2HMVA

Diamond-shaped octameric ring structure of an rck domain with adp bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
139
Chain Sequence
NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords YuaA protein
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 45
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmvA00
4ALIA 2A4KA 3K73O 4CMCA 5CDYA 2Z95A 4KTVE 5KOIA 4CQLA 3WWYA 3DOOA 1T2FA 3QLJA 1DEHA 2C59A 2FOIA 3QHAA 2EJWA 1VSVA 3W6UA 1O8CA 3SC6A 1E6WA 4AJLA 1ZK0A 5F5NA 3NGXA 2A92A 3AJRA 4R5MA 4NZ9A 5CPBA 2C07A 3D64A 4ILKA 3E6AA 1NBOA 1SEVA 1MXFA 2J3JA 2J5RA 1J4AA 2G17A 4FCCA 5G0UA 2O2YA 1MX3A 1LQTA 4R9RA 2QRLA 4WNCA 4OHUA 4BNZA 4EJ0A 1QV6A 2GN4A 1Y6JA 3IAHA 1EZ4A 4AJPA 3O9ZA 5K9ZA 4IS2A 4FOSA 3B70A 3Q0EA 1PL6A 4NJMB 1T1SA 1NXQA 2XXJA 3CXRA 3PRJA 4U6QA 4BMSA 5L40A 1P44A 2EKLA 1HDRA 3BMCA 4IMPA 3JYPA 4FR5A 3JQFA 1L7EA 4XJTA 1NVTA 3F46A 5FI3A 1KIFA 4WPGA 3UGKA 3MTJA 1GYQA 4I08A 1W4ZA 1PQUA 3TWOA 3PJDA 4LSWA 2GRAA 2BHLA 2FY8A 4MIOA 3WQQA 3PZRA 4ND4A 2YV2A 4R1UA 3MJTA 1AN9A 1H9AA 1GFSA 3C24A 3OMLA 3H9JA 1VJ1A 5G0SA 1DIBA 4A03A 1P9LA 4OJNA 3V1UA 1MG0A 4FFOA 4J7UA 2QW8A 3UFXA 3K8ZA 4Y98A 5I9NA 1F8FA 4CM4A 4XRGA 4IDDA 5A3JA 4A0SA 2QIOA 5GZ6A 1I0ZA 3WYBA 4N54A 1P74A 1T2AA 3P7MA 1WMAA 2Q49A 2E48A 1NP3A 2QZZA 3I9KA 4BB5A 2JHGA 2JKVA 4XYBA 5T67A 1NX6A 4PLPA 4RDIA 1D3AA 1GY8A 1QYVA 3RI3A 4E2ZA 4RLHA 2RCYA 3D3EA 1FJHA 4E5MA 1E0DA 4OOEA 4D45A 1QV7A 4CLRA 5TT1A 4NIMA 2J8ZA 2ZB4A 4YJGB 3MOIA 1YJ8A 3JQFC 5AOVA 3GT0A 4I8XA 3DBLB 2EP7A 1EE9A 4D0SA 2FHSA 1E92A 2CFCA 4BGVA 3C1AA 3PHIA 4BO0A 5EL0A 3FF4A 4JK3A 2VZ0A 3ZU2A 4J1QA 3JYOA 2CUKA 3MZ0A 4BIIA 1WP4A 1SB9A 4IDCA 4RV9A 2C2XA 3PLRA 4Z0PA 4AJNA 5A5FA 1IE3A 2CDAA 2YY7A 3AI1A 4YAJA 2Y1GA 3VPSA 4QXMA 5EESA 1AHHA 2Y1CA 2P9CA 1T4BA 4EDFA 3HDYA 3ZCXA 1PZHA 3DOJA 4YRAA 2JCYA 4IZIA 3ZWYA 4DLLA 3ETGA 4MINA 4YDRA 4BNGA 4Z9FA 1RM5A 2WD8A 3U4CA 3ZV4A 1YDEA 2X7HA 2HRBA 3B20A 2RH8A 3JCZA 2VRCA 1QP8A 3GEGA 5KTKA 3JQGA 1JVSA 3HG7A 2D4AA 1A4IA 2X6TA 1LA2A 3FNFA 1DHRA 3ZH2A 1KEVA 4QEDA 1M6WA 2D2IA 3D7LA 3H9GA 4ALJA 5IDXA 4EUEA 3UUWA 4OM8A 3GAZA 3QY9A 3GG9A 3GFBA 1I2CA 3BA1A 4CQMA 1OMOA 3K2EA 3VPFA 1YJQA 3U9LA 2HQ1A 4TZKA 5CAEA 4BNHA 3NTRA 4NFHA 2EW8A 4TRNA 2P9EA 2X1HA 2X9NA 3I83A 4GLOA 4JBIA 4BO5A 2A94A 2FSVA 4ZJUA 1PJSA 5EERA 2JJYA 3VHRA 2GZ1A 3HSKA 3JQ7A 2PTGA 1K6JA 3ADOA 3RC1A 1H5QA 1Z74A 2ZYAA 4J91A 3F6YA 5TNXA 1IUKA 2O7SA 3ASVA 3VC7A 5HS4A 3OBBA 4YJFB 2HMSA 5ICSA 4LCJA 1K0UA 3KB6A 2ZIZA 1NR7A 2E6UX 3JYLA 4PGFA 3V2GA 3TDKA 1E1KA 2Q46A 5AXCA 5L95A 5BNTA 4GX2A 4BNJA 3V8BA 2VHXA 4ZRNA 4E30A 1U7TA 2DBRA 4RZIA 4AJ1A 1O94A 1YH3A 2IZ1A 3RIHA 3AY3A 1X0XA 5ITVA 3KHUA 1IOLA 1XYGA 3ICCA 1GUYA 1X1EA 3AFNA 2EGHA 2AEMA 3ABIA 5AXAA 4E5KA 4II3A 2FWMX 4I5DA 1SAYA 1GAEO 1Z7BA 2CF5A 2FSSA 1EVYA 3RU7A 3I4FA 5DZSA 3RUFA 1V8BA 5CDUA 1C1DA 3U4DA 5TJHA 4UAGA 2EKQA 1P1RA 3WS7A 3GVXA 4UUNA 2IDZA 3DL2A 2W2KA 4D46A 4L4SA 2TMDA 2GCGA 1X7DA 5EN4A 1ML3A 4CM3A 3T4EA 3JQAB 2DAPA 2CNBA 1HDCA 3N74A 4G2NA 1LI4A 4L0QA 1R0LA 4IM7A 5H82A 4KUEA 5IN5A 2WJPA 2O4CA 4A5OA 3PEFA 4RORA 4OOFA 4OXKA 2HMVA 1BXZA 1NWCA 1Q0LA 1V3VA 2BI8A 4ZHSA 3AUTA 1X7GA 3K5PA 4Q3DA 2PH3A 4KQXA 4OYRA 3FN4A 1XEAA 1VKNA 2X0JA 4WCDA 3GGGA 1LRJA 1XIVA 3TFQA 4PIVA 2O48X 3HZZA 2EWMA 3C8MA 4PG4A 4ZU3A 3HFSA 3WWZA 1ADGA 5K0ZA 4BGIA 3F4LA 4CODB 3I9NA 3ZNOA 3VAZA 1R4NA 3L6DA 2HDHA 3AWDA 3G0OA 3WSVA 2CZCA 2CVQA 3KEQA 1DIHA 3A4VA 2GZ2A 5DP2A 4NNJA 4XX0A 2V6GA 3PVZA 1ZW1A 4RJTA 3HWRA 5THQA 5ENVA 1AHIA 2UDPA 2OMEA 4KUGA 3RJ5A 2JD2A 3H3FA 3ZV3A 1K5HA 1ZJYA 1IL0A 2J3KA 4FOOA 4M8SA 5IG2A 1HEUA 4YRDA 1MFPA 4U8GA 2P5UA 1O0SA 3IS3A 1WNTA 1S7CA 2A9FA 4R68A 3VPHA 4EI2A 3QV1A 3WSWA 3HJAA 4W82A 4RO0A 4CM6A 4CMJA 3K92A 4R01A 2XXBA 4RVSA 3PPIA 5AXDA 3TQHA 2BGKA 4WK6A 2XPCA 4QTZA 3FBGA 9LDTA 3RAJA 3TZHA 4BGEA 3UCFA 4BS9A 3VH3A 3D4OA 2LDXA 3EY4A 4N5MA 5K6AA 1O95A 4RDHA 1NAHA 1KY4A 3ITDA 4HKTA 5TSDA 2EKPA 4J0FA 3KXDA 4DBZA 1QKIA 1LLUA 3K2BA 4FFNA 4N5NA 3RUIA 1I3MA 1PZGA 3WBFA 1HF3A 2VRCD 3BHJA 3PHJA 1CJCA 4RF4A 1VPDA 3UAGA 4ZICA 1LSUA 4QSMA 2PK3A 1HDYA 3GOHA 4L74A 3DZKA 3MEQA 4MVJM 3GDOA 3AW9A 3JV7A 4R3WA 1XG5A 4GGPA 3ST7A 2Y66A 4ZRMA 3C7DB 4CQMD 1B0AA 1ZZEA 1I01A 2O3RA 4KTTE 3ZWBA 2DFVA 1R15A 5KIAA 4DLAA 1OBFO 5TJ9A 4EGFA 1F8GA 1TEHA 3FR7A 4F46A 2CMDA 2EEZA 3CMMA 4ND5A 3ROMA 4CLDA 1E6EA 3IJRA 4F6CA 2O50A 4IINA 1IULA 1SZJG 4GMGA 1HZJA 5ES3A 5DP1A 3WXBA 3O8QA 3E8XA 3BXXA 3NAQA 2I3AA 1AXGA 5IDYA 2BFOA 1XQ1A 2O3SA 5CEEA 3LT4A 3GDGA 2FMUA 4CM8B 3T7CA 1UAYA 4Q9NA 4XGKA 2CY0A 5K6AC 1KS9A 3OEYA 5IZ4A 1ISHA 4KZPA 4B7UA 3RBXA 1MC4A 4PRKA 1VE9A 1M75A 1W8DA 4YAIA 3FPLA 1U8XX 2VYNA 2VTDA 4XEHA 4Y67A 1U2GA 3TRIA 4GAEA 4LSMA 2IYOA 4E21A 2BFAA 4DRYA 5IDQA 3ZDFA 2ZJ0A 1OOEA 2B5VA 4XKJA 3KYCA 1SNYA 3GZNA 3K96A 1PJBA 2YDXA 3BMNA 3DAPA 1UJMA 3OIGA 1YB4A 5DF1A 2P91A 5JDIA 1YB5A 2ZTUA 3QRWA 1JA9A 2NU9A 3JYQA 4FFPA 4AJJA 3B1KA 3VKUA 5EQDA 2ZTVA 3HFGA 4NQZA 2OL4A 4DIFA 3FR8A 3W8FA 2HRZA 3NJ4A 4AFNA 3AI2A 1ID1A 2QYTA 4GLLA 1HRDA 1EUZA 2RAFA 1HWYA 1EUCA 4OMUA 3UXYA 2YDYA 3V5NA 1HKUA 1E1NA 2PR2A 2UAGA 2FN7A 3NDJA 4FC6A 4O1MA 4YT5A 3PXXA 1P31A 5DCYA 4R1NA 1NVGA 4DPKA 1PR3A 3EAGA 4IS3A 1Y9AA 4FPXA 4Z0HO 2WD7A 3AM5A 4NBVA 3DZBA 3E5RA 5CP8A 3LC2O 3RUDA 3GMSA 1ISJA 1GQQA 3TOZA 3JD2A 2JD1A 2ZQYA 1TT5A 1ZO8A 4HFNA 5I7SA 3DBRA 4RQTA 2Y93A 1BRMA 4J7XA 4RPHA 3AOGA 2OBYA 4PLFA 1NFFA 1ZIDA 2BELA 4YQYA 3FCOA 4MP8A 4GKVA 1E7MA 5JDIC 3KSDO 4DQXA 2HUNA 4W6ZA 1MB4A 3HE3A 2VUSA 3GG2A 3VTFA 3MJSA 3DEYX 3DWFA 4JNKA 1FK8A 3GRKA 1LC3A 2HMWA 3PP8A 4E12A 2YHIB 4OSOA 3ZWMA 1E3EA 4YJHA 4CM9A 4FDAA 2GN6A 2AA3A 2PGJA 3BHMA 4WLNA 2DTXA 4IIUA 1JLLA 2Q2VA 4GH5A 4WCFB 5I8ZA 5I7FA 1YKFA 1NPTO 3E9MA 4Z9YA 2CDBA 4E2YA 3KEOA 2NVWA 1Z73A 3GNTA 3BIOA 1B14A 1E7YA 4J1TA 1LNQA 3EZYA 2AEFA 2BGMA 5L51A 3H5RA 2DPGA 4PG7A 3INGA 1C14A 4J4HA 1DSSG 5A5EA 5KJ1A 1LQUA 2X58A 3ENNA 4A10A 1ZK4A 2WTBA 5B1YA 4W7IA 4WLEA 4EEXA 1O5IA 3KTDA 3TFOA 2IODA 1LRLA 2ET6A 3S2GA 1G0NA 3RVDA 2FP4A 3CPSA 3LDHA 1HDZA 3C3XA 4PZDA 2O3UA 3GF4A 4LMRA 2W8ZA 2NVBA 1W0CA 1YQXA 2QYSA 2YV3A 3G3EA 1SCUA 3RC7A 1U4SA 3TZ6A 3DAGA 2VT2A 4WNIA 2VHZA 2VOJA 3RC9A 4YAKA 5DBFA 3K9QO 4EZBA 1I3KA 1I5RA 4LMPA 4W99A 3I9JA 3ZU5A 4DIOA 4GQAA 1GEGA 4WEQA 2FPGA 3FNGA 1H93A 3ZWNA 2AE1A 1R4MB 2PZKA 3KLPX 3RASA 9LDBA 1QMGA 1GYPA 2Q3EA 2CDCA 4PLYA 4HXYA 4IBOA 3V1TC 2Y1FA 3F1LA 1L7DA 3C7CB 2DBQA 1NQAO 4Q3BA 4DYDA 1SEPA 3HN7A 2X5OA 1UUFA 2WYUA 1QYDA 1QG6A 3PZBA 1PS8A 4MP6A 1UDBA 3RUHA 2E4AA 3A9WA 3V2UA 2VYND 3GVHA 3L0DA 2WE7A 3NT5A 5DOZA 3EYWA 1B16A 1O9BA 4Y6SA 3WYCA 1DRWA 5IDWA 2R00A 2YQ4A 3VVCA 4YR9A 3GFGA 4PLVA 3GVIA 3SJUA 4YT8A 4BO8A 2ZK7A 3W4KA 3AUUA 3PFWO 1PQPA 4YBZA 3S1LA 2FR8A 1NYTA 3P2YA 3IOYA 3OQ6A 5C37A 3HQ4O 5IJZA 2DC1A 3CSDA 1P0CA 3QE3A 1ISIA 5L45A 1Y8QA 1ZUD1 3OECA 1Y8RA 4BKUA 3RCBA 4EEZA 4JBHA 3PIDA 3D5QA 1IHXA 6LDHA 4IJUA 4CMIA 4BO9A 3A06A 5CDGA 1PJ4A 1X1TA 3B1JA 4N18A 4R9SA 5L4SA 3CINA 4Y8VA 3PJFA 1BXKA 2G82A 3UN1A 5FF9A 2HO5A 1LDGA 3C1TA 3LLVA 4XR9A 3TNLA 4FJ2A 5TRTA 3QIVA 5IFLA 4INAA 3VH1A 3KO8A 3AU9A 3WLEA 4OH1A 2PZLA 1HTBA 5A9SA 4B4UA 4MIEA 1KVSA 3L9XA 5KJ6A 3F9IA 1C0IA 2H1SA 4BNVA 4B4WA 2YW9A 1E3WA 1BMDA 4UEKA 2HK9A 3PYLA 5DCWA 1ENPA 1DJNA 2QX7A 4PG6A 2V6BA 1JAXA 3RU9A 3WGTA 2VHWA 1R6DA 2R00C 4S1VA 3LT2A 2AHRA 3G49A 1A72A 4PCVA 3EDMA 1D7OA 4DC1A 3OA0A 3OM9A 3GPIA 3IIEA 2GR9A 1ONOA 2O3TA 1C0KA 3H4VA 4IQGA 4LW8A 1I2ZA 1RM4A 4IDGA 3GDFA 1LDMA 3I52A 3L07A 3JYNA 5HRUA 3S8MA 1DBVO 3UH1A 4XIJA 5HWSA 3WQSB 3BMNB 3Q6IA 1DRVA 2Q1UA 3DBHA 4R51A 5IAAA 4TKMA 3NKLA 4RQUA 1NNUA 4DIBA 4DGSA 1DFIA 1YGYA 4MOWA 2D0IA 4CM9D 4DQUA 5JC1A 4AJEA 3LZ6A 5FWNA 4XYMA 4UVEA 1PJ3A 4K1LA 5ILGA 1GPDG 4IUYA 3M1AA 3RROA 4DMLA 2OORA 3WLFA 4IXWA 2GF2A 4XRRA 3RFXA 4RPLA 1LLQA 3TJRA 1M67A 4WUVA 2D5CA 3X2FA 4J49A 3W4JA 3PYMA 1GYRA 2X86A 1WDLA 5TGDA 3TZQA 2I3GA 1T2DA 2A35A 3WJAA 1PU2A 2EERA 1HDXA 4NH4A 1GD1O 2LDBA 3V2HA 3KRTA 2NVUA 4BQPA 2AQIA 4BB6A 5U1PA 4Z6KA 1R0SA 3DFZA 4OIMA 1CEQA 4YT2A 5GMOA 2I6TA 1MA0A 5L9AA 1ADCA 1MLDA 2YQ5A 1N9GA 5GZ3A 1EVZA 4NDNE 1U5CA 4EJMA 4FN4A 4JQCA 5CPFA 4Y6PA 5JC8A 3GC6A 3O4RA 1KC1A 1BXGA 2PGLA 2WE8A 5B37A 3LLSA 3JQ6A 1BHSA 1VL0A 2BD0A 1R37A 3E5MA 1GZ3A 4XQEA 1MC5A 3PWKA 3S55A 3IMFA 3G1UA 1O89A 2UYYA 3JD0A 1ZKMA 1EFKA 3NV9A 4MKXA 2D8AA 1JKIA 3OP4A 4J43A 3OJOA 4ALLA 4PLGA 3KYDB 1CETA 3PJGA 5CDSA 1Y5RA 3V1YA 2O3QA 2Q1WA 5B4VA 3HDHA 3GHYA 3ORFA 1H6CA 3OJ0A 3FTPA 2BFMA 2PY6A 1HLPA 1W73A 2PLAA 5JCJA 3GQVA 2X22A 2PKQP 4E2XA 1NASA 5TX7A 4PG8A 1PX0A 2Y67A 4R69A 1T26A 2HMUA 3QVTA 3MTGA 1QYXA 3CEAA 4GI2A 4YT4A 4RVHA 4PZEA 2G76A 3JQ8B 1DDOA 5I9MA 2VN8A 3GUCA 2OP0A 3BMQA 3D3WB 2VWHA 3AY7A 3F4BA 3OQ1A 3P19A 4W7HA 4BMNA 3EW7A 4BNLA 1F14A 3PFFA 3ROKA 4P22A 4WLVA 3LYLA 3SLGA 3INTA 1U3UA 3BTSA 3BAZA 3H2SA 1LDYA 5LC1A 4HFJA 4CMEA 3ZNPA 3QWHA 2Z1NA 5KCZA 3KM0A 3OJLA 1I32A 4IDBA 1VI2A 2AXQA 1BW9B 2DTDA 3DO5A 5JO0A 5LDGA 2PD4A 3BMOA 4ZQFA 1T25A 1Y9EA 2YJZA 5MDHA 4PLTA 1Q7CA 4DXHA 3PWZA 1AUPA 3PWSA 4Q3AA 3RC2A 4D79A 1LRKA 4GPD1 1J49A 3WOHA 4YEDA 4HUJA 2IZ0A 1OC4A 2B83A 3P5SA 1DAOA 4RZHA 4FFMA 2ZJ1A 5G2OA 3VZRA 4YAGA 4GSLA 5B4TA 4KWHA 1PGQA 2HJRA 4MVJI 4A2CA 4D41A 1Z82A 2NU7A 1LX6A 2RHRA 2E49A 4P4NA 1HT0A 5EINA 5B12A 4BO4A 1UP7A 1XR3A 4CMEC 1YOVA 4CM7A 5JXWA 4CV1A 3OFSA 5EMHA 3ANNA 4BUCA 4L9RA 2R2GA 2OXIA 4XIYA 1HXHA 1P1IA 3LT1A 1CF2O 1GR0A 1Q2XA 4C7JA 3F3SA 4A7PA 5BT9A 1C0LA 4EITA 4EUHA 1ZXBA 2PD6A 3HDJA 2ZB3A 5JPIA 4UVHA 3D4PA 2X0RA 4YPOA 4BKPA 3D4NA 2DLDA 4ZQGA 4E3ZA 2RH4A 4TVBA 3ZWOA 4B7XA 3GVPA 4Z3KA 3WNVA 4NFSA 1SB8A 4M86A 4LRSB 3TF5A 4ALNA 1ENZA 4J3FA 3I1JA 4NK5A 3Q2IA 2ZCVA 5EIOA 1ZK3A 3B6ZA 3O03A 1C1XA 1QYCA 5A3VA 2JCXA 2HK8A 5DCUA 3PQFA 4MVJP 2GPTA 4R4JA 3EMKA 1FDUA 3E9QA 5TQVA 4CM1A 1SO8A 3RUEA 3WR5A 4BMVA 1G0OA 2WYVA 3ASUA 4MIYA 2E37A 5JW6A 2XAAA 3GR6A 1LSOA 4R54A 3EVNA 5BSHA 2X0NA 2X9GA 4CV0A 3JD4A 4BO3A 1ZVMA 2I5PO 2WEKA 1MUUA 4TRJA 4J9VA 4CQLB 1KEUA 1PS0A 2FPPA 2D3TA 3ZU3A 5EPOA 4LK3A 3GNSA 4I9UA 3UOGA 1DIGA 3AOEA 5CHEA 4E2WA 1GV1A 1A71A 1UXJA 1ZK2A 2DPHA 1JTVA 1X15A 4WKGA 4DL9A 3KZVA 1V35A 5DNAA 3AK4A 2OUIA 4AJ4A 1P1JA 4YB8A 4AJIA 3VOSA 1NQ5A 1VJTA 1HDGO 3AUSA 3GEMA 3JD1A 4DUPA 2QHXA 4CV3A 5AXBA 1E7RA 4J1NA 2NLOA 4AJ2A 2I65A 2X9VA 1FDVA 1SBYA 5JY1A 1Q7BA 5HBRA 4LVUA 1P45A 5JCJD 2CF6A 1B26A 1HE2A 3D0OA 3E03A 4KDFA 4MVJA 5TIIA 1UZNA 3WFIA 5CG2A 4WLFA 2UV8A 3INRA 2BMAA 3BMCB 4M55A 4UEOA 5IXYA 2HCTA 5BR7A 5L7TA 3R0IA 4FQ8A 5A05A 1K2WA 3RQSA 4DYVA 4I5FA 3DHEA 1BVUA 2NVUB 4CLXA 3IL2A 1OAAA 4X54A 4OXYA 2RBEA 3QVXA 4YXFA 4E5NA 3NEPX 2CVZA 1JU9A 1KC3A 3FHLA 3OF2A 3O26A 3DMYA 1B7GO 4KUHA 4OQYA 4EUFA 3AOEC 4IGEA 4Z0TA 3I6IA 4Z9XA 1U28A 5L7WA 2I67A 4BKQA 5F1KA 3H8VA 2POQX 4UULA 1YXMA 2DKNA 3EVTA 5I7EA 5KJFA 3PK0A 1IY8A 2JHFA 5JNLA 3RUCA 1WZIA 4PLWA 2C20A 3HB5X 1N1EA 4Q3CA 3F5SA 2PWZA 5JE8A 3IP3A 1UZLA 3CH6A 3I4CA 1NM5A 1YB1A 1ZH8A 4YYZA 4P4GA 3IKTA 3G17A 4A73A 1BTOA 1ONPA 4CLRB 1E3SA 2GLXA 4FFRA 1DB3A 3RBVA 2J3HA 1S6YA 3NDRA 1U1IA 1XSEA 8ADHA 1FDWA 4BQRA 3LC7O 4BNKA 1QR6A 1GCUA 2P2SA 1KETA 1CQJA 2Q1TA 3PQDA 5I9LA 4CLOA 1C3VA 1VM6A 3KV3O 4YAEA 5JCXA 2OZPA 2EV9A 3B1FA 4PLZA 5C5IA 1PSDA 1T1RA 3GN2A 3VVBA 5G4KA 4CLHA 1K89A 2OOSA 5B4UA 1RM0A 3GUYA 1N8KA 2IEBA 2VHVA 2O7QA 1DHTA 5ER9A 4D44A 4CUJA 3OICA 2QRKA 1Z7EA 1A7KA 5I7VA 5AQ1A 4GBJA 5JBIA 3IUSA 5CEJA 1K3TA 2V7PA 3IQDB 5GY7A 3RFTA 4E32A 1KERA 2NU8A 5DULA 4XYLA 5LCXA 1I2BA 3P2OA 2QG4A 2V6MA 1IZ9A 3OJEA 4BNUA 2DUUA 1PTJA 3TZCA 5C7LO 2EXXA 3BMOB 3JQGB 3PGJA 1ZCJA 4EYEA 5KKCA 2IZZA 4DPLA 2XF8A 5T64A 3DXFA 1P3DA 2ZQZA 4RVGA 4BNFA 1A4UA 3MOGA 4LVCA 1JN0A 4NU6A 4J4BA 1EEHA 3LSYA 4IY1A 4OSPA 2VWQA 2AQHA 2H6EA 3F5QA 4QX6A 4CQMB 1LLDA 3KVOA 4NBRA 5KVQA 3FWZA 2DFDA 3IDSA 4K6CA 3A1NA 2UUPA 3I23A 2ZKLA 2H9IA 5JMWA 2AQKA 3FWNA 3ZN2A 1E1LA 2W98A 3JQ7B 3OSUA 5ICMA 1ZSYA 4JJIA 2B69A 4YJDA 1R0KA 4TZTA 1X13A 2JL1A 3OHSX 4U5QA 3ONDA 1D1TA 3G79A 7ADHA 3FPCA 1K6IA 4LCEA 3EGOA 1Y7TA 3ZI0A 4IQ0A 4JJGA 3L77A 4HADA 4OKNA 4NJMA 4OL9A 1J6UA 3NT2A 1GADO 2GO1A 4QFDA 2FZWA 4GX5A 2NACA 1ZEMA 5IN4A 3NYWA 1SPXA 3ZGYA 1JW9B 1N1GA 2PKQO 3EHEA 2YZ7A 4G81A 1FDTA 3ONFA 2AMFA 4E13A 2BF7A 1T24A 2BGLA 3VH4A 4JROA 2O2SA 3DZHA 4XD2A 1LEHA 2Z1MA 4LGVA 2PZJA 4R5HA 4F6LA 4MVJD 2JFGA 1NQOA 1ZSNA 1C1DB 2X0IA 3RKUA 4UUPA 3CZMA 2Q4BA 1ZMTA 2X4GA 3VTZA 1E5QA 1N2SA 3OQBA 1B8VA 4B79A 2D59A 1ARZA 2W2KB 3RWBA 4NPCA 1KYQA 1NHGA 1EBFA 1F0YA 5CG1A 4CL3A 1LDNA 1PGNA 5L4LA 1Z45A 2W2LD 1SOWA 3L4SO 4HWKA 1RJWA 1BG6A 4QUKA 5DDIP 1AXEA 2J3IA 4W4TA 4TRMA 4KP7A 1DIRA 2G5CA 4H16A 3ZZNA 1YL6A 3GGPA 3WMXA 3KSZO 4RVDA 3H2ZA 4JXKA 4ROSA 4FIZA 3UHAA 3WGQA 4BOYA 4YJGA 4O6VA 4YVFA 2GD1O 4NBUA 2RIRA 5HM8A 4ND1A 2C7GA 3DBLA 2NQTA 2Z5LA 2AG8A 3JTMA 4BVAA 1RYEA 3ZW9A 2PGDA 3G1TA 1T2EA 2RHCA 4RLSA 3PTZA 3H9QA 5KVVA 4QECA 6ADHA 1WZEA 5DBIA 1R4NB 4IDEA 1HYHA 4CLEA 1Z75A 1HLDA 3K31A 3U5TA 4M87A 4IMRA 3SXPA 3KYBA 4XDYA 1VSUA 4IPTA 4IXTA 1GZ4A 2C7VA 3W4IA 1EDZA 3ZHBA 1PJQA 5A1TA 1ZMOA 4BO7A 3R3JA 5CFZA 1P1KA 1JVBA 2VQ3A 3SVTA 1FF9A 3QVWA 4XYGA 1X0VA 2W90A 4E5PA 1WWKA 3GHHA 5T5QA 3I5MA 5LDHA 2F1KA 3ETEA 1NTOA 5COBA 2B37A 3RUAA 1EUDA 5TT0A 3SLKA 3WGIA 1OI7A 1VLLA 1PJ2A 2QQ5A 1J5PA 5KJEA 3QW2A 4PVCA 2B4TO 2IEDA 2NTJA 3WB9A 5G0TA 4HNHA 3GA0A 1EQUA 4CR6A 3QP9A 1EVJA 3H5AA 1ISMA 3M1LA 3PHGA 3I9LA 4JGBA 1UXKA 2Y99A 3ZWWA 4O59O 4XQGA 3BHIA 1CRWG 2I76A 4N5LA 1PEDA 2NSDA 1VRWA 4B3HA 2Y1DA 5C3MA 4I9HA 2I99A 4XQ9A 3JQ9A 1DXYA 2C82A 4UVDA 1A7AA 1DLIA 3CMCO 4B3JA 3ON5A 2YYYA 3H9UA 4ZN6A 2CVOA 2NU6A 4JX8A 1U5AA 4ZA2A 1EVIA 3WGHA 5L4NA 3UCXA 1LJ8A 2X23A 1I8TA 3DOCA 3DFUA 1CIVA 4GMFA 3KETA 1YQDA 2Y1EA 2YFQA 4GX0A 2XOXA 3DR3A 2NQ8A 5C7IO 5DOVA 1ZSVA 2NUAA 1T4DA 1Y81A 3RSHA 2AW5A 2VWGA 4YJFA 2WWRA 1EMDA 1G6KA 2G0TA 5TF4A 4CM5A 4MJLA 4RPKA 4JP2A 3GZ4A 1PQWA 4D3FA 3QSGA 3SBOA 4MDHA 3M6IA 4MVJE 2X5KO 4XCVA 3DB2A 2VZ8A 3O8QB 3GVCA 4L4XA 4ONEA 5G4LA 5KJCA 3OA2A 4GL4A 1HE3A 3S2IA 5CDTA 1BGVA 4ZQBA 3RFVA 3I3OA 4ZD6A 1H94A 1I36A 1L1FA 5U4QA 2O3JA 4IQ8A 1YONA 4EW6A 1NFQA 4J16A 1YL7A 2C54A 4OQZA 1NWHA 3JQ9C 3ZNQA 1KY5A 1EK5A 2FRDA 5BQFA 1ISGA 1GPJA 1SOVA 4KWIA 3EK2A 3PYXA 5H83A 4CMGA 4RVUA 4K28A 2P68A 4CL8A 1TVEA 4FD3A 4H7PA 5FEUA 4E6PA 1PZEA 4ITUA 4P38A 1B3BA 3PDUA 3JQAA 4KDEA 1ZNQO 4XJSA 3KYCB 1MGOA 1O6ZA 4GWGA 3GZNB 4K6FA 5JDCA 3FRJA 2PNFA 1OZAA 5ENDA 4B4OA 3OEWA 5BSGA 1E6UA 4XYEA 2E82A 3IKVA 4DBVO 1JWBB 5KKAA 2OO5A 3HNPA 2O23A 3RD5A 2R6JA 3KOUA 3K30A 2FZEA 8LDHA 4WGGA 2HK7A 3GNQA 3QQPA 1IZ0A 1PWXA 3H3JA 1U4OA 4B7CA 2H63A 5KNLA 3SC4A 3WG9A 1R12A 3HB4X 2Q45A 3MJ4A 4YCAA 3IP1A 4L4RA 4JP3A 4MPDA 3DONA 2JAHA 2IXBA 1N7GA 3N58A 1FMCA 5L7YA 2YFHA 1WLYA 5IXSA 1Q0HA 2EW2A 2WD7B 1MP0A 1EQ2A 2GUGA 5H81A 5HA5A 5F1PA 4LN1A 4NG5A 1XCBA 1IPFA 1IPEA 4YACA 2AG5A 1GUFA 2NV6A 1TT5B 1NPYA 3DBRB 2X5JO 1PGOA 1DC4A 3C85A 4BNMA 2B0JA 4BL5A 1LDBA 3PHLA 4QQRA 5JDCC 4IZHA 1U9JA 3FD8A 2AE2A 4Q3NA 4WOJA 1CDOA 1P77A 4PZCA 1TA4A 1NQTA 2X8LA 3L9WA 5THKA 3ZW8A 2DQ4A 3OIDA 4FGWA 4LRTB 3D5TA 5A4DA 2CD9A 3TL2A 3NDIA 3Q9UA 2BFPA 4FJ0A 4MKRA 1VC2A 3OETA 4KOAA 3ZWCA 1TLTA 5TC4A 4XZ3A 1A9ZA 1VJ0A 3KBOA 2B35A 3Q11A 4Q3EA 4YJHB 5F5LA 4D42A 2BLLA 3BYZA 1HZZA 3Q2KA 4O0LA 1TI7A 2GDZA 4OXNA 3CKYA 3GMDA 4U7WA 3U62A 2NNLD 4JBGA 3WJ7A 3R3SA 2WMDA 1J0XO 1BWSA 2Y68A 1XGKA 4AG3A 2GZ3A 4ID9A 2I66A 1HE4A 4CUKA 1PJTA 4NBTA 2ZCUA 3BTUA 5BNIA 1XHLA 2C0CA 3OIFA 3H9EO 3NX4A 5JLAA 1JKFA 1UAGA 3GY0A 3GAFA 4PLHA 2HMTA 1DAPA 4N7RA 1P1HA 3NTOA 3W8EA 4GGOA 4URFA 4RF3A 4CR8A 4YWJA 4WASA 4F45A 3QJ5A 4FS3A 1U3TA 2FPIA 2WYWA 3NJ8A 4UEJA 3MJVA 2VRBA 1K6XA 2IE0A 2ILTA 2ZTLA 5EJ2A 4IJWA 1EDOA 4HFRA 3LF2A 1RM3A 1YS4A 7MDHA 1ZEJA 4CM8A 4E0BA 3IC5A 1JKJA 4OKIA 1G1AA 1ULSA 3QWIA 3VDQA 5C7OO 2JD0A 5FFFA 3WGZA 3WNQA 2VWPA 4YA6A 4ESOA 2YV1A 3JQCA 2QRJA 1WPQA 5JS6A 1UR5A 4HFMA 4WLUA 3BZUA 2V6FA 2JCVA 4GWKA 3EZLA 4CV2A 3NGLA 1QLHA 1H0KA 4XGIA 5L3ZA 1IYZA 4KQWA 2B4QA 3ZHZA 1GV0A 2PKRA 1EBUA 1LU9A 1ADFA 4NJOA 1CWUA 4M89A 4A26A 3ANLA 3DZFA 4BKRA 1XDWA 1FDSA 2HU2A 3PGXA 2DTEA 4HP8A 4MKZA 3VDRA 2HAEA 3ETDA 4I5EA 2FR1A 1E3IA 1M2WA 4JCOA 4PFJA 4TMFA 1H9BA 4I9NA 2HLPA 1V3UA 1Z6ZA 1GU7A 4BO1A 4PN3A 4FJ1A 1TXGA 1ISFA 2PH5A 3S2EA 4J2OA 3DZJA 3LK7A 3CTMA 4I5GA 4QO7A 4DQVA 1I24A 1GQ2A 1U7HA 3TZKA 1Q7GA 3JQAD 5JAZA 3WYEA 2DT5A 2W4QA 4WE3A 4B8WA 2GASA 2GSDA 1H2BA 2EHDA 5AVOA 3FTNA 1KOLA 4J0EA 4IDAA 1DJQA 3ITKA 1PR9A 2JAPA 1Y8QB 3R6DA 4AJHA 1ADBA 1Y8RB 3VZQA 4E33A 3DBVO 4PVDA 3ZWVA 3PI7A 5T6BA 4CMIB 2HKIA 4J6FA 3UF0A 4YQZA 1E1MA 4XA8A 2YHUA 4G65A 3S2FA 4XGNA 1XWFA 1D8AA 3VPGA 1U8FO 2I9PA 5ILOA 1RKXA 3DMTA 5A02A 1DC6A 2BI7A 2J5QA 5JFOA 3WQRA 3DHYA 2GYYA 5J23A 3W1VA 5A9SB 1XKQA 1UZMA 1GL3A 1NAIA 3SX2A 3I6QA 4J1SA 3ANMA 1E3WB 4B3IA 3AUAA 1A5ZA 3F47A 4RPJA 4XR4A 1YDWA 2Q99A 1PIWA 4NMHA 4FGSA 4MP3A 3IJPA 3CIFA 1Q0QA 4M1QA 4ND3A 1XELA 3ZWXA 4RL6A 3DTYA 4TWRA 2PD3A 3E1KA 4BNNA 2YHIA 1H6BA 1NHWA 4WOKA 4UVGA 3WGGA 1F17A 1VL8A 1IHYA 3AFMA 1JQBA 3L6OO 4U0KA 4FB5A 5COQA 3WIDA 4M49A 1PWZA 3ROQA 4Z3DA 1Q1NA 3AY6A 4WCFA 3MCVA 4GX1A 1YBMA 4GSKA 1MV8A 4XB2A 5G0WA 3RJ9A 2P9GA 3QWFA 5HS6A 3BTOA 4A27A 4CUZA 4MVJF 3HUDA 2Q4EA 1YO6A 3QA9A 3JD3A 1KVTA 4TQGA 4BNWA 4BNIA 2B5WA 3DBHB 3DMTC 2VTEA 4I1IA 3PIIA 1UXIA 2HJSA 4FBGA 1WVGA 2DUWA 1I3LA 1YRLA 3K6JA 2CSUA 1LUAA 4P4LA 5IF3A 1D4FA 2DVMA 3ZV6A 4D43A 1ZFNA 2ZTMA 3DC2A 4TROA 2GGSA 1NVMB 4AJOA 3ZNNA 2J5KA 2VNAA 4B4VA 4QT0A 1DO8A 4QFCA 3GRPA 3LVFO 5F1OA 1BDBA 3UCEA 2VCYA 5JAQA 1CYDA 3CE6A 3GK3A 5F21A 4NK4A 1V3TA 1QXSA 2DU8A 2G1UA 3EUWA 3DQPA 3MWDB 2W2LA 1HDOA 2C2YA 3M2PA 3A28A 3H7AA 5DBGA 3C1OA 4WCFC 1N9GB 3GH3A 4AICA 3VKVA 2PV7A 3MWEB 1R4MA 3AU8A 1UXHA 3Q9NA 5JO9A 1C0PA 1R66A 2DM6A 4XDZA 4K9DA 1HETA 2DBZA 4Y9DA 4RPGA 1HSZA 1BXGB 4NHEA 5JMPA 1H2HA 4RF5A 4CMBA 4R16A 1NPDA 4F3YA 1JDJA 3U3XA 3TOXA 1PGJA 2NWQA 2V65A 1KEPA 5TLSA 5A03A 3JQEA 5KVCA 2EGGA 4IDFA 1EE2A 1EFLA 1LBEA 1KVRA 1MG5A 1R16A 2Q1SA 1N7HA 2OP1A 4QO8A 3HN2A 5MGBA 4UUMA 1UDCA 4K26A 3ZWPA 1YVEI 2VHYA 3ICPA 4OGWA 4BNTA 5BNFA 3JQBA 3LQFA 4Y6RA 3X2EA 3DZIA 5COAA 5TS3A 1SMKA 1CERA 1IB6A 1PGPA 3GLQA 3U4IA 4AL4A 4EBFA 3H6KA 4BHTA 4E4YA 5BSFA 4KMSA 3FBTA 3SJ7A 3ZU4A 1B8UA 1CQIA 1HYEA 4II2A 3WGOA 4IJKA 3WICA 5BSEA 1PZFA 4FC7A 3TL3A 1GTMA 1E3JA 1GQYA 2BH9A 1HE5A 4G5HA 3LT0A 3W6ZA 4ALKA 4PG5A 4NI5A 1W6UA 3H5NA 1JWAB 4DC0A 5KWEA 1ORRA 3CZRA 1XU7A 2D1YA 4MVJG 2Q50A 1DFHA 1QORA 3UICA 5L53A 2BKAA 3ULKA 3BMQB 3WTBA 1PL8A 2VYVA 3QVSA 1ENYA 3COSA 3I9OA 4IIVA 3Q3CA 2HSDA 4YTEA 1YQGA 3PJEA 3C7AA 3DAFA 1GZ6A 2VT3A 4TKLA 4ND2A 3MJEA 1XA0A 3U4HA 1I10A 4CM4B 2EIHA 3VH2A 2ZB8A 1E3LA 3LF1A 4P8RA 1WW8A 2VUUA 4ZQHA 4O5OA 4D3SA 2UUOA 4L76A 4JN6B 3E9NA 1H6DA 3E18A 3JQBC 3U09A 1KVQA 1ZK1A 4GVLA 5G0VA 4DTIA 4OAQA 1V6AA 1YBVA 4Q39A 1MXHA 1QYWA 1OFGA 4OO3A 4XB1A 1NFRA 1T2CA 1ZJZA 4GVXA 5A04A 1DIAA 1RWBA 3NUGA 5JYDA 1HSOA 3ROPA 1V9LA 3R1IA 1M6HA 4U6SA 1H6AA 4UVIA 1DOHA 4WECA 1GEEA 3D1LA 3UKOA 4DWVA 3HHPA 4ZVVA 4BNYA 4BO6A 4DVJA 4RGBA 4BO2A 1AE1A 2B36A 2WM3A 3L4BA 2H5LA 4L8VA 1I30A 2BRUA 2JFHA 2FR0A 5HTOA 3SEFA 1BSVA 3ZHYA 1XQ6A 3ADPA 2GNAA 2P5YA 3WBBA 4C7KA 4HV4A 1YOVB 3OH8A 4RF2A 5A9TA 1UP6A 3U49A 2Q2WA 3T4XA 1D1SA 4D3DA 1YL5A 3DZGA 5ITWA 1ULUA 3ZV5A 4D0RA 4DMMA 1N5DA 4UUOA 1VL6A 1M66A 4FSHA 4NU5A 1U3WA 1YWGO 3MJCA 4J7CA 4CJXA 2AEJA 3GEDA 3LU1A 3F1KA 4ALMA 4LISA 3VZPA 1A27A 2J6IA 1KVUA 1HYGA 3QVOA 1WDMA 4WEOA 1Y1PA 4HY3A 3AM3A 4FFLA 5FI5A 1UP4A 5JAMA 2PA3A 2GERA 1B15A 1HL3A 2QZ9A 1FXSA 2EF1A 2NTVA 3FNHA 1YBAA 2NADA 4HBGA 1C1XB 2VUTA 3L4BC 3KSUA 4CPDA 4CMHA 4M54A 3FSRA 2PZMA 5T8KA 4RVFA 1JAYA 2OFPA 5ADHA 3VPXA 2AQ8A 1LTHR 3A14A 3GGOA 4L73A 5DN9A 1LSJA 3ZHXA 3RBZA 2VNSA 4JLWA 5JY6A 1V0JA 1E77A 3IUPA 2EG9A 1E7SA 3M2TA 4O63O 3DDNA 3KYDA 1DRUA 2Y05A 2Y1OA 1B3RA 2ZYDA 4CMAA 4NR0A 2ZB7A 3WGYA 1DPGA 2ZYGA 4BV8A 4C4OA 4W9NA 1I3NA 2C5EA 5IZCA 4IGFA 4YRBA 1LC0A 1P0FA 4H3VA 4BGUA 1DC3A 2EJVA 3ZWAA 1B2LA 1PS9A 4TRRA 1BDMA 1F12A 1QSGA 1RYDA 4NBWA 4WJZA 1QRRA 3WDSA 1GCOA 2IRWA 5EQFA 1TB4A 3VZSA 5JYEA 3UVEA 3NTQA 1DLJA 3N7UA 1GDHA 3JQ8A 4FW8A 3BTVA 4DA9A 2C5AA 2JFFA 2YUTA 3DHNA 4HX5A 1ZBQA 3D3WA 5JAIA 1RPNA 3RKRA 1ENOA 3L6EA 4BNXA 2EP5A 1OC2A 3I9MA 3HDQA 5A06A 2IXAA 1DC5A 2D5AA 5T8KC 2TMGA 3LC1O 4RCVA 3WX0A 4MO2A 3EC7A 3TSCA 3H65A 1A9YA 4ZQEA 4DLBA 1UDAA 3STHA 4J9UE 4IJVA 1BW9A 4J90A 4BKOA 1PJLA 2OGUA 4H15A 4S3MA 2NTNA 2VYVD 4CMKA 1LXCA 3TPCA 4B8ZA 3GPDG 1E7QA 2VZ9A 4J4TA 3WIEA 3U0BA 4R1SA 4W9NC 5CEFA 1VKOA 4XQCA 1XLTA 2P4QA 2B4RO 2PFGA 3AI3A 3JQDA 1P33A 1QLJA 5IZCC 1YE3A 5U9CA 1DFGA 4R1TA 4JJFA 3FI9A 5A9RA 3DTTA 2GN8A 5JSFA 1LDEA 2P4HX 2ZATA 2Y0DA 3PLNA 3NT4A 3UW3A 1N92A 2GN9A 3AM4A 2WDZA 1PL7A 3NRCA 1UH5A 3PDJA 3KLMX 1BVRA 4CR7A 1EK6A 1TT7A 4TVOA 3T7EA 3Q1LA 3E48A 1Y5MA 5DT9A 3QWBA 1X7HA 4R3NA 4DREA 3FNEA 1NR1A 4PRLA 1WDKA 3HADA 4WLOA 4E31A 1WAMA 1KBZA 1B8PA 5T57A 1ZXLA 4DPMA 4UREA 1WMBA 5KVSA 5GZ1A 1P1FA 1U3VA 2OBNA 2NM0A 4BV9A 4NFYA 4J2HA 4L75A 2Y0CA 1E7WA 2F00A 5FYDA 2WSBA 4CLOB 4GKBA 3OJFA 4MVJH 1KEWA 5ER6A 1LSSA 3O38A 1UXGA 4EJ6A 3WTCA 5G4KB 2C29D 2VOEA 4AJKA 1I33A 2OHXA 3QWAA 4PLCA 5AYVA 1SC6A 4TSKA 4AVYA 5F3RA 2IYPA 2Q2QA 1E5LA 4R41A 1XU9A 3E82A 1F06A 1ONNA 2Y0EA 1GUZA 3PQEA 3CUKA 1M76A 2SCUA 3WMWA 2UVDA 1WXDA 1U2DA 4JIGA 4XWYA 1MFZA 3W8DA 3JSAA 1AGNA 3ONEA 1LLCA 3TN7A 3KUXA 4E5YA 3ENKA 3WFJA 3GN1A 3PHHA 1PJCA 2O4UX 4ZGWA 2DBVO 4U0JA 1X14A 5I8WA 4D7AA 4HNGA
chains in the Genus database with same CATH superfamily
3P9PA 3QM1A 1Y4ZA 3IO5A 4FI3F 2E6KA 2QX6A 4KTVE 5FR1A 2C42A 2IIPA 4DDVA 1X9GA 1UKBA 2FOIA 3T9AA 2L17A 4N0PA 5C35A 4R2KA 4MUMA 5B1DA 1Z7WA 1E6WA 1A9XB 5KYNA 1ZK0A 3INNA 3TW8A 2GYUA 2P79A 5F5NA 3F8TA 5JCZA 2A92A 4PINA 4R5MA 4NZ9A 2C07A 4RX1A 4BE7B 3AGPA 3E6AA 5LUBA 4C0LA 3JAWB 1KMIY 2HCFA 3PGVA 4PGAA 3RHSA 1TJPB 2VPYA 1J4AA 2G17A 1IPHA 2QM0A 3HCPA 2O2YA 2I7DA 3IMGA 1KI9A 4FCCA 1LQTA 3T5MA 1XCJA 3UV6A 1V5GA 2WRZA 3A6GA 3LXUX 4E2ZA 4LQLA 1UXOA 1CRLA 2WBLC 1EZ4A 3BB4A 3C8ZA 4OHOA 2O6HA 4AJPA 1AUQA 1CV2A 4TYWA 2A0UA 2ASVA 2GBFA 2VNIA 3KWMA 4QTTB 2YRXA 1GA4A 3DM9B 1PL6A 3NHFA 3G8CA 3HY3A 4D8YA 4KI0A 1IBLB 1SD5A 4PPGA 5DT2A 4BMSA 3GQBA 3MHPA 3FVTA 4F5WA 5L40A 1HNWB 1GLVA 2I54A 1F6WA 1GKUB 4XUEA 3PE3A 3H0EA 4K7JA 1UF9A 4FUTA 4YP1A 2G9NA 4XJTA 2G07A 2N1MA 3LGAA 5FI3A 4DB4A 2XUZA 3HWWA 4GLFA 3UK0A 1J70A 2IP1A 2HCRA 2EQBA 4I08A 1W4ZA 2P0AA 3ORYA 2YTZA 5H5JA 2F48A 2WJ4A 3MMPA 3DOIA 3PJDA 2Y6UA 1JG3A 3O73A 5JZBA 2G5PA 4OQNA 2F3RA 4KQEA 3WQQA 3EEOA 4IIJF 1JKMA 2QW1A 5BQOA 4ARSA 4DLRA 3MJTA 4EM6A 4LGMA 1TVCA 3BRQA 2QLTA 4L7VA 4PEVA 1DIBA 3CCBA 1HMPA 1GPLA 2REQA 1P9LA 3IA2A 2P9TA 3C6MA 4TT3D 4PPYA 5HG0A 4H3SA 2LPMA 2QW8A 3UFXA 2I0FA 4LHSA 2NXJA 2PX4A 7REQA 4UCXA 4XRGA 1Q1BA 4DCCA 2GCEA 5CFRA 1IJFA 1JLMA 1ZD5A 2PX3A 4JA0A 2I2AA 2R4QA 4ZI5A 3B3QA 5JYCA 4F3CA 3JZIA 1T2AA 2QVBA 1MB3A 3T7JA 5CXUA 3S4YA 1IVYA 2CK3A 3KJHA 5KYYA 1EGVB 3G2IA 3GRVA 4ZVQA 5I4BA 3I9KA 5BSRA 4R40A 1DV1A 1JKXA 2JHGA 3GCGA 1XU4A 5E4TA 3UMRA 3D3EA 3RO7A 2BKUA 1I4DD 1WEHA 5AKHA 2B20A 1IQUA 3D43A 2RKWA 3QXGA 2RAUA 1FUIA 4G1VA 4NIMA 5TT1A 4WZAE 3SYTA 3JQFC 4DQDA 3EPRA 3AJEA 5DLYA 2GBCA 3DBLB 1KQFA 2EP7A 1ZS9A 1EE9A 4D0SA 2NZVG 1E92A 2CFCA 1JB1A 1OI4A 3KEGA 5CVTA 4LFBB 1PR6A 4KN9S 4QUGA 3UJ7A 4NVRA 1YRYE 5ADVA 4NY1A 4QOSA 4H7FA 1NULA 1PQ4A 2VZ0A 5D1HA 3AEUA 2CHEA 5EMJA 3WMEA 1B1AA 1H4TA 3E7WA 1JTFA 4EPWA 3AF1A 1D6NA 3LVQE 4LXUA 1G8HA 3F90A 5K1ZA 5KWJA 1L4FA 3UYKA 2F62A 4Q15A 2CNWD 2HSWA 3A6EA 3ORHA 4Z0PA 3O4JA 2WKQA 2Y76A 4XPIA 1WKVA 3N6VA 3V9AA 4DWWA 4BVJA 2H1WA 1OI3A 2DWPA 3VPSA 2Y1GA 2MSWA 1E1RA 4QXMA 4TUYA 2JVIA 3N3BC 4UAJA 1B73A 2I8LA 2Y1CA 3BE8A 2P9CA 1U2RA 1XTSA 2F6RA 4GEGA 2EL9A 1O4WA 3D0RA 3ZKWA 3DOJA 2C2ZA 4CEJB 4YRAA 1Q0RA 16PKA 4RPIA 4FDMA 3ZWYA 2PWYA 3BBLA 3VJRA 4JEUA 4MINA 1HDEA 5TQJA 4BNGA 5AW6A 1RXEA 4AURA 1RM5A 2QZ4A 2WD8A 4G5OA 4CT0A 1FB5A 5KDLA 3WNBA 3PE6A 3AHCA 1JSXA 4D9EA 3S8EA 3PU6A 4N3NA 1V7PC 5C8XA 5C8VA 3HVHA 2VRCA 4LC0A 1QP8A 4UZEA 1WG8A 3JQGA 5EXEA 1JVSA 1Y8ZA 4LDPA 3D8RA 3FNFA 3SEQA 3UMYA 4B33A 5D3MA 4CF3A 3MGBA 1KEVA 4TTAA 3AM1A 2WIAA 1M6WA 1QAOA 2Q5OA 4YYEA 4BMCA 4X3PA 5EHQA 1KSFX 2O2ZA 2OK7A 3H9GA 3QXJA 2R751 5DBEX 5IDXA 3HR8A 5LBTA 5DYNA 2Z2IA 1R8QA 3GAZA 3QY9A 1KE2A 1OVMA 3AUFA 5AJZA 3KHKA 3CUWA 4MB6A 5D86A 5FNVF 4CQMA 1NMSA 2D4HA 2BJHA 5JAHA 3SZ3A 2HQ1A 1TKAA 2XBLA 1YIDA 4G4IA 1I7DA 1LVUA 1H2XA 1LD3A 3HMKA 4TRNA 3I9V6 3V3KA 5HNKA 3F6BX 2H2GA 1QKJA 3I83A 4GLOA 2FSVA 3UMBA 4ZJUA 2NU6B 3JS5A 2LV8A 4MYSA 5DGXA 2GZ1A 3JQ7A 3K0CC 3KEFA 2ZE5A 3BD6A 2Z6QA 4BZXA 1K6JA 4OA5A 5ALWA 5IT5A 4J91A 1UFVA 3F6YA 4HX9A 2NUAB 1N1MA 1QG0A 3S2SA 4FK8A 2P30A 2O7SA 1CBUA 5CVVA 1RTKA 2O8DA 1HE8B 4TYMA 1T4GA 3SI7A 4HZIA 1IBKB 4YJFB 1EFTA 1WVIA 2HFJA 2TMYA 3MVEA 1EIZA 3EBOA 1RWQA 5FLKA 3JYLA 4PGFA 3V1MA 3TDKA 2AI1A 2XDAA 3JWJA 2PPLA 4TV8F 1EJ6A 5BNTA 1S2GA 5JHGB 1Y80A 2JFVA 4D0NA 1UC4B 1GWNA 4B31A 4ZRNA 2OHOA 4PGMA 3ZCVA 3MAAC 4TTSA 1O94A 1VIVA 4P7BA 4UTRA 4ZVRA 5IHXA 3TZBA 3ZDRA 1XYGA 3IDOA 4W5NA 4N5IX 3BK1A 2WAAA 2ODBA 3EAQA 1AH2A 2JFZA 3VHXA 3ABIA 1FX0A 2WYIA 3UMGA 3A04A 2P75A 3OCWA 4ZGGA 2HXYA 3ZIDA 1RQLA 1D7AA 3PA6A 4KN8A 2CF5A 2AG0A 3I4FA 5CDUA 1UIRA 1F9EA 2VSYA 1X86B 1G7SA 1J24A 1TZJA 1MJFA 1CNFA 3U61B 1E64A 4XVRA 1XZIA 3WS7A 5EA2A 1PZMA 2HXSA 2A5GA 5J4KA 1ODJA 2RCNA 4UUNA 1P2SA 4HAWA 4KDCA 5FAKA 4YHHB 2GCGA 1LY1A 5EN4A 2AZXA 5BN4A 3FIJA 2VYFA 3IFSA 4MQEB 1KMMA 1UK6A 1K68A 1WB5A 2J33A 3D3JA 1HEYA 1R0LA 2R66A 3M7IA 5ADUS 3ZDDA 3SSNA 4A5OA 3LCRA 5EIXA 3N9IA 4D8VA 2CJFA 2NV2B 1ZIYA 2JI7A 2X8BA 2HMVA 3W06A 3DMNA 1BXZA 3Q7IA 4CEHB 1FFHA 1Q0LA 1V39A 3BF8A 1U0RA 3DEKA 3HKBB 3MLBA 1U3CA 2VPIA 4KQXA 3A6JA 4Q3DA 5I8PA 5LWHA 4BLPA 1UBEA 1ISPA 1QGUA 3IQWA 3N07A 4REQA 4FYPA 1WZNA 3GGGA 2V74B 1LRJA 2HYDA 2YMLA 2J3MA 3K5IA 3C8MA 3L7KA 4Q0MA 4ZU3A 2GXUA 4HDQB 4KXYA 3MT0A 1F3LA 3DOHA 3OJCA 3WK8A 2YWXA 3B52X 4NV1A 1KZ1A 3FNQA 1M8FA 4BGIA 1SHZA 1BU8A 3OLQA 4CODB 4X3CA 1R4NA 1SUFA 4LE2A 3L6DA 4YS6A 2HDHA 5JJIA 3AWDA 4HZUB 5BYJA 3WSVA 2XUIA 2W11A 2CZCA 1QZ3A 3A27A 2VKQA 4PX9A 3E58A 3E3OA 1MRNA 3UWKA 1J09A 2PV0A 5IPFA 5CUQA 2OQRA 2A2ZA 2V6GA 1ZW1A 4ZOQI 1XFAA 2SKEA 4QYIB 1LFDB 4RJTA 5CB0A 1RI2A 5THQA 3E2IA 2GXAA 1AHIA 2RHLA 4K46A 3MTQA 4EENA 1KMNA 2AWNA 2COKA 3PB3A 3H3FA 5H3LA 1KYXA 3RJ5A 1K5HA 4UZFA 4F4HA 3DVSX 2GAFA 1IL0A 1JL3A 3CNQS 3X0DA 4BFTA 3AR8A 1W5TA 1KS2A 2OENG 4YRDA 5AM5A 2L42A 3SMVA 1N6IA 1T91A 1JPJA 2ODEA 1O0SA 4H2DA 3GJ6A 2XA9A 1KAQA 4L8FA 4QGBA 1IHDA 2OO3A 4HOYA 3HJAA 3Q1KA 2UYGA 5KYUA 1OFHA 3Q7EA 3WY9A 2ZDGA 3EIXA 1MCZA 1P3Y1 4TMTA 3K92A 4B82A 4TT8A 4IFIA 1W1UA 1GFIA 3P0FA 2KI5A 1JWLA 2UXCB 3FAKA 4I46A 3VKHA 4TLDA 3TQHA 4PSUA 2XTAA 1Z63A 5B3JA 3A4IA 1RLOA 5KS2A 4KAXA 4QTZA 1QPGA 1ZH6A 2PMDA 3FBGA 4PYNA 3TZHA 1OPRA 4H1WA 1M8PA 4OLBA 2I6UA 4MW6A 3D4OA 1TMYA 2LDXA 3LDFA 3SZMA 4HRYA 4DUGA 1NAHA 4MUYA 5KMGB 2GCIA 2I1WA 4M0KA 4DBZA 1OJ7A 1QKIA 4NXMB 5HEKA 4ZTBA 2YJ3A 3M9XA 4C2UA 2DPLA 2ZSUA 5DV9A 3DWGA 3WBFA 3N59A 3BHJA 3PHJA 3D3KA 2BKEA 3FPEA 1VPDA 2PUCA 3ESCA 4ZICA 2B9VA 1TF7A 2QMEA 2ZW9A 2YWRA 1HDYA 1USKA 2C1EA 2ZJZA 3CYFA 3N7AA 1GZVA 4GEKA 3L8YA 4L74A 3S1AA 3P1JA 2GKSA 4IIJB 1TAQA 3GDOA 2ONKA 4J0KA 4Q4DA 4GGPA 4R3WA 3ST7A 3S8YA 4QSHA 3AUYA 4ZRMA 4AKHA 1WCXA 2OCDA 3N2GA 3T4PA 1BD4A 1ZZEA 4ZT5A 1I01A 3QE2A 3VI4B 3W5JA 2C7OA 2DFVA 2YWHA 3T61A 1OT5A 3EQ9A 1O58A 2GAAA 2OQIA 4KDRA 4PZZA 4AD8A 4DLAA 4EGFA 4J0IA 1TEHA 1PFVA 1V26A 2JZCA 1M1YB 3KD2A 2EEZA 4F46A 8GPBA 2JI4A 4ND5A 3L0ZA 1Z4QA 5P8WA 1Z17A 1E6EA 5ECGC 4EA8A 4BMZA 2B1GA 3L46A 1IULA 1PW7A 1SZJG 2KWIA 3T1VA 4ACBA 4CTJA 3WXBA 2FPIB 2PQMA 5DP1A 3GLKA 2Q4RA 3IOMA 4UCQA 2FE1A 3AVWA 3NAQA 2I3AA 2BFOA 3KXPA 1TUBB 4B73A 4YASA 1MPTA 4B3GA 5K6AC 1KS9A 3KKPA 3R6GA 3QYJA 2WFZA 2HSZA 3TM4A 4PAMA 3SHQA 3TIFA 3OEYA 2NVOA 3FGOA 3QGMA 3WGUA 5BUQA 3FG9A 1N36B 1MC4A 3P9SA 1VE9A 2D1FA 2B25A 4NL4H 4BFUA 2A1TR 4PQFA 4FDTA 4PW0A 1JZQA 4YRSA 4EG5A 4LF6B 1U2GA 1Y48E 2J09A 3NUQA 3QF4A 3R6LA 2ZXFA 5FIUA 3H04A 5HIMA 4LSMA 2H4WA 4R71A 5IDQA 1FQOA 2XRMA 2F43B 2W2TA 2XYPA 3O2SB 3Q7SA 4HGQA 1V5IA 1SBZA 2ZJ0A 2FETA 4NAHA 3T94A 1GUDA 3BCRA 2XVYA 4FOTA 3L7JA 3M9LA 1F7VA 4HO1X 2FMIA 3VR4H 4JI8B 5HIAA 1IH8A 1MHPA 1TTTA 2E5FA 1BE6A 1RMQA 2AJLI 3N0XA 3BULA 1XA4A 2ZRLA 3OIGA 4XJXA 3SQLA 4LXHA 1N6HA 2LIPA 1YB5A 5LQNA 2C2KA 4DJJA 2ZTUA 1JA9A 1GPKA 2NU9A 3R5SA 2YH2A 2NMVA 4K6HA 3RYTC 4R81A 4AJJA 4B6QA 3RYCB 1Q83A 5AIAA 3B1KA 3REQA 3VKUA 2OCGA 5EQDA 1POXA 2GHIA 5IHPA 2IOYA 2OHJA 3FR8A 3W8FA 4AFNA 4DIFA 3AI2A 1SCNE 1Q0UA 1HRDA 3DT9A 3KALA 3L18A 2A7XA 3V5NA 3U4QB 1HKUA 3HXPA 1JBEA 3A3YA 4KQ1A 5J2TF 4MCIA 3L06A 5DJ5A 1D2NA 3NDJA 2AFIE 2L82A 3PXXA 5B7PA 1VKHA 1N2CA 1VB3A 4I6JA 2H7XA 4JDUA 1A8IA 2O5EA 2ZI6A 2G6TA 2GJSA 5FOXA 3TLXA 4FPXA 3U4AA 4W5TA 1IK4A 1UMBB 2J6BA 2X4DA 2B8NA 2GEJA 3AM5A 4NBVA 1Y4SA 3LCVB 4ZOLA 3RUDA 5CDHA 1EFVA 5FNVB 4AQYB 2FUG6 1GQQA 1XZJA 3RRXA 1B41A 5IM4F 1W36C 3AT1A 1ZO8A 3HV0A 5I7SA 2ODNA 1CSEE 1VHDA 1W8IA 1COWA 2Y93A 3ETJA 4J7XA 4RQTA 5T41A 5TPWA 5CLFA 5FJJA 4ZIRB 2CXUA 4U6NA 5FI1B 3TSOA 4JUIA 1J8MF 1ZN7A 3TB4A 2VQSA 4RADA 1A8UA 4JLBA 4BUJA 1P81A 5IK2A 5BSKA 5IF9A 1RBMA 3FCOA 4MP8A 4HYTA 3MERA 1E7MA 4DQXA 2WYHA 4KACA 3VTFA 3EQ2A 3MJSA 4JX9A 2VLIA 2R6ZA 3LTNC 2W6JD 3X44A 1C7RA 2CV2A 1TVKA 3PP8A 4QUEA 1VHWA 4TV8B 5JXIA 2XQVA 1NU6A 1XZNA 4D80A 4FLFA 3DAHA 4QPCA 4TM7A 4X61A 4PX2A 3UK1A 5JADA 1YMUA 1W49A 1EGHA 1EFHA 2AA3A 2CUZA 2QMHA 1SWVA 4FDAA 2PGJA 2FW0A 4R1LA 4OGKA 5FL3A 3BHMA 1OJLA 3D3QA 4IIUA 3EVZA 3MNFA 4GH5A 1EX7A 4D81A 1G2QA 1IMJA 3K16A 3KPJA 3BKXA 3SG0A 2I2FA 821PA 3STUA 1UC5B 2VPPA 4G6ZA 5AP9A 3TG8A 4YRZA 1Z73A 3GNTA 2QJFA 1TU3A 4KK3A 1LNQA 3HA5A 3WJ2A 3LFHA 4LYDA 4KE9A 5T3UA 3TUJC 1TCUA 3EZYA 2VVTA 1KI3A 2BE9A 1N5KA 3FWYA 3H5RA 2D2XA 3OQMA 3INGA 2FZLA 1FQJA 1GRCA 3A9CA 2DCMA 2A9KA 1Z13A 3EUFA 1LQUA 4Q7QA 5DHRA 4GIBA 3ENNA 1TM5E 4HQFA 5FA6A 3GJZA 3NBFA 4W7IA 1BFDA 3ZE1B 4M76B 3TLZA 3FTEA 1UPXA 1REQB 2GZMA 2V8OA 3FMGA 3KTDA 1PVVA 4FR0A 2OD2A 1X8LA 4ZQIA 3TFOA 1YMVA 1NJ5A 4HLQB 5LIRA 4WXYB 3VR5A 1QB7A 4Y1RA 5JNRA 1FLVA 4G2TA 4OJQA 4HT3B 2E85A 3V4SA 2W8ZA 2IYXA 3KTAB 4KWTA 3OHMA 3BC1A 4C4PA 1W0CA 3W1EA 2JGEA 2MU1A 1B6RA 1VCMA 2YV3A 3IBGA 4N41A 4AULA 3GPLA 1A76A 5H3HA 4B48A 4QGSA 2VOJA 1IXRC 5DBFA 1TAGA 3G68A 2O1EA 3G2PA 4LMPA 1R0XA 5FPHA 1BRTA 4Y6OA 3NBZC 2VG8A 4O4JA 3NC0C 1NSTA 2CHGA 4GQAA 4NCAA 1GEGA 1QH1A 2AE1A 1L4BA 1XDDA 1UOPA 5HKLA 3I2GA 4ZK2A 2VA8A 2ZYRA 4V1CA 1MH9A 3ENQA 3V1TC 5JV5A 4MHOA 4MI6A 4RYLA 1M7HA 4FYJA 3P2KA 3B8EA 3A6PC 4D97A 5C8DA 1QYDA 2A67A 4RTSA 1CVRA 3PZBA 3HO1A 3RUHA 4XAQA 1M6NA 1Y82A 3NT5A 2JGKA 2VT7A 3G85A 2AOUA 2G09A 3EYWA 1Q17A 4IKOA 3KPWA 3ELYA 4NNOA 4R7TA 1ESCA 1O9BA 4URVR 1W36D 1V5EA 1TE2A 2OXTA 3GL9A 1WCWA 4BMDA 4PRYA 1MENA 2OV3A 3AUUA 3RIXA 3CGGA 1PQPA 1FRZA 5ALSA 3S1LA 4FYYA 4B6PA 4DJDC 4DNXA 2IX9A 1C3JA 1X87A 1JFLA 1LFAA 1KI6A 1XEWX 2DC1A 3MBIA 3SKXA 1Y8QA 1ZUD1 2XMBA 3WLMA 4H17A 1RWNA 4GXTA 3RCBA 4BV2A 5JSZB 2KS6A 3D5QA 5TEVA 5DEIA 4NENA 1IHXA 1A96A 3IMEA 4NMWA 5LZ4A 1NN3A 3A06A 2ZANA 4MULA 2FMHA 3EXAA 4WGFA 3V42A 4C0WA 2C5HA 2XEDA 2XI4A 4PF1A 4R9SA 2OILA 1V6SA 2IYZA 4HH3C 3PJFA 4LJAA 4P2GA 5C46F 3UN1A 2EX4A 3SF8B 1LDGA 1IXZA 5F3DA 1LGYA 1EE1A 3BFPA 4FJ2A 3TNLA 5TRTA 3C7KA 3RK4A 3EGDB 4DIKA 2V7UA 5ITZA 5CVDA 4UM8B 1N3IA 2F17A 2Z6VA 2PZLA 2PO7A 3PFNA 4OH1A 5F78A 5GTDA 1HDIA 3L9XA 1XVUA 5D6OA 1C0IA 2G36A 3KPUA 1RD4A 4NE9A 2UXDB 4B4WA 4DNPA 1E3WA 4KR7A 4LG1A 2ZRQA 5DCWA 2G83A 5HOEA 4RIEA 3DZ8A 3CE9A 2VATA 4LY3A 1IEVA 3PITA 4RGYA 3H5OA 1E1CA 4QEKA 4ZPJA 3RU9A 1XTKA 5IW8A 1R6DA 1RFLA 2R00C 3T7KA 4HTFB 3NHWA 4N65A 4ZHQA 1M0EA 3IT1A 2IS1A 4R1MA 1VIAA 2BR4A 4RJ2A 3NFRA 3OA0A 4UC0A 1JSZA 3ETCA 1B8NA 3RRZA 3FGZA 3KZMA 1U0EA 4ZQCB 4IQGA 4TQUS 3ZDCA 2YC4C 3K05A 2XGJA 1RM4A 1CUEA 3FPGA 3WB0A 3CZPA 4EHKA 3CVUA 1K66A 5HRCA 2ZJYA 1MAUA 3ZE9A 3F4KA 4ECEA 3N75A 5BYAA 4RTOA 2OB1A 2YJGA 1FVOA 2BMEA 4RENA 4XIJA 3JY6A 4XJVA 4BZWA 3BMNB 3Q6IA 4PV7A 1E2MA 2H00A 4CNBA 4J0HA 3NKLA 4DGSA 1NNUA 1YGYA 2GJ9A 4RVNA 4YUVA 5IRCD 1NNSA 1X8XA 1WV0A 2WT4A 1EBBA 5J4YA 5ILGA 1TEXA 2BHRA 3KQPA 4JLMA 2O1XA 2VK8A 4V24A 3H1FA 4OL9A 4QJ3A 4B3RB 1RYMA 2X1VA 4JB0A 1G8YA 4K03A 4XRRA 3E3NA 2GVNA 3CW9A 4MQBA 1RWWA 1ZJJA 2D5CA 1AX9A 3X2FA 1FFWA 4L9AA 3T3GA 4RXTA 3E8SA 3ZGVA 4KR6A 2IS4A 3TZQA 5TGDA 3OJWA 1T34A 2IOQA 1EJ0A 1T2DA 4EK9A 4M1SA 4ZEWA 1QIGA 3ZJTA 4HNUA 3M83A 2EERA 1RYFA 4PWYA 2I4LA 2VTBB 1R9MA 4V0MA 4Q18A 1I4LD 1XVTA 2V7VA 5AM3A 1D1PA 4BQPA 1JG6A 1OZGA 2AC7A 4TL8A 3QKSB 2AVNA 1RSZA 1W2GA 1NIPA 2VDWA 1SC9A 2QU7A 5LMUB 1ADCA 2EEPA 5C1OA 5GZ3A 4G26A 3IBFA 4HDNB 2BCGY 2ZUVA 3MWEA 4J8PA 5NULA 4DBLC 3IAS1 4JQCA 3LUHA 1DMSA 2Y8EA 4LJSA 2QPLA 3U80A 1AQNA 3EZ6A 1A7UA 4YDHB 3THSA 1JQ5A 1TLFA 3E7DA 3ELUA 3LLSA 1XQYA 2PVSA 2CUTA 1B2RA 3LP8A 1VL0A 3RHTA 1R37A 3E5MA 1GZ3A 3W9SA 1T3SA 2VPQA 4UEQA 3BRSA 3IMFA 3RVKA 3KOWA 3MILA 3QLUC 3TW6A 1F20A 2UYYA 1OA0A 3R8CA 2EX0A 4F6RB 3BGIA 1JIKA 1OYYA 1ZKMA 2DHRA 2X3UA 3J81k 4G36A 2OORC 5KEIA 3KX2A 4MKXA 4E51A 4GUDA 1EFRD 1DUVG 4J43A 3RSFA 4B43A 4B40A 4DNOA 1XPRA 1KGSA 5A0FA 1L0BA 2FGJA 2Q7DA 3KXKA 4WVLA 4PAQA 4GFDA 1UQTA 2COUA 3CW8X 4AY6A 1CR0A 2OTCA 1JH8A 5CW2A 1Z8NA 4JBLA 4R0NA 5I01A 5LMCA 3HDHA 2WZQA 3AO0B 3GHYA 3LCCA 5H70A 3OJ0A 1KEEA 3FTPA 5FPQA 1RAGA 1Y7LA 3FX2A 2PY6A 3I0MA 1C3EA 1VLQA 4DJFC 3RAFC 5HFAA 2D1QA 5FBWB 2B98A 2PKQP 3C14C 1Z62A 2H1LA 2MYNA 5JCJA 2Y67A 3E8MA 4M1ZA 4G0UA 2E5LB 3CNBA 3HACA 3N6XA 1QYXA 4Q47A 4HNAA 4X3OA 3M6LA 4YP5A 3CEAA 4Y2XA 4GI2A 4PYOA 1I4EB 1EAMA 3URKA 4DABA 1HG0A 4QDTA 1JA1A 1DDOA 1FZTA 3FMPB 1CJKC 3GUCA 3BMQA 1PFUA 5GJVC 3LT5A 4ZU6X 3OQ1A 5C52B 1KP2A 1DO2A 2Q5IA 1YI0A 3KKNA 4RA6B 4WVFA 3WLRA 1AKUA 3PFFA 3PXUA 3ROKA 4R0VA 4P22A 4EJ2A 2N9UA 4AZWA 4NDZA 4NYIQ 3S6JA 2VDKB 1QIMA 2Z2XA 1LKZA 3BTSA 3HA3A 1SXJA 5FUQA 4BLUA 4B6OA 5BQ3A 1CUXA 3ZNPA 3E81A 2XD4A 4MLPA 1FDRA 5A6VA 5KDDA 5KCZA 3QKRA 2D00A 3OJLA 1V3QE 2WU8A 1NRWA 2AXQA 1J0AA 3TEMA 4CG2A 1KHTA 3SSMA 2WWIA 5B53A 5LDGA 4C7OA 3BMOA 1ILWA 3FOAA 2XUKA 1PX2A 4KXQA 1HRKA 2JI9A 3UG7A 2O57A 4CT5A 1R8YA 2X13A 3AQ4A 1A5BB 5JG7A 2KBEA 1JR6A 4K8RB 1I6WA 2YW2A 4PLTA 1W7AA 4X20A 3RVBA 4B3BA 1BQEA 1OYOA 1AUPA 4Q3AA 1G291 3TSYA 4PY2A 1MABB 4Z1MA 1JLRA 2P4EA 4GPD1 2PUGA 3IT2A 2P2NA 2Y4OA 4F9GA 1BEZA 1SGWA 1GFZA 2XNHA 3CLHA 3P9QA 4HUJA 4NPHA 4YEDA 3T5PA 4HDKA 2J67A 4Z4QA 2RGRA 1JSRA 2G3YA 2HJGA 3P4YA 1UFKA 3P5SA 3PKJA 4QXRA 4WESB 5AVWA 2FPSA 4MAFA 4FFMA 4RZHA 5G2OA 3BEDA 5B4TA 3MWJA 4GSLA 5BORA 2DFPA 2X8AA 4X95A 4NP6A 1PGQA 1DV2A 1SOAA 4MVJI 4JT8A 1L3CA 4M6WB 3VUFA 1BXRA 1DJOA 1Z82A 2O0HA 4LDNA 4OI1A 2RHRA 3GRRA 4RHYA 2E49A 1HT0A 4JL8A 5EZYF 4HVAA 1MJHA 1UP7A 1Y5LA 4H7HA 1CP3A 1M2NA 4B87A 3OFSA 4CV1A 10MHA 3UGTA 3NFYA 1VMDA 3LL7A 1XP5A 2VHTA 2IU0A 2C4HA 3MUOA 1HXHA 3LT1A 2J59A 2PX6A 1GR0A 4UNIA 5IEJA 1T1GA 1ZUHA 2AF4C 1PD1A 4EITA 4HRAA 4AO6A 2XTMA 3EMDA 3HDJA 4G1MB 4UVHA 4ON9A 3RB8A 3ELWA 4O2AF 1L4LA 2X0RA 2VP6A 3EA4A 3IT0A 4YPOA 3RIGA 4OIFA 2DLDA 3ZS8A 2PL1A 1F6DA 1HR0B 2RH4A 3GUUA 3FGNA 3UT5B 4L78A 3GVPA 3JATB 4Z3KA 3KJZA 1XA3A 4KMOA 5AR1A 1GTL1 2P9YA 4DCNA 2HU8A 2GHTA 4BXOB 1NNI1 4NK5A 1BEEA 1ZDMA 2QTVA 3Q2IA 5DN6A 4FILA 3DCJA 4RKQA 1CDDA 1GPYA 2CEAA 3A3NA 1ECCA 3B6ZA 3GLHB 1C1XA 4PTZA 4TL7A 1VIMA 1ODSA 3BXZA 5A3VA 1KPHA 2JCXA 3GLVA 2Q5HA 1K7SN 2WJYA 3EG9B 5C9ZA 1MC1A 4JGIA 1FP1D 4DV7B 5HILA 4W8OA 3WR5A 2HLDD 1R5OA 1GSAA 1PDWA 1YZQA 3EXEB 3V8PA 1Z4OA 5LR6A 4FHEA 4YCNA 4JXZA 2OCXA 3ASUA 2ODPA 3R7DA 4DS3A 2JIRA 3NDPA 5LXTF 4WZBE 1WSAA 4JR1A 1LSOA 1OT3A 5DYWA 3RTCA 3EVNA 1V96A 5KOJA 4A6DA 2CMHA 1Y4AE 2BSXA 4O1IA 3RYFA 1P2UA 4J9VA 4QXPA 1BKYA 4NE7A 1AKRA 3ZK9A 5K51A 1S89A 3GJ8A 1KMHA 1PS0A 2WWVD 4CQLB 1RAAA 2V7EA 4LK3A 5ELLA 5B58T 1BFUA 2VF4X 3P9NA 1VQ1A 3SZUA 3UOGA 2NQ2C 1WSWA 3AOEA 3TK1A 4KQ6A 4E2WA 3I6ZA 1GV1A 2DPHA 2CE2X 1R5NA 1DKUA 3A1FA 1GLNA 1X15A 3D3NA 4WRRA 2WZBA 3AEKB 4F3KA 3AK4A 1XZ8A 4NZMA 2OUIA 4AJ4A 5JFGA 3ZTWA 4HDRB 4MJ3A 4AJIA 5KWSA 1DJPA 1HDGO 3AUSA 2OFFA 4E4RA 4DUPA 4MQ4A 5JRDS 4O4LF 2OBXA 1E7RA 2QTWB 3ZLJA 5BWLA 2NLOA 2ZRGA 1JR3E 1KA9H 1T5OA 2XQJA 2IW3A 4IYJA 4Y0NA 3FPKA 4IVQA 4X1IA 2IY8A 3BFKA 4B81A 5JY1A 4OHXA 4Q4AA 1KJQA 5DWDA 5SYMA 1MAHA 1OZFA 4X93A 1QZUA 2C92A 5L6MB 4N47A 3WFIA 1A69A 5CG2A 2XYRA 2YWBA 3PNKA 3KQSA 2DQYA 3BMCB 5AVYA 4M0LA 4R9UC 4YV7A 2VAPA 2JJ1D 4OY3A 2A59A 3PC6A 4X45A 5L7TA 1Z2AA 4FQ8A 4UM9D 3RQSA 1Y42X 3GFPA 4JOQA 2QW0X 2Z3ZA 3ZUGA 5KWIA 4HAZA 4ZZIA 1A77A 1X70A 3WRXC 4FYKA 3DB1A 3QVXA 3C3EA 4Q4HA 1SBTA 4FFWA 3ZE8A 4E5NA 4LAFA 3NEPX 5ANRB 1F2UA 1P80A 1JU9A 2CVZA 4ZV9A 3O26A 1SXHA 1A1SA 3DMYA 3NIBA 3VPDA 3NEYA 5BQXA 1JEDA 3ZJ5A 2OLEA 2N1BA 3GPBA 1Y33E 4IGEA 8ADHA 1RZRD 1QQ7A 2FOLA 3R7BA 3K32A 3O7WA 4OP3A 2HYIC 3ZXUB 1BX3A 3OLZA 4HH0A 2I67A 3VSDA 4BKQA 4DUZB 5F1KA 1YV9A 1G8FA 2FN9A 3T5DA 1WTAA 4LA4A 5DE3A 4MZXA 2IS2A 4B3DA 4QDOA 3CCFA 4UBLA 4BN0A 2GBLC 2C2HA 5F2OA 1CCWA 2IKQA 1IY9A 2UZ4A 2G71A 1OXVA 2R7NA 2WWGA 1EA7A 3WV5A 2CMFA 1IOZA 2VDOB 3UJAA 5JE8A 3IP3A 2OCKA 2W9XA 1P62B 3CH6A 4UDXX 3PD0A 4P5EA 1VG0B 4FKMA 4YYZA 2F1OA 5ERGB 1KZHA 1PNQA 4A73A 1RCTE 1VRCA 3IP6A 2HMAA 2FFQA 3E05A 1E3SA 2W6CX 3CRQA 3MBKA 3WYAA 1KZ6A 2IXGA 2Y3IA 1QZXA 2CZGA 1R0WA 1QH9A 1XZLA 1PUXA 1XSEA 2YHSA 2G1JA 4KH1A 1R74A 3TNFA 2YOGA 5I7RA 3OOHA 3D2BA 4Q9IA 5KYWB 5IDVA 4MKHA 4CU2A 3PQDA 5BMVA 3LLUA 1U63A 3CT6A 2F7SA 1L7XA 1M34B 4JEMA 3BDIA 3JALB 5DM70 2EV9A 4R8KA 1I4OA 1UEXC 2R8EA 5BOSB 2OC4A 2C9MA 1F3OA 3EARA 1K89A 4EG0A 1MQ8B 2GI4A 4KN5A 5FKJA 1RM0A 4UFNA 4QG7A 3TIIA 5K0EA 2IPLA 1CY4A 5KPDA 3L93A 5GJBA 1A7KA 3NBKA 4F1JA 1FNNA 2D54A 1JQJC 4MS3B 1K3TA 4QE3A 3RFTA 5CEJA 4E32A 5HUHA 2Q4OA 5F76A 5DULA 2OSBA 2YC2C 4XSVA 2V6MA 1JJVA 1Q15A 3EZ7A 1IZ9A 4J0JA 2H1OA 3OJEA 1PTJA 4KO2S 4CKCB 1E32A 1WCIA 3AF4A 3U9TA 2BH2A 2RGGA 1MOSA 2JLQA 3MELA 1NM5C 3WLKX 5KKCA 4KXNA 4DPLA 2VL7A 2GTIA 2ZJ8A 3DXFA 3L4KA 4XFKA 3K20A 1SZPA 4I1PA 2EP8A 3CX7A 3NHKA 3OFNA 4BX3A 1ZR4A 3KU1A 4CGZA 3ISVA 2FRVA 1IXYA 4LVCA 3T9DA 2VSQA 3DEIA 3IXQA 1J1ZA 4OSPA 3QYPA 1W9HA 2AQHA 5FTLA 3GLGE 3EZ9A 3T3NA 4B9AA 4HQNA 5I3ZA 1LLDA 1TGYA 3KVOA 3WNZA 2VPWA 2M6LA 5AKYA 2DFDA 4EX6A 1IN4A 3LFTA 2BKXA 2UUCB 1NZFA 2ZKLA 1KDRA 1NBIA 4R8LA 4U3JB 1ZLXA 5JVDF 1A9XA 3QMMA 2AQKA 2AFHE 4E09A 5ICGA 1WUIS 1FUYB 5HKAA 1QFYA 1E1LA 1TTHA 3G6KA 3JW8A 1CF4A 4QPNA 4ZODA 4QRHA 1ZSYA 3JAWA 1AZLA 4GPEA 1S2OA 4XASA 3O8DA 1E69A 2FEAA 2I8AA 2Q9BA 4TZTA 3LPCA 2PRSA 3SQMA 1Z38A 2AG6A 3PRHA 4HI0E 3ONDA 4RMIA 2B2XA 4IGKA 2KM1A 4U5QA 4WQMA 2IHUA 1D1TA 2XOEA 4EVQA 1F1BA 5HKKD 4KXFB 2W71A 5EZSA 4OGFA 7ADHA 3VBEA 1N0HA 3EGOA 2MSEB 1FTNA 4GQIA 3GCWA 3TTUA 3QQ5A 5GQSA 3T9FA 3IODA 1UK7A 5IJXA 3F7OA 1R0ZA 2IYYA 3BD8A 3TIXB 5LLDA 3N2IA 4GX5A 4X84A 1JU3A 1NR5A 1ZA2A 2WM2A 3MMXA 3MWKA 1WUHS 4X6XA 3HYCA 4ZWNA 3AVTA 2P4UA 2QPAA 2XDWA 1QOPB 1ZEMA 3DVLA 3Q8MA 1L8QA 1SPXA 1TZ2A 3LS2A 3N05A 4M38A 4F8EA 3ZGYA 1I1QB 1FNBA 1QAQA 3ZY2A 2PKQO 2WTEA 3EHEA 2YZ7A 3LJKA 1G2IA 2W6ID 2AZ4A 2FCAA 5FCDA 3SCZA 5IX8A 1G55A 3GROA 3ONFA 1Z35A 2CKDA 1QIIA 4DA8A 1S2MA 3EWSA 3VH4A 4TZ0A 1K5PA 4ZVOA 3DZHA 3KPVA 4RJKA 1LEHA 4ZTZB 2IZOA 2PZJA 1DTEA 3OCYA 1TU4A 4R5HA 5BR1A 4RIGA 1EWKA 4MVJD 2JFGA 1ZSNA 4XIIA 1ZCAA 2X0IA 5JALA 5C1PA 1RZVA 2A9PA 2E2WA 3CZMA 4QU8A 1ZMTA 2C2GA 1EWTA 2AX3A 1CTQA 3K94A 3KQMA 4RHEA 5KOHB 4KIFA 3AFHA 2IYLD 1B8VA 2CBXA 4JOCA 3FTDA 3VPCA 3P2EA 5CG1A 1T36B 1F0YA 5KTRA 4O2AB 2AUMA 1VPEA 5L4LA 1Z45A 3BGVA 3DZDA 4N6OA 4D9NA 4HWKA 5C5EA 1A9RA 3GZJA 3OE7A 4KX5A 4QUKA 1MEJA 2UVPB 4HN9A 1FP6A 3Q15C 4KMRA 3SQDA 4KEAA 5ENZA 4NC9A 3NOOA 3STXA 3WBKA 5C2JB 1NBME 3GGPA 2ZPTX 1CX9B 3KSZO 1S4QA 1X6VA 4FQ5A 4RVDA 5CVCA 1J42A 1FRFS 3GRUA 4JXKA 1CB0A 2NAFA 4BLRA 4BIMA 4HH4A 4PGHA 3P96A 3K35A 3L7AA 2RIRA 4WDQA 4I5IA 4ND1A 5HM8A 3DBLA 2NQTA 2IC5A 4BVAA 2CL6X 2HADA 4O3MA 1KGDA 5FNZA 1TUIA 3ET4A 3S3TA 2QL7A 2GA9A 1Z6AA 1EI9A 3L7IA 4M60A 3TMAA 2VJCA 1NVBA 2J87A 2O07A 2X2FA 3B1XA 4OAOA 1E5VA 3TI7A 3W7AA 2PRKA 3HR7A 1ANKA 1FZQA 2GFIA 4IDEA 4JLSA 4DCSA 4TLLB 3ANSA 3U5TA 2ENWA 1T5BA 3R41A 3WI7A 1IONA 3L0BA 4XDYA 4XX0B 3E22B 3DDHA 4ZAYA 3SD7A 2XY4A 1KSHA 4X8HA 4C0KA 2C7VA 3QUQA 3FOCA 5CH3A 1PJQA 1ZMOA 2R8OA 1CY2A 2SBTA 5K0GA 3OUTA 4DSUA 2JJ2A 3PFKA 4F38A 4KHZA 4CEJA 1UBLS 5LDHA 1I2AA 3ETEA 1NTOA 5COBA 2FFBA 2R60A 2CV0A 1Y3BE 3LHSA 2WVHA 4YUAA 3EPKA 3DMDA 3IOEA 2QQ5A 4PYRA 3ROEA 1J5PA 1GVHA 2ONYA 3V80A 2BGWA 1YS7A 2WMOB 3CNLA 2B4TO 2IEDA 2NTJA 1U0OC 3FB4A 2YVAA 3FVRA 5G0TA 3E70C 1ZOIA 1EQUA 1A8PA 1U1EA 5K8JB 1XPJA 3Q3EA 1TTQB 4JENA 3TR5A 1JG2A 1M6VB 3PHGA 1MR3F 3MCUA 4Q3LA 5EMNA 2JPDA 3RVSA 5HE9A 1Z88A 3AVXA 3ZWWA 2JI6A 5D5HA 2VF2A 3E9CA 4ICIA 4P4SB 4U7FA 3VTAA 3FLBA 5CLJA 4PANA 1BOOA 3ESZA 2XAUA 2NSDA 1C80A 4P08A 2Q27A 1Q5PA 3WIVA 2XIJA 3G7NA 3M34A 5EUCA 5FFMA 1EYZA 4QVKA 4TX1A 3JQ9A 1OROA 5AI9A 4NV0A 2ZYTX 2POCA 4Q21A 4FE7A 3SOZA 3X1KA 4ZN6A 4Z4CA 4BKMA 4YK7A 2NU6A 4JX8A 1U5AA 1EVIA 1C7ZA 2G1KA 1JMVA 4BPBA 3R5FA 4WXRA 3DE4X 4PR