2HMVA

Diamond-shaped octameric ring structure of an rck domain with adp bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
139
Chain Sequence
NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords YuaA protein
total genus 45
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmvA00
1SAYA 1ZBQA 4WLOA 2NVUB 3S8MA 1NHGA 3MOGA 1RJWA 1WW8A 4J4TA 5K9ZA 5G4KA 1T1RA 1ZZEA 3K8ZA 4JJIA 1N1EA 1V3UA 5KVVA 5JS6A 1HDYA 4GLLA 5EESA 2VHXA 4I08A 2FSSA 5B37A 3WX0A 1IHYA 3DBRB 2B4QA 4IDBA 4D41A 2VHVA 3COSA 4ROSA 4R1NA 4RQTA 1AE1A 1PIWA 2QHXA 4U6QA 3QSGA 1PQUA 1UDBA 5BR7A 5DCYA 2X0JA 2ZQYA 1K2WA 5JO9A 4EUHA 2A94A 3JQ7A 3RIHA 1D1SA 4ID9A 5L4NA 3DOJA 3ZCXA 1LDBA 3IKTA 4N7RA 2P4HX 1Y5RA 3PYLA 4PG4A 3B1KA 5KVSA 1TXGA 4X54A 5L3ZA 1ADGA 4EI2A 3LYLA 2QYTA 3IIEA 1E92A 4BNHA 1MUUA 2QRJA 4NI5A 5CDSA 3STHA 1I36A 3FR8A 3BA1A 3F3SA 2R00C 2Y05A 3OA0A 4M87A 2O4CA 2VWHA 3OF2A 3UFXA 2VHZA 1H94A 2PV7A 3CMCO 4AJ1A 4RF4A 5L4SA 1VJ1A 4EUFA 4NMHA 5L4LA 1JN0A 2DQ4A 4CMHA 3M1LA 3PRJA 1RYDA 3DZJA 4WLUA 1JLLA 2O7SA 3KVOA 3N74A 1LUAA 4B8ZA 1C14A 1QRRA 1GDHA 1W8DA 2X0RA 1WNTA 1AHIA 1OFGA 2VTEA 3F4BA 2HMUA 1ADCA 1LI4A 2Q45A 1T25A 3GMSA 3PZRA 3A06A 3NRCA 4MO2A 4UVIA 2HRBA 3LLVA 2Q46A 1N7HA 4GLOA 3AFNA 1BW9A 4BMNA 4D44A 2JL1A 3WFIA 1F06A 3BMQA 3I9MA 4XGKA 4JK3A 4MVJD 4F46A 4XRRA 1W6UA 3ITKA 5A05A 4ZQBA 3WIDA 2B37A 5JC1A 1UZNA 2OL4A 3QHAA 3SJUA 4R51A 1U3VA 4L76A 4AVYA 1W73A 4BO9A 1JA9A 2WWRA 4XYGA 5H82A 5BQFA 2W2LD 3CMMA 4BO2A 4LISA 2DVMA 4JBHA 5L7WA 2PGLA 3RROA 5JNLA 3E82A 3JD4A 3FD8A 3TPCA 3JD2A 1AUPA 2X86A 2ZTMA 4RGBA 1BGVA 2FMUA 1XQ1A 4LSMA 1ZK1A 4FPXA 4QEDA 5TNXA 1NQAO 2RHCA 4DPKA 1ONNA 3JQ6A 3SC4A 2HQ1A 5TT0A 3BTSA 4G81A 3WXBA 4J0FA 1LSUA 3KO8A 2W8ZA 4LVCA 2OGUA 4GBJA 5BT9A 3DZIA 3KHUA 1M76A 3C24A 3PQDA 2ZJ1A 2VN8A 4CQMB 1SOVA 1I2BA 2WYVA 1G0NA 4J3FA 1Z82A 3HB4X 3KOUA 1N8KA 1PJQA 3NEPX 4Y6PA 2Y0DA 3HHPA 3L9WA 3CKYA 4I9HA 4YYZA 3BMOB 4WOJA 1IZ9A 3K6JA 9LDTA 1KVSA 3LVFO 4GL4A 5C5IA 3I9KA 3O03A 1Z7BA 2TMDA 1GD1O 1LLUA 2JCYA 3OH8A 4CM9D 1NTOA 1ZK4A 2NU6A 3IUPA 4HADA 3RWBA 2BHLA 2DFVA 3AU8A 1R0KA 2C5AA 1O89A 4BGIA 4DLBA 4EJMA 4IGFA 2PZLA 2BD0A 2O3TA 4B4OA 1EUDA 3GN1A 3K31A 3PXXA 1HL3A 2FRDA 1QV7A 2FR0A 2WD8A 4O5OA 4AJJA 4BHTA 4OQZA 4FFNA 2BELA 1GAEO 1DC5A 2A35A 3WYEA 2VNAA 1BSVA 4ND1A 5A5EA 4JJGA 3PDUA 2QIOA 4I5GA 2EJVA 4IM7A 1WMAA 3ASVA 4YWJA 5A9TA 3V1YA 1B0AA 2IDZA 1U2GA 1YL6A 5BNFA 2BMAA 2P9EA 1ENOA 3RC9A 3AI3A 3L4BC 3U62A 2DAPA 4ZN6A 3JD3A 2I9PA 1E3WB 5DCWA 1SNYA 1B2LA 3H2ZA 2YDYA 3ANNA 3O38A 4IJVA 1UJMA 3T4XA 1O0SA 1V0JA 3G17A 4YBZA 5IZCC 3L4SO 4RL6A 2BLLA 4YAIA 1M75A 3JQDA 2VCYA 1XCBA 1X0XA 4Q3BA 2PTGA 3CEAA 1HYGA 1HWYA 4H15A 1D7OA 3AM4A 3GNTA 4YT5A 4R54A 1U9JA 1GTMA 2YV1A 2I67A 1DHRA 1HDXA 1I33A 4WEQA 3CSDA 5C7OO 4FQ8A 1Q0QA 1V9LA 2C20A 3OSUA 4XDYA 3JTMA 4ZA2A 2C2YA 2G1UA 3RJ9A 2G5CA 4RORA 3CPSA 3GDGA 3GA0A 4G2NA 3SEFA 1NP3A 2IXAA 2V6GA 4NPCA 2Z1MA 3GDOA 1Z73A 3NDJA 4C7KA 4TROA 5HS4A 1LSOA 1I3NA 4MIEA 3SLGA 1YL7A 3RUDA 5T64A 1LC3A 5ITWA 5JDCC 2PGJA 1C1XB 1X7GA 3DZHA 4L73A 4XQGA 4PZDA 2FN7A 4RZHA 2DM6A 3OIGA 1YJ8A 2YHUA 3GUCA 3LDHA 1FDSA 3TN7A 5FEUA 3UAGA 2E4AA 3LLSA 2ET6A 2C54A 3LZ6A 4L4RA 1ADBA 2HCTA 4ITUA 3ETGA 2PNFA 3E1KA 4XQCA 1SEPA 3QE3A 3Q6IA 4E21A 3EVNA 5H81A 2PKQO 1LQTA 4RCVA 3BHIA 3IOYA 3D4NA 3CUKA 1ZW1A 3VVCA 3G49A 4GX1A 1Y8RB 1K6XA 3F6YA 4KWIA 1LQUA 4Q3DA 5CG2A 1R4NA 5I9NA 2D2IA 2GPTA 2PH5A 1CETA 4DC0A 1D3AA 3DZFA 5A04A 3HFGA 2O23A 1HT0A 2OORA 4YRAA 3KSUA 2VZ8A 3K2EA 1HYHA 2RIRA 3NV9A 2H6EA 2HJRA 2ZYDA 5DP2A 2O2SA 1DRUA 4JIGA 3W8EA 1TT7A 2BFMA 3UH1A 1HZJA 5IFLA 3L0DA 2J3IA 2NQTA 3IS3A 1DFIA 5TT1A 4YXFA 1LRKA 3OEWA 4YJFB 2RH8A 1XLTA 4RZIA 3H65A 4H16A 1UXKA 1DIAA 1NFFA 1GQ2A 1X7HA 5FI3A 3WMWA 3H9GA 5JFOA 1LSJA 2IODA 4UUMA 2EHDA 3E5MA 1SCUA 1EMDA 3DMTA 3KYDB 3GC6A 2W2KB 1E1NA 3AI2A 3X2FA 4N5MA 1QKIA 3FCOA 4C7JA 3GZNA 1MFZA 3BMNB 5CEEA 4Y98A 2GZ2A 2EKQA 3JQGB 2PGDA 2O3JA 1YB5A 2HDHA 3GH3A 3OICA 4BNLA 8ADHA 2O7QA 4QTZA 1WDKA 3IDSA 4DYDA 1LXCA 1QP8A 2EGHA 1E3LA 3U5TA 4FFPA 5T67A 5EJ2A 4CQLA 1ORRA 3FSRA 3E5RA 3PJGA 1QYVA 4K6FA 4RF2A 2NWQA 2ZJ0A 2X5JO 3F4LA 2VYVD 3PLRA 5G0WA 3UGKA 4EGFA 3KYCB 5JMWA 4P22A 4NK5A 5CDGA 1UH5A 2X58A 1E1KA 3M2TA 4R1UA 3E48A 2D1YA 1SMKA 3CIFA 3QJ5A 3GLQA 3EY4A 3KM0A 4W82A 1E6WA 1K6JA 8LDHA 2ZATA 4IMPA 2FPIA 5AOVA 4WKGA 4OOEA 3RFXA 3GEGA 4AICA 4CLOB 1QLJA 3JD1A 4BGVA 3ADPA 3VPFA 5L45A 1JWAB 3SXPA 1A4IA 1NAHA 1U1IA 4CODB 2YZ7A 3U4CA 1XA0A 3K96A 1EUZA 4B4VA 2HMVA 4UVHA 3UVEA 4L0QA 3WLFA 3ZWXA 1BWSA 4NJMB 1RM5A 4P4LA 2DFDA 1R16A 2PD4A 3QLJA 4D7AA 3TF5A 4E6PA 4BNNA 3ZHYA 4NBWA 4AL4A 4HV4A 3E9QA 2JFGA 4CMEC 4Y8VA 1U2DA 1ZSNA 4I8XA 1PL6A 1Z74A 3DOOA 3WQSB 4OKNA 3LQFA 4NHEA 4OGWA 5AXBA 4LMRA 3KTDA 3V2HA 5I7EA 3Q2IA 3M2PA 2GDZA 1E3SA 4D43A 4XJTA 4DQUA 1WLYA 4J9VA 2GO1A 1NQ5A 2SCUA 1PGOA 3JSAA 5B1YA 2B0JA 3SJ7A 1DIRA 3DFZA 3K5PA 4I1IA 1GV1A 1G1AA 1HEUA 1WXDA 2P5UA 2VT3A 1KEVA 2BI8A 2IEDA 3NX4A 4IPTA 1CQIA 2XXJA 4KOAA 4LN1A 3ETEA 3HDHA 2HJSA 2AG8A 1MLDA 3C7AA 4BGUA 5AQ1A 1NFQA 3ZU3A 1MFPA 4BUCA 4CV2A 4HNGA 4J2HA 1KEUA 3INGA 5A9SB 2H9IA 4GKBA 3JQ9A 4Y6SA 3EDMA 3FTPA 3GK3A 3PYXA 4JP3A 4YJHA 1LC0A 4A26A 4YAKA 1EUCA 1T24A 3AJRA 2TMGA 3JQAD 1PL7A 2GNAA 3UCXA 4E2YA 1J4AA 4CM9A 1PJSA 1SC6A 1LSSA 4MVJM 3UOGA 1HLPA 3UXYA 9LDBA 1OOEA 5THKA 4DWVA 1YGYA 3PHJA 1VJTA 4LW8A 5K0ZA 1R4NB 3ZWPA 4NFYA 2VTDA 3DHYA 3IL2A 2B83A 1JAYA 3QQPA 1ZEJA 2ZQZA 1Q7BA 3AY3A 3H3FA 3LC7O 3UKOA 5T57A 2O4UX 4O59O 1RPNA 1M66A 2CVOA 1GPJA 4IBOA 5I7FA 1PZEA 3JQGA 4TMFA 4J7XA 3WGYA 1JKIA 5KWEA 5GY7A 5CDUA 3DAGA 4WEOA 3H5RA 3VPHA 5G4KB 3NT4A 3DAPA 4ND2A 3AOEC 3GRKA 3I4CA 3WGTA 1T1SA 2WE7A 2QRLA 4WOKA 3CZRA 4PRLA 4CV3A 1ISGA 5COAA 3JQFC 5KCZA 2DBVO 2P91A 1O95A 4BMVA 4N5NA 3VH1A 1HDOA 2FZEA 1C1DA 1Y8QA 5KKCA 2AQKA 4LCJA 2X5KO 1E77A 5TJHA 3ZDFA 2X8LA 5B4UA 4A03A 4B79A 3E03A 2W2LA 4IQ0A 5DP1A 5A3JA 1UXHA 1ML3A 3E6AA 1R66A 2JCVA 2NADA 5HS6A 2W90A 2WMDA 2HUNA 2CSUA 4CUZA 2CDCA 4P38A 4RVHA 2GF2A 4L8VA 1YB4A 4E5YA 1KS9A 3PGXA 4PN3A 1YQXA 3GPIA 1ENYA 5EQDA 4YTEA 4AJPA 3PGJA 4NG5A 3VPGA 2CFCA 4IJUA 1B26A 4HFJA 3JQAB 4R41A 1Y8RA 3QA9A 3TZQA 1I2ZA 1T26A 3C1TA 4ONEA 1MV8A 5JY1A 1RM3A 1MC4A 4XQEA 3C7CB 3PDJA 3HN2A 3ZW9A 1MP0A 1W4ZA 2J3JA 1R12A 3LF2A 4K1LA 4UEOA 3AUSA 4LVUA 2BFPA 1DBVO 2J3KA 4U8GA 4B4WA 3KUXA 3RKUA 4D46A 1VSUA 2ZIZA 2QZ9A 4KUHA 1AGNA 5J23A 1U4OA 2NACA 4E12A 1Y5MA 3OETA 4L4SA 1O5IA 4WLNA 4YR9A 1C1XA 1OZAA 2G82A 3PFWO 3RQSA 4E5MA 2IYPA 2HAEA 3R0IA 3W1VA 1ZEMA 2D8AA 3EYWA 3VC7A 4Z6KA 4N5LA 1N7GA 3TJRA 3GR6A 1B14A 1E5LA 1ZSYA 4KUGA 1BRMA 3HB5X 1IHXA 3F1LA 2EKLA 2F1KA 3RUHA 5AXAA 1TEHA 2E6UX 4PLYA 3U3XA 3KBOA 4A10A 1I2CA 2EP7A 5ILOA 1YJQA 2POQX 5LC1A 2VYND 2HK9A 4JLWA 1JW9B 4GQAA 4TRRA 2JD1A 4RPLA 1P31A 1YB1A 5U9CA 1NVTA 4E3ZA 1HLDA 4EBFA 1VLLA 2VRCD 2LDXA 4CLOA 2Q99A 1NPDA 1R6DA 5KNLA 3NAQA 3QVSA 4TKLA 3D4PA 5FWNA 2VNSA 3WICA 1CRWG 5CDYA 3HADA 1NVMB 4BO8A 3JQCA 2C7GA 1HDGO 2AA3A 3QWHA 1P45A 3TFQA 2I99A 1OAAA 4BB5A 5BSFA 4HFNA 1B15A 2B4TO 3GGOA 3I83A 3L07A 3P2YA 5A3VA 2QYSA 1Z6ZA 1JWBB 2B69A 3ROQA 4CM3A 4J6FA 1H93A 3DMTC 1U7TA 3LT1A 5CP8A 3QP9A 5ICSA 3MZ0A 5JAMA 5AXDA 3BHJA 1JVSA 2AE2A 2D5AA 2VYVA 3D4OA 4ZGWA 1FF9A 3EW7A 3K30A 5L40A 3NTQA 2QZZA 1MXHA 1T4BA 3I9LA 1SO8A 3TL2A 4EW6A 5KVCA 3JQEA 1UDAA 4CLRA 2CDBA 1P0CA 1UAGA 1WZEA 3KETA 4W7IA 4HFRA 1R4MA 4GKVA 1K0UA 1PGJA 1GYQA 1VL8A 2D0IA 3T7CA 1VSVA 1NFRA 4INAA 1N2SA 4BNJA 4F6CA 4RPJA 2Q3EA 3ORFA 2EXXA 1PZGA 4XD2A 4BO3A 3RUFA 2NNLD 3F9IA 2XXBA 3DR3A 3AOGA 5CFZA 3ZWWA 4I5FA 3HDYA 3F5QA 4JQCA 1GUFA 1XR3A 2OZPA 4XDZA 4J4HA 4DYVA 4YRDA 4CLRB 5I8WA 4IINA 4PG6A 2NUAA 3TQHA 2Q4EA 1QLHA 1X0VA 3WTCA 1QYDA 3WGQA 4I5DA 3FF4A 5EERA 3FNGA 2Q2WA 3R1IA 3W8DA 2BF7A 2AMFA 3ASUA 1KIFA 3OJLA 2DBRA 4PLTA 1QYCA 4YCAA 1NX6A 2PY6A 3I6IA 5C7IO 4CM5A 1P44A 1NXQA 4JXKA 2J3HA 1BDMA 3GVHA 1VC2A 1KVTA 1DJNA 1SB9A 1DRVA 2JJYA 3WNVA 5GZ1A 4EEZA 1LDEA 1XQ6A 4W7HA 3F47A 3SLKA 4XWYA 4ALLA 1HE5A 4GVXA 3TOXA 2RHRA 3PIIA 4IDFA 2CUKA 4IDDA 5LDGA 2BI7A 1ZXBA 2JFFA 2J5QA 4KDEA 3OQBA 4I5EA 4NDNE 3JD0A 5T5QA 4R9RA 6ADHA 2NTJA 1SEVA 3B20A 4CM4A 3DOCA 3K9QO 4XGNA 1GFSA 3OIFA 1XDWA 1Z7EA 3PQEA 2DTEA 4FGSA 3E18A 4UAGA 5A9RA 2EIHA 4BNYA 1PGNA 1F17A 4FDAA 4DL9A 1DIGA 1A72A 3WYBA 3QWIA 1X13A 2JHGA 3DWFA 4RVUA 1DIHA 4ZU3A 4BO0A 1V3VA 1XIVA 2QW8A 5I7SA 2B5WA 2I76A 3FWNA 1E7MA 3U09A 1MA0A 4NH4A 1U8XX 5JSFA 3UHAA 3PWSA 4XB2A 3B70A 1ZH8A 4PIVA 1FK8A 2BGKA 1FMCA 3WR5A 2XOXA 1Z45A 1FDTA 3ZWMA 2P5YA 4ZJUA 4GSKA 3TRIA 1YBAA 3KEQA 1QMGA 3OIDA 4YDRA 4II3A 4ZQEA 1U8FO 3ENKA 1J0XO 5JCJD 4D42A 1KVRA 1W0CA 2X6TA 4LMPA 4R3NA 1DRWA 2GD1O 3BZUA 3FPCA 4KTTE 1DC3A 2EJWA 1JAXA 3JQAA 3DHEA 3KB6A 3DBHA 2X22A 3OA2A 3FPLA 3SX2A 1AXGA 1I5RA 5A03A 1YDEA 4KDFA 5DOZA 1Y9EA 1LX6A 3DO5A 1MX3A 2CF5A 1NQOA 4ZQFA 4AJHA 1YONA 3UW3A 1RWBA 3ETDA 4YJGA 5ES3A 2X9VA 4Q3AA 3VAZA 2CVZA 2YQ4A 5EN4A 4GH5A 3U4IA 1PR9A 4BKUA 5DNAA 1XKQA 4HUJA 3FNFA 1NYTA 2G17A 3DHNA 5T6BA 4F45A 3R3JA 2YQ5A 3HDJA 4P4GA 3WWYA 1WMBA 2IZZA 1A7KA 5B12A 2IRWA 4JJFA 1BXKA 3MJSA 1C0IA 3D5TA 1O8CA 4MKZA 1UZLA 1VM6A 1C0PA 2HK7A 5JE8A 2PWZA 3OM9A 5BSGA 2Q4BA 1F8FA 3BMOA 5ICMA 3B6ZA 3KSDO 1ISFA 1HSZA 1Q1NA 4NJOA 4S3MA 4FFMA 4BB6A 1K5HA 4YQZA 3G0OA 3DL2A 4YT2A 3GNSA 4DBVO 5C37A 4A0SA 4J49A 2YFHA 4UUOA 1XEAA 5THQA 4BNGA 2HK8A 1IOLA 1UXIA 3DMYA 3D64A 4HNHA 4GX0A 1X7DA 3NUGA 7ADHA 4S1VA 1TT5B 2FSVA 1NR1A 2HO5A 4O0LA 3MJCA 1R0LA 4K9DA 1K3TA 2Y1EA 3ZU5A 3SVTA 2DPGA 4GSLA 2AHRA 5EQFA 1EVJA 1MXFA 3KRTA 4MPDA 4BMSA 1AN9A 2NU7A 3GT0A 1R37A 3TWOA 2NU9A 1RM4A 1BDBA 2UUPA 4J90A 3IJRA 1N5DA 1UZMA 3FN4A 3SC6A 3NKLA 3V1TC 4BNIA 5L9AA 2I66A 2AQHA 1V3TA 4NU6A 4IZIA 1YL5A 2YYYA 4CM6A 5ADHA 1GZ6A 3TZ6A 5U1PA 3QWAA 3TOZA 1H6DA 3DDNA 4BO4A 1PQPA 4D3FA 1HE4A 4NIMA 1HF3A 3S1LA 4AJEA 1BG6A 2CY0A 4ILKA 4XYEA 4CM8B 4RLSA 2GN6A 1LTHR 1PZHA 4BNFA 1EK6A 4BQPA 3AUAA 5AXCA 3H5NA 1N9GA 4JROA 3PFFA 1U28A 3GF4A 5TC4A 4MVJI 4DLLA 3WYCA 2DLDA 3QY9A 1E7YA 5HBRA 4M49A 4M54A 3Q9NA 4FCCA 4IZHA 4J1QA 4TKMA 5JCJA 4E2XA 4B7CA 5JYEA 4AJNA 3ABIA 3LC1O 4E33A 1DIBA 1IPFA 4HX5A 4MIYA 1HDRA 1J5PA 5JPIA 2O48X 1QYXA 3ZV4A 1HKUA 1O9BA 3P19A 1VRWA 3D7LA 4RO0A 5KJCA 3BXXA 3ZU2A 3GGGA 2X7HA 3GVPA 3RC1A 2ZB3A 5IDWA 5JC8A 5IXYA 4RF5A 2OP0A 1P1IA 5TQVA 4MVJE 4J1NA 3H3JA 3BTOA 4CR7A 4RLHA 2B5VA 4IQ8A 1K6IA 3IMFA 1MB4A 1I30A 4BNVA 3BMCB 3PYMA 4OM8A 1CEQA 3H9UA 3I5MA 5LDHA 3AOEA 1GU7A 1M67A 3AW9A 1VL0A 5GZ6A 4YEDA 2ZYAA 4YQYA 1YDWA 3HE3A 3TZHA 4CV0A 5CPBA 3V5NA 1XYGA 2J8ZA 4IQGA 5BSHA 5JCXA 1PS0A 3PWKA 5KKAA 4KQWA 3IP1A 1LJ8A 2E49A 4PCVA 1WVGA 1A7AA 1YRLA 3ONDA 3C3XA 4P4NA 1QORA 1QR6A 1YWGO 4KTVE 3CINA 3FTNA 4UEJA 4KQXA 2FPGA 2B4RO 3NT5A 3GOHA 4EJ6A 4CQLB 1BHSA 3Q2KA 4B8WA 2D5CA 1H0KA 3P5SA 2FP4A 1PGPA 3ZWCA 2I6TA 4QFDA 4QT0A 5A5FA 1E3JA 1DLIA 1Q0HA 3DZKA 3UCEA 2CDAA 3KYCA 3KLMX 3QVOA 1KY5A 1R0SA 2ZB4A 2YDXA 3LK7A 1JVBA 3KV3O 1DFHA 4PG5A 4CLEA 5IF3A 1ZJZA 2OFPA 3H6KA 3ENNA 2FR8A 4CL3A 1I32A 4EUEA 4Q3NA 3VH4A 3QWBA 4WNIA 2WYUA 4UUNA 1G6KA 4FJ1A 3GG2A 4L75A 2WE8A 1TI7A 1YVEI 4QO8A 5I9MA 2NV6A 3WNQA 4OKIA 1YKFA 1GL3A 5JDIC 2XF8A 3INRA 3INTA 2EF1A 2C7VA 3RC7A 3PHLA 2AEMA 2HMTA 3WMXA 2YUTA 4Z0PA 3BMNA 3MEQA 5G0UA 4YJFA 2Y1CA 2AQ8A 3ON5A 3ZHXA 4CM8A 5A4DA 2VRCA 5IN4A 1U5CA 4ALKA 4CMAA 3TSCA 5CG1A 4QQRA 2ZTUA 1P1HA 1PS8A 4HWKA 5JDCA 3H9QA 2X23A 3ST7A 5CHEA 2Y99A 2Y67A 1DAOA 4B7UA 3JQ8B 3MOIA 4F6LA 4MJLA 5GZ3A 1BXGB 1U3UA 1GYRA 4DPMA 1EZ4A 2EKPA 5IZ4A 1E6UA 2XAAA 2UUOA 4CR6A 4XR9A 4Q3EA 4I9UA 4CMKA 4CLXA 4J7CA 1SZJG 3H8VA 1ZK3A 2Q2QA 3I52A 1ULSA 1ISIA 2CD9A 4BVAA 4DVJA 1X1TA 2RAFA 3LT2A 2NM0A 2OO5A 4OSOA 1MGOA 4B3IA 1KBZA 2OXIA 1P1KA 4OMUA 4KZPA 4OXYA 2UDPA 1OC2A 3MJVA 1L1FA 3ZWYA 3OBBA 4LSWA 4W9NC 3ZV3A 3B1FA 1NNUA 1VKNA 5CPFA 2VUSA 1LLQA 3JCZA 4OXNA 1A9ZA 3L6DA 2OHXA 3F46A 4FBGA 5AVOA 1XHLA 2BGMA 3DB2A 5B4VA 5JW6A 4A5OA 4BOYA 1U4SA 4CMGA 3I6QA 2HKIA 1GV0A 1IYZA 2VWGA 2UAGA 2P9CA 2VQ3A 4WASA 2GUGA 5DN9A 4ALJA 2FY8A 4AJKA 4FN4A 3X2EA 2A4KA 1UDCA 4PLHA 2X1HA 3PHIA 3ROMA 4EYEA 4DA9A 3P2OA 4BQRA 1B3RA 4OOFA 4J16A 4PG7A 1P33A 2O50A 4AJLA 4HFMA 4RPHA 3JQBC 3VDRA 4OJNA 5CDTA 1GUYA 1NVGA 2E37A 3OQ1A 4KMSA 3S2FA 4ZQGA 3D3WA 1Q7GA 1NM5A 4XX0A 5F5NA 4TZTA 2JKVA 4NBTA 4XZ3A 4B3HA 4IIVA 4OHUA 3DBHB 1Y81A 3DBLB 3OEYA 1YOVA 2BFAA 4TRNA 4YJGB 2Q1UA 3M6IA 5EIOA 5DBIA 1P74A 1Y7TA 4E4YA 2AQIA 3VZRA 3WBFA 5KJ6A 1HE2A 2HRZA 5COQA 1E7RA 1EDZA 3OQ6A 3GFBA 3I1JA 4O1MA 2A92A 1V35A 5TLSA 3KZVA 1CQJA 1UP7A 4E32A 1HDZA 2RBEA 4IDCA 2ZK7A 4OH1A 3RJ5A 4XJSA 2DTXA 2YV2A 1U7HA 3RU9A 5TRTA 3PPIA 4MKXA 4IXWA 1XWFA 1SOWA 3DFUA 3W4JA 3V2GA 4W4TA 4CMIB 2Y68A 2GN4A 3TZKA 1NWCA 3RVDA 3GVIA 2AG5A 2PZMA 3HZZA 2LDBA 1PWZA 5TSDA 5IN5A 2VWQA 1LLDA 3HQ4O 1PTJA 4ZVVA 3A28A 3OJFA 5TIIA 2P68A 1ENPA 1PJ4A 5GMOA 3GG9A 3WBBA 1ZO8A 4H7PA 5I7VA 2FOIA 1E6EA 5T8KA 2WD7A 4FJ2A 3ULKA 4ND3A 4GGOA 3ZNPA 3ZWVA 4FD3A 3ZZNA 1IE3A 3H4VA 4MVJF 4UEKA 5COBA 2IZ1A 1C0KA 1DLJA 3FRJA 4KUEA 4DUPA 2GN8A 3GRPA 4J2OA 2CZCA 4NBUA 4XQ9A 1LDNA 2AEJA 2V7PA 3FWZA 1B8PA 1BXZA 1T2AA 1GYPA 1KVQA 4RDIA 5G0TA 4WUVA 3HSKA 4CMJA 3KLPX 1FDUA 3BYZA 4CQMA 2PLAA 3WSWA 2WDZA 1PZFA 1FJHA 2WYWA 4FGWA 3GHYA 2OUIA 3DONA 3IUSA 2AE1A 1H6BA 1RM0A 2ZB7A 3ROKA 2NU8A 4YB8A 1ZJYA 3L9XA 2HU2A 2YFQA 3NTOA 4I9NA 2CF6A 4GI2A 3OHSX 4JX8A 1H2BA 3JYQA 1D4FA 4IGEA 4EITA 1EK5A 2NVBA 2V6FA 3PZBA 4CL8A 4NR0A 3AI1A 1V8BA 2PZJA 4IS2A 2EERA 3O26A 3GMDA 3TFOA 1PJLA 3WSVA 3L6OO 2OMEA 2NVWA 4WECA 2PD6A 5DF1A 3WJ7A 1Z75A 3EGOA 3IQDB 4GWGA 5A9SA 5AYVA 1ONPA 3AUTA 1LDYA 2PR2A 3A1NA 2Y0EA 3BTUA 5G4LA 2D3TA 4LCEA 4R3WA 4YT8A 5JDIA 4BO7A 5HWSA 4ND5A 1Y6JA 2BH9A 2ZKLA 3A4VA 4W9NA 4BV8A 4IDGA 1BVUA 3ZNNA 3DBRA 4Y6RA 1CYDA 4DC1A 5KTKA 4Z9XA 1I24A 1M6HA 1ARZA 5ENDA 3GNQA 4CLHA 4ND4A 4RVDA 2GCGA 2DC1A 2X5OA 1U3TA 1KETA 1XG5A 4JBGA 4TVOA 4FS3A 4MP3A 4ZHSA 1P0FA 5L7TA 2CMDA 4BNUA 5HTOA 3DQPA 3NJ4A 2GYYA 1ZNQO 1LRLA 1GZ3A 1T2DA 5L51A 1P9LA 1L7EA 5DBGA 1P1FA 1QSGA 1SBYA 3CE6A 2WEKA 3C7DB 4QUKA 2C2XA 3EC7A 1EQUA 2BGLA 4XB1A 3NDIA 5F5LA 5BNIA 3VH3A 1A4UA 5CEFA 1D1TA 1KYQA 5K6AC 3MWEB 1EVZA 4BIIA 1YO6A 4E2ZA 1LRJA 3WQQA 3GZ4A 2NTNA 3JQ7B 5TJ9A 4D3DA 1EFLA 4YRBA 5ER9A 4AJ2A 5BNTA 1KC3A 3S2IA 3PLNA 4DTIA 3LU1A 1DB3A 3Q1LA 1DC6A 1DFGA 3OJ0A 2OP1A 3QVTA 3K2BA 1GADO 4BO1A 1BMDA 1VE9A 3NT2A 1BTOA 3N58A 4OYRA 1H5QA 3C1AA 2O3SA 3NJ8A 3VH2A 3W8FA 3BMCA 1LA2A 3ZGYA 3ROPA 4ZD6A 4GMGA 4XIYA 2GASA 1E1LA 1OBFO 1EQ2A 3BAZA 4WCFC 4Y67A 4E2WA 2WD7B 1O94A 3FHLA 1CJCA 2R6JA 4LRSB 3I9OA 1PJCA 4QECA 3HDQA 3T7EA 4BKQA 1EDOA 2FZWA 3V1UA 1ZK0A 5IDYA 4R4JA 4B3JA 2EG9A 3Q11A 2Y93A 3WGHA 2EWMA 4TZKA 4R1TA 3MCVA 4CMEA 1YE3A 1WZIA 1G0OA 2EP5A 3QIVA 3MTJA 4E30A 5KVQA 3ZW8A 5TF4A 1C3VA 2J6IA 1N9GB 3M1AA 4LGVA 4BNZA 2B35A 4XYBA 2HMSA 4NZ9A 5DCUA 2GZ3A 1HSOA 2J5KA 1ZVMA 1O6ZA 3QW2A 4JGBA 5IAAA 1UXJA 1NHWA 2ZTLA 4A73A 1HTBA 2RCYA 3Q0EA 3VKVA 1OMOA 3AM5A 4J7UA 3BTVA 4D3SA 3U4HA 3WWZA 1LU9A 2ZB8A 1X15A 4F3YA 4CUJA 5HRUA 1VL6A 4EZBA 4K26A 3ZHZA 4RQUA 7MDHA 1QG6A 1B8UA 3ICPA 1PJ2A 2ZTVA 1UR5A 3PHHA 1JKFA 1NASA 3QWFA 4XYMA 5F1OA 3O9ZA 3ZHBA 3MJEA 3FBGA 2H1SA 4M55A 1DSSG 4TWRA 4XIJA 4NBRA 1WAMA 1CERA 4DQVA 1F12A 2NLOA 1YQGA 3B1JA 3RFTA 1KEWA 1CWUA 3DZBA 3L4BA 4BS9A 2I5PO 3LC2O 4HBGA 1HXHA 2YJZA 2JD0A 3UUWA 1DAPA 3ADOA 1N1GA 4L4XA 4DQXA 3WIEA 1GQQA 1LDMA 2PD3A 3DEYX 5I9LA 2VYNA 2GN9A 4GX2A 3R3SA 3ZV6A 2GRAA 4MINA 1EVYA 2O3QA 3JV7A 3JQBA 5L95A 3ONEA 2V6MA 2YV3A 4UUPA 2Q1TA 4PLGA 3GY0A 2E82A 4R5HA 1H6CA 4IDAA 1F8GA 3RAJA 3RUCA 3VPXA 4M8SA 3RUAA 3E9MA 3GFGA 3KSZO 4FIZA 3HN7A 3TL3A 1XGKA 1GZ4A 3D1LA 3ZNOA 1I0ZA 4YJDA 1WP4A 1ADFA 3HG7A 4CM4B 3ZWAA 1VKOA 3RKRA 1NR7A 1PEDA 2NSDA 3E8XA 5ER6A 1EE2A 3BIOA 3MWDB 3WQRA 3HNPA 4A27A 3RFVA 4FB5A 1B3BA 3A14A 1TA4A 3LT0A 3WB9A 1NWHA 1PX0A 1GY8A 2VZ9A 3H2SA 4FC7A 5TGDA 4RF3A 1NQTA 2H5LA 3ONFA 3OJOA 3QVWA 5CEJA 1LBEA 4PRKA 4MVJG 2BRUA 1LLCA 4OAQA 2OBNA 2R2GA 3T4EA 1PU2A 3PWZA 3H9JA 2R00A 4R68A 2V6BA 1UUFA 1GEEA 1A5ZA 3VPSA 2JCXA 1Y1PA 2BFOA 4CV1A 2Y1DA 1PS9A 5I8ZA 2IEBA 4XKJA 4YACA 4D0SA 3GEDA 3ZWNA 1J49A 4BNWA 3DZGA 1NPYA 2FWMX 4CLDA 2ZYGA 4A2CA 3DAFA 4DREA 5JY6A 3PTZA 4CUKA 1H9AA 3AK4A 4OQYA 1PGQA 4E31A 4U7WA 5CAEA 3EAGA 3AY7A 4C4OA 2P4QA 5DDIP 3VZQA 5B4TA 1IZ0A 3E9NA 2YW9A 4YAGA 2JD2A 4OIMA 3I23A 4KP7A 3D3EA 1TB4A 3AFMA 4IJKA 4MP6A 5EINA 4ESOA 4NJMA 4RVFA 4IDEA 4H3VA 5ENVA 3RASA 5KJEA 4RVGA 1P77A 1EBUA 3GZNB 3HFSA 2HLPA 1E7SA 3JYLA 2ILTA 1P1RA 3G3EA 3OFSA 4BL5A 4PG8A 4CR8A 5IDXA 3PI7A 3KYDA 3WS7A 3WGZA 1FDWA 2F00A 4PZEA 4UVGA 3O4RA 4XCVA 1I3MA 2IZ0A 2PH3A 2GSDA 3GDFA 3N7UA 4Z9FA 3MTGA 4XR4A 3TDKA 4RV9A 3U0BA 3DTTA 4NFHA 4CMCA 3LT4A 3G1UA 1XU9A 4IY1A 1PSDA 4BNMA 3ANLA 1Q7CA 1KERA 5A06A 2WM3A 3L6EA 3AUUA 3RSHA 1UAYA 2GR9A 2VWPA 1Y9AA 1NAIA 2DBQA 4YAJA 3ZWOA 1TLTA 4FOSA 3PHGA 1OC4A 2FR1A 2Q50A 2J5RA 3DXFA 4L74A 3IC5A 4DLAA 4WNCA 3U9LA 4L9RA 4M86A 3RCBA 3U49A 4BKOA 1AXEA 1ZFNA 2Y66A 4CJXA 2W4QA 4YVFA 2JHFA 1YS4A 4UVDA 3PJFA 1QYWA 1KY4A 1VJ0A 4AJIA 1GCOA 1JQBA 1LDGA 2EGGA 2Y1FA 3GVXA 1U5AA 2X0IA 4FR5A 3WFJA 4E5PA 3I9JA 4MIOA 4KWHA 5LCXA 4U0KA 2DT5A 5FYDA 3ZI0A 4JNKA 3EZYA 1IULA 1KVUA 1S6YA 4J1SA 1IPEA 4NNJA 3IAHA 3WJAA 5JMPA 4U5QA 3JQFA 3GQVA 4PLFA 4DMMA 2W2KA 1ZSVA 3PP8A 3BMQB 4E5NA 1FXSA 2QG4A 3G1TA 3D5QA 2FPPA 4MKRA 5F1KA 1ZK2A 4BNTA 4YAEA 2EW8A 1DDOA 2V65A 1GEGA 1R15A 3OP4A 5HA5A 1IY8A 2VOJA 4FFLA 4DIBA 5JO0A 2JAPA 4TQGA 3WGGA 2X9NA 2X0NA 2PFGA 3GEMA 4EDFA 3MJTA 1GUZA 5F3RA 1HZZA 1AHHA 1Q2XA 2YHIB 2I3AA 3EHEA 4N54A 2OBYA 5DT9A 1XELA 3FNEA 3CZMA 3S2EA 1E0DA 3PJDA 4PZCA 1ZIDA 4ZICA 3PK0A 4BGEA 3RI3A 2Z95A 3S2GA 4B7XA 4R16A 4TVBA 1PJTA 4GPD1 3UN1A 2P9GA 4HXYA 2I65A 5DULA 2Q1SA 3DBVO 3IJPA 3AWDA 1K89A 2WSBA 2UV8A 5F21A 3Q3CA 2RH4A 1CDOA 4WLFA 4WLVA 4BV9A 4JBIA 1LEHA 3TZCA 1X14A 2BKAA 4G65A 4FC6A 1TT5A 4R9SA 2DKNA 2CNBA 1P3DA 1ISMA 1KC1A 3FBTA 5HM8A 4UVEA 1WWKA 2PZKA 2I3GA 4WCFA 1DOHA 2Z5LA 3FR7A 3EMKA 4ZRMA 4A7PA 5C7LO 1A27A 3GVCA 1EE9A 2YHIA 3VVBA 1PL8A 3H7AA 4XA8A 3ICCA 1KOLA 2GERA 3U4DA 4XYLA 5L53A 2VUTA 4IXTA 3RD5A 4CM7A 5JBIA 5KOIA 4OO3A 3GAZA 2NVUA 3H5AA 1ENZA 4R1SA 4N18A 2WJPA 1EBFA 1YBMA 4WCFB 5DOVA 3PVZA 1ZCJA 5A02A 1ZKMA 1J6UA 1NBOA 4CMIA 2D59A 4PVCA 2C0CA 4DIOA 3JQ9C 3MJ4A 4RPKA 4U6SA 4ALNA 2B36A 1RKXA 4LK3A 4OSPA 4FFRA 3JYPA 2H63A 2XPCA 3FI9A 3VDQA 1DXYA 1E3WA 1T2FA 3RU7A 3I9NA 2PA3A 4IJWA 5EL0A 2D4AA 4E0BA 5ILGA 3LF1A 4Q9NA 2VOEA 3AM3A 4W6ZA 4ZRNA 1T4DA 4D0RA 1JKJA 2C82A 3L77A 2O2YA 2ZCVA 1JDJA 1WPQA 3LSYA 1IB6A 5EPOA 1F14A 1GPDG 3C8MA 4J43A 3PIDA 1HYEA 2VZ0A 1H6AA 1B8VA 2NTVA 1YOVB 4JN6B 3VKUA 5JXWA 3H9EO 4BO5A 4Z0HO 4DXHA 2PK3A 2QX7A 4OL9A 1I3LA 2Q2VA 2Q49A 4YJHB 2VT2A 1OI7A 3CTMA 4RJTA 3G79A 4NFSA 3NGLA 3NYWA 1X1EA 2C29D 4HKTA 2Q1WA 4FSHA 3WTBA 1BXGA 4J91A 2Y1OA 3ZU4A 2JFHA 5JAZA 1KEPA 1BW9B 4J0EA 4BO6A 1PR3A 4O6VA 2IYOA 2VHYA 3HWRA 3JYOA 1E3EA 3VHRA 4PLPA 4G5HA 1R4MB 3C85A 3UF0A 3UCFA 3GAFA 2G0TA 1JU9A 4M1QA 1JTVA 3K73O 4ZQHA 3VZPA 1YBVA 3TNLA 4CM1A 5ITVA 4XEHA 1N92A 4TSKA 4AJOA 2AEFA 2DU8A 5DZSA 4O63O 4PLCA 3WG9A 1YXMA 4MP8A 5TX7A 3ZNQA 1PWXA 1ISHA 2FHSA 3QRWA 5K6AA 4NQZA 3W6UA 4ALIA 2WTBA 4IUYA 2EV9A 5IZCA 4K6CA 4WGGA 4AFNA 3V8BA 1ULUA 3AU9A 4HY3A 4CQMD 2Z1NA 1RYEA 3WOHA 4RDHA 1A71A 3EUWA 1SPXA 4RVSA 5L7YA 2O3UA 1EVIA 2O3RA 1I8TA 1M2WA 1PJ3A 3JQ8A 3S55A 1WDMA 2ZCUA 3GHHA 3C1OA 3W6ZA 4QFCA 4Z9YA 1SB8A 4WPGA 3NTRA 4QSMA 4YT4A 1MC5A 4BKRA 4D79A 4ALMA 1V6AA 1EEHA 2UVDA 1P1JA 3GN2A 1M6WA 3OMLA 3DC2A 4M89A 1E7QA 4WK6A 4DGSA 5FF9A 5KJFA 4LRTB 1IL0A 3I4FA 2AXQA 2VUUA 4OXKA 4DIFA 5KJ1A 1E7WA 1E5QA 1YH3A 2DTDA 3WGOA 4DBZA 3KEOA 3ANMA 4WE3A 3CXRA 1GCUA 4PLWA 4NBVA 3V2UA 2VHWA 5DBFA 4CMBA 4URFA 3GPDG 1I01A 4BKPA 3ZH2A 1MG0A 5IG2A 1EFKA 3PJEA 4AJ4A 4IMRA 2QQ5A 2PKRA 4MVJP 4XGIA 5JAIA 3HUDA 3RBXA 2DBZA 1B7GO 4R01A 4PVDA 5U4QA 4K28A 5TS3A 1L7DA 1ZMTA 4Z3DA 2YY7A 4PLVA 3I3OA 3NDRA 4P8RA 5H83A 3WGIA 2C5EA 2Y0CA 1I10A 4PGFA 1CIVA 1PJBA 5JAQA 2DUWA 5IDQA 1ONOA 3DTYA 2CVQA 1XU7A 3ZV5A 5FFFA 4U0JA 2QRKA 3EZLA 2NQ8A 4JP2A 1QV6A 1ID1A 2HSDA 4R5MA 2G76A 2IE0A 4NK4A 3OJEA 4RPGA 1C0LA 2DUUA 3VTZA 2JAHA 3Q9UA 1IUKA 1DHTA 3O8QA 4FOOA 4WLEA 1DJQA 1VPDA 2GLXA 3KXDA 5IXSA 1FDVA 3DBLA 5JLAA 1B16A 2E48A 3P7MA 1BVRA 1TVEA 5MGBA 4YA6A 5KIAA 5F1PA 4Q39A 1U3WA 4HP8A 1HRDA 3ITDA 3D3WB 1CF2O 3R6DA 4TRMA 4YPOA 4QO7A 2GZ1A 4JCOA 4MDHA 2C59A 4GAEA 1T2CA 1T2EA 2HMWA 3IKVA 3PEFA 1E1MA 4Q3CA 4TRJA 4B4UA 2C07A 2A9FA 4XRGA 4AG3A 5T8KC 4EEXA 5IJZA 3RUIA 1D8AA 4QX6A 1DEHA 4J1TA 4EJ0A 1H9BA 4DRYA 2Y1GA 4UULA 4MVJA 1Y8QB 4E5KA 1PQWA 3KYBA 1QXSA 1HETA 1E3IA 4MVJH 3RUEA 4GMFA 1DPGA 5MDHA 1XSEA 3EK2A 4IIUA 3VOSA 2EW2A 3RC2A 5G2OA 5G0SA 1VI2A 3IP3A 3ZN2A 4Z3KA 5JYDA 3K92A 3RBZA 3FNHA 1S7CA 1UXGA 4FW8A 1ZMOA 4Z0TA 1F0YA 4BNKA 3RBVA 4DPLA 3BHMA 3EVTA 2IXBA 1A9YA 5FI5A 4CPDA 5C3MA 1DO8A 3GGPA 5BSEA 4WCDA 2VRBA 4DMLA 4MOWA 2X4GA 3HJAA 2GGSA 3VTFA 3CH6A 4FFOA 3WDSA 2UYYA 1ZUD1 4GX5A 3JYNA 5A1TA 1H2HA 4GWKA 1NPTO 3W4KA 3O8QB 1UP6A 1YQDA 2DPHA 1ZXLA 2PKQP 4E13A 3GUYA 4BNXA 4GVLA 4PFJA 3UICA 4NU5A 3W4IA 1HDCA 4J4BA 3OECA 3D0OA 1GR0A 3VZSA 4II2A 4WJZA 4PLZA 3A9WA 3F5SA 4GGPA 4R69A 1UP4A 1GQYA 1LNQA 2X9GA 3PQFA 1ISJA 1HE3A 3QV1A 2AW5A 4Y9DA 4IS3A 2P2SA 3ZWBA 3F1KA 3NGXA 3QVXA 1DC4A 1MG5A 5EMHA 2OOSA 4J9UE 6LDHA 3WLEA 4QXMA 5G0VA 1C1DB 4UREA 4W99A 3AY6A 4D45A 2EEZA 1Q0LA 2W98A 1I3KA 4FJ0A 3SBOA 1WDLA
chains in the Genus database with same CATH superfamily
3NETA 3DOEA 1QP7A 1XCPA 5JTTA 3PV0A 1WW8A 4CTMA 1UDRA 4WXMA 3H1GA 1R74A 4R8SA 4OLHA 3RARA 2OBBA 3K8ZA 4RVOA 2JGRA 3X1YA 1EFRD 5KVVA 5JS6A 1HDYA 4MI3A 1F4PA 1URPA 2Z04A 3FLEA 2YXBA 3EIOA 2IVFA 4PAQA 4YFVA 2VHXA 4I08A 2FSSA 5BNZA 2CYCA 3V1NA 1UKVY 1G4HA 1IHYA 5AJHA 2ZYUX 4IDBA 3SDZA 3BXHA 3VSDA 4D41A 5K3EA 4ROSA 4RQTA 1RCTE 3RWOA 3MJHA 4LZPA 2QHXA 5ALYA 5BR7A 4ZOBA 3QEKA 2ZQYA 2D1RA 2GK4A 3H7IA 3LDGA 2A94A 3JQ7A 3RIHA 4HATA 1Z5UA 2VDUE 4I14A 3VR6D 4UZSA 3HLTA 4QJ5A 5L4NA 4Z4IA 5DM2A 3PC3A 3EAQA 4N7RA 1VE5A 2P4HX 1ECCA 4PG4A 2W7TA 3B1KA 3GCXA 2H1HA 1Z0IA 1TXGA 3IYLW 4O4HA 4P9NA 2GJKA 2R44A 7REQB 4OHBA 1B93A 1MUUA 2QRJA 5CDSA 2Q0QA 1Q74A 2XE4A 3QG1A 1U8TA 2UVPB 4YJKA 2A0UA 2QT0A 2PBZA 2YYZA 3I9FA 4ACBA 5EMMA 1SCIA 4PIMA 2CCGA 1TKRA 2Y05A 3LCVB 4TL6A 5CA1A 1Q6YA 3B82A 1RJEA 2DSNA 2NO0A 2CV1A 3MUOA 3O8CA 3CMCO 5DB4A 3V80A 3PFBA 5KC8A 3SKYA 2YIVX 1JHAA 1CVIA 1X42A 4G4SP 4FYHA 2XBLA 1JN0A 5L4LA 1EDEA 3PRJA 1UFQA 3DZJA 4G4IA 2WAYA 3W7BA 2O7SA 4TPKA 4B8ZA 4EW3A 2EQBA 4MV4A 1CVRA 1GDHA 1JS1X 4P82A 3S2ZA 3CGWA 4HGZA 3M6LA 1P17A 4Q48A 4DQKA 4F4IA 4E94A 4BTLA 1QIHA 4HAIA 4Q4JA 1LI4A 1GQFA 4ITRC 3GLHE 1CUXA 2C42A 1K6MA 3IAFA 4OA5A 1WHTA 5HJEA 3GMSA 5BXQC 3AHDA 4UVIA 1MCZA 2R8EA 1UBRS 2HRBA 3DOFA 2O1SA 4YBRA 4DSTA 1V5FA 1YI0A 4EUNA 1N7HA 2MHCA 2B1RA 3AFNA 1BW9A 1C7IA 5H4HA 5BV7A 2ZT7A 4D44A 2JL1A 4MYTA 2HA5A 3WFIA 3BMQA 4XGKA 2EJTA 3HFRA 4JK3A 4MVJD 4EIWA 1DX9A 1EH5A 3PC4A 4KI0A 4XPZA 2I2AA 3GU3A 4G01B 1NULA 3SG0A 5EE0A 1U8CB 1O58A 4BQEA 3CR7A 2MTBA 5A05A 1G1MA 4DNQA 5D3MB 1TW3A 2XMQA 3U7HB 1OZFA 3CZ5A 1W73A 1A1SA 2OHGA 3H0KA 1XK6A 1JA9A 1PUJA 2PUJA 2WWRA 2VT7A 4XYGA 3CMMA 2VHTA 2QJFA 3QYFA 5FD8A 3JQQA 8GPBA 2NP7A 5C5CA 1K92A 3HCPA 4EFDA 1MV5A 3KQWA 4UAUA 1W36C 3BILA 1CUAA 1N2XA 3OCYA 2ATXA 4XQ0A 2HWYA 4QRDA 5JNLA 2RGRA 1TF2A 3DFMA 1CY4A 3HVHA 1T9ZA 1T4CB 2XE6A 3TPCA 1LV7A 5JBNA 4FCWA 3JVUA 3JD2A 4TKUB 1DJMA 2XTJA 3ETLA 3L5KA 2ZTMA 4A8HA 4RGBA 1QZ3A 4C3ZA 3RLFA 4EHAA 4RZUA 2V5UA 4DIEA 4F3CA 4LSMA 5J4HA 3ESYA 4DPKA 3MCWA 2F17A 2HV9A 2UYHA 3S5JA 2HQ1A 4C08A 4HEJA 4HAOA 3WXBA 1IUNA 5AW3A 1M1NB 4HB3A 4J0FA 2Z8YA 2XODA 3GT7A 1PFVA 1ZMRA 2W8ZA 2R6AA 4J0DA 1A8SA 3Q41A 2OGUA 4JELA 3DZIA 1E9RA 1Z4QA 5TARA 2AI1A 3RABA 4OP3A 2ZJ1A 2VN8A 3SSAA 3Q15C 4CQMB 1Z7GA 2P9YA 5JIBA 4LXGA 3F98A 2JGNA 4ZIRA 1AU9A 1XD8A 4KE9A 2MSKA 5JD6A 1DUVG 3E7WA 4G0MA 4BB9A 3FPGA 5BWLA 2W6QA 4CHTA 3O0DA 4Y6PA 4QNMA 2EATA 9LDTA 1DEOA 1CZUA 3NHSA 2OYCA 3ZY4A 4YYZA 1CUFA 4LF7B 4R1OA 2V4ZA 3FVQA 4DQLA 1VG1A 1I4DD 1XRMA 4RXUA 1ZX1A 5KU7A 1GD1O 1YU6A 2JKYA 1LLUA 3JPWA 3OH8A 3N86A 4CM9D 2R8RA 1LNSA 4H7HA 1XWWA 4GEGA 4I81A 3GYBA 1IJKA 4DSOA 4OMFG 1CFZA 4TXNA 1AKRA 1E2IA 2O0MA 1O89A 4BGIA 5AM2A 4AS2A 1Z6GA 1C8VB 1H85A 2PZLA 3RUPA 4MKHA 2C9BA 4C5AA 3H2BA 5HKKA 2FYTA 4EG3A 3QKUA 5A3SA 3GN1A 2GPSA 3K31A 4O4IF 1HL3A 2RC5A 2WD8A 2FR0A 4P3NA 2X0FA 3CRVA 1P7WA 3UMCA 3VKGA 1FMTA 1FXUA 3IVGA 5FX2A 4LK2A 3BN3A 3OU7A 4IFEA 4QOEA 1HDIA 1NUQA 2D1QA 2CFSA 3IPLA 3CV3A 1SVNA 1X7ZA 3O9MA 4IEFB 5A5EA 1IY1A 2TSYB 4NCAA 3EG9B 2AFHE 1SKYB 2HOQA 5CA0A 2Z30A 3WK5A 4K9SA 1U1CA 3EXG2 1TMYA 5A9TA 3ZPXA 4AJOA 3KJQA 1B0AA 3B36A 3M89A 5BNFA 1ESDA 3L4BC 2QAGC 1KFBB 2DAPA 2FGKA 4G1CA 1PR1A 4HC4A 4ZCSA 3V00A 2DEUA 3N0VA 4L07A 5FDFA 2RGDA 1KF0A 1JA1A 3G23A 2DECA 5DLPA 3VC1A 4US2R 1SNYA 3H2ZA 1PWHA 1UJMA 4D9KA 3Q85A 2R8PA 4RL6A 1JHRA 1TFRA 1HNZB 1KH2A 1U6KA 1M75A 2QDXA 3EVCA 1LX7A 1X0XA 1XCBA 1HT1E 3NIGB 1C2YA 3A2MA 4LQ4A 1DPFA 3PXCX 3FG9A 3GNTA 4IX9A 1L5NA 4F2DA 5J43A 4P36A 2JH8A 1GTMA 4ETMA 2AW3A 3PGA1 1HDXA 4FEGA 4QBIA 3SNHA 2ZE7A 3EEYA 3QH4A 4RX1A 2HR1A 2I3ZA 1Z35A 1L6RA 2QQGA 4FQ8A 4IQ4A 1Q0QA 3H13A 2D13A 4KFUA 4YAFA 3OSUA 4EB8A 4ZZ0A 1RZRD 5AVZA 4TV8B 4ZA2A 1THZA 5FBVB 2VA9A 2B99A 3N6RA 3QQ5A 2G5CA 4GNRA 5ALSA 1B8NA 3WP0A 4OKSA 4I0WB 5AVKA 5IS2A 3MWFA 4AY6A 4NPCA 4ICIA 2BPOA 2Z1MA 3A26A 3NDJA 2NXNA 4OQEA 4C7KA 1MQAA 1J8FA 2IWHA 2QA5A 1NW6A 3CEHA 2FZGA 1CUZA 3D8TA 3U16A 1YL7A 5ITWA 5T64A 3ECSA 3QGMA 4Q3KA 4Q7JB 1JEAA 1U81A 1ZQ1A 3AJ9A 4Z2AA 1EX7A 1V25A 4LC9A 3HEMA 1CV2A 2CXPA 3LDHA 3R74A 1ZINA 2H0QA 4KZKA 3AP3A 2ERYA 3ROXA 1TJ5A 2OHJA 3LLSA 4NMXB 5H3CA 3RRYA 4QJBA 4Y18A 4ITUA 3NEAA 4U02A 4ZCLA 4J0HA 5J5CA 2J0UA 1XTVA 1D2CA 1VLQA 1Y5IA 3AEUB 3EGVA 3ND8A 4RK4A 2WWTA 4TS1A 4XQCA 5FPSA 4EMBA 1FNBA 1YHNA 3LG2A 3M6MD 3Q6IA 4L95C 4E5UA 3O1JC 3HCOA 3NAMA 3GPLA 4Q4AB 3D4NA 3TS1A 3DF7A 4LX8A 1ZW1A 5SZHB 4CKCB 3R6LA 2P8JA 4QGGA 2CHGA 3IRVA 2X42A 3DMHA 5FJIA 3S27A 4LYJA 4DA7A 5CG2A 5KTRA 1J2EA 1R4NA 2HQRA 2PWAA 1THTA 2D2IA 3AFIA 3LY7A 2PH5A 1CETA 2QJTA 3CW8X 3EIQA 3TNFA 1AX9A 4AO6A 1K4KA 3C3CA 4Q18A 1MJFA 3HFGA 4EHBA 1YR8A 3H8WA 2C5BA 2GK6A 4RVNA 1ORWA 3PRHA 1RJGA 4TTRA 4YRAA 1N2ZA 1U0JA 1WB5A 3NV9A 3SS9X 2ZYDA 3HA2A 2O2SA 1DRUA 4JIGA 4MZDA 1JHDA 3CIOA 1JFRA 4IJ6A 4URZR 3V46A 2BFMA 1G6OA 3HJGA 3N9IA 4TV9A 2GN0A 4ZT6A 3GFVA 3EHDA 4J1TC 5IC5A 3LPAA 3SY8A 2VK8A 3LOUA 5LQKA 2BFNA 3B2EA 5EXDA 4QAQA 1FFBA 2IBMA 2WJJA 3ABQB 2OPBA 3BE8A 2ZR9A 2O0KA 1OLSA 1XDUA 3JALB 4MVCA 4WBXC 2XDAA 1DIAA 1V8ZA 1NFFA 2NSJA 3RRJA 3WMWA 4AG5A 1JKXA 4EMTA 3A8TA 5C18A 1XALA 4UUMA 4OU5A 3TCNA 4KMRA 2VXYA 3GFQA 2ACWA 1ICEA 1T1JA 5ADWA 3OQMA 4RTOA 2WAXA 1USVA 3AI2A 3BRCA 3GZNA 1C2TA 4GM4A 1M8PA 3U49A 1JXQA 3BMNB 3QE9Y 4NCHA 4G5QA 2RGNC 4ENUA 2NUPB 4O4JB 3VSAA 2ACKA 5CEEA 4QNNA 1K86A 3OJXA 1V7CA 1O8BA 3M70A 1XB2A 1T5LA 2M6RA 5K6TA 1RRCA 5B6JA 4FILA 1XX6A 1POWA 2JFOA 1YB5A 2B8NA 2P4SA 3OICA 4BNLA 5BRAA 1R5NA 5JVDA 4NYMR 5DISB 4GOND 5B57C 4F3TA 1N2CA 4F4JA 5KINB 1YR1A 4M9SA 1LXCA 8AT1A 3L0BA 4PFQA 2PYDA 1UBNA 3N2YA 4LJAA 1ORRA 4G5SA 4W63A 5EJ2A 5T67A 3VQTA 5BVGA 4X1YA 3VSBA 3KKMA 2OZLA 1E2QA 1QOPB 4RF2A 2NWQA 3L06A 3UGKA 2IUEA 2XVMA 3A9VA 4U7DA 4QPDA 3TLJA 3MVEA 2VYFA 1UH5A 4Z7OB 5CDGA 4LOJA 2X58A 4H31A 4HDMA 3CTPA 3ZHUA 2FP4B 3LTEA 4WKBA 2Q21A 2QRPA 1C8LA 1PE0A 1Y3FE 4URHA 4MS4A 2M6LA 4F91B 1GAWA 1SMKA 1U0HC 3GZTB 2QIPA 3GLQA 3HSYA 1E1DA 3KM0A 1GT6A 1AUXA 4KEAA 1VKJA 3WDLA 2ZATA 4MCIA 3I76A 5AOVA 4HUQA 4RV4A 1J8YF 2H57A 1T6XA 3CPEA 1V5GA 2O7VA 4IAOA 1YR6A 4BGVA 2HDWA 1JWAB 1A4IA 2C2KA 2OZLB 3KFXA 1E2LA 4LWZA 5GVRA 4CODB 4MW6A 5JRZA 1RKUA 5IYZB 3DPUA 3K70C 5CURA 1IBSA 1T3SA 1NDQA 5EFZA 1NVXQ 1W5EA 1EUZA 2HMVA 4IH9A 1AUOA 2ZGVA 3WLFA 3WVNA 1BWSA 1OREA 4RA9A 3VPBA 2PD4A 3QLJA 4ZXFA 2QG6A 1X2BA 2VJQA 3G0CA 4HDCA 1OBCA 4M46A 4RS3A 4BNNA 4ZI7B 3TF5A 4L9SA 1SURA 4AL4A 2YJ6A 3BXFA 1XNRB 3C70A 1QWOA 1UWCA 2HPHA 3DR5A 4I8XA 4D57A 3ISJA 4IJQA 3WQSB 4YC7A 4BWGA 2CUNA 2FE1A 2JGDA 2E4UA 2Y1WA 3EDYA 3HL0A 4WFJA 4E88A 3KTDA 2IXFA 3SJAA 4C2BA 3Q2IA 4BLTA 3ZDCA 1YK0A 2GDZA 1E3SA 3TQOA 4EX6A 2R79A 2HYIC 2FLWA 4ON9A 3FDXA 4QUJA 5CXUA 2G9UA 1R0XA 2OCKA 3ZGNA 5EYPA 3SS7X 5KWVA 1PGOA 2VPTA 2WIBA 2C3OA 3JSAA 4LY0A 1OXUA 3TLGB 3H1BA 4XD7A 4EKEA 1OYOA 3DFZA 2PH1A 1NVUQ 2H48A 5J2UA 3U0VA 3JALA 5HBGA 3OEEA 4B32A 1WXDA 3PQ5A 2H54A 4MUAA 1QM5A 2OBLA 2H4JA 8ABPA 3C5HA 2Q5OA 1L0BA 3KUCA 4KQMA 4LN1A 3ETEA 2HEGA 2OAEA 3HVJA 3IPCA 4UCXA 3RYHA 2MJLA 3H1PA 1VPEA 2F55A 3LUCA 4DG8A 3OZTA 5SYNA 3ASYA 4BUCA 1IHOA 2FSGA 1AKTA 4HRYA 4UNNA 4BV2A 3GDHA 3INGA 2JIZD 2H9IA 3IOMA 2R6R1 3BE4A 1T4GA 5L3QB 1LC0A 4GMKA 1N4AA 1B6SA 3ZD8A 1PL7A 3LW7A 5ED4A 1X1SA 3UCXA 3W2IA 4F2WA 1PJSA 1SC6A 1D2EA 3LKZA 4MVJM 2RHDA 3Q3IA 5B58C 1L4MA 1HLPA 4DJ5X 3ZLJA 1OOEA 3EIWA 5K0ZA 2IYSA 1R4NB 4GYYA 3VHQA 2ZXEA 2ZE5A 2VTDA 3WB0A 4ZYVA 2Q3JA 4D9BA 2Q2NA 4GYJA 2B83A 1HNWB 1KH1A 2EF0A 4HWSA 4RIEA 1MEEA 1I6LA 1WB9A 3H3FA 1VECA 4BPBA 2O4UX 4YYEA 5AKHA 2GPWA 3EUEA 1M66A 2ZIGA 2CVOA 1GPJA 2D00A 3QPWA 3G5TA 5IC6A 5IK2A 3T1HB 1A2QA 1GKKA 3I1IA 3WB2A 1FNMA 2QD5A 1U0SY 5FO1A 1M2GA 2OV1A 5KWEA 5LQJA 1UOQA 3KOWA 3WGKA 2BR5A 3ZBTA 1YJBA 2PYZA 3H5RA 3SR4A 2A8YA 3FCSB 3OCJA 1NW3A 5H59A 3CWZA 5G4KB 1VCIA 1J2YA 5LR6A 3DE0X 2XUZA 3I4CA 4BCCA 1T1SA 2QRLA 1XMQB 4PRLA 1H2RS 1ISGA 1RBZA 4WBNA 2QY6A 5KCZA 4BMVA 1AMNA 3EVBA 5CNKA 2QD2A 2YVAA 5I7UA 3F8WA 4QDUA 5HP4A 3GPBA 1HDOA 2FZEA 1IEWA 1DBWA 1TOAA 3U56A 2GDJA 5KKCA 1QH8B 4FZRA 2OENG 4LCJA 5AI6A 2X5KO 1FIUA 5DU2A 1E77A 1ECGA 1Y7HA 3RAGA 3ZDFA 4R1PA 5E7JA 2OB1A 1XYVA 1JE0A 4PS1A 4B79A 2XMBA 1IN4A 1GGHA 1OX6A 1YOBA 3FFWA 5ETJA 5DP1A 1G5QA 3EUAA 2JCVA 3G8AA 3AF0A 1XN1A 3TZLA 2IV2X 3KE9A 4PGAA 3THOA 3TVYA 3G5LA 3Q88A 4UNSA 2CDCA 3ESXA 2GF2A 3AHEA 4L8VA 2PR7A 3MT7A 1KDOA 4TLEA 3SC3A 8ATCA 1ENYA 2RJNA 3BEOA 5EQDA 1SUEA 3D0RA 2CFCA 2ZLBA 3ADDA 3OTGA 3ZR4B 4IJUA 4Q1CA 4R41A 4WKNA 1ZIOA 4O1MA 2J31A 2VDWA 1NMZA 1T9CA 2EVWX 5J1SB 2Z3VA 1R4ZA 2WKWA 2QAJA 2QAGA 4UUQA 5JZBA 5JY1A 1X94A 3SZGA 4R1QA 4MICA 3WK8A 4AF8A 1CY1A 1UM8A 4XFDA 2NTEA 3C7CB 4GHWA 4DAEA 3FLBA 1HORA 1ZM9A 2FDRA 4X7RA 3LF2A 4K1LA 1CE8A 4LVUA 4OHWA 4TQ9A 3H99A 4D46A 3A27A 1VSUA 5ELLA 4CIDA 4KUHA 1U94A 5D2CA 3IILA 5K6RA 1Y5MA 4KNYA 3WI7A 2BHTA 3QBEA 1XTJA 3HCEA 4LSGA 2WMYA 4YR9A 2PZFA 1OZAA 2PZAA 4K3UA 1GL7A 2NAFA 1IBMB 2VJAA 3R0IA 4N3BA 1G5HA 1TKBA 1ZEMA 2D8AA 3B48A 2B3TA 2Q3FA 3L8EA 4L0DA 2RD2A 4B83A 2KWIA 3ICOA 1E18A 1QHGA 1N7GA 1V11A 2JBWA 3LX6A 4KO8A 1D9ZA 3C5EA 5C8ZA 1OLUB 5A71A 1VKHA 1GPMA 2P90A 1ZSYA 1YFLA 3PPXA 4MUGA 1EVLA 4HZUA 3L5OA 1XDGA 3CWCA 1T15A 5JH7F 1ZA1A 4MXDA 1DE0A 4OQQA 3QU9A 3R3YA 1QK3A 2C2ZA 3HJBA 3M34A 1QO7A 2ZU6A 3K8OE 1NMEA 3NAGA 4KBGA 1G66A 1M1UA 3DE5X 2FFQA 3U3XA 1I2CA 3HUTA 1YJQA 2XHEA 1IXKA 2FMFA 2J0SA 1N8SA 4LRQA 1H4QA 1K9SA 4MK4A 4C07A 3VHXB 4GQAA 4BZZA 3KHKA 3CVXA 2I54A 1IG0A 2JD1A 4LDZA 2KMLA 5I7OA 3K3PA 4BLOA 3QKIA 3K1ZA 1NVTA 3T7JA 4E3ZA 1HLDA 1Y4SA 1ZIXA 2VKTA 2VRCD 3FOAA 4FMDB 1JQ3A 1PQ4A 1E2PA 1TMKA 4DR1B 2HW8A 1NPDA 1JSXA 1R6DA 1OFUA 3DTVA 1PL0A 5C8YA 3TRJA 4ZOLA 5ARDA 4TKLA 3PVCA 4ZK2A 5FWNA 2VTBA 3LYAA 3WICA 1W94A 3KJXA 3I1FA 1NIJA 4ZVRA 1QJ4A 2ZWMA 4XUDA 3DLHA 5JMOA 2G1KA 1HDGO 4DBLC 3I04A 5JAHA 1SHKA 3O3CA 4V0KA 2I99A 3IEXA 2CBGA 3A0UA 4BB5A 4MLPA 4F4UA 2GAOA 5EUCA 2YVKA 4FI3C 4DEVA 3L07A 3HYTA 2WHPA 1EFCA 4KMMA 1Z6ZA 1S01A 2B69A 3HXQA 4JV5B 1BE6A 3QW4B 2UVQA 3BICA 3ROQA 4IO0A 3RS2A 1H93A 4B80A 5J4VA 1KA9H 1U7TA 2ZRLA 4LTDA 2HPVA 3BG5A 5CP8A 5DX1A 3ZHTA 1XXLA 4QU9A 4RK6A 1FFHA 1P7CA 5AXDA 2VYVA 2GJSA 1WCXA 3D4OA 3QF7A 4ZO4A 1FF9A 3DOIA 3MIIA 3S4YA 1UQTA 4F7DA 1MXHA 1T4BA 4KRGA 3DWIA 3KQYA 1SO8A 2KSQA 3CO5A 4X41A 5JXGA 2X15A 5BYBA 1N78A 3JQEA 2RHLA 3RPEA 1UDAA 4M99A 4RDCA 4ESHA 3FPSA 4CLRA 2CDBA 1GPWB 1TM7E 4F21A 1GHTA 3QNUA 4HFRA 5AT1A 5IJ9B 5E4JA 1K0UA 2IYLD 3HCDA 4GMDA 4PZLA 1QBKC 4PTZA 1RTTA 2CLCX 2C5HA 4Q0MA 2ZRJA 3A05A 4KN5A 1NFRA 5HNKA 4BNJA 3GLRA 2FJPA 4OP1A 1JPVA 2PXXA 4OJYA 2YFYA 3OX2A 5EXXA 5C34B 4BO3A 5B7QA 3F9IA 2XXBA 4YUVA 1SKAA 1UBFA 5HKBA 4TZ0A 4FNAA 4I5FA 1Z08A 3H2GA 3HDYA 3HACA 5AH0A 1DQYA 2X2FA 2A5LA 3KB2A 4OBBA 4DYVA 2MT9A 2CD7A 5CB4F 1ILWA 5ICGA 2NUAA 3UGQA 3TGWA 1X0VA 2O6LA 4D9CA 1L9XA 1QYDA 4LE1A 1F3OA 3UG7A 3P4XA 4YCSA 2WHPB 3WGQA 4NYMQ 2QN9A 5DGTA 3QFFA 1FP4A 2ZWAA 3A6GA 5EERA 3VKFA 2Q2WA 1GNTA 2XQIA 2Q7XA 3CUTA 1L1QA 5IBPA 3W8DA 4X60A 2B1GA 5DTEA 3OPYB 5JJLA 4CTOA 3A58B 4YCAA 1Y1KE 1F1JA 3KSAC 1IY9A 2AK3A 3I6IA 1IAQA 2H2DA 4M6WA 4AMBA 1VBNA 3C3WA 3CRQA 3EQ8A 3UHFA 5KDOA 1H8EA 4G8JA 1XTBA 4JXKA 1CUEA 4M1WA 3B9PA 3GVHA 4S0XA 1QP4A 2ZEJA 1RAGA 1DJNA 4I9FA 2GJ4A 2X3UA 3IGFA 4FFSA 4FR0A 2Y27A 1LKZA 1MTZA 4M37A 1E1QD 3VNRA 4KSYA 4C2AA 2QX9A 3GLHA 3SLKA 1P72A 4FEYA 1HE5A 4GVXA 1XVVA 3MIZA 3FDIA 1J8DA 3TGPA 2CUKA 1NXWA 2ZI3A 3NW9A 2LIVA 4IDDA 1J1IA 5FTJA 3K5WA 2ZVJA 3AX6A 3B60A 1ZXBA 1VCNA 1C5KA 3O7MA 3DDCA 2I6XA 4ZDJA 1CS4C 1Y6FA 3CF6R 3JD0A 4R9RA 2P9ZA 2NTJA 1M5RA 2I4RA 3O95A 4XXHA 5AW4A 1XF9A 5HCIA 4XX0B 2OK8A 2WIJA 4B2LA 5CCEA 3G68A 1ZYUA 2DSTA 1NI3A 5CIWA 3RSQA 3S68A 4EVIA 3OTOB 5CTJA 1XPJA 2MSDB 1XMIA 5A9RA 4ZZIA 1VI6A 3ZBUA 1TU3A 4DJEC 4A4DA 1F17A 3HKDB 1XQWA 5FLKA 4UTVA 3IO5A 1CHDA 3DWFA 5LD2C 3LXRA 4RVUA 5AWFC 2QP4A 5AK5A 2JI6A 3DMNA 4ISCA 1XIVA 4ZU3A 5KVAA 4RZSA 2ZPAA 5I7SA 1ZVJA 2BGRA 1QIKA 2IYRA 3OZSA 4MCJA 3UBTA 1E4VA 1E7MA 1R9NA 1E63A 1WF6A 1F60A 3NC4A 2JAOA 4IHJB 1C9KA 2Q3DA 1FTGA 3B9QA 4XE5A 4ZYYA 4FDMA 5BVHB 1ZZGA 4HVLA 2WWXA 4ARZB 4MCHA 2HHAA 3T1YB 1NL3A 1E1YA 2C3YA 2EZ8A 3DDZX 3WQBA 2FQYA 1ETUA 1CQZA 1AF4A 3G8BA 4ND8B 2XQVA 2OHOA 3KEQA 3KZNA 3CW2A 4C0KA 3OIDA 4YDRA 2BTQB 2HU7A 3IE0A 1Z4JA 1I4WA 4QYXA 5LD2B 4QHYA 3JQPA 4P32A 1PI3A 1G3IA 2WG2A 2PWBA 3DJYA 5JCJD 2PLNA 1KVRA 1W0CA 3MN1A 4FS8A 5TXGA 2B21A 3BZUA 4N5DA 4PSDA 3KB6A 1UPFA 3L46A 3R20A 3CUWA 1UT8A 5DBOA 2PXHA 3SX2A 1AXGA 3RANA 2ETVA 3H5IA 3VDMA 5A03A 5BW4A 3O5AA 4XVRA 1PO7A 3FMIA 1MX3A 4UDOA 4ZVPA 4N47A 3X1MA 2I1WA 4W5WA 4ZVOA 1JHYA 1NQOA 1K1EA 1RAAA 1FTYA 3C6BA 2CVHA 1P3Y1 3AB3A 3WLJA 2IOQA 4Q3AA 1XJWA 2YTZA 1SXQA 1L1EA 2BM0A 2JJMA 2WJGA 3AEYA 5DNAA 4BKUA 4CTKA 2FUG6 4NDAA 1NYTA 4YS6A 3LPNA 5I7WA 2FV8A 3HDJA 4QPNA 4X6UA 2FSPA 2VXCA 3HWWA 5EPEA 3V8EA 1TK9A 3DAHA 2VFAA 1AURA 3WLLA 3LQKA 1SVKA 5AHXA 5KSPA 4EY4A 4GKAA 1C0PA 3FUVA 3N1UA 3MJRA 5JE8A 1YB2A 2DWPA 1GCGA 2H31A 2XMCA 4LVNA 4WBNB 1QTQA 3QBTA 5ICMA 3B6ZA 2P4UA 4ZO7A 4G5OA 2XKAA 1CQPA 1K06A 2VBCA 3D5EA 3G0BA 4FFMA 4WN9A 4BB6A 5A2GA 2ZSBA 5F7OA 3GNSA 4CI0B 2XECA 2B7BA 5FOTA 1G2QA 4FI3F 1SUCA 4J49A 1T9GS 1W4AA 1D6SA 1YKGA 3I2KA 4QYSA 5K4AA 4EPXA 5BWOA 2PUAA 3FW1A 1UXIA 3DMYA 3A9TA 3T61A 2N1MA 2OYSA 4TVSA 3D64A 1ZGHA 4GX0A 4Q1FA 1LNZA 1WG8A 3NUGA 4UDYX 4X95A 1XEFA 4KQJA 3TW8B 1BE1A 3TLYA 5KYWB 1LTQA 1R0LA 1JG7A 1MJGM 4KAJA 1TCUA 4K9DA 5JVDF 1APBA 2ZJBA 5D00A 1XJCA 1OLXA 3QUQA 3X1JA 4BFUA 3SVTA 4GSLA 3EGCA 5LA6B 1SC4A 1QDLB 2I6SA 3LOQA 4FIDA 3UIEA 4BMSA 2BCEA 1Z4MA 5BSVA 1BDBA 1IN5A 4WKPA 1UZMA 2PZGA 4URWR 1RI1A 4UDXX 3NKLA 2J4DA 2YOFA 2I66A 2GRUA 2AQHA 2Q0XA 1NBHA 3C45A 5AW7A 4IZIA 1LH0A 2CK3A 1YQUA 2YYYA 4PCUA 1GG2A 4AK9A 2JS7A 4S1PA 2E1PA 2FMHA 3TZ6A 4BUZA 5U1PA 3TOZA 3BIXA 3DDNA 2QUAA 2Z58A 2PQ6A 4D3FA 1W0KA 5BXYA 1EKXA 2R7LA 2Q5QA 2BCGY 1PJ8A 3FNIA 1U0FA 1FL9A 4N6GA 4AJEA 4LXIA 1II8B 1XXHB 1IDOA 2X7XA 2ZJOA 3DHWC 3OD5A 4XYEA 3X1DA 2UU9B 4TX1A 4RLSA 3H11B 3VOAA 1OB2A 2GN6A 1LTHR 3GJ4A 3KQTA 1NSFA 4BNFA 4PRYA 3AUAA 4WADA 5C8DA 5AXCA 2WHQA 1CJKC 1FSZA 4FT2A 5L3SB 3GF4A 4NICA 5TC4A 4DLLA 4EVQA 3GLFE 1ULBA 2AIRA 2I0FA 1E7YA 5J5AA 5HBRA 1AA6A 4V38A 3SBDA 1HL7A 1KOFA 1ZONA 5FQNA 4BLSA 3OU2A 5JYBA 1BEEA 5JYEA 2BYTA 2R96A 3QMVA 4B7CA 1PG0A 4UNRA 3LC1O 4Q7MB 3ZD9A 4MLDA 3RHZA 3EPHA 5LZ8A 5IBQA 1QIGA 4NV1A 4DILA 2WY2D 3V4LA 3ZV4A 4LIPD 3B3QA 1LK7A 1YS2X 2OAP1 3H18A 1VRWA 2HF8A 3D7LA 3QVUA 4GXQA 5KJCA 5KOHB 3GGGA 1F7VA 4XIIA 3PB3A 2IYQA 3RC1A 5HZKA 4ZI7A 4QQ8A 2Y6VA 3BK7A 4BU1A 4TWAA 4Z1OA 4MI1A 2IPAB 4BMDA 4AXXA 2GT1A 3ZGXA 4RLHA 2Q6VA 1U04A 3DLPX 4JZYA 1ZH0A 2GH1A 3K35A 4IQ8A 1GZ7A 2JI4A 1I30A 3IMFA 4QGHA 4RY8A 4BNVA 3PYMA 5AP9A 2BMEA 1TADA 4IL5A 5GV7A 3KJIA 1OAKA 1BHO1 5KUTA 2IS4A 3WWPA 4IDOA 3FSGA 1OX5A 5KX5B 4R8LA 1NV8A 2MR5A 2ZTHA 2PRJA 3DCNA 4JC0A 5FAKA 3HE3A 5D84A 5DNVA 3V5NA 1XYGA 3L8MA 1PS0A 2C96A 3WWCA 1BCSA 5CYOA 5KKAA 4ZMSA 3WYAA 1NVFA 1P3JA 2H65A 1FVOA 4MS1B 4GPZA 3GMTA 3EQ2A 4EYKA 5CB0A 1JHVA 4TYNA 1OBHA 4PONA 5BSTA 4ZVMA 3CINA 5BSUA 2IEYA 2CXHA 2C98A 4RVCA 4BBPA 3TG8A 1F0PA 3NT5A 4D1YA 2LNDA 2X3FA 3BEDA 1LPBB 5KNCA 4R0VA 1BHSA 3HNOA 2F1RA 4CT4B 3B5EA 1C3XA 4HMOA 4C7XA 4RTMA 3T5CA 2NO6A 4PEVA 4DDTA 2WLTA 2P6OA 3VXKA 2O52A 3PENA 2AXEA 5AVJA 4F9GA 3UAVA 1HFKA 1P4HA 3NHWA 2BWJA 4KE7A 2VEDA 2YDXA 1ZGCA 5DPMA 5BORA 3QLEA 1D09A 1ZJZA 3GQBA 4BJ6A 2OFPA 1H4TA 1KAHA 2DZDA 3P9IA 2FR8A 3NBZC 2ZDGA 4AIIA 5D01A 1QX4A 1SKUA 3QWBA 3E8SA 5K3FB 2BFCA 3PVSA 4AB1A 4UUNA 2BFDB 4EJFA 3GG2A 5GGXA 1UWLA 1ODFA 4MV6A 1YVEI 4O4LB 4YJ2B 4PC7A 5DGXA 1CY7A 1KI6B 5J3JA 2P9FA 3PUIA 5BN1A 2FDCA 1JDZA 1O1YA 2QX8A 1RWQA 3OZUA 4FZ3A 4HVCA 1WUHS 1PEAA 3WMXA 1KK1A 1W9HA 4O3FA 1G9SA 5AHKA 2Y1CA 3NKFA 5JCOA 2ZRIA 3ZHXA 1I9CA 2Q4TA 5A5FA 5A4DA 1JKMA 2VRCA 1YR3A 2CNLA 1K66A 4ALKA 1KAGA 1RI2A 2B4AA 2CE2X 2CJYA 3PDIA 3TSCA 5B3LA 1VPTA 2XNHA 4QQRA 3THRA 4DV1B 4PPYA 2H2HA 3H9QA 3FE2A 3ST7A 1BH6A 2Y99A 2FX3A 1DAOA 3FCCA 5GGYA 5TE9A 1D2AA 2NNWB 3TIVA 4F6LA 3GRYA 2XRYA 1NJ1A 3Q5EA 3SIWA 5GZ3A 1BXGB 2BC9A 3O4GA 1U65A 1R8SA 5EMKA 4DPMA 5JS2A 2EKPA 4TUYF 1DS6A 1SCAA 5AM1A 2FSFA 3IKMB 3KFLA 1UKBA 1UMKA 2QRNA 4N3CA 3TQIA 1E2KA 4NECA 2WU3A 2UUOA 4Q3EA 4E08A 1R6BX 2E7ZA 2Z08A 3EEIA 4CLXA 1Z0UA 1HTWA 4WKOA 2CLFB 5JWOA 3I52A 4DVJA 1N0UA 5IF9A 1X1TA 2F59A 1JKJB 1Z39A 2DKOA 1KBZA 1LBIA 2PV0A 3ZDDA 2QTAA 1L1FA 1Q0PA 4IJ5A 1M1YA 3A6HA 3HO6A 3LUAA 4W9NC 3R3HA 3B1FA 3NM4A 5I7AA 4B5KA 4NC9A 3F7NA 3G1WA 3NDPA 3JCZA 4MV3A 3AL0C 4PNPA 3RIEA 1A9ZA 2QR3A 3RIMA 4BECA 4UM9B 3FTEA 3QLTA 1F6BA 3SI7A 4LZZA 3NB0A 4WN9B 4F5ZA 4JHXA 1X1QA 2XJ9A 1ZXXA 3RTGA 1ECPA 2XWQA 3AXTA 2BMDA 4X20B 5BMVB 4AULA 5BPHA 1IYZA 1P75A 4QTTB 2Q4OA 2IHNA 3CH5A 2SKDA 1OAOC 1MNQA 4XOUA 2GUGA 2WPDD 4PQGA 3U80A 4ALJA 3GW8A 4AJKA 1H0SA 4MGYR 4F1KA 3X2EA 3T0GA 5WRFA 2DP4E 4XFKA 1HQYE 4KDRA 3W04A 1UKAA 2ZUUA 2C4WA 2FETA 4V0MA 3PHIA 3P2OA 1EFPA 2IUYA 3PGMA 1NF2A 1KQ3A 1KZ9A 3CJQA 3MERA 1P81A 4FMDF 3N2IA 4DMUB 1I7PA 3WKAA 2JA2A 4H9GA 4UU1A 3VSCA 1HFEL 1KAMA 4CFSA 5F2KA 4RPHA 3LV8A 3UPTA 4NL4H 1G3UA 3SIXA 3AESB 2HWWA 3GGCA 3GAAA 1XTIA 2KM1A 4KWCA 4BPRA 2BMFA 1L1RA 4TLMB 2YMPA 1W581 5JQGA 1E2GA 3LY5A 2NUTB 2RGGA 3R5HA 4OHUA 2QGNA 3OEYA 1YOVA 1RI5A 2YHAA 1H5NA 1WXEA 2Q1UA 1BGWA 2D54A 4KG7A 1KY2A 4K9RA 5DBIA 3B12A 5AD1A 4JUBA 3VZRA 1GTJ1 1YQTA 2B92A 3ADKA 4MW1A 4TYQA 1E94E 1A5AB 3TKYA 3ICQB 3RGWS 4IKEA 2PFSA 3MS7A 1HDZA 4IDCA 4Q3OA 3NUZA 5ALUA 1KR2A 2WNSA 2DTXA 1BX0A 1U7HA 3AWIA 1P4RA 2R86A 4FBLA 4JITA 2NUTA 4LDJA 1YCFA 3PPIA 3UTDA 4P5DA 4XW2A 3Q12A 1IEXA 1XWFA 1E1RD 3N5CA 1CUUA 3IPRA 1AQ6A 2IYWA 4W4TA 4CMIB 4FFWA 2EBUA 2Y68A 3RVDA 3UKJA 3GVIA 4M4SA 5JS1A 3QHQA 3HZZA 1V1MA 2XBMA 3CPJB 5TSDA 1VRVA 1KZ7B 1RLOA 2G04A 2VWQA 3HQ4O 1P39A 4ZVVA 2GUWA 2JLBA 3BJMA 3E4DA 3T6KA 4A1FA 1UOEA 1ENPA 1EFUA 3HB0A 4Z7NB 3GG9A 4UM7A 1ZO8A 2CL6X 3JZIA 3FYUC 4PYLA 3LECA 2FOIA 3UOWA 1EFAA 2H59A 1W0JA 2WD7A 3OLWA 5T8KA 5J2TB 4CCSA 5CVCA 1KMHA 2C61A 2Q29A 4YP1A 3TSOA 1Q14A 1IE3A 1X19A 2Z0MA 2GJ8A 3BD9A 4MVJF 3R0ZA 3VO2A 5BUCA 4UEKA 1FP2A 2F1HA 1GG9A 5CVTA 3NC1C 3AVUA 2H00A 1WDWB 1COZA 2YN4A 3KVVA 1JJIA 1Z18A 3G2KA 2GN8A 4J2OA 2AG1A 3LUPA 1HOXA 2OKGA 3DNMA 3FWZA 1FUEA 4U2DA 1TUBB 1KVQA 2QQFA 3CEMA 3OC6A 4RDIA 1SKYE 5G0TA 3H5OA 3HSKA 1JXOA 4YMHA 1NDHA 4MR7B 1XZGA 1NE7A 1ZESA 2C2GA 1IOZA 3R9KA 1U2SA 4P7FA 3V32A 2GZHA 2R7MA 2XT0A 2C3MA 2UZIR 3F2VA 2J4FA 4FMCB 4Y2JA 4ZV7A 1X1CA 3ROKA 3F6BX 2NU8A 3JAMA 4TKUA 5DI9A 3TEMA 3ANYB 1KYTA 1BJRE 1XAGA 1OHHD 2CF6A 4JX8A 1H2BA 1FTSA 3I53A 3MC1A 4LY3A 3GGDA 5BUZA 3QFSA 1GU0A 4BX0A 3MK31 3QI2A 4EITA 1SXJD 5FV7A 4R2MA 4CL8A 1F8YA 1NMQA 1U9IC 4NR0A 3PWTA 4Q03A 1EFTA 4BP1A 4YCNA 2OD2A 4BRUA 1DDIA 4IS2A 4EA8A 2EERA 3SNKA 1O9HA 1HNNA 2ZBUA 1IZYA 3GMDA 2Q8QA 3SF8A 3TFOA 4DLXA 2I91A 1NJSA 2AZMA 1ZD2P 2NVWA 1Z56C 1SOUA 1YTLA 2XCLA 4WECA 5DF1A 3WJ7A 3VVLA 3WL5A 4B4KA 2GBPA 2I33A 3W5IA 2XHZA 4EO4A 2RGCA 4GECA 4GWGA 4B3SB 3H16A 3PDIB 3WDKA 1ONPA 4WA8A 2F1JA 2PR2A 3BTUA 1LGYA 3A1NA 4LNUA 1IBCA 3UMSA 2W2NA 3RIYA 3IT0A 3TE7A 4YT8A 1NF9A 2YS6A 4ND5A 1WIWA 1E4OA 3PPYA 3A37A 3GJ3A 3Q2OA 4M98A 4QUHA 4BV8A 4GO1A 5BUSA 4YO7A 4GDFA 2MSEB 3DBRA 4Y6RA 1CYDA 5C46F 3NXSA 1FU8A 4DC1A 5DM4A 5KTKA 2GM4A 2VSOA 2QN1A 2BUBA 3CLSD 4OM7A 4OHKA 2RARA 3SSNA 1KI9A 1ZM4A 1MAHA 4KPFC 1ARZA 5ENDA 1CX9B 4Y0AA 2IGBA 4MQ6A 4AS1A 4LJSA 2VLBA 2BFCB 2Y8EA 5ICCA 4RVDA 5CDFE 2JGDB 3FWYA 2CLHB 2GCGA 3BZBA 4JVNA 4AY3A 4JBGA 1G5TA 3CUYA 1NW9B 1VMKA 2DOKA 2CMDA 1Q3TA 1IWOA