2HMVA

Diamond-shaped octameric ring structure of an rck domain with adp bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
139
Chain Sequence
NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords YuaA protein
total genus 45
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmvA00
3OIFA 2PTGA 3JD3A 1YH3A 5JMPA 4Z9XA 2Y0DA 3GDOA 5KIAA 5TSDA 3L9WA 1Z7EA 5B37A 2BHLA 3I83A 4BNLA 1Y8RB 2I3GA 4WLFA 1FXSA 2WTBA 3MOGA 3FRJA 4AG3A 3JD0A 1HLPA 4I5DA 3TRIA 1KERA 2NQTA 1D1TA 2WM3A 5L45A 1KVTA 5COBA 3RU9A 4DL9A 3A06A 4YTEA 1WZIA 3GY0A 2X23A 5A03A 2FR0A 3S2FA 3D3WB 4Y98A 1H9AA 3I5MA 1N9GA 1S7CA 3HWRA 3D5TA 2EWMA 4W82A 2PD4A 3WSVA 1E1NA 2B83A 2VRCA 3GAZA 4Z3DA 1U7HA 1VE9A 4PLPA 3COSA 3D4OA 1AGNA 5HS6A 4DQXA 4L76A 4D0SA 4KTTE 4GLLA 4XGNA 4AJNA 5JAZA 3AM4A 4MVJM 3DMYA 5L7TA 3V5NA 4H7PA 1MXHA 2FSVA 1VKNA 2DC1A 3PWSA 3U09A 1YDWA 3UH1A 3S2GA 3ZDFA 1M67A 4DREA 4IJWA 4MVJP 1DXYA 4BKQA 4E5NA 4CL3A 4I5GA 4K26A 3Q3CA 4XRGA 1DEHA 2IXAA 3W8EA 4N7RA 3WMWA 1KBZA 2X22A 3P2YA 2YQ4A 4FJ0A 5TNXA 4LN1A 2V6GA 4TVOA 1EZ4A 3LT4A 1HDCA 4QFCA 1QG6A 3TOZA 1ONNA 1XLTA 1XELA 4WCFA 1M76A 4HFMA 4BNVA 1PWXA 3ABIA 4IMRA 4B3JA 1BWSA 4R9RA 4CM1A 5A4DA 3T4XA 4CLRA 3AI2A 4B7UA 4D7AA 1P33A 3C7AA 2WE7A 1Y7TA 5EERA 3U4DA 1P9LA 4LMRA 4NMHA 5JDCA 1UH5A 2NU9A 1EVJA 3D0OA 1WLYA 3ZWMA 3KZVA 2G1UA 4IJVA 4R3WA 3K6JA 3PFFA 3CXRA 2FHSA 3GGGA 4IDCA 2C5EA 2D2IA 3VPSA 1ZKMA 4D79A 3NYWA 1A7KA 2P9EA 3OJEA 2X0IA 2V7PA 1VC2A 2FY8A 4A10A 3NAQA 3VH2A 1XYGA 1YJ8A 3C1OA 2NWQA 4HWKA 3QWFA 2GNAA 3W6ZA 1I8TA 4B8ZA 4BNWA 3GVPA 3IDSA 1YWGO 1NVTA 1J6UA 1I10A 2H1SA 5FWNA 5L7YA 3C1TA 3TL3A 3RBZA 4YEDA 1NASA 5MGBA 2Z1NA 3M2TA 1NAIA 1LXCA 2X86A 4WPGA 3BHJA 3JQGB 4OOFA 3GVIA 2PLAA 3WLEA 5I7EA 3FF4A 1U9JA 1Z74A 5IXYA 3KBOA 4B7XA 5I9NA 1RM3A 2A35A 4BNZA 3LT1A 1PS8A 4HP8A 1X15A 1AHHA 5IZCA 2I67A 4E13A 3G0OA 3M1AA 1HSZA 4FPXA 3RIHA 3I9NA 4HXYA 3ROPA 1GADO 2H9IA 5THKA 1KIFA 1Z7BA 4DC0A 4GGPA 3RUEA 3TPCA 1VL6A 3WS7A 4IPTA 3LSYA 5DZSA 4IDEA 5COAA 1Q7CA 4BNFA 3R0IA 1V3TA 5DULA 3FSRA 1C0IA 1HDYA 3TZKA 5L53A 5JDCC 4CJXA 4R3NA 1EK5A 1ISMA 4QX6A 2CZCA 3AUUA 2IXBA 4Q9NA 4YB8A 4W9NC 1PJ2A 3MJSA 2EF1A 4LSWA 3HZZA 4EI2A 5JS6A 3FBGA 2B4RO 1BRMA 4BQPA 4P8RA 2B4QA 4PRLA 1BDMA 1FDWA 2OP1A 3OETA 3L4BC 4XGKA 4AJ2A 2GSDA 1LA2A 3KXDA 2J6IA 4BKOA 4BKPA 5C7LO 2VHYA 3KM0A 4M87A 2EIHA 4AJOA 4CR8A 1GQQA 4QECA 2NV6A 3UOGA 3ZWBA 3TFOA 1DPGA 3LZ6A 1WPQA 3WTBA 9LDTA 1ADFA 3U4HA 3PDJA 2OORA 3HNPA 4A7PA 3C7DB 4XIYA 1GV0A 2EW2A 4I08A 2HJRA 2Q2WA 2ZTLA 4Q3CA 2X7HA 2YFQA 1PS0A 4AJ1A 3JQAD 1E6UA 5CDUA 2POQX 1V0JA 2PKQO 2VOEA 4AJHA 2NVUB 1D7OA 1WDLA 5KJCA 1MC4A 4ZRMA 3ZU4A 1DO8A 4XGIA 2HQ1A 1B8PA 2HUNA 1UUFA 2O50A 4NK4A 1OI7A 4IXTA 2DUWA 5TJ9A 5IZCC 5TT1A 1LDEA 4NI5A 3ADOA 4UVIA 3GVXA 4A27A 3ZWAA 3LQFA 1NBOA 5LC1A 3AY6A 3A4VA 3GZNB 1ZCJA 1C1XB 1ZUD1 5CEJA 3PQDA 4RVDA 4N18A 5TGDA 4J16A 2BGMA 3RUDA 3P19A 2PZMA 3JQFC 4KQXA 3B70A 4NH4A 5KVCA 3EUWA 1FDTA 1SC6A 1N1EA 1P1JA 2PH3A 4NBWA 4NIMA 1TT7A 3BMNB 2CFCA 3KLPX 3ZHXA 4DXHA 4XJTA 1GTMA 2AG5A 2ZYAA 2AQIA 4E2ZA 5CG2A 1T2EA 5IN5A 3NTQA 3LK7A 3PEFA 3JQEA 4HFJA 4DC1A 3DZBA 2EP5A 1KVUA 3TZCA 2Q4EA 1ENZA 4WCDA 2VUUA 4IDBA 3MJ4A 1A4UA 3CUKA 1ADGA 1NWCA 4MO2A 3DOJA 3FBTA 5GZ3A 2O2SA 1C1XA 4UVEA 4BNYA 1E7QA 1Y1PA 3NRCA 3I9MA 1PR3A 2X5KO 1X1TA 1R0SA 2WD7A 4ZRNA 4AJLA 4J0FA 3DZKA 5KVQA 3IJRA 1Z75A 3RUIA 3V2HA 3EDMA 5T64A 2V6BA 3PRJA 2LDXA 2G76A 3WB9A 2ZB7A 1E1LA 2FN7A 6ADHA 2X5JO 3LC7O 4NBUA 3BMOA 1SOWA 3H5RA 4NU5A 1EQUA 3RWBA 1C3VA 1M66A 3AU9A 4CLXA 5A05A 4CLRB 1H94A 1OC4A 2PFGA 3N74A 1P1RA 2PGLA 4EEZA 4FFNA 5ENDA 3FPCA 3SJUA 4XB1A 4IY1A 2C07A 3O03A 3PFWO 4KQWA 4J3FA 3WXBA 3EW7A 3OFSA 1SNYA 1B14A 1XEAA 1FDVA 4GSKA 4P4NA 3IL2A 1G6KA 3ENKA 1DJNA 4CMGA 3I1JA 4CQLA 2J5KA 2ZYGA 1T24A 3KYBA 2UAGA 1DRUA 4JJIA 4BGIA 4DYVA 4GX2A 5GMOA 3H9QA 4YJFA 3HN2A 5B12A 3U49A 2O23A 1YQDA 2IZ0A 2EKPA 3CTMA 1RM0A 1X13A 1YXMA 2X9NA 2JCXA 5L95A 1RKXA 2BD0A 1XIVA 4CMKA 4J1SA 1T2DA 4BHTA 2LDBA 3L4BA 1CYDA 4J7XA 1BXKA 2HK9A 2XOXA 2WJPA 1W4ZA 2VQ3A 2X0NA 2CUKA 5IDWA 1JKIA 5F1OA 3ZGYA 1G0OA 3FTNA 3GN2A 3MCVA 5FI5A 4D3SA 1WDKA 2CVQA 4XEHA 3FNHA 3GVCA 1BW9B 1QV7A 4UUPA 5G0WA 3E5RA 5JC8A 4LMPA 8ADHA 1ISGA 1RYEA 4GVXA 2NADA 1E7MA 2C29D 4OH1A 3AFNA 5DNAA 2JFGA 4BNIA 3D3EA 3PZRA 4C7JA 3Q1LA 2JD0A 1RM4A 2NTVA 4HFNA 4TMFA 1ISJA 4CM6A 1ZK0A 1NWHA 2J3IA 1N8KA 3GOHA 3N7UA 4WJZA 3RVDA 1M2WA 3CSDA 2VTEA 1OAAA 4U0KA 1E7WA 1PJSA 2O3QA 1QMGA 4CPDA 3EAGA 3VH3A 2VUTA 1E5LA 3PWKA 1WVGA 4IS2A 5A5EA 3L6DA 4L4XA 1I01A 3UVEA 3INGA 1VI2A 3OH8A 4J1QA 4BL5A 2E6UX 5AOVA 2A94A 4DPMA 2GPTA 1UDAA 2E4AA 3ULKA 1YOVB 2EEZA 2H6EA 3H2SA 4DBVO 4JCOA 4DWVA 4N5MA 3PJEA 3TJRA 2Y68A 3GAFA 2VZ0A 2VZ8A 4YT8A 1S6YA 2BI7A 3D4PA 1PGPA 1JVBA 1BHSA 1HF3A 3U9LA 3ETGA 3VVCA 2IZZA 3VAZA 1F12A 2O3SA 4O63O 1JTVA 5FEUA 4RGBA 3L6OO 4BMSA 4ZQGA 1KC3A 4E12A 4PZEA 4R68A 2BELA 2CVOA 4ALKA 1HDRA 1LBEA 4R1SA 5I7VA 1SEPA 3FTPA 4CLOA 4AJIA 1QYVA 4LW8A 3CH6A 3DZIA 3F4BA 5ER6A 3WYBA 4YBZA 4DPKA 2CVZA 2OZPA 4GGOA 5K6AA 2YUTA 1C14A 1R4NA 1EUCA 2YZ7A 2HMWA 5ICMA 4JNKA 2WSBA 3I23A 1Q0LA 4GWGA 3ZV5A 3N58A 4RDIA 1I30A 1MLDA 3D5QA 4ZQBA 2VRBA 1Z73A 3TDKA 1X7GA 2QZ9A 1XDWA 3OM9A 1JDJA 2O4CA 3AM5A 1P0CA 2GZ3A 1ZK1A 4RF5A 3KTDA 3Q9UA 4IJUA 5KKCA 2NTJA 2ZJ0A 3ZNPA 4IIUA 4RF3A 1HXHA 3RUCA 4ONEA 2YQ5A 1KEPA 3WMXA 4NPCA 2QRLA 4ALJA 2Z95A 4KWHA 4XQCA 2FPIA 4J43A 3F6YA 4EJ6A 2B0JA 1PWZA 3CEAA 1IPEA 4QUKA 3VPFA 2QIOA 3JQBC 4BNXA 5IAAA 1VLLA 3EYWA 3GDGA 3GNTA 5ILOA 4ZQHA 2EV9A 2DFVA 2ZYDA 4K28A 3T7CA 4MIOA 3HJAA 5CEEA 1N1GA 3IIEA 4Q39A 1MC5A 3BIOA 4Z9YA 3WICA 4TRNA 3TQHA 4J0EA 3VTZA 2W8ZA 3KYDA 3R3SA 4RDHA 1HZZA 2EHDA 3O4RA 3U3XA 4RZIA 3U0BA 1E3WA 4GMFA 2I5PO 1Y5MA 3R6DA 4WEQA 5G4KA 3F9IA 4EITA 3EZLA 3H8VA 3O8QA 4OKNA 3IUPA 1EUZA 5A9RA 4LCEA 2C7GA 1GUZA 2QW8A 3QWHA 2CD9A 3GGPA 1P1FA 3QIVA 3H6KA 3CZRA 4HNGA 2I9PA 2SCUA 4MJLA 3KEQA 4U6QA 4Z0HO 3UGKA 3FR7A 3IS3A 4P22A 4EW6A 1LRJA 4IQ8A 3ZNOA 2PD3A 5I8ZA 1VM6A 1LEHA 2PKRA 3FCOA 4A5OA 5K0ZA 3GMDA 1A4IA 4FN4A 3KHUA 3QVSA 1UXGA 1OMOA 2O48X 4IZHA 5BNIA 2IEBA 1LDYA 4W6ZA 4J91A 4AFNA 5JAQA 3F5SA 4BO6A 1UP4A 4D43A 1LLCA 2DFDA 4BO9A 5EPOA 2C7VA 4PG8A 1IB6A 3RKUA 2IDZA 2WDZA 3IQDB 3F5QA 1ID1A 3DAPA 5CPFA 1LX6A 3AOEC 4JP3A 1NM5A 4KMSA 4RPJA 5G4LA 5CAEA 2YV2A 4JX8A 3ENNA 1CQIA 5KTKA 3DONA 3QA9A 2Q45A 1ZH8A 2FWMX 4OXKA 1HL3A 3MJVA 2X4GA 4G5HA 1N7GA 5F1KA 3PDUA 2NU7A 2O3TA 2Y0EA 3D7LA 3GUCA 3SJ7A 4M55A 4I9UA 2DKNA 4IZIA 2VYNA 3G3EA 5CP8A 2UUPA 5TJHA 4M8SA 1T26A 4QO8A 5ER9A 4DPLA 3WJAA 2VCYA 3DZFA 5F21A 3ZU5A 1N7HA 1X0XA 4W7HA 3JD1A 3ZZNA 3QW2A 2I65A 3AI1A 1ISIA 2BFAA 2PK3A 4P4GA 5I8WA 5JO0A 5CG1A 4PLGA 1A7AA 5TT0A 4F45A 3QY9A 3QVXA 5H82A 2YV3A 3KB6A 2D59A 3JQ8A 2ZJ1A 4ND3A 4CLHA 2VWGA 4GX5A 2OP0A 4II3A 1LLDA 3ROKA 1WNTA 4LRTB 1H2BA 2BGLA 4MINA 1TLTA 4R1UA 1EBUA 3WGGA 2EP7A 2BF7A 4Y6SA 1K0UA 5HM8A 2AQKA 1HDZA 1LLQA 4O1MA 3ONDA 1QYXA 3VDRA 1WWKA 1GQ2A 2YHIB 3GHYA 1MA0A 3PTZA 2WYUA 4UEOA 3S2IA 4D42A 2IYOA 3GEGA 1I0ZA 3ICCA 1F8GA 2HK7A 3NT5A 4ALMA 4Z0TA 5I9MA 3BMCB 3SLGA 2EERA 2JHGA 2EG9A 3IKTA 3K8ZA 4NBVA 1NYTA 1LQUA 3K30A 1HE4A 3DBHB 4NQZA 4XR4A 4GL4A 1XGKA 2WYVA 1XA0A 3DBLA 1H6AA 1NPYA 3OHSX 3IP1A 3S1LA 3BMNA 3JQFA 3KSZO 3W4IA 3PLNA 5K9ZA 1MV8A 2WMDA 3PHJA 2A4KA 3ETEA 1QORA 3BTSA 4HADA 4UVGA 4ZD6A 3I6QA 2WD8A 4NHEA 4BO4A 3U4CA 4CMIA 4QEDA 4TWRA 4BNKA 3JQ9C 2ZQYA 2TMGA 4WE3A 4BV9A 3DTYA 1A72A 4XYMA 1LRLA 3EVTA 1NVGA 3E03A 3ZWXA 1L7EA 2DVMA 2X9VA 1BVUA 1YQXA 1G1AA 4XYEA 3JCZA 5LDHA 1ZFNA 2VHXA 1DJQA 2GZ1A 3F47A 4OJNA 4Y6RA 4E5PA 2HMUA 5JBIA 1E77A 3PHIA 3WLFA 3G1UA 1ULSA 5B4VA 4PG7A 1DLJA 3K2EA 3DWFA 1I3LA 4WGGA 5HBRA 2WEKA 4RF2A 1LNQA 4BO2A 3OJOA 3AOGA 2HSDA 4OKIA 3DAGA 5BQFA 4BVAA 1D4FA 2RCYA 2OBNA 3R3JA 1T4DA 3PJGA 3DZJA 2CF6A 4Z0PA 3U5TA 1C0PA 4PZCA 1C1DB 1OFGA 1LSOA 4DQUA 4F3YA 1WXDA 5ITWA 3B20A 4B4WA 3BYZA 2PV7A 3FNFA 4BS9A 4QT0A 2FOIA 1KEWA 5JXWA 3OIGA 2X1HA 4IDDA 2O3UA 4E5YA 3TZHA 1F14A 1LSUA 3UCXA 2PKQP 4L4RA 3WGHA 3GK3A 3QVTA 4YXFA 2VOJA 2GF2A 2GZ2A 4DIOA 4YAGA 3PIIA 1UXJA 3MJTA 4GQAA 1EUDA 3VPXA 1DC3A 4BO8A 4CM7A 1ZK3A 1IULA 4M1QA 1R6DA 3UCFA 1HETA 1ZJYA 2DBVO 3GHHA 5EL0A 1FJHA 1NQTA 1ONOA 1KYQA 1ENOA 1FDUA 4IIVA 4FGWA 4L74A 3UICA 4XWYA 3AW9A 3ITDA 3H9GA 5CHEA 2Y93A 3Q11A 5BSGA 4J4HA 4GLOA 5KJFA 3DQPA 1TB4A 2O2YA 2JD1A 4WLOA 3E9NA 4A73A 1B0AA 3ON5A 4DIFA 3KYCB 3H9UA 4Y67A 3KSDO 3PYXA 1HT0A 5JAIA 4TQGA 4R5MA 4ZHSA 4BV8A 4XD2A 1YB5A 2XF8A 1EE9A 3HUDA 2UUOA 1CERA 3A14A 4JBIA 1QLJA 5A02A 2IEDA 3ASUA 4NDNE 1H2HA 1ZK4A 5ADHA 2NACA 3G49A 1Q0QA 1MFPA 4DUPA 5JW6A 1KVQA 1GCOA 2FZWA 1B3RA 4QO7A 1U8XX 2EGGA 1AXGA 3AUTA 3FI9A 3GVHA 3RUHA 1NXQA 2EW8A 5DT9A 5G2OA 3AY7A 1XR3A 4II2A 3WOHA 1GYQA 1WDMA 4YR9A 3SBOA 1P0FA 2VHZA 4FOSA 4YACA 3QWBA 4CLOB 1UAGA 3IOYA 2NVBA 4KDFA 3AWDA 3H4VA 2Q1WA 1BDBA 1LDGA 1UXIA 2R00A 1P3DA 5JMWA 3NDRA 3PZBA 2JHFA 3PIDA 1F06A 4YJHA 3ZU2A 1LU9A 3OJLA 4TRRA 3WDSA 5JDIA 3OQ6A 3WIDA 1XWFA 2AEMA 1U8FO 4R4JA 4R54A 3PQFA 3RC2A 1UZLA 3INRA 2AW5A 4QTZA 2Q1SA 4R9SA 4GAEA 4E21A 1H5QA 5A06A 3UXYA 3WBBA 4IDAA 4CM5A 3DBRA 2Q99A 1VRWA 1U7TA 1YL6A 1YB4A 3DL2A 2W2LD 4Z9FA 1HE3A 1E0DA 4BO5A 3DOOA 4WNIA 4ND5A 1R0KA 3SC6A 2G82A 2X9GA 4BNTA 3OA0A 4FQ8A 4PRKA 3TZQA 2BFMA 4DMLA 3Q6IA 2VYVD 1T1SA 1KS9A 1E1MA 4UUMA 4ILKA 3VKUA 4JJFA 3CKYA 3PI7A 4U8GA 5JYEA 3BHMA 3NGLA 3DB2A 3CMMA 5BSEA 2JL1A 2RAFA 2G17A 3GGOA 3PGJA 2B4TO 1K2WA 4JGBA 1UP7A 3F46A 4YAJA 5EESA 5G4KB 1DC4A 1B26A 4M86A 5F3RA 2Y1FA 1E3WB 3DR3A 1SOVA 4J4TA 3AJRA 1NQ5A 2VTDA 2HRBA 1AE1A 1LC3A 3AY3A 2YY7A 4CM3A 2DBZA 9LDBA 1R12A 1HE2A 1JVSA 5DP1A 2IODA 4A26A 4XYBA 3X2FA 4TVBA 4YPOA 5IN4A 2B35A 1JAYA 5BSHA 4DBZA 1PGOA 3L4SO 1PJ3A 4G65A 1BW9A 1I3NA 2FPPA 1UP6A 5T8KA 1J5PA 1T25A 3JYOA 5A3VA 3RJ9A 4CR7A 5TQVA 2OHXA 5IZ4A 1ZW1A 3WGOA 5TIIA 4RPLA 2HK8A 3C24A 3KLMX 1ZMTA 4WNCA 4IQGA 2QRKA 4FFMA 4RQUA 2BLLA 3KUXA 3W4JA 2HU2A 3ZWOA 4ALNA 4KUEA 4Y6PA 3BTUA 3WTCA 2C54A 1Z45A 4H16A 2Q2QA 2B36A 3WYCA 3KOUA 2Z1MA 5C37A 1L1FA 4NBRA 1SBYA 1I2BA 1XU7A 4OAQA 3WNVA 4IINA 1ZBQA 2VWPA 4YCAA 4BNHA 4ZQEA 5T57A 4DLBA 2D8AA 3A28A 3W8DA 1NFRA 1YBVA 1EFKA 4EUEA 4KDEA 1E7SA 1DDOA 5KJEA 1PTJA 5JYDA 2DLDA 1B15A 1DSSG 4IMPA 2JKVA 3E6AA 3PLRA 4GBJA 4JBHA 4CMHA 4J49A 3L77A 4ND1A 3LLVA 2QG4A 4CMAA 3RQSA 1ZSYA 3VOSA 3R1IA 4GKBA 5ICSA 3WX0A 3HDQA 2O7SA 1E3JA 3ROQA 1SCUA 4DIBA 3ITKA 3ONEA 2RHRA 4ZN6A 1U3TA 4NG5A 1MGOA 1EK6A 3RFXA 3ZWCA 1HDXA 1PL7A 1VL0A 2XPCA 1GZ3A 4AJKA 2B69A 3EGOA 1X7HA 1GYPA 4FFOA 5JY1A 5TRTA 4WCFC 1MFZA 1EVZA 1JWBB 5L4SA 2R00C 1V3VA 3PHHA 1ADCA 4ZQFA 4NJMB 2AQHA 3H9JA 1XHLA 3L0DA 3HHPA 4KTVE 4JXKA 4C4OA 3WGQA 2X0RA 1GL3A 4B3HA 5IF3A 3JTMA 3SVTA 2Q46A 1B8UA 4BNUA 5U9CA 1MX3A 1QYWA 1RYDA 5JLAA 3V2GA 4E2XA 2NLOA 3B1FA 5BNTA 1U28A 4TKMA 5ITVA 3F1KA 2PH5A 2VT3A 3D1LA 3FR8A 4XA8A 3K2BA 1PJBA 2FZEA 1YONA 4CQMA 4OMUA 3TFQA 1R37A 1CF2O 2GN4A 4G81A 4WUVA 2AHRA 3E1KA 4JIGA 5TLSA 3WWYA 3LYLA 3M6IA 3NJ8A 3LF1A 2Y05A 4PZDA 3WGZA 1YO6A 1R66A 5G0VA 3ETDA 3FN4A 4XKJA 1P1HA 2X6TA 2ZK7A 1M75A 1UXKA 2NVUA 2YFHA 3B6ZA 3BHIA 3AK4A 1N9GB 4L4SA 4UVHA 3JYPA 1A27A 2VRCD 3RJ5A 5JCJD 2HMVA 5B4TA 4LK3A 3B1KA 1ML3A 4AJEA 5B4UA 3I9KA 3F3SA 4FJ2A 5A3JA 2GRAA 1E3IA 2EJWA 2C2XA 5L4NA 2RH4A 4RVSA 3UAGA 3OECA 4J1TA 4WLVA 4XDZA 4E30A 4B4VA 4TZTA 3TL2A 2YHIA 4M89A 1C0KA 3LVFO 1LSSA 1X14A 4E2YA 5DOVA 2NSDA 3DZGA 1F0YA 1K5HA 4HBGA 4YA6A 3VTFA 4J6FA 3O8QB 2BFPA 4QSMA 3TN7A 4OQYA 4CV1A 3JQAA 2X0JA 4CM8B 3V1YA 1PJ4A 4I5FA 1BXGB 1YDEA 5L3ZA 3AUAA 1V3UA 1ZEJA 1XU9A 2HMTA 4RL6A 4YDRA 1OOEA 4Y9DA 1AHIA 3GQVA 1RM5A 4ITUA 3ZNNA 1NR1A 3L9XA 4MPDA 2FPGA 3MOIA 2IZ1A 2ZQZA 1TT5B 3A9WA 3WGTA 4OHUA 3GRKA 1VJ1A 3GPIA 3QE3A 4L0QA 4BO3A 3GEDA 4OM8A 1DIHA 2E37A 1PIWA 2CMDA 4DMMA 1I24A 5EJ2A 4CV2A 5JE8A 1P45A 5U4QA 2DQ4A 3T4EA 4CUJA 1CQJA 4M54A 4ZA2A 1TEHA 2VHVA 4OQZA 3QVOA 1UAYA 3ASVA 3GN1A 1MXFA 1ZVMA 2GN9A 4YJDA 1UXHA 1IL0A 2X58A 4LRSB 3O26A 3ZWVA 4CL8A 1DHTA 3CZMA 1JU9A 4BNJA 1GAEO 2OMEA 4OSOA 2RHCA 5L51A 3RUFA 3IJPA 2Y1EA 1UR5A 4AJ4A 4DGSA 2P91A 4XQ9A 4FW8A 1GUFA 1ZXBA 1DAPA 3VHRA 3PYLA 4R01A 1C1DA 3BTOA 3TSCA 4CQLB 2OGUA 3NT4A 4GWKA 4ROSA 4IGEA 3WYEA 3TOXA 1VSVA 3BMCA 4FGSA 1PJCA 3PJDA 2FR1A 3OMLA 3PHLA 4RLSA 2TMDA 3WWZA 4W7IA 4CMCA 1OZAA 4UEJA 1PGNA 4BOYA 5CDTA 1U3WA 3UKOA 3I9OA 1PS9A 2XXBA 1K6IA 3RC9A 1KC1A 4FJ1A 4FB5A 1GY8A 1P1KA 2I76A 2PZKA 5DP2A 6LDHA 4BGVA 1I32A 2QQ5A 4CMIB 4B4OA 1UZNA 4Q3AA 3KYCA 3SX2A 5A04A 3K92A 4LVCA 2QHXA 4CMBA 3I6IA 4CUZA 1EVYA 1P77A 3NDJA 2J3KA 4MVJE 3HADA 4NFHA 4OGWA 3LC1O 1KVSA 1GEEA 3DBVO 4KUHA 3ZH2A 1MG5A 2OUIA 2HKIA 3E82A 3BMQA 3OEWA 2NNLD 4S3MA 2AQ8A 4RQTA 3EHEA 2PNFA 5IDQA 1QXSA 4U5QA 4FD3A 1DIBA 5JSFA 4B8WA 3H3FA 4Z3KA 2IE0A 2Z5LA 4DLLA 3ZW9A 3ZWPA 3FHLA 4J1NA 3VZRA 3EZYA 3E5MA 4HFRA 4IBOA 5HWSA 1H9BA 4PG6A 4PVCA 2GO1A 3FNEA 4NFYA 5F1PA 1K6XA 1YGYA 3GC6A 4ALLA 3GFBA 2WYWA 2J3JA 2GD1O 4QXMA 4DVJA 4YRDA 4BIIA 1WAMA 1BTOA 3GNSA 2ZCVA 2CDBA 3GNQA 1PL8A 3QP9A 5GZ6A 1IZ9A 3CPSA 3TF5A 2Q3EA 4GX1A 3ZHZA 4BKRA 4D3FA 2HJSA 1NPTO 1ZXLA 2Q1TA 5AXBA 2P4HX 3RC1A 1LLUA 2EXXA 3O38A 4KWIA 2YDXA 2GLXA 1FDSA 2HDHA 4XQEA 4OL9A 4FR5A 3QRWA 3GFGA 3WG9A 1NQOA 4E3ZA 1A9YA 4OXYA 5C7IO 1HZJA 4W99A 3OQBA 4XYGA 2H63A 5COQA 2AEJA 1O8CA 1ZSVA 3C7CB 3K31A 3E18A 1R4MA 2UYYA 5A9TA 4MP6A 2VZ9A 4KUGA 3INTA 1JN0A 1OBFO 3BMQB 1H6DA 4TZKA 4EGFA 3HFSA 1ISHA 4BQRA 4XZ3A 4P4LA 2NUAA 4YJGB 3SXPA 1NAHA 2WD7B 1HYEA 2B5VA 3I3OA 4H15A 4R51A 5HRUA 1PL6A 5CDSA 2HO5A 4L73A 2W2KB 3PXXA 4YT5A 4D41A 1WP4A 2CY0A 3TNLA 4U0JA 5J23A 1PQUA 3VZQA 4NR0A 2C59A 3QV1A 2VUSA 3NT2A 1NFQA 3H2ZA 4E2WA 4J7CA 1J0XO 1ZK2A 4RPGA 3EC7A 4XYLA 4CUKA 3EY4A 4PFJA 1VL8A 1T4BA 3HQ4O 4XQGA 1FMCA 2H5LA 4MVJI 4EYEA 3HDHA 4K6FA 1E3EA 5AXAA 2BMAA 2ZTMA 3OP4A 3LT0A 5TF4A 1IHXA 1KVRA 4CM8A 2HLPA 1IE3A 3KV3O 4B7CA 3MTGA 4K6CA 1JKJA 1IPFA 4KP7A 1AUPA 3HB4X 3DDNA 1NP3A 3S2EA 5I9LA 1HTBA 1TA4A 4J9VA 1P1IA 3GG2A 5AXDA 1VJTA 1UJMA 1YL5A 1O94A 1SMKA 2I6TA 3DTTA 3PVZA 4IDFA 2GR9A 3H3JA 1YE3A 3G79A 1D1SA 2BGKA 4EDFA 3DZHA 1KEVA 4O59O 4RJTA 3ANNA 3ZWYA 4YRAA 4BGEA 2C5AA 1HDOA 1N92A 3I9JA 5GY7A 2VN8A 3S55A 3D3WA 4NJMA 3PPIA 2DU8A 3RU7A 4DRYA 2P2SA 1W0CA 3E8XA 3HFGA 3ZWNA 4L8VA 3PJFA 4GSLA 5EIOA 4ZJUA 2ZTVA 2D1YA 1DC5A 1HWYA 2Y0CA 2Y1GA 4Y8VA 1MB4A 1IUKA 2JCVA 4L9RA 4Q3NA 2DTXA 3MWEB 1PGQA 2FSSA 3E9QA 3VH1A 2GASA 4PG4A 5EMHA 1K6JA 1ZSNA 5L7WA 4WKGA 3WJ7A 3SEFA 4AICA 3JQGA 1Z6ZA 2YYYA 2PY6A 2O4UX 4L75A 3PWZA 1NX6A 1BXZA 2EJVA 2XAAA 2UV8A 3NUGA 4YJGA 1JA9A 3NTRA 3RBXA 2V65A 3K73O 2X8LA 5CEFA 2OOSA 1LDBA 2DBQA 3LF2A 3WFIA 1E3SA 1P44A 2OBYA 1NVMB 1X0VA 3Q2KA 4I9NA 1I3MA 4IQ0A 1IYZA 2PZLA 1UZMA 4UUNA 4BKUA 3IMFA 2Y1CA 2IYPA 1Q0HA 3JQDA 1DHRA 3RAJA 4S1VA 1CETA 4YRBA 1U3UA 3FPLA 1PR9A 3ZN2A 1G0NA 4TRMA 2Y1OA 1GEGA 2AG8A 1GDHA 1DIAA 1LDNA 3FD8A 1GPJA 3JQAB 4CQMB 4KOAA 2ZB3A 4F6LA 4EJ0A 5CDGA 1JWAB 2W4QA 3MWDB 4CLEA 3GT0A 3KVOA 4PVDA 4WCFB 3ZV3A 5A9SB 4LSMA 4R1NA 1DBVO 1LDMA 2EGHA 3O9ZA 4WECA 1ONPA 2JCYA 3ZU3A 1BG6A 4HUJA 4K1LA 4RV9A 3ZNQA 3NEPX 1BMDA 4BNNA 1ULUA 3JQ7A 2BFOA 5JNLA 3HB5X 4AJPA 4XCVA 1HDGO 4INAA 2DPHA 1Y9AA 4EBFA 4BB6A 2JAPA 3WNQA 5CPBA 1NFFA 2HRZA 2FMUA 3ORFA 4E31A 1GUYA 2P5YA 3NKLA 3QWAA 2R6JA 4PIVA 1GZ4A 2R2GA 3TZ6A 3IAHA 3JYNA 1KEUA 3PP8A 1EBFA 3QHAA 1NQAO 4D3DA 3PGXA 2QYSA 5T5QA 2E48A 2YJZA 3MJCA 2X5OA 4XIJA 1YQGA 1IHYA 3H5AA 3V1UA 3MJEA 4CQMD 5ILGA 2P4QA 3SLKA 5DCYA 4RPHA 2JD2A 5DCWA 4ZVVA 3VPHA 1O9BA 1R0LA 1XQ6A 3EMKA 2G5CA 4JP2A 1GR0A 1SZJG 2PGDA 1LUAA 1GFSA 5AXCA 1BXGA 1ZO8A 2P5UA 4E4YA 1ENPA 4B4UA 3Q9NA 2ZCUA 2BI8A 3UF0A 1NHWA 5JCXA 3DAFA 3DBRB 1I2CA 1AN9A 3M2PA 4PLTA 1WZEA 4RVHA 2VYVA 2GERA 2C0CA 4GPD1 1B2LA 4RO0A 4GX0A 1Y8QB 4NK5A 4RVFA 3GH3A 3V1TC 1AXEA 2ZIZA 4X54A 5JDIC 1U5AA 2E49A 3NV9A 1PQPA 3JSAA 4E33A 4EEXA 1H93A 1EEHA 1E5QA 4YWJA 2GDZA 4NBTA 3LC2O 3KRTA 2UVDA 3LLSA 1R15A 1XQ1A 3C1AA 1SB9A 5IDYA 2DM6A 1CIVA 2O3JA 1A9ZA 4RF4A 1SB8A 4NFSA 4G2NA 2O7QA 4A0SA 4J4BA 4H3VA 2HMSA 3OA2A 2PR2A 1XSEA 3WQQA 5KNLA 3HDJA 3I4FA 5DDIP 1QSGA 2Q50A 4J2OA 1DFGA 4WLEA 3VC7A 3OJ0A 3G1TA 5EINA 4D45A 1I2ZA 5T8KC 1YL7A 3UFXA 5BR7A 3IC5A 3VPGA 5CFZA 4TRJA 4PN3A 4BGUA 3JD4A 1DB3A 4N5NA 5U1PA 4MKRA 1W8DA 3GZNA 4D44A 1Y8RA 1WMBA 4MP3A 1HSOA 4XB2A 5KVSA 2DTDA 1QYDA 1XCBA 3GLQA 4WOKA 5TS3A 4Q3BA 3KYDB 5L4LA 4RVGA 2AEFA 1DOHA 1N2SA 3LDHA 4LCJA 1I36A 4NZ9A 1VKOA 3ANLA 3DOCA 4MVJG 4Q3DA 4EUHA 4R16A 1F17A 2GUGA 2RBEA 1V35A 4XJSA 5AVOA 1LTHR 5IXSA 3BTVA 3NX4A 3VDQA 3ONFA 3DHYA 3E9MA 4BB5A 1GCUA 1PX0A 4TSKA 2BH9A 2JAHA 3M1LA 4RVUA 3LT2A 4IXWA 5FFFA 1EFLA 3ROMA 5JCJA 3UCEA 1EDOA 2ET6A 5KWEA 1PGJA 4I1IA 1GD1O 4WK6A 1BGVA 4NJOA 3ST7A 1OC2A 5JPIA 4B3IA 1U4OA 4MVJF 1KY5A 4CV3A 3WIEA 1E3LA 4AL4A 2NQ8A 4GVLA 2B5WA 5DF1A 3Q2IA 4WEOA 2ZATA 3HG7A 1NHGA 1U1IA 2BKAA 3E48A 4JJGA 3DHEA 5G0SA 2CDAA 4PLCA 3G17A 4UULA 2GCGA 2DTEA 5T67A 1U4SA 5LCXA 4CM4B 1Q1NA 3JQ8B 1GQYA 1DLIA 4BNGA 3VKVA 4URFA 4YQYA 3AFMA 5I7SA 1ZJZA 4YAIA 4WOJA 3CMCO 3IP3A 3DC2A 2GN6A 3PHGA 3STHA 2GYYA 4CM9D 1BVRA 3KETA 3JQ9A 4BNMA 3DFZA 1GYRA 2J5RA 2DBRA 4IDGA 3W4KA 1GU7A 4W9NA 2PWZA 2CDCA 4J7UA 1VPDA 4MIEA 3H65A 5F5LA 1JKFA 2JFHA 4J9UE 5H83A 3WQRA 1F8FA 3QVWA 2NM0A 2I99A 3AI3A 1W73A 2QRJA 1DAOA 4OO3A 4UREA 4RORA 1LI4A 1YRLA 4E5KA 5G0TA 4HKTA 1PU2A 3CE6A 4BO1A 5L40A 1J4AA 5FI3A 1DC6A 1A71A 1ENYA 1H0KA 2OL4A 5KJ1A 5MDHA 2J8ZA 4HNHA 5EN4A 1O0SA 1QYCA 2C82A 3QLJA 4JN6B 3VZSA 2I66A 3BXXA 3F4LA 5KOIA 1E1KA 3OSUA 3DBLB 2W90A 3EK2A 4FFPA 1Y81A 3H9EO 4HX5A 2P68A 1YVEI 1V8BA 2GN8A 2Q4BA 1V6AA 2VNAA 4ZGWA 2Y66A 2AXQA 2XXJA 2FRDA 3RUAA 1PJLA 3H7AA 2W2LA 4I8XA 3DO5A 1NTOA 4W4TA 1YS4A 4WLNA 4BUCA 7ADHA 1E7YA 3BAZA 2J3HA 2D4AA 2NVWA 3CINA 3ZV4A 4CMEC 5A1TA 3IKVA 1PZFA 4JROA 2NU8A 1K89A 1YBAA 3WQSB 1TXGA 4DLAA 2NU6A 3QJ5A 4ID9A 3QWIA 2D0IA 4JK3A 3ZCXA 1YKFA 1YJQA 4OOEA 1DFHA 3PK0A 5C7OO 4U6SA 1JLLA 1X7DA 4KZPA 2Q2VA 2WWRA 3TWOA 4FC7A 1BSVA 3K5PA 4FDAA 3NGXA 3KEOA 3JYLA 4AVYA 1U2DA 2OO5A 4K9DA 2VWQA 4YAEA 4M49A 4GMGA 4XRRA 2I3AA 1EVIA 1XKQA 3QQPA 3ZHYA 2YDYA 1U2GA 5C5IA 1T2FA 1E6EA 1HKUA 3MTJA 4F6CA 5JAMA 3PYMA 4E6PA 2D5AA 3H5NA 3AM3A 4J90A 4PLFA 1Y8QA 4YYZA 4XR9A 1Q7GA 2HCTA 3D4NA 4BMNA 3T7EA 1LSJA 4JLWA 1SPXA 4C7KA 2F00A 1NPDA 4MKZA 3OICA 5G0UA 3F1LA 3GF4A 2CSUA 1PJTA 3LU1A 4FCCA 3WR5A 3GA0A 5JFOA 2GGSA 4HV4A 2DPGA 4MVJH 4FFRA 4Q3EA 3WBFA 2YW9A 3MZ0A 5EQFA 1HLDA 1Q7BA 1QP8A 1Y9EA 4YVFA 2JJYA 4OYRA 1A5ZA 1O5IA 1R16A 3GEMA 4GH5A 4J2HA 4PLYA 1IY8A 4FC6A 3RKRA 2AMFA 3V2UA 1RWBA 2D5CA 2WE8A 4A2CA 5LDGA 1QKIA 1MP0A 5JO9A 4LISA 4HY3A 1CWUA 5JY6A 1DRVA 3C3XA 4EZBA 3ADPA 1Z82A 2Q1UA 1PJQA 2A9FA 2DAPA 4CLDA 5IFLA 4DYDA 1Y5RA 5BNFA 4NNJA 4N54A 3EVNA 3D64A 1X1EA 2ILTA 4P38A 3UUWA 1I3KA 4TKLA 3ZW8A 3WFJA 1SAYA 3P7MA 1T1RA 1QLHA 1T2CA 3L6EA 1I33A 5BT9A 3V8BA 1E6WA 1WW8A 1KETA 3BMOB 2HAEA 1J49A 3ZV6A 1YB1A 1ZZEA 1VSUA 5FYDA 3JQBA 4ND2A 3NTOA 1RJWA 1NR7A 3BA1A 4YT2A 5IG2A 3RROA 2VT2A 3DMTA 1U3VA 3WGIA 5DCUA 2W2KA 3OBBA 1MG0A 3KSUA 4F46A 1IOLA 1U5CA 4RPKA 3K96A 4BO0A 4PLHA 3GRPA 1B8VA 1FF9A 1K3TA 4JQCA 4CODB 5L9AA 3DBHA 1V9LA 1ARZA 1M6WA 1IZ0A 1LJ8A 5F5NA 3ZWWA 1DIRA 5A9SA 4WASA 2DT5A 1ZIDA 1CRWG 1P74A 4CM4A 5TC4A 4UUOA 1JQBA 4IGFA 1D8AA 2P9CA 3JD2A 3BZUA 3X2EA 2ZKLA 1GZ6A 4OIMA 3L07A 1VJ0A 4ZU3A 3I9LA 5DBGA 4IJKA 5ES3A 2C20A 2O3RA 3HN7A 2JFFA 4I9HA 4D46A 3C8MA 2AA3A 1ZEMA 3RD5A 4UEKA 2VWHA 3VZPA 5B1YA 4LVUA 4GI2A 5IJZA 1UDBA 4CR6A 4PGFA 3RSHA 1M6HA 3A1NA 4MVJD 3UW3A 1NNUA 4MP8A 2J5QA 5A5FA 3RI3A 4IUYA 3GUYA 1YBMA 2YV1A 4GKVA 5ENVA 3ZI0A 5T6BA 5K6AC 4DTIA 1PEDA 5CDYA 3OJFA 4CV0A 4JBGA 2QYTA 2A92A 4XDYA 4MOWA 3B1JA 1B16A 3MEQA 4D0RA 2VYND 2EKQA 4DQVA 1TI7A 4QQRA 1Q2XA 4LGVA 5THQA 4BMVA 2CNBA 2QX7A 2QZZA 1ZMOA 1O6ZA 1SEVA 4FSHA 2PZJA 2AE1A 4R69A 3P2OA 4QFDA 2ZTUA 5HTOA 3GMSA 3CIFA 2Y1DA 4R5HA 3AUSA 3WGYA 7MDHA 1JAXA 3SC4A 3FNGA 3VH4A 1KY4A 4PG5A 2V6FA 1B7GO 3GG9A 4WLUA 3ICPA 5HS4A 4MIYA 3S8MA 2E82A 1QV6A 3OF2A 3U4IA 1HYHA 1YOVA 4E32A 2ZB8A 1EQ2A 3FWZA 1L7DA 1HE5A 4DA9A 5AYVA 5DBIA 4FIZA 2IRWA 1EMDA 4UAGA 1O95A 5H81A 4PLWA 2EKLA 3GZ4A 4PLZA 2DUUA 1FK8A 4OSPA 1T2AA 2RH8A 4ZICA 2YHUA 2W98A 3FWNA 5BSFA 4AJJA 1WMAA 1QR6A 1LC0A 3DFUA 2VNSA 3IUSA 4YQZA 4PCVA 5TX7A 1SO8A 2B37A 2FP4A 2UDPA 3RFVA 2F1KA 4ND4A 4MVJA 1EDZA 2Y99A 2ZB4A 1LQTA 1TT5A 1B3BA 2PD6A 3HDYA 3RASA 4R1TA 4FFLA 4RCVA 4N5LA 2FR8A 5I7FA 5DN9A 4EUFA 5C3MA 2NTNA 3GR6A 3HSKA 3RFTA 3JYQA 4O0LA 4Z6KA 3JQ6A 1KOLA 3VVBA 3AU8A 1PZEA 3W6UA 8LDHA 2Q49A 4YJFB 4YAKA 3NDIA 3UN1A 1CEQA 1I5RA 3U62A 1E7RA 1CDOA 1R4NB 1RPNA 4I5EA 1HYGA 1DRWA 2CF5A 3C85A 1GPDG 1PZHA 2V6MA 4O6VA 1D3AA 1Y6JA 1CJCA 3JQ7B 4OXNA 1PSDA 3ZHBA 2P9GA 4NU6A 4RLHA 4TROA 1LRKA 3JV7A 2OXIA 3OQ1A 1UDCA 4A03A 3DHNA 4IM7A 2BRUA 4EJMA 5KKAA 5AQ1A 1C0LA 1PZGA 1ZNQO 2D3TA 3Q0EA 4ALIA 1PQWA 3DXFA 5EQDA 5FF9A 4CMJA 4PLVA 4YJHB 2RIRA 1QRRA 3I52A 1R4MB 4FBGA 5DOZA 4CMEA 3K9QO 5KCZA 3RCBA 3JQCA 4CM9A 4RZHA 2PA3A 4O5OA 3ANMA 3RC7A 2G0TA 3WSWA 3I4CA 1O89A 2Y67A 3OEYA 4MDHA 4XX0A 3W8FA 3KO8A 3DEYX 3AOEA 1P31A 1ORRA 3GDFA 1EE2A 1ADBA 5KJ6A 1H6CA 4ESOA 4UVDA 1TVEA 1XG5A 1DIGA 3RBVA 4IS3A 1DFIA 2AE2A 3GPDG 3NJ4A 3PQEA 1JW9B 2VHWA 4BO7A 1N5DA 3UHAA 3DMTC 4FS3A 4R41A 3HE3A 4YT4A 1HEUA 3P5SA 5DBFA 4U7WA 1W6UA 3W1VA 3QSGA 4E5MA 4B79A 3OIDA 2PGJA 2OFPA 1H6BA 4MKXA 1E92A 4E0BA 5IDXA 2C2YA 1ISFA 5HA5A 1GV1A 1HRDA 1MUUA 5GZ1A 5KVVA 5JC1A 4FOOA
chains in the Genus database with same CATH superfamily
5DWDA 3IIMA 2FFAA 2QAIA 2JCBA 2WSLA 2HF8A 2XNDA 1DI0A 1G2IA 1YH3A 3JD3A 5JMPA 3UYLA 4Q18A 4Z9XA 3VPAA 1YZFA 4F1JA 4LI0A 5B37A 1U63A 2I3GA 2Q21A 4HXEB 1OKKD 1QZXA 3JWIA 3MOGA 3FRJA 1MB2A 3F67A 4HK4A 4TTTS 4I5DA 1NATA 1E6KA 3RIMA 5CTJA 3UQYS 2QMQA 3GXBA 5K99A 1KZ9A 4FE3A 1KVTA 2Z43A 2W9XA 3EEYA 5COBA 3RU9A 4DL9A 1UKBA 4PBTA 2AD1A 1J8VA 3BF8A 3ZKWA 2FR0A 4BQNA 1YNSA 2BH2A 1N9GA 1MVNA 4RETA 1ZC3A 4DUYB 1OX5A 1Z63A 4DXAA 2Z30A 2FEKA 3CG4A 1IN8A 1E5DA 1U94A 1XKXA 3MT9A 3QH4A 4G01B 1WUJS 2PQMA 1Z8FA 3TDNA 2WT8A 4O1HA 3WSVA 2IP4A 4EG4A 4M8LA 4YMVA 4E7OA 2J87A 1E1NA 2DULA 2GPBA 3IAUA 4Z3DA 3R0XA 3COSA 1ECPA 4W8HA 2VHTA 3P20A 3D4OA 4QGBA 3OQOA 1AGNA 2GXAA 2YZGA 3RTCA 3T8YA 3K9HA 1GRCA 3FWYA 3LGXA 4L76A 4D0SA 4HC4A 4KTTE 1OZ0A 2H1HA 4XGNA 2IOHA 5A71A 4ZU1X 3VR4A 3A6HA 3DMYA 2VHEA 5E6RB 4H7PA 1MXHA 3VC1A 1G9SA 1IATA 1NLUA 1OWPA 2ES4A 3O8NA 3MQ2A 4MVWA 4O1IA 4UXIA 4V0RA 2WFLA 3CTPA 3S2GA 4DREA 4BZPA 1XXHE 4QOEA 4JNCA 3TW8A 2YWEA 3UAOA 3K20A 5EZSA 4I5GA 2A84A 2J48A 3U60B 2IXAA 2WJZB 3W8EA 1TO1E 4K86A 5CLQA 3WMWA 1KBZA 1V7QA 2ZRMA 4KXWA 2JC3A 4QXRA 5CB0A 2YQ4A 4FJ0A 4Q4DA 5BOVA 4Q1AA 4PYMA 3WO1A 4Y7CA 5JFGA 3RRBA 2DPLA 3LT4A 2WIAA 2GTHA 2FSVC 4WW0A 1QG6A 1OHHA 1XLTA 4Y2VA 1XELA 4WCFA 1ZUNA 4HFMA 5CNIA 2Z9DA 3VU9A 3WHKA 3COZA 2ALJA 3ABIA 4QUBA 4X3OA 4N48A 2GWRA 3A6LA 4M88A 3VNRA 1W88A 1EAYA 4CLRA 2NU6B 1INLA 1BE1A 2OY0A 3BE4A 3AJEA 3C7AA 5EERA 5C0OE 1FSFA 2FP3A 1EFVB 2ATEA 3MAGA 5I4KA 1JHOA 1L8LA 4BE9A 1UH5A 1NYLA 3ACDA 1WLYA 1JMVA 1XTJA 1XMPA 1R2QA 3NOQA 4IIJF 4UUAA 5GV7A 4ARSA 1OGJA 3PFFA 2FHSA 2WIGA 2H9YA 2ZIGA 4GI7A 2D2IA 1XP5A 1ZKMA 4R6WA 5F3WB 4G89A 4N49A 5AW6A 2PFKA 3NYWA 3SZOA 4DCUA 1QJ4A 2XT6A 1E3DA 3DEJA 3MIZA 2AF3C 4AZWA 5H70A 3RS9A 3HY3A 2FY8A 1VC2A 2P1RA 2VJMB 3PVSA 1XQ9A 4QRHA 4A10A 4M0FA 1K8ZB 2C0PA 1XYGA 3VU9B 3T15A 3ENVA 4BNDB 1XMOB 4X1KA 3WNBA 4KH0A 2Q5JA 1W52X 1FFWA 1A8QA 2FSHA 1ZH6A 2IEYA 2ZSIA 3QWFA 1KMCA 1BD3A 2NO1A 3CW9A 3KR9A 4QREA 3Q3EA 1WCWA 1I8TA 5BMVA 4NSNA 4H7HA 3EXAA 1J6UA 4Y2UA 4BDSA 2H1SA 1YR1A 5D3MA 1M1YE 2V03A 4UMVA 4CIWA 1NASA 1TM4E 4XVUA 5K8IA 4IIXA 3PA6A 3G9TA 2X86A 3GFOA 4EL0A 1RXEA 1Z33A 4DLVA 3ZDDA 3JQGB 4OOFA 1H4TA 3QI2A 3R5SA 4IIDA 5AK4A 2RK4A 2OG2A 2Z4TA 3KTAA 1AT1A 2QRMA 4A6PA 1RSZA 2O6HA 4MCAA 1Z15A 3WL4A 5EJIA 3FUWA 5I9NA 3X44A 2A35A 3WMFA 1NP7A 4BNZA 3U1VA 3LKDA 3EJ6A 4HP8A 2I67A 3HFJA 3SFVA 3G0OA 2EQ5A 1RRKA 1Y1RA 1Z62A 3VX3A 4F91B 3S27A 1VPWA 1GTL1 3A3PA 1QHHB 3CF4G 2ODEA 5KWJA 1D2AA 1MCZA 5AM0A 2ZYVX 3CR7A 4DBLC 2AFRA 3CT6A 4UU8A 4HPWA 5E6SA 3AINA 3AYXB 2QF7A 3G7UA 4D5GA 3EULA 2ODPA 5KQLA 3M9XA 2BEWB 1SN7A 3S0JA 2CYCA 3OC0A 5COAA 4LYGA 5DNYB 1SUEA 1V3TA 5DULA 2WF7A 3RYTC 3UG7A 1HDYA 1KBQA 5JATA 4XJVA 1RQXA 3GGJA 3Q7IA 1EK5A 4HYTA 2JGRA 4X20A 1ST3A 1PEKE 2JFBA 1X42A 2ZWOA 3A2NA 2B99A 2CUNA 2HEIA 4YB8A 3MJSA 1P0PA 1TECE 4LSWA 5F4ZA 1KZ1A 5JS6A 3IVXA 4R7GA 4PZ0A 3N2EA 2B4QA 2Y1WA 4MMZB 1F4VA 1FDWA 3PPVA 2UKDA 4FMCB 3L4BC 4K9KA 4XGKA 4AM8A 5J1SB 3GPCA 1RABA 4X8MA 1LA2A 3MTBA 2NAPA 2PWBA 3KXDA 3PR2B 4BKOA 2YWXA 1J24A 2ID8A 4HLNA 3KM0A 1DEOA 3FDFA 4QECA 4KO8A 4DMCA 2R4UA 4RYDA 2XDAA 1N2EA 3GI1A 3P26A 4FWTA 1SCDA 5JVDB 2MINB 2H1OA 3F2VA 3FAZA 4ZO6A 4LFAB 3PITA 1DJOA 2EU8A 3WTBA 3WA7A 4ZQCB 3HO8A 3PUKA 1JWLA 2UZ1B 4A7PA 4XIYA 5HKBA 2HJRA 5EI5A 2PJUA 4BJ5A 3N9IA 4FFWA 4D9IA 3OLCX 4N41A 2VOEA 1XZMA 1IEWA 1PTJC 3UJHA 1D7OA 1TEZA 1IIBA 2C8JA 1YHZA 2IUEA 2YWBA 2FPGB 1JE1A 1QIEA 2CUTA 3BULA 4JUBA 1FLVA 5FBVB 1ZUWA 2HQ1A 2ZDHA 2HUNA 3QLUA 3IPAA 1RKQA 3NH9A 5F3DA 1L4HA 3AVYA 5TJ9A 2DUWA 1NONA 3JASB 5I48A 1VLHA 3C70A 1LDEA 1RAGA 2BGRA 4UVIA 1T8TA 3BGSA 3H9BA 4YLYA 1RAIA 2H0RA 2Q3CA 1BJRE 1NBOA 1XRSB 3A4VA 3GZNB 1GLVA 3LQFA 3P94A 1PT5A 4FUQA 3QUTA 5CEJA 2OQ2A 3L5KA 4N18A 1QRAA 3ZI4A 5C4MA 2G7MC 1FW6A 4B48A 5DGCA 2A5FA 3P19A 2B4KA 2PZMA 4MA4A 4EX6A 4J0IA 3DCIA 4G0PA 1KI1A 3KL2A 2F8TA 3IQFA 1VE1A 1J97A 2DPYA 4B6FA 1UKCA 2MSDB 4NIMA 5G1OA 1O9HA 1TT7A 3VVLA 3VZBA 4AYTA 2CFCA 2EP8A 1WZUA 3KLPX 4Q7JB 4DV3B 1GTMA 4TXJA 1SKAA 1RKUA 2ADMA 2AG5A 4P5EA 2AQIA 2GB4A 2W0MA 1E94E 5CG2A 4M8IA 1O57A 4B3XA 1C9DB 1F1BA 5IVKA 2FKNA 3LK7A 1M6VA 4HFJA 3TH5A 4DC1A 3QFRA 2H54A 4GEKA 2Q4EA 1ENZA 5ALGA 4WCDA 4IDBA 5LP6B 2C9YA 4NAUA 3CUKA 1NWCA 1ORHA 1ZVKA 4MO2A 3U31A 5FLEX 2V7EA 2PN1A 1DJPA 3L7LA 5IWCA 1PR3A 1WVMA 4QXOA 3FI0A 4QJBA 1XZAA 3UK6A 1MIOA 2YJNA 4J0FA 3E9RA 5TQ0B 1Z75A 2QUAA 2XT0A 1K7XB 1EG7A 3KUUA 3ZUPA 2KW5A 1IXYA 1IIRA 1KYWA 3PENA 3CRQA 4CT5A 3ZWQA 1JILA 4A0RA 4OFZA 1A9TA 4FSDA 1OT3A 1G3QA 1WXWA 2ZB7A 5EIAA 1DU4A 5BP7A 4MYTA 2JAXA 3H5RA 3KX2A 4HUTA 3ZY5A 4INZA 1MAVA 1C3VA 3AU9A 5B1SA 1J0DA 1KQPA 2GF9A 4YK7A 3UWOA 3KD2A 5F9MA 5T4HA 3C97A 1GR1A 2VDLB 3I32A 3PFHA 4X71A 1OC4A 4O25A 2IZ5A 4DS3A 2PAAA 2QLNA 2KBFA 4B84A 4P3XA 3ICEA 4XB1A 4E2FA 1X39A 5H3LA 2R7NA 1YASA 4UBNA 1H65A 3P9XA 4UAVA 2C9BA 2OM2A 3EW7A 3OFSA 4L4UA 1XFAA 4N03A 1KMHB 4HDKB 4ZGGA 3NYRA 1FDVA 1PX2A 1XYYA 2AFHA 1IONA 3B9PA 1KBOA 2CVHA 1G6KA 3DH0A 2WM9B 3GCDA 3ENKA 1VYTA 5KQMA 3I1JA 3K1ZA 4DR6B 1V5GA 2J5KA 2ZYGA 3B6EA 3EYAA 4UZEA 1RCFA 5ECDA 3KYBA 1MZPA 2J41A 1W76A 2IIQA 4GX2A 3S7ZA 1AA6A 4DFDA 5GMOA 4V2UA 5GQSA 4YJFA 3EEQA 2QROA 3HN2A 5B12A 3MS2A 2INGX 3QGMA 5D2CA 3JX9A 2ZB2A 4NEGA 4ZVPA 3M3PA 3GFVA 5J2TF 2QQEA 1X13A 4TS4A 8AT1A 4P7GA 1CY2A 1NVFA 2X9NA 4Q9JA 3EXHA 5B2EA 4X45A 4J1SA 3VNUA 1T2DA 3K53A 4TSRA 2FX2A 4BFCA 3L4BA 1RHQA 1EFVA 4K88A 3I0NA 3VJLA 3ZD6A 3KAJA 3CCBA 3WL5A 3KHSA 4PX9A 3ZVLA 2X0NA 2WSSA 2O5CA 1X8JA 5EMJA 1I6WA 2NO5A 5F1OA 2WMNB 1FYWA 3WDKA 4XEHA 2CVQA 4D82A 4PQFA 3GOQA 4LMPA 3H16A 1D6SA 1FBNA 2IDKA 2D1QA 2NADA 2Q3JA 3MWFA 4OX9Y 2X8BA 1FC0A 4S1PA 4BNIA 4IIEA 5FJIA 3D3EA 2VA8A 2JD0A 3OQPA 1YZTA 2NTVA 5DM4A 4BDTA 3R5FA 1YZUA 3F7OA 1U0BB 1XTTA 4NAVA 3MHTA 1PG0A 1SKUA 1UJ5A 3IAXA 4WJZA 3RVDA 3V46A 4U0KA 3CSDA 4HPXB 1YV9A 2JDIA 2QVYX 2GUWA 3ZCRA 1HNWB 4M83A 3W6OA 4TLAA 2F55A 1XMJA 1Q12A 2ZRQA 1P4RA 2H07A 2XD4A 4OQFA 3GFFA 1E32A 1YB6A 1QVVA 2D5BA 3C5EA 4ZT2A 2A5JA 2R7KA 4G86A 3WBJA 3HHEA 4KR0A 1DT3A 1MENA 1VI2A 3A70A 1U0GA 4FD2A 5AOVA 1QDLB 1C7ZA 3RSGA 4LZNA 4B40A 4MSUA 5M7EA 4DBVO 1ZCFA 1D9ZA 3H2SA 4JYMA 2BKUA 4DWVA 3A6GA 2YMLA 5IUKC 1VJCA 2XXAB 1ZNZA 3PJEA 1QONA 4JYPA 3HV2A 1YVRA 6REQA 1EP1B 1K9VF 2BI7A 3LUAA 2NYUA 4K9LA 5B6PA 3ZLVA 3HEBA 1HF3A 2FEPA 3WP1B 4ZWNA 5EHXA 3VVCA 3WLNA 4LRUA 1WW3A 4HDNA 3GA7A 3GPBA 4K9SA 4O63O 2JIRA 3U3KA 3PFKA 4K46A 4BMSA 4YJ3B 2PL9A 3NDBB 1U6JA 1Z4PX 1A76A 4JKIA 1T9DA 2PSJA 1T8UA 3EDCA 4I1VA 4PZEA 1UKZA 2E18A 2BELA 2CVOA 3AQ4A 1HDRA 3FCEA 2MYPA 3OZUA 3IH5A 4QTXA 4R1SA 1AUXA 5A4FS 3GLFB 4CLOA 1VG1A 4G0VA 4RKQA 1I94B 1QYVA 3G8CA 4LW8A 3K70C 1TC2A 4YBZA 3K0FA 2I3ZA 4C06A 3IX7A 3RSOA 2P2LA 4P5DA 2WV9A 4EGCB 1DJMA 4CDNA 2PRYA 1G6HA 3GX1A 1W5SA 3BREA 3KZOA 1TTHA 3COVA 4H7KA 5JADA 1JPUA 2ROQA 1C1YA 4OQLA 3PDCA 2ZIFA 2WSBA 4N0PA 4YP7A 1XDUA 4MUAA 5DHSA 4OBWA 5C4IA 1NU8A 4B1FA 4LXHA 2APJA 3LX8A 1MLDA 1FSSA 3D5QA 4ZQBA 2VRBA 4GBED 3FCAA 4D6YA 5SV2A 3C8UA 2QZ9A 3DZ8A 4F2WA 4CKCB 4CEIB 3OM9A 1JDJA 3SD7A 5EE1A 4ABYA 1GUAA 1M8PA 3NTUA 2GZ3A 5CA1B 1WXEA 3OD5A 4L9AA 1ZK1A 3GJXC 4IJUA 4NXNB 4F86A 3EH1A 5C5EA 5AFSA 4O4LA 4PY2A 2ICAA 2XW6A 2VP4A 2VZEA 5JJKA 2CWDA 1KEPA 2ZJZA 3P2EA 4BFYA 4P3OA 3WMXA 1VG8A 4ALJA 3DMFA 3R40A 4KWHA 1XZGA 2FW8A 4XQCA 2E1PA 2FPIA 3ZX4A 3F6YA 4KRYA 4EJ6A 1VHQA 2I6SA 4QU5A 1GNVA 5DHTA 3WYAA 3ZHSA 5F12A 3F96A 2REQA 3LLCA 1QM5A 2KM1A 3EYWA 3MCAA 2X41A 3VJKA 4D2IA 1DO2A 2MSNA 2EV9A 4K28A 5BSUA 1CUHA 3OF5A 3IE2A 4LJ7A 1JMYA 1DTWA 1MC5A 2PUWA 2GK7A 3BD8A 4UBKA 1ZJJA 4B09A 5B1EA 3BIOA 1KSGA 1FP4A 1J23A 3WICA 4EMBA 4CIBA 4DV4B 3THWA 4TL8A 3L8YA 1QOPB 1ZM3A 1GRVA 2W8ZA 3KYDA 4LF8B 4A23A 4RDHA 3THYA 4OEHA 2EHDA 2DRIA 1NN5A 5BPHA 4RPIA 4ZALA 1E3WA 1W0KD 3U0BA 1VFPA 1E9BA 2ZAMA 2ZJ8A 3P96A 4K3UA 2QI9C 4WEQA 1ISRA 3KP1A 1SCIA 2O8EA 3A4LA 1YQEA 1QGZA 3H8VA 3KVNA 4MQ5A 1BZYA 3AHGA 3IR7A 1KJJA 4QDJA 3RLFA 2BFCA 4JC5A 3B9QA 3BWXA 4MQMA 1U0EA 4CGZA 3CZ4A 3GGPA 1U9IC 1H3EA 3OAAA 2F64A 4BP1A 1LS1A 3JAWB 1PWEA 5LBTA 3BSYA 2GVZC 2HIAA 2PQ0A 4I5IA 1EVLA 1YFKA 4BVLA 7REQA 4P22A 4URHA 4OHFA 4IQ8A 5F2OA 4YPVA 4DWOA 2JLVA 2PD3A 4KQ2A 5I8ZA 1VM6A 2QGFA 4INPA 5HKOA 4A5OA 4JI6B 4K7JA 3GMDA 4W9MC 1G3IA 2VT6A 3KLOA 5KYTA 4IZHA 1C5KA 2O48X 5BNIA 1KJ8A 2UZ1A 2NXWA 5HZHA 4W6ZA 5DCLA 4MWTA 3S70A 3OTWA 3PQ4A 1YKGA 2B5OA 2H4JA 4GT1A 4KW7A 2HWKA 4INOA 3WGMA 3E9YA 2HIMA 3P0EA 3PC6A 3RYIA 3A6DA 4D43A 3IBGA 1E0AA 4BO9A 2J9FB 4DF3A 5EPOA 2XE8A 3VPBA 2GEBA 1VKRA 3I05A 4NFLA 2P6UA 2G9QA 2WDZA 3X1YA 3F5QA 2I87A 4BY9E 1FNNA 3D7RA 1LX6A 1WD7A 3QMWA 3D6NB 2R68A 3IEUA 4PZAA 3DBOB 4TLLB 1H42A 4MV6A 4ZJPA 3H1GA 3LYUA 1FSZA 3ZTWA 2D1RA 4CEHB 3QA9A 1LI5A 1YC5A 1FX0B 1ZH8A 2FWMX 2HO4A 4OXKA 3UJ8A 5FOQA 3A37A 2XNJA 5JQWA 2QTGA 3D6VA 4GICA 5LQUA 2CEAA 3RTGA 2O3TA 3D7LA 3IAS1 3KJFA 1GQRA 2W7TA 2JH8A 1EHYA 2PUBA 4LF9B 3T7AA 3QSYA 2IHNA 2UUAB 3UW1A 2AJLI 5LOVB 5JJIA 1RIFA 3GELA 2D8MA 2H8KA 3ECAA 1QQ6A 3HVKA 4GECA 2WJJA 4R1OA 3ZZMA 2J0UA 4LDQA 4QO8A 5JSUA 1QE3A 2RGDA 5F21A 1NVWQ 4GMHA 1N7HA 2KE5A 2XKJE 4FP9A 3HCCA 1X0XA 2IV7A 5GADl 2JJ2D 1P81A 3G7SA 3JD1A 3AI1A 4CI0B 1WUHS 5I8WA 2WAAA 4P4GA 5GONF 5FEMA 1E5VA 4H9GA 5E0OA 3IMCA 3QPAA 5KDDA 3JQ8A 4ND3A 1B1CA 4CLHA 4XOUA 2IDJA 5IM4F 5ESRA 5C34B 4X64B 3IVRA 2AI1A 4II3A 1DKPA 1LLDA 4BWGA 3GLHB 3M6MD 4R1UA 3FUUA 4PYIA 4RY9A 2HC9A 2Q28A 4JT4A 2BEVB 1GN9A 3TMAA 4AMBA 1K0UA 3Q72A 2AQKA 3N6RA 4IH1A 2HHJA 4K8OA 1HRKA 4TX1A 4ZDIA 5HF5A 3IUQA 3KS9A 3PTZA 2QQ0A 3S2IA 1BMTA 2IYOA 3KOZA 4HDOB 2HK7A 5EJAA 3A1FA 2V7QD 2K4MA 2WWIA 3CEHA 4JGGA 2JHPA 3QM1A 4ZOQI 3SLGA 3B53X 4FINA 2YZKA 3IKTA 3BRQA 5ELMA 2RGNC 4ZVMA 1P80A 3IPRA 1IQPA 4EBBA 3PNQA 4ZZ0A 3QVKA 4ASUD 3K30A 4EHKA 1HE4A 2R8BA 3KUKA 2DF8A 2R7LA 3U16A 1WBJB 1GGEA 1C3XA 1SURA 2ZBFA 4FZRA 4QJ4A 3UATA 3ZHVA 2A8YA 4GL4A 5I6DA 1K4MA 3FSEA 5BY2A 3DBLA 4G9EA 1NPYA 1Z47A 3S1LA 1RWQA 3BMNA 3JQFA 3BJMA 3HA5A 1X1DA 2LP4Y 1JUDA 3IUMA 4URZR 3PHJA 2A4KA 2G40A 3EE6A 2J5BA 3ETEA 3BTSA 4TLCA 4UVGA 5EHQA 4FMBB 5A0FA 2KBEA 4P82A 5SY4A 3GLGB 1CJUC 1G38A 4BO4A 4CMIA 4QEDA 4WD3A 2ZULA 1NVAA 1XKLA 2AB0A 2FX5A 3LQRA 2RC6A 1QAMA 5EUMA 3BRWA 3SP1A 3W2TA 1SUPA 4DA7A 1L7EA 4EA7A 5HK8A 1KA9H 1G1AA 4EKNB 3JCZA 2VHXA 3KBBA 2AI2A 3QA3E 2GZ1A 4BMYA 4M9UA 5FBZA 4Y6RA 5JBIA 3RAFC 2WINI 4WT7A 1M2EA 1E77A 2HGZA 3S1AB 1OIWA 2G4VA 5H16A 3GLIA 1YZYA 1EK1A 4Z53A 5ESWA 5HKKD 4DR2B 2N42A 5CLHA 1ETUA 4B76A 4B2YA 5HBRA 3C5HA 2WEKA 4RF2A 1N9ZA 3DAYA 2FEWB 3OJOA 3F8SA 2PU5A 4OKIA 2A7XA 4PSUA 4JL8A 1ISPA 1R0ZA 4MICA 1U0JA 2G3YA 5IVIA 1TIKA 1T4DA 2R3SA 1ZA2A 3DC7A 3DP7A 3H97A 1C7QA 4QXAA 3OTIA 1C2YA 3G2LA 2YYZA 3UAVA 2WMOB 3W90A 4WSOA 5ALHA 1OFGA 2PUDA 1PE0A 3IBTA 3BL5A 1U04A 4DQUA 1O5OA 1QFMA 4F3YA 5BYKA 1A9XB 1YSCA 3NM5A 2RC5A 1SVUA 4ZC8A 5IYZB 3UB4A 4QT0A 1AJEA 1JSLA 1FSPA 3L5OA 3IP7A 5LUAA 4UCXA 4R7ZA 3TZHA 3UCXA 1ODTC 2OCLA 4JASB 4RFSB 1PWHA 1SFRA 3GK3A 3WGHA 3BMXA 1O0CA 1L5HA 3HEMA 2MYTA 4TMKA 1KDVA 1O0BA 2GZ2A 4TTVA 1ZKDA 3ZE6A 5BR1A 1AN0A 2RJNA 3MJTA 4GQAA 2VL7A 4B87A 4BVKA 2H59A 4M1QA 1IULA 2J6BA 2HJGA 3UCFA 1HETA 1ZJYA 4ARVA 5JJ5A 4URWR 4H3SA 3IALA 4BE7B 1FJHA 5AUNB 4XWGA 4DZZA 2P3SA 1LWOA 3A1TA 3HB7A 5KYWB 3MJHA 4L74A 2JHAA 4XWYA 5D3ZA 1IXKA 3OQIB 4R9VA 4X1OA 3VHLB 1E9AA 3ITDA 5CHEA 2Y71A 3CJTA 2FOLA 2Y8EA 3Q11A 4J4HA 4E5SA 2ONZA 1PLKA 1EXVA 1ZD9A 2BMJA 4PNHA 3KJHA 2BR4A 4ZMBA 1OKKA 1PFGA 4LXIA 2IF2A 2JD1A 1FFCA 4P4UA 4WLOA 2FN4A 1KR5A 4YMIA 1OASA 2FCAA 4EAQA 1V5WA 1KORA 1NX9A 2W6OA 1JTEA 3KYCB 4QBIA 2PVPA 4RK4A 1JPNA 3ECCA 2ZZMA 3V4FA 3PYXA 1YS1X 5BUCA 1HT0A 5EJ5A 5KNDD 2GYWA 4TQGA 5FORA 5HFJA 4ZHSA 4JJ6A 2OBXA 1J39A 3S5JA 1UXOA 2XF8A 1CERA 2GARA 3H42B 2GBCA 2YN2A 4HRYA 4E94A 1QLJA 3TAHA 4D8YA 4HXFB 4A15A 1NSTA 4NDNE 5CA1F 3LTNC 3SQDA 5IUNC 5K6TA 2VJYA 3G49A 1E2DA 5GOTA 4P5PA 1KVQA 1IOWA 1A9PA 5J2TB 3QEAZ 3D2CA 4ZO9A 5CD1A 1NW6A 3N0XA 2AOUB 4X44A 1GSOA 2IXGA 4MAMA 1AXGA 2PV0A 4BUJA 5G2OA 3SYTA 2H85A 1U2TA 4O2LA 2HBRA 1DBSA 3V6LA 1TO2E 3WOHA 1QTRA 1WDMA 3FJ1A 4I6JA 3SBOA 1BX1A 2ZAOA 1BD4A 4L3VA 1VL2A 4XCXA 3R3HA 3CVWA 3EGDB 3QLUC 4YACA 1A9SA 1JJVA 5C1PA 3TIXB 4BVHA 4ZJZA 3NBMA 4NG4A 3SFTA 4KI7A 4M0EA 1NKSA 4RA6B 3FKSD 2R00A 1E0SA 3SS8A 5TQ2A 4YMSA 1SA0A 1K7FB 2RI0A 1ZRMA 1I80A 3AB8A 2G9NA 3KSRA 3PIDA 1SU8A 1ZICA 1WB6A 4XIGS 3SHOA 3T5GA 2EFGA 1FS6A 1B73A 1KR2A 3W0LB 1GPWB 3N0WA 3AEQB 1H2FA 2CXOA 1QLWA 3E7PA 2AEMA 3IHKA 5IBCA 1NI5A 3REOA 5KNBA 1SQGA 2IOYA 1BXRA 2R1TA 3T06B 1JYEA 1CUVA 2Q1SA 2IVFA 3G0BA 4FKBA 4GAEA 4H1HA 4D9HA 3G2IA 2ORIA 1V1JA 1E18A 1X1BA 2PTHA 1E3QA 3DBRA 3X1ZA 4Z9FA 1YB4A 3SMVA 4L3WA 4HDNB 4BO5A 1E0DA 1ZL2A 3BB4A 5ENZA 2JLYA 1G21B 1Y0BA 3PTAA 2ZT6A 4HAVA 3L18A 4OJYA 3VYRB 4EA8A 3DEAA 5K0LA 4HH3C 2FPUA 5ABPA 3JVUA 1QFXA 3TZQA 2BFMA 1UPFA 3M6LA 3A0RB 1CIJA 3COYA 4QPZA 4UTZA 3MCUA 1V8OA 4MV8A 2V1UA 1KS9A 5FRDA 2PKCA 2WG2A 1M3SA 3K0FB 3K0BA 3VKUA 4NRDA 1KJNA 2VDKB 2G25A 2VS1A 4M0MA 3EIQA 3L0SA 3CKYA 3PI7A 3FRIA 2JEZA 1RD4A 4B71A 3SM3A 5BVHB 3EIUA 2V9CA 1Z4QA 2JL1A 2RAFA 2G17A 2EAUA 1JSXA 3DE7X 2PRZA 3FHCB 2Z4RA 1YZLA 5BO5A 1FUEA 1R4ZA 1RLUA 3KL4A 2B20A 4C3ZA 3N5CA 4EOGA 4BQSA 1DC4A 4ZYZA 5CK4A 5HGXA 5F3RA 4QJ3A 4MIKA 4D1YA 1TUEA 3F4KA 1CUCA 1V48A 2CNDA 1UWLA 1NQ5A 4YJ2B 2HRBA 3OE7D 1S2NA 5BPFA 1LC3A 4IF4A 4HQOA 3KT0A 2AJBA 4FYWA 2DBZA 4ARBA 1HE2A 1SWVA 2JI8A 2IODA 2HHHB 4B34A 2UXCB 4KMOA 1XRPA 4A26A 2PUJA 4LRYA 1T2VA 4FGKA 3UM9A 2I03A 4DEXA 5KINB 3W04A 2B35A 3ZXXA 1EAMA 1G3RA 2FLVA 1NTRA 3M6WA 4OLJA 3WADA 4DBZA 1ZY2A 3KVRA 1N3IA 1WPGA 1OWMA 4Q4JB 2J9GA 5CVCA 1M34A 1YRHA 1P18A 2FPPA 4H7DA 5A3SA 4C3OB 3R7LA 2XCSB 1T25A 1L2TA 5A4IS 2IYQA 3Q7TA 1E9RA 5TQVA 2J09A 4R40A 1ZW1A 3MTAA 4HNSA 4JBNA 3X2SA 4RPLA 4B2PA 1MABB 1JLHA 1OWLA 1UZAA 3KQTA 4KBYA 4WNCA 1TADA 4C2UA 1U2EA 1YBFA 2H3HA 3AKDA 3KUXA 4KGVA 4U00A 3WL8A 1FS4A 5DLEA 1CEEA 3TTXA 4LXGA 3HBNA 1ZN8A 3QNUA 3WTCA 1XZCA 2C54A 1Z45A 1GNRA 4Z4EA 2Q2QA 5DW0A 1GNPA 2B2XA 3NANA 3U7HB 4TS9A 4NBRA 1SBYA 2CDRA 4FYHA 4FT4A 1W5FA 2PGIA 4P4SA 1YRAA 1XN1A 3D6AA 3A31A 3IOMA 4HEQA 4XLTA 1SVIA 3EISA 4ZO8A 4DMFA 5M2QA 3BUSA 2A0KA 4WKNA 1AV6A 1ZH2A 3BFXA 3A28A 4LZJA 1NFRA 5EKDA 3CQ9A 3D7MA 1VCOA 4KDEA 4EARA 1CY6A 5F98A 3GLHE 4L6IA 4MYCA 1DDOA 5AVJA 2ZR8A 2HHCA 5DIZA 5C53B 1B15A 3EPLA 5JZMA 2CB9A 2HJHA 1FTGA 2R44A 3E6AA 3G8DA 3KEGA 4MITA 5AUQA 1DAKA 6YASA 1RJEA 4J49A 1TJNA 3REGA 4AULA 5J2UA 3VOBA 1Y3HA 4D9BA 2Z8XA 3LLVA 1WB5A 1QHSA 3RQSA 3VOSA 4BX3A 1DZIA 4DNQA 4QYMA 2DR2A 3R1IA 4GKBA 5IF9A 5E7QA 2DX7A 2LV8A 2ATCA 2O7SA 4OXRA 1Z36A 2C5BA 3NOXA 5CH5A 4CKCA 1XZ8A 1WTAA 4WADA 4DIBA 3SHQA 1B0ZA 1QDUA 4YCCA 4EO4A 1VIYA 1MGOA 2WNHA 1EK6A 4NG5A 4RY2A 4TGLA 1VL0A 1U2QA 2XPCA 3SDBA 4HB2A 3U44A 1PLJA 2GK4A 1Z37A 1J8MF 3BWEA 3CJRA 4LOJA 3L7DA 1JEOA 3G2HA 1ZRNA 4UM7A 3T1QA 2BONA 2QDXA 4EHJA 1QRTA 5FFNA 4U9HS 4BLWA 3CX7A 4EQ6B 4YRLA 1ADCA 1JAIA 3ABOB 2HUPA 3K7EA 4HNVA 2ZUSA 3EGIA 2CJFA 1TA0A 2DQSA 3L0DA 4KTVE 1DAIA 3KZKA 2YC2C 1GL3A 4C2AA 2XOKA 3G89A 3VM6A 1SIUA 1CE8B 4UU1A 1Q3KA 2DP4E 3X3HA 2V58A 2O0MA 3K2IA 1JT2A 2HSGA 2FWBA 2Q46A 2CWWA 1UBEA 3AFGA 3BJZA 2D74A 3HKBB 1GG8A 3CNOA 1TO6A 4KXVA 5JLAA 1FVFA 2QT9A 4E2XA 1IZZA 1U28A 4Y2YA 2G0NA 2VT3A 3D1LA 2K87A 1TQDA 5KEIA 2XB8A 4CQMA 3E22A 2AYXA 4OMUA 3OLZA 1CF2O 3TFQA 4D3XA 4WJLA 1AGRA 1GDTA 3DMHA 1UT8A 2VPIA 2G8LA 4L0MA 1QHNA 2QW1A 1BQ3A 3V48A 1QS0B 4HVAA 3LYLA 2ZU0C 3DTVB 1ZGCA 2VSNA 3LO8A 3M6IA 5EXXA 5HCNA 4PZDA 3UJCA 2R1UA 3WGLA 2HCJB 5CCXA 3L8CA 1R0XA 1E20A 2AHOA 2PHZA 5G0VA 5B30A 1IH8A 2QJFA 4H17A 4L5BA 4TWJA 2ZK7A 1M75A 2NVUA 2YFHA 3TW0A 4HEHA 3VHQA 4U2FA 1N9GB 1V8ZA 1IWPB 4L4SA 5D8DA 3MAAC 3OC6A 4BJ1A 1M1UA 1UBNA 3L43A 1JBKA 4NULA 2OCKA 4LK3A 4MUJA 2CLOB 2XQIA 4AJEA 3I9KA 3TQOA 4P98A 1Y48E 1DQNA 1JIVA 3K0HA 9ATCA 1E3IA 3RRZA 4DG8A 4GLFA 4BZWA 4F5ZA 1NIJA 3RIGA 4HQNA 4GZ6A 2XQFA 3O4HA 1DCKA 4RVSA 3UAGA 3U1BA 1G8PA 2WP8J 3MQFA 3MT7A 4J1TA 4WLVA 1AG9A 3S2YA 4AF7A 5BURA 3BL8A 2V0NA 3UXHA 3FPBA 1LSSA 4C5BA 4E2YA 2QZSA 2QTCA 3E61A 2N46A 2EX4A 4MO9A 3ED5A 3O8QB 3TN7A 1ZG3A 3STWA 2LVBA 1Z6AA 4ABTA 3KKKA 3FAKA 1ZGHA 2G1JA 4X24A 1PJ4A 4LWQA 1SG9A 1IB0A 4CEHA 1HQYE 2CLEB 3ECSA 3K1JA 1JLKA 3DDSA 3PFGA 3GQVA 2YMQA 1RM5A 3D8RA 4ITUA 3ZNNA 5ITZA 3LBFA 3MOIA 2QX4A 2Q6VA 2BZGA 2ZQZA 2DFKB 3WGTA 1M2HA 2ISQA 1Y8AA 4EW1A 1VJ1A 1JEJA 3GPIA 2RKOA 4HDSB 3RIEA 2Q5OA 1Y4SA 2B1RA 2VVTA 1K06A 3FDZA 1XVUA 4LBYA 4BEJA 4PC7A 1PIWA 4UU0A 1ZNYA 5LQNA 2CMDA 4LK2A 4I6GA 4NESA 5EJ2A 4CV2A 4DMMA 1JFRA 3M5CA 1Q6ZA 4RJLA 3B6IA 3HM9A 3ELBA 1T34A 2AFHE 1BIFA 4CQJA 1CKEA 2WWFA 1CQJA 4M54A 1K5DA 3D4LA 4ZA2A 1UADA 3A26A 3E15A 3BZWA 2R6R1 1TU3A 1ZVMA 2GN9A 3N8DA 4YJDA 4AWXA 1VDZA 2X58A 1YRBA 4ER7A 2IHUA 3AONB 3K4QA 4KLCA 4LRSB 3P9NA 1TJ5A 2O9JA 5K3CA 3ZWVA 4MI6A 3V9AA 4YMHA 5EGSA 4PBSA 3G2QA 2RHCA 4TXNA 4C20A 2H06A 3H13A 4RC9A 4OGLA 4ZO4A 4JX9A 4FGLA 1G55A 1UR5A 1Y80A 4GXQA 1A0OA 4Z1MA 4DGSA 2P91A 1XAJA 4JEIA 5K01A 4HEJA 1GUFA 1MEJA 1E1CB 3KQKA 1VE7A 3KOOA 2NZUG 3MWKA 3HZHA 4X97A 4Y2TA 2LCIA 3ZZ1A 1JMKC 2UYHA 2QM3A 3I09A 2WSMA 5JSZB 4DG9A 3N8GA 1Z18A 1OREA 3TSCA 1D4OA 3TIFA 3LCJA 1A69A 1N4DA 4GWKA 2IHJA 5KYGA 2BAGA 4ROTA 4GL2A 3WB2A 1EZ1A 4BN5A 2P0YA 4QD3A 1VSVA 3BMCA 5BNWA 4AS1A 4FGSA 4U7HA 3E7FA 2O14A 1ABEA 2PZBA 5HDBB 2EFHB 4H4CA 3GDHA 4BLUA 3OMLA 2J6HA 4O4IA 2NZXA 4CMCA 2YVUA 4UEJA 2F7SA 1PG5A 4D4IA 3UMYA 4ACAA 2B8TA 3QOYA 3M89A 2HR1A 3FLAA 5IT9A 1ZN7A 4EI7A 2H65A 2FPMA 1RQ7A 2WKPA 4BWVA 1I2AA 1K6IA 1XNRB 1EFPA 3QE0A 5CVDA 2IYXA 3DV0B 4MZDA 1CQXA 4QOSA 5ALNA 2BGWA 2D1SA 4BGVA 1A5AB 2HPZA 2FVXA 4RTMA 4YUYA 1KK3A 4PEVA 2FZ5A 3AVPA 1C9NA 3K0AB 3MBIA 4OLHA 1KMHA 1YBHA 3EGEA 4FZ3A 4HDKA 4LVCA 5BN3A 2QHXA 2AJCA 2XSZA 4I81A 2HA4A 4JJZA 3GZJA 5D5QA 4AQDA 3FYUA 2P2CA 4IG4A 4MVJE 4EPVA 3H8SA 2VUHB 2OKGA 1F51E 2QIPA 4G84A 1I7SB 3NM6B 4K8RB 3DO8A 2B7LA 1ZGZA 1C1HA 2BJWA 3CV3A 3DZDA 2Z6AA 2C7BA 2YQZA 4MARA 3ZH2A 2OUIA 2XYGA 2HKIA 3E82A 2RJ3A 3AF2A 2FPOA 3BMQA 2CLFB 2JIMA 4S3MA 2AQ8A 4G0UA 2BR5A 3NETA 3DV0A 1YT5A 2BEWA 4MCHA 1I4WA 3I2FA 2BMWA 2MJLA 2ODQA 1SVKA 3HDVA 3MLAA 4H3KB 4OH7A 4B8WA 4LHZA 3TGPA 4G0NA 3OIWA 4MQ4A 2Q4DA 2Z5LA 4A6XA 1WU8A 3WLSA 1NNEA 1LKZA 4J1NA 1A3CA 1KYVA 2C2GA 3OE5A 3EZYA 4BUZA 1TZKA 3E5MA 4ML3A 3OI7A 3ZW7A 2HQSA 4EPTA 3CVYA 4PG6A 3EOBI 1O03A 3FNEA 3HXKA 3OU2A 1CG6A 4DCOA 4EY5A 3VDXA 4MRNA 3SIPA 3EEIA 5ES4B 5A4KA 2OVFA 3GC6A 4UASA 2X77A 4B6RA 1RWWA 2VP3A 5BOSA 4G0XA 4IRUB 2J3JA 3GO4A 1QAOA 1BEEA 2G1AA 1P72A 2QGZA 1KEEA 4FMDF 4YRDA 3TEFA 1I4OA 4KFCA 1QCZA 5EIFA 2QMOA 3I2JA 2OMKA 3QP9A 4RTSA 2PXCA 4U7JA 4WJKB 3CPSA 3TF5A 2Q3EA 4XSVA 1E4VA 5EWJA 3ZE7A 3TK1A 1DWUA 4D3FA 3AVVA 2X5NA 1CPYA 3PNLA 1ZXLA 3A25A 3LDUA 2P4HX 4M8NE 3RC1A 2EXXA 4OBEA 2SKDA 3OM8A 1BE8A 3S1AA 2HWUA 2GLXA 2X5XA 2YDXA 4XQEA 5ALQA 5K05A 4JL6A 1K3UB 4DCGA 2V54A 4GXNA 3QRWA 2MSWA 2QTFA 3AKEA 2OGSA 1A9YA 3FYDA 3HSSA 4TXLA 3UA3A 4QTYA 3OZCA 4URYR 5C7IO 4G0ZA 5HE9A 3OESA 3FUXA 1RRCA 5BN1A 1O8CA 3C7CB 3E18A 4G67A 3RRXA 5A9TA 3MFQA 2LE0A 3OPMA 4GBMA 1HY3A 1OBFO 1JDZA 4BP9A 3MOSA 1ZESA 1MAHA 2PMKA 1KK2A 4F3RA 5LD2C 4TZ0A 1WULS 3DM9B 4XZ3A 5GINE 2ZWAA 1Q84A 3EZGA 2NUAA 4I4CA 5AKLA 3NKFA 4WGFA 2V74B 3NHRA 2DKOA 1J07A 4GC9A 4H15A 1U5BB 4OHWA 4ZIRA 4US2R 5C2JB 2Q4OA 3F8WA 1DWPA 3E22B 3OZ7A 3F6PA 5FHQA 2HBYA 2J7PA 4OMCA 3M9WA 4L73A 5AM2A 5ADWA 3PXXA 5KX5F 4YT5A 3VDNB 4UCFA 3D4BA 4A0FA 4D41A 4NYJQ 2BWJA 3TNLA 1FXUA 2ZLBA 1UBTS 1FFYA 3HM2A 2EFJA 3EZNA 2FZKA 1H2ZA 2A88A 4B43A 1TK9A 2D1TA