1U4OA

Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedicarboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
309
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Mapping the binding site for gossypol-like inhibitors of Plasmodium falciparum lactate dehydrogenase.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 112
structure length 309
sequence length 318
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u4oA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1u4oA02
4N7RA 2C59A 1LDNA 2ZQZA 1E6EA 3NDRA 3LZ6A 4ND2A 3BMCB 5IDWA 4J7XA 3TWOA 1E3SA 1W8DA 4GLLA 1G0OA 4N5MA 5GZ3A 3P2OA 2I99A 3N74A 3PHGA 1PR3A 4J49A 1B26A 4Q39A 4NIMA 2FR8A 1JA9A 3WGYA 2O3JA 2G82A 5TT1A 1XQ1A 5TGDA 1QSGA 3RUIA 1EVIA 3G3EA 2D2IA 4AJEA 3HDYA 1PL8A 5IF3A 4BQRA 4EW6A 1PR9A 2GN8A 3GEDA 1XYGA 3H9UA 1E7WA 1EDOA 4RL6A 1ULSA 4XRRA 2EJWA 3FNEA 5KJ6A 4DRYA 1HE2A 1LDMA 4ZD6A 4BMNA 3JV7A 1ZK4A 3WMWA 1YBAA 4M54A 1H5QA 2CDAA 4NQZA 3GF4A 3ZWOA 1NWCA 1J5PA 4HFMA 3PLNA 4MIEA 3VOSA 1Y9EA 3LYLA 4RF2A 2ZIZA 3IOYA 1A7AA 2O3UA 1PGOA 2BFPA 2D59A 2C5AA 3V1YA 1YRLA 3PGXA 3AM5A 5I7FA 3TZHA 3D3WB 2VZ8A 4II3A 4PLCA 1P1IA 2PD6A 2I6TA 3ZGYA 3S2GA 1L7DA 5COQA 1ONOA 4B3JA 3GH3A 1I3NA 1E3JA 1ONNA 4OJNA 3RUDA 4FSHA 3VPSA 4YJHA 3KVOA 4DGSA 4DXHA 2WDZA 4BNYA 3H8VA 4UUNA 4DIBA 4PLFA 2ZKLA 2VTEA 1NXQA 3NJ4A 4JJFA 1K0UA 5THKA 5JFOA 1CWUA 3ADPA 4PLWA 1WMAA 3NT2A 5BSEA 3MCVA 2O2SA 2ZYGA 3NYWA 2Y0EA 1HDOA 1E77A 1LRJA 1NPTO 1R4MA 2PD3A 1SCUA 3G0OA 1BMDA 4FOOA 1HRDA 1DB3A 3WGZA 4WEQA 2DFDA 2EKLA 3QQPA 4U0JA 4NK4A 3AU9A 4UEJA 3GNQA 4ALLA 4GX2A 1H9AA 1ZK1A 1XLTA 4I9HA 4BMSA 3F47A 1F8GA 4B3HA 3WNVA 5JC1A 1M76A 1V35A 4B4VA 4DLBA 3AI1A 2AEMA 3UFXA 3K8ZA 1AN9A 5G4LA 3GAFA 1ID1A 4WEOA 2PWZA 5KJCA 2C7VA 2C2YA 2EWMA 1SC6A 3CPSA 3F4BA 3LT1A 2EHDA 5LCXA 1JVBA 5CPBA 2BKAA 3ASUA 4K9DA 2RHCA 3BMOB 4XD2A 3H9GA 5EN4A 3OH8A 2JKVA 2VZ0A 1YOVB 1LSUA 4P38A 1RM3A 1LDYA 1T25A 1DEHA 2Y1DA 1GADO 3EVNA 4OMUA 4Z0PA 1L1FA 3ST7A 2YHIB 1XSEA 2E49A 4CMEA 1X7HA 3HNPA 4HUJA 1AHHA 1ISMA 3JQAA 4IIUA 1L7EA 4QQRA 1MC5A 4RVUA 2PKQO 2J8ZA 1H2BA 5KVVA 1G6KA 3MJ4A 1E1LA 4IDBA 3UN1A 1ZK2A 4FR5A 3ZU3A 4YAKA 4RF4A 2FSSA 3NDJA 1HTBA 2Q4EA 1NAIA 1DRVA 3I5MA 5HRUA 2HJSA 5JW6A 4NBTA 1T2DA 3WSVA 3SC6A 3CH6A 3WQQA 3O4RA 4WCFC 1GZ4A 2NVWA 2ZCVA 1LSOA 4PLTA 1VM6A 3STHA 2E4AA 3G79A 3RC9A 2V65A 4WKGA 2RBEA 4NFYA 4OQZA 4R68A 1Y9AA 3RKUA 2ZTMA 5DZSA 5COBA 4ND3A 4RGBA 4BNZA 1PTJA 4E5KA 3PJGA 5ILGA 5I9LA 2Q4BA 4U7WA 2BFAA 3IJRA 3Q3CA 3F5QA 4J0EA 4BL5A 1UR5A 4IUYA 4B8WA 4WCFA 1U9JA 4DQUA 2YDYA 4YA6A 2HCTA 4J1QA 4CM1A 5A03A 3GLQA 3S8MA 1I0ZA 1JN0A 4L75A 1XWFA 3QW2A 4KQWA 5DCWA 3ANMA 3PIIA 4BHTA 5JYDA 2PZKA 1N7HA 3M1AA 5ENDA 5I8WA 1GQ2A 2B5VA 3NV9A 2X8LA 3QWIA 4MINA 2NACA 3NTQA 4BNWA 5G4KA 1FDSA 4IGEA 2AG8A 2DBRA 1YONA 4CR6A 1C0KA 4YBZA 2E82A 4NJOA 4OOFA 3HFGA 3I9MA 1PJ2A 3E6AA 3ABIA 4RV9A 3VTZA 1LDGA 4WK6A 3HHPA 2IODA 4GSLA 5B12A 1NP3A 3JQFC 1Y5MA 4OXNA 4FFRA 1ORRA 3JQBA 4J4TA 1JAYA 4D3DA 4ZVVA 2ZK7A 3INTA 5A05A 1Q7GA 4ZHSA 1Q0LA 4LCJA 1QYDA 3AOGA 4FOSA 3ZNQA 3MTJA 4TRNA 2UDPA 4IDCA 4R5MA 1E7SA 2WYWA 1EK5A 3PRJA 4II2A 4P4LA 4EUEA 3VKUA 3DTTA 3RU9A 4Y9DA 3JQFA 5EJ2A 3RUEA 4PG6A 4YT5A 4EGFA 4F3YA 3ZNNA 4AVYA 4FN4A 1QLHA 2O7QA 3DOCA 4C4OA 1PJBA 4BNHA 3UKOA 4EEZA 3WOHA 4Q3BA 4CLRB 4M49A 4YVFA 2ET6A 2C82A 3E8XA 1Y8QA 2BGKA 2VNAA 3Q2KA 1ZKMA 5LDHA 2H9IA 4FFOA 2BELA 4AICA 4CV0A 5JAMA 2NUAA 3OQ1A 1DIBA 3NUGA 3BTOA 3QIVA 4BO4A 5TIIA 1U3TA 3L4BC 3DBLB 3WGQA 4MIYA 3DB2A 4K26A 4HNGA 1DIAA 4ZQFA 2JFHA 5KOIA 4IJUA 2HK9A 2WD7B 4R3WA 3WWZA 3GZNB 4NPCA 4CLHA 1JWAB 2IXAA 4W7HA 1GTMA 1NNUA 3PIDA 4O63O 2VHWA 3D5QA 5DCYA 1EE2A 2VTDA 2XXJA 3GGOA 3ZHYA 4RVSA 3JQ8A 4WLVA 3D3WA 2DKNA 4OIMA 4BUCA 1VPDA 1HZJA 3M1LA 3HFSA 4J6FA 4GL4A 5EIOA 1GCUA 1NVTA 4LSWA 2GERA 3DBHB 5JO9A 4NFSA 3SLGA 3HSKA 3L4SO 2V6GA 2POQX 3H6KA 3RC7A 4YQYA 4J4BA 1EUCA 4KUHA 4CJXA 1P3DA 4E2WA 2VHVA 5BR7A 2NQTA 5CP8A 4FS3A 4YWJA 1ZVMA 1N1EA 2NQ8A 2OORA 2X6TA 2YW9A 3QRWA 3U49A 2RH8A 5EQDA 5THQA 5A9SA 2P5UA 1MV8A 2HJRA 1DDOA 3LC1O 4Z9YA 3TZQA 1TLTA 4N18A 5CDSA 4WLNA 1UXIA 3EHEA 1HE5A 2D5AA 3C1OA 1VLLA 3DWFA 3R3SA 2WE8A 3QHAA 3PQEA 1PL6A 1K89A 1PL7A 4D42A 1ZNQO 3PJEA 1LLQA 2NNLD 4WE3A 3HWRA 1A7KA 1SEPA 5TQVA 1GV0A 4TRMA 3C24A 1P74A 3KETA 3KV3O 1PGQA 4NBRA 1Q7CA 3HB4X 3OIDA 4IDGA 7ADHA 5AQ1A 3WIDA 2QHXA 4NG5A 5KJEA 3WQRA 4JJIA 2NU7A 3TOZA 3JTMA 3P7MA 1SBYA 2QX7A 2EJVA 4NJMA 2X9NA 4W7IA 4QT0A 3VH2A 3ASVA 2OBNA 3HDJA 4OYRA 1YBVA 2BD0A 4Z3DA 1R0LA 3PWZA 4X54A 2BRUA 1E7RA 1TVEA 1MFPA 2IZ0A 3EUWA 3LLSA 4MVJI 1PS9A 3QE3A 2ILTA 2J3IA 1I3LA 3JQAD 3D1LA 1FDVA 1W0CA 1RYDA 2JAPA 1Q0QA 1O94A 3PHLA 4KZPA 4RZHA 1HXHA 1D7OA 2R2GA 2ZJ0A 3FHLA 4L74A 4JQCA 1J4AA 5KJ1A 3AUTA 2Y1GA 4KUGA 3FTNA 2GUGA 4UEKA 4EJ6A 3C3XA 4A2CA 3HZZA 4RPGA 4Z0TA 1YB1A 3WGHA 2Y68A 3DEYX 4J0FA 1P0FA 1C1DB 1NR1A 1VJ1A 4RPHA 3W4IA 2QRLA 2CNBA 2OMEA 2IEDA 4XB2A 1O6ZA 5KCZA 2OP1A 3E9QA 3CMCO 4D41A 2BHLA 4LW8A 3T7CA 2FN7A 4BKRA 4FC7A 4R4JA 4R5HA 2GDZA 2EP5A 4AG3A 3U5TA 1VJ0A 1EFKA 4RQTA 3VAZA 5L9AA 3Q9NA 3JSAA 3O8QB 3BHJA 4FFLA 1GUYA 1NASA 3EK2A 1YQGA 5IZCC 5TRTA 3DTYA 4ALNA 1HLPA 1H6BA 1LRLA 1IPEA 1Z6ZA 2RAFA 3K92A 4YTEA 4XEHA 2GN4A 5A3VA 4YJFB 1K2WA 4Q3DA 5CDTA 2B4TO 3JD4A 4KTVE 2G1UA 3I1JA 3VZQA 1D8AA 5B1YA 2J3KA 5U4QA 3CSDA 2YY7A 2YV3A 1PZHA 1KC3A 1X0VA 2JD0A 4JX8A 4LK3A 4J43A 4BNJA 3OQ6A 4CMBA 5IZCA 1K6XA 4PN3A 3Q6IA 1T26A 7MDHA 3H9JA 2UV8A 3WMXA 3ZU5A 2PFGA 4HWKA 1HYGA 5I9NA 1U3VA 1ZSNA 3DC2A 1N8KA 3E9NA 3G49A 2P9EA 4AJJA 1U3WA 4PLYA 5DBGA 4RO0A 2JCVA 2HLPA 1HE3A 2X0JA 3DHYA 4WUVA 3TDKA 5I8ZA 3RCBA 2G5CA 3Q1LA 4C7JA 4A0SA 2VRBA 3C1AA 1G1AA 3DAPA 4RCVA 1TT5B 5TT0A 1HDYA 2W2LD 3ZV6A 3U09A 3ZWPA 3FCOA 2JL1A 2VWGA 2PGJA 4FGSA 2AA3A 2EIHA 5GY7A 1MA0A 3PHHA 1VKOA 2VUTA 3B20A 4Z9XA 3WBBA 2O2YA 4UAGA 3WTCA 4A27A 1DHTA 1I24A 1H94A 1Y81A 4E4YA 1U8XX 4BGIA 1GZ6A 5A3JA 4GGOA 2NVBA 1BRMA 2FWMX 3BMQA 4YR9A 5JPIA 1UXHA 2C7GA 5TNXA 3A28A 4R16A 3TQHA 1FDTA 4QTZA 3GRKA 3R1IA 4RQUA 2DM6A 3C7AA 1R66A 5DOVA 4JXKA 2EG9A 1A71A 4CMIB 4CUJA 4XDZA 3GK3A 1WXDA 2W2KB 3N58A 3ONFA 3ZV4A 5KVSA 3AUUA 4XCVA 3X2EA 4BKOA 3GR6A 2J3JA 3NEPX 5KKAA 4F6CA 2Q1UA 3SLKA 3MWDB 1N5DA 2Z1MA 3GVPA 3DOOA 3LVFO 1N9GB 4E6PA 3NDIA 1V3VA 3OETA 3KXDA 1XEAA 1AE1A 2WTBA 1ISHA 2UAGA 4S3MA 4ALKA 5GMOA 3QWFA 2OHXA 3F3SA 5JAZA 4YJDA 3INRA 1M2WA 2BH9A 1MX3A 4WECA 4BNGA 1OAAA 4FGWA 1Y6JA 2HMWA 4UUOA 3TJRA 2FSVA 5K9ZA 4OKIA 4DBZA 1GL3A 1I2CA 1XU7A 1H0KA 2Q45A 4MVJE 1BXGA 2Y1OA 3ZU2A 3C7DB 4R69A 1X1EA 1DJNA 3F5SA 3KOUA 1HLDA 1WPQA 3GC6A 4FJ0A 3LC2O 3KYDB 1W4ZA 1YVEI 4IDEA 1B14A 1U28A 4TRRA 5H83A 1X7GA 5TJ9A 1VL0A 3EMKA 4IZIA 2Y93A 5G0SA 5T67A 3CIFA 1NM5A 3K30A 2Q3EA 4R1SA 2B69A 1A27A 3RI3A 1UP6A 1S7CA 4XYLA 2X9VA 4RDHA 1B2LA 3WFJA 2C2XA 3WLFA 4A5OA 1YDWA 3V1TC 4DYVA 4CM9D 2H6EA 4MVJG 3B1KA 5FFFA 4BGEA 3DDNA 3LU1A 1YXMA 1QXSA 2UYYA 3LF1A 6LDHA 1AUPA 2DPHA 3S2IA 4DYDA 1P33A 4GI2A 4CM4A 1WDLA 3JQ6A 1BVRA 4LGVA 3D4PA 3PYXA 2NLOA 5A9TA 3M2PA 4DL9A 5T6BA 3QWBA 4D79A 3V8BA 5CDGA 4CUZA 6ADHA 3GZ4A 4P4GA 3GUCA 1PQWA 3DBRA 1QYWA 3UH1A 4ZQGA 1Z74A 1QV6A 4JCOA 3JCZA 4GWKA 1GY8A 2VOJA 1PGNA 4WJZA 4BO2A 4CV2A 4PG5A 3SEFA 1V8BA 1Y5RA 4IXWA 3RBVA 1UAGA 1HDCA 4XIYA 3SXPA 4TKMA 1E7QA 3HN7A 3TFQA 3Q9UA 4MJLA 4IJVA 3SC4A 3OBBA 1MGOA 1ZUD1 2C07A 1R15A 1F0YA 4JIGA 2H5LA 3FPLA 1UZLA 1Z7EA 3D3EA 4CMKA 2NTVA 3IC5A 1KY5A 5JE8A 1VC2A 2HMTA 2JD2A 2OOSA 3RJ5A 4CM8B 4BNMA 4EI2A 4MP6A 2YJZA 1HWYA 4IINA 3OF2A 4OM8A 3TPCA 1JU9A 3PJFA 8LDHA 1GZ3A 2DTXA 2F00A 5BSHA 5AXAA 5T64A 1EE9A 1E3EA 4EEXA 3IP1A 3NTRA 3OA0A 1PWXA 1BTOA 3MOIA 1K6IA 3MJTA 4YYZA 1PS0A 1VI2A 1MG5A 1NVMB 2X5KO 1I30A 3GGPA 5T8KC 3K96A 4F46A 4D0SA 1EUZA 2HO5A 5CFZA 5CDYA 2O23A 3U9LA 4DMMA 1WMBA 2I76A 3JQ7B 4QO8A 4IGFA 3TRIA 1FDWA 3O9ZA 2NTNA 2B36A 1P44A 3D5TA 4XGKA 2WYVA 2X5OA 2PA3A 5JAIA 3H4VA 1IZ0A 1P1KA 4JBGA 5AXCA 3DL2A 3D7LA 4E5NA 1F17A 1QORA 5T8KA 1IHYA 1LC3A 4IY1A 3KLPX 4RVGA 4TSKA 1O0SA 5IFLA 1QYXA 1CQJA 3VDRA 4AJOA 3WFIA 3EZYA 1M6HA 1QYCA 2DTDA 3VZSA 4MO2A 1FK8A 3ROKA 3L6OO 1I3KA 3HUDA 4QEDA 2Q1SA 1M66A 1LDEA 4HFJA 4WNCA 1KEVA 4A10A 2GZ3A 1U7HA 2SCUA 4PCVA 1HF3A 2B5WA 2WJPA 5A9RA 1V3TA 1YBMA 5TX7A 2Q2QA 4AJ1A 1C14A 1RKXA 4J7UA 1NHWA 1FF9A 4GMGA 4JGBA 2HMVA 1QG6A 4TVOA 2FHSA 3KBOA 2BI8A 2ZB8A 3H2SA 2HAEA 1WVGA 4BGUA 4U5QA 2VHYA 4TVBA 1A4IA 4ZRNA 2IXBA 1BXKA 4J16A 2CF5A 5CEFA 5EQFA 1MP0A 1WWKA 4DC1A 1U7TA 1ZIDA 4NR0A 4F45A 1HT0A 2BMAA 2FP4A 1IHXA 2O4CA 3AI2A 4IM7A 1NYTA 3ROPA 4BNFA 4A73A 1BW9A 3E5RA 5GZ6A 1ZXBA 1LSJA 4BNXA 3JYPA 2GZ1A 2AG5A 1LU9A 3U4DA 3WWYA 1GD1O 2BFOA 3KUXA 1GU7A 3ORFA 2IYPA 3AI3A 3HE3A 4CM5A 4CMEC 3PQFA 4L8VA 1EBUA 3QVSA 1GQYA 2I3AA 1QLJA 1ZK0A 1DBVO 3PVZA 1C1XB 4OQYA 4FW8A 1WDKA 3U4IA 4O0LA 3WB9A 4QX6A 3KHUA 4YRAA 2B0JA 1XELA 2AQ8A 2PGDA 2GYYA 1DHRA 2OP0A 1CERA 3BA1A 1GV1A 3PI7A 3IL2A 4DIFA 2DUWA 4ALMA 4CQMB 3B1FA 2EGHA 1CRWG 4GKBA 1E5LA 3DMYA 3Q0EA 1EVJA 2C29D 1I01A 1R0KA 1SEVA 2CUKA 2VYVD 3BMNA 4I8XA 1VRWA 3KYBA 1TEHA 4D0RA 3GOHA 3I3OA 2DFVA 1DRWA 4JP2A 3WYBA 2WD8A 4XR9A 3RBXA 2I67A 4B4UA 1X0XA 2AE1A 3OIFA 3COSA 5F3RA 2JFFA 4TMFA 2NVUB 5I7VA 1H9BA 1PSDA 5TS3A 1KC1A 2E6UX 4UUPA 4FBGA 3WICA 4D3SA 4EYEA 3WS7A 3O26A 2P68A 5ES3A 4B3IA 4GSKA 1ZMOA 4H7PA 5A02A 9LDBA 4DTIA 3AWDA 2YQ4A 4HBGA 1W6UA 1XCBA 2A35A 2IDZA 2V7PA 1BDMA 4XDYA 1BG6A 1DSSG 3DAGA 1YB5A 4JN6B 5B4TA 3JQEA 2CVOA 3OJFA 5IXSA 5ENVA 4UULA 3L07A 3FNGA 1HKUA 3QA9A 4TZTA 2H1SA 3JYOA 1DFHA 1H6AA 2FRDA 3LT4A 4ZU3A 4RPLA 1UJMA 3UVEA 1YQDA 1QMGA 4CL3A 2HK7A 4URFA 3K6JA 2A4KA 3PQDA 2IZZA 3LQFA 1BDBA 1K5HA 4CLOB 2I9PA 1E7YA 2YHUA 3IIEA 4DREA 3BHMA 1NQ5A 4CM3A 4FPXA 4E33A 3AY7A 1A72A 4MKZA 4N54A 2GN6A 3JQBC 3BZUA 2GASA 4BO0A 5JXWA 3T7EA 2EW8A 4XQEA 3W8FA 1R4NB 3CE6A 4J91A 4BV9A 5JC8A 4KUEA 1NQOA 3KO8A 4CQLB 3T4EA 3CZMA 2PKRA 4F6LA 3UAGA 4YJGB 2E48A 4U6QA 4B4OA 3TF5A 5LDGA 1U3UA 2J5QA 5KVQA 2HMSA 3I83A 1YGYA 2G76A 3QVWA 1Q2XA 2B4QA 2ZATA 3UCEA 2WSBA 5H81A 3W4KA 2JJYA 4GQAA 1H93A 3ZHZA 1EDZA 1UZNA 5HBRA 4BNKA 2O3TA 3LSYA 1ISJA 1KOLA 1PZGA 2CVZA 2W2LA 3BMCA 4DA9A 2D4AA 3OEYA 1XA0A 4DMLA 1KVRA 3ZCXA 1BSVA 3ZWMA 1NTOA 5EMHA 1S6YA 3CEAA 1NQAO 1KEWA 1LLDA 3G1TA 1PS8A 1ADGA 4CODB 3KSZO 4E13A 2HKIA 4J9UE 3SX2A 4YACA 4GX0A 1NPDA 3NTOA 1SB8A 1LA2A 2CMDA 4GLOA 2Q2VA 3AW9A 3H5AA 3EGOA 4LRSB 4BO3A 1GAEO 1RM5A 4OXYA 4R01A 1I3MA 4KMSA 4DIOA 3IDSA 4NU5A 1LLUA 4E21A 3WLEA 5F21A 3FTPA 4IS2A 3GRPA 4BQPA 4J90A 5IG2A 1BWSA 3ON5A 4GKVA 4J9VA 5JMWA 3VH1A 2B35A 4AJ2A 3WGOA 5C7OO 2GF2A 4PLHA 4RLSA 1JKIA 4ZQHA 4FFNA 4CM6A 3TL3A 1ONPA 3E03A 4QECA 3WBFA 2WYUA 4O5OA 4EBFA 4Q3AA 5L45A 4BO7A 3RVDA 1WZEA 3EDMA 1E3WB 4E31A 4QO7A 1WW8A 1CYDA 4GVLA 2VZ9A 2ZJ1A 1MLDA 3MJVA 4CMCA 4PRKA 1LQUA 4YEDA 3JQCA 4RLHA 3KZVA 2VRCD 3PLRA 4Y98A 3HG7A 3TNLA 3BIOA 3OHSX 1D1SA 4KDFA 4NDNE 4YT4A 3PFFA 2Z1NA 1PJTA 4PGFA 1F06A 2B83A 2EW2A 4LVCA 3JQDA 2QQ5A 3FI9A 4U0KA 5DBIA 2JCXA 4P8RA 4XQCA 4FFMA 2YV2A 4CPDA 1G0NA 4DPMA 3GNSA 2Y1CA 2HRBA 2J3HA 1PJCA 3U3XA 4E2ZA 5L4SA 3E9MA 5DDIP 3U0BA 1BGVA 3FD8A 2YYYA 1QP8A 4PFJA 1OC2A 1GEEA 3H2ZA 4CV1A 2YUTA 4DLAA 3MJSA 4CM9A 2IE0A 1P0CA 2ZTVA 2FZWA 4EUHA 4NBVA 3PWKA 4QFDA 1ADBA 4IQ0A 4OHUA 3F4LA 3OJEA 2EV9A 3LF2A 4BNTA 4XJSA 4MVJH 3JD3A 4RORA 2VHZA 3QVXA 3RU7A 3ZU4A 1J6UA 2I65A 3NGLA 3WJ7A 2OGUA 2CD9A 3IJPA 3M6IA 1T1RA 2A92A 2DT5A 4RVDA 3BMOA 2FR0A 5EESA 4KQXA 2Z5LA 3RSHA 3GVCA 1V3UA 1YOVA 1HYEA 5DP1A 5L4LA 4EJMA 2OO5A 4IJWA 2YHIA 1T4DA 1ZXLA 5F1KA 3OJ0A 1I32A 3C7CB 2XAAA 1E6WA 3H3FA 4TZKA 3AOEA 4ND5A 1HDGO 1R6DA 1VL8A 4BS9A 3DZKA 4Y6SA 3LK7A 2PR2A 4XZ3A 3JQ9A 4K6FA 4WGGA 1NX6A 1LBEA 1PJQA 3C85A 1GFSA 4A7PA 1IPFA 1XQ6A 2V6BA 2VWPA 2DU8A 3WGGA 4DPKA 1KVUA 1UDCA 3ONEA 3EAGA 1IULA 1X7DA 4FCCA 1DJQA 4XA8A 2VHXA 3QY9A 2FPGA 5ICSA 1ADCA 1LX6A 4E30A 1EZ4A 1XKQA 1MUUA 3GDGA 3V2HA 2JHFA 2PK3A 2ZCUA 3ONDA 2FPPA 3WR5A 3JQGB 2WMDA 4R1TA 1XDWA 1ARZA 3EVTA 3HADA 1LLCA 1YH3A 4UUMA 4WCDA 4IDAA 2EF1A 4JBHA 4L4XA 1B16A 2NV6A 3FF4A 4E3ZA 3AK4A 2AQKA 3PHJA 3ZH2A 4Z6KA 3ETDA 1PGPA 1GPJA 3TFOA 1IY8A 1RYEA 4XYMA 1SB9A 3P2YA 3Q2IA 3OEWA 2CVQA 4J4HA 4LMPA 1TA4A 3H7AA 4D3FA 1EBFA 4I5FA 3VTFA 5BSFA 3VZPA 1KVQA 3KTDA 2X0IA 3I9KA 5HS4A 4BIIA 4PLVA 1I33A 4HV4A 3IKTA 3VHRA 3W4JA 4HX5A 1PGJA 3FN4A 3SJ7A 4ZICA 1AXEA 1SZJG 3RQSA 5JO0A 1UAYA 1R4NA 5KIAA 4NU6A 2QRJA 4ITUA 4GVXA 2VCYA 4BKPA 4BB5A 3ZWCA 1VE9A 4IQGA 1SOVA 3GVIA 1VSVA 3JD2A 1UZMA 1MG0A 1KVTA 1ULUA 1A9YA 1DRUA 4MOWA 1IE3A 3R6DA 3I9NA 4R41A 1NVGA 1KBZA 2GR9A 3KEOA 2GO1A 1GPDG 3TOXA 1J49A 4EDFA 4I08A 3ENKA 1QYVA 1M67A 4E2XA 1B7GO 1EFLA 4YDRA 4E5YA 1T1SA 4YJHB 4BMVA 4W9NA 3DZBA 4NBUA 1F12A 4S1VA 4J2OA 1HSZA 1I10A 4HY3A 4RF5A 4AJIA 5IAAA 2HQ1A 4HP8A 3LC7O 4CMHA 4EITA 3GG2A 4M86A 1JAXA 4XYEA 4CLRA 1DXYA 4J3FA 3ZHXA 2FR1A 5JDIC 2ZTUA 1R4MB 3KEQA 2OBYA 5JMPA 4A03A 2PZLA 5G0UA 5DCUA 2ZYAA 3F1KA 1O8CA 2EXXA 3GFGA 2PH5A 2PZJA 3K9QO 3ZWAA 3GA0A 5DULA 4YAIA 3DBLA 5G2OA 4PLGA 2PY6A 3UOGA 4M89A 5BT9A 5DP2A 4FDAA 4KWIA 2WD7A 5JDIA 3ZNPA 3GZNA 4B7UA 1X13A 3LDHA 4OL9A 1OZAA 1RJWA 5IDXA 4KP7A 4M87A 3AY3A 2BLLA 1PZFA 4ZJUA 3D64A 4L73A 1I8TA 1KEUA 2A94A 2VOEA 3C8MA 1B3BA 3JYNA 2VT2A 3VZRA 1KY4A 2AQIA 1TI7A 2FZEA 2VYVA 3E82A 2AE2A 3ITDA 5HS6A 3ZW8A 2D8AA 3NT5A 2NU6A 4BNVA 3WDSA 4I5DA 4E5PA 4HXYA 2ZYDA 1ZSVA 1HZZA 3MJCA 1JW9B 3DBHA 3FWNA 4HFNA 1GUFA 1YL6A 3L9WA 1FDUA 2X0NA 1OOEA 3QP9A 3PDUA 3GG9A 3JQAB 3ITKA 3I9LA 4WLFA 1K6JA 3QLJA 2OZPA 1PIWA 1YWGO 2YV1A 1O9BA 3KRTA 5FYDA 1ENPA 3BAZA 1FXSA 4GAEA 1FMCA 4BVAA 3EZLA 1HDZA 3KB6A 1WDMA 4ONEA 1MB4A 4M8SA 2QRKA 4M55A 4G2NA 4NNJA 3RWBA 3V2UA 2X23A 1XR3A 3HJAA 4DPLA 2GGSA 4MPDA 3RKRA 3UCXA 1CDOA 5I7SA 2QYTA 4H3VA 3U62A 3NRCA 4XR4A 2AEFA 4OH1A 3ZDFA 4AJKA 1LXCA 1HSOA 2DBVO 1Z73A 4JROA 4E12A 2Q50A 4RVHA 2NM0A 1ENOA 2EERA 3WNQA 3RFXA 1PJSA 4WLUA 4AJPA 3FBGA 4WCFB 3C1TA 4XJTA 4A26A 3WXBA 5JSFA 1ISGA 5AXBA 1NHGA 2QIOA 4PG8A 5KVCA 1LSSA 5K0ZA 2FPIA 2Y66A 4R54A 3PWSA 4AL4A 5F1PA 1ISFA 4IPTA 2O3SA 1UDAA 1ZBQA 3ZW9A 1O95A 2AHRA 2D1YA 2VYND 3B1JA 4AJHA 5IDQA 4XX0A 1R0SA 1KYQA 1IZ9A 4HFRA 3B6ZA 4NHEA 5B4VA 5JY1A 4H15A 3QVOA 3PHIA 1C1DA 3OM9A 2GLXA 1K3TA 2CF6A 3PZRA 1W73A 3QSGA 2Q46A 3ULKA 3GY0A 1KVSA 4INAA 3GVXA 5T5QA 3GNTA 2NU8A 3V5NA 1CETA 1N1GA 3AU8A 2RH4A 1SNYA 2R6JA 1FJHA 2X5JO 4W6ZA 5G0VA 2XF8A 5CAEA 4BB6A 4AJNA 1PQPA 1QRRA 4E2YA 3ZZNA 3O8QA 3CINA 1NPYA 2HDHA 4XRGA 3ZI0A 5FEUA 2PLAA 4GBJA 1JQBA 4WOJA 4CLDA 2GNAA 4GGPA 3ENNA 1DC6A 4IMRA 4CMJA 1P1JA 2IYOA 4G65A 4YJFA 5L3ZA 2Y05A 4ID9A 1DLJA 3IKVA 4ROSA 3GPDG 3WTBA 4NI5A 3PJDA 2Q99A 1P31A 4BO1A 2QYSA 3N7UA 1PZEA 3PZBA 1V6AA 2X7HA 1LJ8A 1IOLA 1Y8QB 3OFSA 4L4RA 3IAHA 3AFNA 4BGVA 4L76A 1X15A 3RASA 4YQZA 2C0CA 1RM0A 1C0LA 2JFGA 4P22A 1VL6A 4PZDA 5C7IO 4ZA2A 2OFPA 1MC4A 1DPGA 3FRJA 3L6DA 3L0DA 1LUAA 2DLDA 3H3JA 3L77A 3W6ZA 2GZ2A 1E1NA 4J1SA 3ZWBA 3ZWNA 1N92A 4EZBA 2W4QA 3PGJA 3ETGA 1IUKA 2VRCA 3PDJA 3JQ8B 3PYLA 4CUKA 1TT5A 2TMGA 3MZ0A 2O50A 4PVCA 3QJ5A 1T2FA 3MOGA 2DUUA 3QWHA 1PU2A 3UGKA 4NZ9A 5EPOA 2DBZA 1E3IA 2X86A 1DAPA 2EKPA 3IMFA 3JYQA 4FJ2A 3RAJA 3AM4A 5A5EA 2UUOA 3RIHA 1ENYA 3FSRA 2EGGA 2AXQA 3A9WA 3R0IA 4FC6A 2VNSA 5F1OA 9LDTA 1NFFA 2Y67A 4UVHA 1HYHA 4U8GA 2P4QA 2QG4A 1E1MA 3O38A 5TF4A 4MP8A 5L7TA 3ANNA 5IDYA 3ROMA 4G5HA 4CMIA 2AMFA 2W2KA 4TWRA 4CLEA 4I9NA 4H16A 5DOZA 5A9SB 3GDOA 1DO8A 5JDCC 5HA5A 2I3GA 1V9LA 3V2GA 1A4UA 3FR8A 2O7SA 3S1LA 4R1UA 3WQSB 5A06A 3K73O 3UICA 8ADHA 3WGTA 3NJ8A 1LNQA 2XOXA 3GEMA 2NADA 4R9RA 1N9GA 5ICMA 1WNTA 1NQTA 2V6FA 2YFQA 3GFBA 4XIJA 1JKJA 4P4NA 4IBOA 3UW3A 3E18A 1F14A 4W99A 1GQQA 3A14A 4K1LA 1AXGA 1R16A 3BTVA 2DC1A 4BOYA 4FQ8A 5JDCA 1XIVA 1T2AA 3OQBA 4JNKA 4D43A 5C7LO 1KS9A 2O3RA 3F1LA 2YFHA 4G81A 4NJMB 2CFCA 1MXFA 2W98A 5L40A 1I2ZA 5G0WA 2R00C 4ILKA 4UREA 4OSOA 5CPFA 5C3MA 5JAQA 3MEQA 2OUIA 2C20A 1HDXA 3DXFA 1NBOA 1Q1NA 4HKTA 1JKFA 4XYGA 1OI7A 3ZWYA 1N7GA 5CG1A 2E37A 3RUHA 3VVBA 4EJ0A 4YPOA 1CIVA 1ISIA 3KYDA 4OGWA 1U8FO 4RPKA 4MVJF 1AGNA 4XQ9A 4Z0HO 1WAMA 4BKQA 1QKIA 2P9CA 3RUAA 2ZB3A 2HRZA 2D5CA 1PEDA 2R00A 3IUSA 3QWAA 4E5MA 2Q1WA 3GMSA 3S2FA 3TN7A 4WLEA 4HADA 2B37A 2FOIA 2J5KA 4IQ8A 3KM0A 5B37A 4Q3NA 2VUUA 3IUPA 1DAOA 3JYLA 1EK6A 3VPFA 5LC1A 2Y0DA 1D4FA 1B8PA 4XKJA 3MWEB 1Z82A 2JAHA 1DLIA 3DZHA 1PJ3A 1I36A 1P77A 4KTTE 1ZH8A 2NWQA 3AUAA 4OO3A 1HDRA 4J1TA 5CHEA 3GVHA 3VDQA 2X4GA 1CJCA 1Q0HA 3GUYA 3K5PA 4U6SA 4XYBA 4AJ4A 2CDCA 3DO5A 3I9JA 4L4SA 2NU9A 5GZ1A 3DONA 4PIVA 3FWZA 5ADHA 1A9ZA 3T4XA 1P1RA 2TMDA 3DFZA 1YDEA 2VN8A 3MJEA 2VQ3A 4IDDA 5JBIA 4RZIA 4CR7A 3NT4A 3I52A 3P19A 4TKLA 5AVOA 2AQHA 1ZW1A 5J23A 3R3JA 4LMRA 4WNIA 3VH3A 5HM8A 3OMLA 3GMDA 1GUZA 4D46A 1NFQA 3RBZA 4O6VA 4ZN6A 1HETA 3QVTA 1PJ4A 1M6WA 3CTMA 1U5CA 1PX0A 4OOEA 5KTKA 4AJLA 4CM8A 3PP8A 1IB6A 5C5IA 2ZQYA 4OAQA 3GN1A 4XB1A 3EW7A 4WASA 4TRJA 1HE4A 3PEFA 4DLLA 1LI4A 4RF3A 2DAPA 2HMUA 5JYEA 4C7KA 4R51A 3I23A 3ZWXA 4ESOA 2A9FA 3IS3A 2DQ4A 3UCFA 2NTJA 1RWBA 2HK8A 3E5MA 4Y8VA 4YAGA 1C3VA 1WZIA 4DQVA 3PFWO 2F1KA 5TJHA 4I1IA 1DOHA 1P9LA 1YQXA 3F46A 1LC0A 3VPGA 1Y8RB 3JQ7A 3OICA 4KWHA 4OSPA 1UXJA 1Z7BA 3ANLA 4TQGA 3PYMA 3ZV3A 2O48X 3EY4A 2BFMA 4YAJA 1D3AA 3G17A 1B0AA 3TZ6A 4YT2A 1YS4A 5AOVA 5BNIA 4LRTB 3OJOA 1P1FA 4B7CA 3BMQB 1EVYA 4N5LA 4ND4A 3H5RA 3W1VA 2UUPA 3A06A 4NK5A 1NFRA 1HL3A 1I5RA 3WSWA 2OL4A 4PZEA 4QUKA 1GDHA 3HN2A 1CF2O 3AY6A 4PG4A 2YZ7A 4FFPA 5L53A 3A1NA 5DN9A 5KWEA 3JD0A 5ILOA 2LDBA 3U4HA 3GN2A 4W4TA 2P9GA 4GX1A 5EERA 3TL2A 3I4CA 4IJKA 4XGNA 4EUFA 3FPCA 2QW8A 5TC4A 4DC0A 3SBOA 1PWZA 1T2EA 3ZV5A 2JD1A 1GYQA 1XU9A 1WP4A 4IMPA 4XWYA 3V1UA 1YO6A 1DIHA 2UVDA 4IIVA 1JDJA 1XG5A 4DBVO 1GYPA 1ZK3A 2PTGA 3HDQA 5L7WA 2P4HX 1E0DA 3QV1A 1BXGB 1IYZA 3DZIA 3EYWA 3GAZA 3L4BA 4WPGA 3GEGA 2ZTLA 2YDXA 4YRBA 3RJ9A 3OA2A 1PJLA 3D4NA 2P91A 3E1KA 3UXYA 5KJFA 4PRLA 3DQPA 4JLWA 5F5NA 1CQIA 4IDFA 1DFGA 4LCEA 1KERA 4Z9FA 4MDHA 1UUFA 4QSMA 1A5ZA 3CMMA 2B4RO 4WLOA 3OSUA 4B4WA 4ZRMA 1JVSA 1DIGA 5IXYA 1UXGA 2GPTA 2G0TA 5CEJA 1C1XA 5JY6A 1J0XO 4BO5A 3OIGA 3AOEC 2Z95A 4B79A 4RDIA 2VWHA 1RM4A 3DZGA 4DVJA 5MDHA 4UEOA 3WYCA 5CDUA 3F9IA 3MTGA 4NBWA 3AFMA 3JQ9C 3L9XA 1YL7A 2XPCA 5A04A 3PK0A 2YQ5A 1ENZA 4JK3A 3ADOA 4CQMA 1EEHA 4LN1A 5ER6A 5IJZA 5KNLA 1T2CA 1QR6A 2PH3A 1MXHA 4WOKA 3IQDB 3RFVA 3TZKA 5H82A 1VSUA 4CM4B 4LSMA 1U2GA 4ND1A 3VKVA 3ZHBA 5A4DA 1SOWA 4D7AA 1E7MA 1ZSYA 3X2FA 3DBRB 4RPJA 1ZFNA 2FMUA 3KYCB 4L9RA 1WLYA 2IEBA 4PVDA 4O59O 2J6IA 2IRWA 5BNFA 2HSDA 2VYNA 3GT0A 3DZJA 4FIZA 5IZ4A 1OFGA 2NVUA 4D45A 2QZ9A 4I5EA 3KSDO 2CZCA 3H9EO 1YKFA 1JLLA 5BSGA 3KSUA 4Y67A 1V0JA 1EUDA 3P5SA 1ZJYA 2W90A 5COAA 4J1NA 2X58A 3NX4A 1ML3A 2D0IA 3AUSA 4DQXA 5FWNA 5JCJA 4J7CA 1TXGA 4R9SA 1AHIA 2CSUA 1ADFA 4Y6RA 4GWGA 1B8VA 4QFCA 4ALIA 1H6CA 1B15A 4B7XA 1UDBA 1LDBA 4MVJA 3RC1A 5DT9A 2NSDA 4GX5A 3VVCA 3W8DA 3WYEA 1HEUA 2FY8A 3CUKA 2VUSA 1C0IA 1F8FA 4MKRA 3UF0A 5L95A 2W8ZA 3ICCA 2DVMA 2GD1O 5JLAA 3VC7A 1LEHA 4BNLA 4O1MA 4CLOA 1RPNA 3I9OA 3NGXA 3LLVA 1YB4A 4MVJM 1LTHR 1YJ8A 2PKQP 2Y1FA 5JNLA 2ZB7A 4TROA 3CXRA 1DIRA 1YL5A 4XGIA 4NFHA 1DC4A 1U1IA 2Y1EA 1SO8A 3ETEA 4E32A 3DZFA 2WEKA 5BQFA 4MP3A 2BI7A 3DBVO 2X9GA 4AFNA 4CQLA 1BXZA 4IS3A 1EVZA 1E3LA 1IL0A 4MKXA 2GRAA 2V6MA 4JBIA 3GHYA 5DF1A 4ZQBA 3GHHA 5AXDA 3IP3A 4OXKA 4YJGA 2BGMA 2AW5A 3S55A 4W9NC 5ER9A 3SJUA 3UUWA 3D4OA 1U5AA 1YJQA 1EQ2A 4UVIA 1OC4A 5EL0A 1E5QA 4BNNA 3OECA 2CDBA 3OP4A 3LT2A 2I5PO 5L51A 2C5EA 2DPGA 4Y6PA 5L7YA 1OBFO 2AEJA 4IXTA 3RD5A 3HB5X 3OJLA 2BGLA 3ZWVA 5EINA 2CY0A 4BO9A 3H65A 1ZO8A 4GH5A 3WJAA 4UVEA 1N2SA 4Q3EA 5DBFA 4BO8A 1I2BA 2GSDA 2GCGA 3CZRA 3TSCA 1H6DA 3GGGA 2ZB4A 3WG9A 1B3RA 1U4SA 5CEEA 5FI3A 3AJRA 2O4UX 5TLSA 4MIOA 3NAQA 1SPXA 1JWBB 3F6YA 3BTSA 3DFUA 1E6UA 1LQTA 4FD3A 2DTEA 4JJGA 5FI5A 1Y8RA 3RROA 3O03A 1U2DA 3FNFA 1EMDA 4NMHA 4CM7A 3M2TA 1BVUA 5FF9A 3H5NA 1BW9B 2JCYA 4GMFA 5AYVA 4DUPA 5IN4A 5L4NA 4LISA 3JD1A 3DOJA 2RCYA 4CMAA 1VJTA 5K6AC 1H2HA 4BKUA 2PGLA 3INGA 2GN9A 2PD4A 2PNFA 4BNIA 5HWSA 1E1KA 4Z3KA 3CKYA 3A4VA 4J2HA 3ZNOA 2HUNA 2QZZA 3B70A 4PLPA 5DNAA 5BNTA 1SMKA 3SVTA 3EC7A 4GPD1 3NKLA 3PTZA 4OKNA 3S2EA 2DBQA 1T24A 1UH5A 2JHGA 3PXXA 1E92A 3DR3A 4KDEA 4L0QA 4DWVA 1E3WA 1OMOA 3ICPA 4I9UA 3WX0A 3VPXA 5K6AA 3I4FA 4FJ1A 5U9CA 3RC2A 4E0BA 4K28A 2P2SA 2Q2WA 1UXKA 1EQUA 4UVGA 3WIEA 1KETA 4Q3CA 3GDFA 3ZWWA 5ITVA 1GEGA 1NR7A 1ZJZA 3RUCA 2BF7A 4CV3A 3K31A 5A5FA 2H63A 1GCOA 1QV7A 4MVJP 2WE7A 3FR7A 3BMNB 2LDXA 1D1TA 4JP3A 4NH4A 1TB4A 5C37A 4HNHA 4YRDA 2EKQA 3E48A 3BYZA 3W8EA 1PQUA 3AM3A 4M1QA 2Y99A 5TSDA 1Q7BA 5ITWA 3L6EA 4CLXA 5JCXA 3Q11A 1DC3A 2VWQA 1Z45A 2RIRA 3FBTA 1R37A 3I6IA 3K2EA 3DAFA 2X0RA 3HDHA 1UP7A 4YCAA 4PZCA 1Y1PA 1CEQA 1ZMTA 1XGKA 5T57A 4KOAA 4BV8A 2Q1TA 5F5LA 4YT8A 2EEZA 2I66A 4W82A 1O5IA 4R3NA 3BTUA 2Y0CA 4QXMA 1ZZEA 1O89A 4YAEA 5HTOA 4I5GA 1ZEJA 3PPIA 2Q49A 3DHNA 1GR0A 1ZCJA 5I9MA 5G0TA 5CG2A 3I6QA 1P45A 2X1HA 2EP7A 4CMGA 3DMTC 5I7EA 1YE3A 4CR8A 4RVFA 2C54A 2WM3A 4IZHA 5B4UA 4PLZA 4N5NA 4Q9NA 4CQMD 2WWRA 3DHEA 4ALJA 2OXIA 2PZMA 1R12A 3UHAA 3D0OA 1C0PA 2VT3A 4XQGA 3ZN2A 4BO6A 4ZGWA 3KLMX 4CL8A 1NAHA 1ZEMA 4FB5A 2XXBA 1DC5A 5MGBA 2IZ1A 4PG7A 3VPHA 1KEPA 3G1UA 4LVUA 3DMTA 4RJTA 1KIFA 1DFIA 4BNUA 1U4OA 1XHLA 3KYCA 3TZCA 3U4CA 3LT0A 5G4KB 2PV7A 1VKNA 1TT7A 2O3QA 3GPIA 3WGIA 2D3TA 1GYRA 3RFTA 2P5YA 3RUFA 4B8ZA 1SAYA 4YB8A 1BHSA 4K6CA 4YXFA 1T4BA 3ROQA 4UVDA 1X14A 1Z75A 3GQVA 3H9QA 5IN5A 1MFZA 2X22A 3VH4A 1NWHA 3BHIA 2G17A 1LRKA 2J5RA 5JCJD 1P1HA 1B8UA 1JTVA 3BXXA 5A1TA 4ZQEA 2HU2A 3HQ4O 3W6UA 2RHRA 1M75A 4MVJD 1Y7TA 3JQGA 5KKCA 4R1NA 1UP4A 3FNHA 4D44A 1X1TA 3K2BA 5U1PA 5JS6A
chains in the Genus database with same CATH superfamily
1GKUB 1Z83A 2G1JA 3O8OB 1E6EA 1YZQA 1S3SA 3BMCB 5IDWA 3PCXA 2R1UA 3TWOA 2PX3A 4I8DA 4I50F 3W5AA 3ZD7A 2QJTA 1VLZA 4OYLA 3UA3A 3GCWA 1XALA 2H5JA 1G0OA 5AUPB 4J7AA 3P2OA 1QIIA 1QRDA 5AP9A 3WHKA 1CV2A 5CFRA 2WQ7A 5CM2Z 5KWSA 2ODQA 1M5UA 1PR3A 3NYQA 4WK4B 4Q39A 1PV2A 4JUBA 4NIMA 2W6CX 1QS0B 3AIMA 3Q98A 4Y3UA 1YE5A 3N3BC 1VJDA 4AC9A 1FNSA 5LLSA 5LP1A 5TT1A 2GNPA 1XQ1A 1NMQA 3RUIA 2D2IA 3GUZA 5CIWA 4M98A 2ZIFA 1F9EA 3CR8A 5K2OA 1PR9A 2GN8A 4PC6A 4XI9A 3K6SB 1EWVA 4KQFA 2V9ZA 1JHYA 2CZGA 4YO7A 1ULSA 5ARDA 1T6XA 2OVFA 2EJWA 2X4IA 1HE2A 1LDMA 1SKAA 3C4JA 1XVAA 3CF0A 4ZD6A 3TH5A 4LFAB 4EGQA 2O5CA 1ZK4A 4RJJA 1NRJB 4JEHA 3QKSB 1H5QA 4NQZA 4QG7A 1TVCA 1NWCA 2NIPA 2R68A 3U61B 3KKOA 4J8PA 2F3TA 3KVNA 1Y9EA 3LUDA 1THZA 3BB3A 3F3YA 3V1LA 2ZIZA 2VBGA 4B09A 2YJ6A 5HJ5A 3P96A 1L4GA 3EPRA 3HBLA 1TM3E 1L5VA 3BCUA 1GT6A 3PGXA 3E7PA 4L1KA 3NXKA 4RVCA 4ROTA 4ECEA 3PUXA 3ZUGA 1XF9A 4D1YA 3UY4A 4D9IA 5BPFA 1QE3A 3BJIC 4Z8XA 4GL2A 2ZBDA 3L06A 1L7DA 1G4AE 4DTCA 3KWMA 4BP9A 1ONNA 1MABA 3UAVA 3HKBB 3RUDA 1C7JA 4HGYA 5AJZA 4BAGA 4EG1A 2WDZA 2QORA 2W2MA 3A26A 3HCDA 4DIBA 1RXWA 3THWB 1EJBA 1VCHA 4Z54A 5CX1A 3MCAA 1FNMA 3NJ4A 4YP7A 1ZH4A 5JFOA 3DOEA 2QVGA 4P86A 4YY3B 3MCVA 3EC1A 1E60A 1F8UA 1S2GA 3A31A 3C48A 3S81A 2PX4A 1J2RA 1G2PA 2H2HA 1R4MA 3TIVA 3R8FA 1BMDA 1HRDA 3ER6A 2WIAA 3R6WA 5AK5A 2IHKA 3SM3A 4KNYA 1E6CA 1OBHA 2JJ1D 2XUIA 3FIJA 4NZPA 4ALLA 1ZCFA 4GX2A 4LGMA 4NY1A 1CP2A 4BLQA 1NXSA 2DUNA 3UMVA 2VDPB 3EDRA 4CIDA 2IW1A 2X7JA 3SZLA 2Z83A 3L1JA 4GOKA 3RABA 3R23A 4XAQA 4QXOA 5CT9A 1ZICA 2ZSBA 1P5RA 2PPVA 2XDQA 3OURA 2XT0A 3RM3A 3ROTA 3AIKA 4C6TB 3UYLA 2ZBUA 3AI1A 1RYMA 2I2WA 2WR8A 4MV1A 1L5OA 1QHHB 3K8ZA 3ECAA 4ZK6A 1ID1A 5JHHB 1QTIA 4N6NA 3DEIA 2XB8A 2R79A 3DE1X 3KT0A 3Q10A 2C7VA 3RF6A 4DLYA 2EWMA 4G0PA 2HK6A 2AZXA 2JS7A 4P3OA 4I6GA 4A3SA 3CPSA 3F4BA 3LT1A 2EHDA 4UZEA 5CK4A 3VYWA 5KNDA 3VA7A 1T1IA 3I12A 1XN1A 2ZG6A 4YUVA 4BBZA 3LDFA 1ITZA 4K9DA 4H1UA 3SS9X 3CZQA 3BMOB 1Q6YA 4F4FA 5LNK6 1Z6QA 3K09A 4LRUA 2FF5A 3M6XA 5CDFA 3QFSA 1FPQA 1T25A 1LDYA 2OZEA 2Y1DA 2QV0A 4MTLA 4QYIA 4CMEA 5IUNC 1CRLA 4FFWA 3H0KA 4OP1A 3RVLA 4HUJA 1I9CA 4K6GA 3FOFC 1IBRA 3P52A 1L7EA 4HS4A 4IIUA 4O25A 3FPAA 3BDAA 4ARVA 1N5LA 2PKQO 1ZL2A 2DG2A 3GJ7A 3WYDA 4KLCA 2IQIA 4FMDF 3N07A 4G1MB 5KVVA 3RVNA 1XVUA 1IK4A 2OPBA 1H5NA 2N0SA 2HBQA 1QNFA 1QDLB 2IXDA 2QP4A 3AFHA 3CVOA 5DMXA 1ZK2A 5J2UB 1SKYE 4GG1A 5CB6A 4RF4A 3I58A 3MHTA 3H5OA 5E6RB 1PTJC 3WK4A 2IYAA 2PSJA 3I5MA 3TIGA 1ZH2A 2R48A 1OXXK 3UUEA 2AXNA 3KJNA 3IT3A 2F90A 1SHUX 3PQ4A 2HCRA 3QE0A 2H51A 1LSOA 2FPGB 4FT2A 5AIBA 5JPCA 1R6AA 4MRNA 4IV0A 3C5WP 3U44A 3DMHA 4WKGA 4X1OA 4KSCA 5H9WA 4R68A 1Y9AA 3N0VA 3RKUA 2FPPB 2W6MA 3OHMA 1W4CA 4RGBA 3KZMA 5D8DA 4MGIR 4R3UC 3QJGA 4MQ5A 1LPMA 3NM5A 5ILGA 1TQ2A 1IY1A 1C30B 3MTQA 1NLUA 1OSNA 2G72A 2BFAA 4MV5A 3Q3CA 4P0TA 4I8IA 4BEJA 4C0AC 3U4MA 1OJLA 2RC5A 1CZLA 4WCFA 3G5LA 1TJ3A 1U9JA 3T5TA 2ZRBA 4I3FA 4M0KA 1NNI1 1G2QA 2HCTA 3CE9A 4IJ5A 5ALKA 3TEJA 1BMFA 1NKSA 1I0ZA 4H0NA 4IRMA 4LJ5A 5EP1A 1ZLYA 3EGVA 2XF2A 3NEAA 4KQWA 3OE1A 3DE6X 4BVKA 1MB0A 2XY4A 1N7HA 3E3OA 3JR7A 1RZRA 5ENDA 2H11A 4P2BA 3B5JA 1YV9A 5KNCA 1AKNA 4AO6A 2B5VA 4HO1X 5D1HA 2VG8A 1NVXQ 4M0UA 4F6RA 2GHRA 3AEUA 4JEIA 4JJ7A 5G4KA 1FDSA 4WV3A 4QOEA 5EE3A 4M0FA 2OWDA 1NATA 1RKBA 4Y1RB 4JC5A 1C0KA 3LQKA 3IIIA 2XTJA 3V6MA 4NJOA 1L4NA 1CR1A 4OOFA 1NBWB 1PJ2A 3GWZA 4MTCA 3ABIA 3J7AC 3A6EA 2BONA 4QHTA 4TXNA 3ZTTA 3HHPA 3RSFA 2IODA 4DYHA 4BEWA 2W48A 3GH1A 3KB1A 2PRYA 4INZA 1IB0A 1DEOA 4J4TA 3KKZA 5FL7A 4A1OA 4AW9A 2XUOA 2XOKD 4LXTA 1ZCZA 5ICEA 4JOCA 4DG5A 2ZM5A 2YN2A 4YJ3F 4BLPA 3I9V6 1B0PA 4I14A 3ZGNA 4C6HA 3FFTA 3PL1A 4G56A 5BMVF 1ZOPA 4R5MA 2C4VA 4UOQA 4N3AA 2WB2A 1WB6A 1EK5A 3IERA 1CUGA 2BMEA 3DTTA 1KDYA 1IUOA 3VKUA 4UHEA 2Q5FA 4YT5A 3UMSA 2QLJA 3H9CA 4R1QA 2ZPTX 2HWWA 4K87A 2C4HA 3KKPA 4LOKA 4QAQA 1HG1A 2HM7A 2RGCA 3KQSA 5JBNA 4C78A 4C4OA 2GXAA 3JVDA 1P4HA 4DLRA 3SYTA 3N2ZB 3DPUA 2F67A 4ZMRA 3PJRA 2VP6A 1T5BA 1L4KA 3P1JA 5JXIA 2H4HA 4FKMA 3VYRB 1ZS9A 3FMGA 1UC5B 4I2NA 1EJ0A 2VP9A 1K8YB 2ET6A 3B1ZA 4QQNA 4KGZA 5C4GB 4XWKA 2C82A 2DWPA 1RU3A 1T9ZA 2BGKA 3CVWA 1DTSA 2BE7A 4QPNA 2VNAA 3SYKA 1HR0B 3Q2KA 2AF4C 1ZKMA 4L8GA 3ICVA 4ZDIA 1V1MA 2H9IA 5JAMA 3IQZA 2ZIXB 2A5YB 4EW2A 5AVZA 2QX8A 5K0NA 3BIJA 4M4SA 2YJTD 3KFLA 2EATA 3GPBA 4LDNA 1QCCA 4K9SA 5AJWA 5CBKA 4B34A 3WGQA 3DBLB 2FUKA 3DJYA 5ALZA 1CS4C 1ZIXA 3USZA 4K26A 2P1RA 2B1JA 1DIAA 2JAUA 2YJNA 2O54A 4UNSA 3GAMA 3L8MA 5CTJA 2GLUA 4UMDA 3GZNB 4KSYA 4CLHA 1USWA 1JWAB 2IXAA 3A4LA 4EH1A 5JH7B 5CTAA 5I51A 3PIDA 2GD0A 3O91A 4RWEA 3S2ZA 5DCYA 1F60A 2OFOA 3GGOA 1ISRA 4X85A 5DSZA 4ZMSA 3ZHYA 2Q6LA 1BVHA 3UBTA 4M9RA 4FWIB 5FO0A 2BPOA 2QDXA 1T8RA 4WT7A 1QHFA 5DEOA 4UOEA 4OIMA 4KI0A 4JSRA 1D0IA 1VPDA 4TXLA 2AZ4A 1OBOA 2CWWA 3LECA 4KFTA 1AGPA 4U3JB 2O0MA 5EIOA 2A3NA 2PLFA 3EA0A 4UPEA 3N2LA 1USGA 1Y3FE 2VAPA 2YYAA 3N86A 2OZLB 5KYUA 1KR2A 2JAQA 3HSKA 3L4SO 4ZAFA 1NBEA 3H6KA 4YQYA 1AMNA 1RHRA 1BE0A 1U2SA 2JGKA 2QUKA 5DNWA 5JI2E 1XE3A 4CJXA 1HV8A 3DF9A 3MGGA 1J8QA 1FLNA 3B5EA 2ZR9A 1LZKA 4KRXA 4YWJA 1ZVMA 2NQ8A 2X6TA 1B6TA 2VDKB 3RAPR 4AMGA 4DADA 2DR2A 1QLWA 5GIOE 3KCNA 2P5UA 5CNIA 2BMWA 5H8WA 4ZZ0A 4K86A 1FFXA 4R8SA 2Z58A 4OA5A 5AW4A 2C8LA 5DM0A 5CDSA 3UJHA 3VMMA 3AF4A 3O8CA 3L4EA 1WPXA 3N6VA 1IUPA 1GG5A 1VI5A 2DFKB 2EW1A 3C1OA 3ORSA 5DHSA 5DIFA 4TXJA 1G5PA 1VLLA 2IEGA 4YUZA 4EF6A 1KIMA 5JOQA 3PXBA 1ZNQO 4QARA 4D42A 1W5BA 2YV4A 4C0JA 5FPQA 5TQVA 2UUBB 3AVOA 1NOIA 4JT9A 2OLJA 4NBRA 4MQMA 4DR4B 4HZGA 5LZ4A 1NZFA 4IDGA 2PS9A 1NN1A 3O8RA 5TS2A 5AQ1A 3WIDA 3ZU6A 1DL5A 1SUBA 3WQRA 1GL9B 2CLFB 2PJDA 4M1KA 4EHNA 3JTMA 5KOHB 1EXWA 2V7XA 2OBNA 1JG1A 5KCMA 1RI1A 4LWQA 1YBVA 3L49A 5EJ4A 1XZCA 1RLJA 2OUKA 3CPHA 1E7RA 1MFPA 3LUAA 3CGWA 5CA1F 4ZVRA 1RJDA 2VXOA 3D4BA 1ML4A 3JQAD 3D1LA 2C5BA 2R7KA 3R0JA 4JC4A 3I9FA 3BGOS 4RZHA 4O1HA 2K7FA 4AUKA 1U1EA 1YS2X 1II9A 1SM4A 4FTWA 1P9RA 3VNUA 5FAKA 3GEIA 3EPPA 3WRYC 3X1ZA 4KUGA 3EZ7A 2GUGA 1UOPA 1OH8A 2Q4OA 4HNQA 4XX0B 5KPDA 4JFAA 1OASA 2IP4A 2RHLA 5H5JA 2FDXA 3C43A 5AMXA 1FX1A 3QEKA 3WGHA 2ZWOA 1P0FA 2XUPA 1C1DB 4EAQA 1M8JA 2GK7A 1UQRA 1FB5A 1VJ1A 3FMVA 2YYZA 1PR1A 4EL0A 2HQBA 1JDSA 2B4AA 1J9GA 1WF3A 5LKRA 1D9XA 2OYRA 1O6BA 1P4JA 5KCZA 3MWEA 1ODTC 1TCUA 2AZMA 2XE7A 4XE5A 2NU8B 1XVLA 5EUCA 3PQCA 3WNDA 4GM0A 2BHLA 4ZOCA 3WZLA 5ESXA 2FN7A 1P7VA 2XNHA 3HBMA 4BKRA 3EFHA 2R7LA 4FC7A 1KZYC 3MXOA 3C45A 1FUIA 2GDZA 3MB8A 2AUTA 2WWGA 3JWIA 3U5TA 4CF7A 1YS9A 5B2FA 2PKCA 4HZUA 4PTLA 4M1YA 5EPUA 5EKSA 1S8NA 1GR1A 1JMYA 3JSAA 3G2KA 3RNOA 4QU9A 5FCDA 4HNAA 4UHDA 2UUAB 2IS2A 3HM2A 1RE0A 1SKYB 4EB8A 4POOA 1NN0A 4ALNA 4H1HA 5IZCC 2CYAA 4E46A 4ZHQF 1H6BA 2RAFA 3FYDA 1Q57A 3K92A 4GPTA 3TXYA 1PJRA 2GN4A 3VJMA 4EPYA 2QMQA 4AKSA 2HI0A 4D96A 1BCRB 4FSXA 5AR1A 3JD4A 4KTVE 2G1UA 1GKKA 2AOTA 4BAUA 5ALVA 1F7VA 1F38A 2RHDA 3OD1A 5B1YA 2QN7A 3DULA 1XZIA 5U4QA 4EY3A 1SVWA 3NVAA 3BFJA 3F6RA 1VG9B 3M4NA 4REQB 2FCAA 4L3VA 3ZX4A 2JD0A 4LK3A 4F7WA 4EJSA 1MEEA 4S0XA 1XMQB 1SVSA 5KYYB 4J43A 3G2QA 3LQ4A 4HQ0A 4CMBA 3TXXA 2AMLA 2ARKA 4HBZA 4D9MA 3K9LA 1SVUA 4KGDA 3EDCA 1I5EA 3P5BA 1XZNA 3RLFA 2MR5A 2Y77A 4IMJB 2PFGA 3ZOKA 4OQMA 3U1TA 1U3VA 1ZSNA 3FY4A 5AO9A 5HCIA 3GYGA 2P9EA 3D4IA 3K9BA 4HYYA 3JSXA 2FW0A 1YS7A 3I1YA 3NPMA 4H7EA 2JCVA 4RO0A 3U81A 3D59A 1RABA 4WUVA 3IQFA 3O3NB 5EWMB 5H0IA 5I8ZA 2XA2A 4PC2A 4LJAA 3Q1LA 3R9KA 2HT1A 2P27A 3HR7A 4BRSA 5CYFA 5IKOA 2XCOA 4IR7A 3LY8A 1QPZA 4M99A 1AKTA 1G1AA 1TJYA 4RCVA 1TT5B 1HDYA 2LCQA 2W2LD 3MSXA 5BWMA 4JYAB 3SWWA 2Q3CA 3U09A 3DUFB 1BEZA 2JL1A 2VWGA 2GJSA 5A3RA 1OW3B 3KQUA 2CKMA 4FGSA 5DX0A 2EIHA 4Q00A 4DCSA 5K3EA 2P79A 2VUTA 3V9AA 4C89A 3VPAA 1UKYA 1Y3AA 1NXOA 4XEUA 5A5GA 1I24A 3N0RA 2D7DA 1USUA 4JYZA 2O2IA 1Z38A 3AHCA 5LU9A 3CWQA 3FVQA 4ZEWA 4BGIA 1U9IC 1UF9A 3PQ7A 4HAOA 4TL6A 3IBTA 3C2QA 1BRMA 1UC4B 1V6CA 3RS7A 3ZQJA 2WZCA 5CT8A 2RAPA 1EP1B 5IUJC 4QTZA 3GRKA 2YRFA 3R1IA 1EZZA 2A7QA 2EG9A 4JXKA 4X1KA 5BWLA 5KC8A 3ONFA 3I5UA 2XIJA 3PNLA 4NG4A 3ZV4A 5MN5A 3UJAA 1DKMA 2ZIXA 3VR3D 1Q7EA 2CB0A 4JLPA 2VL7A 3DT6A 4F6CA 3NCTA 1C29B 1HYQA 3QXHA 4IIXA 4JL8A 3MWDB 2GJ4A 3F9CA 4Y2QA 5HE9A 3SLKA 4C4XA 3DOOA 4PFSA 1F7UA 1N9GB 4NCHA 5CURA 3I2JA 3Q72A 2WHEA 3SBDA 1V3VA 3OETA 1JKJB 3KXDA 5EKXA 3RYCB 1KI8A 5AK6A 3T12A 2VZEA 2C96A 3IB3A 1AE1A 2WTBA 3AXTA 2FLKA 2UAGA 4IIGA 4JI6B 3F97A 4LPSA 5JH7A 1J00A 4JJEA 2CLHB 4YJDA 3INRA 3ADBA 4QXAA 4ZEMA 3N53A 4FHDA 4WECA 4ISBA 2C2ZA 3ZEIA 1OAAA 5KB3A 1IY2A 2WAMA 1SC1A 1GL3A 2NZUG 4G0UA 2QXUA 3AETA 5HGXA 2H18A 3LL7A 1X1EA 1RZUA 1XZ8A 2BKXA 3D8TA 3F5SA 4FE4A 4AO8A 3I32A 1DQNA 4U3JA 1N9ZA 3KOUA 4EFKA 5JNSA 2BCGY 1YSCA 1KJNA 2EG5A 2IELA 1WPQA 2QZPA 2R6CA 2YOGA 3GC6A 2XVAA 1BX3A 3CZCA 5BYJA 3USES 3UV6A 1XQYA 1RRPA 4K2AA 2JFVA 4LGYA 3TG2A 1IRXA 5TQJA 5HFAA 1EK2A 4C2TA 2DRIA 4WMLA 1X7GA 4QRHA 1E5TA 3PE4A 2IP1A 1RWWA 1D2AA 4MS4A 5J4YA 3FCCA 4UE2A 1THTA 3CIFA 3KTFA 1SUCA 3IDQA 2QN8A 5BV8A 1A27A 3UWPA 4A15A 3RI3A 1DXQA 5LWHA 3ZTYA 4BU0A 2VJKA 5D3ZA 2IXEA 4GEKA 1L7BA 1B2LA 2Z2KA 2C2XA 3WFJA 3WLFA 4FXPA 3R3UA 3T5CA 1E4YA 2D1RA 1CR2A 3ZQ4A 4DYVA 4KL8S 4CM9D 3F8TA 3FFAA 1UT5A 4WXEA 3B1KA 2QAGC 3CR3C 1GPWB 2WJZB 1SQFA 5CDHA 3DDNA 4OHMA 2VZLA 4B1FA 4K9OA 5MHTA 3FZNA 2QGNA 3QXGA 5HKOA 4PSCA 2PGAA 4BMYA 4JBYA 2I6FA 1L5HB 4IGIA 5A9TA 2JFOA 1ICIA 2EFGA 2A9JA 4WINA 5AVVA 2BJVA 4D79A 1SZCA 3OCUA 3V8BA 4FWTA 1MF7A 3ZE2B 2AJTA 2XYRA 3GZ4A 1YZTA 4X6YA 3E3NA 4EI7A 4P4GA 2VDWA 4S04A 1PQWA 1L4LA 1XQVA 2TSYB 5AKGA 2IUUA 5E0OA 2NU9B 4U2GA 2IWRA 4WBSA 4BMXA 4C87A 1XLUA 4ZQGA 2UXBB 1GM5A 1Z74A 2O2EA 2AMVA 1MRSA 3SEFA 2E18A 5D85A 3THSA 3WQBA 5HKKA 3PGA1 4AN0A 2QR2A 4C4YA 4IJQA 4MHOA 1HKHA 3BIXA 2PSSA 4X8LA 3CPEA 3LM8A 4MCJA 4J0IA 4C0SA 3W3ZB 4MPTA 1CW2B 2CYBA 2XJ9A 4EI9A 4ZCIA 1GQFA 3Q9UA 3C6KA 2I7VA 3U13A 1MGOA 1ZUD1 4B2IA 1F0YA 3W77A 3E70C 2YY5A 4Q3OA 4TLDA 1T9BA 1NUAA 1Z7EA 4RIGA 3ICWA 4CMKA 2J9GA 2QTLA 3IC5A 4OMFG 1GPAA 4MZDA 2PX5A 2XOKA 5NULA 1KY5A 1P80A 2NUPB 2HMTA 2QD4A 2JD2A 4JNCA 3RS4A 3RWMB 1SG9A 4ARUA 1FE8A 2NZ2A 5C46F 1TUBA 2YRXA 4YRLA 1C7EA 2CJWA 8LDHA 3PJFA 3R5XA 1N8TA 2RJNA 2GWHA 3QXSA 1KFBB 3N2GB 3FROA 1JE0A 4J0DA 1XV5A 1EE9A 2V1XA 2R8RA 1E3EA 1NBME 2GF9A 4M38A 3RRXA 3NTRA 3NBQA 3MT8A 2WIGA 4IRUB 3UJ9A 5ALIA 2CD7A 3HRKA 3JPYA 3FYSA 4LHYA 2CW5A 2JFWA 1U94A 3MT9A 4PPQA 4YYZA 3HABA 1TYBE 1NYQA 1NVMB 2VNKA 2X5KO 3PSAA 3S5UA 2WIDA 5T8KC 4FZJA 4D0SA 4IHJA 4KR2A 1Q1AA 2JBAB 4TM7A 1U99A 3JX9A 3FFWA 4YMHA 5CH8A 5K3AA 3MGAA 2I76A 2YWRA 4QO8A 1XFDA 1XTJA 2L2QA 2J41A 4R8RA 2RD2A 2QS9A 2J7KA 3L0BA 5CD9A 2ZRMA 4LGCA 1P44A 4JDUA 2X5OA 4MRSA 3COJA 4EHDA 1IZ0A 3FLAA 1CX9B 3V3TA 4AECA 3KDPA 5LA6B 3QVMA 3DL2A 1SOAA 4A8JB 4Z2AA 1CUYA 1F17A 2PRJA 4GR9A 1ZW6A 2CL0X 1MJ5A 1LC3A 4RLFA 4GMXA 5IFLA 3V8VA 5EMLA 3CCFA 5BQPA 4REQA 2IXGA 3QUBA 2BGTA 3H8SA 4B3SB 3UIEA 4Q37A 4U7DA 1M6HA 1QYCA 1SA0A 1H2FA 5HEKA 1TA0A 4WZBB 4HGRA 4TGLA 3H19A 4H18A 4ER7A 3ZJVA 2FFAA 3HNRA 3HUDA 3L6OO 1UJ4A 2GKOA 1O2DA 2KWIA 3P9QA 3KZ1E 5CU7A 1LDEA 2QM0A 4BRZA 4HFJA 4J16C 3KEMA 4X92A 1Q6ZA 3T5GA 2VDUE 2F9LA 3CLVA 3QXCA 1U7HA 2QNRA 5JNRA 5LXTA 4H6VA 3WK5A 2EKBA 3H1FA 5AK4A 2NSHA 2DR3A 2Q2QA 4NEGA 5FOWA 1MTOA 4CKEB 2IC5A 1C14A 5JAHA 2JJQA 1R8QA 4L9SA 5B53A 4JGBA 3OPMA 5K3SA 4ZIRA 2REQA 1OXKB 3R40A 4H7HA 4N12A 1IBSA 1QG6A 5KQMA 2BI8A 3GXOA 2HAEA 1WVGA 2QWXA 1TGVA 1KGDA 2G9NA 2QTWB 2VHYA 3FM9A 4UTVA 4PTYA 1BXKA 1OYYA 1Z3CA 2XMPA 4G09A 3SQLA 3PX7A 2CF5A 2V4ZA 1GTVA 4K8OA 1C1HA 1QR2A 2QT9A 2MINB 2VA8A 3QA3E 3AV3A 4DA8A 1DAIA 3WV5A 4DC1A 2YYSA 3NGMA 4K6KA 1ZIDA 5C3UA 5K4GA 5K8VA 2XMDA 3IHWA 2EZ4A 1M72A 3KHSA 4AKTA 4B2PA 1IHXA 2ZSIA 3AI2A 3ROPA 1NYTA 4A73A 1ZXBA 3PGMA 5BQXA 3PUKA 1CDDA 1T9CA 1EVLA 1XC7A 3VDMA 2FSGA 2LW7A 1CUUA 2X3FA 5A1JA 3WWYA 1GU7A 1H0SA 1L8OA 1UKAA 1PRYA 2QNBA 1LS1A 3VFDA 4KO8A 4CMEC 1CUFA 4NBLA 3PQFA 4RA9B 3RHFA 1RIFA 3UG6A 1NGSA 1Z39A 3D2BA 1F4VA 1QLJA 1ZK0A 1C1XB 4JB0A 4F86A 4F93B 2C9CA 3U6BA 1WDKA 2BZGA 2VSXA 3QEOA 1U9ZA 5DXJA 3IXMA 1E20A 3WWPA 2OAQ1 2AQ8A 1P9OA 3MPOA 2YZ2A 3CO0S 1MIHA 3MWDA 4W1RA 1DHRA 3VUFA 4GP9A 1R3UA 3L92A 5KTRA 3VJKA 4PAQA 1PLJA 4JUIA 5DGTA 4XJXA 5BR8B 5CMLA 4ALMA 5JFGA 1KYWA 3WJ2A 2VAWA 3H75A 2H1WA 4M6WA 4B2LA 4PYKA 1E5LA 6AT1A 3PDWA 5CT6A 3KSMA 4MDYA 1L7QA 5FNZA 3OZVA 5J2UF 2RC6A 2C29D 1OH7A 3NHWA 1FYXA 1SEVA 5D51S 2CUKA 3PD0A 2JFXA 5GONF 3C3JA 3LIIA 2VDOB 1XLVA 2AC4A 1VRWA 4KXMA 5PGMA 4ZZ1A 5FA5A 2NYUA 1P81A 1YS1X 3GOHA 2DFVA 1Y6ZA 1VA5A 4JP2A 2AI3A 4XR9A 4HZIA 5IP5A 1K68A 5C53B 3K0FA 1Y4SA 3OFND 3AR6A 5YASA 3SR0A 1M2JA 4BFWA 4BQEA 4TMFA 1IHOA 1VIAA 3GLIB 2RG1A 1PSDA 3VV3A 1KC1A 2E6UX 4EYEA 4MUMA 1LH0A 2FRDC 2AKAB 3B3FA 4D3SA 2P68A 1A5BB 4H7PA 4BYMA 4YRMA 1TRHA 4MYTA 2V9CA 2YNMC 5DTEA 1U6JA 4JAVC 4YP9A 4DTIA 5BN4B 4V38A 1CQXA 2V0NA 2YQ4A 3ODGA 4HBGA 1W6UA 3AJ9A 4UMFA 4BWGA 1V9SA 3ZLUA 4CNBA 2IBSA 1UBFA 2CMFA 2IDZA 3NDPA 2QE7D 4Q0MA 1BG6A 1DSSG 5F9MA 3DP9A 3AEQB 4JN6B 3JQEA 4EVSA 3AF0A 3MUNA 3OJFA 2OK7A 4YRPA 1SVKA 1OPRA 5IXSA 5ENVA 4EY6A 5K8IA 5L3QA 2AVNA 4PYQA 4NATA 3MBIA 4DRXB 3FNGA 1PKXA 5F33A 3UHOA 2H1SA 3JYOA 1VHDA 1WCXA 4JGGA 4ZU3A 1TCCA 1YQDA 1NURA 1LGYA 2WG1A 3KQHA 4URFA 1NC3A 3K6JA 3RSOA 2IZZA 3SQDA 3C39A 5CB4A 1K5HA 3LDAA 2I9PA 4AIIA 2B4YA 3D0QA 4DREA 1YRWA 3GRRA 4CM3A 1XTRA 6REQA 1L5HA 4MKZA 5JJKA 4DCVA 4LJ7A 1JPNA 2EJCA 2M2IA 2ZJ5A 5JNVA 1T5OA 4N54A 3H3XA 4PO3X 3BZUA 1ZHHA 2GASA 4MVYA 4DS3A 1OBCA 4R8KA 3B7GA 3H4IA 4DA0A 3OZGA 3T7EA 2EW8A 4GOOD 1V8OA 5KAPA 1DV1A 2G9VA 2P4SA 4L2IA 3ZXIA 5LL6P 2HSEA 1E2LA 3CE6A 2EX0A 1DWQA 3ANSA 3JVVA 4LHZA 3MT7A 4GF5A 5FBZA 5JC8A 4XARA 2JEOA 1NJSA 2R97A 3DA8A 3QV2A 1NQOA 1NW7A 1T13A 4CQLB 2BFEA 2P2DA 2XTAA 4JHLA 4QHYA 4WXRA 5F5XA 5A3SA 5C4MA 2VKTA 2EL9A 1ZD4A 2H5EA 3T4EA 5KOJB 2VTBB 1EESA 3LTNC 4F6LA 3UAGA 4YJGB 4R0MA 4BN5A 2ZM6B 4U6QA 3V1NA 3HGQA 4IIJB 5LDGA 4B4OA 3TF5A 3F3KA 4MROA 1YGYA 2ACEA 3UGJA 2HA4A 1IIBA 2B4QA 2ZATA 5H81A 2F1JA 1WBBA 2MSCB 2B94A 1QJCA 4Y2YA 3V32A 3W4KA 4U4AA 3OCVA 1RYBA 4C43A 3B8HA 3EAQA 1S8FA 1MOPA 4HYEA 4EB3A 3LSYA 4HDNB 1KOLA 4N48A 5LB2A 3MBKA 4NCBA 4HG2A 3AL0C 4JBNA 1B6SA 1COZA 3ABRB 4ZANA 4A8HA 2W2LA 3BFKA 4B32A 4H77A 3SNKA 3ZI4A 3G88A 4UD6A 5C1PA 1E2QA 3P71T 1SIOA 1IDOA 3KR1A 4HK4A 4TM8A 4C30A 4JH0A 2W70A 1YRYE 1RQXA 2MSKA 1MTZA 4Q9AA 1GIAA 3A32A 2XRYA 4V1CI 2NQ2C 3OF5A 4RJIA 4U9HS 3HJHA 5IVDA 5C0OE 3RGGA 2P2NA 5EMHA 3ZQKA 4A1FA 1JQEA 1GXSA 1H85A 1RE1A 5JFTA 3N2YA 1LLDA 2RGDA 4E13A 1ADGA 5FDFA 3KSZO 1SUFA 2ZRFA 3P94A 4I4TA 4QWMA 5IBPA 3SX2A 2ZVQX 4RAQA 5BRAA 3NTOA 5SYAA 2CMDA 2W0SA 5B58C 3NORA 3H5AA 3WBJA 3EGOA 3TZEA 4UBOA 4DNFA 4Q48A 2ZWIA 3LMKA 4V1CA 4NU5A 1LLUA 1DU4A 3LWZA 2ZJ2A 3HPRA 4CDMA 2AW3A 3D6UA 1G16A 2CK3A 2FEPA 1TIPA 1SU6A 3FTPA 3L8FA 1C5KA 2BM8A 3A36A 4J90A 3R74A 1AHNA 2FUNB 1N6KA 2KBFA 5JMWA 2W2OA 3SZRA 3LIPA 3PBKA 4OB6A 2XT9A 5C7OO 1QQ6A 1P75A 2GF2A 4FFSA 1JKIA 4D9KA 3DHVA 4FFNA 1JXMA 1QF6A 3LTEA 4E14A 3UJ3X 2FWAA 2CHUA 4NZZA 5MFZA 2WYUA 4WH0A 2TYSB 4Q3AA 4RPCA 4XM1A 1WXWA 1BHO1 3A9VA 3B85A 3NAZA 4XGRA 4A6EA 2VEDA 4E31A 2DCUA 4GYJA 5ES4B 1EVQA 1XVIA 4AQYB 3I34X 5FOTA 5JCPA 4IL5A 1IQUA 4ERXA 2H57A 3F49S 1TE2A 5FWDA 1O4WA 2Q28A 2XRMA 3AMVA 4LYHA 4KBFA 4PRKA 5E3JA 4AZVA 3KZVA 4F11A 2VRCD 3DLIA 4HH4A 2B25A 2Z2JA 4ZO7A 3TNLA 5L6MB 3BIOA 3B89A 1XMVA 1Z4LA 1PFWA 3E15A 4LHEA 1D1SA 5BW4A 2VJAA 3T15A 3PFFA 2R8EA 3CLTC 1EA7A 2PL9A 5JLJA 3BD8A 3AYXB 4QNMA 2XR1A 3SC2B 3CUWA 4LVCA 4HUQA 3JQDA 2QQ5A 3DEKA 5DBIA 4FFMA 4B40A 3MTDA 2GAIA 2BZ1A 4JLAA 1YOBA 3LLUA 1XOIA 1PJCA 5L4SA 4E2ZA 2QW0X 4OFWA 5ECWA 3U0BA 1BGVA 3A9CA 4A2WA 1QH9A 2H0QA 3ELBA 4PZLA 4PFJA 1OC2A 1GEEA 3G5AA 4LMAA 2QRMA 3ICQB 1G6Q1 1YR6A 4CM9A 1FP1D 5FULA 4EUHA 2BEWB 1W4BA 4AMUA 1N1MA 3WA7A 1BA2A 3ILHA 4AWBA 1ADBA 1I2AA 1RYYA 4X5OA 4Y2TA 5ALYA 1QCDA 2YJ5A 2WWWA 2PYZA 5ALQA 4XJSA 3VPCA 3ZLBA 4MULA 4B47A 1J6UA 2Y9MB 4KRGA 4FI3F 2EC5A 1G8JA 2RKBA 2WNIA 4RIIA 1C9YA 2L69A 4IGAA 4DV4B 4RDCA 1GNRA 2B34A 4XOUA 2NZYA 4RVDA 1ORDA 3H5TA 1Z34A 1DRKA 2KHZA 2OCPA 3H0CA 1Z68A 2FR0A 2ZE7A 3FUUA 4H7DA 3RQIA 4KQXA 3ZY5A 4GDFA 3RSHA 1E0SA 2YR0A 5BVGB 3GVCA 3HTXA 3R77A 4YGYA 2IIQA 2ODPA 5HRCA 1QWOA 1SBIA 1ZOIA 4N82A 1EFCA 1UWVA 4YREA 1Z4MA 1JKXA 2FG5A 4UARA 3FX2A 3EMDA 1E6WA 2H8KA 3AIIA 1R6DA 3PUWA 2ZBVA 2P6UA 4KO1S 3C6YA 3HU3A 3GA5A 1XB2A 3RVPA 2P11A 2PIDA 4KYVA 4CKXA 5JISA 1PJQA 3ZXUB 3C85A 4JOBA 4JWKA 3INNA 1CZRA 4TTIA 1X1BA 3FAZA 2VWPA 1JJBA 3IQIX 3HLYA 4FUTA 1RCTE 1XRPA 5LQJA 3GLIA 2WTMA 3ONEA 4DDVA 3HLTA 3PNKA 3EAGA 2ZLBA 1H1DA 2HIHA 2VHXA 1TF2A 4PTZA 4DQKA 2AHOA 4MGZR 1Y6RA 2QD1A 2X4DA 4P54A 4HB3A 1K9SA 3MINB 3V2HA 4EG6A 2JHFA 3A2LA 3WR5A 4R1TA 1NUHA 2WSLA 1XDWA 1W9HA 1YK0A 2ZKIA 3EVTA 3HN6A 3HADA 3NC1C 1YH3A 4Z99A 5AVSA 1HT3A 2JAOA 5EJ8A 3WJ1A 3TW4A 1R0YA 2QUHA 2EF1A 4GZLA 3HZOA 4MGEA 4MWEA 3AK4A 3GJQA 3IMEA 3OEHD 4JFRA 2YNMD 2JJMA 1NUPA 1PGPA 3MRVA 3TFOA 3ECCA 2M6LA 3P2YA 4O4JB 1R9NA 3ZZ1A 1RWKA 1MBZA 3OEWA 4QUDA 1MAVA 2CVQA 2E3JA 2O52A 4J4HA 1QGDA 4TPKA 3B52X 1FDOA 3ANXA 5T3YA 5BSFA 1MB9A 1PHPA 1YR9A 3VZPA 1QF7A 3KTDA 4G9GA 2X0IA 1OCEA 4DWWA 3WL4A 4PLVA 1X80A 1OWOA 3SJ7A 1FCJA 1QHXA 3PFGA 5DM2A 1AXEA 1JIKA 1O9GA 2VDNB 1SZJG 3RQSA 1K4YA 1O5TA 2ZIEA 3M5PA 2NUTA 2C5LA 5EE0A 2DBYA 1RAGA 1HRKA 2QRJA 4KYTA 5CA0A 4Z5XA 1Y1LA 3CN9A 4GVXA 4HHEA 5EPEA 4AZ0A 1G42A 1V2GA 2Y0PA 4Q24A 3GVIA 3FPSA 2HADA 1T4MA 2WC1A 3A0RB 1W88A 3AUYA 3GPCA 3Q15C 1IQRA 4Q01A 1VSVA 2H7CA 2Q5CA 4M7PA 4UM9D 1OX4B 3AR7A 4FDVA 1A9YA 4P4SB 2RI6A 2QGZA 3UMFA 3KT8A 1JMVA 2WHPA 3MLAA 4OHOA 1TF7A 4DXDA 2BM9A 3IV7A 3O47A 4I1VA 1GRNA 4XLTA 3GLGA 3KEOA 1ZUNB 2F3PA 5REQB 2HTFA 2HHCA 4DN6A 1XEWX 2EJUA 1HNZB 1T6BY 2IEYA 2OCKA 4Q7QA 1ACMA 1D4OA 3S8YA 4E7OA 1QV9A 4X90A 3PICA 2XB6A 4PZAA 2BYTA 3TRHA 3E9CA 3M49A 4ZRDA 5AM0A 5FTMA 5C81A 4YJHB 3W6PA 4MUBA 3DZBA 3BWVA 1F12A 1I6LA 1EFAA 1IY0A 4J2OA 4EKGA 3K71B 4M76B 2YVKA 3C3CA 4U2BA 1OB2A 3U6KA 1TM1E 2J0EA 2QM8A 1DE0A 1Y33E 2FPUA 3DVSX 3OTWA 3R0QA 4HY3A 4RF5A 3W2FA 4HB2A 4E15A 1WB5A 1GPYA 2HQ1A 5AVKA 1IHUA 5FUVA 5D5PA 3TLZA 1OF1A 4O2AB 3ODPA 4EWLA 4HGQA 1BD4A 4G5YA 1NJ2A 1KZ7B 1P61B 1U7UA 4ZJZA 1NSYA 5CLIA 5IXJA 3PFCA 3ELWA 4MPPA 3S40A 5IUKC 4UDXX 2QUBA 3GA7A 1J70A 2O8DB 1G3IA 4FDUA 1TKBA 3W3AH 1O8CA 2SBTA 3KELA 4NV3A 4MI6A 3SHOA 4QWWA 3ZWDA 2NTYC 2ZDHA 3T95A 1VSQA 3D2LA 1TJPB 5DULA 1BHQ1 1OIVA 2GWRA 3BK1A 4UM7A 4EATA 1PF7E 4F4DA 4HGPA 2OXCA 3KB2A 2PY6A 3UOGA 4URUR 2ZYTX 1A9SA 3THYA 3R44A 1B2RA 4MWSA 4QUHA 1DKLA 2DWUA 3ZNPA 2JKZA 5E7IA 4AZ3B 4EB6A 5JDIA 3QU4A 1X13A 2BEKA 4L3OA 3PXGA 4DUZB 5JZ9A 1FZTA 3LDHA 4M36A 5CYOA 4YUAA 1RJWA 3BJRA 2VO1A 4D9FA 1KI1A 3RTBA 4BIMA 3QPVA 5EIBC 4OUDB 4PYRA 4MS1A 4ZJUA 3HV2A 4AUEA 1I8TA 3UAYA 3QELA 4JI8B 3JYNA 3R0VA 1GZ5A 3T99A 4D9BA 2A9PA 5IASA 4EEKA 4N3CA 4NNPA 3HCOA 5H3LA 2P1ZA 4G5SA 5BSTA 2NXNA 1Z7GA 4R1PA 3S99A 2LWIA 2D8AA 3IULA 3NT5A 3WDSA 4I5DA 1GU1A 2FLWA 1F2UB 3AR4A 5F2KA 3FPFA 3MJCA 1Z2PX 3MELA 2PGXA 3FWNA 5ILQA 4HFNA 4DBLE 5LNK1 2XZLA 1YL6A 1YFKA 4Q4JA 4B35A 1Z13A 4L3WA 4EARA 5EKDA 2P7IA 5FWAA 1OOEA 1J7JA 3FDZB 1ZL0A 3H87A 3PDUA 1AD2A 5LLTA 2YWFA 4KO4S 3C8ZA 3ZIAA 1K6JA 3F6SA 1L5KA 1MR3F 3NHYA 1E0JA 2PYDA 2C4MA 2YV1A 3EH2A 1O9BA 4GLBA 4MJ7A 4UNPA 1EM8A 2CVPA 2X40A 1ENPA 2AG0A 3BAZA 2OCYC 5FYDA 2DR0A 2VQEB 4YAUA 3EFEA 4MV3A 4O4IB 2WOJA 1X7WB 3TNYA 1UBRS 2DOKA 4X84A 3U9TA 1QBGA 3PEEA 2MSDB 1IN4A 4ONEA 3CLTD 3KAKA 3LSTA 3KV1A 4CN8A 4M55A 2BFBB 2ZU0C 4