 4KE7A 1ODSA 4CCYB 1EVQA 1QO9A 1DT3A 1Y37A 3AIMA 5AJHA 2WHQA 5JARA 4TVKA 1ZIYA 4UBNA 4DNFA 1DT5A 1CPYA 1GKLA 4C88A 4FWBA 1THGA 4MJ3A 5E4JA 5JAUA 2G5PA 4C01A 5BWCA 5K3BA 3DKRA 4KAJA 2BKLA 4K6GA 1YAJA 2E3JA 3WWEA 3DKKA 2WHPB 3D2AA 1MN6A 4I4CA 5K5EA 3ANTA 1MNAA 4Q34A 4XIIA 2WIJA 4J0IA 2BFNA 1H2ZA 3BXPA 4FFWA 4X85A 3WKDA 3LP5A 1BU8A 2JF0A 4LYEA 4EB0A 2BAGA 5BOVA 5HFAA 1P0PA 4KAAA 4LXIA 4FDMA 4B7ZA 1U8EA 4JEIA 1CLEA 2XMRA 4UHDA 5FPQA 4CCYA 3T4UA 1FSSA 1F0PA 3D4LA 5CMLA 5CXUA 4OB8A 3VKFA 1WB4A 5EIHA 1ZJ4A 2QZPA 4U2FA 2OCKA 4J0JA 5LYYA 2GBCA 4J0KA 4CG1A 5AK4A 4P93A 2JGFA 5AOCA 1R4ZA 5K3FA 4UFOA 4G4GA 2WJ4A 1H22A 4B83A 3OG9A 5YASA 5JANA 5JAHA 2O7RA 4HAIA 1X70A 4Y2RA 5LZ8A 5BWBA 2AJLI 3C87A 2GYWA 1QIDA 3RARA 4N8SA 4F21A 1XKTA 3N0TA 3R3YA 4DLNA 1MTZA 1CQWA 2OAEA 1BEZA 4BTLA 4MYDA 1FJ2A 1ZICA 3V9AA 4RNCA 4JUIA 5ISMA 2ECFA 1CIJA 5HKAA 1SCIA 2C58A 4D9JA 1GQSA 2DR0A 4KAFA 5F4ZA 4B6GA 4X93A 4RPCA 1AC5A 3TEJA 4J7AA 4EA6A 1XZBA 2WFLB 1GPLA 1LPMA 5FV4A 1VKHA 2QRUA 3OPMA 3WLAA 4H7HA 3GFFA 5D7BA 4AN1A 4BE4A 1A8SA 4BVLA 2O2GA 1UZAA 3KWJA 4NMWA 4HTAA 3PUIA 4RGYA 2P8SA 2XQFA 2W6CX 2AXEA 1QLWA 3ED1A 3L1IA 1QTRA 1HBJA 1K8QA 2PSFA 3BJMA 4BYMA 4W63A 1USWA 3GROA 1YB6A 2YH2A 4E46A 3SC2A 2HA0A 1QFSA 1Q0RA 1XZDA 5JD6A 2ZYRA 3G7NA 2GBGA 3F8SA 4INZA 4Q3OA 1AMNA 1WB6A 1ZOIA 1YA8A 1WOMA 2Z5GA 3WK8A 3IBTA 1XZHA 3VJLA 3AJAA 4YX9A 1B41A 5ALNA 3X3HA 4QWMA 5AM5A 1PV1A 3HI4A 3IVMA 3WKBA 1CUCA 4JYPA 5AKGA 1CUDA 3EQ8A 3G0DA 1AQLA 1DQZA 4KE6A 1VA5A 3JW8A 1ZD2P 3FCXA 5D6OA 3WYDA 3CXUA 3MVEA 2XMQA 1O6FA 5A62A 3KXPA 3GUUA 4DIUA 2H7XA 3IUJA 2Z8ZA 1Q0ZA 3DCNA 5AOAA 1LPPA 4LKOA 5T4EA 3WKCA 1ZIXA 5EHNA 1TAHA 1W6RA 5AI0A 2DHCA 5ALFA 3GBSA 4QDUA 3FVTA 5K3AA 2BGNA 1QE3A 1UOQA 2JGKA 3O0DA 1D07A 4FFVA 5FP0A 2JGEA 1NU8A 2OXEA 2JGMA 4AO6A 4KEAA 1P0IA 2CBGA 1EDBA 4G8DA 2ZJ7A 2H7YA 3ZI7A 3HYSA 2Y2VA 2X5XA 2GBFA 2HDWA 1L7AA 1IMJA 1ACJA 4TGLA 5AI8A 1TCAA 3B12A 4UBLA 2X76A 2C0QA 3GZJA 1U65A 2O7VA 2XMDA 2UZ0A 2HFJA 4N8DA 1K6EA 5LLSA 2WFZA 1G66A 4JH0A 3RK4A 4OYYA 5ALXA 2HA7A 2GYVA 3I1IA 1AKNA 2WM2A 1EH5A 2WSLA 3FLAA 3RKSA 4G4JA 1C7IA 4L3WA 2JBWA 4ARAA 2GZSA 3H2GA 1OILA 4UBJA 1AURA 1ORVA 3PFBA 4GLBA 2FX5A 2Z8XA 1X2BA 1MT3A 4FLEA 4BRZA 1WB5A 4DM7A 4H7IA 3O4IA 4OU5A 3U1TA 1CUJA 1R88A 4X6YA 2JEYA 1UKCA 2XUGA 3V48A 2Y6VA 1T2NA 1CQZA 1TRHA 4DYHA 3AZPA 4AO8A 4OYLA 5ALMA 1TCBA 4UHEA 3NWOA 4H18A 4L0CA 5AM3A 4DMKA 3E0XA 1P0QA 2V9ZA 3WK6A 2V98A 3F67A 1YAHA 4EY7A 1FFCA 4U2EA 1A7UA 4ZRDA 5T4BA 2Q0XA 1XLUA 3FYUA 4W9RA 2WKWA 4CIAA 1EI9A 1WPRA 1E5TA 1N5RA 1HDEA 1GGVA 3C6XA 1XRMA 2DQYA 2WUGA 1DX4A 4BTVA 2HA3A 1LBTA 1LPSA 3VISA 3SK0A 5AHXA 4BAUA 5KBYA 1XQVA 3DL7A 4HRYA 2XLCA 1CUEA 4ZGBA 3H17A 3DOIA 3CCBA 1Y7HA 5LKRA 2PX6A 1TIBA 3FSGD 4Y2VA 2C0PA 3IB3A 3ESAA 4OUKX 1JJBA 4G8BA 4ROTA 2VATA 1ZI9A 4WJLA 3D2BA 5K3EA 5T4HA 1H2WA 4FNMA 3AZQA 3WIBA 5HZGA 1BS9A 1MX9A 2VA9A 5LIPA 3EQ9A 1MJ5A 2ZJ6A 3PE6A 3WQHA 1ZGBA 1KEZA 3HJUA 3CCCA 1EDEA 3WWCA 1B6GA 4E15A 3QYJA 4MXDA 4C87A 4K5QA 1AZWA 1VZ3A 1SCQA 2WHRA 1IZ7A 1CUUA 4GDMA 2RAUA 1K4YA 4B9AA 2CJPA 4QLAA 2C5FA 2ROQA 1G42A 5FUMA 4FNGA 4BC1A 3KWFA 1EK1A 1ZGCA 4P92A 3G9UA 4I19A 1QTIA 2X8BA 5A7HA 1UOPA 4BDTA 3BJRA 1TQHA 3MUNA 4PNZA 5EGNA 1BCRA 2HM7A 4NZZA 3I28A 1ZJ5A 4WFKA 4BATA 4X91A 4U2BA 3H0CA 1RWQA 4Y9SA 1XRLA 1NX9A 3STYA 1GQRA 4NVRA 4ZV9A 5ALEA 5C81A 3VJMA 3GA7A 3M83A 1Y7IA 2WUDA 1A8QA 4ETWA 5CT5A 2QJRA 4EY4A 1GXSA 3O4HA 1YS1X 2C5GA 4X90A 5HF8A 1ZD5A 4KR0A 4B81A 4WFIA 3IULA 5CXXA 3QMWA 4AXBA 1QGED 5FPPA 2XLBA 3NGMA 1ZD4A 5IVDA 4X71A 5ALWA 5K3FB 2EEPA 1E66A 1QIMA 4CG3A 3G0CA 1FFAA 3BDIA 4H7FA 2VJAA 5DJ5A 3DYVA 2CKMA 2XUPA 4UHCA 1XZMA 1BN6A 4OPMA 1OXMA 1W75A 5JADA 1MX1A 1WHTA 5EHQA 5I9IA 3N2ZB 4J0CA 3Q8WA 1VE7A 2QUBA 1BE0A 4OSEA 3O95A 3FVRA 3UUEA 2FJ0A 4F0JA 2OPHA 2ACEA 4NS4A 2AJBA 1KU0A 1LPOA 3AFIA 1VOTA 2C7BA 3DL4A 3HLKA 3BIXA 3GELA 5AP9A 5AKEA 5ALVA 1ACLA 2QTBA 4C6HA 5I7UA 1GKKA 3G9TA 5D3ZA 5ALJA 5AKJA 3WWPA 1CUFA 1U2EA 3SX4A 3KD2A 2HA4A 5DTIA 3KSRA 2PU7A 3T52A 4P9NA 4YPVA 4IHAA 2XUOA 2HADA 4BP8A 4U2CA 3I2KA 5EIEA 3ZPXA 2B61A 1QZ3A 4IQ4A 1WCYA 1UT6A 2ZYIA 1BRTA 4FBMA 3H1BA 1J2EA 1UKBA 4W1SA 3G02A 3B5EA 3FCYA 4QDTA 1CUGA 4U2GA 3H19A 5EHZA 4X94A 1MAAA 4IH9A 3I2GA 1JI3A 2I78A 3WL6A 1CUHA 2YYSA 1IUNA 2XMCA 4RE6A 4XWGA 4ZREA 3WJ1A 2GBIA 5SYMA 2DCMA 3BF8A 1GZ7A 2HIHA 4S0XA 4GWLA 1HL7A 3TRDA 4X3CA 1N1MA 1CUIA 4MWTA 3VVLA 5AI4A 3U0VA 5I8PA 1XZJA 1XRNA 1UK7A 5FRDA 1HLGA 1E89A 3I1YA 4N5HX 4HS9A 3STWA 2J3DA 5DWDA 4X6XA 3TJMA 3HABA 1L7QA 3IA2A 3LCRA 1H23A 2DQZA 3D3NA 4C4YA 2BCEA 2BUAA 5A6VA 4UBKA 2OQVA 3STXA 1CV2A 4FLMA 1SCKA 1F6WA 4DMFA 4IH1A 3DOHA 5ALUA 2H1IA 1N8SA 2EDAA 3ZWQA 1LPAB 5KWIA 3E3AA 1ODCA 2DSNA 4DSAA 5AM2A 1UKAA 1QJ4A 2W22A 3H2IA 2VJBA 2PU5A 4L9AA 3C6BA 1ETHA 3G0BA 3WWOA 2BUBA 1O6GA 4UFNA 2G4LA 1A8UA 1N5MA 3VJKA 3C6ZA 4MWSA 5AI5A 4KRXA 5HK8A 1XQWA 2WLSA 3C70A 3DYIA 3BF7A 3B3QA 5CTAA 2ZYSA 4HXGA 1W1IA 3WIOA 3EQ7A 3K6KA 1JJIA 2VAVA 4Q82A 1QIGA 5CT4A 5HCUA 3A2MA 3I6ZA 4PSCA 4OB7A 5JZSA 4QWWA 3ICVA 4Y2JA 1E8NA 3IDAA 5IVIA 4DNQA 1QIJA 4C4ZA 3R3UA 4AX4A 4UBOA 5C8VA 4G9EA 1X2EA 3H2KA 3V1KA 2WJ6A 3WA6A 2BGRA 4OD0A 4X6UA 2XQKA 1GPNA 2RIPA 1SOMA 1JMKC 4UUQA 2WILA 3A6ZA 2VSQA 4HXFB 1VZ2A 2WIDA 5AKYA 5ALGA 2PSEA 5ALKA 3D7RA 3S2ZA 2VAXA 4M0EA 5A71A 3M81A 3QPAA 1DU4A 4WDRA 5LZ5A 1LLFA 3R40A 1MX5A 2G5TA 1XZFA 4FBLA 2NW6A 2XUAA 4HXEB 4LIPD 3L1HA 4AMZA 4OCZA 4UPDA 2B20A 4G5XA 3SWWA 5A7FA 5JZBA 5C7YA 3FYTA 4GEGA 4Q1VA 5FLKA 2PVSA 1IZ8A 4AQDA 2Y6UA 2BJHA 4WCVA 4ZXFA 2WUEA 4AN0A 1ODTC 5CT9A 5ALLA 3ESBA 4DTCA 4X7BA 4W1PA 3D0KA 3RM3A 4MQMA 5DYWA 4TPKA 1YSCA 1QOZA 2HA2A 4QDOA 1UFOA 5JALA 4EUSA 1T4MA 1DQYA 1XZKA 2D5LA 3IUQA 1XLVA 4ZI5A 3STUA 2CMFA 1YA4A 3WK5A 1UXOA 2QJWA 4B85A 1AUOA 2VJDA 4B9EA 1DWOA 4BRSA 1CVLA 1YCDA 2I03A 1LNSA 4AB1A 1QIEA 5SYNA 1J06A 2XMSA 4WDQA 5AI6A 3ZLVA 5IVHA 4MYSA 3FLBA 1H2YA 1PFQA 4QE3A 4BAGA 3ILSA 4M0MA 3WA7A 2PKYX 2RHTA 2OGSA 2OGZA 4QLOA 1ZI8A 2H9YA 2ZYHA 3PDCA 1J1IA 4HRXA 4GECA 1FFBA 3RLIA 1I6WA 4Y7DA 2XE4A 2ZSHA 1XRRA 2XMZA 2HL6A 5A7GA 5AKHA 4EZIA 5IH7A 3EBLA 3E1GA 3DLTA 3ANSA 2FJPA 2XI4A 4PSDA 4B84A 1E8MA 4EY8A 3HRHA 5CBKA 2J4CA 2WJ3A 5FDFA 4PSUA 4J0HA 4IO0A 1EXWA 4YASA 4BBZA 5JD5A 1EX9A 2HRRA 2XUFA 4A16A 1C7JA 4FMPA 1LZKA 1JU4A 3EF3A 5KREA 5D3KA 4I3FA 4DGQA 1TCCA 3FYUC 3ZV7A 3V1NA 3C8DA 4CFSA 5H3HA 1XZGA 2XUIA 1XQXA 4GBGA 1JKMA 5EIAA 3STVA 3NOXA 2CUTA 4E14A 1NU6A 4PW0A 2HRQA 1DWPA 3AIOA 4KJXA 5CH8A 1VA4A 3H2HA 5CH5A 1IVYA 4Q3LA 1XRPA 5E2IA 2DFPA 4DNPA 3QPDA 5AIBA 4X92A 4Q3KA 1K5PA 4Y2TA 5AKKA 2Z3ZA 1VLQA 1R9MA 2XUJA 3P2MA 3UUFA 4H7JA 2EDCA 3AINA 5IKXA 2R8BA 4MQLA 4H0CA 5JD4A 3BWXA 3WZMA 4KACA 3R3VA 3AUKA 3C43A 5LKAA 4RE5A 4J3JA 1GPKA 4X95A 5BV7A 2HA5A 5LZ4A 5ALOA 5AM0A 3ZLUA 4Y2YA 2OLEA 3DJYA 1MPXA 4PQEA 2AJCA 1WPXA 3G8YA 3G0GA 4EY5A 1SC9A 2WU4A 5AKLA 1EHYA 5LP1A 2H7CA 4FHZA 3QVMA 2HA6A 3R41A 4C4XA 4QEKA 5DYTA 5AH0A 2OGTA 3PICA 2HHAA 2JGJA 4BC0A 3FLEA 5DLPA 1CUAA 5ALYA 1LPNA 4J03A 3YASA 4B80A 2XQGA 2XUKA 4FOLA 5DNUA 4K6HA 1E3QA 2PSHA 3IURA 5ALIA 2QXTA 1UOOA 5CH3A 4QNNA 1GT6A 2QVBA 1R3DA 2VQ6A 3OC0A 2VEOA 3W9BA 1DX6A 3JYHA 3M82A 1W76A 1XZLA 2WQZA 3WL8A 2VT6A 5C8ZA 2QT9A 3I2IA 4GHWA 5CURA 1CUYA 2O2HA 3OOSA 2PUJA 5DTJA 4BDSA 3PF9A 2PSJA 3A2NA 5AOBA 1H2XA 3FSGA 4QDXA 4CI9A 2VJCA 4F60A 4P08A 5CW2A 3E4DA 2WIGA 4H35A 3DD5A 1WHSA 1QIKA 3O9VA 2OQIA 3PUHA 5T4FA 5JYCA 2WG0A 5AK5A 3EIOA 1UK6A 5AKZA 1ISPA 2XMGA 5DNWA 1L7RA 2WTMA 5EHXA 1BN7A 3DNMA 5LZ7A 4H7KA 3VVMA 1EINA 4YK7A 3JWEA 5CRIA 3QBJA 3OTQA 1EA5A 3R3XA 3G0IA 4HZGA 2PUHA 4AZ3A 3DDUA 2WIKA 2ORYA 4UBMA 4FKBA 4CIBA 3MUOA 4J0GA 1P0MA 4KE8A 3AIKA 3G9XA 3KOOA 2QM0A 1CUZA 2G63A 1MO2A 4Y2XA 3WMRA 1QFMA 3FBWA 4XJVA 4DSZA 4LXGA 3PI6A 5JZ9A 2CZQA 2J4FA 1QIFA 1CEXA 1HKHA 3R0VA 3C5VA 1EDDA 1UWCA 1M33A 1EB8A 1JT2A 2XUDA 5CT6A 1W4LA 1UK9A 4W1RA 1DTEA 2AJDA 2XQJA 3NUZA 5AO9A 4DNOA 4DMHA 2BUCA 3DQZA 1AX9A 3F98A 4XVCA 1FFEA 3PFCA 4BCBA 3HSSA 3L1JA 1FFDA 3O4JA 4EY6A 1LZLA 1LGYA 4UBIA 2HU8A 2ZJFA 2XB6A 3QM1A 5J3JA 5HQ3B 2VT7A 1YS2X 2I3ZA 2XUHA 3C5WP 2QXUA 5ALRA 4EBBA 1MNQA 2O2IA 5HF5A 1XKLA 3D2CA 1WM1A 2IITA 2RONA 7YASA 4F5ZA 5C8XA 5ALSA 1THTA 3STTA 4KRYA 2HFKA 3BIWA 2HU7A 1HQDA 3O4GA 4H77A 5AM4A 3WL5A 3H2JA 5HK9A 3FYUB 4E11A 2AJ8A 2I3DA 4PO3X 5IVKA 2GZRA 4B0OA 3ZLTA 4BAZA 1AGYA 3HEAA 3G9ZA 3BE8A 5ALTA 2OCGA 4H7DA 2R11A 2XUQA 3WL7A 5JATA 3DS8A 4QDZA 1IUPA 2B9VA 3C8HA 1C4XA 3W2TA 2YASA 3WWDA 2WUFA 3VDXA 4UHBA 1PJAA 3O9MA 2ES4A 3CN9A 4O08A 5FXMA 2OCLA 4BZZA 5K3DA 3LS2A 3H04A 3IUMA 4B82A 1VXRA 3ESDA 4PV7A 4LHEA 4UHFA 5K3CA 5LZ9A 3HXKA 2PPLA 4L72A 4X00A 2QR5A 4Q05A 4BCDA 4IH4A 3W06A 3WYNA 4W1QA 3I6MA 5E4TA 3C45A 2DHEA 1VJ5A 1UK8A 1LPBB 5ALPA 4Y2SA 3DEAA 4JNCA 4JYMA 5EI5A 4N5IX 1IUOA 4MEBA 4AO7A 5HKBA 5KWJA 3AZOA 4AZ0A 3ICWA 3QMVA 2ONCA 4MEAA 3FOBA 4UHHA 4Y2PA 2ACKA 5AIAA 2RI6A 4BVKA 1XQYA 3Q0TA 4LYDA 4G4IA 5JAOA 4V2IA 3WK4A 3HC7A 3AILA 3D5EA 3F9CA 2XMBA 1MU0A 2PL5A 5HF9A 1JJFA 2C4HA 2Y1KA 5HF6A 2JEZA 4A5SA 4XX1A 3W04A 3QH4A 4KYVA 4G8CA 2XT0A 5FKJA 4DMCA 3TGLA 1CUWA 5JASA 5ALDA 4ZV7A 1XLWA 4GW3A 3VXKA 5E4YA 1QIIA 3F97A 1Q84A 5HQ3A 1XRQA 3LIIA 4G9GA 1QO7A 2Y2UA 3LIPA 3I2JA 4WFJA 1DWQA 2WU3A 3M3DA 1YR2A 4EHBA 4CG2A 3QMMA 1U4NA 3C6YA 5AICA 3WJ2A 2VTVA 2WTNA 5AK6A 1S8OA 1R9NA 1A88A 2IIVA 1HPLA 2WG2A 2XQIA 4CCWA 5CT8A 3I2FA 2WFLA 2CB9A 2OG1A 1TKRA 2OAGA 1JMYA 4X97A 3WKAA 1K63A 1TK3A 1F8UA 4N8EA 3WK7A 2OCIA 1BROA 3IIIA 5AKXA 1YB7A 5ESRA 2DHDA 3A70A 4BCCA 4GXNA 5DNVA 2RGUA 3UMJA 2QKYA 1RYYA 1CUBA 3LLCA 1YASA 3W05A 5LZ2A 3W9UA 4OU4A 4C89A 1DINA 2QMQA 3WK9A 2QOEA 1ZD3A 1R50A 6YASA 4PF1A 2JIDA 4BP9A 3QITA 3S8YA 1CRLA 4ZWNA 3WZLA 1CUXA 1QIHA 2V97A 4QZVA 3ESCA 2WHPA 4Y2UA 3WKEA 2V96A 3QPCA 5ALZA 2WIFA 1QONA 4KE9A 1CFJA 1ORWA 2B4KA 1JU3A 1KU6A 3A2LA 2IX9A 3MGAA 1G4HA 1R1DA 2ZSIA 3BL8A 4J0DA 4FTWA 2FUKA 4WY5A 1VE6A 2QS9A 2WG1A 2QUAA 5AK3A 2YXPX 1Q83A 1F0NA 1CUVA 3QZUA 5AM1A 1XROA 4ARBA 1EK2A 4K2AA 1CUSA 1JFRA 3CN7A 5JIBA 4WY8A 3KDAA 3HACA 5FOQA 4LXHA 5A2GA 1LBSA 1XZIA 5DYYA 2PSDA 4U2DA 1VXOA 1EB9A 1ZI6A 1E8DA 2J3QA 4OB6A 2D0DA 4BE9A 2JGLA 3R3ZA 4B0PA 2VF2A 2GYUA 4QA9A 4GI1A 2Z3WA 4M0FA 4BZWA 2LIPA 3BDVA 1J07A 2RHWA 5JAPA 2ZVDA 5ALQA 4BVJA 1XFDA 3OM8A 1XZAA 2JGIA 3V1LA 5ALHA 4ITVA 2WFMA 3FWHA 2PM8A 1OCEA 4HVTA 4AMYA 4G1FA 4BB0A 3WI7A 3HZOA 1BEEA 1RP1A 3I6YA 5AI9A 1G5FA 1Z68A 3I2HA 1W52X 3FNBA 3OURA 3R3WA 5HFNA
chains in the Genus database with same CATH superfamily
5FWAA 2CFTA 4IFEA 3BQNB 1U0LA 2ZR0A 1BVYF 2ZIZA 2A88A 4TYYA 1WUIS 1HXHA 3P7MA 3MWEB 4DE5A 5KNDA 3M3PA 1WETA 1QG0A 2YNMC 1ZUNB 3BG5A 4IQ8A 2YFYA 4LZLA 4LAFA 2H4FA 4GEKA 3DYBA 4BNIA 4NU8X 4YLEA 1D6SA 3MTEA 5K1ZA 1QF6A 1J25A 2CEKA 1M2JA 2XDWA 3G2HA 4N03A 1OIWA 4ITUA 4B33A 3C3YA 4I55F 5FULA 2HU5A 3RVDA 2ZZNA 3IEKA 1ISRA 3HB4X 2C97A 4KBYA 2HGZA 4W4TA 3L8YA 2NSLA 3H4MA 4MVJI 1QWSA 5FLKA 3PCTA 3NBZC 2BEWB 3EFEA 3O2JA 3D59A 3WICA 5FIUA 2Q5LA 4JLPA 1WU8A 1D9XA 1N92A 1U7UA 2IZ6A 2Q2NA 3DTVB 1REQA 3U62A 3JU3A 3PT5A 1JDVA 3EVBA 2P5SA 4PR0A 1EK5A 1SFRA 4WE3A 3ZK8A 4AMVA 2VJMB 1ZD1A 1YC2A 4LRSB 1YB4A 2FPIB 4UUOA 1EVQA 4RJJA 3GLFB 1GOTA 3QUQA 2PLWA 4HDOB 1DOZA 2HQOA 4K87A 3ZZUA 3B38A 3SF8A 3NAZA 2VWQA 3SC2B 3IX7A 2WHQA 2R6FA 3WY9A 1P9LA 5ICSA 4MB2A 1V1MA 2CDNA 4XX0A 4H4DA 4DNFA 1GD1O 4R5MA 4KPFC 1OHHD 1SG6A 1CIVA 1KFBB 1GKLA 1Q14A 2PMFA 2XCQA 3DL2A 4LDZA 1BE1A 2WM8A 1IZ0A 4LRTB 3OHMA 4N7RA 2A1UB 5FQNA 2P65A 5JR3A 4FWBA 1THGA 1EXNA 1OJ7A 1SXIA 2M32A 1A98A 5ERGB 2E9SA 4D4GA 3P96A 1JR3E 4OHZA 1KA9H 1P72A 2B69A 4P7FA 1ZCZA 1FTQA 4MQ5A 1NBIA 5K3BA 3HXMA 5J2TA 1PVOA 4MULA 2KBFA 3K70C 2O23A 1B3BA 3C0KA 3DT8A 4FVTA 4PICA 3RS0A 2QTNA 3U61B 3A4LA 3KNZA 4YT5A 2J5RA 2J48A 1E63A 1DFHA 3VTAA 2Q41A 3FROA 3K09A 3OE5A 4IGKA 4XQEA 3OTGA 4NMLA 4PZ9A 2FQWA 3VAZA 4MKHA 1UJBA 1M6WA 3F1LA 4R16A 4DEYA 5C32A 5JXWA 1VKNA 1K68A 2M1ZA 2XT6A 3E3LA 2GAFA 2Y0PA 3PPVA 4U6NA 4KYTA 3QF4A 3MTAA 4TS4A 1ZAYA 3ROMA 2D5BA 1PNOA 3ROFA 2QAGA 2PKEA 2HWWA 3HJNA 5BOSB 4TTQA 4OHCA 1GGFA 4Q1CA 2FVXA 4K6FA 1KJJA 4X85A 3PNVA 4HAVA 3ND6A 4L9WA 3GLQA 1BU8A 4TTIA 4CKCA 3QW4B 4F2PA 1E79A 1HTTA 1SXJD 3GEDA 4UULA 1NVEA 2BAGA 2Q0HA 5HFAA 3M5DA 5EP1A 4AWXA 5M29A 4KAAA 4LXIA 3N5KA 3ZJ5A 3S55A 5KINB 1CP2A 5B1YA 5IEBA 1U8AA 2XMRA 4UHDA 3KJFA 1OBCA 2FPIA 1ZK0A 1N9GA 1D8AA 2XNHA 4FGLA 3T4UA 1ZGZA 4PZLA 4F46A 3W5AA 3E7WA 3LX8A 4LQ4A 3V42A 5BV8A 3MGGA 4UVGA 5HRCA 1U2DC 5GPBA 5LYJF 4UNPA 3QLUA 3GA5A 4QDJA 1HM5A 3VKFA 2MHCA 5KWVA 2ZSKA 1P0CA 2B3DA 1KZ7B 2GO1A 2QZPA 1Y6RA 2OCKA 1MAVA 1JEEA 2BRUA 1IVNA 2FR8A 4F2GA 1CZUA 2BFMA 2GRJA 4P38A 3Q8LA 4JI0B 1HI9A 4K8RB 4J0KA 5KTPA 5FLYA 4P93A 1N6HA 3C85A 2JGFA 3JQBC 1KR5A 1WBDA 1DMSA 4G5HA 1C7EA 1R6AA 3N76A 1ZMRA 1T6XA 4RU1A 1U9IA 4G4GA 3ISTA 3RUDA 2IXEA 5HM6A 1ESMA 2XVMA 2ZK7A 3TUZC 4X60A 1Z0AA 1OWOA 4FILA 4Q4CA 3BHJA 1ZL2A 4HY3A 4IJ5A 5EA2A 5LZ8A 4EKEA 1L5FA 1Y9ZA 2C03A 4V38A 1JAXA 4GMKA 3HN7A 4Z2AA 2DPMA 3C87A 1WHTB 5DRTA 4KZPA 2ZJBA 1KYWA 3DDOA 5IC6A 1Z4OA 1I80A 1YBHA 4QTXA 3DE5X 4WNCA 4B7UA 1FYFA 2XCLA 3KPUA 2GAOA 4D82A 3T1TA 2E55A 4OGGA 1RZRA 1MTZA 2CV2A 4IVPA 1CVIA 2ZPTX 4FW9A 4IXWA 3CNBA 3DTTA 4BTLA 5JVDF 2Q50A 1Z0ZA 4W99A 4N65A 3CLRC 3V9AA 5IRCD 3UJHA 5L45A 4IKOA 1H69A 5AW0A 1A2KC 5IFKA 2ECFA 3IBYA 1CIJA 2VWPA 5D5QA 1HSZA 3VSBA 3A7EA 1SCIA 3A9WA 4KV9A 3BFJA 4R7TA 1F14A 1HORA 1P5ZB 3COVA 4HQRA 5J1SB 3FKSD 4MWBA 2DR0A 2HCFA 1YI8A 4H59A 5I47A 3F2IA 5DLEA 3KXKA 1USGA 3W8FA 1JECA 4K9PA 3TEJA 1RBZA 3ABZA 4E2XA 1ABBA 3TXYA 4J7AA 1MDBA 1XZBA 2MYTA 3C16C 3CWZA 3CEHA 5D8DA 3RC3A 2MYPA 2QRUA 3LGSA 1U9IC 2FZVA 1NMYA 3EDOA 3OPMA 1XDZA 4H7HA 5TX7A 3GFFA 3V8EA 3SSMA 4D8TA 1Z8HA 5J43A 4LQLA 1A8SA 4S1WA 3V80A 3LT1A 1FE8A 3RT7A 3I4CA 4BVLA 1KWKA 2XZOA 3CG4A 1UZAA 5D1NA 1VC2A 4TTAA 4PFSA 1Q6YA 3OETA 2RKOA 3DVLA 1IHYA 2P8SA 2QT0A 3FSJX 4YP1A 4ZVPA 2P77A 1XTQA 5DPMA 1IN7A 3C3EA 2W6CX 5EQFA 3X1DA 5KS2A 4EELA 4KHPB 1K3UB 3ZV4A 5DLQC 1C3OB 2GVDC 1E61A 3A3KA 3ACDA 3AFNA 3LT2A 4JAVC 4BO4A 5HKOA 4GE3A 3TZQA 5HIMA 2A9FA 1QLWA 3DVQX 3H4VA 1WPGA 3P9CA 2EZ4A 1V71A 4M7RA 4Q7MB 5BYBA 1OB5A 2QD1A 2AMFA 3SMVA 1YUBA 1W2GA 3LOQA 5DBFA 1GTMA 2OAQ1 2OV8A 2WZCA 3AG6A 3QUCA 5DXAA 3WV4A 2QRPA 4DA4A 3HY6A 7REQB 1JB9A 2YVQA 4MVWA 4LF8B 2BI7A 3S1AA 4OQDA 1DCTA 1YB6A 4R8RA 4NK5A 2NNLD 3DBIA 4E2YA 5JSUA 2IELA 4US2R 1QFSA 5CVDA 2D0OB 3UB4A 4ACBA 2R62A 4AM8A 3AUYA 3ZWBA 4J16A 1U2SA 3EXIA 1ZDMA 1Q0RA 1Z5UA 3MUFA 4B3HA 2GEBA 1QDLB 3HJTA 1J2YA 1FTGA 1VGQA 2BGJA 4C43A 3ADKA 4NU0A 3A9SA 1PV4A 1T2EA 3LUKA 4Q3OA 5C1IA 5JLJA 1M10A 4KSCA 1WB6A 2QEQA 4GXQA 2GD0A 1EXDA 4FT2A 3N9IA 4F4HA 3ITNA 5KC9A 2BHNA 4WIAA 3MB5A 4KWCA 4GKJB 3H6GA 1QANA 2XE7A 1WOMA 4NOKA 1ELOA 3WK8A 3IBTA 4AUEA 4PN3A 2MTBA 3A8TA 4HPWA 3QJYA 3Q7SA 4MKXA 4LRQA 4F92B 1TXGA 4N7MA 4YX9A 1C7ZA 4MGHA 5HFJA 4Z4CA 1K8RA 4FNOA 1FUKA 4KFUA 2BI8A 3X3HA 3PLNA 4C9BA 4BE7B 3IR7A 3NBUA 5AM5A 4IO1A 1Z0SA 4O25A 1XGKA 2WD9A 1UMKA 5A1TA 1KP3A 3MWLA 5JSYA 1Z8DA 2VAPA 3HI4A 1TOAA 4ZAXA 1LSUA 3IVMA 5FD8A 4WXEA 2WAYA 3KJIA 1WUJS 1AN0A 1HMPA 4HDSA 3ZEIA 1CYDA 2BJVA 5AKGA 4WZAA 1P39A 1ULSA 2ZFUA 4QX6A 3C4VA 3OY2A 1Z4PX 3ENKA 5AMXA 2G08A 4GYKA 2XYGA 5IKOA 3PFHA 4DLKA 1I7DA 4CM4B 3T5MA 2H8KA 4G25A 1EDZA 2CCJA 5I3ZA 1GNRA 5FL7A 2PUAA 1D4OA 4ZZ3A 3WGIA 1ZR2A 4KE6A 5KOHB 2QI9F 3JW8A 5MN5A 4WLFA 2R6R1 4R83A 2QL7A 3Q8MA 3MERA 5ITZA 1BG6A 3C7CB 4DC1A 3FCXA 3NTUA 2J3KA 4B35A 1YJ5A 1E5DA 3H3FA 3OD5A 5C5IA 1XTKA 1A9TA 2IC5A 4RO0A 5AW8A 3OZWA 5J1TB 4QARA 3KZMA 5LR6A 2JLSA 1UWKA 1XL1A 3KXPA 4IIHA 4BPBA 5EWMB 1J8QA 2VF7A 1SBQA 2DGDA 3QV2A 2Z8ZA 3FMGA 1Q0ZA 2R6JA 5AOAA 4WBNB 4NNPA 3IPAA 5KQGA 2VH2A 3QEOA 3T9CA 2KLHA 4PHTA 2J09A 1EYZA 2ZQ5A 4JHLA 4N6GA 3E9QA 3T3EA 2GPWA 1E99A 3SF8B 2QVXX 4NFYA 4JP3A 4BV9A 4JJAA 1TKBA 1U0SY 1TAHA 5FBQB 5TF4A 3S44A 3PNPA 4MYHA 2F8SA 4YDQA 2JHCA 5ALFA 4JQYA 5FI3A 3GBSA 2XDYA 4LV5B 4MIKA 4TYNA 1C9YA 1UDAA 2REXB 1FUUA 2JARA 2CLEB 3K32A 2HH9A 4DDMA 2Q5IA 3OM9A 1QE3A 1TQ4A 1UOQA 1CKEA 2CN1A 2YQ4A 1XMPA 3F5QA 5BPFA 1T4CB 1U1GA 2X8JB 5H82A 3LPAA 3ZK9A 4EAAA 1IBRA 2DEUA 3FWZA 2MIIA 5ECDA 2PRSA 5DN9A 5C1DA 2P2NA 4KPGA 4DJFC 3NWJA 4B75A 5FP0A 4R2KA 5C46F 4XGIA 3AYZB 5GONA 1F51E 1ICEA 1Y4DE 3L4BA 3ETDA 4CDNA 1UJ4A 4ND2A 2JGMA 4EA8A 1PBNA 3OZIA 2FW9A 1P0IA 1O2DA 2CBGA 2RHJA 2JBAB 2ZJZA 1E1QD 2VZEA 4MP3A 4Q1EA 3ZZTA 2FNAA 1O0SA 2JHGA 2AX3A 4GYWA 4LC1A 4M53A 3TW4A 4B3XA 1TKCA 4BO6A 5HUHA 3BJEA 3QV1A 4ALMA 3P9KA 5B3LA 3BFVA 2ZOSA 3HYSA 4MUNA 1ISSA 4PRLA 1HC7A 5DYGA 3LGXA 3GCWA 5FADA 3REOA 4YRNA 2HDWA 3DG9A 1KERA 1FXSA 3JVEA 3PU6A 1YDMA 4ZI7B 3L1VA 1ABEA 1UMBB 5I48A 3L41A 4F71A 4QOSA 3SF0A 2C31A 4JJZA 3H2BA 5JUWA 2O2YA 4RL4A 5JNRA 1I1NA 2C84A 4OAQA 2C0QA 1DL5A 2YYAA 3GZJA 4OI1A 4ZYLA 1AK1A 2O7VA 3F4KA 2UZ0A 4NESA 1JHAA 2WLTA 5KU7A 1QLHA 5HXAA 4LYGA 1KAEA 3OCYA 3KR9A 2Z95A 1O8BA 1U02A 5LLSA 1PDOA 3F5SA 1EP3B 2FTKE 5M34A 1E5LA 2JIBA 1R8QA 5EZYB 1L2TA 4F04A 2CEAA 4MUXA 4OQEA 1ZMTA 2O0LA 4YQYA 4G09A 5B6PA 2FZGA 3SZ3A 3HXOA 3RKSA 5BR7A 4AJJA 1HG1A 1B8UA 4ARAA 2GZSA 3H2GA 4R9RA 3T5AA 1OILA 4UBJA 1UBLS 1W4ZA 1NY5A 3KKKA 3PFBA 2HSJA 4JCCA 4JGIA 3DQPA 1N9ZA 3ZW9A 4QVIA 2V3CC 3UHAA 2JKZA 3SNKA 3I3OA 5I9NA 2CFRA 1DKUA 2V6JA 1JFTA 2VDOB 2FGJA 3D4IA 3AM3A 2ZSFA 1P44A 2OILA 1CY6A 4FLEA 5CVJA 2Y77A 3OIGA 3OMXA 5AJVB 3TSYA 2A35A 4BRZA 4E88A 4H7IA 1R66A 4C08A 2HF2A 3H7AA 2KSQA 3DOEA 1C9KA 4X6YA 3F7TA 1UKCA 1Y0BA 4HI0E 2ZETA 2RFLA 1E94E 1NVTA 2BJWA 2XUGA 4MR8B 4NYMQ 1T2NA 2X2FA 3EWIA 3E03A 3PIDA 1TRHA 3KZXA 5BQPA 4R71A 1YONA 1VGVA 2VZ8A 2TMDA 1FQWA 3AZPA 1GKUB 2FZKA 3IV9A 2P35A 4KK3A 2GN0A 4YECA 4DARA 1GCIA 2IFTA 5CUQA 3N5CA 1CY0A 2VC2B 4I6EA 4JJEA 4RD6A 4RHCA 5E1DA 1VE5A 4H18A 4OQQA 1W5EA 2FPRA 4ZYTA 3CRW1 2FP3A 3M4ZA 2W90A 1YB2A 3QWAA 4D45A 2DBVO 1QGAA 1GV0A 2N9UA 2VQSA 3W5JA 2I2WA 4S1VA 3NQ41 3LZDA 4P36A 2IYTA 3T9FA 3TLGB 2I66A 5B3JC 1L4BA 1TCVA 3E0XA 3MCZA 4RPIA 3L49A 4RH3A 2V9ZA 1I0IA 2V98A 2JLYA 1HY3A 3GEEA 4V0NA 4EY7A 2LNDA 3GF4A 3HKBA 5CBPB 5ITSA 2O54A 2ODQA 4U2EA 1A7UA 3SKVA 3EMDA 1RI3A 1RMYA 1AU9A 4LBYA 5FWYA 1JSZA 1TJNA 1TW3A 1VLHA 4RDXA 4CIAA 3VMFA 1BWRA 1EGHA 4DCJA 1KI9A 3EG5A 2G9RA 2F8TA 2GHRA 2WTXA 3U4IA 1YOVB 8OHMA 1NIJA 3LNTA 2GX6A 2FW0A 4OMDA 4B17A 5L9AA 1GGVA 4AJIA 3C6XA 3VBCA 1PE0A 1RBMA 1XRMA 4RY8A 1Z3CA 2ZUEA 4ZQFA 3WVNA 4FYVA 3ZGZA 3FA2A 3GR6A 1DX4A 3M6FA 4BTVA 3AH8A 3OLVA 2PT9A 3I9FA 3OZXA 2OY0A 1K3FA 2DTEA 4IKPA 1LPSA 2V7QA 4G85A 1IHXA 3K92A 2PRJA 5M3BA 3SK0A 1XNQB 4Z1MD 1E7SA 1OBOA 1N2BA 3F7OA 4YRQA 3PENA 3DL7A 4CM8B 4DDWA 3E5MA 5I7AA 1CUEA 4C29A 3DOIA 4MAAA 4MKIA 2I7VA 3OEHA 1K92A 5G3YA 1CR2A 1W30A 1LEHA 1Y7HA 821PA 1IN1A 1YL5A 1OHHA 3JWIA 4AWBA 3NKLA 3I5XA 1TIBA 3RS8A 4Y2VA 2C2MA 1O94A 1O9GA 2WTEA 4ZGGA 4TS1A 1XTSA 2DFKB 2WW8A 4HH1A 1IRIA 4CKEB 1TKAA 1Z07A 4LXYA 4XCQA 3L77A 4C22A 5ADHA 1HE3A 1NT4A 4TM7A 3FNHA 1V5EA 4G8BA 4ROTA 3MHTA 1ZI9A 1KHTA 1XCPA 4IDBA 4WJLA 1G7TA 3UNXA 1ZR4A 2CK3A 2XVXA 2C3OA 3EGEA 5F64A 2YZMA 4JBWA 3IP7A 3LF1A 4DXAA 4BNVA 3V8RA 3WIBA 3DHYA 2GM4A 1PJCA 2AR9A 3V4OA 2I6SA 3G79A 1Z13A 2VA9A 4JQZA 5B7PA 1KIMA 1GUFA 1GYRA 2Y05A 3DUFB 1L4LA 2IUTA 2YXEA 4NZYA 3ETCA 1T9CA 3EQ9A 5C1BA 4JWKA 4XCXA 4BJHB 1KEZA 1QH9A 3GAAA 4Q1AA 1TJ4A 1M1XB 5BRJA 2JGRA 3HJUA 2WYHA 1LX6A 2GFIA 2PYIA 2VPWA 4JMLA 1XMSA 3WWCA 4LVCA 3QYJA 3AVXA 1T26A 5TMDA 4JUBA 1VZ3A 5DEIA 3BXOA 3H1PA 4S0ZA 2RHMA 4C7OB 1CDOA 1UR5A 1XAJA 3PUZA 5E7QA 1IZ7A 4CKBB 3BXZA 5G0UA 1CUUA 5DLDA 2IQIA 2QAGC 3NEYA 4RLSA 4BVHA 5A6SA 3BA1A 5JZMA 3JAKB 2RAUA 1ZGHA 3H6KA 2MCFA 1UADA 3F73A 4Y9TA 4Z4IA 4QLAA 2IX3A 2PXCA 4J4HA 2ZB8A 4IG9A 3OWHA 1ADGA 5TNXA 4AG3A 3UFBA 3IEVA 3U19A 1KVUA 3NWPA 2FEPA 3SXJA 1BE6A 3B8HA 1NVVR 4NBTA 1XDWA 2RBGA 5BWNA 1IQUA 4LX8A 1ZGCA 1CIPA 2NYVA 1YACA 1WUYA 2VNHA 3G9UA 3LQ2A 2PZBA 1QTIA 2X8BA 4I19A 4NPHA 4C4RA 1HH4A 5K9ZA 1PNVA 2IHJA 2MU1A 4BU0A 4ERNA 3BJRA 3EAFA 3LXMA 2FLWA 1TQHA 3MUNA 3T61A 4YCSA 1NVDA 2OZPA 1P91A 5EGNA 3IDQA 2HM7A 1DQPA 3V1UA 1NNSA 3VO8A 4ZQIA 2HBYA 2QLFA 1X7XA 3CRNA 3MF4A 4S05A 3U44B 1EUCA 4W8HA 3OJOA 3K0CA 1DMRA 1CWUA 2AN1A 2QTZA 5CLGA 1E1KA 1T2CA 4IGFA 4HUQB 1NQ5A 2V7VA 4G0MA 2D5AA 5FEMA 3VNBA 4PYMA 2XCSB 1VSTA 1OC4A 3GFQA 1ZC3A 3GLGE 2OBBA 3HSKA 2NLOA 2ZTMA 4QJIA 2QTGA 2DERA 3QE3A 4M9QA 2Z9CA 3VKVA 3NFRA 2EQAA 1WVMA 3PCXA 4D3YA 3B2EA 3URMA 4DT1B 2AJTA 3UHJA 4YAIA 2YHIA 3QEMA 4OLBA 4D9CA 3CUTA 3HU5A 1KVTA 1TGYA 1W44A 2W0SA 1AH2A 3B89A 2YV4A 5IZ4A 5JMTA 2VUTA 1S5PA 4ZICA 3GA7A 3M83A 2HUPA 1OI4A 5KSZA 1CY1A 2H1LA 3CS3A 4CKBA 9ABPA 4C4TA 1WF3A 3UT6A 4GSKA 4QGAA 2XJ9A 5MFPA 3GH3A 5E1BA 4ETWA 1SG0A 1P33A 2ACWA 5CT5A 2DXIA 2FFQA 4IQ0A 2YWBA 1ADJA 1AKUA 2MSCB 3LVFO 4JSYA 2LD4A 8ATCA 1H94A 1KY3A 2R1TA 3PRYA 1Y42X 2QQ0A 4GYYA 1I0LA 4QOHA 2CVZA 4WOPA 3TZLA 1EZ4A 2QAJA 2A30A 4LOHA 3EGVA 3GLIB 4KIWA 1Q3HA 2C2YA 3H9BA 3KYDB 1HNNA 5BQ5A 1OX5A 1PJ3A 4LDJA 1FP2A 1X3SA 4MV6A 2X9GA 2DKOA 1ZN2A 1C30A 1Y7PA 4UZSA 5JZOA 1QGED 2A58A 3NGMA 4YHBA 2XBMA 3EIUA 2GNPA 2W43A 3DHVA 3DMTC 1T8WA 4GPBA 5IVDA 4D42A 4YRSA 3SR4A 2BFWA 4DUZB 3VKGA 3UHOA 4JLUA 1KS9A 1ZJWA 4F3RA 2OL4A 6GPBA 4HK4A 3LQYA 2VP0A 5K3FB 1HZZC 2EEPA 5CB0A 4WESA 1EIWA 1CY7A 1QIMA 5KTKA 1Z2DA 2IDJA 3ASYA 4LZWA 1JIIA 4DIBA 2N42A 4KRFA 3CIFA 1HE2A 1MIOA 1HDXA 2PMBA 2AWNA 4EB8A 4PR3A 4ZOBA 3ULKA 4MRMA 4Y1GA 5BWLA 1T1SA 2O3JA 2XQVA 4CQJA 1OFGA 4MV4A 2GJ4A 2O1XA 3LHIA 1U7OA 4UHCA 3HU3A 1HSOA 3TLEA 2Q29A 2BW0A 4OPMA 1W75A 4C7MA 3I58A 3PDIB 4TV9A 1UJ2A 2WP0A 3K35A 4PPGA 3AEXA 4J0CA 2PJRA 2PT7A 3GGCA 3CZRA 1UEIA 4D92A 1W19A 5C34B 1NUSA 1GADO 5DM60 3A28A 2A5GA 4H6XA 2UYCA 3WZ2A 2J0QA 3WRXA 4Y7CA 5ICFA 5KOJA 1QQ6A 3HKCB 3DDZX 3KXIA 4LVUA 4GMHA 5E9JA 4R4JA 1EWRA 2RHGB 3L7KA 1RU3A 3WDMA 1KNXA 1VPVA 4OBXA 4EOGA 1MGPA 3H16A 3UOAB 1KQOA 5LDDC 3BD9A 3OKPA 5FUXA 1IHPA 2FJ0A 4TVSA 3LCVB 3GLGB 4F0JA 3L7NA 3CH6A 2ZDGA 3CUUA 2ZI5A 4H2DA 2CYBA 2OPHA 5B4TA 4CEJA 2PT5A 3B13B 1HV8A 4KSBA 4D4IA 4MPRA 4XAQA 1KWGA 3B2QA 3FCEA 4XFKA 2C20A 3FUVA 1Y5IA 2AJBA 3QE0A 1XFAA 4LUCA 1JG7A 3BPSA 4M88A 1CT9A 1DTSA 1RC0A 3AFMA 3IT1A 1PFWA 3INTA 4M3NA 4OVKA 3RF7A 1HETA 4C7VA 4PNEA 2EZ8A 1ITZA 3EZ2A 2D2EA 3GELA 4N3GA 5BUSA 1R6TA 1Z7BA 5AP9A 3TM4A 4EGCB 4ENUA 4JXXA 2ZUVA 4KDCA 421PA 1YTLA 3F0TA 5TDHA 1NDHA 2JIQA 4Q3NA 2BFDB 3RI3A 1CZOA 5A4DA 3L4KA 4A8TA 3PX3A 4Q9NA 1MVNA 2AFIA 3QXHA 1V5WA 4XASA 1CE8A 4Q9HA 4P34A 1IJEA 1JDSA 1Y7LA 2X6TA 3IYLW 4RXTA 3RU9A 5CFOA 1A2OA 2CYCA 3NT5A 4MP6A 3G5LA 4UUPA 4D44A 1U2EA 1HT0A 2GN8A 3ZBPA 1PD0A 3DE7X 1NOJA 3BB1A 4Z3DA 5COAA 3SX4A 1PAUA 4FMDB 4DG5A 4NF2A 4B87A 3ZVRA 1XCOA 2HA4A 4W5WA 3R5KA 1U0HC 3FMOB 4XQGA 4EG5A 4YAEA 2EKQA 3MS4A 1Q20A 2PKWA 3T52A 1FMFA 3VR4D 4TSRA 3ILVA 3OZVA 2Y4NA 2W71A 4RULA 1HDZA 2AD1A 2G1KA 3JPYA 2AD5A 3LV8A 2QW8A 4QYIB 4R40A 3ADCA 4KQJA 1E9DA 4U2CA 2FPGB 3W3AD 1FFXA 1DVRA 2TYSB 2YFHA 1C8VB 3THOA 2OECA 1FZTA 4IOKA 5P21A 3VR6H 1ZM7A 1K2WA 3ZPXA 5EIEA 4AKGA 3OT1A 4TTVA 2B4QA 2WSSD 1WNTA 2QTTA 4MO2A 3BWCA 3ET4A 4WXPA 4PZEA 1QZ3A 3VOTA 1UT6A 3LYHA 1PSWA 1YZNA 1O58A 3OF2A 2IKSA 4GMGA 1CR4A 3NTOA 2COEA 1P7VA 4IIEA 4RD1A 3ZKWA 3LX4A 1HK7A 1W0KD 2FSVA 2WWIA 3KT3A 4GOOD 4JR2A 4RA9A 2X41A 4BQFA 5K0BA 3L0SA 3D7MA 3HN6A 1K0UA 2F7SA 3VNAA 1RQXA 2HMAA 1VJRA 4ML3A 4JKYA 4U2GA 1T1EA 3H19A 1DZ3A 3I9NA 2Y76A 3NBAA 5HGJA 3ZGNA 5EHZA 2MMGA 5DN6D 3HCWA 4X94A 4MRPA 2PWZA 1MAAA 4IH9A 3TKYA 2Y9PB 2XNDD 1JI3A 1X9IA 4PIPA 2QPAA 5B37A 1NQWA 1V8BA 4OA5A 1T10A 4DA9A 4KNWA 3L9XA 3GZNB 3UK0A 2YYSA 3VNSA 4PGHA 3CURA 1KNQA 1IUNA 3P9XA 2ZRMA 4XWGA 1VL1A 1YHZA 4ZREA 4DR2B 3DHEA 4MIEA 5ED0A 5SYMA 3V8BA 3B1ZA 3VPCA 4EWLA 4CEIA 4UD2A 4X64B 2HIHA 3ZDXB 2N46A 3HUDA 4CZ2A 3K9HA 2OO3A 3QTTA 4FQ5A 1H6BA 4RW0A 3KPYA 3N0VA 3TRDA 3R8FA 4D9NA 4JI2B 1LBIA 2AZXA 3ORSA 1EA7A 4FI3F 1XDGA 3HPRA 4FBGA 4FNAA 2CDCA 4MWTA 4MUFA 1YFKA 4X8LA 4D25A 3NRJA 3OA2A 2B1GA 3PFWO 3WSTA 2E1RA 5HCIA 1UK7A 1UPUA 1XHLA 5FBLB 5FRDA 4DMRA 1E89A 1NKTA 2OO5A 3I1YA 5KJ6A 3O8RA 4HS9A 1WZ2A 4Y2GA 2HHHB 4GIBA 3AF5A 4GM0A 4X6XA 1UC4B 4CXMA 2A0XA 3DO6A 4YAJA 4CG0A 4KYUA 3LCRA 4G1EB 3X1XA 2HJWA 2W2LD 4RTLA 3FOCA 2VUIB 3MLBA 1K7SN 1NBAA 2PUGA 5JVDA 4ZEMA 5H4HA 3TFWA 1YDFA 2E18A 1GZ6A 4MR7A 1EFAA 1CEYA 4Y2HA 2Q6TA 4NJMB 2BUAA 5A6VA 4XRGA 5M5BA 1YNSA 4A7PA 2A1TR 5GTDA 2X3YA 1JALA 2E4ZA 2GAIA 3L1UA 3STXA 1CV2A 2HHCA 3DE6X 3HM2A 4TXJA 4YJ2F 2F3UA 1B15A 4DMFA 3W78A 1Y3HA 2GLTA 2QD3A 3B9RA 4MX8A 4G4SO 4PN7A 2XVZA 3EVTA 5LQDA 2CYAA 1X8XA 3CVWA 3Q3IA 3A1EA 1F06A 2AEMA 3FWKA 3W2EA 3SFVA 4OQZA 3BIOA 1RMQA 3N8DA 5HJ2A 3H86A 2WB2A 1GAXA 4Y1RA 1HT3A 1OGIA 1PW7A 1QMPA 3GFSA 1ZOLA 2CLHB 3ZWQA 5E3HA 4BNTA 4P83A 5L6LB 1CFZA 4LPKA 4PQRA 1D2GA 3ORYA 3K1TA 5KX5F 4ND1A 1XEWY 3ADDA 3BCUA 1NYLA 1UWVA 3I3SR 3C1OA 3LQ4A 3PPIA 3X1JA 4EDFA 2JH9A 5AM2A 4PZYA 1KO8A 1UKAA 3KQQA 4NONA 5IN5A 1MJHA 3T1VA 1AA9A 4XEHA 3SVZA 4BX2A 1UINA 4PYQA 1P45A 5LWQA 5EAIA 1KTIA 1RW4A 2FZ5A 3RD5A 1P1JA 3E8SA 4ICIA 1YO6A 4L08A 3NANA 3G0BA 4D9FA 1T1RA 2BUBA 3BWVA 3EGIA 1O6GA 4RFSA 2OBXA 2B1QA 2O7QA 4D0LB 1TZ2A 1VRCA 3NETA 3MM4A 5KYVA 1I24A 4JXZA 1G21E 1UC8A 3R5XA 1WXGA 2IHZA 1MQAA 2G3YA 3C6ZA 9ATCA 5GZ1A 2SCUB 3FDIA 4K26A 5HK8A 2DWUA 5IKEA 1I2ZA 3C70A 4PLHA 2E4YA 1CU1A 4Q15A 4WK4B 3SVTA 1U0NA 2JLUA 2O8BA 1DRJA 3DYIA 5GVRA 1DIBA 4XWAA 1R9GA 1VLJA 4RTPA 3JD0A 1GITA 1QX4A 3L8FA 3ONWA 3RREA 4X8OA 4BGEA 5HNKA 1QSGA 3PWSA 4KDRA 3EQ7A 5KMGB 4ZJZA 3PNLA 1LCIA 1T0PA 2SKEA 2GBLA 3PGMA 2XGJA 1YVRA 3WGUA 2IWHA 2IU6A 3VUFA 1IXRC 2WJHA 3GMTA 1AOXA 2EKDA 3BUSA 2Z2YA 4MUJA 3I6ZA 4B6PA 3X1WA 5K4AA 4X7RA 1C3OA 4FFNA 2FWJA 3EFBA 1YJ8A 3IHTA 5E7JA 3KXLA 1G8MA 1M76A 2BRUC 2PQ0A 1ORHA 3LLVA 4LY6A 4X1OA 5J2TF 3TLGA 4A8JB 4RDCA 3EB9A 2G7MC 1P7PA 2IW1A 1E9BA 2V0CA 4LY9A 4WZBB 2FFRA 1SC4A 2F3RA 1DEHA 3ICVA 1OASA 3PD7A 1PBTA 1UFVA 1IY9A 2X19A 1RKQA 3KUKA 4POOA 5EXSA 2GN2A 3Q3VA 1O87A 4C4ZA 3RVPA 3H6HA 1V6SA 2NPOA 4AX4A 3NIBA 4P84A 4U39A 3IBCA 1P3Y1 3H2KA 2YUTA 4MUAA 5LMUB 3KE8A 3V1KA 2IZ7A 3R6TA 5E2BA 4RETA 5KQRA 5GADl 3JQAD 3P52A 3D1LA 4OD0A 2BBWA 3WLLA 4TOIA 3A1FA 1PKEA 3L7CA 4W9NA 4E5SA 1GPNA 1N57A 1LC3A 1KO5A 2O8EB 1SOMA 4BO8A 4URXR 4RS3A 5IAOA 3PXDA 3QFTA 4J4TA 2H1SA 5EMJA 1CJSA 4RF3A 1PQYA 3GVXA 1RRKA 5HP4A 2WIDA 1UMDB 1C8BA 1USKA 2BM8A 2W6IA 3C6MA 5AKYA 2WD7B 3AWIA 3BQ9A 3L46A 4O1IA 4PIVA 3PC7A 2Q3MA 2WNSA 4C0KA 3LL7A 2Z5LA 4CFZA 1W36C 3ZYZA 2RI1A 2JFYA 3KJNA 2X58A 1JHMA 3KQYA 3OM1A 5ALKA 5F1OA 3D7RA 1ESCA 5IAEA 1XBTA 3RYHA 1A77A 1NMQA 1RWKA 3LSYA 4IS3A 3S2ZA 5BSFA 4WERA 4DQXA 3KT0A 3D1VA 1FP4A 3T9AA 1Y3AA 1WD5A 4ZHQB 2ZCJA 2P1RA 2P9HA 5A71A 1Z18A 1VHQA 3KKPA 5DOZA 2PO5A 5DV9A 5ER6A 5FWXA 5GJBA 4HPJB 3E82A 1MX5A 5I7OA 5KTYA 2G5TA 1YZ3A 1L5HA 4EABA 1GV1A 1XZFA 4K3VA 3HVHA 4FBLA 3RE1A 4PLGA 1X19A 4Y6RA 3ZCRA 4LIPD 1NYRA 3L1HA 5J47A 4JI6B 3IT2A 3S70A 2QW1A 2Y99A 3DUWA 4UPDA 4A15A 4ONEA 1RM5A 3B6MA 2JHFA 5CA1F 2HWUA 2J31A 3O8DA 1M34B 1V45E 4R01A 3QLUC 2PS1A 1UBOS 1TZBA 4QSMA 2N75A 3KK0A 1ML3A 5EVCA 3VAAA 3NP9A 4DUPA 1OPXA 5JZBA 4OXNA 1NQVA 4NE7A 5TARA 1M7HA 2QJOA 2WOJA 3SYLA 3ENWA 3FYTA 3KKMA 5C7YA 5CFQA 4A0GA 4H0NA 3A14A 2IUEA 4DCVA 3BHIA 3D4PA 4HQFA 4XGQA 2BJHA 1Q5PA 4CEHB 4WCVA 5A3SA 4EJSC 4F6LA 3G8CA 3UPUA 4QGSA 3AEKB 3HY3A 2WUEA 1KORA 1WXDA 1ODTC 2H00A 2K2WA 4KVFA 2PGLA 4LYAA 5CT9A 4A82A 1H4SA 3ESBA 1DAKA 1UT5A 3P0JA 4D9HA 1ZVKA 2AYYA 2PV7A 2H1HA 2QUHA 3BERA 3KHSA 5DX0A 3V4VB 1HGXA 4MTLA 1U3GA 1QCDA 3G0OA 3J80A 3JRXA 4EP1A 4TPKA 1MF7A 1YSCA 3DWEX 1P7YA 3LC7O 3OZGA 3CQ9A 2JFVA 2HA2A 4LHYA 4QDOA 4R3UC 4BFLA 5KSOA 1ECFA 1UFOA 4IKEA 1NBMD 3N0XA 1Z6PA 4GMDA 4LE0A 2EZUA 3I4FA 1UQRA 2H4JA 3OZSA 4KQHA 4HC4A 4QXPA 2WMNB 3GGGA 2ZJOA 3LL4A 3G2KA 2G1PA 1P2FA 1B43A 4OLAA 2D5LA 3PUJA 4ZI5A 3STUA 3X43A 2CMFA 2Z6QA 4MGIR 3RS7A 4OGWA 2CLLB 4BHTA 4XIJA 4JOQA 3IJEB 1UXOA 2QJWA 4DLPA 3OESA 3MFQA 5FNVA 1EFUA 5CAEB 2BYTA 2IBTA 1DWOA 1QP8A 4AU1A 4EW1A 1SOUA 4LOLA 3L0OA 4IZIA 2H9IA 3IEXA 5CFRA 1YCDA 3B7GA 1YQ9A 4LS3A 4R1NA 4DB2A 4XDYA 4NICA 3WSWA 1Z45A 1GNTA 1SWWA 1Z4KA 4NC9A 2I03A 4UPVA 1RCFA 2IYUA 1X3LA 1H0HA 1Z28A 5E6RB 1NASA 2PY6A 4UM8B 3LZCA 3ZNNA 1MV8A 2VYCA 1L3BA 5AI6A 1Y3BE 2MT9A 3SQDA 3EXG1 1OVGA 4MVJE 3FLBA 1DEAA 2A8YA 1U9ZA 4TMVA 1Z5NA 2QHXA 2HIGA 4MA0A 1PFQA 4IHJF 4WKOA 3VPHA 1G3IA 3H83A 4QE3A 3EDCA 4K40A 5F2KA 3P9NA 4M0MA 4AC9A 5CCEA 1YBMA 5JJKA 4GXTA 1IZZA 1E5VA 3WLPA 3MXTA 5ELXA 2CHGA 1SVNA 3PGLA 3Q5DA 4PVDA 4RF2A 3TZ6A 4CWAA 4EG1A 3SC3A 4LMBA 4KUHA 5A2QA 2VQEB 2RHTA 1GRCA 3S40A 4JZKA 2FG6C 2AOUB 1CS0B 4RD0A 2ZXEA 4FI3C 1RR6A 2IY8A 1IZ9A 2NAFA 4QLOA 3SJAA 1JIVA 4OQYA 2J3MA 3M6AA 1XWWA 4II2A 1ZI8A 4OEHA 5HTKA 1DKOA 1P9WA 2ZYHA 3SU8A 2P2YA 1SZJG 5JH7F 4QAJA 2YVAA 4G6ZA 3PJFA 4QUJA 4GI5A 1U8TA 3GQBA 5DSTA 4YMGA 4CQMA 5BYAA 4EG8A 5BN3B 3WGLA 4TLEA 4S1TA 2AKEA 4LFBB 4RLHA 4E07A 3L79A 1D5CA 3HBNA 3DBVO 3FNRA 3RLIA 1GG5A 4QODA 3W8NA 1GUAA 1P31A 1TO2E 2Q9AA 1GP2A 5SICE 5IAJA 3SJBA 3U3ZA 3DAOA 3QPUA 2CXSA 1CJMA 2XE4A 3G2OA 3OQPA 4OQMA 2VOEA 1JHOA 3EXFB 1VYHA 1ORTA 2ZSHA 1VKZA 2RBEA 3G6KA 3SYKA 1P2BA 1RHMA 3WYFA 3OICA 5EWJB 1Z34A 4YO7A 5A7GA 2GD2A 3CLTC 3CSSA 1Z26A 1O9BA 2IE8A 5CA0A 1ZRHA 3D8SA 1PWEA 5JS2A 2H5LA 3DLTA 3HPQA 1JV2B 2WV7A 2TMKA 4WZ6A 2JIZD 4IV8A 1RMTA 3AWDA 3UMFA 4DZZA 3ANSA 4ON9A 2ECQA 1P3DA 2FJPA 4MRSA 1SQ5A 2VPYA 2WT8A 4B6JA 3O8QA 1DDGA 4MV9A 4PSDA 5IASA 4LKRA 2C3MA 3AVVA 4B84A 3V3KA 1NONA 2Z1MA 5GWXA 4ZV4A 5IDYA 5CBKA 1XEFA 2J1LA 3UCEA 2Y4OA 4R1QA 1ZUHA 3DMDA 3SC4A 5J4YA 1Z7YA 5DIZA 3H9EO 3NJ4A 4TWZA 2WJ3A 1NN0A 4U5QA 5FDFA 5IT5A 2ZRLA 3CONA 4PSUA 1XYVA 4J0HA 4NDZA 4AECA 4Y0NA 3VZCA 3W77A 4D9MA 2HMYB 1ZCBA 1YQUA 2CSUA 5E38A 4QRDA 1OJLA 2BM0A 4LJ7A 5I7WA 3EEOA 3LQKA 3I9JA 2QLMA 2YBEA 3KQMA 3PE4A 2XUFA 4UQLA 1HDYA 2JAWA 1E1DA 5CYFA 3KU1A 3KPJA 4R1PA 5GAJA 1L7PA 4MROA 3OOHA 2PMKA 4LXUA 3WGHA 1CP3A 4R2MA 3SIWA 4ZVMA 1B14A 1QZTA 4Q93A 2YVKA 1TCCA 2G0AA 1BXKA 2UV8A 4E4YA 2A0YA 1QP4A 4H1VA 3WB0A 5DLYA 3CKKA 3TBKA 3EFOA 1S02A 1GQ2A 1DEKA 3KKNA 4FGJA 4YP6A 3T99A 3T94A 4E21A 1KRWA 1ZFNA 4CFSA 3C97A 5KJEA 3AB3A 1RHRA 3BRQA 1XQXA 4M0LA 2IOFK 2H7VA 2R8ZA 4JLVA 1KY4A 4LZPA 4XPZA 4P32A 2NU8B 3TX2A 4UTNA 5KPDA 2HY7A 3IMEA 3STVA 4PNPA 10MHA 1LRKA 1VP9A 4URVR 3AGQA 2HRQA 3RVNA 4QUAA 3MB8A 1DWPA 3LDGA 4WWHA 2YDXA 2IHVA 3AIOA 5DBEX 3GT7A 3TZEA 3UKJA 2XCUA 1E6WA 1TUBB 2VQDA 2YC2C 4K1LA 4X6LA 5EKTA 4WVFA 3RQIA 3VHQA 2HDHA 1MJGM 4Q3LA 3HZRA 4FMCB 3TD2A 1T36B 4IJ6A 2IBMA 4V1CI 4A8JA 1D6NA 3QPDA 3DT9A 4R51A 2A92A 5A3VA 1NLZA 4IJKA 5K0FA 4DADA 1SKMA 2WAOA 3ZBQA 1K3TA 3CB2A 4X92A 5A3QA 4NV1A 2QD4A 2C88A 2HC9A 4H1TA 1DI0A 5JWHA 1OT5A 4R1UA 3BWBA 3PL5A 1M5RA 2ZYTX 4KR7A 1EGVB 4BUJA 3L9WA 2IIQA 4EUEA 1K5PA 3GJYA 3IO3A 3WB9A 2KWIA 4WXRA 3OMLA 3IODA 3KT8A 4I7EA 2XUJA 4U8HA 1DUIA 1L5MA 1C8KA 3WMEA 3QLJA 4KPEC 3PZBA 3S28A 3WL3A 5EXXA 1U11A 1V39A 2I65A 3QPBA 3RRJA 5IKXA 3ZVMA 3THYB 2YQ5A 3KB2A 1XN4A 1K4KA 3AUSA 3VC1A 3RYCA 4M1EA 121PA 4QJ5A 4BQNA 1FMJA 3QX3A 1BJRE 3CX7A 1GNSA 3EARA 3RYIA 3SAJA 5JD4A 3PUXA 4CN9A 1NG1A 4BXOA 3BWXA 1T9DA 4LSGA 4PQFA 4UXIA 1KXJA 4YRFA 3WAJA 1RADA 4QUDA 2VKQA 1Y80A 3B5JA 5JQWA 2WY2D 5L4NA 3HBAA 1BKSB 3AUKA 1VBMA 1WY5A 2PDAA 2GD1O 5TMPA 3ZKWB 1KMQA 2JZCA 3II6X 4KUEA 4Z54A 5L4LA 1X7WB 4CRWB 5LKAA 1A4UA 4J3JA 1VPTA 4PAWA 1JA9A 1GPKA 1QB8A 2ZWIA 3NGLA 5LYJB 1BEUB 2OYRA 4G0VA 4CKZA 5LZ4A 3UMYA 2LV8A 2DFDA 3WB1A 4ER3A 3OQVA 2OT3B 3GRUA 3KV3O 4QFDA 1MPXA 5F1KA 2AQHA 3UV7A 4G1BA 1VTKA 3FTNA 4JT8A 3DFKA 4MAMA 3WIEA 1ZESA 1NI4B 2CFSA 5I6DA 3ZZMA 4MW6A 1GL6A 1Y7TA 1A9PA 1PSDA 3TQHA 3RC8A 1JQBA 1ZXBA 4OHMA 1SC9A 2DH5A 2RMKA 3VU3A 5FFNA 2B25A 5LP1A 3LZ6A 2H7CA 2QYOA 3LA6A 2QTFA 4FHZA 4RZUA 2W42A 1QU2A 1BS2A 1EFLA 3QVMA 2JH3A 3WXBA 4C4XA 5DYTA 2OO7A 2VNKA 4PGAA 4WN9B 2HSDA 5AH0A 4YV1A 2VBIA 2VDQB 1YCHA 2JGJA 1N4DA 1YZUA 3T12A 3LBFA 2GF0A 3KC2A 3TXXA 2FUCA 3B1XA 3L6DA 1Z2CA 3YASA 1UZLA 3GGOA 1J9GA 3EGDA 3TDKA 4D0SA 2AHOA 1QGUB 5AVWA 2XYPA 1SCAA 4ISCA 1V8ZA 4M0KA 4NECA 4ZQEA 4DA6A 1MQSA 5LQJA 5JPDA 1ZKMA 2IEAA 2AE1A 3D7KA 4YC7A 1DXQA 5DGCA 1RKUA 2ZBVA 1Z12A 2ZVPX 3DWGA 3HYTA 4DHEA 4OXYA 4NS1A 4DMMA 4CV3A 2WUWE 5JVDB 4D6XA 3T1YB 1YNOA 3MMPA 4UOEA 1L3CA 1F17A 3L0ZA 3LDUA 4MWDA 1R3DA 1NW7A 4RK4A 4UMFA 2HHJA 3QX9A 1NQUA 3SP1A 1IXSB 1LU9A 1O9HA 4BMNA 4WZZA 1JDZA 2OVFA 2R48A 3ZE2B 1OUMA 2CDAA 3K0EA 5CNMA 2ILTA 3ELUA 3JYHA 1U63A 4BFYA 1K6MA 4O3FA 2YV2A 3A25A 4UVDA 2C4TA 4HX9A 4PANA 4R0VA 1TM7E 1DIRA 1EAYA 2WFAA 2CLSA 2FWRA 4GHWA 5CURA 3ZR4B 5BMOA 1CUYA 4D4MA 2O2HA 1QZXA 5K0CA 1YC5A 4KVZA 1J8MF 2G1AA 2CUNA 1XWFA 2WAXA 3OQBA 5DHQA 1TAUA 4PCAA 2PSJA 4IHKA 1YHNA 2P6OA 1C1XA 4PC6A 1GWNA 3VHXA 2Q5JA 5J9FA 1E6CA 1V4NA 4DS3A 3FSGA 1OTYA 3LBNA 4RABA 1MOZA 5M2QA 2H4HA 4F60A 1E4EB 1WG8A 2ZANA 4GKKB 3AOEA 3KOUA 2ZB4A 4L85A 3CSDA 2NU9A 3HSYA 4JUDX 2A7XA 5IEJA 3KFXA 3EDYA 4CM6A 3ESXA 1TM2A 3DD5A 2VK4A 3IAFA 3IOBA 4H35A 4K9RA 2CBZA 1AK9A 5EE5B 2GN9A 2QAIA 1E6LA 4ZMSA 3O9VA 3AL3A 2CUKA 3LKDA 4BNDB 3G8BA 3FNIA 3NORA 1ZYUA 4XFDA 4O2LA 4RFSB 4ALKA 2CVHA 4EAQA 4ZEWA 1SBZA 3EF0A 1W5SA 2A84A 3AUAA 4XDZA 1LS6A 1ZJYA 3LD9A 4N76A 3DBHB 4IQGA 3M5PA 1L7RA 3NHBA 5EHXA 1JDTA 1BHO1 1N2EA 3CUSA 1K5DA 1QNFA 3P0HA 4ENTA 1DOAA 2ZAOA 1OR8A 1FRFS 2JASA 1Y9AA 2V0GA 3C5EA 2RB5A 4ALLA 2OXCA 1H9CA 3I52A 5LP6C 2DWOA 2DQKA 5KYGA 5C37A 2Y93A 3WHKA 3TLMA 4IXDA 3QBJA 1BA3A 1DCMA 1EA5A 3R3XA 4TYPA 1DB3A 2WJGA 4INPA 2RE8A 3C5CA 2RCYA 3Q12A 4RDHA 4I3HA 3VNVA 3E5RA 3UB3A 2GRUA 2IEGA 2QV0A 4F84A 4W82A 2CUZA 3L06A 4CIBA 3CGWA 3MUOA 1J8FA 1Z73A 4K9NA 1EWKA 1KZ1A 3R7WA 4AVYA 2P3OA 1SQFA 5LA6A 3CVYA 3BQMB 1NVBA 1IN8A 4KE8A 3OPYA 1R0XA 1ZWKA 3SM3A 4E70A 5AOVA 1MO2A 1RYZA 2OHGA 3JQCA 1QFMA 4LE1A 2FR0A 4EI7A 1ZOOA 2IHKA 3QUTA 4KPUB 5D6NA 4ZCMA 4KFRA 5A04A 3ZWPA 4X65B 4P35A 5CXSA 1NPYA 1TDJA 2PCLA 2HPVA 4LXGA 2YRXA 1EZ1A 4EHFA 3CVXA 4FONA 5I9SA 3AEQA 3AJEA 4PS1A 3PI6A 3WNDA 4ZOLA 1J0CA 4ND3A 3RSZA 1V11B 1DUVG 1J23A 5I45A 4IJQA 4ZK2A 2C00A 2A4KA 1YD7A 1LW7A 1RPNA 4WZBE 3W5IA 4EJMA 1DXOA 1IIBA 3PQ2A 3Q15C 2XB9A 3WDLA 1PD1A 2GCNA 3HCNA 3R7LA 1IJBA 3L05A 3WGGA 3ZDEA 1UWLA 3EVZA 5KJ1A 1ZVMA 1PYGA 3PRKE 2P2GA 3FKSA 2VCYA 4ND8A 4DUGA 5JNWA 1C0IA 2QQEA 3PA8A 3SZLA 1DTEA 2P1DA 1VSQA 4KR3A 3WNZA 3CY6A 3GHHA 2HF8A 2FMTA 3MOSA 1PWYE 4QXQA 4EG4A 1RIIA 1KZHA 2XQJA 5K8VA 2FEAA 4FIZA 5GV7A 5EIBC 3S2EA 3CINA 4KI7A 3KOMA 5AO9A 5GY7A 4DNOA 4PU0A 2NOAA 1FFHA 1S6YA 2X3UA 4C2TA 4LMAA 1ULZA 1QKJA 3MTGA 3QFFA 4HO1X 1EGAA 3AP3A 1U7ZA 3BC1A 4JFRA 1KOFA 3HMKA 2R8XA 2P2CA 3DQZA 5IT9A 1X80B 4TVOA 3HK2A 3F98A 4XVCA 1NVKA 4LA4A 1DJOA 2X40A 4KXVA 4RHXA 3QVLA 1VMIA 2EOAA 5IM4F 4XR9A 2PRKA 2I0FA 2VK1A 3JRWA 3ZOZA 4BCBA 5LQNA 4J07A 3LCMA 2Q45A 2CLDX 1N3YA 3L7OA 4QFCA 1LZLA 1KI2A 1V2GA 3HLTA 1I14A 3HY4A 4NZMA 3UQZA 3X0DA 3BMOA 3GN2A 3G5UA 3Q10A 2AFHB 1FQKA 3RW9A 3EMVA 3E22A 3JD2A 3ONVA 2A0WA 4MJ7A 1H1TA 2VT7A 2G77B 3KQWA 4OAOA 1MOQA 4OKNA 3GEHA 4OFXA 3VR1A 2M6SA 2AEJA 1SCDA 2XHEA 3PGVA 2DPXA 1DC5A 1I0ZA 1ZGJA 3K5HA 4D7AA 1ZVVA 5T6BA 5LXTA 1U7DA 5L7TA 3P9ZA 4CMCA 2ZYGA 1CBUA 2P9QA 3CR7A 4RKWA 3LY5A 5DBHX 4AULA 5MN4A 1J9ZA 4FJ0A 3TLYA 2BMVA 1NXWA 5GOZA 2PQ6A 4GZLA 5ARCA 1Z4QA 3AR6A 4BO0A 4ZHSA 2PWAA 3UJ3X 5EE1A 4LOKA 5F23A 3DOOA 1Z6GA 3FVVA 3HA3A 2XYHA 5A06A 3D4OA 3BIWA 4LJLA 2ZJ2A 1M6VB 2ID7A 2R1VA 5L3SB 4NI5A 3H9QA 5KQPA 1V5GA 5A4FS 3KUCA 4X41A 1DBSA 2VHQA 4YP9A 5HK9A 2RJ3A 1TT5A 4CGYA 2I91A 4MLDA 1PTJC 2QG6A 3UAWA 4CM9D 6NULA 3R5FA 4MYCA 1GU7A 1JU9A 3TW6A 2LIVA 2G82A 4ID9A 4E11A 5K0EA 2AJ8A 1FEZA 4UTXA 1AZLA 1OLXB 3I72A 3RBVA 1ONNA 4RXMA 4TQUS 3KTDA 4ZI7F 2IU3A 3RVLA 3VU1A 2NUAB 4B0OA 1W7AA 1AGYA 2FQQA 3TD9A 1ZUWA 3HEAA 1USUA 4E5KA 1GGJA 4NHOA 3AHDA 1E62A 2XYQA 2OCGA 4EYSA 5B3KA 4H7DA 5B6JA 3WNCA 1XYYA 5K0ZA 4P4UA 3S68A 3DB2A 5HIKA 1TD9A 3DS8A 4C3OB 1TUEA 4C7BA 3FB1A 1BXGA 3RVSA 2GM5A 1EM8B 3GDOA 5CLHA 3MYRA 2JJ1A 3QKTA 4R68A 5EERA 1XG5A 4KBFA 5G1PA 3AX6A 1TT7A 1SC3A 1NX6A 1T1GA 1A82A 2BDUA 4HDKB 4KXLA 3G2LA 1IVSA 3ONEA 3WWDA 2GF2A 3SX0A 2BFBB 3TG2A 4OY3A 2G8NA 3QQPA 4U7DA 4QJBA 1KQNA 4K7JA 3FDFA 4BB6A 5DIFA 2FB9A 2X5OA 1KPIA 4O08A 1HOXA 1W35A 2X1HA 3FNEA 3HBFA 4BLUA 1PDVA 4EPVA 3I34X 2OCLA 1JW9B 2HJ9A 5K3DA 3LS2A 3U4QA 3WC4A 4LCEA 2PFSA 4P58A 2A1UA 5L40A 1V9CA 2RG7A 3BHNA 3IUMA 3E3MA 1T24A 3O74A 4MOWA 4DM4A 1ZIOA 2FEKA 4LCBA 1EX1A 3MJ4A 3ZKAA 2GDJA 2IGTA 2DR2A 3CLVA 3TSCA 4EA7A 3FOAA 4GX2A 2O48X 3KZOA 2BFFB 2W5UA 5LLTA 2DJ5A 1SM4A 4PV7A 2R25B 3I62A 5DKFA 2A2ZA 3AI3A 2V8BA 5K99A 1QYIA 2YOGA 1W8DA 4F6RA 3CRQA 1R0CA 2RK6A 2CLOB 2QR5A 5P8WA 4IIFA 4MQEB 1OY1A 2KI5A 4E08A 4YIHA 2OWEA 3RYFA 2J9YB 5K0GA 4TWAA 3LUHA 1AQJA 3ECCA 3GFVA 4W1QA 2CJYA 2GJ8A 3NLLA 4TLDA 3ZE1B 5AUQA 5CNJA 2Y66A 1MV5A 4ND6A 2ODTX 1SGWA 1NMXA 3C45A 3D0OA 2DHEA 1KDPA 1LPBB 2A5YB 1FBTA 1RQNA 3MWDB 2VP4A 1GU0A 4DLSA 3JALA 2C07A 1BVRA 5BOSA 1EFTA 2AIRA 3RS5A 2VBGA 1GZSA 3IP5A 4FYKA 4FN4A 4UDOA 3RUPA 3CO0S 1GN9A 4JYMA 2MR5A 4GQAA 4TMZA 5JDIC 1UBUS 1BC5A 5IJWA 2BF7A 3UH1A 3OP4A 1JBKA 1G55A 1O0BA 3L4EA 2EARA 3NIDB 4HNVA 5E3IA 4LF6B 2ZRCA 3P97A 2BL4A 5JYBA 3NHWA 4F1JA 3O8QB 3ICWA 3QMVA 2HQRA 3AJ9A 3QKRA 5DTMA 1O97D 1W4BA 3FOBA 1NUHA 2YIDA 3GAZA 4MEAA 4UHHA 1D0IA 4HGYA 3IXLA 4Y2PA 4CTJA 1U4SA 1T8TA 5AIAA 1SELA 3HA7A 2OD9A 4HUJA 5I7EA 5CIWA 3FHLA 4FYPA 5A02A 3GGJA 1YA6A 5KCMA 3WK4A 1MXFA 1MGOA 2Y1KA 3BGVA 5HF6A 1U6IA 3I8OA 1MORA 1NXOA 2ANCA 2JEZA 2VPXA 2WYIA 3SXUB 4XX1A 1H6AA 3AVPA 4X3PA 3OE4A 1AKVA 3T0GA 3H65A 4L4ZA 5IDQA 1RYEA 1L4UA 1HE4A 1NLMA 5AVKA 3I73A 2F1OA 2NQ8A 5JASA 5EPUA 3RB8A 2IY9A 4AX8A 3M4JA 4RKEA 2W7TA 2UVPA 1C7FA 1T25A 2NIPA 1ZLXA 3A58B 4YXWA 4RLQA 4WN9A 1SBHA 2ZWOA 4WA7A 5CVCA 4LZOA 4FCVA 4TQAA 4RIHA 2BGUA 4EI2A 1C9DB 2BHTA 4JOSA 1JFFA 4C07A 1RXEA 4L07A 4H60A 2WE7A 2Z09A 1IEWA 1MIHA 2DUMA 2YJ6A 3OY7A 4FYYA 1GPJA 2LPMA 4TX1A 1BJTA 4UXHA 1P4HA 4DC0A 3P2YA 5BVGB 4BJ5A 4NABA 1ECCA 1C7RA 3SC6A 1WEHA 4PC7A 1T8PA 1H2RS 1P7CA 1NLFA 4IXMA 4D80A 5AVXA 3ZCVA 1V16B 2O7NA 3MGCA 2FH5B 4M1OA 2CNLA 4EFDA 2QVGA 1J8DA 2P68A 3WTBA 2PQMA 2AQIA 3IEPA 1VYVA 2AI3A 1Z4MA 4UVHA 1SCNE 1WCWA 5CFZA 5KB3A 3BIFA 5C2JB 1ESEA 1YZQA 5FF9A 1T3GA 3BREA 2YS7A 5BR1A 1UAAA 4EKGA 4ZI2A 1FSGA 2GNAA 2GARA 4Z8YA 5IMSA 2QRGA 4CMGA 1X8KA 4UCWA 5EXEA 3VPSA 4DBLC 3HO6A 4U5XA 5D2CA 1XMVA 5AVZA 4UZFA 1CD5A 2FPUA 5LWHA 2Q3LA 3KSMA 2A78A 3QKSA 1RKVA 2FMFA 2HK9A 4GP6A 3KELA 3MTIA 5CT8A 2J67A 4AAYA 4IGEA 4CCWA 2D7JA 5BW5A 5CFPA 1WP9A 4F3CA 2ODAA 2CB9A 3LDHA 4HTFB 4MSUA 4CDGA 5LQMA 2OAGA 2HO5A 2OQ2A 2Y0EA 2H57A 4L95C 3WQRA 2I3BA 2XR1A 4ZDIA 1K63A 3LO5A 2C9BA 3D6AA 4P4SA 3WK7A 4Y1FA 4IP0A 1VJDA 4J91A 4NZPA 2R8YA 3UMRA 3AHJA 2AVDA 5CX1A 5JPCA 4HLUA 3IDFA 4RVGA 3LFHA 5L6MB 4GP7A 4WRRA 1SVLA 3AG5A 1R9JA 3G82C 4JUCA 3AY7A 2PH1A 4WKNA 5FHQA 4RKYA 3T0IA 5BN5A 2VI5A 1N7GA 1FZQA 2RGUA 5GONF 3DULA 1FNDA 1LQTA 1RYYA 5CYOA 3DDSA 3LLCA 1KZ4A 3TNDA 1VLLA 2IIPA 2QMHA 1E3MA 1QOPB 3I5YA 3G13A 4B48A 3PE3A 4FSXA 4XUEA 4OU4A 2JD0A 3KSZO 3LY8A 4ES6A 2B1RA 1UF9A 1EAMA 3QSYA 2DX7A 3U4GA 2VT3A 4ZIRA 1M7BA 4GPTA 2Z5VA 2Y1CA 1R10A 4PF1A 4XM1A 1DAMA 2X14A 2JGDA 3CPSA 3MCAA 4RA6A 3E7XA 3RUCA 3BD7A 4ZWNA 1KVSA 4BP9A 4ZJPA 2JI4A 3MJRA 3B9BA 4F11A 1A4RA 1W9MA 3H1TA 1Y4ZA 3GMIA 2BDTA 5TQ2A 4DCUA 5B58C 3HCCA 1ZK1A 5BVHA 5ADWA 1YL6A 1K88A 4J94A 4TLLB 3E18A 1RJWA 4BUCA 3BCSA 3JY6A 5TMBA 2CF5A 2GH1A 4A3SA 1IATA 2FCRA 2IEBA 1PFUA 5E7MA 2OK8A 4KU4A 1C9JA 1I01A 1M8GA 1ODKA 2HX1A 3E53A 4WTOA 2TMYA 1R8XA 4OGLA 1T3HA 4EHAA 4YRZA 1IY0A 1IK6A 4KE9A 5AW4A 1A95A 1CFJA 3KB1A 3THWB 1DAPA 5EKDA 3K0AA 2GHTA 2EU8A 2DVMA 1ORIA 2ZB3A 1YJQA 3C98A 4DF3A 2B4KA 5BURA 1ZUNA 2QL5A 5JH7A 1JLLB 1IG0A 1UXJA 2IPAB 5BQFA 1ZM2A 4ZO9A 5LB2A 3TMYA 3HHEA 1R1DA 4UEKA 4QTZA 4BGUA 1XIVA 1P9RA 5IJ9A 3KSAC 2ZSIA 2AG0A 3ND7A 2HWXA 3T7DA 1J90A 1A0OA 2DTDA 3BB4A 4LFCB 1EJBA 2KM1A 2GXUA 3V4LA 3HDHA 2GAJA 4FTWA 4LJ9A 4MW1A 3EPHA 1YMQA 2QS9A 4HRVA 1OFHA 4MIOA 3ZD8A 3U7HB 5I7RA 5DF1A 2I7DA 5AK3A 1RAGA 2INGX 4O6VA 1VL5A 1FMLA 1VI6A 1F0NA 3W8EA 2KPOA 2YY5A 3TCKA 1UIMA 5FI0B 2WD7A 1YQDA 4TUYB 2BGGA 1H8ED 3DFUA 3QZUA 1F4VA 2J0UB 4DLZA 3ZDRA 4B8WA 3BFXA 1E98A 1N3IA 2IHTA 1XROA 3NDPA 1ENYA 4JY7A 4TSFD 2ZUFA 3X1ZA 2ODPA 1CUSA 4LNUB 2XMPA 3GP3A 3EAGA 5JIBA 4XM0A 5A2GA 1RT9A 4MV1A 5K0NA 3RKRA 1I1HA 3UJNA 2B4YA 2NO6A 3MEQA 4CLOB 5AESA 1VPLA 2NVUA 2YOHA 2ZAMA 3NM4A 5DYYA 1P9NA 4LCJA 3EY4A 1MEEA 2PBFA 1WR8A 1VSVA 2J3QA 2PANA 5J5CA 2K87A 5DRYA 2D0DA 3E70C 4MS3A 4BE9A 1RAFA 2B99A 2DQSA 5FHRA 5BVHB 1QFYA 5IYZA 2FOIA 2AT1A 4F56A 1NFFA 4UE2A 3RSHA 4RD3A 2H4YA 2O3UA 3B5IA 2Z3WA