1U4OA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedicarboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
309
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 112
structure length 309
sequence length 318
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4oA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4oA02
1NTOA 1BXZA 3EDMA 5I8ZA 1PQWA 5C7LO 3L77A 5U9CA 4FR5A 4JGBA 4D0RA 1K6XA 1P0CA 5JLAA 4Y6PA 5A4DA 3JQ9C 1NXQA 5IXYA 3C1OA 4WNIA 2O3SA 1VJ1A 3JQEA 4OO3A 3JQ9A 4YJHA 2YJZA 4CMGA 3H4VA 4QTZA 4Z3DA 3GFGA 3C7DB 2BF7A 1V8BA 3FBGA 4LK3A 4RO0A 4BNUA 3EVTA 4WLOA 3H65A 2GUGA 1K6JA 2VOEA 2DBQA 1EVIA 2HLPA 3JQGB 3FNHA 4U8GA 3KYDA 1UZLA 4N5LA 1RYDA 3JV7A 2RCYA 1AN9A 2F1KA 3K6JA 4GL4A 5KKCA 3KEQA 1KYQA 4RVUA 3GF4A 3NRCA 3W6UA 1HYHA 2JD0A 4IDFA 3WJAA 2X5JO 3DOOA 5JO0A 4YBZA 2D8AA 3AOGA 3KXDA 4Z9YA 1XQ1A 1U3TA 1ORRA 4MVJD 1NPYA 4W7IA 4BO9A 1CYDA 1T25A 3KBOA 3WSWA 4BB6A 5FWNA 4DXHA 4HNGA 2X86A 4CMIB 5KJEA 1X14A 2HSDA 3F1KA 4R68A 5HS4A 4YJDA 2Y1EA 3PYMA 4XQGA 1ZH8A 3KM0A 4OOFA 5AXAA 4S1VA 1O94A 1P1FA 5G4KB 1QR6A 5IDQA 3Q6IA 4UEJA 3KB6A 3AFNA 1IB6A 4K9DA 3V2GA 5K6AA 2P9GA 2WD7B 1I36A 5JC1A 5TNXA 3U4HA 3PIIA 2PKQO 4NHEA 1EVJA 4JLWA 3RSHA 2FSSA 3G79A 2I99A 2VWHA 4GQAA 1P77A 3T7CA 1RM5A 2QW8A 1ONPA 2UDPA 3VH3A 4RV9A 4BKQA 5TQVA 4FFPA 3PJEA 4FD3A 3GZ4A 2DPHA 3O4RA 2IZZA 1YH3A 2AEMA 2CVOA 3VPFA 3M2TA 5F5NA 4TMFA 4GKVA 1UZMA 1NFQA 3PHIA 4HP8A 4MPDA 1D1TA 4NU5A 5HA5A 2DTEA 3ZWPA 4E5YA 4EUFA 2NACA 4J90A 1A71A 1NX6A 1VL6A 4PG4A 1MC5A 4YYZA 3RI3A 2D5AA 2IE0A 3S2FA 1ZEJA 1PJCA 4IQ0A 1HWYA 2ZYDA 4U7WA 2ZCVA 1OC4A 1ZK1A 5A3JA 3GG2A 1OBFO 4BKRA 4XWYA 4EYEA 5DP2A 4YAGA 2ZTMA 1PJ4A 4IDDA 3RUEA 2J5RA 1HDGO 3DMYA 3K2BA 4HFMA 1XG5A 2C59A 1A4UA 4FFNA 2DU8A 4HBGA 4XYLA 2E49A 2E37A 4AJ4A 5BNIA 4BGEA 2OMEA 1QLHA 2VHYA 2UV8A 1MFPA 1LC3A 2B83A 3K5PA 4GGPA 4YT8A 2Y05A 1WZIA 3KYDB 4YJGA 4NQZA 5T57A 4Y67A 3TQHA 2VZ9A 3F1LA 2VHWA 4JJFA 4IXTA 2PR2A 4CV0A 5BSFA 2JFFA 2DQ4A 2VHVA 3RUDA 3GZNA 2ZQYA 1E3SA 1NR7A 3PQDA 1BSVA 4MP3A 3FTNA 4QT0A 1Q7CA 4QQRA 1T2CA 1T2AA 3DR3A 1KETA 3P2YA 2RIRA 4J49A 3IKVA 4YT4A 1I24A 1NWCA 1ENOA 5GY7A 2DT5A 2X23A 3FD8A 3U3XA 1Y9EA 4PLPA 1B8UA 1H5QA 4IQGA 4YVFA 2W98A 1R12A 4A2CA 4BGUA 2C2XA 2PKQP 5A02A 1XLTA 1NPTO 2Q1TA 3DZHA 3ZDFA 1DJNA 3H9UA 4OOEA 1K3TA 4KUEA 3WGZA 1QKIA 2QRKA 4A27A 2DFVA 2FY8A 3I9LA 4MVJF 2JHFA 3PFFA 4CM8B 3D1LA 4ZJUA 4ZRMA 3WMWA 6ADHA 1R4NA 1T2DA 3HUDA 3PYLA 2AEJA 2NQ8A 3HQ4O 4PVDA 4YPOA 3JQBA 4PLYA 2PGDA 4O1MA 2IZ1A 4Z0TA 2Q45A 1AXEA 4ILKA 4ZD6A 1K5HA 4WLNA 5L4NA 3ZHXA 1N1GA 1DHRA 3MJ4A 4H15A 3NT4A 4EEZA 3I3OA 2PA3A 4IGEA 3G0OA 4BNYA 2FWMX 1K6IA 3E9NA 1YJ8A 3GVCA 3ZU5A 4IY1A 1LXCA 1UH5A 2Q99A 4B4WA 3SEFA 3EY4A 1ULSA 1WDMA 4AG3A 4EDFA 2A94A 2CY0A 3S2EA 3GN2A 3JQAB 3PWSA 4L4RA 5DULA 2ZTLA 4BIIA 1HXHA 1A27A 1XA0A 2FPIA 5JDIA 3NGXA 1B14A 3H9JA 4XYGA 5GZ1A 3RUFA 1ZKMA 2QZZA 4QSMA 3GQVA 5HWSA 2O2SA 4MVJE 3UUWA 4FIZA 5BT9A 1WDLA 3E03A 5EINA 1NM5A 3PHJA 3PJDA 3T7EA 1P1HA 1KEVA 2BI7A 1A7AA 4HUJA 2V6BA 3DBLB 1CJCA 3QHAA 1QYVA 5TX7A 4YRBA 4ALKA 1ZCJA 4OXKA 5JAMA 4KQWA 1NVMB 1LDBA 2PV7A 4AJPA 3WDSA 1D4FA 1O95A 5IF3A 3L07A 1E3LA 3I23A 4R1NA 2J6IA 1KVUA 2YQ4A 2GPTA 1AGNA 2D1YA 2BGKA 5JNLA 3GGOA 3LC2O 1ZK0A 4ZQHA 4HKTA 3SX2A 4FQ8A 1ENYA 2AW5A 3ROMA 3ZNOA 5T8KA 3WLFA 2Y1CA 3AM3A 4FC6A 1LRKA 4TVOA 4TQGA 2VUUA 4XZ3A 2X0NA 3O38A 1PJQA 2DUUA 3R0IA 4PFJA 3SXPA 4NU6A 1ZNQO 2GN4A 1HKUA 4E33A 2VRCA 3INTA 1X1TA 1R4NB 1HDCA 1HE5A 1AHIA 3UVEA 3H9QA 4I8XA 2Y0EA 3ZCXA 3IJPA 4J4HA 3U9LA 4I9UA 1TLTA 5JAQA 1AE1A 3U0BA 1Y8QB 3X2FA 1EVYA 3QVTA 3OQBA 1GQQA 3JQAA 4XQ9A 3CUKA 2RH4A 3P19A 2P5YA 4IPTA 4YJHB 5A05A 1HE3A 1O89A 1W8DA 4BMNA 3GVXA 2VWPA 1EVZA 5A1TA 2JCYA 4QFDA 2EKLA 5B12A 1VL0A 4MIOA 5BR7A 3KETA 2X22A 1MGOA 4IJVA 2X9NA 4CR7A 3AFMA 5TJ9A 3K92A 3GFBA 4DMMA 4Z3KA 3IP1A 2X1HA 1E6WA 1MG0A 3CE6A 2EGHA 3A06A 4IDEA 5ENVA 5I7FA 3LF1A 4U6QA 1GEGA 2FZWA 2OGUA 4WLFA 1I2ZA 2EW8A 3DZIA 4ALIA 1WZEA 4W82A 2V7PA 4OKNA 1UXJA 2WD8A 1K2WA 1DIBA 1PJLA 1QRRA 1Y5MA 2OXIA 4IDGA 1YS4A 2UYYA 4HY3A 3ETGA 4HX5A 1T2EA 3RC9A 3ANMA 3TRIA 1QYCA 4UUNA 2ILTA 1VI2A 4PLHA 4PN3A 1PJBA 2YQ5A 1HZZA 3ABIA 1NQOA 2IEBA 1LUAA 1NAHA 2PZJA 1Z6ZA 1GV0A 3H8VA 2VTDA 5TT1A 1U4SA 2ZK7A 4ZQBA 4AJOA 4C7KA 2DAPA 3TDKA 4UREA 2EJWA 2YDXA 4BB5A 4N5MA 1VC2A 2D59A 1LLDA 3Q11A 3R3SA 1VPDA 2GR9A 3NT5A 3ZW8A 1HL3A 3DBRB 5JMWA 1DIAA 3CEAA 1E6EA 4BNIA 1B26A 1PTJA 2Q2VA 3ZWCA 4BS9A 4ESOA 1E1MA 4DC0A 1JW9B 2YYYA 3RFTA 3FWNA 4OIMA 2WD7A 1DB3A 3NDRA 1FXSA 4KMSA 2CD9A 5DBIA 3RBXA 1PR3A 3BMQA 5G4KA 4AVYA 2B5VA 3C1AA 1X7GA 3Q9UA 1YKFA 3MJCA 4TRMA 5IN5A 2VUTA 9LDBA 3DBVO 4D46A 4XQEA 4A03A 3ZHYA 3RBZA 1JQBA 1E5LA 1JKIA 4A26A 4ND4A 1DIRA 4CQMA 3NEPX 1I30A 1HLDA 1P44A 4TROA 8ADHA 1BDMA 2B36A 5LDGA 2H9IA 3IQDB 3VZQA 4MVJI 1P1JA 1NVTA 3ZH2A 5KVCA 3UN1A 4XIYA 5TSDA 3HSKA 3O03A 3GMDA 3BMNA 1Y7TA 4WEQA 4L8VA 4BNFA 3PLRA 1K0UA 4GMGA 4K6CA 1CF2O 4D44A 1KC3A 2QQ5A 3GNQA 1E1LA 4BNLA 4E2XA 5AYVA 3C7CB 1Z82A 1IUKA 3ROPA 4CMEC 4AL4A 1JKFA 1PGQA 3ZWBA 1OFGA 2IZ0A 1I5RA 2YV1A 5KIAA 4JP2A 1YBMA 4WLVA 1WP4A 4J7CA 2NADA 1KY4A 1NASA 5EMHA 3LYLA 5L9AA 3ADOA 4Z0HO 4TSKA 1QV6A 4P38A 1DC5A 4XB1A 4DYDA 4CQLB 4EJ6A 2CNBA 1R0SA 2BD0A 1MFZA 3WQQA 1C0LA 3JQAD 1O9BA 4UVHA 4DRYA 3TZKA 4U5QA 3GMSA 4KZPA 4GGOA 2EJVA 4RVFA 4ID9A 1KVSA 1CIVA 1M6WA 2Q1UA 4H3VA 4RZIA 4R54A 4BGVA 4NBTA 3JQCA 2EW2A 3VPHA 3GGPA 1P0FA 3H3FA 4Y8VA 2XOXA 5JYDA 3H9EO 2GSDA 4J2OA 3W8DA 3VH4A 1R37A 1P74A 4MO2A 5DCYA 5FFFA 3V5NA 3AY6A 4KQXA 3PLNA 1PJSA 4P4GA 3O8QB 2B4TO 2DFDA 1M67A 1VKOA 4UAGA 4NG5A 1MXFA 4CM7A 1HYGA 4DBZA 3RBVA 4UULA 1Z7BA 4O59O 5KJ1A 5DT9A 2ZB4A 4CM6A 5KVVA 4OXYA 1GY8A 4FOOA 3L6OO 4DIFA 3W8EA 3EZYA 4J7UA 1XWFA 2O3QA 4B7CA 1X0XA 4LVUA 1QYXA 4WGGA 5HS6A 5IDYA 1DXYA 1E7RA 4LGVA 2D0IA 4ZICA 4E5NA 2X5OA 3E5RA 4CPDA 3G3EA 2G1UA 3NKLA 5JY1A 3EW7A 5JCJD 3MWEB 2PD4A 5DN9A 2V6GA 3AM4A 2AE1A 2QG4A 1U9JA 4R1UA 2YUTA 4YAJA 4FN4A 3JTMA 1PX0A 1F0YA 1E3WA 2BFPA 2NQTA 4J4TA 3AI1A 4ZQFA 5JAIA 3A4VA 3GLQA 3WGIA 2G17A 3D0OA 1LBEA 1QP8A 1P45A 1UXGA 4FGWA 4JBHA 2BFMA 2GASA 2ZJ0A 4XDZA 1G6KA 5G0SA 1M66A 1YE3A 5DBGA 3WWYA 4WCFB 3SC4A 1LEHA 5L45A 1Y81A 3DXFA 3K73O 4PLFA 1FJHA 2OHXA 3TL3A 4RORA 6LDHA 2R2GA 5IG2A 1ZJYA 5IDXA 5THQA 2A35A 4AJ1A 5A04A 1R6DA 3LF2A 2NU8A 4ALNA 4M86A 5KJCA 2G82A 1YO6A 4GWKA 1EE2A 3FCOA 4NFHA 2JCVA 4QXMA 2JJYA 4Y9DA 3EHEA 1N9GA 3I9OA 1H2BA 2O23A 4XEHA 4XYBA 3TF5A 2H5LA 5F5LA 3EVNA 3F5QA 2YFHA 1DFGA 5EIOA 1YB4A 2NVWA 1DO8A 4QECA 4D45A 4FJ0A 4AFNA 2C82A 2E4AA 5T5QA 7ADHA 3HZZA 1BDBA 1E1NA 1YBVA 5KJFA 3WIEA 4Q3AA 4A73A 1E3EA 3BTVA 3GGGA 5JY6A 2VHXA 5EN4A 3H5AA 4HFRA 4B8WA 1N1EA 2A92A 2GLXA 4JX8A 4CJXA 1R4MB 3A1NA 3GY0A 1KEPA 2IODA 2OL4A 4ALLA 2EF1A 5CHEA 3ZWYA 5A3VA 4B4VA 2Q2QA 4FC7A 3TN7A 4RPJA 5GZ6A 3FPCA 2YZ7A 4TRNA 2FHSA 3GN1A 3R1IA 4KTTE 4Q39A 5IJZA 4OAQA 4BKPA 2HU2A 1V6AA 3C1TA 4NJOA 3NTQA 3PHLA 1TT7A 1MG5A 2JHGA 2V65A 3C24A 1B7GO 3JD1A 3U09A 1XKQA 3EC7A 3OJLA 3LSYA 5CPFA 3B6ZA 4WLEA 4BKUA 2J8ZA 5JCJA 4L0QA 2ZYGA 3F4BA 3RKUA 4DA9A 1F17A 3UH1A 4YAKA 4IDCA 1GUYA 4PCVA 2JCXA 4MVJA 3AU9A 3I4FA 4R3WA 4YJFB 5CDYA 4MKZA 3SVTA 5L4SA 4TRRA 1I33A 1GL3A 4E13A 4MOWA 3VOSA 4HFJA 3UF0A 4GAEA 1R0KA 3D4OA 4BNKA 5B4TA 3H6KA 3SJ7A 4CQMB 4NK4A 3ZNNA 2X0IA 4INAA 4JJGA 4RF5A 2GN9A 3VHRA 1E5QA 4E5MA 4WASA 4Q3BA 1CWUA 2V6FA 2DTDA 3LT2A 4DLLA 4D3DA 3AJRA 3QJ5A 3PI7A 4IINA 4II3A 4YDRA 4YWJA 4CL3A 2HJSA 2X8LA 1XEAA 1FDVA 2A4KA 4DL9A 2DLDA 3OQ1A 4PZEA 5TS3A 4TWRA 5COQA 5JSFA 3FBTA 2PD6A 1UXKA 3ASUA 4E2ZA 1JWAB 4YJGB 5F21A 3NAQA 3LU1A 3ZI0A 4RVDA 4WK6A 4F46A 3CTMA 1BXGA 3IUSA 3NT2A 3TNLA 1F06A 2O3UA 4N18A 3HB5X 2CUKA 3OM9A 4NH4A 5TC4A 4GSKA 1JKJA 3IAHA 4FW8A 1QXSA 4QUKA 1MLDA 2FPPA 1KIFA 3OMLA 5JMPA 1FF9A 1D8AA 4JNKA 1G0NA 1Q0LA 5JS6A 2CDAA 3ZHZA 2O48X 3GRKA 5CEEA 5TLSA 1Z74A 1RM3A 3H2ZA 4J4BA 3GVHA 1NVGA 2FR8A 1JTVA 3V2UA 4FS3A 3WS7A 3BAZA 1PZEA 1GYRA 5CEJA 4ZA2A 3OIFA 3UXYA 1ZSYA 4BO6A 5DP1A 1ZO8A 3TOZA 2VYVA 1RM0A 1NQ5A 1J0XO 1HDXA 4MINA 1Y9AA 4L75A 1C1DA 1IL0A 1E7MA 4RPGA 2Q1WA 4MVJP 1WMBA 4BL5A 4DBVO 1NAIA 3MJTA 3RUCA 1U4OA 1UDCA 1SB9A 1Y6JA 4BO5A 1YL5A 4LN1A 5BSEA 4IZIA 4OYRA 1NR1A 1SNYA 1CETA 4YJFA 5DOVA 5G4LA 2FP4A 4ZRNA 4NJMB 2PH3A 4FFLA 4DC1A 3GUCA 2WE8A 2Q49A 4IUYA 3QV1A 4ROSA 4RQUA 4E2YA 4GX1A 2O3JA 4NFYA 1RKXA 4BO2A 4YAEA 4MP6A 1H9AA 2JKVA 4ZVVA 1P33A 4J0FA 4Q3NA 4E4YA 1TVEA 2YHIA 1DLJA 2Y66A 4PLVA 3CZMA 1UXHA 4ALMA 4UEOA 1L7DA 1VSVA 5KOIA 1ISJA 2ZTVA 2I67A 4OGWA 3UHAA 2E82A 1V35A 4CM4A 3I83A 3JQ7B 5LC1A 1RJWA 5F1OA 1LSJA 1R4MA 2CFCA 3L4SO 3LDHA 2BFOA 2CF6A 1WW8A 1ML3A 2C2YA 1NBOA 5BQFA 4R69A 1M6HA 2GZ3A 5U4QA 5I9NA 2C7VA 2P68A 4OSOA 2VZ8A 2CF5A 1GU7A 3I9KA 1KEWA 1QYWA 3PQEA 3U4DA 5KTKA 2I5PO 3RWBA 1NHGA 3WGOA 2IYPA 3OJ0A 1PR9A 1I01A 1LX6A 5A9TA 1YOVB 3DZFA 2OP0A 1Y1PA 4PZDA 4M54A 5HBRA 1N2SA 1P1RA 2DBRA 1C0PA 3CMMA 3AUUA 3WGYA 3FNGA 1BMDA 3ZW9A 4IIUA 4LW8A 4I9NA 4I1IA 4XA8A 1VKNA 2VWGA 3PDJA 4W9NA 5HRUA 2W90A 3ZWXA 2TMDA 1RWBA 4Z9FA 5BSHA 2D4AA 1ZW1A 4IJKA 1KEUA 3A9WA 4XGNA 1N7HA 1LLQA 1SC6A 1UZNA 5TIIA 2JFGA 3WFIA 5JFOA 1H2HA 2OORA 5L40A 3JYNA 4LSMA 1E6UA 4MVJM 4D3FA 1DFIA 1H6DA 4RVHA 4PG8A 3D3EA 3DAGA 3QVWA 4RJTA 3PFWO 4ND3A 2JAHA 4FFRA 4BV8A 3GEDA 3K8ZA 3MJEA 2Q3EA 3RQSA 1E92A 3UGKA 1BRMA 2I65A 3GHYA 4GVLA 3RUAA 5JC8A 3H5RA 2JD2A 3D64A 5T6BA 3WBFA 2WYVA 4BO8A 3DHNA 4WE3A 4CUJA 1AXGA 2J3KA 5ES3A 3BA1A 4R41A 3GDGA 4O5OA 2I9PA 1ZMTA 1P31A 1GYQA 3O8QA 4BMSA 2ZCUA 4YB8A 3FNFA 4J1NA 3I6QA 4PIVA 2B5WA 1LC0A 4BNWA 1V3VA 2DPGA 3HFGA 5A9SA 4HWKA 4O63O 1DAPA 4KWIA 4D7AA 1T24A 3K2EA 1EBFA 4RPKA 3JYLA 4LISA 4OHUA 2GZ1A 2VNSA 1PU2A 3BMCB 3GC6A 4HXYA 4OXNA 1Q1NA 1SAYA 4CMJA 4GI2A 4JCOA 5AOVA 1I8TA 3H7AA 4TKMA 1OC2A 2NV6A 1UDBA 1KY5A 3F46A 3FF4A 5CG1A 4I5EA 1HETA 3WYCA 3NX4A 4ZGWA 4UUMA 4M89A 4EZBA 1V3UA 2H1SA 1WWKA 1XELA 3Q3CA 3VZPA 2GZ2A 1DRWA 7MDHA 5G0VA 1DSSG 1LA2A 2VRBA 5KVSA 3KHUA 2AXQA 3CIFA 3VDQA 3GOHA 1SEVA 4G2NA 1ADCA 2O50A 4UVGA 3HDJA 1ZVMA 1LSSA 3KSDO 5BNTA 3VZSA 2YHIB 3ZWOA 5L51A 1WXDA 1I0ZA 4YXFA 4IJUA 2EKQA 2O3TA 3WIDA 2IEDA 3HJAA 4GX0A 4YCAA 2ZB3A 4EBFA 1MX3A 2C5AA 3GZNB 4J0EA 4DWVA 2IDZA 3HDQA 5H83A 3S2GA 1GADO 1E7WA 1LDGA 4B79A 3NV9A 3KEOA 3RU9A 1LQTA 4XCVA 4FPXA 4AJEA 2VRCD 2W2KB 4BNZA 3QWFA 4CLHA 5I9LA 1HDRA 4BQPA 4DPKA 2EP5A 3MWDB 5COAA 2ZQZA 3A28A 5L7YA 3S55A 3AI2A 1YQDA 1ZFNA 1ZXBA 3DMTC 5F1PA 3ZZNA 1B16A 3GDOA 1XYGA 1ZZEA 3E18A 3KZVA 3L9XA 4BNJA 4R16A 1HT0A 2J3IA 4CL8A 1EUCA 1GCOA 1ZBQA 3OETA 1QYDA 3G1UA 1TB4A 3WMXA 1C1XB 4EI2A 1NQAO 4NJMA 4YT2A 2DTXA 1Q2XA 2PZMA 1VSUA 3BMQB 3DZKA 5EL0A 2CDCA 1J4AA 3VH2A 3DZJA 2ZTUA 3INGA 5TF4A 3WNQA 3VVCA 1I10A 1N92A 3GT0A 3OEWA 4B7UA 1ARZA 1HDYA 3QY9A 4AJNA 4GWGA 4M8SA 1PL8A 1TT5A 4UVDA 5JDCA 4GVXA 3V2HA 3HFSA 1YQGA 2HAEA 1HSOA 2VYVD 1V3TA 5ICMA 5ITVA 5A03A 3OJEA 1PWZA 3U49A 3FHLA 2WYUA 3OFSA 4O6VA 2WMDA 5ILGA 1PZGA 5I9MA 3B1JA 2RHRA 4CQMD 3UCXA 2I76A 3LLVA 1MV8A 1UAYA 4KP7A 1ZEMA 3ONFA 4IDBA 4NBRA 3EUWA 4CR8A 4M49A 4UVIA 2FN7A 4FOSA 5FI3A 3BTSA 2X9GA 2C0CA 5THKA 3BHIA 1M2WA 1B0AA 4J1TA 3L0DA 1IZ9A 4LRSB 4HV4A 4WECA 5J23A 1R16A 1G0OA 5G2OA 5I7SA 4D3SA 3GPDG 2VUSA 4BO3A 3KYCB 4D43A 4NNJA 2WSBA 4BNTA 1GCUA 2AEFA 4GLOA 4DPLA 3IJRA 4LMPA 1QSGA 1U3WA 1ISHA 5TRTA 2WJPA 3MJVA 3V1UA 4CLEA 5L7TA 1XCBA 3RVDA 2EV9A 2NUAA 3F47A 4GPD1 4J91A 5I7VA 4L73A 1QV7A 1YB5A 4E32A 3DMTA 4TKLA 3ZWVA 4P8RA 5I8WA 1GTMA 1XDWA 1WLYA 3VAZA 4AJHA 4ITUA 3JD3A 2D5CA 3OP4A 4N7RA 3QQPA 3T4XA 1FDUA 3HWRA 4CM4B 1GD1O 4LSWA 1PS8A 3INRA 3WX0A 3ROKA 4A5OA 4E21A 1CRWG 1Y8RB 2Q4EA 4HNHA 4MIEA 1HDOA 5A06A 5CP8A 1V0JA 1HE4A 1GFSA 3B1KA 4CLRB 1LDYA 4DPMA 1YXMA 4XDYA 1F8GA 4B3HA 1ISFA 2DKNA 3ZWAA 3NDJA 3NTRA 5ER6A 2NU7A 3QVSA 3DQPA 4PG6A 1UXIA 4N5NA 2IRWA 1HSZA 3TOXA 4CMCA 3GDFA 3OEYA 1GPJA 1UAGA 2Z1NA 2HK8A 2DC1A 2WDZA 2NVBA 2Y67A 5L7WA 3JQ7A 3PJFA 1UDAA 2RH8A 4DQUA 3DO5A 3ZWMA 2QYSA 4QO8A 4XGIA 4RDHA 5EJ2A 4FFOA 5CFZA 1FDSA 4FGSA 4FB5A 3E6AA 3IMFA 4J16A 4Y6RA 3UAGA 1XHLA 2DVMA 1FMCA 1PJ2A 1VRWA 2QIOA 1JA9A 3H2SA 3HDHA 5C7IO 4IMPA 1BVUA 4WOJA 2VT3A 3R6DA 1C3VA 4W99A 1U5AA 1WPQA 1I32A 2Y0DA 2WYWA 3LC1O 2VN8A 1LLUA 1N9GB 4NBUA 3OHSX 3WGGA 1X1EA 1U7HA 4UUOA 5HTOA 1Y8QA 3OECA 1Q7BA 2C54A 1I3MA 3IIEA 4NPCA 1PZFA 1P1IA 3ROQA 5JXWA 5G0UA 4D42A 3WXBA 4AICA 2PFGA 2CSUA 4H7PA 3M1LA 1O6ZA 4DREA 5ADHA 1PIWA 2P4QA 3QWHA 4IXWA 5A5EA 3GEGA 4IIVA 5L4LA 2B0JA 1SBYA 3D5QA 4PLWA 3DBLA 4JK3A 4LMRA 1NFRA 2AA3A 3L4BA 1JN0A 1ZJZA 2R00C 4CODB 3FRJA 4LCEA 1J49A 2PTGA 3BHJA 1LI4A 2FSVA 2HKIA 3EAGA 2POQX 2YY7A 2NTVA 4PRKA 5IN4A 3JD4A 5AXDA 3ENKA 2PZKA 3F3SA 4A0SA 2AG8A 2PGLA 1FDTA 1PL7A 2CDBA 2H63A 5EERA 2OOSA 1BVRA 3CSDA 5CAEA 5T64A 1E0DA 3ZU4A 4Z9XA 3VTZA 2BH9A 1CEQA 2P9EA 2X0RA 1BHSA 2HK9A 3TWOA 1EE9A 1DIGA 2OP1A 4C7JA 1F8FA 1UP4A 4ZU3A 4CM9A 3ETDA 1H6BA 3WWZA 4B7XA 4NFSA 5C5IA 1YONA 2VYNA 3Q2KA 3L6EA 4P4LA 2PH5A 3VTFA 1CQIA 3O9ZA 4IM7A 3GR6A 5A9RA 1LSOA 1ZK2A 1BW9A 3I9JA 3OF2A 3RJ9A 5DDIP 2C29D 3OIGA 2PZLA 4D0SA 2FR0A 2GN8A 2VT2A 1Z45A 1XU9A 4E12A 4OM8A 3OQ6A 3PEFA 1C0IA 4CV3A 2J5KA 4WKGA 1OAAA 2OBYA 2XXJA 2HUNA 3SJUA 3TJRA 3WBBA 1H9BA 3GRPA 1PJTA 3AI3A 4AJJA 3MZ0A 4JIGA 2EERA 1LRLA 3PJGA 3U4CA 4CV1A 3PDUA 2WE7A 1ISMA 4BHTA 2Y0CA 4RGBA 4XR9A 4DLBA 4JN6B 3RJ5A 5JAZA 1PQUA 3GAFA 4J1QA 2NU9A 1U3UA 1PEDA 2CZCA 1JAYA 3HHPA 2J5QA 3IUPA 1LTHR 4GMFA 4R1SA 1PZHA 2NSDA 4M1QA 3LVFO 4ZQGA 4BNXA 3IC5A 3W4IA 5FI5A 1ONOA 1B8PA 3DZBA 2ZJ1A 2GNAA 1ZSNA 3M2PA 1KERA 5CDUA 3PHHA 3ICCA 2FR1A 4G81A 1EDOA 4DIOA 5JBIA 5COBA 3LT4A 1KOLA 3PWKA 2DM6A 2HMSA 4MKRA 1RPNA 3NUGA 3GH3A 2C7GA 2FRDA 4J6FA 1DBVO 3F9IA 4YT5A 2Y1FA 3TSCA 2Z5LA 1S7CA 1U2DA 2VOJA 3NJ8A 4XJSA 2HQ1A 3B70A 2HK7A 3PHGA 5LDHA 5KCZA 3T4EA 1ZK4A 3DHYA 1JAXA 1GPDG 1TI7A 4RPHA 2EKPA 2W8ZA 4MP8A 1PGJA 4U0JA 3GG9A 1DC4A 2P9CA 1X7HA 1IZ0A 3E82A 1KVQA 4EJ0A 4II2A 3AU8A 3OICA 5U1PA 2BLLA 3FPLA 5KWEA 2DBVO 2DBZA 3E8XA 2GO1A 2X6TA 1SZJG 4DLAA 2NTNA 3AY7A 4YRDA 5EQDA 1DC6A 4J3FA 1ADGA 1MXHA 1Z7EA 1WMAA 3RUIA 3TZ6A 3JYQA 1GYPA 1PGPA 1CERA 3OIDA 3H9GA 5TT0A 4IZHA 1E3WB 3EK2A 4U0KA 3LZ6A 1C1DB 4XX0A 2G76A 3JD0A 5H82A 1Q0HA 2NU6A 4Q9NA 1QLJA 2ZYAA 5B1YA 3DWFA 1O5IA 2SCUA 2P91A 4TZKA 2X0JA 1KBZA 4UUPA 4FFMA 1VM6A 2D2IA 4M87A 5AVOA 3AUAA 2BI8A 3IS3A 2X7HA 1DJQA 2D3TA 1TXGA 3Q2IA 2I3AA 1JWBB 4CV2A 1ZUD1 3D3WB 4WCFA 2NLOA 1EFLA 1IOLA 1B15A 2DUWA 1GDHA 2QRLA 3FWZA 2E48A 4NBVA 3JQFA 4EUEA 3QP9A 2XAAA 4MDHA 9LDTA 3VPSA 3L6DA 2UUPA 4IJWA 3BIOA 1D3AA 3DBHB 5IZCA 2HCTA 1LDNA 1TEHA 3L9WA 1H0KA 3CINA 2UAGA 4CMIA 5T67A 3WNVA 2ET6A 4J43A 1UP6A 2PNFA 1PGOA 3AWDA 1IULA 1TT5B 1PWXA 4CMKA 1SPXA 3UW3A 4G5HA 5IAAA 5DZSA 2BFAA 5T8KC 3ONDA 3LK7A 1B3RA 3QVXA 4DYVA 3UCFA 3G49A 4KTVE 5G0TA 1UP7A 3E9QA 1MC4A 2OZPA 2NTJA 3FNEA 5K6AC 3OA0A 3OJFA 3ITKA 3RIHA 1FDWA 2VWQA 1XQ6A 3QWAA 2R6JA 1GQ2A 4L76A 5B37A 4B3IA 4NZ9A 3AY3A 8LDHA 1SB8A 2FZEA 3DAFA 2VHZA 3PYXA 3SC6A 4OQYA 4DMLA 1JDJA 3QIVA 3ZN2A 4F3YA 4WJZA 3SLGA 1U2GA 4IDAA 4KUGA 4AJLA 3BYZA 3VC7A 3ORFA 4P4NA 2JFHA 4ONEA 2X4GA 1PGNA 4M55A 4BGIA 1AUPA 5KKAA 1A9YA 4IS3A 3X2EA 1NPDA 1PS9A 4GX5A 4DUPA 1SO8A 3ZHBA 4LVCA 1ISGA 5MGBA 3EYWA 3P7MA 1T2FA 4Q3EA 2GERA 4R9SA 2XXBA 4CM9D 4ND5A 3LT0A 5KNLA 2C07A 3JQ8A 2Y1OA 4CQLA 1CDOA 4J9UE 5KVQA 4WCFC 5ICSA 2BHLA 4OSPA 3IOYA 3RKRA 4U6SA 3TFOA 3ZV4A 3VPGA 5C3MA 2GN6A 3UOGA 5FF9A 2JAPA 1LSUA 3OJOA 1FK8A 1H6AA 2BGMA 5DBFA 1C14A 1EUDA 4RLHA 3DBHA 4IQ8A 4CUKA 1OOEA 1YL7A 2C5EA 2EP7A 4LCJA 4BNNA 4EJMA 4DTIA 5FEUA 3TFQA 3D5TA 2YFQA 3ON5A 2FMUA 1E77A 4CM5A 3COSA 4YAIA 1YWGO 3ETEA 3K31A 4CMEA 1HLPA 2AHRA 1LDMA 1VLLA 1YJQA 3BXXA 4TVBA 4URFA 5CG2A 1EBUA 5BNFA 2A9FA 4JBGA 5DCUA 1KVRA 3NGLA 1BG6A 3MTJA 3N7UA 1U1IA 1HYEA 3AK4A 4NBWA 1IY8A 4Q3DA 1W6UA 2GDZA 4KWHA 4WEOA 5IZ4A 3ZV6A 4EW6A 5AQ1A 2Y1DA 1ADBA 2NVUB 1BXGB 1ZXLA 3WR5A 3C3XA 4OH1A 3WGHA 5A9SB 3O26A 4QEDA 4GSLA 3KYCA 1X13A 2W2LD 5B4UA 4RVSA 5L95A 3K9QO 4L74A 4CUZA 1EFKA 3I4CA 4XD2A 2HRZA 4E5PA 2ZB8A 4KUHA 4F45A 1D1SA 2JD1A 1I3LA 4QX6A 1DHTA 2AE2A 2HMVA 3P5SA 4GKBA 1N7GA 4XQCA 3D3WA 1YB1A 2WM3A 4K28A 4DIBA 2LDXA 2EGGA 3KOUA 2FPGA 2AQHA 3Q0EA 1A5ZA 4MVJH 5CDGA 3AW9A 4ZHSA 2JL1A 3HN2A 4BNMA 3NDIA 3SBOA 4B3JA 1SCUA 5MDHA 3FI9A 1U8FO 3RD5A 3PIDA 3C7AA 4F6LA 4IGFA 4I5GA 4BV9A 2HMUA 1IPFA 3IKTA 3D4PA 3ITDA 4B4UA 5F1KA 3CZRA 2IYOA 3HNPA 4PLCA 2BRUA 3M1AA 1GAEO 3CH6A 3HDYA 4JROA 2X58A 3DBRA 3DHEA 4CM3A 5CPBA 2C20A 3E5MA 5H81A 4IBOA 3VDRA 3H5NA 4RL6A 2QYTA 4WUVA 3DC2A 3KUXA 4J1SA 1B2LA 2WWRA 1SOVA 4R1TA 1BTOA 4PLTA 3DL2A 3PGXA 1E3JA 3QWBA 3ZV5A 1EK6A 1WVGA 1C0KA 5IFLA 3ANLA 3NYWA 1DLIA 3WLEA 1KC1A 4PGFA 3E1KA 3WTBA 4WPGA 4AJ2A 5G0WA 1QORA 3RC7A 4NDNE 4E6PA 4BNGA 2OO5A 2VCYA 1EMDA 4Q3CA 3STHA 3WICA 4J9VA 3DFZA 4ZN6A 1X0VA 4XYEA 5ILOA 4RCVA 3DZGA 2FOIA 3TZHA 2NM0A 2QX7A 3I5MA 3WQRA 1LQUA 2CVQA 1M76A 4BMVA 5GZ3A 1PL6A 5DOZA 3NTOA 3W6ZA 1GZ4A 4BKOA 1EDZA 1W0CA 4RF3A 3E9MA 4Y98A 3IDSA 4JXKA 3ENNA 1H94A 2Y99A 3MJSA 4RZHA 3TZCA 4A7PA 2PGJA 2X9VA 4S3MA 1BW9B 1S6YA 4E0BA 4HADA 4RF4A 3GNTA 5B4VA 1A9ZA 3GUYA 4CLDA 2UVDA 5AXCA 3WOHA 4W6ZA 3M6IA 3GVPA 1DPGA 5ENDA 3DFUA 3KLMX 1DFHA 5CDSA 2I3GA 3GK3A 1R66A 1GZ6A 2WEKA 1P1KA 1ID1A 3GNSA 3JQBC 3D4NA 3F4LA 3QRWA 1VL8A 3PWZA 1F14A 4PZCA 4CMBA 1B8VA 4NR0A 4L4XA 5K9ZA 2Q1SA 4BQRA 3I9MA 5EPOA 2AQKA 3VH1A 3GHHA 3OA2A 4XKJA 3Q1LA 3U4IA 4R3NA 3WJ7A 4RVGA 3HE3A 1UJMA 2NVUA 3RU7A 3ST7A 3WTCA 4C4OA 3W1VA 3UFXA 4E2WA 5C7OO 1DOHA 2Y68A 1NYTA 5DCWA 3MCVA 3QSGA 4ZQEA 1XIVA 5JO9A 4JP3A 4R5HA 3W4JA 3KTDA 1L7EA 1KS9A 2CVZA 2EWMA 2Y1GA 1C1XA 3DB2A 4KOAA 4NMHA 3L4BC 1X7DA 1UR5A 1LJ8A 3RAJA 1BXKA 1Q7GA 2UUOA 5JW6A 1EK5A 2IXAA 1WDKA 2Q46A 5EQFA 1A7KA 2B35A 2PD3A 4WOKA 3JD2A 1O8CA 1YOVA 3VVBA 1EZ4A 3DTTA 4DQVA 1RYEA 1Y5RA 1YVEI 2O7SA 1DRVA 2WTBA 2Q2WA 3PTZA 1E7YA 1XGKA 2BMAA 3MOIA 1GUZA 3I6IA 1BGVA 3SLKA 1SEPA 4XRGA 5JYEA 4PVCA 2B4QA 3JQGA 2VNAA 4XGKA 1HEUA 1O0SA 3RCBA 1MB4A 2AG5A 4PLZA 3AUTA 3R3JA 4BUCA 1DIHA 1ISIA 2EHDA 4FSHA 4OJNA 4IS2A 1D7OA 3V8BA 1T26A 3RC2A 3PZBA 4ALJA 1I2CA 3PVZA 3AM5A 3K96A 2RAFA 5EESA 4YQZA 1EEHA 1ZIDA 1YDWA 3TL2A 1G1AA 4YACA 3W4KA 1ZMOA 3ULKA 1ENPA 5JDCC 4CLRA 2W2KA 5K0ZA 4UEKA 2QRJA 4A10A 1XU7A 3ZWWA 3DOJA 1U5CA 3WFJA 4CM8A 3JQ6A 5JDIC 3VKVA 1R15A 5AXBA 1Y8RA 3GPIA 4N54A 2H6EA 3JYOA 3WYBA 4CMHA 4W4TA 3C85A 2GD1O 4ND1A 4EUHA 3F6YA 3HADA 1J6UA 3PXXA 3RFXA 3WGTA 1HF3A 1A4IA 4R4JA 1XR3A 1P3DA 2VQ3A 4BNHA 4NI5A 1CQJA 3FR7A 4PG7A 1ADFA 1K89A 3ADPA 1PQPA 3QLJA 3LQFA 4KDEA 1DRUA 2O2YA 2YDYA 3OH8A 4ND2A 3TZQA 4GH5A 4JBIA 3S8MA 1MUUA 2GYYA 3BMCA 3B1FA 3DONA 4GLLA 1AHHA 1I2BA 1GQYA 2IXBA 4BO0A 2CMDA 1GR0A 1Z75A 4XYMA 3ASVA 3CKYA 4LRTB 1IE3A 3N74A 4TRJA 1DAOA 2J3HA 3G1TA 3QWIA 4PLGA 2W2LA 1E7QA 3PGJA 4CM1A 1P9LA 4BO1A 3U5TA 4RPLA 1Z73A 1ONNA 2HO5A 2P4HX 4GX2A 5TJHA 3PRJA 3QVOA 1R0LA 4L9RA 4R51A 5JCXA 3VZRA 3ZNQA 5TGDA 2BGLA 4O0LA 2Z95A 3CXRA 1HE2A 4DVJA 2AQ8A 2O3RA 3BTOA 2PK3A 3BMNB 2GRAA 3GAZA 1N5DA 4I5DA 1ULUA 1W4ZA 4K26A 3KSZO 2HJRA 4RQTA 3JQDA 3VPXA 2EEZA 3FSRA 1IYZA 3DAPA 4IMRA 2GF2A 4R9RA 4I5FA 3RC1A 4MJLA 4E31A 3I52A 1EQUA 2QHXA 1ZK3A 3QA9A 4J2HA 2VYND 5C37A 2ZKLA 4AJIA 4DQXA 3BMOB 3S2IA 4AJKA 1Q0QA 4BO7A 5DF1A 1LDEA 4WNCA 3KSUA 1UUFA 1T4DA 3CMCO 2P5UA 4D79A 2NWQA 1YRLA 1JVSA 4YA6A 2OFPA 3ZV3A 3OBBA 3ZGYA 1HZJA 1EUZA 3ONEA 3DEYX 4I08A 5L3ZA 1SOWA 4EITA 4JJIA 1T1SA 4CR6A 1GEEA 2G0TA 4OKIA 4Y6SA 2HMWA 4Z0PA 2V6MA 4FCCA 3RASA 4BVAA 1X15A 2ZB7A 4D41A 4E3ZA 1U28A 3AUSA 1GZ3A 3DOCA 3Q9NA 2YV3A 1MP0A 1YDEA 5GMOA 2Z1MA 2OBNA 1U7TA 4QFCA 5IZCC 4G65A 3HN7A 3LT1A 4RDIA 2AQIA 1N8KA 2O4CA 3U62A 2X5KO 4YTEA 3RUHA 3N58A 4MVJG 2QZ9A 2VZ0A 3JQFC 4OL9A 4I9HA 1YQXA 3GVIA 4E30A 1JVBA 1MA0A 3ICPA 1VJTA 1JU9A 1TA4A 4HFNA 4PRLA 4CMAA 4PG5A 5L53A 3A14A 4H16A 1L1FA 1PS0A 1T1RA 4YRAA 1XSEA 4BO4A 3MOGA 2W4QA 3EMKA 2B4RO 2E6UX 2Q4BA 3HG7A 1E1KA 1U3VA 4RF2A 4MIYA 3G17A 2I66A 4KDFA 5DNAA 4W7HA 5BSGA 3KO8A 3W8FA 3UKOA 3ZNPA 3H3JA 1LU9A 3GEMA 3D7LA 1WAMA 1WNTA 1HDZA 4GBJA 1M75A 1IHXA 5CDTA 2AMFA 5ER9A 3ZU2A 4FJ2A 3EZLA 3HB4X 2PLAA 2PKRA 2TMGA 3LLSA 2HRBA 2R00A 1A72A 1E7SA 1BWSA 4WCDA 5FYDA 1DDOA 2RBEA 1VJ0A 2Q50A 3PK0A 5A5FA 4B8ZA 4BOYA 2VTEA 3DDNA 1F12A 3B20A 1OI7A 4FDAA 1JLLA 5CEFA 2ZATA 4MKXA 4DGSA 3PP8A 3PZRA 1GV1A 1OMOA 3WG9A 3BZUA 3VKUA 1W73A 4WLUA 1ZSVA 3KYBA 1J5PA 1ENZA 1NWHA 4TZTA 3IL2A 3FTPA 1IHYA 3FN4A 1NFFA 2G5CA 4QO7A 1IPEA 2BKAA 4W9NC 3P2OA 4CLOB 5KJ6A 4K6FA 3DTYA 3AOEA 1NQTA 3KV3O 3LC7O 3WYEA 4OQZA 4YR9A 3KRTA 3AOEC 1U8XX 2EIHA 2EG9A 3I1JA 2YW9A 2F00A 4RLSA 3UICA 1I3NA 1PJ3A 4K1LA 3I9NA 1OZAA 2GCGA 1YL6A 4B4OA 1LNQA 4R01A 3C8MA 1YBAA 3PQFA 5IXSA 3E48A 3GA0A 3MEQA 1QMGA 3S1LA 2B37A 3OSUA 1HTBA 1E3IA 1NP3A 4XR4A 3WSVA 1VE9A 3BMOA 4F6CA 4JQCA 4NK5A 1RM4A 1NHWA 3BHMA 4FBGA 4EGFA 1GUFA 2J3JA 4P22A 2LDBA 3RFVA 5HM8A 4R5MA 2P2SA 3ANNA 3F5SA 3WGQA 1YGYA 2GGSA 3BTUA 3KVOA 3EGOA 1T4BA 3JSAA 2ZIZA 3JYPA 3MTGA 1KVTA 1V9LA 4XB2A 4Z6KA 2EXXA 2O4UX 1QG6A 3QE3A 5JPIA 2OUIA 5JE8A 1PSDA 4FJ1A 2RHCA 4CLOA 1EQ2A 2O7QA 3JQ8B 2I6TA 3IP3A 3K30A 2XF8A 3CPSA 4L4SA 5F3RA 4BNVA 4X54A 4XRRA 4NIMA 4OMUA 1I3KA 2NNLD 2XPCA 3V1TC 1SMKA 3JCZA 4YQYA 1NNUA 1H6CA 4CLXA 3PPIA 3UCEA 1LRJA 3WB9A 1B3BA 2HMTA 3WQSB 1H93A 2YHUA 3ZWNA 3NJ4A 4XJTA 2PY6A 2HDHA 3TPCA 5ITWA 5I7EA 2Y93A 2B69A 3FR8A 4J7XA 2YV2A 4EEXA 1DEHA 1LLCA 2PWZA 5LCXA 4E5KA 3V1YA 4XIJA 2BELA 3QW2A 3ZU3A 3KLPX 1DC3A 4YEDA 3RROA 4UVEA 5IDWA 1HRDA
chains in the Genus database with same CATH superfamily
1HTWA 1QO7A 1Z33A 2ABWA 3TVTA 1CJSA 3IQWA 1HNWB 2WZDA 3ZLVA 4JGBA 5F78A 2CBGA 1F2TA 1K6XA 5LQSA 5JU6A 1G64A 1SK8A 1U7ZA 1KJ8A 2J3EA 5FTMA 4NU8X 1NXQA 5JCOA 4DLKA 3C1OA 4PPFA 2QVGA 3Q0IA 2P3SA 3CZAA 3REQB 5BRJA 4XD7A 3H99A 1JHYA 3H4VA 3OLVA 4KGVA 5DNDA 3L1JA 1FLVA 2BF7A 4BNUA 2WT4A 3O21A 1QBGA 4O29A 1QRAA 2V7XA 3G2OA 3H65A 1K6JA 2KM1A 2VOEA 3C16C 4FFBB 4L4ZA 4MJ7A 4WFQA 4YP9A 1EVIA 3T3NA 3THOA 2I91A 3LGSA 4DZTA 1UZLA 4N5LA 3JV7A 4AZ0A 2RCYA 4E5UA 1BU5A 1VE3A 3DV9A 3JPWA 3ER9A 3GF4A 1XAJA 3EHDA 1AMOA 1HYHA 1D6JA 2QZJA 1Z8FA 1U3CA 3PFGA 3WJAA 3DOOA 2Q6IA 3FSEA 3AOGA 4B5LA 1J09A 2GESA 4AY5A 1E0AA 1QYIA 4Z9YA 4K40A 1KIAA 3OWOA 2FOLA 2O8BB 2CLEB 2HPHA 4G6ZA 2H3HA 1B76A 3LDUA 1T25A 1E9VA 3KBOA 3L7AA 2VNJA 3EDOA 4HNGA 2H85A 3EZ6A 4KDCA 5LD2C 3KXKA 4I1OA 4V02A 3LOQA 2Y1EA 4OOFA 1JX6A 1C30B 2QR3A 1G8YA 3A70A 1F9EA 3KM0A 1LCIA 3TW0A 3QYAA 3UJ7A 3J80A 1QR6A 2WKWA 4C3UA 3U3OA 4LX0A 2XMQA 1IB6A 4K9DA 4OJYA 4ZI3A 2G3YA 1CZLA 1UIRA 4QXOA 1BFUA 4XDHA 4EVRA 2EKZA 2OFOA 5EIXA 1LBTA 1OV6A 3FNRA 2WHPB 3NU1A 3PIIA 3ELUA 3VYWA 4JLWA 5TGTA 3GBVA 3ND8A 5CGQB 3NC0C 3HK2A 1Z3CA 3E3MA 2QW8A 4KB5A 4OREX 1RKBA 3B8HA 3FUXA 3UA4A 3VH3A 1A9OA 1NUHA 4FFPA 1UMBB 2BEWB 2YC2C 5TQVA 3TTSA 4HZGA 2IZZA 1YH3A 2CVOA 3IHWA 4KK3A 3KQPA 3M2TA 1F48A 2XI4A 3BJMA 2J45A 4MDYA 1Q84A 1KAQA 1RACA 2IOFA 1VI6A 3EDQA 3PHIA 2ODAA 3PT9A 4IIBA 4LV6A 4MPDA 3TQRA 3ZJVA 4YXWA 5GAJA 4J90A 3IT2A 4FUQA 2RGXA 2H4ZA 5K2MA 4YYZA 2PWAA 4I6GA 1MPTA 1IHPA 3RI3A 1F3LA 3S2FA 4MWOA 1HWYA 4NC9A 1XPOA 4F1WA 2ZCVA 3IP9A 2PXHA 4HQNA 2G88A 2VHTA 3GG2A 3SOPA 1DTWA 1OBFO 2EARA 1I4LD 2ID9A 4JJ8A 2A59A 3GCZA 2JJ1A 4U9UA 3RUEA 2IZ5A 1FTWA 1HDGO 1T2UA 2PKCA 5JEDA 4FI3C 5JBQA 4MV6A 2REQB 3E84A 3FPBA 4QGSA 3DZCA 2DU8A 2SCUB 4KFUA 4BLOA 4TV9A 2I34A 3W8RA 1WKCA 3F67A 1WHTA 1N2HA 2OMEA 4ACBA 2UV8A 3AX6A 4DSAA 3I5YA 3H05A 4MCHA 4EG7A 4X61A 3ECAA 4FIDA 4FMBB 1YK0A 4QU0A 2ZJ6A 2RB5A 2PLRA 4FT2A 4JLDA 3U7FB 4WZAB 5DU2A 4TQ9A 3T12A 3FTCA 4UCXA 3CLRD 3P9XA 2P62A 1ZI8A 3WGLA 3OQIB 1JAZA 2BFBA 3FDFA 3IDFA 3WMGA 3GZNA 4YIHA 1E3SA 1HE8B 1JPJA 3D1VA 2YVQA 3RK1A 4LZLA 3PQ5A 3LW7A 4MP3A 3GCXA 1JEJA 4N65A 5DWVA 1GQSA 4QE3A 1W5AA 4KJZA 1CUHA 1Y3HA 3TLGA 1TIKA 5FOSA 1NWCA 4CTKA 2JZNA 1SRQA 5BUQA 3GLRA 1ENOA 1N8NA 5GY7A 3MFQA 5E1MA 2DT5A 2X23A 4TSRA 5BWNA 1G2IA 1O96B 5D2CA 2YWXA 1AKYA 3UUEA 1H5QA 4RGQA 5C0OE 4TWJA 2W98A 4B4KA 1R12A 3WAKA 4J76A 3VI4B 3UPTA 3UK2A 2Q1TA 1DJNA 1Z5GA 4GLJA 4G4JA 4ZXFA 5C51B 2PZGA 3H2KA 3WGZA 2RGWA 1MVLA 2BHNA 2XA2A 5A4IS 1HURA 1QQBA 3I9LA 3OU2A 5KWIA 3PGA1 4MVJF 5BXQC 1JQLB 4MGEA 1OCEA 4MUBA 4Q21A 4CM8B 2I4NA 3Q7EA 2ZWIA 4UCFA 1T2DA 1V25A 4PVDA 1PAUA 3MA0A 4G5XA 2FPWA 1SGWA 1VPEA 2PGDA 1SVWA 3NWBA 4QOIA 2W71A 2YXLA 2Q45A 4ZD6A 4ILKA 4DMHA 4LCBA 1K5HA 3DCNA 1MHTA 4WLNA 3KLBA 3ZHXA 1E4EA 1DHRA 1N1GA 2JFYA 5KC9A 1G6Q1 3R7AA 5DM1A 1C9DB 2CFOA 2IDKA 3N1UA 4HDMA 2RAUA 3G0OA 4Y2HA 5M04A 3LYAA 3BWMA 4FOTA 4Q48A 2EFYA 2OECA 3HI6A 1IK6A 1LXCA 1TAUA 4JVSB 3AV0B 2L82A 5HVNA 1PYDA 1ULSA 5SY4A 1ZM4A 4ZFNA 2B99A 4EDFA 4DB4A 1ZVQA 3NYRA 1NONA 2C9YA 2CY0A 4HWPA 4BGDA 5I4IA 1QU3A 3GN2A 3JQAB 3PWSA 5KHLB 1SQ5A 3STTA 1A27A 5JEEA 1XA0A 1VRVA 4OBEA 4RD6A 3H2GA 4C0XA 2RGYA 3NGXA 3IALA 5FWXB 4NE2A 1WNFA 3IQHX 1G4AE 1L5FA 4QSMA 4MZDA 2PWPA 3GQVA 1Y9ZA 5HWSA 2JFBA 1PUJA 3WK6A 3DTVA 1R5OA 4DG8A 5B3AA 3MCTA 4G5FA 1AC5A 3M6LA 1DWOA 2XKAA 2H1FA 4E7OA 4IFIA 3BAFA 3HM2A 4DMFA 4JP8A 3PHJA 4WZZA 3QEBZ 2AG1A 4P98A 2ODBA 3NBMA 4KG7A 1A7AA 1SWWA 2XF2A 4EA9A 2WB2A 3ESRA 1OH8A 3GX1A 1Z08A 1PNTA 3HHEA 4NDAA 5HKKD 4KPYA 3FPGA 2GK4A 1QYVA 2VL7A 4X97A 4ZVUA 1TMYA 3L4KA 1ZCJA 3K6KA 3ONWA 1RQ2A 4Y7DA 2QD3A 4BX0A 3EXHC 4JUCA 4G84A 4AJPA 3WDSA 3RADC 4G8CA 5JTTA 3DOEA 3FPHA 3L07A 3B1WA 3F7OA 4XFKA 1W35A 2IGBA 1ZIYA 2YWBA 3HEAA 4R1NA 2HB6A 2XA1A 2IIBA 5DYWA 3TQCA 3WJ1A 1G9SA 4EMBA 4JLUA 4CF5A 1JIUA 1RZUA 2ONYA 3GLHE 3TJZA 4QNMA 3LC2O 4U00A 1J8DA 1HZZC 3CGGA 4LRXA 3CW2A 3EQ8A 4WZBB 5B2ZA 3SEQA 4HDSB 5B3KA 2X0KA 3T7DA 4FQ8A 4KBYA 3H13A 4V1CI 3WLFA 5CX4A 2IKQA 3M6AA 4AXBA 3IE2A 2Q5QA 2Y1CA 3MC1A 3FGOA 4V0SA 3SXPA 2CYAA 3C7TA 1ZD1A 3FFTA 2I03A 3OT4A 3VMMA 3UG6A 2VRCA 3AHHA 3CVOA 1FTYA 3FMGA 1HDCA 3INTA 3K1JA 3H1GA 4KYUA 2GN2A 3B51X 2H17A 4C6TA 1M8JA 3UVEA 3F6EX 4KR2A 4OQFA 1RHKA 2AXEA 1Z17A 1J33A 4OFXA 4E2FA 1IQUA 2QBYB 5EIBD 3A1FA 5A3QA 1N57A 1NXWA 1IY0A 2QK4A 4H60A 5JAQA 4LC9A 1Y8QB 2IYLD 1E79A 1WL8A 3QVTA 4H1HA 4UBLA 4RTPA 5AR1A 1LBIA 2GZSA 3JQAA 5CYFA 5K8TA 2VZEA 4GUAA 3CLRC 1F2UB 3E7PA 3FUCA 1HE3A 4IPTA 4L5AA 4MWBA 3SJBA 1KZ6A 4O4IF 2FJ0A 2DQKA 2QLNA 1Y6ZA 4HB3A 1U7XA 2D7JA 2GK7A 1A95A 1PEAA 4P3NA 1U94A 5CVVA 5BQ5A 2D74A 3X1JA 5A1TA 2QL9A 3L8HA 2VDWA 5FTWA 1ZOOA 1QU2A 3NANA 1ITZA 4RJKA 3SYTA 4DN6A 1E2FA 2YVUA 4EGQA 4IJVA 4R0VA 2PX6A 1Y33E 2X9NA 2YZGA 2ZUBA 2GWHA 2OR3A 3FOBA 1RQ7A 4DMMA 4RM2A 1PSWA 1ZP6A 2OHGA 4HVAA 2GAJA 3CE6A 4IDEA 4KWCA 5I7FA 3A06A 1S1MA 1MIHA 1GEGA 2G9ZA 4MUMA 4UMVA 3KKOA 3NNSA 4ALIA 4PYIA 3OHMA 2TYSB 3UMYA 1YACA 1N6KA 2V7PA 2YRXA 3EXHB 1M7BA 1UXJA 1BCSA 3VA7A 3GLHA 3TQTA 1DIBA 1Y5MA 1Q0PA 1QRRA 5AKKA 2OXIA 5B36A 5HFJA 4YLEA 3DUFB 1YS4A 1XMXA 1DKOA 2SNIE 2ZIGA 3UWOA 3R3WA 2XMDA 4AROA 3HB9A 3ETGA 5CT6A 5DTIA 4QDTA 3BEDA 5ALLA 1SCJA 3TRIA 4OQDA 2CE7A 2ILTA 3KIPA 3NETA 1K3UB 1HZZA 3I0MA 1H0SA 4P31A 5F9HA 1NQOA 2FGKA 4J0DA 1WB9A 1C9EA 1NAHA 2C3PA 3A58B 3PNYA 4OXRA 4OL0A 4QYWA 1Z6ZA 1GV0A 2PRIA 3PICA 3OT1B 4JYCA 5CH3A 2OPHA 3WGJA 2IX9A 4ACAA 4EQ6A 4U2CA 1T1EA 2GEJA 3Q3IA 3QV2A 5FPPA 4MRSA 3GJTA 2XKBA 2YDXA 2WWXA 4G1EB 5LZ5A 2AN5A 3LQQA 4HDCA 2D59A 5MGNA 8MHTA 1LLDA 1ZDMA 2NSJA 1VPDA 4B3SB 4DV3B 4CCWA 4Q4CA 3HYTA 2BFFA 3EGDB 3C5HA 3SQMA 5CXSA 1TF5A 2YMLA 1NJ5A 4DCNA 1JUDA 1QZ3A 1S2IA 4N1AA 1QK5A 1PTJA 2Q2VA 3MYRA 1XDGA 3AL3A 4ESOA 5P21A 1QK4A 3T3PB 4INZA 2XOKD 4ITRC 3RFTA 2IP1A 3FKQA 5CLHA 1D4ZA 3NHFA 4MW7A 3BWBA 4REOA 1MBZA 2WVJA 3FJ1A 2H7VA 3ZE0B 1VIDA 2W6CX 2CD9A 4MWZA 5E2AA 4J8PA 3A10A 1PR3A 2EG5A 4H7KA 2P6NA 4GW3A 3GLIE 5JD3A 1PJZA 4C06A 1XMPA 3FYCA 3UWMA 3KZ1E 2FEXA 2FCRA 4MW1A 1R2QA 4TRMA 3GT3A 5IN5A 2VPPA 3HO6A 4FP9A 4K9KA 9LDBA 1AQNA 4I1SA 5HBGA 4LYYA 3UMMA 4ARCA 2QMEA 1T3LA 1U1EA 2NAPA 3QEMB 4I1VA 3ZHYA 3S2ZA 4LFAB 4ND4A 4YNBA 2NSLA 3K0FA 1KAOA 3KLNA 1KO4A 4MWTA 2IHTA 5JYCA 4M1YA 4FGUA 4RJJA 1BU8A 1DU4A 1S3FA 4ZO4A 1O9GA 1SBZA 1BX3A 3QLTA 4N82A 5LDGA 3BQ9A 2H9IA 1PFYA 5TSDA 2DCUA 3I39X 4DJEC 5ERXA 4RLQA 3JWPA 3JW8A 3WKCA 4LFCB 2YASA 4NENB 4WEQA 3U1BA 3B6JA 3MW8A 4HQKA 3HCRA 4KNVA 4XEUA 1X42A 2ZVJA 3DMRA 4CIXA 9ABPA 5IHPA 4JEHA 4D44A 4W1SA 5CDFE 1KY2A 2CL5A 1W85A 1BE6A 4E2XA 5AYVA 3C7CB 4Q7JB 3UV6A 3HLKA 5CVDA 5YASA 1GL7A 2O5CA 1IUKA 4IWNA 4BE4A 1ANKA 4KXUA 3AHGA 1VPTA 1SVOA 1P1CA 3CQ9A 4YCBA 1JKFA 1PWHA 2AYYA 3PUWA 2DFNA 1ZOPA 4ODIA 5KIAA 3ZJ5A 1GFZA 1YBMA 4XGQA 4WLVA 2HLHA 4PX2A 5L3SB 1KY4A 2Q7OE 1Q91A 3R75A 4RW0A 4C0BA 1NKSA 3HJHA 2FK8A 4G01B 5CB6A 3OE7A 3KQVA 4P38A 2V5VA 3OESA 2B5OA 4GBGA 2CNBA 4EJ6A 1DXHA 1T5BA 1X87A 2XBLA 2C8LA 3FB4A 4OLHA 4TKVB 1MFZA 3ANSA 4QLAA 1MO2A 1T1JA 3JQAD 3HRKA 4ERNA 3UT6A 3CZ4A 4EMSA 2WWVD 2OBXA 1JHMA 2R1TA 4KZPA 3ISTA 4RK0A 3ZX4A 2OG1A 2EJVA 3AQ4A 4C0QC 4DNFA 4UBNA 4OHXA 1ECGA 2JLAA 4NZYA 4BGVA 2Q28A 3HKCB 3VPHA 1EVLA 2ZJAA 3MBKA 1P0FA 3E1SA 1S01A 5FTLA 2XOXA 2HSEA 3B52X 2VPWA 3FA2A 3IP6A 1TU3A 2DPXA 3LFUA 4J2OA 1JF8A 2GXSA 3NBAA 4RPIA 1PEKE 3OHPA 3CWZA 3PCTA 4RE6A 1JDBC 2ZBRA 4CKWA 4UHHA 2JKZA 2KWIA 2Q6OA 4ML3A 3V5NA 1XK7A 3AY6A 2VUIB 4ITVA 4KQXA 3PLNA 5KYVA 1ISRA 3O8QB 4KDRA 2B4TO 2DFDA 2J9FA 5ALZA 1XEWX 3CN9A 2D1RA 3K72B 4Q82A 4YMWA 1AS3A 2HJHA 1TM4E 5H68A 4CM7A 4MKFA 1FP2A 2ARKA 3FG9A 3C43A 3OQPA 5CGZA 5BW8A 1CDZA 4AN4A 5DT9A 4CM6A 4TZ0A 1DL5A 1F60A 4FOOA 2PL3A 3L6OO 3WI7A 2Q1XA 4B3CA 3EZYA 4J7UA 5CFNA 2IHVA 5AP9A 4B7CA 1RAEA 3ESBA 3BSFA 2G06A 2Y3IA 4PO8A 1KPHA 5JFTA 1SXJD 5IDYA 1DXYA 4LGVA 4BB9A 1IBCA 2IBMA 2MMCA 5LP1A 4CPDA 1DRJA 1CD5A 2P4UA 5JY1A 1W5SA 3MWEB 3KKLA 4U7GA 2PD4A 5TMBA 2V6GA 5ITSA 3AVYA 2QG4A 1NXTA 3I9V6 2QZPA 4O33A 4HGRA 4YAJA 1G7TA 1OWLA 1RYYA 2NQTA 4HAZA 4ZQFA 1P4AA 3UMFA 3WGIA 1LBEA 2XB8A 1T4MA 4RFVA 5FX2A 2BFMA 2GASA 1UC9A 2ZJ0A 3NGMA 2P5TB 2GLTA 2JEOA 3N2ZB 3NHZA 2CKDA 1R9JA 2X41A 5LXTA 3QKIA 4QXQA 1TFRA 2Z09A 5AVKA 3BRWA 4FYYA 4GICA 3DR5A 2V7TA 4X93A 3TSAA 4CKCB 3GRZA 1FFYA 4Z5XA 4CT0A 3KTAA 3KSRA 4YX9A 1E5VA 5A04A 3I6BA 4OHMA 3V00A 2XKJE 4KR3A 4HD8A 4UAJA 5JRDS 5KJCA 1U2DC 1EE2A 5D1NA 5FUYA 4MVWA 1N9GA 3VYUB 1QQTA 4XEHA 3PK0A 4XYBA 2H5LA 3TYXA 2VHQA 1FS5A 3UAZA 3WV5A 3MGKA 2XUZA 1OFIA 2IYUA 2G4CA 3GJXC 1YB4A 3PC4A 3ZBQA 1DBQA 3Q7SA 3TX6A 2C82A 4RY2A 4EZEA 7ADHA 5KJFA 4RK7A 3WIEA 1J06A 4Q3AA 1E3EA 2RHWA 1VE7A 2OXCA 4PWZA 3TI7A 4CF3A 1TUEA 2XUKA 4ISCA 2YWDA 1ZHOA 3UW1A 4FYKA 4ZMSA 2P2GA 1ZG3A 1OWNA 4B8WA 4EYGA 3EA4A 1N33B 4JX8A 4CJXA 2JLUA 3CR8A 4PYLA 2P2YA 2PRSA 4I9FA 1UQTA 3M70A 4TLDA 4F5DA 5AVWA 3I0ZA 4K6MA 1E6KA 4GXNA 3RJTA 4JR0A 2JASA 3N8IA 4KMMA 5CHEA 4B4VA 3VI3B 3RNOA 3TN7A 5IJ0A 4JOCA 1Q7EA 1UDRA 1U8UA 4AO8A 3TRHA 5H3LA 3GN1A 4KTTE 4Q37A 3ZEIA 3DPIA 5JR3A 2GI4A 2CJXA 3Q3HA 4UNNA 3JWGA 4WI1A 3MJHA 4MQ5A 4BKPA 4HEQA 5EZYA 3R7LA 5EKDA 3C1TA 1VIYA 1DCMA 3CVWA 1L5SA 1I3CA 2JHGA 4RY8A 3OX3A 3CUUA 4TKZA 4TTJA 1JHPA 3QUCA 3RVOA 3TLGB 3JR3A 3OJLA 2R6DA 3C6MA 1UWCA 5CLGA 5CUQA 4P34A 3QLUC 2I1VB 1QHSA 1DBWA 5GONF 2HU8A 3NCHA 3U7QA 5LQDA 4NNPA 1I6MA 4DA9A 4F85A 1GZ5A 2D2FA 5C4GB 1RYHA 1KMHA 4NS1A 3L8ZA 2ZIXB 3SDBA 1E2BA 4C1NA 3FCUB 1EGMB 3TBHA 2VR1A 2OV4A 4XDGA 5TXGA 1CUAA 2EJTA 4YJFB 4OG2A 1H1TA 1C7JA 2JH8A 4TRRA 1I33A 5HZHA 4G86A 4G0OA 4MOWA 5E3IA 2B30A 2PLNA 1DXQA 1GDDA 4GAEA 4BNKA 4UM5A 1NW6A 4NZOA 5NULA 2AFIE 1GPMA 3H6KA 5B4TA 1X7WB 2PZEA 3U6BA 4NK4A 1WHTB 1CRQA 3N0XA 2QEQA 2G09A 1RAAA 2ZVPX 4UBJA 5JNWA 2R68A 3N8HA 2ZGVA 2DJIA 1E5QA 4A8JB 2DQSA 2ZT7A 4FFDA 2Z9CA 5J1SB 1Q77A 1Z0JA 4FOPA 2NU8B 4IIHA 2ZAGA 2A84A 3AJRA 3EF3A 4NCXA 4II3A 5THXA 4ZHQF 4AY2A 5JRJA 4EPVA 4LOHA 1NUPA 4O2AA 3RVSA 2HJSA 2OAEA 4JXJA 4BMYA 5B57C 2OV6A 1KXZA 2VYQA 3A4TA 5KQSA 2YWHA 1DG1G 5DLEA 3U44B 2ZIUB 2DLDA 2WVAA 2Z2JA 3IEUA 3OQ1A 5D7BA 4MUIA 4TWZA 1YUNA 3V7YA 3ZV7A 1Z7WA 4TT3A 4CKZA 1OI3A 3FBTA 4L27A 1UXKA 2E5FA 1NP7A 1UC4B 4YJGB 3T1HB 1EWQA 2R8ZA 2ZJYA 2ZR0A 2ZUWA 5FPTA 4BZWA 4WK6A 1A2OA 1EX9A 4LV8B 5TS2A 1XT6A 3JVVA 4U3JB 1FRNA 5BN5A 4N18A 3ZJUA 4KQFA 1AK2A 1XK6A 2ZRIA 4Q1AA 3R5JA 3SMVA 1P2TA 4IX9A 1JKJA 1DX6A 1MF7A 4FW8A 4KXWA 5DSZA 1OW3B 3PRHA 4NMWA 1OUMA 3UT5B 4G0MA 1KIFA 4CKYA 1K66A 1PNOA 3WHPA 5JUWA 5DW0A 3OMLA 2JHPA 3PS9A 2Q2NA 4FEEA 4JNKA 2VP5A 3ETLA 2JGIA 1E2MA 5A71A 3ZHZA 1MCZA 4YCJA 5AT1A 1I6WA 2O48X 2PL1A 3CVYA 5TLSA 2GCNA 4F3NA 2QQFA 4MV8A 1RM3A 3THWB 1BGWA 1D7AA 3M5PA 5DLQC 1QB8A 1P91A 2EX1A 1NVGA 3MWKA 4GFDA 3L79A 3S2SA 2CZQA 2VK1A 4FS3A 3EVCA 3REGA 2QD4A 3BAZA 5DLYA 2X2FA 3E3LA 4D6XA 5CEJA 3NWPA 2R2AA 4JZKA 2XE7A 1TJ3A 4NOKA 4TV8F 4LXYA 2FPKA 2X77A 3TOZA 3FAKA 4BMDA 2QENA 4YMSA 4NLLA 2GVZC 3I2YX 5J2TF 1OR8A 2BV3A 4CTOA 3NORA 5L6MB 1AVTA 4UE3S 3L1IA 1ZM2A 4M0PA 4QECA 4MVJP 1WMBA 4YJ2B 5BORA 1PP4A 3DEZA 3MJTA 2GFHA 4RXTA 1U4OA 3AVOA 3GRUA 2E18A 2GPWA 1CIPA 4OD0A 4QL3A 3R3VA 5K8LA 1YL5A 4LN1A 4M7OA 2BKEA 2FSVC 2FRVA 1KZHA 5JPCA 4LRYA 1MRNA 1NR1A 1CETA 1FMFA 4NJMB 5B7GA 1WHSA 3ZOKA 2F1HA 2BR5A 2DULA 2HCRA 4REQA 3TDMA 3T9FA 1RKUA 4I3GA 2YJTD 4TLMB 2VLIA 2I7XA 3S28A 5FWDA 1ZVJA 3A1WA 3CBGA 3SX0A 1H9AA 2PS9A 1P33A 1U2PA 3VV3A 1U0FA 4E4YA 1E89A 4UU7A 3SEZA 1DLJA 4C88A 4PANA 1OI4A 2G1PA 4QUHA 4UM9D 2ZTVA 3FIJA 3GRRA 4KNYA 4KO8A 5B53A 4NCHA 2ZRAA 4F12A 1KI8A 3ZHQA 2YVAA 1QRSA 5LC1A 4C6SA 1LSJA 2CFCA 3L4SO 4C78A 5B7PA 2PUFA 1VP9A 1GILA 2ZRJA 3FZEA 1QRUA 1NBOA 2P9JA 2SKEA 5LYJB 2REBA 4NS4A 4R69A 5KSPA 3DJFA 4H0FA 5FLKA 2G71A 1WBBA 1OF1A 2BL4A 1QFJA 2C7VA 2V9CA 2ZSIA 4JODA 4LXTA 2VZ8A 4UDNA 3CRQA 2ZFUA 3OT5A 5EXTA 4GPBA 3NASA 5H4GA 1FUEA 2OMKA 4OBWA 2I5PO 3RWBA 5EJ4A 4LPKA 4GZ6A 1QGAA 3WGOA 4GYWA 2FK7A 5ENZA 3CCFA 4BFSA 4UXJA 5FBVB 1J42A 3KVRA 4OB8A 1Y1PA 4AX8A 1VJRA 1TF7A 1GTJ1 1N2SA 4AF7A 2DBRA 3LMKA 3IUBA 4JR1A 1C0PA 3ABZA 3FB1A 2XDWA 2XRMA 3FNGA 4RQBA 4X6UA 5ELMA 2QTGA 1BMDA 1NW5A 2BGRA 3C41J 2BGIA 1AKVA 1TO1E 4I1IA 4XA8A 3HNOA 5C4MA 2Q8NA 1T0BA 1VKNA 2TS1A 4PXSA 5J2UB 2HR1A 2YQZA 1G5HA 1NLMA 4CXMA 2F59A 2AJBA 3IDAA 1WY5A 3ZWXA 3IDOA 3NHLA 3IUJA 4HAVA 5HKLA 4L02A 2D4AA 4UM9B 5JASA 1BDIA 1HX7A 3KCQA 2FN8A 2MHCA 3H2IA 3VTAA 2PKYX 3FRHA 1ICEA 4WFIA 1LLQA 4YN3A 3X0DA 4BVGA 4XWOA 2VIIA 4KR6A 4HUQB 5TIIA 1OH5A 2FFRA 5FRDA 3WB1A 3WFIA 2TRSB 4CG2A 1H2HA 2WUFA 4HMQA 4OQXA 3R5SA 1WDWB 5L40A 3JYNA 2AMJA 4L72A 4G07A 1DFIA 2FW8A 4RVHA 4PG8A 1A1SA 4M22A 3RRFA 3P1JA 3PFWO 4G89A 5CT4A 4BV8A 3GEDA 3TD9A 1XZAA 2Q3EA 2SHKA 3RQSA 3WK8A 1J2EA 3UGKA 1EFDN 4YFYA 3DOFA 1ZOLA 3TLAA 2I65A 4Q9IA 2D1QA 1YI1A 3BB4A 4B9EA 4ZVTA 2YMMA 1T10A 1WABA 3ISVA 3VJRA 4RX1A 1E1YA 3NEAA 4H08A 3MAGA 2WD9A 1B74A 1G5QA 4EFDA 3FJYA 2QRZA 2BTQA 2XUFA 4RK1A 3TLKA 2FPRA 2QTLA 3LW8A 4HLNA 4XVRA 1P31A 3MUEA 1P5ZB 5JRZA 2VAWA 4J1NA 4HG2A 2H2IA 3RQIA 4K05A 2DPGA 1F51E 3AWIA 3FNQA 4KQHA 5A9SA 2O2CA 1SCAA 4JUDX 2K87A 4O63O 1HNXB 1DAPA 3T35A 4D7AA 1AMUA 2PL9A 5BOSA 3K2EA 3HV0A 4RPKA 1B8OA 4HYEA 3PQ4A 2L0XA 5K7SA 1JFLA 3DFMA 1T8SA 4JX9A 1AV6A 1NC1A 3C6YA 2GZ1A 3KELA 1PU2A 4GU5A 3BH6A 1ORIA 3T61A 4UHEA 1JBKA 4A91A 2AXNA 4D96A 2G5PA 1DBPA 1L3CA 4QLOA 3H7AA 2YIVX 2PYIA 4TKMA 4A6DA 3I05A 1YR8A 1GXSA 4UTPA 1UDBA 4EO9A 4PX3A 3OPQA 2Q9BA 5JZBA 3F46A 4MHOA 4UOQA 3GWZA 2FHPA 1HETA 4I5EA 1JG4A 5H1YA 4E88A 5CG1A 3L7KA 3AVVA 3HDTA 3TM5A 1QDUA 3Q8LA 1AZSC 2VTBB 3D0KA 1XELA 2OUKA 3TAXA 3X1KA 5ALVA 4OTZA 2GKOA 3LHKA 4YUYA 1RSZA 4RTQA 5EIHA 1Z35A 1BCRA 1M0TA 4U9IS 3ABRB 3AM1A 2D5LA 1YR9A 3G5UA 5G0VA 2RD2A 1LA2A 1KDYA 4MDEA 4H9GA 3HXTA 4MYTA 2AXQA 1QCZA 1SUPA 5ELXA 1Z0SA 3K0CA 3CIFA 4CEJB 2VDPB 1KJWA 1SEVA 3FCAA 2FQYA 3COYA 1YBHA 3HDJA 4UVGA 3VR6A 4ZKDA 4G0ZA 1I7SB 2OHOA 3DNPA 4ICIA 4N3NA 3VZSA 3PUVA 3ZWOA 2DX7A 3QELB 5E6RA 3TNJA 2PXAA 4IJUA 1K3FA 4Q1FA 1RS0A 2O3TA 5EUMA 2IW1A 1USIA 2IEDA 3EA0A 2XGMA 3HJAA 4GX0A 4YCAA 4BDSA 5CB0A 3P9KA 1NLFA 5DISB 2GPYA 3T4UA 1Q92A 4ZGGA 5MN5A 4R7ZA 4LS3A 4X62B 2GCOA 2B1IA 3G2NA 3FF1A 3LWDA 3MQ4A 5E0OA 5FDFA 3H2BA 2EIXA 3NV9A 4RMIA 3RU9A 1GAJA 2DRIA 1IY9A 1EG7A 1LQTA 1Z4QA 2NXNA 4FPXA 2VTVA 4P2BA 5LJIA 2AZXA 3QWFA 4GUDA 1NC3A 5I9LA 1L4MA 1I7DA 3WRXA 1OY1A 4D5GA 5BSVA 3G5LA 3M6VA 1HEIA 1M2FA 1O96A 1V8OA 4FKMA 4JBYA 3A28A 4BFTA 1RPZA 2UUCB 2R9VA 3S55A 4RBNA 1ZFNA 2NSYA 1QM5A 3HFRA 3PEYA 2BONA 3FGPA 1W1IA 3L9XA 4BNJA 3STYA 1QTIA 3I8OA 4CL8A 1E0KA 1SBNE 3HUFA 3PFNA 2HWUA 3G1UA 1I2AA 4F06A 5B3JA 1BS9A 1TLFA 2EZ4A 4DLVA 5GTDA 4LOIA 4NJMA 3D7MA 4YT2A 2YJ5A 1Q2XA 1KFBB 2PZMA 1VSUA 3BMQB 2YN0A 4KQ1A 3CH5A 3GQBA 3U6KA 1RI1A 4ENUA 4CG3A 1N2GA 3IEPA 5ALPA 4ZCLA 4GZLA 4FB4A 3JZDA 1LVUA 3VVCA 3GT0A 4B7UA 3SHVA 1E2HA 1MNQA 3EMVA 4YRSA 4CIBA 1KIMA 3PKIA 3PXUA 1NN5A 4M8SA 5K3BA 3D6JA 3U7EB 1IHOA 1PL8A 2NMVA 3WQBA 4TYWA 4HI0E 1RLOA 5JHGB 1A4XA 1V5FA 3IUYA 4NY1A 1YQGA 2HAEA 4N0DA 3ZXSA 1Z37A 3U19A 5ITVA 5A03A 1E99A 3INYA 1N2EA 2PX8A 3T5GA 2BW0A 3N2IA 1PZGA 5I9MA 1RI5A 2RHRA 3V8QA 3I37X 1SQFA 4X9XA 4KP7A 3JARB 2W2QA 2ZANA 3L93A 5KWVA 4CR8A 3D6NB 1RYNA 4DCVA 3WVNA 5IFKA 3FLEA 4UVIA 1WBDA 3BQNB 5FI3A 1WTCA 2C0CA 2X9GA 3IKLA 4I50F 4IYRA 4MAMA 2CLHB 3HA2A 4NWIA 2D5IA 3NR2A 5THKA 3VC1A 3ADBA 1M2WA 2QYHA 5H9VA 1KKUA 1YGPA 3BWDD 4J1TA 5REQA 3SQWA 2OLKA 4LRSB 4NOJA 4E7PA 4JSTA 4JYMA 3L5OA 5EWLB 5JXGA 3E9ZA 4D4GA 1TQ4A 1WULS 4R81A 1G3RA 2QN6A 3GJSA 3GPDG 4D3SA 2CK3D 3CVUA 1NY5A 4D43A 5FWYB 4C0SA 2RHLA 2FZ5A 1GCUA 2H00A 4L51A 4GLOA 4M0KA 1M5TA 1ODTC 1ZU5A 5AM5A 3O8RA 4LMPA 1U3WA 1UIMA 3ECSA 5TRTA 4YYEA 4B74A 2B1RA 5L7TA 4HBZA 2PR7A 2A0KA 2HMAA 1U98A 2EV9A 2NUAA 3G59A 3IVRA 2ZRBA 3DKPA 4E32A 4TKLA 5JNTA 3N9IA 1TK9A 3EFOB 3UMVA 4O0MA 4DQKA 1EINA 1GTMA 2LPMA 3A04A 3KWFA 3R09A 1EPUA 5FR2A 2ZXUA 1UDXA 4JEIA 2EKBA 4WGFA 1LS6A 1PZNA 1Q19A 4DAOA 4N5IX 2G1JA 4BATA 4F04A 4A3SA 2JVIA 4H1TA 1YU9A 1EP2B 1VJCA 3D59A 1KYIA 2GB4A 1GD1O 2XGGA 3HB1A 3Q12A 4IJQA 4LSWA 4TTQA 5ARCA 3RWMB 3V4FA 1TM1E 3X2SA 4N0PA 1GKUB 3VR5D 1CRWG 1Y8RB 1INLA 5K0NA 3I9V1 5TVGA 2QYOA 2DR3A 3KQWA 2A4MA 2P30A 5AJUA 2RHJA 3AFGA 1GFSA 1W75A 4MB0A 2XWBF 1I1OA 2YV5A 4MWCA 4PZAA 2BZGA 4CLRB 4DMGA 1F8GA 2OZLB 5B2EA 2LTAA 4B3HA 2HXGA 1GAQA 2YCLA 3G8CA 3ZWAA 5ER6A 1U90A 2QN9A 3U4QA 1V37A 2A3RA 3QVSA 2QN8A 3V7NA 2D4HA 2R84A 1ZJJA 2FKAA 4PG6A 4ZRMA 1JU4A 3BRCA 3OEYA 3JWIA 1AKMA 2Z1NA 2AOXA 4BYGA 5ICEA 1S2MA 5LMUB 4K2HA 2C7QA 4YASA 1YZVA 5CVEA 2YNMA 1DINA 3FH0A 1N0WA 2VT7A 1II9A 4FVTA 1EZ1A 2RH8A 3HKCA 1EESA 4DQUA 2Y1LA 3DO5A 4HLUA 1JTFA 1F4PA 4XGIA 4ENTA 3TPFA 5EJ2A 3JRXA 1N4DA 4FFOA 2GKSA 4UHBA 3ICOA 2IKSA 2QIPA 3AKEA 3BSWA 2VF5X 5DLPA 5HUQA 2X19A 3AYZB 3FUVA 3A4YA 4X1KA 4EY4A 5DK6A 1K7SN 1QF6A 3TGWA 4WOJA 5HK9A 2IPMA 5JZSA 1UJ5A 5ABPA 4PQGA 4W99A 4QYIB 1WPQA 4Q5IA 2WYWA 3AGPA 3DHWC 3LC1O 4MJ3A 3LM8A 2VDJA 3KXLA 1XVUA 1OX6A 1LLUA 4LSZA 1C7QA 4NBUA 3SSNA 1ZCAA 4L2IB 5HTOA 2JF0A 2A9OA 1XC7A 4BQNA 2CK3A 1Q7BA 2NNWB 4W1RA 3MWFA 3JVDA 2IYSA 1I3MA 2OAQ1 2NO6A 3DZ8A 2UVPB 5C81A 2PPVA 4RSRA 2QE7D 2ZT8A 1H4TA 2PFGA 2CSUA 3TTUA 2ZWVA 4D97A 1YQ9A 1YT5A 1TEVA 5ADHA 1XYYA 1EAMA 3L02A 4KV9A 2P4QA 3KKKA 4QULA 3QK7A 4H27A 3GEGA 5IH3A 2PTHA 1K4YA 2B0JA 1XDSA 1SBYA 2ONZA 3A37A 3E2IA 4C89A 4ZCTA 1Q1BA 1QX4A 1O97D 1NFRA 1MRZA 3MT9A 4X94A 3UPUA 3A1TA 3B2EA 3TOSA 2Q21A 3ZVNA 1EXDA 4BN0A 1JWLA 2JIQA 1DTWB 1WUTA 4W63A 1G59A 3A3KA 4HXEB 4NEHB 4PE5B 4TN5A 3V80A 3C7KA 1U0LA 2WWGA 3CNBA 3RIGA 5LR6A 4XB6B 4KL8S 3G0BA 1A5AB 5AXDA 3GRVA 3F3SA 1OLUB 4A0SA 1IG3A 1FDTA 2X2PA 3PDHA 5FO0A 3ZGNA 2OOSA 4HZUB 3MCUA 3BE5A 1HYQA 1KI6B 5B1HA 3ZU4A 2CMFA 2ZYSA 4AMVA 5EFZA 3BL5A 3QXJA 3R24A 2YX1A 4KKVA 1F8FA 1UP4A 4UHFA 4CM9A 3ETDA 4FYIA 4YY3B 1LNSA 1H6BA 4B7XA 3E05A 4GR4A 3ZLBA 3AUXA 2VYNA 3QVGB 3Q2KA 1AY0A 3L6EA 3QLVC 4P4LA 3PXBA 4DNPA 3VTFA 2R4QA 3DEJA 3HJRA 5JJIA 1NNEA 3VNBA 1OU0A 3GR6A 4XCXA 4NCNA 3H5LA 3G0HA 3OF2A 4ZOQI 4ZAVA 5ITZB 4TSFD 1JBEA 2XMPA 3B6KA 2AGVA 3OIGA 1G20E 4PAMA 1UFKA 2VT2A 2PUVA 3W3ZB 4HDRA 2ATVA 1W5BA 2I4RA 2I1WA 3EVGA 3ZY5A 3OQ6A 3PEFA 3VR6H 2J5KA 4Q4JB 1OAAA 5EEGA 2JDID 2W48A 2XXJA 1U0JA 1L5NA 2C7OA 2JCBA 3QFFA 2J0QA 3SJUA 4UU8A 1AGRA 1PJTA 3AI3A 1T4GA 1PR0A 4DBLC 2HBQA 4ENRA 2C61A 2Z4TA 1ZC3A 1LRLA 1P6UA 4UFPA 2NU7B 3U4CA 3TLMA 1ZINA 2NN3C 3CISA 3PDUA 4X65B 1ISMA 2NU9B 4ATNA 4RGBA 5LP6A 1OROA 4MCJA 2X0FA 1SD1A 2F64A 3AI7A 3CSSA 2ZWPA 3CS3A 3P0IA 1H22A 2QNRA 4J1QA 4C14A 1U3UA 3ZD6A 2EZ9A 3SX4A 2DERA 2J5QA 4ZCPA 3BN3A 4F11A 5FNZA 3OQHA 3MWDA 1D2RA 1PZHA 2GAOA 1H2RS 1I0LA 3IC5A 3KOOA 3W4IA 5FI5A 1CJMA 1HRKA 2FQQA 3OZDA 1JHUA 2HHLA 3VBCA 3NYQA 2QW1A 2I2AA 1XVAA 3M2PA 4AMBA 5EQTA 2FZCA 1BMQA 2DR2A 4HRVA 2NX2A 1DDIA 4H18A 1N0VC 5A7HA 1M2VA 3IO5A 4YRLA 1XI2A 4JT2A 1IVNA 1HQCA 2JI7A 2P1DA 4QU8A 5COBA 5AJYA 3REQA 5KSOA 5GINE 1U1CA 2DM6A 2GHTA 1NXPA 1ZGJA 1BQ4A 1Y48E 2HMSA 1U5BB 4V0LA 1J0BA 3GH3A 1ZAKA 3SC3A 4YONB 5IMBA 2C7GA 3DLBA 1MJHA 4RCYA 1PV1A 2GAIA 3B1VA 1LV8A 4YT5A 4WKNA 2J09A 2AOVA 2Z5LA 3CLTC 1A8QA 1SUEA 3EUAA 5EMLA 1UJBA 2VDNB 1QH1B 2FZ4A 1VLQA 4C0WA 3LV8A 5IJWA 2CNWA 3G2IA 2HQ1A 1H66A 4CHGA 4ZJZA 1U6KA 3QJYA 1ZK4A 1GPDG 1TVKB 3IQGX 4QAJA 2EKPA 4GOOD 4G1BA 1EXVA 1MOZA 4FGKA 5T41A 5BWLA 2P9CA 3RJMA 5AO9A 1CS0A 3JSXA 1IZ0A 2I3BA 4N7JA 4RH0A 5JNSA 3K1YA 1P19A 3WFZA 5CB4A 2JFOA 3NQ41 4B76A 4V0NA 2FP4B 4ZK2A 2A0YA 1WW2A 3RC8A 1NUAA 1CFZA 5KWEA 2UZ1A