2HMVA

Diamond-shaped octameric ring structure of an rck domain with adp bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
139
Chain Sequence
NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YuaA protein
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 45
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmvA00
3WTBA 1R4NA 5G0TA 5ICMA 4OQZA 2Z5LA 5I7FA 1ZJZA 3INRA 1X15A 5L7TA 4R41A 4GQAA 5K6AA 1Y8QB 4NQZA 3CZRA 3TFQA 1U3TA 4ZRMA 1N7GA 1FDWA 1NWHA 1MC4A 2Y0EA 4R51A 2BD0A 2CDCA 1HYHA 4EYEA 2GCGA 4H16A 1TT5B 1YH3A 3DBLB 4M8SA 2Q4BA 1PQUA 1TEHA 3IMFA 5G4KA 5L53A 1GEEA 2HCTA 4NI5A 3ZW8A 4Y8VA 1ZSYA 3NJ8A 3GF4A 1O95A 1WDLA 1ZEJA 2PH5A 3VTZA 4AICA 4DQVA 3A28A 4ZQHA 3R1IA 4IDFA 3TDKA 3U4HA 3GRKA 4XDZA 1CRWG 2IRWA 1IYZA 1Q7GA 1KETA 2EG9A 2EWMA 1UXKA 2VYVA 3H6KA 2DQ4A 2ILTA 2G1UA 3QHAA 4PRLA 3E6AA 3A06A 3L4BA 1N7HA 2GASA 4HFMA 1LUAA 3F46A 1NPDA 3ROMA 4BMSA 4K1LA 1A5ZA 1T1RA 2IYOA 1X0VA 3C24A 4RQUA 4CM9D 4OSPA 5C7LO 3TFOA 2UAGA 3FTNA 3WGZA 1FDTA 5B1YA 1YE3A 3AM4A 3V2UA 2NTJA 3AUAA 4BKQA 3F5QA 3UW3A 3KSZO 4OSOA 2VOEA 4FQ8A 1DAOA 4I5EA 4A10A 4TRJA 2YJZA 1IOLA 2PZMA 3A1NA 3V2GA 3ZHBA 1T26A 4LSMA 1T4DA 2OZPA 4Y6PA 4CMKA 2A35A 3F6YA 4L74A 2B4RO 1VE9A 2VN8A 2BGLA 4E21A 2Q1UA 5T67A 4MIYA 3QLJA 1E1MA 2GRAA 2I66A 1J0XO 3DR3A 4WOKA 4AJNA 1XIVA 4M54A 3GT0A 4HV4A 5I8WA 3IOYA 4MDHA 3VHRA 2AG5A 4URFA 2BI7A 1GFSA 2TMDA 4YBZA 4QSMA 4QTZA 3RC9A 3ZWXA 1U3VA 3ZHYA 1E7QA 4WLNA 3VZPA 4OL9A 2EJVA 1Z7EA 3Q9UA 2CY0A 4KMSA 3HFSA 4D3FA 4L4SA 3TPCA 4D43A 3VKVA 4DQUA 5KJEA 2X1HA 4OHUA 3W8EA 3BTVA 5G0SA 4CODB 2JAHA 3FWZA 1QMGA 2ZB7A 4GX2A 5EIOA 1G0OA 3QJ5A 1IHXA 3BHIA 4EW6A 2CVQA 2JJYA 1PS8A 3EHEA 1BHSA 3O03A 1NP3A 4ALIA 5A1TA 1U8XX 3DL2A 4CV3A 6LDHA 1YDWA 1HT0A 1SPXA 4MJLA 5DCWA 3BAZA 2GDZA 4NJMA 2VHYA 3EZYA 3VZRA 4DPMA 3S1LA 3JQDA 4XQCA 5FI3A 3TSCA 5CDTA 1B14A 1DJNA 2I9PA 4J4HA 3I1JA 3GH3A 4CMIA 5JCJD 5A3VA 2VQ3A 3CPSA 2Y67A 4LSWA 4HFNA 1QSGA 1LRKA 2HO5A 3EYWA 5GZ1A 2IZZA 1YQGA 5JW6A 1Y8RA 1ZKMA 3DZBA 3NEPX 4IJWA 3DEYX 3HADA 4E2XA 3PIIA 1PJCA 3HSKA 4CMJA 3PI7A 1BVUA 3P7MA 4M86A 1AHHA 1XG5A 2ZYAA 4QT0A 4AJPA 1X1EA 2OGUA 3AFNA 1HWYA 1PQWA 3EC7A 3S55A 1BXGA 2B5VA 2C07A 3BTSA 2HDHA 4PFJA 4TKMA 4HFJA 4N54A 1I3MA 3UFXA 2J5KA 3AY7A 4XB1A 5ITVA 2BMAA 3D4OA 3PTZA 2W2KA 3WLEA 1E7YA 3LLSA 5A04A 3IP3A 5IAAA 5L4SA 4CL8A 1UUFA 4ALNA 1HDZA 3V8BA 4PLWA 3VPSA 3HZZA 1DC6A 2P2SA 3PVZA 2D59A 2EIHA 2HMTA 5IG2A 1N2SA 3ETGA 2CD9A 1KEVA 1MP0A 3BXXA 3D4NA 5MGBA 4RZHA 4E4YA 4DC1A 4DL9A 4JQCA 5K9ZA 4XRGA 1LJ8A 3NGXA 1I33A 2P9GA 4EUEA 3HUDA 3PP8A 4Z9YA 1LSOA 1NQOA 3QVXA 4R3WA 1E5LA 2NVWA 3HDQA 4RLSA 3WBFA 2GZ3A 4PVCA 2EGHA 2P4QA 4ZQGA 3RWBA 2QHXA 5JY1A 2QZZA 1DJQA 2C7GA 4RVDA 1CQJA 4M87A 1N92A 4U7WA 3H4VA 1L1FA 1YKFA 5LDHA 5A03A 1QLJA 4ALKA 5L3ZA 5DCYA 1SZJG 1U7HA 1UDBA 2B35A 1ISMA 3GFGA 5L4LA 4XDYA 1UDAA 2D0IA 4XZ3A 1P0FA 5HWSA 5JDIA 1Z75A 3E9QA 3ZV5A 3AOGA 3DOJA 4TRNA 4RV9A 1ZK2A 2C7VA 4KOAA 5G4LA 5T64A 4KQWA 4WGGA 2Y1GA 1TI7A 1LI4A 5BT9A 3ZWOA 2NU6A 2VYND 3JQGB 2Q50A 5IXYA 2QQ5A 4PN3A 5HBRA 2GZ2A 3VPHA 4FN4A 2YY7A 1X13A 4CM4A 1Z7BA 1EBUA 3GDGA 1EUCA 1LDNA 1K0UA 3ONEA 4XYGA 3A4VA 2E37A 4MKRA 4FFRA 5TRTA 3JQFC 2W8ZA 4Y6RA 3WNQA 3GEGA 3TL3A 1V3VA 3GR6A 4R3NA 4OXNA 1MV8A 4D41A 1OZAA 1P74A 1SC6A 2R00A 1W0CA 1VRWA 4YJGB 3FRJA 3KYBA 1VM6A 2DBZA 4GBJA 4BNFA 4FFPA 1C14A 4HP8A 1T2EA 3MJ4A 4CR8A 1KS9A 4P4NA 3AFMA 3DXFA 1LLQA 1ONOA 1Q0LA 2J5QA 3Q11A 1E3EA 4P22A 3BMNB 1NVMB 1Z45A 2BFMA 3FHLA 3VH2A 4CV1A 2FSSA 2IE0A 2HLPA 3AUSA 4R01A 1YO6A 4KWHA 4NBRA 3ZGYA 1I32A 2X7HA 4IZHA 5A9SA 3FPLA 3HWRA 5EMHA 1DLIA 3WJ7A 2WD7A 4RF4A 1P1IA 1QYCA 2H63A 3JQ8A 1KERA 4N5NA 1QYXA 2PLAA 5HRUA 1NPTO 1OI7A 4F46A 4ZJUA 4BV9A 1GQQA 1O8CA 3RAJA 2V6GA 4AJHA 2GNAA 2WWRA 3Q0EA 2YZ7A 4Q3CA 4BV8A 2NU7A 4K9DA 4Z6KA 4KP7A 2UYYA 1PS9A 2VWPA 3ZDFA 5BSEA 1D1TA 2AMFA 3D7LA 3RD5A 2OHXA 4R1SA 4LISA 5KJCA 4GKBA 4AFNA 4Z3DA 2R2GA 3GZ4A 4FBGA 1QV7A 1YBAA 4YAIA 1JAYA 2AEMA 5JFOA 3D1LA 3JQAA 1R0KA 3RKUA 4B4OA 4CM7A 4DMMA 2JFHA 2W2LA 2WE7A 3RU9A 3WGHA 3LT2A 4HX5A 4J43A 2IEBA 4FIZA 1E92A 2C29D 1BTOA 2I99A 3ULKA 1VL0A 3R0IA 1GD1O 5DZSA 1V35A 3JQ9C 5CAEA 1ZMOA 3F1KA 4M49A 1H2BA 3NRCA 3NT5A 4RO0A 1EDZA 2PKQP 3ONDA 3ASVA 4RVFA 2D1YA 3R3SA 1I0ZA 1PJBA 3G3EA 3VH4A 4FFLA 4L0QA 3GGGA 4JK3A 4GVLA 5T8KC 2JFFA 4WNCA 2JL1A 1GEGA 3U0BA 1BXZA 1VJ1A 3WTCA 4XYEA 2LDBA 4HBGA 4TRMA 2FZWA 3PQFA 3GZNB 1LDMA 3E9MA 4KDEA 4B4UA 4IIVA 1PJTA 3K96A 1PR3A 1YQXA 4TMFA 4XQ9A 3HJAA 3U62A 1YBVA 1ML3A 4IDBA 2JCYA 4Z0TA 2XPCA 4BO1A 2VWHA 4HNHA 4IXTA 3TJRA 3VPXA 4B7UA 2CMDA 2QW8A 2DKNA 2O2SA 2X0JA 1SO8A 3C1TA 3DMTC 1LDEA 1U4SA 1BWSA 1SOWA 3CIFA 3H9QA 7ADHA 3HE3A 4PZCA 3UCXA 2X22A 1E3JA 4UULA 2C82A 1W73A 1YJ8A 2SCUA 4UEJA 4WE3A 4NK4A 4RVSA 4I9NA 2XXJA 4MKXA 5CFZA 1QR6A 3GFBA 4DC0A 1P31A 1DIRA 3V2HA 1D3AA 2NU8A 3DZJA 3JD4A 3I6QA 3UCFA 2OMEA 3KYDA 3ANMA 4Y67A 5IN5A 1UXGA 2NSDA 1C0KA 5DDIP 1PZFA 4XJTA 4GWKA 1MGOA 5ADHA 3FNHA 4YQYA 1NQTA 1DRWA 4BMNA 3O9ZA 3FI9A 1DHTA 3DONA 4BO8A 4YWJA 3HDHA 1E7MA 5B12A 2Q1SA 5T5QA 3QWBA 3ZI0A 4KWIA 4R16A 3BTUA 2VZ9A 5EPOA 4Q3AA 5KTKA 4LRTB 3C8MA 1J5PA 2VHVA 2DBQA 2WJPA 2ZTMA 3CZMA 3HNPA 3GVCA 1SBYA 3JQEA 1QV6A 1KEUA 3HFGA 1ENPA 4FC7A 4UEKA 1D8AA 2J5RA 4UVHA 1PWXA 3ZCXA 4FPXA 3FR8A 1S6YA 1NASA 2RH4A 4R54A 3S8MA 2Y1EA 3KYCA 4FDAA 1K6IA 1SAYA 2C0CA 2P5UA 2ZB8A 3TRIA 5JC8A 4XB2A 1CEQA 1ZVMA 4MVJM 4Z9XA 4NFSA 4ZA2A 1E1NA 3D0OA 4Z0PA 3GNSA 3DTYA 2G17A 3LU1A 3MJTA 3OICA 1HXHA 3TZCA 4RPLA 3WWYA 1WNTA 1YB1A 2AEJA 3ZV3A 1NX6A 4KQXA 2UUOA 1XA0A 3IAHA 1E3WA 3QW2A 4WCFA 4GX1A 4A5OA 3KRTA 4UREA 3UUWA 3RFTA 4R1NA 3D64A 4NH4A 4TQGA 3I9KA 4J4BA 5IDWA 2X6TA 1F14A 4CLRB 3I9OA 3DTTA 3WGGA 4RJTA 1HE3A 1UZNA 4P4GA 1E7SA 5CPFA 4E2ZA 2X4GA 3MTJA 1GV1A 4H3VA 2JKVA 2ZYDA 3BMOA 3PJDA 3GK3A 5CEFA 4J90A 5DN9A 1WMAA 3KLMX 1YRLA 3R3JA 2EERA 3HHPA 4JROA 3TQHA 2GSDA 2QG4A 4E2YA 1JW9B 4DIFA 1VLLA 8ADHA 3Q1LA 2PZKA 3DOCA 1LLDA 2BF7A 1Y1PA 2QRKA 4D42A 4FR5A 1HDGO 1WW8A 1Z6ZA 2BFOA 4Y98A 3OFSA 3WDSA 1ISJA 1P1FA 5JO0A 3OH8A 4K6CA 4P38A 2FSVA 4OQYA 3O4RA 4BL5A 1U5AA 4PGFA 1WDMA 3BMQB 3IDSA 5EQFA 3H5NA 4EEXA 2OOSA 3AW9A 1PGPA 3KSUA 3KB6A 3LDHA 4OOFA 1AN9A 4I5DA 1WWKA 4U6SA 4BO4A 1CIVA 4WOJA 4AJLA 3TZKA 4IIUA 2B37A 4MP3A 4JX8A 1CWUA 3PJFA 5F1KA 3LQFA 3NJ4A 1GQYA 1Q7BA 4PLTA 1PJ3A 1H6AA 4PG6A 4CLHA 1YONA 2Q46A 1EDOA 3QV1A 4BNTA 2H6EA 3IKTA 1UP4A 2HJSA 4NNJA 2DBVO 5EQDA 2HK8A 4QFDA 3T4EA 2CF5A 1HYGA 5FFFA 5TNXA 2HMUA 5IN4A 3VPFA 5IZCA 1QYDA 4FSHA 4PG5A 1WLYA 2E82A 4BUCA 4J1TA 5EL0A 3E03A 4YT2A 1H6CA 1Y5RA 2AEFA 3V1TC 1DFGA 1GZ4A 2GN6A 3LT4A 5DCUA 2AW5A 4MVJD 3T7EA 4YVFA 4NFHA 4CJXA 1V6AA 3N7UA 1Y7TA 2X0RA 4RDIA 2OL4A 2VTEA 4CV0A 1LQUA 4RF5A 5JAZA 5BSGA 4PZEA 1GQ2A 4CM5A 3DZGA 4EJMA 3HN2A 4WCDA 4U6QA 2RHRA 1ADBA 4L76A 3ENKA 4RQTA 4AJ2A 5B4VA 1PU2A 3DOOA 4HXYA 1FF9A 4IZIA 1MFPA 3GLQA 1RPNA 3WWZA 3ZNPA 1C1DA 5IDXA 3BMCB 4KUHA 1EVZA 4U0JA 3GA0A 4W7IA 1RYEA 4Q3EA 1KBZA 3ROPA 2Y68A 4ITUA 2DTEA 2RHCA 1PGQA 1LDYA 1Q0QA 4MVJE 4CQLA 3JSAA 1PL6A 3E5MA 3GUYA 4N5MA 2D8AA 3H2SA 1BGVA 1MXHA 4K6FA 4L9RA 1YL6A 4NPCA 4OGWA 4R5HA 3FWNA 1KOLA 2IDZA 3RVDA 3U3XA 1C0PA 1X1TA 4XJSA 3FSRA 4GI2A 1IE3A 1SOVA 3GDFA 3OQ6A 3UKOA 1P0CA 3EK2A 4DRYA 4L8VA 3DFUA 4KUGA 3AI1A 2YUTA 4R1UA 1NFRA 3QVOA 4E2WA 1LQTA 2HJRA 1LRJA 2NV6A 4FW8A 2BHLA 2VZ0A 4LCEA 1YB4A 1Y9EA 1UAGA 4TSKA 4YT8A 1FXSA 1NR7A 3GNQA 3NKLA 1BW9B 1Y8QA 3EZLA 2NWQA 4WKGA 1XDWA 4YAGA 5AXCA 1YOVA 2IXAA 4G65A 3ZW9A 4WJZA 3D3EA 4E5KA 3ZWBA 4GSKA 5CEEA 5KVCA 1LDBA 3RC1A 5AXDA 4YRBA 1TT5A 3DBLA 5DP2A 3ZWNA 3CE6A 5HTOA 3JD2A 3EGOA 3OF2A 1FDVA 2BI8A 3GGOA 4Q3NA 1XHLA 2NUAA 3H9UA 4BMVA 5L45A 3TF5A 4IDCA 2EKPA 3HQ4O 3P2YA 2OP0A 4WEQA 1DXYA 2Y99A 4IDGA 4IS2A 4BB6A 1B3BA 5I7SA 3I9MA 1BDBA 3P5SA 2FR0A 1JLLA 2YW9A 1WVGA 3OIFA 4R4JA 4Y9DA 5CEJA 4W4TA 1K2WA 1OOEA 1Z74A 2X0NA 5CDSA 4OYRA 4JN6B 3RASA 2ZIZA 4GWGA 4R1TA 2IXBA 2VTDA 3JQ6A 4BNLA 4P4LA 4NDNE 4BNYA 5K6AC 1E77A 2QIOA 4XR9A 3IUPA 3KOUA 3WFIA 2TMGA 4WASA 3ZWMA 1T2CA 3ZU2A 1SEPA 1PS0A 1QORA 1B7GO 4N18A 4XGKA 4ESOA 3VZSA 4FGSA 1CYDA 3HB5X 4ZQFA 1HDXA 2G0TA 1PL8A 3INTA 2VNSA 2FRDA 3ZWVA 5AVOA 1K5HA 6ADHA 4AJ4A 1KY4A 1DPGA 1KC1A 3H2ZA 5KNLA 1RWBA 3RUEA 3TZQA 5JY6A 3FNGA 1ISFA 2YQ5A 3MJEA 4RPHA 1DSSG 4YR9A 2VHWA 2VRCA 3LC1O 5I9MA 1UZMA 1R6DA 1NAIA 3RU7A 3L4BC 4E5MA 2CZCA 1C0IA 3PQDA 4GGPA 5BR7A 1GZ6A 5A06A 9LDBA 2YFQA 1RM4A 1K6JA 2GR9A 3VH3A 3I3OA 4RPKA 5A9RA 3ANNA 3X2FA 3MWEB 3OA2A 3WMXA 5JXWA 3FBTA 5IDYA 4J49A 3WQQA 2D5CA 4PCVA 4Q3BA 1H6DA 1CERA 3WQSB 2BFPA 3U4CA 1M76A 3L07A 5ENDA 2CFCA 2HSDA 2CDAA 4P8RA 1HDOA 4XA8A 2E49A 2Z95A 3PK0A 2O23A 4BNUA 4QXMA 4QUKA 3ZZNA 2O48X 3SC4A 3HB4X 3WGOA 9LDTA 5AQ1A 4J6FA 1XEAA 4O6VA 3IS3A 3VZQA 3QE3A 3P19A 2DAPA 2HRBA 2DU8A 1O6ZA 4W7HA 3K9QO 2Q49A 1VL6A 4I5GA 1NAHA 2IZ0A 4EDFA 2H1SA 1ULSA 3WYBA 1PR9A 2HK9A 3GVIA 4LMRA 3FF4A 3M2TA 3QWAA 1ADFA 5F5LA 3G0OA 1EMDA 3UGKA 3WG9A 1DIBA 5HS4A 4ND4A 4PLZA 2X5OA 4I9HA 4FFNA 4CMEA 1ADGA 1CDOA 3DHYA 4OH1A 3WYEA 4FFOA 3D5TA 2Y0CA 5CPBA 3PWZA 1PIWA 3PDJA 4BKUA 2WMDA 3D3WB 4PG7A 4CMAA 2P91A 3E1KA 4LCJA 1P9LA 4QX6A 4NFYA 4NR0A 4BO6A 1U5CA 1N9GB 1R0LA 2OBNA 1KIFA 3VDRA 4QO7A 1ZO8A 3L77A 1EE9A 3TZ6A 5U1PA 1LC0A 1I30A 3M1LA 1G1AA 1W6UA 5LC1A 1QRRA 3DBHA 4CM3A 3ST7A 1KC3A 1I5RA 3H65A 3LYLA 4GLOA 3Q9NA 4NU6A 2PGDA 3I5MA 3ZHZA 2D3TA 1EUZA 5CHEA 5T6BA 3MCVA 4PG8A 2PZJA 2Y05A 3JD0A 4I5FA 5BQFA 5DP1A 4YAEA 2EKLA 4WLOA 1UDCA 2O3JA 3PJEA 4IJUA 1H93A 5C7IO 3AOEA 4DLAA 5COAA 1GPDG 1LSUA 1PGJA 1PGNA 2VUTA 5AOVA 3WXBA 4CR7A 1I8TA 1JKFA 4FFMA 1HDRA 5C5IA 4MVJF 3DWFA 1EFLA 2Q4EA 3LVFO 3F3SA 4NBTA 5GMOA 3ZU4A 4XRRA 3GQVA 4YT5A 1E6WA 1DFHA 3K92A 4HY3A 2Q2QA 3QSGA 3VDQA 3WNVA 1HYEA 2C5EA 4OKNA 1VI2A 2NQ8A 3CMCO 5FI5A 3JQ7B 5H81A 2CSUA 2GD1O 3WS7A 1UXHA 2RIRA 2ZK7A 2I3AA 4XGIA 2E48A 4L4RA 1DRUA 2OXIA 1PJLA 5G0VA 5TF4A 3WMWA 4DBVO 1ZSNA 3CTMA 1V3TA 2Y0DA 1UP6A 1QKIA 4IXWA 4BGUA 4ZGWA 3AU8A 4OKIA 1A72A 1GTMA 1LLCA 2B5WA 4IMPA 4JGBA 2YYYA 3JQGA 2AG8A 4ZICA 4B7XA 2E6UX 3F4LA 3ZWYA 1SNYA 3MJVA 4B4WA 1SEVA 3G1UA 2X9GA 2YDXA 1EK6A 3IQDB 3W8FA 1P1HA 2VRBA 4XYBA 5JO9A 3U49A 4GAEA 4AJKA 4KTTE 2ET6A 3I9NA 4EI2A 1GDHA 5ILOA 3RUAA 1H94A 4ND2A 1ZSVA 4WLEA 1RJWA 2A94A 4F3YA 4U0KA 4BKPA 2H9IA 2YHUA 4BB5A 4DPLA 1ID1A 2NTNA 1ISHA 4UUPA 3OQ1A 3KZVA 2WYVA 3W8DA 4YJGA 3SLGA 4EUFA 4GX0A 5JDIC 4MVJA 2A4KA 4YTEA 1VJTA 4CLOB 5L9AA 3S2EA 5KOIA 4CM4B 4WUVA 4H15A 4UVDA 4AJ1A 1N5DA 4OXYA 4BO9A 1GUZA 1EVIA 4BGEA 1E3SA 4AVYA 1A4IA 1XSEA 3SC6A 4ZHSA 1M66A 1ORRA 4IDDA 3BMNA 2AQ8A 5MDHA 3ASUA 3DO5A 4NJOA 4AJIA 5TGDA 1P1RA 2J3JA 3JQBA 1DO8A 4RORA 3ZH2A 5I9NA 4XCVA 4A27A 2XAAA 5C3MA 3GUCA 2UVDA 4B3HA 3RBXA 3MOGA 5I7EA 4XD2A 4RL6A 3LT1A 4XQGA 1ZIDA 4ZRNA 2Y93A 3L9WA 4YXFA 4PLYA 1JKJA 3AM3A 4F45A 4ND3A 1K6XA 4BNMA 1ZXBA 4I08A 3GMSA 1X7DA 2HMVA 7MDHA 3F47A 1KYQA 1H0KA 5A5EA 2YV1A 1KY5A 1IL0A 2R00C 4BOYA 3K5PA 1DB3A 4DIOA 3S2FA 2X9VA 4L75A 1R4MB 1UXJA 2RBEA 3KV3O 5KVQA 3VVCA 4D45A 1DIGA 1T24A 3MTGA 8LDHA 1EEHA 2DUUA 4E5PA 1QYVA 3PZRA 3DHNA 1GZ3A 1X14A 3QWFA 2B36A 2D4AA 1XWFA 2Q1WA 3UOGA 3LC2O 2DBRA 2VYVD 2WSBA 1EUDA 2Q99A 1KEWA 4E13A 2AE1A 2OP1A 1JWBB 3JQBC 4NK5A 3WGTA 1NXQA 1U3UA 2NQTA 1ZCJA 1ZBQA 1EBFA 2BGKA 1A9ZA 3I4FA 2VHXA 4CL3A 2PY6A 3ENNA 1NNUA 4TVBA 3RBVA 1IPFA 3AJRA 5G0WA 3MJSA 5FYDA 3DHEA 4G2NA 3AY3A 3PLNA 2NVUB 1QG6A 1XGKA 1MFZA 3NDIA 4LVUA 4I1IA 2JFGA 5U4QA 1ZFNA 4RPJA 4MP8A 3GZNA 3SVTA 4XQEA 4GX5A 1GV0A 3B1FA 4M55A 1WZEA 3NTQA 3K31A 3BA1A 5GZ6A 4J2OA 2NNLD 3TOXA 3COSA 3WGIA 3MEQA 1JU9A 4CLDA 3TZHA 2PFGA 1FJHA 1BMDA 1PJ2A 4PG4A 3ZNQA 1B0AA 3JYNA 4BO5A 5F5NA 1U7TA 1B8VA 2I6TA 3SJ7A 5I8ZA 3I6IA 1B8UA 1LEHA 1HRDA 4JXKA 1ZMTA 1E0DA 1O5IA 3QWIA 2D2IA 5TC4A 2ZTUA 4NG5A 4GPD1 2I5PO 4UUOA 3KLPX 1HE2A 1RM3A 3O8QB 3AY6A 4CR6A 2P5YA 3GC6A 3DAPA 3ZV6A 3N58A 2V6FA 4YJHB 1ONPA 3CMMA 5JAMA 4IY1A 4CM9A 2XOXA 1UH5A 1VSVA 4TZTA 4J2HA 2FZEA 3C7AA 2ZTLA 4OOEA 1I2BA 1MX3A 4QO8A 3Q3CA 3CEAA 4BNJA 5CP8A 2JHGA 2VZ8A 1T4BA 3PLRA 1Y9AA 1DBVO 3PGXA 4W9NA 1OC4A 4XGNA 3GOHA 4ALMA 1CF2O 3AI3A 3L6DA 4IDEA 3VVBA 4E5YA 4FJ2A 1Q1NA 2C2XA 4B3JA 1DDOA 1BXKA 4JJGA 1NFFA 2HRZA 3OP4A 2PR2A 5HM8A 5TS3A 3RUFA 5A9TA 5EN4A 2HAEA 1T25A 1PJSA 3GVXA 4CUZA 4J16A 2QRLA 3WB9A 4ZQEA 4IMRA 2GPTA 3Q2IA 4D46A 4BO0A 1MUUA 4JP2A 4BHTA 4OXKA 2I65A 3M6IA 1M2WA 3O26A 4JIGA 3ICCA 2DVMA 5KJ6A 3BHJA 3I52A 4XYLA 2G82A 4J4TA 4JCOA 1NYTA 2FR1A 3STHA 2VUUA 1OBFO 1V3UA 4CLXA 4YDRA 3GPDG 3PHGA 2GO1A 1M6WA 2Z1NA 2O50A 5H82A 3PYMA 1SMKA 3L6EA 2F00A 3QA9A 4JNKA 2PZLA 3C3XA 1HETA 5JS6A 2H5LA 1HSOA 1W4ZA 3PDUA 5IXSA 1QLHA 1XYGA 4QQRA 3WOHA 2DT5A 3UICA 1OAAA 2UDPA 4NMHA 4J3FA 4B79A 2WM3A 3QWHA 4CQMB 4CLRA 3QP9A 5IFLA 3IP1A 1T2AA 1J49A 1PQPA 1WDKA 3ETEA 3H9EO 1Z82A 1L7DA 2CF6A 2FPIA 4J7XA 1VSUA 2O3TA 5JCJA 5A05A 3E9NA 5IJZA 2Y66A 4WPGA 5ILGA 1HSZA 3ONFA 4IQ0A 4IUYA 1F0YA 1LX6A 2NVBA 4BNHA 1CQIA 5IZ4A 4R68A 1DHRA 2Q3EA 2J6IA 4K28A 3T7CA 3JYPA 2BGMA 3ORFA 4TRRA 4J9UE 5EESA 4E3ZA 3OIDA 3GGPA 1LTHR 2PWZA 2XXBA 1YGYA 1KVRA 3F9IA 1MG5A 5THQA 4ALLA 4RPGA 4IM7A 5JCXA 3JYQA 2B69A 1YL7A 4WCFC 1R0SA 2EW8A 3S2GA 4XKJA 2DUWA 3VKUA 3ABIA 3DAGA 4UVIA 4RF2A 5TX7A 3B1KA 2IEDA 4K26A 1Q2XA 2ZCVA 2PKRA 1GCOA 1XU7A 1ADCA 4GH5A 4ALJA 4BNZA 5KJ1A 3Q6IA 3RUHA 1TB4A 1MA0A 3P2OA 4JJFA 1H9BA 4EEZA 1JDJA 3PJGA 4RVHA 3KEQA 3RFXA 4II3A 3ROQA 1J6UA 3KXDA 1ZK1A 2HUNA 3HDJA 4FCCA 2YQ4A 4MP6A 5DULA 3C7CB 2CVOA 1HTBA 2GF2A 3CSDA 1YS4A 2ZJ1A 4D0RA 1YVEI 4WLFA 1CETA 1U9JA 1MC5A 2EXXA 3G49A 5KJFA 2YV3A 2B4QA 3MOIA 3PXXA 2DC1A 1MB4A 1NQ5A 1ZW1A 1H9AA 3UN1A 3UVEA 2JD0A 1E7RA 4YACA 1XQ1A 3E8XA 1RKXA 1DRVA 2YV2A 3TN7A 4R69A 3H5RA 2ZTVA 1K3TA 1MG0A 3N74A 4FGWA 1C1XB 3H3FA 4LVCA 1IHYA 3LSYA 2J3IA 2R6JA 4PLPA 4DLLA 4CMHA 4FB5A 3OSUA 2ZB4A 3H9JA 4CM8B 2QZ9A 3UHAA 3S2IA 3BMCA 4CM6A 4FD3A 1XKQA 1A71A 3M2PA 1DAPA 2G5CA 3DMYA 3QVWA 3U4IA 4LW8A 3VTFA 4U5QA 1CJCA 3BIOA 5IZCC 1NR1A 2FP4A 4GVXA 2X86A 5BNTA 4OJNA 4E0BA 1F12A 4DXHA 3DZIA 4YJFB 2GUGA 3GY0A 2VYNA 3OMLA 4YAJA 4AG3A 1O9BA 2NU9A 4BNWA 1Y6JA 3WFJA 1ZK3A 5ENVA 4O59O 3I4CA 1N1GA 4D79A 3I9JA 4EBFA 3PPIA 2AQKA 3OEWA 4LGVA 2X8LA 3OIGA 1GL3A 3FPCA 3WICA 1PJ4A 4FS3A 2EJWA 4Q39A 4W6ZA 4YRAA 5BNIA 4F6LA 3U09A 1HZJA 3RUDA 1DEHA 3ZU3A 1NFQA 3DZHA 1DIAA 1IZ0A 2YHIB 5LDGA 3I9LA 3RFVA 3K2EA 1IZ9A 4OMUA 4ND5A 4L4XA 4Z0HO 5TT0A 1LSJA 3ZV4A 4QFCA 1O0SA 4H7PA 3JQAD 1I2CA 1G6KA 3E48A 3MJCA 3IL2A 3UAGA 2PGLA 4BO7A 1GUFA 1UJMA 1MXFA 2JAPA 1X0XA 3DBRB 4DA9A 3PQEA 2D5AA 3PIDA 4BVAA 4OO3A 1KEPA 4UEOA 4MO2A 1XU9A 5JC1A 5F1PA 4L73A 3U5TA 4R9SA 3NDRA 1RYDA 1DC5A 3EVTA 1R4NB 4HWKA 4ZQBA 1ZK4A 2NLOA 2OFPA 3OJFA 4J0FA 5F21A 4UVGA 3ZWWA 3QIVA 1HF3A 1R16A 3GG2A 4ILKA 4NHEA 3PYLA 5J23A 3SJUA 5DT9A 4A2CA 4BNGA 4D3SA 5ES3A 3V1YA 1GYQA 1YOVB 2CUKA 1GU7A 5C7OO 3KVOA 1KVSA 2I76A 1XQ6A 2PTGA 3IIEA 3UH1A 2FPPA 5AXAA 2B83A 3WSWA 5TT1A 3LLVA 2DTDA 1LDGA 2EHDA 3SXPA 3GNTA 5G4KB 3W4IA 2DPHA 3PEFA 4XIJA 2WEKA 1XR3A 1ZUD1 1U1IA 4Z9FA 1B3RA 2P4HX 3H5AA 5KKAA 1P3DA 2Q2WA 3WSVA 1JWAB 3WIDA 4DQXA 4RVGA 4DTIA 5EINA 1PEDA 1SB9A 2EW2A 3HDYA 1F06A 5DBFA 1N1EA 4MOWA 2ZJ0A 4O1MA 1U2DA 2DFDA 4C7JA 2O3QA 4JBGA 4NZ9A 1JVBA 2EEZA 3ZN2A 4A7PA 5DNAA 5L4NA 4S1VA 3SLKA 3SX2A 3RBZA 3ROKA 4BKOA 3ZWPA 5B4UA 2EP7A 1I10A 5IF3A 2O3UA 1LXCA 2ZQYA 4BKRA 1WXDA 3K30A 2ZQZA 1A4UA 2JHFA 3RKRA 1TLTA 3GEMA 2NM0A 4J0EA 1WAMA 1Z73A 2DFVA 3EVNA 3ZWCA 3NGLA 4O63O 4EITA 1HE5A 3NDJA 5C37A 1P45A 4DGSA 2GN9A 3OBBA 4JLWA 3AI2A 4UUMA 1DIHA 1I24A 4J7CA 3VAZA 5COQA 1FDUA 1EK5A 4OM8A 2BKAA 3GPIA 2BH9A 1D1SA 2Q45A 3G17A 2CDBA 3GMDA 4LRSB 3HN7A 5TLSA 4WLVA 2PA3A 2RCYA 1AHIA 5L7WA 3Q2KA 4PIVA 4A03A 3L9XA 4LK3A 1JTVA 4LMPA 1A27A 3JYLA 4UUNA 4R9RA 2CNBA 1FK8A 2VWGA 1AE1A 3IC5A 4CQMD 3NTRA 4AL4A 1LBEA 2W4QA 3FNFA 1PGOA 4J91A 4BO3A 3QQPA 3C1AA 3W6UA 1EQUA 1TT7A 4IDAA 1VC2A 3WGQA 4HADA 1XCBA 1L7EA 3TWOA 2PK3A 4CLEA 1B2LA 5DOZA 1GUYA 3D4PA 1BSVA 4XWYA 1WMBA 4KZPA 2NADA 3VH1A 4ND1A 5L40A 3U4DA 1AXEA 2W90A 2O4CA 4NJMB 2ZB3A 4G5HA 4NBVA 5A3JA 3D3WA 1YWGO 3DC2A 2E4AA 3WR5A 5ITWA 4HKTA 2FMUA 2C5AA 2X5JO 3DZFA 2RH8A 4CMGA 4BNKA 1LNQA 1N9GA 2I67A 4CMIB 5JNLA 3WLFA 1TA4A 3PGJA 1H2HA 2O3RA 4XIYA 2P9CA 3PWKA 1PX0A 1WP4A 3E18A 1Y8RB 2VT3A 4MVJP 4GMGA 1IUKA 4R5MA 3NV9A 3OECA 1NVGA 3AU9A 1I01A 3LF2A 2O7SA 2PD6A 2YFHA 2V6BA 3ICPA 5K0ZA 3NUGA 3TNLA 1I3LA 5B4TA 1P77A 4HUJA 4D0SA 3FN4A 1ULUA 1BXGB 2WYWA 4IPTA 5KWEA 1ISIA 3A9WA 2GN8A 3GN1A 1VJ0A 2HMWA 4ROSA 2A9FA 2W2KB 4DYVA 3TL2A 3PFFA 5JAQA 3PWSA 3M1AA 2IODA 2UUPA 4PLCA 4PRKA 1Q0HA 4AJJA 1HLPA 4CMEC 1AXGA 3DBHB 3GVHA 3OEYA 1E1LA 2GYYA 3PZBA 4YT4A 3WIEA 1P44A 1DLJA 1RM0A 1N8KA 2RAFA 3RJ9A 4WK6A 1YQDA 4MVJH 2DLDA 3FTPA 4HNGA 4BGIA 1HDCA 4E30A 4M1QA 4MIOA 4PLHA 5DBIA 1UZLA 1VKNA 3ITDA 4EJ0A 5JYDA 1ZXLA 3JQ7A 3CINA 3B1JA 5JBIA 4M89A 2IYPA 5I7VA 3FBGA 3INGA 4C7KA 2DM6A 5F1OA 1S7CA 1K89A 2PV7A 3JQCA 1Y81A 5FWNA 5EERA 1VL8A 3GVPA 4E32A 3EUWA 3LT0A 1EVJA 4DWVA 2O2YA 2PNFA 3LZ6A 4OIMA 1EE2A 4CMBA 5JE8A 4Z3KA 4DLBA 3AOEC 1UXIA 2GLXA 4ZU3A 1H5QA 4B8WA 1OC2A 2QYSA 2PH3A 3UF0A 4BO2A 2ZATA 3GRPA 4O0LA 3SEFA 3JQFA 2QYTA 1PZGA 4AJEA 3WX0A 4II2A 1ENYA 2EGGA 2DPGA 3OJOA 2FOIA 4IGFA 4WEOA 3C1OA 3ITKA 2DTXA 2BFAA 2OORA 1E3LA 1F8GA 1YXMA 1V8BA 3VPGA 3AUTA 1E7WA 4A26A 3BHMA 2YDYA 4E31A 1EQ2A 1JAXA 3ANLA 2FPGA 3W4JA 1ISGA 2WDZA 1EZ4A 3GAFA 2OBYA 4BGVA 4YEDA 1LLUA 3DBVO 4Y6SA 3CH6A 1EVYA 5CG2A 4IINA 1VPDA 4PZDA 4YAKA 3C7DB 4NBWA 1ENZA 2O4UX 4Q9NA 3OETA 3TOZA 3A14A 5THKA 1YB5A 2V7PA 3QRWA 3UXYA 4DBZA 3KTDA 4CLOA 3ON5A 2CVZA 3BTOA 2ZKLA 4RZIA 5CG1A 1BDMA 3PHIA 1HE4A 3OQBA 1VKOA 1U28A 3E5RA 1GYRA 1XELA 3KSDO 1X7GA 4J1SA 1NPYA 1GY8A 4MPDA 1NHGA 4ZD6A 2OUIA 4KTVE 1UAYA 2VUSA 3DAFA 1GPJA 5ER9A 4BNVA 4HFRA 2X0IA 1T2FA 3DB2A 3EAGA 1HDYA 2NACA 4RF3A 1P1KA 1IULA 3GHHA 4XYMA 1A9YA 4CUJA 1NQAO 2O7QA 4MVJI 4LN1A 5TQVA 5F3RA 3NT4A 1M67A 4FJ0A 4GLLA 4FOSA 2P68A 4G81A 4ID9A 2B0JA 3C85A 3JQ9A 4RDHA 2AQHA 4MKZA 4BNIA 2EF1A 3JV7A 1OFGA 2UV8A 4Q3DA 1V0JA 5A9SB 2NTVA 3FNEA 1R4MA 3V1UA 2WD7B 4NU5A 2XF8A 3JQ8B 3AM5A 3KHUA 3NAQA 3W6ZA 1Q7CA 5T8KA 1NTOA 1J4AA 1LA2A 4FJ1A 4E12A 3H3JA 4EZBA 1LRLA 1FMCA 3VOSA 3GHYA 2C54A 3FD8A 1NHWA 1E1KA 5KVVA 5BSFA 4DIBA 3MWDB 1DFIA 5I9LA 2ZYGA 4XX0A 1BRMA 1E6UA 3KETA 3EW7A 4IQGA 1E3IA 4TWRA 1YJQA 4QECA 5T57A 1A7KA 5U9CA 1B15A 2C20A 4J1QA 1LSSA 4N5LA 2P9EA 3JQAB 5CDUA 2NVUA 2Y1FA 1UP7A 3IKVA 4UAGA 3OA0A 4RGBA 4CV2A 1PSDA 5A02A 3NT2A 3DMTA 1EFKA 1B16A 4BQPA 5AYVA 2HQ1A 3RUCA 4JJIA 3RI3A 3H7AA 4RVUA 5HA5A 2POQX 2VT2A 4GKVA 4E33A 1LC3A 1T1SA 1IPEA 3KM0A 4UVEA 4F6CA 4XEHA 5B37A 2AQIA 1BG6A 4E5NA 1F17A 3RUIA 5JMPA 5FF9A 3RQSA 3K6JA 3X2EA 1R37A 3GG9A 1JQBA 2FY8A 2LDXA 4PLGA 3G79A 1YL5A 4JBHA 1R12A 3H8VA 4WNIA 2VRCD 3RSHA 5KKCA 4IJVA 4INAA 1D7OA 2X23A 2Z1MA 3AK4A 3O8QA 2GZ1A 1C0LA 4D3DA 3ZNOA 4I9UA 4YJHA 3CUKA 4GGOA 1DC4A 1C3VA 1GR0A 4WLUA 4PVDA 4IS3A 1GADO 4BIIA 4GMFA 3RC7A 4GSLA 3R6DA 2A92A 2HK7A 2PKQO 4OAQA 4I8XA 2X9NA 4PLFA 1ZEMA 3NX4A 3F4BA 3K8ZA 1QP8A 5LCXA 4YYZA 5TSDA 2J3HA 3CXRA 4DUPA 3QY9A 3B70A 4IQ8A 3AUUA 3PFWO 5TJ9A 2HMSA 4IBOA 3F1LA 4NIMA 2F1KA 3KBOA 4C4OA 3DZKA 1ONNA 2Y1OA 5JSFA 1U2GA 5TJHA 1Y5MA 5DF1A 1H6BA 4CPDA 3FCOA 5DOVA 4JBIA 2Q1TA 4B4VA 5KVSA 4FOOA 2X58A 2QRJA 5KCZA 1ZK0A 3VC7A 3KYDB 2AXQA 3KO8A 5H83A 5JYEA 1ZZEA 3EMKA 1FDSA 3NTOA 2V6MA 1P1JA 4J7UA 3WQRA 3OJLA 4KUEA 4YRDA 2WD8A 1ENOA 2VWQA 2Y1DA 4GL4A 1PJQA 1WPQA 4EJ6A 1HZZA 3IJPA 1PTJA 3PYXA 1PWZA 1GAEO 2G76A 4W9NC 5L51A 4EGFA 3RCBA 2VHZA 3ZNNA 1YDEA 2HKIA 4IGEA 4EUHA 5JMWA 5TIIA 1E6EA 3CKYA 1NWCA 4W99A 4MVJG 1BVRA 3FR7A 4BNXA 1PL7A 5BNFA 3T4XA 4CQMA 3ETDA 5AXBA 4CMCA 5ER6A 2BELA 3ADPA 2FR8A 4AJOA 4CUKA 4DPKA 1HL3A 3KYCB 1NBOA 1XLTA 4RLHA 2FWMX 2FN7A 2BLLA 4TROA 3OM9A 5EJ2A 5CDYA 4MINA 1F8FA 1ZNQO 2OO5A 3E82A 2AE2A 5JPIA 4CM1A 2IZ1A 2VCYA 2Y1CA 5FEUA 1UR5A 4WCFB 4ZN6A 1E3WB 3G1TA 1X7HA 2AA3A 3ZU5A 1ZJYA 5JAIA 3HG7A 2I3GA 2J3KA 4B3IA 2J8ZA 1MLDA 2X5KO 2JD1A 1I36A 1G0NA 4J9VA 4ZVVA 3OJEA 3BMOB 1KVTA 3QVSA 4PLVA 3D5QA 3BMQA 1B8PA 1O94A 5DBGA 2JCXA 3EDMA 3RJ5A 1I3NA 1JN0A 1IB6A 1DC3A 3AWDA 3BZUA 3L4SO 4B7CA 2B4TO 2HU2A 5L95A 1PZEA 1W8DA 3O38A 3OHSX 3F5SA 4YJDA 1JKIA 1E5QA 1V9LA 4TKLA 3RIHA 3W1VA 2WYUA 2EKQA 4X54A 4QEDA 1HEUA 5GZ3A 2WTBA 1QYWA 2O3SA 4RCVA 3K2BA 5A5FA 5ICSA 1HLDA 4B8ZA 3DFZA 3H9GA 1NM5A 1KVQA 1T2DA 1DOHA 1D4FA 1GCUA 3PRJA 3U9LA 3GAZA 5HS6A 2JCVA 4YCAA 4D7AA 3GEDA 1JA9A 5L7YA 2WE8A 2QX7A 1R66A 4A73A 1SCUA 2VOJA 5JDCA 1GYPA 3B6ZA 2C2YA 4TZKA 4DREA 4S3MA 5GY7A 3PHLA 3JD3A 4D44A 1HKUA 4TVOA 1A7AA 1QXSA 1R15A 3KUXA 5G2OA 1C1XA 4ONEA 3OJ0A 4YB8A 1AGNA 1U4OA 4KDFA 3BYZA 3K73O 2ZCUA 1U3WA 5JLAA 5COBA 4O5OA 2BRUA 3IUSA 3KEOA 3WGYA 4CM8A 1P33A 1B26A 1I3KA 3EY4A 3B20A 1M6HA 3PHJA 1ARZA 1OMOA 2AHRA 2JD2A 2W98A 2VNAA 3NYWA 4XR4A 1O89A 3V5NA 3I83A 3ADOA 4FC6A 4DVJA 4YJFA 1RM5A 4E6PA 1WZIA 3ZHXA 5G0UA 4DYDA 4W82A 3QVTA 1IY8A 3SBOA 1LU9A 3WBBA 2FHSA 4A0SA 1I2ZA 2PD4A 3UCEA 5BSHA 3DQPA 3PHHA 5JDCC 1C1DB 3JTMA 1ZH8A 2Q2VA 4YA6A 3ZWAA 1NVTA 2PGJA 3RROA 2EV9A 1PZHA 4NBUA 2GERA 5KIAA 4JP3A 1YBMA 2V65A 4WECA 1KVUA 2GN4A 1SB8A 3WYCA 5A4DA 3LF1A 4MIEA 2GGSA 4YQZA 4CQLB 3DDNA 3GDOA 3L0DA 2YHIA 1JVSA 4DMLA 4IJKA 5CDGA 2PD3A 1BW9A 1U8FO 3LK7A 2W2LD 3GN2A 4BQRA 1M75A 4YPOA 3MZ0A 1TVEA 2C59A 2EP5A 3DBRA 3L6OO 3LC7O 3RC2A 3WJAA 4BS9A 3JYOA 5IDQA 3W4KA 4N7RA 1TXGA 3JD1A 3I23A 3IJRA 1AUPA 3JCZA 4U8GA 4J1NA 4BNNA
chains in the Genus database with same CATH superfamily
2ZYUX 1MZPA 1R4NA 1WBBA 4V0RA 1KP3A 4UBLA 5G0TA 4C29A 1BDIA 2C4MA 5ICMA 4PZUA 1WCV1 3INRA 4U2CA 3RGWS 4RZXA 4R41A 3SSNA 1NRXA 3BCRA 2CHUA 4YK7A 3THWB 1ZQ1A 1RXSA 2CXTA 3G5LA 3IMEA 5LXTA 1FX0A 3HABA 2VXBA 3G6WA 3O5AA 1FDWA 2CYCA 2P6RA 4MRPA 2J0EA 4I8DA 1MR3F 2G71A 2XA9A 1T6YA 2CDCA 3VA7A 1I7LA 1N1MA 3ZBTA 4IOLA 3FRIA 2J9GA 1BJKA 2XE8A 1NYLA 3M4XA 2Q4BA 4QBIA 5EXEA 3IJ5A 4G8JA 5GIOE 4JBYA 5L53A 1GEEA 3ZKAA 2HCTA 5TMDA 1VHLA 3KWLA 1U7OA 3EZ6A 3UJAA 1B8NA 3NJ8A 1NATA 3GF4A 1F20A 1M2GA 2GKOA 1P2BA 4DQVA 3LP5A 1RI1A 4JASB 1JLLB 2J9YB 1GZUA 1CS0B 1VBKA 4J0DA 1T0PA 3U4HA 1Y7PA 3CRRA 2ZRKA 3UK7A 1PLKA 3H2IA 4XDZA 2VXCA 1CRWG 3P45A 1IYZA 4B0OA 1SUWA 1ATZA 2WKWA 2EG9A 3SE7A 1UXKA 3ORQA 4GLJA 3AERA 4FGUA 1Q84A 3EAFA 1QGDA 4HDSA 4KLNA 2BEWB 4LZZA 2IFTA 4R1LA 4XOIA 5JOQA 4DR7B 3K0AA 1CX9B 1SVMA 3LX8A 2HU8A 4XIIA 3T9BA 2IPOA 1OTXA 2P9TA 2C8KA 4K1LA 5CVJA 2BBWA 2BM8A 4CM9D 2HA3A 2ADFA 1KK2A 1WHSA 5C7LO 2UAGA 3GLVA 1XNGA 3WGZA 1FDTA 1POWA 1GGEA 2RAVA 2W0SA 2ZSDA 3CW8X 4P58A 4YP6A 4DM3A 4LDZA 5JBNA 3CLSC 2R6CA 4BKQA 3F98A 5BSVA 4OSOA 2OCGA 1CFZA 2CJPA 4FQ8A 3ZDXB 2F9MA 4GW3A 4A10A 2PZMA 5H4HA 4HAUA 4J94A 3ZHBA 2DKFA 4LSMA 1T4DA 4V38A 2PFSA 5HHTA 2C00A 1YA8A 2MINA 4I3HA 4PQEA 4UJ5A 1H3EA 4FEAA 2VN8A 3LBIA 4E21A 1S8AA 2JBAB 3DR3A 1T8YA 3GCDA 1NNSA 1R8YA 1RYBA 1U3FA 4M54A 4FKBA 1SVUA 1S1CA 4PYNA 3BD7A 1NU6A 2WU4A 3IOYA 5BVGA 3LKDA 5I8WA 4ZCQA 3ZK8A 4EUNA 5JAPA 4FNGA 4LVNA 5JAHA 1WXQA 4URFA 5IM5A 1GFSA 2TMDA 2W6PA 1CUHA 1L3IA 1XO1A 4QTZA 2WP8J 4YBZA 1SOAA 4HDKB 4DIDA 3A6DA 2F1OA 1E4YA 2I7TA 3Q9UA 1V4BA 4JKOA 3T7SA 2R25B 3ROXA 5BMVF 3CWQA 2YIJA 3SMVA 2DGDA 3JARB 3GLKA 3TPCA 4F5EA 4QU9A 5KJEA 2BEUB 3WISA 5BQOA 4MW4A 5D5QA 3WLMA 5ICCA 4LJLA 5CA1B 4CODB 1ZVQA 4ZO4A 1JEDA 3EMBA 4F72A 4JUAA 4M4SA 1M33A 4HQKA 2R8YA 2JJYA 1BGWA 4V2IA 3EHEA 4LBWA 2G06A 1BHSA 4RAQA 1NP3A 3IGFA 3T9EA 3COYA 3FVVA 1WB4A 3F8WA 4C43A 1NW4A 5FR1A 2NO9A 3OCWA 4DRXB 2FWAA 3CUTA 4CV3A 2GEKA 2FX3A 1YDWA 3OD5A 3GRUA 3PQ4A 1HT0A 2AOTB 5FBWB 1M2FA 4GIBA 4NJMA 3EZYA 1O97C 2IY8A 4NKRA 1EZZA 5JQGA 3JQDA 4ZOQI 3UBTA 2F1HA 3SIWA 4ZHQB 3KOWA 1B74A 3R24A 2YN2A 2AN1A 3I8OA 4FYMA 3C6MA 4KGZA 4CMIA 4Q4AA 5A3VA 3LPAA 3G5UA 7YASA 1QSGA 1Z4KA 3TB4A 2Q8NA 4HATA 2IZZA 1TTHA 1ZKMA 4ABYA 4FP9A 4G5RA 4IJWA 4P54A 3DEYX 2XUPA 4RE6A 4CQNA 2JVJA 3P4UA 4DR2B 1PJCA 1E58A 3HSKA 1L4MA 4CMJA 2G1JA 3K8QA 1R5BA 4QT0A 2IHTA 2I33A 2OGUA 3QVGB 4LZAA 4BKMA 4DLSA 1MTZA 2GJKA 3K20A 3DM5A 1BXGA 4PFJA 2HDHA 4TKMA 1XJ5A 4UE2A 4L5JA 2JLQA 3BIFA 5ITVA 2BMAA 4GZ6A 3MAJA 1A9RA 1DAIA 2PX5A 4U7HA 3UYKA 1E7YA 2AXNA 4P0QB 2X2EA 5HUHA 3PD1A 2OC4A 2OFOA 3MUEA 4HN2A 4QKQA 5BWCA 3RVKA 2WV7A 3HVHA 1RI4A 4MQ4A 1XPJA 2QRZA 4EYSA 3V8BA 4A0QA 1T6NA 3AVYA 5JD4A 1JFVA 2DJIA 2NSLA 2P2SA 4FKZA 4W5WA 2D59A 2EIHA 4U2KA 2NZVG 1Y63A 1NXSA 1G41A 1N2SA 5C80A 4R98A 7MHTA 2IUEA 1B0ZA 2ZBRA 4DDKA 3D4NA 3RO7A 5MGBA 1P3Y1 3DE1X 4UFNA 2FKAA 3ABQB 4A8JC 1XB2A 4JQCA 1LJ8A 2ID8A 3I39X 4R2XA 1I33A 4EUEA 3RADC 4Z9YA 3GELA 3U7HB 1NXWA 4RK7A 5I9BA 3V6LA 2NVWA 3GPBA 3HDQA 3ODPA 4RLSA 3WBFA 2GZ3A 1U8AA 3R0JA 4IIXA 4PVCA 4V0MA 1ZY2A 5UKDA 4XPZA 5AW5A 1DJQA 1T35A 4NXNB 4GPAA 3LIPA 3HJCA 2QAGB 4RYDA 3BB4A 4C0QC 1DQZA 2NZJA 4LJKA 3UGJA 1GNRA 4E4TA 3U44A 1J0EA 1NMXA 4LXXA 1JHPA 3NR2A 5DX8A 1MV5A 5HKAA 4F60A 5LDHA 5A03A 4P4UA 3V4OA 5LYYA 5L3ZA 4C30A 1U7HA 1U0LA 1W0KA 3TOSA 4MUIA 3QX7A 5EVCA 2HA4A 3R0VA 2HXGA 4BV2A 1OY1A 3A1UA 4O2BF 2B9EA 1I6MA 1UDAA 2JHAA 1RWKA 4XZ3A 3HWSA 5H9VA 4IUBS 1JZQA 5JDIA 1PD0A 2PTHA 4JQYA 1QZXA 4QE3A 4OI1A 2JAOA 2YOGA 4KQJA 4ZVPA 1ECFA 2O1XA 3AOGA 4EGQA 1L3BA 1ZK2A 4KOAA 5G4LA 1C1YA 3ONVA 4B80A 5YASA 1KRXA 3D8UA 3G8DA 4P35A 5KTSA 2VYND 2QORA 3JQGB 4MRMB 5AI5A 3L6RA 1F1JA 3DVAA 4RIIA 1P4JA 4L95C 1OW3B 8MHTA 5JCOA 3DVQX 1OREA 1GARA 2GZ2A 5FL3A 3OZUA 3LW8A 5EWMA 1AKNA 4F9FA 4RLFA 1GPWB 1KDRA 4ZDWA 1QH0A 2FHPA 3HKBA 3ANXA 1LV7A 3RFUA 2K6GA 2XWQA 4P2BA 1DG1G 1HQYE 3MT8A 3QLVC 3AVTA 4P0PB 3SX4A 2VS1A 4MKRA 1P7YA 2JZOA 3JQFC 2W8ZA 4Y6RA 3WNQA 2M6KA 2DY0A 3MMNA 3ZD6A 2FFBA 1V3VA 3GR6A 3PL1A 4RS3A 1MV8A 1RI3A 4M2LA 1E0KA 1SC6A 4EHJA 1DDGA 1W0CA 1L4GA 5AR1A 1GA6A 4PPGA 3P9IA 1VM6A 2YZMA 2DBZA 4LRUA 4XUGB 5KMGA 2ACWA 3LKZA 1V6CA 3O3OB 3EF0A 2B7BA 5FUBA 2HX1A 4HP8A 2PGNA 1KJWA 2ZJ8A 4Q21A 1KO5A 2ZFUA 4X6UA 3SM9A 1Y3AA 1HMYA 3PC8A 3LXRA 3AFMA 4B35A 1CZLA 1LLQA 2C9ZA 7ABPA 3TG8A 4TMZA 3R7BA 2X5NA 1M7BA 3I61A 4X7MA 3Q11A 1Z16A 3LBHA 4P22A 2AOWA 1NVMB 3KOZA 3AT1A 4CV1A 1U7WA 1NJ6A 4DCGA 1DGQA 3KTOA 3AUSA 4R01A 1YO6A 3PR1A 5BWMA 3S99A 1I32A 3R76A 1FMFA 3FPLA 2WSYB 2ILVA 3DL0A 1JQ5A 4EMBA 2R6R1 2DHDA 3JS5A 4G84A 1P1IA 5L3SB 1KERA 4A2WA 4M1ZA 1GQQA 1NULA 1O8CA 3RAJA 2EYQA 2GNAA 2QBYB 2QR3A 3Q0EA 4IJQA 3GJ6A 1JP7A 2ASVA 2CNOA 4BV8A 2NU7A 1YVPA 2Z4TA 1MHTA 1F2DA 3E7DA 4IH1A 2Q29A 5BSEA 1CFJA 3PC3A 1CP2A 2AMFA 2XMSA 3D6JA 1L5VA 2E7ZA 2ORYA 1JIIA 3ZHCA 4HF7A 2IYLD 5KWIA 2FDCA 1K86A 3M3HA 1WXFA 4CXMA 3ZI4A 4GKBA 5D3MB 3CRW1 5HKBA 3FOAA 2R2GA 4YROA 5DM0A 4Z3DA 1ZINA 2WVHA 3QY0A 1JF8A 1QV7A 3I0NA 2ZJOA 4Z4QA 2HLDD 1KQ3A 2AEMA 3A1CA 1R0KA 2IHZA 1UOEA 3RKUA 4DMMA 2GEFA 2D2XA 2JFHA 3LA8A 3P0JA 3RU9A 3Q10A 1KS2A 3ISVA 4D9EA 4WFIA 3OVMA 3GFSA 4HX5A 1RXVA 2I87A 4U2FA 2C29D 1BTOA 3NMUF 4KGVA 3BWBA 3HN6A 4GYYA 1GD1O 3WV4A 1J23A 1OZGA 2GARA 2Q4DA 3FVQA 3WRVA 4X7PA 3VR1A 2HJWA 1LNZA 4QEKA 4DXDA 1Z6TA 2NXJA 3LUGA 4RMHA 2WA1A 1DQSA 3ASVA 4EYOA 3BILA 1I0ZA 1S96A 3Q1KA 4OHVA 1PJBA 1BGXT 1D03A 3Q7RA 4WZAE 4JK3A 4IGAA 2JFFA 2JL1A 4Q3LA 3H0CA 1LPOA 2FX2A 3USCS 1UPUA 1I7SB 2GJSA 4XYEA 2LDBA 3EEBA 5BW5A 3VNVA 1IN4A 4QUHA 1LI7A 1ZDMA 1VMAA 1YAHA 2FZWA 3AHDA 3B7WA 5CU7A 2WFZA 2BHRA 4D25A 1Y1SA 1LDMA 2HSGA 2XVZA 4PE5B 1K08A 2V5VA 5KSWB 3VNUA 1YI1A 4TMFA 3AEKB 4XQ9A 2JKYA 3ZXXA 4BN5A 4FFDA 3CH4B 2RHMA 1GCIA 4BFLA 3AB7A 1U7ZA 3OEEA 1ML3A 2VBGA 1XP8A 2WSIA 4IDBA 4Z0TA 2IJGX 1NVXQ 3TINA 3UPDA 4BO1A 1D2HA 2DWPA 2QR5A 4H1TA 2B8JA 2WG1A 4O02B 2PXXA 1PWHA 2CMDA 4DFDA 5KS2A 2DKNA 3U17A 1M10A 2OSBA 1Z6QA 2W6QA 3CX3A 4PGGA 4B76A 4EHAA 3SLRA 1UMBB 4IF6A 5EMLA 4B40A 1CLUA 1SXQA 3DLBA 3ZJVA 4KI0A 4JLMA 3G2LA 3GJYA 1N77A 3IAS1 1NJGA 1BX0A 4BE9A 1M6YA 3Q8MA 3AF6A 2X22A 3RTGA 2N0SA 3I53A 5F35A 1IWOA 4JLAA 2OYSA 4UAUA 1QX4A 4WE3A 5EWJB 1G3QA 1AZLA 4XFJA 1CJTC 2QL7A 2XTNA 2Y77A 5KSPA 2WJWA 4I9NA 1L8XA 2D1FA 2DUJA 5FHRA 2J09A 1IOZA 3HGQA 1N78A 4E08A 4DC0A 1IWBB 2ZS8A 4XWWA 2D1RA 3V2HA 4WRRA 3L0YA 4JCCA 2NU8A 4ENRA 3WNBA 2YVAA 1CXZA 1UJ5A 3DZJA 3Q7TA 4CIBA 1RYYA 2NSDA 5F77A 1MO5A 2JGJA 1PZFA 5DDIP 5C1IA 3WLAA 1F38A 1YHZA 2PIAA 1WVMA 5AKZA 1EDDA 4CT4B 3A70A 7GPBA 4YIKA 3D2CA 1OKKA 4YQYA 3GZTB 1NQTA 1FMJA 4G41A 3T0IA 4RTJA 3DONA 2VP3A 1SQ0A 3HDHA 3CX7A 2FMKA 2NAPA 2AWOA 4LZNA 5T5QA 5B12A 1FVXA 3PNBA 1HNWB 4FYKA 1PEKE 3BTUA 4C07A 1RRGA 1N2CE 5HJEA 4GKKB 4QDJA 5FBRB 5KTKA 3U2QA 3GFOA 4OIFA 2I4IA 3HZHA 4R9VA 3ZE9A 2VHVA 2WJPA 3PNSA 4JS0A 4FE7A 1SBYA 5AKGA 4EDHA 5GJBA 1IJKA 1QV6A 3K15A 3NEJA 1KEUA 2E0IA 4UASA 5BRAA 1D8AA 1RLOA 3LK6A 3QVLA 2WWIA 1C7ZA 1PWXA 4F7DA 1SXIA 3H75A 3ZCXA 2RGRA 2V4MA 4FPXA 5M3BA 4MV7A 3GGJA 2XTAA 2PZEA 4L6AA 2RH4A 3EDRA 4Z2AA 1GNPA 3IPYA 1U2GC 3OPVA 2FJ0A 2I1LA 2Q2NA 1GG2A 3FPHA 1CEQA 1E4OA 3L0OA 4MVJM 4NFSA 4PZ9A 5DTIA 1E1NA 1LW6E 2A9KA 2X4DA 5SZJA 3TDNA 2GHIA 3GNSA 2G17A 3LU1A 3MJTA 3QOYA 3R5TA 1II8B 4FGKA 4RPLA 3K53A 1WNTA 4HDQB 3WWYA 1KQFA 4MUFA 1GZVA 2JGLA 1MQ9A 4UU7A 4V0NA 2I4MA 4DMUB 3PXCX 4A5OA 2QW0X 2DUMA 4UREA 3ZJ4A 2B82A 5JNRA 1JE1A 3D64A 2EYUA 2JJQA 1Z4LA 3I9KA 4J4BA 1XTUA 4DLTA 5IDWA 3QE2A 4WAUA 1O87A 4AO7A 1GL7A 5FLKA 4BTLA 2QVGA 1ZOLA 3BE5A 4KWEA 1HZZC 5CPFA 2X4GA 2FPIB 4DANA 5BXQC 1O4VA 2DYKA 1N8NA 3I45A 2JKVA 3K0CA 5AW6A 1TM5E 3GK3A 3P4XA 1Z7WA 2OBBA 3EN0A 5CUQA 4R8MA 5IJAA 3L7DA 4MS1B 4K6GA 1CQIB 1YRLA 3R3JA 2EERA 1O6GA 3HHPA 4HNTA 2VT7A 3HYNA 4KQ6A 5U4XA 3CXUA 1ESEA 3MWGA 3TQHA 3FTEA 4E2YA 1JW9B 1FXWF 1I9GA 7AT1A 1FNDA 3O82A 4LOLA 3R6GA 5E7QA 1CK4A 2QXUA 3PA6A 4L7VA 4EKGA 4JI0B 4MX8A 5BUSA 3TLXA 1YGPA 5HIIA 2RGGA 3MXOA 2BF7A 4TLAA 2H06A 4WXYB 5SICE 4AQDA 1UC8A 3ILXA 4MQBA 2QRKA 2XIJA 2PUEA 3BFPA 4XVQA 3WDSA 2BMJA 3OFSA 1PVDA 5HG0A 3FWPA 1BDJA 1U2RA 1XZLA 1DUIA 4P38A 3MNFA 4O1HA 1JLMA 1U5AA 4PGFA 5LKAA 2GD6A 3NHSA 4U6NA 5EQFA 1BD4A 4ZWNA 5EE9A 1GU0A 4LK2A 5IF9A 1GPKA 5KNDD 4BFTA 3SVZA 1YJBA 3AW9A 3OFND 5F64A 1AN9A 1H2RS 2FOLA 4I5DA 4QTXA 2IXTA 4U6SA 4YECA 5HFNA 5ALSA 3TZKA 2B37A 3GOQA 2QZ4A 4JX8A 4P6VF 3T3NA 4ZI7A 2VUIB 4A82A 3NJ4A 1FS4A 4WZBB 1OX4B 4ZEXA 4H35A 4F4JA 4TKUB 5AW7A 3MIIA 1WXIA 4CLHA 4YASA 1YONA 1EDOA 1NVBA 3QV1A 1YRHA 1F1BA 2PMFA 2DBVO 2HWYA 4YX9A 4I1OA 3UYLA 5JWOA 2HMUA 3URKA 5IN4A 4S1TA 4YUZA 2E82A 5EL0A 1L7PA 3E03A 4B45A 3VKHA 4CN8A 2PXCA 1JQEA 2YMLA 2XDQB 1Y1QA 1H6CA 2AEFA 2ZJBA 2ZYWX 2X8JA 4Q9AA 2ZRCA 1DFGA 2XMGA 3MUOA 3LLCA 5LIPA 4MVJD 3T7EA 1Z18A 5IAEA 1ELOA 3RK0A 2VDPB 3IKJA 3NIBA 4R6WA 4D3ZA 4B47A 1HC7A 4FK8A 1V2HE 4BQFA 3OIVA 3ZVMA 3PDIA 2XZDA 1Y7TA 4R2KA 2YWBA 3WHKA 3C0KA 1P5ZB 2VTEA 1NI4A 1Q1ZA 5FEMA 3QGMA 1RHJA 3FCEA 5ALWA 1J90A 1P2DA 3A4MA 4PZEA 4KQKA 5DH9A 3T54A 1WL8A 1A9OA 3DZGA 4YJ3A 3GRCA 5BQPA 1KI3A 3NHAA 1JEYB 2QQ0A 4LJ5A 3L4EA 2X19A 1E9FA 2RHRA 1QOZA 4HI0E 1W5BA 1Z62A 3K9WA 1IRXA 2RGEA 2IIPA 5DKFA 4ZV9A 3VDNB 1KR2A 2G07A 3JWPA 4LBZA 4HXYA 2PQMA 2QNRA 3RJMA 1DNPA 3GJ5A 4PZPA 4TLEA 3TRFA 3WWZA 2QXTA 3ZNPA 4BFWA 4KUHA 3MMXA 2PCLA 3OX2A 4MPRA 3FCAA 3KWJA 1KI9A 4ZOLB 1C81A 3A4NA 2C3YA 4ITUA 2DTEA 1XN1A 5IM4A 3VAYA 1LDYA 4RTLA 3N59A 5EHXA 3E9EA 1AUVA 2QLJA 4LKRA 3G9UA 4MGIR 4CQLA 3JSAA 1SOMA 4BXOA 2F4VB 1V45E 2R68A 4ENQA 2BRUC 3COPA 4R5HA 1UODA 3IQXA 4FX5A 1GLNA 4ZOAA 4MWOA 4AIIA 1TDJA 2I34A 2QJFA 2FDRA 3SS9X 4F2WA 3LCUA 3FSRA 3Q5DA 3QXCA 4PR0A 1CUCA 1SOVA 3ESZA 2HF8A 2F67A 4L02A 1AZSC 2C9OA 4DRYA 1VG1A 1Q15A 3AI1A 4NC9A 1MTOA 2HF2A 5TDHA 1AKEA 3QVOA 4X3CA 1V6SA 3ENQA 4KITB 1ZLXA 3KJNA 4TV8A 2VZ0A 4CTOA 1H2AS 1K63A 4ZT5A 3QIAA 5AVXA 1I7DA 3LX5A 1Y9EA 3EG9A 5K8TA 5IMBA 4Q4HB 4JQSA 2ZWAA 5FTKA 1J9EA 1FXSA 2Y0BA 3O4IA 4L8WB 3T06B 2CBZA 5JANA 1LF0A 1JNYA 2PMWB 2Z6VA 3EZLA 3FGZA 2Z8YM 3IMGA 4M8NE 3ZY3A 5CW1A 1PZMA 2YOHA 5AW2A 4OLFA 1WOYA 3I1FA 4G65A 5FOUA 1HKHA 2JVIA 1EH5A 1MIHA 4MUNA 4GSKA 1OH5A 3BS4A 1JR2A 1LDBA 2NYUA 2PO7A 4WI1A 5TEVA 2L2QA 2WT9A 4PQFA 1ZM4A 5DP2A 3WK8A 2WFAA 1BJTA 3K8YA 5HTOA 2KE5A 2QSYA 2Z98A 3OF2A 5EXXA 2BI8A 1XHLA 2NUAA 4EZIA 1PJ8A 2GXQA 3AEYA 3PGLA 1L5NA 3PIRA 2OP0A 5E4FA 1CUIA 1DXYA 2RHLA 4C6TA 5CA1F 4IS2A 5EXTA 4BB6A 5JXJA 5I7SA 2QL5A 3JAWB 4RA9B 1GITA 4GUAA 1NG1A 3L0SA 5AIBA 2RGYA 4EELA 1DWUA 3CV3A 5GGXA 2HNAA 2AB0A 2ZDGA 3QVVA 2YMPA 4R4JA 3V8PA 4WZAA 4BP3A 4WJLA 9MHTA 2QB5A 1VE5A 1Z74A 2X0NA 4TTRA 2H2HA 3GJ8A 4BFVA 1X9HA 1EFUA 2NV2B 3C6YA 3DJYA 4JN6B 3RASA 1G66A 4X0EA 3R5HA 2F8SA 2CV2A 2VTDA 3FTCA 3O95A 4NPHA 2OBMA 2HD4A 3G0BA 1XWWA 4P4LA 1XFDA 2BEVB 2RK6A 2P3LA 4TM7A 4V0SA 4XR9A 4D74A 2PS3A 4REQB 1TVMA 4XCXA 2QYOA 5IFKA 4J29A 2CMFA 2I54A 5ERGB 4ETNA 4WASA 3ZWMA 4ZHQF 1D2AA 1T2CA 5BN5B 1KGDA 1SEPA 1JG2A 1FW6A 4ESOA 4OB8A 4UTNA 1OYYA 3VZSA 5C46F 4BYMA 5ITZA 1ZH4A 5LNK1 1A3CA 1B6TA 1MD9A 1GPNA 1QH8B 3QBJA 5DHSA 4Z99A 5F5XA 1P2TA 3G9TA 4PO1A 3G0CA 3W6NA 4DN6A 1WV1A 2QVBA 2XD9A 5B7NA 2H4FA 2JGKA 1NF9A 2OAQ1 1N2JA 1DPGA 4PW0A 5BWBA 1ZVKA 4RGQA 4OX9B 3CUWA 5KNLA 1Y9DA 3RUEA 3WLIA 3NI2A 4EUHA 5C81A 1CU1A 1ISFA 4Y2PA 4M0FA 2AYYA 2YQ5A 2ZGVA 1G21E 3CIOA 3IDZA 4LMBA 4RPHA 1I6LA 4KQCA 5JMTA 1QBKC 4OQEA 5LSAA 2HEIA 2ZYVX 3BXEA 3LC1O 3HUFA 3W7AA 1R6DA 3J80A 1NAIA 3KELA 3RU7A 3WO0A 1RBYA 2CZCA 2G9VA 2QSUA 1NRIA 1Q3HA 3EGWA 5EG5A 1WKBA 5JPDA 4M9XA 8GPBA 1M0SA 2IUSA 2OGZA 3VH3A 3ZZTA 5BR4A 3NVMB 1G63A 3X2FA 1VDZA 3MWEB 4KQGA 3IT1A 2R6FA 3OA2A 4ZAGA 3WMXA 4D80A 4MJ7A 4J49A 3WQQA 3NONA 2GZDA 4EW1A 1S5PA 1H6DA 2VQSA 1CERA 1Q0SA 2AW3A 3FNRA 3GA7A 1UJBA 3WQSB 3HL4A 4Z1MD 2B1RA 3PNVA 4FNMA 3MCWA 4MR9B 3OKFA 3SAJA 1GRNA 5IG2A 1HDOA 2E49A 3DZCA 3OT5A 3AJ9A 3ZZNA 1E9VA 2N46A 1EFPB 2JGDA 3HB4X 3NU1A 4QLBA 1ODCA 1ZLYA 4KQIA 3KR9A 4YAWA 2V7GA 3TX2A 3VZQA 4QU0A 3AR5A 1GPH1 2V6JA 1IQ0A 2DH6A 2A14A 2PZAA 2ZZKA 2DAPA 2ZREA 3Q3VA 5K0BA 5KKNB 4GICA 1JSCA 2CFOA 2CYBA 2O05A 5JSKA 3ELUA 3MUFA 4QJBA 1IB0A 2Q49A 4FZJA 4YRMA 3VTKA 3HM9A 4RM3A 2P75A 1SJ9A 2CMGA 2IZ0A 2H1SA 1BO6A 3GBSA 3M89A 5C35A 1PR9A 3PC7A 4MWZA 4MRNA 2CLOB 1WXHA 1SUFA 1G8HA 4Y1FA 5DN6A 3WG9A 2BFEA 4DJEC 4EPXA 2C7OA 3LBFA 4HWGA 1RQXA 5GONA 4NV1A 2Q3DA 4FFNA 1QS0B 4OH1A 3DHYA 3EIQA 3WYEA 5IJ0A 3G13A 2Y0CA 3KHSA 2YWHA 3IUJA 3PDJA 2DT8A 5FNVB 3WBJA 2WMDA 1WD7A 4P3YA 4BVKA 3PRHA 1CUVA 4P53A 3ILYA 1P9LA 1VG8A 2FN8A 1U5CA 3P8ZA 1JQJC 1YRYE 2XMQA 3MT9A 4OQXA 3S28A 4BO6A 4C2UA 3NAGA 3VDRA 4ZVMA 5DWQA 3A0RB 1DG9A 2WPDD 1U7XA 3R0XA 4PXYA 2ZRHA 3GJXC 3NTLA 4L85A 4QO7A 4XGQA 5H02A 3DOEA 5EHGA 3TZ6A 5KQSA 3R5JA 1G1AA 1GZ5A 4CM3A 1QRRA 5I9IA 1HX7A 3LKBA 3FUUA 4ISBA 1I5RA 4P84A 3D2AA 4GLOA 3VO8A 3Q9NA 4DILA 1P2UA 1RLIA 3ZHZA 2GJ8A 1YB2A 2CLSA 1IAVA 1IBCA 2NSYA 3CLUC 3MCVA 3QKTA 5CHEA 5T6BA 4EUSA 4PG8A 3L0CA 1O6FA 2Y05A 1KR5A 5FL7D 3QKWA 5EKUA 2ZT8A 4YAEA 4JI6B 3N5KA 5BUZA 1UDCA 3DF7A 4QFMA 4IJUA 4S04A 3AOEA 4DLAA 3PNQA 4X71A 5ALLA 4YJKA 1UJCA 3WLOA 2QX9A 1L4HA 5AI0A 5FPHA 5B57C 1GPDG 1LSUA 1P8AA 1R27A 2GZRA 1PGNA 4MRVA 5AOVA 3SG0A 1GAQA 2V7QA 1O57A 5HZKA 2WUDA 4H1UA 3TVDA 1I8TA 2B8EA 5CIYA 1HDRA 4MVJF 2O2EA 2BFCB 5C8YA 1QGED 2RKOA 1T9DA 4Q7EA 3KP1A 4NBTA 1V47A 3T1TA 1K8ZB 3QEKA 4YT5A 4RHFA 2H59A 1QIKA 2QM8A 1QRDA 2Q2QA 3QSGA 4OHYA 5HGJA 5BPHA 4RIFA 3WNVA 3ENZA 4OKNA 3JQ7B 2GT1A 1L5QA 1WQ1R 4CKEA 2B94A 1E2EA 1O3YA 3FSEA 4XASA 1IEXA 4JODA 2ZCJA 3R7FA 2LWIA 1RNLA 2K5UA 1E2LA 2RIRA 3EGDA 4FEGA 4G4SP 4PX5A 3QKIA 4V2UA 5ELLA 2VNJA 1NN3A 1TD9A 1DRUA 2PO5A 2ONJA 2OXIA 1OD6A 1PJLA 5TF4A 3WMWA 1ZSNA 1FFSA 1XP5A 2PXAA 3HVJA 3AW8A 1XZHA 4IXWA 4LVOA 2C58A 1L9KA 3AU8A 2IS6A 1A72A 5BYKA 1Z56C 2H3HA 2JCSA 5K6RA 4QG3A 4IMPA 4JGBA 4MCIA 3UMJA 2DLCX 2CJWA 1NR5A 4P86A 4BJHB 4ZICA 2MT9A 2PT9A 4QXQA 1RR6A 4HAWA 3F4LA 5KYWA 2I1WA 3ZWYA 2JLVA 4DV2B 4QYTA 3G2OA 1X1BA 1GNQA 1IEQA 3L6CA 1L5GB 4KX3A 5JD3A 5ARDA 3EMVA 1P1HA 1AUOA 3CC8A 3ZBUA 3DDWA 4G4SO 4GAEA 4KTTE 2P6MA 4WIAA 3V1LA 2OBXA 2HNBA 4MH0R 4Q9IA 2HM7A 3RUAA 4RESA 5K8LA 1ZSVA 3NBFA 1CUXA 3KWMA 5EZYA 4DJ5X 1MJGM 3O1LA 4U0KA 4BKPA 3DKVA 1AK2A 1RYNA 2FW8A 4DPLA 1JH9A 1ID1A 4WSOA 4BAZA 1JV2B 2M1XA 3C3AA 2PHZA 1RRCA 4UUPA 3LYUA 1H0RA 3SYLA 2WYVA 3REFA 3VC3A 2NXCA 3W8DA 4GX0A 4EUFA 1OV4A 4YMWA 5JDIC 1HNZB 4CLOB 2AT1A 5L9AA 2JDIA 1V8DA 3S2EA 1VL5A 2F4NA 2ZWOA 1N5DA 3P20A 3F7OA 5K3SA 1EVIA 3OLWA 2YTZA 1Y1RA 2O8NA 1E3SA 4P3KA 1A4IA 1XSEA 4BGEA 1UJ4A 1G2QA 5HMLA 3HGTA 1FNBA 2GCNA 3I37X 3DMDA 4IDDA 1ZAKA 5MDHA 5EOVA 2XUGA 2OXTA 3HCWA 2DJ5A 2FUG6 1E5TA 4MV3A 1GGJA 2J3JA 2X3UA 3GD5A 3JQBA 4JP5A 1T3GA 3R3ZA 3ZH2A 5JCOC 1TQ8A 3OOEA 13PKA 1QX3A 5KREA 3B1YA 4H7JA 2XAAA 2XB9A 4BZPA 5C3MA 1QQBA 3GLHE 4NNPA 4RS4A 1N6NA 5KQLA 1PNTA 3MOGA 3KD3A 1FCJA 2HMYB 2B2NA 4I1PA 2Y93A 4GXRA 2ZR9A 3Q12A 3SQLA 1K3UB 1LWNA 2ETVA 3BH7A 3OPQA 4LYJA 4PNPA 3RSFA 1R00A 2P6NA 2PVCA 2PH7A 2ZWIA 4I08A 3AM1A 5BN3B 1B2RA 4N49A 1KYQA 2HCJB 1OWMA 4URZR 5D2CA 1DB3A 1BDHA 2ZETA 1UKAA 4IF4A 1M1YB 4P36A 3EGVA 3A6FA 2IYNA 1UBLS 1UEXC 2X9VA 1UXJA 2GF0A 1K5DA 2AFVA 3KHTA 1G4AE 2AEEA 1TKCA 4D45A 1QK5A 1F6BA 1YS7A 3DE4X 3SM3A 5A3QA 4MLPA 4Z2YA 5FPYA 3PC8C 4QYWA 5JG7A 4UFOA 1XZGA 2XZLA 1ONSA 1GZ3A 1J8FA 1ORIA 2XQIA 1A9XB 3QWFA 1MA3A 4HG2A 3TW8A 4KZKA 2D4AA 1CULC 1XWFA 2XDWA 3QKUA 4LXQA 3UT5A 1SBZA 3LC2O 2WI8A 4V3CA 4K9PA 3UMSA 4QYIB 4D6YA 4KR0A 1QPZA 1QHNA 1JWBB 2J67A 2MSDB 2OP1A 1FLVA 3WGTA 3A6HA 3LBYA 1U3UA 2NX2A 2NQTA 4YCDA 3AKYA 2UXCB 1YS9A 4HGQA 1A9ZA 1G7RA 3CPHA 3A9UA 1QVAA 2WAAA 3LNTA 4TVBA 4KNVA 5LJIA 1IVSA 3PUZA 3MJSA 5FBHA 2WWGA 3L79A 2O8CB 3T15A 4R7GA 1RMTA 3E9DA 1QG6A 1QU3A 1Y34E 1MFZA 4W5HA 5JWHA 1ZRMA 3VUEA 1WCXA 2JFGA 1GO2A 4CCYA 1U63A 2IYXA 1HI9A 1ZFNA 2Q4TA 3OCZA 4QOGA 5D01A 4HB2A 4IDQA 3GZNA 4D6XA 4RKQA 4B8YA 4XQEA 3NFRA 2PRZA 3CO5A 5BQ3A 2OT3B 4KGDA 2AN9A 2PUGA 3K31A 2BCEA 2W11A 4LXUA 5GZ6A 2HV9A 1FSPA 4J2OA 1SHKA 3KPJA 3O0DA 3TOXA 1TMOA 5INTA 3COSA 3NVDA 4WADA 3QPDA 3RK4A 3K5HA 1FJHA 1XVAA 2IZOA 1I9CA 2PAFA 1B0AA 4JEUA 2UKDA 3UB4A 1OLXB 2IEZA 3UT0A 4CF7A 4E5SA 3INNA 3R9IA 1B8UA 3TSYA 2E4ZA 5IXJA 2RK3A 3MVEA 1J0DA 2O5VA 1FA9A 3QFFA 4JXKA 5JI3E 3ZHUA 3Q9SA 2P1ZA 1YVDA 2HYDA 1SXJD 3QUSA 4GPD1 4L2IA 4NG5A 4RU1A 4BPRA 2X4LA 4PBSA 3NBXX 3O21A 3O8QB 2Q4RA 5FWXA 1SVOA 4JBWA 1I51A 2P5YA 3DAPA 4EJSB 3N58A 4N8EA 4UZSA 1WUTA 5E1MA 3KFLA 1G21B 4M7PA 5K5EA 4TWAA 1VL1A 1SKQA 2NPOA 4QQNA 1UBOS 1IJEA 3QNUA 5AJUA 2ODAA 5JAMA 4CM9A 4NONA 1ID8A 4M1OA 1UH5A 3V80A 3N0WA 2JAWA 1JBKA 1P9WA 1A9PA 3OZ7A 1JI0A 1G8KA 2ZTLA 1T1IA 1MX3A 4OOEA 4AYWA 5AOBA 2JS7A 4JJKA 2P40A 2VZ8A 2ZTSA 1CY7A 1T4BA 4CCAA 1QIFA 1DBVO 3PGXA 1AKRA 4XGNA 4TLLB 4HAOA 5IMSA 1MGPA 1OXXK 4B44A 3VSCA 2AN5A 2YX1A 2VDWB 1TK3A 5A4JA 2ZJ6A 2GFQA 4R1PA 1VCOA 4FJ2A 2IDKA 3IXLA 2C2XA 4BZQA 1FFBA 1BXKA 2BJVA 1TCVA 3L8FA 5B7QA 5JAOA 3EDQA 2PR2A 2FXIA 2UVQA 4ZAYA 3RUFA 2AV6A 4G5OA 4CIXA 1K75A 5EN4A 1PJSA 4XUCA 2E2WA 3T1HB 3WB9A 5GJVC 2BAGA 4ZQEA 2GPTA 3R8XA 5ANRB 4F3TA 3KKEA 4QBHA 4BO0A 4D46A 1J9ZA 3GFVA 4BHTA 1SIWA 2I65A 3O26A 2PT5A 1YDGA 4OF4A 2B92A 3Q8WA 3NIGB 4EF6A 3BBLA 1OH8A 1JXAA 1J8DA 2VUHB 3AI7A 2OHIA 1FUIA 1G9XA 1WXXA 3HPRA 2DVMA 3ICCA 5A2GA 2BYTA 4PYJA 5JSHA 1J07A 2V7BA 4A6XA 4PCLA 3KLNA 4J4TA 4JCOA 2A9VA 2FR1A 3CUVA 4L0MA 3GPDG 3GEHA 3R74A 3TK1A 5LWQA 2DPYA 4N40A 4MUGA 5H82A 1KA9H 1N0HA 3CB4A 3PYMA 4JKIA 2A88A 2F00A 3QA9A 4RNCA 5LPNA 3D3JA 1AQLA 2M32A 3GLUA 1TKBA 4AT1A 5JS6A 2OZVA 1HSOA 2BFFB 3M9LA 3RRFA 4M8IA 3WLQA 1M8GA 1F5NA 1UWKA 4XTRA 3ZHRA 1AQUA 1KMMA 3I6ZA 2YINC 2FJUA 2UDPA 3MPUA 5FPSA 4J3FA 5T41A 2I7CA 2WM3A 3TTUA 1M5TA 4JLOA 4MNTA 3V8RA 6REQA 4CLRA 2YWDA 3T1QA 1T5DX 4TV9F 3ZHVA 4G0XA 3GA5A 5DW3A 2G1KA 5DHUA 6ABPA 3OPXA 3PUJA 1A8SA 3L06A 4RIHA 2P78A 1TIBA 3KOYA 2Y66A 3RH0A 5J5AA 3TLEA 4DJTA 5JSYA 1QGUB 3K0FA 3UZUA 4FSDA 2XXAB 1HRKA 4R68A 3Q3EA 5AVYA 2J6IA 2XVMA 1Y8AA 3NAMA 3ZY6A 4Y30A 4FBLA 3MSCA 1U9YA 4NX2A 4P34A 4Y18A 2Y2VA 4W1PA 4J9UE 3TZEA 4PQYA 4MV5A 1T1JA 3QFSA 3OIDA 1H2WA 5LYJA 4R0MA 3OOWA 2NIPA 5LZ7A 4D8VA 4LTNA 5IJWA 2IYAA 4ZOLF 3HDTA 3X1XA 3F9IA 4DM7A 1KAEA 2H65A 2XTMA 2A3RA 4IM7A 3SHTA 5JCXA 3L7YA 2I4NA 3JYQA 1TM4E 2P5TB 1R0SA 1B0UA 3R0ZA 3H8JA 3MF4A 4Q7JB 3QBEA 4X1KB 2VSNA 4M88A 4YC7A 2WG0A 3B1KA 3LZDA 2AGVA 4QHSA 2OXFA 1Q2XA 2I1QA 2ZCVA 2XVAA 3BSWA 3CE9A 4GR9A 4DVGA 3FAZA 3GQBA 1SXPA 4JUDX 4ALJA 1TYDE 3A1SA 3TLCA 5KJ1A 4WDQA 1HOXA 1MA0A 1P4RA 4M53A 3QF7A 4DLPA 4EEZA 1JDJA 5F9FA 3K0CC 5EIXA 2Z5VA 4MYTA 5HM6A 4RVHA 3RFXA 3S1SA 4J0QA 1OLSA 1TYCA 4KREA 4II3A 5LOVA 1P4HA 1DCFA 4FE4A 1J6UA 3ROQA 3S44A 1KK1A 1NN5A 2AXEA 1R6TA 3BK7A 4B34A 4OLHA 5JWRA 1JVNA 1ZK1A 1I94B 3HDJA 3W5AA 5EE5B 3EULA 4DMGA 3T7DA 4QNMA 3MYYA 1OGIA 2GF2A 2JW5A 4C7OB 1HL7A 4KAAA 4MS3B 1AX9A 3T5DA 1GRCA 4CDRA 1GPMA 2WJIA 1TU3A 2EXXA 3AQ4A 3I0ZA 3EIXA 3IT2A 1G38A 3E15A 1V7PC 1ZM7A 2BMVA 2IU0A 1MB4A 2OHOA 5D85A 2UZ0A 2X3YA 4DQ0A 3UVEA 4S2UA 1SURA 1E7RA 2B25A 4HDRB 1PDVA 4F4FA 3KUUA 1DRVA 2CC2A 3EXFB 2IL1A 4LWOA 4XLTA 1JFRA 4R69A 3TN7A 3H5RA 1VA4A 2JEOA 4RFSB 4ARZB 4D4GA 4FGWA 3N74A 2KJQA 4F5ZA 4G0VA 4NL4H 5GV7A 4UNQA 4Q02A 1I4OA 3LSYA 4IZ6A 1TJ4A 2DULA 3S4YA 4DLLA 3KAQA 1FXWA 1CZNA 3ZBPA 2BGNA 5F76A 3WDLA 3RYHB 1WEHA 3H9JA 4L4ZA 4DIKA 2R0QC 3WO1A 1KYZA 4MROA 1BS2A 1P0PA 3S2IA 1KYIA 1TLFA 3EXG2 1A71A 1XMVA 3MMPA 1ML4A 4W8GA 2JFQA 3R4VA 3QVWA 4DNPA 2VQEB 4Y9TA<