2HMVA

Diamond-shaped octameric ring structure of an rck domain with adp bound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
139
Chain Sequence
NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YuaA protein
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 45
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmvA00
1U8XX 3DDNA 4CM9A 4JCOA 2ZB7A 2ZQZA 4H15A 2EGHA 3GGGA 5CDSA 5U1PA 4DLLA 2A35A 4BNGA 3FNGA 4EEZA 1K6IA 4Z6KA 1LDGA 1LLQA 4AL4A 4D0SA 4EITA 1GDHA 4W4TA 1GR0A 1PR9A 4M8SA 1B8VA 3DZBA 3OETA 1KIFA 3LT0A 1KOLA 3ZWCA 1E6UA 1T2CA 2YQ5A 3RKUA 5JDIC 2OP0A 1ORRA 1EFKA 3C7DB 3PDUA 1JTVA 2YJZA 4YDRA 1W8DA 3PP8A 4FD3A 1GEGA 3GRKA 5CPFA 2PH5A 2B4RO 3VC7A 3ZHBA 2BMAA 4TKMA 3H65A 1CQJA 3W8DA 2I3AA 3WGHA 2Q3EA 4WASA 4ZHSA 4PVCA 2W2KB 3RVDA 3CIFA 4PZCA 1JKIA 4GPD1 5JW6A 4DQXA 2PNFA 3ZHYA 1AHIA 2ZYGA 2ZTUA 3CXRA 2CMDA 3I3OA 3DBRA 5JDCC 3W4JA 5AXAA 3AM4A 4B8ZA 1BW9B 2QYTA 3PLNA 2NSDA 5T64A 4MIOA 4R01A 2CFCA 1PS0A 7MDHA 4D43A 1BWSA 3RC7A 1IZ9A 1MGOA 1A4UA 4U0KA 4OM8A 2GN9A 4HKTA 1F8FA 1LC0A 5TIIA 5IAAA 4DLBA 3HDQA 3E6AA 1LLCA 4JBGA 3ZWBA 3LC1O 2X58A 3EHEA 3F47A 3UUWA 5K6AA 3OEWA 2Q1SA 4Y67A 1FDUA 2C07A 3RROA 2YFHA 1E3SA 3S2IA 2Z95A 3PZBA 4ILKA 1DB3A 1X7HA 1B0AA 1JQBA 1PJ3A 2Q1WA 4BGIA 5IG2A 4CMEC 4YRAA 5TQVA 4KZPA 4MVJD 1A7KA 4IJVA 3KVOA 4XX0A 3WLFA 3DTYA 1VSVA 1YOVA 4II2A 1MUUA 3CINA 2NWQA 2B5VA 2VTDA 1GCOA 1LU9A 4QUKA 1A71A 3GK3A 1ZJYA 1KS9A 5A9SA 5J23A 3F5QA 1KVRA 2ZB8A 1LX6A 1N9GA 4UVHA 4P4GA 4DC1A 2JHFA 4ZQEA 1ZSVA 2VUUA 1AHHA 2R00A 4D79A 2HK9A 5TS3A 2C2YA 2WDZA 4N5MA 1W6UA 4GWKA 5TSDA 4XZ3A 2B36A 2Y1GA 3WIDA 1JAXA 3VVCA 2JAHA 3R3JA 1QLHA 1EVYA 3ONFA 5LC1A 1LLUA 4YXFA 1HSOA 3VTZA 1KVTA 2VCYA 3ZWXA 2UAGA 3ST7A 2WJPA 2Q4EA 2VNSA 4N54A 4R68A 2H5LA 4WLEA 4YAEA 1BVUA 1IOLA 2EJWA 4CQMB 3IUSA 1NASA 4ALMA 3D4OA 3MTJA 3KYBA 1PGOA 4WGGA 3ENNA 1UR5A 4FFOA 5DP2A 1H6AA 5DBIA 1GD1O 3P2YA 5KVCA 2V6MA 4RF5A 1BVRA 4KWHA 1PQWA 3VAZA 1PS9A 5TRTA 4F45A 3SEFA 3I1JA 1I24A 3ROQA 3EMKA 1E3WB 4KTVE 4IQ0A 4XRRA 1AN9A 1B8PA 4J2OA 3UICA 4CLHA 1HYEA 1JLLA 1XU9A 2JCYA 2H9IA 4QEDA 1CWUA 2DQ4A 2Q4BA 2UUOA 1IE3A 1VL8A 4J4BA 3K5PA 4Q3NA 1DFIA 3PDJA 5JFOA 1B26A 1MLDA 1ZSYA 3H9GA 1J5PA 1U4OA 2Q45A 2W8ZA 1MFZA 5L7WA 4IDDA 3GPIA 1PGPA 3LT2A 4UEKA 5A9TA 1A4IA 3HNPA 3KYCA 2FZWA 3PHJA 2AHRA 3OQ6A 4BHTA 4BVAA 3VTFA 4LCEA 5KJFA 3GG9A 1MFPA 3DZGA 1X7DA 2W90A 1BDMA 3I9LA 2FPPA 3DC2A 4LMPA 4BNWA 2D0IA 1GEEA 1A9ZA 1PEDA 2NQ8A 2ZYDA 4RPGA 3KV3O 2DBZA 1DIGA 2WM3A 3X2FA 3ZHXA 4TVBA 3U9LA 5A06A 3F5SA 4BNKA 4UEOA 4MOWA 3H5NA 2ET6A 1U5AA 3RFTA 1ISGA 4FC7A 3H9UA 4UVGA 3RCBA 4E2WA 3K2BA 3X2EA 3BMNB 1MV8A 2V6BA 4YJDA 1H9BA 5CG1A 5U9CA 1VKOA 1Q0QA 4B4UA 4BO2A 5HS6A 1B15A 4CM7A 1XSEA 5F21A 4I08A 1U2GA 4IGEA 3WWZA 3ETGA 4E13A 1DIHA 2PKQP 1PZHA 3H5AA 3MOIA 3OJ0A 1KEWA 1FXSA 1JWAB 3DTTA 4GKBA 4Q9NA 5BQFA 3Q3CA 3IMFA 4IQ8A 1ZBQA 3AW9A 2JCVA 3H5RA 3I52A 2DUUA 3VZQA 1P44A 2GN4A 1SB9A 1YVEI 4NDNE 3RUEA 2RHRA 3M2PA 2BF7A 4XB1A 2VNAA 4MKRA 4OAQA 3KETA 1KC1A 1G6KA 1OC4A 4HFNA 1K89A 1ZVMA 4ZU3A 5F3RA 3PYMA 4QT0A 4RDHA 3SBOA 2NTJA 2NTNA 2Q46A 3O38A 2VOJA 2HMTA 3NDIA 2CF5A 3V2GA 4XYEA 4PLCA 3TZCA 4RPKA 3DBHB 5EERA 2YUTA 4FFRA 2BLLA 2EF1A 3L4BA 1O94A 4RL6A 4N18A 3JYNA 2YW9A 3DOJA 3ZWWA 3N58A 5AXCA 4AJEA 3WGZA 1JKFA 2P9EA 3CEAA 3KXDA 3TJRA 4ESOA 3OIGA 2DFDA 1QG6A 4DPKA 1Y6JA 4YJHA 4BS9A 2IZ1A 4CQLA 3M6IA 1DHTA 2FHSA 1T1SA 1X0VA 4FDAA 4WOJA 2G1UA 1PJ4A 2YYYA 4XA8A 3T4EA 4AJLA 3JQ8A 2LDXA 3ZNPA 2OP1A 1WLYA 3WGTA 4FR5A 1NQAO 3BXXA 3JQ9A 4TSKA 4H16A 5I7FA 3BMQB 1ISJA 4U6SA 4BO1A 3RKRA 2D1YA 3WTBA 3H3JA 3ONEA 2EJVA 5KJEA 3ZV4A 4EGFA 5CEEA 5KVVA 2P68A 3WX0A 4IIUA 2AMFA 2UDPA 3ZU4A 4D46A 1R0SA 4D7AA 3MWDB 1DDOA 2RIRA 1HXHA 4NZ9A 2JAPA 1R16A 3DONA 5JLAA 3A06A 4JJGA 2YDYA 4O59O 1C1XA 3RJ5A 2IRWA 5JS6A 3TF5A 5THKA 4PLYA 1Q7CA 3Q2IA 1XDWA 1T25A 2AE2A 2DTXA 2X22A 4ZVVA 4WLFA 2I5PO 3IL2A 5DBGA 4H3VA 4R1NA 4ZICA 3GNTA 2FOIA 3DZHA 2JCXA 4HY3A 1T2FA 3GY0A 4UVIA 3TFQA 3AU9A 2RHCA 1N2SA 1VPDA 4YJFB 2Q2QA 2EP5A 3VVBA 5G0TA 2GASA 1EE2A 1OZAA 1UJMA 5JMPA 2WEKA 3CSDA 4EYEA 1U8FO 2FWMX 5FFFA 4I9UA 1MP0A 4WEQA 1F8GA 3OIFA 4P22A 1ZKMA 2ZJ1A 5COAA 1ISMA 5BNTA 5JCJD 1Y9AA 2AEMA 3ZWNA 3FPCA 1I0ZA 3TPCA 4B4WA 5ER9A 4BMVA 4KUEA 5L3ZA 3EZLA 2VYVA 2YHIA 1PWZA 2NTVA 1PQPA 3RI3A 3AY7A 2EW2A 1WVGA 4A5OA 3C1TA 2I3GA 3QW2A 1GPDG 1V9LA 3E5MA 2YV2A 3PJFA 1VL6A 3JQDA 1ISHA 4NBTA 4INAA 2Y05A 1SOVA 4NH4A 2VRCD 1JDJA 1MX3A 3BMCA 4YRBA 1M75A 5IDWA 3BTSA 5G2OA 3UFXA 3V8BA 5G4KB 3O4RA 1MG0A 1HWYA 1RYDA 3AUTA 3JQAA 4GVXA 2EP7A 1A27A 2NADA 1PU2A 1GQ2A 4E30A 3OJOA 1I3LA 4BO7A 4BIIA 4DMLA 1Z45A 1BSVA 3LLVA 1H2BA 4IZHA 1T24A 4D3DA 3M2TA 2NVWA 4BNUA 1J6UA 1ZXBA 2HMSA 2JJYA 3RUFA 4YR9A 4XRGA 4B8WA 3ITDA 1LBEA 4DA9A 1G1AA 1I33A 4I9NA 4XGIA 3VZSA 4WE3A 3ZWPA 4IINA 5KVSA 3LLSA 1P45A 4OIMA 1B3RA 1DJQA 3GZNB 4PCVA 4ZA2A 5JCJA 4CMJA 4IS2A 3PIIA 3PTZA 1GADO 3NTRA 3JQ6A 1Z75A 3ROMA 5JC1A 1ZNQO 1PJQA 4XKJA 2YFQA 1PZEA 2OMEA 2ZB4A 1UP6A 1Z7EA 1IL0A 3TQHA 3JYQA 2CVOA 1P1IA 4DPMA 4B4OA 4IDEA 5I7SA 5T5QA 3P19A 1RM5A 2BGMA 3DBLB 4J43A 3U49A 4M86A 2BGLA 3QE3A 3TRIA 5JC8A 1D1TA 2NLOA 5C7IO 1UAGA 1PGQA 2VRCA 4QO8A 5IXSA 4WK6A 5JAZA 4CLOA 1WNTA 3DB2A 1HLPA 4XQ9A 1Y5MA 2DU8A 1NVTA 1D7OA 4GQAA 3KEQA 4MIEA 2I65A 5DNAA 4DMMA 2IXAA 1Q2XA 4K26A 4WLNA 4RVGA 2UVDA 3OHSX 3ZWVA 4XDZA 1E6EA 1LRJA 5L7YA 1D8AA 5IF3A 3WYBA 5L4LA 3ANLA 4P4NA 2PGLA 3M1AA 3DOOA 4W9NC 2QRKA 5F5LA 3DFUA 2DKNA 1Y8QB 3NV9A 3OEYA 3LDHA 2EWMA 1F0YA 3PLRA 2WD7A 2D5CA 2GN8A 2DUWA 1S7CA 3K96A 2VZ0A 3O8QA 4A73A 2QZ9A 2DPGA 3ADOA 3GZ4A 4WCDA 4ZQHA 4CODB 4PFJA 1LDEA 1ONPA 4IPTA 2TMDA 4XGKA 2XOXA 3SC6A 3WBBA 3U09A 4WCFB 3CUKA 4A2CA 3CH6A 4AJ1A 1PTJA 4XJTA 1JWBB 1Y1PA 5KCZA 4G81A 2WYVA 1U4SA 2VHZA 1DXYA 1FDVA 2O3UA 1UDCA 1X1TA 1XKQA 1YQXA 2PD3A 1HTBA 1HDZA 4XB2A 4Z9YA 4YAJA 3UCXA 4BGUA 4S1VA 4ND3A 4ALIA 3RSHA 3KEOA 3L6EA 4OHUA 4GL4A 1QYXA 1NWCA 3OA0A 1P0FA 1BDBA 4M1QA 3F4LA 3KYDA 3VKVA 4OQYA 1HSZA 4EJMA 1YL6A 5I8ZA 5LDHA 3R3SA 1ULSA 2ZK7A 3I6IA 4WPGA 1KYQA 3RU7A 4LMRA 5JBIA 2SCUA 4ND2A 2VTEA 5EN4A 4CUKA 3C1OA 3PVZA 4L75A 2VWQA 3TFOA 3WWYA 3M1LA 5A05A 1DAPA 3UAGA 3UXYA 2BELA 1F14A 4PLGA 1GYQA 4QQRA 2HRZA 1I2CA 3QWAA 5AOVA 3MJTA 2GPTA 2X0JA 3OECA 4CMIA 4YT8A 5CDTA 2HQ1A 5IZ4A 2BKAA 1PL6A 1N1GA 4WLVA 2DTEA 4WLOA 4RLSA 4XWYA 3TDKA 2C29D 3H2SA 5G0WA 3H9QA 3E18A 3GNQA 5CDGA 2Q49A 5CPBA 5JY1A 2HK7A 3PYXA 4CM9D 1EK5A 2GZ1A 4WECA 4NBUA 3B1KA 3NJ8A 4GMFA 4CM8A 2AG8A 3SXPA 4ND4A 4NI5A 1B8UA 1RJWA 4H7PA 4JNKA 2C7VA 1N5DA 1GZ6A 3GDGA 3VHRA 5I8WA 4YWJA 2HCTA 2OORA 2BH9A 4FB5A 1LA2A 1NR1A 4TVOA 4YT4A 2B5WA 2BHLA 1ZMTA 1V8BA 5BR7A 5COBA 4CLRB 4D45A 2C5AA 3JQ7A 5CEFA 1Y5RA 4W7HA 3AI3A 1E7WA 3ZGYA 4AJOA 2CY0A 4FFNA 1I3NA 3KLPX 1R4NA 1EVZA 1NXQA 4CV3A 1E1KA 3FD8A 1DOHA 4QX6A 4W7IA 4EUEA 2O2YA 3HADA 3IOYA 5F1KA 4HUJA 3VH2A 3DAPA 1UUFA 1YBAA 5EPOA 4DYVA 5AXBA 3AOEA 3ETDA 3WQQA 1T1RA 1E6WA 2ZIZA 3L07A 3ROPA 2CNBA 2Y1DA 1N1EA 4AJ2A 3JD2A 4URFA 3DMTC 1X15A 3QA9A 1ZXLA 3RWBA 4DUPA 4JXKA 5DCUA 1QORA 5L7TA 1FF9A 4BNJA 4J1NA 2A4KA 2PTGA 1QKIA 2NU9A 1XEAA 4BKOA 1UXKA 3QIVA 5TGDA 1BGVA 3L6OO 4RDIA 4J7CA 1UP4A 1V3VA 3HUDA 2Q2WA 4XYGA 4TQGA 3GN2A 2ZKLA 5B4UA 4KUGA 4Z3KA 1CRWG 2C82A 4L4XA 1ADBA 4YQZA 1M2WA 2VHVA 2XXJA 1E1NA 4BO8A 2NVUB 2V6GA 2NUAA 3H4VA 1EE9A 3IKVA 3UF0A 3L4SO 3ZNNA 5GMOA 3HDYA 5MDHA 3GGPA 4HFRA 5T6BA 4B79A 3D4NA 5MGBA 4IDAA 1U1IA 4D44A 3DMYA 4RORA 3FN4A 3ONDA 1NPTO 5KNLA 1LRKA 2WYWA 3LC2O 2HLPA 3JYLA 4MP6A 2FR8A 3GQVA 4MVJP 2RCYA 4S3MA 4J1SA 2ZB3A 4WCFC 2NU7A 4KWIA 3NKLA 1GYRA 3PQDA 4IUYA 4CMBA 1ISFA 3LK7A 3DZKA 4OGWA 4EW6A 4CM4B 1I30A 1HLDA 3A14A 4FQ8A 1NHGA 2G0TA 1WPQA 4L73A 1NWHA 3HDJA 2H1SA 3WYCA 2F00A 4PGFA 3LC7O 1NPDA 3QY9A 1VLLA 2E37A 4IXTA 1HF3A 4CM5A 2X86A 1XGKA 4UUMA 3DAGA 5L53A 4ZRNA 1GV1A 2JFFA 5JAQA 3IIEA 3GPDG 3ITKA 2NACA 1BXGB 1KVSA 1FK8A 1DRWA 1P33A 3GFGA 4Q3AA 2QHXA 1KVQA 2DLDA 2NQTA 1T26A 4OL9A 3KRTA 5B4TA 2AXQA 2RAFA 1C0IA 4I5GA 5FI5A 2GZ2A 3P7MA 2OUIA 2HUNA 3JTMA 2FR1A 3UH1A 1LQUA 4L0QA 3FF4A 4BO4A 4TROA 4JROA 1CQIA 1JKJA 1ENPA 4AVYA 1CYDA 2EG9A 4YAKA 1LSJA 3FRJA 4PLTA 4R5MA 3IP3A 1CF2O 3CMMA 1SCUA 3E9NA 3R0IA 3TL3A 5A03A 4KQXA 1F06A 1LDMA 4D3FA 1ISIA 4HV4A 1XIVA 2J3IA 2Y99A 2QRJA 4YACA 1IUKA 5L95A 3IC5A 1F17A 4PLWA 4RVHA 3S2FA 1VSUA 1T2EA 4U8GA 4XR4A 4Y6PA 4K6CA 1C3VA 1CJCA 2EKLA 4QXMA 3EDMA 5JDIA 2Y0CA 2PKQO 3PPIA 5BSHA 3QRWA 1GU7A 2AQKA 3WGGA 1VE9A 2PGDA 3D3WA 4PZDA 2DAPA 4DBZA 1C1DA 2O23A 3TNLA 4BO9A 1GUFA 4XYMA 3FTNA 1YXMA 1IHYA 1XU7A 4CLEA 3DR3A 1WDMA 2VQ3A 4WNIA 1EZ4A 3GEGA 3GVPA 4LVCA 5A04A 4B7CA 4C7JA 4BO0A 5CG2A 4E6PA 4NK5A 4JN6B 1BTOA 4K28A 4E5MA 5JDCA 1WAMA 3I83A 4GX0A 5T8KC 2X8LA 1KY4A 4AJKA 1MG5A 5DF1A 4DBVO 2I99A 2IYPA 4QO7A 4ZQBA 3VPHA 4DYDA 4ZQGA 1Y8RB 5HTOA 3PJDA 1QRRA 2ZATA 2HMUA 3V1UA 4GMGA 1K2WA 2C20A 3K9QO 4JGBA 4M87A 4XYBA 2X0RA 1DO8A 4Y9DA 4D41A 2JFHA 1PJBA 3RD5A 2O3RA 4Z0TA 2E4AA 5EL0A 4XGNA 5JO9A 3CKYA 1DEHA 1W0CA 2IEDA 3KZVA 3GH3A 5KIAA 3RC9A 3DZFA 3GHYA 9LDBA 1B14A 3B70A 4NJMB 4BKUA 2UV8A 2BFMA 4Y8VA 1FDTA 1S6YA 4L74A 4LGVA 1Q0LA 4IDFA 1E5LA 1D3AA 4YJGA 3GAZA 4XYLA 1TT5A 2V6FA 5C7LO 4K6FA 3TL2A 4BO3A 1RPNA 1RWBA 4BNXA 4CUZA 4CMEA 1B16A 3PRJA 3BMOA 4LK3A 3ZH2A 3T4XA 5BSEA 2C5EA 4CMKA 3FWZA 2CDAA 3ZV5A 2J5KA 4BNVA 2O2SA 3KSDO 1OAAA 1I2BA 4MVJE 3AOGA 3R6DA 2VUTA 4FCCA 4XIJA 4AG3A 1AGNA 5TJ9A 1UXIA 3QVWA 4GX2A 3E1KA 4ALLA 3H9JA 4I1IA 4XEHA 2P5YA 5EESA 1CDOA 2WWRA 3HSKA 4G65A 4BNMA 4HFMA 4ROSA 2OFPA 2PD4A 3CMCO 1EEHA 2C7GA 3WR5A 3EUWA 2HK8A 4M49A 3QVTA 1R4MB 1YONA 2HJRA 2VZ9A 1TVEA 3GNSA 3RQSA 3Q9NA 1T4DA 4RJTA 1B2LA 3F6YA 2DPHA 4PLFA 1NR7A 2X4GA 1FDSA 2IEBA 1ZK1A 2BFOA 3TN7A 4B4VA 2C54A 3IKTA 1DIBA 3OH8A 1X13A 2DTDA 1SC6A 4BNFA 4Z9XA 4IMPA 4N7RA 4HX5A 3ROKA 2YHUA 1PIWA 1NHWA 3NDJA 2GN6A 3GMSA 5T57A 3D0OA 4J1QA 1HDYA 1YBVA 4I8XA 2PLAA 3FR7A 5ENVA 4NQZA 4CV1A 4UULA 2VOEA 4J7UA 1IHXA 1Y9EA 3H2ZA 1HDGO 2TMGA 2ZCVA 3DZJA 3RBXA 3FNEA 4YAGA 1DFGA 4N5NA 1EK6A 4JX8A 3S1LA 1OOEA 3INTA 2J6IA 3I9NA 1MC5A 2Y1FA 1KEPA 5FYDA 2CDBA 5HA5A 3AJRA 1SB8A 1IPEA 1P74A 1L7EA 4IJUA 5TLSA 4I9HA 4HXYA 3FNFA 1LRLA 3G1UA 3K30A 4O63O 2NV6A 1ZH8A 2Y67A 4TRRA 1XLTA 4XD2A 2HU2A 4FOSA 3QSGA 3E03A 3DFZA 3GUYA 4FW8A 1AXGA 3QVSA 4MVJM 1E77A 2D59A 1E7YA 1DIRA 1NVMB 2O4UX 3OJLA 3U62A 1GCUA 4J9UE 2UYYA 4TKLA 4L4SA 4PG7A 3O03A 4KMSA 1LLDA 1TB4A 1E1MA 3WOHA 1PS8A 2W2KA 2W2LA 4AFNA 3D3EA 2AQ8A 4E5YA 4BO6A 1BMDA 3T7CA 3GEMA 4R54A 4WJZA 1ZUD1 4TZKA 2IZ0A 1HYGA 3ASVA 5B1YA 1P77A 1UDBA 2PZKA 2VWGA 3GVIA 4KTTE 2VYVD 1H94A 2GERA 5ICSA 1R6DA 1W4ZA 3LF1A 3ZWYA 1UXHA 2H63A 3L9WA 1BW9A 3ZU2A 1ZFNA 2C2XA 2Q50A 4P38A 5DP1A 4BGVA 3P2OA 4PLHA 4NBVA 2Y0DA 5HRUA 3JQGB 1YGYA 1F12A 4P4LA 4CL8A 4BB5A 1ZO8A 3CE6A 1I3MA 4CPDA 2FSSA 3N74A 5EIOA 3F9IA 1RYEA 1WXDA 1SO8A 3DO5A 2Z5LA 2J3JA 2RH8A 1LSUA 2C0CA 4FJ0A 3AM5A 4HNGA 1YJ8A 3F1LA 1I32A 3VKUA 3QWBA 3VH4A 1GFSA 3RC2A 3JQAD 4CQMD 4G5HA 1NNUA 3H6KA 2Z1NA 2ZYAA 4X54A 3KHUA 3PFFA 2OXIA 3WGYA 4ALKA 5JYEA 4GVLA 3KTDA 2JD2A 1LQTA 3L9XA 2P2SA 4YPOA 1U9JA 2D2IA 3BIOA 4NNJA 2X1HA 1G0NA 3K73O 1ZK4A 4DVJA 4OH1A 3HFSA 3CZMA 2DT5A 3MJEA 1E7QA 1XELA 1E3LA 3KBOA 1Z73A 3GHHA 3WJAA 4R9RA 2BFPA 5JYDA 4D3SA 3NT5A 3WDSA 4RLHA 4GKVA 1D4FA 3AUSA 2CDCA 5JSFA 4CJXA 4R1TA 3E9MA 1NQOA 1U3TA 2GCGA 3NGXA 5L45A 3L6DA 5L4NA 3DZIA 5TNXA 1IULA 3PHIA 4FPXA 1O8CA 2DVMA 1PJTA 2PA3A 3WMXA 1HE2A 4CMCA 2G82A 2QX7A 1M6HA 4OQZA 1ENOA 1DPGA 5H82A 3HHPA 3CPSA 3JD0A 4MKXA 4E31A 3HJAA 3DXFA 2Y1EA 3WSVA 4YVFA 3V1TC 4RGBA 3MJ4A 3AFNA 1U28A 2B4QA 3JQFC 3OF2A 4CQMA 3OJFA 1P1FA 3VH3A 2Y68A 2WD8A 2GUGA 1IYZA 4BOYA 2BFAA 3IDSA 4NU6A 4R1SA 5FWNA 1X14A 2AG5A 1I3KA 3HN7A 3ICPA 3KB6A 4BKPA 1YKFA 1HDXA 4IDGA 1Z6ZA 1LC3A 1PWXA 1QV7A 4M55A 2PY6A 1PJLA 4ZQFA 3K6JA 1JN0A 4Z3DA 4GLOA 4O1MA 1E3WA 2XPCA 3ZU5A 5JY6A 1MXFA 4Z0PA 5C37A 3QHAA 4KDEA 5ILOA 2I76A 2QZZA 2CD9A 4CMHA 1JAYA 4W82A 2OHXA 3D5QA 1H2HA 3U4DA 2D5AA 3PHLA 2FPGA 3GDFA 2P5UA 4UREA 2B37A 3DHNA 3EZYA 1XR3A 5THQA 5F1OA 4R1UA 1Z74A 4I5FA 4UAGA 1K0UA 4J7XA 3NEPX 5EQDA 3MEQA 2PZJA 2Q2VA 4PG8A 1C0LA 1LDYA 1OI7A 2DBQA 3LU1A 5ILGA 3SX2A 3VOSA 3DBRB 4HADA 2PFGA 3KSUA 4W99A 1EMDA 4A26A 5CHEA 4YT5A 2FZEA 4MVJI 3HN2A 4LCJA 5IZCC 4R51A 3NTQA 4TRJA 1GUZA 1H9AA 2AE1A 2PZLA 2BI7A 1NX6A 2EHDA 1P1HA 3W6ZA 2GF2A 3FI9A 4XJSA 2NVBA 1PJCA 1H6CA 1J0XO 1YB1A 1VRWA 4UVEA 3GN1A 3FTPA 3BHJA 2FR0A 3BMNA 3OQBA 2QW8A 3B1FA 4HWKA 4ALJA 3DWFA 3ZW9A 3H9EO 1ZMOA 3G17A 2EW8A 1NVGA 2WYUA 4YA6A 5K0ZA 3I23A 1P1JA 2P9CA 5DBFA 3NT4A 1JU9A 3EVTA 4L76A 4WUVA 2EEZA 4NMHA 2VRBA 5IJZA 4Q3BA 4A7PA 4C7KA 4GLLA 4GX1A 2GRAA 5ES3A 3W6UA 3DL2A 3S55A 3ZW8A 3E8XA 4ZJUA 1GUYA 3RUAA 4LRTB 5JCXA 5FF9A 1BXZA 1UH5A 1YOVB 3OMLA 2Y66A 1NAHA 3UGKA 2PR2A 2R2GA 1ADGA 1MXHA 1KY5A 5A9SB 1QSGA 1NYTA 2HKIA 3V2UA 3S2GA 1E3EA 3Q0EA 4FGWA 1N9GB 5FI3A 2AEJA 1LEHA 3VPSA 3ZU3A 5L40A 3QJ5A 2WE8A 1WP4A 2P4QA 3GUCA 5KJ1A 1H5QA 1EBUA 1E3JA 1QV6A 2X9VA 3AK4A 3I9JA 3LT1A 4BNZA 1I36A 1JVBA 4EBFA 1DHRA 1DFHA 3U4CA 1YB5A 1V6AA 5I7VA 1GAEO 1DLJA 1U7TA 1N92A 3FWNA 3GOHA 4QECA 1YH3A 4E4YA 4I5DA 1W73A 4EJ6A 1V3TA 1SMKA 3DBHA 1MC4A 1HKUA 3WGQA 4OOEA 1DC5A 1RM4A 2X0NA 1DSSG 2E49A 3UHAA 1OFGA 2W98A 2X7HA 1N8KA 1O95A 4NFYA 1EVJA 1E5QA 4EDFA 2C59A 1DC4A 3HZZA 2O3JA 1KERA 3RASA 5KOIA 2EXXA 3FHLA 3OIDA 5G0SA 1GZ3A 3KSZO 4OXNA 4Y6RA 4AJIA 4CLDA 3Q2KA 4OXYA 4GAEA 4DLAA 1PJSA 1EVIA 1L1FA 5I9NA 2FPIA 3ASUA 4GSKA 3WMWA 4PIVA 2GSDA 4UEJA 4BNIA 3DAFA 4GX5A 3UKOA 5A5FA 4W9NA 2BI8A 2BGKA 1IY8A 3QWIA 3BTUA 2CZCA 3QVXA 2PD6A 3C8MA 3I9KA 1VC2A 4Z0HO 3GVCA 1U2DA 3BAZA 1GTMA 2HSDA 4MPDA 3G1TA 3K8ZA 5ITVA 3ZNQA 2J3KA 3LSYA 1BXKA 2D8AA 3DBVO 4B3JA 4RPHA 1UDAA 3ABIA 3G79A 3KYCB 4RPJA 1OBFO 3DQPA 5TC4A 2EKPA 2VWHA 3GT0A 3WYEA 5BSFA 2ZTMA 1E1LA 1Q0HA 1WZIA 2A9FA 3RFXA 4R69A 5DDIP 1UXJA 4YTEA 1OC2A 1VM6A 2JD0A 3S8MA 3RUIA 5FEUA 3GR6A 1K5HA 4QSMA 1WZEA 1KC3A 3ZZNA 3BYZA 4TMFA 3OQ1A 3H7AA 3IP1A 3VPGA 3NRCA 4IS3A 5GZ6A 1R0LA 1KEVA 4YJFA 4YBZA 1PJ2A 4E2YA 1YL5A 2AEFA 3JD3A 1ZJZA 3TZQA 4NG5A 3QLJA 4XDYA 3ANMA 4LSMA 4DXHA 4U5QA 1YWGO 4FOOA 4NK4A 2J5QA 4XCVA 1WW8A 3JD4A 4E5PA 3RJ9A 4IM7A 3R1IA 4N5LA 1A5ZA 2X6TA 3HWRA 5JE8A 4ALNA 2XAAA 3U4HA 1PZGA 4JJFA 1Z82A 4CR6A 4F6CA 1DJNA 3RU9A 1PGNA 3IJPA 4IXWA 1H0KA 3ZI0A 2EV9A 3LT4A 4DQVA 2G17A 1SZJG 4A10A 1HEUA 3WNQA 1HZZA 1YRLA 2WE7A 2DBVO 4J4TA 2HDHA 3UOGA 4M89A 1V35A 2E82A 4BL5A 1E7MA 1YQGA 4WOKA 4NU5A 1A72A 5G4KA 2GO1A 3A28A 5GZ1A 1ONOA 1VJ0A 1ZIDA 3AI2A 2GGSA 2YDXA 2P9GA 3GG2A 1YBMA 4FS3A 4OMUA 3WJ7A 1VKNA 4J4HA 3NX4A 4NJOA 3SJUA 2GZ3A 5KKAA 2V7PA 3EC7A 3GEDA 1UZNA 5DZSA 2Y1OA 5A02A 2IODA 1U5CA 3JYOA 1A9YA 4BQPA 2PKRA 3W1VA 1C0PA 1AUPA 5CEJA 1PL8A 3GZNA 4YJHB 2R00C 4CQLB 2O3SA 2J3HA 2QG4A 3C24A 2X23A 3AUAA 4Q3CA 3K2EA 4CMGA 4LISA 1E7SA 1TA4A 1N7GA 3COSA 2R6JA 1LXCA 2AQIA 3JQ8B 4TZTA 2CVQA 2GDZA 2P91A 1L7DA 1UXGA 2G76A 3DBLA 1CEQA 2AW5A 3SVTA 3EGOA 1ENZA 4LW8A 3AY3A 1QYVA 3JD1A 1GV0A 4CL3A 2F1KA 4KUHA 2G5CA 2ZQYA 3DMTA 4RZIA 1U3WA 5GY7A 2H6EA 3ZWMA 3WG9A 5TT1A 1PQUA 1V0JA 4TRMA 2E6UX 1SNYA 5K9ZA 1YDWA 3TOZA 1LNQA 4J49A 5JO0A 2E48A 1XWFA 1LUAA 3D5TA 4BKRA 1TT7A 4RPLA 5KTKA 4ZRMA 5C3MA 1DC3A 3ZWOA 2Y93A 1C1XB 3HQ4O 3MJSA 4R3NA 2UUPA 4XIYA 1P3DA 5EINA 4EZBA 5AQ1A 3RBZA 1H6DA 4AJJA 1EDZA 2JFGA 4MP8A 2Z1MA 3OJEA 4BUCA 1LSOA 1GZ4A 4OXKA 1Y8QA 2AA3A 2VUSA 1A7AA 3EY4A 3DEYX 5L4SA 4G2NA 3FNHA 3ICCA 5AYVA 3C3XA 2RH4A 1JA9A 1K6XA 3ADPA 3G0OA 4MINA 4D42A 1Z7BA 4KDFA 5DN9A 5TF4A 2O7SA 2DBRA 4QFCA 1VJ1A 3GGOA 1XQ6A 4CV2A 3I4CA 4NBRA 2O7QA 3GVXA 3GF4A 4WCFA 4FJ1A 1V3UA 3WLEA 4AJ4A 3IAHA 4PLZA 1NQTA 3I9OA 1EFLA 2X5OA 3N7UA 4FSHA 1Y7TA 3F46A 1EUCA 1EQUA 2YHIB 3IQDB 1LDBA 3L0DA 1HETA 4FBGA 1E3IA 2CUKA 1H6BA 1T4BA 4IDCA 5HM8A 3AFMA 2A94A 4GH5A 1NFQA 3L77A 1TXGA 3U5TA 3STHA 2FSVA 3OM9A 1O89A 4L4RA 1WMAA 3NTOA 4J0EA 4PRKA 3TSCA 1ML3A 3H3FA 1DRUA 3KO8A 4IQGA 3MJCA 1VL0A 3BMCB 3IUPA 3ZCXA 4CM1A 4U7WA 3QP9A 4EEXA 5EMHA 4JIGA 1ARZA 6LDHA 3PWSA 5JAIA 3WTCA 1I5RA 3A4VA 8ADHA 2VWPA 1UP7A 3JQAB 2POQX 4NPCA 4JJIA 1MA0A 2FMUA 1YQDA 3I5MA 4PRLA 5KWEA 2OO5A 4R9SA 2EKQA 3NT2A 1BG6A 3MJVA 1ZK3A 4TRNA 5EJ2A 1NTOA 4MVJA 4CM3A 1MB4A 5IXYA 2PK3A 4J6FA 5A1TA 3JQEA 3I4FA 4YAIA 3H8VA 3SLGA 5I7EA 2YQ4A 4PLVA 4JBHA 2ZTLA 1RM3A 2JHGA 2BD0A 5TT0A 4RO0A 4DTIA 1M6WA 1IPFA 4J2HA 4BV9A 3C7AA 3WQRA 1PGJA 3JQBC 5L9AA 4K9DA 4Z9FA 3PZRA 4F6LA 4NIMA 4RZHA 5A3VA 2J8ZA 3BHIA 4LRSB 4B3IA 4MVJG 2VHWA 2IDZA 3Q9UA 1SBYA 1EUDA 3OICA 3BTOA 3GA0A 3HG7A 3L4BC 3MZ0A 1NPYA 3QWFA 4XQEA 3K92A 3PI7A 3UVEA 3WGOA 2X9NA 2ZCUA 4W6ZA 2GR9A 4E3ZA 9LDTA 3HFGA 2HO5A 3P5SA 4DIBA 4CLRA 4CLOB 5A4DA 3V2HA 4RVDA 5BSGA 2QIOA 3PYLA 2ILTA 4DIFA 4YRDA 4GGOA 5CDUA 3IJRA 2FN7A 3TZKA 4FC6A 1ENYA 1P1RA 5TX7A 2GD1O 5T8KA 2OOSA 1P9LA 4FGSA 3JQ9C 1H93A 4UVDA 4DREA 1ZZEA 1SOWA 2PWZA 3HB4X 3MOGA 4P8RA 1PSDA 2W2LD 3AU8A 4R41A 3Q11A 4E21A 3EVNA 1R66A 1ONNA 5I9MA 4OKNA 4QFDA 4JQCA 3ZHZA 3SLKA 1JVSA 4DWVA 1GQQA 2WD7B 4ND1A 1O9BA 1WDKA 2I9PA 1FMCA 3O8QB 3LZ6A 5COQA 4RQUA 1PL7A 1VI2A 3WBFA 4OKIA 5IDQA 4XR9A 1O6ZA 1KEUA 2WMDA 2JL1A 4NHEA 4J16A 2XF8A 4BNNA 4YYZA 4MP3A 2O50A 3WQSB 1K6JA 1LDNA 3FBGA 5DT9A 1YS4A 2AQHA 1LTHR 1LSSA 4ID9A 3NGLA 1U3VA 4R3WA 1GYPA 2NVUA 3LVFO 4IJKA 1NAIA 3EYWA 4NFHA 2V65A 4RF3A 1PZFA 4AICA 1NFFA 1TEHA 3PIDA 3BHMA 5JXWA 4RCVA 1EQ2A 5CDYA 3JQBA 2O4CA 2JKVA 3VH1A 4CUJA 3C1AA 3KYDB 4FJ2A 2B4TO 3G49A 5BNFA 4LSWA 1M66A 5DOVA 1HL3A 5DCYA 3BA1A 3CZRA 1HDCA 3ANNA 3INGA 4IGFA 1R37A 4BNHA 4CM4A 2X9GA 5ADHA 2OGUA 3E5RA 5H83A 3WICA 3WGIA 4CMAA 1XQ1A 5JAMA 5HS4A 3KM0A 1XCBA 2D3TA 3PHGA 1K3TA 1P0CA 3V1YA 2JD1A 2O3TA 2I6TA 4CMIB 5ER6A 3BTVA 4BGEA 4GBJA 3FR8A 3W8FA 3VZPA 1HYHA 4MO2A 2FY8A 1BXGA 4FN4A 1ZK0A 3WXBA 5A3JA 1GQYA 3KLMX 1HT0A 4FFMA 3PGJA 1YDEA 4DL9A 1R12A 1U3UA 1QLJA 2CF6A 1XA0A 4XQCA 1QR6A 1C0KA 4JLWA 1XG5A 2IYOA 1KETA 1ADCA 4R16A 1O0SA 4CM8B 1C14A 1BHSA 3LQFA 3VPFA 3F4BA 4HFJA 4DGSA 4OO3A 2P4HX 1ZCJA 5C5IA 5G0UA 4DPLA 5KKCA 2X5KO 4WKGA 2A92A 4AJPA 1E92A 3D64A 4J1TA 1YL7A 1T2DA 3JQ7B 3VZRA 3AY6A 4WNCA 1E7RA 3NJ4A 3I6QA 3K31A 1HZJA 1DC6A 2EIHA 4J0FA 5G0VA 4YCAA 1R4NB 4QTZA 5AXDA 4ZN6A 2LDBA 3ULKA 2HAEA 4E2XA 4BNLA 1QP8A 2YV1A 4K1LA 5U4QA 4B7UA 5B4VA 1HDRA 3GC6A 4IY1A 4GI2A 3PFWO 3PWZA 4O0LA 2ZJ0A 3I9MA 4ONEA 2EERA 5IN4A 1RKXA 5B37A 4HNHA 3QQPA 1RM0A 1T2AA 2WSBA 5CAEA 3ENKA 2I67A 1HDOA 4Q39A 4HBGA 3PHHA 1HE3A 3WFJA 1ID1A 1LI4A 3LF2A 2CVZA 3TZ6A 1FDWA 1QMGA 3NYWA 3WIEA 2VT3A 5TJHA 2OBNA 4UUNA 3TWOA 1XHLA 3AM3A 3ORFA 3QV1A 4MKZA 3U0BA 1DLIA 5DOZA 4CR7A 1NQ5A 5IDYA 2XXBA 4XQGA 3MTGA 4YB8A 1I10A 4BMNA 1X1EA 1B7GO 4DC0A 3HDHA 3AI1A 2B69A 4NFSA 4RVSA 1TI7A 1YB4A 1B3BA 4IJWA 1Y8RA 3UW3A 3PEFA 3KUXA 2W4QA 4MDHA 1XYGA 3LYLA 1LJ8A 2IZZA 4JP2A 2VHXA 3MCVA 4A0SA 1I01A 4WEOA 3RFVA 1AE1A 4B3HA 3PJGA 4B7XA 4BQRA 2BRUA 3BZUA 2WTBA 4BB6A 2HRBA 3ON5A 4ND5A 2PZMA 4UUPA 4IZIA 3KOUA 4JK3A 4OYRA 3INRA 2GLXA 4F46A 5IFLA 1WDLA 3D7LA 5I9LA 4MVJH 4NJMA 3JSAA 4CLXA 5ITWA 2PH3A 4IIVA 4TWRA 4MIYA 1Q7BA 1NM5A 1X0XA 3ZWAA 4ZGWA 5BT9A 2HJSA 1YE3A 4II3A 2DFVA 2ZTVA 3QVOA 5IN5A 4MVJF 4Q3EA 4O6VA 2EGGA 3AUUA 1GY8A 4UUOA 3PK0A 4CR8A 1PX0A 3G3EA 1OMOA 1WWKA 3GAFA 1N7HA 3JV7A 3NDRA 3TOXA 3PGXA 1NBOA 4J90A 4KQWA 5CP8A 2OBYA 4E2ZA 1DRVA 1KVUA 1YJQA 3B20A 1I2ZA 3T7EA 1YO6A 5A5EA 5JMWA 2VZ8A 1G0OA 2IE0A 3JYPA 5H81A 4AJHA 3GDOA 1QYDA 1ZEMA 3FBTA 3ZNOA 4PN3A 4U0JA 3IS3A 1O5IA 3EW7A 3ZDFA 5ICMA 5JNLA 4ZD6A 3WNVA 3QWHA 3FCOA 1R4MA 1QYWA 3Q1LA 3E48A 3SJ7A 2GNAA 4C4OA 4L8VA 4O5OA 4YQYA 3W8EA 2OZPA 3JQFA 3U3XA 3RUCA 1IB6A 3FPLA 1ZSNA 8LDHA 2O48X 3GMDA 3WS7A 3GVHA 3EAGA 2YZ7A 4OOFA 4CM6A 1ZK2A 4BKQA 1PR3A 3E9QA 4J91A 4RVUA 1EBFA 4PVDA 4U6QA 2NM0A 2NU8A 3RAJA 1D1SA 3FSRA 5BNIA 2QQ5A 3U4IA 3MWEB 5CFZA 1ZEJA 4E33A 3OBBA 3ZV3A 3D3WB 4RV9A 3B1JA 3GFBA 2YY7A 1C1DB 5B12A 4GWGA 4NBWA 1GL3A 5ENDA 4E5NA 1NP3A 1QXSA 4M54A 7ADHA 4OSPA 2FP4A 2GYYA 3VPXA 1CIVA 2I66A 5HWSA 2QYSA 3HE3A 3RUDA 3D1LA 3S2EA 1IZ0A 4MJLA 4IDBA 2Q99A 4CV0A 2PGJA 3RC1A 3UN1A 1JW9B 2X5JO 3PJEA 3OFSA 1M76A 3W4IA 1SEPA 2QRLA 5A9RA 4NR0A 1ZW1A 4D0RA 5HBRA 2VYND 1BRMA 3ZN2A 4GGPA 4PLPA 4R5HA 1NFRA 5IZCA 3AOEC 5DCWA 1KBZA 4DIOA 2VHYA 2B83A 2B0JA 3W4KA 4Y98A 3V5NA 3F1KA 4GSLA 3O9ZA 5KJ6A 3E82A 4E12A 1E0DA 4JP3A 3Q6IA 5LCXA 5LDGA 4E32A 3BMQA 4RQTA 1Y81A 1DIAA 4KP7A 4OJNA 2Q1UA 2OL4A 4RF2A 2B35A 2PV7A 4BV8A 1Q1NA 2Y0EA 5AVOA 1M67A 4YT2A 5KVQA 1P1KA 5JPIA 1R15A 3WSWA 4BNTA 3AWDA 4IMRA 4YJGB 5DULA 1DBVO 1TT5B 1U7HA 1UZLA 5IDXA 3JQGA 1EUZA 4A27A 1UZMA 1VJTA 3RIHA 3BMOB 5F1PA 1Q7GA 3VDRA 4JBIA 1R0KA 2NU6A 3ETEA 4L9RA 3GLQA 4PG5A 2CSUA 3VDQA 4WLUA 4KOAA 4FIZA 2HMVA 1J4AA 4ITUA 3F3SA 3TZHA 4YEDA 3HB5X 4EUHA 4E0BA 4I5EA 5F5NA 1QYCA 2VYNA 3OP4A 3UCEA 1SEVA 3D4PA 3SC4A 2J5RA 3B6ZA 1CETA 1AXEA 3WFIA 1HRDA 2X0IA 1TLTA 2YV3A 3A9WA 4BNYA 2RBEA 4AJNA 3ZV6A 3PQEA 3NAQA 2DC1A 5EQFA 2VT2A 2VN8A 3A1NA 1FJHA 3OA2A 1ADFA 3PWKA 4LVUA 4RVFA 3CTMA 4EJ0A 4Y6SA 3C7CB 1DAOA 4A03A 2O3QA 3PQFA 5L51A 2NNLD 4PG6A 4RF4A 5G4LA 3O26A 3OSUA 4FFPA 4OSOA 3DHEA 2HMWA 4IBOA 4F3YA 4LN1A 4PG4A 3RUHA 2Y1CA 1X7GA 4BMSA 5KJCA 1I8TA 1GPJA 4BO5A 4HP8A 6ADHA 5GZ3A 1P31A 3DOCA 1EDOA 4Q3DA 2Q1TA 1WMBA 4DRYA 4J9VA 3UCFA 1UAYA 2FRDA 3RBVA 3GRPA 4EI2A 3C85A 1SPXA 2DM6A 3PXXA 5C7OO 1ULUA 4E5KA 2D4AA 5T67A 3DHYA 4EUFA 1CERA 1HE5A 1SAYA 5K6AC 4FFLA 4J3FA 3JCZA 3NUGA 4R4JA 1HE4A 3JQCA 3WB9A 4DQUA 1J49A 4PZEA 2IXBA 3EK2A
chains in the Genus database with same CATH superfamily
1TLFA 1C8VB 1G18A 2ZQZA 5TQ0A 4EKYA 3VR3A 1UKVY 3WK7A 1T1EA 3OCWA 3R5KA 4Y1RB 1XCJA 5AW9A 4I8IA 5U1PA 1QOPB 1TMOA 1RI2A 1JFRA 1P9OA 1X77A 1CRPA 3MW8A 2PWYA 4EEZA 1Z47A 4L1KA 4GI3A 1Y4SA 1WTAA 4D0SA 1TJNA 4W4TA 4EECA 1GR0A 1B00A 3OAAD 2BGWA 3NAGA 1T3HA 2F90A 1NUTA 2FFHA 4OMFG 4Q1CA 2VA8A 2IYRA 3MWJA 1VGVA 1WB9A 4LXUA 1RRMA 2Q7XA 2ZWPA 2OP0A 3KP1A 3PE4A 2PGXA 3RVPA 2AF4C 2AYXA 3TK1A 1EI9A 5K3FA 1W8DA 2WIJA 3H5WA 2OBBA 1T6ZA 3PA6A 2OK8A 3OLZA 2BVNA 1GEGA 2YMLA 3GRKA 4FD3A 4EOGA 4AI6A 2PH5A 1OSNA 2B4RO 2YIDA 2BMAA 4Q47A 3ZIDA 221PA 1EJ0A 3WGHA 3S8YA 1D8TA 4N9WA 2W2KB 3PNPA 4M9CA 1HFKA 3DXXA 1MAVA 4KPEC 2EQAA 4PXYA 1N3YA 4DSNA 3QPAA 3QEBZ 1DJOA 2RGNC 2ZYGA 3ONVA 5B1DA 5C53B 2JBHA 1E2BA 2OBMA 2D1QA 4GT1A 4M9SA 2XCIA 3TQQA 1E5TA 4X71A 4EY5A 3J81k 1P6QA 1M1YB 4YLGA 2B78A 2QYOA 3T5MA 1JKMA 3AYZB 3MELA 1N3LA 2XLBA 3BM5A 1I4EB 3LDFA 3GDHA 2Z9DA 5LYYA 3VSCA 3WWCA 4CEJA 1NI4A 4LMBA 3WL5A 1BWSA 1IZ9A 4M0FA 5KOHA 2YNMA 1A4UA 1D5WA 4GYWA 2ZT5A 3ZCVA 3VX4A 2GN9A 1J8VA 4HKTA 1F8FA 1MO5A 1YUMA 1ZP6A 3K5IA 4IDNA 4TXLA 4YXWA 3JAWB 2VP9A 2FLWA 3OAAA 4IKOA 3A4YA 3WLJA 1D4AA 3W3AH 3ZWBA 3M8KA 4L6IA 2ZWVA 4HRYA 3F47A 3UUWA 5CYPA 5K6AA 1QGYA 2Q1SA 3MGGA 4Y67A 5EWJB 2C07A 5DM4A 3ZHTA 4A15A 2YFHA 1MDBA 4L8LA 4QPDA 1G20E 5BYKA 3KE8A 2ZZKA 1S7GA 1DB3A 2WRZA 1YC5A 1B0AA 2Q1WA 3GRAA 5F4BA 5K6RA 3BB3A 3CNNA 1DQPA 1WHTB 1KZYC 3N8IA 1FU4A 4LXIA 4YRAA 2E4YA 2HA4A 4R0NA 4C30A 2QK4A 2DFKB 3PQCA 4XX0A 1W4RA 2Y92A 5C4MA 5DYYA 3WLFA 3D3QA 5GJCA 1ODLA 1UKCA 3CG4A 4II2A 1Z39A 2RK6A 4NX2A 4MH0R 2B5VA 1GCOA 3L8EA 3SOPA 3BB1A 3VX3A 3BRSA 3MBOA 3LO8A 4IRXA 2AFIA 3K72B 4DLWA 3SZGA 3F5QA 5A9SA 3PC8C 2DFTA 1N9GA 4P4GA 3OPVA 4R31A 5TGTA 4DC1A 1DT5A 3B9QA 4UZFA 1EFAA 1AHHA 1X74A 3OPYA 5E4JA 1N0IA 4DDUA 1SVMA 1C81A 1TTTA 3C39A 3EQZA 4IUBS 1W6UA 1MIOB 3THXA 2G67A 2QVBA 1O03A 1O9GA 1U8EA 2ZP1A 3AHGA 1XBTA 4I1SA 4WWHA 4B80A 1T5IA 1JAXA 3M82A 2D4HA 2WIFA 3ODPA 5I7HA 4P98A 3FHOA 2C0PA 5LD2B 4TSFA 2ZSAA 1UJ2A 3NYRA 3ONFA 4DOMA 2YN0A 1LLUA 2HCBA 1Z6YA 3B38A 1K7YA 1M2OA 3D8NA 3H2IA 4YXFA 2C95A 3VTZA 4GBED 3KHSA 1KVTA 1RVDA 2IYAA 2F9MA 3AUFA 3I2GA 4X3OA 2WJPA 2Q4EA 5FUBA 2QNRA 4I3FA 1XVVA 4N54A 3LUAA 4WLEA 5FXMA 3C5EA 3IUSA 4JS0A 3HWX1 4JA0A 4GPAA 3D4OA 5AP9A 1ZOPA 1ZONA 2E9SA 3ENNA 1TW2A 1THTA 3PUIA 3QX8A 4P5DA 5DBIA 1E2KA 3QUAA 5LA6A 3P2YA 3PFKA 2IW3A 4NV0A 4RF5A 4KPFC 3RODA 4ENTA 1IHUA 3EQ6A 3W5BA 3UJNA 2W42A 1PQWA 3R0JA 2B2NA 3VAZA 5EJ4A 2HR1A 1X7ZA 1FFGA 4QNMA 5ADVA 1I24A 2BP7A 3EMKA 3UWKA 1MJ5A 3KZOA 3UATA 4Y0AA 4MUYA 1AN9A 4J2OA 3G2IA 4COKA 1H1TA 4MGYR 1JLLA 1HYQA 1AO0A 2FGKA 1EXNA 2CLHB 3CLKA 4BLUA 4ILEA 1YZGA 2ZTSA 4RENA 1P62B 4Q03A 2H9IA 4P4UA 4P34A 4WADA 4LZPA 521PA 4PQYA 4YONB 4FBMA 3U7QB 3K5PA 4X6YA 4I46A 4WZAB 3PDJA 4L57A 4Z8YA 1ZSYA 2O1XA 2PZFA 4D4IA 1C4KA 2W9XA 4RX1A 3UJ9A 4KRYA 1QR2A 1M7GA 1QVZA 3VYUB 3HNPA 3KELA 3QUBA 4B34A 2CJWB 5HSGA 1USWA 4AKTA 1W1WA 4KLRA 3VTFA 2W83A 5JS1A 4U39A 1U5BA 1GXSA 4X3CA 3WLQA 2OBFA 3DG9A 3D6MA 5CT9A 3ESQA 2GK7A 4IXMA 1N2GA 2VP6A 2FPPA 2KM1A 4YECA 5IJ9B 3DC2A 1XLTC 2YL2A 2D0OB 1VCMA 1Y3DE 2CXTA 2IV3A 3WV4A 2FMHA 4BP1A 2WM2A 1UBJS 4H6WA 1PJZA 2ZYDA 5EP4A 2IXTA 4RY8A 1NVKA 2XUAA 2JI7A 3M3HA 1FTQA 5FQOA 1D1QA 3X2FA 2IHBA 3D2BA 5A06A 4R8RA 2PDAA 5J43A 1A2OA 2JGDA 3W79A 3K0FB 2YYZA 3F5SA 2NSJA 3KPUA 1JA1A 1MAAA 4HZUB 1A9RA 4P3XA 4MOWA 1PUIA 1YR7A 2ET6A 1U2QA 2GOYA 4FC7A 4UVGA 2VATA 3H9UA 3MN1A 3WGUA 3BMNB 4C6TB 1MV8A 3W2EA 2V6BA 4YJDA 1P5HA 1BFUA 3RYFB 3OHPA 1FQWA 1Q0QA 3VC1A 1D7AA 5HS6A 3Q8XB 2FWPA 4M53A 2P1DA 3WP0A 2JGEA 1MC8A 2GBGA 3ETGA 4UZEA 1SKAA 1JVNA 1PHRA 1J99A 2JLSA 5GPBA 2PKQP 3D8BA 1PZHA 5LP6F 4F4UA 1HMYA 4TQUS 4MWBA 4KJXA 3OJ0A 1KU0A 1JPJA 1JWAB 1KXZA 4Q9NA 2VXBA 2X8JA 3Q3CA 3VRHA 1E0SA 3IMFA 4POOA 2IEGA 2OR3A 3C15C 2ZVDA 4WXMA 5H4GA 2D6FA 4B3GA 2I33A 4HGOA 4QRHA 3I52A 3K1ZA 4AKEA 1K0FA 2DUUA 1P44A 4PAOA 4D74A 1AB5A 1G4AE 4BMCA 1YVEI 2ON6A 1Z2EA 2RHRA 3E3NA 3RUEA 5DM70 2BF7A 4WDRA 2BMEA 2VNAA 4WHMA 3K4HA 4JU8A 5FPPA 1R2QA 4MVWA 1G6KA 1OC4A 2XYHA 2X8WA 1ZVMA 3AYXB 1GPLA 3KKZA 4RDHA 4XI9A 2VXYA 1AURA 1U2ZA 2NTJA 5JYBA 2NTNA 2WV9A 4LVNA 3MERA 1NMXA 4DY6A 4F3TA 2EBHX 1YRBA 3HCCA 5D6OA 1YF3A 2HMTA 3I05A 1CZNA 4Q00A 2VPQA 2POCA 2ORVA 2C4WA 1Y1QA 2Q0SA 5B64A 2Z2JA 3V2GA 2V55B 3IP7A 1SCJA 1IPHA 1Y4DE 3N59A 1T3ZA 4XYEA 5AKXA 3VQTA 4NRDA 4EPXA 2GWRA 4DCNA 3OE4A 2HPHA 4YLYA 5EKSA 3KB8A 1UBGA 4RL6A 2HTEA 1MVLA 3DOJA 4WINA 4MV4A 4G0XA 1M7BA 3H11A 3WB1A 5ES4B 2JLZA 1LW6E 2QW0X 2P9EA 1JJIA 3TJRA 5G1OA 1KWKA 1QG6A 2BONA 4LE2A 2RBKA 4BS9A 4CQLA 2ONJA 3KD3A 3M6IA 2BJWA 3DPIA 2AZXA 4WXHA 3I2HA 3RIYA 1X0VA 2PCLA 3SP1A 3TNJA 2IYFA 1PR4A 2ID9A 3VHXB 1RBQA 3W5AA 4H0CA 1QPBA 2FPIB 3F6SA 2QTLA 1Y3FE 2Z43A 3JQ8A 3QKRB 4W5WA 3SYKA 2DQKA 1WLYA 1Y1SA 2OP1A 3WGTA 1U0RA 1A9XB 4HI0E 3U48A 1DBRA 4HEA1 1CK4A 4UFOA 4V0SA 4F9EA 3EBLA 1PT5A 2NXEA 2Q27A 3CR8A 3ONEA 1OFUX 5CIWA 1QDLB 3LUJA 1DC7A 2EJVA 3B1WA 4XOUA 5KJEA 3ZV4A 5KVVA 3CVXA 4EJSA 2N1MA 1F2UA 2PS9A 4IIUA 4RKYA 3WX0A 1I94B 3D7NA 5JSHA 5E6UA 3WGVA 1YKGA 1ZNZA 4R0MA 1U1FA 3GLIE 1I2DA 3Q7IA 2OHJA 2GARA 3I1IA 5FI1B 4JI8B 1R0RE 1UM9A 3AINA 1IRIA 1DXQA 5FLYA 3WYNA 3MWDB 3ZLJA 4O4HF 5D3ZA 3RHSA 3WNBA 4X0EA 2RIRA 4MV5A 1BX1A 1DNPA 2JAPA 2GCNA 2P2GA 4NZ9A 5K3BA 4JJGA 3TH5A 2Y4OA 3W6NA 3ZVRA 2IRWA 2E0IA 3B82A 4DSAA 5JS6A 1AH2A 2ZVQX 1XPRA 2QZ4A 5IJ0A 1ZUNB 3R0VA 1Q7CA 4NMMA 3MRVA 3QTBA 1T25A 2AKAB 2X22A 3C8DA 3IURA 3I8SA 2H5IA 5I8PA 3ERCA 3HS3A 2G7MC 4IILA 1YZQA 4F84A 3U7HB 3LXMA 1FNCA 2XUHA 3CF6R 4HY3A 5IC5A 2X5XA 4UVIA 4CHGA 3AU9A 4H3SA 3QBVA 3TNFA 2OBLA 3O7WA 1N2SA 2QVCA 3K1TA 2CBGA 4RK1A 5K3AA 3SSNA 2Q2QA 3VVBA 5L3SB 1IOWA 4AZ3B 4N0MA 2WWGA 2GASA 2A9QA 1EE2A 4ZZ0A 2WEKA 4EW1A 3QPWA 2R0QC 3VC2A 1U8FO 5D7NA 1QX4A 4H31A 5FFFA 3GUUA 4I9UA 1RAIA 1E2LA 1YACA 3RVQA 2FW1A 1QANA 2Y1XA 1F8GA 2CMFA 4WXYB 3OIFA 5TARA 3MJRA 5IU6A 3NBKA 4XLTA 2AEMA 5JCJD 3FPCA 1E4OA 1WW2A 4HGPA 4B4WA 2UXCB 1D6MA 4YUXA 4EJ2A 4ZAGA 4DDHA 1U0GA 1FS5A 1X39A 1ZGBA 1M2VB 2E1RA 2QZSA 3ELWA 4B8YA 3DE5X 3C7KA 1PWZA 4CKEA 2WVAA 4RTOA 4C4XA 3RI3A 1T4CA 3DWGA 3NIDB 1WVGA 1KQNA 4EY4A 1EX6A 9ABPA 4U2KA 3FCXA 4FSXA 4A5OA 1CUWA 3C1TA 5FLXA 4FT2A 3D3NA 3R4CA 1JDVA 4GE3A 5D00A 2XCOA 4M2LA 1K4MA 1FLDA 3AILA 2Q3LA 2RJ3A 3DVRX 1RJ9B 1ZUWA 2XTAA 3FAKA 2YCBA 3BMCA 3EUFA 3IEUA 4GQIA 3ZXYA 1YE5A 2CXQA 3BTSA 2P90A 4MWOA 5G2OA 3UFXA 3UXHA 4E5VA 4ZO9A 4EL0A 2BCJQ 4WXPA 2K6GA 1JMYA 5JSZA 1YA8A 2BGJA 2R3SA 3AQIA 3AV3A 3PXGA 3TTWA 1SCKA 2IPLA 1RYDA 2ODTX 3AUTA 4MO9A 1BVYF 1NLYA 2H0AA 4HCJA 4N0EA 1A27A 1V6CA 3A1VA 1PU2A 1NVVQ 4HRXA 4MCAA 3WBKA 3CEHA 1FTNA 2R7AA 1I3LA 4BO7A 4A2QA 3LLVA 2IC5A 5ALLA 3E9YA 3PFHA 4D3DA 3FPGA 1T8RA 3QK7A 13PKA 3ETNA 3FSJX 3U4GA 2JJYA 3W3ZB 3RUFA 1QMPA 4XRGA 2G09A 4LFCB 3ITDA 1A7JA 1CUFA 1QNFA 3BK7A 5KNBD 2ZR7A 1UBFA 3RIMA 3LKZA 1TZMA 1QAOA 5KVSA 2XZPA 3G5UA 3LLSA 1QLWA 2CB9A 2C7RA 4CMJA 4RE5A 4ZA2A 5JCJA 4YX9A 3PIIA 2WYOA 3PTZA 1YIDA 3Q6NA 3JRWA 1QIHA 3IH5A 5JJLA 1Z75A 4NTZA 1RKUA 4FI3F 4DG5A 1ZNQO 3UJCA 3B36A 2C3YA 5EZ5A 3RYHA 2OMEA 3DW1X 2PHZA 4ZTUB 3TQSA 4FXPA 1D2CA 4GRIA 1F0NA 2W37A 3AR2A 5DEOA 2OAQ1 2ZIXB 4JHLA 3ZD7A 4BQIA 4N7BA 1RRKA 2BGLA 3QE3A 4DXDA 3SBDA 4UEQA 5JC8A 1NUHA 4BNDA 2VDWB 1PGQA 5E3HA 2QQ0A 3CZAA 4WK6A 1YV9A 3LHDA 3NNNA 2BEKA 1S96A 1WNTA 2EW1A 1CT9A 1Y1TA 1MC1A 2OD9A 4R8KA 1I4OA 5I7WA 1C8KA 1CIJA 1XMIA 4MAMA 1OBCA 4E1VA 1EBBA 1S2LA 4K26A 1TKBA 5CA0A 3RJTA 1JXQA 4NEGA 4OK3A 3DL7A 4FZRA 5J2UF 4YRGA 5L7YA 1D8AA 4B6SA 1S5PA 1TO2E 2WSSD 4LXTA 4OP2A 1JAHA 2OCAA 5L4LA 4P4NA 6REQA 4RHYA 4W9NC 1NBEA 3HB0A 1OTXA 4JCCA 1TZKA 4JNCA 4F97A 1WM1A 1Q77A 3DVAB 4HH3C 1CUEA 4EHNA 2NO6A 5NULA 2X4LA 2XKAA 1JSLA 2DUWA 3C4QA 1Y9ZA 4Q3OA 2QZ9A 3ZY6A 2IT1A 5TB5A 2DPGA 3ADOA 1TUBB 3GZ4A 4UFNA 2XUFA 4ZQHA 5ECGC 3TQIA 1QHEA 3V3TA 4CODB 1LBHA 4FGZA 4XGKA 5A2QA 3F9RA 3G2KA 1FMFA 1UBMS 3SYLA 1E62A 1UKZA 5C5CA 5C1PA 3CH6A 2BDEA 3IQXA 3PFBA 2RCNA 4JC4A 2PQ6A 4LNHA 4NOMA 4DNFA 4G81A 4GP6A 1W94A 1XB2A 2C77A 1FEZA 1EUCB 2VHZA 3PICA 4FGKA 1SVNA 1XRPA 2QD4A 1XNRB 1P81A 1XKQA 1YQXA 3FB4A 1HTBA 3DJFA 4NYJQ 5P8WA 1D09A 4ZCQA 4H27A 1SU4A 2R5FA 3L6EA 1SQ6A 2GJSA 5G3ZA 4TLLB 4QVIA 1XEWY 4IG4A 2EARA 1AKWA 3DF7A 3TNDA 5LZ7A 1JDPA 2BZ0A 5D5HA 4ZVSA 4HDQB 1BDBA 2FQ1A 2QN9A 2SNIE 5KCMA 1TNDA 4OQYA 3TW0A 4HQKA 2HWUA 2H1WA 2I6XA 3R3SA 4QAJA 5KREA 3CNLA 4FEGA 4W9RA 3I6IA 1FTYA 1CJKC 1WO8A 3A2MA 3EPRA 3GJSA 2O8EB 4N0PA 1J70A 3R3UA 2WFZA 4MR7B 2XMDA 4RZQA 5AOBA 2R6R1 3V7YA 3Q98A 4LMRA 2C5LA 2SCUA 4TS4A 3PX7A 2FVYA 3DL4A 1E1QA 4GM4A 1K6MA 4B47A 3Q3VA 1TAHA 3BD7A 1MMFB 4ICIA 2CXHA 3A4LA 4Q4JB 3REOA 2M9MA 4MUKA 5IM5A 4DJAA 4ER0A 1LW7A 1L4LA 1W4AA 5BYAA 1DAPA 5JVDB 2A67A 2EC5A 1SUFA 2BELA 4CXMA 1GR1A 4PO1A 2HRZA 3OM1A 4LX0A 1AKYA 3QWAA 2J9FB 4YT8A 2X0JA 4CMIA 3HYRA 4F4CA 3IP9A 1XKTA 4XARA 3QVVA 5CM2Z 2XDQA 3IPYA 5KX5A 4ETWA 1YAJA 4G0WA 3A05A 1XPUA 5J4HA 3AVPA 2EJBA 1NG9A 5KYNA 1U2PA 1N4DA 4MVCA 5DWDA 3DVSX 3OX4A 3RWMB 2PX5A 1KMHB 3EVFA 4XWYA 1OXTA 2IHZA 4HDMA 3QX3A 1Z88A 2DZDA 4FX2A 3ELBA 5G0WA 1KRXA 3H9QA 3E18A 1X1SA 3JAKB 3V1YA 5CDGA 3OIYA 3WGNA 2Q49A 4AK9A 3ROFA 4CM9D 4ARUA 1CB7A 3BREA 2FFQA 1ZN7A 2GZ1A 1VYTA 2VF5X 3LLMA 1FW6A 4CM8A 1DL5A 2X7XA 4TMYA 4ND4A 4TWIA 2GK6A 1EUDB 3T7JA 3BIFA 4UW9A 3B89A 2VZEA 3CB2A 3KUCA 2E4ZA 4J3JA 5C35A 3TLMA 4YWJA 4B3CA 3PGKA 4FB5A 4YT4A 1VXRA 2B5WA 1H22A 4Z5XA 3LCJA 4Q4HA 1JU3A 1MOZA 2ZBQA 4YO8A 3C3MA 4FWIB 2QV0A 4EFMA 1R6AA 1Y5RA 4W7HA 3AI3A 3ASZA 1ZA2A 2UZ1B 3ZGYA 4YUYA 2HF8A 4FD2A 3IUJA 5B5SA 5KBYA 2HA2A 3KLPX 4FFNA 1R4NA 5BW8A 1KFBB 4CV3A 1FUEA 3RT7A 1R10A 1WX1A 4W7IA 4LZJA 4YNBA 4C2AA 3L7YA 1XRQA 4YFYA 4ZZ2A 4DLNA 1OTYA 2O2YA 1U2RA 4RMJA 1EFVA 3HADA 3DAPA 1PO7A 4QXAA 4REQA 2IS2A 6PFKA 3VTKA 5HF5A 2C03A 4DYVA 1W34A 3T3IA 1PR1A 4MI9A 3IMKA 4RWZA 5ARCA 2ZIZA 4F21A 3DDUA 4JJEA 5H0IA 2CXPA 4ACAA 3AVVA 1RHMA 1XQXA 1XZMA 2WPNA 3WFZA 1WDTA 2OCGA 1ONSA 3DMTC 3RWBA 1ZXLA 2QUZA 4ZTBA 1QORA 2XBUA 3UK2A 4J1NA 2CWDA 1QKIA 4TMTA 3Q12A 1XEAA 4L27A 3OCCA 1L1EA 2DHDA 1JSCA 3L6OO 4B4KA 1TIPA 1L5ZA 3SQLA 3OEEA 4B82A 3D8SA 1P3Y1 5FUXA 1GPUA 4Z54A 2F6RA 1JSXA 4XD7D 4KX3A 3UJBA 4BMXA 2Q2WA 4N5HX 1J5XA 2R68A 3GN2A 4IHJA 1YMUA 4KUGA 4L7QA 2P6RA 2LTAA 3FETA 1K1EA 4YQZA 2XAUA 1M2WA 2Q29A 5EGNA 4BO8A 3H4VA 4PAWA 1KRHA 1L7BA 2B6HA 1P17A 2PNJA 5BQOA 1KKMA 3AERB 4HFRA 1O8BA 5H70A 4B79A 4Y2VA 5MGBA 4RORA 4YQFA 2WJ3A 1XXLA 1YSCA 1J24A 2ZIUB 4DJJA 1U3GA 5KNLA 1Z33A 2P2DA 3RS0A 4RM3A 5IBCA 2RCYA 2HJWA 4J1SA 3A2KA 3F4KA 4Z4QA 4GKAA 4KWIA 1GYRA 4X24A 2JPDA 3CX8A 4YAOA 4ARBA 5AVRA 3LK7A 5LJIA 2CFTA 3QH4A 3FFTA 4JYZA 4I81A 1M7HA 2DT8A 1MX1A 4DLXA 3CU5A 2W93A 4OGWA 4RABA 4EW6A 1X1RA 3TPZA 3K6SA 2BFWA 3NHKA 3PNSA 4X1IB 5EJ7A 3LBIA 3TR6A 1IM2A 1NHGA 3X1ZA 2G0TA 5IYZF 4EG1A 2P35A 4MQUA 3HXQA 1IAVA 4L73A 3ZGLA 4G84A 2BDTA 1P5ZB 3HDJA 4KW7A 3K05A 2F00A 4ZHQB 4D6PA 1XK6A 2BBWA 1ITZA 1OLUA 1CY7A 2JKZA 2P2ZA 1D2NA 1SVIA 2X86A 3DAGA 5F73A 4ZOLB 3UG7A 1M34B 5L53A 1GV1A 3CXUA 3H83A 4TUYF 1RNLA 4IIHA 2OXCA 4JMLA 3AGPA 3QF4A 3ITKA 2PM8A 4CEIA 1MF7A 1KVSA 1FK8A 1DRWA 1L4NA 1N0WA 3GFGA 4Q3AA 1KVQA 2WWFA 1E3TA 2DLDA 4QYIA 3WV5A 2NQTA 4LJ8A 3ZCRA 2IUFA 3UWOA 4BLWA 4MA4A 2Z83A 2BDUA 1KYVA 1SOUA 5FL3A 2RAFA 2P1ZA 5DLDA 1JEQA 3RSZA 3MAAC 5BR1A 1C0IA 4G4SP 5A4KA 2BY4A 5B1HA 1CUZA 3P7MA 4I4TB 4MR8B 4OHBA 2HUNA 4QJBA 3UH1A 3ZBQA 4L0QA 5F35A 4L51A 3PV0A 2HQBA 2BZSA 1Z0SA 1ENPA 2WINI 4CU2A 3HVRA 5DXFA 2E87A 4I1RA 4YAKA 2DR3A 3FRJA 2M6RA 4PLTA 4R5MA 2J59A 3IP3A 5TS2A 3ZXIA 2VH5R 3CMMA 3FPBA 4MHTA 4G4GA 4ZCRA 1LDMA 1S89A 2Y99A 3Q6MA 2G1KA 2QRJA 3HKDB 3QFRA 4YUVA 2BFCA 3KSMA 3HXOA 2W2QA 2P6PA 5CJ2A 4S0ZA 2ZBEA 4RVHA 5JI3E 1JLSA 4AX8A 1BQ4A 3S2FA 4UAUA 2GAJA 1T2EA 2A7QA 2LCQA 4PRYA 3LUCA 4WGFA 4QGSA 2BW0A 5GOTA 4M4SA 4XR4A 1TMGE 2AR0A 3KHKA 4K6CA 4Y6PA 3F6BX 4A8JA 2EKLA 4RLFA 4BMZA 1WVMA 4F5ZA 5J1SB 3FLEA 2PKQO 3RIEA 5BSHA 1AUQA 3QRWA 3QELA 2AQKA 4WBNB 4JB8A 1F0PA 3THYA 2QWXA 3ICOA 3MNFA 3WIOA 5BN5B 4DBZA 2O23A 3TNLA 2ZUFA 1IAQA 3COWA 1WDWB 4WDQA 5SICE 1OV6A 4URWR 1XU7A 2AC2A 1BDIA 1II9A 1QX3A 4LVCA 3E1SA 4B7CA 3S2UA 4C7JA 5CNKA 1P75A 1OLSA 3D54D 1XZHA 4HMPA 4YBRA 4AY3A 1QHGA 4HF7A 3WHLA 3F74A 1ICIA 3GAAA 2H2IA 2RHGB 2PO5A 4K28A 4TLDA 3I83A 2WOJA 3VYSB 2BMJA 2J31A 3PR3A 4D96A 3IQGX 3TLAA 4DIKA 2ZUUA 3V8NA 1OH8A 2OHIA 2BM1A 3VPHA 4EGCB 1Y6GA 1E1DA 1BXRA 1Y8RB 2J0VA 4ZQGA 1SRRA 2ZATA 2WSLA 3KPYA 1X38A 1I6KA 3V1UA 1K2WA 4XYBA 3STXA 4M87A 3ZZMA 2P9YA 3KEFA 1S01A 2XWQA 3KALA 1KPGA 4LDJA 4KR3A 1QIJA 2JFHA 3SM9A 4HBZA 3OD5A 3ZZ1A 3WIBA 4Z0TA 4YMLA 2E4AA 3I12A 5FTKA 3TRJA 3CRRA 1L3BA 3LA8A 3LLCA 1YJBA 2HLNA 4GC5A 1W0CA 2IEDA 5BWBA 1NJSA 2W71A 2QMZA 4HEQA 4TKUA 9LDBA 5E6SB 1KNQA 1N2XA 4ME6A 2PT6A 4EHAA 2HNKA 2W2NA 4GU5A 4NJMB 3TD9A 4J16C 4KIGA 1DUIA 2F8SA 3O4HA 1S6YA 1X2BA 1QOQB 1YAHA 3FNRA 4RLQA 4IDFA 1Z35A 5FPYA 3BT7A 1TYEB 4LA4A 4KFTA 1NW6A 1TT5A 4Q5IA 5AKEA 5C7LO 1VMAA 5J4LA 1RWBA 4CMEA 4D02A 1T13A 3IHWA 5CT4A 3IMEA 4G0UA 1XV5A 2W8BA 3T4XA 1Z0AA 1G5RA 4TTRA 2GZSA 1FMJA 1LX7A 3IUEA 5HIJA 3ZV5A 1QGOA 3GLUA 5DW3A 5HZGA 2O2SA 2IYNA 1GCGA 3KSDO 4JOQA 2P4SA 3LXRA 5BORA 2ZKIA 3KU4A 2VUTA 3B52X 2PEZA 3NJRA 4XIJA 1PUJA 1YTUA 1WXIA 4HN9A 5DM1A 3TL6A 4AG3A 5CCXA 1I1QB 4Y2TA 3E58A 2ZIGA 1H85A 2XY4A 2WT8A 1Y4UA 2C2GA 3LPNA 5AVWA 1HNZB 4XEHA 5HZHA 2P5YA 4G8DA 2IS1A 5E3JA 4AB1A 2XDYA 4R3UC 1B42A 4HEHA 4IIJA 4TTAA 3FZYA 1J06A 3LRPA 2WWRA 4Z2YA 1NN1A 2GKOA 2PSSA 4HFMA 3SIPA 3WMGA 5KNDD 2PD4A 3T8YA 3KKKA 1U0BB 2QP3A 3L18A 3B7WA 5LQJA 3O93A 1PSWA 1CSEE 3IPAA 4OQLA 1PFVA 5LIPA 1AV6A 4MKFA 3REQB 3RC8A 3ETHA 4BZWA 4DV3B 1G6Q1 4AXXA 4TMKA 3WRVA 4W9MC 4RJTA 3MGAA 3KNZA 1PDVA 1NR7A 2WMOB 2BFOA 3ND8A 2X5NA 3TN7A 3A27A 3IKTA 1VPVA 5B30A 5CFPA 2FJUA 3AL2A 3GV0A 1J8FA 1VIAA 1K8RA 4IMPA 4Z9XA 1IUNA 2YYSA 4HX5A 5M2QA 2XQKA 5A4MS 1ZLYA 1CY6A 4JC8A 4JZKA 4OQXA 1KZ6A 2GN6A 1FVHA 3RVOA 3SXUB 5AVVA 3WHIA 4DJEC 5HZMA 4GUDA 2IUSA 5KYWA 4BY9E 1VHLA 5JXJA 1YBVA 3G89A 1TQDA 4F12A 2NUTB 4NQZA 4CV1A 4S05A 2IEZA 2NZWA 5EYPA 5DSXA 1Y9EA 1HDGO 2ZSJA 3FHCB 2TMGA 5EFOA 1V7QA 4NAUA 2KB0A 4NHOA 5SYAA 3DZJA 4WW0A 5JSQA 5IWAB 3TAHA 1K98A 2PMEA 1OZGA 2GWHA 3L6CA 4KQCA 1Z5UA 1A9TA 4YAGA 2XRFA 5LUBA 1DFGA 2I4LA 4N5NA 4BYGA 3QU4A 3VZBA 4JP1A 2W6NA 1VSTA 1XTVA 5J2UB 2TMYA 3QEMA 2JGJA 3INTA 3R0XA 5BVHA 3TLYA 1M1NA 4D2IA 3GJQA 3PC7A 4JP8A 2FP4B 4J1TC 4K2HA 2ZUWA 1U0LA 5K4AA 4MX8A 4OMCA 2CDBA 1V7CA 3AJRA 4RD6A 3ZZTA 4ATNA 4UBKA 5TLSA 3P9RA 1G9TA 4UOEA 4I9HA 3SSOA 2WBLC 4M9UA 3G1UA 3ANSA 3K30A 2BEWB 5KMGB 2F2TA 3LBAA 4O63O 4URYR 1K9VF 1CBUA 2JATA 1NSFA 2G4VA 3K0KA 3AVWA 1PT9A 4R40A 4HQOA 2QRPA 2REBA 4JITA 3AWIA 1ZCZA 1U4NA 3E03A 2P40A 5EIBD 3X1XA 4A0QA 2F59A 2BAGA 3U60B 3QVSA 4YRSA 5J40A 4ZVQA 2O0KA 3U62A 1E7YA 1VL5A 3NEAA 3RTGA 1FDIA 1IEWA 1J7KA 1JR3E 1N6KA 1QFSA 1UJ6A 2UYYA 4UD2A 8AT1A 1UOOA 1EEXB 1RXEA 4KMSA 3L7AA 1TB4A 3N2GB 3RS3A 1E1MA 1R64A 2SECE 1XFAA 5MFZA 1GAJA 2PLFA 3TIFA 1PS8A 1SA0A 3FM9A 1KP2A 9GPBA 2W2LA 3NM6B 4DY4A 3RJZA 2E3JA 1SVLA 1YOBA 3GEMA 3N0XA 2DY0A 1JXAA 4HQ0A 1P77A 2PZKA 2OBXA 3CONA 3OQOA 2VYVD 2XRZA 1K92A 1OFIA 2LZ0A 3CRZA 3LF1A 3EG9B 3VZDA 4GPEA 2EZ9A 3TR0A 2J3LA 5HBGA 1ZFNA 4IH1A 3ZIUA 4BUZA 3ETLA 3T9AA 4BGVA 1JB9A 1XVLA 4NBVA 1Q7EA 5JADA 3JQGB 1YGYA 5BMVF 5MF6A 1J1IA 4JLOA 4JX9A 4PPQA 4JT2A 4BB5A 1ZO8A 4RULA 2WUFA 1QWSA 2IK8A 1E6KA 5EIOA 3IEPA 1WXDA 2Y6UA 2NU6B 2DEUA 1LSUA 3IEXA 2X15A 1MX5A 2JCGA 4FJ0A 4LYFA 5AM5A 2HJVA 1XYYA 3AM5A 1P1BA 3FCUB 3P8ZA 2FZVA 3IFSA 4GPTA 2ZU0C 1YJ8A 4XQ0A 2I4NA 2QM7A 4BLQA 3NTUA 4KR7A 3JQAD 4P84A 1E4EA 1NNUA 4KVFA 4AG6A 2ZYAA 1P7PA 1GGVA 4U6NA 2HX1A 2GEKA 2A0FA 1G41A 3A6HA 1UXOA 3D6VA 2CL6X 5JYEA 3KTDA 1LQTA 1XTJA 2XJ4A 3LOQA 4YCBA 4DEVA 4M22A 4OUDB 3PRYA 3BIOA 2X1HA 1G0NA 1ZK4A 3GLHA 2QXYA 3MJEA 3PXEA 2Z8YA 1CDEA 3WJAA 2BFPA 2RGEA 4FW9A 2ANCA 3ZEIA 4CKZA 4GKVA 1SXJA 1OLXA 4HD8A 5EMMA 1GVNB 2GK4A 5JS2A 5JSFA 4CJXA 1XZFA 5FOSA 5L45A 4Q37A 3NGXA 3L6DA 1I13A 5HF9A 3DZIA 1IULA 4X1YA 2JA2A 5DVZA 4UBJA 3VYVA 4M0KA 2F3QA 3X1YA 3ZUPA 4XVCA 2DVMA 1C2TA 1CJTC 4O2BA 2J7PD 1V41E 2PA3A 2XCTB 1ATIA 1P4RA 3RVMA 3WMXA 2G82A 4OQZA 2PL9A 3IVXA 1ENOA 4EHIA 2PUBA 4M0CA 4FYPA 1JDBB 3AJ9A 1Y63A 2WJ4A 1HT3A 1NL3A 1SZCA 2Y1EA 5BWOA 3NANA 2CVHA 2G77B 4IRMA 4G07A 3PL1A 2D54A 2QSZA 3ZK8A 2VCEA 2ZAOA 5J2TF 2ECOA 3HKBA 3WRWA 1COWD 1AGPA 2PJZA 2WPDA 3Q4GA 3ZGVA 2GNOA 1CY1A 4U2EA 4GLBA 3R6LA 2WHRA 1KYXA 4G56A 5FWNA 3IDQA 2AG5A 3TLKA 4FM9A 1G9XA 3D2AA 2IITA 4MUAA 1KKLA 3OX3A 4R7TA 2Q7DA 1HDXA 1U2TA 2XNSA 3U5ZB 1A8UA 1IY1A 1KARA 2DWUA 4Y3UA 4ZQFA 3K6JA 3GAMA 1JN0A 3GRUA 2B0CA 1E3WA 1G2PA 1MXFA 4Z0PA 3QHAA 1OW3B 1P5FA 5K8LA 2YVQA 2NYUA 2FWJA 4HJXA 3OURA 5IMBA 2OHXA 2YINC 1DKPA 1NVDA 3VV3A 5B55A 4PR3A 4CDMA 3HJNA 1C7EA 4GXQA 4WN3A 3MUOA 5DX1A 1JPUA 1RS0A 4IIFA 3AIKA 3U7RA 4AP5A 2FPGA 3D6AA 2OVBA 1CQJB 1IOZA 1IBCA 1Z8FA 5FI0B 2J7PA 2KW5A 2P5UA 1XD2A 2H3EA 3Q5GA 3NEJA 5BVGB 5F1OA 4R1UA 2IP2A 4I5FA 1MO3A 5KYUB 1T9KA 4Y1FA 1VRCA 3NBQA 1Y80A 3N8DA 3NEPX 2Q2VA 2YR0A 2PXCA 1FSSA 2DBQA 5BSWA 4KITB 1TVKA 3DBRB 4HADA 4QBTA 3KSUA 3BFVA 1NVXQ 1U3DA 5ALPA 5JJCA 7MHTA 5CHEA 4I1YA 4OM7A 5DN6D 2WMNB 4TKVB 5D3MA 1SHTX 1C7JA 4K3VA 4K86A 4PS0A 1W1UA 3ZKWB 4XH9B 1GUZA 1COWA 3LGAA 4FNAA 1CS0B 1RJDA 1ZG3A 2Q5IA 2R25B 2YXEA 3GOQA 4MS1A 4JOSA 1Y37A 1JZQA 2J5BA 3K0HA 4RZXA 1R9NA 1F1JA 2A5GA 1W9HA 4BVEA 2NVBA 5BWLA 1RFLA 3KXPA 4BB9A 5K8IA 3R6WA 2KBFA 1AGYA 4Q4AA 5IX8A 4ZYUA 1W46A 1Y8ZA 1U99A 2GILA 1Z28A 4K3UA 5JZBA 1AZLA 4HWKA 3FKSD 5FHQA 3W5UA 1ZMOA 3G17A 1TKCA 1XJCA 2VLIA 3TLXA 3S1AB 3V4VB 5K0BA 5K0ZA 1P1JA 5DBFA 2Y2VA 3FPSA 4DZTA 3DHWC 4WUVA 3B2QA 2FOXA 3LNCA 4NMHA 4Q7MB 4Q3BA 1SKYB 4ZOAA 5IJZA 4GLLA 4DV5B 2OAP1 3I9V1 4EA9A 1KI3A 3CF0A 4EI2A 1IVYA 4JBYA 2MYPA 1Y82A 1RD4A 4MB2A 2QZJA 3W6UA 4A91A 1R8YA 3E8XA 2IGBA 4J75A 3F6CA 1T5LA 3R5JA 3Q8MA 1HK7A 1FNSA 2H1HA 1BXZA 1YOVB 1OX4A 5C1IA 2Y66A 1HBJA 1QC5B 3TYXA 1ADGA 1ECJA 3RAEC 3MTAA 1KJ9A 1QSGA 2BZGA 1NYTA 2SKDA 1HTWA 3UAXA 3V2UA 4CI0B 5JS7A 2JK1A 4FGWA 4RD2A 2AEJA 1LEHA 3ZU3A 1GL9B 2EKBA 4JASB 3MCUA 4MWEA 3QJ5A 2WE8A 3OE7D 5DN6A 4YCNA 4BRWA 1FUUA 2PJUA 3DE3X 2XWPA 2XNCA 1N2CB 2X9VA 3LECA 3MWYW 4EHHA 4EKGA 2WWXA 1CY8A 1B1CA 1NRWA 2WTNA 1V6AA 3A4IA 5JMOA 5I7VA 4FP9A 1BE8A 5CVTA 3UBTA 3E3AA 4G63A 1RXSA 2XMBA 3ND9A 3TLBA 2QLBA 1RYBA 3DBHA 4OSEA 1VG0B 1CQZA 4JLBA 3HCFA 3VSEA 3P0FA 1NBAA 3FPAA 3AFGA 5SY4A 4EHKA 1RM4A 2QU7A 1I7LA 4OD0A 3FKSA 3C1UA 3UHAA 3UMGA 3AXTA 4MWZA 1KWGA 1O95A 4EDFA 4FZ3A 1J33A 1DC4A 4QOSA 3RW9A 2WU0A 3DE6X 4O08A 5KOIA 2VSFA 1P8JA 5G0SA 4OXNA 3KDSE 3TO5A 3QG1A 2FRDC 1EVIA 5K45A 3ASUA 2ASVA 4GEGA 4KB5A 1SC1A 1JDBC 5E6RB 1P29A 2GSDA 2QV7A 2IA5A 2PEYA 4IIEA 3U3JA 2NVOA 4BNIA 4BASA 1H5NA 3EIFA 5K4HA 4UATA 1XJQA 3OESA 1T6NA 2ZSEA 3EFOA 3OE5A 3QVXA 4QBGB 1Z2DA 3FPHA 2ZI3A 2SKCA 3QKWA 2FG7C 1VC2A 2VJQA 4AZVA 3GVCA 1U2DA 4FYXA 1RQXA 2HZBA 2HO4A 4IRUB 1VKHA 1N2HA 2QA5A 3KVVA 3TX2A 3G1TA 1D6JA 1V2GA 3H4MA 1NV9A 3ZNQA 2J3KA 3G9ZA 3LSYA 4OVKA 2WY2D 2FNAA 3EZXA 2J0EA 3TLJA 2X0DA 4DMCA 2H07A 3A6ZA 3AGQA 3IP6A 3HI6A 5DCLA 5DYNA 1Z5OA 4TV8B 1YZ3A 3AHIA 4ZXFA 1P9NA 2DRIA 4WY2A 2VWHA 3GT0A 3BXGA 1PQYA 2AZ4A 1Q74A 4EGSA 5KYYA 1Q0HA 2BPOA 4GZLA 5B2ZA 2VQFB 4I50B 3LY8A 5IF9A 1DX9A 5K4GA 2KS6A 5DDIP 3OQIB 4RKFA 3DM9B 5FO1A 2UVPA 1T9DA 4YTEA 1DG9A 4W8HA 3ZBTA 2A3RA 2ZDQA 1KO1A 5BUSA 1C1HA 2Q2NA 4DQKA 5JAHA 3C5VA 5DNYB 1I9GA 3UC9A 3KTAB 3ER9A 2VK1A 4MQ5A 2ZZMA 1VDMA 1KC3A 3ZZNA 2I22A 1CHNA 3LPAA 3OQ1A 1JQEA<