1U4OA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedicarboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
309
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 112
structure length 309
sequence length 318
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4oA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4oA02
4HX5A 2Q1WA 2FHSA 3CE6A 3N58A 1QYWA 1NR1A 1P77A 5EERA 2VHYA 3FWNA 1ZSYA 1ISHA 2FY8A 5T6BA 1C1DA 1I3MA 1JQBA 4GVXA 1H6DA 3GRKA 1U28A 5C37A 3GPDG 1MUUA 4DMLA 3RUDA 2HMUA 3LF2A 1CQIA 1QYXA 1DIRA 2BFPA 4FDAA 4PRKA 3PWSA 3RJ5A 5FF9A 5T5QA 4YAJA 3PHHA 4E4YA 1XKQA 2Y05A 4N54A 1GZ6A 5KKCA 3DXFA 1PQWA 1Y6JA 4I08A 1JKJA 5ER9A 1AUPA 4YAEA 2HSDA 3L6OO 1E7RA 1ONOA 3WGOA 4R16A 4XYBA 2VRBA 1DPGA 1Y8QB 3WJAA 4LCEA 2B4TO 5DZSA 3TZQA 1ZXLA 1AHHA 1YE3A 2HK7A 3GEMA 3IP3A 4YT2A 4D3DA 1NAHA 4RL6A 2P5UA 3TDKA 3WOHA 4K1LA 4L4RA 1Y8QA 5JMPA 1DHRA 1N2SA 3BXXA 1E7QA 4DPLA 1E6UA 4TVBA 2VNAA 4D79A 2P68A 3ZWXA 2IYPA 3S1LA 5JAMA 1U2GA 3OECA 4P4GA 4KDFA 1U9JA 3GEGA 4RZIA 1VSVA 2EW8A 5JE8A 2HMWA 2NVWA 2C7VA 3GDOA 1K89A 1NQTA 1GEEA 3ANMA 3R3SA 3UUWA 3T7EA 4R5HA 2D5CA 1FDUA 3M1AA 4QECA 4C7JA 2NVBA 5I7FA 1H6CA 1LSJA 2AG8A 4EJ0A 5COQA 4ZA2A 2QW8A 1X7GA 1VJ0A 2Y1OA 3EZLA 5CP8A 3HFSA 3K96A 1EE2A 3SLGA 4OMUA 2J5QA 3MJVA 3H9JA 3ORFA 3BYZA 3GGOA 3IIEA 1GFSA 5A9TA 1HSOA 1WWKA 2VCYA 4U6QA 4CM8A 3L4BA 4CLOB 1MX3A 4HWKA 3M2TA 3JQ7A 5BNFA 3CEAA 1Y9EA 1IOLA 1P44A 1PJ3A 4PLVA 3ZNQA 5TT1A 4DQVA 1ADBA 4YJDA 3HNPA 3P2OA 2DTXA 3H9GA 1X1EA 1KS9A 1E3SA 3AI2A 4QT0A 3U62A 4RF4A 1VJ1A 2YJZA 2VYVA 5JY6A 1I36A 1T4DA 5CPFA 5HBRA 3UCFA 4A73A 3KUXA 3IUPA 1OZAA 2TMDA 3LLSA 5TJHA 1Y5RA 3WGQA 1LTHR 4CLDA 3VKUA 3OM9A 3I6IA 2A35A 1PJCA 3P2YA 2R00A 2BELA 2RCYA 3U4DA 4BO4A 3WB9A 4CMAA 3DOOA 3MTJA 1WAMA 1U4SA 2WSBA 1P0FA 2OORA 1CEQA 1L7DA 3AOEA 3KSUA 4U0KA 1Y9AA 3JQ8B 4YXFA 2C20A 4ALMA 3AUUA 3Q6IA 4R1UA 2LDBA 5B4UA 4GMFA 3O8QB 1I01A 1C0KA 1D4FA 1JVSA 1M67A 3AUSA 5JAIA 1WZEA 1DIBA 3CUKA 4BNJA 1RYEA 2FWMX 3JQ8A 4AJNA 1G6KA 7ADHA 4WCFB 1GU7A 3ZWWA 3RCBA 3UF0A 5JC1A 3C8MA 4OQYA 1HWYA 4E5PA 2VYNA 5FWNA 1Y1PA 3O8QA 4E31A 4RPJA 4RCVA 1VC2A 4XCVA 2ZYDA 3AI3A 4CPDA 3WICA 3IC5A 2HRBA 1E1LA 2AG5A 1O5IA 2V65A 1AE1A 4WCFA 4X54A 4WUVA 3ADOA 1QV6A 2D59A 3GN1A 3JQBC 4MVJF 4Q3BA 4AJ2A 1GADO 4Q39A 4ESOA 1V3TA 1ID1A 1YXMA 3STHA 1WMAA 3WYEA 4LRSB 3W8DA 1UZNA 1E1NA 5L95A 3FF4A 3P5SA 4J1NA 4E13A 1E92A 4BB6A 3RI3A 3ZHZA 3H3FA 4TQGA 1GD1O 1YL7A 1GUFA 1T2FA 1W8DA 2AEFA 3K8ZA 4J2HA 2WWRA 3MOIA 4C4OA 3L4SO 4YEDA 4DQXA 2VHWA 1U1IA 4Z0PA 3ZNOA 3WMWA 3VPGA 3D4OA 1E77A 4AJLA 4AJJA 2UYYA 1LBEA 1N7GA 4CQLA 4E2ZA 2W2LA 3B20A 2H1SA 2RAFA 4TRMA 3ONFA 3TN7A 4OQZA 4ZJUA 2OMEA 4J9UE 3G3EA 5I7VA 2ZCUA 2GZ3A 5C7IO 3WGGA 4FJ2A 3NUGA 3OEWA 1H9BA 3CIFA 2FP4A 1HDYA 3VPHA 2I67A 2ZTMA 3ZU2A 4HFJA 1R0KA 1XCBA 4YDRA 3V2UA 2P9CA 2PH3A 3DEYX 1DEHA 1P33A 4CMHA 2CVOA 2OOSA 3BMNB 4XB1A 1DFGA 2B37A 3DL2A 3BAZA 2F1KA 3GAFA 3SBOA 4FC6A 2I6TA 3U5TA 4U8GA 4F45A 3CXRA 1GZ4A 2A94A 4HUJA 1UXGA 3WWZA 3H9UA 4HP8A 5T57A 2VZ8A 5JDIA 4Z6KA 3L9XA 5COBA 3PZRA 4UEOA 3KLMX 2O2SA 3U0BA 2Y0DA 3GAZA 2NTNA 1ZO8A 4HFRA 3UVEA 3Q2KA 2C54A 2J3HA 5ILOA 2CUKA 2VZ9A 4YYZA 1PWXA 1IZ9A 3S2EA 1ZH8A 4LVUA 3F3SA 1WPQA 4TZTA 3WYCA 4BNMA 1ZEJA 3ZV6A 4LMPA 1Q7GA 4RPHA 4E5MA 1VSUA 4GWKA 4EEXA 1RM5A 2GN4A 2J6IA 2TMGA 1EEHA 1YS4A 3EC7A 4UVIA 4CM5A 4P22A 2RHRA 1KVQA 3PWKA 5KWEA 3MJEA 3FD8A 4BGVA 2DQ4A 4E0BA 2X7HA 1TXGA 4PVCA 5G0WA 5JY1A 3T4EA 1XU7A 5TQVA 3JQGB 4UREA 3ZW9A 1HKUA 1B3BA 3JSAA 3VZQA 2X9NA 4XQEA 3ZV5A 4B4OA 4CV2A 4JBGA 4OH1A 3GNSA 1H5QA 4BV9A 4R3WA 1HETA 4GVLA 4CJXA 1BHSA 4IGFA 2NWQA 2OBYA 4KUHA 3NDJA 4Q3DA 3VZRA 3DFZA 4OIMA 3G1UA 3E5RA 2JCVA 3MJ4A 5IN5A 3EVNA 3JV7A 3RUCA 2C5EA 1CF2O 5ENDA 3LU1A 1DAOA 2EIHA 3AY6A 1AHIA 1E3EA 1NR7A 3DWFA 2DAPA 4ZICA 1X14A 4YT8A 1QYVA 1CYDA 1NFRA 2YDXA 4I5EA 4CMJA 3F46A 5ICSA 3JD3A 3QW2A 4RPLA 1GZ3A 2GRAA 4PFJA 5EJ2A 3OJFA 4L74A 1A7KA 3Q9NA 2NADA 4RVDA 2O48X 1UDCA 1LQUA 2Q49A 4DQUA 4OOFA 3JD2A 3FN4A 3TRIA 4RDIA 1YDEA 3DAFA 1KC3A 3BTVA 5IDQA 3W8FA 2VQ3A 3QLJA 2VUSA 1I32A 4BO9A 5CDYA 3L0DA 2DBVO 3K6JA 1ENYA 2DFDA 2VRCA 3RU9A 2YHIB 3KVOA 1C0IA 1I2BA 1Q0LA 1ZXBA 4WLNA 4EITA 3S8MA 3ICCA 3I9NA 4TSKA 4XR9A 2ZB7A 3HJAA 5L9AA 1JLLA 3C3XA 3PQFA 3RFVA 4MJLA 3Q11A 2QX7A 1V0JA 1W4ZA 2I99A 3SXPA 1I2ZA 3WTCA 3DHNA 4YJHA 2PKRA 5C7LO 4TWRA 4BNZA 2JFGA 2X58A 2X9GA 2FZWA 4PZDA 3QY9A 5DNAA 5KVSA 2PKQO 4JXKA 3L9WA 4JROA 1NVMB 3ZI0A 2QYTA 4XIJA 2B5VA 1Q2XA 4HNGA 1MFZA 3W8EA 1NM5A 1QV7A 2B4QA 5JAZA 5IG2A 5L4LA 5F3RA 3GZ4A 3RFTA 1SCUA 1KETA 5A1TA 4BKPA 2BFMA 3KHUA 5AVOA 1DHTA 4N5LA 1P1HA 3QQPA 2ZIZA 4Z0HO 1B7GO 4JGBA 3I9JA 4BO7A 2BGMA 3S55A 4IJVA 4UUPA 2QIOA 3S2FA 1DSSG 1DC6A 3RFXA 3GZNB 4XDZA 1LLCA 4E32A 2NSDA 3EDMA 2VWQA 1LDMA 1KIFA 5A5FA 3L6DA 1HE2A 4MKXA 5IN4A 1C14A 1NP3A 1MB4A 5G0TA 1ZFNA 4PLWA 4YJFA 4DWVA 2P2SA 4RORA 2JHFA 2QHXA 1NPDA 3ZW8A 1S7CA 4MKRA 1BGVA 1BVUA 1HZZA 3EZYA 3TOZA 5BR7A 4UEJA 3LYLA 4D44A 3R6DA 4TKMA 1TB4A 1YJQA 2BH9A 3FBGA 4MVJH 1K0UA 1NX6A 1ZJZA 1BWSA 3HDYA 3E9MA 2IYOA 5KVCA 2PFGA 1PR9A 1O94A 4NBVA 2FPIA 4DPKA 1Q0HA 1VE9A 4U6SA 5AXDA 4M55A 1GY8A 3PJFA 4D45A 3NDIA 4B3IA 1R6DA 5JLAA 4KOAA 1ZIDA 4J90A 3OQ6A 5AXAA 4YCAA 3QWAA 3FPLA 3GN2A 5DT9A 5H81A 4E5KA 4AJKA 2AQHA 5FYDA 4CM4B 4EW6A 5I9LA 1CWUA 2A92A 3E1KA 2VYND 3GC6A 3E5MA 3VPSA 3CZRA 4ND1A 4JJIA 1A72A 5EIOA 3GG2A 3ZGYA 3WFJA 5TS3A 3R1IA 5CEJA 4EGFA 1HSZA 1Y8RA 1T25A 3LC7O 3A1NA 5L3ZA 4WECA 5IDXA 1TI7A 2FMUA 4HXYA 4RF2A 3DAPA 3JQ9A 4LVCA 3BHMA 1BMDA 2ZKLA 3UICA 1YB4A 1VL0A 4G2NA 8ADHA 4B8ZA 4FFRA 3AM3A 4NFYA 4PLFA 5CDTA 2POQX 4BNIA 3D3EA 4GH5A 1WLYA 3WMXA 5COAA 4BNTA 4IQ8A 4PVDA 3OH8A 4QFDA 5TX7A 1GTMA 1UJMA 5IAAA 5F1OA 1ZMTA 2V6MA 3B1FA 2ZCVA 4CLHA 1YO6A 1IHXA 4CUKA 2W2LD 2C59A 5IZCC 1MG5A 1K2WA 4IDFA 4DIBA 3JYNA 1JKFA 5L7YA 3NTQA 2BHLA 4YVFA 1XQ6A 2UUOA 1SBYA 3HQ4O 1VI2A 2JHGA 4DC1A 3VH1A 2QG4A 4AJHA 4F46A 3QWIA 4TRRA 1RM0A 1I3LA 1P31A 4XZ3A 1LDBA 4XQCA 5ER6A 1U4OA 1F8FA 4JP2A 4F3YA 1WMBA 2X0JA 3ZWMA 4PG6A 4S1VA 4UULA 5CEFA 2P4HX 1QRRA 3BMCA 3QIVA 4WLVA 3VDQA 4PZEA 3K9QO 1S6YA 4CR6A 1U3WA 5L40A 2O7QA 3RU7A 3K30A 1Y81A 1N7HA 3ZV4A 3TNLA 1E3WB 3GH3A 4K28A 2IEDA 3H5AA 1LSOA 4GQAA 4NK5A 4J1QA 3ZHYA 2DUUA 3ZWVA 4J6FA 3TL3A 5A05A 5KIAA 4NFHA 3GRPA 1M75A 1LU9A 1BXGB 1U8XX 3D1LA 3IP1A 4HFNA 5ADHA 5TLSA 4BMNA 4OSOA 1HYEA 2CD9A 3ASVA 4JCOA 2RIRA 2FPGA 2VNSA 3AWDA 5CEEA 2VT3A 3RBXA 2Q3EA 1Z7BA 3QWBA 4IJKA 1A5ZA 4D41A 3F5SA 3HB4X 2B5WA 2Q1SA 1LNQA 1BXGA 1E1MA 4BIIA 3U4IA 4YJGA 1GYRA 2AE2A 2Y68A 3ZWBA 2Q2WA 3TFQA 3WIEA 3C24A 1UP4A 1BVRA 3FTNA 4LCJA 4M54A 4DVJA 2O7SA 2YFQA 2ZYAA 4W6ZA 4WASA 1IPEA 4IQ0A 1DO8A 1FDWA 3W4JA 1E7MA 3NAQA 3IKVA 2P4QA 4XKJA 1HDCA 2D5AA 3V2GA 1ONPA 2RBEA 3WSWA 3EK2A 3SJ7A 1I0ZA 5JMWA 3JYLA 3TJRA 2GSDA 3OJ0A 1NVGA 3E9NA 3RUIA 1ZEMA 1XHLA 5T8KA 3TZCA 5U9CA 1IULA 4NU5A 1BDMA 3ICPA 4JBIA 4CODB 4IDDA 3ABIA 5JDCA 1B8PA 1R4NA 3HWRA 3DTYA 4GBJA 1KVSA 1HF3A 3VH3A 4MP3A 4XJTA 1T1RA 2AQ8A 2BFAA 1Z74A 3D64A 1ZCJA 3PGJA 4IXWA 3HN7A 3ON5A 4LN1A 4Y98A 1Y5MA 3HDQA 3RBZA 2EJWA 4WLOA 4IDGA 5IXYA 3I6QA 1C1XB 4RVFA 5DCYA 3RROA 4E21A 4J1TA 1MV8A 1PL7A 2Y1CA 3WGYA 2J3KA 2PD3A 1B14A 3QVXA 1HRDA 1LC3A 1NTOA 1ULSA 4B7CA 4U5QA 1ORRA 3INRA 4PIVA 2GLXA 4R1SA 4A5OA 1M6WA 3DONA 1C1DB 4IIUA 4Z3DA 1FDVA 3GDFA 5TNXA 1VL6A 4P4LA 1ZUD1 1E1KA 5KJFA 1T2CA 4BO8A 3BHJA 1QYCA 2D0IA 4QTZA 4FJ0A 1JU9A 1IZ0A 1Z6ZA 4GGOA 4WEOA 2YV2A 4HBGA 2WYWA 3QP9A 2VOJA 1PGPA 5K9ZA 4J7UA 3NKLA 3L77A 1P45A 4G81A 4XYLA 2Y1EA 1F0YA 3H6KA 4R68A 4ZQEA 2HAEA 4YACA 3OP4A 9LDBA 2YW9A 3M2PA 2CF6A 4IZIA 5IF3A 1V6AA 4DREA 1VKOA 3QSGA 4UVEA 3BZUA 3ITDA 3V1UA 3GPIA 3IAHA 3V5NA 2VTDA 3OIGA 1PS8A 1YB5A 2PZJA 3WLEA 2O3SA 3JQFC 1B15A 4OM8A 4RV9A 3GMDA 5EN4A 1OI7A 1WZIA 2YV1A 3NGXA 4FOOA 1VKNA 1CERA 4XYMA 4UUOA 2WJPA 3L4BC 2WM3A 3ZHXA 3D4NA 1UXKA 4PLHA 2WD7A 3K31A 2WD8A 2FRDA 4L4XA 1HXHA 4XYGA 4FIZA 1HDRA 4GI2A 3C1OA 4GPD1 4WLEA 5KJCA 3NEPX 3KSZO 3UH1A 1F14A 1PS0A 2ZK7A 1LUAA 1AN9A 2IZ1A 3AM4A 1NQ5A 3V8BA 2B0JA 3UW3A 4YB8A 3H2ZA 2B4RO 3C1AA 3JQAB 4JJGA 3OQ1A 3DZBA 3RC7A 1IYZA 4N5MA 3SC6A 4MO2A 3GVIA 5BSGA 4UVHA 2AE1A 1IY8A 2BI7A 1EK6A 1EBFA 4FC7A 3VVBA 4CM8B 3EY4A 4RPGA 1DOHA 3JQAA 1LRKA 3KTDA 4ILKA 5JS6A 2R00C 5EQFA 2VUTA 4CQMB 3JQ7B 4GX5A 5C5IA 1OC2A 4H16A 3SX2A 3AOEC 2QZZA 2XAAA 3S2IA 5CAEA 2C82A 1HDZA 2PTGA 2Q2VA 3JQFA 3QE3A 4J1SA 4J49A 4MVJI 2X9VA 3PHIA 3VPFA 3ZWAA 2J8ZA 4MDHA 4QXMA 2UAGA 1ZK3A 3QRWA 3CKYA 1HEUA 4CQMA 3FR7A 3U9LA 3ZU3A 3H2SA 5BQFA 3IMFA 4XWYA 1TT5A 5HA5A 2X6TA 3IDSA 2BF7A 3G0OA 2E4AA 3DZGA 1UR5A 4W4TA 3DZHA 1P3DA 3AJRA 4S3MA 1ISFA 4FBGA 3ZHBA 3WLFA 5DCWA 3KLPX 1SZJG 4XIYA 4L73A 3T7CA 1ZKMA 1A7AA 1SEPA 3RUAA 4EZBA 4RPKA 4WCFC 4BV8A 3ZWOA 1XYGA 4LW8A 1WNTA 3ENKA 4RF3A 3ZWPA 3LT4A 3TL2A 5MDHA 3AUAA 2DBQA 2GZ2A 4INAA 1UDBA 4MVJA 1K6JA 4IM7A 5B37A 1LA2A 2Y1GA 2Y67A 2ZB3A 5GZ6A 5DCUA 4D42A 1NXQA 1J6UA 1GV1A 3C7DB 3GY0A 3LLVA 3VDRA 3BTSA 1ONNA 1QMGA 4Y6PA 2PV7A 1X13A 3JD0A 1GUZA 3ULKA 3NRCA 2GCGA 4FFLA 4NFSA 1SB9A 5F1PA 3RD5A 3PEFA 4BNLA 1BRMA 1DC4A 4F6CA 2CFCA 4BHTA 2NACA 4FFMA 2YQ4A 2ZATA 1Q7CA 1Z45A 4EYEA 3OJEA 2XF8A 1U2DA 3WG9A 1N8KA 3ZU4A 3B6ZA 5GY7A 1I24A 4TZKA 5G4KA 2OHXA 4R1NA 2X22A 1K5HA 3F9IA 3K73O 3D3WA 4O63O 2RH8A 1RM3A 2JCXA 4DBZA 2PZMA 2V6FA 4RQTA 2YY7A 1B26A 4RZHA 2X1HA 5AYVA 3SJUA 3UFXA 2GD1O 5KKAA 2Q2QA 4O59O 4CV0A 4KQWA 4DIOA 1QYDA 3I9KA 5JDIC 1JA9A 4R51A 1DJNA 4OYRA 3U4CA 1EVIA 1P1KA 3DTTA 1KVTA 3P19A 4CQLB 2PR2A 1VRWA 1HDOA 1I2CA 3VC7A 1PJTA 2X5JO 2YQ5A 1K6XA 4W82A 2JAHA 1KEUA 2WEKA 2X5KO 1OMOA 4J4HA 4MP6A 4Q3EA 4K26A 3K2BA 4GAEA 1V8BA 4HADA 2GN6A 5KOIA 2P9EA 2Z5LA 4XA8A 1G0OA 5JYEA 2E48A 4Z9FA 1UAYA 2VWPA 3DR3A 2VOEA 5B1YA 3IS3A 1H94A 2NU8A 1KEVA 3AFMA 1NHWA 5KCZA 4M89A 2G82A 2LDXA 4P8RA 3G49A 1BSVA 3GT0A 4R9RA 3PPIA 4UEKA 1L7EA 4BMVA 2EHDA 2NVUB 1KBZA 2EGHA 2GO1A 1N92A 2PZLA 2JD1A 1E3IA 2ZTLA 4KDEA 4LGVA 1KVRA 4AVYA 1I8TA 2XXBA 3FNHA 3M6IA 4J3FA 3UAGA 4J4TA 2VUUA 2X23A 2Y66A 1PTJA 2WTBA 3BMQA 3BHIA 5I7SA 4WLUA 5L4NA 2NVUA 3ZWNA 4CM9D 3KETA 2EP7A 3DZKA 4IDBA 1CRWG 1PGJA 4ND5A 1QLHA 3E9QA 2YYYA 1TLTA 2IRWA 4XDYA 4B3JA 4JBHA 4YRDA 3OJOA 4GX1A 4U7WA 1ZVMA 4QO7A 1E5LA 3I4FA 1WVGA 2UVDA 1NFFA 3H5RA 2VWGA 3EYWA 3H8VA 3HHPA 3KRTA 4JP3A 4AL4A 1QSGA 4RJTA 1XGKA 3C7AA 3QVTA 3WIDA 6LDHA 5DP2A 3GFBA 3INTA 4IS3A 2YFHA 3CZMA 1X0XA 4RVUA 3AW9A 3CTMA 3PYLA 4YWJA 1X1TA 4UAGA 4DLBA 3W6ZA 1YGYA 4ALJA 1EFLA 1EVJA 4Z9YA 4NIMA 4XX0A 3KBOA 4JNKA 1KY5A 1MLDA 4B79A 3PXXA 4QQRA 4RO0A 3C1TA 3SC4A 2Y1DA 4W9NA 4CV3A 4CMBA 3FI9A 2OUIA 4K9DA 4QO8A 4WNIA 5A4DA 1UH5A 4EJMA 4DYDA 3EHEA 1YH3A 5JO9A 3WS7A 2I65A 4IJUA 1PGQA 1KC1A 3DMTA 4PG4A 4BO2A 4Q3AA 3RVDA 1OOEA 5JYDA 3QV1A 1EE9A 1U7TA 4RLHA 5L51A 4PLCA 1DC3A 2B69A 1G0NA 4ITUA 3KM0A 4J2OA 3ST7A 3QVOA 1PZEA 5DBFA 5FI3A 4PLYA 3ZZNA 3DZJA 1MFPA 1E3LA 4C7KA 1B8UA 4WLFA 1N1GA 5G0SA 2Q4BA 1J4AA 3NGLA 1IUKA 3DBVO 3HUDA 4IPTA 3LT0A 3FPCA 4FQ8A 5EINA 4AJIA 3TZHA 4B4WA 1I33A 1CQJA 4BKUA 3O38A 1ARZA 5AOVA 3PYMA 1KERA 5H82A 2ZQYA 4A03A 1KVUA 4EUFA 1DBVO 4R54A 4FFNA 5TF4A 3MJCA 4NBTA 1QXSA 2R6JA 4E5YA 4YJHB 1XSEA 2JAPA 4CM6A 1A9YA 1YDWA 1KYQA 2Y99A 2YZ7A 2C2XA 3QWFA 2X0NA 3BTUA 3F6YA 1B16A 1JVBA 1JAXA 1R66A 4KQXA 4I9UA 1MXFA 1WXDA 4KWIA 1AGNA 6ADHA 3ETDA 5DDIP 3GGGA 1PWZA 2YV3A 2HCTA 3JQAD 5G2OA 5GMOA 2DT5A 3ZDFA 3A28A 3WFIA 4E12A 4O1MA 1U3TA 1BDBA 4PLPA 2P9GA 4R9SA 2WE8A 4B7UA 4URFA 3ETGA 3SVTA 1H9AA 3NT4A 4GX0A 2CNBA 3RUFA 1DLJA 2H9IA 3I9OA 5KJEA 3WQSB 4AJOA 3B1JA 2DM6A 4N5NA 2IEBA 3I23A 4M86A 4A27A 1T2AA 1F06A 4I1IA 2GNAA 4J7CA 4RF5A 4CQMD 3KB6A 5EESA 1PZFA 2Q46A 3ZH2A 4IDCA 3WGHA 1DRVA 2UDPA 3N7UA 4ZN6A 4FFOA 1WW8A 2FPPA 1JKIA 3FNFA 3PIDA 4YJFB 1DC5A 2AQIA 2E49A 2XPCA 3DHYA 4WK6A 4FCCA 4XQGA 4BO0A 5HWSA 1PL6A 3NTRA 5A06A 4FB5A 4EDFA 2VYVD 4WE3A 3W1VA 3IUSA 4YAGA 3ZWCA 4BOYA 1I30A 1B0AA 3VTFA 3JQEA 5MGBA 3MTGA 2HJRA 2G0TA 3OETA 2GUGA 4Q3CA 1PZGA 1GUYA 5I9NA 4OKNA 3JYOA 2EKQA 2WDZA 2HQ1A 3VKVA 5EMHA 3JQ9C 1QORA 4M1QA 3WBFA 1NWCA 3TF5A 2EW2A 3GK3A 3DB2A 1P1JA 2Z1MA 5ENVA 4ZQFA 5CPBA 5BT9A 4CM3A 2JFFA 3VAZA 3X2EA 3TZKA 2EEZA 5ICMA 2CF5A 4WCDA 4MIYA 1K3TA 4JX8A 4FS3A 1LRLA 1HL3A 4BNWA 4L8VA 5J23A 4EEZA 1LXCA 5U1PA 2W4QA 3HDJA 1SAYA 1L1FA 2JD0A 4WJZA 4XB2A 4ZHSA 1TA4A 1EVZA 1XU9A 2GERA 1R37A 4N18A 1O8CA 2HU2A 5THKA 1PU2A 1SOWA 4BO6A 5JXWA 5DN9A 3DBHB 1NWHA 3PVZA 2WYVA 4UVGA 1N1EA 1VPDA 2HUNA 1Y8RB 3GLQA 1HTBA 5IZ4A 1ZSVA 4PG5A 1GPDG 1H0KA 2VT2A 3F4BA 3UKOA 5JCJA 3CINA 3V1YA 4RDHA 3DBHA 3DHEA 3ZN2A 4E2XA 1EMDA 1MXHA 3JYPA 4ND4A 4IXTA 1GPJA 2PY6A 2NU6A 3R3JA 4DLAA 2EGGA 2QZ9A 4MIEA 5CDUA 1B2LA 4IGEA 3OMLA 8LDHA 2X8LA 4HFMA 3N74A 4BNXA 2DKNA 1EBUA 2GF2A 5CFZA 1C0PA 1DJQA 4BB5A 3NX4A 1UZLA 5A3VA 3I9MA 2GN9A 2HJSA 4NK4A 3KSDO 3ADPA 2DUWA 2AHRA 4HY3A 4XGKA 4N7RA 3FHLA 3RC1A 5CDSA 1R0LA 1J49A 2CY0A 1R15A 1IPFA 4H7PA 5EQDA 5FEUA 2GPTA 4ZQGA 3BMCB 2C07A 1H93A 1DFHA 1TEHA 5HM8A 1CJCA 1RM4A 2GASA 1B8VA 2ET6A 1NNUA 1O6ZA 3DZIA 2BKAA 4E5NA 4NNJA 2X4GA 2C29D 5ILGA 4PN3A 1K6IA 2OFPA 1YWGO 3PDJA 4FR5A 3MOGA 5H83A 1IL0A 3EW7A 2D2IA 3LC2O 4FJ1A 4QFCA 5L4SA 3RJ9A 4M8SA 2HKIA 4FPXA 1DIAA 5T8KC 4FW8A 3GGPA 5TGDA 1EVYA 5HRUA 2O50A 3E8XA 3RASA 3UCEA 3LDHA 5JDCC 3DMYA 2IZ0A 4NBUA 4YJGB 3MJSA 1A4UA 2VHZA 5DOVA 1SOVA 5TT0A 4BQPA 2IXBA 2ZJ1A 4EUEA 2OZPA 3WYBA 1VL8A 4CM7A 5L45A 3JQ6A 4WOKA 3UHAA 2B36A 2DBRA 3QWHA 3ROKA 1ENOA 2O3JA 4A10A 4GKBA 4LMRA 4J4BA 1YBMA 4AJPA 4BUCA 4J16A 3DZFA 1LI4A 4I5FA 3QJ5A 1M66A 4ZQBA 4IZHA 2EP5A 3Q1LA 3TSCA 1YOVA 3GDGA 2O3TA 2PA3A 3GQVA 4MVJP 3EVTA 3GVXA 4KMSA 1R4NB 2QYSA 4OXNA 2FZEA 2JFHA 1PIWA 5A04A 4OOEA 3A14A 4LSMA 2D4AA 3KEQA 5BSFA 3VHRA 4IJWA 2AEMA 4H15A 3KXDA 4B7XA 5DBIA 4IIVA 4RVSA 3FBTA 3TOXA 4YR9A 3PYXA 4OAQA 3VZSA 3U3XA 3A9WA 3F4LA 3I3OA 1PJ2A 4R41A 5A02A 4IMPA 4DMMA 4OL9A 3WSVA 3TPCA 4CLRB 1PEDA 2V7PA 2YUTA 3OA0A 1A4IA 1GYQA 5KJ1A 4UUMA 1PL8A 4PG8A 1KEWA 5JBIA 3VZPA 4XYEA 1UP7A 3WR5A 4CMEA 2HMTA 2EJVA 3NDRA 2C5AA 2OP1A 2V6BA 2V6GA 3O4RA 1DXYA 3DBLA 1UXIA 4Y9DA 4CLRA 3CH6A 4NJMA 3H65A 2VRCD 2JJYA 1XLTA 2Q1UA 4M87A 1FK8A 3EUWA 4FSHA 3KOUA 4R3NA 1UUFA 1C3VA 3CSDA 3QA9A 4E30A 1SB8A 4II2A 4MP8A 1C0LA 3F5QA 4R1TA 2W90A 4I5DA 4FD3A 5B12A 2FR0A 4YT5A 1TVEA 3ZWYA 1ULUA 5G0UA 2X0RA 4BGIA 3PLNA 1PS9A 3ITKA 3EMKA 4J91A 4WNCA 1EDZA 5I8WA 3GVHA 4TRJA 4FN4A 2RH4A 3GNTA 3JCZA 3KZVA 2BGLA 2Q45A 2JD2A 3SEFA 4IBOA 3WDSA 1ISIA 1U3UA 2CMDA 1EDOA 4GL4A 3INGA 1JW9B 3AY3A 3PDUA 1B3RA 1JDJA 1H6AA 3FWZA 5AXBA 3QVSA 3WGIA 3PIIA 3O9ZA 3OICA 2Y93A 4JQCA 1X15A 3WTBA 1YL5A 4E33A 2DPHA 4YQYA 3GVCA 2O2YA 5LDGA 1JAYA 4XEHA 4ZD6A 1M2WA 2WD7B 3FNEA 1LX6A 1E6EA 3WNQA 3AUTA 4WPGA 4O5OA 4XJSA 1J0XO 2QRKA 1F17A 3MWEB 4CL3A 3AU8A 4AICA 3LC1O 2ZYGA 2I66A 2JL1A 2Y0EA 2NM0A 1BW9B 1MC5A 1WP4A 2PH5A 3IJPA 3PRJA 1QP8A 3HADA 3GOHA 3F47A 3I9LA 4DTIA 5F5NA 3PQDA 5TC4A 3NTOA 2Q99A 1UDAA 1IE3A 3TZ6A 1ZNQO 2C0CA 3GEDA 3KYBA 1NBOA 3AFNA 1PJ4A 4BNUA 1R0SA 1T26A 4DRYA 4YT4A 1BW9A 5I7EA 3WBBA 1LJ8A 1G1AA 3CMMA 1Q1NA 1AXEA 5A03A 2W8ZA 3JYQA 4D0SA 4GX2A 4QSMA 5BSHA 3A4VA 3DDNA 4G65A 1RWBA 2CZCA 4ZU3A 3X2FA 2JCYA 3DAGA 5CDGA 3FCOA 4EUHA 4QX6A 4WKGA 3JQDA 5JAQA 4J9VA 2QQ5A 4L9RA 2HO5A 1DDOA 2PD4A 3OQBA 3PHGA 4OKIA 1NVTA 4JK3A 1W6UA 1HLPA 1TT5B 4W7IA 1J5PA 2H5LA 4ZRMA 4YBZA 2Q4EA 4BO3A 4Y6SA 5JCJD 1NQOA 2HMSA 3OIFA 4AJ4A 4HNHA 4PCVA 4WEQA 3D7LA 2P5YA 5AXCA 4I8XA 1OBFO 1PZHA 2GN8A 1I5RA 3E03A 4IQGA 3VH4A 1PSDA 1XEAA 2NU7A 4PG7A 1EFKA 1FDSA 1P9LA 3Q2IA 2G1UA 1N9GB 5DF1A 5F5LA 3GNQA 1YJ8A 2JKVA 1WDMA 3DBRB 1HE4A 3E18A 1E7YA 1GDHA 2I3GA 4A7PA 1FF9A 3OA2A 4ND2A 3W4IA 1T2DA 1N9GA 2IDZA 2VTEA 4GSLA 1T2EA 1YVEI 3QVWA 4W7HA 5IXSA 2A9FA 3G79A 3DBRA 1LLQA 1D7OA 4PLTA 1MG0A 3I4CA 4CL8A 4P38A 4DXHA 3OEYA 1U3VA 1U7HA 2CVZA 4PLGA 3RUHA 2IE0A 1O95A 4IDEA 2D3TA 5FI5A 3WXBA 2OO5A 1GR0A 4R4JA 4CLOA 2O4UX 5JC8A 4PLZA 1M76A 3PWZA 1FMCA 1NAIA 3M1LA 3TQHA 4NQZA 3IJRA 1ZZEA 1EQ2A 5ES3A 1Q7BA 2EF1A 3Q9UA 3FRJA 4WGGA 1A27A 5G4KB 3DOJA 3KV3O 4CUZA 3VPXA 5CG2A 1P1IA 3D3WB 2DBZA 2ZJ0A 3OF2A 4KTVE 5BSEA 1NPTO 1PQUA 2WE7A 1ADGA 2GYYA 4WOJA 2EV9A 9LDTA 4AJEA 4O6VA 3PFFA 3E48A 4FGWA 3VOSA 3CMCO 5JCXA 4TMFA 5JO0A 1E0DA 4LISA 4A2CA 3T4XA 4K6CA 3BA1A 4DLLA 1Z82A 1VJTA 2IZZA 1V3VA 3MWDB 4M49A 3G17A 3K5PA 3ROQA 5LC1A 1X7HA 1D1TA 1Q0QA 3DC2A 3RUEA 4BKQA 2J5KA 3UXYA 4RVHA 2IXAA 1OFGA 4BL5A 2NNLD 5TRTA 2R2GA 5KVQA 4BMSA 4OJNA 4KUEA 2NU9A 4ID9A 2OBNA 1CIVA 3HZZA 5KJ6A 4NHEA 1ZBQA 1GEGA 4L0QA 5A9RA 3LK7A 4Z0TA 5L53A 5L7TA 1ZJYA 2C7GA 1E5QA 5EL0A 3GUCA 1T24A 4I9NA 5BNIA 2CDAA 2I9PA 1A71A 2EKLA 2QRLA 3LF1A 3BMQB 1CETA 4CV1A 1IB6A 2HMVA 4DC0A 2HRZA 1BXKA 3IKTA 1U5AA 1KEPA 1KOLA 4YAIA 2GZ1A 3HSKA 4YPOA 1GQ2A 1BG6A 1W73A 3NJ8A 4Q9NA 3W6UA 1VM6A 3PJGA 4W9NC 2E6UX 2PD6A 1P1RA 1RKXA 2AEJA 4GLOA 1O9BA 1EZ4A 1GYPA 2AW5A 2OP0A 1NASA 3WWYA 1XA0A 3DMTC 5G4LA 4KTTE 2CVQA 3IOYA 4GLLA 1I10A 3Q0EA 2FOIA 2I3AA 4L75A 2XXJA 1O89A 5JSFA 1SEVA 2DC1A 3ENNA 4NBWA 3EAGA 3LSYA 3GMSA 3MEQA 4NDNE 4BKRA 4Q3NA 3NT5A 3L07A 1XG5A 4D0RA 1GQYA 1HE3A 1ZK2A 1ZK4A 3JQBA 4IMRA 4XRGA 2YDYA 2EERA 3AI1A 1V9LA 2VN8A 3NYWA 4YQZA 3RSHA 4GGPA 4RGBA 3QHAA 2FSVA 1UAGA 1YBVA 3MCVA 1JWBB 3BMNA 1CDOA 3WNVA 3KYDB 2BI8A 2FR8A 3CPSA 1PGNA 2EG9A 3GR6A 4PZCA 1EK5A 2BMAA 1LQTA 4BQRA 4B8WA 3ZCXA 4TRNA 5TIIA 3PTZA 1HE5A 3OJLA 1EQUA 4CM1A 2BRUA 1MGOA 1NFQA 1PJLA 1YQDA 3AU9A 4R69A 4CMKA 5IJZA 2DLDA 3KYDA 4OGWA 2AMFA 2E37A 2ZTUA 4DA9A 3OSUA 1HYHA 2EKPA 1X7DA 2A4KA 3MJTA 2J3JA 1O0SA 1BTOA 2GDZA 4AJ1A 1ZSNA 1F12A 3KEOA 5TSDA 1YQXA 3DFUA 4B4UA 4DPMA 2HDHA 4BNYA 1DAPA 1GCUA 4FGSA 1LDNA 2Q1TA 1DLIA 4ROSA 2O3RA 2CDBA 3GHHA 3PFWO 3HE3A 4IINA 1U5CA 4BO1A 1PJQA 3GVPA 2GR9A 1YKFA 3JQGA 1X0VA 4ALIA 3JD4A 1PJBA 4NBRA 1YB1A 3HDHA 1M6HA 1YQGA 4IY1A 4YRAA 4D3SA 2FSSA 1GL3A 1Z7EA 3FNGA 3WJ7A 4MVJG 5T64A 5K0ZA 3H7AA 4R5MA 3S2GA 3ONDA 4P4NA 1BXZA 2OGUA 3C85A 1DFIA 1GAEO 5B4VA 3WQRA 4NZ9A 4E2YA 5DULA 3BMOB 2J3IA 2PNFA 1ISMA 1ML3A 4Z9XA 2PK3A 5THQA 1LEHA 3AOGA 2VZ0A 4BNVA 4O0LA 2VWHA 5F1KA 1F8GA 1HDXA 4CUJA 1XWFA 3O03A 1PR3A 2NQTA 3RKRA 2ZB8A 1D3AA 3I83A 3BMOA 1XDWA 3HN2A 3EGOA 3PHJA 4FFPA 4LSWA 4RVGA 4E6PA 4HV4A 3AM5A 2I76A 3RC2A 4CMIB 1OC4A 1UXJA 4DIFA 3F1LA 2Q50A 1ENZA 3COSA 4OXYA 2PWZA 1QR6A 3Q3CA 1XQ1A 3A06A 4BNFA 3PZBA 3I1JA 3TFOA 4CMIA 4KWHA 4QEDA 3VTZA 2PLAA 1H6BA 3B70A 2EXXA 4BNHA 1PGOA 5CHEA 5JFOA 4NR0A 2VHVA 3E6AA 2HLPA 2YHIA 2AQKA 5KTKA 2BFOA 5HTOA 4BNKA 1ADFA 4D7AA 1NQAO 4HKTA 1H2HA 2NUAA 1JWAB 1R12A 3PQEA 4DGSA 1N5DA 3H9EO 1ZMOA 1HDGO 4U0JA 1GCOA 2Y0CA 3ONEA 1LLDA 5A5EA 1XR3A 4TVOA 1YONA 4CR7A 1EUZA 2OL4A 4CLEA 3PJEA 3D5QA 4XQ9A 1D1SA 2G76A 4NU6A 3JD1A 4BKOA 2O23A 3AY7A 3I5MA 3NV9A 4ZQHA 1FDTA 1AXGA 4MVJD 4MKZA 1DIHA 4ND3A 5IDYA 4CMCA 2W98A 3U4HA 4MPDA 4LK3A 4XR4A 4ALNA 2I5PO 2CSUA 3RBVA 1I3KA 3D0OA 1LSSA 4TKLA 1LLUA 4CLXA 2HK9A 4PGFA 5DOZA 5IDWA 2YHUA 3H9QA 4BVAA 2W2KB 3R0IA 4JN6B 5I9MA 1E6WA 2GGSA 4QUKA 2CDCA 3HFGA 1SNYA 2F00A 3PJDA 2PGJA 3GZNA 4L76A 4BS9A 5JPIA 3ZV3A 3PLRA 4A26A 2PGLA 1Z73A 4II3A 1EUDA 1SC6A 2FN7A 4I9HA 3PGXA 2PZKA 4BGUA 5I8ZA 2E82A 2X86A 3GFGA 2G5CA 3UCXA 4GKVA 2W2KA 5K6AC 5JW6A 4OXKA 1E7WA 4JLWA 1ZK1A 2H63A 4KUGA 5LCXA 3NT2A 3RIHA 1WDLA 1LSUA 3K2EA 3V2HA 3VH2A 2DU8A 3TWOA 1YRLA 2SCUA 3WGZA 4UUNA 1D8AA 4A0SA 5IFLA 1T1SA 4EI2A 3NJ4A 2ZB4A 3H4VA 3SLKA 4XGIA 3LT1A 4IUYA 1DRUA 4Y8VA 2WMDA 5G0VA 3BTOA 2NTVA 2RHCA 2Z95A 3DOCA 2Z1NA 3B1KA 4JIGA 4AFNA 4L4SA 3IQDB 2VHXA 4YRBA 4NH4A 5F21A 3UGKA 2H6EA 1P1FA 1H2BA 3HG7A 2O3UA 4K6FA 2PKQP 4NG5A 3RAJA 1ENPA 4G5HA 3LQFA 4B3HA 4CM4A 5B4TA 4GMGA 2IODA 2EWMA 2X0IA 4MIOA 5FFFA 5TJ9A 2WYUA 1RYDA 1W0CA 2BD0A 1NPYA 1HYGA 2FR1A 2NLOA 4FOSA 5AQ1A 4CR8A 5C3MA 1LRJA 1LDGA 3PP8A 1HLDA 1VLLA 5K6AA 3ZNPA 1R16A 1MP0A 1JTVA 2HK8A 3V1TC 2X5OA 4D43A 1TT7A 1MA0A 1PJSA 3D5TA 2XOXA 4Z3KA 3VVCA 3RKUA 5A3JA 4MINA 4UVDA 3WGTA 4NJOA 5LDHA 3MZ0A 5ITWA 2D8AA 1ZW1A 4DUPA 3GUYA 3ANNA 2AXQA 4B4VA 1SPXA 1U8FO 1UXHA 5ITVA 1FXSA 2DFVA 3W4KA 1PQPA 3RQSA 4BO5A 3LT2A 2ZQZA 3WX0A 3ANLA 1Y7TA 3OIDA 1MC4A 5KNLA 1UZMA 2Y1FA 3KYCB 5T67A 4XGNA 3I52A 3JTMA 1HZJA 1P74A 4TROA 2ILTA 4RLSA 1R4MB 2ZTVA 3ETEA 4OO3A 1A9ZA 1ISGA 1ISJA 1I3NA 3U09A 1NHGA 1EUCA 2J5RA 4CMEC 2NV6A 2DTEA 3KO8A 3DQPA 1YOVB 1WDKA 2B83A 3KYCA 1KY4A 3LZ6A 2BGKA 2DTDA 4NPCA 3F1KA 5U4QA 1ZK0A 4BNGA 1R4MA 1SO8A 2UV8A 3GA0A 4ALLA 4EBFA 1E3WA 3OHSX 4GWGA 3H5NA 4ZVVA 4J7XA 4XD2A 1FJHA 2AA3A 3FTPA 3GHYA 2P91A 4OSPA 5IZCA 4JJFA 4NI5A 1PX0A 3C7CB 1IHYA 4BNNA 2NTJA 1E3JA 4I5GA 4KZPA 1E7SA 3D4PA 3UOGA 3FSRA 1YBAA 3ROMA 4EJ6A 4MOWA 2QRJA 5DP1A 5C7OO 4KP7A 2O3QA 2B35A 4H3VA 3K92A 7MDHA 3DO5A 3PHLA 4Y6RA 3L6EA 1P0CA 4R01A 2UUPA 3GG9A 3BIOA 5A9SB 5DBGA 2D1YA 4MVJE 4NMHA 4D46A 3ZNNA 3P7MA 5HS6A 3DBLB 2O4CA 1UP6A 4NJMB 1V3UA 3GF4A 1LDEA 1LDYA 1QKIA 2G17A 4YA6A 4D3FA 4F6LA 3RC9A 1YL6A 4E2WA 5A9SA 2PGDA 3ZU5A 5GZ3A 3LVFO 1DRWA 4DBVO 4DL9A 4J43A 4ALKA 4CMGA 5GZ1A 3O26A 2BLLA 1HT0A 1ADCA 1NYTA 2DVMA 2DPGA 4DYVA 1GV0A 1XELA 4IS2A 1QG6A 3G1TA 2OXIA 1Z75A 4CM9A 4PRLA 4MVJM 3ASUA 1DIGA 1GQQA 1V35A 4ONEA 3HB5X 4J0EA 5BNTA 5L7WA 4RQUA 4ZGWA 3E82A 3JQCA 4E3ZA 3RWBA 4J0FA 3ROPA 4AG3A 3OBBA 4YTEA 1QLJA 2NQ8A 4OHUA 1OAAA 4BGEA 3PK0A 3H3JA 5EPOA 1RJWA 1RPNA 3UN1A 4YAKA 5CG1A 5JNLA 3U49A 3FR8A 4XRRA 2C2YA 3PI7A 1DB3A 4IDAA 4Y67A 1XIVA 4W99A 5HS4A 5KVVA 4LRTB 3IL2A 3OFSA 4GSKA 1JN0A 1LC0A 4ZRNA 1SMKA 1C1XA 1T4BA 3AK4A 3WQQA
chains in the Genus database with same CATH superfamily
1XZGA 4PSDA 2Q1WA 3TIVA 3OCCA 3O73A 3N58A 1SCKA 5HKAA 1JFFA 4Y2UA 1P77A 1V41E 3DA8A 3TW0A 1T9AA 3IKLA 1DAFA 2Q4TA 3CLUC 3PUZA 5C1DA 1AQIA 1W85A 5T6BA 3ZX5A 4LF5B 9MHTA 5B3LA 1RXIA 4AT1A 1M2OB 4PTLA 3ZTTA 1R7RA 3GPDG 3NBQA 1NN5A 4DMLA 3FZGA 5JSUA 1JKJB 3M33A 2NZ2A 1DIRA 1VCOA 1NV8A 2X1MA 2Y1KA 4FDAA 3X43A 1CNFA 2HXYA 4F6RA 5KWIA 3PWSA 5LB4A 3D4LA 5FF9A 1JI0A 4EFLA 4O2AA 4RSRA 3OOHA 1RAFA 4E4YA 1Q50A 1TU0A 2J4DA 3AL3A 2OBFA 3AETA 4N54A 3HJFA 1JB1A 4FX5A 2PGOA 3PQ6A 1C30B 4MI9A 1PQWA 1Y6JA 5ER9A 2XOKD 4ENVA 1AUPA 1BHQ1 4P35A 3U7QB 2HSDA 1GGVA 3KWLA 1LJLA 3BF7A 5CA1A 1E7RA 1VCIA 3AR8A 1D2GA 2JHAA 2HHCA 4YMVA 5FUQA 2VRBA 4IVQA 1DPGA 1IH8A 3B12A 2V1XA 3CCCA 5B6JA 1KDPA 2GN2A 2KE5A 3SF8A 4MHSA 4MQEA 5ALGA 5FL7A 4A36A 3EBLA 3T1NA 1M1ZA 4N7MA 1BS2A 5DBOA 2NZYA 1QBGA 2BEWA 3IP3A 4HC4A 4YT2A 4L3WA 4OG2A 1Z38A 1OQAA 3TLCA 4R84A 1Y8QA 3LHDA 5JPDA 1DHRA 1F0NA 2OV3A 3U44A 3E9EA 3LQ1A 2P8JA 1ZCFA 4QGGA 4LNUB 4LZLA 1WSAA 1NRJB 3NHAA 1NVBA 1PI3A 1ZN9A 2W2TA 3MMPA 1MMFB 4MRAA 4J0GA 4OHMA 4PYQA 3S4YA 4NV0A 1L8LA 3EFHA 3GEGA 3CEJA 4ZP1A 1QRAA 3X1KA 3TLGB 1M7GA 4Q9KA 3G6WA 1WB5A 5JE8A 5E6SB 3H2JA 3HA7A 4ZHQB 2QU7A 4RK7A 4FD2A 4R5HA 4C07A 2NNWB 2D5CA 3M1AA 5CVCA 5CVVA 4C7JA 1ZZGA 3U1VA 1H6CA 4F3RA 5I7FA 3TECE 1LSJA 1U7OA 1EWQA 2AG8A 1DQSA 4EJ0A 1LZKA 5KWJA 2QD1A 5TXGA 3SVLA 1SCJA 3L49A 1UMDB 2HPZA 2LR0A 3EZLA 5CP8A 5BQOA 1A04A 5KYYA 3DXXA 3SLGA 3TAHA 3MJVA 3CZ5A 3NIWA 3ORFA 1ZJ4A 3FNBA 2IUEA 2GNPA 4JCCA 5FPKA 1AKYA 4U6QA 1WWKA 4BWYA 1D2CA 2NV2B 4ZI7A 2ZDQA 5CGZA 2GHRA 5DLEA 1MX3A 1HOTA 2WV7A 3E05A 2JVIA 3M2TA 4A5SA 3IT2A 5FB3A 2JFPA 2GCOB 1M5UA 2PWAA 1Y9EA 3WKBA 1P44A 1B6SA 4PLVA 1QP0A 4RL4A 5TT1A 3VGJA 2VPZA 1PVDA 4REOA 4DQVA 2J9YB 1E5XA 1GTZA 3U0VA 4N4AA 3Q8XB 5DK4A 2JANA 1QZXA 3H9GA 4JC0A 2C31A 1TM1E 1QE0A 4KHPB 1H2ZA 3BG5A 1EGAA 2HB6A 4EHIA 3KSRA 1FRVA 4QXAA 2A1TR 4OU5A 5LPNA 4AY6A 4UM8B 5REQA 3RGGA 2YJTD 3SPXA 4OGLA 1FS5A 2UYQA 5J43A 2XDAA 1TCUA 2TMDA 4B3FX 1OVGA 4JI3B 1EGHA 4E70A 1CKEA 4MQ4A 4CLDA 5L3QB 3VKUA 1QU3A 4O3FA 2WNHA 4IV0A 1YCDA 3GJ4A 1YKGA 4RXUA 3WB9A 4DDVA 2JAWA 2CE2X 4LV8B 4MRMA 3KUKA 2WSBA 1I6LA 1I0LA 3DOHA 3KZ1E 1Y9AA 4N3AA 4U0KA 2Q4DA 3VHXA 2GEFA 5CTAA 5EJFA 4CEHA 4P3KA 4HWRA 2RB5A 3ORHA 2RH9B 3Q6IA 4JSRA 5ES4B 4MQLA 3HU3A 4X24A 2ARKA 3D7KA 3PFCA 4QNRA 2G6BA 3AL2A 1P4JA 2W0MA 4BC1A 4M9ZA 3I2GA 3AUSA 2C92A 2ZYUX 4JA0A 4RHFA 1XKXA 4P3NA 5FI0B 1KTIA 1YVRA 4F93B 2FWMX 4PSKA 4V1CI 3RIMA 5KNDD 4M99A 2NU9B 3SZOA 4EGQA 1DRKA 3B3GA 1GA4A 4KAAA 3RCBA 1AUVA 3E0QA 5CCDA 3ZHTA 4EFDA 1ULBA 1Z2PX 3AVQA 3LXMA 4OQYA 1DCKA 1HWYA 3PC3A 2X0DA 3UGQA 5FWNA 2R4QA 3H4MA 4E31A 2HN9A 4CTMA 4HF7A 2YRFA 4RCVA 4XCVA 1ABBA 1N2CE 3CYFA 2WIAA 3HNOA 5ALFA 2RHLA 2C61A 4CPDA 1ZR4A 3U4GA 3WK7A 3A6GA 5DBEX 5EXEA 3WMEA 4WCFA 2AXNA 2V65A 2W2PA 1BQEA 3MGAA 4JBLA 2HRDA 1QV6A 2D59A 2H2FA 4AJ2A 1FNDA 5DEIA 1O03A 2V98A 4ESOA 3LV8A 4CKXA 3AG6A 2VFAA 3LCRA 3T3DA 1WB4A 2DQSA 2V6IA 2XDWA 3EZ2A 4E03A 2FSVC 1WKVA 2G88A 3FTDA 4EKIA 4CEIB 2C0QA 2W70A 4BB6A 3RI3A 1BMFD 4OX9B 2C3MA 1YL7A 3P9NA 2PZEA 4D4KA 3IUJA 1FDOA 1VHJA 4JYCA 1MAAA 2AEFA 1E4EB 2CCJA 3GJ8A 4J2HA 4NE7A 1J97A 1T6XA 5A7GA 3TYXA 4C4OA 5I48A 2VHWA 1YFZA 4AG5A 2F1IA 1E2DA 3L8MA 1YUNA 2Y0PA 1KZ6A 1UWLA 2WINI 1FVXA 1MPXA 1I3OA 2W2LA 1PUJA 1JHQA 3B20A 3F5MA 3LY7A 2H1SA 2REQB 3ONFA 5AJYA 4LNAA 2IH2A 4OQZA 4AMVA 1FNSA 1QGUB 4BFYA 4ZYLA 2OMEA 4J9UE 4BLVA 3ELDA 1Q3KA 2BZ0A 2GZ3A 3V4OA 1JBQA 1KPIA 1L4MA 3OEWA 4FJ2A 4NMMA 3CIFA 2EQAA 3JAWA 1L7VC 3I1YA 1K5DA 5I3CA 2PU5A 2ZZNA 2ZTMA 1FFXA 4R31A 4DJJA 2PH3A 1M1UA 2YRXA 1DEHA 4KVAA 2VZEA 1XMIA 2CVOA 1DFGA 2B37A 2QORA 3AUJB 5IM4F 3GJRA 3CX7A 3D1JA 1IHUA 1P7ZA 1YJBA 3FDZA 3LXUX 2XKBA 3ORYA 3IILA 5EKDA 4C0WA 3PD1A 4C20A 2I6TA 3NI2A 1TO1E 1ULHA 3A6KA 3CXRA 1N2ZA 2QF7A 5FRDA 3WBKA 1RLJA 1U0RA 1UOEA 2QTTA 1N5OX 4Z6KA 1XZJA 3SF0A 1ECCA 1KHTA 1DQNA 4PEVA 3KLMX 4M76B 2Y0DA 3FPFA 3OZIA 3PWTA 3KQYA 2QJOA 4HFRA 3GUVA 3U40A 2NT3A 3A6DA 3BS4A 3LCVB 3O4JA 4IOMA 4OQMA 4DEXA 5ILOA 5DTIA 3CLHA 1PWXA 4LSGA 1XRMA 2A6PA 2GJ4A 4EZIA 1XD9A 1F20A 1NULA 4B31A 1Q92A 3CKLA 3MRXA 3IV9A 4GUDA 4YQEA 3IT3A 3UPDA 1E94E 3ZV6A 4NBKA 1Y8ZA 4BECA 1VSUA 4LMBA 4JV5B 3DL4A 2ZBPA 4TUYA 4YAIA 4OHCA 5LBUA 1ST3A 2J6IA 1ZICA 3EC7A 2IU6A 2XVYA 2BV3A 3BWCA 3S68A 3CVYA 1QF9A 4WFKA 4DR7B 1LBTA 2PLFA 2P3LA 2JEOA 4TKUB 3MJEA 4B80A 3MQ2A 4E0BA 1HPLA 4IWYA 5HIKA 5JY1A 4NYMQ 1PJZA 5K8UA 5L8VA 5TQVA 4WOPA 2GWHA 3VZQA 3AR2A 4PYLA 5M5BA 4FCTA 4OX9Y 4XQEA 1HFKA 2IC5A 4JBGA 5JWOA 4QU0A 3GNSA 5J47A 2FX5A 4BZWA 1JFVA 3WIOA 3EQ6A 4GVLA 5TQ0B 1BHSA 2HA5A 2WVGA 4IGFA 3KD3A 4KUHA 4X7BA 3T3IA 5FUMA 5HGJA 1Z34A 1W5TA 3VZRA 1NUPA 2FZVA 4LAFA 4GBED 1JFRA 1ZRHA 4IH1A 5TR9A 2AOTA 2EIHA 5I51A 1NNI1 3CUVA 3I72A 5CB0A 5H59A 3PTLA 2Y4OA 1Z5GA 2GN1A 1N0VC 1RMYA 3WRXA 4YT8A 1NFRA 5HSGA 1QZ3A 4L6AA 5AI4A 1QJ4A 3JD3A 4RPLA 3ZE9A 3R3VA 4PFJA 5EJ2A 1QCZA 3BPSA 5FV7A 2OQIA 5HBGA 2I6UA 1R0WA 1LQUA 5C81A 1D6SA 3LUPA 3QVKA 1MNAA 5C3UA 4AN0A 1T3HA 3DTNA 2D2EA 3O82A 1HT3A 1VHWA 1YQTA 4OOFA 1DZIA 2YYZA 4LKOA 5I7OA 2OXRA 3GELA 2IPNA 1P7YA 1U2TA 2CJWA 1CULC 3QLJA 1MQ8B 1I32A 3U4AA 3QEAZ 2WSYB 1ZUNA 3K6JA 3TG8A 1JUDA 1NIPA 3L0ZA 3H05A 4HB3A 1KIMA 3PA8A 4MPPA 4MKIA 4CGYA 1FQJA 6REQA 1C9NA 3CLUD 4W5NA 4WZAA 2IW1A 2FMFA 3HYRA 1CY8A 2D5BA 3PT9A 1C0IA 4WLNA 4D80A 2RHGB 4EITA 1JSZA 2C2KA 3OCUA 4LXIA 3OHMA 3JATB 3ICCA 1YR7A 4TSKA 3PA6A 1GQRA 5JJBA 2G1AA 3L79A 1BWRA 5DX0A 3U17A 4PZPA 5KVAA 1YS6A 5L9AA 4Q4AA 3URKA 5C51B 3RFVA 4BFTA 4ZVKA 2Z4RA 4U7FA 1RKQA 1R0XA 1L3IA 2BHRA 4F4JA 3HVJA 2H7XA 1DBQA 2PKRA 2AZMA 2Q29A 2QN7A 3ABZA 1H4VB 1MB9A 2X58A 3AF1A 2PS1A 3L1IA 3AESA 2WAOA 3MWGA 1ZU4A 3SBXA 5KVSA 2ONJA 5DCLA 3L9WA 3AEKB 1RFLA 4R2KA 4RFVA 4HNQA 3O8OB 3RHSA 4N9WA 4YR7A 2QYTA 1IY1A 3GCWA 2J3QA 3HU1A 4KE7A 4XVRA 4BP8A 4HNGA 2V9CA 5DX1A 3WRWA 1BE1A 1NM5A 4OB7A 1QV7A 2B4QA 1RQGA 5JAZA 3KVYA 4UMEA 5LD2C 5F3RA 4FWBA 5LYJF 4O2BF 5CB4F 1SCUA 3LM8A 2O1XA 5DYGA 1A5SB 5KWSA 4N5LA 2ZI5A 4TYWA 1X8KA 2V7WA 3LCCA 2OCPA 3KSMA 1GZVA 4OBBA 4ABTA 1I6WA 1N34B 2GAOA 1WTCA 2ZYHA 1RWPA 3IX7A 3KT0A 4BO7A 2DE0X 3DVLA 1QHHB 4X65B 1QTQA 2BONA 2B1QA 4X1KB 4EKDA 3NHRA 2XBMA 1FTQA 3ML1A 1XD2B 3S2FA 2WAAA 1V8FA 3RFXA 1EKXA 3IVXA 3EMDA 4I1PA 2V3WA 1HC7A 4E32A 1NUTA 4DNOA 4F92B 4D9KA 1EUDB 2VWQA 4ZGGA 1ND5A 2PUWA 1CP3A 1KIFA 5EJ8A 2EAUA 1RWQA 1HE2A 4MKXA 4DQLA 2REXB 4BMZA 1W88A 2WM8A 2VF7A 1MB4A 5G0TA 5C80A 4YJFA 3K0CA 2XUGA 2ZROA 2WHXA 4RORA 1TUEA 2P1DA 4Z3OA 4EHLA 2VPQA 4UEJA 3LIPA 3CWZA 1MOQA 4TS4A 3ZCVA 1C8KA 1TB4A 4BN4A 3KLBA 2A7QA 1ZJZA 3CR8A 4HRXA 2P2LA 3HDYA 3P9SA 2FTKE 3QFSA 5KVCA 3VC1A 3L4KA 2PFGA 1MH1A 2WILA 3BGDA 3WNVA 4GI7A 1RXWA 1G4HA 1MO4A 1W76A 2Q8NA 1Y89A 4U6SA 3UK6A 4DPKA 2FFQA 3MD9A 2QTBA 1LNZA 3C5VA 3NDIA 1R6DA 1Z7GA 2F48A 4JU8A 3SICE 1ZIDA 3K9GA 2V7VA 1WW3A 3DV9A 3OQ6A 3S2UA 2VJNA 4HB2A 9ABPA 4G0VA 3GN2A 4YN3A 5H81A 3OTHA 2Z57A 4E5KA 2IP1A 2IX9A 1VG9B 4M1ZA 4AJKA 4IIGA 5BSWA 4D6YA 1U0HC 3RDPA 4CM4B 3CUUA 1RYZA 1SUEA 1R0BA 5GJBA 3VPSA 2HNBA 2G7ZA 1YVDA 5IBRA 2ZJ7A 4GZ3A 4JJIA 1GGNA 1Y7LA 5AI0A 3S3TA 4X64B 1O1YA 2RI1A 1RAHA 3MWFA 4YMGA 4HPWA 1A72A 3ZHRA 1O5OA 5EIOA 3SY8A 3PXAA 5EOVA 5I5EA 4QM7A 2JJ1D 3MVEA 3R1IA 3TSZA 3OEHD 1Y8RA 1T25A 1IU9A 2VA8A 4PV7A 1XALA 5I7RA 3ZJUA 2XE7A 1TI7A 1RWKA 1JHOA 4P58A 2MIIA 4UQOA 3ZY3A 3KHSA 3O47A 4HRYA 3WXMA 5HMLA 1EIWA 4DA0A 1KMNA 3UTCA 2ZKLA 1ZUHA 3BJRA 1HM5A 1RJFA 3K4HA 1ODLA 2EATA 4KQGA 1I1HA 1NDQA 2W00A 3HN6A 1VL0A 3IJEB 4G2NA 3UICA 4R8VA 1DL5A 3MRSA 2POQX 3AJ8A 3OIVA 4F9EA 2FLVA 2OK8A 3BRWD 3D3EA 5COAA 4BNTA 2GESA 2O0MA 2BFDB 4KFUA 4O4JA 1ZBDA 2LZ0A 3C5WP 4KXMA 4U1RA 5IAAA 1G98A 3A6PC 3B1FA 5FOQA 4CUKA 1RQ7A 3I0MA 1KEEA 1GL9B 4TV9F 1GRCA 3ICEA 1PJRA 4HAVA 5EFOA 3RTDA 3VI4B 1GVNB 4IDFA 4YAWA 1L5YA 1WEHA 4YRGA 4I4LA 2QLLA 3LUKA 3PENA 3A4LA 5PGMA 4BTEA 3NOQA 2AK2A 2JFOA 1S2LA 3NTQA 2BHLA 1G18A 1MX5A 4K0RA 1XQ6A 1EBBA 3L7KA 5FV4A 1BDJA 1VI2A 1II9A 4JKOA 1A1SA 2J9FB 1ULAA 2JHGA 1VFPA 2BFNA 1D5WA 4MULA 3MIZA 4TRRA 4GPEA 4INJA 4G37A 2P41A 3X0DA 1EFAA 3O5AA 2AT1A 3MHPA 3H2HA 3KJHA 5HRCA 1KJJA 5AFSA 1CUSA 2H7CA 5EE9A 1E69A 5TY0A 3BREA 5CEFA 1Y3CE 3BMCA 1QRRA 2PXXA 3OUUA 3QIVA 4NOJA 4WLVA 3K9QO 4X92A 3MWLA 1U3WA 1ZGCA 2O7QA 5AIAA 1V39A 5AKEA 3HB1A 3RSGA 1P9WA 3TNLA 3H1PA 4K28A 2QUAA 1E0KA 2CFRA 4GQAA 1E9RA 2JLSA 5BXQC 4J1QA 3VNUA 4J6FA 2I1QA 3HKBA 5KIAA 3SFVA 1N7JA 3UPUA 3GRPA 2FW7A 3NBYC 3FZEA 3BCHA 4AWXA 1LU9A 3KEFA 2DQZA 4KE8A 5ERYA 1YI1A 4B3XA 5K4GA 1MT3A 3C8UA 3D1LA 1MQ9A 2ZYVX 4DDMA 4PXAA 5ADHA 4R98A 4KH0A 1HYEA 5FLEX 2GEVA 4HGZA 4NMXB 2FPGA 2VT3A 2GKGA 1VGQA 2QN3A 5JFGA 1ZOLA 2PHZA 2N0SA 2FHPA 5C4MA 1W75A 3RIYA 2OCGA 5GADl 3AWIA 4G56A 1SM4A 3U4IA 3U3RA 2R48A 2BJWA 3A6ZA 4O4HF 4X7PA 3UB2A 3P45A 4FYYA 4YJGA 4X1YB 2RC5A 2Y68A 1NJSA 5J59A 3ZXIA 2C2MA 2B9EA 4P81A 4CL0A 3K8YA 3WIEA 3C24A 1UP4A 5IC4A 1ZNZA 5HZKA 5I9IA 1WQ1R 2O7SA 3H4TA 2XTMA 4CRWB 3VKHA 1YS1X 2YFQA 4B2IA 5CITA 3TLBA 4W6ZA 3RVMA 4EUKA 4MQMA 4LNHA 1P17A 2J3LA 2XMBA 3COVA 1Z0IA 2ZJYA 4OQDA 4G0UA 3HJHA 2YJNA 1DO8A 3C70A 1U9ZA 4C4RA 1JHYA 3I45A 2JH8A 3NAQA 3EJ6A 5BOVA 4RACA 4BZQA 1ONPA 2CHVA 1AUOA 3EK2A 1I0ZA 1U8ZA 3OFVA 3OJ0A 5LQNA 4HYTA 1I5EA 2CNDA 3E9NA 2FW9A 4UOZA 1ZD4A 1XLUA 3TZCA 1WU8A 4FGUA 2QR2A 3HCOA 1BDMA 3ICPA 4JBIA 4NU5A 4PWYA 1V11A 1RAGA 1ONBA 1SD5A 3NPMA 2QBYA 3DDSA 1HF3A 5E9WA 4D8WA 3OZSA 5IM5A 4MP3A 1IN7A 1B1AA 2H7YA 4Q7JB 2RGAA 3NIDB 1GNRA 2GEJA 3DOIA 1IN6A 3D64A 2H85A 4RK0A 4YP1A 4CT0A 3GLGA 3BN3A 1MQAA 3HN7A 3RRMA 2Z2YA 3I61A 1X80A 3RBZA 1D6MA 3B9BA 4F9TA 4WBSA 2D62A 3BJMA 1CUDA 1YK1A 1WXEA 3DZ8A 2GLUA 3I6QA 2H9AA 3L7AA 1C1XB 4XM2A 5F7OA 4PHCA 1Y6ZA 4E21A 3ZWQA 4HAUA 4HSGA 5KS2A 5F7XA 5K3FA 4B6QA 5K0GA 1PL7A 2VO1A 1FYDA 2VP4A 1FS6A 1YR9A 4QPDA 5DGXA 3ZI7A 1JFFB 1CJTC 3ZIAA 4PZAA 2CXHA 1GFWA 3DMDA 2RE8A 1HRDA 2XUHA 5TPZD 3K6SA 1GRRA 5E7IA 5JXJA 3DLAA 4R1SA 3K09C 3SMVA 4IIUA 4Z3DA 3BORA 5KJFA 2C5BA 1VL6A 4LZWA 4QTYA 2VDVE 5EUQB 1T2CA 3G82C 4KV9A 2F1JA 5DMHA 3FTEA 3BHJA 3CLVA 2D0IA 4QTZA 2XYHA 3HUFA 1JU9A 3L82B 3A1VA 1O6FA 4XPIA 3BL8A 2Q2NA 1PR1A 4F6RB 1PGPA 2J45A 4O08A 5A4KA 4O2AB 2DHEA 1ACJA 5KYTA 2NPIA 4E7PA 2H4WA 4ANFA 3AETB 2UZ1A 3WVNA 3TVTA 4K7JA 2BLNA 2Z09A 4KXXA 4QDKA 2UUCB 3KOYA 1YZTA 3NHZA 4Z51A 1XFAA 1QCYA 1I7DA 3RYIB 1T15A 5CA1B 3TGLA 1XRNA 3E8MA 1YA6A 3RS8A 5JQGF 3CR3C 3DVQX 4Y2SA 1RRCA 2Z8YM 2F2TA 1ZM7A 3BZUA 1WUJS 4F5DA 2PRJA 3IAS6 3SCZA 1AMNA 1GAWA 3OIGA 1GSOA 3X1WA 4OHFA 3SF8B 5FBHA 1ILEA 4DSOA 3PNKA 1WABA 1IPHA 1B15A 1ULTA 3K9CA 3HI6A 4RV9A 3D8BA 3BXZA 2FFRA 4M22A 1WTAA 4G07A 3D0QA 5J5CA 1KZ1A 1ORDA 2A0XA 2W93A 3TPFA 4R2WA 3DD5A 3D4NA 2HC9A 2X7XA 4CG0A 2WD7A 4QJ3A 3JASA 4C5AA 1OXVA 2FRDA 1C9EA 1Z17A 2WD8A 4Q6BA 3C3PA 1FFGA 1LVHA 4GPD1 4NZNA 5KJCA 4K81B 1QGAA 3V4FA 4F56A 3F6BX 4YCBA 4EX7A 3COYA 5JS7A 2DX7A 4AYWA 1G5FA 1C3EA 2CLKB 4A0QA 4J0DA 2F8TA 2RB4A 3VBEA 2IZ1A 2PMDA 3S5UA 2JGLA 4K9PA 4K9KA 3OQOA 4ZPXA 2AG6A 5DTEA 1P6XA 1O94D 2Q7DA 1M2KA 4G5GA 3OQ1A 3CT4A 3COWA 1IYZA 1ZN7A 3TSWA 2O0JA 2QSZA 3A70A 3C6MA 4JBWA 1SHTX 2H2DA 4ZALA 4ZCMA 2BI7A 1UT6A 4FILA 4DIDA 4KLCA 4FWTA 1C2TA 4ZI7B 1DOHA 2BEKA 4CIBA 1Z13A 1I6MA 3SN6A 5JS6A 2OFXA 1NE2A 2R00C 3GWGA 1NJ2A 1Z5OA 3KHKA 5EQFA 4ER5A 4GX5A 4D92A 3SBDA 4GL2A 1ZIOA 1XYYA 2PX2A 5JZSA 5KSPA 1PVVA 3S2IA 3HYSA 2HIAA 1V45E 2PTGA 1DPFA 3QE3A 4J49A 3ESXA 3CA8A 3HACA 1NNSA 3IVCA 1XMOB 5AHWA 2UAGA 4LOAA 1P9RA 2Q3LA 3LBYA 5AT1A 4B0PA 5AI8A 2W6PA 1HEUA 3CKYA 1AHPA 1LWNA 4HDNA 2GM4A 1NGSA 4DA6A 5IJ0B 3N5CA 4LECA 4EFKA 4MROA 2W83A 3UJ8A 2WHQA 1DADA 1P4GA 1DBSA 1SU8A 4XWYA 1E99A 2FPLA 2JB9A 4H7EA 2ATIA 1A2OA 1FNMA 2H1HA 3GJXC 5JD6A 1NDHA 1T6ZA 1JJIA 1O54A 2FDXA 4N12A 4COKA 1D1PA 1QC5A 2B6HA 4JR0A 4OFXA 4FBGA 4HDRB 4H6XA 4FGLA 5SZJA 3T7CA 3HCFA 3R76A 5KBYA 2PZAA 3LJKA 1XQVA 2ZBDA 2CJXA 5LQKA 1THMA 2RHWA 1UWKA 4KKXB 4LW8A 1EJ2A 1LVGA 4MRMB 3FTQA 1QRDA 4XCQA 3VHXB 1ZA2A 3BQMB 5MDHA 1XTQA 3AUAA 4CEHB 4Y6LA 2X77A 2QRZA 2HGZA 4GNKA 1G66A 1UDBA 1CDDA 1XX6A 2J07A 2ZAMA 5BN1A 1K0FA 2ERXA 3B8HA 3GLHB 4ND8A 2PUHA 1YZVA 2IHYA 5T6MA 4Q7QA 3KB8A 4WK2B 5B37A 2QT9A 4EB0A 3M5DA 3UM9A 3G0GA 3IQZA 3QMPA 4ZCTA 4JT8A 1RRVA 5UKDA 1GV1A 2Z2KA 3LLVA 2IIPA 5CJ2A 3VDRA 2V5UA 2VEOA 3ED1A 4Y6PA 3C74A 1UJ4A 2PV7A 4R7GA 5FPQA 5E38A 4IG9A 2GCGA 2NYRA 1ZISA 4MUGA 2XT9A 5K6RA 1SB9A 3GFQA 2PH7A 3RD5A 2OCXA 3FJOA 3PEFA 4WZAE 1D4ZA 4X7MA 3V4ZA 3RLIA 5LBTA 2IYSA 4TT3D 2VQDA 1C9DB 2YQ4A 2ZATA 3DV2A 3M0EA 3L0SA 3OJEA 1K92A 5IARA 2WP8J 5K8CA 3PRHA 3TJMA 1DUVG 1Q2UA 3WG9A 1G7CA 1S9DA 2QZJA 2HCJB 3B6ZA 3DPUA 3JWEA 5EWMA 3A1UA 1LB1B 3MK31 4UE3S 1JR4A 2CL6X 2OYRA 2QLBA 3RF6A 3F9IA 1DX4A 1W47A 2A5FA 4L5IA 3C3YA 4OYHA 1R64A 4RQTA 2YY7A 2LIPA 4C6HA 1K2VN 4FKMA 3RRJA 4YV0A 5KTNA 4PHGA 4PGGA 4XTRA 1XHFA 3MC1A 5CFNA 2H51A 4ETIA 3CF4A 2Q2QA 2GOYA 2F6RA 4JDUA 2IQIA 4KXFB 4HXGA 4N8DA 1S01A 5A4MS 1Y1SA 4G09A 3PCRB 1EX6A 1EVIA 3EVZA 4V3BA 1KVTA 1T0HB 3E35A 4PM4A 2BF4A 4ZOBA 2C58A 3T9DA 1G4UR 2YQ5A 1XZCA 4YRPA 3T4PA 5LNK6 5CT9A 1OMOA 4RHTA 4Q3EA 3WQBA 4LZOA 3V4LA 3DMHA 4K26A 4AO8A 1IUPA 4M37A 3L6UA 3JAWB 4RCYA 1QH9A 4L3VA 4Q7MB 1G0OA 2Z30A 2A5YB 1FFXB 1XZDA 4Q48A 3ISVA 2V3VA 3JZAA 3WAJA 3LBNA 3ZUPA 3IAAA 1KEVA 1IQPA 4N1AA 2NU8A 4EBBA 1ODCA 3QOFA 2YHBA 1JPUA 2VYFA 4E5SA 4JC5A 4P8RA 1CE8A 1MKYA 4YJ3A 1ECGA 4DLPA 1EA5A 1Z2EA 1L7EA 2CXSA 5EE5B 3PXEA 2R79A 3VOAA 1KBZA 1P3JA 2PZLA 2GARA 4G26A 1SPBS 1E3IA 1OX6A 2W48A 1VI5A 4QUJA 4NNOA 2QP3A 1KVRA 3T38A 3O75A 4G89A 4G86A 2XGMA 3M6IA 5AOCA 2LCQA 1KZ4A 2GTHA 2VUUA 5I01A 5JAOA 1PTJA 2H92A 1SK8A 1IFXA 1WP9A 3BMQA 4BZZA 5L4NA 3LDGA 3ZWNA 1E2MA 1CY6A 1V1JA 4PQYA 4QJ4A 4RSMA 4XYGA 1CRWG 2G40A 4ND5A 1QLHA 3H16A 4TUYB 3BCSA 3O4FA 5K99A 3Q5DA 3E9QA 1OAOC 2IRWA 4HN4B 3JXEA 2YMQA 4JHLA 4XDYA 4B3JA 4DARA 1T8TA 3H11A 2Z1DA 4B2LA 1XEXB 2HU5A 4QO7A 2P9HA 4TYYA 4MB6A 4QUDA 2CN1A 1Q95A 2UVDA 3G5MA 3D8HA 3NMUF 1XDBA 3ZJ4A 1PV1A 4LF7B 1EFUA 3KRTA 3IJ5A 2ZJ2A 3MW8A 4N41A 4AXXA 4D9GA 4RJTA 5FBLB 1XGKA 3DCNA 1HGXA 1J8FA 4RVOA 3RTAA 3WIDA 3C4VA 3KDPA 3QU7A 3S27A 3FHJA 3GFBA 5DP2A 5K51A 5BPFA 1YUMA 1X0XA 4RVUA 5IC6A 4C05A 1X1TA 2I4LA 2WF7A 2PKWA 5JZVA 1C7ZA 1KK0A 3T5GA 4W5OA 1BVYF 1EHIA 4HH3C 4ITRC 4JMPA 4XSGA 1NP7A 3EEBA 2HR1A 2AOTB 3D0RA 4X60A 1GG8A 2AD5A 4DMFA 1J25A 2D2XA 4QQRA 3ZKWA 1RJ9A 3HZRA 4FFDA 4DIEA 5DXFA 2FOLA 3DE7X 3Q3HA 5A4DA 3DAYA 1UH5A 1EGMB 2Y2UA 1YH3A 1W48A 2JBHA 2WWHA 4Z99A 4ARBA 3PKIA 4BZXA 2X7JA 4ZT7A 4NPAA 3NCTA 1NA5A 4NEQA 2XUJA 4OFBA 4Q24A 4Q3AA 2IY7A 1Z6AA 4MVYA 4YLGA 4CFZA 3LTNC 3QNMA 1TZKA 4RLHA 5L51A 4PLCA 3VKGA 1M1XB 1VKHA 5H4GA 2B69A 3ES9A 1G0NA 2CJWB 2J85A 2OCAA 4ITUA 1ZGGA 5A0VA 4J2OA 3BWYA 3ST7A 3QVOA 4ZOAA 4ZU1X 3B89A 3PQ8A 5DBFA 1XQYA 2CLHB 3AEUA 3DZJA 6REQB 4MDFA 4C7KA 2BMDA 4WZAB 2HNAA 3ORRA 2FVYA 1JS1X 1XRLA 5DNWA 5SZHB 5JNTA 2FG7C 2IYXA 3F8SA 5IT0A 1TVMA 1Z18A 1GRQA 4IPTA 4BJ1A 1JIQA 3M81A 2XNSA 2OAGA 4Q01A 5EINA 3TZHA 4A2PA 4B4WA 5HKKA 1U0SY 4QSHA 4Q4AB 5AOVA 3PSHA 1KERA 3LTEA 1KVUA 1TVKA 4EUFA 2HXSA 4R54A 1OWLA 5TF4A 1QXSA 2R6JA 2G77B 3EXIB 3QY0A 1XSEA 2Z2IA 4F85A 4BBPA 3A1WA 2Q9BA 3CF0A 2WJ4A 2X0NA 1PWHA 1RXUA 1B16A 2HWYA 2GVDC 2P77A 1Z12A 1TTHA 3IOEA 2FI1A 4I9UA 1WG8A 5JS2A 5FDFA 4S1NA 3O2NA 2NYVA 1AGNA 4F86A 6ADHA 2G8LA 3ETDA 2FN8A 3EWAA 5DVZA 1COWD 3SG0A 1PWZA 2NXNA 2DG2A 1RHKA 3JQAD 1A0OA 1J9EA 3KOWA 3WFIA 4E12A 4ER7A 4ZYUA 3ZYCA 4PLPA 3IB6A 3OLVA 3Q5EA 4B7UA 4MK4A 1H9AA 3D81A 3NT4A 2CNBA 3RUFA 1PVOA 3I9OA 1QH8A 1LVUA 4MWSA 4MYTA 5KJEA 2Z2ZA 2QT1A 4FOTA 3TLJA 2FPPB 3B1JA 2DM6A 3IVAA 3WQSB 3D31A 4AJOA 2CLSA 4B6JA 5H3CA 1VMIA 2Q3HA 3O1LA 5BYBA 1F06A 3OPVA 4I1IA 4RF5A 5AHRA 3A1CA 2CYAA 4JGIA 4X94A 3NM5A 5KTTA 3ZDBA 3DE4X 3RSCA 3T5MA 3ZXSA 3R24A 3HXOA 1ETUA 1Z4IA 3BK7A 5JZOA 1U0FA 3NV7A 4M7WA 2PX8A 4ZN6A 16PKA 3SYNA 1KRWA 1XV5A 2EJTA 1WW8A 2ZT6A 1JKIA 4TLCA 3EWIA 3PIDA 2BW0A 4PZZA 4YJFB 4GXQA 2BHSA 4E51A 4WK6A 1UPUA 2PRYA 4JOSA 3TAXA 4C06A 2VYVD 1MW8X 3BD9A 2GM9A 1GSAA 3IUSA 1CG6A 2QY9A 2R1TA 3BFPA 2OHGA 1NOJA 1FFCA 3DTVD 3W1WA 3MTGA 4ZYTA 5IDVA 2JDID 2VH5R 2C2WA 4R71A 1L7OA 3C7KA 1O2DA 3LFHA 1GUYA 5EEHA 1U7XA 2XB9A 3IAM1 4LV5B 4OKNA 2IPLA 5CU7A 2FPRA 3PPWA 1DQZA 2PVSA 2WDZA 1YQQA 2NP6A 3DEHA 3KUCA 2VXBA 3C8ZA 4M1QA 4R7ZA 2YWCA 5D85A 4OHWA 1IBMB 4LVNA 1X2BA 3TF5A 4TMYA 3DB2A 2VR1A 2C2HA 1A9PA 5HIJA 1VA4A 1AF4A 2NSHA 2Q5IA 3AR4A 5CPBA 3GLGE 5IAOA 5LMNB 3LP5A 5E95A 1N25A 1G2PA 1TO2E 2EEZA 4URUR 3QVMA 2ORYA 3R7BA 2BFCA 1HL3A 3VI3B 1XMPA 1GFIA 4IEIA 3FFAA 3BCUA 4EEZA 3EPRA 1MPTA 3HDJA 3FRHA 4HXEB 2G71A 4WJZA 1XAHA 1K6MA 1UADA 2X13A 4RFSA 2WKWA 2ZUTA 5THKA 3X1JA 3WAGA 1PU2A 5LZ9A 1VDZA 1R0RE 1XZ8A 3DBHB 4UVGA 1F0KA 4TGLA 3L5OA 1N1EA 1CBUA 1OFHA 1Z4LA 2BAGA 1Y8RB 2HUNA 1HTBA 3H1TA 2OYSA 3NVAA 3OO0A 5LR6A 5BVGA 2NU6B 4HR7A 5EIFA 4RSHA 1QFJA 4PG5A 3ILVA 1QHEA 4QBKA 3H97A 3NHMA 4LPKA 4NZOA 3UKOA 1DU4A 5JAHA 1SOUA 3HC7A 3TZLA 1XF9A 3KE9A 5FBRB 3DLBA 3V1YA 4RDHA 4LBWA 5FWXB 3K9WA 4E2XA 3IEUA 1XBTA 3JYPA 3OQMA 1HYQA 3JARB 3R3ZA 4JFRA 4ND4A 4OFZA 5CIWA 4EX6A 2P62A 1QVRA 4YUZA 1KMIY 1S8FA 2PY6A 3EGIA 3LZCA 1XNGA 1OXKB 1XAJA 1ZL2A 4LXHA 4O4JB 4UNRA 2FWPA 3A11A 3UUFA 4R2JA 4WKBA 2XYGA 1B2LA 4XDHA 1R3UA 4L2IA 3RTGA 1OXXK 3QTBA 3Q2OA 4FEGA 4YMIA 2AJ8A 2DKNA 2J9RA 2XMQA 5HF8A 1Y6GA 1L7RA 1IQRA 1C0PA 1JHPA 1UZLA 5A3VA 4JQSA 3F3MA 2ZWIA 2OHOA 4GI5A 3Q5GA 4NK4A 5AJVB 1ONSA 2BEJA 1SIBE 4DJDC 1S9HA 3TOCA 1L8AA 4MVXA 4RTRA 5DHTA 1FUIA 4JJAA 1DTEA 4FYKA 3RWOA 4AO6A 4H7PA 2WFLA 3UWDA 3LUFA 2FEKA 1JEJA 1UK6A 1VIMA 2Y3IA 4L15A 4ZQGA 4CIYA 1NUUA 3BMCB 3ZD6A 4G6ZA 1TEHA 5HM8A 2ZUCA 2GASA 4R05A 4ZEOA 2CXOA 5BYJA 8ADHA 4A82A 3UTDA 1KSGA 4MMXB 5A71A 4JT9A 1JR2A 2BKAA 1DWPA 3QXJA 4I99A 2DHRA 1XZNA 4E5NA 1UJ5A 1TF5A 1SXGA 3HKBB 5DJ5A 4BEVA 4NVRA 1R5BA 2PX3A 5ILGA 1M34A 2JFZA 3WJ2A 4IV8A 4PO8A 1QIDA 2G9UA 3NONA 5DNYB 3ZHCA 1LI7A 1IL0A 4GP9A 4DTCA 2IHTA 2XHZA 3TVDA 5D1HA 3AERA 4TMXA 1GTL1 1YHZA 3WSTA 3LLUA 5JYCA 2HBQA 4S1TA 5AKGA 5P21A 4M8SA 4XQ0A 5L4SA 1DIAA 2ZVPX 5IT4A 4FGZA 2EIXA 3GGPA 4IMIB 5DM1A 2VRWA 3ZX4A 2P75A 5TGDA 3USES 3SSNA 3WDKA 2WB2A 5CT6A 3B7WA 1YSCA 3EMBA 1FYXA 1TM3E 5JDCC 1M8JA 3P9PA 4NNPA 4YJGB 4RKYA 3A4YA 2ZKIA 3JQQA 4HT3B 1SOVA 3VSEA 3G1WA 4DQDA 2ZIEA 1T9HA 2V8BA 4BV2A 3VNQA 1YA8A 1KJZA 1RI4A 1D9XA 4ICIA 1FIUA 1GCIA 5F2OA 3V4SA 1VL8A 2WM2A 3OKFA 5K09A 1JEEA 1K5GA 5EJAA 3TCKA 3DEIA 2XCUA 3BXOA 1JDBC 4M1YA 3ETCA 1YBHA 5TS2A 5KPDA 2H5EA 1L5QA 2WJVA 1ZH4A 4AJPA 2DECA 5BSVA 1K4KA 2G9RA 4BUCA 3VA7A 3BIWA 1JMVA 4MW7A 4AUKA 1KYYA 1ZJ6A 1JHAA 3HV2A 4KI0A 4JNCA 3PXBA 4KE6A 3KELA 5LL6P 2AZXA 1GWNA 4XVQA 1ZDMA 2EWWA 3MJFA 3R74A 1AKVA 1PR2A 2XZTA 4NZZA 3R3WA 1LPNA 2ORWA 5JD5A 4BXOA 2CL7X 1Y5LA 3W7VA 2HU7A 4D0NA 1E0JA 1FVOA 1NSFA 1SUCA 1TK9A 2IYWA 3P94A 2O8FA 4ZOCA 5FBWB 5CXXA 4DABA 2WTAA 3GVXA 1V11B 3G13A 4ZOLA 2Q4OA 1AM4D 2QBYB 1PIWA 1M2NA 1BMFA 3CUEF 3DBOB 3SP1A 4C43A 4KO3S 2I1LA 3FH0A 1NZFA 1Z6QA 3MB8A 1TCVA 3GLGB 3KEQA 5EJ5A 1A8QA 1I2AA 3FXAA 3OQJA 5BSFA 5BWBA 2FN3A 2YWEA 3LKZA 2LTAA 4ARSA 1X80B 2G9ZA 3D3QA 3KXDA 4G0OA 2A9JA 5FH9A 4YR9A 3W5CA 1C4KA 1IBKB 1JB9A 4FSDA 3FYUB 3A04A 1JHZA 3I3OA 4HX2A 4IMPA 4U2EA 3TPCA 4CL2A 2FZCA 4H31A 5K3FB 1UANA 5KJ1A 2OCDA 3LYHA 1YVPA 3B3QA 2YINC 5LZ8A 3W34A 1GITA 1NVVR 5FA5A 4YPOA 3C2QA 5BY2A 3FUTA 4XLZA 4L3OA 3VZPA 5LQCA 1RRPA 1RRMA 2H1CA 1UP7A 2QGZA 3DO6A 3WR5A 3CW8X 1Y48E 1HNXB 1EFHA 1IN8A 3MWKA 2V6GA 1NXTA 3B52X 1AZLA 1SRRA 1ZA1A 3DBLA 4YCJA 5JJKA 4C7MA