2HMVA

Diamond-shaped octameric ring structure of an rck domain with adp bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
139
Chain Sequence
b'NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YuaA protein
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 45
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmvA00
4WLVA 1B16A 4J4BA 3HDHA 4AJLA 3FBTA 4HX5A 2GN4A 2PY6A 4KUGA 4M86A 4Z0PA 4DA9A 3TFOA 7MDHA 4EITA 4QFCA 1HRDA 3RC7A 3KZVA 4Y98A 1RYDA 2WWRA 3WLEA 1E7MA 1DHRA 4CMEA 1T4BA 3TZ6A 1LDNA 5A9SB 2WD7A 4M89A 4A7PA 1B8PA 4OKNA 3KXDA 2IZ0A 5G0VA 4IS2A 1XWFA 4CMKA 4IZHA 2I76A 4R5HA 5U9CA 4JCOA 1Q7CA 1YJQA 3UCEA 3WGIA 2ZCVA 1ULUA 1E3SA 3OJOA 1KEPA 1T2DA 1YL5A 3INGA 1YBMA 1IHYA 3OJ0A 2VRCA 4KMSA 4CPDA 1PX0A 3G3EA 5DCUA 4HFMA 1LC3A 3TZCA 3U4HA 2J3HA 3V1YA 5BR7A 3DBLA 3TZKA 3C7AA 4BKUA 2DQ4A 4U7WA 3EMKA 2Y0CA 2Q1UA 3R6DA 4N5LA 4OL9A 4CMEC 1M76A 1JLLA 3PJGA 2GZ3A 3GDGA 1B15A 1C14A 1ZXBA 4LCJA 4RZIA 4DYVA 2PGJA 2Y93A 3KEOA 4EEXA 4UUPA 1SB8A 4XB1A 5ICSA 3V2UA 1GYQA 2IXBA 4DUPA 1GQQA 2UVDA 4E2WA 1N9GB 3VZQA 3F3SA 4GVLA 4BNFA 5K6AC 4IBOA 1NAHA 3ZHYA 1PZGA 1ZKMA 1P1KA 3PHHA 1X14A 1ZMOA 4HV4A 1EQ2A 4ALNA 1O9BA 3ASUA 4LSWA 4DIBA 1H93A 4DLBA 3E9MA 1EDZA 5HBRA 1XCBA 4NBWA 1FDWA 3WJAA 4B8ZA 5BSGA 3LYLA 5CDYA 2X9VA 2I3AA 5DULA 3VC7A 3ZN2A 5JS6A 4I5FA 3GAZA 4W82A 4CM1A 1I3LA 1PU2A 3KYBA 3I3OA 4GH5A 1NFFA 1PR9A 3VPFA 2OP0A 1R4NB 1NNUA 3I1JA 3RC9A 3WICA 3F1LA 2ZYGA 3NEPX 4FD3A 1QYVA 1J0XO 4EUFA 5JFOA 1LSSA 3FRJA 4J0FA 4HFJA 2VZ0A 1E6WA 1YRLA 1A4IA 3PJDA 3AY7A 2IYOA 5FYDA 4XQ9A 3U62A 4X54A 5JO0A 1HTBA 5IDYA 2W98A 3DHEA 2OMEA 1TT7A 3PP8A 4R5MA 3QVXA 3P2YA 2AG8A 5JCJD 2D5CA 5CHEA 3V2GA 3ZZNA 1HYGA 3PTZA 4XWYA 1OC2A 3C85A 4FOOA 4YEDA 1BTOA 4XQGA 1NWCA 5B1YA 2RHCA 3I5MA 1BXKA 4OOFA 4YR9A 4HNHA 1W4ZA 2O50A 4AJOA 4FB5A 4IMRA 1PJBA 4BNZA 1U1IA 2CZCA 5CEFA 3OICA 3IDSA 3RC2A 2P9CA 4B7CA 5L53A 4UUOA 2I6TA 1HZJA 1K5HA 2NU9A 4BNLA 5KKCA 2BI8A 4JP3A 4DQUA 1E3LA 3AM4A 3Q2KA 5F3RA 3O8QA 4RPGA 4J49A 3X2FA 4QSMA 1JKIA 2YZ7A 5THKA 5L95A 1DLIA 4OOEA 3GEDA 2HKIA 4A5OA 1HL3A 3WTBA 1GCUA 4WECA 3PYXA 4J1NA 1T1SA 2DPGA 4FOSA 1BRMA 3B6ZA 4LVUA 1WNTA 1YDWA 2J5KA 5KJ1A 3F47A 2H6EA 4GKBA 5JAIA 4F46A 1GCOA 3A14A 3GVXA 2BH9A 3WFIA 3ROKA 3ZHXA 2C29D 1H6CA 2X5JO 4A27A 3CTMA 3ITDA 3DMTC 1XDWA 3GGOA 4TKLA 3SX2A 2HAEA 3HN2A 4IIUA 4MVJG 5CPBA 3U49A 5I8WA 2OGUA 2UUOA 2PZKA 1DO8A 1M75A 4ROSA 4RVUA 4BNGA 3MJTA 1UDBA 4F6LA 4DBZA 1YKFA 4HKTA 2D8AA 3GUCA 1Y8QB 3T4XA 3DBHA 1KC1A 1NQOA 4LGVA 4J43A 1BXGA 4W9NA 1MP0A 2PKQP 4CLOB 1Q1NA 1LX6A 3HB5X 4YJHA 4GX0A 2JL1A 5A4DA 3KYCB 5EERA 3F5SA 2BD0A 3RBXA 1W0CA 1ENPA 3WGTA 1K6JA 1U2GA 2BFMA 3SBOA 4BNNA 2YW9A 3TL2A 1HE5A 3DHNA 4MVJM 5LDHA 3WMXA 4CLDA 4CLEA 2FMUA 3V8BA 4IQ0A 2AQKA 1E6UA 1Q0QA 4C7JA 3RUIA 4NDNE 2HK9A 1O95A 1WVGA 3AU9A 1Y8RA 1HDOA 3NT4A 4XX0A 4Y67A 4ZU3A 3GF4A 3TQHA 1QKIA 4W9NC 3U4IA 4BO5A 4Z3DA 5IZCC 3GMDA 3CMCO 4Q3EA 2R6JA 1BVRA 3P19A 1H6AA 2NTJA 2LDBA 1EVJA 1HDXA 3HWRA 2Q1WA 3LLVA 4PLYA 4LVCA 1GFSA 2EKQA 4UAGA 2AA3A 2Q45A 1Y7TA 3FF4A 4J91A 3HZZA 1XKQA 3ON5A 3GG9A 4WLNA 3ROQA 1NHGA 2DUWA 3COSA 3WGOA 1JTVA 2SCUA 1I3NA 4FW8A 3RVDA 1AGNA 4ND2A 4WJZA 4BO1A 4D3SA 4XIYA 2CFCA 3SJ7A 5A9SA 3VH4A 3PDUA 1VKNA 4KTVE 4A26A 3RFTA 1MXFA 1DSSG 2GPTA 3HB4X 4XR9A 1UZNA 2Q46A 5G4KA 2C2XA 4GGPA 3TNLA 2C2YA 5FI3A 3HDYA 3ADOA 3P5SA 3GR6A 4DGSA 4J1SA 4PRKA 2UUPA 3ETGA 4WCFC 3UCFA 2NNLD 1DRUA 4U5QA 1ZMTA 4L9RA 5G0UA 1EFKA 1DDOA 2EWMA 3QHAA 5LC1A 1RKXA 2WMDA 2C5EA 1ENYA 3VPGA 3JQ9C 4QQRA 1WLYA 3KHUA 1NTOA 3I9JA 2YJZA 2CNBA 1EVZA 2Z1MA 3ST7A 3ZNNA 1JW9B 5H81A 4ALIA 4EJ0A 1FDUA 3OF2A 1DHTA 5F1OA 2EP5A 2IRWA 3IAHA 3RBVA 5T57A 1SBYA 4JLWA 3ENNA 4FDAA 1N9GA 1R4MB 3VKVA 3WIDA 1NBOA 4JP2A 5IFLA 4D79A 2QG4A 3K96A 4DLLA 4DXHA 1P1JA 1QSGA 4R1SA 4NNJA 4R9SA 1ZEMA 3WDSA 3ZHBA 1ZH8A 5IDQA 1PQUA 4YJGB 4BKOA 3PI7A 4BO3A 4BQRA 1BDBA 2FWMX 2G5CA 4RPJA 1LDMA 2J3JA 4JX8A 1LUAA 3LC2O 1OMOA 4PLCA 1QV6A 2W2LA 4BNWA 1PGNA 1LLDA 2VYNA 4QXMA 1R4NA 1VJ1A 1GUFA 3NX4A 4AJNA 2E48A 5L45A 4U0KA 3K31A 3ZWMA 3PHLA 5U1PA 4OYRA 2NVBA 4G65A 2O48X 3RFVA 2FHSA 1UDAA 3G49A 4BMSA 4PLFA 1EUZA 3JQCA 2A9FA 1YVEI 5ENVA 4DLAA 3K5PA 5KVVA 3X2EA 2CVQA 4KTTE 3HUDA 3K2EA 5FI5A 4YAEA 1R0KA 2X23A 2C7VA 4O5OA 4IM7A 1QYXA 1LSJA 1K3TA 1CEQA 3JSAA 3L9WA 4FFPA 3TN7A 2FRDA 4D7AA 4JBHA 3FI9A 2BKAA 1YH3A 5EN4A 3CEAA 5JDCC 2J3IA 4WPGA 1UDCA 2VHZA 1HE3A 4NBVA 4E21A 2CF6A 3RCBA 3T7EA 1P0CA 5EJ2A 2AQIA 4WEOA 1NR7A 4BGVA 1F8FA 1R16A 1XR3A 2VOEA 4EI2A 3R3SA 4ZQBA 1UJMA 2Q1SA 2PZMA 3H4VA 5IJZA 3NDRA 2JD2A 2HDHA 3D3WB 1AXGA 2Z95A 1ADCA 3Q2IA 1GV0A 2ZK7A 2H1SA 4MP3A 3QVWA 4BB5A 5L7WA 5ILOA 3HDQA 4P8RA 1A7AA 3TOXA 5JY1A 3MTGA 3VPSA 2V6MA 3GN2A 4Y9DA 4MP6A 4E2YA 1TEHA 1UP4A 2D59A 2D3TA 1H0KA 4PIVA 3VZRA 3WR5A 1ZK2A 1ZW1A 3GNTA 3AOGA 3R1IA 1XGKA 1XQ1A 4PFJA 4R16A 1OZAA 4PLHA 1I30A 2BF7A 3QQPA 1BGVA 4WLFA 4DIFA 4E13A 2ILTA 2VTEA 2QZ9A 5DT9A 3OA0A 3H9UA 3GA0A 1LEHA 1EEHA 1ONOA 4BL5A 1WDKA 3K8ZA 4HY3A 2X4GA 4GLLA 3MOIA 4XGKA 4TWRA 1WZEA 1DC5A 2X58A 4J4HA 3SEFA 2PD6A 2NVWA 4JJFA 2ZATA 3H5NA 4XJTA 1Y8QA 1LNQA 4F6CA 4JNKA 5JBIA 4AJJA 1PGPA 2LDXA 2P91A 3DO5A 5KWEA 2WYUA 1HEUA 1N1GA 4BNKA 3KSDO 4I9HA 3DTTA 3GFBA 4CLOA 1EFLA 1MXHA 5JAQA 3ZWWA 1PS9A 1U7TA 4FBGA 4B3JA 2X0NA 2GSDA 1LA2A 3JQ8B 2HMUA 3ZH2A 1JA9A 3IP3A 4MVJD 1GV1A 3BTSA 5F5LA 4IJWA 4YT2A 3RQSA 4KDEA 4ND1A 1M66A 3F6YA 4CR6A 4NU6A 2AEFA 3EVNA 1UZLA 3HG7A 4NFHA 3BZUA 4I8XA 1ISFA 2HMWA 4RCVA 2G0TA 2BFAA 2OBNA 5J23A 4FC7A 4HWKA 3ZWYA 3ZU4A 5TNXA 4YYZA 3LZ6A 1N2SA 4B4UA 4CUJA 1J49A 4A2CA 4ZJUA 4NR0A 2DFDA 2OBYA 5BNIA 1A9YA 4AJ4A 1P1FA 2O3QA 2Q50A 1LQUA 4I5GA 3AUTA 3JQAD 3JD1A 3OIFA 4EEZA 1U3TA 5AXDA 3K2BA 4RLHA 2AMFA 2AG5A 3RUDA 4E5MA 3PZRA 3DWFA 1YBAA 1ULSA 4B79A 1NVGA 3TF5A 4RVFA 3JQGB 4E0BA 1XG5A 3WGGA 4EGFA 4A0SA 1DXYA 4IDAA 2Y1CA 4EBFA 3MOGA 1Q7BA 3KB6A 2AQHA 3NUGA 3S2FA 2J3KA 2VCYA 4KQXA 3VZPA 4ZRMA 3I23A 1TI7A 1U5CA 1W73A 3ROMA 4BNUA 2YFHA 2IEBA 1U3WA 3JQBC 4NK5A 5L4LA 4I5EA 3WGQA 1E7SA 3PHJA 3B20A 4NBRA 4CM6A 4CODB 1Y5MA 4INAA 1MG5A 4CMAA 4NJOA 3ZV6A 4CQMB 3M2TA 4CMCA 3TDKA 3IUSA 5C5IA 4GBJA 1QXSA 4TRNA 1U2DA 5A06A 1BW9A 5TF4A 1HE2A 1OI7A 1P77A 1E7RA 6LDHA 3RUEA 4DREA 1VL6A 1SEVA 3DBRB 3KRTA 2HJRA 1TT5B 4IINA 3QP9A 2P2SA 3OIDA 2QYSA 3AUSA 1FMCA 4IGFA 3SLKA 1R4MA 3PFFA 1GPDG 3JCZA 5A1TA 3O8QB 1E7YA 3PZBA 4FJ0A 2WEKA 4J1TA 5IXSA 1JKFA 1B7GO 2RAFA 1FDSA 5FWNA 3N7UA 4D3FA 3WBBA 3PQDA 1WW8A 4LSMA 4YB8A 2J8ZA 4L4RA 2NU8A 2FY8A 3C7DB 4E31A 2PZJA 3FN4A 3AUUA 1NPYA 3IKTA 3ZWAA 2R2GA 1K6IA 4C4OA 3ULKA 4CMHA 1YS4A 1GU7A 3PRJA 5ICMA 3PHIA 1EDOA 3GEGA 4RGBA 1U3VA 4U8GA 3TPCA 3PWKA 1LSUA 2B5WA 1Q0HA 4BMVA 5L9AA 2ZB3A 1JU9A 1E3WA 4TRMA 3DBHB 2ZB7A 4NK4A 5JCXA 1HLPA 4FPXA 5DN9A 4FGWA 3IQDB 5I7EA 1B2LA 1BXGB 2DM6A 4IDGA 4XIJA 4OAQA 1T26A 4UREA 5TGDA 4CLXA 4IDEA 2CDBA 5JCJA 4MVJH 4O59O 4I9NA 4OMUA 5T5QA 2FP4A 2CDAA 1CWUA 3FWZA 1E1NA 3GPDG 3MJCA 1FJHA 3PJFA 4FFMA 1G0OA 1S6YA 3D3WA 2ZYAA 1G1AA 4CV1A 2PNFA 1ADBA 4E2ZA 1C1XB 4TKMA 3RUCA 2V6BA 5U4QA 4BNVA 1DAOA 3L4BA 3FTNA 1PTJA 1A71A 2OFPA 2F1KA 3WSWA 4CJXA 2YDYA 2HCTA 3DZBA 2A35A 2O7SA 1ISIA 5IXYA 2C07A 3LSYA 1ZCJA 4MIYA 5ITWA 3WWYA 3DBVO 3ZGYA 3B1KA 4O1MA 4CM8A 4RJTA 2CMDA 4GI2A 3JYPA 3FCOA 3DOCA 1GD1O 5B4TA 2PD3A 2GNAA 4M54A 4RF5A 4YT5A 1FK8A 3PLRA 3WYCA 2B0JA 4BO7A 1D7OA 1NFQA 5JAZA 1ONNA 2C5AA 2XXBA 3H2ZA 1DEHA 1A4UA 4D0RA 5FFFA 3AY6A 3GVHA 3BTOA 4E5YA 4CM7A 5G4KB 4K26A 2VZ8A 4B3HA 3AJRA 3T4EA 5JSFA 4E3ZA 1Y1PA 3RJ5A 3PYLA 1R0LA 2G1UA 4ZGWA 3JQ8A 2F00A 3RBZA 1CERA 5KJEA 1IHXA 3H3JA 4JN6B 2HK7A 1CQJA 2RCYA 1UXGA 4OQYA 2VUTA 3D3EA 1E1LA 1EBFA 4LN1A 1IB6A 1J4AA 3RU9A 5G0TA 4CM5A 2OORA 3CKYA 3QWIA 4S3MA 3OA2A 4WLEA 4WLOA 2NUAA 3E48A 2C20A 5T64A 1M6HA 1E5QA 1V3UA 1XYGA 3C8MA 3B1FA 3QW2A 5L51A 2Y05A 5L4NA 3SC6A 3WGZA 3E8XA 5EINA 5C3MA 3W6UA 3LT2A 5A3VA 2C54A 2CSUA 3GH3A 4CV3A 4E2XA 3CZMA 2TMGA 1QRRA 4KDFA 5DBIA 2YUTA 4YWJA 3GNQA 3KEQA 4AJEA 3F4BA 3BTUA 3KOUA 3AM3A 4Q9NA 4BNYA 2PA3A 5HTOA 4QO8A 3NTRA 1LDEA 3AFNA 1SO8A 2YHUA 2HO5A 2JCYA 2D1YA 1SAYA 1QLJA 3M1LA 1RM4A 1LDYA 3KYDB 3WQQA 2W2KA 2EEZA 1AN9A 3JQGA 3PQFA 1NXQA 3TJRA 4U6SA 1JWBB 4PZEA 1A5ZA 2G17A 1F0YA 1B3RA 4EUEA 1NP3A 4QUKA 5CEJA 2EERA 3VDQA 2JHFA 4HBGA 3CPSA 4IJUA 1O94A 2QIOA 1Q2XA 2NWQA 3WTCA 4W6ZA 3KSZO 1PJSA 1GEGA 3MJSA 1C1DB 1OAAA 3VH3A 1V8BA 3EC7A 4FFOA 4LK3A 3WQSB 1NFRA 5FF9A 4PN3A 1BG6A 3DB2A 4CQMA 1HT0A 4YRBA 2NQ8A 3JQFA 3DZHA 3UN1A 4JROA 3D1LA 3BYZA 1X0VA 1I36A 5T6BA 1YQXA 3CINA 3DBRA 1P3DA 1TT5A 2VWQA 3H3FA 3GUYA 4OXYA 1VL8A 1P1HA 3GY0A 5EESA 3RWBA 1IZ0A 3OP4A 3ZW9A 1MFPA 1MUUA 2GN9A 2WTBA 5TT1A 2OP1A 3GDFA 2X86A 1KEWA 3OQBA 1U8XX 4B4WA 3K30A 5TJHA 1PJCA 4RV9A 1PWXA 1GADO 5CG2A 3CIFA 2QYTA 4N54A 3IS3A 5F21A 1SOVA 3S2GA 4OXNA 2OUIA 1DC6A 1E92A 3UGKA 3LC7O 4GLOA 4BQPA 3DMYA 3QRWA 1FDTA 5DNAA 3WNQA 1XQ6A 2YFQA 3DONA 3FD8A 1F17A 1C0IA 1DIRA 3OETA 2E49A 1F12A 2Q4BA 1Z75A 2PK3A 2HQ1A 1KVUA 4URFA 1JAYA 1KY4A 4R3NA 1VE9A 4PVDA 1DRVA 3CUKA 3PLNA 5FEUA 2WYWA 4J7CA 3QE3A 3JQ7B 1LLCA 1DAPA 3GGGA 2A94A 2EW2A 1PJ2A 1DLJA 2OO5A 2V7PA 4DPKA 3PWZA 4WOKA 1I24A 1JDJA 3O26A 1VJTA 1IPEA 2IODA 2VN8A 2ZKLA 9LDBA 1AXEA 3QY9A 4RVGA 5BNFA 3NGXA 4PLZA 4YDRA 1PZHA 1E6EA 5ILGA 2NTNA 4XGNA 2PWZA 2P5YA 2ZYDA 3RFXA 1D4FA 1GQ2A 4XR4A 4J3FA 1X1EA 3VH1A 3KUXA 5HWSA 1U9JA 4EUHA 4AFNA 4XGIA 5BT9A 1I5RA 4L74A 1DC4A 3U0BA 2EJWA 3JYQA 1WDMA 4NJMA 2EGHA 4CQLB 4HXYA 3WX0A 3EYWA 2O3SA 4J16A 4R68A 1BDMA 1T2CA 3SXPA 3WG9A 2DAPA 3JQDA 1Z7BA 3VZSA 3U9LA 4WASA 3ORFA 2V6FA 1M6WA 3ONEA 1A9ZA 1N7HA 1ZXLA 1Z74A 4YVFA 2VRCD 4ZHSA 1C1XA 3P2OA 4Z0HO 4DIOA 5CG1A 4MVJE 4CLRB 5LCXA 2ZTMA 1LLUA 3RD5A 3PHGA 5AXAA 1HDGO 4XRGA 2ZB4A 3LDHA 5JE8A 5DF1A 3H9QA 4XZ3A 3PFWO 1D1SA 2VNSA 4OO3A 4AVYA 3B1JA 3DEYX 4YA6A 3GK3A 3BXXA 3DL2A 1XELA 3WYBA 2JKVA 1PIWA 2VUSA 4II2A 1IULA 2XF8A 3O4RA 3AM5A 5F1PA 2QRKA 5CDTA 2XXJA 4IIVA 1I01A 3DZKA 3KTDA 3C3XA 3U09A 3MWEB 3ZI0A 4EZBA 2JFGA 2DTXA 5H83A 5HS4A 1R15A 4TZTA 4E12A 4M8SA 3D4PA 1YB4A 3C7CB 4RL6A 3AOEA 4R69A 3H9JA 2B4QA 3ZU3A 3NDJA 2G76A 1J6UA 1SC6A 3W4KA 3ZWOA 2PD4A 3WS7A 3EUWA 2O4UX 4K9DA 1PGOA 1N7GA 3G17A 3QA9A 3OM9A 1Y9EA 1M67A 4D41A 2Q4EA 5IDWA 2C0CA 4U0JA 3D5QA 3DAFA 3BAZA 4MO2A 4MVJA 4GKVA 4YACA 1PJLA 1NYTA 3CXRA 1BW9B 4B3IA 4MINA 3T7CA 3ZV5A 3ZWPA 5DBFA 3ETEA 3PGXA 3UOGA 1NVMB 4Z9FA 3EGOA 2A92A 4WK6A 2BGLA 4ZQEA 5HS6A 4ZN6A 1PR3A 2FPGA 3QVTA 4NQZA 5A05A 1WAMA 1WDLA 1MB4A 4J0EA 1ADGA 1B3BA 2UV8A 5JNLA 4RQTA 3UICA 2P9GA 1XHLA 3Q9NA 4TMFA 4H7PA 1GQYA 3RUFA 4JQCA 5EIOA 4CM4A 4FS3A 5B12A 1G6KA 1AHHA 2D5AA 4DBVO 3A06A 5ENDA 3Q0EA 3ONDA 1YB5A 4JXKA 3KLPX 3WIEA 3KYDA 4XQEA 1WPQA 5L4SA 2G82A 2Y1EA 3A4VA 1I33A 4LMPA 4GX2A 4L8VA 3VVBA 2VQ3A 1UUFA 2BI7A 4D0SA 2D4AA 4UVHA 1EZ4A 3ZNOA 3I52A 3GC6A 4FFRA 4R4JA 3UW3A 1PL8A 3VAZA 4ND3A 3ENKA 4QX6A 5ADHA 3UHAA 4CV2A 2NADA 4TRRA 1VSVA 1WWKA 2Y1OA 5CDSA 4ALLA 2DVMA 2GR9A 2UDPA 4ONEA 4LISA 3L6OO 3ZNPA 4CL3A 5C7IO 5EL0A 1EBUA 2VT2A 1GY8A 2W90A 3JD2A 3K6JA 1WZIA 2NVUA 2AW5A 1C1DA 1E3WB 3AI1A 4FGSA 1GZ4A 3GZ4A 1C0LA 1KEUA 3IOYA 4OGWA 3ZNQA 8LDHA 1UR5A 4AJHA 2OHXA 1HDZA 3EK2A 2HSDA 1AHIA 4BO6A 1Y81A 3E18A 4W7IA 1VJ0A 4KZPA 5AYVA 4FFNA 1O0SA 1SEPA 3U4CA 5I9LA 3DQPA 3RUHA 3LF1A 3VPXA 1QG6A 2JD1A 4QT0A 2PLAA 1DPGA 4O63O 3OMLA 5BNTA 1ISGA 1P74A 4E4YA 4XB2A 1ISJA 1V35A 2J6IA 3E5RA 1QORA 1U3UA 4PG8A 3I4FA 5A02A 2BRUA 2NQTA 2CVZA 1BWSA 2JJYA 5L3ZA 4HNGA 5K0ZA 2BFPA 1YB1A 5EQFA 4IPTA 1VL0A 1PJTA 3GVIA 3FBGA 4NPCA 4Y8VA 1RM3A 1UZMA 4E30A 1K0UA 3E82A 5AXBA 4HP8A 1A27A 1RYEA 3KSUA 3CE6A 4YTEA 1U8FO 5JMWA 1E7WA 4B7UA 1DBVO 2VYVD 3F1KA 1LTHR 3LC1O 4BB6A 3PYMA 4CM8B 3O03A 1D8AA 1P1RA 4XRRA 2AHRA 5F1KA 3LU1A 1RPNA 3G1TA 3OEWA 5BSFA 3JQ7A 4R3WA 3VHRA 4YPOA 4I1IA 4QTZA 4NI5A 1CIVA 3RU7A 1ISHA 1X15A 4ZRNA 2HK8A 2UYYA 3GGPA 3UFXA 1K6XA 5KOIA 1ISMA 3RIHA 1ZK1A 2HJSA 5IZ4A 3DOOA 3ANNA 4K28A 3TL3A 3W4JA 2JHGA 4BUCA 2BFOA 1PL7A 1ADFA 4ZQHA 4J2OA 4LW8A 1T2FA 3EAGA 4K1LA 2Q2QA 4M49A 5K9ZA 5A3JA 1GUYA 2NU7A 4ZQGA 3V2HA 5GMOA 3ZWXA 4BGIA 4BO2A 4CQLA 2B83A 4J2HA 3WQRA 3SJUA 1X7DA 4E33A 3BMOB 4W99A 3MJEA 4CM9A 1CDOA 4G2NA 4ND4A 4OJNA 3D64A 2I67A 1MA0A 1I0ZA 1IPFA 1NVTA 4ALJA 1Q0LA 3WLFA 4E32A 3D7LA 2DU8A 4XYGA 1PGQA 1Y6JA 2BMAA 2X0JA 1ARZA 4R1TA 4CLRA 4H15A 1PJ3A 1NPTO 2QHXA 4MKXA 1NHWA 5TSDA 3I9NA 3IJRA 2YQ4A 4Z3KA 2Y99A 3KM0A 4DVJA 1B26A 2IEDA 5LDGA 2EHDA 4PLPA 2PKQO 4GQAA 4CUKA 4ZICA 5A5FA 3BMNB 1JAXA 4JGBA 1E1KA 3HJAA 2WDZA 1Z7EA 3V1UA 2IE0A 4WLUA 2J5RA 3DAGA 4PGFA 2W4QA 1SB9A 4MP8A 4LMRA 5JPIA 4R1UA 5IDXA 2W2KB 2WE8A 1JWAB 4BNTA 4E5NA 2GUGA 2R00A 4UEJA 1KEVA 2YY7A 3DZFA 3TSCA 4IUYA 3OECA 2ZJ1A 1E77A 3JYLA 2E6UX 1HE4A 1EUCA 4GX1A 1MLDA 2GLXA 2YQ5A 2C59A 4LRTB 2RH4A 5DCYA 4NFYA 1MV8A 4K6CA 1DJNA 2EG9A 1SCUA 4RORA 2VYND 3WGYA 3DHYA 3PGJA 4L75A 5GZ3A 4LRSB 1H2BA 1MC5A 3N74A 2BHLA 4UVDA 1QLHA 2DT5A 5CP8A 1ZVMA 1Y9AA 3HQ4O 1HLDA 4PZDA 2IXAA 2PZLA 1PEDA 4P38A 3OFSA 5I9NA 2R00C 4IS3A 4KP7A 2WM3A 2E37A 2DBVO 3MZ0A 3AW9A 2VHXA 3PXXA 2NV6A 4RVDA 2FSVA 2CY0A 5A9TA 1P1IA 1UAYA 2VHWA 1GTMA 3QIVA 5AVOA 1DFHA 2ZTUA 3ICCA 4R41A 1TXGA 4L73A 2ZB8A 1Z6ZA 3C24A 2AE1A 5C7OO 3I4CA 4D45A 7ADHA 2B35A 3NTQA 3RAJA 1DIAA 2HMSA 3MTJA 4CM3A 2OZPA 3VKUA 1AUPA 1YBVA 3H9GA 4J1QA 2YHIA 4GVXA 5B37A 5KNLA 4YAKA 4XYMA 4J6FA 4NH4A 5L7TA 4XJSA 4ALKA 4BO9A 2X5OA 2ZQZA 4BKPA 4NMHA 3OJFA 4YBZA 1E7QA 2IZ1A 3ZCXA 2JCVA 4L76A 5KIAA 3ZW8A 3INRA 1EUDA 3W8DA 4JBGA 4Q3CA 4E6PA 1HZZA 3P7MA 4Y6RA 1VSUA 4JBIA 1SOWA 4FCCA 1IY8A 3EY4A 4GSKA 1XLTA 4YQYA 2P4QA 2PGLA 1YQGA 1CRWG 1DRWA 4WCDA 4G5HA 1I8TA 1UXHA 2QRJA 3CMMA 4RO0A 1J5PA 4RVHA 3QV1A 2AEJA 3IC5A 5A04A 1UXJA 4FJ1A 2IDZA 3MJ4A 1MG0A 2Z1NA 4PZCA 4ID9A 1LJ8A 3DZGA 4PG6A 4W4TA 5G4LA 5JO9A 3W8EA 1YWGO 1PGJA 2ZCUA 1H9AA 4GWGA 3H65A 3AFMA 3TRIA 3O9ZA 4UVEA 1EE9A 4AJIA 3I9KA 5JDIA 4RPLA 3A1NA 2DUUA 3UAGA 1PWZA 3EW7A 1YQDA 1Y5RA 1VPDA 4NJMB 1NQAO 1X7GA 3H6KA 3H8VA 2GN8A 2DBZA 3M2PA 2I5PO 1EE2A 4YQZA 4D42A 2H9IA 5JC8A 3QWBA 1QP8A 2I3GA 4EJ6A 3INTA 4Z9XA 3VTFA 5KCZA 1MFZA 2Y1DA 1LC0A 1FF9A 2UAGA 4MPDA 2Q2WA 2WE7A 1XA0A 2XOXA 1V3VA 4J90A 5G2OA 1LSOA 3E9QA 5T67A 4CLHA 4NBTA 4AJ1A 2CDCA 3GZNB 1T24A 5DP2A 3CH6A 4CMBA 4DYDA 1V0JA 1B8VA 4FFLA 3RKRA 2FPIA 4GL4A 4YT8A 2P9EA 2EF1A 2JAPA 1YOVB 3DZIA 1CQIA 5KJCA 4NIMA 3PPIA 3IP1A 1IZ9A 6ADHA 4PG4A 3IMFA 2DFVA 4XQCA 5TJ9A 4XDYA 4B4VA 1V6AA 2BLLA 1IL0A 2POQX 3S2EA 1X1TA 3L4BC 2PGDA 1OOEA 4TVBA 3ZWNA 4D43A 4IQ8A 3PQEA 1JN0A 1GZ6A 1Z82A 5THQA 1TB4A 1ZSYA 1Z73A 2I65A 1L7DA 4TQGA 3JV7A 1LXCA 4L4SA 2A4KA 3ZU2A 4WCFB 4NG5A 5C37A 1U4SA 4IDCA 4JJIA 5IAAA 2NLOA 2Y0EA 1GYRA 1HYEA 3ZWVA 4TSKA 5JXWA 4H3VA 3HFGA 1UH5A 4ITUA 2XPCA 4R51A 3L4SO 2ZTVA 3BMOA 2EKLA 1PJ4A 4AJ2A 4YAIA 1P9LA 1L7EA 1UP7A 3NAQA 5F5NA 1D3AA 1SZJG 3VOSA 3NT5A 1U28A 4QFDA 1JKJA 3HFSA 4MIEA 5AXCA 5TT0A 2PV7A 3WBFA 3GAFA 5K6AA 2Y68A 4Y6PA 1LU9A 3MCVA 3DR3A 3UKOA 3MWDB 1Q7GA 4IDFA 3FWNA 3UUWA 3N58A 3DZJA 1ONPA 2ZQYA 1I3MA 3BMNA 5ITVA 4CM4B 3C1AA 2O4CA 4IJKA 5AOVA 4XYBA 1MX3A 5CDUA 3PIIA 3JQAB 5BSHA 1H9BA 1ZK3A 4BO4A 2JCXA 3QVOA 4Z9YA 3WJ7A 3DC2A 3ZU5A 5TLSA 2QW8A 3GDOA 1U7HA 4OKIA 3ABIA 4R54A 2EGGA 2NSDA 4O6VA 3C1OA 3SLGA 1EK5A 1EK6A 4R9RA 4BNMA 4IJVA 2O2SA 4B8WA 1DFGA 4EW6A 2NVUB 3BHJA 3JYOA 2RHRA 4CL8A 1HKUA 4P4LA 2HRBA 2QRLA 4CMIA 3RSHA 1DOHA 3KO8A 3W4IA 3WXBA 1MC4A 3RC1A 4H16A 2P68A 4RDIA 4E5PA 9LDTA 3M1AA 4Z6KA 3TWOA 3OJEA 3L0DA 1PQPA 3RASA 4D3DA 3NDIA 2YV3A 2ZJ0A 4IXTA 4EJMA 5HM8A 2GD1O 3FHLA 3G0OA 3PVZA 2HMVA 5CEEA 1UXKA 5B4UA 1EQUA 1KOLA 1P33A 4EYEA 4OXKA 5EPOA 2X1HA 4RPHA 1GAEO 4D44A 3UXYA 4DMMA 5GZ6A 3NKLA 4XD2A 2V65A 3L77A 4EDFA 4CMGA 2DBRA 3G1UA 3VVCA 2PKRA 1DJQA 2FR0A 3GLQA 1EMDA 1IUKA 1GPJA 3NYWA 4TROA 3TZHA 1H6BA 4KWHA 3F46A 1ZK0A 3GVCA 4UEKA 3JQFC 4YJDA 1IE3A 3AU8A 4WE3A 3LK7A 2X5KO 1TA4A 3Q11A 4F45A 4YCAA 5KVQA 2EW8A 4J9UE 3IIEA 4BS9A 2Q99A 3DMTA 1UAGA 3L9XA 2EV9A 3C1TA 5JC1A 2RBEA 3MEQA 2D0IA 2GERA 3OQ6A 1PJQA 2VZ9A 3BA1A 1WP4A 4GMFA 2DKNA 2Q49A 4CR8A 1N8KA 1YXMA 4UVGA 5COQA 4ILKA 4CV0A 5ER9A 2YYYA 3DFZA 5G0SA 3S8MA 3UF0A 3G79A 5HA5A 3STHA 1ORRA 1I10A 2VWHA 2IYPA 2OL4A 2B69A 2W8ZA 1QYWA 1WXDA 3PEFA 1ZSVA 4MKZA 1QV7A 4HADA 4FQ8A 1T1RA 4TVOA 3JTMA 2C7GA 5JMPA 5KKAA 3DAPA 4Q3DA 4Q3NA 4R01A 1OFGA 2X6TA 3R3JA 4Q3BA 1RM5A 4GWKA 2O2YA 4I9UA 2FZWA 4J7XA 3OSUA 3OJLA 2B36A 3FR7A 4DC1A 1WMBA 4MVJI 3RROA 3I6IA 3AI3A 1H2HA 3L6EA 4PG7A 1BHSA 2GCGA 3PDJA 1ML3A 3A9WA 5IZCA 1PS8A 1PZEA 4L4XA 5JYDA 4KUEA 1TVEA 2WD8A 4DTIA 3IKVA 3L07A 4I08A 4ZD6A 3ZV4A 5BSEA 1NWHA 2JAHA 2Y66A 3GZNA 4NHEA 1GUZA 1HDCA 4RPKA 3WB9A 2AQ8A 2GN6A 4TZKA 4RF2A 3WNVA 4UUNA 3OIGA 4JIGA 5CPFA 2VYVA 4YJFB 1GR0A 2X0IA 3ROPA 1YOVA 2QZZA 1W6UA 1U4OA 2BGMA 2HRZA 4PVCA 3WSVA 5I7SA 1X7HA 4XEHA 2I66A 1I32A 3OH8A 3ADPA 5ES3A 4S1VA 4XCVA 5CDGA 5MGBA 1KVQA 5A5EA 3HE3A 1GDHA 2PH5A 4P4NA 1K2WA 3BMCB 5COBA 3VTZA 1PZFA 3U4DA 4UULA 3UVEA 2NTVA 4ND5A 3TFQA 5GZ1A 2VNAA 4Q39A 3OBBA 3SC4A 2FOIA 1KVTA 1CF2O 2I99A 4NU5A 1KBZA 1NX6A 1YGYA 5G0WA 4YT4A 1KETA 1N92A 2ZTLA 4WCFA 4A03A 1DB3A 5DOZA 1ZNQO 3PWSA 3GG2A 1LI4A 3DTYA 2AEMA 1IYZA 5BQFA 1LDBA 3VH2A 4CMJA 3IL2A 3QWFA 5DZSA 3JD4A 2E4AA 3DOJA 2GGSA 1SPXA 4UUMA 4IXWA 3ZV3A 3MJVA 3K92A 3JQ9A 1YL6A 1EVYA 4WUVA 3ANLA 2GASA 5ER6A 5KVSA 1BSVA 2NACA 2YV1A 3CZRA 4MIOA 4N18A 3JYNA 4IY1A 5JY6A 4PLTA 1E0DA 1O89A 1RWBA 2OOSA 2WYVA 1BXZA 3PJEA 3LT4A 4JK3A 3GMSA 1NM5A 1LRLA 3I9LA 3W1VA 2AE2A 3AOEC 4II3A 1VLLA 4YRDA 2O23A 3BMQB 3QVSA 4CQMD 3H5AA 3QJ5A 1ENOA 4M87A 3CSDA 4PLGA 1ZJZA 2BGKA 1HDRA 2VRBA 4J7UA 3O38A 5B4VA 3H5RA 1HWYA 3LT1A 5I7VA 5DP1A 1U5AA 1T2EA 4JJGA 1E3JA 3E03A 5CFZA 2YHIB 2DTEA 4IQGA 1HDYA 2HMTA 2YV2A 5T8KA 3JQAA 1N5DA 4KWIA 1I2BA 3WMWA 4RQUA 1G0NA 3NJ4A 2TMDA 4YAJA 1UP6A 3KVOA 3B70A 5JYEA 3HADA 1V9LA 1H6DA 1YJ8A 4W7HA 1P0FA 3U5TA 4BMNA 3FNGA 3D4NA 4NFSA 2OXIA 2Q3EA 2O7QA 1XIVA 4BV9A 1E5LA 4BO8A 4WEQA 2DBQA 3ANMA 3I6QA 4NBUA 3ONFA 3TZQA 1AE1A 2NU6A 1GL3A 1PSDA 4RF3A 2IZZA 4NZ9A 2B5VA 2FR8A 2VWPA 2Y67A 3ZWCA 1W8DA 5T8KC 1LDGA 4FC6A 2VOJA 4A73A 1ZO8A 3H9EO 3GFGA 3WWZA 4DWVA 2VT3A 3AI2A 2X9NA 1YONA 1VRWA 2PFGA 3BHMA 4B4OA 2X9GA 4WKGA 3WYEA 4KOAA 1KVSA 4WGGA 5CAEA 2O3TA 4A10A 8ADHA 3NTOA 1KYQA 1D1TA 4R1NA 4P22A 5JW6A 1I2ZA 4Z0TA 2X22A 5COAA 5IF3A 2B4RO 4BO0A 5MDHA 3GNSA 3ZWBA 1R12A 4UEOA 2Z5LA 4N5MA 4YXFA 2O3UA 4ZQFA 1R37A 3GRPA 1L1FA 3HHPA 2CUKA 2D2IA 1T2AA 3LLSA 2O3RA 3KETA 1ZJYA 4GX5A 4Y6SA 1E3IA 3D4OA 1I2CA 4QO7A 1NQ5A 3DFUA 5IN4A 3ITKA 4IZIA 4Q3AA 3ZHZA 2V6GA 4RLSA 3NRCA 2GRAA 5EMHA 1X0XA 4MJLA 4RZHA 3GT0A 2WSBA 3QWHA 1B14A 3UCXA 2GF2A 2FR1A 5I7FA 2AXQA 1B8UA 3FNHA 3GHYA 3AY3A 3V1TC 1WMAA 1SMKA 3JD3A 2GZ2A 3NV9A 2PTGA 3K73O 1F8GA 3L6DA 3BHIA 1DIBA 3DXFA 1A72A 3RJ9A 4U6QA 2RH8A 1JVBA 2DTDA 1MGOA 2FZEA 4BV8A 1ZK4A 4M55A 4WNCA 5I8ZA 1C0KA 3D5TA 2VHYA 3PK0A 1SNYA 2H5LA 5KTKA 2X7HA 3KV3O 4XYEA 4PRLA 3RUAA 4GPD1 3LF2A 5I9MA 3E6AA 3HDJA 4AG3A 1V3TA 4IGEA 4BNJA 1A7KA 3EVTA 1PQWA 4OQZA 2Q1TA 3OQ1A 4RF4A 2WD7B 3QSGA 5TRTA 2FN7A 5KJFA 5JLAA 1F06A 1O8CA 1O5IA 1GZ3A 3GEMA 4BVAA 5IG2A 1C0PA 3WFJA 3H2SA 5A9RA 4KQWA 1KC3A 4F3YA 4BHTA 4IDBA 2GO1A 1ID1A 5DOVA 3KYCA 4DPMA 1CJCA 3F4LA 4XA8A 3AWDA 1XEAA 3BTVA 2B37A 3Q9UA 3DBLB 1KY5A 4HFNA 3IUPA 3I83A 4AJPA 1EVIA 4BOYA 2P5UA 3OHSX 5HRUA 2VUUA 2EP7A 4CUZA 4OM8A 1BMDA 1PL6A 2I9PA 3PIDA 4YJFA 2EXXA 2P4HX 4OSPA 1P45A 4K6FA 3GHHA 3WGHA 2X8LA 2HU2A 1LBEA 3VDRA 4N7RA 2PR2A 4YAGA 4WOJA 3BMCA 3I9MA 4CR7A 3DDNA 3LVFO 1E1MA 2Y0DA 5DBGA 2J5QA 3E9NA 3VPHA 3BIOA 1YDEA 1T25A 3JQBA 2EKPA 3NJ8A 4GAEA 3UH1A 1XSEA 4AJKA 4HFRA 1UXIA 2GZ1A 3D0OA 2EIHA 3HN7A 1QYDA 1H94A 4IDDA 4ZA2A 4DL9A 2W2LD 1LQTA 3ETDA 4GMGA 4CMIB 1PS0A 2JD0A 3KLMX 4PCVA 1R66A 4BGEA 3HNPA 2GDZA 4G81A 5H82A 2Y1GA 3E1KA 4FJ2A 4FR5A 3RKUA 1X13A 1ZFNA 1GYPA 4RDHA 2X0RA 3V5NA 4OSOA 3AUAA 3R0IA 1OBFO 2FSSA 5L7YA 3TOZA 2Y1FA 3Q3CA 3ZDFA 2HLPA 1VI2A 2VWGA 1NPDA 2Q2VA 1ZSNA 3FNEA 4XYLA 1GEEA 4BNXA 4I5DA 4N5NA 3S55A 3JQ6A 2H63A 1KVRA 1FDVA 3BMQA 1OC4A 4J4TA 1JQBA 1F14A 2CVOA 1KS9A 1M2WA 1ZUD1 4ALMA 1ZBQA 3AK4A 3GN1A 3EZYA 3EZLA 1LRJA 1R6DA 2QX7A 1YO6A 3FSRA 2CD9A 5TIIA 4E5KA 4FSHA 3KBOA 4GGOA 4MKRA 3GVPA 3M6IA 4HUJA 4OH1A 3QWAA 1QMGA 1QYCA 3F5QA 1NR1A 4UVIA 1E3EA 4BNHA 1HYHA 2XAAA 1VKOA 3GRKA 3JQEA 1VC2A 4D46A 3GOHA 3U3XA 4WNIA 4MOWA 4O0LA 1B0AA 3EHEA 3I9OA 3FNFA 5DCWA 2JFHA 1C3VA 2FPPA 4B7XA 5IN5A 2HUNA 2DLDA 4AL4A 1H5QA 4KUHA 3IJPA 4YJGA 5TS3A 3ICPA 3Q1LA 4BKQA 4OHUA 4QECA 1LRKA 1BVUA 4BGUA 4BIIA 2NM0A 3GQVA 2B4TO 1T4DA 3F9IA 4FIZA 2BELA 5TX7A 4BKRA 5JAMA 3W6ZA 1HXHA 4C7KA 2ET6A 3S1LA 4PG5A 2C82A 3GPIA 4XKJA 2WJPA 4MVJF 3SVTA 1LLQA 1P31A 1YE3A 1Z45A 1ZZEA 4DRYA 1KERA 3OEYA 1FXSA 1XU7A 1R0SA 3H7AA 1CETA 1XU9A 4AICA 1ZIDA 3HSKA 4ESOA 5JDCA 2E82A 5DDIP 3Q6IA 1S7CA 3FPLA 1IOLA 1TLTA 1YL7A 2GYYA 3FR8A 1I3KA 3E5MA 5TC4A 4DQXA 2DPHA 4DPLA 1DIHA 4L0QA 3RI3A 5L40A 4FN4A 3LT0A 1HSOA 4YJHB 4XDZA 4YRAA 4LCEA 3K9QO 4M1QA 1HSZA 4IMPA 4RVSA 4OIMA 4PLWA 1NASA 4CM9D 5KJ6A 2RIRA 1DIGA 1ENZA 1K89A 1RJWA 4P4GA 3JD0A 4DC0A 2QQ5A 4PLVA 5JDIC 1ZEJA 5TQVA 2O3JA 2CF5A 2ZIZA 3S2IA 1N1EA 1O6ZA 1NAIA 2YDXA 1NQTA 1DFIA 4MVJP 1QR6A 1JVSA 1DC3A 3NT2A 1HF3A 3FTPA 1KIFA 3WOHA 5GY7A 4DQVA 1Y8RB 3EDMA 2VHVA 3NGLA 5A03A 4J9VA 2VTDA 2DC1A 5KVCA 3ASVA 3LQFA 5C7LO 4MDHA 3QLJA 1P44A 3A28A 3W8FA 1HETA 4GSLA 2JFFA 4BNIA 2EJVA 4DMLA 4ZVVA 1CYDA 5AQ1A 1VM6A 4TRJA 3FPCA 4QEDA 2PH3A 1RM0A 5EQDA
chains in the Genus database with same CATH superfamily
1UMCA 4XARA 5EIXA 3KKLA 3LHDA 3SI7A 6PFKA 4XPZA 3W9BA 1CUZA 4AJLA 1E79D 3R09A 1QG2A 4KUGA 3G02A 3ZVKA 2HCJB 2HXSA 2RHWA 4DA9A 3BGIA 1SU7A 4KQFA 7MDHA 5JRDS 3IBTA 3TFOA 4QFCA 2CVFA 5DSTA 3G7UA 4NP6A 4PZAA 4HNVA 2OV6A 5L3QB 5EZYB 2FPXA 2HSGA 4RELA 3T5MA 3CVWA 1A7JA 5JJ5A 2H1OA 1L7RA 4EATA 3TZ6A 4M89A 5FO0A 2Y76A 1GPH1 1U7WA 3AEKB 1LKZA 4HVAA 1RIIA 1BROA 4J0JA 3KZOA 3EGXA 3SQLA 2J5XA 1ODSA 4E70A 1AXRA 3TLBA 1SU6A 2ADFA 2ZAIA 4S0XA 4Y0VA 4CBVA 2I76A 3ECSA 4MS1A 4JCOA 1MDBA 1Q7CA 1EFRD 4R5HA 5U9CA 2ZCVA 1ZL0A 3KBBA 1MW9X 1TMGE 4ZYVA 4LWOA 1T2DA 1YL5A 3QE2A 4ZO4A 4F4DA 2DKFA 2O1EA 1YBMA 1O9GA 1IHYA 3OJ0A 4AKTA 1HEYA 1BOFA 2AG6A 5DCUA 4EY5A 1ZH2A 4PYJA 2D0OB 4TSRA 1LC3A 5EY5B 3V4RA 2BHSA 2J3HA 4YJ3A 1MT0A 3J7TA 5EOVA 2I6UA 1SUIA 2WHXA 3C7AA 4C89A 5IAOA 4FKMA 3HWSA 5EMNA 4RK1A 2HF7A 2Q1UA 3R6DA 4RTJA 4WFKA 1BN6A 4IFEA 1FRVA 3DAYA 1A2QA 1GA1A 1WPGA 1VZ2A 3DTVB 3R44A 2Q8QA 2I2FA 3FWHA 3N0VA 1NLMA 5DBHX 2Z6UA 2A6PA 2I4OA 3GDGA 4M6WB 1C14A 3W7AA 4ARZA 2AFIE 4RZIA 2WM2A 5HF6A 5K0NA 4DYVA 5K4AA 1RVV1 3KEOA 2HLDA 3B12A 5ICSA 4BJHB 1T1EA 1G20E 2EDCA 4BEJA 1JLMA 3BC1A 2PLFA 1WHSA 3RF7A 5JZMA 2QN9A 2O8EA 2Q3LA 3F3SA 1PQ4A 3T7KA 4Q9AA 1I94B 1L8LA 3D6MA 4LY9A 2Q3JA 4O3FA 1ZKMA 3ZY6A 2FXVA 3EQ9A 3DZCA 3PHHA 5FQOA 1P39A 3WKCA 3PSAA 3ASUA 4LSWA 4ZO9A 1H93A 6AT1A 1P7WA 3PT9A 1EDZA 4L3WA 4EO9A 2RGUA 1PEYA 2ZPUA 1FDWA 2WRZA 4JDUA 1QVWA 3U40A 3FHJA 1H22A 3PVSA 1KZ4A 2NXJA 4I5FA 5JS6A 4N65A 2WKRA 3HH8A 3I3OA 3KYBA 5FLYA 2I0FA 3F49S 1CG6A 2P27A 3FKJA 1WKVA 5GWXA 2Q5CA 3RC9A 4LZZA 1LPOA 4DRXA 2OR3A 4MKFA 2JS7A 1QYVA 1UDRA 1XYVA 3CF4A 4LQCA 3V80A 1R9JA 1F2UB 2PKEA 5MN5A 4Q7JB 2RGYA 4F93B 4DM3A 5CGZA 1E1QD 2JFPA 3HJNA 4D26A 1V1MA 1YRLA 1YA6A 1VZ3A 1OXMA 3ECAA 2W2MA 2HZ7A 5ALGA 2OBXA 2WUDA 3A9UA 4RSHA 4X54A 1TVCA 5SZIA 3SOZA 3I3SR 3VR3D 3K9FC 5AI5A 1AV6A 5EI5A 1UMDB 3LX8A 4QWMA 3IOBA 4HUQA 4MKGA 3P2YA 5CFLA 1MAHA 4OQNA 1N6NA 3LP6A 4G5OA 5CHEA 4ZVPA 3EXHC 4XWYA 4X0EA 4FOOA 2ZUUA 4YEDA 3UWOA 5FWYA 4XQGA 1NWCA 1TYZA 1V5WA 4WA8A 2RHCA 2Y77A 1J00A 1BXKA 1RKQA 3CJQA 4YR9A 3HXMA 1XNQB 1R6TA 4U63A 1P72A 5AKKA 5F12A 4AURA 4EECA 2JJ2D 1CUUA 1N2XA 4FB5A 4IW3B 1M1YA 2XNJA 2Q1YA 3IBGA 3DO6A 1GCIA 1RYBA 3AEQB 3OICA 2XNSA 4B7CA 3ICEA 4UUOA 4IMJB 1NR5A 4FM9A 1LPAB 3WAGA 1K5HA 1VE1A 1VL1A 2O5RA 1SWVA 2C7PA 2RHGB 4XD7D 4X6XA 2H1LA 3EIEA 4RPGA 4J49A 2VJBA 3IQEA 5C8YA 1ICIA 4MV5A 4QSMA 1ITZA 1SXJD 2GEUA 2NZVG 4IGKA 4XFJA 5FPTA 3UK0A 4A5OA 4FYMA 1K97A 2CJPA 1GCUA 1A76A 1E2UA 1ND6A 2IH4A 4O4HB 4EENA 3FW1A 3KEMA 3W8RA 4U7FA 3FMOB 1RCTE 3VPDA 3X0DA 1DAHA 4KW7A 3B6ZA 1U6IA 1YDWA 3MCWA 3HCOA 1TCVA 2H6EA 5BW4A 2F7SA 1G3UA 4F46A 4KQ6A 4B8YA 2BH9A 2NZXA 4BFTA 3MIIA 2XMPA 2ISQA 3LGSA 3FFAA 4EJSB 2BSXA 4A27A 1JJAA 4JVSB 5IS2A 3CTMA 1ZIYA 3HXTA 5ALHA 4C04A 3ITDA 3M3PA 2RHHA 4X65B 4K0RA 3AILA 4KXFB 1ZH0A 2WK1A 1ZGJA 3R40A 3HKBB 4LNUB 2XIJA 4LVNA 4ROSA 2R8XA 4RVUA 1QKKA 1K4KA 4RMIA 3WOVA 3EYAA 3VFDA 4MWDA 4F6LA 4DBZA 3ELBA 1V95A 1N4DA 2D8AA 5IARA 3I62A 3T4XA 3LGXA 3UQZA 1JQEA 5F33A 3W77A 4ZVTA 1NW8A 3BSFA 1JQJC 3L93A 5HEKA 5BMOA 3OQJA 2FUG1 4J43A 4E6EA 1BXGA 1QQTA 1W48A 2W8BB 2HEGA 3HA7A 4KAXA 4Q12A 1MP0A 3TLGA 3NHLA 2VQEB 1H4VB 2ZUSA 3G2LA 1BA2A 3HB5X 1YR1A 2CSXA 4N4AA 5KTNA 5A4DA 1Q83A 1G8JA 2ZUEA 5GP1A 1QOQB 3SP1A 2PUJA 3DCYA 2IEGA 3OQNA 3MBOA 4S1WA 3RBXA 2LNDA 3T95A 4WOPA 4MUEA 1FP7A 3PD7A 4PWZA 3SBOA 4BNNA 3KKNA 3V1MA 3CLSD 2BSAA 4DLWA 1XRMA 3GX1A 2H4WA 1T34A 2FMUA 2LP4Y 3CW9A 4H6WA 3AF1A 4FHDA 4ZCRA 3TBHA 4R2MA 2FG5A 1Q0QA 1YZTA 2HRCA 3AZOA 5GV7A 3WGVA 5GJBA 4I4TA 5E6UB 3SFVA 1FFGA 4XGRA 4Y67A 1Z35A 2Q5JA 2YIMA 3UFBA 3U4IA 2X13A 2NYRA 2PTHA 3FYUB 2I4IA 5J40A 4Q3EA 5F9MA 3IE1A 5D85A 4MQFA 2R4UA 4D0GA 4Q9DA 2R0QC 3HXKA 3E9RA 4X62B 1SQ5A 4G9GA 3PRYA 3V7YA 5KOHB 3HWRA 3LLVA 4UHFA 1KXZA 4G0VA 1RC1A 2EKQA 1U2GC 3ZXUB 4OEHA 2FPWA 3FF4A 4J91A 3SFTA 5K45A 1XKQA 2QL9A 4WLNA 2P69A 2CCGA 4Z7NB 1NHGA 2HQOA 1KORA 4HTFA 2SCUA 3HVJA 1C7JA 4Y0AA 5H68A 1PO7A 3IMKA 2P40A 4D3SA 1AQUA 3O2QB 4K6MA 2QR2A 3SJ7A 3R9XB 2ZITA 1UOOA 1JNYA 4WY2A 3VH4A 3N2KB 4AYXA 3HY6A 1QFXA 2OSVA 2QAJA 1P19A 3P2JA 1T8YA 3VHLB 1DSSG 2GPTA 3HB4X 1M2KA 2QUBA 4XR9A 1UZNA 4DY6A 3EBPA 2E89A 3P0RA 2YC2C 2YS7A 2QM8A 4IJMA 1P7ZA 3AJ9A 3D4LA 5F5XA 1L4HA 3JW8A 2CCKA 3PGKA 5ITZB 5DGXA 1RW4A 2D5BA 1S4QA 4M1TA 4B6JA 2M6RA 4E03A 3TSZA 3ETGA 3X3HA 3CEPB 4ENUA 1F1BA 2MSLA 2NNLD 2WU3A 4HMOA 4LYHA 3UCFA 1CUEA 1ZMTA 2C3YA 2IP2A 3WK5A 1RQRA 3PNOA 2PSDA 4PN7A 1JPJA 1Z17A 5CJPA 1Y4DE 4HRAA 3ZCVA 3H3XA 2R2AA 5TQ2A 1DDOA 3OKAA 2NV2B 3QHAA 2ZM6B 1RKXA 3WWDA 4OVKA 4BMZA 4KKXB 4HZIA 1ZITA 2CZQA 2JA2A 3IP7A 3VPGA 2C5GA 1WB6A 1KO5A 4EHNA 1NI5A 1XRPA 2FETA 3I9JA 2AR9A 3QNMA 2CNBA 1EVZA 3I8XA 2PKCA 1DWOA 3EUEA 2YZKA 1QFSA 4I55F 4FK8A 2MMGA 2TRSB 3OF2A 5F1OA 5C5DA 2EP5A 1NM5C 7AT1A 1Z4LA 1GU0A 4QXPA 4V0RA 3AKEA 1D2MA 4F2PA 3PQ2A 1YR9A 3CLVA 1R4MB 3QKTA 3T1QA 3FZGA 1W94A 3FUVA 5LLTA 3K96A 2A9VA 2QTTA 4DXHA 3HR4A 5B55A 2D13A 3NWBA 4F92B 4LF5B 3UAVA 4DXAA 2C4TA 4DLRA 1ZH8A 3H2YA 1E59A 4YJGB 2P2LA 2BEKA 3BDVA 3PI7A 1N2IA 2XVAA 3CLTD 4BO3A 3RNOA 1KIAA 3C4QA 1SD5A 1BDBA 2G5CA 2X19A 4BQEA 3PTAA 1VHTA 3B85A 4D9KA 2J3JA 3A3KA 3NBXX 4R8VA 1L7BA 1QGAA 4EVIA 5LQCA 5IVIA 1U0HC 1OPXA 3O74A 2A30A 2VYNA 3Q5GA 2J30A 4QXMA 5B3JA 5JDCA 1R0WA 2WF7A 3JAKA 2E48A 3NX4A 5DLYA 2QUHA 1GSOA 2VT7A 3GMIA 3R20A 5F9HA 3TNDA 2N0SA 2ZYWX 4GBGA 3PHLA 2QUZA 4G65A 4UCXA 3D54D 5DNCA 2GPJA 2P2YA 2XUPA 5FLKA 2BHTA 5KNDD 3G49A 4BMSA 2IK8A 5JSZB 4PLFA 1EUZA 3AR9A 3JQCA 2B6NA 1ACMA 1YVEI 3JRXA 3K5PA 3LHFA 3SBDA 3ZKWB 4D9BA 1R74A 1HNXB 2V03A 1NVKA 3OIVA 4EQZA 5FI5A 3AH8A 1EA5A 1E2JA 2X23A 2C7VA 3V00A 5CFRA 1D2EA 3OPYI 3EPRA 4MIKA 4F8JA 2QZPA 1IXRC 1CW2B 4MITA 5HCUA 4MUIA 3M4XA 4FFPA 3L9WA 4H7KA 1VB3A 4L15A 1B6TA 2CN1A 5DEOA 3TN7A 4GI1A 1UKCA 2BKAA 1GUBA 5P8WA 2VK4A 1GG9A 3TIIA 1YH3A 3CEAA 4RGVA 1Z29A 3P9SA 1C7ZA 2AR0A 1TZ2A 2OY0A 1Y3CE 4YMSA 4KOEC 3RG8A 4G1BA 5EJ2A 1VI6A 2AQIA 3STUA 3T7EA 4EX7A 4IOJA 1E2GA 2BKUA 3MB5A 3PC8C 2WFLA 2C2BA 1F8FA 1R16A 3O4VA 3SEQA 5EPUA 4C7BA 2GUWA 3SDZA 2F1RA 4R2IA 3CY6A 4ZQBA 2Q1SA 2PZGA 4D8XA 3H4VA 1A3CA 4V3CA 1S3SA 2AOXA 5ARBA 1V7QA 2FX2A 4MKIA 5LQSA 4G8JA 1ADCA 4NZMA 4L6AA 1GV0A 4TWAA 2ZK7A 1D09A 2ZRFA 3OOEA 3QVWA 3TVDA 3GLTA 5ILOA 3HDQA 3OAAD 1A7AA 2G71A 4RTNA 2D1RA 4MB0A 3VPSA 1U7ZA 4E2YA 3EVZA 4ZCTA 4HWRA 4MLDA 4DEYA 1EJ6A 4QNMA 5BYBA 3R5XA 1XF1A 3W7VA 2OLEA 2WTMA 1S96A 3VZRA 3P2MA 3R1IA 1XQ1A 3M5PA 2IT1A 4IJ5A 4JA0A 4MGKR 3VUFA 5CFNA 5JH7A 2VJKA 4GRDA 3RREA 3S7ZA 1LW6E 1QO9A 4X9XA 4CQNA 4HF7A 1XALA 3CVUA 4OI2A 2ORIA 1N77A 3ZHOA 5E9AA 1KMHA 4HAZA 1KY2A 1TJ4A 5J4LA 2Y8EA 3DNPA 3H83A 4FLEA 2QMHA 4MCIA 4GICA 3K8ZA 4AMYA 3KZMA 1MO6A 1OPRA 3G7NA 2OD9A 1KFCB 2X4GA 4DDVA 4W5HA 4AMUA 5MF6A 5J47A 3SEFA 1DC5A 3U9TA 2PD6A 5KCMA 2ZATA 4EUKA 2AGVA 3BHNA 4JNKA 3TG8A 3ET4A 4QYXA 1PGPA 3P45A 1EX1A 2YVQA 5F2KA 4DIEA 1H1LB 3ZS9A 1KQFA 5KNCD 3GFBA 1EFLA 1MXHA 1LBHA 4MJXA 1RNLA 5JCOC 4FBGA 4QQKA 2X0NA 3GUVA 1OV4A 3B1WA 5TARA 1IB0A 1LVHA 2ID8A 2WPNA 1QH0A 3F8TA 1PUJA 2IIVA 2HMUA 2XCSB 4QGSA 4L8YA 4EJSC 3ZH2A 1JA9A 3L8HA 4J29A 3IP3A 1CQJB 2WPDA 1WCIB 3BF7A 5ILQA 5EHGA 3URKA 2N3ZA 2HA6A 3I2KA 1I6MA 1UBEA 3LKBA 3OWXA 4HDMB 4MGHA 4AJ9A 3L0IB 4RC9A 4YGXB 2I3ZA 4A0RA 4YT2A 2Y92A 2YV4A 4K8OA 2QJFA 1IZ8A 1J33A 1I4EB 1TX4B 2LGJA 1E0KA 3EVNA 3IT0A 4OK6A 2HMWA 1NG9A 4I7EA 2HA4A 5J23A 4FC7A 2JBWA 1AGYA 3ZTWA 4XUGB 4KXUA 2GZRA 3KQTA 1QHYA 3BWYA 3ETCA 4B4UA 1JHXA 2JIDA 1I13A 1I1QB 4FUQA 2M2IA 3SVZA 5IH7A 4GYWA 1GPMA 3GH1A 3LG2A 4CEHB 2O8DB 3EGDB 3JQAD 3TSAA 5EHXA 2XHEA 2EFDB 5AKHA 2KPOA 4N3CA 4MR7A 2AI3A 3RVBA 2AD1A 1RRKA 3KR9A 3WKDA 2PXCA 3K0KA 4QM6A 2P79A 5HOEA 4C5BA 3DWFA 1RACA 3LIPA 5EQDA 3UT5A 1YBAA 1ULSA 2G5GX 3K0CA 4YPFA 5JEDA 1QHHA 4TLCA 3PT5A 4U6NA 3BFPA 3C41J 4IDAA 3COJA 1YC5A 4EBFA 4UTXA 3OD1A 3MOGA 4KLZA 2VBIA 2JJMA 2QTVB 2AQHA 1CB0A 3IODA 3K0EA 2BZ1A 3F71A 1ABEA 3NUGA 3FYUC 1N2GA 4YH1A 4EL5A 3OX4A 1MH1A 4WV3A 1Z8DA 4KQXA 2H4JA 3W1WA 2Q3MA 1IN5A 1KYIA 1HFEL 3EMVA 4UNSA 2ZBVA 3A58B 4XUCA 3P5BA 2IDMA 3TTWA 3W5CA 3IB3A 5FEMA 1UBTS 4EA6A 5BQXA 4I5EA 5JQGF 4ZAVA 2D4HA 3HABA 1N1MA 3WJ1A 3PHJA 4NBRA 4RTOA 4CM6A 1Y5MA 2BTQA 4H35A 1U2SA 4INAA 4ZGGA 4CMAA 3SR0A 3C7KA 4HDRA 5DT2A 1YK1A 2K2WA 1XVLA 4IAOA 4CQMB 4AT1A 2ASEA 1J2RA 5AJXA 4CMCA 3H04A 2TMKA 1L7QA 3LPLA 3QK7A 4GBJA 1QXSA 1U2DA 4RACA 5CVEA 1AU9A 4RYDA 3T8YA 1DKPA 2N75A 3VOTA 4UTPA 3GA5A 3EWSA 3KLNA 1EG7A 1P77A 3C6BA 1E7RA 4QXAA 3RUEA 1E32A 4K3UA 3DBRB 4E5UA 1BWQA 1KYXA 3GFSA 1TT5B 2GBFA 4RTLA 4FGLA 4UD2A 1A77A 1P17A 3E3NA 4K03A 4RMHA 3SSNA 1GVNB 1V5EA 3AUSA 3FPBA 1XD8A 1U0EA 3LBIA 4IGFA 1L5LA 2YL2A 4CL2A 2GEDA 2WQ6A 2PL5A 4Z49A 1ACJA 4PSUA 5CX1A 1F4PA 1YZUA 2R5WA 3OD5A 1E7YA 5A1TA 5REQA 3PZBA 2WEKA 4ZTZB 3MGCA 3I9FA 2P2ZA 5B1IA 3M3HA 2XSZA 2SKCA 4HAYA 3UOWA 1JKFA 5DM0A 1B7GO 2OHOA 4RXMA 3G13A 3ONVA 1L5GB 2BGWA 4LEIA 4X97A 1NLUA 2VP3A 3UXEA 3BE8A 3QKSB 1RHUA 5JZOA 1F9AA 3GLSA 3F73A 3PQDA 5EZYF 2X9QA 1WW8A 3JWPA 2EL9A 2J8ZA 2NU8A 2FY8A 1QQ7A 4H1UA 1BYUA 1XTRA 2AX4A 4JL6A 4E31A 1SURA 3GJSA 1N2OA 1SFRA 2J3MA 4X3CA 5FR2A 5C0OE 3ZWAA 2HLNA 2R2GA 4AN0A 1VYVA 1M6VB 2H5EA 1W36B 2PT9A 4D0NA 1DQRA 3LHIA 4IKOA 1EDOA 5A7HA 1F1JA 2PFKA 4QFBA 3TPCA 5KMGA 3W1EA 4WH0A 1V6CA 4Q4JA 1E1QA 2B5WA 3TLZA 2MYNA 1GGKA 4DCVA 4BMVA 4YRIA 5L9AA 4JB2A 4QPZA 2FLVA 3FFXA 1E3WA 1Z6PA 4KVAA 4TRMA 1S8NA 5I45A 4FPXA 4IQ4A 2W48A 1XCMA 4HB0A 1OILA 4XIJA 5KYTA 4OAQA 5BUZA 1FNBA 1T26A 1VCNA 3OUUA 5D84A 1P4SA 5TGDA 1Z5PA 2BZ0A 2R8ZA 4IDEA 5ULLA 5AKEA 3KQMA 2RK6A 4MVJH 3QX8A 4OXXA 2LBPA 5T5QA 3VV3A 3OZUA 1CWUA 2NO4A 1M0TA 4BBAA 4TZ6A 3GPDG 4REQB 3EY9A 4AMBA 3D6TB 3MJCA 1UFOA 4HVTA 5LYJB 2QY9A 3UA3A 5KOHA 5IASA 3PJFA 3DVAA 2B78A 4FFMA 4BVBA 1G0OA 5IT5A 3J80A 4MUJA 4UDNA 1STOA 2ZYAA 1QHIA 4UUAA 4YV0A 2QTGA 5JEEA 1H2WA 2D74A 2DWCA 5I7FA 4B32A 5AVJA 1ZM9A 2R1VB 4NYMR 2V3CC 3MUEA 2IXGA 4BNVA 1DAOA 3MERA 3CTPA 2OFPA 3EOAI 4UQOA 5FWXB 4ZCLA 3GRAA 2O7SA 1SXJA 4WK0B 1ZYUA 1DADA 1EVQA 1Q6YA 1BCSB 1IVYA 3E1GA 2HJGA 4PHGA 3CBQA 3NXKA 2YZ2A 2J08A 3OFND 1P0PA 1QDLB 1KSHA 1P7VA 4W5JA 4O1MA 2JZOA 5AIBA 5CDHA 2X1VA 4AX4A 2X77A 4GF5A 4GI2A 3JYPA 3FCOA 5BN4B 3GJ5A 3A1VA 3L7DA 3AR2A 1K7YA 2XMBA 1FRQA 4P3PA 3RK0A 3ZJVA 1XVVA 2ST1A 4UQPA 2VIIA 3ML1A 4Y2YA 2RHMA 3C8DA 1LBIA 3TNFA 1GGFA 5LQKA 5AM0A 3P0EA 1DEHA 1A4UA 4RK4A 1TIPA 1BD4A 1ZG3A 4OIFA 5KSPA 4R05A 3BTOA 4D0RA 5K3BA 1IJFA 2G3YA 2GPWA 2H8GA 2UZ1A 3EXIA 4E5YA 1DOZA 1JFVA 1U0FA 2HQBA 3FOCA 3GZJA 5JS2A 2IHBA 1Q19A 3KPYA 1Q1ZA 1QIMA 3AJRA 3C2QA 3CLUC 3KG2A 1T9AA 2QDXA 3UMRA 2JFOA 2YXNA 4ENTA 5LA6B 5JAUA 1CUGA 4QVGA 5LDDC 4KRFA 3DKPA 3C70A 4FP9A 4AS3A 2F00A 5H3LA 1E9SA 5I6DA 1OIWA 2O8VA 3BXOA 5SYNA 4G41A 4JN6B 1CPYA 2XOKA 1TL7C 1D9XA 2RCYA 1CX9B 1UXGA 3ELUA 3R5FA 3JX9A 1KZHA 3A7EA 2OVBA 4M88A 2IHYA 1J4AA 1HY3A 3JVEA 1KDRA 1G3MA 4LKOA 5G0TA 1JIXA 2I78A 4C14A 1P3JA 4S3MA 3ZVNA 4WLEA 4WLOA 3IPLA 4DV6B 3E8SA 2XXAA 5CLFA 5T64A 2FKAA 2VA8A 1EJBA 1K92A 2VHTA 4URHA 1XYGA 4XUDA 4NU0A 2XTMA 4RHTA 3PGLA 1RJEA 2VDWB 2Y1WA 4RD1A 2JFBA 4DLVA 4YALA 4OA8A 3WLQA 2CXUA 4GUDA 5EINA 5C3MA 5CFPA 2HHCA 2FPGB 3BF8A 4RJKA 3RS4A 3HCCA 2AFHB 3Q7SA 4BWVA 4DC9A 5DBIA 2OB2A 5FPHA 4DUZB 1QO0D 2HRQA 3TZLA 1H66A 1KMNA 3GNQA 1TK2A 2GXUA 3KEQA 4P32A 4AJEA 1AJEA 2V3WA 4MQMA 4Y2XA 5EJ5A 4MZXA 5B1HA 1ZH6A 3T1YB 5HTOA 2RI6A 1LDEA 3AFNA 3FHTA 3ZD9A 4B5KA 1Y6RA 1IBRA 2RGEA 1E9BA 2X5NA 1VE6A 4H17A 3F97A 4RM3A 3TXYA 3VZCA 4LJSA 1LV7A 1YS7A 2OAEA 2ACEA 4Q3KA 5A1JA 4E4RA 4DDHA 4DIUA 2OCYC 3UWSA 4U6SA 3AI7A 4YPVA 3VHXB 3BXGA 1JWBB 2O8FB 1D8TA 1Z5OA 1AY0A 3R0ZA 2SECE 1E3QA 3LVQE 2EYUA 1J06A 3EDRA 3VDQA 2JHFA 4OP2A 4ZO8A 2W2QA 1U9CA 4ZKEA 4ZOEA 1FFBA 1PRYA 4R8KA 4D6YA 4GPIB 2CLMB 2NWQA 4W6ZA 3G0IA 4K9PA 4Q03A 4WKBA 2IU0A 3L1JA 4MROA 3M1YA 1PJSA 3JWIA 5INTA 1SQ6A 4UXHA 1V8BA 3EC7A 3QKUA 3TM5A 1NFRA 2BCGY 3SC2A 4H77A 1R0XA 3QVJA 3UV6A 3DB2A 3PNKA 1V96A 4CCAA 1TGVA 2RAUA 3HDTA 4I1VA 1BGWA 1H5UA 2BP7B 4MWEA 3OZXA 4AIIA 5JTTA 4YHHB 3GEBA 4FEEA 1HT0A 4YRBA 3JQFA 2HQRA 1ODKA 6REQA 5K99A 3DTNA 4IDNA 2ZSAA 1C9KA 4IO0A 2V7EA 4JROA 3L02A 3BS4A 2G08A 4MI6A 4ZEWA 2I6FA 3C8HA 2E3JA 3CINA 1USIA 3OE4A 5TEWA 4ND6A 3CVOA 3P32A 4X7BA 1NV9A 1F60A 1P1HA 1EZ1A 2IPMA 2A3RA 2W00A 4DCSA 4ZEXA 2YMMA 3M89A 3RHFA 4M0FA 2WYOA 1GZ5A 2OP1A 2XWBF 1MJNA 3JXEA 4KC0A 4BBZA 4ZCSA 5DM2A 4B4WA 1IQPA 3F2VA 3FHCB 4D9JA 1XTKA 1Y9DA 4GR9A 4NICA 4QARA 4N54A 5F21A 3WGLA 5CXSA 2FQXA 4OXNA 5E1BA 2EIXA 3S2GA 1WF3A 3AIOA 4BMOB 4GLJA 1H9CA 1E92A 4JHLA 4RY8A 1TU0A 1DP4A 1GNVA 5DNAA 1FDTA 3WNQA 1WBBA 2ERXA 1IBMB 3RK4A 2E49A 5AW0A 1M8FA 4KFUA 5BWMA 3VU8A 5DBEX 1KVUA 2BEUB 2Q5FA 3EGIA 4G2TA 4URFA 1VE9A 3QVKA 4URYR 3TVYA 5DWVA 2QM7A 3K05A 1DLJA 2O14A 4TSFD 1UDWA 3H87A 4WOKA 1CP3A 2FUKA 3DUFB 1FXWA 4NKRA 1UKEA 1W30A 1VJTA 2XV1A 3O26A 3ZE0B 1MJGM 3O4JA 4TUYB 3HJBA 3QY9A 1P80A 4XVCA 1S1MA 2IHJA 3KTAA 4IILA 1W88B 4YMTA 5EIEA 5MHTA 4M9SA 5BNFA 2ZBQA 4PLZA 5EJ7A 1ISSA 4UFPA 1Z5UA 5ILGA 5CJJA 4QJ4A 1N0HA 3MGBA 3VPAA 2Q0XA 3NHWA 4BTEA 2P5YA 1CVRA 3BFJA 4GPTA 3EH2A 4C6TB 5C7YA 2VQFB 1F38A 1SR8A 1SBZA 2XQKA 1IRXA 1THZA 3D6JA 3CG4A 3LRPA 3ZEIA 3OTIA 4RV5A 4XR4A 4WNAB 1I0LA 3KUXA 5DCLA 8ATCA 2ORYA 4EUHA 1AMUA 4GPAA 1X1QA 5BT9A 1DC4A 4IIHA 3ZD8A 5ADHA 5LMUB 1W36C 4HXYA 3WX0A 4V0NA 4N01A 1P75A 4J16A 1FJ2A 4EJ2A 1T2CA 3LO5A 2DAPA 3GRRA 3BXEA 3VZSA 4PS1A 1UWVA 3TOCA 4WASA 4KREA 4HR7A 1RRGA 1TDJA 3ORFA 4TS4A 3FIUA 4QD3A 1WXQA 1AS2A 2REBA 4LTDA 1A9ZA 1GTL1 4YVFA 1Q1BA 3P2OA 2P67A 4GKJB 5CG1A 1SBIA 4O4JB 3EZFA 4MVJE 3KQPA 1UEIA 1WB4A 3G6KA 1MBZA 2GMWA 3ER6A 3FSGA 1EWYA 3A1DA 3PHGA 5AXAA 4XRGA 3A3YA 3LDHA 4MVXA 2NSHA 5DF1A 3NBMA 4XZ3A 3ZWKA 4AZ0B 1R9NA 2NZYA 3ZX5A 3B1JA 4Z5XA 1N2CA 3DEYX 2FSHA 3LPDA 4DM4A 1WY5A 1B4DA 3GJ4A 3BXXA 5FTNA 1XELA 2FNAA 1ZW6A 1KFJB 2AFHE 4L72A 2JKVA 3UXMA 5JXJA 1FX0B 2HK6A 1IULA 3O4RA 5CDTA 5F1PA 4UPDA 2G77B 1I01A 5EXEA 2E5WA 1Z34A 4MRAA 3DZKA 3OLQA 4HUTA 3C3XA 3EFHA 3BL5A 1KJWA 3MWEB 4TMKA 3ZI0A 3UK6A 4HDCA 3GJ8A 5H83A 1E2NA 4Z8XA 5LIRA 3AHCA 2V0NA 3KX2A 4WESA 5EIWA 4LF7B 3LAWA 3WRXC 4Y9TA 3ZKAA 4M8SA 4AZ3B 4E12A 2GJKA 3EEQA 2PYIA 4BB9A 4RL6A 3UJHA 4EB3A 3AOEA 4OYHA 2C77A 5JD5A 5KWSA 2B4QA 4LY3A 5K0SA 3NDJA 5FNVF 3R7WB 3ZV7A 1J6UA 1MZVA 2YWFA 4FYIA 5AUPB 3I2IA 2PD4A 1M2VB 1XYYA 2WIAA 3WS7A 4L0DA 2Z3ZA 3O7MA 2E1PA 4WY5A 2OWDA 3EVFA 3FSEA 1N7GA 3GCWA 2OFOA 3BKXA 3G17A 5FOUA 3SX0A 3TX2A 3WZMA 4ES6A 2QPOA 2C7RA 4MV0A 3H4MA 1IQRA 2BGNA 2F3PA 3O8DA 4N40A 4U0JA 5JVDB 3KXKA 3LYHA 2XCOA 4DZZA 5FUMA 1QH8B 3C0KA 4GKVA 4CF3A 4XAQA 3CXRA 4EW3A 4B3IA 1E3MA 4DEXA 4ZJPA 4PE5B 3GRUA 5ALMA 1RQPA 4O1IA 3T9EA 4HCJA 5KI6A 3PGXA 5AVQA 1NVMB 2NSLA 1N75A 5IBPA 2FFJA 1IM2A 1L4MA 1OLUB 3BGDA 3EGOA 3E2PA 3EQ6A 1U8CB 3T1TA 4KAJA 1YUBA 2A1UA 1V11A 5D7NA 1RMQA 4EUNA 3T3GA 1I80A 4UQLA 3QVTA 1L5YA 5CGQB 1DTEA 1K86A 5TVGA 4FMCF 4DMKA 1ADGA 1B3BA 4HQNA 4I99A 1AX9A 5ALSA 1GGMA 1RLIA 1M1UA 1XMJA 2P9GA 3UICA 4EYGA 3IEMA 1RAAA 1NUUA 3Q9NA 2VPXA 4TMFA 3KELA 2K6GA 3RUFA 3V34A 1E9AA 1IXZA 1AHHA 3FPEA 5G3YA 3BWBA 3TBFA 3V4ZA 2I2WA 1RZRD 3WA7A 5EJGA 1JU3A 5I48A 3AGQA 1ZA2A 4WW0A 1D2CA 3KYDA 2W2TA 2QP3A 3DE0X 1KAQA 3C8ZA 3A4VA 2HMYB 2IZ7A 2WWFA 1SA0B 2Q2NA 2AEEA 3GJ0A 1JIIA 4D0SA 1E89A 1EZ4A 1PR0A 3ZNOA 4L3VA 5KC9A 5GM2A 3UW3A 2ISSD 1QUFA 4QX6A 4NENA 4Q18A 4TRRA 3W2IA 1AHNA 3WQHA 4BATA 4CV2A 4ALLA 1CY7A 1BMFD 2DVMA 1TUIA 3DNMA 2YW2A 2GPAA 3KOXA 4TS3A 1CY8A 4NCXA 2G70A 5FUQA 1UDXA 4OLFA 2NVUA 2AW5A 3KT0A 5CM8B 1GVHA 2P75A 3TKYA 4FGSA 4W8OA 2GCNA 1ZD9A 2X6QA 3B9PA 2ZGVA 4X8LA 3ZXXA 4AJHA 4UFOA 2W6OA 4C0XA 5ADUS 5HR5A 4Q4HB 2BOVA 3V4OA 1BQEA 3QELB 4L9SA 5AK4A 4DNFA 2J6HA 4W5QA 3SQWA 4OLBA 1VJ0A 2VDMB 3P0HA 5HDBB 5J1TB 1MRNA 2LCIA 4FFNA 4Q9JA 1Q3HA 1O0SA 2G5TA 2FP4B 1Q84A 1J8VA 4UKDA 1DUIA 1FQKA 1NUQA 3NP9A 5DO9A 2L42A 5IC6A 3WWEA 2EATA 1PUXA 2IY8A 2Q5QA 1DPGA 3KK0A 4O63O 4U1RA 5B58T 3V7UA 4Y2QA 1T3HA 4TKUB 4G63A 2PT6A 2E6KA 3KIPA 4EHFA 4NULA 5BV0A 4HEA6 4QOHA 5A02A 4IUBS 5FDFA 3QY0A 4KQKA 2CVZA 3E0QA 4H18A 1NJGA 3M7IA 4NOKA 3O1HB 4HYTA 1T3ZA 1NW9B 2OD2A 3GVIA 4NPCA 3FBGA 1E9EA 4Y8VA 4YHBA 1RM3A 4ARUA 3D1VA 4X64B 4AJ2A 2R5FA 1K0UA 3GLVA 3E82A 3OEHA 4HP8A 1A27A 1RYEA 3D9QX 3KSUA 3REFA 1E0SA 1U8FO 5BNZA 5JMWA 4YLYA 3FOEC 1DBVO 5HQ3B 4MV6A 2LV8A 3E5HA 3LC1O 3B5JA 5LKRA 4NXNB 4FUTA 5DMXA 3F5DA 1XTQA 1RI4A 3R3HA 4AP5A 1O95D 2XYPA 5F1KA 4A1OA 3H9CA 3O6VA 4IV0A 5IT9A 5BUCA 1CQIB 3GI1A 5JS8A 7MHTA 2XDQA 3JQ7A 2CXRA 3PD0A 1X1BA 5CNIA 4JBNA 4ACBA 2O8BA 1LLFA 1CIJA 3CR8A 4RHXA 3C3KA 5BR1A 1UBRS 3PQ4A 1BVYF 3L7YA 1L5KA 2CL6X 3IT2A 1LCIA 1WTAA 3KKEA 4A8JA 2UYYA 1OBOA 2R7NA 4MV9A 1YACA 3ZGVA 2F8MA 4YMLA 3ERCA 3KL2A 4Q1BA 1JEQB 3A1SA 4PX5A 1PSWA 4CI0B 3IVGA 3RS5A 5PNTA 1J20A 4U2CA 4PF1A 4E1VA 3KOMA 3ESAA 5IZ4A 4YDSA 1CZUA 5FORA 1B0ZA 3MXOA 2FP3A 2ZI3A 3DOOA 4OHZA 1PWEA 4DANA 2ASVA 4OJKA 3PX7A 3SZOA 2V9PA 2XOEA 4JR0A 3TZEA 2R3SA 1TCAA 3HJHA 3LBNA 4JVNA 4ZQHA 1KH2A 1Z36A 3EAGA 2QORA 1AGPA 1F2DA 3PHCA 1S9HA 4HNSA 2G4VA 1MIOA 4JEHA 5A3JA 1GUYA 5DHSA 4ZQGA 4UHKA 5JAPA 5KYXB 3VISA 3IVAA 4NF2A 1BCRA 4KNVA 5GOTA 3CISA 3K71B 4B3MB 4QUBA 1KHTA 3WQRA 4JCCA 3UM9A 2G9ZA 1X7DA 4GR4A 1VJ5A 3ISJA 4QZVA 1CDOA 3CNQS 1II9A 2W11A 2EX1A 4G2NA 4ND4A 5TV2A 1JHAA 2ZBUA 4MWCA 4FFBA 1I0ZA 1IPFA 2QNIA 1MX5A 1XPUA 1JKJB 1L4LA 1NXTA 2QTHA 3AG6A 4HNAA 4XYGA 2UUBB 3EEOA 5LZ5A 4ZIRA 2HF9A 4P3YA 3C98A 3T1HB 2X0JA 4A92A 1CFJA 2FW6A 2J5BA 4H15A 1NPTO 3PUYA 4M8LA 1VJDA 3WJ2A 5TSDA 1VYTA 1L7VC 2P7IA 3K2QA 1K7CA 3RTCA 5HKAA 2CL0X 4G0ZA 1DKQA 3JALA 2JGLA 3DTVD 1JIKA 2XUIA 4KMMA 2GCEA 2PKQO 4ZICA 4QATA 1JAXA 1EGVB 4LHZA 1WZNA 3FPSA 5H3CA 4LZPA 3T94A 1GNQA 3P52A 5LZ4A 2J5RA 3T7TA 1OXSC 4LXUA 4PGFA 4Q82A 1X1RA 1XHEA 2W4QA 2FWRA 3NDPA 1JJVA 3ORYA 2QP4A 4IRMA 1FSGA 2Q4TA 2WIGA 5JIBA 5JPIA 4QASA 3Q6NA 2W2KB 3F8WA 1NRWA 5BURA 1FTYA 5I9TA 4ZDIA 5DK6A 3A4TA 2VXYA 4LXQA 1XJQA 1C8LA 3VBEA 1UBUS 1I6LA 1APBA 1MMFB 4IUYA 4P81A 5ALFA 3W2EA 3ZDDA 4A2PA 1RXVA 3UMGA 2C9DA 3QJYA 2E6UX 3G2NA 4BQFA 1HE4A 3T5DA 1WDTA 3EPKA 3MLEA 4LRTB 2NP6A 2RH4A 5DCYA 4NFYA 5CLLA 1RZUA 2HPVA 4C1NA 2DPLA 3WGYA 3SNKA 3FNBA 4KQHA 3PGJA 1DELA 1ZN8A 2ORWA 1B1CA 1NP6A 1OAOC 1XZGA 3A25A 3N74A 4V2IA 1KQNA 4DRZA 5AESA 4QGBA 4UVDA 1QLHA 2EX0A 5AVWA 4RTMA 1CS0B 3EVDA 4PC7A 3D0KA 5DHRA 2XWJI 4G8BA 1M54A 1KEEB 1Z8HA 3GJ6A 3HQ4O 4L95C 3ZBTA 2PBRA 5FBWB 2QTZA 2I4RA 1VGQA 1Z0IA 1J5EB 2QVYX 4ZYZA 2G8NA 2RE8A 3O95A 3UMSA 2AOUB 4LDJA 3FLAA 4B6EA 1GCAA 1JLSA 3AW9A 5EWLB 4TM8A 2FSVA 3CO5A 5T3YA 4B6FA 3W5DA 3Q2OA 1YS6A 3QIVA 4DLYA 3CLRD 5ECYA 3UATA 3ICCA 1A9XA 5EIAA 2QRVB 1KOJA 4R41A 2BJVA 3FMGA 1WHTA 4IL5A 2B92A 5E95A 4CG3A 1XAIA 1UM9B 3HSSA 3WV5A 1V1RA 1L6IA 1NSYA 3JAWB 4QQ8A 4B4KA 4LRWA 4F3RA 5F3DA 2CVPA 1J0CA 1SELA 4BWYA 5DWDA 1AUPA 1QWOA 4LV8B 4OV6B 2WKWA 5B37A 2PV0A 3C97A 2CMGA 1EESA 4XYMA 4XIFA 4MS4B 3ELDA 3RNLA 2AW3A 2WJJA 2X5OA 2ZQZA 4BKPA 3VSDA 1MZPA 2IZ1A 2OAQ1 2QPTA 3AKYA 2JCBA 2Q6KA 4C0AC 1G7RA 2ZRQA 1H2ZA 4MI1A 1A0OA 4BQOA 1EUDA 2HA3A 5DTQA 4PGGA 3ESQA 4CIDA 4FNAA 3AINA 1HZZA 4IMIB 4N12A 4U2EA 2QAGB 3P7MA 2FMHA 3EIQA 5KQSA 3HBFA 3ZDXB 5EQJB 5C8ZA 1U7XA 2KBFA 4Q24A 3GBSA 3EY4A 2ZETA 4LCBA 1XLTA 3H9BA 5BR4A 1XLWA 2P4QA 1US8A 4WCDA 1M7HA 1TKCA 4G5HA 4TN5A 4AG5A 5CBPA 4J1TC 3IC5A 5IFKA 4LA4A 2IDZA 1YR3A 2O8CA 3MJ4A 1MG0A 4JLBA 2IC5A 3BJZA 4GNKA 4ID9A 1O0BA 1G5HA 4IIJF 1TUEA 2BM1A 3HYLA 3D81A 3A2KA 1EWQA 4TLAA 4KPUA 2HFJA 1IG3A 1JHYA 2EJCA 3LOPA 4HZGA 2VNIA 1H9A